4WY8A

Structural analysis of two fungal esterases from rhizomucor miehei explaining their substrate specificity
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
PTVKLKPYCQNIADAATIDSTQYPPEVVRKAEAASIIDDPKALEGLPDVYLEEKTINRKNGSKIELTITRPLDTENQVLPPIVFFHGGGWVVGSKLTHRRTVYELTVRARAAVIFVNYSLSPEVRFPTALEECLDAVVWVAKEENAKSINVDPTKLVVAGDSAGGNLSAVVCIRAKQLGLNIIKGQVLIYPVTDDNFETDSYKQFAENYYLTRKLMVWFFDHYIPDKKDRQSIFACPLKASIDDLRVLPRALVITAEADVLREEGEAYARKLIEAGNDVTAVRYLGIIHGIFNLATLSPTGSEILDHIVAWLQKTWKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords esterase
publication title Structural insights into the substrate specificity of two esterases from the thermophilic Rhizomucor miehei
pubmed doi rcsb
source organism Rhizomucor miehei cau432
total genus 111
structure length 325
sequence length 325
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wy8A00
3C43A 2XUGA 2OCIA 3C8HA 3AFIA 1PJAA 4DMFA 3HLKA 1WCYA 3O9MA 4DNFA 5ALVA 4Q3LA 1M33A 4E15A 4U2GA 4C4ZA 4ZXFA 4XX1A 4FDMA 5T4EA 3FVRA 1A88A 5HF9A 2XQJA 5EGNA 1H2WA 2HM7A 1DTEA 5FV4A 1JU3A 2C5GA 1EXWA 3WKEA 4HTAA 3D59A 2VEOA 4P9NA 1EB8A 3F9CA 1JI3A 5AHXA 5KBYA 1GXSA 1GPKA 3WL8A 2Z5GA 4E46A 1ZI6A 1XZDA 4WDRA 2FUKA 3V1NA 4JYPA 1KU6A 1L7RA 4C01A 2UZ0A 3KDAA 3ANSA 3A2NA 1EX9A 4J03A 5A7FA 3BF8A 2HA2A 2BUAA 5LLSA 2AJDA 4G4JA 5C8ZA 4UBLA 1BROA 2YASA 1DWPA 3FOBA 2WHPA 4BP9A 3MGAA 4J0DA 2J3QA 2CKMA 5K3AA 4W1SA 4EY7A 2HRRA 5AM1A 2JGIA 5EFZA 3HXKA 2IX9A 4L72A 1IVYA 2QZPA 1LGYA 1LLFA 3QITA 3O4JA 1RP1A 4A23A 1TAHA 2CJPA 2EDAA 5AIBA 1AZWA 3PUHA 2XUOA 2EDCA 4EA6A 1GPLA 4X6YA 2GYWA 2IIVA 5AK5A 4Z49A 3VKFA 2I03A 3AZQA 2GBFA 4QDUA 3D4LA 2V9ZA 2C58A 5K3BA 1R4ZA 3WIBA 4TGLA 2W22A 5AKLA 1Y7IA 4G1FA 4Q3KA 3EIOA 3A70A 4C88A 3A2LA 4OB7A 1ORWA 3L1IA 4XIIA 1JJBA 5I8PA 4EY6A 4Y2VA 2AJ8A 1CUEA 5CH8A 4EY5A 1KEZA 4PF1A 4Q34A 1CR6A 1WHSA 4K6GA 3IBTA 1AC5A 2HA7A 5AKHA 1DX6A 4Q82A 4HXGA 5ALOA 4QLAA 3OPMA 4OPMA 3VJMA 3WWCA 5JZBA 4DMCA 3C8DA 4DMKA 2OCLA 3E4DA 3SX4A 4PV7A 1YASA 4H77A 2XMQA 1LNSA 2OG1A 4UBOA 5LIPA 1HDEA 4BC1A 2VF2A 4WY5A 4DGQA 5EIHA 2HU8A 1N1MA 4UHFA 4FFWA 3ICVA 3WZLA 4YX9A 4B7ZA 4UPDA 4N5IX 4UHEA 3FBWA 3E3AA 5C7YA 1HKHA 1EDBA 3PFBA 3AILA 4JYMA 1VZ3A 4KRXA 3BXPA 2QXUA 3F67A 3G02A 3O4HA 3TGLA 1CLEA 4KR0A 1ZGBA 4Y2PA 1EVEA 3H2IA 5A7HA 1W1IA 4G4IA 5ALQA 4UFOA 2ZJ7A 5JD4A 4W1PA 1Y37A 3O95A 4CG1A 1XZGA 3BIWA 2QT9A 3H19A 5LZ7A 4B0OA 4BAUA 3D2BA 5AKKA 5AI8A 4MXDA 1CUGA 4X6UA 3O9VA 2DHEA 3I1IA 2XMSA 3WK5A 5JD5A 3H1BA 1BN6A 3W06A 2Y1KA 3ICWA 4C87A 3TJMA 4KACA 3R3WA 3I2KA 1L7QA 3CCBA 2C5FA 1O6GA 3F97A 3Q0TA 1QIKA 3CN7A 2K2QB 4I3FA 3EQ7A 4DNPA 3I2IA 5AIAA 2PUJA 3BF7A 4EBBA 1YA8A 1XKLA 2PSHA 1ZD2P 2C0PA 2DCMA 3D2CA 4Y2YA 2HA0A 4UHBA 3WK7A 2XUQA 3F96A 1PV1A 4BCDA 1CVLA 5JZ9A 2WHRA 3C5WP 2ZSIA 4G4GA 2HRQA 1JT2A 5IVKA 1ZI8A 2DFPA 4BC0A 1LZLA 4ZV9A 2QOEA 2Y2UA 3QMVA 2RHWA 2H9YA 2J4FA 4P93A 5AOBA 4WY8A 2AJLI 3K9BA 4BTLA 5LZ4A 3OOSA 4QLOA 4LHEA 3C6XA 2WUFA 4DM7A 2BGNA 1MNQA 1U2EA 4BBZA 1IUOA 3I6ZA 2RI6A 3CXUA 1E8MA 3FVTA 4FOLA 2BUCA 2XUHA 1MO2A 2O7RA 1VLQA 4IH4A 2O2IA 4BDTA 2CBGA 1QIFA 1YA4A 1XRRA 2QR5A 5ALEA 3WL5A 3OG9A 3FYUA 5HQ3A 4QWMA 5AH0A 5AM4A 1QIDA 4EY8A 4J0HA 2PSFA 2ONCA 1DT3A 3PDCA 2RAUA 2CB9A 4EHBA 4BZZA 5HCUA 4N8DA 1FFEA 2ACEA 3G0CA 4BCCA 4DMHA 1FFBA 1ETHA 4BCBA 1T2NA 2OGSA 1YR2A 3AJAA 3ED1A 2FJPA 3HABA 2XUIA 1BEEA 5IVIA 1EVQA 2QJRA 3H2JA 5CT6A 5FRDA 2WILA 3G9UA 3VVLA 1MU0A 5AM5A 1OXMA 4MYSA 3MVEA 4EZIA 5AKXA 3QPCA 1THTA 1YS2X 2HA5A 1D07A 3S8YA 4X7BA 5CT5A 3G0GA 4KAJA 2OAGA 3PUIA 3R40A 3T4UA 4UFNA 3ESCA 5K3CA 2R8BA 5DYYA 2AJBA 5AOAA 5AM2A 4HS9A 3DKRA 3WLAA 4AN0A 1DQZA 4U2FA 4GECA 5CT8A 1LPAB 4M0MA 3I6MA 4NZZA 4MQLA 2QM0A 1BCSA 1PFQA 4H7JA 4ROTA 2Y6VA 4FWBA 4UBIA 1VA5A 3WWOA 4J7AA 5BV7A 4KJXA 4BE4A 2G5TA 1LBTA 3QZUA 5JAPA 2WJ3A 3IURA 3I2FA 1QFMA 1CUVA 1C7IA 2O2HA 4HVTA 5JASA 1UK9A 1CUHA 2WQZA 1MNAA 2WFLA 3O0DA 5AKGA 3T52A 4MQMA 1H22A 1R1DA 1ACLA 5JD6A 4L3WA 1IMJA 2XE4A 1GKKA 1XZHA 1NX9A 1Y7HA 5DJ5A 1FSSA 4AO6A 2DHDA 3GA7A 3STWA 2ES4A 4FNMA 4D9JA 3V9AA 3IUMA 3BJMA 2PSEA 4Y9SA 5CMLA 3WK4A 1QIMA 3HRHA 3FAKA 1H2XA 5LYYA 2WHQA 4KYVA 2VT7A 1ZJ4A 1XZJA 5C81A 4XVCA 3JW8A 4RGYA 3PF8A 4GWLA 4LYDA 5LKAA 1ZGCA 5D3KA 4BP8A 3H2KA 3E0XA 2GYUA 4GI1A 5E4YA 2JIDA 5K3FA 3I28A 2O7VA 1F6WA 4C4YA 2ZYHA 3D3NA 3G0BA 1ZD4A 4QNNA 3AUKA 5AOCA 3DDUA 1JJFA 1UK6A 4ZRDA 3H04A 3N0TA 2VAVA 2DQYA 4NS4A 3PI6A 1X2EA 1YAJA 4H7KA 2WIKA 4YPVA 1UT6A 1THGA 3H18A 1QLWA 3DCNA 3F8SA 4BYMA 3BDVA 1W76A 3WI7A 4OSEA 1JKMA 1UOQA 2ZVDA 4CCYA 3R3XA 3V48A 4PNZA 1ZICA 3IULA 3RLIA 3PE6A 4H7IA 1Q0RA 1VA4A 4WDQA 1W4LA 3V1LA 1UWCA 1H23A 4U2BA 2HADA 4UBKA 4N5HX 3KWJA 1EDEA 1GQSA 5JYCA 3HACA 5AI9A 2JGFA 1CUJA 1LZKA 5SYMA 1Q84A 5A7GA 4B81A 3FLBA 3W9UA 4U2CA 1WB4A 2JF0A 4H7DA 3KSRA 2ORYA 5KWJA 2QUBA 1XRMA 4Y2UA 4J0JA 2GBIA 4Q3OA 3ZLVA 1EHYA 4FBLA 1HBJA 5HFNA 4QDTA 2WJ4A 5ALTA 5EHXA 4RE5A 4OU4A 3K2IA 4UUQA 1WM1A 1YAHA 2PSJA 1E89A 5DTIA 4MWSA 4YASA 1N5MA 1QIGA 3C6ZA 3A2MA 2VTVA 4HRYA 4MJ3A 4INZA 2GBCA 1K63A 1TIBA 1XRQA 5ALDA 1CUUA 4A5SA 4J0CA 3WJ1A 4F0JA 4A16A 3QM1A 2VATA 2W6CX 4AB1A 2HA6A 5ALHA 1N8SA 3I6YA 4W9RA 1SFRA 1XKTA 3VXKA 3DS8A 3E1GA 5AK6A 4C4XA 5ALNA 4G8CA 3OURA 2XUKA 2HIHA 1ZD3A 4H0CA 1U65A 4JUIA 4KE8A 2ZYSA 4Y2XA 1AUOA 2XB6A 1TCBA 1EDDA 2D5LA 1UKAA 3C6YA 3SWWA 5AI6A 1ODCA 1CUWA 3IB3A 1RYYA 1YCDA 3ESDA 5K5EA 4P92A 4WCVA 4QWWA 3IIIA 2VT6A 4CCWA 2PVSA 1VE6A 1BS9A 4QEKA 1YSCA 2R11A 1C4XA 3IUJA 2WU4A 1XZEA 5T4BA 3TEJA 3HC7A 1CUCA 4X93A 2OAEA 5DNUA 2XI4A 3I1YA 4L0CA 1ODSA 2XMRA 4HAIA 3U0VA 2J3DA 3G0DA 2PL5A 4UFPA 3RKSA 1H2ZA 4Q1VA 3RK4A 5ALMA 2BFNA 3MUOA 3QMMA 2PSDA 4NMWA 2OCGA 4Y2RA 1XZLA 2NW6A 4FFVA 4LXGA 5E4JA 3WL7A 3RM3A 5LZ5A 2XLBA 2WIJA 4KAAA 2OGZA 2BCEA 1FFCA 1MAAA 2VA9A 2BGRA 3FYTA 1CV2A 3D5EA 4FHZA 5CW2A 5AM0A 3IVMA 5A6VA 1O6FA 3NWOA 4KE6A 2HL6A 5FOQA 4OB6A 4P08A 5HKBA 5D7BA 1XROA 2QXTA 2ZSHA 2Z3ZA 1J1IA 1R88A 5HF6A 3DL7A 1VKHA 1AQLA 2DHCA 4BRZA 1KU0A 2OCKA 3R41A 1X2BA 3G9ZA 4XJVA 3FYUB 4IO0A 3BWXA 2QUAA 4LXHA 4K6HA 1AMNA 5EIEA 5HQ3B 4V2IA 1QO7A 3ILSA 4KE7A 2CZQA 4DSZA 4WFIA 5EHNA 1SCIA 3CCCA 5ALXA 4J0KA 3IDAA 1A8UA 4B82A 5E2IA 2G5PA 4FKBA 1DINA 4HXFB 2Q0XA 2BJHA 5FDFA 2X8BA 4UBMA 2WUGA 2YYSA 3DYVA 2XMDA 3HI4A 2WFZA 4BB0A 4IQ4A 4AO7A 5FLKA 3DYIA 5AI0A 4H7HA 2WIDA 4DTCA 2WIGA 4O08A 3WL6A 1NU8A 3H2HA 1QTIA 1DWOA 5IVDA 1GQRA 4N8SA 2PPLA 1IUNA 4K2AA 1QZ3A 5ISMA 4DSAA 4CI9A 1AGYA 1QO9A 4LIPD 5FPQA 4DNOA 3ZI7A 1FJ2A 5CH3A 4YK7A 3VJLA 3LCRA 2GYVA 3W9BA 1TCAA 2WJ6A 4LKOA 4WFJA 4G5XA 3TRDA 1P0PA 1CQWA 2WU3A 1VXRA 2GZSA 5JZSA 5I7UA 2PKYX 5AKEA 3GELA 3R3VA 2V97A 3FYUC 3KXPA 3O4GA 1MX9A 5CT9A 5YASA 1CIJA 1Q83A 3HYSA 2WIFA 1CUSA 4J3JA 4JNCA 1UXOA 4AX4A 4BE9A 3I2GA 4G9EA 1VXOA 4ZV7A 1K8QA 4BTVA 1WPRA 2WFLB 1QONA 1SCQA 3ZLUA 5LZ9A 2QMQA 4X97A 3BJRA 2RIPA 2WUEA 5AI4A 5CRIA 2OXEA 3DNMA 1HPLA 3GBSA 1FFAA 1LBSA 3C45A 4PSDA 3LP5A 1YB7A 5CBKA 3D2AA 4RPCA 1CUDA 4KAFA 2AJCA 2BAGA 1EI9A 4K5QA 2DR0A 3LIPA 3B5EA 2XMBA 4QDXA 3C6BA 5CT4A 4EUSA 1JJIA 2JGKA 2ZJFA 3HZOA 5C8VA 1NU6A 6YASA 3P2MA 4ETWA 3WK9A 1ORVA 3DJYA 4X71A 3W04A 2C0QA 1W52X 4GXNA 5JAUA 1LPNA 3DQZA 1QJ4A 2RGUA 1XQWA 3F98A 5K3FB 1JU4A 3X3HA 3VVMA 4XWGA 2GZRA 1BEZA 5J3JA 4GBGA 2HFKA 5ALRA 1ACJA 4UHDA 3G7NA 3LIIA 5HK8A 1VJ5A 4AZ3A 2EEPA 4Y2TA 5CTAA 4X00A 3V1MA 2Z3WA 1SC9A 5AK4A 1IZ8A 2XDWA 2HDWA 5IKXA 1CPYA 1XZBA 4W1RA 7YASA 1VZ2A 1CUBA 3Q8WA 3SK0A 5ALJA 1TKRA 4Q05A 4PW0A 4GHWA 3FWHA 4CCYB 4UBJA 5ALPA 3H0CA 1XLUA 3K6KA 4UHHA 3NOXA 4PO3X 3G9TA 1HL7A 2OQVA 4X3CA 4S0XA 1CUAA 1CQZA 3FSGA 4KRYA 4AZ0A 5D3ZA 4FNGA 5BWCA 1HLGA 2FJ0A 1QOZA 1LPSA 3FCYA 2Z8ZA 1BCRA 2WHPB 4JEIA 3WK6A 2WG1A 1IUPA 4OCZA 3AIOA 2PBLA 1MN6A 1R50A 1A8QA 1XLVA 1DT5A 4CIBA 1I6WA 3ESBA 2VSQA 1EH5A 3QPDA 4KE9A 4E14A 5BOVA 1K4YA 1WPXA 2X5XA 1QIJA 3R3YA 2HU5A 4GW3A 3STXA 1ZJ5A 4IH9A 1J2EA 1EINA 1A8SA 1Q0ZA 3WKBA 2XQGA 2XT0A 1QFSA 4F21A 2V98A 2B61A 3EBLA 4G9GA 3WYNA 4W1QA 1H2YA 2QTBA 1VE7A 2WSLA 4OUKX 1QE3A 3JYHA 2B20A 3WZMA 3DOHA 5I9IA 4X85A 2I78A 1XQXA 1XQYA 2WTMA 2ZJ6A 3GROA 4FMPA 3ZLTA 1EK2A 2O2GA 4BRSA 1DX4A 1BRTA 3QYJA 3STUA 5T4FA 5D6OA 5AKZA 4UHCA 3A6ZA 5CURA 5HKAA 2ZYRA 3LS2A 3QPAA 5FPPA 5LP1A 2I3ZA 3O4IA 4Y2SA 4KEAA 4BVJA 2ACKA 2WG0A 3U1TA 4B9AA 2XUJA 5ALIA 4HRXA 4Y7DA 1ZI9A 3STYA 5AM3A 3AZOA 4B0PA 3WWDA 1P0QA 3DD5A 2OLEA 2ZYIA 4ZREA 2X76A 3RARA 1MTZA 4B85A 4E11A 4GLBA 3D7RA 5HZGA 3BE8A 3M3DA 4OYLA 4N8EA 1E3QA 5ALYA 4PSCA 4B84A 3HSSA 2GBGA 5AI5A 3ZPXA 1G66A 5LZ8A 3QVMA 4OYYA 2CMFA 1F8UA 4BZWA 3FCXA 1TCCA 1MT3A 1CUZA 5ALLA 1XZKA 2RHTA 5ALKA 5EI5A 1XRNA 3H2GA 4QDZA 1RWQA 5ALSA 4B80A 1QIIA 5A71A 3C87A 3G9XA 2VQ6A 1UKCA 1P0IA 4PQEA 1CUYA 1WOMA 1QTRA 1CEXA 5CXXA 1JFRA 4K6KA 4MYDA 2BUBA 2VJCA 4ITVA 4CIAA 1UZAA 2PX6A 3BDIA 3OM8A 5K3DA 1XQVA 1TRHA 1EK1A 1UFOA 4M0FA 3HEAA 3WYDA 3R0VA 4OD0A 3DKKA 5A2GA 5ALFA 4LYEA 5ESRA 4IH1A 1CFJA 1XZMA 5EHQA 3M83A 3STVA 4X94A 3DOIA 2CUTA 4X92A 4ARAA 3W05A 1UOPA 5DNWA 2YH2A 3WWPA 3C70A 4WJLA 5AO9A 3PF9A 5AKYA 1ZIYA 2JGLA 4ZI5A 3AZPA 1SOMA 2V96A 3DLTA 2Y6UA 2JEYA 1MJ5A 1WB5A 1K5PA 1E66A 4G8BA 4AN1A 2XQKA 2WLSA 3LLCA 5DWDA 2VJBA 1F0NA 1C7JA 3L1JA 3PFCA 1N5RA 2XUPA 5FKJA 1ZOIA 5K3EA 4DLNA 5JAHA 1YS1X 3MUNA 4DIUA 1K6EA 1R3DA 3VISA 3S2ZA 5IVHA 1CUXA 3VJKA 5AJHA 4DYHA 5ALZA 1CUIA 1L7AA 4FLMA 2QJWA 3KD2A 2XUFA 4CFSA 2C4HA 2XUAA 4I19A 5HF8A 2VAXA 3R3ZA 2H7CA 2JEZA 3FNBA 3H1AA 4FLFA 3WMRA 5E4TA 2PU5A 3UUEA 2RONA 4EY4A 1AURA 2FX5A 2PM8A 4H7EA 2JGJA 4OU5A 2ECFA 2HA3A 3GFFA 1B41A 4FTWA 5HF5A 4OB8A 5A62A 5CXUA 3BIXA 1EA5A 1MPXA 3D0KA 1E8DA 4TVKA 1FFDA 4H7FA 3GUUA 1F0PA 5AP9A 4GDMA 2XMZA 5FXMA 1U4NA 2HHAA 2DQZA 1UOOA 4ZGBA 1G5FA 3FLEA 1JMKC 3N2ZB 3ZV7A 1P0MA 2JBWA 3UMJA 3UUFA 1IZ7A 2H7YA 4BAZA 3I2HA 2WKWA 3NGMA 1GGVA 4ARBA 4BVLA 3IUNA 2IITA 3NUZA 1GZ7A 1J06A 1YB6A 3ANTA 2HU7A 1E8NA 3QH4A 1W75A 5H3HA 5DTJA 4J0GA 2QS9A 1LPBB 1GT6A 2WUDA 5IH7A 1BE0A 5SYNA 1R9MA 1CUFA 4BVKA 4B83A 4B6GA 3AIMA 1Z68A 4QE3A 2OQIA 4NVRA 4WFKA 1T4MA 1QGED 2OPHA 1MX1A 1OILA 3YASA 5ALUA 3V1KA 3G8YA 1UK8A 5ALWA 1LPPA 1MX5A 1VOTA 2HA4A 3G0IA 4MWTA 4BDSA 3BL8A 4AQDA 5DYWA 1OCEA 2XMCA 3DEAA 4RE6A 1DU4A 3ZWQA 1XZIA 1XLWA 2DSNA 5FUMA 3WA6A 4IHAA 1USWA 2PU7A 3ESAA 3L1HA 5LZ2A 1XRPA 1WB6A 2PUHA 3QBJA 5JANA 1XZAA 2LIPA 4AXBA 5AKIA 3R3UA 4U2EA 2WM2A 4ZWNA 3QMWA 3AINA 5AICA 1W6RA 1E5TA 4RNCA 2QRUA 5F4ZA 4C89A 4I4CA 4CG3A 2QKYA 5FP0A 4Y2JA 4Y2QA 5EHZA 5JAOA 1R9NA 4L9AA 5T4HA 5DYTA 3WK8A 3B12A 5JADA 3OTQA 1MAHA 4X90A 2C7BA 3JWEA 5AK3A 4FBMA 5DLPA 2WFMA 1LPMA 4HZGA 1B6GA 4F60A 4X6XA 3OC0A 4H35A 1BU8A 3WKDA 1BN7A 2H7XA 1LPOA 5JIBA 1ODTC 4AMZA 1TQHA 2VJDA 3W2TA 4X91A 1DWQA 2XLCA 3M81A 4QDOA 3FSGD 3IUQA 4UBNA 1GPNA 4TPKA 2P8SA 4EB0A 5KREA 2D0DA 5C8XA 2I3DA 3EQ9A 1EB9A 5AKJA 3SC2A 4X95A 4F5ZA 5JARA 4CG2A 5ALGA 2ROQA 2VJAA 1XFDA 1X70A 4U2DA 2JGEA 4DNQA 4MEBA 2J4CA 4LXIA 5BWBA 1S8OA 5KWIA 2OGTA 3WA7A 1XZFA 3HJUA 4G8DA 1XRLA 3WJ2A 4QZVA 2B9VA 1QIHA 4AO8A 2YXPX 1TK3A 4B9EA 3H17A 1UK7A 4M0EA 4MEAA 2WG2A 3KWFA 1DQYA 2XUDA 3PICA 4H18A 3GZJA 1WHTA 3I2JA 5EIAA 1U8EA 2Y2VA 3AIKA 2XMGA 3WKAA 1G42A 1ZIXA 2XQFA 2Z8XA 2HFJA 4GEGA 1ZD5A 3B3QA 2H1IA 4W63A 3WIOA 2QVBA 4QA9A 4C6HA 5LKRA 3C5VA 2G4LA 3EF3A 2XQIA 1A7UA 2AXEA 2E3JA 5CH5A 2CEKA 2WTNA 4J0IA 5JATA 1XZCA 1ISPA 5HK9A 1HQDA 5DNVA 1JMYA 4AMYA 4HXEB 1GKLA 1SCKA 3M82A 2BKLA 3VDXA 1QIEA 3WKCA 3DL4A 1AKNA 3WQHA 2B4KA 2G63A 1J07A 3EQ8A 3CN9A 1AX9A 5JALA 1CRLA 4JH0A 3FLAA 1G4HA 3WWEA 3KOOA 5HFAA 2JGMA 4FLEA 1UKBA 4BAGA 4PSUA 4BATA 3STTA 3IA2A
chains in the Genus database with same CATH superfamily
4UUNA 2OMEA 1TD1A 4M21A 2F55A 1J2YA 3A1WA 3C8HA 3PWTA 1D0SA 1IHOA 4UQPA 1TC1A 2HQRA 3HB5X 3MYYA 4PINA 5DK4A 2RKWA 4DMFA 1XE3A 2GN6A 1SXJD 2V5UA 2XEDA 3H6GA 3RCBA 9ABPA 4U63A 4FZVA 4NLLA 3UK1A 2P4SA 4KBGA 1PGQA 3I9V6 3IP5A 1VI2A 2AF3C 2XYHA 3O9MA 1GRVA 4N82A 4RMGA 1Z45A 2I1WA 2KBFA 3TM4A 1FMCA 4EGFA 1DZ3A 3AG5A 3E22B 4ZU3A 1OFUA 3ICCA 2F3QA 3LX4A 1N1GA 3NBZC 4M9QA 5K1ZA 3UOAB 1L4GA 2D13A 2K4MA 5GZ3A 1DKMA 3B36A 2GN9A 3CS3A 1M33A 3P4XA 4LDAA 4C0QC 1SH7A 4PQFA 2UZAA 4E15A 4C4ZA 1S5PA 1KY4A 2XOEA 4H17A 1VLVA 1F2UA 1KFCB 3DULA 4ZXFA 4G0MA 3ZWXA 4DSOA 4D43A 2E0IA 1HFKA 3UYLA 4ED9A 3BXEA 1XK7A 5JSFA 1O94D 1MEOA 2YN4A 2GKGA 1WMFA 1QQTA 3PQFA 3W1VA 3PU6A 2UVDA 3W7BA 1MAUA 4JGIA 2ZYWX 2C9CA 2AYXA 4MKFA 5E95A 1BX3A 5FV4A 2AR0A 1JU3A 4X7PA 4L8YA 3JCZA 2HMSA 5KYUA 1UBUS 2W2PA 3EGIA 1U6IA 4LV6A 1D8AA 1T8TA 1Y3HA 4Q3AA 5BT8A 1UJBA 2BZSA 2DTDA 1DIAA 2DAPA 4O2BF 1OPXA 3BMOB 3LVBA 1Q2UA 1G7SA 4AT1A 4DLUA 5F9MA 1IIBA 3ZNNA 1A76A 3F9CA 4HTFB 2EKDA 3QFTA 5IJ9A 2W6PA 2XOXA 4LQLA 1XNJA 1UC4B 4GDFA 4LZJA 4XRRA 3SY8A 5KBYA 4BGEA 4E5MA 1WV0A 1CD5A 4EKEA 2AUMA 1RMQA 1WXGA 3HUTA 4JUBA 4KXMA 2ZI6A 4IGFA 1OD6A 3WL8A 1OLUB 3AEKA 3QEMA 4YQZA 2P91A 3JAWA 4KQHA 3CW9A 3L8HA 4E46A 2CXRA 1XZDA 2W2LA 2YV4A 3HHEA 3LRPA 4AJNA 5F78A 2DJ5A 2OO5C 2P69A 3GJ6A 4JYPA 4C01A 2FWIA 4UVDA 4CEIB 3DWGA 3QKRA 1SBIA 4BV3A 4R40A 3C4QA 3B1VA 3CF4G 4PSKA 1FDOA 2F1RA 2GD6A 5CYPA 5TF0A 4H1WA 1WBBA 1GY8A 1CRZA 1YCFA 1JBEA 4G0VA 3EXIA 4GZLA 2IELA 2JIZA 2BUAA 1P2BA 1SHLA 3UUWA 2AJDA 2BEWA 2O57A 5JCJA 7REQB 2AL7A 2E4XA 3FMVA 4O2AF 3MTIA 1P44A 2OSBA 1NLZA 4UBLA 4XUDA 5A5FA 1L5RA 2Q0HA 3H2SA 2DUWA 1VPVA 1X1AA 1LDYA 4UM7A 1VE5A 3MGAA 3B2EA 4XCQA 1BXGB 4D4JA 2J8ZA 2J3QA 3LCJA 1KSHA 1Z13A 2ZBUA 1QCDA 2IOHA 2JDIA 2K2WA 1Z7GA 3BZBA 1ZW1A 4P80A 5AW1A 3UANA 4GRDA 2DULA 3BHNA 4WNCA 2GCEA 2H08A 3WJ7A 2VQ3A 3W6OA 2WB2A 5AM1A 2UZ3A 2AUTA 5EFZA 1U9ZA 3HXKA 2W93A 2QVYX 3NM6B 2I54A 3H84A 5J5AA 2JLRA 1NBIA 4KH1A 4HNUA 4RH1A 5EGSA 2V7XA 3HEBA 3KTDA 3TNDA 2QZPA 2BR3A 2WP8J 1SC6A 3NHYA 1NUSA 1W5EA 1CT9A 5CDTA 3L9XA 1L5QA 4B3DA 3ICOA 3IRVA 3U4MA 1KEUA 5IS2A 4XTRA 2EDAA 3KKQA 2PLAA 3L1UA 1GFZA 2G88A 1G6OA 3MB5A 4GMDA 1DXOA 4NQRA 2XDAA 5T6BA 3U4HA 1KI7A 5JRJA 4RTQA 5KWSA 1CVIA 1ADYA 1E0SA 1UMDB 2CYBA 4K9MA 3D6NB 3P9NA 3ITDA 4FFMA 2GYWA 3I61A 1E2QA 4H6VA 4P84A 4EB6B 2BV3A 2Z2XA 4DMUB 2VKQA 5FUYA 4P83A 2IIVA 3BXZA 1QLJA 1DAOA 4F2WA 4PAMA 4Q9LA 4DRZA 2NV2B 4ECAA 3VPGA 4RETA 3UG7A 3WSTA 1NUQA 4P0TA 1K8XB 3MPUA 3B38A 2GBFA 4QDUA 2Q8NA 3GT3A 2V9ZA 3LX6A 5TT1A 5K3BA 1JVBA 2ZRAA 2CLDX 4NDAA 2AE1A 3DEHA 3E6AA 5CB6A 2WJJA 3EMVA 3H1GA 1D4AA 2LTAA 3WIBA 3PE3A 1AUQA 4PWZA 2W22A 3HVKA 4GM0A 4KBFA 4M1SA 3ZCPA 4BNVA 4NTZA 1LTQA 4GX5A 1J0XO 3BJZA 3EIOA 4MMYB 5DTEA 3T3DA 3WGJA 1OAKA 1PZXA 3QVXA 1SY7A 2QR2A 3OX4A 4NAVA 3BXHA 3KCQA 3JQBA 4NMLA 2CHUA 4FC7A 4Q0MA 4WKCA 5CH8A 2P9JA 1E1LA 2YS6A 2HXGA 5GTDA 3VR4H 5H3LA 3LYHA 3TVYA 1IAVA 2DHQA 1XFAA 2FETA 2JRCA 2RHCA 1GL6A 2W4MA 3P0RA 3T9DA 1GZDA 3NZEA 4MI9A 4EQ6B 3HKBA 4F04A 5CEEA 4TS1A 1NXPA 1ZONA 3EHDA 3HVUA 2CUKA 3ABZA 3QE3A 4KO2S 4MKZA 5AKHA 4AJLA 1W4RA 5C4IA 2AR9A 3UO8B 1TF2A 4KXNA 2QE6A 1Q1BA 4FXPA 1VHQA 1YDFA 2IEZA 3LC2O 5JEEA 1MB4A 3FDJA 2LVBA 3JQGA 1EIWA 2AI1A 2OENG 4OHPA 4UTZA 1NSYA 3VJMA 1JVNA 2C7PA 4Y18A 2AG1A 2PD6A 3V4VB 1CS4C 4BWFB 5JZBA 4B74A 3MOSA 2QE7A 2R00A 4MJXA 4ER0A 1M2WA 5KINB 1SKUA 4L28A 4DV5B 1DKRA 1TI7A 1X77A 4REQA 4PV7A 2ZEJA 1RPTA 1TJNA 1LNSA 3ZVNA 2QAJA 2I3GA 2XAUA 5JHHB 3BDAA 2H57A 3OKAA 4DGQA 1U0RA 2I3AA 5EIHA 5CAEB 1Z0UA 1N1MA 1E2DA 4AG5A 5JROA 1IY9A 1RI5A 3OZCA 2GUGA 4PO9A 2ERCA 1UMKA 4LOAA 1NW6A 2OBXA 3NJ4A 2JLQA 1Z4KA 4P33A 2BH9A 1HKHA 4NYMR 4WKBA 1CEYA 3PFBA 1KI6B 2MSLA 2UZ4A 4DABA 3OPQA 2WJWA 1K4KA 1O5TA 4DLTA 3RUFA 2XCTB 4LMBA 2UV8A 3L7BA 2FEPA 2J59A 3FY4A 1U8TA 1PEYA 3QWHA 4ZC8A 5LB2A 1HDZA 2GHRA 2QXUA 3OC6A 3TGLA 2YFKA 1PP4A 2FR8A 1JECA 1N9KA 1S2LA 4BWYA 4BQPA 3MXTA 1EVEA 4BKMA 2QP4A 1UWLA 5DBGA 2HN9A 4GM1A 1JFFB 4KVGA 4C76A 3E05A 2QU7A 4BEJA 3CJRA 2XRMA 1H0SA 3WC4A 2DM6A 3DBLA 3DM5A 5C80A 1NI5A 4BLUA 1G6KA 5JD4A 4R1UA 1CF4A 1X9GA 3PWSA 4I6JA 4UDOA 4ZCRA 5MFZA 2IEIA 1DGQA 3DZGA 2RI0A 2I6XA 4QBHA 5FJJA 1XZGA 2J9FB 1ZIOA 2L42A 4HX9A 1L8XA 1FLDA 2D2FA 2YIMA 1NASA 4LAFA 1BO6A 4QFCA 3G7UA 2FGKA 5LZ7A 4B0OA 4JI1B 2QM8A 1ZMXA 2PS1A 3B6JA 3FPJA 3DLPX 1M72A 2JK0A 3D2BA 3L05A 2JIQA 3L49A 1XKXA 4MS4A 4X1KB 5AKKA 1NQVA 4NICA 1E2GA 3CH7A 5AI8A 1W35A 4IG9A 3RJTA 3IMKA 3BRCA 1S3SA 2IYUA 3W5HA 4OHOA 4YAWA 4JOSA 4B3IA 1A4XA 3RRZA 3KU4A 1T2FA 1MIHA 3EEBA 3E03A 4IS3A 3I1IA 4ZYXA 5A02A 3MJFA 4HRAA 1SK9A 4MPTA 4QOJA 5H68A 3WK5A 3QFFA 1MUUA 4P81A 4LGMA 3F2VA 1BN6A 2QAIA 3DEYX 1IAQA 4FONA 2YYAA 4TUYF 5CR9A 1QVVA 1KJYA 3SCZA 1TQDA 2IXDA 2BKVA 5CEJA 3PEUA 3ICWA 1EP3B 1BQ4A 2ZBRA 2EFEB 3AOEA 3CUYA 3FMGA 2HLHA 4K03A 3W5BA 4DGSA 1WUHS 4IOLA 2J6IA 1PLJA 2DHRA 2VQFB 1QGDA 1Z2PX 1M6HA 3NKVA 1WKCA 2P78A 5EJ2A 1L2TA 1KZ1A 3WFJA 2GAOA 4DEYA 4QYWA 3ZN2A 1Y6FA 3ANLA 3F97A 4FHDA 3Q0TA 1QIKA 3RS9A 1H4TA 1Z7EA 1ZWKA 4ZVUA 4J7CA 4KDCA 2UYCA 3EQ7A 1ECCA 2Q3DA 2ABWA 3G9QA 3QU9A 3BF7A 2HTEA 2QTZA 5GWXA 2H9AA 3OX3A 3WTBA 3LBHA 1RQRA 1YR7A 3VBEA 1MEEA 1W0CA 3DTTA 1XKLA 3B9RA 4HG2A 1GHTA 2GZDA 3ZYZA 4BQIA 4EX7A 2ZWIA 4MO2A 1R8JA 1TA0A 2C0PA 4B73A 3CEHA 2HBZA 4Y0NA 1Z37A 2O8FA 5DXAA 2JLUA 3FRIA 4PCUA 3TI7A 4F2PA 5EKSA 3WK7A 1D2NA 3GRAA 3NGLA 4JY7A 1P62B 1T25A 4KXWA 4B79A 4LVOA 2IPNA 1A72A 3I37X 2P90A 2AK2A 2YJ6A 4MARA 3ELDA 5KNDD 3PR2B 4YGYA 4FYXA 1T6YA 4Y6QA 4DPKA 1PNTA 3N9IA 3X1MA 2Y1EA 4G4GA 2HRQA 1KY3A 2ZUUA 2A7QA 3GUVA 1KR2A 3HJGA 1G21E 2CNOA 3L0ZA 3ODGA 4LE0A 4YRDA 4EF6A 4AZWA 1G0OA 2OEPA 1Z8NA 1DHRA 2ZUEA 4K28A 2BJVA 1Z3IX 2A4KA 3R6GA 4H7PA 4YI3A 1EFCA 3HA3A 3GL9A 4M0CA 2DFPA 3GI1A 3GPDG 4PHGA 1RBQA 3F6SA 2B99A 2WWIA 1NJ5A 2QN2A 3IA7A 3I04M 2FPIA 3AYXB 2H9YA 3AF2A 4RSGA 2E5WA 5EJGA 3ZHBA 4P93A 3DD1A 5BUSA 5M7EA 2DBQA 4WY8A 2INGX 3D8UA 4D4KA 1JLMA 1GRRA 5TV2A 4X54A 4BTLA 4KMRA 3LF1A 4CV0A 5LZ4A 3GOQA 4F4CA 1GQQA 4LTMA 3UAWA 4YMHA 1RRGA 4LJ8A 4QLOA 1KKUA 5A4MS 4B17A 2V7QD 3AH8A 4DM7A 4WLUA 2XW6A 2JJ8A 2ZT5A 3FDZB 4IRXA 4BMZA 1U2EA 1V47A 3DC2A 1E79D 3GLQA 4YUYA 4B2IA 2VC2B 2EXXA 3WGVA 2DERA 3N2GA 4PC1A 1WBDA 3FVTA 4NNOA 3SMVA 1RAEA 4Z4FA 1LF0A 3UHOA 2BUCA 3RHSA 3HG7A 3QX3A 4N01A 4NMXB 4JELA 1YNSA 2JCVA 4TKZA 4HN4B 3LQFA 1AA9A 5TQ0A 3ZGZA 4E4RA 5JO0A 3T0GA 1UPAA 2CBGA 2QR5A 3LUFA 2OFOA 4JLVA 4MKGA 3CVXA 4ALKA 4HDMA 3OIYA 5I7SA 2Q50A 2VOEA 1EQUA 2XNDD 4FI3C 5G0VA 3WL5A 4XWTA 1WMDA 3ZK7A 4D8UA 1IDN1 1KIFA 2EEZA 3GH1A 4QJIA 4TQ9A 2O8VA 3AEUA 4XVCA 5DGIA 4E03A 4Q9HA 4QVKA 4UD6A 2EZ8A 2L2QA 3GJ5A 4HEA6 4LWPA 3RU7A 5HQ3A 5LLTA 1JLHA 3ITNA 4IYRA 3O8QB 1VBNA 4WOJA 1RQGA 4G0UA 4EKGA 3WB0A 4V1CB 3UHFA 3RLFA 1SBCA 2PLNA 4EJMA 2ONCA 2E6UX 2PNFA 3PDCA 2RAUA 4JEMA 4AZ0A 4TXNA 2ZUSA 5DN9A 2NQTA 3FYDA 3O38A 4RLHA 2OHHA 3SF8B 4N3NA 5HKLA 4D44A 1T8RA 3QBTA 4DLVA 4D79A 1FFBA 1EYZA 1XYGA 4M4SA 4Q1AA 5DI3A 3O8RA 2GSDA 3EUFA 5K8CA 4GRIA 2OGSA 4GMFA 3CV3A 3AJAA 1QF9A 3Q85A 2ZBFA 5IXSA 1M1YE 1O6ZA 3AP1A 1FXSA 3ED1A 5CFNA 1MDBA 1E7RA 1I80A 4F4FA 4F4HA 5A4KA 5K09A 5HPYB 1R6UA 3VTZA 3FWZA 1BHSA 2QWXA 4UNIA 1CU1A 5SZJA 2R1TA 5E9WA 4M7OA 5BNTA 1MU0A 1GGNA 1I3LA 1M8JA 1LV7A 1XDWA 3NWJA 1EK5A 1QH8B 2AIRA 2H1SA 4NPCA 1IWPB 4MYSA 5FLYA 5HFNA 3JY6A 3U17A 3B2QA 4GGPA 1P2UA 4H3HB 1NYRA 4N5LA 3MAAC 4K2HA 3SIWA 3TLGB 1W9HA 3TQTA 5HS4A 2A9OA 3JQRA 4TYMA 1MC4A 2IEGA 2C29D 1JS1X 3GVXA 3NTRA 3MD9A 3EQ6A 1E6KA 3ACCA 5IJ0A 3KZ1E 1VYUA 1YL5A 4FFPA 1E77A 1YS2X 2HA5A 7MHTA 4J91A 2D1RA 1NV9A 1ULSA 1QZTA 3AK4A 4HDNA 4ARIA 2PX3A 3A27A 3AETB 4B87A 1N1DA 2CCKA 2XYRA 4X7BA 3EPHA 5FPSA 2ZIUB 3LM8A 1Z12A 2A58A 3UT5A 5CBPA 2C3OA 2R4QA 2JLSA 3MELA 4FCVA 4KAJA 5DHRA 2A1TS 3QE2A 3UQYS 4EYGA 3ESCA 4R1OA 5AJYA 2AKYA 4MAAA 1EFRA 1YFKA 4EB3A 1JQ5A 1QM5A 2ZTSA 4WT7A 4YCAA 2RBEA 2I8AA 3AFOA 2GF9A 2HLDD 2P4EA 5AOAA 1SZJG 4EHDA 1DHTA 4HS9A 3WLAA 3KQQA 2G25A 1FQKA 2CNWD 1R0LA 4FYYA 1PWYE 1DRVA 3LP6A 5CT8A 2TECE 4I08A 4ZK6A 2HBRA 2R5WA 1LPAB 1MKYA 3INRA 5K0ZA 4YXWA 1C1XA 1O95D 3I6MA 3HV0A 5HKKA 1NYQA 5EJ7A 3ECCA 1NR5A 4NZZA 5D6NA 4ZHSA 4G5SA 1UBFA 2QM0A 4QU0A 2ZUTA 3BMQA 3OIWA 1GV1A 1G0NA 1QHFA 4OQXA 5SV2A 1W46A 3C8ZA 5DTMA 4K6FA 3JQFA 4OUDB 5BURA 1AGRA 2NZJA 2Y6VA 3NAMA 5G3YA 1XYYA 1Z7WA 3QOXA 4UBIA 1KK2A 1YZKA 2CDRA 3D43A 3M6XA 3Q12A 4KHPB 1IM2A 2D0PB 5BOSB 4KJXA 1BXKA 2E1RA 1UBCA 3P2YA 1ONOA 4PGAA 2ZATA 3UBMA 2YJTD 4XIGS 1MB2A 5J43A 1RWWA 3LKBA 1MZPA 1E2UA 4NHOA 1KIMA 2QV0A 3QZUA 4ZOLA 5H82A 1NATA 2WJ3A 4KX5A 4RHUA 4BJ3A 4KYIB 1K92A 2H2IA 1M2VB 3IURA 1P75A 3PQ5A 2IPLA 3ZVMA 3AKYA 3ESQA 1JIVA 4A7PA 3WYFA 1N5DA 3CEAA 1WJGA 1DIGA 5J4VA 4Q4HB 3KB6A 4XASA 3DMYA 2BSAA 3IKMB 2O6LA 4AMGA 1X7WB 1MNAA 2PBFA 1I32A 2F43A 3O0DA 4IS2A 2GXAA 1PR2A 4MQMA 1KEEB 1Y6RA 1H22A 4QREA 1I94B 4WZBE 5E3IA 3UAOA 1E3IA 2Y0EA 4JMLA 1SHTX 2GEJA 4KREA 3PNPA 1A82A 2PCJA 4L3WA 1J97A 3K9GA 5P8WA 2LKCA 3AESA 2XADA 4M2LA 3HR7A 3ZE9A 3WGIA 3B9PA 3W2IA 3OJCA 4GR5A 3WNVA 2O1WA 4TVBA 3KELA 3WSVA 1TM4E 2VPYA 2OC9A 1HE1C 2WD9A 3CT6A 4GPBA 3O9ZA 4I36A 2F4VB 1FTGA 2R7LA 1Y7HA 4YHBA 2FOLA 5DJ5A 2O5EA 1R4MB 4PVDA 2N1MA 3OFSA 4KAXA 4RK4A 4AO6A 3GUHA 1J99A 3A1DA 5EQFA 4XB1A 2J0EA 4IBOA 3VPAA 1UMCB 2VP5A 4H3KB 2A1IA 2FMXA 3K0HA 3NAQA 3HYCA 4M55A 1XEWY 3VSCA 1T8SA 3RSGA 1NMSA 5JVDB 1XHFA 2MYTA 1I8TA 5HM8A 1SB9A 4FNMA 2PG3A 4NYMQ 1NKTA 1VP3A 1JDJA 1GAWA 1D8TA 1ZISA 1QC5B 2B1QA 3RIXA 3HTXA 3REFA 3D8TA 1GXSB 2CL5A 1Z08A 3ZWVA 3HRHA 4BLRA 1O5OA 2G8LA 2WHYA 3OO0A 3VKWA 3ROKA 1Y4UA 4AJHA 1QDUA 4P0PB 2Z43A 3HXTA 1CDOA 2CWDA 4WXEA 1JDBB 3GUCA 5CVVA 1JPUA 1GPWB 3I64A 3L4BA 2C95A 2VT7A 1ZSNA 4DG9A 1R18A 1KAOA 3UGQA 2C5SA 4CCSA 1EXDA 1E9VA 1H1LB 3L06A 5AVWA 3JW8A 3W0LB 1JKJB 4GOJA 4GYKA 3EUAA 3DB2A 5E38A 3IJEB 1DRUA 3DLHA 3R8CA 3N5CA 3O3NB 5ECGC 2XKAA 1U98A 5JYEA 3T12A 3TYXA 1EGHA 4DV1B 3O82A 2XE6A 1ZGCA 4LMAA 2WTBA 1LBEA 5D3KA 5J5CA 1DDGA 2PLWA 1UJ4A 3IAEA 3LTEA 3OT1A 1ZCAA 2GYUA 1T9GR 2IIPA 3O26A 3QXGA 4RA6A 4TMTA 4YRKA 3A6LA 1P77A 4DUGD 2JFPA 1P18A 3PK0A 3HL4A 3Q5EA 1MR3F 4GG1A 2NUBA 4HDOB 4LDRA 4MW1A 4YRGA 4JZYA 1ZD4A 4O63O 4Q4AA 3M0EA 3NFYA 3QVWA 1SUAA 3QE4A 2QTFA 5AM5A 1HDCA 3UEOA 3PI7A 3X1KA 5CP8A 3OTOB 2Y4OA 4NAHA 1UK6A 1YK1A 1R9JA 3M70A 1Z6PA 3IXMA 5COBA 4Z9YA 4BRUA 4BGIA 4WECA 5D2CA 3WVNA 5LWQA 1GNLA 4H7KA 4YPVA 5EOVA 3DDHA 4AP5A 3KFLA 1SHJA 3IV7A 3BK7A 4L74A 4YLGA 3WAGA 1XCBA 3C48A 3KE8A 4WNIA 3RSOA 2FWAA 4MGIR 3F1KA 1UH5A 1HRKA 3HE3A 4MHSA 1SXHA 2Y8EA 4BMDA 5LXTA 2X0RA 3QPWA 3N70A 1KPHA 3DW1X 3L0IB 2P6RA 4DQUA 4D4HA 4Q5IA 3ZV3A 1G8GA 2EQ5A 4N3AA 3WMGA 4FD3A 4ZDKA 1KYZA 3FPAA 3P71T 3F8SA 1RWMA 3MXOA 2IFTA 2E4YA 1LVUA 3DXYA 1IM5A 3SE0A 3TLEA 5LPNA 1W34A 3GBPA 3LQKA 2Q6KA 3B6KA 4R8RA 3VGPA 5J58A 1E6CA 2O3TA 2R25B 4ZAFA 1UOQA 4KQ1A 4QNRA 3SPXA 3GXBA 2WF6A 3MCZA 2BPOA 1QG6A 1R37A 3A26A 3S29A 3EVNA 5A5DA 4C0LA 4QO7A 5IN4A 1C9MA 3IEMA 1V41E 1JEOA 3L7DA 2GM4A 3HQ4O 3TLMA 2DTEA 1L5MA 3IULA 5KJ6A 2PN1A 3SEAA 3SDBA 4IJ6A 5SY4A 1E1QA 3RLIA 3PE6A 4H7IA 5BSUA 2QPAA 3HDJA 1H1DA 4C1NA 1VA4A 3A6KA 4WDQA 2P3QA 2AVNA 4JBGA 1W4LA 5DCWA 3GAAA 4J2HA 3V1LA 3PGA1 1P7ZA 1YKGA 3V6MA 4N5HX 3U7RA 3FPBA 1DIHA 1P73A 3OU2A 1L5WA 2QTWB 2CVZA 2M1ZA 3PA8A 4FW8A 4UEOA 3KWJA 3T61A 2CFIA 3E61A 5ITZA 1KDVA 4L75A 5JDIA 4HEHA 1ZR4A 4A0HA 4NL4H 1MC5A 2DJIA 2NUAA 5AI9A 4EMSA 3PC8A 1CUJA 1LZKA 4LK3A 3EXFA 1U94A 1PN3A 4UASA 4GMHA 2XTJA 2WIBA 5E0OA 5IP5A 1WAMA 5TJ9A 3HJHA 1U8UA 4KWCA 5BPHA 1US8B 1BW9B 1R6DA 4FZ5A 4PPNA 1EFDN 3LU1A 4JODA 1JDBC 1KYIA 2ZRCA 4JASB 4YJKA 4OHRA 3R0IA 3B1ZA 3E15A 3VDMA 1QMPA 1Z2NX 1T0IA 3OHSX 3RJ9A 1FS6A 1ZN9A 4CTMA 3SSNA 1G8SA 1RHQA 2ACVA 3ZHRA 2VHQA 2C99A 1RPNA 5B5SA 4G5GA 2JCXA 4DLLA 4LHWA 5IF9A 3ZE7A 5JH7A 5KDDA 2R6AA 4EO7A 3AF4A 4L95C 2ORYA 1OW3B 4PIVA 5KWJA 1L4NA 3KQWA 8MHTA 3AV3A 4Z0PA 2L19A 2JI6A 2ZE6A 1S1MA 4QXOA 2DEUA 4J0JA 2GBIA 2PAFA 3CZ4A 5JCOA 4CEJB 1EHYA 1T2CA 4P4SB 3LKDA 5KPJA 1KNQA 1Z0DA 1HBJA 3CXRA 4FBLA 3LUBA 4MWGA 3X43A 1FZTA 3GC6A 3CU5A 4PNPA 4Q4JB 5FWAA 1XSEA 2QW8A 2FZCA 4FILA 1XUOA 4KI0A 3OE1A 4MHOA 4N3BA 5EHXA 5L7WA 4ZTZB 1TL7C 3K2IA 5KWVA 4UUQA 4FI3F 6REQB 1YAHA 1U2QA 1BDJA 4DREA 1UM8A 1PUIA 1N6PA 3NC4A 2XF8A 3JQ9C 1BGWA 4I4LA 1N5MA 4LDZA 3AUJB 4WEQA 1BKSB 2FI1A 4JI7B 4LNUB 2XCQA 1DOZA 1UBRS 4NQZA 1CR2A 2EJVA 4RZSA 4Z99A 4XIYA 2HJVA 3NIDB 4ZZ2A 2VTVA 1UP4A 3DO6A 3UJDA 4M49A 1C0EA 4HWGA 5M29A 5FL7D 1HNXB 5HYVA 2H52A 5KYVA 4EW6A 1YS4A 2V55B 4JLJA 4G0XA 4J0FA 3PD7A 2HSGA 4RK1A 2CF5A 1K63A 1Z5NA 2VHUA 4L07A 1P2DA 5ALDA 1XALA 2AT1A 3T0FA 3UAZA 3WJ1A 4QSMA 2JFXA 3QVGA 1NLFA 4MCAA 3OZIA 1U2RA 2VBIA 4KGXA 4U7WA 1L9XA 3LNCA 3UOWA 1OLSA 5G2OA 3ASUA 1VC2A 4BJHB 2VATA 1HKUA 3F8WA 3PYXA 4AB1A 3SYNA 1ZGAA 1Q7BA 5ALHA 4A27A 1LSUA 3VR5H 1X7DA 4I9GA 5GZ6A 3EDQA 1NE2A 1SNYA 2DUMA 4W9RA 5K6AC 2QRHA 1ZDMA 3FB4A 5LU9A 3DS8A 1DV1A 4C4XA 4AS1A 3ZH9B 4LMPA 4G3XA 2V8BA 4AZSA 4NXNB 2FR1A 4G8CA 3OURA 4RAOA 1RHMA 2JZCA 2PWZA 3B89A 4JQOA 1NUPA 1ZD3A 1NBOA 4MPRA 4QUEA 2WIAA 2R1ZA 4JUIA 4MAMA 4IVQA 4LEIA 4XX0B 3CONA 3COPA 3RFTA 3ZE6A 4QXRA 2PYZA 1S2DA 4PTZA 4RKFA 2QQ0A 1VLMA 1EDDA 5D7NA 4O8ZA 4CLEA 4NBLA 1D4OA 1GVNB 1FTNA 2PZEA 4JIMA 3AUAA 4AJEA 4ES6A 4UTNA 4JEHA 4A9AA 2FX2A 4O59O 4CFZA 2FOIA 5AI6A 1RMYA 3Q8XB 1Y48E 5E9JA 1TXGA 3ZHXA 4P54A 2XVMA 1XF9A 3EZFA 1CRPA 1ISGA 4LXTA 3VR2D 4B6OA 1YCDA 1VDZA 3ESDA 3Q6IA 2IEBA 4WCVA 3JYOA 1CX9B 4Z51A 1VL0A 2Q7XA 5TRTA 5I9TA 5I9NA 1N6LA 5FAKA 3DFUA 1XWFA 3A36A 4S1WA 1HRDA 3WYCA 3NHWA 3B51X 1ZUNB 4Q9AA 4CCWA 1QRSA 2OC4A 5CM9C 2FMIA 3UJAA 1XXLA 1IQRA 4HK4A 3OP1A 4NABA 2OA0A 2R11A 4U6QA 3IUJA 2CFRA 5J4KA 1TYDE 1GKUB 2WU4A 3NOQA 1XZEA 5AHOA 3WSWA 5B1DA 1W5SA 2V45A 5DNUA 1WZEA 5I7RA 3NCHA 1VSVA 2IYNA 3I1YA 1MVLA 3CGGA 4PZ9A 4YJ3B 2IXBA 4G1MB 4GZ3A 1H65A 1Z5UA 4HGYA 1J8MF 4L0CA 1Q44A 2BFAA 4AKTA 5A5VA 2ECKA 2J9ZB 3PPXA 3AC0A 2Z1NA 2J3DA 3CLSD 4HAIA 4ZPXA 5DX0A 4WNAB 4D4MA 1IBKB 3CRNA 2I2XB 4PRKA 3QYAA 3BXOA 5K4GA 4F5DA 1S8NA 3GK3A 1H2ZA 1MF7A 4LN1A 3BM5A 3TR5A 1NF8A 1XAJA 3V7WA 1ZOOA 2ZB3A 3GZ4A 2WA1A 4Q4DA 2YUTA 1WU8A 2JATA 2QX7A 5LNK6 1SXPA 1G7CA 2BMVA 3Q2OA 1Z4PX 2RH4A 4FFDA 3COYA 3U3DA 5B12A 1MOQA 4KGZA 2W6MA 3LDHA 3PQEA 2WAMA 1GP2A 4V0LA 2NW6A 1HE2A 1DCTA 3LTNC 4B8WA 4FFVA 2OR3A 3QTBA 4Q18A 2AOUA 4M89A 2V4ZA 3DYBA 3S2SA 3WL7A 1G2IA 1V26A 2H1VA 2FN9A 1ZGHA 1GO2A 4O1MA 1P8JA 2DPYA 3RM3A 2C1ZA 2YBDA 1WSAA 2WMYA 3A8TA 1NN5A 2TRSB 2OGZA 3LBFA 5KYYB 1PW7A 4F46A 1MAAA 6NULA 1FNNA 2C5HA 1QP4A 3DMGA 4FHZA 5JWRA 1EUCB 1U7UA 5I8ZA 1V2GA 2V6JA 2R0QC 2WD7B 2QN7A 3IVMA 3K96A 3DZHA 3HU1A 1V8DA 5JCPA 1O6FA 2VHEA 3BX1A 4QUGA 5JZOA 1N32B 2ZCUA 3NWOA 1GGEA 4RMHA 4ZYVA 4KE6A 2IYPA 3O83A 2HL6A 4KUHA 4BJ6A 5GJVC 4BKRA 3PRYA 2I80A 4CZ2A 1IU9A 1TF7A 1GLVA 3A25A 1TU3A 3IBGA 1RD4A 3O84A 4C08A 3UMBA 5HKBA 1O58A 3EIXA 1HDYA 2ZSHA 2QXTA 4J43A 1Y3BE 4OI2A 2QW0X 3RU3A 1F38A 1X7HA 4OI0A 4E6PA 1A9QA 2C7OA 4OP1A 2DQKA 5G1OA 1VKHA 2VDRB 3Q9NA 4QUHA 1XO1A 2VDVE 4AY5A 4BRZA 1P2VA 2HV8A 1KU0A 2NTJA 3R0ZA 3EC2A 4BTEA 2BN4A 3R41A 1KI3A 3VHXA 2R4TA 3GZNB 4JJ6A 5FB3A 5FD8A 2G1JA 1Y8RA 1X2BA 1HTBA 3BGVA 4H15A 3UJPA 3UFBA 3ZY2A 5KYGA 3N76A 3ASVA 4NENA 3O47A 4IO0A 1V43A 3DFFA 4JJIA 4K6HA 2NO9A 5TQJA 3SBEA 4JDUA 5FFNA 1GNRA 3K0FA 2OL4A 2XCRB 3CH4B 3FF1A 1DFHA 2AG0A 2GA9A 3HN2A 3O2SB 3PSHA 4JU8A 5EVCA 3AJDA 4ZK2A 3GRUA 3T3GA 3LWNA 5I4BA 2GS9A 4CL3A 1U8ZA 1O1YA 3HNRA 3MMPA 2W2XA 2SKEA 1CULC 4MROA 4JSRA 4DSZA 1ZM3A 3H42B 3CKYA 1ULHA 2IXEA 4OHKA 5CLLA 3VHQA 5BSKA 1R6AA 2OYSA 3TPFA 2DBYA 3FKSD 1SCIA 1V6SA 3CCCA 4RD1A 4M9SA 1DZIA 2AN4A 2IZZA 5ALXA 4WN9A 3ZQ4A 4CF7A 5F7XA 5HX7A 4W9NC 2PWAA 1KMHB 1DAPA 5D1HA 5E2IA 3RASA 4NBTA 3ZW9A 2C3MA 4IIJB 1UWKA 1KERA 3K05A 1YZLA 2M9MA 2Q0XA 3WLJA 4PGMA 2NZVG 4IJVA 5FDFA 4EL5A 2Z6UA 2X8BA 5AXBA 1T5TA 1RM3A 1XZNA 4OHZA 2WUGA 4MI3A 1IHDA 3RSQA 3KUUA 3QEJA 1AKTA 3AJ8A 5FWYB 4Q66C 3F5SA 4AXXA 1KOGA 1B8VA 4YVFA 3N0VA 4WLOA 1C41A 3PL5A 2O3SA 4Q3DA 1XXHA 1H6CA 3FUCA 4HZUA 5C37A 5JHGB 1R15A 4AO7A 5FLKA 3NKLA 4WLEA 4O08A 2EBHX 3GVPA 4NBRA 1U0JA 1U1FA 2WDPA 3CWZA 3FTEA 2WD8A 2VHJA 4R98A 2FZ4A 3RYHB 4OQDA 3TD2A 3TIVA 3K0SA 3H9CA 4S05A 3CF4A 4N8SA 4C2AA 4DIEA 3JSAA 2PAAA 1JAZA 1ZO8A 3QMPA 2HIGA 4GYWA 3U4GA 3ZIAD 1FNBA 1QZ3A 3VNSA 2J5RA 5GGXA 5ISMA 4JLBA 1JEYB 5ULLA 4CI9A 1SUPA 1AGYA 2HCTA 4GI3A 2W9XA 4LVNA 4ZC1A 4BU1A 4LGVA 3REGA 5TC4A 3H9JA 4FWTA 1YQTA 1XU4A 4DNOA 1XVVA 3KUXA 3M1AA 3QJYA 3ZI7A 1FJ2A 5DGXA 1YZQA 3W8RA 4AKIA 1H66A 3G5AA 4RJLA 1N2IA 4YK7A 3WWZA 3GAZA 2NT3A 2IDZA 1YJXA 2OFPA 4Z0HO 3NRBA 2X2OA 4JL6A 4ENPA 3EEOA 1TCAA 4JQSA 5BN5A 3PEVA 3VAAA 2HT1A 2HDNB 1KO5A 3GCGA 3KYIB 1FSGA 4WFJA 1DXYA 2BGUA 3MJ4A 2JZOA 2C5BA 3ZS8A 2QU8A 2FMKA 3CGWA 2YIDA 3TRDA 1IY1A 3ZC3A 3GN2A 4O1IA 4EPYA 1OH8A 2WU3A 4O0MA 4NI5A 4RPJA 4NR0A 2GHIA 2HZBA 4XVRA 4C07A 3GFRA 3J7TA 4TS4A 2GZSA 4M9UA 3KOMA 2XD9A 3AV0B 1XTPA 5JVDF 3R5KA 5G3ZA 3G2OA 1EJ0A 3L8GA 1C9EA 1GZ4A 2PKYX 3ESYA 3H9EO 4YRQA 5H0IA 4EPVA 4M8LA 3DNPA 3GELA 1T5SA 3OEWA 2GO1A 1A9TA 2O52A 3VO9A 4JX9A 4TN1A 2Q1YA 5D3QA 3FFBA 1TYEB 2ZUCA 2AN9A 3W7AA 1H2FA 2QENA 1KY2A 3NWPA 4OQLA 4MJ7A 1KBQA 1C30B 4KYTA 2EJWA 1GADO 5DEIA 3ZY6A 1XLTA 4QATA 2N3ZA 2P27A 4E32A 4DB2A 4IAOA 5G0SA 3IXLA 3TLJA 4J3JA 3P9RA 1UXOA 3I2GA 3DO8A 3AR9A 3GLHE 3PQ2A 4MA5A 4ZV7A 4FT4A 3T1VA 3GR6A 1WPRA 1E18A 1CR0A 2WFLB 1QONA 4YUXA 5EWMA 2QT1A 3DV0A 1PLLA 1YQQA 1EUYA 1OZ0A 521PA 3N75A 3BMNA 3TF5A 4CM9A 1Q91A 1JBKA 2HC9A 3GFPA 1TEVA 2C94A 2FW8A 5CRIA 1SQ6A 4RANA 3G2HA 3BXGA 4KTTE 1KYWA 2VPZA 2DRIA 3GBSA 3UCEA 5F7ZA 1DADA 1FFAA 3DZIA 3C45A 4JR2A 2VJMA 3ND9A 3TCNA 4KQEA 4Y6PA 5FOVA 1ECGA 1JDSA 5CFQA 3IBSA 1PJ4A 4IHJF 3Q7QA 2N75A 4MV1A 2HMYB 1EFVB 3PNLA 1E61A 2R8RA 5CDSA 2BMDA 4NBVA 1XQ9A 3IR7A 4P3KA 4WA8A 4YBZA 4OMUA 1YJCA 2DZDA 1Z17A 3W1WA 1CUDA 1KJJA 2AJCA 3FNHA 4IOMA 4ALNA 1DKQA 4ZQFA 1BYUA 1XWWA 4K5QA 2AEMA 2D06A 3GCWA 4NH4A 2H2WA 4HOYA 2A5FA 2YV1A 4CXMA 3FPHA 4KZPA 4O2RA 2A9QA 3H3XA 4JKOA 5F3DA 2O1XA 5A4DA 4KWHA 4CI0B 1JSZA 1P1RA 1ACMA 3PUXA 2WKRA 2GF2A 1WQ3A 2X3YA 4X1OA 5CT4A 2P7IA 3I8SA 4QOSA 4EKNB 5C8VA 1ORIA 1E6EA 1ST2A 4PLTA 2GOYA 1NIPA 2WY2D 2K7ZA 1LNZA 4CQMD 5H70A 1W85B 4IIEA 5BXYA 5CNKA 2IHNA 4ETWA 1AO0A 3WK9A 5E6UA 2RJNA 1CETA 1NYTA 2CGEA 5B37A 4DDTA 3BCRA 1YDEA 4X71A 1OMOA 3PX3A 4B7AA 1FY2A 4E21A 1MVNA 2RJ3A 4L9WA 4R81A 4YRIA 4L5YA 4MVWA 3LVFO 3PDHA 5EA2A 4HY3A 2CK3A 1W8DA 4KIWA 1YU9A 1Q7GA 2ZBPA 4I81A 3DQZA 3QK7A 1QK5A 1WP9A 3DE7X 1RE0A 2RGUA 3R3HA 2YRFA 5EXXA 5K3FB 2CJXA 1N3IA 4MV6A 3X3HA 2VFAA 4BB9A 4LFBB 4QYIA 3M2PA 2OP0A 2XWPA 1EFKA 1Y98A 2CLIB 3FWNA 3IMGA 4DDKA 2A78A 4WVFA 4KIFA 5J3JA 2QAGA 2IS4A 4Z9AA 1EVYA 3OPYI 2X2FA 4B3MB 4J3NA 2YWDA 1YZTA 3D6UA 3QWAA 3P0HA 4YDHB 5U1PA 4CQLA 1FF9A 3L4JA 2CHVA 2YYZA 1ZA2A 1RQ7A 4V24A 3OUTA 4WCFA 2IZ0A 1QDLB 1N2SA 3G7NA 3RSZA 4YMVA 3OMXA 2IV7A 1H0KA 2IRWA 3IUEA 4OSOA 4I55B 3TBKA 1KYQA 3EULA 4AZ3A 4OHWA 4Y2TA 3L4EA 3QOFA 1G5HA 4LWQA 1E4VA 1PJSA 1XPJA 4LBYA 2VPTA 3PLRA 4X00A 4ZRNA 8ADHA 2AWNA 4P82A 2BHSA 2GBLA 1UPXA 2Z2JA 1QUFA 3FZQA 2W42A 4L5AA 3L8CA 2R6JA 2GFQA 2V54A 2QRLA 1IZ8A 4LZLA 4AY2A 3I53A 3UT0A 4OHVA 2HDWA 3IT0A 4JLWA 3M8KA 4P7KA 1CPYA 5AXCA 3TZQA 3SJ7A 1HFJA 4FZRA 5GV8A 1XZBA 3LZ6A 5KNCA 1GUFA 3ZXIA 1GG9A 4IOKA 1CY4A 4F56A 5A5GA 3ENKA 2I4OA 4YT8A 1XOIA 4B76A 2FUEA 3PQ8A 4TRRA 3MBOA 1I10A 4TUYA 1K7SN 3GDOA 2C5LA 5A0FA 5IUNC 1TKRA 4K40A 4L4RA 4ZZIA 3GMTA 2QIOA 5K99A 2ZITA 4D9HA 4UM5A 2J45A 2J0UA 5TLSA 1L1EA 3UMFA 1KI9A 4X9XA 4E2ZA 3MG9A 4BNKA 2C4KA 1E5XA 1LJLA 2HCRA 1PG0A 3H0CA 3IDZA 3JYNA 1XLUA 2NYVA 3K6KA 1M2OB 1NSTA 3PXEA 4Z8XA 5CGZA 1G64A 3BL5A 2AEEA 1M0EA 3K15A 4BUJA 1QNFA 3H11A 2HX1A 5BN4A 2JL1A 1HL7A 4H3SA 1Y1LA 2OQVA 5F5XA 1NOKA 3IQHX 4X3CA 5H81A 1U4SA 3CH5A 4HDRB 4R3UC 3CTMA 1X7GA 1T1IA 3KOZA 1QQ5A 4KO3S 5EJ6A 5BWCA 3NS7A 3U7HB 2A4MA 5EZ6B 3F3MA 1V45E 2PUFA 4E2WA 2JAOA 5JSKA 3QFSA 1QYCA 2FEOA 4DR3B 5D84A 2F67A 3KVRA 4W8HA 2A0YA 4IDBA 4ZCQA 1LPSA 4KFSA 2JHAA 3FCYA 2ZJ2A 5JCZA 4OI1A 1DXHA 1XEXA 2FLWA 2IHTA 4OGGA 1P1CA 3OLZA 1R0WA 2WG1A 4RIGA 3EZ6A 4OCZA 3AIOA 1U80A 3FA2A 3LX8A 5KYTA 1GZ6A 2PBLA 3JVIA 2GPBA 2CNKA 3NAZA 1L5NA 3EIWA 1A8QA 4AS3A 1XLVA 4DQDA 1PS8A 1PRYA 3QQPA 1C14A 5FUVA 1PLKA 1ZNQO 2Q45A 2NSYA 4JI5B 3BWBA 4MPPA 1MQAA 1UBHS 2JLXA 1CVRA 3AJRA 3UM9A 1PO7A 3N2EA 2QRQA 3U60B 3DHEA 4E14A 4II2A 5BOVA 1U6KA 3FOWA 2QRVB 1RFLA 3KZMA 5BMVB 1QIJA 1TU0A 1OYYA 4YRZA 2C8JA 4P8RA 2ZIVB 3U4QA 2HU5A 4EG0A 4BNDA 4D97A 1EINA 1TYAE 5BR7A 5KJCA 2Q1TA 1GWNA 4TM8A 1OF1A 3S2IA 1GZUA 2NU7A 3T5AA 3TQHA 2NXEA 2W6ID 3SJAA 2I1VB 5J63A 3B5JA 3SJCA 4C4TA 2AQKA 1FUYB 4W1QA 2VT2A 4O1HA 2H5JA 2WSLA 2FXVA 1NHWA 1F3LA 1GAQA 3ROGA 1IB6A 1ZAKA 1CYEA 4EKDA 2JGRA 3PUYA 3ISTA 3WNZA 4L2IB 2J0SA 4MVJE 3GLIA 3FAZA 2X2PA 1H3NA 3QV1A 4Z2YA 1EMDA 3KQYA 1SCDA 2WTMA 3M4XA 2QMOA 3ZLTA 2HAEA 5C1BA 3U7QB 4QOGA 3VBCA 4YRFA 3RKUA 3QXJA 4AKGA 4BRSA 3ELUA 1EZ1A 1I2CA 3QYJA 1UMBA 3OE7A 4U3JA 3TG2A 2P30A 1SG0A 3A11A 3O94A 4UAUA 4C7KA 4DPLA 3EH1A 1Q2XA 4JJEA 2XB2A 3HN6A 2OUIA 1LLDA 5G4KA 3CMCO 4URYR 1E0DA 1BKYA 1NW5A 1ND6A 2NAPA 2OO7A 4ID9A 5CURA 2ZYRA 5HKAA 4HB3A 5DHPA 3RAJA 3CKLA 2REQA 2YXLA 1LCIA 5IX8A 1FLVA 1DBVO 1N3YA 2Q4RA 2CBZA 2A9JA 4YJ3F 1WNFA 4GVLA 3ZYCA 3TPZA 4BVJA 5AD1A 2R8ZA 3PHHA 3E9QA 2ACKA 1OI7A 2BDUA 4QXQA 4DANA 3IOYA 1Z4QA 2YINC 3HHPA 2FWJA 2I0FA 3MS4A 2G83A 2EX4A 2EZTA 3QLUA 3IFSA 4OGFA 4ZHQA 3THXB 1QUEA 1DQRA 4HRXA 3C39A 4QQRA 4CUJA 2ZYDA 3PR3A 4QD3A 1FDSA 1DBQA 3TQQA 1H94A 4ZVKA 3UN1A 1WHSB 3I5YA 4E4TA 5KJFA 1JZTA 4TL6A 1DPGA 3B3JA 2ZROA 1NXWA 3PQ3A 2PUWA 4MVJM 2Z30A 3AZOA 5JXWA 4B0PA 1HNZB 3KO8A 3OOEA 3WWDA 3G1TA 1VPEA 1HO3A 2OLEA 2XA2A 2ZYIA 4IINA 1P1JA 3RAGA 2OWDA 1PJTA 1T8PA 4FJ2A 1D09A 1MTZA 1ZMOA 2VJYA 1YJ8A 4IQ8A 4TSFD 3W2HA 4B85A 4MHTA 3DMRA 2IBMA 4QNMA 3U2QA 4N8EA 3EGDB 3M1IA 4AW9A 3THWA 2JH3A 2GBGA 3ZPXA 3QXCA 4JUAA 5LZ8A 4N40A 1HWYA 1NN1A 1FS5A 4RZQA 5GONB 3TL2A 4MWCA 1I01A 2HRDA 1OH5A 5GGYA 4CDMA 1YRBA 2YNMD 2DFNA 1UCFA 3BE6A 1F8UA 1LLUA 2KX7A 3WP0A 821PA 3LT1A 3ML1A 2HCJB 5DCUA 4B7UA 3GAMA 2P11A 1Y1SA 2D2EA 4GICA 2J41A 5I7OA 5F7JA 2JHFA 1ZK3A 1W5FA 1J22A 4RM2A 4C30A 1DJLA 3ELBA 3OCYA 4BHTA 4EARA 1QP7A 1SXJA 3NDIA 1JIIA 1WXXA 1X86B 1YQUA 2JGNA 4N18A 3S8EA 1ORDA 3H2GA 1RWQA 1OBVA 2CC2A 1QIIA 1TZJA 2HJGA 3E22A 3PFWO 5A71A 2GKSA 3G8AA 4ER3A 3DWEX 3V4LA 1BH6A 2QVLA 5DNYB 4MKRA 1R6TA 4PRZA 5JSQA 1H6BA 3H8JA 4EPTA 2XWBF 3HU3A 4H6XA 5DWVA 1N2EA 1P0IA 2W4IA 3JQQA 3KZOA 4AMBA 4J6FA 1CUYA 4LHYA 3ANNA 2O2EA 1QTRA 1RWXA 2GJSA 2PH7A 4B3GA 2QZ4A 1CEXA 5CXXA 5FNVB 1M6EX 2COKA 1E7MA 3ZWMA 3ZJ5A 3GUYA 3W9YA 4N6NA 4F06A 4MS1B 2XODA 5ICCA 2PJRA 1KPIA 2VJCA 3NEAA 4I1UA 4W6ZA 1YI1A 2G09A 3LL7A 3DOEA 4OSPA 3L7KA 2WU0A 4TTIA 3RS8A 5L51A 2ZTLA 3ABQB 3KQNA 2XGJA 3KSAC 2C9OA 3N8DA 1NTRA 2CZCA 3B9QA 4V0MA 1XQVA 3KPWA 4GKAA 5FHRA 5H3CA 3T7JA 5C1PA 2CV0A 1N4DA 1QGOA 5HIMA 2H2AA 2VWHA 3GYBA 3MB8A 3BMOA 1K9SA 2I99A 4PXYA 4HQRA 3IX7A 3NFRA 1SWVA 4BMSA 3ABSB 4HTFA 3UTDA 3IP6A 4IJ5A 4OD0A 3S44A 2FSFA 4IIJF 3K4HA 3N3BC 1M7GA 3PQDA 2H4JA 2AEFA 1CFJA 3K1JA 5B1EA 5H7XA 2WWGA 4O5AA 1F7VA 1KDOA 3ZTTA 2G82A 3WRVA 5EHQA 1JXMA 1HZZC 1Q14A 2OV4A 1FX0A 1MAVA 3UWMA 5AT1A 3IYLW 1HEYA 4CEIA 4NU6A 1WEHA 4WMLA 1G3MA 3KYDB 3KLOA 3Q11A 5A2QA 4BN4A 2QN9A 3ZH2A 3ROMA 1UOPA 4PYJA 2YH2A 1NG1A 4KLAA 2W71A 4LRYA 5FFMA 2NGRA 1EWKA 2YRWA 3GJ7A 1PYOA 2ET6A 5AO9A 1Q19A 4KXLA 3D8RA 2NZWA 4NYIR 4ZI5A 1A4UA 2XXAA 4NAUA 1W6UA 3GLFE 2NU6B 3X1ZA 3KOWA 3UNXA 2IUTA 3AZPA 2IYSA 3B6IA 2V96A 4GRAA 1FE8A 2Q1XA 3KC2A 5CPBA 5SY6A 5U4XA 4LF8B 2YJGA 3TJZA 3ZZ0A 4GC5A 1SHKA 1BXGA 2JJ2D 3RD5A 1DP4A 3E27A 1IOWA 1YI8A 2Z5VA 2JA2A 4JWTA 5CDFA 5LOVA 1V1RA 4J8PA 1AQIA 1YCGA 2R7KA 3ESRA 1USKA 2DETA 3HB9A 5CD9A 3QVKA 1E66A 1N2CA 3FPFA 3OVMA 4G8BA 2XQKA 1G16A 2PZAA 5K0CA 2VJKA 4RTPA 4RS3A 1BNCA 2EJCA 5DWDA 2VJBA 2GH1A 2G9QA 5EHGA 3L1JA 1ZSYA 5TSDA 1EUQA 3GDGA 4RM3A 3CUKA 2BLNA 3TCKA 1KYVA 2QV7A 4CW7A 1VSQA 1W88B 1XCLA 3GJRA 1A7AA 1FFHA 1YS1X 2Y05A 4DJDC 1ZH2A 5KNCH 3FI9A 5LQJA 4ZYYA 3LCMA 5E4FA 3P2OA 5IVHA 2DLCX 1DRWA 1UMDA 2PO5A 2Q62A 9MHTA 2IW3A 5G40A 3HO8A 2ZPUA 2X3FA 4G2TA 3JV7A 1L7AA 4RPHA 4FYJA 5EE0A 4EB6A 5IASA 3JASB 4R51A 4DXDA 1SD5A 4WX2B 3PBKA 1W29A 5ADVA 2OBBA 2QJWA 5ITSA 2FF5A 1VIAA 2YZNA 1F8XA 2XYPA 1XELA 2HY7A 3IVGA 4O4IA 1FQJA 1SKYE 2XXBA 5ENZA 2VZ9A 2OUKA 5HF8A 3NG1A 3H87A 4ENWA 1GRCA 4C20A 3ASZA 4TTVA 2NP6A 2JEZA 3FNBA 2FZWA 1G21B 4ZU1X 3WMRA 1FTQA 1K8RA 1O87A 1RYEA 3L0YA 4MLDA 1IZ9A 3Q7TA 2B8NA 4YCMA 1EUDB 5E4TA 3BREA 3BE4A 3OOJA 2GZAA 1T2UA 4KO4S 4G0OA 4B3HA 5JNUA 1OXBB 3I72A 4MR9B 3H1FA 4A8TA 2RONA 3IPYA 2C4VA 3OQJA 2BDEA 3PTZA 2E18A 5CYFA 4ASUD 4RULA 1L3CA 1XJCA 3HXQA 5FEMA 3ZDCA 3I9LA 3JWJA 4FEAA 1CQJB 2PZJA 1TADA 2AJTA 5CA1F 3B7WA 4J07A 5KEIA 3L0DA 3GGPA 3W8DA 3FMPB 3IR5A 3P9KA 4FGKA 1RWNA 3PQ4A 4PR0A 4IGAA 1E4EA 1D6NA 4W5TA 3ER9A 4K0KB 3KWLA 5KJEA 2NLOA 2UUAB 4X8MA 1VCNA 4B47A 2ZWVA 3BIXA 3LZCA 4QVGA 1DKUA 1MPXA 4LXUA 2ZCVA 1ISFA 5EZ5A 3GGOA 5DW0A 5HVNA 2XXAB 5MN6A 1OYWA 4YT2A 2XWSA 3ANXA 3DEIA 3EGOA 1PCXA 3WDKA 4DMRA 3ANMA 1I4TD 2D4HA 3E48A 5K0NA 4A0RA 2D1YA 1MFZA 1Z83A 2CDCA 2FQ1A 3OLYA 4HMOA 1U4NA 4DLYA 3V97A 3PPYA 4F9EA 3EEQA 1W44A 2D7DA 4A0GA 3R9XB 3S2FA 1Z4OA 3IERA 4I8DA 4EDFA 4CU2A 1L4BA 2VNSA 2PKWA 1P0MA 2X5NA 2YVLA 2JBWA 1QF7A 3UMJA 1G3IA 1V8BA 4JJ4A 3SJUA 1X80B 4Z6KA 4B75A 1BGVA 3I6BA 2QTTA 2HQBA 2XBLA 3OKCA 3LUGA 1D1PA 2L17A 2DBZA 2WKWA 1KA9H 1QTQA 1P33A 3NGMA 4CEHA 1XNQB 1Q3KA 4YJFB 1C8LA 1XTZA 2F59A 2VL7A 3A28A 4Q7LA 4R2HA 4DB4A 1XD2A 5CAEA 2A9VA 3IUNA 1MRNA 4QUJA 2IITA 3ORFA 3NUZA 2EVWX 1EXVA 1B0UA 3GLRA 2II6A 4Y9RA 3R7NA 4G36A 1N36B 2B35A 2ZBGA 4CN8A 2NUPB 2I5PO 3CLVA 4HUTA 1P4HA 2BCJQ 2WA2A 1VG9B 3BGIA 2VTKA 4MYTA 1K3FA 3BB1A 3EXAA 1T1EA 2A0FA 1BRMA 1C2YA 5IXJA 2HU7A 1E8NA 3OZEA 4RPIA 4DLKA 5H3HA 5KYWA 2IYRA 1KO8A 5REQA 4B3BA 1D2GA 2DKFA 1OKKD 3H65A 3H5TA 1M1YB 4GMGA 6ADHA 3MC1A 4BFLA 4NP6A 2JBAB 3CX3A 3UQZA 4EX6A 4V2UA 2P4UA 4XR4A 4G8JA 5K51A 3DXXA 5LBIA 5H83A 3BWEA 3MINA 3R75A 3AUUA 4ZPJA 1L7EA 3L3BA 5IH7A 1RDFA 4EJSA 1BE0A 5BWBA 4DWWA 3I30X 2ZFUA 1PBNA 2H2HA 2Q6LA 4N7MA 4BVKA 1JFFA 1T6BY 5B53A 2YC2C 3ILXA 1Q12A 3HDGA 1IVSA 4V0RA 2RHBA 3AIMA 1V35A 1Z68A 3DOFA 4HFNA 2FSGA 3D3JA 4LNAA 1X3SA 2R47A 5F1OA 1ZCFA 4ZCSA 3LGXA 1QGED 4JXKA 4TLMB 2OPHA 1VPTA 2UXCB 1U2DC 4ZYLA 2RHLA 1U1IA 2B7BA 1J09A 3MUFA 2FE1A 1A5AB 3V1KA 1UBLS 4I55F 4UZSA 2EIHA 4G63A 5BPFA 4LISA 3E58A 2VSFA 3V8PA 1OX5A 1ZCZA 2POCA 2FKAA 3RO7A 1FRQA 2RJOA 4LC1A 1OGYA 4L1KA 5CX1B 3D7NA 3G0IA 3U0BA 3MRVA 1UBKS 4WJZA 3FOCA 3SP1A 4GH5A 5CDGA 3NTLA 1WU7A 1SIOA 4QIHA 1HYQA 2G3YA 1HY3A 2EF1A 4Y1FA 1PZEA 2VBFA 3DEAA 5ESDA 1XT6A 4QYMA 5M34A 5LMUB 3RVQA 4LOIA 3TB6A 2OHIA 4PZPA 3LPDA 4O5OA 3B82A 2DB3A 4ND1A 4CE6A 4IDCA 3KKOA 3LT5A 3A3NA 2PR7A 2Z3VA 4YR7A 2QNIA 5IAOA 1QHNA 1JIKA 1II9A 1KJWA 2OWEA 3ORHA 2AXPA 3KLBA 3RS3A 5B4VA 2EKBA 5LZ2A 3VVCA 5E6SA 2NSJA 1U2TA 4IQGA 4NFSA 1VRCA 1U6JA 3SIRA 3N07A 2PUHA 1ZQ1A 3UHJA 2GAJA 3VR4D 3LDUA 2PXHA 2LIPA 1LD3A 1E6WA 1ECPA 4Q9JA 1ONSA 3R5HA 5LYJF 4TMVA 3R3UA 1E3JA 3H9QA 3NTXA 3I4FA 1LJ8A 1U5AA 3T4PA 1WVMA 4RLFA 1KS9A 2ZXFA 3V9PA 4DFDA 3D9QX 1R0RE 3SJZA 1HI9A 3FMOB 3KX2A 5BRNA 4TWJA 3L7NA 3NT5A 1EEXB 4PPQA 1W6RA 2QRUA 3BCUA 3K5PA 2OV3A 5F4ZA 1VMDA 1QX3A 4I4CA 4JVNA 2FU5C 4LTDA 3OUZA 4EAQA 1GDTA 4UM9B 4G0NA 4Y2JA 5E9AA 1R00A 4WD3A 1OX4A 3KPUA 5DH9A 5J1TB 4Y2QA 3ZU3A 2PEZA 2RCYA 3SSOA 1OB2A 1QS0B 5I4CA 4Z7NB 3AKZA 2V7VA 4XD2A 2CCJA 2EJBA 3A4YA 1R9NA 2MCFA 3IT1A 1NNLA 1RIIA 3T3IA 3LF2A 1AMOA 4Q15A 5KNDA 1PFYA 1UANA 4N54A 3R2JA 2C7BA 5AK3A 3WLRA 3ER6A 1EWRA 1V4NA 3IQFA 2DCUA 4HZGA 4F60A 3RREA 1U11A 2CDNA 2EKZA 1CJSA 2WHXA 4EZBA 1EM6A 1RP7A 3OC0A 4UKDA 4H35A 3B3FA 4YRTA 2HJHA 4V03A 3U6KA 3NYRA 1T8WA 5BR8B 3N0WA 2FP3A 3E9EA 2QHXA 3FNFA 1Q1EA 2HLNA 3MTDA 4K7JA 5BMVF 2YKGA 2R4UA 1NW9B 1EAMA 3II6X 2XX3A 3B1YA 4DJ5X 2VKTA 1KOJA 1ODIA 2ZJAA 4YR9A 3IDOA 3TNJA 3CB4A 3ZKAA 1N5LA 3EZGA 5DIZA 2KPOA 4I6EA 4L0DA 3AI7A 3QNWA 4KBYA 4U6SA 5FO1A 4E5YA 2AUNA 3NX4A 4YRCA 2GCNA 4Z1MD 1CJTC 4DJFC 2RGEA 4JC5A 2QZ9A 4L8FA 5JO9A 3DE3X 3T95A 3HJNA 4EB0A 4PBRA 5KREA 2H6EA 2VHZA 5C8XA 1ENYA 2JLCA 3WFIA 5ADHA 2FMUA 1NF2A 2J3IA 1E79A 3EWNA 3SC2A 4MQEB 4PHTA 3UH1A 1MZVA 3ROQA 3ZY4A 5JARA 2R6ZA 2GCPA 3WLQA 2MJLA 5B58T 3E0QA 1WTAA 3GFSA 2BDTA 4UEWA 5DBHX 2HIAA 4J3FA 5I7VA 2GEBA 5EMMA 1I7SB 4AY4A 3FOZA 4RHCA 4OK6A 4RS4A 4FE3A 3QEKA 4EO9A 2TSYB 3I9JA 2Q5OA 4ZRMA 5FL3A 1QWSA 1RLUA 2YC4C 4FJ0A 3TNFA 3O74A 3OHMA 1XX6A 3M49A 3NRJA 3QXSA 1L6RA 2XNDA 3GT4A 3LZDA 1G63A 2JRLA 1W5TA 1P5JA 1GIAA 1XTIA 4IXWA 1QB8A 1S8OA 3I5AA 4IF6A 4JBXA 1UJNA 2HJRA 3KCNA 3N5KA 4WADA 4JB0A 3KOYA 3OLCX 4CM1A 1D0VA 4OQNA 1R5BA 3BTUA 1FP4A 5HUHA 1XZFA 4DHWA 1Q7RA 2ODAA 3V7YA 4ZZ0A 4XR9A 5A3RA 3WA7A 1RJWA 1DBIA 1X8LA 4G8DA 1W94A 3WJ2A 4ZJYA 2B9VA 3K09C 4QELA 1F2VA 1L5HA 3ZZ1A 4D9CA 3I1FA 3Q3IA 1TK3A 1J5XA 1F0YA 2ZIWB 3LRTA 2IDMA 4R16A 5F5LA 4WCDA 1L4FA 4IHKA 5G1NA 5TGZA 2WG2A 1B15A 3FGOA 4C14A 3EX7C 3NYIA 4D9EA 3GT0A 3ZE0B 3I5MA 1C8KA 1OH7A 3I01A 2IBSA 5EUMA 4BNXA 2NIPA 1JQAA 2FW7A 3MWKA 4M46A 2C5EA 4B6SA 3S68A 4HUQB 3ZDYB 3I2JA 5EIAA 1QYDA 1U8EA 4HB2A 1UDRA 3PJEA 2IXTA 3IEUA 2O0LA 1NVFA 3FWYA 5D5QA 5L9AA 1JLLB 1G42A 1NBAA 2V1XA 3VFDA 2OOKA 5K0FA 3V1UA 5AVSA 4W4TA 5J47A 3LPNA 2Y27A 2J0VA 5CJ2A 1Y63A 3D7MA 2G28A 2ONKA 2QVBA 3KJQA 2MYNA 4YI5A 2OBLA 4HWSA 4F84A 2R1VA 3LV8A 3TLGA 4L4SA 1U4OA 2FG6C 4RFVA 4PG8A 5GONF 3RC3A 5CH5A 3FTDA 4DQVA 4G9BA 4XM2A 1L7NA 1JA1A 1TLLA 3ZOKA 1Y9EA 1NONA 5GM1A 5H16A 4PRLA 3IHLA 4G1BA 4KQFA 4M6WB 1EP2B 4CR7A 2WTNA 1E2NA 2AGVA 1P31A 2OZEA 2YVUA 3AETA 3CR7A 3FRHA 2CMDA 4RV9A 5L3SA 1XZCA 3U81A 2Y4NA 5DNVA 3ZU2A 4NSNA 2HWWA 1M10A 1VE1A 2QZJA 3ONEA 3QSGA 4IIDA 4URHA 4CM8A 4UTPA 1TEXA 1MENA 1ULBA 4GI5A 4EAAA 4JAVC 1XAGA 2BKLA 3D02A 3Q3EA 1R0SA 1TEHA 4CM7A 4CG0A 3PKIA 2BELA