2FHPA

Crystal structure of putative methylase from enterococcus faecalis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
183
structure length
183
Chain Sequence
AMRVISGEYGGRRLKALDGDNTRPTTDKVKESIFNMIGPYFDGGMALDLYSGSGGLAIEAVSRGMDKSICIEKNFAALKVIKENIAITKEPEKFEVRKMDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKMLERQLLTNEAVIVCETDKTVKLPETIGTLKKTRETVYGITQVTIYRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methylase, putative
publication title Crystal Structure of Putative Methylase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 57
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fhpA00
3EGVA 3BKXA 1O9HA 3LECA 4PNEA 1G55A 5CUQA 3EEOA 1TW2A 5CVDA 3EVEA 5ICCA 2PT9A 2YR0A 3MTIA 1NW8A 2GLUA 2QRVA 4FSDA 4ISCA 4HTFB 5DX1A 4WXHA 3T7TA 4DKJA 1PRYA 2ZIEA 1X1AA 3AWIA 4AZTA 3EGIA 5P8WA 3THSA 5HOQA 3HCFA 3PT9A 1QAOA 1SUIA 5BW5A 2P41A 3GCZA 4DZRA 3GRZA 1ZG3A 3M6WA 2B2CA 5E8RA 3G5LA 3LBFA 4KWCA 5CVUA 1R74A 1NW7A 2ORED 1NE2A 4C07A 2OKCA 4DMGA 2P8JA 1KYWA 3R6TA 2B3TA 3I5UA 3GGDA 3CJTA 1SVUA 3BWYA 1EIZA 3IHTA 3HEMA 3LCUA 4RV9A 3T7RA 2PLWA 1X1CA 4PYIA 4F84A 1X1DA 2N47A 3ERCA 3KPUA 2IPXA 5GWXA 1XCJA 3QOWA 1D2HA 5LQJA 3PS9A 4PGHA 4QTUB 2PY6A 1KHHA 4LG1A 5DPMA 3VC1A 5EPEA 3A7DA 3FTCA 3E7PA 2H11A 1XVAA 2QE6A 3KQMA 3LKDA 4XUDA 2Y1WA 5U4XA 1FJXA 3IV6A 2OBFA 3UZUA 2ZIFA 4MIKA 1IXKA 2AS0A 2UYHA 1ZQ9A 2HWKA 1MJFA 3KR0A 3I64A 1O54A 2XYRA 4AZWA 2BZGA 3SSOA 1FP2A 1R8YA 4PYJA 3OFKA 5C1IA 1DUSA 5IH3A 3SSNA 2ZLBA 2VP3A 2OXTA 1KYZA 1FP1D 2AOTA 1SKMA 3S68A 2P7HA 3EVDA 4LWOA 3MQ2A 1Z3CA 4YUWA 3P97A 5HIJA 4YV1A 5EZSA 3LCVB 4KDRA 5EEGA 3RODA 1RJEA 2AN4A 5CVVA 3NJRA 7MHTA 3FPHA 4EKGA 3GNLA 4P7KA 4KIGA 5T64A 3BUSA 5E2BA 4C04A 5DRYA 1NW6A 3NTVA 1G8SA 3NVKI 3M6UA 1EJ0A 1ORHA 4MWZA 1H1DA 4LWPA 3HVIA 1KPHA 2F8LA 3C0KA 5FA5A 4E30A 1L1EA 4E2YA 3EGEA 4ATNA 4YUYA 5GOZA 2P35A 3I9FA 4HGZA 2P1DA 4BP1A 3ID6C 2UYQA 5EQJB 2Z6AA 3KQTA 5K0EA 5EC8A 3BT7A 2JHAA 3ME5A 4EK9A 1R00A 2AOXA 3LSTA 3Q7EA 4HGYA 2ZWAA 4QDJA 4R8SA 2QM3A 4GBED 4BLWA 3G2MA 2AOWA 2AOUB 4CKCA 3C3YA 3DXZA 2ZBQA 3KR2A 3R9XB 1TPYA 1YF3A 5C0OE 2ZW9A 2A14A 2I6GA 3UJ9A 4DQ0A 1KPIA 5ICFA 1F38A 5EZQA 4OX9Y 4MTLA 4HC4A 4HH4A 4PYOA 4Z2YA 3SGLA 1HMYA 4AX8A 5LQNA 4M38A 2CWWA 2XVMA 4EKIA 2XBMA 2I62A 3BWBA 3G5TA 1JQDA 2PT6A 1QYRA 2QY6A 4PCLA 5DX8A 3SMQA 3HVJA 1NV9A 3CJRA 1I4WA 3BXOA 2BM8A 3UJ8A 4PWYA 4GQBA 3OZTA 3P2KA 5E1BA 5HILA 8MHTA 1JQ3A 3AY0A 3G88A 1BOOA 2VDVE 5F2NA 4B17A 3NWEA 4QVKA 4YMGA 5BP7A 1XCLA 3I58A 2CKDA 3UJ6A 1ZGAA 1I9GA 3KPVA 3IEIA 3OU6A 1JQEA 1WXXA 3GWZA 1WY7A 4KDCA 5E1DA 2IBSA 4AUKA 2VDUE 3OCJA 3WSTA 3M6VA 3A4TA 4E2ZA 1JG3A 2WK1A 3P9NA 4ER0A 2IH5A 5KQRA 3GU3A 3KPYA 5FULA 3PFGA 4CXMA 4PCAA 1P1BA 5DXJA 3TKYA 4F86A 4POOA 1M6EX 1WZNA 5E9WA 4RSRA 3VYWA 2PBFA 3PVCA 3RIEA 3LBYA 4FT2A 5ICGA 5BXYA 4PYKA 2DPMA 1VIDA 2JJQA 5D1NA 3NDIA 4BY9E 1ZGJA 4RVGA 4U7PB 3C6MA 3UA3A 1RI5A 1VLMA 2AVNA 3EMBA 3PFHA 3TKAA 1INLA 4C05A 4E32A 2UZ4A 3FYCA 2K4MA 2QRVB 3DMFA 5GIOE 5EEHA 3THRA 3KQWA 4OA8A 5EIWA 3DH0A 3ELUA 3UFBA 4FR0A 3LL7A 4WVLA 3Q87B 2JG3A 4PINA 5DM4A 3BWCA 5EMMA 3UJ7A 3ANXA 3PX2A 2YXEA 5GP1A 2ERCA 1QAQA 2BM9A 2O0LA 2PGXA 3E05A 3FPGA 5JR3A 1MHTA 3G2OA 4O29A 4BLVA 3R0QA 4CWAA 4EVIA 4RYLA 2IH4A 2O57A 4PYNA 4CKBA 4A6EA 1B42A 1YB2A 2FK7A 4X63A 2ZULA 3G2PA 5E1MA 2C7RA 5DM1A 4C03A 5LQCA 4PONA 3R3HA 1VQ1A 1M0EA 5ICEA 5FWAA 3M70A 4X61A 3LDUA 1UIRA 4QDKA 2PWYA 1XTPA 2C7PA 3KQYA 4HTFA 5B1SA 3M4XA 5GIPE 2NNWB 1P39A 1WS6A 3A7EA 3R24A 4HSGA 4P7FA 5HEKA 4JXJA 4QTTB 5HFJA 2ZIGA 3MGGA 5K0JA 3C3PA 5D1HA 1SQGA 3X0DA 4AZVA 4RTMA 1XJ5A 9MHTA 2PKWA 2FRXA 5M5BA 3UJCA 1JSXA 5GINE 3FTDA 2ZZKA 2NP7A 5DWQA 4GC9A 3DULA 1JR4A 1RJFA 2ZTHA 3NMUF 1X19A 2PX5A 3V8VA 1DL5A 2GPYA 1R8XA 5DX0A 2AOTB 4C08A 3CGGA 4MQ4A 5DTQA 5FHQA 2AVDA 3UJDA 3BWMA 4XUEA 3TQSA 1G6Q1 2ONZA 3M6XA 3OFJA 4RWZA 3P8ZA 2IIPA 3HCBA 3KR9A 2Y1XA 4GOOD 5EOVA 2OPBA 2CMGA 3FRIA 1U2ZA 3NDJA 1P1CA 1EQAA 3DLIA 3FZGA 1I1NA 1YUBA 4R6WA 4RTNA 3TLJA 3ORHA 4PIPA 1KXZA 1M6YA 4FT4A 3OZRA 5HIMA 5EMLA 2B9EA 1RJDA 1VP3A 3AXTA 3MCZA 1QANA 1RJGA 4RVHA 5DT2A 3RW9A 2AN3A 3DXXA 2BR3A 3TM4A 3JWHA 1JG2A 4OQEA 4Y30A 1P91A 1ZKDA 2ADMA 2XYQA 4GOLD 4GOND 4OA5A 2YTZA 2GA9A 4IWNA 2PV0A 5MHTA 2IFTA 2G71A 2JHCA 2O05A 3DTNA 1G8AA 3DLCA 3DP7A 3ELYA 4FGZA 4K6MA 3G89A 4U7TB 1KR5A 3HCCA 2P3LA 3U81A 3KHKA 4H0NA 3UJAA 2ZBRA 4E2XA 3FTEA 2CL5A 4Y2HA 3HTXA 4YV0A 1NBHA 4GC5A 4HRAA 4YUZA 3LHDA 4EMSA 3I53A 2I9KA 3CCFA 4FS8A 2E5WA 1VBFA 2WA1A 5DRTA 3TR6A 4P7GA 4DCMA 1BC5A 2IGTA 5EMKA 1XDZA 3HCEA 3B7PA 1WXWA 3GO4A 1ZHFA 3SR4A 3ER8A 5DSTA 3REOA 1N7JA 1O9GA 3B3JA 3KU1A 5FHRA 3TOSA 5K05A 4RTRA 3G7UA 3MTEA 4ER6A 3LGAA 5BW4A 1VP9A 5FADA 4P58A 1JTFA 5CCXA 3HVHA 3CVOA 5KVAA 1SUSA 3QV2A 5DLYA 3DMGA 2ZZNA 2PXXA 1G38A 1KIAA 2AR0A 1N7IA 3GXOA 2EJTA 1AQIA 2B78A 1XDUA 2H00A 2IDKA 3KPWA 5LQAA 5CD1A 3JWJA 4PYLA 4QQKA 5EHGA 2JH9A 3FYDA 1XXLA 3DOUA 3KQVA 1Q0TA 4KRGA 2R6ZA 3KQOA 2ZCJA 3VSEA 3OE4A 4RVFA 2HTEA 5DM0A 1RI2A 2ZFUA 1QAMA 2EJUA 2Q41A 3UJBA 4YUVA 10MHA 2G1PA 1L3IA 3KQPA 4OBXA 4R6XA 3B5IA 2PX2A 3F4KA 3GRUA 3KPJA 3SM3A 5FQOA 4X1OA 2HR1A 2JHPA 2NYUA 2ZVJA 3FUTA 1L9KA 2B25A 2OO3A 3NVMB 2PX8A 3TRKA 1YZHA 5FQNA 1ORIA 5GM2A 4CTJA 1DCTA 3P2EA 5K8VA 2ESRA 3LPMA 3C6KA 2HMYB 3BGDA 2Z6QA 2OZVA 4RTLA 1WG8A 2R3SA 3GRVA 4PYMA 2V74B 2QYOA 1NW3A 3FUWA 3AJDA 3OU7A 1NW5A 4XCXA 5HIIA 3G8AA 5EGSA 1OR8A 1R18A 4EQZA 2NXEA 5K0FA 4GUAA 2EX4A 2YX1A 3HM2A 1FBNA 3P9KA 3MB5A 1UFKA 2IP2A 5K0LA 2PJDA 1QZZA 3P2IA 2KW5A 3E8SA 4MHTA 3OU2A 3CJQA 4C06A 2LD4A 5HZMA 3KKZA 5E1OA 5EVJA 2YUIA 2VS1A 5FA8A 4M37A 1AF7A 3ER9A 2NXCA 4RX1A 3DXYA 3P9CA 3T7SA 2YXLA 5F2KA 5K0GA 1AV6A 3V97A 3HA7A 5F2OA 2FPOA 5LSAA 2OY0A 3FRHA 2AZTA 3OPNA 3TMAA 3E23A 3EVGA 5LR6A 4E70A 2FYTA 3FUXA 2XVAA 4FSXA 3EVFA 1BKYA 2OB2A 3KQSA 3KR1A 4X41A 5DTMA 3BGIA 4P7JA 2FHPA 5FUBA 2PVCA 5K03A 4A6DA 3A27A 2XYVA 5GM1A 4GF5A 4RTKA 5EMJA 1YZ3A 4ER7A 2DULA 3HNRA 4PGGA 4X60A 4CTKA 2UYCA 2C7OA 2Z6UA 3EPPA 2IDJA 3EEYA 3LDFA 1XDSA 4OBWA 5K0NA 2EG5A 1FPQA 3HCAA 3GDHA 3LX6A 4PIMA 2UYOA 2ZSUA 3FPFA 2FK8A 5E9JA 2O06A 4OQDA 5HIKA 2WA2A 5LQKA 3GRYA 2CMHA 4UOEA 3JWIA 1PJZA 2P3OA 2OYRA 3LKZA 4ER5A 4FP9A 1F3LA 1VE3A 3O31A 4M36A 4RTQA 1JG4A 3UBTA 5T6BA 2BH2A 1JTEA 1VPTA 2EFJA 3G2QA 3GIWA 3ELWA 4XUCA 4KIFA 3H2BA 3PX3A 5LQUA 5IKMA 1SG9A 3NW9A 5ERGB 1VL5A 5E9QA 3HVKA 1UWVA 5EG5A 4DCGA 5K09A 2BR5A 2PWPA 5KQSA 3T0IA 3O7WA 3IYLW 3HCDA 4CKEA 2OB1A 3FPJA 5E2AA 2AOVA 2VZ9A 4RTOA 3PLAE 1IY9A 2VDWA 3SVZA 3QOXA 2V7EA 5G02A 3EMDA 1R6AA 1YFJA 2GH1A 3L8DA 5EKXA 1L3BA 1D2GA 3A25A 5E8JA 1KP9A 1N2XA 3UWPA 3D2LA 3MERA 1EG2A 2I7CA 4AZSA 4V0RA 4BP3A 3KQQA 3SSMA 2G8NA 5T67A 1IM8A 3G8BA 4IV0A 4YUXA 4FZVA 2PX4A 2IBTA 4E33A 2YQZA 5CM2Z 5LQRA 2YVLA 3FUVA 3HP7A 2H1RA 3SXJA 2G72A 5DTRA 1V39A 5KYGA 3LDGA 4NECA 1TW3A 3P9IA 4ER3A 4F85A 5K01A 3B3GA 3NWBA 4IV8A 4C4AA 3PTAA 4KW7A 3CBGA 2P3QA 5EIFA 3TPZA 4KVZA 2JH8A 4G56A 1BHJA 2AOUA 3ELDA 1NBIA 3HA5A 2GS9A 3BZBA 3B89A 4GOMD 4IKPA 2GAFA 1HNNA 4L7VA 4HG2A 3CC8A 5H02A 5DXAA 3A26A 4RTJA 4V0QA 4DA4A 3JWGA 3B3FA 1EJ6A 4R05A 2G70A 2P7IA 4GEKA 5JUWA 1NT2A 5CVJA 5EHIA 3TFWA 2BR4A 2ZZMA 1KPGA 2PSSA 1G60A 1RI3A 1Y8CA 2NXNA 3GJYA 1EAMA 4BLUA 5K0CA 5FWDA 4RTSA 3LCCA 1D2CA 1T43A 3DUWA 3OZSA 4R8RA 4E2WA 5C9ZA 1YFLA 3P71T 2YXDA 3EVAA 4LECA 5FCDA 3EVBA 2GB4A 2O07A 3UA4A 3BKWA 2IH2A 4QVGA 4QPPA 1NKVA 4QPNA 3PB3A 2AN5A 3BGVA 4RVDA 2P40A 4M7RA 3TM5A 4RTPA 1JG1A 1X1BA 3DMHA 3SX0A 1SQFA 5FTWA 3MHTA 2PXAA 2PXCA 3M33A 2ZWVA 1NV8A 3CKKA 4PYQA 1RI1A 5EKUA 2ZBPA 3AXSA 3OE5A 2FCAA 5KS2A 4QQNA 5CVEA 1AQJA 2NXJA 3VC2A 4YV2A 1L3CA 3FPEA 2C7QA 5DSXA 2HV9A 4ZTBA 5CCBA 2ONYA 3GRRA 3HA3A 4YMHA 3FUUA 3EVZA 1JSZA 5DM2A 3K0BA 5K0BA 3EVCA 1RI4A 2HNKA 3DR5A 4DF3A 3FTFA 3MCTA 3O4FA 5CIYA 1Q0SA 4DM3A 3K6RA 3MAGA 2NP6A 4E31A
chains in the Genus database with same CATH superfamily
2I6QA 3ONDA 2C4WA 5ICMA 2QRJA 4JENA 5ITZA 2X3FA 4OGFA 4MP6A 3LRXA 5DX1A 1EVEA 2ZJ5A 4AP9A 2PFGA 4R1LA 4BVFA 1JN0A 1X1EA 2FVYA 2DWOA 3D7RA 2BMAA 3HJGA 4JWTA 4ZIRB 2ZSDA 1FSSA 3PHCA 2EP5A 1Y8RB 4UEWA 2J31A 3K0KA 2NG1A 4LYJA 2JJ1D 1RPJA 2RI6A 2KX7A 3FPLA 1CD5A 4RIHA 3K35A 4IKOA 4ZOQI 3VHRA 3VH1A 4LXHA 3FCUB 1KYWA 1Q1GA 3IP9A 1SVUA 1R6UA 1XA0A 2CVQA 4JLAA 3FKSD 4MVXA 1NBWB 2Y27A 3QE9Y 4H18A 3IUNA 3FDJA 4GDFA 2VHXA 4GO1A 2GYVA 2H1HA 3AP3A 4R1OA 2A3RA 3DZDA 2Y1OA 2PD4A 4F5EA 4PVDA 2GCGA 2HMVA 2B1RA 2Z57A 4F3TA 3K9QO 1TK2A 1ZGHA 1ZK1A 3BM5A 3AR7A 4I1YA 4M8KA 4ZARA 5B1EA 4PPFA 3PR3A 4IDAA 2IS1A 1CRWG 1CRLA 1MT3A 1C0PA 1RLUA 5HK8A 4QICA 1Q1AA 4D8YA 1C3OB 2ZIFA 2DR2A 1PP4A 2TRSB 3GMTA 3WMXA 4E5DA 3QWIA 4JBGA 3SDZA 3KYCB 1E3WA 1FP6A 2PGJA 4YJ2F 1R8YA 1W85B 4WI1A 4EW3A 1Z75A 3E0XA 3LP6A 4PZPA 5L40A 2GAOA 4OO3A 3K09A 1QRAA 3DZFA 1G8KA 4BQSA 5EJ5A 1QB7A 1Y5NA 1Y6RA 4NVRA 4DW8A 4YUAA 4I55A 1G8PA 4Z9FA 4EHAA 2YOFA 2D1QA 1YU6A 2C3MA 4G5GA 1E6WA 4EKYA 3RRJA 2H2AA 3PG5A 4V39A 3UICA 1H2RS 5G0UA 1N92A 1FZQA 3R2JA 1N5KA 4GP6A 5EP3A 5AVZA 1JHDA 4BTLA 4DGQA 3LXUX 2XV1A 1Q0QA 3G2KA 4TYNA 4DYDA 1OYYA 1GIAA 1I30A 4ATNA 1TMYA 2CXUA 2MDTA 3OFND 4LK3A 3PYMA 1I2CA 2XWQA 5ECDA 3JD2A 1XRPA 1ESCA 2Z9DA 3HZHA 3WB9A 1ZVQA 4L8YA 1KYTA 3R7SA 3WOHA 2HQ1A 1JLRA 1G6OA 3LT4A 4HGYA 3RU9A 4P98A 3K8OE 3ZE2B 4TYWA 4B9AA 1UDAA 1PG0A 1NVWQ 1YQUA 1DX6A 3RDPA 2N42A 2OCIA 4DA6A 1HSZA 3DCNA 1NLMA 2R8ZA 1N3IA 3BBLA 3CV3A 3DXZA 4BUZA 1IU9A 1K89A 1KK2A 2NYRA 1EG7A 2NU9A 3DL0A 5D6OA 1W44A 1ISHA 1E5TA 2AFIB 3ZWPA 2J41A 2QS9A 3IP7A 1GQRA 3DQPA 2H1OA 4JJZA 3ZI0A 3N2ZB 3UT6A 4WWHA 2FWJA 4P22A 2W42A 1CR2A 5EP1A 2MTBA 4PCLA 4S1WA 3P2YA 5DX8A 5H0IA 2WD7A 4UHEA 2NU7B 4TXMA 1ORVA 2AXEA 4KP7A 3RRNA 3ZE1B 3WQSB 1OLSB 5IVIA 8ADHA 1QKIA 4G5YA 3IUYA 2CKDA 3UPDA 1O96B 2A92A 1KMIY 3IP3A 3PNYA 1X7XB 2BWJA 4Y6RA 5HRAA 2O8EA 3WK4A 2IJGX 4BNLA 4DAOA 3A4TA 4G0XA 4S3MA 2IH5A 1C7EA 5K8LA 3CZ5A 3VZPA 1WDTA 1DO2A 1P1BA 4KDEA 4WRRA 1LI7A 4PZ0A 2QJOA 5HF8A 2B9VA 4OUDB 1MB4A 3K1YA 4OAQA 3MWEB 3ROPA 1A4UA 2CYAA 2EXXA 4JZYA 5BSMA 2NVWA 4XGQA 1AQNA 4KPYA 5FV4A 2RJ3A 5KTOA 4RPGA 4NBLA 4NQRA 4Q16A 2UZ4A 4X94A 4U2BA 2FSUA 3FYCA 4KJZA 4O4IA 3GVHA 4Y3UA 1G8MA 5KVSA 3VNVA 1PR6A 3IS3A 5E6UB 1O94A 1WR8A 2PRYA 3TBFA 4PINA 5LUBA 1RP7A 4II2A 4TQ9A 3GD5A 5EMMA 3U3JA 3UJ7A 3IXQA 3KO8A 2X2PA 2PGXA 3W5AA 3R9WA 2E4VA 5AKXA 4HNQA 4GWGA 4IIYA 3T7IA 3LKBA 1RHMA 1U31A 1XZ8A 2PZJA 1NJFA 2C2OA 2YHUA 1CCWA 3EFOA 3NETA 4W82A 2E1RA 2DUMA 5A1JA 3DZHA 1G7CA 4ZI3A 3EEQA 3UNXA 1B73A 3ZOZA 3A1CA 3ED5A 2X13A 4GRAA 4RADA 3DDZX 3ZJVA 3FFTA 4D8TA 5LLDA 5FWAA 3OIWA 1H2ZA 2NPIA 3TE6A 4B3IA 5JAQA 4Q18A 3EQ9A 3NBAA 5B1SA 3IILA 1Z6TA 1QS0B 3LVQE 1Y7PA 2CZGA 3DWIA 4GX5A 4KE6A 3KYIB 4Q4LA 4R84A 1GAQA 1L5RA 1G7SA 1VSVA 3ESYA 3P0JA 4IYRA 5TQ2B 3U7QB 4TVOA 1YAJA 3JQPA 5BPFA 4QT4A 3WXMA 4IQGA 3H5AA 2QYHA 4RZUA 4DQXA 1JFTA 1VM6A 5JCZA 5JCJA 3LX8A 3BWEA 1NL3A 3G2IA 4PNZA 2NUAB 4MVCA 3OAAA 3VJMA 1RJFA 3O2SB 3P4UA 3PQ5A 4GVLA 1DJOA 3QPDA 4CKEB 5ADWA 3P9YA 3GAFA 4KIJA 3SSAA 1DB3A 5FEMA 3WGKA 3R8FA 1NQTA 2QP9X 3UJDA 1GAEO 5AVKA 3THXA 1BYUA 4TKLA 3NNNA 5CT4A 5CA0B 2D8AA 3PPIA 4CF4A 5BQ3A 3HXTA 3HZOA 2JCXA 1IE3A 2CYCA 3D31A 1NYLA 3H4TA 2FZGA 1ZD5A 4BO3A 1GYRA 2YZMA 4XE5A 3TLJA 1F0NA 3FJYA 5DXFA 4RJJA 4XOIA 5ALJA 5GJCA 2R6JA 5CG2A 1ZZGA 2CEAA 5KREA 2YN2A 1QANA 1YK0A 2Z83A 3GB9A 3N05A 4LIPD 5JZSA 3MJHA 5EJEA 2X1VA 3WYCA 3H1TA 4Z9AA 4QM7A 3WLHA 3AYZB 3NYWA 4GGOA 3V80A 1SKBA 3O4RA 1C81A 1FFGA 2OC4A 4G24A 4MMZB 1QK5A 4UPVA 4BU0A 3EGDA 5FKJA 3VOTA 3EDCA 4MKXA 4KQMA 1T5TA 1GV0A 3F97A 3BHJA 4R31A 5CH5A 1R12A 1XFDA 4RQUA 3JQ8A 4HDNB 2OCXA 1MF7A 1CF2O 2VJBA 1FX0B 1ZGZA 3VDRA 5DF1A 1VMKA 4ABYA 4ZZ2A 5KTSA 1QUEA 2QTZA 3C3XA 3DR3A 1QQTA 1TQ6A 1J33A 3TMKA 3HE3A 2FZ5A 3ZVKA 4RXTA 3UAOA 1XD2A 1X0VA 3CF2A 5BT9A 4JL8A 4ZZ1A 3CT6A 1HL7A 2AE2A 3MW8A 4DJ5X 1SVKA 3WYEA 1KU0A 1KOJA 3JQGB 1KGDA 4YO8A 4JB0A 3AL3A 4P86A 4CDMA 3ER8A 1B6TA 2D54A 4UJ5A 1FVHA 5CAEA 1FP4B 4XB1A 3AVOA 3WFJA 1E77A 1N7GA 1H94A 4W9RA 1DTSA 2AHRA 1VBKA 2WC1A 2YYYA 4HR7A 2HSGA 4JSRA 4Q19A 4L78A 1RKBA 4Y2VA 5FPKA 5LQAA 4TKVB 3KSRA 4TRJA 3NM5A 1GZHB 1LLDA 4NTZA 5HQ3B 1PWXA 4GPTA 2BZ1A 5JQGF 1IXRC 4QXAA 4FOPA 1UBSB 3WGVA 3MMNA 4IOJA 4URYR 1F3OA 4X8HA 1RYBA 3Q7RA 1D1PA 5CLQA 5CG1A 3K0CC 4C3UA 2XNJA 2ZS9A 2YVAA 3NBYC 3V7WA 2HK6A 1AHHA 4Z0TA 4ZO9A 4N03A 5LD2B 4AD8A 4JYPA 3HWWA 1KI1A 4BECA 4M21A 3DF7A 4XW2A 3C6BA 1G41A 3NDBB 3T3EA 1JEQA 3PX7A 5I8WA 5CXUA 1OIXA 2R79A 1GNRA 1FS4A 1L4MA 1AXEA 2VJMB 2X4IA 3R5HA 2B98A 4NYIQ 2BFCB 4URVR 4MS3A 3TX2A 3O84A 2IOYA 3IB3A 1ISSA 1X7HA 3C14C 3FY4A 1X74A 5FTKA 4LZPA 5K0LA 3Q7IA 1OXMA 4C7MA 3E8SA 3R7FA 1QIGA 3IAM6 3QPWA 4QSHA 4D97A 1TTHA 2H5LA 2LD4A 1S4QA 4P3KA 4HZGA 1I1OA 3G68A 3GLIA 1KYXA 2YUIA 3KB1A 3MJ4A 4BO6A 4K03A 4GQIA 4M37A 3L0CA 4WXMA 4N5DA 3OIYA 3N1UA 6ABPA 4M9CA 3TQCA 3P9CA 4D80A 2PZLA 3HXQA 1SBCA 4F5WA 4L95C 4O2BA 1YQGA 4G36A 4QXMA 3TIFA 5AW4A 1LPNA 3MXOA 3UTDA 5HUHA 2R1UA 3JQFC 1JXAA 2PSEA 4O1IA 4Z53A 3VV2A 5C34B 3A9UA 3WO0A 3KR1A 3SQWA 4CF3A 2PZMA 2F62A 3NTUA 4R8VA 5EIHA 2FHPA 1Y5IA 3DONA 2H1CA 2OLEA 2VF8A 2IZ0A 2WF9A 3C1TA 3RBVA 1I5EA 5EHZA 2D2IA 1IEQA 4X7RA 2HA7A 3U3OA 3LC0A 4ACBA 3K9BA 5HYVA 4W1SA 1A8QA 1CUIA 4IIBA 2IYLD 4C6SA 1Z0JA 4OHUA 4WINA 1WEHA 2VBCA 2OV1A 1KMCA 1XDSA 2GAIA 3D6JA 3L8YA 5BV1A 3G0GA 1M2EA 4KOEC 3GA7A 1ADCA 1YQXA 3JY6A 3C5WP 5T57A 3WIOA 5AQEA 4AULA 5CR9A 1GGJA 2GK7A 3QVJA 3MK31 3DAHA 1E1LA 1L7BA 1QZUA 1Y1TA 2BSXA 1GRVA 2EP7A 2O06A 3HRKA 2XEXA 3RM3A 3A3OA 5LQKA 4PNPA 2JIQA 3OY2A 4N6NA 5COQA 4B48A 1F60A 4RUKA 5L3SB 4IZOA 1Z68A 3A3YA 4RF5A 2D4HA 3PFKA 1E1KA 1QOQB 4Q4JB 3CN7A 5SZKB 2GYYA 3NHRA 2JW5A 3I2KA 4FEYA 5BSHA 2OCAA 3I0ZA 3NW9A 1CS4C 4HAWA 2GJAA 5K7SA 1XEFA 3CPSA 2XW6A 3KLBA 2YFKA 4PZLA 5KQSA 2PE5A 5JROA 3ZJYA 1Y63A 1GZDA 4FGUA 4ZOCA 2QA5A 4OHRA 3DT9A 4R98A 2OFOA 1Q11A 1COWD 1YDGA 3E84A 4FCWA 4ND4A 5AKLA 5A4MS 1R6AA 1KI6A 3ANYB 1AJEA 4UMDA 4Z4IA 2H48A 2ZCUA 3N0WA 4ECAA 3VHLB 4HNGA 3TL6A 4GRDA 2G08A 4JL5A 3VC7A 1TIBA 1YTLA 3MT0A 4CMBA 1RQLA 2OAQ1 3JQDA 2L2QA 5KAMA 5ADHA 4K9RA 1NNLA 1N9ZA 5KZMB 3U4HA 3HCRA 2CJXA 2DC1A 3O9MA 2A0WA 4JUBA 5F35A 1S3SA 4KV7A 4D81A 2IBTA 1M5RA 1CW2B 1U8FO 2OHJA 1BAPA 3FAKA 2ZUUA 4OH7A 4PGMA 4RAOA 4S2UA 4Q03A 1T5LA 2XUIA 1IAQA 3RGWS 4BO5A 2MSKA 4IX1A 3TLYA 4C0WA 5J1TB 4MPTA 2W2NA 2YWRA 2B4QA 2GX6A 5CD9A 5CXQA 1JYEA 1RC0A 3Q41A 4NECA 4UVEA 3N8KA 1E1RA 1HBJA 1WXIA 2CMKA 4IV8A 4QLAA 1LQTA 3PR2B 4RIGA 5EINA 4ZT2A 4BAZA 4DPKA 3J81k 4B3SB 4LF7B 1PTJC 1PGNA 2A9VA 1X38A 2RFLA 4M9SA 3FX2A 4NYJR 4XGRA 1NI3A 3PUXA 1MGPA 3OHPA 1VE7A 1WXHA 1Z82A 2FWRA 2WP0A 2R66A 3P9ZA 4RSMA 5AJUA 2CUKA 3KM0A 3LQ1A 5DYIA 2NSLA 1I33A 1SVWA 1OU0A 2VNSA 2HXYA 4XWGA 2C88A 3RC9A 1FTQA 4P93A 3W2FA 3V4ZA 1NI4B 4NSNA 4GQAA 2IV2X 4B46A 4R05A 1AOXA 1K0UA 1H0SA 1XLUA 4JA0A 5IXSA 3TAHA 4W5HA 4DZTA 4QZVA 1RZ3A 1LTQA 4R51A 4BLUA 1KZ7B 1F1BA 4DA9A 4UZFA 5K6AC 1UBMS 1LBEA 1RWVA 2CMFA 3K5HA 3LLUA 3M9XA 4OXRA 4PRYA 4CLOA 1C9JA 1TTTA 1NN5A 2XWPA 3OO0A 4TM8A 1GZ3A 1H5NA 1BMFD 1VIMA 1ZW1A 3ASYA 1M2NA 5HF5A 2AN5A 1M8KA 2CSUA 4KBYA 3AV3A 4WLVA 1UIMA 5TGDA 5KJ6A 1AC5A 4CIDA 3RU3A 2XGJA 1YR7A 2RGNA 4L8FA 2Z4SA 3V4VB 1LBQA 1PU2A 1F2UB 4PYQA 3DKVA 5KYUB 2GO1A 3DL4A 4GPD1 4D8WA 5B7NA 4BFTA 1AHIA 1KH3A 2ZJ1A 3E9EA 2PKRA 1Q91A 2EFYA 2QLNA 1J0CA 4RE6A 3DMTA 2QMYA 1R6DA 1BFDA 1Q21A 3ABOB 1N5JA 2VJDA 2QZSA 3HWX1 3JS5A 2VPQA 2JFXA 3BHMA 2ZREA 3EEBA 2JGNA 2XOXA 2YS7A 3IMGA 3P1JA 4I4CA 1N2CA 2JIRA 4COKA 1RU3A 1W47A 3SDBA 4DM3A 2EL7A 4TYMA 3T35A 1XZLA 5JXHA 1NVFA 3TTSA 2ZBGA 1WCWA 2NV0A 4LVUA 1GYPA 5CA1F 2PUJA 1T3HA 1V3VA 2YR0A 3MTIA 3LYUA 2Q8NA 1JIVA 5HP4A 3OFSA 1JDSA 1LLUA 3C1OA 2ZIEA 1SPXA 3THSA 3FUCA 2WDPA 4Q1VA 2NVUA 2CXPA 1P7ZA 4E12A 3GCZA 1EE9A 5BW5A 4L0MA 3ZHSA 1ESMA 3W6OA 1UK6A 2JC3A 1FC0A 1XMSA 2ORED 3QKWA 1OH6A 2OO5A 2A1UB 3FZEA 3QXXA 5AVVA 1TJ3A 1UJBA 3FI9A 1SVNA 5EXPA 1U99A 4NCKA 4I4TA 4L4RA 4HZUB 1G98A 4OXXA 2AEEA 4AT1A 1NF3A 2W8ZA 4KPFC 2YIJA 4DXHA 5THKA 2I7TA 5GWXA 5KMGA 1WSWA 3I37X 3RRFA 4PS1A 4L76A 4B3GA 2C5HA 2EGUA 1G18A 1ODCA 1YJQA 4ZAGA 1W0JD 4BFSA 1DAPA 5LN1A 3HY3A 1V4VA 3M3PA 3ZUPA 1Z47A 3QOFA 4YDRA 1FRVA 2AS0A 5E6RB 3WLJA 4F4CA 4R9RA 2FSHA 2W0MA 5TSDA 3RE1A 4KI7A 1PIWA 1SZPA 3DDCA 1SWVA 5ITWA 1K7SN 2AUTA 4MVJH 4Y0VA 5EYPA 2WU8A 4ZZ3A 1YZLA 1PL7A 2VH2A 4U2CA 2AN1A 3PUWA 4ZWNA 2ZSBA 3IXLA 2OXTA 2AD5A 2ORIA 5KDDA 3B6JA 4V1CI 3ZDFA 1QH8A 3A6PC 2XE8A 2XY4A 1LFAA 2PRJA 1P2UA 2WFZA 3WGNA 1EE2A 4BL5A 4LYGA 1C4KA 2FSGA 1FPMA 1OC2A 1OX4A 3BIXA 4FYVA 3QVGB 1T8TA 3SE7A 1L8AA 1ZNZA 2UVDA 4YY3B 5B36A 4AB1A 3L84A 3PZRA 3GBSA 4RABA 4D43A 4IJWA 1XGKA 1II9A 4BV9A 1NW6A 2WQZA 3O4GA 3OICA 4ENTA 1HX7A 3D6MA 4OVKA 3KTFA 4CM6A 3LOPA 4KR6A 3I3SR 2FMKA 2OZLA 3DEFA 3INGA 1M6WA 3UV7A 3W5IA 1G5TA 5A0VA 2RHDA 3E7XA 1OHHA 5J5CA 2O5VA 4GM0A 1YTUA 5EQJB 4CT4B 4BGEA 5K0EA 3RWBA 4KG7A 3SHWA 1V6CA 2JHAA 4KACA 5JD3A 3NBZC 3E3NA 4EK9A 1PWZA 4CQMD 1RPNA 4GI7A 3E9CA 4HO1X 2DVMA 4LPSA 3RRYA 4KXLA 4AMGA 4MVJG 1KJWA 2CXHA 2YNMA 1J2JA 4DA7A 4FC7A 3JU3A 4O2AF 5D00A 3FH0A 4DDTA 4UAJA 4C2BA 3A6EA 3C3YA 3WFZA 5BRJA 2R84A 4RF4A 3MCAA 3CBQA 5DBGA 4X0EA 3CZQA 1UZMA 4UVHA 1DC6A 1A9RA 4OB6A 2ZRGA 4LHXA 5ICFA 4FBLA 5REQB 4N47A 3PHHA 1XZJA 2XE6A 4Q37A 2C94A 4Z2YA 3D9QX 3L7OA 4HFNA 4PE5B 5C7IO 4WVFA 4QQFA 2I62A 2DQKA 1VJRA 3QFRA 1I4WA 3IRUA 5IJZA 2BM8A 4NXMB 2RB4A 1RZRD 1U2GA 3PC4A 1TUIA 1RKUA 2HIHA 4OFZA 4I14A 3SJBA 3AILA 1FLAA 4B17A 4YMGA 5A5VA 2AJCA 4OHBA 1N5DA 3AMVA 4KDCA 4O63O 4R16A 1SM4A 4Y98A 1RADA 2I9PA 2ZTSA 1UJ2A 3OCJA 2XMDA 2FU5C 4HDMA 1WO8A 3L41A 5F5XA 2BSAA 1YB6A 2VAPA 3MNFA 5D3QA 2ZVDA 5A71A 2J30A 1J0BA 3RYHA 4JOCA 4OH1A 1MPXA 4M98A 3RLIA 4MVJM 4JJ7A 2OHOA 5JDCA 5LLTA 4R2XA 3W5HA 1P1KA 3VR6D 3T94A 3JQ7B 4ENVA 1E4OA 1Q0HA 2BEWB 4WH0A 2XNKA 4YRLA 3CF4A 4EDHA 1E2FA 1L4FA 2EBUA 3Q3EA 1C1XB 3AP2A 4LCBA 5KU7A 4ZQEA 2HOQA 5THXA 3PFHA 1O5OA 5F5LA 4LNHA 4HSEA 4BMCA 3KDAA 1ZJYA 4ZOBA 1Y3FE 2F3PA 4Z49A 2P0AA 1H05A 3LCMA 1CR0A 1H0HA 4XVHA 4XQGA 5CNMA 3TGWA 4WVLA 3ZBUA 4DB4A 4DWOA 2ZS8A 3EVTA 5BRAA 4N8DA 5IF9A 3AM4A 4TL9A 3F9IA 5BUSA 4BO8A 2YZKA 3PNQA 4MV4A 2PWAA 3R0XA 4C4YA 2G0NA 2BM9A 2ZSFA 1A5SB 2J48A 5BQ5A 3FFXA 5TXGA 3N2EA 3MD9A 1K6JA 5C46F 2FB9A 2O8VA 5KWJA 4D4GA 2CD9A 4JJEA 4LJYA 5LFAA 4UVGA 2JGKA 5F1PA 2VUSA 4DTCA 1PE0A 1EX9A 1LV8A 1DC3A 3R1IA 3I6QA 3ZZ1A 3L0DA 3WLOA 4RK7A 4DIUA 2OZPA 4UCFA 3MWKA 1Z7BA 2G0TA 3KALA 1GQSA 2VT6A 3DV0A 1MRZA 16PKA 1P2DA 5FX2A 5IXJA 2NZYA 2PWYA 1TM7E 3AG5A 4ITRC 2IZ1A 3X1ZA 4D41A 1JMVA 1U7WA 3UYLA 4EMUA 5IM4F 4EG3A 2IIVA 3A1TA 1NUHA 2X1LA 4JXJA 4U63A 5HFJA 3ZWNA 3ROXA 5CIWA 1UDWA 2ZTUA 1V4BA 2HRCA 4HAZA 2Q7DA 3KOYA 3T4XA 4D57A 2FEMA 4S1VA 4U7GA 2F2TA 1ZD3A 4UNIA 4KQHA 4P80A 3WGYA 1I2DA 1CSEE 1E3WB 4M9RA 5DWQA 4EJSC 2X9NA 3LF2A 4HP8A 1OXXK 1X19A 3ILSA 1W581 2W37A 3U3DA 4DLNA 1SKQA 3M4JA 5EGNA 2P2ZA 2XJ9A 1E4VA 1K5HA 2YV5A 5DYGA 1BTOA 1KNXA 4I55B 2ZRCA 4XB2A 5TB5A 3RV4A 4AZ0A 2R7AA 5KBYA 4P5PA 1LZKA 2NIPA 1I0IA 1YUBA 2G6BA 3FKJA 1EA7A 3FXAA 4COOA 3U49A 2YOHA 5A2QA 3ZLVA 2XCTB 4O3FA 3RADC 4QO8A 2I4LA 3PQCA 2Z3ZA 1L5KA 1XZPA 4RLSA 2F64A 5TMEA 4L1KA 3TI9A 2Y93A 4GLJA 4G9GA 1D0SA 4J2OA 4LQDA 1TGYA 2JDID 5CDYA 2JNWA 5HA5A 2VDJA 4MUMA 4WLOA 2XVYA 1QP8A 2EW2A 2GA9A 2LVBA 5BNFA 5MHTA 4F56A 5DZSA 1V7PC 2IX9A 4MLCA 5C7YA 3BH6A 3DLCA 3ELYA 1G8JA 4W8GA 3C7CB 4EB8A 2O2SA 5TIIA 4OQ4A 5C31A 4N6OA 3DE7X 3TPCA 2A9QA 2DEUA 1BWPA 1EFRD 3HTXA 3DFIA 2PZKA 2M6RA 2DB3A 3DF9A 3RKUA 1LVUA 1SHKA 2CLDX 2DWUA 5GZ6A 2FEAA 5AVTA 1NFFA 3GOHA 2C8JA 1CY7A 4M88A 2NU9B 4DBLE 4UASA 3VRHA 1ZLYA 2IKQA 4J9VA 5IVDA 3RAEC 5JOQA 1V1JA 1PJ8A 5DIFA 3L18A 3SR4A 1N7JA 1GUZA 1XDWA 2KJQA 2Q5OA 3TOSA 2EKLA 2DFLA 1YFKA 2RG7A 1GAXA 5BW4A 4IHAA 4TQAA 1H42A 2XSZD 2XRFA 3DC7A 1VL8A 1OKKD 2D1RA 2NZXA 3JV7A 2WD7B 4I36A 1QGAA 2HM7A 2ZJ4A 4QJ4A 3ESZA 5KVAA 1VG1A 3RBZA 3K30A 1GL6A 1NM5C 2EJTA 2FHSA 4JROA 2B1GA 5SY9A 2UAGA 3QQPA 4L5AA 3S2SA 1P0CA 1V7ZA 3JWJA 4AY5A 1V8DA 3D3EA 3KQVA 2JLRA 1GKKA 1LJUA 4JP3A 3MQFA 1IQ0A 1K3UB 3CUUA 4PY2A 3SU8A 1PG5A 3N8DA 1L3IA 1KIFA 3KB8A 4K7JA 4NCIA 4RIEA 3B9BA 2PMKA 1HK7A 1MNQA 1W19A 3HG7A 2I8AA 3EFHA 2IEAA 5KWEA 5JNRA 2P2SA 3PJRA 2HKIA 2WVAA 2PNJA 1BX1A 1DJQA 2JEOA 3K32A 4G1BA 1RAAA 4GX0A 4PHGA 4YN3A 2JFHA 3TQRA 2OZVA 1GGHA 4YDSA 2Y3IA 2P2YA 4GVPA 2QYOA 3VISA 2HMAA 3LUBA 2C42A 3NCTA 1QYXA 4XCXA 3AFGA 2DERA 5AUOB 4UFOA 2PR2A 3QEJA 1CIVA 3DDHA 3DT6A 3F98A 3T7KA 4OHYA 1E1DA 4DJEC 2OV2A 3D02A 3LDAA 4IVQA 2ZRNA 4US0R 1PEAA 5J40A 3B1XA 4QXPA 4PZ9A 1O6ZA 1S02A 2OVFA 2UUCB 1WDWB 3QYFA 4NAUA 4DSAA 1UBLS 3U9LA 3CR8A 3CJQA 4OHWA 2W6QA 5FI0B 1YHNA 3D7MA 3FSRA 3ER6A 3O0DA 4FFPA 4RH1A 3GN1A 5SV2A 1K88A 4UNNA 3T6KA 3WMWA 3ZHYA 3EFOB 3GV0A 3DBLA 1J1UA 4L4XA 4KN6A 3QFTA 1U0BB 3SXPA 2B83A 4IZHA 4A91A 4JODA 5BWBA 3V97A 1T9BA 1FW8A 2CHEA 2VZ0A 1H2XA 1U2DA 4L02A 2QP4A 1P7YA 1ZGBA 1WOMA 3ZHBA 3IAHA 4X8MA 2P5TB 3WHIA 5ALVA 5DASA 4CE6A 3K0FA 5A4FS 1DWOA 3C8ZA 4IXDA 4MRRA 4WMLA 3HU1A 1JEDA 1FFXA 2QM7A 1WP9A 3C48A 2H06A 1Q74A 1WX1A 3AGQA 3I39X 4HJXA 3W90A 3NGLA 4Z2AA 2KE5A 2X5OA 3L7KA 3HL4A 4I9UA 4F1WA 1XNRB 3HYCA 4ENRA 4BO0A 3EIHA 4WZZA 3B3AA 2XYGA 1SEPA 3IOYA 3I62A 5G1OA 1U6IA 1PWHA 3OZBA 4NZNA 2WSSD 4DCPA 4YHHB 3HR7A 4OQMA 4XFKA 3GDHA 2PT5A 1W75A 1WMDA 4FMDB 1LDMA 2F1OA 4MV7A 3THXB 3RI3A 4EG7A 1EWVA 1AHNA 4HH0A 1MCZA 2BI7A 4UBOA 1Z7EA 1M3SA 2FJUA 2GCOA 2JD1A 1V96A 3L93A 4L85A 3JWIA 4L8WB 4C0SA 1HFWA 5BR8B 2J9YB 1VE3A 3SPXA 2HZ7A 2SCUA 1EXMA 5FWXA 5GZ1A 4OJTA 5DMXA 3OF5A 1U7DA 1N9KA 4ZDKA 2PRSA 1GA4A 2HLNA 3H2KA 3QVSA 5ERGB 2VLBA 2DFTA 1VL5A 1UWVA 2BSQA 4OK6A 2G7MC 2JD0A 2BR5A 2QTNA 4INOA 1FQWA 3KOWA 5BWLA 3GHYA 3EGDB 2LPMA 5E2AA 1AGRA 4KXXA 4V24A 3ZNQA 2VHVA 2KM1A 2Q1XA 5IKXA 5AW1A 4I46A 5IC6A 3SZRA 5G41A 3JQ8B 4YQYA 1PZNA 3ZK8A 3VDMA 1DV2A 1N3YA 2VHUA 3OEWA 5AJVB 1CNMA 4WFIA 4ZQFA 2ZJ0A 5E8JA 3H7AA 1XD2B 3UWPA 2X8JA 4ZCRA 3OMWA 1LF5A 1ZNQO 2BF4A 3DYIA 1UBUS 3HXLA 3EODA 3UT0A 2F7SA 3ECAA 3KQQA 2IY7A 3BG5A 1I3MA 2HCJB 3CTMA 4PHHA 4AXBA 2VDNB 5B58T 1FU4A 1WTAA 4QUIA 1KAOA 1TQ4A 5HFNA 5IAOA 1G1AA 5J2TF 4LI0A 4Q6BA 1DARA 5KYXA 2G07A 4KWEA 4MS4A 3PTZA 2HSDA 4MGIR 2JCVA 2EHJA 1P1HA 5CH8A 5BV2P 3B3GA 1SXJA 3FNIA 4KW7A 1HSOA 3OE7A 4QQRA 1VKNA 3NDPA 1RM5A 1GCGA 3SQNA 1S0UA 3CLRC 3PZBA 4V02A 4J3NA 3C97A 3Q3CA 4YJFA 1KK1A 5KUTA 2WYVA 4D6XA 4F11A 5IG2A 2W2LA 4PICA 2OE2A 4A0FA 4HF7A 3HKCA 2CDNA 1IIBA 1FE8A 3LHKA 3L7MA 3R5XA 1HTTA 4KK4A 1P1JA 2WIGA 1PKXA 4BFVA 4F8YA 2VPZA 4M87A 2GN9A 3RROA 5B6PA 3ZWCA 2JCYA 4IDQA 4E03A 1UAYA 3OQ6A 1TTQB 4OMUA 2R5FA 1E2BA 4CI9A 5EY5B 2GZHA 1RW4A 2HO5A 3R6WA 2AQ8A 5IANA 4GMDA 3CT4A 4LECA 2I2CA 4JN6B 4KX3A 2QTTA 1JEQB 1U0EA 4ND6A 5JY1A 1ISMA 1QHGA 4CT0A 2DH5A 4HXFB 2PLRA 1AK9A 1R9NA 2ZYSA 5KSZA 3IHWA 4MS3B 3S6JA 1D2EA 1L5ZA 1XZKA 2HF7A 3AW8A 2A1TS 3K9HA 1RABA 3M33A 4JSYA 3S7TA 4P92A 3IURA 2V5VA 1NIJA 2XA9A 3AXSA 1KY4A 2FCAA 3ZYCA 1QRDA 5KS2A 4S1TA 1JQAA 4FYIA 2MYPA 3DGEC 4IYJA 4Q02A 4PR3A 1L4HA 2NM0A 3GLIB 1TC2A 3O8CA 3HA3A 4RACA 2Z04A 2DLNA 3ENVA 3C3BA 3LUJA 4YK7A 3DW1X 4CIYA 5C1BA 5I7VA 4UMVA 2IYEA 3CZPA 1ECJA 1CUSA 4BRWA 4ESOA 2YBDA 4URUR 3OJEA 1BX3A 2ZJFA 4ZVMA 1V8ZA 4BN5A 4O2BB 1UJ4A 3HYSA 3W4KA 3GMIA 1SJ9A 2NXWA 1NYRA 4UM9B 4LV8B 2CHGA 2YQ5A 4HB2A 1NW8A 3L77A 1XTJA 3OJCA 1XZNA 1Z15A 3M5CA 3QVXA 3ZDEA 3UGQA 2W2MA 2P2DA 3HVRA 2TMGA 3D6FA 1C29B 2GUGA 4L5IA 4NE9A 3ZXSA 1UEJA 3K53A 4WNCA 1QO7A 2O8FA 1EFKA 3LBFA 5DGIA 3JYNA 4Z4QA 2XJ4A 1M0TA 3ICWA 4FFSA 1NE2A 1VGQA 3TLMA 5C35A 3GT4A 2WILA 3IHTA 4TXJA 1CV2A 1P0PA 3ZY5A 2YIDA 4R2IA 1X1DA 2DJ5A 2N47A 3SIRA 2GM9A 1L5QA 4LMBA 1W9MA 2JKYA 3FOAA 3MSXA 1XDBA 3EZ6A 1YCGA 3G49A 4W7SA 4EW6A 5FPPA 3GY0A 3V3KA 4LJ9A 2XMPA 4QTUB 4FFBB 1ZESA 2PIAA 4P4LA 1IB6A 3PNSA 1H2FA 3FSGD 4CM9D 3LXXA 4TLMB 2QRUA 1HDZA 3CLVA 4N0QA 3OKFA 4YH1A 5HNKA 1QLJA 1XSEA 3CZCA 3UZUA 4JJ6A 4JNCA 3WDKA 4N3AA 5F7XA 2WWXA 4ND1A 5C4GB 4ARVA 5JNWA 4J3JA 3NPAA 3OSUA 3YASA 5L6MB 1ZITA 3UGJA 1H2EA 1GRCA 1L8XA 5AW5A 1Z74A 3PWSA 4DILA 5LBIA 3WK6A 1T0JB 3WAKA 3HFRA 5IARA 5ILOA 4IH1A 4UUOA 1YJAA 2RDMA 3NUQA 1NMXA 3HUEA 2VQ6A 3A1SA 1CFZA 1RKVA 1KI2A 1KI6B 1KDRA 1R9MA 4OXYA 4QPCA 3LCVB 1YUNA 4UKDA 1TCAA 2BI4A 3NB0A 3LQ4A 4DLWA 3G6WA 3HXMA 1W4AA 3NS7A 3Q10A 5HS4A 5KWSA 3MBIA 4ZI5A 4KLAA 2YMLA 3DPIA 2I4OA 5D01A 1RVDA 1PGJA 2XVZA 2Q9AA 1SCDA 1I2BA 2QNIA 2VYND 3W78A 2F8LA 3V34A 2BBOA 4EUSA 5B2ZA 4RHEA 5CFQA 1QZXA 121PA 1NJSA 1UDBA 5JYDA 1P8AA 3I9FA 1SH7A 1NR7A 3HDYA 4WAUA 1CVLA 3BRWD 5F7ZA 4B2YA 2AF4C 3IIEA 4JASB 5EC8A 4TV8F 1F8XA 1QR2A 1GUAA 3FYTA 2PKQP 1F14A 2HJ9A 2LKDA 4AO8A 2HV8A 1AF4A 2BUCA 4G4GA 5GOTA 3AZOA 3KETA 1AA9A 2JA2A 3WGJA 5K8CA 2I4MA 4OREX 4B9EA 1NXXA 4M2LA 1DDOA 1UDCA 2H2IA 1TKBA 4U6NA 4H2DA 2IEGA 4ND2A 4AF7A 4OF4A 2VAVA 2ANBA 1QPBA 2PVPA 3DMDA 5CAEB 5KNBA 4EIWA 2OQ2A 2VA8A 2WINI 4AC9A 1WXFA 1KSFX 4FZJA 4BQPA 1MX5A 1OZ0A 3AEXA 3OWOA 3PQ2A 1XROA 3JAKA 4Y2GA 3WKAA 4BLRA 4AX8A 2RHBA 4UUPA 4ZYXA 3R9KA 2XBMA 4UMEA 1XIVA 3MGBA 3L7IA 2AIRA 4ZVOA 9LDTA 3B60A 1ZCFA 4NDNE 4CLOB 3H97A 1GQQA 1U0JA 3EZLA 2HA4A 4MKRA 5E1BA 1LA2A 5HXAA 2OBMA 3NYIA 1JJBA 2QTFA 4FDVA 4NEGA 3B2QA 1FRZA 3L7AA 1DKNA 2IDMA 3NWEA 4GKVA 2ZIUB 4I6GA 4UARA 4MK4A 4PC6A 4RZHA 2DFVA 3EFBA 4NJOA 3GWZA 2OK8A 3BD9A 3ZE0B 2J7PD 4B79A 4GWKA 1BHO1 4PFJA 2GVDC 2FZKA 1ZSYA 4E09A 1JPNA 2QRGA 3X44A 4AJNA 4BO7A 2GKSA 3HDVA 3Q0EA 3PFGA 1TYEB 2BKAA 1UJNA 5DXJA 5HS6A 3W8FA 3BXFA 3OA2A 3QP9A 4GP9A 1GG9A 1RZVA 1SCNE 3DL7A 1JVNA 1Z88A 3TQQA 5J9FA 4IM7A 3SI7A 1MHPA 3EUFA 2IOQA 3EZ9A 3EIQA 1C5KA 1N2CB 1I13A 1QMGA 4G67A 5KQLA 1Y37A 3GJ7A 1PK8A 1CE8A 5EJ4A 1QHYA 3OZUA 4HB0A 1G3MA 2QORA 3E70C 3U31A 2F9MA 3B6KA 2MR6A 3O8OA 2YMQA 3AFMA 1EXWA 4HWKA 3AG6A 5EEHA 2IU0A 3A4YA 3L6BA 1M66A 5HUQA 4FOTA 1H0RA 4J2HA 2KBFA 1MB9A 3Q87B 2W4IA 3P0HA 4PBSA 1GXSB 1CDZA 2OVBA 3H8VA 1DDIA 1M1XB 1RFGE 3IODA 4BV8A 2ERCA 2NVUB 4FXPA 4CBVA 1MHTA 4GEGA 4YP9A 4BMXA 4UCWA 4EEKA 1ISJA 1IHUA 1U7XA 2IEIA 4IS2A 4RJTA 2QDXA 3O4VA 2IH4A 4NG4A 2WNHA 4X85A 3JQ9A 1FU7A 4YP6A 1Q3TA 1UBKS 1R37A 4I4TB 3F49S 1O95A 2GPTA 3LYLA 1XZIA 4PONA 5LQCA 2CFSA 1FW6A 2CHUA 2HA5A 4WSOA 1YI8A 2YN0A 3PJEA 4EY5A 5KMGB 3L0YA 1W30A 1VE6A 3RUPA 2ZUFA 2NGRA 3GLHA 2WTXA 4QRIA 1X9IA 4F21A 4S24A 2NNWB 1NJ1A 2H4XA 1LBIA 1FYDA 1UDRA 4CG1A 3OX4A 1A7AA 1L7AA 2YV4A 2AXPA 3CG4A 3A6JA 3MGGA 5LYYA 5AHRA 4HEA1 3D81A 4OSPA 4IHJF 3AB3A 1JT2A 5CK5A 1X87A 2M2IA 4BLQA 4E5NA 1JQKA 5EYPB 4B4OA 4D8XA 4Y8VA 2ZTHA 1IG0A 4R1MA 3D2BA 4EITA 4P5EA 4EPTA 3OLWA 1P0MA 1TUGA 1DMRA 1GKYA 2WM3A 3K3PA 4MQ4A 2GBGA 3B53X 3ZH2A 1D8TA 1QH8B 1XOIA 1C7IA 4V03A 5KNDD 3AVYA 2JJYA 5DLEA 1ODJA 3CFYA 1WPRA 2QD5A 4MRMA 4NOMA 2Y1XA 4J0HA 3ZE6A 4EA8A 3TWOA 3FRIA 3UFXA 5JS8A 4GR5A 5I9TA 1CF9A 1OX4B 4H6WA 2J9FA 4K9SA 2FPPA 4QBGB 4R2MA 2W70A 3CLRD 4FB5A 2V4UA 3IPYA 4L5BA 1PSWA 4JI7B 4M7PA 5I7RA 2HD4A 3WNZA 1CLEA 4WCFA 1G0OA 1JRLA 3Q8XB 2QENA 3SS9X 4G26A 1KVSA 5GQSA 3T1OA 3ULKA 3PDIA 2VVTA 1OFGA 3VPFA 3U4MA 3DEZA 4EAQA 1A8UA 4L28A 1NRWA 3HHPA 4MR7A 2OZLB 4IXMA 1JI0A 3DXXA 4TKUA 4W63A 5DI9A 1M2KA 1PQWA 3WLLA 4OQEA 2YASA 3AFOA 1F8GA 1TEHA 4FFOA 2XYQA 5AKIA 2C31A 4B34A 2QJRA 4U5QA 1KDOA 5BO5A 4F8EA 3VAAA 1CUEA 4Q48A 1XK6A 4K6MA 1J8VA 1SBNE 1ECCA 2P6NA 3C4VA 2ZBRA 3CEMA 2G9UA 5TE9A 1J06A 2NTYC 2MSCB 2P68A 2HI0A 3GZTB 4LJAA 1ADYA 2EIXA 2OENG 5HVNA 4UW9A 1CK4A 2FN9A 1YC2A 3RRZA 4DSTA 1T8WA 1CDDA 3TR6A 1BC5A 3OJLA 1RRMA 1YKSA 1YMVA 5AW6A 1QYVA 1VJTA 3U60B 1DUVG 3GO4A 2VPWA 3JQRA 4J7AA 2LE0A 2FZWA 4X00A 5K05A 4WGFA 3QPCA 1MAWA 4XAQA 4RDCA 1AH2A 4W7HA 1G20E 3L9XA 1J5EB 3HN6A 2PUDA 5CCXA 5SZIA 4CIAA 1D2RA 3CWQA 3CMMA 1ISFA 5IBCA 3DV2A 5DJ5A 5DLYA 1ZUIA 1KQPA 3MINA 3MRSA 1X7YA 3L8ZA 1XDUA 3CG0A 4Q21A 1GILA 2X9VA 1EXVA 1PVVA 4GBGA 3SYMA 4Y2TA 3J7TA 3SBDA 1XXLA 4Z4FA 5JW6A 3H84A 3VMFA 2XTMA 4F92B 2QNBA 2W6JA 3WLTA 3CA8A 3KEMA 4II7A 3A4IA 1XVLA 2W00A 3R9XA 1PVOA 2FR0A 1XT6A 3BXEA 2VK2A 4HDMB 1EUDA 3F4KA 4RF3A 4OM7A 1ORDA 4X1OA 1CY8A 1G19A 2M6KA 2JHPA 4HXGA 3RYHB 1M8PA 1TDJA 4OI0A 5GTDA 1A98A 1CG6A 3QLUA 2V8BA 1VXOA 1SZDA 4HQKA 1HI9A 2VXCA 1OPRA 3H2YA 3G23A 1IC6A 2F1JA 3D6UA 2F6RA 4JGGA 1XEAA 2AC7A 2QTMA 1KDPA 3H83A 1J8MF 3ISJA 2CJPA 3KJHA 2R3SA 5LLSA 5BN4A 4RTLA 1NVEA 1LRLA 3ZQ4A 2YJNA 4MIYA 2FW1A 1R8JA 5JVDA 1VLQA 2WJGA 3NWPA 3OFVA 3QLVC 5SICE 3WP0A 4JJ8A 4GECA 1KI4A 2HBYA 4YCBA 1P2BA 3M3HA 5I3CA 4HS9A 3N2NA 2HYIC 2DPGA 2N46A 2IP2A 1EVIA 2H1FA 1HY3A 2OGUA 2RH9B 4JNKA 1CYEA 1KO4A 3CISA 5AVQA 2XYHA 3E8XA 3PDWA 3RWMB 2GXQA 1XYVA 2QRNA 3E4CA 2BE9A 3B36A 2XQIA 1W29A 2EWVA 3GJSA 4G4JA 5T8KC 1XV5A 1FNCA 1FB5A 1S2MA 2VRCA 1DELA 5ALFA 5C80A 1XMXA 3GJXC 4YRQA 4Q24A 2FPOA 3DV0B 4KIWA 2WYWA 3FCOA 4YFYA 2CBXA 4WL0A 4YP0A 2FYTA 2XVAA 3EY9A 3AKZA 3T7DA 1ZRMA 2QGNA 2HJWA 3CKMA 5AKYA 4A2QA 4F5DA 1T26A 3ADCA 1NN1A 1I1QB 4M8IA 5JHHB 3WDMA 2P9JA 1D4OA 3HA2A 1Q5PA 1WY5A 2PGIA 3OCUA 4KZPA 1GQYA 2W6PA 1EFUA 1Y3HA 4LJRA 1LRKA 4U02A 3SMVA 3HB4X 3OT1A 4BKMA 1KRXA 5HJ7A 4YVFA 1ZVKA 1EQUA 4ND7A 4V38A 4EATA 2VCEA 3I05A 1I7SB 1RAFA 3S8EA 2X7JA 4DLXA 2GILA 1X7ZA 2Q0XA 1CB0A 1XU7A 5BWOA 4A4DA 2BDEA 4QOJA 2ZB8A 3QEOA 4E5UA 1DX4A 2RHHA 3IUPA 3QW2A 4G07A 4AZ0B 5TPZA 2VTBB 3G13A 5EQDA 3HV0A 4UOEA 5TGTA 3IT3A 1PJZA 1PL0A 2YHSA 4YRTA 3T4EA 4CKXA 1FTYA 3R6LA 5NULA 3QEAZ 3ZU4A 2Y6UA 2QMEA 3MIZA 4DVJA 1TYCA 2DHDA 3E9YA 4FWBA 2ZXUA 3MLAA 4YR9A 1MG5A 4NBUA 2C9ZA 2P1ZA 3C3EA 3DTVA 1WV1A 2JLQA 2PA3A 3MC1A 3MEQA 3OM9A 3PFIA 4G0NA 5DTEA 1OFHA 5I7AA 2P2CA 5IC4A 2DJIA 2R1ZA 4LDJA 2R4QA 1XTKA 3OWHA 3PXDA 3QOXA 3AI1A 3EXEA 4W4TA 4IUCS 4GXNA 1JHOA 4JUFA 3T1NA 2RBGA 1TA0A 3OOSA 3KVYA 5CBPA 4KNYA 4IBOA 3ETEA 4UEJA 4NE7A 1R15A 2PZBA 2REOA 3BXXA 3G8BA 1EHCA 3F71A 3IAM1 1R5OA 1DCMA 2PUCA 1F2DA 4B87A 3WZLA 1L5YA 2OXRA 4I8IA 2YVLA 4GBMA 5D87A 2IV3A 4F4JA 2H1RA 5DCYA 2G72A 1ZIPA 4JVOA 5SYAA 3RVOA 3U3RA 1YNOA 2PGOA 1KOLA 4F91B 1R7RA 1JWLA 3K96A 3VH3A 1XLTC 4NBVA 4J0FA 4UXIA 2WIBA 3BICA 5FPSA 4C4AA 2I33A 5JE8A 3PTAA 2Z56A 1S7GA 2G4VA 1AE1A 2EFDB 3U3XA 4D56A 4G56A 3VV3A 4C1BA 4QD3A 2AOUA 2B8NA 1NBIA 4O4HA 1MW8X 1A8SA 1P3DA 2ZAYA 1ND6A 4FZ5A 1CVRA 1VFNA 4TMTA 3W6PA 2YV3A 2JFWA 3HJHA 1CNEA 4MW9A 3ZVNA 2A0UA 3NHYA 2EWMA 1YIOA 3RKSA 3CRW1 2Y71A 4K0RA 3SYKA 2QJFA 3MJCA 1DKPA 5IJXA 1MORA 5AK3A 4B3DA 2JKZA 3VVBA 5AXBA 5EZYA 2G67A 4H4DA 5FWDA 3RS7A 2CLOB 1B0ZA 2Q29A 5DGDA 1FXWA 1EP9A 1L4EA 1KDYA 4GLBA 3LO5A 4HDKA 3P27A 1F06A 1HM5A 2IY9A 3HZRA 4JB8A 5L3RA 4G5SA 4KITB 1Z6GA 5M7EA 3LQ2A 2NYAA 4HNSA 5T67A 3VAZA 2HHJA 2P40A 3EPRA 2PSFA 1NGSA 2H5EA 3CRQA 1QX4A 1GPKA 3F5QA 2Q9UA 2RK3A 1BWQA 4WERA 3CF0A 3MMSA 1SPBS 3B70A 4IQ8A 1NW4A 5KNBH 1QIDA 1EIWA 4O4IF 4EGAA 4HVAA 2C96A 3KVVA 3COVA 3QM1A 3NTRA 4KR9A 4BNFA 3AUYA 3T1TA 1IN8A 4O1HA 1B76A 2I2WA 3DBLB 4OMDA 1LF0A 1XBTA 2LW7A 3B6ZA 3LSYA 4J0JA 1BS2A 3I0MA 4HAOA 1J07A 4RLHA 2P0EA 4X3CA 4EKEA 2VWQA 4DR1B 4ZI7A 1R0CA 1V5WA 4RVFA 2V6MA 5LKRA 1IJBA 3EGVA 3LECA 4E46A 4LF5B 1I8TA 1N3BA 4K86A 3R4VA 1VSBA 3SC4A 1GSOA 2IZ6A 2MMCA 5AHWA 1TVEA 5HZKA 3GLKA 4DKJA 3K0FB 4AKTA 3FD8A 2AMLA 5DTJA 2JS7A 2IT1A 3ZWYA 1FFXB 3QNWA 5P8WA 4X9XA 4HKTA 3BMQA 4UHKA 1D2MA 1QV7A 2P41A 1AN9A 2WYOA 2Y9MB 3GJ0A 3M5DA 1AT1A 3BRCA 4PFQA 5LP6A 4IINA 5CVTA 3FROA 4B6FA 5CVUA 1R74A 1ZU5A 3CB2A 2RHGB 3ESXA 4FS3A 2BIFA 4F3RA 1Q6YA 1WBBA 3I5UA 1SBYA 1TKRA 2O7VA 1EIZA 3BWYA 3H9QA 1PNTA 3IKMB 4RV9A 5DHQA 2AL7A 1M6VA 1Z35A 2EKDA 2HU8A 3TW8A 4Q1BA 4J4TA 2ZI3A 2P9BA 2GCOB 5ES4B 3QY0A 2PY6A 1AS2A 1ST3A 1U0NA 1NZJA 2GM5A 4YRSA 2BD0A 1F0PA 4TS4A 2OMKA 2SCUB 2ZKIA 3FTCA 1UXHA 3I3OA 2KLBA 1P31A 2JBHA 4IIVA 4XA8A 5FWXB 2C4VA 3LBIA 3Q9UA 1UQRA 2Q5FA 5JJ5A 3UMMA 1JLLA 2R6HA 3ZCSA 3VVCA 1RRPA 2GEBA 5IT9A 4AZWA 3A4LA 1F0YA 1FP2A 2CXSA 2EJBA 3TD2A 2HREA 3PD1A 1DUSA 4RCYA 3O8QA 4AJ9A 3VSDA 4J1TC 3IKTA 1SXGA 1R64A 3U16A 2LWIA 4UTPA 4Z7OB 3H9BA 2H0RA 4KMOA 5FNZA 4FEAA 1E2PA 4NCXA 5AVOA 1XWFA 2H63A 5TJHA 4J1NA 3DEAA 1SUCA 3CH5A 3PUIA 4IIXA 5BW6B 5CVVA 2X8JB 4KR2A 2Q6IA 3FPHA 2OSVA 2FJPA 3N7TA 4HEJA 2X76A 4AN4A 2R1TA 3DQQA 2AJ8A 3OLVA 4TOIA 4YFVA 3TJRA 3RSZA 4B32A 4E2YA 3RYIA 2QYTA 2W6OA 2XMGA 5KYXB 1RXWA 4KQEA 4U2FA 4MS4B 4HH3C 1RPAA 3J81A 2P1DA 8AT1A 4PRLA 2C84A 1D4AA 1V5IA 3L4BA 1KYVA 4UU1A 1SXJB 2XDAA 1R00A 5JCXA 3SM9A 2ZUTA 1P5HA 4LJLA 1W36B 1EPUA 3B5JA 4HDSA 1JKXA 3KX2A 2JRLA 5B6JA 1Q0PA 5G0VA 1H2AS 4YJFB 2QTBA 3NHFA 3ICOA 1FJGB 3WKBA 5TJ9A 2BH9A 1CZNA 2R96A 1ATIA 1NX9A 1PQ4A 3ICCA 3KR2A 3IR6A 5HE9A 2VF5X 3F3MA 3HKCB 4L72A 2K87A 4IDFA 4NU0A 4FUQA 2G0AA 3DO5A 1M0WA 3X1XA 3PP8A 4UBLA 4PSKA 1PK7A 5TV2A 4EKIA 2CT8A 2FEPA 2EDCA 2QY6A 1LX6A 1ZRHA 3FF4A 1GPAA 4R1UA 2IXTA 4BBAA 1TIPA 2C7BA 3VGJA 1JQ3A 2GETA 4TWZA 2HU7A 3G17A 3WBJA 3SD7A 4PLTA 2ABWA 3UB4A 1ZGAA 2GNPA 1DP4A 2OG2A 3K0SA 1Z12A 4OQLA 5BSWA 2IE0A 4AUKA 1H2BA 4LY6A 4NARA 3V8MA 1T6YA 2W11A 3HY4A 4L9AA 3THOA 3CUKA 3BFVA 1NPTO 1Y7TA 3U7GA 1CKEA 2AJBA 2GVZC 4CXMA 2ZXEA 3MWJA 2W7TA 1PTKA 3NU1A 1NVVQ 3TCXB 3TZQA 1UF9A 4W5TA 1QHIA 1GOTA 4POOA 1Z7WA 3BF7A 1GRQA 1JR2A 3WQRA 1E9BA 2D1FA 3AONB 3P45A 4FT2A 4EUKA 4LVNA 2JFGA 5KO2A 3SLGA 3PEYA 3PE6A 3IDFA 3QTTA 2JGFA 2FPMA 2PKYX 4MW1A 2C2BA 5EJ7A 3KJGA 1G21E 5FBLB 5K4HA 4NNJA 2QTCA 3CPEA 4KXWA 4E32A 4D8VA 5JZMA 4MHSA 1P2SA 1Y5MA 1NX6A 3CPHA 4DCNA 3GLFE 2OYSA 5BP7A 3DH0A 3VUEA 4BFXA 2C2YA 4H1WA 3SX4A 1QJ4A 5CDHA 1NVMB 2ZE5A 4US2R 4O2BF 3BWCA 2QL6A 4C7BA 1QAQA 5JR3A 2MR5A 1Q12A 1NXSA 1RHRA 2O8FB 4KQ2A 4MWSA 5IW8A 4INPA 3S2UA 3QUAA 1LDYA 1LPPA 2Z9CA 1FFEA 4W1PA 4C6TA 2X5NA 3AOGA 4O2LA 1I36A 3KSDO 2C7RA 1KO7A 4GVXA 1Y9AA 2P6MA 2YWGA 3LD9A 3I5MA 2JLWA 1PJLA 4MO2A 5JWHA 3SFTA 4DANA 3VKGA 1WZEA 3MFYA 3ROMA 2G5GX 2A5DA 3FOBA 3MPOA 2C7PA 3GDOA 3USCS 4M83A 2WVHA 3FDIA 5FFFA 1P39A 5JEDA 3WLKX 1XCOA 1OAOC 3BWVA 1E2QA 1O0CA 1J21A 2C1ZA 3RG8A 3RAJA 2E4AA 1PR2A 2UZIR 1D1TA 2EW1A 4P34A 1EM8A 3DL2A 1AKRA 1XTUA 3C3CA 2WWHA 3RK0A 2W98A 3FTDA 2ZZKA 3GP8A 1I51A 3LLVA 4IJVA 3ANLA 5CYGA 2XXAA 2NO0A 2O2HA 1YDWA 1ZOSA 2Y9PB 3N59A 5C8DA 3ZCUA 3PCXA 1MW9X 4E3WA 4BTEA 2GZRA 3ETHA 1X70A 1HRKA 3IUBA 5BSGA 4CG0A 3ZI7A 1TK9A 3LOQA 3MCWA 4OYHA 3W4IA 1P1CA 2I0FA 5A3QA 1DC7A 3ROTA 3TJMA 3T5CA 2CXTA 1B0PA 1NQUA 1U1IA 3V48A 2HDOA 3LC7O 4FT4A 3I5YA 2B9EA 1QIFA 3H9EO 3AL2A 1T9ZA 2G88A 4AJPA 4NNOA 4IFTA 4X62B 3V3TA 1ADFA 1SCAA 1FLVA 3ZY3A 3RW9A 1QQ6A 4FK8A 2Q5HA 3RF7A 3TYXA 5L7TA 4YJKA 2ECQA 3C5VA 3D8BA 4A3SA 1S8NA 4ESVA 3A3PA 4YRBA 5HKKA 1X94A 3UG6A 4EAAA 1K8YB 1SXQA 1PLKA 2MU1A 4BV3A 2Y6VA 3HC7A 4NMMA 4YA6A 2XTJA 5EXXA 1E89A 4C5AA 3G9TA 4HGPA 4K88A 4R9NA 3WB2A 3UJAA 3VO8A 3BGWA 1Z5GA 1T4DA 3MXTA 5TDHA 4HQOA 1F6DA 3KXIA 2CL5A 1MOQA 2IVFA 2YZ2A 3K4PA 3ZKAA 3GN2A 4NH0A 4F6CA 9GPBA 1UBFA 4HRAA 1RWWA 3QVWA 3B7WA 4DS3A 2X0KA 1G63A 3WQQA 1U7TA 1AO0A 1VBFA 4LXQA 4F2DA 5TLSA 5F76A 3ZE9A 5AR1A 3SYNA 2GCIA 2P67A 4C0JA 3ODPA 1WXWA 4KYTA 4MVYA 1ZHFA 3DKKA 1UZAA 1WOYA 1H66A 3JAKB 3JSXA 1LK7A 2ORYA 4PZEA 4YONB 4M1WA 4LJ4A 2ZB4A 4ZEMA 1IEVA 4QTYA 3IJRA 3V7FA 3UOAB 4F1KA 2QTLA 1PR0A 2B0JA 2PUGA 1WUJS 5KOHA 3IR7A 1IXYA 1XNGA 3MBOA 3SE0A 4CCWA 4Q12A 2A1TR 1FUIA 3OKPA 1N7IA 4REOA 4WZAE 1G38A 1TM5E 1ENPA 1ZXLA 5JAMA 4DIEA 4F7DA 4QQKA 3CF6R 1YQTA 3DOUA 5HKOA 1OZAA 2B99A 3RUAA 3UJPA 2HZBA 1LSSA 2GBLC 2HTEA 1QRUA 2VYVA 4BWVA 1D5WA 1HYHA 2AT1A 2O2YA 4RJ2A 1DQPA 2BPOA 3SM3A 5TQVA 4WA7A 2CY0A 4MR8B 3GLGE 1NP6A 3QXHA 3S81A 1EFDN 4X91A 5EI5A 4WA8A 1PFVA 3EF3A 1VI6A 3FHOA 4QBIA 5DWDA 4K05A 3C6KA 3T3PB 4H4CA 3BGDA 3I09A 4X97A 4Z1OA 3FVRA 3QX3A 4HNAB 4HMPA 1IWPB 1CE8B 3N0TA 4YT4A 3KZMA 4ZODA 1A2OA 1GCUA 3OCCA 3O8OB 3G0OA 1U5CA 1DFIA 3QA3E 7REQB 2CNLA 2R8XA 4LXIA 1N5MA 4TWAA 5I5GA 3RBXA 3ZU6A 2RGRA 3K0HA 4WCVA 2UYYA 4P4NA 2IHJA 3RT1A 4E07A 2H18A 1WETA 4MKGA 2EKQA 3FCSB 5AUQA 3GLTA 1NKTA 4K87A 4HVLA 2BHLA 4JLVA 4C06A 5IAKA 4Q47A 4LMAA 1VCOA 1ZJJA 2XOKA 3IELA 1P3JA 2E55A 1A04A 2HLHA 2O52A 1C80A 2P5YA 3BREA 1NQ5A 3E2PA 4JHLA 4E08A 2NXCA 2F4VB 1BE6A 3O9ZA 4M0DA 2GM4A 1T24A 2CJWA 3FBWA 3P9RA 2HLPA 5F2KA 1JTVA 4LGVA 2GERA 2WKQA 1CUZA 4UE3S 4YRIA 1ODLA 1WMBA 2O2ZA 1UBOS 2E7ZA 3BFKA 3GLSA 2AZTA 3DOCA 5COBA 2A5LA 2NSJA 2XR1A 3A04A 1R50A 3N2KB 3AETA 4MULA 4NAVA 5D7NA 5K3OA 2J5QA 5FOUA 3CVYA 3PXCX 1S2NA 4TWRA 4MXDA 2ZI5A 5DNWA 3U17A 1Y1QA 1Y3IA 3KT8A 1RM3A 3GVXA 1SIWA 3ZGOA 2H65A 4F38A 2G28A 3N7AA 5JAUA 1C7FA 1E94E 1NULA 2B34A 4BN4A 1TQ8A 1SC3A 3DKRA 4HDCA 1IL0A 1SIOA 1QIHA 1S8FA 5EMHA 2IDJA 1BGWA 2FN7A 3L0PA 1D8AA 5K0NA 1ML4A 3TEMA 3ZX5A 1IVNA 2RKBA 2PXHA 4PIMA 1UC5B 2HCRA 3EWAA 1XD8A 4EA7A 4QM6A 3SZOA 3L1IA 4KH1A 1ZLXA 4JOSA 5HR5A 1DAFA 4FFVA 4MRMB 5E9JA 2F67A 3CX4A 1U7ZA 5LDGA 5FI5A 3UFXB 2PUHA 3CX7A 3FAZA 1ZBDA 2V9PA 3AZPA 2J9FB 1VA4A 5CRIA 2OYRA 2VTVA 2X8WA 2XF2A 4FP9A 3DVQX 5D7BA 1TZJA 3ZZUA 2FNAA 2LR0A 2WJWA 4HWPA 4N6GA 3UBTA 4J9UE 3O93A 3ZWXA 3PDIB 3PX3A 4EPXA 4ZTZB 2IHNA 4FFMA 2CF5A 5BUCA 4MR7B 3EPLA 4CHGA 3PNVA 5EIOA 4EZEA 2I8LA 3EX7C 1JFLA 2IBSA 1WWKA 1LSJA 2PL1A 1GZVA 1ACMA 2CJFA 1R5NA 2Y66A 3JRXA 3OEYA 4H6PA 4OQNA 5CURA 5GY7A 3ZEAA 3ODGA 4WK4B 3DE0X 2PUTA 4DMHA 4DR3B 4J94A 3VPCA 1LJLA 3L7CA 2JCBA 3EMDA 1IZ0A 1ZSNA 2QUJA 3G1WA 4D0SA 4W5OA 3DE5X 5EKXA 2OWDA 2YY5A 3C3JA 3GEEA 3GJ4A 1XO1A 1R9JA 3A14A 5FFMA 4DLSA 2JIMA 1GGFA 1WKBA 3LP8A 4MCJA 1NATA 2O5RA 4O5AA 4RVNA 3U4AA 1IZ8A 1PYDA 1U1CA 1ZAKA 2AYZA 2JZOA 2H29A 3MWFA 3FPSA 4HB4A 1GLGA 1JDPA 2FMTA 3LO8A 1T2CA 5LCXA 1IOLA 1PJSA 3AI7A 3DAGA 3VMMA 3ICEA 3VR5A 1DBPA 1SVOA 1KI9A 2BGLA 2HRRA 3INNA 4PO8A 2QD1A 2CXQA 1DAEA 2GTPA 2G9RA 3H9GA 3EFEA 3RRXA 1LW7A 2IZZA 3MINB 3UK6A 1X7YB 1IBRA 4XGIA 3OZIA 4IEIA 1SELA 4DWJA 3I83A 3I8XA 1PGOA 3U56A 1FXUA 4RHYA 3X1YA 2ZUSA 4DMCA 1UR5A 3AIIA 4MIEA 2DPYA 5AW2A 3T5PA 3B89A 3BTVA 3WJ7A 1SKYB 4EENA 1EFCA 4G8JA 4I3GA 2F3TA 1EUDB 1HDCA 1B16A 1P4AA 2QJWA 3KKKA 1A27A 2GMWA 2C20A 3JVEA 4EGFA 3NEAA 5HMMA 1KE1A 3W9SA 1R0RE 2PX6A 2C5EA 2N0SA 4L2IA 4EHFA 1IXSB 1EAMA 2ZT5A 4KAXA 4FOOA 3DJYA 3IAEA 4GOJA 5FJJA 4DJDC 4I2VA 1GPUA 4F97A 2EFCB 2IF0A 2WAMA 3LG2A 5BN4B 1L8OA 3OQHA 1ID8A 4F71A 1V25A 2FR8A 2EERA 2GB4A 2OESA 1HE8B 3PK0A 1PV4A 4L27A 5AJTA 4P38A 1Z0SA 4RVDA 3VNAA 1XU9A 3E3OA 1PEKE 2PO5A 4M7RA 5IDVA 3EXHA 3VYVA 4BGIA 3P52A 1E2UA 1MOZA 1BE0A 3BYZA 1Q7BA 3PGVA 1GG2A 2ATXA 3FWZA 4IMIB 1KQNA 3PIIA 3IV7A 4XVRA 4QU0A 4HJRA 1AQJA 2QXTA 2J0UA 4QQNA 4CL0A 3NHWA 1EU1A 2YYZA 1ID1A 4G0YA 4L5YA 1U28A 4RD4A 4EG5A 3KYJB 1OBCA 4Y7CA 1AQLA 1TIKA 2GD2A 3V4FA 3X2SA 4QGSA 5K0BA 3GEBA 1CEEA 4Q3KA 3TW4A 1FXSA 4N49A 1PN3A 5CW2A 1YA4A 2AV6A 4DY4A 1HT2E 3DPUA 2DQZA 1YBMA 2XUHA 4F6RA 1T8SA 1Y1RA 4N9QA 4QOSA 4AY4A 1TW2A 3N39C 3BXHA 4NYIR 3PUHA 5ALQA 3G9QA 3Q3IA 2GLUA 3ZUGA 2Q2WA 4CIVA 1E61A 1GDDA 2OUIA 4DQKA 1RCFA 1JDBB 2LCQA 2QQFA 1UXGA 1OF1A 3KOOA 1XTSA 2I65A 2H1LA 1M2JA 1RRFA 1TUEA 3AHCA 2Y67A 4WGGA 5AHKA 1AZLA 3SP1A 2GDJA 4Z9YA 4LSWA 1JHVA 2II6A 4LF8B 1P1FA 3AR8A 1CUAA 3PU6A 5E8RA 1ULHA 1GG5A 2KB0A 3OT1B 4YAFA 4P0QB 3GFOA 2BFMA 2ZPTX 3KUCA 4ALMA 2B3TA 5HHTA 4JAVC 3WHKA 1M72A 1X7ZB 4PYIA 3VR4A 2QKYA 4JOQA 1PDVA 3N2IA 4ZZIA 2W6MA 2WU0A 1NU6A 4IH4A 1LNZA 4XEHA 2OHFA 5LNK6 3EG9B 4ETNA 1D2HA 1KI7A 4QOGA 4CM5A 2HDNB 1SU7A 2GKOA 2V3WA 3CYFA 3V4SA 1VPWA 1AV7A 4I9FA 2X42A 4KV9A 1X1TA 1FJXA 2O4UX 2Y1WA 4EB0A 5B30A 3LDHA 4WASA 3QKRA 2JFUA 1E6MA 3TBKA 3K09C 1X2EA 1GPMA 1MJFA 1QIJA 3AUSA 4MH0R 3DTVB 4BVEA 2BTEA 3ADPA 3AINA 3D3NA 1Q44A 1W1IA 3CRNA 3GG9A 3GLUA 3SSOA 5C5IA 4OB8A 3Q5DA 4OP3A 2DR0A 2X0JA 2CLSA 3AR6A 2ZLBA 3EGCA 2VBFA 2QZ9A 4B40A 5B6IA 1TF5A 3THYA 1UBEA 2PH1A 2CNWD 2ICAA 3MQ2A 3QF7A 4P0TA 4ZRDA 3EXEB 1M0SA 1GZ6A 1J39A 2VP5A 3IDZA 4RMJA 3AX6A 3ZQKA 7YASA 5CHYA 3TZCA 2OMEA 3NIDB 1ZEJA 3GFFA 4KDRA 4U0JA 5ESWA 1A0OA 2KI5A 4FPXA 4X8LA 3ZDDA 3AY6A 3NCHA 4NJMA 1V43A 2NU6A 2X19A 5CBPB 4ZK2A 2W2QA 1F9AA 2VA9A 4J2TA 1P29A 1S6YA 1OFVA 5CU7A 1WDLA 2I6SA 2H7XA 2PQ0A 1RWMA 1Z56C 4L07A 1XVUA 2IYSA 3A9VA 2A3NA 2HY7A 2VAXA 4HNHA 4E88A 1S2LA 2AMVA 4H0FA 1EGMB 2J0QA 4JS0A 1FRFS 2EATA 1V11A 4IAOA 1YS1X 4UNSA 3BT7A 5HG0A 4CUKA 4BB6A 3V8RA 5B2FA 4BLWA 3ZV7A 3G2MA 3DC2A 5KYYA 1RLMA 4QEKA 2AOUB 4UOZA 3V8QA 2OM6A 3R0ZA 4O4HB 4F2PA 3TXAA 1GT6A 2VPYA 4BRUA 1Z4MA 5FEUA 3KL4A 2ZRHA 5C8VA 2BJWA 2C29D 4WESA 2XX3A 4Z8XA 3D4OA 1T4GA 1YF3A 3ZZNA 4Z1MA 1Z06A 1O0SA 1G16A 4YRNA 2G9QA 5TF0A 2AQKA 3IXMA 4W1RA 2XQKA 3U0BA 4KWHA 4MTLA 2B5VA 4A27A 4JELA 4QEZA 1VLVA 1HNZB 3V9AA 5EZYB 4PSCA 4QULA 1A2QA 1WW8A 3H1PA 4FIDA 1DXHA 4HDKB 4GQBA 4TT3D 3WWYA 4BIIA 2GSDA 1KK3A 4IRUB 1V71A 2NAFA 3M5PA 5JO0A 2DFPA 1AY0A 3GCDA 3R8CA 4MW5A 1BQ4A 4HDRA 1NRXA 4J0IA 5ALEA 1MOPA 1JQEA 1WXXA 1J0DA 3ZY2A 3OF2A 4CHTA 4P54A 4ZAWA 2GFHA 3T9AA 2BGGA 3QLJA 4DJFC 4ER0A 1GQFA 3KIPA 3WGTA 4RTQA 1Q0TA 1QF9A 3LY5A 4N9WA 4QBTA 5FRDA 2IWHA 5KQRA 4JV5B 3ABQB 5IDXA 3BD6A 1C50A 1Z13A 1UEXC 4EABA 1AS0A 2CUZA 1BE8A 4ZRMA 1QNLA 3ZWBA 1TEZA 3PEUA 5LQMA 1TLTA 4QU8A 4L6CA 4ZJZA 4ZI7B 1OYVA 3AR4A 3R3SA 4K6GA 4WADA 1VXRA 3H2IA 3D1VA 3ROFA 2P62A 2I4RA 3NANA 3UHPA 4EYKA 4H16A 5IC5A 4GMFA 4AMYA 5FF9A 3DZKA 4CM3A 2IYWA 2R6R1 3SZUA 3NT5A 2PMFA 4MYTA 2QPTA 3KQWA 3UFBA 3EIFA 3HFSA 1WAMA 3LPLA 3A2KA 3T3MB 1Z2OX 1QFMA 2HPVA 2ZPUA 3BD7A 1UM8A 5GP1A 2FSSA 4IVPA 3G2OA 3NZEA 5KHLB 5LP6B 4HATA 4AG5A 1MVLA 1T6XA 4XKJA 1NG1A 1I94B 3COSA 5H3LA 2WD8A 2WU1A 1UXOA 1QVZA 3G2LA 3KJXA 2ENUA 3T7JA 3UK7A 1M6VB 2DY1A 4XYGA 3REQA 4HVTA 1MLDA 1HEIA 2FLVA 1ZISA 3M70A 5L4NA 3TW8B 4JI8B 1KH2A 1FDUA 1UIRA 3LDUA 2CFRA 1G9SA 2H31A