2FHPA

Crystal structure of putative methylase from enterococcus faecalis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
183
structure length
183
Chain Sequence
AMRVISGEYGGRRLKALDGDNTRPTTDKVKESIFNMIGPYFDGGMALDLYSGSGGLAIEAVSRGMDKSICIEKNFAALKVIKENIAITKEPEKFEVRKMDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKMLERQLLTNEAVIVCETDKTVKLPETIGTLKKTRETVYGITQVTIYRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords methylase, putative
publication title Crystal Structure of Putative Methylase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 57
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fhpA00
1KPIA 3EEYA 3JWGA 3B3FA 2ZBPA 3MQ2A 3DMGA 3G8AA 5DX0A 4CWAA 2IGTA 5EIFA 3CJQA 2NXEA 8MHTA 1JR4A 2ZWVA 2XVAA 1F38A 1WXWA 5FADA 1NW3A 2NXJA 2ZIGA 2ERCA 2P3OA 2ZSUA 3C6MA 2AOWA 2GA9A 2XYRA 3DMHA 5CCBA 4OX9Y 1ZKDA 2CKDA 2PWYA 4LWPA 5CVVA 2PX8A 2R6ZA 2ZTHA 4PYKA 4A6EA 4PYIA 4DM3A 2Y1XA 5FTWA 1Z3CA 4F85A 5M5BA 5F2OA 2C7RA 4POOA 5LR6A 4X1OA 4AZVA 2G1PA 2PT9A 5FULA 2P3QA 3FUUA 5CVUA 2UZ4A 2UYQA 4XUCA 2YTZA 4PONA 4QTUB 4NECA 2CL5A 3R9XB 2AN3A 2PT6A 5GM2A 4BLUA 2V7EA 3EPPA 3A7DA 3ORHA 3EVFA 1G55A 3DULA 2FHPA 4HGYA 3F4KA 1RJGA 3NWBA 3KQOA 2GB4A 4L7VA 3TLJA 4FR0A 3EEOA 4YV2A 2ADMA 1YB2A 3HEMA 5FHQA 2PLWA 5EMKA 3OZTA 3LKZA 5E9JA 3ELUA 2E5WA 3CGGA 2IH5A 2FYTA 5LQAA 5EKXA 1H1DA 3OE5A 3DH0A 5FA8A 1Q0TA 3PLAE 3C0KA 1Q0SA 4E33A 3NWEA 3EVBA 1YZHA 3C6KA 3HA7A 3G7UA 2GPYA 4PCAA 3EVAA 3HCEA 5T67A 3GCZA 4RTKA 4Y30A 2P7IA 4AZSA 3MCTA 4RTJA 2ORED 2YUIA 5GP1A 1NW6A 2F8LA 3BGIA 3BWYA 5KS2A 4PYQA 4OBXA 4PINA 2Z6QA 5DX8A 3LGAA 2G71A 2QE6A 3DR5A 3KPYA 3M70A 4HSGA 1YFLA 4RSRA 5KVAA 5C1IA 3G8BA 2P3LA 3R24A 4WVLA 3P2IA 1WS6A 2PGXA 1JTFA 3P9NA 4E30A 4RTMA 4KWCA 2ZZMA 2YVLA 5EOVA 2O05A 5DRTA 2WA2A 4BLWA 3BT7A 1G8AA 1ZGJA 2NXNA 1IM8A 5E8JA 5EHGA 1RI2A 4R6WA 3REOA 3UJCA 1I4WA 2P35A 3DXXA 4KRGA 4PYMA 5CVJA 5MHTA 2Q41A 3PFHA 5T6BA 3PX3A 5B1SA 2GS9A 3OE4A 3O4FA 4WXHA 2NP6A 3QV2A 3ID6C 1ZQ9A 4GQBA 5C0OE 3EVCA 4ER6A 3GRUA 3KQMA 3EGIA 2OKCA 2O0LA 2Z6UA 1FPQA 4R8RA 5EHIA 3TPZA 1KP9A 4C05A 4FP9A 3MB5A 4U7PB 4RTOA 1R8XA 5GINE 3FUTA 3ER8A 1VE3A 4RYLA 1L3CA 5D1HA 1EJ6A 3SVZA 2ZVJA 1R74A 2P1DA 1N7IA 4HRAA 5LQCA 2QM3A 4QTTB 5E1MA 4OA5A 4C08A 2IDJA 1X1AA 3KHKA 1X1DA 3PS9A 4P7KA 2O57A 2C7OA 2JJQA 1FP2A 3DMFA 5FQNA 3V8VA 3NMUF 4XUDA 4MWZA 4CTKA 1UFKA 2NNWB 4M37A 4RVDA 2BZGA 1O9HA 3QOWA 4PGGA 4ER5A 4BY9E 3FTFA 1IXKA 3P71T 4GF5A 2B2CA 4RX1A 4PYLA 5DTRA 5F2KA 3SXJA 5CIYA 4DCMA 3CC8A 1G60A 2PWPA 3LHDA 3OU6A 4DF3A 1WG8A 3C3PA 5D1NA 5GOZA 2IFTA 2BM9A 1R6AA 2P40A 3VSEA 2PJDA 4HG2A 1R8YA 3BGDA 5K0EA 2XVMA 1L9KA 5EPEA 3UJ7A 2PY6A 1TW3A 2OPBA 2GLUA 1VBFA 2AOUB 1FP1D 3DUWA 3LCUA 3FUWA 3P9CA 3CBGA 3R0QA 3WSTA 1XTPA 2ESRA 3E23A 3FPGA 5E1OA 2IPXA 3GNLA 3LPMA 2VZ9A 3P2KA 4AUKA 3ERCA 4QVGA 2ZIFA 2I6GA 3NVMB 5HIKA 3AXTA 1G38A 3MHTA 5K8VA 1JG4A 3K6RA 3A4TA 4KVZA 4R8SA 3FRHA 2BR4A 4E70A 2FCAA 2DPMA 4PYJA 4EVIA 1JQDA 2PX5A 3RW9A 3ELWA 2P8JA 1YFJA 1O9GA 1JG2A 3HCFA 3EVDA 2AOTA 2ZLBA 1QAQA 1XJ5A 3KPJA 2FK7A 3ME5A 5DSXA 3KQWA 3T7RA 4P58A 5GIOE 4QPNA 1NW7A 3PT9A 4AZTA 4C4AA 2AOXA 1NKVA 2CWWA 5GM1A 4YUVA 1JQ3A 3HP7A 4UOEA 5JR3A 3P97A 1M0EA 4DZRA 2I7CA 2I62A 2PXAA 5HIMA 3UBTA 2OXTA 5C9ZA 3AY0A 1HMYA 2YXLA 4IV0A 3HVHA 3A26A 1AV6A 5DLYA 1N7JA 3RIEA 3AJDA 2OB1A 2QRVB 3A27A 5DTQA 4CKBA 3ER9A 4RTSA 4OBWA 4GOOD 2HNKA 3GJYA 3OPNA 4Z2YA 3DLCA 2O07A 4KW7A 3IYLW 1NW8A 2OB2A 3G89A 3T7SA 4HTFB 2EJTA 5EKUA 4OA8A 1NV9A 3HCCA 4PYOA 3LCCA 5DM2A 1L3IA 3THSA 2PBFA 3M6XA 3UZUA 3TOSA 1O54A 2A14A 4CXMA 4ZTBA 3MERA 1P39A 1NT2A 3MGGA 1FJXA 1TW2A 2B3TA 1B42A 2JH9A 3B5IA 3K0BA 4V0RA 5DRYA 4F86A 3NDIA 3DOUA 3SM3A 1JSZA 1RI3A 3UJAA 4YMHA 4FT2A 5HZMA 4X60A 2AN4A 2LD4A 3G5TA 3HCBA 3P9IA 2PXXA 4H0NA 4P7JA 4GUAA 1JSXA 4ATNA 5K0JA 2ZZKA 5E1BA 4KIGA 4P7FA 5P8WA 3V97A 3LSTA 3C3YA 5GIPE 3JWHA 3JWIA 2PKWA 1FBNA 1YUBA 4DA4A 3PVCA 1NBHA 4AZWA 1BC5A 1MJFA 2EG5A 4ER0A 1XCJA 2C7QA 2YQZA 2I9KA 3GRRA 1UIRA 4BLVA 3LBYA 1RI1A 3VYWA 3G5LA 3OU7A 3PX2A 3FUXA 5DM4A 1RI4A 1QYRA 2KW5A 4U7TB 2UYCA 4ISCA 2B9EA 1SQFA 4QDKA 1U2ZA 1EG2A 3G2MA 3KQVA 5CCXA 5K0FA 4GEKA 3FPFA 5CM2Z 5HIJA 5JUWA 1UWVA 4YUYA 1VIDA 3FTCA 5ICGA 1XDUA 3AXSA 5LQJA 4E2ZA 2BH2A 3A7EA 2PV0A 3Q7EA 3KPVA 1KHHA 2GH1A 3LDUA 2ZFUA 5K09A 1V39A 3FZGA 4YV1A 2N47A 5CUQA 1DUSA 3PTAA 2HTEA 2VDVE 3E8SA 4MIKA 2VDWA 3LDFA 4A6DA 3CJRA 2EFJA 2JHAA 1SG9A 1ZGAA 5DM0A 5ICFA 2YX1A 3EGEA 3HVJA 4QQKA 2K4MA 3T0IA 1VLMA 2ONZA 3OFJA 3T7TA 1KPGA 4DCGA 5E8RA 5IH3A 3GDHA 3LECA 3FTDA 5DX1A 5KQSA 3HTXA 1SVUA 4KDRA 1P1CA 3PB3A 3FPHA 3FRIA 1XVAA 5FUBA 3ELDA 4PYNA 3UJ8A 1MHTA 5FWDA 9MHTA 2YXEA 1X1BA 5K0CA 3AWIA 1KR5A 2B78A 3FUVA 3LBFA 3SMQA 5E2AA 3BUSA 5FHRA 3VC2A 5EG5A 4R05A 3TKAA 5KYGA 4E2WA 2FK8A 3G2QA 3M6UA 4RWZA 4EKGA 2XBMA 2JHPA 4ER7A 4FSDA 3GRYA 3SSOA 3I5UA 1L1EA 5HIIA 1IY9A 4IWNA 5HILA 3TM5A 3KR1A 2WK1A 4RTPA 3UWPA 1R00A 3TM4A 3TFWA 1KIAA 2VS1A 3EMDA 4IV8A 2VDUE 4Y2HA 5DWQA 1RJDA 3I64A 4FT4A 1ZHFA 3P9KA 3DP7A 3HM2A 3DLIA 3I58A 4C03A 4XUEA 4E32A 5KQRA 1WZNA 1WXXA 3HA3A 4FSXA 4V0QA 1EAMA 1EJ0A 3M6VA 4OQDA 3UFBA 2UYHA 5EIWA 4C04A 1SKMA 4HGZA 2ZIEA 2O06A 3KQYA 4QQNA 2AVDA 2G8NA 3MTEA 5GWXA 2PSSA 3EVEA 3OU2A 2EJUA 4G56A 4X61A 1VP3A 1VP9A 3KQTA 4F84A 1R18A 4PNEA 5K05A 5T64A 1VL5A 3HA5A 3ELYA 5FQOA 4FZVA 4EKIA 3HVKA 2ZBRA 2IH2A 1NV8A 3RODA 5FWAA 1P1BA 1RJEA 3O7WA 5ICEA 2PXCA 2ZCJA 4LECA 4PGHA 7MHTA 2AOTB 2FRXA 4PWYA 1PRYA 3FPEA 3U81A 4BP3A 4FGZA 5K01A 1X1CA 1JQEA 5EC8A 3S68A 3SR4A 3TKYA 3B3GA 1D2CA 2NYUA 5BP7A 4GC9A 3OZSA 3ANXA 3BGVA 4RTLA 1RJFA 3GRZA 2NXCA 2G72A 4YV0A 1JTEA 3E7PA 2AVNA 2BR3A 5EQJB 2H1RA 2AR0A 1SUSA 2ZULA 5DM1A 4RVHA 1XXLA 3R3HA 2FPOA 5DPMA 1P91A 2PVCA 5G02A 5EMMA 2Z6AA 2NP7A 5E1DA 5U4XA 3B89A 4RTQA 3UJDA 3QOXA 1OR8A 1JG3A 2IDKA 1I9GA 4ER3A 4JXJA 4CKEA 4KDCA 3GO4A 3KQSA 3JWJA 1NBIA 2BM8A 3KU1A 5E9QA 3SX0A 2QRVA 4PCLA 1M6EX 1YZ3A 3EVZA 2XYQA 3KQPA 3LKDA 4HC4A 5EMJA 4QDJA 3TR6A 4EQZA 2AOVA 5BW5A 5K0GA 3P2EA 4YUXA 4O29A 4HTFA 3NVKI 3OCJA 3TMAA 3THRA 5BXYA 3CKKA 3NJRA 3UJBA 4CKCA 2GAFA 2V74B 3BWBA 3FTEA 1KYZA 3P8ZA 5DSTA 1KXZA 2IBTA 2B25A 3NW9A 3SSNA 5HOQA 4RTRA 5K0LA 3I9FA 4M38A 5EMLA 4GBED 2ZW9A 3M4XA 5EZSA 4PIMA 3G2OA 1QANA 4GOMD 3G2PA 3IHTA 3FYCA 2JHCA 3GU3A 5BW4A 1BOOA 1RI5A 5E9WA 5E2BA 2HWKA 1YF3A 5HFJA 3KKZA 2QY6A 1BHJA 1XCLA 1HNNA 2VP3A 4B17A 4YUZA 3X0DA 1KPHA 4YMGA 3FYDA 3A25A 1N2XA 3CCFA 4LG1A 1ORIA 1PJZA 4XCXA 2P41A 2XYVA 1X19A 4DMGA 3LCVB 3MTIA 4E31A 4E2YA 4X63A 5EEHA 3BXOA 3DTNA 2R3SA 5K0BA 3GXOA 4P7GA 2HR1A 2PX2A 3BKWA 2ZZNA 2CMGA 3IV6A 4MTLA 3BKXA 2BR5A 4RVGA 3KPWA 3KPUA 3DXZA 2HMYB 4R6XA 3MAGA 3EGVA 1QZZA 4M7RA 4RVFA 3MCZA 1XDZA 4GOND 1BKYA 1ORHA 1XDSA 2HV9A 2OY0A 3UJ9A 5IKMA 4DKJA 4K6MA 4QPPA 2EX4A 4PIPA 4CTJA 3B7PA 3O31A 5HEKA 2G70A 3KR0A 2OO3A 2IIPA 5LQNA 3E05A 5DT2A 2C7PA 4FS8A 1QAMA 3EVGA 4EK9A 5ICCA 5FCDA 3HCAA 4GC5A 4E2XA 3CJTA 2IBSA 4QVKA 3I53A 3GRVA 1Y8CA 3GIWA 5EGSA 5LSAA 2OZVA 1D2HA 5LQKA 5EEGA 3LDGA 1NW5A 4RTNA 2AZTA 5F2NA 1T43A 3HCDA 2AS0A 3PFGA 3B3JA 3NDJA 3LX6A 1D2GA 1F3LA 2Y1WA 3BWMA 1M6YA 3HVIA 3OZRA 4MQ4A 4IKPA 3SGLA 5K03A 1QAOA 2H00A 2ZWAA 5DTMA 5H02A 2WA1A 1L3BA 4OQEA 3OFKA 3H2BA 2JH8A 3HNRA 2ZBQA 5DXJA 3R6TA 2IP2A 1EQAA 2YR0A 1KYWA 10MHA 3M6WA 3TRKA 5EVJA 2QYOA 5DXAA 3UA3A 5EZQA 1NE2A 1VPTA 4KIFA 3KQQA 1EIZA 1ZG3A 3BWCA 3BZBA 5FA5A 5K0NA 1AF7A 3IEIA 2OYRA 4C06A 3G88A 5LQRA 5CD1A 3D2LA 3FPJA 4BP1A 1SQGA 1SUIA 1DL5A 1AQIA 4M36A 3SSMA 2PX4A 3M33A 5CVEA 2OBFA 5CVDA 3KR2A 4X41A 2ONYA 3CVOA 1AQJA 3UJ6A 2P7HA 1VQ1A 5ERGB 4EMSA 3TQSA 2IH4A 2H11A 3LL7A 1TPYA 4AX8A 4C07A 4MHTA 3VC1A 3L8DA 4LWOA 3UA4A 3KR9A 2JG3A 3NTVA 1G6Q1 1I1NA 3GGDA 3Q87B 2AOUA 3DXYA 3EMBA 3GWZA 4HH4A 4DQ0A 5LQUA 2CMHA 1G8SA 1JG1A 2DULA 2YXDA 1INLA 4GOLD 1DCTA 1WY7A 4YUWA 2AN5A 2UYOA 4RV9A
chains in the Genus database with same CATH superfamily
1TCVA 2E4AA 2V8BA 3JWGA 1SUFA 1J21A 3G8AA 1AKWA 1TCUA 1JYEA 1NONA 1C8BA 1Z0SA 3D3EA 4UUBA 4JQSA 3GVIA 2K87A 1JUDA 2C98A 2YY7A 5AI0A 5IULC 3O0DA 4YJGB 6PFKA 3LYHA 5AUPB 1PG0A 1TQ4A 1UXIA 4OD0A 5IWAB 2QTWB 1QG0A 4M7OA 1S9DA 3ZD6A 3JASB 3SP1A 2TSYB 3E81A 3QK7A 2BDUA 1SCJA 2ZB8A 2ZQZA 1JB9A 1UIMA 1W5FA 3V8MA 2GARA 5MF6A 4M99A 1OFGA 5ERXA 5BRJA 3X1ZA 5CB4B 3ABIA 4DOMA 1Q0ZA 2R44A 1O8CA 4ZVUA 1A5TA 2WM2A 2X42A 2WNSA 4K9NA 4F45A 1N75A 1TVKB 4BC1A 1JNXX 3TGPA 2PUFA 2YFYA 5AK3A 1YOBA 3L46A 2P3QA 4O08A 4BP9A 3E22A 1E2PA 2YTZA 3QU9A 2CN1A 3I39X 5TVKA 2JBAA 4JENA 4JQZA 3BXZA 3ITEA 4DIEA 5JJKA 1DJQA 5ANRB 1EUDA 3HY4A 2OSBA 3ORHA 2VRBA 4LSWA 1Z9BA 2YWGA 1RR6A 4N6GA 1WD7A 3OQVA 5AP9A 5G1NA 3H9EO 4NMMA 3SJCA 4MRMA 3GLGE 4JYCA 3KLNA 4FR0A 5AI8A 3B1XA 1F2TA 4UD2A 3H3XA 1L8AA 4NVRA 3WYGA 3QUAA 4WZAE 1RYDA 4R1LA 4JI4B 4KJXA 4P22A 1G8HA 2IC5A 4AKSA 1P3Y1 4MUHA 5DXFA 3F4BA 5TY0A 1FL9A 1SUBA 4H7KA 1XNHA 2VH2A 1KO4A 4P6VF 1SURA 2YFHA 3EVBA 5EESA 3ROZA 1QGZA 4C0WA 5DTJA 5B7GA 2WABA 4DL9A 1JSLA 1P4GA 3H19A 5CTJA 2W6PA 3ZGOA 4CV1A 3NKVA 1AO0A 1NMYA 1WCXA 4TVBA 3AP2A 1U2DA 2F8LA 1CS4C 1Z18A 3BGIA 2HWYA 2QLFA 5IXSA 4OLJA 1Z4MA 1KVRA 3WAKA 3ZV3A 4O4JB 5CDYA 2O8CB 1LDNA 3HEBA 3BRSA 1EEXB 5FPQA 4ZWNA 4BNXA 1YFLA 2OXRA 3OY7A 4BIIA 3E0QA 4RZSA 4YDSA 4DDTA 5LXTA 5EWLB 4FEEA 1XXHE 4DN6A 1JEJA 2O05A 2WAYA 2WTEA 1VL1A 3A4YA 3OI7A 3QPVA 5DRTA 4KYIB 4R0MA 3OUUA 3M6IA 5CPFA 5M04A 1RE0A 2ONJA 4YYEA 1E6UA 2P90A 1Y80A 3PF9A 3L4KA 5MHTA 1KDOA 2G7ZA 3IUYA 3L7BA 3EOAI 1NXWA 2IV2X 3QIVA 3ZE9A 3CVVA 4W9NC 3Q2OA 3W4KA 5AK4A 4CT5A 3AQ4A 3UGKA 4LJAA 2O8FA 2I7TA 2JLAA 1CRZA 4LOKA 1L7MA 1ACLA 3H2IA 5BT8A 5EHIA 5BQXA 3S3TA 4GQIA 5BQFA 5A3JA 2FN7A 4ARBA 1ZXLA 1WXDA 3ORFA 3FOFC 1GRQA 4Q93A 4JX8A 4OGWA 1FQOA 2M9MA 5HF5A 2YQ5A 3H84A 4R69A 3ZKWA 1NNEA 1CCWA 5A0TA 2Q5EA 4MUKA 2COEA 2DSNA 4MP3A 4C20A 3PKIA 2IDJA 4EGJA 1Y8ZA 1B23P 3D0RA 5GJBA 3UJ3X 2C7OA 1XMIA 1ZH0A 3BGWA 1L5HA 4CFZA 2XVXA 4CT0A 1TT7A 4HQ6A 1SRQA 4FFDA 2X3FA 5B1EA 2GAAA 1WABA 3RUCA 1YIOA 1Z35A 4ZICA 4FBLA 4A6PA 3HUEA 1NOIA 2D4AA 5IN5A 5F2KA 4KX3A 5JOQA 1QFJA 3O3NB 4FMDB 1E2JA 2F3PA 3L06A 1J0EA 4F72A 4KPUA 3KOZA 1AQUA 5FOUA 2PWPA 2CE2X 1HC7A 3B78A 2GPJA 2XUFA 2CUKA 4UPVA 2IFTA 1R6AA 1C7JA 2R48A 2PJDA 1VCOA 5SICE 3ICEA 4OK6A 5L95A 2A2ZA 2FR8A 3EBOA 4CUJA 1DRWA 1WZIA 2EKBA 2XVMA 2PUDA 2RHCA 3LU1A 1MC8A 3EQ7A 4MNTA 5IX8A 2PY6A 1QOQB 2F90A 1MW8X 2AOUB 1OU4A 2IYYA 5THQA 3DMDA 3OMXA 4R68A 2IQ5A 2EDCA 4H4CA 4ZQGA 4LF4B 3ON5A 2O8DB 2HT6A 3M6FA 3P9ZA 4KSBA 1EP1B 4G81A 3KSMA 1KJIA 4YUZA 4N6NA 1Z5NA 1L7AA 3DPSA 4Z3OA 1SG6A 1R50A 2NO4A 3SNKA 3TTSA 3EAFA 4RD4A 4J4HA 4UOZA 2H1WA 4E70A 1SU8A 1K4YA 4EVIA 2NVBA 3RW9A 1O4WA 2QG9A 1ZSYA 4YJ3F 1ZN7A 4J7UA 1YCFA 4IDCA 1QAQA 2AF3C 2CLEB 4MEJA 3O6VA 1SD5A 5IARA 5TF4A 5I9IA 4QPNA 2BY4A 3PT9A 1E32A 3GT0A 2MDTA 2RI0A 4WN9B 5CMLA 1NKVA 3A6FA 5FI0B 2C3MA 4YUVA 4UOEA 5JYCA 3TTTA 1M0EA 1WUHS 1RXSA 4L72A 2OXTA 1JR2A 4WBSA 5FPSA 2FSUA 3PA8A 2VPTA 4Y6GB 3DZ8A 4XWTA 4DE5A 2SBTA 1YBMA 2IHBA 2QRVB 3OIGA 4MPPA 4D82A 1CIPA 3QQ5A 3TQCA 1FQWA 1K7FB 2GDZA 1FDRA 1XUOA 1GU0A 2VDOB 2O07A 4HTFB 3IQWA 4QFMA 4A5SA 2JH3A 4ARCA 4OJMX 2IOYA 3PPVA 4IJMA 3F6SA 2C2BA 2I33A 4O1MA 2BI7A 4QC2A 2XA2A 4OFXA 2X5XA 1VTKA 1N5KA 3BIXA 3DZFA 3PPXA 3E1SA 1P4AA 2IEAA 3IOYA 3MJVA 3OQIA 1G5FA 1LJ8A 1I7QB 5F77A 1QH1A 3MGGA 2QPLA 3Q6MA 1TW2A 2P91A 2EP7A 1T36A 2QIPA 1DKLA 2E21A 3DO6A 4OXKA 5AWFC 1ZW1A 1G5RA 2Z95A 2F1KA 1JSZA 4BUCA 4FT2A 2CNDA 1GARA 2GZMA 3HJTA 3SQWA 3BIFA 1E2NA 1P29A 2ZCUA 1F8UA 2YNMC 4L9RA 4RORA 2PDAA 2NX2A 3RYHA 2ZR9A 3HJCA 5DVZA 3UW1A 3N8HA 3OJLA 2XKKA 3C3YA 5A05A 2IHZA 4BU1A 2I4NA 3MYYA 1RYEA 4DHWA 4Y2SA 1R8SA 1NYLA 3OZCA 3QH4A 4IXTA 3C74A 3M82A 1MH9A 3DR3A 4W1QA 2BE9A 2X9GA 2WYUA 3LY8A 4C29A 1XPJA 2G6BA 4ISCA 1LRJA 3RK1A 1Q2UA 1GRVA 2A5JA 4F2DA 1VB3A 1K0FA 2YWFA 4KVAA 3I32A 3RLFA 4CMJA 1XVUA 1KH1A 1MJGA 4QUIA 4AP6A 4HZUA 1MEOA 1UBTS 2A88A 2P68A 3CPHA 2HPHA 1HRDA 3EXEB 3PC2A 4Z1MA 2G5PA 4O4LA 4C6TA 7REQB 1XDBA 2G36A 3GUVA 3D2CA 3QYPA 4KXWA 1XK6A 2WYOA 4H15A 4MR7B 3O95A 2DU8A 1M2FA 1AK1A 2E49A 3CJRA 5HJEA 5EP4A 1AS0A 4EPTA 2K4MA 1XMXA 4X7PA 4D9JA 2QROA 3UM9A 5JASA 2VJYA 2GN4A 2O7RA 3PCRB 4S2EA 1A8IA 3NM5A 1KGDA 1O1YA 3FTDA 3ODGA 1B3BA 2PKXA 3UCEA 1IPFA 5CG2A 3UK1A 4DA7A 1PUXA 4XGRA 1NXTA 2VYCA 3W3AD 1TZ2A 2FVXA 3VI3B 1ZUHA 1G7TA 1M5UA 1NP3A 5JMTA 4D9FA 3ANTA 3I2JA 2WSLA 3VKHA 1WB6A 1XYYA 1SKAA 4R05A 4E2WA 5DHTA 5CX4A 1KAEA 4GOJA 3ZZMA 4CG2A 5KQPA 4FYHA 1RTKA 1NUAA 1HLPA 4DNQA 3I5UA 1WHTB 3KL4A 3SF8A 3B1JA 1AKQA 5AJXA 5B12A 3U80A 2WK1A 2VJLA 4NAVA 2EBFX 3TQHA 3KKLA 1ABFA 2QD5A 2VDUE 4G0QA 3A1CA 1OXSC 3DP7A 2B34A 3FPCA 1WXXA 3BWVA 4K03A 1QPZA 2ECOA 1H0SA 1X15A 2CNOA 3LA6A 4CUKA 2O06A 3UWOA 5DCUA 2AC7A 4YQEA 5JCPA 4LV5B 4PPNA 2EJUA 4BEJA 1E64A 2DQKA 2X5KO 1X7HA 1HQCA 3G0BA 3HV0A 2BMAA 2PYDA 3NHLA 3RVRA 2VYQA 4GVLA 3QX9A 2CHUA 5BR4A 1PTJC 2FDXA 3MTDA 3OT1A 4M76B 4WQMA 1PR6A 2ZBRA 2RKBA 4FZ5A 4PHFA 5FOVA 4G1UC 1ADCA 3EGDB 2AYYA 1T9GS 2I2BA 4KQ1A 4ZDWA 5DGDA 1R5NA 1Z39A 1M67A 2X9LA 4IEFB 3SS9X 1SVWA 2BGGA 2QP3A 3UUGA 3HFRA 3RVOA 4HB0A 3QUBA 2VVTA 4TKUB 4LXIA 1U9IC 4A23A 1DAHA 2ZSHA 2QG6A 3G2HA 1MPTA 3DE5X 4HDAA 4B0PA 3FMPB 3ONEA 3OZSA 4QATA 1OLSB 3MTJA 2FR0A 3TB4A 1DS6A 5DN6D 2QW1A 4BQEA 2BFCA 3CNLA 1JTEA 1WW3A 3DDSA 2BTQB 3R3ZA 3FAZA 4CM7A 4F6CA 5J1SB 2FXVA 4YJGA 4YFVA 1SXQA 2ZUBA 3R7DA 1N7GA 3T1VA 2ZRFA 3PXXA 1WMAA 3A9VA 4YMIA 2CGEA 1OTYA 1EFHA 2J3EA 3JASA 3ZXXA 1FNSA 5A4KA 1R8QA 3Q8XB 3U4MA 4DR4B 2IOFA 3V8RA 3H86A 4FYPA 3QOXA 1MZPA 5CB4A 1PZXA 1DT5A 1I9GA 3FLMA 1W76A 3HKDB 4G4SP 4IGIA 4JD5A 4JXJA 5A5DA 1YJXA 1TVKA 2GAOA 3GZNA 3WICA 2H2GA 5F9MA 1M6EX 1HYEA 3BXEA 1V6CA 1BWRA 5BQ3A 1SKQA 1STOA 1CLEA 1S7CA 3QUSA 4JR2A 4L8YA 3ZCQA 3J7AC 2UZIR 1IN5A 1XZMA 3GDGA 4DCVA 1BW9B 1ZYUA 2XEDA 2YYZA 1EFTA 2XAAA 4MVJM 3VDXA 2I55A 1FP4B 2GAFA 2HWXA 2C9DA 2HFJA 3QRWA 1QO9A 3EWSA 3HCWA 3N2GB 2OENG 4HPXB 4CRWB 2VN8A 4J9VA 2AUTA 3IBTA 4XB2A 3VUFA 4WKNA 5A7GA 2AD1A 4P31A 3GLTA 4B73A 3NETA 2Q2NA 3HKEA 3KV3O 2QNRA 3R23A 5K2MA 4TV8F 3VR2A 2ZJ5A 2VQSA 1BHJA 2IE8A 2QQEA 1H9BA 3OE7D 4TMWA 4EHNA 3X0DA 1NPYA 5KOYA 2Z1DA 4G0UA 4YMGA 1GADO 3OFVA 1N6IA 1OGYA 1Z37A 1HFJA 1TEVA 2OFXA 3BHMA 3D6UA 3T15A 2NTVA 3T3PB 3GRPA 2A9JA 1PFGA 2R25B 5JATA 4X63A 4D9CA 5FFNA 4MICA 2H9AA 4B8WA 5K0BA 3NM6B 3CZMA 1JYFA 4O4JA 4QM6A 3HABA 4JT8A 3RSOA 2BR5A 2B5VA 1JFFB 1Z6TA 3Q7RA 1RWOA 3EISA 4EPRA 4BWGA 3E3AA 4WWHA 4JX9A 3I5YA 4OQ4A 1BDMA 2PN1A 3LV8A 3WYDA 5JIBA 4A03A 3DEFA 1O95A 4D02A 3UY4A 3PUYA 4ZCIA 1FRVA 4N48A 1E9AA 5K8IA 2QB5A 2FWMX 3LQ4A 4P4NA 1W94A 3B7PA 3OQBA 4WNYA 4M6WB 1JDNA 3IPYA 4LRXA 5A5FA 4ONEA 3IAAA 5LD2B 1NI3A 3VYTB 1F60A 3ZDZB 1BG6A 4NK4A 4QPDA 3PXGA 1OIXA 2IU6A 3GIWA 1IB6A 3Q7SA 4IDAA 3W8EA 2Q5FA 1OZGA 4DC0A 5ALKA 3IOBA 4FQ5A 4X6LA 1OGJA 5BV0A 2ZI4A 2XGGA 4UAGA 3BG5A 1M3SA 1NXSA 2QX9A 2X1MA 4EMUA 1VSBA 1W2HA 4RGQA 3ZUGA 3PYMA 3NHRA 3SOZA 1KH3A 3ROQA 2FXIA 2IYVA 2VWHA 3NC4A 3GLVA 1ULSA 1SUAA 4NULA 3S55A 4FE3A 1J2EA 2JH8A 5CFRA 4ETWA 5DXJA 4BC0A 2DJIA 10MHA 2RGXA 1GZUA 2N3ZA 5U4QA 1A8SA 1PJAA 1E3JA 3STXA 4ZP1A 4D0RA 4IAOA 3OOEA 4FW8A 3II6X 5C81A 3UAZA 2OCYC 3C8MA 1WMEA 3FYSA 3TW8B 1COWA 4UHJA 4PLPA 4D8XA 2DPLA 2Q9UA 3UT5A 2FFHA 3FTNA 2OBFA 1G18A 2HUPA 3PGLA 4JLJA 4QJ5A 4U39A 5A5GA 2EF1A 2P7HA 1D7OA 5DDIP 1W0KA 3ZLUA 2Q3HA 3MILA 1EFPB 3UUWA 4RMIA 2B2XA 2GHQA 2PS3A 3AF0A 2AOUA 4L95C 4ZU6X 2IW3A 4PAWA 4JQYA 2FG6C 4FJ2A 1W96A 2A7XA 2WPDD 2B3DA 1H93A 1QCCA 1TYCA 3H5LA 2VHWA 1JLHA 1S1MA 2IKQA 4E4RA 1G8GA 1K68A 3D6NB 3WGKA 4JUIA 1I0ZA 1OX6A 5KDLA 2REQA 1WPXA 1I0LA 3HB4X 1ZCJA 2Z30A 4BJ3A 4BL5A 2XVAA 4BFZA 4O4JF 5HMMA 2FEPA 1N2CB 2P3OA 4K9RA 2B1JA 2NG1A 3RU2A 3ITNA 4AJ2A 5JFGA 2PX8A 2ZTHA 4WN9A 5DLPA 4CIXA 4EFKA 1T1RA 5LA6B 5CHYA 2W6MA 5ILOA 1PFQA 4TMXA 3CZAA 1SCUA 2UDPA 5CGQB 2NU9B 2JLYA 1CQIA 3EDCA 1S2MA 4AZVA 5HNKA 1GZ5A 4PZ9A 1SZCA 1QLWA 2VNIA 1XMQB 4URZR 3MT9A 4ZDIA 3OUZA 4OXXA 2AUMA 2ZWOA 1VKJA 2WT8A 3E8MA 3F5FA 3L0CA 4IJKA 3GW8A 4Z8XA 3K4PA 2I3DA 3WNVA 1IEXA 1A8PA 1RRVA 1GTG1 4M0UA 4NY1A 3RYIB 5A2QA 3UJNA 1Q74A 1CY4A 2VKTA 1X1SA 2RDMA 3IDAA 1SXIA 1E2EA 1NUUA 2PT7A 3JW8A 4MZXA 3EE6A 3G6WA 4KSCA 2VSYA 3TLJA 3K9QO 6Q21A 5JAUA 3KETA 4N18A 4HB2A 4A6XA 2G1KA 2AJTA 3O1JC 2ENWA 3OZTA 4TMZA 2E5WA 1DP4A 2ZTLA 4TXHA 1YB7A 3C5VA 5DK4A 5DMXA 1XCOA 3QE0A 1P1RA 4HLUA 1DC6A 3K2QA 4MRRA 3ZE0B 4AF8A 3ZUPA 2D3WA 2Z3WA 3PFNA 1YZHA 1GUBA 3HA7A 2WQ7A 1IJEA 2Y8EA 4RTKA 2VWGA 3EULA 4H2DA 5JZSA 2AMJA 1IHOA 3V9PA 4S05A 1E2MA 1KAQA 4Q39A 4LZJA 2OYCA 2IXEA 1HETA 3R7SA 4BLPA 2VRCA 4PYQA 2QZSA 3ICQB 3KWMA 1WZUA 1MF7A 1E7MA 2QE6A 3OURA 1S2DA 4HT3B 2HW8A 1POXA 1P4JA 2B1GA 3WHIA 4JP1A 1T91A 5CEFA 4TMVA 4XQEA 5JSKA 1BJKA 1G98A 2AJDA 3EQ8A 3CONA 2ZYUX 1V8PA 1GSAA 1RI2A 4PQYA 3VM6A 2WIDA 2P35A 4MGIR 1CR4A 2RGRA 1ADFA 2PKCA 4FW9A 3VJLA 1BO6A 2J41A 1LRLA 2QE7A 4Q1CA 1XZAA 3ZK9A 1P4SA 3GHHA 1H6AA 1SCAA 3GRUA 3RVDA 1DRJA 4GX5A 3ET5A 3VR6D 1T13A 2QD1A 5JY6A 2XUJA 4NBLA 3O8CA 3S2IA 1WCWA 4B3DA 1AKVA 2AF4C 1D2RA 3BF8A 1C7QA 1VMKA 3IIMA 1T25A 3L7MA 1G0OA 3ONFA 4URUR 5DF1A 4Z7NB 1XD2B 3UMGA 5C1PA 2VDPB 1J9EA 3K1YA 1W5BA 3HMKA 1JAIA 3LHIA 1EXMA 4K6CA 4O1HA 4JVOA 4P98A 2WWIA 4RHXA 5FQNA 1XLTC 1NF3A 4X8LA 1QVAA 4XUDA 2VHXA 4GO1A 4J07A 2BI4A 2NNWB 1PJCA 4JBGA 4WHMA 3QLVC 5AM2A 2HF2A 3UGJA 4HRYA 3WSWA 1U0JA 4BFSA 5DISB 1H22A 4YO7A 3AJ8A 1I24A 1SBQA 1ZL0A 4RX1A 4AWAA 4V0ME 2A5YB 1B74A 4QGGA 4MW5A 1H9AA 3J7TA 3VR3D 3I1FA 5AVUA 3QTLA 4LKRA 2WAXA 3O2JA 4X90A 1QV6A 3FM9A 2BM9A 1Q17A 2IXGA 1EESA 2E7ZA 3BILA 5LYJF 1E3DA 4NYIR 4CN9A 1PJ8A 1TGYA 4PXAA 3BWDD 4UTVA 3N6XA 1JFLA 3LFUA 4OI4A 1P7PA 2HCFA 5DIFA 4ZVLA 3CPEA 3U4CA 3ST7A 3BRWA 4E5VA 2H1LA 4L50A 3NPMA 5JXHA 2HA7A 2WT4A 2MR5A 3Q5EA 5EUMA 4YHHB 2VO1A 1DZ3A 2VRWA 3AOEC 3BBLA 3FWZA 4HB4A 4KXYA 5E1OA 3HY3A 5EAIA 1PGPA 1Z45A 4B34A 1NC3A 3CA8A 1TU4A 3MLEA 4OQPA 4RQUA 2I6GA 3ZE2B 4Q4DA 4UTPA 4WECA 3NUGA 4DIUA 3TEJA 3QXSA 2ZKIA 1QRUA 1JLLB 2DBZA 2IOHA 3A4TA 5KINB 3JQ8B 1JFRA 3PUHA 2G77B 4YMUA 5CFOA 1I1HA 5LKAA 1VMAA 1YZGA 2QW8A 3LUBA 4E94A 2BPOA 1JG2A 1K8ZB 2W6JA 621PA 1YA4A 2OGZA 2NU8B 3GLFE 3OTWA 2RD2A 3T7RA 3CUTA 2UUOA 1L7VC 1ECCA 1XZGA 2DE0X 3F67A 5ABPA 4AZTA 4OXQA 4P0TA 4UFNA 1YDHA 2DFNA 4G4IA 4KGZA 1PR4A 1R1DA 3NTUA 1RRKA 1PL8A 1SOUA 4YPFA 1JLSA 3MUFA 1WP4A 5AOBA 4I4LA 3SKXA 4I9NA 2PVSA 4O8ZA 3BMNB 4HXEB 3Q3IA 4GOOD 3GJYA 1FVFA 2BTQA 2EBWA 4RCVA 2GAJA 1QHXA 1TYDE 5JAPA 3BAFA 4D8VA 4R3UC 3JQQA 1Q7CA 3PRHA 4LK2A 4MDEA 5CIQA 1X39A 1RWWA 1CUXA 1W19A 4GR4A 1M1YB 4HLCA 2Y1CA 5CNIA 5SZHB 3HFGA 4X5OA 3GAAA 4KFTA 1RKBA 4TM7A 4MO9A 2ISSD 3V4PB 5IVHA 2WF6A 2VXYA 3GD7A 3HKDA 3KT6A 2A9KA 2VT3A 1T3TA 3B5IA 1MTOA 2VK8A 4PY2A 4U3JB 5DRYA 3WLNA 1BDHA 2WD7B 3LAWA 1NIJA 4HB3A 1JKXA 3ZY3A 2CJFA 3D6AA 4PFSA 4RIIA 4BMVA 2XDYA 3R9XA 4LJ8A 1LF0A 4QOEA 4G9BA 3VTFA 1N6KA 4D9EA 1JP7A 3CZRA 4XWGA 3JQEA 3CF2A 1RBZA 4KQGA 4BVJA 1Z12A 3U9TA 2CK3D 1TA4A 1MG0A 1AB6A 1ZWKA 2XRYA 3BH0A 3TD2A 2CLKB 3C7DB 4KAXA 4UCWA 1OH5A 1T2DA 1YQEA 4HQOA 4XQCA 3OZVA 5BYJA 3BORA 4GVPA 2MHCA 4RF3A 1ULZA 3ZG6A 5JBIA 1XCJA 4KZKA 4ZO6A 2G0AA 5KX5F 5M3BA 2I5PO 3NUZA 4GE0A 4Z9XA 4KMSA 1QIGA 2FZ5A 3T95A 2VNSA 5JH7B 1XD8A 5KWJA 1JJIA 2YZGA 4D96A 2XT0A 2QGFA 1CQJB 1E79D 1U2ZA 2EL9A 3G2MA 1G3QA 4BKQA 4A8JC 3FPFA 4JNCA 3AG5A 4O2LA 2D54A 1FMFA 4QDZA 3KO8A 1E0SA 4OB6A 1U3CA 2QGZA 3PCXA 3Q7EA 1UM8A 3UBMA 5ADVA 5ECWA 2JLWA 4YIKA 4GEGA 2Y68A 2WF5A 1X1QA 2QLNA 1X2BA 3E8SA 5C8YF 1NBWB 3R4VA 2AXPA 2Y77A 3T7TA 2VTBB 1O0CA 1RQRA 2A35A 2ZSJA 4F9GA 5M2QA 2QD3A 5E8RA 4AMZA 3HK2A 2FH5B 2Z09A 9GPBA 3QWIA 3P0EA 1LNZA 2C59A 2C4WA 2FEOA 3LK6A 1RHMA 3NBZC 2PO5A 3FWHA 3JVDA 4L16A 4LVCA 4UQOA 2GBPA 3X1WA 4AQYB 5EFZA 3PUIA 4M6WA 3P4XA 3ZQUA 1J8QA 3E9RA 1JDVA 1ZSNA 3ELDA 4ACAA 4ZYYA 2WHQA 4PVCA 2FY8A 2PBZA 1X0VA 1BDBA 3IVMA 3OJOA 5EPUA 5LBUA 3LBFA 3ZCVA 3IKVA 5TIIA 1ML4A 1HOXA 1WA5A 2LCFA 1RRGA 1ZOIA 2X3UA 3LLVA 2JIPA 3PDUA 2D1YA 2ZUFA 1PD1A 4LOIA 1K66A 1KMIY 3RF6A 5JSFA 1CJSA 3LUFA 5DI3B 4PG6A 3NHZA 3K35A 1L1EA 4I81A 4RGBA 5JO0A 1V7CA 2BEUA 3OTOB 2D0OB 3HYRA 4IV8A 2GMWA 2SECE 3D1JA 3V1LA 3IR7A 1DEOA 4FDMA 4CQMB 3KJZA 1E2UA 2G08A 2FQXA 2OMKA 1XA0A 1G8FA 1BD4A 1PNTA 2K2QB 2XNSA 3EHDA 1NOJA 5BSTA 3DZKA 5EIWA 4C04A 2A0FA 1YB5A 2AVDA 3TSCA 3TW8A 3SYKA 4QQ8A 4P83A 1YNSA 3AUKA 1GQYA 3RGGA 3SDZA 3H5RA 1C4OA 721PA 1Y37A 3HA5A 5A7HA 2YWRA 4GX0A 3T06B 1U04A 4D3FA 5FOWA 1Y3IA 4J29A 1N2EA 3H05A 1X2EA 4JYAB 3JQ9A 2JIBA 3CB2A 1XQ1A 4N4AA 1GTVA 2B9VA 5FAKA 2PLAA 3I9KA 2AQKA 3F3SA 1EVJA 2M1ZA 2Q6OA 1KOGA 1JECA 3VYVA 4ZVKA 1T2FA 3U9SA 4Y6LA 3K6JA 1AGXA 5KOJB 1LBTA 2PVPA 5BV8A 1EFRD 2V45A 1VDMA 2RGNC 1ZIOA 3D5EA 1QDUA 4J90A 1KI6A 2VHVA 3A6GA 4QO7A 3AHEA 4JXKA 4K8OA 4FB4A 2BGWA 1RWQA 4GOKA 3K20A 3TBKA 3U7IA 3V3KA 2A5LA 1OBHA 2F7SA 3WWDA 4BN5A 4F91B 3Q9LA 1V5EA 3OC6A 4ITVA 4MQEB 3KAPA 3PJDA 1N2CA 2ZDGA 4MIYA 5DM1A 3SLGA 1J99A 4YT8A 2CNWD 5AMXA 1OLXB 2V4UA 2Z6AA 4KQ9A 2PGAA 3NBUA 5E1DA 5TMEA 3IVGA 4AECA 3K9FC 2O0HA 3EDOA 3H1GA 5LA6A 3UMVA 1GDDA 2XUGA 1Z4OA 3MS2A 4B81A 3DV9A 2VHJA 2NU9A 1A9PA 1RDFA 4G1BA 5DHPA 4YP1A 3RFCA 4GL2A 1N8TA 1U3DA 3OZXA 4C6SA 1ZICA 221PA 2FN4A 1G6KA 1CV2A 4W63A 4DV3B 5C80A 4YACA 3K09A 3K5IA 4Z8YA 5GGYA 4BFLA 4HBGA 1I4OA 4KXUA 4ZARA 2AOVA 3MUOA 2N1MA 3FPBA 3TMKA 2FAXA 4N39A 1DAMA 3TN7A 3EZYA 4PC2A 4WKBA 2Z2IA 4P5PA 4ZMRA 1JEQB 5TDHA 3WYFA 5BXYA 3RYIA 4KBGA 2GZ3A 1DE0A 4NBTA 3UJBA 3NO4A 4FCCA 2VSNA 4RZIA 4PX3A 3FTEA 1RWVA 1WNTA 1YS4A 2V7BA 3NW9A 5HOQA 3AY6A 2ID7A 1EAYA 2IHTA 2IYZA 2BUCA 1UOOA 4BJ5A 3H9BA 1G8JA 3CUVA 5CLGA 5EZSA 5BNTA 1NBMD 4Z4GA 1Z0DA 1A9TA 1R4MB 4QJ4A 1JHAA 4RDHA 4DLBA 2HM7A 1CUHA 3PBKA 5JYDA 5TJHA 3GG9A 2JFYA 2PMDA 2DRIA 3DOHA 3TLYA 4NOJA 2N46A 1QFZA 1WF6A 3H16A 1ORIA 3PQ4A 3UJHA 1TAHA 5KMGA 1X42A 3BD8A 4DLVA 3ZH9B 4KQXA 4DMGA 3G7NA 3HPQA 3LCVB 2ET6A 1U6IA 3DHVA 4E5UA 5DBIA 3ENVA 4EPWA 2OO7A 3CINA 4Z9AA 1M1ZA 3GBSA 3K4HA 3W9BA 1Q0PA 4F6RB 3IV6A 1NX6A 4BEVA 2R87A 2HDHA 2ZIXB 3BK7A 1XWIA 4FILA 5D7NA 3WBKA 3NIDB 2D5AA 5CRIA 4D0GA 4GQAA 4L28A 1K4KA 2WKPA 3I52A 2DX7A 3MBOA 4PX9A 3AB8A 5EQDA 3DHNA 5A02A 2QY9A 1XEFA 3H42B 4MR8B 4DYDA 2OHJA 1Q95A 1ZA1A 1H8HA 4FS8A 1G5IA 1QLHA 3RT9A 3B38A 4EK9A 1SEVA 1NNSA 4RHUA 3PIRA 4EG0A 4EYQA 4GLBA 1Y8CA 5KU7A 1PEDA 5CYFA 4KREA 1A69A 1T0BA 2Q62A 3DDHA 3K1ZA 4Q1BA 5T4HA 5LQKA 3CN9A 5J4LA 4HH1A 3WLOA 4RXUA 4C7XA 3R41A 1RYMA 5BSHA 5IG2A 4G89A 1YVRA 3PITA 3FVQA 3SYMA 1R6DA 1GUFA 3EZNA 5AVZA 4FIZA 1QR6A 4JSYA 3OFKA 4D7AA 4EY8A 3BXHA 1VRVA 2FW8A 1JFTA 3TRKA 3WLTA 3PSHA 4R9NA 3UO8B 3W04A 1D1QA 3TXXA 4L8LA 7AT1A 2XUQA 1FVXA 4KR0A 1WSBA 3Q0IA 4HNUA 3JZAA 5EJEA 5I8PA 1NOKA 4RHEA 1QF9A 3O38A 4GICA 4HYTA 4I4TF 5FNVB 1SA0A 4EB0A 2OGUA 1VCIA 3JSXA 4PW0A 3FVRA 1Y9DA 1ISSA 2G5TA 3N8NA 1N8SA 2JFUA 2VTDA 3BEOA 4NABA 1N5DA 1P72A 2ZQ5A 3O8DA 5HM6A 5ENVA 1EXWA 3QWFA 3TLXA 4HGQA 2GLXA 1P74A 2LDXA 3HNOA 1W0JA 4YRCA 5DCWA 3VV2A 1S0UA 4J43A 3UA4A 3DVAA 5T8KC 3ZVNA 1ODSA 3PLRA 2QN8A 4MWGA 4FI3C 4RV4A 3NTVA 4EATA 1XQXA 5DNEA 5IBRA 4YXWD 4E5SA 2NZVG 2E55A 1GV1A 5BSVA 1EHIA 1EVIA 4NG5A 1IBKB 2RHRA 3ZCRA 2DULA 3EZ9A 4HADA 2PEZA 1N0VC 1FUIA 3H7AA 3W5VA 3EEYA 1FMLA 2B1QA 1QHSA 4H0FA 1U8AA 4HI0E 3I6YA 4PZYA 4LDNA 4XWAA 5EIFA 1IAVA 1JLLA 2JCYA 2W6IA 3N53A 3F0TA 3BHJA 4UDNA 2H6EA 3TVYA 4B6JA 5KO2A 1A2QA 2GRAA 1F38A 3RRFA 4IHJA 5FADA 4ZEXA 2NU8A 3AVWA 3D9QX 4BMCA 3E27A 2CKDA 4J0QA 1IBCA 1M8FA 3HHEA 5CM9C 1QVWA 3T1TA 3NGMA 2PKQO 2J7PA 2VATA 5AICA 4PYIA 5DHSA 4YMVA 4DM3A 2ZVDA 2QT1A 1E4VA 4PC3A 3KJNA 1BHQ1 1MU0A 3R9WA 4M21A 1F4LA 4G37A 4BCCA 4E4TA 3HA2A 3PQCA 5BYAA 3I04A 1NBEA 3O0TA 3T3MB 2DHCA 2NYVA 2Q7XA 1S2GA 3NOQA 5KHOC 1I7LA 3QGMA 2HQSA 1M34B 2JZCA 1OFTA 4R31A 3A7DA 4DMUB 4I3FA 2D2XA 1GNSA 2PJZA 5B37A 4LY0A 4GE3A 3L1KA 5B2ZA 3I8OA 3OMWA 4DM7A 1IIBA 1VBMA 4ARAA 4V1CB 1W1UA 5EZYB 3IMCA 1KY4A 1XT6A 2JFXA 2PLWA 2QTZA 2XVYA 2I54A 3OLVA 4FKBA 2IW1A 4JBHA 3VU3A 4U3JA 3TW0A 5TT1A 5B6JA 2FE4A 2IYNA 3OE5A 5CXQA 2QRQA 1V4NA 3ZJTA 3K8OE 3Q88A 1BX1A 3E9CA 1YR6A 4FUTA 3HRHA 4OATA 1PR3A 3HGTA 4V24A 3T3DA 3G7UA 3G9TA 4DCOA 5LN1A 5T4EA 1H0RA 2B8TA 1FYXA 1Z2NX 2ZSDA 3ULKA 1KFBB 3S27A 4TTSA 1TZJA 3W2HA 4OQZA 1TJNA 5C34B 3VDMA 2BEVB 1EK5A 5T4FA 2HADA 1V4VA 2W0SA 4HNGA 2H1CA 4D2IA 4AN1A 5K3FB 1F6DA 1WXIA 2NZWA 1TEXA 4RSRA 1SXJB 1UCFA 2PKQP 1UJNA 2B0CA 2JEOA 4E30A 3RVJA 2FUCA 3UWMA 2YS7A 5IU6A 2WA2A 3AVPA 2NSJA 5JEEA 1ZGJA 1DX9A 1CQJA 1E6WA 3REOA 3DXXA 3A3OA 1IDOA 3ETHA 3FZQA 4UTXA 3ZW9A 2Q41A 3QYAA 5HK9A 3LDAA 4HQRA 3OIVA 4FUQA 3WLLA 1ZQ9A 3AJRA 3DL4A 3H2GA 2PV7A 1NVVQ 2Z0MA 3PL1A 2L18A 1UKCA 3UXHA 2HF9A 4CW7A 5A5EA 3FN4A 4BNYA 5C53B 2HYIC 2A78A 4NF2A 2QP9X 1P7WA 1U1FA 4DS3A 3AHDA 4ZJYA 1BE1A 3CG0A 2CKMA 2JI8A 1KO8A 1MC5A 1O94D 1Z56C 3HFJA 4GT1A 4MX8A 2VTBA 3EFOB 2OQVA 3IERA 1B41A 3OJ0A 4MUAA 4FBGA 1AD2A 1R74A 2CDBA 3PR2B 5HE9A 1PT6A 3S28A 3WV4A 5BRAA 4S1WA 2HX1A 1PNRA 1IN1A 4HAYA 2Q7DA 3IDZA 3O2NA 2WWHA 3ITKA 3ZWCA 4EMBA 3RFUA 2QZPA 5M7EA 4PGGA 2I2XB 2EEZA 4BY9E 1E0AA 1B3RA 4ZO9A 3TTXA 1IXKA 3BBPA 3LRTA 1D5CA 2ZPAA 1TMYA 3EJWA 1VSVA 3HZHA 4ETNA 5MGNA 3U9LA 1MOPA 2BGKA 3ZIAD 3BHNA 2YHBA 3MLBA 2P4SA 3R74A 4L85A 4MB2A 5LB4A 3E03A 5CA1B 1GA6A 4DV4B 1YMUA 1UXOA 3WGUA 2XQKA 4XSHA 1QQ5A 4CQMA 4G0WA 3GLHE 2JW5A 1DSSG 2LV8A 3OQ6A 5KCMA 4WLOA 1EDZA 3CTPA 5DNDA 3LPMA 1W8DA 1CK4A 4IDDA 4LZZA 4CUZA 1JN0A 5IKPA 4XGIA 2P9BA 2ONCA 4IFIA 5A4FS 2W00A 1FMJA 3JV7A 1JDSA 3HO8A 2AKEA 1L5FA 4D9MA 1YI0A 2VJOA 4BCBA 4F3KA 3ELWA 3TRHA 3DCNA 5EXEA 4KDFA 3CUSA 1SH7A 2WP8J 2WTXA 3PU6A 3GLGA 3MTQA 1T8RA 3KQWA 1ICIA 1MENA 4GKBA 4LW8A 1QYIA 1Z5ZA 4M9SA 2VJCA 2D7CA 4CMIB 5IYZA 5KOJA 1O77A 5T41A 5JH7F 4MOWA 2CWWA 1PWEA 3VPXA 1B0PA 4FZ3A 2P77A 5KYXA 3GLRA 4XSGA 1KEUA 2RHMA 2I62A 2PCLA 4NC9A 1IZ9A 1EKXA 4FHCA 1ZPDA 2QLLA 4M0PA 1ECPA 1Z7WA 2HDWA 3A27A 2IKSA 4AF6A 5CFMA 2X41A 2VUIB 1E2DA 2PRJA 1FXWF 1ZJ5A 4JA2A 4R81A 4INZA 2OB2A 2H5EA 2XB2A 1ONBA 2R1UA 4MQEA 3TLEA 1I2AA 2BOVA 3MSCA 4AMVA 2OVFA 2DR2A 1E6CA 1OLXA 5FL3A 1X9IA 1PS9A 1UK7A 2V97A 3I0ZA 4JB3A 4PZDA 3OEEA 1ZZGA 1ZOOA 3PC8C 3G8YA 1HLGA 3AL3A 5ES4B 2YXBA 2WWTA 4BAZA 1Z4JA 4LOJA 4YCBA 1VKHA 4EFNA 1NT2A 2QS9A 3M2TA 4IZHA 3PFIA 5G1PA 1IL0A 4MPTA 1HWYA 5J63A 5JSQA 1Q6ZA 5AJWA 1LS6A 2ZRGA 2F9MA 4WBXC 3UYKA 2Z2YA 3QWAA 4YMHA 2IHKA 3QX7A 4UUOA 4B6QA 2VAPA 3HCBA 3O93A 1EXVA 2PXXA 4CPDA 4Z7OB 3AGPA 1JFVA 1ZMTA 3D5TA 5A6SA 2W5UA 1U1GA 2ISCA 1JEQA 1PJSA 4KB5A 5LBIA 4BO4A 5KBYA 1ZLYA 2RHDA 2LIVA 4Q66C 5H80A 5J5AA 1U5BA 3WRWA 4TYNA 4L0DA 4C2TA 3IOEA 1FBNA 1P6UA 4H1HA 4MS4B 4ALJA 3TAUA 3IODA 5B64A 4DA4A 2DUMA 3PNKA 4AI6A 2DUUA 5FTKA 1WY5A 4HX5A 2OXFA 1SBCA 3O1IC 1GCUA 2OG2A 4IOJA 1XJWA 3X1DA 4EFMA 1PV2A 4LE2A 2DPHA 4WLNA 4ZEOA 1R4MA 2P6PA 1DI0A 3AWDA 1THZA 1Z2EA 1SUWA 4OH1A 2BI8A 4UVGA 3PQFA 1LC3A 4AJNA 1RI4A 2KW5A 3S5JA 3U2QA 5F52A 2YY6A 1A2OA 3KKEA 1MGPA 2R751 1ZH8A 3GN2A 1ECJA 2C4KA 3BXPA 4KXVA 3A1FA 2BF4A 2J33A 3FDZA 3PR1A 3KWFA 3NRCA 1KHHA 3LDUA 2V5UA 4RW0A 2CVFA 1Y1SA 2FP4A 1X7DA 2IZ0A 2MINB 4R0NA 4YH1A 3LO8A 5ED0A 2P4EA 4YMTA 1N4DA 1OAKA 1T5SA 2ZIXA 3GYGA 1SU4A 1L6RA 3LDFA 3CPJB 3LQKA 4H27A 5C8ZA 1V2HE 4EYKA 4NR0A 3NOXA 1BH6A 3HUTA 1C7RA 1VLMA 2YRFA 2GRJA 1VHQA 3K0KA 3KUDA 3AY7A 4DR3B 4COKA 2V3CC 3GDHA 5I6DA 1IBLB 2UZ1B 2X6TA 5CJ2A 1Y4AE 3UHOA 1M10A 5AHKA 4I55B 1RAIA 4MCIA 1I2BA 1TYZA 4FDLA 3RYTC 4ENPA 2IZZA 4EUKA 4YAOA 2IHNA 3D6JA 1E69A 4JC8A 1OTXA 2EZUA 3CNEA 3QVXA 3FSGD 3TNJA 2BBWA 1TJ3A 1WUTA 2FN8A 2VJDA 1WV0A 3AWIA 2FUEA 3P52A 4K3UA 1UKBA 2QT9A 3FGOA 4R1QA 1N36B 2PUCA 2CV1A 2PMFA 1L5WA 2QKYA 4F9FA 1V3TA 2IYOA 2VTEA 1KE1A 3O4HA 2G9VA 1E2FA 2WVAA 2JCXA 3KVOA 3W6OA 3OX4A 5HIIA 2RFLA 4EG5A 3D3NA 5H9WA 1JA9A 3KQNA 3BB4A 3N9IA 5E6SA 1ZA2A 5FFFA 3ROFA 3TFWA 3TM4A 3FR8A 4Q05A 2IYLD 3USES 1HNWB 2O3JA 4BQRA 3T38A 1GZDA 2ZAOA 4GXTA 3VR5D 1EDDA 5KNCA 4H7DA 4BLOA 2EQAA 2C97A 2N1BA 2CZGA 4HGZA 1T8UA 4EPXA 1KIFA 1VPVA 4XOUA 3NYWA 1NT4A 2E4VA 2PSSA 2XGSA 3I83A 3OU2A 4HDQB 1Y9EA 4NNOA 1ZBDA 4TZTA 4AMUA 1T9CA 5ARBA 3LFHA 4RVNA 3WGMA 4ZQHA 3SKYA 1JB1A 5IM4F 1G2OA 3HYSA 1Z22A 4EHAA 3AR3A 4RC9A 2XGOA 1DAKA 1WOMA 1X94A 4AD8A 4PLYA 2C5HA 3UH0A 2Z4SA 1Q2XA 2P27A 4RL6A 3R76A 2OZKA 3SHQA 1Y1QA 1PRYA 4MJLA 1Y3FE 3THOA 1YR3A 1KZ6A 2Q5IA 4JC4A 4PS1A 5AKGA 1EK1A 1MT3A 3KNZA 3NKFA 1PWYE 1AGPA 1I1QB 3IALA 1GGKA 4IH4A 1U81A 3JRNA 2W4QA 3O73A 2EGUA 4RK5A 1I6LA 1QK3A 4GC9A 4JWKA 2ZTMA 1MVLA 3LO5A 3P4YA 2FV8A 2HC9A 5DZSA 3GGOA 2FOLA 4OKIA 4QYSA 5IDVA 3X1YA 3K71B 2ZT8A 4PGMA 5AH0A 1MP0A 2UVQA 2DFDA 1QC5A 3R1IA 3TSOA 4RVHA 4CEIB 3KUUA 4MZDA 4PXYA 5FL7D 1M6VB 3LVRE 3AHHA 1K2WA 3GFVA 4TZKA 4JEIA 3D0QA 1JSCA 4I46A 1OH7A 4I5FA 1K7EB 2PLNA 1L5MA 3CXRA 3OOWA 1T6ZA 4UUAA 2JNWA 4XYMA 2NMVA 1PI3A 3HXQA 2QAJA 4RIHA 5NLLA 1UXHA 1TB4A 2BM8A 3JZDA 1YQQA 4XW2A 3F2IA 3A37A 2Z5VA 3VZSA 3KXLA 4IOLA 3DCIA 4DLWA 1DT3A 2H4YA 4NE2A 4QDJA 5C35A 1HPLA 2FJPA 2P6UA 4JASB 1NSYA 3FDIA 3IP1A 1ZHHA 4IZOA 4R1SA 2XUIA 2AFHE 1TD1A 1D9XA 4JT9A 4MHSA 3DE7X 3CH5A 1F3OA 2WYHA 3UAWA 1FSFA 2NQ8A 3CLKA 3EZ2A 5FWYB 3RFXA 4LDZA 4CKCA 4ZREA 3RNLA 4O2BB 4UBLA 1PU2A 3U3DA 3FX2A 1WZEA 5EZYA 3FJOA 4CM4B 4V1CA 1L7BA 1GCIA 2ZW9A 1PZMA 3LK7A 1UBNA 3HKBB 5AIAA 3BMCB 1T5HX 5IK2A 1GQRA 2ORVA 5B55A 3GVCA 2BTOA 5HGXA 4BX0A 2B36A 4BE4A 3N58A 2R66A 1NW4A 1O6FA 4QX6A 4JXZA 2H2FA 3BWEA 2W6CX 3DMTC 3PC7A 3V46A 1VPLA 1NVEA 5FNVF 5IVDA 1P7VA 3LTEA 1OT3A 4Y2JA 3S7ZA 3TE6A 3IBCA 3CGWA 1I6KA 3WGNA 5FH9A 1EGMB 3MTIA 5F23A 3ZGYA 3L77A 3ZWQA 1M1XB 2HF7A 3LC1O 1QIIA 3HWRA 1H66A 1LPAB 2WIAA 2YWCA 3OA2A 1C0PA 5K3FA 4BASA 2VEDA 3IPXA 4OL0A 3N0XA 3UAVA 3PP8A 1RWKA 1ZUNA 3KJEA 3NX4A 2EJVA 5JNVA 4L9SA 3RIGA 4B85A 3IMKA 3BE8A 1SOAA 3F97A 4U8GA 3PV0A 2C2OA 4H4EA 5JCJA 2F1RA 2BHNA 1WU7A 2VFAA 4MH0R 4ZCRA 2ODNA 1LLCA 2VBIA 1EG7A 2PPVA 4FYIA 1V35A 3VU1A 1PW7A 3SXUA 1FNCA 2FQWA 1JQKA 2EQ5A 2G07A 2WIBA 2XUOA 4QXOA 1QAMA 4LFCB 4P4UA 3ZBUA 2P4UA 4CTNA 1IJBA 3GK3A 3ZEAA 5ENDA 3GRVA 1E98A 3KZNA 4ZAXA 1HFEL 1JQBA 4GSKA 1ZLXA 2NPFA 3RC9A 5FAXA 3HJHA 4IDQA 3PT5A 3SSOA 4JJEA 4ARUA 2GESA 3WRXA 2UYGA 2PL1A 1GGMA 1SVIA 4PBTA 2VDNB 4LXTA 5E7MA 2AN9A 3M5CA 2EXXA 1L3BA 2X4IA 2W2PA 4NHEA 2LUOA 3PNVA 2H4WA 3MS4A 4C7JA 3Q12A 4OI0A 3HSYA 4K2AA 3MGBA 3GGSA 5DXAA 1HQYE 1VRCA 2HBQA 3BFJA 3K0FB 2DJ5A 4DMFA 1IU9A 4ZOCA 5FEUA 4HEQA 2WP0A 4NXMB 5FA5A 3GJRA 3L0IB 3IEIA 1CUWA 2G9ZA 4W9NA 4YGXB 4JLKA 2H7VA 4EB6A 2YWBA 3FPJA 1MT0A 3HBMA 4G0ZA 2RMKA 1DL5A 1BSVA 3GFGA 2P69A 4U02A 3R77A 3NQ41 3ZE1B 1CP2A 3CV3A 5AOAA 3LT5A 1RAHA 3UPTA 4F3YA 4YS6A 1XZCA 1UM9B 4PSDA 2QW0X 3EGOA 1D6JA 2HD4A 2QV0A 4LDRA 3L8DA 3AL0C 4D3ZA 2RONA 3SAJA 1UJ6A 4YASA 4JQCA 4U9IS 3WXBA 3L2OB 3ZVRA 4DR7B 2ZSBA 4O2AA 5DGCA 2I6QA 3N7AA 3B70A 5JAHA 3RYCB 2ODTX 1GTZA 2JJ1D 2ZG6A 3LHSA 1K0UA 2O0JA 5JS6A 3K0SA 2VZ0A 5FV7A 4V2IA 3JR7A 4IVQA 3CFYA 1PWHA 4AY5A 3TGWA 4E22A 3SU8A 4CF6A 5AXDA 2V1UA 5DX0A 2IYQA 3F74A 4EUFA 4G8BA 2A94A 2ZWVA 1DDIA 3B6EA 1JT9A 3VZPA 5CNMA 4UNQA 2VRNA 1WXWA 3WLFA 2WU1A 4D80A 1QP7A 5BSRA 1GPJA 5CVVA 5LUBA 1YRAA 1MAUA 2ROQA 5F5NA 4D8UA 3DE4X 1A95A 1TOAA 4KAJA 3ISVA 2W2LD 5DCYA 4CVNA 2VH5R 4QL3A 4B31A 3DXFA 1NBOA 5CK5A 1CYDA 1C4WA 2EYQA 5F2OA 5PGMA 4R83A 3G85A 1P9LA 4DA0A 2GYVA 2F3RA 1MQAA 5CVUA 4B6GA 2CXTA 3EUAA 3NS7A 5JDIC 1ZRMA 2HHJA 4XWOA 4IZIA 4OLBA 2P5YA 4ZPXA 5ILQA 2ODPA 2IEYA 4XCQA 1FJ2A 1XL0A 2AE1A 5DMHA 4N7MA 1ZR4A 1SM4A 5JMPA 1QRDA 1N32B 2FHPA 1H3NA 3A1WA 1MBZA 2VCYA 3NWBA 1D1TA 1NQXA 2GB4A 3CT6A 5HJ5A 3ZHUA 1K97A 1SG0A 4HK4A 4TTJA 1X8LA 2O7SA 4NPAA 1S3GA 4EB8A 2GN9A 1JIXA 1GN9A 2HMWA 5SV2A 5H4GA 2PZKA 2FYTA 2G4CA 2E6UX 2ODEA 2CY0A 4KPFC 4DFDA 3IBGA 4WCDA 1OJLA 3OLXA 2W48A 4YVFA 1OAOA 2C94A 2DF8A 4IJWA 4BB6A 1FMTA 1PG5A 3IHKA 3OTGA 4TRNA 1MGOA 3MA0A 2YRXA 1XROA 3TX6A 3DDCA 2I78A 4BMPB 1V9SA 4UTZA 4EW6A 4RTJA 4ZAYA 2YUIA 3DB2A 4MS4A 1KP2A 4OBXA 4FZJA 3FSRA 5CA1F 1HE2A 1P61B 1H1LA 1RIFA 3KUKA 1AH2A 2PU5A 4D0SA 2W43A 3L1VA 3M70A 4ZT6A 3QU7A 5GZ3A 1VB5A 2HK8A 4IO1A 1OYOA 3DBHB 1Y89A 2FX5A 3RUHA 1UBEA 2JFWA 2JFVA 3P9NA 1DEKA 4N12A 2HSGA 2WZQA 1SHKA 4E1BA 5MDHA 2ZZMA 4HNSA 3AZOA 2PUTA 2HHCA 2BISA 2GX6A 4KL8S 3MN1A 1V71A 1HI9A 1FUUA 4K46A 3B1WA 4F93B 2UAGA 4JBLA 5B1SA 4OJKA 2CVOA 3QV2A 1CF9A 4Y7CA 4GQBA 1B8UA 2BFAA 4D0LB 3ILHA 4D4LA 1Y4ZA 4GKKB 3H7IA 2CHEA 4LPKA 1LK7A 2XNDA 2MINA 3EXFB 4L3OA 5M34A 3GP8A 1WPRA 2ZQYA 3DLAA 3MWDB 1NJ6A 3M1IA 5FTMA 3W5CA 4WXRA 2ODQA 1KEEB 4HNRA 4WJKB 5KIAA 1CZHA 3E7DA 5THKA 1OROA 4YT5A 3I1JA 3TEMA 4AM8A 1QG6A 1YKGA 2UZ1A 4HNTA 1N0WA 1OLOA 3EOBI 4HEA6 3PS9A 2FLKA 2FF5A 1OU0A 3K32A 3NJ8A 1FA9A 3B9QA 3RJTA 3MVEA 2IYXA 4DIDA 1NR5A 1TRHA 2IL1A 2IY7A 3IUEA 2D5BA 1UFKA 4LKOA 1R3UA 1XVTA 5IJWA 1OF1A 2WSSD 4WXPA 1YO6A 3NCHA 2OWEA 1FDUA 3FTFA 3ESXA 2O1XA 5LLDA 4PYLA 3EXHC 4HJRA 1E7RA 3SLKA 4ZCMA 1WDMA 2IYEA 3SC2B 2W90A 3LUCA 4RD0A 2QUAA 5ECDA 4JDPA 3R3YA 5CYOA 2PKYX 2WB4A 2YW9A 5D1NA 3K2IA 5GOZA 2OL4A 3NT2A 5EJGA 5JWOA 1NXVA 3ZCXA 5I4CA 5IBCA 2NTEA 1LLFA 1GPWB 2DWCA 4YCJA 4FNMA 3CF4G 2Y1OA 3CX6A 3IQZA 4I9FA 4KH0A 1UKAA 2XQIA 4LWQA 4OHCA 3A58B 4NBVA 2WKWA 1YI8A 1C14A 1EQUA 4Y6OA 2HSEA 1KY2A 3DUWA 5JCOC 1F0YA 3C1OA 1EIWA 3K92A 4V03A 3TDNA 2Q5CA 5EIBD 4DUGA 4AUKA 3L01A 5HM8A 1Y7IA 2PJRA 3AXTA 2NLOA 4LCBA 1T9KA 6YASA 2R00A 3RAEC 1QIJA 1R6XA 3GT3A 5EJ5A 4K9DA 4DJTA 1P1HA 1ZMOA 5KOHB 4JYPA 1DQNA 2A30A 2FK7A 3EZXA 4KP7A 1BKSB 5AW6A 1KBQA 1D9ZA 2FRDA 1EK6A 1Q0RA 2VYFA 4CNQA 1YDFA 5JR3A 4ZCSA 3VDNB 1IEQA 1BCRB 1XQYA 3LQQA 3VSDA 1C41A 1Q6YA 5FIUA 4ZAVA 1GAEO 1U0FA 2BKAA 3AY0A 4HXGA 3KLPX 3L1UA 4K9QA 3BJEA 1I30A 1CE8B 5EP3A 4J2HA 4J0FA 3U7EB 1PK7A 4OBWA 2Z3VA 5KYKA 3DYBA 1D4FA 3P2YA 4FNOA 4H4DA 4L5IA 4RVCA 4QPJC 2D0DA 1E5QA 2B83A 3RO7A 1BDJA 4CEIA 4U7HA 1DIBA 3B8EA 2C0QA 4OGLA 1JEAA 1MZVA 3DBRA 3DAPA 2FSVA 2EX1A 2P8SA 3WB2A 5L4LA 4IHKA 3MQFA 3V55A 3ZXIA 5A3QA 3SD7A 4EDHA 5AQ1A 3U1VA 2PQ6A 2ZBUA 2JZNA 1AKNA 2B3TA 3IJRA 4I55F 4IS2A 4TKLA 3LOUA 2B8JA 1E5DA 3GPIA 4Q9AA 5JNRA 4FFOA 5A7FA 1MO4A 1KI8A 1RI3A 1OE0A 1E20A 3ZKAA 1PS0A 5U1PA 2AN4A 1J8FA 3QMWA 4R54A 1SWWA 5E38A 3ZYZA 1DJMA 4GUAA 3L8ZA 3V7FA 4BVLA 5GONF 1RZRD 3IDFA 4ATNA 3EW9A 2EGGA 2PEYA 2PQMA 1PX0A 4AZ3B 4JP8A 1DG1G 3RC8A 2C4MA 1M8KA 5FWYA 2C9BA 4C3VA 2DTEA 3I28A 3ZYCA 2QA5A 2Z08A 3AW9A 1PWXA 3ETCA 3FF4A 5G1OA 4CM4A 5I9NA 5TPZD 3R75A 1KOJA 2PL3A 4ER0A 4NL4H 2X2FA 1K2VN 4QRHA 4HZIA 3HKBA 3VKGA 4AFNA 3QHPA 4YX9A 1IEVA 3H9JA 2Y92A 3TOCA 3UC5A 5I48A 2PBRA 4M9RA 1VLLA 1AZSC 4TSRA 5TGZA 4CV0A 3D3JA 3T5AA 2BFFA 1TUBB 1ZM7A 3IE1A 2VQEB 1JIVA 4ILEA 3OCUA 4N8SA 1QRRA 3ZOZA 4BNNA 4JYZA 5SY4A 4HAOA 2YHUA 4LC9A 2JBWA 4X20B 2P65A 5HIJA 2JGMA 3SQLA 1UWVA 3UK7A 1CY0A 4JJZA 4RUKA 5BW6B 4EJSA 1VIDA 821PA 1QONA 3VOBA 3O8BA 1HE3A 4O59O 4E2ZA 5JQGB 2ORWA 5K8JB 3U60B 1QCZA 3R8FA 3PTAA 4LUCA 2NNLD 4MV4A 3O9VA 1CP3A 3Q7IA 3BQNB 4N65A 1YK0A 5KNDA 5LNK1 2DHQA 1AK2A 3OWHA 5BMVB 3EGEA 4EKYA 2HK7A 3QVGA 1XTZA 2G0NA 1RD4A 3ORYA 3R0ZA 4ZQCB 3UAYA 3A10A 4UVDA 1SUEA 2D74A 1JWAB 4P92A 4XSVA 5EKDA 1KNXA 4IQ0A 4PVDA 1ID8A 2HKIA 3G17A 4HY3A 4AYWA 4G9GA 2PH5A 4ZHSA 3AERB 4AY6A 2Q6IA 3SFVA 1NKSA 4YK7A 3FZNA 1NVFA 3D4NA 1X1BA 3VZDA 5CLFA 4UCQA 4AMBA 3FPSA 4DV6B 3KOOA 5F21A 2VDLB 2AJ8A 1E6MA 3BUSA 2BTEA 4J8PA 2JA1A 1X87A 2QAIA 4E3WA 3P20A 3BMQA 4ZA2A 2FK8A 1ZM2A 3GH3A 4FFBB 2O2XA 4Q6BA 1IONA 4PX5A 4Y1FA 3UHPA 5BV1A 1LU9A 4YMWA 4ZZ2A 5K3SA 3WB1A 3FOZA 2PUVA 1IVYA 4B3JA 2YJ4A 1LNSA 1VJ0A 3DLTA 4B3TB 4TLEA 1W6UA 3L8MA 4RJJA 2WG1A 1UUFA 1R0RE 4YCSA 3CYFA 3CQ9A 4MQFB 2W8BB 3HM2A 1II8A 2AKYA 2OCXA 1DOHA 3ND9A 3MT7A 4H3KB 4JOSA 5F7XA 1DBVO 3EH2A 1FYFA 3FHJA 3KQYA 3X44A 4FB5A 1GKUB 2C99A 2WZCA 2IRWA 1K63A 1ZX1A 4DQUA 2E2WA 1WU8A 4QTZA 3A6EA 4GPBA 3WIUA 2WWWA 1WMBA 3ELYA 2GPAA 2ZVQX 4EL0A 1XNRB 3PWSA 2HRQA 1XWFA 3DLPX 4YRLA 1CUGA 1Z7YA 2I2WA 4O2BF 1IUOA 3PNPA 4KO4S 1GL6A 5FBLB 3VU9A 1VYUA 2HJWA 4JGGA 3Q72A 1M76A 2FRXA 3JD2A 1J7KA 5G3YA 3RSQA 4OOEA 3VYSB 4IIYA 5ITVA 3ZU6A 3TQRA 3QEKA 1X1CA 3ZJ5A 2WTNA 1CVLA 3EGXB 3ANMA 3T7JA 1NDUA 3MM4A 5FEMA 1ZH4A 3OCWA 1E6EA 4B35A 5IRCD 3EA4A 1NI5A 1LSUA 3BDAA 3T34A 4ZI2A 1Y3CE 1OVMA 1EX7A 3CM0A 5BWNA 4NHOA 2VOEA 4YT4A 2G67A 4LXYA 4GWLA 4N3AA 5DW0A 3R7NA 5HWSA 4HUQA 4C4SA 3VR4D 3MGAA 2CEAA 2ZULA 1POWA 3Q15C 4DWWA 4EIWA 2OAQ1 2QN1A 3AEQB 3UNXA 1YULA 1O0SA 2FPIA 3PD0A 1TU3A 5DPMA 3LP5A 4WFKA 4DHEA 4BV2A 1QG2A 1L7PA 1YE3A 3B89A 3IKJA 4NI5A 4PQGA 4WXMA 1JXOA 5B1HA 1WKVA 4MYTA 1RM4A 4XVRA 2FDCA 4EF4A 5G0UA 4OYHA 3O9MA 2QD2A 3KQSA 4UJ5A 3RTDA 4NE7A 3DHYA 3EDRA 2O9JA 2Q21A 4TL9A 2H2WA 4Y9RA 4YAKA 5BURA 5JNSA 2XWQA 1PIWA 4LFAB 1QGDA 3P2EA 2QVXX 3SYRA 5KSZA 1ZSVA 3THRA 4OGGA 3H5TA 2EDAA 3ZWOA 3BZWA 3I12A 5MN5A 3JYQA 4C0AC 2V74B 1SO8A 4EP1A 4D9HA 5FO0A 4RESA 4XVUA 1I2CA 3WNBA 1T8PA 1R88A 2J0QA 5EMLA 4DUZB 3W5SA 2PX6A 4N03A 1Z63A 5FXMA 2VF8A 2FPLA 5T7BA 1UP6A 1X7XB 1E2GA 3EWAA 2QSUA 1BX3A 4KIUA 3W3AH 4RPIA 2D1QA 1GGEA 5HE8A 1T4CA 1XALA 4MUIA 2CXHA 3CLTC 3ENKA 4YRIA 1X19A 2G1JA 3CWQA 3DAOA 3W3AA 4JVSB 3AILA 3ZBQA 4IXMA 5EHQA 2I6TA 2GZHA 2I4IA 1AGNA 1GL9B 1SVOA 1M1NB 8ATCA 1NX9A 3WLQA 4FCTA 4WH0A 2HR1A 1JJVA 4EPYA 3HXPA 3QBVA 4KPGA 2NN3C 1Y3BE 2WI8A 3KL2A 4R6XA 3ADBA 3KK0A 4EPVA 1P62B 4M7RA 1NLMA 1XA4A 4TWRA 1SKYB 2YZKA 3V7NA 1UPBA 1QE5A 2H4FA 5FI1B 4YBRA 1NW9B 1E60A 1FFDA 1LTQA 5BQPA 4BTLA 4YRSA 1PJBA 2J59A 4BMSA 1I0IA 4UNNA 5CFPA 4PGAA 1GUYA 3V2UA 1A9XA 2JPDA 1NN5A 1VIAA 2B4YA 4RF2A 4F0JA 4CEJA 1DWUA 1DAEA 2DM6A 3WL4A 3QJGA 1D2HA 1Y5MA 3EXFA 3FG9A 5EEGA 1O6BA 3M83A 3TOVA 1EWYA 3LLMA 3E5NA 3MWLA 2XXJA 4YPOA 2JCBA 1H65A 1LDBA 1SK8A 2PSFA 4RKYA 1YMQA 2NTNA 3DOOA 1F3LA 4DTCA 1DO8A 4GZLA 2CEKA 2BN4A 5BUSA 1YIDA 4Z54A 3C70A 1XCPA 4QBIA 1QGUA 5AVTA 3E18A 4HMOA 3H2BA 3KKNA 3WYEA 2GNOA 3W2IA 1EQAA 4E5MA 1BMDA 3I5XA 2FLWA 4NBSA 2Q3CA 3DBOB 3ZTYA 3O5AA 5DNCA 3DAGA 4KIFA 2GCEA 1QQBA 1SC6A 1N8NA 2CSXA 2CFOA 2QTVB 1GLVA 2J6CA 4RLSA 2BAGA 4IFTA 3N2NA 5CD9A 3D2LA 1GGVA 5DN6A 4WNCA 3SC2A 3ZNPA 1HTBA 3KR2A 1EB8A 2EW1A 1X7YB 3A9WA 3ICOA 4XKJA 4I5EA 4WZZA 2X0NA 4BMOB 2DKNA 1AQJA 1X14A 2QJTA 2ZI6A 3CXUA 4R2WA 4DWJA 1YBFA 1VIMA 4TZ0A 1EJBA 4G8CA 1XGKA 2XUHA 4LWOA 2BMFA 5ELXA 4GUDA 2EFHB 1TIPA 2O8NA 2BGJA 4O3MA 2X8BA 3FMVA 3CVJA 4MA4A 3CWZA 3VO8A 3CX7A 1MDBA 1A71A 1EGAA 3GPDG 1RS0A 4KUHA 4L2IB 3E7XA 1ZK4A 1E92A 4R8VA 3L43A 3DTTA 1B1CA 1KPIA 1N8KA 1TJPB 2H8KA 2HJ9A 3MWFA 4CWAA 1L5LA 1K88A 4JJFA 2XB4A 3HEAA 4WAUA 3PLNA 4D45A 5KOHA 2BMDA 4AKEA 3UKDA 3B13B 2XYRA 2G1AA 2OCIA 5CBPB 2PWYA 3SCZA 2RHOA 4P0QB 4YALA 1SJ9A 2R5NA 4PRLA 5D3ZA 1KR2A 2X13A 3DV0A 3EUEA 3QNUA 3QWHA 4N41A 4JC5A 3AHGA 2Y1XA 4MA0A 3G3EA 3AIIA 3TH5A 2AX3A 3G6KA 3E3NA 3CLSD 2YIDA 2C7RA 4M7WA 1C3XA 5E4TA 4PAQA 1UBGA 4C0LA 1XJCA 1A4IA 1CE8A 1YJCA 3PGVA 4XPIA 3F46A 4PM4A 3WGTA 5EMKA 2UZ4A 5ALOA 1U2DC 5FI3A 3L41A 2ECFA 3VSAA 3A6PC 1HLDA 3K9NA 4C89A 1TZKA 1S8FA 3RHZA 2V7EA 3EPPA 3PGKA 3HCPA 3L6UA 4EECA 3ZD9A 1KU0A 2XECA 1GLNA 4ICIA 1FC0A 4LNUB 4NFSA 1YQGA 4XDYA 4NCIA 4K9PA 4EG3A 2ADMA 5LQNA 3SFTA 3LZDA 3ZXSA 3CGGA 1ZH2A 2Q3LA 4TWAA 3SHOA 3WGYA 4F3TA 3EARA 4HAZA 3N6VA 4F4IA 1XVLA 4LN1A 1X1RA 2J48A 3M9WA 1D0VA 1V47A 4OUDA 1AXRA 4QUDA 1NJ5A 4RJKA 4BX9A 2GPYA 3LXRA 2KE5A 2VPXA 4IIVA 2P7IA 3R9IA 3LT0A 3ZDEA 1XELA 5BQOA 5H3HA 1BYIA 2IU3A 1NW6A 1V3VA 4MS3B 2PS0A 3RBXA 2CLIB 5JHHB 1D2MA 3VO2A 1QYDA 1HGXA 1R0CA 3DS8A 5ARCA 5FYQA 4Y2PA 2COKA 3G8BA 3QOYA 5C1IA 1NL3A 4EF6A 2AD5A 3ETEA 3GUYA 4RTMA 1JZSA 2VHTA 3NR2A 1DIHA 1OX4B 4BDTA 1QO7A 2C4TA 3T9AA 1TUBA 2GGSA 4PZEA 2RG7A 4KX5A 3BT7A 1QHGA 5DM70 4F60A 3FCCA 4Q16A 1AIPA 4HWKA 4UHFA 1ONNA 3PFHA 5T6BA 3PIIA 1P0PA 4GHWA 2P6MA 1QKJA 3OBBA 4S12A 1QNLA 2V0NA 3O83A 5DTEA 4C0HA 4H7FA 2Q9CA 4X00A 2O0LA 1FPQA 1NNLA 5JBNA 3QYFA 3PUJA 3Q7QA 4JHXA 1RLOA 1XEAA 3RAGA 4C05A 1C5KA 1X0XA 4COOA 1GNRA 3X43A 1Q57A 2FR8C 5BMVA 2BM0A 4QXMA 4QGFA 4P3PA 1G5HA 4Q7EA 4WASA 3IBYA 3KUXA 3QUCA 2Q2OA 4GDFA 1ZNWA 1EFVB 2AXNA 3HPRA 4HYEA 3EIWA 3H1BA 4C08A 4DMRA 1FS6A 4MK4A 4MKZA 4WNAB 1XNJA 4CDMA 1GT91 1TYEB 1GPNA 3CY6A 3H5NA 3OF5A 2JLCA 1L7EA 1SUDA 4UPEA 3GMDA 1BFUA 5KHLB 1OY1A 5I9MA 2WPDA 2GJAA 4BZZA 3HVUA 1ISJA 3OJXA 4YP0A 4UKDA 4GZ5A 1HRKA 4M9ZA 4XWYA 2B2CA 4JZKA 3SXJA 3F6EX 1VPWA 3KWJA 4G09A 5SY9A 3H2HA 3H83A 4UMVA 3ZZUA 1QUFA 1FJGB 3HJUA 3C3DA 1T4BA 3MCWA 4TV9B 3RWBA 2GPNA 3GWGA 1Y48E 1ZOLA 4D4MA 1VL8A 3H4IA 1XRQA 1XRLA 1YL5A 2CD7A 3G8CA 4TMYA 4ENWA 1YJ5A 1JS1X 4L8GA 4MVJF 3B1KA 1M6NA 3MOSA 1IATA 1FP1D 4Y9DA 5LP6A 1P9OA 2OQIA 3ICPA 5FPYA 5KAMA 3CLRC 2BH9A 3TNLA 4YCLA 2EARA 2X23A 4BWFB 3HHPA 3Q4GA 3VMMA 3REQA 2I6UA 3AT1A 4M88A 5TT0A 3ERCA 1B8PA 4L0QA 2IOFK 3JATB 4YLGA 4TQUS 4N54A 5EE1A 3TRDA 5EP2A 3ZGNA 3D4LA 1A9SA 1IH8A 3M3HA 4KVZA 1AQYA 2DPMA 3ETJA 3C3XA 3NC0C 3GD5A 4GW3A 5K3CA 5HKKD 5I7OA 2GN0A 3WAGA 4NENB 1U5AA 4PFKA 2HXYA 1R8JA 2W6ZA 2ZLBA 4Z0PA 1UPAA 3OWOA 1GTSA 1TI7A 3WGOA 4TL7A 2CBGA 6LDHA 1NW7A 3UXMA 2H08A 1DHRA 2GBCA 5TQ2B 4L9AA 3EGXA 2DOKA 4ZZIA 2R6AA 4JL8A 3UK2A 3OFND 3S40A 4DLXA 4EJMA 1KDVA 1V37A 3WQBA 4B6EA 4CV2A 1RRCA 1QO0D 5AFSA 5HUHA 3E84A 2OB1A 1IZ0A 4DLYA 2ACVA 3BN3A 4AKHA 4Z2YA 1G6OA 2AMYA 1Y3DE 2HNKA 4I19A 4HV4A 1G4HA 2OR3A 3AYXB 2AI1A 5JQGF 1AQNA 4PLWA 5B3LA 5BWLA 3HKCB 1KMCA 1IOVA 4R41A 3QA3E 3RRJA 2CFRA 5DM2A 1VSQA 4WFQA 4BO5A 2FPPB 5BNWA 5CAEA 5K7SA 3W0LB 1I3LA 3TOSA 2AV6A 1HYBA 2J9GA 2JARA 2N75A 4JP2A 5IABA 3KB1A 2FW7A 1CLUA 2O2ZA 2ZUDA 2FQ1A 2Z83A 4L73A 1P75A 2SNIE 3K73O 1CRQA 1VBKA