2FHPA

Crystal structure of putative methylase from enterococcus faecalis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
183
structure length
183
Chain Sequence
AMRVISGEYGGRRLKALDGDNTRPTTDKVKESIFNMIGPYFDGGMALDLYSGSGGLAIEAVSRGMDKSICIEKNFAALKVIKENIAITKEPEKFEVRKMDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKMLERQLLTNEAVIVCETDKTVKLPETIGTLKKTRETVYGITQVTIYRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Methylase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords methylase, putative
total genus 57
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fhpA00
4ATNA 3G2QA 3K6RA 4FS8A 5DM0A 3GRRA 3PTAA 1U2ZA 3GIWA 4EKGA 1SVUA 1XCLA 2BM8A 2CWWA 2XYQA 4DF3A 4KW7A 1HNNA 3BWBA 3R0QA 2B78A 5T67A 1INLA 3G89A 3LL7A 3E8SA 3NWBA 4K6MA 1RJDA 3UJDA 3CJQA 3UWPA 2IFTA 2O06A 3QV2A 5FHQA 1N2XA 5LQKA 1G38A 2EX4A 3EEYA 4RTPA 3JWHA 3PFGA 5EC8A 1QZZA 2ZWAA 5C1IA 1R6AA 2PXCA 2FK8A 2AVNA 3LECA 5ICFA 8MHTA 2AR0A 1YFJA 4BLVA 1I4WA 3Q87B 3HVJA 2FYTA 5EIWA 4QVGA 1WXWA 3FUTA 2C7QA 1MHTA 5HOQA 1RI1A 3O31A 3IYLW 3LHDA 4E2XA 2YXEA 3UFBA 3OU2A 3B3JA 3B5IA 1JG4A 1MJFA 1JQDA 2AOUA 5E2BA 3KQPA 3HCAA 4WVLA 4CWAA 3HTXA 3OFJA 3FYDA 4XUEA 2FPOA 3B89A 3M6WA 3VSEA 5EKUA 1I1NA 3P2EA 4OA8A 4GC5A 4L7VA 5DPMA 3P9CA 4YMHA 1KPIA 3EVZA 1Q0SA 3HP7A 2JHPA 1ZKDA 3GRZA 3FUVA 3OFKA 1Z3CA 3G8BA 3A27A 2Z6AA 2XYVA 4FP9A 4X1OA 5CVVA 3HVKA 5E8RA 4KIGA 5LSAA 3SSOA 3BGIA 5FQOA 2QRVA 3HVHA 2ZLBA 3HCBA 4RTSA 3PLAE 2YX1A 3T0IA 1BOOA 3NVKI 3VYWA 1FP2A 5FCDA 5EHIA 2UZ4A 2KW5A 3KPVA 5EKXA 4E33A 3FTEA 2PXAA 2AS0A 2PJDA 4PGHA 5HIJA 5K0NA 5H02A 3KR1A 1G8SA 3GRVA 3MTIA 2XVAA 4DQ0A 2IH4A 5FULA 4YV2A 3EVCA 3SR4A 4OQEA 5EMMA 4OBXA 4RTLA 4X61A 2IP2A 3LX6A 2R3SA 4RVGA 4AZVA 2IBTA 1EJ6A 1P1CA 2AN4A 3I5UA 3TFWA 3KU1A 3G2MA 2AN5A 3D2LA 5EMJA 2PSSA 3FPFA 4HC4A 3ERCA 3MCZA 1NT2A 4YV1A 3L8DA 3G7UA 5CVUA 4PCAA 5K09A 2LD4A 2IIPA 4V0QA 3I64A 4MHTA 3LBFA 2FHPA 2OY0A 1VP3A 2AOUB 2VDWA 3KPYA 4CKEA 5EEHA 3BT7A 3LKZA 3ORHA 3TPZA 4CTJA 1SG9A 3MB5A 4FSXA 2UYQA 4YUZA 3M70A 4IV8A 1JG3A 5T6BA 4C4AA 4E2WA 3DLIA 3FTCA 1M6YA 1L1EA 2OB1A 3HA7A 2EG5A 4PIPA 3HA5A 3SMQA 5EMLA 5KQSA 2OXTA 1EJ0A 2N47A 2ZBPA 3KR0A 2C7RA 3DOUA 2NNWB 4RTRA 2JJQA 4FT4A 2NP6A 3FUXA 3LKDA 1HMYA 1KR5A 3T7SA 3HVIA 4ER6A 3OZRA 4OBWA 4ER7A 4QQNA 1NBHA 4RTQA 3NMUF 1EQAA 2OZVA 3C3YA 3EPPA 1XDZA 2QY6A 4GC9A 2IPXA 3T7RA 1KPGA 4RTMA 5DM4A 4C07A 3M6UA 3T7TA 4E2ZA 3SX0A 2OKCA 3DMHA 4HSGA 2ZVJA 1I9GA 3AJDA 3HCCA 3GJYA 3TKYA 2AOWA 5K8VA 4EQZA 5HIIA 4OQDA 3TR6A 3LSTA 3UJ6A 1RI3A 3P9NA 4M38A 3SSNA 3TRKA 2PKWA 5FADA 1QAQA 2Y1WA 5JR3A 3FPHA 2ZZKA 1L3BA 5LQAA 1RJGA 2PVCA 4PYIA 4POOA 1O54A 3BWCA 3FPEA 5E1DA 1WXXA 2K4MA 3GU3A 4GEKA 2ZIEA 4GOND 4RVHA 4AZTA 2HR1A 3G5LA 3THRA 1L9KA 1XDUA 2H11A 1KHHA 3GGDA 5GWXA 2EFJA 1XCJA 4YUXA 3KQSA 2EJTA 2AOVA 2IH2A 5GM1A 3TOSA 1KYZA 2H1RA 9MHTA 1TW2A 2ONZA 5FA5A 3GO4A 3Q7EA 3O4FA 4PYMA 2B25A 3EMDA 3UBTA 3C3PA 3E7PA 5KYGA 5EOVA 3KQVA 10MHA 2AOXA 3LGAA 2PXXA 2CKDA 4PONA 3FPJA 1QAOA 2PX5A 1KPHA 3P2IA 3GDHA 1XTPA 3CCFA 3GNLA 3OE4A 4OA5A 5P8WA 2ERCA 3DUWA 1PJZA 4BY9E 2G71A 5E2AA 4PYJA 5FWDA 2P3LA 2ZIGA 3FRIA 4RTNA 1KYWA 3R24A 4R05A 5F2KA 3CGGA 4PYLA 1JSXA 3AWIA 2QM3A 1EAMA 2O0LA 1JSZA 3DH0A 4NECA 2HTEA 4IWNA 2I9KA 3WSTA 1R00A 1XVAA 2P7HA 4G56A 4OX9Y 1JTFA 2FCAA 3GRUA 5CVDA 2A14A 4XUDA 5EGSA 1UFKA 5EMKA 4H0NA 2QRVB 5FTWA 4A6EA 4MIKA 4PGGA 3HCDA 2PLWA 1X1DA 1X1BA 1VIDA 4MWZA 3EVFA 2P1DA 5DTRA 5E9QA 2R6ZA 3EVDA 1QAMA 4YUYA 1M0EA 3EEOA 4V0RA 4QPNA 3KQOA 3IV6A 5E8JA 5CCXA 3V8VA 5CCBA 1VQ1A 4KVZA 4AUKA 2PWPA 3MAGA 4P7KA 5EEGA 1NW5A 2XVMA 2O57A 4HRAA 1R74A 1ZQ9A 3OU6A 5DX1A 4RTJA 2OO3A 1JG2A 3PT9A 3BKXA 4C05A 1M6EX 1R8XA 2WA2A 2YQZA 3DXXA 4R8RA 2P7IA 3QOXA 1D2GA 4RVFA 2G8NA 2PX8A 4IV0A 3TQSA 1ORIA 2JHAA 1YZ3A 2PV0A 3OPNA 5K0GA 3G2OA 1R8YA 3CJTA 4Z2YA 5MHTA 3P8ZA 4LG1A 3UA4A 3VC1A 4O29A 3BGVA 4ZTBA 3BWYA 1FPQA 1D2CA 3GWZA 5K0CA 3FRHA 4UOEA 1QYRA 3G5TA 3NW9A 2VS1A 1F3LA 2PWYA 4RTKA 1T43A 4R6XA 3I53A 3NDJA 5K0EA 3KR9A 5HILA 2G70A 5DRTA 3O7WA 4KDRA 2B3TA 1JR4A 3G88A 4RV9A 3BUSA 1KP9A 4ER3A 5LQJA 1XDSA 3QOWA 3THSA 5CIYA 3RODA 3FUWA 2BH2A 5CVJA 1YFLA 4Y30A 4PYQA 3DLCA 5KQRA 1KXZA 5ICGA 3NJRA 2CL5A 2P40A 5E9WA 1RI2A 4F85A 4YUWA 1YF3A 1VBFA 1P91A 2YXLA 3DTNA 4PYKA 1G60A 4AZWA 1ZGAA 3R9XB 1NV9A 2ONYA 3LBYA 3E05A 1IXKA 1XJ5A 3G8AA 2WA1A 3BZBA 1ZG3A 3MTEA 3M33A 3I9FA 1NV8A 2I6GA 2UYOA 3PB3A 3SVZA 3KQYA 3KPWA 4GQBA 1O9GA 2OYRA 1NKVA 1X1CA 5GIOE 1Q0TA 4YV0A 2GH1A 5EIFA 3KHKA 5D1NA 5FQNA 4DZRA 2ZCJA 2YUIA 1ZGJA 4LECA 5DLYA 3DMGA 2Q41A 3G2PA 2AOTA 2ESRA 2B2CA 3HA3A 1FBNA 3KQWA 4FR0A 1B42A 3P9IA 3PFHA 5EVJA 1WY7A 1SQGA 2GAFA 5CUQA 3ANXA 5CD1A 1NW8A 3LCVB 3M6XA 5EZSA 2HMYB 1F38A 1X1AA 3EGEA 2YXDA 3AXTA 3NWEA 5DSXA 4DM3A 4PNEA 5LQRA 3EVBA 4HH4A 2UYHA 2CMGA 1V39A 3V97A 2ZZMA 4LWPA 4DMGA 2ZBQA 1KIAA 4CTKA 1VP9A 3P9KA 5EZQA 3P97A 4M7RA 4YUVA 4FSDA 4F86A 3TM5A 3MHTA 4Y2HA 3NVMB 5HIMA 5C0OE 2Z6UA 4HTFA 4E70A 2UYCA 3R3HA 5JUWA 2GLUA 3P71T 3TM4A 5LQUA 1P1BA 4ER0A 3U81A 2JG3A 1YUBA 1DL5A 2EJUA 5CM2Z 1N7JA 1N7IA 5FHRA 4B17A 2I7CA 3ER9A 4ISCA 3B7PA 3HEMA 5GP1A 1O9HA 5DTMA 5DRYA 4M36A 3BKWA 4E32A 3JWGA 4KDCA 2HV9A 3EGIA 1PRYA 2Z6QA 3B3FA 3M4XA 3LDFA 2VDUE 2P3QA 3CKKA 3DXZA 4JXJA 4M37A 2ZW9A 1ORHA 4P7FA 4X63A 2C7OA 5CVEA 3OU7A 5LQNA 1R18A 4AZSA 5IKMA 3CC8A 3K0BA 2V74B 2ZZNA 3EVGA 4DCMA 2AOTB 3UJAA 5F2OA 1FJXA 5DM2A 2NXNA 4BP3A 5DWQA 1IM8A 4AX8A 2VDVE 4GF5A 3LCCA 2IDKA 3DP7A 4PWYA 1YB2A 3A4TA 5U4XA 4U7TB 5T64A 3UZUA 3GRYA 3KKZA 3KR2A 4DCGA 1DCTA 3DR5A 4LWOA 3UJ8A 3LDUA 2I62A 4MQ4A 3B3GA 1UWVA 3ELYA 2P8JA 3A26A 3REOA 3FTDA 5K0LA 3CVOA 1NE2A 2BR5A 3TMAA 1D2HA 3KQMA 2IBSA 3NTVA 4C06A 5GIPE 3VC2A 3FPGA 2NXEA 3PVCA 2BR3A 2VP3A 3EVAA 4BLWA 7MHTA 3HCFA 3PX3A 3UJ9A 3UJ7A 1NBIA 5GM2A 5E1MA 3PX2A 4GOMD 5DM1A 2ZSUA 3IEIA 3SGLA 3C0KA 3GXOA 2VZ9A 2H00A 4FZVA 4KRGA 4BP1A 5DX0A 1X19A 3HNRA 4QPPA 5K05A 1G6Q1 5BW4A 3F4KA 4XCXA 2NP7A 1L3IA 4X60A 3FYCA 2PY6A 3SSMA 2YVLA 1H1DA 5HEKA 4EK9A 3FUUA 5BP7A 2IH5A 2YR0A 2AN3A 2NXJA 2GA9A 1EG2A 1ZHFA 3ELDA 1TPYA 2GS9A 3GCZA 4MTLA 4QDJA 1JQ3A 4QQKA 5IH3A 2ZIFA 5K0JA 1AQJA 1TW3A 3OCJA 3M6VA 1NW6A 3UJCA 2PGXA 3A7DA 4KWCA 3MERA 2O05A 5D1HA 3RW9A 3DMFA 3LPMA 4QVKA 5EPEA 2P41A 3JWJA 3JWIA 5GOZA 4ER5A 4HGYA 4XUCA 5DTQA 5FWAA 2FRXA 2WK1A 2AZTA 3AXSA 1RI5A 1EIZA 1JQEA 1VE3A 2OBFA 2C7PA 2DULA 3KQQA 3EMBA 1VL5A 5BW5A 4GUAA 4GBED 1YZHA 4CXMA 4RWZA 1NW3A 3KPUA 5EHGA 1Y8CA 2DPMA 3KQTA 4PYNA 4BLUA 2QYOA 3A25A 2CMHA 5GINE 4E31A 5DSTA 5E1OA 5E9JA 4EVIA 4A6DA 5ICCA 3OZSA 2ZWVA 3OE5A 4CKCA 1SKMA 3DULA 1SQFA 3A7EA 2PX4A 2ADMA 1JG1A 2YTZA 3UJBA 2HNKA 2G72A 4DKJA 2B9EA 3OZTA 2XYRA 4C08A 5C9ZA 4P58A 3MQ2A 1BHJA 1BKYA 1JTEA 1WS6A 4RVDA 4PCLA 3LCUA 5FUBA 1VPTA 4RTOA 5K03A 2G1PA 4HTFB 4YMGA 3BGDA 5B1SA 2NYUA 3X0DA 3ELWA 3EVEA 5KVAA 1SUSA 3BWMA 5E1BA 2GPYA 3CBGA 3R6TA 2O07A 3ID6C 3SXJA 1OR8A 5M5BA 2PT6A 4WXHA 3TKAA 3DXYA 4X41A 5BXYA 1UIRA 1QANA 5K0BA 4C04A 2JH9A 1L3CA 2HWKA 3C6KA 4R6WA 1DUSA 4EMSA 3HM2A 1RJFA 4QTUB 2ZTHA 3NDIA 3UA3A 2GB4A 2BR4A 3IHTA 5DXJA 5KS2A 2NXCA 3FZGA 2JHCA 1NW7A 2ZBRA 1RI4A 2E5WA 5DX8A 5G02A 5K0FA 2ORED 5LQCA 2V7EA 4P7GA 5FA8A 5EG5A 1G55A 4IKPA 4F84A 5K01A 4DA4A 3ER8A 4E30A 4E2YA 4HGZA 5DT2A 3MCTA 3ME5A 5EQJB 3BXOA 2JH8A 4RX1A 3TLJA 5ICEA 1XXLA 2ZULA 3LDGA 3RIEA 4PYOA 5HIKA 5HFJA 4RYLA 4GOLD 2P3OA 4FGZA 5HZMA 4QTTB 2XBMA 3ELUA 1VLMA 2AVDA 2IDJA 4KIFA 1SUIA 4R8SA 1P39A 2IGTA 2PX2A 3HCEA 3KPJA 5DXAA 4GOOD 3FTFA 1AF7A 1FP1D 2F8LA 1AV6A 1BC5A 4PINA 1WZNA 1WG8A 4U7PB 3E23A 3AY0A 3MGGA 3PS9A 4HG2A 4PIMA 3SM3A 2OPBA 3P2KA 2PBFA 3I58A 4CKBA 4EKIA 2ZFUA 1RJEA 3H2BA 4C03A 3CJRA 3C6MA 1G8AA 2OB2A 2P35A 4P7JA 2Y1XA 5ERGB 1IY9A 3S68A 3EGVA 4RSRA 5F2NA 4FT2A 5LR6A 4QDKA 1AQIA 2PT9A 2BM9A 2FK7A 2QE6A 2BZGA
chains in the Genus database with same CATH superfamily
3QVXA 1F2TA 3V4PB 4R3WA 5FTNA 3PVZA 3T34A 4WUTA 4BNVA 2VEDA 1ZO8A 3AHDA 1W0KA 1QF6A 1O89A 5IDQA 3NWBA 3L07A 5F3WB 2R751 4QU8A 2NUAA 4D99A 3GEHA 5JNRA 4J7AA 4JT2A 2O5CA 2BHTA 2PRKA 4Y1RA 3UKOA 5K45A 3ZIAD 2XB2A 4R8MA 1L4FA 5L9AA 1DINA 1MT3A 2WLTA 3BJIC 3QYPA 4KWIA 1Z07A 4PCUA 4QVGA 4IRMA 3VAAA 3ZV6A 1KEUA 1D8AA 13PKA 1GFSA 1Z6GA 2KYRA 3HBNA 4NYMQ 5EJ5A 1M66A 4ZVQA 4OY3A 5ITSA 2O3UA 1N6LA 2EFYA 5BR7A 1ARZA 1B8OA 5BRJA 3D64A 5IAOA 1JG4A 2AOUA 1F9EA 1EHCA 3EQ7A 3PJDA 4I9NA 4KMOA 2EKPA 4NARA 1J90A 1KMIY 1GAJA 3R9WA 2JZOA 5T8KC 2O3QA 1T9BA 3FNBA 1XZKA 5K7SA 1YBAA 3K3PA 3MS4A 5DK4A 4O6VA 1C9NA 4RH0A 1ZVJA 3HB9A 2HF8A 3GLGB 5F76A 3GRZA 3ZY3A 1SVKA 4K9LA 2ZJ6A 4MVWA 4A4DA 4XASA 2G4VA 5JE8A 4BTLA 4R2XA 4FMCB 4D4GA 1I7SB 4FM9A 1E3SA 2ZBVA 3N2KB 1DEHA 1GA1A 1NKTA 3BGIA 1M33A 4EGCB 3I8OA 2V0CA 4S2UA 2HPZA 3EPKA 3AHGA 2J5XA 1T13A 3G0IA 4DLLA 5CXQA 2IZ0A 2C4WA 4JI0B 1X1RA 2XD4A 4HH0A 1X6VA 1UBMS 5K0NA 1CLUA 3E9ZA 4GWKA 1U5BA 1H2FA 3AJRA 4JQOA 1XKLA 2BVNA 4NAHA 1JWLA 4RTLA 1MNAA 1SZPA 1XK6A 2BFBA 4DS3A 4G0UA 1EXDA 5LMZA 3FNGA 4GM0A 4HAIA 1UXOA 5F4ZA 1NQTA 3KU1A 3U3RA 5AW7A 2YIJA 1T8PA 4K8RB 3C3EA 3L8DA 4DLVA 4V1CI 4ZEXA 2C7RA 2YW9A 2DWOA 4AJKA 2WV9A 3F71A 2GEBA 1DIOB 4MHTA 4ZN6A 3F47A 2XY4A 3KAJA 4KPEC 2O8FA 1VM6A 2WWIA 1NVBA 1L5FA 4Q7EA 2Q0XA 5KTYA 5I9BA 3K53A 1BH6A 3FCCA 2AIRA 3ORHA 2O14A 3MMPA 2HH9A 4QPJC 4ZYLA 3L7KA 3RC1A 1L4EA 2WSBA 1TYEB 1WQ3A 1LW6E 3FYUA 3QUQA 3REQA 4BPRA 3O91A 4D4LA 4WCDA 4E2WA 5MN5A 4URYR 2OB1A 4NU0A 3S5UA 1W36D 1IN1A 4EW3A 5CCDA 3PEEA 4TVOA 1KJYA 2OXTA 5I47A 2NADA 2N47A 4O2LA 1XNJA 4JOSA 1FFAA 1OASA 1O6FA 4OIFA 5DMXA 5A7HA 4B34A 2XCSB 3MFYA 4ER7A 1WNTA 2GN6A 3F90A 1AKWA 2VOEA 4WEQA 1KMQA 4R69A 4XXHA 1EQAA 2OZVA 3C3YA 4HNTA 3T1TA 3ULKA 3D0QA 1HF3A 1WZEA 2FFRA 3N7TA 4G97A 2XE4A 4UAJA 3UWDA 1DQSA 2CVQA 4KHPB 5FORA 3M5DA 1XGKA 4RCYA 2GT1A 4C0HA 5JD4A 5EVCA 1Q22A 3F9CA 5JO9A 1IYZA 2VHQA 3NOQA 4JA2A 4J4BA 4AW9A 5INTA 3W7VA 3KLMX 5HIIA 3EGDB 4C6RA 1YZVA 4HVAA 5JAZA 2R1TA 5LBIA 3TCXB 1A95A 5AESA 3NP7A 5KYKA 2YS6A 4FQ8A 5HE9A 4GM4A 3ZY5A 4RK1A 3UMJA 2QMHA 2HHAA 2JIRA 4L9AA 1P17A 1HZZC 4UXIA 4F7WA 1LK0A 3C7TA 3Q3EA 2IYXA 2PPLA 3EXG1 1P0QA 1N1DA 1XDUA 4J3FA 2PZBA 3GCDA 2E48A 5A3QA 4C78A 3L7OA 2IYTA 1NQWA 4KKXB 4XGKA 2BEWA 3IMGA 4G8BA 3WFZA 1YDEA 4UHBA 1XEWY 4NE7A 4WXPA 4CV3A 3OA0A 1GKUB 3AU9A 3FPAA 2G1KA 2XGMA 4MB6A 4F7DA 4MTCA 1YR9A 1QO9A 2CFCA 2X3FA 4LJSA 3TTVA 1QV6A 3PGVA 3ONWA 1QAOA 4TS9A 1ZSVA 4B46A 3THYB 3FWZA 1Y0BA 2DFKB 1NN1A 1TM5E 3P9SA 3PXAA 4OKIA 4X90A 1K8RA 1QIKA 5FWDA 1OZGA 1F0PA 4F21A 4MIYA 2KQUA 3F97A 1U0EA 3EA4A 1IUPA 1ESZA 2VJMA 4ZYXA 5B3JC 3MN1A 1GPUA 1UMDB 4M9XA 1ZR4A 5BQ5A 1BO6A 2ZOSA 3G2KA 3KZKA 1A82A 3NPAA 4OXXA 1JDTA 1X39A 3I42A 2HU5A 2DFLA 3UW3A 5KYTA 1F2UA 2I7VA 4KRYA 4L8GA 3UMMA 5L7YA 1G7TA 4R54A 1JTFA 2FCAA 1Q83A 3KD2A 4FFBA 3L7BA 1MX3A 4K9DA 5EGSA 1W4BA 1PS8A 5EMKA 1XZMA 4LBZA 3NHLA 4OUDA 4DJDC 5ABPA 1TVKA 3EMKA 3NC1C 4B76A 3AY7A 1KFEB 1UJ2A 1IBLB 3W0LB 4JQZA 4G4IA 3ET5A 4PEVA 1X1BA 2XDWA 3A4IA 4LYDA 1EINA 1SOVA 5HZGA 4RZUA 2ORWA 3PYLA 5F33A 5ESXA 1NAHA 2ZDQA 3QKRA 3EXFB 4HWPA 4JR2A 3QX9A 4NR0A 4XTCS 2BHRA 4AXXA 1V9LA 1Z34A 4DUGA 3AL0C 3LLVA 2B4RO 2PUTA 3L0IB 2E82A 3MAGA 1NQ5A 3LPNA 3JY6A 1NJ8A 4PX5A 2GEJA 4Q9HA 2IV3A 3SFVA 2SHKA 2CXSA 3QF7A 1Z6AA 2XMGA 4MLZA 3K9NA 2B4QA 3FAKA 1P5FA 1U0HC 4RK0A 3UY4A 3ETLA 1U7ZA 2V9PA 3DXXA 4QTXA 1NJ6A 4EHBA 4FFDA 5TARA 4EJ0A 3PR3A 1FQJA 1II8B 2ETVA 2YJTD 2PV0A 3UHFA 3OPNA 4CDNA 1JALA 3KDPA 3WGNA 3Q3JB 3GEMA 3OLWA 3HJBA 3KOXA 4LG1A 4CN8A 4AN0A 3WL3A 4KZKA 2CV1A 2P90A 1LDGA 1U0TA 1NX6A 4EA7A 2ZROA 3D4OA 1QP0A 1MGPA 1FS4A 1TYDE 2NZXA 3H9BA 3IXMA 4BFCA 2FZEA 2GBGA 4DV4B 2FMTA 3E7XA 1IK6A 1ADJA 1RQLA 2DUNA 1U5CA 1WB6A 1EX6A 4KQ2A 1JR4A 4TQUS 5F1PA 3TW8B 3VZQA 1ZLYA 3WB9A 1F5SA 3QYAA 1FS6A 1YL7A 4K81B 4K9NA 1JYFA 2R11A 3D3KA 4JJ7A 5LU8A 1CYEA 2V3VA 3CTMA 1R64A 1HXHA 3VMFA 3I32A 2GASA 1S3FA 4PO9A 5ALFA 4ANFA 4N18A 3H19A 4A16A 1ZMBA 1Z68A 2EP8A 3UB3A 2BHLA 1MO5A 1E61A 4F85A 3OQJA 4AZ0B 2NAFA 2DPHA 2ODWA 4DYDA 1UINA 1JIIA 4NBVA 5B4VA 3K9WA 3P2JA 2WJ6A 1TUGA 1RYZA 2FG6C 3R8FA 3MCWA 2A9OA 2Q2NA 4M83A 2G67A 3Q2OA 3JVUA 1JVSA 3FYUC 3GV0A 3AG6A 4LV8B 5A6SB 3TIFA 3BSYA 1CHNA 1XCGB 5C7LO 4BDTA 3WGLA 4HQ6A 2CNLA 1POXA 1E1LA 1CY4A 3HRKA 3KO8A 2ZCJA 2C2XA 2JANA 4ND7A 3ZE6A 2RKOA 3AHEA 3BHJA 3DWFA 3TZKA 1GAQA 1SHUX 1SVNA 4OHXA 2GVZC 4CQMA 1CU1A 3EOZA 5DBHX 2FEPA 3C5CA 4P3XA 2G25A 1JTVA 2GAFA 5CUQA 4UULA 3S2ZA 4QRDA 1RRKA 3HJTA 4HDKB 5SY4A 4YMSA 2GN2A 1U04A 4MVYA 4PHGA 5AJWA 4HAVA 3JVIA 2VI5A 1N2BA 2LE0A 3C6XA 2E6UX 3VVLA 4ZK2A 2FZ5A 2J9XB 1KDRA 5CHEA 5EZQA 3ZUPA 1DO0A 1B2RA 3BXEA 4YDHB 3MWDB 2QSZA 2MHCA 1YCDA 4QOSA 4REOA 5IN5A 5IKPA 3LX8A 3TM5A 4TTAA 3U4AA 5NULA 4RKYA 1T1GA 1V47A 3FPCA 2ZUUA 2IP4A 3SZRA 5A9SB 5JUWA 1GDTA 2RHTA 2ZPUA 4FI3C 2PT7A 1BXZA 3IGFA 2H8GA 4M6WA 2ZRIA 2ZDHA 3U49A 2C92A 3BZUA 3HI4A 3MMSA 2EJUA 3OBBA 1N7IA 2O2CA 1VZ2A 1LF0A 1SHZA 4H6XA 1P61B 4DCUA 3HEMA 5MF6A 5D3KA 5IF9A 3ND8A 4M36A 1NVTA 3JVDA 5TMEA 1PQUA 1X3LA 5AHXA 1EUZA 5FPYA 1Q0RA 3OQIB 5C18A 4DV1B 1HKHA 2P3QA 4RK6A 4NQRA 3PEFA 4TT3A 1W9HA 4AMYA 4WJLA 2C7OA 5LQNA 3R09A 1NURA 4FYJA 3P9YA 2CFIA 3I6IA 4X3OA 4ERNA 3ONNA 3Q3HA 3M1LA 3N76A 3DKRA 5J2TF 3A31A 5TQVA 1IZ8A 2VQDA 1YVPA 3COYA 4IF4A 1TMKA 1UJCA 1DXQA 2AFIB 2F3RA 3DO6A 3KU4A 3VSAA 4AMBA 2IYFA 3NTRA 1Y48E 2VJCA 3GMIA 1OI7A 1YB2A 3CWZA 4ZZIA 1OU0A 1YJ8A 3D0OA 5F5XA 2AK2A 5U9CA 1ZC3A 2XPCA 3A1DA 3KWLA 2EG9A 4ARUA 3KKZA 3NONA 4L6IA 4Y1EA 4OJTA 1RADA 121PA 1PG5A 2HDWA 1J9GA 3GMTA 3U48A 1JXAA 3VZSA 3VR5H 4EKNB 3X2SA 2V1UA 3UICA 4GXQA 1H4QA 2G0TA 2VP4A 1XC7A 1JRLA 1N9GA 2BR5A 2H3EA 3LI2A 3TRIA 3VVMA 3NTVA 5C8VA 3PT5A 2WLSA 3S2FA 5HM8A 5LYJB 1Q0UA 1XTZA 5ITWA 1ADGA 2VP3A 3K20A 1ZH8A 3G17A 3GUUA 5G4KB 3D6AA 2YQ4A 2R44A 3LRXA 3PDWA 1NOJA 4XGRA 5JALA 1VE1A 5FX2A 1Z2PX 1EESA 4JXKA 1H1LA 4YPOA 3MT8A 2RGYA 3LAWA 2C04A 2R79A 3CS3A 2OC4A 4X60A 4MQMA 4RJLA 4UHDA 5ESDA 3GEBA 5IDWA 1GPAA 3LZDA 1AHPA 8AT1A 2JEOA 5BMVB 2ZJ4A 4OHMA 4CV0A 3U9TA 1O96B 2DOKA 2QSYA 4WASA 5HK8A 3EHDA 3OIGA 1XCOA 1KI3A 4HX9A 4O2AA 1BD4A 2G36A 3OAAA 1O95D 1UKAA 2GBFA 3RW9A 3Q6MA 5CURA 4Y0AA 3ZQUA 2P41A 2X2OA 3JWIA 4ILKA 4BHTA 2ACEA 3RUIA 2WK1A 3GD5A 3SEFA 1D1QA 1JR2A 2PUJA 4UMFA 3GFBA 4B6SA 4OB7A 4JUAA 3WSVA 5BW5A 2DKOA 4HQ0A 1SCAA 1QLWA 5DB4A 3T4XA 1AVTA 3CKYA 4O02B 4EWLA 3UV3A 1NJ5A 3JAKB 2FV8A 3JZIA 4FFVA 4NOKA 4EGJA 3CF4G 2WAYA 2Z98A 2OHHA 1B6GA 2HQBA 1Z2AA 1ISGA 4PC7A 1A96A 2DCMA 3FGPA 3T3HA 3VZDA 1YRYE 3DDWA 1ZUIA 3KKMA 4YQZA 4GR9A 1ZFNA 3DULA 1SQFA 3O74A 3AOEA 3GOQA 4M1KA 2OCPA 3FMVA 3UQZA 3ZHSA 2EEZA 1ZSYA 3RAGA 4Q3KA 1BXRA 2ZJ5A 3Q3CA 2O5EA 1FFYA 5KNLA 3HJGA 1DPGA 4BVEA 3W5VA 4EYEA 4AI6A 2M6KA 1WSBA 1R0CA 5AXCA 2HPAA 2X8JA 3IQZA 5IYZB 4PPNA 5LBUA 4OK6A 1DAEA 1USWA 1H6DA 1S9HA 1U0OC 2YYYA 4BGEA 3H3FA 4RVCA 4H77A 3N05A 2QUBA 5B1SA 4A0RA 4AJLA 4BC1A 1YULA 3RYFA 2H2FA 2EZUA 4DILA 3OI7A 4DBZA 3D6JA 1OFHA 2O07A 3LC7O 3HXOA 3COWA 5KX5A 3DV9A 4QM7A 3TKAA 2RAVA 2R8PA 4C04A 1SRQA 1UDAA 2DTXA 2V58A 1BVUA 3D81A 4U8HA 5EPUA 5FXMA 5A5EA 5DNUA 1TYZA 2VC2B 1BDBA 1QVVA 3QPBA 3TRHA 3F4LA 4YLYA 3OTIA 3NDIA 1F0KA 5CLIA 1WRBA 4MSUA 2K7FA 4LJ7A 4U02A 3HO8A 2OENG 5DX8A 4P8RA 1KZ9A 2K2QB 2D5LA 1QH1B 3LZCA 1G55A 3ER8A 1BMTA 1C9EA 4XGIA 4LJYA 3D43A 4O0MA 1TL7C 3BG5A 4C7OA 4TSRA 3I83A 4I3GA 1D04A 2B99A 4KNWA 5EWMB 1J09A 3K31A 4G2TA 4KNYA 1DI0A 3I9NA 2ST1A 2J3DA 3AOEC 3OM1A 1JR3D 2GILA 1BJTA 3RHTA 2FRDA 3BTVA 4UEJA 2HJRA 3CH5A 5ALJA 2XZOA 1SD2A 1V96A 4HD8A 2ZJFA 1TM4E 2IYAA 2JFZA 1Z6ZA 1FP1D 1IB6A 3AKDA 5E0KB 3IALA 3TL2A 1HTWA 4BJHB 4EJSA 1TUBA 4XPIB 2IUYA 2X42A 4H4CA 2CNBA 2WIAA 3KJEA 3WGZA 5G4KA 3K2QA 4IDPA 3SU8A 3R0XA 5BNTA 3HGQA 1IY9A 5F2NA 4C76A 3TIVA 2REQB 4FT2A 2LDBA 3GWGA 3KEMA 1JG6A 3L9XA 3QNWA 3LY8A 4I1VA 2BZGA 1GPBA 2HRDA 4QULA 5IVHA 1V5WA 2QNRA 4Q7JB 5JNVA 1Z0ZA 4EKGA 4N82A 1XZJA 2XYQA 4FJ0A 3TSOA 2DR0A 3JX9A 1GXSB 4UBMA 1KVUA 3AVWA 1ZGCA 1HK7A 2AUTA 2FF5A 2VHXA 4JLWA 2C8LA 3NLLA 1YT5A 2MSKA 2ZRGA 3BQ9A 3VO9A 2V65A 3ZCPA 4TZ6A 1E64A 3PBKA 2OR3A 3DZGA 2EX4A 4E3ZA 2V4MA 1ULZA 3JWHA 2QYTA 4PZYA 3DD5A 3IXQA 1E1QA 2O2JA 1E99A 3JYQA 3C4QA 2HNAA 1P7PA 2GMWA 1MHTA 3E7WA 2CDNA 2PLNA 2C7QA 4JFRA 4QQFA 1CS0A 3UCXA 4D3XA 2FNAA 1BX1A 3OU2A 4MUIA 5CLQA 2OSBA 2P27A 1KVRA 5C3UA 3IP3A 2H4ZA 3VU8A 3U7IA 1AGPA 1IEWA 2QZPA 3HCAA 1JHAA 2AK3A 3DZDA 5BN4B 1U1IA 1W52X 1WCIB 2FPOA 3VSEA 1RP1A 1A4UA 1A77A 2YZNA 3ZHQA 2LR0A 4I50F 3A0RB 3A10A 3VJKA 3CU5A 2C4KA 2JHPA 1JGTA 3OCWA 3FUVA 4LPSA 4X1YA 2BE7A 2CF5A 2IYZA 1RCUA 1XMSA 3EFOB 5CVVA 5JG7A 1SUBA 5A1TA 1NXWA 1KO8A 3UJPA 1L4MA 1S2MA 4AP9A 3A6DA 1LNSA 2YX1A 3CSSA 1JJFA 3EC2A 2H07A 2QVBA 4NZOA 5FPSA 5EKXA 3OT5A 3QWBA 3STVA 4E12A 3E9RA 5H02A 2CVFA 3CZPA 3VX4A 5IJAA 1U3DA 4JHXA 4KH0A 4NOJA 4W82A 5LQSA 1E4VA 1SUWA 1RYBA 2A67A 1MAHA 3CZQA 4BX9A 5HQ3B 1V7ZA 4PPYA 3R7NA 1RWMA 1YXMA 1XL0A 1ZLXA 5FBQB 3GJ8A 3ONEA 4QXRA 2J5BA 4EI2A 1ZESA 3QX3A 1V3TA 5FFNA 1T1RA 2V6JA 6PFKA 4BRWA 4AG5A 1YE5A 2EFEB 3WK5A 4FDAA 2A57A 5EUMA 4R9UC 1ATIA 3DEYX 3TX6A 4DLBA 1PLJA 4HXGA 2FHPA 4MGKR 4LMBA 4TM8A 3KPYA 3MF4A 5BSMA 3N9IA 1QJCA 2GPSA 3QF4B 3ILYA 5DYYA 4B0OA 1SG9A 3ZIUA 3SIPA 4C4AA 3P45A 3AC0A 1I2BA 3TGWA 1Z12A 3V2UA 1VB5A 3PCXA 1N92A 1PG2A 2BZ0A 2Q2QA 1LD3A 5EXXA 2KX7A 3PGMA 4KQHA 1VPDA 2VH2A 3RDPA 3LKDA 2Y0PA 1UDXA 3ANNA 3M0EA 2J07A 4OBWA 1ICIA 4WZBA 4S1OA 4MJ3A 2NN3C 1U02A 2QY6A 3H9CA 2CDAA 4PZPA 1ZJZA 3NWPA 1K7EB 3GN1A 5DHTA 2JA2A 3ILXA 2QN1A 1PF7E 2GD2A 2HOQA 2O5RA 1P7VA 2VBCA 4ZVOA 3T35A 4EFKA 3U7GA 1LGYA 4N5IX 2NUPB 3QU9A 4KDEA 2BKVA 4RL4A 1N3BA 1BE6A 1Z6TA 2ZJBA 3PP8A 4ZO9A 2PZJA 1QHFA 4L3VA 3WKAA 5K8VA 4ZOAA 1MTOA 1T4BA 3R74A 3K1ZA 4DR2B 2CLMB 3LWDA 3PDHA 2IJGX 2RG7A 4M38A 1NRJB 2Q0HA 2C1ZA 3I34X 3QWFA 1KXJA 1YAHA 3URMA 3C8UA 4P22A 2YJ5A 4RD4A 5K3EA 1F2TB 1I9CA 3IEVA 2YZKA 3L4EA 1A5SB 4UM5A 3S5JA 1AHHA 2B0CA 4AYTA 2Q9UA 5CM8B 2OMKA 2UVPB 3DLHA 3QA3E 3AUTA 4QZVA 3U62A 5K6RA 4PSKA 3RTGA 1ULTA 4Y0VA 1QDLB 3EPHA 2VLIA 2QU7A 1T1IA 1NP3A 1HT1E 4W5QA 1CWUA 1O03A 1H69A 1U0FA 2WF8A 3AYZB 1XZNA 2DPYA 3NT4A 1F8YA 5D85A 3MOIA 1HLPA 2I22A 1CUJA 2TSYB 3U3MA 4OA5A 6CHYA 3E0XA 4BX2A 5IU6A 3AESB 1ODFA 1JT9A 2G71A 3DJFA 3MIIA 4FMBB 1H94A 4YRGA 1CDEA 5KSOA 4IHAA 3HYLA 4M4SA 5CK4A 1ZL0A 1O9BA 2FR8A 4QELA 1TNDA 3CFYA 5DZSA 2OHVA 1MQAA 4YCMA 2JVJA 3CLRC 1TMYA 3F0TA 1VIAA 4JP5A 3W5JA 3FDIA 1TM7E 5CLHA 1BCSB 3CG4A 3I61A 3DH0A 2BBWA 1JR6A 3PC7A 2P9YA 5ALNA 3H1GA 2O2YA 2IEDA 5B53A 3WFIA 4OX9Y 3MT0A 4XD7A 3QPWA 5CG1A 1E3WB 1R4AA 4BXOA 3OQIA 1R7RA 1CHDA 2RHBA 5FTWA 3TO5A 2J6IA 3DAPA 4DMLA 1ZUD1 2AZ4A 3HV0A 3PFIA 5KSWB 2WSSA 2X77A 4Z0PA 1PL6A 1XWFA 3ZDFA 1OYVA 3EVFA 3WRYA 2QYHA 3NTUA 3UF0A 3B9QA 2C31A 3WGKA 4CT5A 4H18A 1JHQA 2JLCA 2PMWB 3DVQX 3GFRA 4P36A 4BEWA 1CTQA 1ZRMA 5J5AA 1YJAA 1ZKMA 3MTBA 3HUEA 3GGOA 3TGPA 1E6WA 3V4VB 2Y1LA 1FYVA 1QHSA 3PRJA 3V1NA 5DHFA 1SKYE 4YPFA 3V8VA 1OHHA 3K35A 3ZVLA 1B43A 5JOQA 4HL6A 4EG6A 3HXPA 5GGXA 3DC2A 4WY8A 3GLRA 1FX0B 4KV9A 2HRCA 1J97A 1V8PA 2O8BB 1RWPA 1JYSA 3MJRA 3PDUA 1YA4A 1XAHA 2FUG1 3PT9A 3AU8A 4KE8A 1YRWA 4R8RA 5KDLA 1FNCA 2FEAA 3W5AA 2WKPA 3OWOA 4Z4FA 1PL8A 1ADBA 2UKDA 3BXXA 1AQYA 3NKLA 4IDDA 2IHTA 3RNLA 4FB5A 3N2GA 5JDCC 2XIJA 3P8ZA 3TEFA 1B14A 1M2JA 2G76A 1ZD2P 3UBMA 3DOCA 1CUIA 4PLGA 4TMVA 1GHTA 3ICOA 1N5RA 3DDHA 4JLKA 1EK0A 4GPIB 4BEVA 4AKTA 4UEQA 3KYCA 4EPTA 1KOFA 2WFLA 3A1SA 2NZVG 5FL7D 4D6YA 4D3SA 1YWGO 3G88A 2OHFA 1N0IA 4BXOB 2KPOA 4FYYA 4B4OA 3AIIA 3VPSA 4AJOA 4IV5A 3N75A 1YFLA 3LOUA 1F06A 1JEDA 4GX5A 3GRCA 1WKVA 2QD2A 2CL0X 1S02A 4RFVA 4TLAA 3X1JA 3OPVA 1ZRNA 5IUKC 1K6MA 2IU3A 3BMNA 4P2BA 5ICGA 1KWGA 1AJEA 3G6KA 4ZJPA 5L3SB 2XNDA 1BYIA 3PQ8A 1HFKA 4ROTA 5HUQA 1EP3B 1W2HA 1HLFA 3Q9LA 3UAOA 1KQ3A 4I50A 5LP6F 2AMLA 1D2AA 2CHGA 1WUIS 4OGGA 2VG8A 3MAJA 1NY5A 1KEWA 1XJ5A 3BMXA 4P38A 2WUEA 3ZJTA 1UK7A 2Q1WA 4H7DA 4HMQA 5CDHA 2C42A 2HWYA 4OQXA 4TKUA 4YJGB 1X1CA 3PNVA 4JQYA 4TL9A 4AJPA 3TXAA 4YV0A 5B3KA 1O57A 2YXNA 4FFSA 3HK2A 5JSQA 1CIPA 3AF4A 3ABZA 5FQNA 1V5GA 4H1VA 5JSHA 3D3EA 1XVIA 4FLMA 7ABPA 4R1TA 2Q41A 4J1SA 1PYGA 3GI1A 1MC1A 2DUUA 2ESRA 3MMXA 3TQIA 3V1KA 4JX9A 1KDYA 1UBUS 4KQCA 1A98A 3UAZA 5IZCA 2FMUA 2DR2A 4BCDA 4GI1A 3LCVB 3QVVA 4V24A 2W8BA 4IDCA 4GYWA 1W29A 3EVBA 2NGRA 1RBQA 3UMSA 4DCJA 5EJ8A 5LDDC 4MS1A 4LWPA 4WE3A 4PBTA 2EKLA 4BKUA 1GM5A 2OD7A 3CUEF 4M86A 1VBKA 4QPCA 4R31A 3OTGA 4YAWA 3TEMA 3E81A 3QFFA 4UNQA 3IJPA 4AUNA 3RRJA 3DFMA 2HLHA 3PJFA 4MZXA 2QN9A 3AJ8A 3KQKA 1REQA 3E15A 3AR5A 1P0MA 1VJGA 5LQUA 4ER0A 3BE5A 3N2EA 1LWOA 2B7LA 3ICCA 4JLMA 4S2EA 3CX7A 1PWXA 3R5XA 4M0LA 4H7EA 1FSSA 4RYDA 3TQOA 4BNHA 5AOCA 4HNQA 1CR6A 3EXAA 3F7MA 5DRYA 4XYLA 4O59O 4Q4AA 1XVUA 4JVMA 3M5WA 1EWTA 1M1YB 1E3TA 3B3FA 4WNIA 3SQDA 4WX2B 4UOZA 1U3WA 3T5TA 1OH5A 4LW8A 4DDMA 3LCMA 2I6FA 5H0IA 1IATA 1L8LA 3K9CA 1ESCA 4LYJA 4QJBA 4PHHA 4ZEVA 1GNVA 1F8GA 3VI3B 3D2AA 5JWHA 3SDSA 2QR2A 5A3JA 1NXVA 1DKUA 3PTZA 3NANA 2Q5JA 3W5SA 1NE7A 2V6GA 3M5PA 4GQAA 5DWQA 3UKDA 3SXPA 2HMVA 2VF2A 1AM4D 3OHMA 4YMIA 3RVJA 4J4TA 1BWSA 1JDVA 3CHYA 3QPVA 1ZZEA 5BSVA 5KVSA 1YL5A 2YWEA 4E07A 1UH5A 1V6SA 1VJ1A 2J45A 1KDVA 1PR9A 1Y9ZA 4KR7A 1C3XA 5J63A 3BMOA 3RIXA 1WEHA 1QCZA 3L6CA 4HNVA 2IP1A 2QX6A 621PA 5E3JA 2NXEA 1Z7EA 5HBGA 1LQTA 3K2EA 4UNNA 1MO6A 2V6IA 1KJZA 3D6TB 1RHUA 4C0SA 3DP9A 3FMOB 1T5LA 4IDFA 1FMJA 4H17A 1Q1GA 4HZUA 3CRVA 4C7MA 2HC9A 2W00A 2ZSUA 4Q5IA 3LQFA 4Z1OA 3K5WA 4KRGA 3ZZTA 2QBYB 3B20A 3N58A 5E7JA 1XYYA 1KWKA 1Y81A 4R98A 5FO1A 3F4KA 4OATA 1N4AA 3ZQJA 5AD1A 3VNQA 1XU7A 4G6ZA 1KMCA 2VSNA 3P4XA 4YS6A 2YVLA 1H1DA 1HORA 3ENNA 4NFYA 1IRIA 4RV5A 4EUHA 5HSGA 1N5JA 1X94A 4RA9A 1UPTA 4Y1FA 1GG2A 5CT9A 3ZU6A 4IFIA 5KNBH 1UEJA 4DB2A 5KYUB 2ZIFA 2X6QA 1XF1A 5BXYA 1NW6A 1THZA 5K3DA 1F7VA 3N0XA 4ZQEA 4RLHA 4YJFB 5GOZA 3JWJA 5BRNA 4G5FA 1NI5A 3EZXA 4WOCA 3TQCA 4D3YA 1ZOIA 1YGPA 2ARKA 1CRWG 1J1IA 5EERA 1Y80A 1OLUB 3VOSA 4YIHA 3PFNA 3HFRA 4RY2A 2FEOA 2AN1A 1G8GA 2HIHA 3L92A 5AHKA 1UJMA 5FA6A 2FWRA 4KVAA 2W37A 2GLTA 4PYRA 4QYXA 2WAAA 3H5LA 2VUTA 3SEZA 1RWWA 5IJ0A 1K3UB 3KDAA 2BT4A 4UJ3A 1ID8A 4X44A 2QYOA 2ZUCA 4B1FA 4N9QA 1ORTA 3BE8A 2H1WA 1QK3A 5ICCA 4OCZA 2F1KA 3TYXA 3NRCA 5JCOA 1SKMA 1WOMA 2ZWIA 3BJMA 2H2WA 1HO3A 1PJAA 3A9CA 3H9QA 3KV3O 4IVNA 2X0IA 2R7MA 1AY0A 1FRQA 1Q2XA 2XVZA 4JZKA 4NHOA 3H84A 4O2BB 4B6GA 2QBYA 1DRUA 2RKBA 4L85A 4ZGBA 4DE5A 3CX8A 1G0NA 2EJBA 4IDBA 5CB4A 2Q99A 4BMDA 1EA5A 2E4XA 4QLBA 1UBLS 2ZSEA 1DIRA 2J3LA 5K3SA 1MH9A 3ZHVA 1GZ4A 1YUNA 3V7YA 3WBBA 4YFYA 1NNUA 1JNYA 1Q7CA 3BRWA 4XPIA 2FSSA 3JZAA 1MV8A 4QHTA 4BRUA 4YQFA 4C88A 3RT9A 2WUDA 1YDMA 5AKEA 5HCUA 5AK0A 3IVXA 1UBOS 1FL9A 3CNNA 3GFTA 5AW3A 4A82A 4NOMA 2EKDA 5FRDA 2PHZA 4BWVA 2UUAB 5EZYA 3ESBA 2EARA 1F9AA 3JD4A 3O4HA 5K0BA 2D4AA 3O75A 3VTFA 1MAVA 2QTTA 1P3Y1 4N1AA 4QGFA 5C8DA 2AC4A 5EWJB 4UU8A 3JQFA 3B3QA 1P0FA 7MDHA 2HT1A 2GB4A 5ALXA 5KS2A 4TTIA 1VSUA 5AKLA 1KY2A 5D6NA 2BGIA 5E6UA 3H7IA 1YJCA 5EIXA 1WVMA 2CXXA 2D2VA 2PG3A 2F9LA 2UZIR 3MNFA 5I8PA 1C4KA 5I3ZA 2JK1A 4IGFA 1M7GA 3LXMA 5J2TA 4ZD6A 1WMEA 4M0FA 4YREA 1MF7A 4FU0A 5HW0A 2AKYA 1CSEE 4UUAA 4CQNA 3FDJA 1WZ2A 3ETDA 2R6JA 1Y8AA 3EF0A 1DWOA 3ESRA 5KTKA 4ZQCB 4XTRA 2EYUA 4OJYA 1TKBA 5A5DA 5C8YB 4UFNA 2EATA 2NQ8A 2NU7A 4MIOA 2Z09A 3VR6D 2HYDA 3FSRA 4CM5A 1AF7A 1KYXA 1WY5A 3O9ZA 3RK0A 4UTVA 2IKSA 1PX0A 3QXXA 1EK2A 2FEWB 2ONCA 3DB2A 1XQYA 3DEAA 4RWEA 3T3EA 5JSZB 3SM3A 1I4EB 4EYSA 3P2KA 3GJXC 4XFKA 3UWSA 2B4KA 3FHOA 1UM8A 3D8RA 4UDNA 2P35A 4WXMA 3MD9A 1PR0A 3QW4B 4TS1A 4Y1GA 3TTUA 2PKRA 4QDKA 4BNIA 3OTQA 3T8YA 4A92A 4CI9A 4FMCF 2C1XA 2WUGA 4GG1A 4WZAB 4P3PA 4NBWA 2YDYA 5JWRA 1E2EA 3LHIA 3PTAA 2G5TA 1U2ZA 2IU6A 4DAOA 2VHWA 1KAEA 2CWWA 3KB2A 4ZAFA 2QY9A 4KW7A 1X86B 2Q2OA 3IBTA 2RSLA 2CLLB 1A7AA 1RT9A 3C5HA 3PR1A 4BBZA 4PG5A 2ZSKA 2G82A 5LVAA 3FNFA 3WNCA 1W5EA 1JIQA 2GCIA 4FCCA 1GQ2A 3G2HA 4HWKA 2WMDA 5K51A 5EJ6A 2E4ZA 3QEMA 2A6PA 3PQDA 2JIQA 1CUFA 1L7RA 1I4WA 2HA0A 2D1RA 2YQ5A 2ZRAA 3WL5A 5J23A 1WXWA 3FUTA 5HOQA 3BWEA 3GYBA 4EUSA 4AD8A 4E7PA 3OZVA 1E94E 3GLGE 4D8UA 4YJKA 2BWJA 2EBFX 4OOEA 3KG2A 4KDFA 2FR8C 3BRWD 5I4IA 1RYMA 2G1JA 1FYXA 3EXEB 3LH5A 3TD2A 4NS1A 3JQ9A 1SUFA 2QMUA 1HM5A 3CF0A 5AOVA 1O8CA 3P2EA 4NDNE 4RXTA 1BCSA 2B4YA 4GC5A 4L7VA 3HR8A 3B6EA 1J1UA 4RXMA 4AJ9A 1PG0A 1TQDA 1CYDA 2I34A 1KI8A 4MV1A 2H2HA 4I8IA 3HVKA 1P4JA 4II2A 4QUAA 4UHCA 5C1OA 2RG1A 2VCHA 2QTCA 3QSGA 4ARIA 3KHTA 3UEOA 3SJAA 1CQIA 1X7YA 3DMTA 3HVHA 3N74A 5ALQA 1GFIA 5JV5A 4LZNA 3JV7A 2JJ2A 3VU9A 3VNUA 1ETUA 1JKFA 3KEGA 3UWMA 2D54A 1W34A 3AR9A 3PFKA 1U28C 3LPDA 3FTEA 4OHBA 1A9OA 2ZYDA 4EIWA 4O4JA 1FDUA 1ZW6A 2YV4A 1XD8A 4M1QA 5LZ7A 5FOXA 1HDCA 5CA1F 3CRZA 3FJOA 2YHIB 2IP2A 4X61A 3CUKA 3C1OA 1P7WA 1FTNA 4QYMA 3WLJA 4MV7A 3LUCA 1MUUA 3ZHTA 2XCLA 1ZMTA 4RSMA 2ZRKA 3PWSA 4CHTA 1NT2A 1QH0A 3CBQA 3QXGA 4C0QC 1Y7LA 2XBUA 1C5KA 5IBRA 2VAMA 4H27A 1R6DA 3RYTC 2PXHA 2Q9CA 3LLUA 2VPTA 1KERA 4CKEA 4TN5A 3WE7A 1HYEA 3GQBB 3JD3A 3OTHA 2Q6LA 1LSJA 1NP7A 1GADO 1W87A 4OHZA 3ZKWA 3BSFA 1LA2A 3AP2A 4IDQA 2VJOA 3E35A 3IODA 1UL1X 3NG1A 1V8DA 3EVNA 2XF2A 1Z8HA 4WAUA 3I6ZA 4RORA 5TRTA 2KJQA 3UFXB 2NO0A 5ALZA 4FX2A 4PVDA 1SFRA 1JDBC 1KKLA 1X7XA 1K4MA 1L7AA 1SC4A 1WEKA 4ND3A 3L6RA 5CGQB 5COBA 3DFIA 4ER6A 3BFXA 6AT1A 4IGEA 3G0GA 1T3LA 4LE2A 2IPXA 1L7QA 1VKRA 1DWUA 1YQQA 4ZVVA 3T7RA 4C07A 4G8JA 3DZ8A 3K6SB 2C4UA 3G2NA 2QRNA 4Q34A 5LBTA 1PDVA 4KZPA 1E7YA 1ID1A 3G02A 2OZLA 3HCCA 3ZLUA 4WESA 2HPHA 3H9UA 4GAEA 4LZAA 2PFGA 2HKIA 2VPZA 1DUIA 4PC2A 4LQCA 2YS7A 4OQDA 1C1HA 2BISA 5IBQA 1MZVA 1V26A 2VQ3A 4FEYA 4FW8A 4DV6B 1EX1A 3BXPA 4CUZA 5BOSB 2FP4B 3BFKA 1IXYA 3FKQA 1QHXA 1Y1PA 3LNCA 2CHQA 3BHMA 4UPEA 2XUZA 2C9ZA 2ZG6A 4XOIA 1AK9A 3TAXA 1JI0A 4WLFA 2GUGA 2N3ZA 3JAMA 1TIKA 3PXUA 1KHHA 1NXTA 4I2NA 5HG0A 2EFJA 2Y67A 3FG9A 4PLFA 4QGSA 3U5ZB 1JHRA 4HMOA 4M55A 2JRCA 2I33A 3LO5A 1UM9B 3WIUA 4BB5A 5JRJA 5IM4A 3W1EA 3GO4A 3TIXB 1UQRA 2VHYA 3RIHA 1QGDA 1SK8A 1YTLA 4MPDA 4NMHA 1NFFA 3AJEA 4TMWA 4YP7A 3RLIA 4V2UA 3I62A 1E2JA 1H6BA 4X66B 2J5KA 3GDHA 2FLWA 1I7NA 1Q91A 4HLDA 2AI1A 4IDGA 1EU1A 4L7QA 2OBBA 4KO1S 2MSDB 3JYOA 3WKCA 2EAUA 4TWRA 1JQLB 4C7BA 2OGSA 2PYIA 3NFYA 4IZIA 3R24A 4F1KA 5JANA 1XZLA 4MW0A 2QWXA 4PFQA 1T0UA 5TY0A 1ONNA 3IESA 2ZRLA 3ET4A 3MMNA 3OIVA 5AM5A 3E6AA 3ZCUA 5LB2A 1B8NA 1DMSA 3PNQA 4U2FA 5IK2A 3T1VA 1HQDA 2XADA 4C4SA 3QI2A 4G56A 4ND5A 2ZYHA 4IOLA 5ES4B 3GRUA 1VRWA 3O8OA 4FJ2A 1UFKA 1DE0A 3KTAB 1Y4ZA 1ADFA 3P2OA 4PANA 5EI5A 3B1FA 3WJ7A 1AO3A 2CVZA 4PG6A 1UAAA 4CEJB 3E22A 1DWQA 2GARA 1EP9A 5TJHA 2LXNA 3HCRA 3QVGB 4I36A 1BG6A 2O8CA 4NYJQ 3R7WA 3LK6A 5A4JA 4JB3A 5DE3A 1O5TA 4V0RA 3L6OO 3ZYCA 1CLEA 3PXEA 4M8NE 3A6JA 4F4UA 4OHYA 3QX7A 1ORVA 4G1BA 3P9QA 1VCNA 1BX0A 3Q2KA 4U3JA 3CW8X 3ORQA 3W2EA 5I48A 2UDPA 2HWUA 2O2ZA 3GDGA 1AB5A 2XVMA 3QPUA 3QUSA 4YO7A 5ITVA 2DGDA 3OU6A 3HKBB 4GXTA 2JK0A 5TEWA 1G41A 4MVJF 1SOUA 4BGUA 5KDDA 1E2NA 2NU9A 5EIEA 4TT3D 1P45A 3GQVA 3TIGA 2F1JA 3AY6A 3GFPA 4CLRA 4LCBA 4GSLA 2AWNA 1JKJB 4D0SA 4DQUA 5MHTA 4NS4A 3BFVA 3BWYA 4ZDIA 5KI6A 2J7PA 5AHWA 1XA0A 1TC1A 3U7JA 1E6UA 2VS1A 4PLTA 4RD6A 1L4NA 2AFHA 5IH7A 2QUJA 1SC9A 3C3KA 4C0AC 4JJEA 3VAZA 1H23A 4QAQA 1QKKA 2YHUA 3C3DA 5JD3A 3V8EA 4ZZ3A 1GFZA 5COAA 2GD0A 3KNZA 1GPKA 4JT4A 1ISSA 4IFBA 4OYHA 3RM3A 4D9IA 4CRWB 2FWAA 3N86A 4KKVA 1ZCFA 4GGOA 1DT3A 3PIDA 4BKOA 4MGIR 1O97D 4E13A 5BQPA 5H9WA 4O0LA 2UVDA 5CG2A 2L19A 1CB7A 1E2IA 1RI2A 4OQMA 3I4FA 4R2HA 3CVUA 1G60A 1Q7EA 3PXBA 3INNA 3SKVA 4MCHA 4Z54A 2ONYA 3KS9A 3P32A 3LXXA 4MW7A 4NICA 1FQWA 1RCTE 2CJWA 3L7IA 1WDMA 2OD9A 3MBKA 3BB3A 2WA1A 4CDMA 1ZG3A 5D7BA 5FLEX 5BV8A 1FIUA 1ABEA 1QR6A 2ZIUB 4FFLA 3CXRA 1B26A 4C3VA 1RLIA 2UAGA 1UP7A 2YOGA 4D9JA 2NV2B 5K0SA 1EE1A 1T5OA 2L18A 2CYBA 2Q46A 4G9GA 2C1EA 5AJYA 1ZGJA 3DMGA 2XMRA 2XYPA 3QBJA 3LBHA 4N0PA 4PTZA 1N77A 2QUAA 1TRKA 1F1BA 2FG7C 4UDYX 3RRXA 4DLAA 1FBNA 2CMFA 2A1UB 2WHEA 4EL5A 4ON9A 2O3SA 5AHRA 1NUPA 4FZ5A 4N65A 4HRVA 2QRHA 4MW5A 1QX4A 4MI9A 1BMFA 2I4RA 1T1JA 3SPXA 4DM3A 1MQ8B 3RKSA 2C58A 4X85A 2UYHA 1UJ4A 4E21A 3AQIA 4E5NA 1KIAA 4WKNA 3A1CA 1GP2A 1GG5A 1DAMA 3P9ZA 4YJ2B 3NDPA 5BQOA 5F51A 1F60A 1OLSB 3HLTA 4LDAA 3G5MA 5A3RA 2RHJA 3BCRA 3ZZUA 2Q3DA 3LIIA 1XZ8A 2AHRA 4UM9D 2Q50A 3W6PA 4E70A 2GLUA 4RHEA 3NPMA 1YJBA 4YRAA 2QG4A 1HC7A 4R0NA 5CA1A 3BWDD 1YK0A 2ZPAA 2BFFA 3HGTA 5I8ZA 3HJHA 2RGGA 3LA8A 4AYWA 1KHTA 5JNSA 2WT9A 1DEOA 4YCNA 4U7DA 4N6OA 1PQWA 3PHGA 1XCMA 1Q3TA 1YFZA 4CLEA 3WLIA 1PFUA 4F92B 1CD5A 1NJGA 3OLZA 2W11A 1N7GA 5CPFA 1WOYA 4X00A 1X1SA 1RZ3A 3QOYA 4L4XA 1SA0A 2X7JA 4MQ6A 2H5LA 4I3HA 1G7RA 3WWPA 2VP6A 1QRTA 1FPMA 2NYRA 2B98A 3DL4A 4XJVA 1U9IA 4AIIA 4D57A 1VYUA 2R00C 4WOKA 5GADl 2JKZA 1BWRA 4Q19A 1GTZA 2V0GA 5F2OA 4A8JA 2H4JA 3G0DA 4MUHA 4XSHA 3BZWA 4ACAA 4XJTA 2ZI4A 4IIYA 3V8QA 3TNYA 1P44A 3M9LA 3JALA 3GLQA 2ZSFA 3RT1A 3WISA 1XTSA 3E48A 1ECCA 1R0RE 3P9PA 3VQTA 1PZNA 1MHPA 3H0CA 2CCGA 1U7OA 3S28A 3OPYI 2OECA 3CUUA 1TE2A 3IELA 4J0QA 3REOA 2I4LA 2BGUA 5K0LA 1II8A 1EMDA 2PBLA 1T2DA 2QG6A 2OORC 4PHTA 1P2VA 4W99A 3REGA 3V2HA 5L3VA 3U60B 4LF8B 4MS3A 1FLNA 3M6LA 4B31A 3EODA 1N6OA 3OZFA 4JJIA 2CD9A 1G20E 4URHA 5T57A 1C3VA 2I8CA 2FETA 1L4BA 2FN3A 5DM1A 3RVLA 3SKYA 2X8WA 4CFSA 5KUTA 4FMDF 3EPLA 1BXRB 3BM5A 3AEZA 3EZ9A 4QGAA 4LXTA 4XCXA 1GQYA 1ZMXA 3O8QA 4DC9A 1V1JA 3KYBA 5H81A 1EZ4A 2WC1A 5TSDA 4GLFA 2IH5A 3B48A 3OWHA 4CM9D 2ZP1A 4ETNA 1WJGA 2AN3A 2VPPA 3WS7A 5I7AA 3K0AA 3PJRA 4MTLA 3JQBC 2H2GA 2O3RA 4J6FA 4JVSB 5FOVA 1WZCA 4JN6B 2IZ5A 1NBMA 3W3AD 3SC2A 2W42A 1DTSA 3ANYB 1XU4A 2HFKA 1NTOA 2WSYB 2JCVA 3QEJA 5GGYA 3COVA 4F5EA 1KEKA 4FCVA 5CXSA 3R7SA 1CVRA 3UWKA 3UHPA 1XEFA 1CF2O 1DXHA 3NHWA 2C7PA 1J70A 1WMFA 2NPFA 4M1YA 3EXHA 2ORIA 3JD0A 3WK8A 1KQPA 1B15A 1H8ED 4L5BA 2QTBA 4DB4A 3EH1A 1AUVA 4DSTA 4M0DA 1L7BA 3ZNPA 3C1AA 3C3XA 1F1JA 2VZ0A 3CUTA 3KSZO 5IBPA 2IOFA 5EN4A 5EXTA 5CDTA 1R8SA 5PGMA 3DTVB 1GT91 1PGPA 2R0QC 3I2KA 2AQHA 2CEKA 2DBZA 4OL9A 4OAOA 5JS1A 1MN6A 3ZWAA 3OEED 4G1CA 3VBEA 1JAYA 2HYIC 2NXWA 5AR1A 3ZWCA 3A3NA 2FDCA 2ADMA 2C59A 2ZT7A 4YMVA 1YS4A 2G72A 1NKSA 3HJUA 3ZXUB 4FJ1A 4N01A 4DKJA 4MQEA 1KIMA 1TO6A 2YW2A 3L4KA 4C08A 4HNUA 1RPJA 3GFGA 3R3UA 4C22A 4BNDB 1BHJA 1H6AA 2HA6A 5DISB 2PK3A 1N5KA 1Y63A 3ENWA 4JI3B 3SN6A 5EZYF 4RTOA 1U7XA 3C8ZA 2WI8A 1EFVA 1J39A 1O4WA 1V8BA 4UUQA 1RMQA 5KYUA 1Y7HA 2VNHA 3A6FA 5E1BA 3W5UA 1A5TA 1BS1A 5GVRA 3WIDA 4TXNA 4J1TA 2YV2A 4CYMA 3KBOA 4XVQA 4ARZA 3GOHA 4QASA 3PITA 4UM8B 3E1KA 5KHAA 5CVTA 3NDRA 5HGXA 5DNAA 1OC2A 2HU7A 1ORDA 2O7SA 1DRWA 5D7NA 3PIIA 4X84A 4Q0MA 4C4PA 3LVFO 5CB4F 4GUDA 1AS0A 1LLCA 4QO7A 1TEVA 1ZYUA 3EUFA 5E4FA 5B36A 1T6XA 2QUHA 5THQA 3RRFA 1OZAA 2B1QA 2PR2A 2OO5C 2WTNA 8GPBA 5HS4A 4K03A 4RMIA 4Q01A 2FN7A 4WNAB 2ZE8A 2IHYA 4UHEA 4KB5A 4IGAA 1FC0A 1UJ5A 4FNOA 3Q5DA 3TUJC 2HXYA 3ZK7A 3R75A 5FWXB 3HKDB 2JH8A 5K8JB 2GFQA 2GJAA 1PW7A 1FFBA 3C7KA 4C2BA 1JU9A 4PYOA 3BGWA 4GRIA 3VGJA 2BOVA 4A3SA 3UMCA 2HX1A 4Z4QA 1U11A 3AERA 4O4IA 2Y2VA 3DW1X 1E9RA 1EFRA 2VWQA 2AVDA 5LFAA 3DZKA 5LKRA 4DA8A 1BRTA 1FRNA 1P74A 4KPUA 2RIPA 3LYHA 1BNCA 4BNXA 1QIDA 3QLEA 4DMHA 4PINA 1CUVA 4Z4GA 3L05A 1BHO1 1RHQA 1RJEA 4MO9A 4BQEA 3KQNA 3I9KA 4JB2A 1T4CB 4U39A 3ZHUA 2VYVD 1RHRA 1T2NA 2YJNA 1IBRA 2DBQA 1PS9A 2QUKA 3EG9B 4A6XA 4BN5A 4Z3KA 1TCUA 2ZUDA 2WF7A 5DM0A 1G21E 1L1RA 3QMWA 1X9IA 2Q5IA 4LSMA 4BNJA 3BWBA 3T3OA 4TGLA 221PA 3AF1A 1X7GA 3M8KA 1KETA 4LBWA 1U8CB 2ODBA 2OO5A 3IR6A 4MV4A 3TLYA 2CXOA 4RNCA 4QBTA 1GTJ1 2A9VA 3ZZ1A 1KJIA 5IAJA 2ZWAA 3QLUC 2PXCA 4PX9A 5ICFA 2WMYA 1EBUA 2ZWPA 1SIBE 3L7CA 4L6CA 5KMGB 5EIWA 5CJJA 4M0UA 1QXSA 1GUAA 1S2IA 3A70A 1KOJA 2J67A 4WJKB 1X2EA 3IKLA 5LD2C 3C5EA 2HLNA 1AV7A 1FYEA 1G6OA 3B3JA 2PD4A 4R4JA 3OJEA 5C7YA 3PR2B 1V2HE 4LOIA 4WVLA 3IX7A 3AVPA 3ABRB 1SXJB 1DIGA 2ABWA 2X8LA 1JE0A 2YWBA 1IVSA 3TOVA 5LJIA 1S3SA 4M3NA 2Q4TA 3NYQA 1TJ4A 2DWCA 1QONA 3PC6A 4LX0A 1R0YA 3F8TA 4BN4A 3CE6A 3DQPA 1FJHA 2H1VA 1XLUA 1YI8A 1KDTA 3C7AA 3CZAA 3MHPA 1B8PA 3N8KA 2G9NA 1ETHA 4QG7A 4QUJA 2POCA 3KOUA 3KJIA 5DCYA 1BOOA 3WV5A 1T8TA 1SRRA 2KW5A 1M2VA 5HR5A 1EXMA 1G20B 3N3AC 4OO3A 1VGRA 3DVRX 2JIZA 7GPBA 2YWXA 4OQQA 3LKVA 2XVAA 3TF5A 1O58A 1RIFA 2CKMA 2IEYA 2AMYA 3ESXA 1EDOA 2J9ZB 1PEDA 4GVPA 4PBRA 2AXEA 1W1UA 3CRW1 2WUVA 1OQAA 5FFFA 4DIKA 2R5NA 3ZXSA 1OCEA 4QUKA 4RJJA 1V25A 3IPCA 2QORA 4BV8A 2WDZA 5BOVA 1YS7A 3UHJA 4XD7D 4EY6A 1HFWA 3TNLA 1ZGGA 2D0OB 2ZJ8A 2L82A 3WG9A 4LY3A 2QB5A 4RDHA 3BDIA 3W5BA 4L28A 2MOKA 1SZCA 1QFZA 2B8WA 3QTTA 4UAGA 1DV2A 4WFIA 3ZLBA 3V1YA 2OV6A 3B5JA 3KM0A 4HFMA 4LRTB 4RFSB 3IDFA 3FVWA 3JARA 3LCJA 3OD5A 3JQGA 3TPZA 4WZZA 3X1DA 4A91A 1T6NA 2C4NA 3P0JA 1HV8A 2ATVA 1DTEA 1EK5A 1SCQA 2R87A 1OGYA 4L8LA 2AXQA 1S7CA 2FSUA 4XWKA 8ATCA 3Q7QA 4ZEWA 4YT5A 2JJQA 5EE5B 3U09A 4KRXA 1OFGA 1QMPA 3V4FA 4DCOA 2WT8A 5BUZA 4JR1A 4CF7A 3OUTA 3AP3A 3OZIA 4QQNA 4QBKA 4NK4A 3B70A 2QDKA 1MV5A 2AXNA 2QTFA 3IR7A 4O8ZA 3NAZA 3M6UA 5ALHA 1AN9A 3T9DA 4RUKA 5G0SA 3SX0A 2ZVJA 3G7SA 2YWJA 2F2TA 3L7DA 4AUMA 3TQQA 3JQQA 4Q3CA 2XKKA 4EQZA 2WKQA 1NULA 2ZE7A 4FFBB 4E2FA 3LQ1A 3TR6A 1G6KA 4US0R 2C2ZA 2YN2A 2RGUA 2H1CA 3HY4A 3RYIB 4EMTA 4PRZA 4YJGA 3AR3A 1TKCA 1Q1NA 2WHXA 1NXPA 3EZ7A 1QPZA 2W6NA 3R4VA 1RJGA 1IQRA 4N5DA 1GO2A 2QRLA 3FIUA 4NCIA 4ZCSA 1T9KA 2FMFA 2V7VA 4C4RA 3U1TA 1FFCA 1S8FA 4N7BA 2QL6A 2NV0A 4FMDB 2CL7X 3L4BC 1Y1TA 4ODIA 2QJWA 2ZVQX 1H3NA 3F5SA 1XMVA 2EJTA 2GR9A 5JLAA 1J0XO 5SZIA 4BJ5A 1J23A 4YT8A 2PBZA 1THMA 3IHLA 1ECPA 3ILSA 1RD4A 4EGAA 2CNOA 4KR6A 3P7MA 4BQQA 2Q5FA 3G13A 3QNUA 4KXUA 3ZH9B 5I45A 1M75A 3KQVA 1ZCBA 3TVDA 3R6DA 3A3OA 3PDCA 5D2CA 2CKDA 4PONA 1BS2A 4L27A 4BVHA 2YRFA 4UM7A 2C77A 3FJYA 1OXTA 4PQEA 4YRTA 1H65A 1W35A 4IQ0A 2YINC 1QFMA 2ZB8A 1OLSA 1QIEA 3TSWA 4JVLA 1UBHS 3VOBA 4ZCMA 5JAPA 4ZT7A 3I9OA 1OF1A 3T5CA 4ND2A 3N6XA 4KEAA 4XJSA 1OFIA 2FFHA 4V39A 1VLZA 4LJ6A 1LFDB 2WD9A 5FI0B 2C3YA 3H3XA 4Q4HB 4MUJA 4KLZA 2OZLB 3CE9A 2C3MA 3MUNA 4NECA 1IOZA 3IE0A 4JL6A 2C20A 3RQSA 1XVAA 1EFAA 1X7HA 1KSFX 4PSDA 3OOWA 2X6RA 3O7MA 1Y3IA 5LWHA 4YRCA 3FUCA 4H0NA 5CPBA 4BAGA 2YHAA 4IXNA 1ZD1A 3F1LA 2HEGA 1B0AA 3KE9A 4CTOA 3ZYZA 5A0TA 3MWEA 1XELA 2I80A 5FPTA 1KBOA 4NBSA 2I1LA 3KVNA 1R4MA 4B84A 3ZTWA 5C5IA 4M9UA 4O2RA 2BTOA 3I05A 4CIVA 1BN7A 1QH8B 1SXIA 2A0KA 2QVXX 1CR1A 1CUUA 1WB9A 3SC3A 5CCXA 4BVBA 1ZXLA 2P79A 5EEGA 4UNPA 4DIFA 4ENQA 2O57A 4ZT4A 4XDHA 3AO0B 4MKZA 2D2FA 4D9CA 4YMUA 4NV1A 4GI2A 3NALA 3L04A 1R8XA 1Z0SA 4KO2S 3PDIB 2QAJA 2QRZA 1LX6A 1L6IA 1ORIA 4HGOA 5K0GA 1XEXB 3V7FA 1TTHA 5FDFA 2QZSA 1A8IA 4O29A 2ISQA 4FIZA 1D2CA 1J0EA 2R6CA 3GR6A 3ZZMA 4UOEA 4X62B 3E4DA 2YBDA 4YN3A 4CDRA 1ZBDA 2A58A 1JKXA 4RACA 4M9QA 3NQ41 5LZ4A 2VXCA 3AK4A 3KR9A 4P92A 4CW7A 4RAQA 1RAFA 5DRTA 4OXYA 1A8QA 1ICEA 2NVUA 1KAQA 1KP9A 3B1WA 5G53C 3UG6A 4IRXA 1E3DA 1AN0A 1VKZA 4AECA 3GLHB 2DLNA 1U3VA 3K70B 2LRHA 2V7TA 3ZK9A 2YNMD 4DA0A 4EARA 1CUEA 3DUFB 1LPPA 3U1VA 5CDSA 5KQRA 2FFAA 5B4TA 3OCYA 4MWOA 1IBMB 2ZK7A 4X8LA 1IQPA 2HEIA 4KXVA 4PYKA 3ZY6A 4XWGA 4JC4A 4ZI7B 4FW9A 3QKRB 1MABA 5AUNB 4PC6A 3AKCA 1VLHA 4R83A 1RYEA 3GAFA 3BZBA 1W6RA 4QRHA 3THOA 2E3JA 1RZVA 2FY8A 2PLAA 3C3WA 3LSYA 1EB8A 2HLDD 4FE3A 1Q0TA 1M67A 5EKSA 1II0A 1IDN1 2OV4A 2ZI9A 3ZWDA 2J87A 3IXLA 3KHKA 3JRWA 2JIMA 4QYSA 4MROA 3D6MA 4Y6SA 3K71B 3BSWA 3OQ1A 2PSJA 2A5LA 3KUDA 1DADA 1GU0A 1T9DA 3QWHA 2QE7A 2WU1A 1PV1A 3OP1A 5EIAA 5JD6A 4X20B 3AFGA 3BEDA 4I66A 1D4FA 2O5VA 1HDYA 3DM9B 2YWHA 1DU4A 4UE6A 4CZ2A 4IH9A 4F5WA 1DC4A 3NKFA 2AJCA 5T4EA 2Q3JA 4OK3A 3D4NA 5FYQA 2AZXA 1SEPA 5AJXA 4U00A 4DA6A 2IZ6A 5FAKA 2IIQA 3V97A 3RAEC 4G26A 2OBXA 1Z4QA 2FP3A 4RPLA 5SZKB 4UNRA 5FWYA 3THXA 1XB2A 2H2IA 1JFSA 3P97A 4B3CA 2ECQA 3CEJA 2AG6A 5H68A 2J41A 1RWOA 4Z3DA 3O3MB 4E88A 5LP6B 1MOQA 4HTFA 5IDYA 4B73A 2J3JA 2QQ5A 3VYUB 5B6PA 3BGOS 4CNBA 1DL5A 3SX2A 2VUUA 5I7OA 1DAIA 2AMJA 4KI0A 1M2WA 3ER9A 3HP4A 3RKUA 4ARZB 2V7WA 3B7PA 4DUZB 1EVEA 3VDMA 5I01A 2A5DA 4OFBA 1U63A 4KDCA 1NR7A 3TCNA 1F8FA 3M4XA 3CVXA 1IM5A 1OV4A 1Q7TA 5A6SA 1X1TA 4ROSA 3D54D 4DLUA 2GPNA 3FH0A 5ALPA 3LGXA 3KKEA 4B85A 1UBKS 5FI3A 1E96A 5HKBA 3EIHA 3NAMA 4H0CA 1VMIA 1PVOA 2EZ4A 3COPA 4LS3A 3LCCA 3ZW9A 3I04M 1DCMA 1FS5A 4OYLA 4W8GA 4BNMA 3H42B 4D82A 4QU9A 4X1KB 3DE4X 4MPTA 3ZX5A 1EPUA 2QDXA 3PVSA 1Z0UA 1R4NA 2WDPA 3W4IA 2JGDA 2YY5A 4DYVA 4RVNA 5DMHA 2AFVA 1MEJA 2CLFB 2PGDA 2G0AA 2SECE 3ELYA 4BQPA 4DWOA 2O8BA 1EGQA 1Z5GA 3SE7A 2VK2A 2R7KA 4HEA1 4Z8YA 4OGWA 1QNFA 1RJWA 2IE0A 4C2UA 1Q6ZA 4F8EA 1OXMA 4Z51A 3N59A 1GTVA 1LEHA 3NUGA 1D6SA 3JYPA 5FV7A 4ZYUA 3OE7D 1MB2A 1Q16A 3O8DA 1DKMA 1NJ1A 1ZD5A 3B1VA 1L4UA 1RLOA 3PX3A 4BZXA 1IHDA 2A0YA 4IOKA 2BE9A 4HWOA 4G4SP 3S0JA 5DM60 3ADDA 1COWD 3GXOA 4AVYA 1Y89A 2H5JA 4GE3A 4MW1A 5DX0A 2WU0A 5K05A 1CQPA 1US8A 5BW4A 5CB4B 4A5SA 3FFBA 4BDSA 2EZTA 1FW6A 2AJDA 2MCFA 4DNFA 2QN8A 3I1JA 2O8VA 3E1SA 4A0GA 4CVNA 1G8PA 1LW7A 2HTFA 1TQ2A 1EG2A 2V8BA 1ZHFA 3JRNA 3KZNA 4KQWA 3L06A 4TWJA 1R0SA 5LXTF 3SFTA 3SIWA 3L93A 3QW2A 3DEIA 5IHXA 1IBKB 5LKAA 1LV7A 2PGXA 3A7DA 2YVQA 2O05A 3L0CA 3UXHA 3ZU5A 4HOYA 3ZWWA 2JI4A 1PGOA 2XB6A 3K7EA 4M0MA 1JX6A 3UMYA 2MSCB 5DTQA 2CY0A 3PNSA 2E18A 4JCCA 1FX1A 4W5NA 1XU9A 3I2FA 2Q21A 4O4LF 2Z2JA 2BRUA 1L7MA 1VE3A 3LF1A 1KSGA 3ZEIA 4BPBA 1O95A 1OVMA 4G5HA 3LIPA 1KZ1A 5TMBA 3TSZA 2H18A 1AKNA 2LZ0A 1BX3A 2VFAA 3DHVA 4CR8A 5JSKA 4P84A 3TFOA 3OBIA 5DBEX 1M2OA 2E89A 1LFAA 5FYDA 1KTIA 4WNAA 1O87A 4HDCA 2XCQA 1YS6A 3LX4A 2A4MA 2NNLD 1AQ6A 2QLNA 1JSCA 5HF5A 3RG2A 1TCBA 3KE8A 2GF2A 4K6GA 5G40A 3GLGA 1V2GA 2YFKA 1U6JA 5JSYA 2FZCA 4E31A 2IVZA 1M5TA 3ICWA 4L16A 1CB0A 5D5QA 2MSNA 2C88A 3GYGA 3E1GA 1VPLA 4JXZA 3VVCA 2G63A 3UJBA 2C2KA 3UK2A 2HNKA 3R0ZA 1ENOA 5J4LA 3R7AA 1CF4A 2YIDA 1UKVY 2B0JA 2PH5A 2QTZA 4MQLA 4RIFA 1BE8A 3R6LA 3QWIA 3MQ2A 4OXRA 4Y9RA 2IU4A 1WS6A 2B92A 3DMNA 4UEOA 4I2VA 2YKGA 1YOBA 3Q0TA 3T5AA 3KXDA 1CR4A 2RC6A 1P80A 1G7SA 5KX5F 1T5TA 3Q5EA 4JXXA 3U3ZA 2IX3A 2VP9A 3HV2A 1SUSA 3FOZA 1Y9DA 1YBMA 2ERYA 3SC2B 2WILA 1UXKA 5AUOB 1QS0A 4HXFB 4FYXA 3UPDA 2QSJA 1UIRA 1XMXA 3JSAA 4OGFA 5EUBA 3WIOA 3ZNQA 1TADA 3BTSA 1ZZGA 4IUYA 1D7AA 3Q5GA 1NWCA 3MWLA 4ZT3A 3GW8A 4LGCA 5JFOA 2WZCA 4XIJA 3CNLA 1FLDA 2OFPA 4YT4A 5LWQA 1RI4A 2EL7A 1SCBA 1HEYA 1TDJA 1UANA 2VBGA 3EDMA 4ZAGA 4F84A 1R6XA 3EEFA 2VQFB 1J2YA 3MMZA 4JD5A 1TK3A 1YR1A 4LHZA 3WGHA 1VLVA 4BEBA 4E30A 1ZOPA 1GPMA 4FGKA 4RNDB 2PJZA 3V4ZA 3F3KA 2Q4BA 2WHYA 2P4SA 5ALLA 5FPPA 4CHGA 5AW0A 3DZHA 4AJIA 2X9LA 3EA0A 1GR1A 2I7TA 4ABYA 3T7KA 2X19A 3AVYA 1PD0A 1MX9A 3A6HA 3H6HA 5FNZA 3TLCA 2QL7A 4GBJA 4HB4A 2ZQ5A 4M1SA 1DHTA 2PTGA 2B34A 2GVDC 3VDXA 1RLTA 3EXIA 2W90A 3S1AB 3SDBA 4YONB 5AVUA 4A2PA 1IWBB 1EM6A 3DBOB 1W88B 1CJSA 2NAPA 4RKWA 2IPLA 4D4HA 1EUCB 1MGOA 1QYDA 4FS3A 4MR8A 4U7PB 4OHPA 3DFFA 4O2AF 1SXJC 1AXGA 3OJ0A 5FOUA 2PSDA 2PBFA 1PEAA 4YRBA 3SNKA 1UZAA 3IH5A 2N75A 5KTPA 3DEJA 2P2CA 5T41A 1SG0A 4CODB 4JEUA 4CV2A 1KOGA 1G291 7ADHA 2ZYGA 4ZT6A 3ZHOA 3TLBA 3NHMA 1JZSA 1A5BB 1VJ0A 2Q8QA 4H3SA 4QOHA 1K98A 2BM8A 4PLHA 3L7JA 3AVUA 1ZM3A 4L75A 1RAAA 1Y5RA 4JSTA 4MWSA 3TSCA 1H9BA 4NBKA 1Z8FA 3IP6A 4E6EA 3WNBA 2VYQA 1P5HA 1JWBB 1UM9A 2A92A 4HXEB 4PQGA 3WRXC 5E7IA 2YHIA 4DLZA 1D0VA 1G38A 1KYVA 2CDRA 3M3HA 4CKZA 1FFSA 5HF9A 5CFNA 3T06B 5AI5A 8MHTA 2J3MA 4EOGA 3ETHA 2FF7A 1QVWA 4UAVA 3B2EA 1LKZA 3P5SA 1P7YA 1T9AA 3SFZA 1PJ8A 1E92A 3SHVA 2ZBDA 2O8FB 3F8SA 5T4HA 4PTLA 1BU5A 2GEUA 4CKEB 2BEUA 2GCOA 4K40A 4MV0A 1WCV1 3KQLA 1RMYA 4BRZA 2Q8NA 4LE1A 3S1AA 1JHVA 1N9KA 1BCRB 2I67A 2C7VA 1XTRA 2MYPA 2XUIA 1DAOA 1XXHB 1Z7BA 2B5OA 4EX7A 1Q0SA 1AGNA 5JSZA 3RC3A 1TZMA 2BSXA 2QMZA 4W9NC 4LXUA 3TZQA 3B36A 5KYXA 4UFOA 1NX9A 4R1SA 4JSRA 1G5IA 1RKXA 3N53A 4RY9A 1RXUA 1P3DA 1PNQA 1Y4UA 3HCBA 4DVGA 4S1TA 3U4IA 5FI1B 5KQMA 1O94C 2EF1A 5FCDA 4U7GA 4IVPA 2CB9A 2X4GA 1E6LA 5KAMA 8ADHA 4XRGA 4Y6RA 5C52B 1YS2X 5M7EA 2W0MA 1GA6A 1NBAA 1JJBA 1QIJA 4FWIB 4ZVRA 3EVCA 5I7HA 3LX6A 5K3AA 2VJYA 4LRYA 4RL6A 3K4QA 1JFFB 4B43A 2AN4A 4JUFA 3CR7A 3RVPA 3G2MA 4JU9A 4M2LA 1NIJA 5EMJA 2JCYA 5LP6C 1U90A 4TV8A 3QXJA 3U17A 2ZIXB 3CIFA 5CVUA 1EVZA 4S12A 5DIZA 5EXEA 2OZEA 5D8DA 4C0LA 2LD4A 3NV7A 3C6YA 4E5VA 2XWJI 3G1TA 3BK7A 1PR5A 1N8NA 2WFZA 3NT2A 4CLRB 2OY0A 1WHSA 4D3FA 4QNRA 1NMZA 4FFPA 4J0HA 1ZK2A 5I7FA 1Y4AE 4DBLE 4CGZA 2OL4A 2ZI6A 4HGPA 3OEEA 4PPGA 5JJLA 3IUBA 1FP4A 2G04A 3OUUA 1P19A 2H5EA 3ON5A 4N3NA 2QTNA 4B8YA 1ZMRA 1W47A 3M70A 2OWDA 4HLUC 4IV8A 1GAWA 3IQWA 3HKDA 3SMQA 3WAGA 3ZZ0A 4W9MC 3BIJA 1Z5ZA 2EG5A 5BN5A 2IHJA 4M1MA 3T5PA 1CY7A 1GLNA 1J0BA 1NJSA 1TKAA 3A1WA 3D3NA 3OZXA 4GDMA 4EB3A 3LKBA 4EFMA 5A4FS 4TKZA 1RACA 2ZI3A 3EIFA 4IICA 2JW5A 4RTQA 2NP6A 3HVIA 1FUIA 3OZRA 1RXIA 4G8DA 4DA7A 1BOFA 2BZSA 1M7BA 3ZDRA 1D9XA 3DNMA 3WOHA 4X9XA 5DM4A 1PGJA 4J7XA 4Q82A 4XZ3A 3V34A 3ZDXB 3HBAA 3ZWYA 2PUEA 4W6ZA 4JUBA 2O3JA 3LM8A 4KV7A 1UR5A 1ZJ6A 1MORA 2C82A 4D46A 1ZGBA 2AL7A 4OHOA 3UXMA 4NK5A 2XTZA 1XT6A 3S2SA 3GFVA 3GLHE 3IMFA 5JVDB 3P9NA 1M73E 1UPBA 1MQSA 1T26A 2VDKB 2SKDA 3NEYA 5ECYA 1KDOA 5ES3A 3CEHA 4HP8A 5A4KA 1CEYA 1ZCZA 4KLRA 3ZJVA 2ZZKA 5EP2A 4JBLA 1WMDA 1YRQA 3GT4A 3OTOB 4CEJA 3ORYA 3QJGA 2WVAA 1WF6A 2K4MA 5C4GB 1I4DD 1M1ZA 4RH3A 4KSBA 2UZ1B 3THRA 3OM9A 4K2HA 2Q4OA 4DCPA 2W58A 4A15A 3MTJA 3MJCA 3T9EA 4FNAA 4KIWA 4O1HA 1T4MA 3DJYA 4NY1A 3NDBB 3EMDA 3ZCTA 1K5DA 4INOA 1Z4JA 1HE3A 2DKNA 3I6BA 5T3YA 3W04A 4QKQA 1AMUA 4ZV4A 3TLMA 4Q9IA 2VEOA 2N0SA 1DOHA 4LK3A 3NGXA