2FHPA

Crystal structure of putative methylase from enterococcus faecalis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
183
structure length
183
Chain Sequence
b'AMRVISGEYGGRRLKALDGDNTRPTTDKVKESIFNMIGPYFDGGMALDLYSGSGGLAIEAVSRGMDKSICIEKNFAALKVIKENIAITKEPEKFEVRKMDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKMLERQLLTNEAVIVCETDKTVKLPETIGTLKKTRETVYGITQVTIYRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methylase, putative
molecule tags Structural genomics, unknown function
source organism Enterococcus faecalis
publication title Crystal Structure of Putative Methylase from Enterococcus faecalis
rcsb
total genus 57
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fhpA00
3M4XA 4RTRA 1QYRA 4X63A 3M6UA 4V0QA 1XDZA 3NJRA 3P9KA 5ICCA 4FS8A 1XDUA 1ZGAA 1RJDA 3PTAA 2H1RA 3PS9A 3FTEA 3B3GA 3IV6A 3KQVA 2ZZKA 5EEGA 2CKDA 5EMMA 4E30A 1OR8A 2CL5A 1MJFA 2B9EA 2ZFUA 5DXJA 2QE6A 3GRVA 3P9NA 2ZCJA 3LKDA 5FTWA 4RVFA 2AOWA 2CMGA 3KQSA 4F86A 2FRXA 1I4WA 1X1DA 4GBED 4RTLA 2G72A 2DULA 5CVVA 2NXNA 2P3QA 1JTFA 5BW4A 5ICGA 1WZNA 2PXCA 2HR1A 3SXJA 4PCLA 3T7RA 2DPMA 4E2YA 3EMDA 2UZ4A 4QQNA 4RTQA 3THSA 2Z6AA 3FPHA 5DM4A 2O0LA 2XYRA 3CGGA 2A14A 4BLWA 7MHTA 3G8AA 5HIIA 1YFJA 3GWZA 1EAMA 5BP7A 3HNRA 4EK9A 2BH2A 2PXXA 3FPEA 3GO4A 4RX1A 1ZKDA 3GXOA 5DXAA 5GWXA 1VLMA 3KKZA 3DP7A 1M6YA 2Y1WA 2B25A 4E31A 2GH1A 5DRYA 4GOND 3A26A 1Q0TA 2PY6A 4PYKA 4YUZA 4ER6A 2O05A 1EIZA 3LHDA 3EVFA 3H2BA 5KQSA 2GLUA 3AWIA 2IH4A 2YXLA 5EEHA 1N7IA 3PLAE 4R8SA 3SGLA 1AQIA 3G5LA 2NYUA 3ANXA 5DT2A 3LGAA 5HFJA 1G60A 4M7RA 2AOTB 2ZVJA 1WS6A 1Q0SA 3FUXA 2V7EA 4CKEA 4GC9A 3DMHA 2ZULA 1R8XA 2HV9A 2YR0A 3HA3A 4FSXA 2ZWVA 4ER7A 5DX8A 2ONYA 5LQRA 4DF3A 1F38A 2P35A 3E7PA 2B3TA 3KPJA 5K0EA 5E8JA 1KIAA 1VE3A 4CTKA 4E2WA 3NDIA 3UJCA 2PWPA 3EEYA 1F3LA 4RVGA 2B2CA 2PV0A 3OZRA 2FPOA 2O06A 5CIYA 3C6MA 5E2AA 4GF5A 2IDJA 1YB2A 2XYQA 3OE5A 5FWAA 3UA3A 1FP1D 3MERA 3MGGA 3WSTA 5CCXA 10MHA 2YX1A 5M5BA 3HCAA 3MTIA 4A6EA 3P2EA 5DTMA 5K0FA 1N7JA 1AQJA 3R24A 4OX9Y 4AZVA 4O29A 4E2XA 5EC8A 5F2KA 2I6GA 4P7FA 1JQ3A 4WVLA 5EIWA 3EMBA 4QVKA 1L3BA 5DTQA 1NE2A 5GIOE 1EG2A 3SX0A 3VC2A 3GRRA 4FT4A 1BOOA 2ZIFA 4DQ0A 3FYDA 1XCJA 2CMHA 4OQEA 5EMLA 3NVKI 5EOVA 4RTNA 4RVHA 5CVJA 4NECA 2PVCA 3V97A 1O54A 3LL7A 1XDSA 5DWQA 2ZLBA 5DM2A 1M0EA 3DXYA 1ZHFA 2NXEA 2XVAA 3JWHA 3NWEA 5E9QA 5E9JA 4GOLD 4HGYA 1TW3A 2OBFA 1X1AA 2BR5A 1R74A 5LQJA 4RTSA 1RI4A 3BWYA 2OZVA 2VP3A 1NW7A 2PX5A 2QM3A 3ELDA 3LDFA 3OE4A 3UJ7A 5JUWA 3GRUA 4PINA 3NMUF 5EHIA 3JWJA 1X19A 4QPNA 1SG9A 3P2KA 2OY0A 4PYLA 3C6KA 4U7TB 5D1HA 3DMGA 3IYLW 5FHRA 1VPTA 3OCJA 3FPFA 3MQ2A 4RTMA 2JHAA 4P7KA 4LWOA 4DCGA 2NP7A 1EJ6A 3FUVA 3LCCA 5C0OE 5K01A 3DLCA 1G8SA 4FR0A 3K6RA 5CM2Z 3G2QA 3GNLA 3AXTA 4RTKA 2H00A 4B17A 4R6WA 4RTJA 2ZIGA 1D2CA 3B5IA 4KVZA 1JR4A 1QZZA 1ZG3A 2YXEA 3C3YA 4M38A 3P71T 2O07A 2JG3A 4LWPA 3NVMB 3SSNA 3MHTA 2AOVA 3DXZA 1KHHA 3VSEA 2EX4A 3KHKA 2P3OA 4X60A 5B1SA 3GIWA 4BLVA 2FK7A 3GRYA 3EGIA 3IEIA 3SMQA 2ZBPA 5CVEA 4PYOA 1ORHA 2XVMA 4AZWA 2BR3A 5F2NA 3TR6A 1L3CA 1NT2A 2V74B 2QRVB 3E8SA 3PFHA 2C7QA 4HTFB 3TM5A 4QTUB 5EHGA 5U4XA 4OBWA 3HVHA 3HCEA 4PCAA 1VL5A 2IP2A 3FPJA 5EIFA 5K0BA 3R9XB 3I53A 4R8RA 1NW8A 4HC4A 5E8RA 1NKVA 3TKYA 5DPMA 1NW5A 2Y1XA 3G8BA 4E2ZA 4QDJA 2HTEA 3LDGA 2AVDA 1D2GA 3HCBA 3LBFA 5LR6A 1O9GA 3FRHA 2P40A 3BGIA 1FP2A 1X1BA 3B89A 3GGDA 2IDKA 3A7DA 3O31A 3M6VA 3PT9A 4P7JA 2OB1A 2PT6A 3HCFA 1D2HA 1YUBA 3R3HA 1WXWA 5ERGB 2GPYA 3UWPA 3OFJA 1N2XA 4GUAA 5GOZA 4Z2YA 3KPWA 3R6TA 4KIGA 3LSTA 2FYTA 2IBSA 3JWIA 2YQZA 3HP7A 4RYLA 1BHJA 2FHPA 1JG2A 5HEKA 2P3LA 1KXZA 5DSXA 3UJAA 4YMHA 2G71A 1NV9A 3SSOA 4M37A 3EGVA 5T64A 3SSMA 3M33A 1KR5A 2NXCA 5DM0A 4MIKA 3FYCA 4X1OA 4KRGA 2ZZMA 4QPPA 2IH2A 3TRKA 3EEOA 4RWZA 3HCCA 2AN4A 4PONA 4X41A 5LQCA 1XJ5A 3C3PA 2LD4A 3E23A 3HEMA 1JG1A 2QY6A 1RI1A 5P8WA 3ER8A 1QAOA 4R05A 4C06A 5LSAA 5GM2A 5C9ZA 3MTEA 1BC5A 3B7PA 3BKXA 4Y30A 3I9FA 4ZTBA 3DMFA 2P8JA 1T43A 3GDHA 5E2BA 3EVBA 3G88A 3NW9A 2AN5A 3Q87B 2HNKA 5K0NA 4ER3A 4K6MA 3Q7EA 5FUBA 5DSTA 3PFGA 2ZBRA 3OU6A 3A25A 3EVAA 4M36A 4P7GA 5EMKA 5KYGA 1EQAA 3AJDA 2VZ9A 3R0QA 4XUEA 3ELUA 3FTFA 3DXXA 4EMSA 3LCVB 3ORHA 5CVUA 2VDUE 3UJ8A 2PT9A 4V0RA 4PNEA 1ORIA 1HMYA 3G2MA 3K0BA 2PJDA 3KR2A 3SR4A 3LPMA 2Q41A 3MB5A 5EKUA 1JG4A 1XXLA 3KR0A 3GCZA 3D2LA 4IV8A 3KQPA 1VIDA 4H0NA 2GB4A 4DA4A 4UOEA 5EMJA 2BZGA 4E32A 1RJFA 2ZW9A 1NBIA 5CUQA 2G1PA 1PRYA 2N47A 1Z3CA 1G55A 4OQDA 1FJXA 4E70A 4YUVA 3UBTA 3G7UA 5K0LA 3CKKA 2VDVE 3U81A 2IBTA 2OO3A 3ELYA 3FUUA 5T6BA 1UWVA 4AX8A 2C7PA 3NDJA 3OFKA 2XYVA 3LX6A 2P7HA 2PLWA 3KPYA 4EKIA 3OZTA 3P97A 3V8VA 1JSZA 2NNWB 3I5UA 3OU2A 4HGZA 3CJQA 2B78A 4RVDA 3A27A 4YV0A 3LBYA 3TLJA 3ER9A 4HH4A 1WY7A 4DCMA 3THRA 2ZWAA 1QANA 3CJRA 4ISCA 1DCTA 2ADMA 4BY9E 1NV8A 5DTRA 1YFLA 1JQEA 1INLA 5FULA 4MHTA 3BT7A 5GM1A 4P58A 5DX1A 3I64A 5DX0A 5G02A 4DZRA 5K0CA 3DOUA 3M6XA 3HVJA 4QVGA 4PWYA 3KQMA 4X61A 4YUWA 5LQNA 1KP9A 3ELWA 2UYOA 2OXTA 2F8LA 1NBHA 4HG2A 5K03A 3KQOA 3RW9A 2I7CA 2ZSUA 2NXJA 5FQNA 1O9HA 1L3IA 1L1EA 5GIPE 2GAFA 2IIPA 4OA5A 3REOA 1TW2A 3UFBA 2JH8A 4QTTB 4HRAA 1X1CA 3OU7A 3L8DA 1AF7A 1NW6A 1RI3A 3CVOA 3EPPA 3UA4A 1G38A 4GOMD 4Y2HA 4RSRA 2PKWA 3MCZA 3BUSA 4BP1A 5H02A 5K0JA 3M70A 4A6DA 1P1BA 1IM8A 5ICFA 5DLYA 3DUWA 3DR5A 4FGZA 1SQFA 3EVCA 3FUTA 1ZQ9A 3KQQA 3F4KA 1I1NA 2PX2A 3TPZA 3C0KA 3LCUA 2E5WA 3M6WA 3PVCA 4ER0A 4PYQA 1DL5A 2AOUA 2BM9A 3PX2A 4CKBA 4CXMA 4XUCA 1PJZA 2VS1A 3KR1A 3P9IA 2ERCA 4OA8A 3T7SA 1UFKA 3MAGA 4U7PB 5GP1A 3EVGA 4DM3A 8MHTA 3FUWA 3FRIA 3KPVA 2ZZNA 1ZGJA 4MTLA 2AN3A 3SM3A 1P91A 5CVDA 3AXSA 2ONZA 4ER5A 2BM8A 2H11A 2IPXA 1SQGA 3FPGA 3IHTA 5DRTA 3JWGA 4XCXA 4MWZA 1V39A 4RTOA 2AOUB 2QYOA 4PYJA 2IH5A 4KW7A 4PGHA 5D1NA 2JH9A 1KPGA 3KR9A 2G8NA 3EGEA 4XUDA 3ERCA 2WA1A 1KPIA 3NTVA 5E9WA 2I62A 1RI2A 4YMGA 4PYIA 4LG1A 3TMAA 1KYWA 4CWAA 9MHTA 1WXXA 3P8ZA 3KQYA 5FA5A 4PGGA 3GJYA 1U2ZA 3BGVA 1UIRA 3T0IA 3G2PA 1VBFA 1YZHA 3X0DA 1RJEA 2PSSA 5BW5A 2R3SA 3PX3A 4L7VA 1VQ1A 1RI5A 2PXAA 1XTPA 3I58A 4KWCA 3UZUA 2PX8A 3HCDA 1SKMA 3RIEA 1FPQA 2KW5A 2ZTHA 3DTNA 2C7RA 4IV0A 4HSGA 1HNNA 5HILA 1I9GA 3UJBA 4AZSA 4GOOD 4LECA 5K0GA 4RTPA 2Z6QA 3TFWA 5DM1A 3CCFA 4PYMA 3G89A 2K4MA 2YUIA 4DKJA 5HIJA 4HTFA 5K09A 1XVAA 3G2OA 1YF3A 1P39A 2EJUA 1P1CA 3VC1A 4AZTA 4FZVA 2FK8A 2P7IA 5ICEA 4ATNA 1VP3A 3SVZA 2QRVA 5IKMA 1JTEA 3BWMA 1IY9A 1Y8CA 3UJDA 3TKAA 4PYNA 3UJ9A 2WA2A 1TPYA 5EZSA 1BKYA 2YTZA 5E1DA 4DMGA 5KQRA 4C08A 3HM2A 2ZBQA 3HA5A 2OPBA 4PIMA 4FT2A 5CD1A 4C05A 1SVUA 4F85A 2Z6UA 2OKCA 2GS9A 5FHQA 4C4AA 3CJTA 5T67A 5K05A 3B3JA 5CCBA 3TM4A 3KPUA 4GEKA 3B3FA 5E1BA 5FQOA 5LQAA 5HOQA 1AV6A 1FBNA 1JQDA 3HA7A 5FCDA 3PB3A 1NW3A 1KPHA 3BZBA 3BKWA 1R18A 3QOWA 5EG5A 2P1DA 2C7OA 3TQSA 5HZMA 2ESRA 4KIFA 2HMYB 2ZIEA 3LDUA 5EGSA 4FSDA 2GA9A 5KVAA 4RV9A 4QDKA 3EVZA 4EKGA 4G56A 2OB2A 4POOA 3VYWA 2YXDA 4R6XA 3DLIA 4FP9A 3NWBA 2YVLA 1R00A 2EG5A 2O57A 3HVKA 1SUSA 1L9KA 3QV2A 4GQBA 3HVIA 3BWBA 1B42A 1QAMA 3OPNA 5FWDA 4BP3A 2PGXA 2JJQA 3T7TA 2ORED 2OYRA 4CTJA 4YUYA 5LQUA 5GINE 3FTCA 5FA8A 3DH0A 1EJ0A 2UYCA 2AOXA 3BXOA 5BXYA 4IKPA 1IXKA 3FTDA 4IWNA 4KDRA 3AY0A 4OBXA 1JSXA 2AVNA 2IGTA 1SUIA 2P41A 5EVJA 3KQWA 1H1DA 2JHPA 1YZ3A 2IFTA 1QAQA 3FZGA 4EVIA 3ME5A 1DUSA 3GU3A 1WG8A 3OZSA 3UJ6A 4BLUA 3G5TA 5EKXA 2I9KA 1VP9A 3CC8A 4WXHA 4EQZA 2XBMA 2UYQA 1MHTA 2UYHA 2PWYA 4YV2A 2EJTA 2AR0A 3EVEA 4JXJA 5EPEA 5C1IA 4C07A 4C03A 4F84A 2G70A 2NP6A 3O4FA 5EQJB 4YV1A 2AS0A 3EVDA 1R6AA 2WK1A 3MCTA 1RJGA 1R8YA 4GC5A 4PIPA 3BGDA 5JR3A 5KS2A 3A4TA 2AOTA 5LQKA 1M6EX 3ID6C 3LECA 1JG3A 4KDCA 3O7WA 2CWWA 5K8VA 4MQ4A 1G8AA 3DULA 3P9CA 5FADA 5E1OA 3CBGA 3RODA 2PBFA 2VDWA 2FCAA 3A7EA 5IH3A 1G6Q1 3S68A 4YUXA 2R6ZA 4E33A 5HIMA 1KYZA 2BR4A 3E05A 3KQTA 5E1MA 5MHTA 4QQKA 1XCLA 5EZQA 5F2OA 3GRZA 5HIKA 4AUKA 2AZTA 3BWCA 3HTXA 2PX4A 3QOXA 2EFJA 3TOSA 3LKZA 3P2IA 3KU1A 4C04A 2HWKA 4CKCA 2JHCA
chains in the Genus database with same CATH superfamily
2WD8A 4C14A 1L5VA 1VYUA 3JSAA 2VDKB 1RZVA 4EJ0A 1QP4A 3T35A 1IBKB 1O95A 1A9RA 2FMHA 4WZBE 3ZLVA 1V8ZA 3IV6A 4HDOB 3IEPA 4GLOA 4CMCA 1WB9A 4IDCA 2ZS8A 2ZCJA 4WHMA 2Q6IA 2WKQA 4I9GA 1LVUA 2R7MA 3HHEA 1H1LA 5JSKA 3T7AA 4RK7A 1LBIA 1CB0A 1NZFA 1H6CA 1YDEA 2IHZA 3E4DA 1PJAA 2VNKA 4V39A 1ZCZA 4Q5IA 5GONB 2YHUA 3IJPA 4PZCA 1MIHA 1ZRMA 2R8OA 3IBGA 2I1VB 2ATXA 4I7EA 4JZKA 3VU9A 2YWBA 5BO5A 1C7QA 2WSYB 1GPLA 1DAFA 4LF5B 3C8HA 3MUNA 2H0AA 5A4JA 1QFYA 3FPHA 3A58B 4FDMA 4DY6A 1AS2A 3TL2A 3MUFA 2QD5A 4MK4A 3HU2A 1L5ZA 1QP8A 1V3UA 2CBXA 3ZDAA 2ZIXA 3OZAA 4Y0AA 4UTOA 1P0QA 2H4YA 4X20A 5LP1A 3DL4A 1JR3E 3CH6A 2ECFA 2DUMA 3AOEA 4MVJF 3T7IA 5LPNA 4OAOA 5C32A 3KKZA 4DIEA 1XTSA 3FMFA 4QGSA 3KO8A 5EJEA 1R0ZA 2QYTA 3GJSA 2Y4NA 1TK3A 4G0MA 4WXMA 4Z4CA 3FPBA 2GH1A 1DV1A 2IHTA 2ZRFA 2HQRA 3MWGA 4L4UA 4S1WA 4RVSA 5HCIA 1ID8A 2XCTB 2XE6A 1F2UA 1Y63A 2FWAA 2FUG1 3NETA 3V7YA 2HQBA 2H2AA 3Q10A 1AD2A 2CUZA 5FOTA 5A4KA 1RYYA 4PBSA 2KLBA 2ATIA 3JVIA 4JQZA 1D5WA 1N6IA 5SYMA 4RACA 4OHYA 1QLWA 2F43B 3IVCA 1NYLA 1DQSA 2C95A 3QWHA 4G41A 1BCSB 5BN4B 5CCDA 4JUIA 3GOHA 3U7EB 1E2KA 1U2EA 1PR4A 4D74A 4DCCA 3ND8A 2Q2VA 1VJ0A 2OVFA 3EEFA 2IP4A 2ZJ0A 4ND8A 5EUQB 5TV2A 4KN8A 1ZC3A 2GSDA 4BNIA 1Y1KE 2VC2B 3WNQA 1QRAA 1U8CB 4TYMA 4ZCMA 1NE7A 3UW3A 2XKKA 1NJ1A 1CLEA 2PUWA 2AZMA 3H17A 2WG0A 5KNBA 5ISMA 3PXGA 2I3DA 4GI1A 5K3AA 4PVDA 4FN4A 4UCXA 4PFSA 2WTMA 5TQ0A 721PA 10MHA 1BCRB 1JE0A 1IC6A 4RJJA 5F1OA 3VNBA 1RAHA 2GPTA 1NF3A 3VDMA 2BKLA 4OX9Y 4E2XA 1ESEA 1GL7A 2M32A 1KAMA 3DKVA 5EIWA 3JAWB 2KJQA 3TSWA 5B4UA 2PZAA 3TJZA 3EYWA 4WN9A 4R98A 4XVHA 3EZFA 2OHIA 2W8ZA 3J80A 1FYEA 2NU7A 3ZNPA 3RBZA 4D5EA 5CVJA 3F7OA 1ODSA 1VGVA 1O54A 2O2JA 1OMOA 3B9PA 3OCCA 4IG9A 2OZKA 3C8MA 3D9QX 4X7RA 5NULA 3S1AB 4QT4A 3JZDA 1ETUA 3X1MA 4FD2A 1XI2A 2D8AA 2XVAA 4ZYTA 2DXIA 1G20B 2EDCA 4KPFC 1WZCA 2PCLA 4RTSA 4BLRA 4UJ5A 4WZZA 4MHOA 1JEEA 3FFTA 2BFDB 3HB1A 3QVGA 4XEHA 1UBLS 1ZD3A 2IPNA 2CW5A 3QHQA 1Z6AA 3NMUF 5DM60 3C48A 5JS6A 3L0IB 4JODA 2OQ2A 4EGCB 1U8EA 1YUNA 4FM9A 1P72A 1CPYA 1UPUA 4REOA 1N5OX 2AG8A 3OVMA 4L75A 1YL5A 2NP7A 1Z12A 1EX7A 2IF2A 4DM7A 1R0YA 1THGA 4TSFA 5LZ7A 4EDHA 3QYFA 5K01A 1V48A 1CC1S 1QIKA 3WADA 4I4CA 1UKAA 1UPXA 3V1KA 1JI0A 1HYBA 1FDRA 4KO4S 3WBBA 2OORC 4ICIA 3IP6A 2TMKA 1SA0A 1IBRA 4GMFA 3RS2A 3MPUA 2G1AA 4YRBA 2RGYA 3JQ9C 1OD6A 4I99A 3DE7X 3DXZA 3PFFA 3ZH2A 4NL4H 2PR2A 3AR9A 4JU8A 1YRHA 5JD6A 3AVUA 3U7RA 2Q5IA 4LC0A 2PBRA 1P7WA 2VYQA 3AETB 1TCVA 2RHRA 2HQSA 3L01A 4DNXA 3CUEF 4QFCA 1WDMA 2CXSA 3PFHA 2IYOA 1H1TA 4Q16A 3I45A 2C88A 5KNCD 3I9V6 1WA5A 3H1GA 2ZRBA 2VZ8A 4JQSA 4CMEC 1WDKA 3LXMA 3OPMA 2HQOA 3SX2A 3HB4X 2JJMA 1N9GA 3TIFA 2EHJA 2PKYX 3CTPA 3Q40A 4HS4A 4B9EA 2H0QA 5CXUA 3WZ2A 3FCUB 4MW2A 3D4IA 1ZCFA 2AVDA 4X1IB 3ROQA 1O9GA 4XD2A 1ZR2A 3RH0A 1EZZA 1JX6A 3A05A 1QK4A 2M6KA 4KN5A 5HBGA 1D2HA 3HWRA 3KZOA 4GMKA 3AX6A 4LYDA 4Q4AB 4OHCA 4MA5A 1I2BA 2JZNA 2B5OA 2FTKE 1LTHR 1E99A 3NH6A 4ROSA 3ZI0A 2RDMA 1SO8A 1T1GA 2FYTA 2JLAA 3AV3A 1MB2A 2FHPA 4KGDA 1FS6A 2GM9A 3VMMA 1A4RA 1L5SA 4X93A 3V3TA 2VDPB 2JJ1D 2Q5OA 2ZSKA 1NQXA 3Q6MA 3LOUA 1JDZA 1OW3B 5F5NA 2PSEA 4ZJYA 4ZVKA 2QX7A 1WVGA 3GLHE 4RLSA 5DM0A 3U4GA 4DYHA 3EXAA 3FYTA 1ZN9A 4QPPA 3EEOA 1OIXA 2VDQB 5IFLA 2AN4A 4GBJA 5BMOA 1WQ1R 1L4BA 2VLBA 4GL4A 3C3PA 3H18A 3IPCA 1GU7A 1RI1A 2B83A 1K7SN 5I9MA 5LBUA 4UOEA 2BGLA 2X8AA 4P08A 3KUXA 4B3HA 1RYHA 2YV4A 4C2BA 1HE3A 5HS4A 4DG5A 3HG7A 2WP0A 3TLGA 1WB6A 3U9LA 4DLPA 1OXXK 3KSAC 3FNFA 1R10A 1N2OA 3GJ3A 4MUEA 2FFBA 3PFGA 3VR2D 2EZTA 3G13A 4HADA 3C4JA 4R1UA 1EQAA 4C1NA 1Z28A 3Q9SA 3DXXA 1THZA 2ZWIA 3EZ6A 1ZI9A 4RL4A 2VH5R 1BN7A 1SQ6A 3NWJA 5CVUA 4D2IA 2NT3A 5JU6A 3MXTA 3TBFA 3EEQA 5DH9A 2WSBA 2Q41A 4M86A 5BV2P 4TRMA 2B4TO 2I65A 3AKCA 4H77A 3HNPA 2EFEB 4E14A 2HO5A 4ZAFA 4Q82A 2GZSA 2HA3A 3GLIE 3UT0A 3UWOA 1CUZA 3EDMA 2VOJA 3VI4B 3DZGA 4ZAGA 2QV7A 5BSHA 1FNMA 1G55A 2EBHX 2W8BB 3EJWA 4Q4JA 1DU4A 3RK1A 1X1RA 1RQPA 4P3YA 3V2IA 4O1MA 4WERA 1AZTA 3VJRA 4QOHA 4ERXA 4DLNA 1NF2A 4KFSA 3RU2A 3T7EA 1P1HA 2NZYA 3ILSA 3H6GA 5TSDA 4QLBA 1WVIA 1QV9A 1VTKA 1FQJA 1N1EA 2PLWA 2WU3A 2X9GA 3BMOB 2QE7A 3H5IA 3L18A 4I4TB 4OHXA 2D4AA 3EIWA 4CDNA 5KTKA 4NXMB 2P6MA 4IFTA 5MN4A 1ZN8A 3U4AA 2PKEA 1A82A 3VU1A 4E6PA 5BQXA 2CUKA 5BV8A 2ERXA 3VZSA 3UENA 3FMPB 3ONFA 4ISCA 3U6BA 4GVPA 1MC1A 1K75A 2W4IA 2P0EA 3WLKX 4ECEA 4P58A 5DLDA 3WHIA 4RZIA 1V3QE 3BK2A 2I2FA 3D8TA 4WLOA 4O25A 2GCOA 3THXA 3ELWA 3R5FA 3HYSA 1NBHA 3LKBA 2W9XA 3GI1A 1WMAA 2HNBA 2WWFA 3DM9B 3ZLBA 1F8FA 1L1EA 4OGLA 2RE8A 4WJZA 4LJ6A 1XVVA 1W6UA 3R7NA 3ZDYB 3DM5A 4GVLA 1NW6A 1IXRC 1W59A 2DPGA 2W4QA 3RBVA 3UA4A 3DDWA 3VISA 4C0KA 1E63A 3DJYA 4RK1A 5JG7A 1HO3A 1LFAA 3K9QO 3AF4A 1Q91A 1C0KA 2NO7A 4EBFA 3N7AA 4G36A 1UM9B 2JI7A 2VATA 3N07A 3WQQA 2VJLA 3UMGA 3WGQA 4D4LA 2PUTA 2FP4B 3VNRA 3FAKA 4G5YA 3NHWA 1A9ZA 4AJNA 2J67A 3TPZA 3WIBA 1EJ2A 4XLZA 4PHCA 4GNKA 3TRIA 2DFLA 5HX7A 1JIKA 1P1FA 2YC4C 4D4GA 3P9IA 5AW2A 4AJEA 4ZT6A 4YDRA 1E9VA 2JGDB 3LGXA 3MWFA 3M8KA 5AM1A 4E5YA 3VDQA 3FKJA 4PZDA 4BVHA 5ADVA 1AT1A 1HFJA 4MGEA 4OH1A 3FPGA 2PLNA 4D44A 1LI7A 1ES9A 2BZSA 2R87A 3PQDA 4XQCA 4ZZIA 3DB2A 1WU7A 1H93A 4OJMX 1TYEB 5LD2C 4J7AA 1AUPA 3X1ZA 1AS0A 1KARA 2WIAA 1JHAA 4ZVSA 3SC3A 4PXSA 5KOJA 1N1MA 1BHO1 3A6PC 3HSSA 1TVCA 1IG3A 4R8LA 3VSDA 4MMXB 1RI2A 3KD2A 1FY2A 4AF8A 4ZFNA 1OZGA 1OLUB 1TUIA 4E09A 1E0JA 3HN6A 4PGGA 3WYFA 4W8GA 1SEPA 2EXXA 5K3DA 3BFVA 4O1HA 4AS3A 3CT4A 1R0WA 4EGFA 3GMSA 2FUEA 1IUOA 3UMCA 4C89A 4B9AA 2WJJA 1T0PA 3SE7A 1XTVA 1O57A 5ADUS 5ESDA 7AT1A 4NV0A 2HMSA 1UL1X 2FZLA 4IRMA 2XF2A 1KMCA 4AL4A 1STOA 2HUNA 3LFUA 1B1CA 1NLYA 4ISBA 3GEHA 4MS3B 4EVSA 3JQCA 1T35A 3DZCA 2QVGA 2XTZA 3CE6A 3PKIA 1Y1SA 4TV9A 2CJPA 1WW8A 5K0GA 3DCJA 2Z6QA 4FYIA 1FLNA 3MCVA 3ROXA 1OBFO 1L4LA 2AZ4A 2AX3A 2G0AA 2J3QA 4JEIA 2FSPA 4Q02A 621PA 4Y6RA 5SYAA 1ESNA 3NEJA 5AIAA 4EHKA 2FN7A 2H1CA 5CMLA 1DHTA 5JD3A 5KYYA 5FBLB 3KDAA 1Z5VA 2QRVA 5JANA 4RE5A 5JADA 1W96A 1PVVA 5I4BA 5H82A 2X8JB 1ATIA 3FI9A 2UAGA 3K0FB 4XJSA 5EZSA 3UF0A 4U2DA 4YH1A 5E1DA 4D98A 1KYXA 4RLQA 3NALA 1ZSNA 3TEJA 2A9RA 4R3UC 1BA3A 4C05A 1MJHA 5ESRA 5FO1A 3RLIA 4D3DA 5LP6A 3ST7A 4RIHA 5B3AA 1AO0A 2QX6A 1IAQA 5JYCA 3CM0A 1TU0A 4FYJA 4MUBA 4NC9A 4BEVA 1XLTC 4UFPA 3RCBA 4MO2A 4FK8A 2W2LA 1GU1A 4CM7A 1BCRA 2XSZA 3UAOA 2J7PA 2D54A 2GZDA 3ILXA 2D0OB 1JQAA 1KEUA 2I7TA 3I9KA 3TQSA 2HO4A 3EPJA 3LC0A 4KIFA 4EL5A 1B6SA 1R9MA 3ZCXA 4HDAA 5JSFA 3OT1B 1HQYE 2XJ9A 3O1LA 4FSDA 1G8MA 2JGDA 4S1TA 3ZCPA 4B45A 3ZHBA 3H8WA 4YMTA 2HRBA 3EVZA 3LQ4A 3OQBA 1W4BA 2ZUFA 5EIXA 3MINA 1UKCA 4TTJA 3SC2B 1U0OC 2XODA 4Q4HA 2EZ8A 2VAMA 3IDAA 3W06A 3W5CA 2C2MA 5IBRA 4F2GA 3ENKA 3W5SA 1T4DA 3LPNA 1A4XA 2AXEA 4WX2B 1DBQA 2VRCD 5JAPA 4ADSG 5IK2D 5HS6A 3DH0A 3G2JA 3LUPA 2QRLA 3G9TA 4YQZA 2GTIA 1E59A 5A5EA 4J0FA 1G1MA 2W2QA 1C1XB 4C0AC 4DHEA 4R0MA 4TTTS 4ZMRA 1CCWA 3K0EA 4IKEA 5LNK1 1HT1E 4PSCA 4H7KA 4NYMQ 2OQIA 1TTHA 2IFTA 1E9BA 1TZJA 3DNFA 4EA7A 5KTRA 5KSPA 3ZVRA 3FVTA 4FFRA 3P4YA 1VI6A 1CEQA 2W6MA 1PFKA 4H6XA 3BRSA 3G9UA 4UOZA 3ZS8A 5AVSA 3FKQA 4MPTA 4AWXA 2OLEA 4TRRA 3U17A 4M0EA 2KQUA 5JHHB 1ZRSA 2J48A 2O5VA 1K9VF 2W83A 3GAAA 4JITA 5EIHA 1SHLA 5IEBA 2Z43A 2UYQA 3IKTA 3HJTA 3IUEA 1TZKA 4AJ2A 5EZ5A 5EPEA 3O47A 4BE9A 2C94A 2JDID 4XX0A 5EJ2A 4X92A 4ZI2A 4HFMA 1Y9AA 4IIDA 1KZ4A 1T34A 3EVDA 2ZOSA 1KU6A 1Q7BA 1U3WA 1R8YA 1CJVC 1DTWB 2IYEA 4X44A 5CH3A 4YQYA 5LQKA 1PJQA 2PO5A 4GYWA 2FP4A 3O7WA 5BSUA 1MG0A 2V7TA 3E7FA 1U0JA 3HDVA 2Z98A 2IBMA 1GKUB 1T15A 4BP8A 3QEMB 1R5BA 3SR3A 2WDZA 5ALEA 3A6JA 2C83A 1FMLA 3ER6A 1E6LA 4FQ8A 1Z68A 1T1IA 3K20A 4L50A 2R6ZA 4KXVA 4NEHB 4Y8VA 2CNDA 5IH3A 2NIPA 2JVIA 4I08A 3DBHB 4XQGA 2X5JO 5EZQA 3FZYA 2PKQP 1I8TA 3ESZA 3RREA 4ZT3A 1I30A 1RKVA 3THWB 2C4TA 3K9FC 3E82A 4BN4A 3LS2A 4IIEA 4L51A 1QNFA 4XB6B 3UHFA 1SXHA 2R1VA 1SUBA 1Y8RB 3M6UA 2Z3WA 4D9BA 3FX2A 2HREA 3SF8B 1RJDA 1M0TA 3EFOB 3LK7A 4OK3A 1W4LA 4Q7LA 3TPCA 3LHFA 4AG5A 1A9XA 1AKYA 1BVRA 1JKXA 2QLJA 4DCJA 1C7ZA 1X39A 4OQQA 2K6GA 4NJMA 4MNTA 3ZQ4A 1PGNA 2ZITA 4S1VA 5BN5A 5HK9A 4Q9NA 3O2SB 3ZU5A 3QBVA 2JVJA 1DPFA 2B36A 2D0PB 2P90A 3FDJA 4UXIA 4P22A 1C41A 4ZU6X 3WAKA 1MEOA 4QUEA 1IYZA 2DRIA 1DFIA 4PC2A 3ETDA 3QMMA 2UZ4A 2Y1EA 4IXNA 1XELA 4TKUB 4EUNA 5IKXA 4MQMA 3QVGB 2GFQA 1JHVA 1QQBA 1Q12A 5LDDC 2XH8A 1XX6A 5KC8A 3D6MA 3VTFA 1DDIA 4CF5A 1IUPA 5EWLA 2VDRB 4CUJA 3SHOA 1QVWA 1SKYE 2VUSA 2PGJA 1KVQA 5HCUA 4EK9A 5BY2A 1DJQA 1ZKDA 1LZKA 4HNHA 2EJBA 2ID4A 3DEIA 4L6CA 4TS3A 3ZDXB 5A3RA 3H2HA 4PCVA 3EA5A 4ZI3A 3VSAA 3T9FA 3DFZA 5JFGA 2F1OA 1R4ZA 1XPRA 1UAGA 3T1QA 3RYTC 3ZW7A 2CZCA 2BFNA 2J31A 1K6MA 4GOND 1HDGO 5BR4A 1OROA 1G59A 3C39A 3PDIA 3WXBA 1GN9A 4N8SA 3WISA 2YFHA 3ZZUA 3PLRA 4BVJA 4HH0A 3BXFA 1G8YA 1ONSA 5EEHA 5E2IA 1RYBA 3WYDA 3ADDA 1AZSC 1NN0A 3MMNA 3A4YA 4PR3A 3MWDA 3BWDD 3KYCB 3DOJA 2ZJ4A 2AZXA 3FUXA 4HX5A 4FHDA 4Y9DA 3RTGA 1ISFA 1E79A 3HA3A 1UMCB 4JBGA 2RKWA 3SDBA 5CA0A 2QTBA 3WL8A 5LMCA 4MWGA 4XVQA 4PS0A 1XZNA 1R9GA 3KVNA 4J9UE 3ZDRA 4B3SB 5F2EA 1GQRA 1YV9A 1D7OA 2J5XA 3HI6A 2PWPA 4TLEA 5L7YA 1F3LA 1ITZA 1S96A 4RVGA 2V9PA 3BSSA 3C6MA 3ROTA 4BFVA 2B8JA 3M9XA 2W2MA 3K0HA 2QTZA 2XYQA 2V5AA 4TKLA 5CYFA 3TD6A 1RPTA 4OD0A 5GOTA 5H4HA 4AFNA 1I3CA 5JSUA 3L05A 2BZ0A 4HF7A 1KDTA 2G4VA 2XOKD 2Z9CA 3WLAA 4CIXA 5EC8A 5TB5A 4WVLA 2Y6UA 2GBLC 2GJ8A 3AHDA 3SYRA 1VSUA 1ZUD1 4PRLA 5EQDA 1AURA 2DWQA 2E37A 3SBDA 1LRJA 3RC1A 3OIFA 3T3DA 3WGNA 3OQMA 4QODA 3NVKI 3K4HA 1DC8A 1Y3DE 2WIDA 4BNLA 1XEXB 3ZHYA 4PPQA 1Z5UA 5C1PA 4C30A 4F6RB 3WRYC 4YO7A 3AKYA 5E3JA 3EFEA 3W4IA 4F3KA 4LXIA 2CJFA 1SKYB 3AI3A 3PFWO 1M2FA 5HFAA 3CPHA 4ZHQF 5F7OA 1A5SB 2GWHA 1MW8X 2IYPA 1OXBB 3LDFA 4W5JA 1WPRA 3HO8A 2Y1CA 4XAQA 5IJXA 3TSOA 3IUPA 1QS0B 4KXWA 3OMXA 3O8RA 1X19A 5C5CA 2NSDA 1USWA 3FNRA 5CH5A 4KGZA 4AJ4A 1EP9A 5AKXA 1QUEA 3MYYA 4A2WA 3AG5A 3S4YA 1T6ZA 4P7KA 4LWOA 4TWIA 1PJTA 3KKMA 1GQYA 2Y9PB 3FSRA 3KKNA 2NAFA 1YOVA 1GPAA 2VT3A 3JRWA 4TL6A 1FSPA 4OSEA 2GEFA 3E1GA 4MV0A 1E7YA 1E61A 4HYTA 4CCWA 3VHQA 4UMVA 3VXKA 4PM4A 1F8UA 3W2EA 5BWNA 4BQPA 1RXUA 4LWPA 3RRJA 5HKAA 1E5QA 1H4SA 3U4QB 4W7SA 5LUBA 3RFFA 5ALVA 5AW8A 1VZ3A 1SRQA 5EQFA 4QEDA 1Y1LA 4EZIA 1D9ZA 1GN8A 4EW2A 1BWPA 1JLHA 2XYPA 4M1MA 1P6QA 1R0KA 5K45A 1AKNA 1E6CA 1ORHA 1UMBB 4PYOA 5T4EA 3SS7X 1HLFA 2WHRA 3NYWA 4UUMA 4P5EA 1KDPA 3E8SA 3QX7A 3IOMA 3GH1A 2W6ID 2ON6A 4Q3BA 1VL5A 4XRGA 5IDQA 3M9WA 2E82A 1AMOA 4LY3A 3CX8A 3RVQA 3OT1A 2QG9A 2W5UA 2Y1XA 3AV0B 2G5CA 4Y9SA 5B3KA 3VNAA 2GDZA 4F46A 1HT0A 2FW9A 2OMEA 4R40A 5DTIA 3RD5A 2QHXA 5C81A 2QZPA 1MEEA 4IDNA 3O31A 4P7JA 3W5UA 1DC3A 2PT6A 2RHBA 3ETGA 3IP5A 1L4NA 1IHXA 5JZOA 1JZSA 3SBEA 4B83A 3AI2A 1HDZA 4F5ZA 4HGPA 5CX1A 1AA6A 4GLJA 3D4BA 1JG2A 3AIOA 1Z36A 3D54D 5HEKA 5IDYA 1EVLA 4GSYA 4CUZA 4L8LA 5KYKA 4EMBA 3RV3A 3UTDA 1ZAYA 2NUPA 5EHNA 4UBLA 1J42A 2D06A 3U37A 3OBBA 3VKFA 1ZESA 2FXVA 3K0FA 4X1OA 4Y2GA 3MLAA 3TRKA 1H8HD 1KO7A 3DTVD 3FLMA 4B4DA 4FDTA 1F51E 4PTYA 3Q7RA 2WQZA 3HEMA 4DMFA 4NBTA 1ONOA 2WW8A 4RPKA 3TOXA 3TI9A 3C3MA 3NEYA 3QVOA 3GLHA 4YBRA 4RD6A 3TAUA 1SKUA 4N47A 2QTFA 4BATA 1SVKA 3N0TA 3JRNA 3RSOA 5KX5F 1ZSYA 4HWOA 1ESCA 4WW0A 5WRFA 2DBYA 3RWBA 3AJAA 3Q87B 2A5FA 1KMQA 2CUNA 2FJUA 5DK6A 2GXSA 5FUBA 1W44A 2VBFA 2YOFA 2ZBRA 3QA3E 3EIQA 3EVAA 1DBRA 1D4AA 2I6FA 1RT9A 3ELUA 3C1AA 3DBVO 2VDUE 2D0IA 1ORIA 1AKEA 2AFRA 3I8OA 3MPOA 1J9GA 5B30A 4RO0A 1NVMB 5KVVA 1C4OA 2O8CA 1VMDA 5BWCA 2E6UX 1Q16A 2GB4A 3WMRA 4EENA 4DA4A 1P60A 3IR5A 4UKDA 2E1PA 4O33A 2AYYA 1PUIA 4R2LA 5EMJA 3AZQA 5DLEA 4DVJA 3DQPA 1WEHA 1C0IA 3IQZA 4MWDA 1ML3A 4NHEA 4B44A 4C6TA 1N77A 3ETJA 5LLTA 5K0LA 1DG9A 2VDVE 2ZRHA 4F7WA 3DF9A 4ZV7A 3PPWA 4PQYA 3REFA 1IU9A 2NO0A 3GRPA 4PN7A 1Q14A 1UKZA 2A5LA 2AG1A 3SIWA 4BEWA 2HA5A 4RS4A 2PL1A 1GQFA 1TMYA 1CTQA 2JLBA 1HDRA 5L4NA 2XUJA 4AYXA 4QDTA 3SJZA 1H8HA 1QORA 1RCTE 2G08A 2LR0A 2XAAA 3OQVA 4PO9A 5DBGA 5FI0B 1WZ2A 3R3UA 1QMPA 4YREA 4PYRA 3PC8C 4HRVA 2Z3ZA 1VLVA 2BEUA 3ORFA 4C0BA 4F3TA 3CJRA 1RTKA 3F6PA 1O3YA 3F90A 1I6MA 5AVZA 1XD8A 3BT7A 1W2HA 3IDOA 1KWGA 4WFKA 4Z0NA 2AFIE 2IVFA 2EEZA 2QD2A 1KAEA 2QTVA 3SZ3A 4LS3A 4MITA 3PR1A 4I9FA 4YRCA 2J3LA 3ZTTA 4QFDA 4M0MA 4R5MA 4DJFC 3RSCA 1EVIA 1JFTA 4H7IA 2TYSB 4E3WA 2RCNA 1HK7A 3WWYA 1R1DA 3OU7A 3QK7A 2UYYA 2GSWA 4FUQA 5FPPA 3P9SA 1L5HA 4MPDA 1H9BA 1OYWA 4ARAA 5AWFC 1CVRA 2HV8A 4Q0MA 2ADOA 4H31A 2CHEA 1M6NA 4YS6A 5H02A 1R3DA 2GOYA 4A6DA 5FNZA 4DQDA 3QKSB 1ZH4A 2R2GA 4LTDA 5IZ4A 1SHZA 3JQAA 4NG4A 2AUMA 4NHOA 1RZRA 4C2UA 1ELOA 2X4DA 3PVCA 3ZJTA 3D0KA 5ELLA 4IY1A 1CP2A 3TLBA 2NLOA 3DZHA 4HNRA 1M2WA 2PH5A 4GXTA 5KYVA 1E92A 3EQ2A 2BKUA 1QRUA 3HYRA 1Y4ZA 4EECA 4P86A 3KLOA 4LE1A 5CVDA 3IELA 4DGSA 2AJLI 3H2SA 1AOXA 1ISHA 1MNQA 2IPXA 2ZR8A 3DBRB 3FLBA 5AI8A 4ZGGA 1KVTA 4MS1A 1LWOA 2WIKA 4EKEA 4J7CA 4GPBA 5H1YA 3CGWA 4RTOA 2W2XA 3ZJVA 2JH9A 5A0TA 1GPJA 3OAAD 2G8NA 1AM4D 1JJVA 4BNWA 1KPIA 1OZ0A 3VNVA 1GGVA 3VR0A 5GZ3A 4JLPA 3F8SA 2JS7A 4EG3A 4JYBA 5K6RA 4K9RA 4FYXA 4RDXA 3QMVA 5DVZA 5CD9A 1SCBA 4R1MA 5JEEA 4O2BA 1QNLA 3TH5A 3O0DA 5HE8A 4BVEA 3MEQA 4FE3A 1E3EA 4D79A 4DAEA 4UU7A 1Y6FA 1BEUB 2QLTA 3PGVA 4JZYA 4KN9S 5LL6P 1J0EA 2IZ6A 4CF7A 1EM8A 3GCWA 3EXHA 3RO7A 1AXGA 1Q1ZA 3RFTA 4TQGA 3A6HA 3L93A 1E8MA 1VDMA 3CNHA 3UGQA 4WZBA 4L5YA 4EKNB 4LECA 4NNOA 1EIWA 2OV6A 3MB8A 4RXMA 1EFPB 5DM1A 3VZPA 4DLRA 5AVRA 3WL3A 1M1UA 4URFA 1PAUA 4ALNA 3QJGA 1P39A 4QRIA 1T1EA 4FZVA 4GZ5A 3TAHA 1G8HA 2NV0A 2VUHB 2FWBA 1PYDA 4RD3A 3R2JA 1WKBA 4N5LA 2W6OA 4J07A 4WMLA 1YS1X 1LFDB 3D1JA 3UT5B 3DT6A 1I4OA 3ASYA 4JA2A 3DVSX 4C5AA 3MXOA 2V96A 4NCNA 3C74A 3SQWA 4JFRA 1Q0RA 4MKFA 3ZWMA 1CG6A 1J8YF 1FJ2A 2G1KA 2JIPA 3DMYA 3DUFA 3O73A 3PQEA 4H17A 4E4YA 3D4PA 5FP0A 4D4MA 1G6HA 4KNWA 4QTYA 5FV7A 5CCBA 1US8A 1J8MF 1XP8A 2GHQA 3ITEA 4JEHA 1E2HA 1UZAA 3WIUA 3WOHA 4WD3A 2D74A 3H2GA 2P6OA 5JTUA 1WF6A 4IIFA 5AM5A 2NVUB 2ID8A 1RADA 4PIVA 5JLJA 4JDUA 2WSLA 2CDCA 1J33A 2YICA 4CQJA 5IYZB 1VMEA 5BYKA 2I78A 3UANA 5DOVA 4G5QA 3RNOA 3MVEA 3HU1A 1BFUA 4UUPA 1O1YA 3AVVA 4XTCS 1GRNA 4RV9A 1KZHA 4BQRA 2C0CA 3UUEA 3OX4A 3I12A 1F8GA 3IJRA 2BGIA 2D5CA 3RS0A 3W9YA 5E3HA 2UXBB 3AZPA 1ESDA 3HBFA 1ODIA 4XIGS 2WSSD 4LOLA 4GQBA 3KWLA 3O26A 3TQOA 3HVIA 4OP2A 2PGXA 4NKRA 2ORED 4JOBA 3L92A 4WESB 4YUAA 5LQUA 3DFFA 1E3WB 3WO1A 2FOIA 1NZDA 5BXYA 3IAEA 1N5JA 1NNUA 1R0BA 1JYEA 2XT0A 3L7YA 3H1TA 2VHTA 4OU4A 5EKTA 4NDNE 1RVV1 1SBZA 1Z6QA 2FSHA 2HQ1A 3LUKA 2VTDA 4UDYX 5EVJA 2HJWA 5AVWA 3VR2A 4KPEC 3LVFO 4C2TA 1QHHA 1U65A 2DHCA 4J2TA 5U4QA 3FDXA 5GZ1A 3K15A 2TECE 2GESA 2I4TA 2OWDA 4B3MB 1L7BA 1OOEA 4G2NA 4C7XA 1T9GR 1Z7YA 2PEZA 2CLDX 2IX9A 1UXHA 1RHKA 4AUEA 1EP1B 1A04A 3CC8A 2W7TA 2UZAA 2NO9A 2YV2A 1QHSA 2QU7A 1G18A 4II3A 2G88A 4NRDA 2GKGA 4PZ9A 1B8PA 1W0KD 4Z1MA 4AZ0A 4EQZA 5LZ9A 2JI9A 1HL3A 5DYNA 4PC7A 3QHPA 3R7LA 5ALZA 2VJMA 2GLXA 3LIPA 4QUDA 4BDTA 2XQFA 1X8KA 4KRXA 5KVSA 1NOIA 1DKRA 1TFUA 3ABQB 3C1TA 4V2IA 1T4GA 2A5GA 1KKUA 1KO5A 2YOGA 3OJFA 5F76A 3PYXA 1QH0A 2Q4TA 5KTYA 3CNLA 3DD5A 1Y8ZA 1D2RA 5GPBA 4NOKA 4RS3A 5DBHX 5JMWA 1T0UA 3LZ6A 1UK8A 1IDN1 1ZM3A 3PZBA 4ZXPA 3BERA 4RADA 3PV0A 4AIRA 1U6JA 2NZWA 2Y0EA 5DI3B 1U11A 5KX5B 5PGMA 1NPDA 4BRWA 5JZMA 2AZTA 3U7QA 3QPCA 4HAIA 1Z6GA 5CHYA 3SE0A 1YRQA 1WXHA 4LEIA 4YP1A 3FW1A 1QC5B 2EGUA 3PGKA 5J43A 5TLSA 3KZCA 1V8BA 1QYRA 3L8YA 3GBVA 1SPBS 4YXWD 1OWLA 4EUKA 4ZZ3A 3TK1A 3AVTA 4E07A 2OZLA 3CB4A 1CRQA 3QENA 4GPEA 4K0RA 1OR8A 3R6DA 4MAAA 5C1DA 4HGNA 2C8LA 2OXRA 2FMUA 4FS3A 4RY8A 1E5DA 1X1DA 2E4UA 1T5SA 4R5HA 2R8EA 3CRVA 3S7TA 4G01B 4DLYA 4KH0A 4PF1A 3RB8A 3PGLA 4NFSA 5KU1A 1D7AA 1XVIA 4REMA 1V16B 1OFHA 1WHSA 3C3XA 4NIMA 3CPSA 1HNXB 4QQNA 4P0PB 1T0BA 2O1XA 2ZXFA 1I94B 3G8YA 3K09C 4WK2B 4LJ4A 1WX1A 2I66A 3KVVA 1RHMA 2PX3A 2DH6A 3VR4D 3GMIA 4LYYA 3MD9A 4YRLA 4BQEA 4OX9B 1E2UA 2QVYX 3ZI7A 3GWZA 2VJAA 1U7WA 4MRPA 4UATA 3ZZMA 5BP7A 1KDZA 3FD8A 4X66B 2XUDA 4YJGB 2AEFA 1OKKD 3NOXA 5T8KA 3OLYA 5CEJA 4X94A 3WRYA 4QRHA 4FFOA 3RVRA 2OYSA 3DAOA 4OLHA 3WBJA 2ZTUA 2ZSDA 3ZXXA 3LD9A 4WBXC 4YJ2F 3H2BA 4DDHA 3ZZTA 1XWIA 1ABBA 2VP0A 1BW9B 3TYXA 3SOZA 2C9BA 1B0UA 1NKTA 2WHPA 4M54A 3K2EA 3CF2A 3R5SA 3BSFA 2OO7A 1AQIA 2ZE8A 4TSKA 2JF0A 4XSHA 4RHYA 3VO9A 4BNDB 4E88A 3FH0A 4M7RA 5A3SA 1ONBA 3B12A 3F2VA 1X42A 2R85A 2V7EA 5D5PA 4ZQCB 5E4YA 3W34A 1X7YA 3L5KA 2YR0A 3L6RA 3QMWA 4FSXA 4XWGA 1FFXB 4DF3A 5KO2A 2I22A 3MWKA 1ND5A 4Y1FA 4KI0A 2HMWA 2Q7XA 1MORA 2VSOA 5JDIA 1X15A 5IVDA 3BSWA 2O06A 3R0VA 3GLGB 1KYVA 4C0HA 1YQEA 4AY5A 4AXBA 3U44B 1OLUA 3D2AA 1FP1D 3WYCA 2P9ZA 3DOHA 4Q1CA 3MTIA 5H16A 4JI6B 2C59A 1QHNA 1FTSA 5DNDA 1G6OA 1VHTA 2VTEA 4GYYA 3W5HA 1L7DA 3EJ6A 4YRFA 5KNDD 4E6EA 1R16A 1UXKA 1X1SA 3EK2A 4W6QA 1P17A 2G63A 3HWSA 4AECA 2NQ8A 3OZBA 4HSEA 1A76A 4OM8A 5CA1A 3HVUA 1Y8AA 1XCJA 2H6EA 4OQEA 5GONF 2PUCA 4G5SA 2QTVB 2QS9A 3ZJ4A 3RSLA 1DXYA 1C30A 5EI5A 2XGMA 1OI2A 2ZLBA 1PDVA 2VAXA 4MQ5A 1KY3A 3JYLA 1E1YA 4PEVA 4RMJA 1Z17A 2C2YA 2KSQA 2ZI6A 1ZVQA 2R4QA 1N5IA 2QSYA 1K6EA 1GPBA 1B8OA 2J0UB 1FVHA 3HC7A 4I8IA 1N33B 4PXAA 5DP1A 2GYVA 3FBGA 1LDYA 2RG1A 1FLDA 3X1YA 2W42A 1WCYA 2DAPA 3OZXA 4WLUA 3ZDFA 5A6VA 2JIBA 3PUXA 7REQB 3HK2A 3OX3A 4JLAA 2ICAA 3C70A 4KO8A 1FOEB 3JWJA 3KQHA 2ZKIA 3QKSA 1KEZA 1EEHA 4I6GA 1Y6ZA 4U7HA 3GZ4A 1XMQB 2VQDA 1II8A 3FJOA 1GTG1 5JPDA 3MS4A 1P45A 2JHAA 4L8YA 4C43A 1II0A 1EJ6A 2JEZA 1PYGA 2GBCA 4HL6A 4QBFA 3HXPA 4EFDA 3DLCA 3TB4A 2E1RA 3NOVA 5IDVA 5AESA 3PC3A 4TYQA 1KH3A 4KR7A 3AXTA 3KFLA 5BQOA 4YRDA 5JPIA 1FSSA 1RWPA 1SXJB 3ZIDA 1NJ8A 2QN3A 3A6EA 2OCKA 3ADCA 2N3ZA 1DTEA 1ZEMA 4EB3A 4ZYLA 4EHBA 1ZIXA 3JAWA 1LLFA 1OWOA 2YH2A 2Q45A 3KHKA 4O4JF 4X60A 3K5HA 1GNPA 1UJ2A 5BMVB 2VTVA 4FIZA 3IEIA 4F56A 3NHAA 1CDEA 1DIBA 4JB3A 3AY7A 3FJ1A 2CLSA 1K8ZB 1PR3A 5HA5A 3CCCA 2CXUA 2SHKA 2Z1NA 1FXWA 1KI7A 3E2MA 4DUGD 1MDFA 3IGFA 4PCAA 2PRIA 1O4WA 4DJEC 1JDSA 1SUCA 1Y81A 2HK8A 3O8OA 4I50A 4B8ZA 1HE1C 5ICMA 1A9SA 1NW8A 2OZLB 5E8RA 3TKYA 3PFIA 4E2ZA 1NAHA 3NYQA 2BEVA 4NBVA 5DTJA 3PUZA 3HCBA 3LHIA 2XUHA 4GL2A 1C3VA 3HDGA 1NVAA 4K87A 3FB4A 2WNSA 1JBQA 5TQVA 3O91A 1Y3HA 5A9SA 3OQOA 4HWGA 1IIRA 1U1EA 1Z26A 5A2GA 2HRCA 2G07A 3GNSA 4GPZA 2BMJA 1EFVA 2WFZA 3JTEA 3NLLA 4AC9A 3LXXA 2DR3A 5B4TA 2FSUA 4HGQA 1IN7A 4TKUA 1E5TA 1PFWA 3FYUA 3JQ8A 3I39X 2GVNA 4P5PA 1BDJA 4R1OA 2IYYA 3VZBA 3U48A 4WKBA 3E9QA 1QV7A 5BQ3A 1QHHB 1QZXA 2FQYA 3CN7A 3H1BA 4G1MB 4I2VA 4R2IA 1Q74A 4HX9A 4X41A 1I0LA 4EF4A 3R5JA 1JAZA 5I3CA 2G28A 2BF4A 2JD2A 2QAJA 5FOVA 5C1OA 4IUYA 1NONA 3EASA 4V02A 8ATCA 5K6AC 5AI9A 3OJCA 3CVYA 2GZMA 5GV7A 4FSHA 5ER6A 2D0DA 2IY9A 2P8JA 5SY6A 2J8ZA 1NHWA 1FRZA 5BPFA 3T5MA 5F78A 1QVRA 3PT5A 3GY0A 4K6MA 3Q7EA 5CM8B 4YAWA 1XCBA 2X86A 1KDRA 3GUHA 3ZXSA 5FBVB 4A2CA 4KYVA 5A1JA 3CU5A 2OP0A 1JSRA 3KTOA 3O2QB 4IDFA 5DW3A 3LVRE 2HPVA 1A8SA 1IZYA 3O93A 3FHOA 4MARA 4XIJA 3RVDA 4BQOA 4GE0A 3QPDA 1GNRA 1Y7HA 1M10A 4I4NA 2X77A 4FPXA 4AURA 3KR0A 4ZO7A 1GDHA 2DFKB 2YDXA 1JLSA 1TJ5A 4DSAA 2EQBA 4HKTA 5A06A 1A9OA 1JT9A 3ZBQA 821PA 1PL7A 4Q19A 4I5GA 4P3XA 2ZDHA 3VO8A 4E32A 1M0WA 1RJFA 1VPVA 2P6UA 3DW1X 4UASA 1WEKA 4XDZA 1PRYA 5EUBA 3X1KA 3CSDA 4LHYA 1FJXA 2E3JA 3LCJA 4R8KA 2YCLA 4FNOA 3IAM6 2A4MA 2PRZA 3GJTA 1BE8A 2V7GA 2FW8A 3L7OA 5D3MA 1M2JA 1ZOPA 1RE1A 3VHLB 3U5TA 3G49A 3QHAA 2P7HA 4PO3X 1PD0A 3WGKA 3E53A 3I37X 3L84A 3K53A 3OT5A 4IF4A 3SWWA 3GLIB 1YQGA 2O3TA 5BT8A 4HWSA 1BS9A 4O6VA 1AHHA 1VHJA 1D04A 3IILA 3ACCA 4GFDA 2GHTA 3LZCA 5AM0A 1E9DA 4A0HA 4R3NA 4FJ1A 1XG5A 4Y6SA 1NRWA 2GN6A 2PS1A 4BY9E 1JWAB 1OASA 3QVWA 2QI9F 3GNTA 3KOYA 2RJOA 2P9EA 5IAAA 3DZIA 3DONA 4ESOA 1ST2A 3SYKA 3MWLA 3H6HA 3GARA 4D8XA 5C31A 1Z0SA 2UYOA 1TF7A 3BIJA 1H2BA 4N01A 2WYVA 4HS9A 4UARA 4N0QA 3TGWA 2NXJA 2CLHB 2J85A 5EQTA 2V7XA 5CXXA 4LGCA 4DA0A 4EA9A 3IEXA 1NN1A 3P0HA 2VHQA 2YWXA 1I01A 1T3SA 3L6UA 4X00A 2WQ7A 2O23A 1VLQA 4DQLA 1RWQA 4Q3CA 5HJ5A 2GN9A 3BUSA 3TUJC 4J03A 3RFVA 3JVEA 3OLCX 2IELA 3BE5A 5MN5A 3DMNA 2GUWA 2WVJA 1NWCA 2P1ZA 3ZOZA 4FMCB 2BKEA 6ABPA 1MQ8B 3COJA 1WCWA 2J5BA 4BMPB 3EF3A 3KIPA 2ACWA 1OPXA 2LW7A 4Q48A 2QR3A 3UMJA 1UMDA 1Z08A 4YRZA 3K0SA 1C9JA 3LP8A 1OSNA 2MHCA 1DL5A 1E1QA 1SB8A 4HLNA 1XRJA 2H07A 3FGOA 4AULA 4YAFA 1VE6A 4JK3A 1JLLB 2VH2A 3RHFA 1UBCA 1CFZA 3GIDA 1N9KA 1KP3A 3FUWA 4TXMA 4ZQEA 5C1BA 1GKYA 1SXQA 4Z99A 4N49A 4YJ2A 3UWDA 3K96A 2WUEA 3T7CA 4Y2PA 1C9NA 1SQGA 2HSGA 4ZMSA 4NYMR 4GKBA 1C3JA 1GG2A 2A9QA 3BTOA 4KW7A 4N1AA 3PWZA 5DFAA 5KYNA 5IT9A 1ILEA 2UZ0A 1GPUA 4EQ6A 1H2EA 3D7SA 1EHCA 5CBPB 2YMPA 4PYIA 4J1TA 2ZRAA 4LG1A 4O4IF 3RARA 1EUZA 1A3CA 1X7HA 1KORA 5H3CA 3D1VA 5E95A 4GPIB 1GVHA 3ODGA 4PX2A 1KMHB 3GJYA 4ZDKA 1UZNA 2D00A 4KLRA 3E3NA 5F51A 4NQZA 5AJYA 3WLRA 4F3RA 5ITZA 1VJ5A 1KYTA 4JUCA 1BE0A 4RH3A 1EFPA 2FSVA 2R3SA 1M5TA 3I6QA 5TPWA 2GK6A 3SKXA 1J24A 1DMRA 1EX9A 3BJRA 3WWPA 1XTPA 2WR8A 3EULA 2OCDA 4O4LF 2BH9A 5JJIA 4DGQA 2O50A 1FPQA 5LP6F 3QY9A 1U9CA 4QYSA 1KS2A 2VPXA 4BGIA 3E5NA 5H80A 3F6YA 4GOOD 2WIFA 1HE2A 3L49A 4AJKA 1LTKA 4NESA 5AJZA 3TFWA 2DB3A 2XECA 4O2LA 1JG6A 3N2GB 1F2UB 1X87A 1XRNA 2CK3A 1U2RA 2PYZA 3FF4A 3FPCA 4ZYWA 1O77A 4QM6A 1WXEA 3BFKA 1GYRA 4M7PA 1BX1A 2FE4A 5B4VA 1DGQA 2LV8A 3VVCA 4F93B 2Z83A 4R51A 3RNLA 5CK4A 4EFLA 5KWIA 2K5UA 3VOBA 4Q66C 5TQJA 4I1SA 4KX3A 3X1XA 3LVBA 4OATA 2QTLA 2QXTA 3FGNA 3FWPA 4LIPD 4EUFA 1H2YA 4HAOA 2X5NA 2AC2A 4MUHA 3U2QA 5T4BA 3MZ0A 4XJXA 2O2CA 1LLQA 1SVUA 1U6KA 5FHQA 2P2YA 1U28A 2XEDA 2B4RO 4F3NA 1U3CA 3Q0TA 5K4AA 2PKQO 3QF4A 3L4BA 2D7DA 1Z16A 3H0CA 3ECSA 3BKWA 4GECA 3HJNA 2CNLA 4P36A 2I71A 1DTWA 1I5EA 1NIPA 3AHJA 5EJAA 3UQYS 5ELMA 1VKZA 2GA9A 5EESA 4UULA 3WOVA 4INZA 5IU6A 2G9ZA 4UCWA 1ZAKA 5FLXA 4GNRA 4D9JA 3IP3A 1N92A 2AD5A 4RQAA 3QVKA 2VZ0A 1R00A 3EE6A 3FXAA 3GHYA 3VMFA 3DTTA 3T0GA 1JHOA 5DYTA 3BEOA 1JDBC 3M1LA 3NBUA 4YAGA 1XWFA 2JIRA 1E9CA 2FU5C 1TKRA 5G4LA 4OJKA 3Q8KA 1FRVA 1SKBA 4TN1A 2V8BA 2AJBA 3LM8A 4MVJG 2A3RA 2VSXA 2QRMA 3A3OA 1JPVA 1NI3A 1OREA 1TM4E 4BZWA 3H1FA 2JFXA 2Y0BA 4TROA 2B0CA 2CXHA 2C07A 5T5QA 4D41A 4GOKA 4F6CA 3GP5A 3WK5A 4H15A 1KJWA 3VZDA 4RF5A 3Q41A 4PLTA 5SZJA 3I5XA 4ZKDA 4YN3A 4NENB 3P32A 4H0CA 4BGEA 2C2XA 4OJNA 2YHBA 3SF0A 4DV5B 2KS6A 4FI3F 4A8TA 3D5EA 1FQOA 2ZP1A 1NW4A 3UN1A 2DTDA 2VYCA 1ZVJA 4X45A 5DNVA 5A6SA 5K4GA 3R7WB 5CYGA 4EHIA 1X0VA 4FB5A 2EZ4A 3PEVA 4PNHA 5C1IA 3EVEA 4R01A 3A28A 4URXR 2IW1A 4HWTA 3AR3A 1GL3A 4CCYB 4W6ZA 5F23A 2FVYA 1W4RA 3WQRA 3SHTA 3TEMA 3VH4A 3OE1A 1RJGA 5AHOA 3RTDA 1TLFA 2PWAA 5HM8A 3QA9A 2Z0MA 2BMFA 1JG3A 1TKCA 3U3XA 4DFDA 1JZQA 1P4HA 3P9CA 5FADA 4A0RA 1E5VA 1BXZA 3I6MA 3QELB 2GZHA 4LBYA 1E2BA 2PBFA 3TTSA 3S1LA 4MV6A 4D5GA 3G0OA 1F4LA 1WIWA 3C6BA 4OXRA 2J4DA 5E1MA 2PMEA 1CRLA 1H5QA 3JQGB 5EINA 3T9AA 2VHVA 3VR5A 4EF6A 1THMA 1TXGA 3VPSA 2VNIA 3UHJA 3JW8A 1M83A 1NQOA 4BV3A 5KYXB 3PQCA 5FUWA 1HSZA 3IL2A 3GJ8A 5TQ0B 1W36C 4JBLA 1MV5A 5C8XA 1ZA1A 1ZLYA 1K66A 1E89A 4ZYVA 2DOKA 4MJ7A 4RD1A 3OD1A 1TD9A 4C9BA 3KQVA 4BEJA 2PJRA 2ZUEA 5KYTA 4XM2A 2II6A 1Q0ZA 2PCJA 4XXHA 4XWTA 2ZSEA 2CL5A 3FIUA 3V2UA 4EG5A 3WLPA 2MSDB 2Q5QA 4YP5A 4PZEA 1L8AA 5DMXA 1P9RA 1PS9A 4EPYA 4G4JA 3DE4X 3SF8A 4KFTA 1JHMA 1H2HA 4BAGA 1BWRA 1JTFA 3VJMA 1H23A 2GR9A 3GLVA 2Q29A 1VKNA 4PCLA 2X6TA 5FUXA 5E4JA 1M8FA 4MCIA 1QPBA 3D6AA 2A5JA 3ICOA 4NCKA 3H84A 2DVMA 1I5RA 2P5TB 3RASA 4OJQA 5KKCA 4DUGA 4WDQA 2I7XA 2EOAA 4BLWA 3QLVA 3BS4A 2DKFA 3KTAA 3N6XA 5LZ8A 5HIIA 1EAMA 4ECAA 1A2KC 2BD0A 1T9KA 3E27A 3SHVA 2GN8A 2VYND 3II6X 5D00A 1VJGA 1E2EA 4E5PA 5FEMA 1N0HA 3A4VA 4UNRA 3PJFA 3JZMA 5KSOA 3U16A 1WP4A 1K4YA 1GA4A 3I04M 4LJLA 1V5WA 1UXIA 2EBWA 3B85A 4N0DA 4DLTA 4YUZA 2FFRA 4QEZA 5HZKA 2CLKB 1EIZA 1PFYA 3IIKA 1JDUA 2GLUA 2HHHB 3HJRA 3OFNA 2CB9A 1KZ7B 3ICWA 1Z6PA 2Y1LA 2LCFA 2VHCA 2PUFA 5HFJA 2JKZA 1GT91 1M6VB 2XOEA 2EWVA 3IPAA 4FW9A 4GM1A 3PIRA 4NE9A 4NMXB 2C4UA 3OKPA 2NUTB 1I2MA 2J6BA 1Z2EA 4UEQA 2J3EA 1LW6E 3T5CA 2P68A 3LP6A 2BMVA 4TOIA 4A0QA 4UPEA 2B61A 3O0TA 3FCSB 3KYDB 3K1JA 4IDAA 4OREX 3UJCA 1L4GA 1PD1A 4XDHA 2P9FA 2PV0A 5GY7A 1T6XA 4M8IA 1YL7A 5CA1F 5CA1B 1RLJA 4JQOA 1VMAA 3O1IC 5I7EA 3MGGA 4YX9A 3FWHA 3HR4A 1C7EA 4IG4A 4YRQA 2O8EB 4R41A 3OZIA 2VT7A 3CWCA 3R24A 4U02A 1YFJA 2Q9UA 1XMSA 3ASVA 3P94A 1URPA 1BQ4A 3WGZA 1MMFB 4DDKA 4B33A 1Z35A 1AXEA 4ITUA 5IANA 2LWIA 3IUYA 4Z6KA 3EA0A 1ZJJA 2Y05A 3HABA 3GUUA 4LZOA 1A50B 3VPFA 3ZY2A 1FYWA 1G8PA 1X2BA 2PVCA 4GLFA 3U3OA 2WWRA 3UMBA 1U2GA 4C20A 4AO6A 4IW3B 2D62A 4HQKA 4JB0A 2ZUTA 2ZI7A 1B3RA 1YUMA 1BWQA 1ZKMA 4FC7A 1ZHFA 2NXEA 1DUIA 4M55A 2CFRA 3FHTA 1GGMA 1HM5A 3K09A 2OFFA 5KU7A 1RI4A 2WJPA 3LUJA 4IEFB 5E6RB 3EZNA 2AZDA 2QA5A 1QXSA 3GRUA 3LE8A 5D3ZA 2MMGA 4K5QA 1B74A 2ECOA 3WGTA 3RVOA 5BV0A 3IQEA 2BGJA 4OXIA 4ZOLF 2JIOA 3JXEA 1UBHS 2AMVA 3KB8A 2ASVA 1ADYA 1D8AA 3WFJA 5HVNA 3RT1A 4H4EA 2O0KA 4CCYA 1WVMA 1GGEA 1P80A 5EZ6B 3LJKA 3LUDA 4FR0A 1O94D 1V37A 1HXHA 1IQRA 3WX0A 4KWHA 2QUKA 2IDMA 2WJ6A 1EP2B 2X8WA 2FSIA 3OF2A 3SVLA 3QEJA 1G98A 1KGDA 1EGQA 3JALB 3CTMA 1RZUA 3ADPA 4KE8A 3C3YA 221PA 2GPWA 2Q2OA 3ILYA 4NOJA 1VG1A 4JT9A 2GN1A 5CTAA 1EE1A 1Q3KA 2LUOA 1PV1A 2W2TA 3NBFA 1NW9B 3QELA 5C4GB 3QQPA 4EJSA 2P3OA 1OKKA 2CLMB 1EX6A 3SR0A 1Q7CA 1NP3A 5AW4A 1T4BA 5HTKA 3EXEA 4DA9A 4RK6A 3TW4A 1K89A 4D80A 5F2NA 4JU9A 4CL0A 3PPVA 2V58A 1W1IA 4XFDA 4CZ2A 5C2JB 3SN6A 4MS4A 1NXWA 1QHGA 2PSFA 3O4HA 3OPVA 5CXSA 3V4FA 3DE2X 3LP5A 4ZAXA 1PT7A 1AH2A 2IP2A 2GPBA 2ZYGA 5L4LA 4BO8A 4JJAA 4LW8A 4YV7A 5K0BA 1GPWB 4U7DA 1N5DA 5AUPB 4K9LA 4HWKA 3AYZB 1NW5A 3NBYC 5BR8B 3GELA 4FXPA 4MCAA 4BAUA 3KWJA 4QDJA 1EK6A 1H66A 4DR4B 4OYHA 4N48A 4EHFA 1HC7A 4RPHA 1F1BA 3DL2A 1Z73A 4G0PA 5HQ3A 1Z3IX 5CFPA 2QZZA 3TF5A 2WU4A 1EFDN 3V32A 5JO9A 1BXGA 1YUBA 1QYDA 2B9VA 3C4QA 4GXRA 4LPKA 4QX6A 5J1SB 3VZCA 4GUAA 3SS8A 2RGDA 3LW8A 4J4BA 4L9AA 1V3TA 3G82C 1ZSVA 3HY6A 3HZRA 2ID7A 3OLZA 4XSVA 4XARA 5D3MB 2AE2A 2BHNA 4QIHA 4YMHA 4OXNA 5DSXA 5JJBA 2Z5GA 1WAMA 4JP8A 5AJUA 3V34A 1NV9A 2IIBA 3SSOA 5CB4B 3EGVA 1P0CA 4GBMA 1MB3A 2YZKA 3H7IA 2XZLA 1D1QA 3PPIA 3BZUA 1ZI6A 5IXYA 1GPNA 2IH2A 4NH0A 4YRSA 3V9AA 5IHPA 2YUTA 1YS4A 2ZJ3A 3V4SA 1CJCA 1U28C 3GJRA 5LC1A 1XLUA 2H4XA 1EKXA 1EQ2A 1SOWA 1VKJA 3LBNA 1W9MA 1GEGA 2O59A 2FN4A 4Y30A 4J29A 3I9FA 3TXAA 3PSHA 2Z4TA 4Y6OA 4L73A 4Q1FA 4DKXA 3HN2A 5JC1A 3OCYA 2GD6A 3NHYA 3A9WA 3SDZA 3CEMA 4FW8A 3FLEA 3A1EA 5E38A 2Q7DA 1QDLB 2I99A 5HTOA 4WBNF 3CW8X 1H9AA 1JQLB 3GX1A 4DZZA 1BG6A 3KVYA 1NQAO 2P6NA 3EZ7A 4FQ5A 3VDRA 3BORA 2NTJA 3FR7A 1DT5A 1BQEA 2P69A 3ORHA 4GZLA 4JKOA 2X3FA 1P0IA 3VGPA 1GRVA 3DHNA 2AF4C 3EZ2A 4MICA 2CFOA 1PUJA 1T2UA 1XKTA 2Q0QA 2W58A 1GPDG 4R9SA 4KVFA 5DNWA 5C18A 2OO5A 3KQPA 4DCPA 4X90A 1TEZA 1F7VA 5HR5A 2FGJA 3FKSD 5LMUB 4LXGA 2IXAA 1XMPA 4TS1A 1EXVA 4OQDA 4U9HS 2HCBA 1JQJC 1JR6A 3QWBA 3QBEA 1H0KA 3Q85A 5FJIA 3EPHA 1CBUA 3E5MA 3WLHA 4RHUA 3ESRA 3TE6A 5A7HA 5AR1A 3BA1A 4J0QA 5B3JA 3PXAA 4A9AA 1NURA 4PRZA 4IQ8A 1MENA 1D1SA 2GMWA 4LJYA 2NMVA 1YA6A 1KC3A 1ZL0A 4MRAA 3ZZNA 1DO8A 3SK0A 1RXWA 5A9TA 3SZRA 3T54A 3RAPR 1HDYA 5AVXA 1N1GA 1NPTO 2FZEA 1JYSA 1NAIA 1NV8A 2X2OA 1FX0B 1LK7A 3EDOA 4H7PA 4B3BA 3TRDA 1QO0A 4MHTA 2I54A 5GM1A 2AW3A 5L4SA 2XNJA 5G02A 4RK5A 1Q77A 2MTBA 4MVXA 4QVGA 4PWYA 3U7FB 4XDYA 4Z4GA 3GP8A 1LCIA 1P2SA 1U8ZA 5LP6C 4H1WA 2GZ2A 2CNOA 5ALPA 3GYBA 5KDOA 3HXQA 5DEIA 3TR5A 4JLSA 3JYQA 3G3EA 2KMLA 1JRLA 5JCJD 4LF4B 2ZIWB 3QEOA 1PE0A 1MT3A 1QTIA 2G9UA 1EWTA 3WRXC 1U2TA 1D0SA 3W9UA 3THYB 3AW8A 1PEAA 2H59A 2WVAA 1A9QA 4OJYA 3U4IA 4E46A 1PG2A 2YHAA 4G0XA 4KO3S 2QL9A 3AO0B 4IIUA 1XMJA 3QPVA 4Q3OA 2H7VA 4YDSA 3T34A 3ZHSA 1IM8A 3WA7A 4ZOAA 5G1NA 4BZQA 4R1TA 1QB7A 4ENVA 3TG8A 4ZT2A 3EH2A 3C0KA 2JL1A 2E5WA 4X1IA 3JWEA 3PGXA 2ZRDA 2BM9A 3DCIA 1LKZA 4G0ZA 4DS3A 4XUCA 1C0PA 3DQZA 4X64B 5B7GA 2DE0X 3T5PA 4RMIA 1EGVB 3OEED 3ZQ6A 2FPIA 4AO7A 2NZVG 3Q2OA 1RMQA 1WOMA 4AKHA 4ESHA 4D9KA 1V1MB 3BRWD 3AP2A 3PQ8A 5CGZA 3JWGA 1YR6A 1OVMA 3L1IA 3AHIA 4UM8B 1ZD1A 4DLAA 2ATVA 2YZNA 3ZV6A 2W2KA 1TTPB 2P9HA 1P81A 2REXB 4M4SA 4S12A 5CYPA 2FUG6 3K9WA 4FMBB 5FLEX 2WWIA 4Q3AA 1W1WA 4I1OA 2QVLA 2UUAB 1B23P 1SCAA 2IS2A 4WXYB 2VAPA 2AFVA 4C21A 4GYKA 3RIYA 1JEOA 2VG8A 3IBTA 3N76A 2BELA 4QXQA 1JPUA 1TB4A 1F14A 3X1JA 4AF7A 5B7QA 1FUKA 1FS4A 5HOEA 3G2PA 3NV9A 4LE2A 1RJEA 1T8YA 2SICE 3G1WA 5AT1A 2M6LA 5JSZA 1CP3A 2FDCA 4TTRA 4IS2A 1VQ1A 3A37A 1G5HA 1G6KA 2AI3A 1KJIA 4KXXA 3UZUA 4DE5A 2QTTA 1AZWA 2PU7A 4AQDA 3QVLA 5JSQA 5JNSA 3I34X 3O9VA 4G4IA 4DCOA 4C01A 3T1HB 1YU6A 3F67A 2L19A 2PUBA 1X7ZB 3CONA 5ERXA 4MV1A 4QNNA 4KCGA 3V2GA 2C03A 4N3NA 3KL2A 1N2CE 2BKVA 2CV1A 3MBOA 1JB9A 2PZEA 1FXSA 4D9GA 4RULA 5A5DA 2YBDA 1DWPA 1VP3A 2XXJA 4ATNA 5JJLA 4DDTA 1IY9A 1GXSA 1Y8CA 2XD9A 2WYHA 4UHEA 1E1QD 4BKOA 4PYNA 2DLCX 3ENZA 3UJ9A 4CDMA 1D2MA 1J23A 1FXUA 5ALUA 4HYQA 1L6IA 2VNAA 4P81A 5JROA 4OHBA 2QW0X 1O97C 4YPOA 1AQ6A 2WEKA 4ZREA 4EGAA 5A4AA 3CISA 2QPAA 2X4LA 3GEIA 3DNPA 3LRPA 4JR1A 4RY2A 1N6RA 4BQFA 2BMDA 2JFFA 1P31A 3BB3A 4BX2A 4MDHA 3OD5A 3AGQA 1MQ9A 2QZ4A 4B6RA 2OO5C 2QTWB 1E0DA 1U4NA 1NSTA 4YALA 3ZD6A 3SC2A 1GLNA 4NSNA 4KEAA 2JDIA 1X6VA 2JK0A 1SVIA 1ZIPA 2B8NA 2HLDA 3M49A 1IN8A 1E6UA 2ZIAA 3ANLA 4P4TA 4YCCA 5KVAA 1VB5A 3PJRA 1YOBA 3HHPA 1IJKA 2ILTA 3KKQA 3LC1O 3LG2A 4OMUA 1TAUA 3PUJA 2Y1OA 2YXDA 1LWNA 2A1TS 5H5JA 3KDPA 1B6GA 2CVFA 2M1XA 1J8QA 3ZHXA 1L4HA 2IY8A 3R8XA 3K6KA 5MF6A 5AI0A 3BF8A 3R8CA 4XQEA 4BP3A 1WTAA 2JJQA 2BDEA 2IHKA 1R50A 3PEUA 4Z54A 2O3UA 4Z53A 1YRLA 3QH4A 4MUNA 4INAA 4D56A 4JUBA 1IXKA 1RAAA 1SVLA 2YW9A 3JTMA 1L1RA 2AVNA 3MT8A 3CX4A 4IWNA 2C1XA 3ZE8A 5BNWA 2QBYA 2VQSA 2Z56A 4R8MA 1RYFA 3GF4A 5AJXA 5AK0A 3MS7A 2F3PA 1YA8A 4KREA 1JJAA 1MBZA 4QBKA 4XGRA 1PL6A 2HI0A 4NU6A 1W47A 4BNGA 4D42A 4DRXB 1M2OB 3GEGA 3RS4A 4BLUA 1KRWA 3UV3A 4JOCA 5ELXA 4K2AA 4LV6A 3E3AA 4JR0A 5FH9A 1COWA 3T94A 2WZCA 3DDNA 3E5HA 5IUKC 4B3FX 1GNSA 2BRUA 5G1PA 3SJAA 4BQNA 2AR0A 4FYKA 4Q7KA 5AM3A 3GJZA 2P2LA 1A9YA 3ND6A 4LF9B 4KAAA 1G5FA 3JD2A 4HQRA 4C7OA 2B7LA 1GY8A 2QD4A 4KQFA 2AS0A 2B8TA 2UVPA 3CRW1 4P3OA 4KDFA 2BBTA 1RWVA 3EIFA 4ILEA 1FE8A 1VBNA 1VKHA 3J7TA 3V4RA 4KDCA 2Q46A 4KMOA 4PWZA 3G9XA 3DTVB 2WFLB 5ENDA 4Q18A 5A05A 2I76A 3UB4A 3VVBA 4BZPA 5KHLB 3IV7A 2ZIXB 3QUAA 1CZNA 3FFXA 4DA8A 1P6UA 1WXGA 1FNDA 2OAEA 2OCYC 1V5GA 1WRBA 4DJTA 2GERA 3I2JA 1X7WB 1TAGA 1NLZA 2FWNA 2QD1A 5HK8A 4EX7A 5JOQA 3EY9A 3KLMX 5JDIC 3RG8A 1ZMRA 2HJ9A 1E5LA 3JZIA 5FNVA 3KUCA 2ALJA 3FIJA 4B43A 3ZDCA 2JLQA 4RELA 4HVTA 1MCZA 2SCUB 1AY0A 2GVDC 3K71B 1CJBA 1J0CA 4W5OA 3S40A 4NAVA 3K0AA 1M3SA 5BN3A 1NXTA 3NKVA 1FFXA 4LRUA 2V55B 4ZC8A 3T3EA 1UK7A 3AM5A 3B6MA 2FGKA 3U3KA 2AOWA 3JASB 3KQSA 4J0IA 5FPKA 3M3HA 4JWKA 4RTLA 1Y37A 3C7KA 4F9TA 1L5QA 2B37A 2VRCA 3EOAI 4KIJA 5EJIA 1LSJA 1YI8A 2NXNA 4ZU3A 4HB3A 4JI2B 2WHXA 2RIRA 4EP1A 1UBOS 2HR1A 1X77A 2NSYA 2Q0HA 5AKZA 1CEYA 2GZAA 4LHXA 4AN0A 1R64A 1TRHA 3IMFA 1PLJA 3V4PB 1YQWA 1TQ6A 3CZMA 2O0LA 4FEEA 2X5OA 4L2IB 2CNKA 1ZM4A 2VBGA 1XRLA 3AEZA 3INYA 4Q47A 3EQZA 4NMHA 1SURA 4WKOA 4UUBA 1K5DA 2H16A 1V6SA 3GO4A 3SC6A 3E35A 2HD4A 1KAQA 3GXOA 3HPQA 4KXQA 5GWXA 1VLMA 3KBBA 2EWWA 4E4RA 1BYUA 3KT6A 2B25A 5LVAA 4RTJA 1HEIA 1YK1A 2FEOA 1G7CA 4RKWA 1PFGA 4TT3A 3UHAA 3R9WA 1L4KA 1K4KA 4GYJA 4BMXA 4RZ3A 1UDCA 2L0XA 3NNNA 4OFZA 1RCUA 4XIFA 2Z57A 2C5SA 3D7NA 4GS5A 2PYDA 2GDJA 3I01A 2EGGA 1FRNA 3FDZA 5HG0A 5EJ5A 1JG7A 1A69A 1WMBA 3V1NA 1N7IA 3PLAE 4W4TA 3SGLA 5ILGA 1A8QA 3KP1A 3PHCA 1X0XA 2ZJOA 4OM7A 1U80A 1DOZA 5AUNB 3ZNNA 2Z2ZA 3UNXA 3DCNA 2R6JA 5KHOC 4DARA 5LQRA 4NMWA 4X7MA 4MW5A 1GDDA 4AUMA 2I8LA 4JT8A 4ENTA 3VTZA 2P35A 3GLFB 1DRWA 1KIAA 2MYUA 2UZ1A 2ACVA 2Q3HA 5JCPA 3RKSA 4JJ4A 3WQSB 5B1DA 5KI6A 3DV2A 3LC7O 5E2AA 1QH8B 2EKBA 1LGYA 2AMYA 4L16A 3EXFA 4F45A 1TUBA 2XQJA 1PVOA 4N3BA 3VOTA 1V1RB 2A0WA 1P0MA 3LC2O 5CXQA 5K3OA 1XVTA 3EPKA 3CF6R 4P1ZA 5DF1A 1LB1B 2FF7A 3DB1A 2QG6A 1EG2A 3K16A 2J7KA 1PJ4A 2QL6A 4MMZB 3WV5A 2BEWA 4JGIA 4OCZA 3LBHA 3FYDA 3H5VA 5EOVA 3ETHA 2PPVA 3GGSA 2C99A 2QZSA 4NULA 3ZTYA 5KQGA 4BTEA 3A04A 1AKVA 1XDSA 2AEJA 4HAYA 3NDRA 4IINA 4RMNA 2FQWA 4GE3A 2ZE5A 1IB6A 3F49S 3LLCA 3Q6NA 4CJXA 1E7QA 1T4CA 4ND1A 2HFJA 1G21B 4U3JB 2VEDA 3M89A 2J0QA 1W75A 3MBIA 3P26A 2DQZA 4G0YA 5JCOA 3UFXA 1QFXA 1EA7A 2OHGA 1ESZA 3H0KA 3UXEA 3BC1A 1TEVA 1NFFA 5J9FA 1VIVA 2XVZA 3AHFA 4PINA 5AW5A 1A7KA 4D92A 1G7TA 1HYGA 5A5VA 5DHAA 1QIEA 5ITSA 1A96A 2NO1A 1RMYA 4IDPA 3N2EA 1R27A 2IUFA 3E1KA 3DAFA 2PUVA 4PYLA 3PHIA 3D0RA 3K1AA 1VSVA 4NMMA 3V7WA 1AXRA 3V7UA 5LN1A 3BCHA 1M5UA 2YRFA 3O9MA 1DNPA 1YJ8A 1I7DA 3MMPA 1KY5A 4ZZ0A 1G8SA 5E6UA 4ZO4A 3ZI4A 2A0XA 3NOOA 3WDMA 1L8OA 5DBFA 1HYQA 3A9CA 5AYVA 3SIRA 4AZ3A 4R6WA 1UBEA 1MFZA 2CMFA 4IH9A 4PGFA 1TC2A 2IT1A 1VM6A 2QY9A 2R48A 3MTAA 3ZWKA 2H1WA 5TPZD 5B7PA 3PP8A 2AOVA 2JFNA 1IHYA 3OG9A 2POCA 3H5RA 1EUCA 3PNSA 1RBMA 2G1UA 3DHVA 1ICEA 4BLVA 4O1IA 3GDFA 2VOEA 4EYQA 3IQWA 3ZQUA 4IIJA 2C57A 3CNNA 1YCGA 1WZEA 5EWMA 4I55F 4HLQB 3ZQKA 2OQRA 3OQHA 2FX2A 4G1VA 1E4EA 3P5BA 4Z4QA 1YB6A 1C29B 4HTFB 2BFFB 4G4SO 4KP7A 4Q34A 5EHGA 5IVHA 4S0ZA 1E9EA 2QOEA 3V8MA 3FPJA 2C61A 3N8GA 4DILA 3H11A 4MGZR 4RA9B 4ETWA 5C3UA 4LOJA 2AIRA 1W94A 4HC4A 521PA 2CVZA 2HMTA 4ZJPA 5CG1A 2VH1A 3RRYA 4E5SA 3PEYA 1CVLA 3LDGA 4MDEA 3DWFA 4B3CA 1QZ3A 3S3TA 3GL9A 2HF7A 2QW8A 2QMUA 3LL4A 1SCDA 4Q3DA 1QIGA 2V4ZA 1IOLA 1O8BA 4LKRA 2PZJA 3UUFA 3ZCRA 4E5DA 1UDXA 4WBNA 4NZZA 3VC7A 3HCFA 4ZVLA 3CG0A 3EODA 1TA9A 5GOZA 3ZHTA 4RJIA 3LX8A 4FMDF 1XTJA 3HFSA 5AW1A 2XUZA 3RWOA 5ECYA 3W8RA 3AVXA 1G64A 3CEPB 4NZNA 4D6XA 4K86A 3FG9A 4M0UA 5AK6A 1SXGA 2X2EA 3V1MA 2P79A 2VDMB 1XFDA 3HEBA 3H8SA