4WY8A

Structural analysis of two fungal esterases from rhizomucor miehei explaining their substrate specificity
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
PTVKLKPYCQNIADAATIDSTQYPPEVVRKAEAASIIDDPKALEGLPDVYLEEKTINRKNGSKIELTITRPLDTENQVLPPIVFFHGGGWVVGSKLTHRRTVYELTVRARAAVIFVNYSLSPEVRFPTALEECLDAVVWVAKEENAKSINVDPTKLVVAGDSAGGNLSAVVCIRAKQLGLNIIKGQVLIYPVTDDNFETDSYKQFAENYYLTRKLMVWFFDHYIPDKKDRQSIFACPLKASIDDLRVLPRALVITAEADVLREEGEAYARKLIEAGNDVTAVRYLGIIHGIFNLATLSPTGSEILDHIVAWLQKTWKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords esterase
publication title Structural insights into the substrate specificity of two esterases from the thermophilic Rhizomucor miehei
pubmed doi rcsb
source organism Rhizomucor miehei cau432
molecule tags Hydrolase
total genus 111
structure length 325
sequence length 325
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wy8A00
3WLAA 3H2IA 5JD6A 1WHSA 2AJLI 1R4ZA 2VQ6A 4WDRA 1BN6A 3STUA 1GPNA 3DL4A 1QIEA 4AN1A 1F0NA 4BAZA 3IA2A 5LP1A 1G42A 1UKAA 1DU4A 3H0CA 2XMRA 3PDCA 3AJAA 3FYUC 2PX6A 1QIKA 5CRIA 5AM1A 5ALZA 1JU3A 4U2FA 1X70A 4KR0A 4X85A 1LPAB 1ZD4A 5AP9A 5ALDA 1EDEA 4C01A 2XUJA 5AI0A 2WHPB 1CUWA 2Y2UA 3B12A 3ED1A 5JASA 1ACLA 1WPXA 5ALQA 1OCEA 3L1IA 3STVA 4TGLA 4UHCA 4Y2VA 2DR0A 1CUCA 1AC5A 4UBLA 1TKRA 4KE8A 1CUBA 4J0CA 4X6XA 1ZI6A 5AICA 3CCBA 4MEBA 4OYYA 2ACEA 1HBJA 2J4FA 3QMMA 4QDOA 3H04A 5CTAA 4DNPA 4X94A 3ZI7A 4C4YA 1N1MA 5FOQA 5SYMA 4UBNA 4G1FA 4Y2YA 1IZ8A 4UPDA 3WL8A 4E11A 1U8EA 2WJ4A 3ZPXA 4CCYB 3AFIA 2DCMA 4KRXA 3ZV7A 1XFDA 5LZ4A 4YX9A 4EY5A 3WKCA 2WUDA 1XROA 4TPKA 1BEZA 1XZIA 3CN7A 4GWLA 2D0DA 1Q83A 3NWOA 2K2QB 1CQZA 3DS8A 3TEJA 2AXEA 4EY7A 2JGFA 2XDWA 5ALHA 3I6YA 4H7KA 3PI6A 1HDEA 4L0CA 5K3EA 3EQ8A 1T2NA 1B6GA 4YK7A 4ARBA 4ZI5A 3FVRA 2HRQA 3SWWA 1QE3A 3FCYA 1HQDA 1ZI9A 4PSDA 2H9YA 5AIBA 5E4TA 1QO7A 4QEKA 4H7EA 2R8BA 1TK3A 3G0DA 5CT6A 2BFNA 4AMZA 2H7YA 3GFFA 1JMYA 2IIVA 2WJ3A 4F60A 2Y2VA 4X00A 1IZ7A 4FNMA 5K3DA 4LYEA 1CFJA 1YA4A 2Z3ZA 1BU8A 4AB1A 4LHEA 3V9AA 1JKMA 5LIPA 4XWGA 3CN9A 5IVKA 5LKRA 4GHWA 3WWOA 5CXUA 4KAJA 3WKEA 3VVLA 5LYYA 3AIOA 2B9VA 4BTVA 4YPVA 1WB6A 4BZZA 3PF8A 4XX1A 4B82A 4C87A 3STYA 1TIBA 1OXMA 4BVJA 4K6KA 2J4CA 3H17A 2GYWA 3DDUA 2XUOA 1P0MA 1Y7HA 2EEPA 1TAHA 5AK3A 5EFZA 2RHTA 5JARA 3IUMA 2RONA 3FLEA 2PUHA 2WG2A 3R3XA 3G8YA 1GKLA 3W9UA 4GDMA 4QWMA 4KACA 2BJHA 1MTZA 2QUAA 3O4GA 5EHQA 2XLBA 2V96A 2VEOA 3DKKA 1W52X 1CUIA 1WPRA 2Q0XA 3FYUA 4J0HA 3DL7A 3WZLA 5AOCA 3WJ2A 2HU7A 4XIIA 4INZA 1N5RA 3AIKA 4JNCA 2BGNA 5AOAA 5C8VA 3C87A 4Q34A 5FXMA 5LZ2A 4HS9A 4UHHA 3D2AA 5ALJA 3TJMA 4WY5A 1E8MA 1A8UA 1D07A 2OCKA 3D2BA 5HZGA 3WL6A 2ORYA 5EHXA 1UK8A 1RWQA 4ARAA 2GYVA 5FDFA 3ESDA 4IO0A 5FKJA 4H0CA 1SFRA 1WHTA 5AKHA 4B84A 4M0MA 4PQEA 4L3WA 2HFKA 2QJWA 5I8PA 1P0PA 4QDXA 1JJBA 2DQZA 4OYLA 3IUNA 7YASA 2PUJA 4FWBA 2DHEA 5KREA 3AINA 4DGQA 3D4LA 5ESRA 4QE3A 4Y2RA 1XZMA 1XRMA 5D6OA 1P0IA 1CVLA 4FHZA 1GKKA 3C8HA 2UZ0A 1LPMA 1XQVA 3BIWA 1BN7A 2YASA 3BWXA 4N8SA 2GYUA 3RLIA 5FLKA 4BYMA 1R88A 4C88A 2WUGA 4B85A 4EB0A 5HCUA 4DM7A 1EHYA 2Z8XA 4OU5A 2XMQA 1QTRA 4KEAA 1XZKA 3C6YA 3GROA 5AKEA 2C5FA 1GPLA 4EBBA 3RK4A 1CLEA 1JMKC 4BCDA 1XKLA 4AO8A 2WM2A 3G02A 3EQ7A 4BDTA 1C7IA 2WFZA 3BE8A 2DSNA 3FYUB 1EI9A 3NOXA 2WHQA 1CIJA 1CUAA 1XRRA 4N5HX 4KYVA 5LZ5A 1DQYA 2QZPA 3AZPA 2HDWA 4Q82A 3OOSA 1AGYA 5DJ5A 4GBGA 5K5EA 3G9ZA 5DNVA 2JGEA 1LNSA 5IVHA 2HM7A 3GUUA 3LP5A 2Z8ZA 2XMGA 1OILA 2XQFA 2GBIA 2QMQA 4FFWA 1QOZA 3HYSA 4ZV7A 1YAHA 1T4MA 3B5EA 5JZ9A 2WUFA 1Q84A 5HKAA 3ZLUA 2XUGA 2H7XA 2JGLA 2I3ZA 1CUXA 5J3JA 4J03A 1I6WA 1YSCA 3EF3A 3HEAA 2VF2A 5AK6A 2V97A 2GBGA 3JWEA 3F96A 3AIMA 4U2GA 3S2ZA 4OCZA 3U1TA 1LPNA 2OXEA 4Y2PA 3MVEA 1BEEA 3R3VA 4DYHA 3VXKA 2CEKA 1LBTA 4QWWA 1R3DA 4BZWA 2XMDA 2G5PA 3IB3A 4Q3LA 5ALVA 4U2BA 4QA9A 1DX4A 1VE6A 5ALKA 1H23A 2FJPA 4IHAA 3A2LA 2XUQA 3A70A 4J0KA 3IULA 1FFEA 4F0JA 2Z3WA 1FJ2A 2HA7A 1P0QA 5JD4A 4BTLA 3BF7A 1JU4A 1UK9A 5CH8A 2O7VA 1XLWA 2Y1KA 4IH1A 3H19A 1EB9A 4OD0A 5EGNA 4L9AA 2VJDA 5CH3A 3OURA 1GQRA 4NS4A 3A2NA 1XZCA 2OG1A 3KD2A 1YR2A 1ZJ5A 2I3DA 5CT4A 3M81A 4B9EA 4J3JA 5AKIA 3C70A 3DQZA 2PBLA 2Y6UA 3UMJA 4DSZA 5D7BA 3H2GA 1MT3A 2CMFA 4X7BA 4FFVA 1XZFA 4PSCA 3QVMA 3H2HA 4DMKA 1GPKA 1HLGA 4LIPD 2HA4A 4BVKA 1QO9A 5HQ3A 2AJBA 1MX9A 1G66A 4A16A 5EI5A 1Q0ZA 4FDMA 3PFBA 2AJCA 5DYYA 4U2EA 1LBSA 5ISMA 3G9XA 2O2IA 2JEZA 4HZGA 3IUJA 1SC9A 1ZI8A 1WB5A 5BWCA 4H7DA 3FSGA 4B83A 1R1DA 1CPYA 2IX9A 2OGTA 2BCEA 2DHCA 3V1KA 1XZEA 3QPDA 4UBOA 3K6KA 1H22A 2ES4A 1MNQA 4DNFA 1RP1A 2I03A 3WK9A 1Y37A 2GBCA 4CCWA 1CUGA 1ZD5A 2ECFA 2ZSIA 3D59A 1WCYA 3FLBA 5AKYA 3O9MA 4EY4A 1QIFA 2PM8A 4FLMA 5ALSA 4X93A 5LZ9A 2QXTA 5AKKA 3N2ZB 3PUIA 2AJDA 1AQLA 4H7JA 5K3BA 3O0DA 2VTVA 5DYWA 4KE6A 3R3YA 1WM1A 5A6VA 5E4YA 2XMCA 2RIPA 5AKJA 3C6XA 4X6UA 1SCQA 2X76A 4WDQA 2PPLA 2BUBA 4QNNA 4J7AA 1Y7IA 2HFJA 2CUTA 4WCVA 4WFKA 3HSSA 5AOBA 3I2KA 2ZYRA 3H2KA 4N8EA 3CXUA 1AURA 5C7YA 3Q8WA 5ALNA 5ALGA 3L1HA 4KRYA 3R41A 4JUIA 3MUOA 5HQ3B 4AN0A 3A6ZA 3I2FA 1XLUA 2D5LA 4GW3A 3VVMA 4M0FA 4Y7DA 1QIHA 1GXSA 4HAIA 2CB9A 2B4KA 4PV7A 3H2JA 4H7HA 2ACKA 4K2AA 2WU3A 4Z49A 3QMVA 2CZQA 4BP9A 2XQJA 5IH7A 4LYDA 5ALMA 1X2EA 2OGZA 1ETHA 3WKAA 5JAPA 1IUOA 2ONCA 5ALOA 1LGYA 3FWHA 5FPQA 4AX4A 3F98A 3WA7A 4LXIA 1XZJA 3G0BA 3W2TA 3ZLTA 2HHAA 4BBZA 2VJCA 5AI6A 2QOEA 5K3CA 1XLVA 4DTCA 1E66A 5ALFA 1J2EA 1L7AA 1DX6A 3O9VA 4W1QA 3PICA 2ROQA 2RHWA 4FBMA 4PNZA 3WK6A 1LZKA 1C7JA 2BAGA 2R11A 3BXPA 1E5TA 3I1YA 5JYCA 3QH4A 4MXDA 4OB8A 2HA0A 1QONA 5HK8A 3EIOA 3ANTA 3VDXA 4OB6A 1QGED 5AM4A 4N8DA 1EH5A 1ODSA 1CUUA 3BL8A 4RNCA 1CUYA 4FOLA 2PSJA 4OB7A 4V2IA 4PW0A 5AJHA 4AO6A 3X3HA 2J3QA 1W76A 1ZIYA 1TCCA 4IQ4A 5JZSA 4KE9A 3LCRA 1RYYA 4X97A 1W4LA 3DD5A 4ITVA 5AKLA 3E3AA 4FKBA 1USWA 3I2JA 1XZAA 4LXHA 4QDZA 1IVYA 4OUKX 2CKMA 2WKWA 4QLOA 4ZWNA 4I3FA 2O7RA 5AM5A 2C7BA 3R3ZA 3STTA 3AILA 2XT0A 1YCDA 4FTWA 1XQWA 3KSRA 2HRRA 4A23A 4E15A 5JATA 4B7ZA 4NVRA 4W1SA 2XQGA 4C4XA 4AQDA 3N0TA 1HPLA 2RGUA 3R40A 4G4IA 1KEZA 5ALLA 1J07A 3ZWQA 3S8YA 1X2BA 4Y2SA 3ESAA 1DT5A 1GZ7A 1EA5A 5EIAA 4F21A 5DNUA 4EUSA 2WJ6A 1XZBA 4YASA 5KWJA 1EK2A 4UUQA 5AI4A 2QS9A 1BS9A 5D3ZA 5ALWA 1DTEA 3F67A 4WJLA 5HFNA 2WIFA 2W22A 3BF8A 3HI4A 3OG9A 5ALXA 3PF9A 2JEYA 2VSQA 2EDAA 1R9MA 1QJ4A 4ZV9A 5E4JA 1YB7A 4X95A 5A7HA 1C4XA 1E3QA 1XRNA 5EIHA 3WWCA 4Q1VA 1KU6A 1VE7A 1U65A 4B0OA 1E89A 3I2IA 1R9NA 1K5PA 1AUOA 2CJPA 4NMWA 2G5TA 3OTQA 2BGRA 5F4ZA 5AM3A 5BV7A 1SOMA 4CFSA 4E46A 1DWQA 2PSFA 4A5SA 1Q0RA 4CG2A 5AHXA 2G63A 2EDCA 3KWJA 1QIDA 2ZVDA 5AKXA 2WSLA 1TCBA 3QBJA 1UKCA 1CUEA 5A2GA 4Q05A 2W6CX 5EIEA 2JGMA 3D0KA 3WWPA 1QFSA 2WIKA 4BC0A 4DNOA 1CEXA 4ZRDA 4EY8A 3STXA 4J0IA 2OLEA 1VA4A 2O2HA 4UHEA 2XUHA 3DEAA 3HXKA 1A8QA 1CUJA 4BE4A 1LPPA 2WG1A 4ZGBA 4H35A 5FPPA 3I6MA 5C8XA 4AZ3A 2ZYHA 4IH4A 3IDAA 2WIGA 2FX5A 2DHDA 2JGJA 3E4DA 3BDIA 1XZLA 1VXOA 5AM0A 4W63A 1DINA 5K3FA 4JH0A 1XKTA 5ALEA 1UXOA 5FUMA 6YASA 2VA9A 4JYPA 2Y6VA 4AO7A 1PFQA 3WL5A 4JEIA 4KE7A 1LLFA 2H1IA 4DSAA 1VKHA 4RGYA 2XMZA 2OAGA 1LPBB 3EBLA 4QDTA 2QRUA 3DLTA 2WTNA 1K8QA 5C8ZA 2OAEA 5FP0A 2WIDA 4AZ0A 4Y2JA 1QIIA 2YH2A 5AK5A 5YASA 2VAVA 4Y2TA 1XZGA 2HU5A 4OU4A 4BAUA 2ZJ6A 1XQXA 2PVSA 3NGMA 4B9AA 3IUQA 1F0PA 2HA3A 1MAHA 2ZJFA 3JW8A 2E3JA 1ZICA 4MQLA 5CT5A 3D7RA 1N5MA 1UOOA 3OC0A 2BKLA 2PU5A 1L7QA 1UK6A 3K9BA 3C6BA 3O4IA 1MN6A 4ETWA 2VJBA 2DQYA 1SCIA 4BDSA 3RKSA 1N8SA 4P9NA 4H7IA 2PSDA 5HF8A 3QPAA 1BE0A 3VISA 3FYTA 3G0CA 1EDDA 5JADA 4BP8A 1DQZA 2VT7A 2XI4A 4MYDA 2X8BA 3L1JA 4OPMA 5HF6A 4UBKA 2QVBA 1E8NA 3BDVA 3H18A 3RM3A 1GGVA 5AK4A 2YYSA 1TQHA 4QLAA 5AI5A 4WFIA 2J3DA 5AO9A 2I78A 1IMJA 2JGKA 3TGLA 1ISPA 2WHRA 4BRZA 5CMLA 1AZWA 2CBGA 4BRSA 5AKZA 4BC1A 5K3FB 2VAXA 4Q3KA 3R0VA 1ODCA 1EX9A 5JZBA 2RAUA 2PKYX 4G9EA 4K6HA 1QIGA 3QMWA 2QTBA 4FMPA 4Y2XA 4EA6A 2WTMA 3I2HA 2IITA 3D2CA 4CI9A 4AMYA 3CCCA 3V1NA 3VJLA 4P93A 2WUEA 4G8DA 4E14A 5T4FA 4JYMA 2C5GA 1EB8A 2VATA 3WWDA 1CUHA 2LIPA 1U2EA 3KOOA 4BCCA 1R50A 3YASA 1XZHA 2FUKA 5CT8A 1FFCA 2OQIA 3JYHA 4CIAA 1UK7A 4QDUA 4W1PA 1MX1A 2WU4A 5IVDA 1L7RA 4GEGA 3QPCA 3R3UA 1UFOA 3VJKA 1FFDA 2HU8A 3C6ZA 5CW2A 1W75A 4QZVA 4Y2UA 2OGSA 4KAAA 4PSUA 1VXRA 5LLSA 5DWDA 1PV1A 3LS2A 3VJMA 3I28A 5T4HA 1FFAA 1YS2X 5D3KA 2ZJ7A 2QM0A 3F97A 4WY8A 3DOIA 2PSHA 3C45A 1WB4A 3BJRA 5ALPA 2XMSA 3ESBA 5FRDA 3G7NA 3H1AA 4UHFA 3DKRA 5CBKA 4X3CA 1W1IA 2B61A 1VZ2A 3E0XA 3T52A 5AIAA 1NU8A 5AKGA 2QR5A 1UOPA 5ALYA 1J06A 1H2YA 3WK4A 4HTAA 3F8SA 1PJAA 5SYNA 4C6HA 3EQ9A 2VJAA 1UKBA 4Q3OA 5JAOA 4N5IX 5AH0A 1EINA 4MQMA 3WK5A 1HKHA 3DYIA 2OPHA 2XUDA 4U2DA 4BCBA 3C43A 1DT3A 1U4NA 2GBFA 1HL7A 2WQZA 3C5VA 4WFJA 3WK8A 3GA7A 1CUSA 4DIUA 4J0JA 4J0DA 3HACA 2HA6A 3DCNA 4EZIA 3DJYA 4DMHA 5A62A 5T4BA 3FVTA 4M0EA 1EVEA 5AI8A 2QJRA 4K6GA 3G0IA 1XQYA 5ALUA 1ZD3A 1A7UA 3ANSA 3W9BA 2WLSA 1H2XA 5KWIA 3I1IA 1MJ5A 4LKOA 2BUCA 1KU0A 2XUFA 4LXGA 1CV2A 2HA2A 3I2GA 3OPMA 2HA5A 5LZ8A 5JAHA 3ICVA 1THTA 1XRLA 3FAKA 4KJXA 3GZJA 4L72A 3IIIA 3WZMA 3G9TA 1FSSA 1QIMA 1LPSA 3MUNA 1CUDA 2WFMA 3HC7A 5JD5A 4UFOA 3O4HA 4GXNA 1ZOIA 2P8SA 3GELA 1ZJ4A 4O08A 1EDBA 4MEAA 5A7FA 3LLCA 3WWEA 2FJ0A 4DLNA 1BCSA 1LZLA 3WKDA 3WL7A 4Y2QA 1YS1X 3G9UA 1H2ZA 4X6YA 1AKNA 1CR6A 4XVCA 4X91A 3V48A 1ORVA 3D3NA 4MWSA 2XQKA 2QT9A 4PO3X 2PU7A 5T4EA 1AX9A 2WIJA 5I7UA 1IUPA 5JALA 1JJIA 1JI3A 3I6ZA 3WYDA 4EY6A 1YB6A 3M83A 1MNAA 2PSEA 5HK9A 1E8DA 2G4LA 5LZ7A 4D9JA 5CXXA 1MU0A 3O95A 2XUAA 5JAUA 2PL5A 2NW6A 3STWA 4EHBA 3DOHA 2ZYSA 4FLEA 1ACJA 3BIXA 3M82A 4G8BA 3D5EA 4BATA 5DNWA 4KAFA 3ZLVA 3W06A 2WG0A 3O4JA 4CG3A 3U0VA 1O6FA 4F5ZA 2QKYA 4XJVA 1YA8A 5IVIA 1A88A 1YASA 4HRXA 3UUEA 1EK1A 1K6EA 3HRHA 1JT2A 5CURA 2QXUA 4CG1A 3IVMA 5A71A 1AMNA 3C5WP 4UBJA 1F6WA 1QTIA 4H77A 4RE5A 3QYJA 2Z5GA 2AJ8A 1ZGBA 5EHZA 3HJUA 2VT6A 3FNBA 3AZOA 4G5XA 1ZIXA 4BB0A 3NUZA 4BVLA 1VLQA 4B0PA 3MGAA 2JIDA 4DMCA 1UOQA 3LIPA 4W1RA 1CUFA 3FSGD 3QZUA 1LPOA 3AUKA 5DTIA 3WIOA 1BROA 3W04A 1IUNA 5DYTA 4X92A 1A8SA 2OCLA 1MPXA 2XMBA 3GBSA 1QLWA 3ILSA 3UUFA 2O2GA 1CQWA 5ALRA 1W6RA 4G9GA 4B80A 4AXBA 1CRLA 2XLCA 4X90A 3WMRA 3FCXA 3C8DA 3KWFA 2XUKA 1G4HA 4DMFA 3E1GA 5BWBA 4C89A 1ODTC 3OM8A 2WFLA 1QFMA 4G4GA 4J0GA 3IURA 4HXGA 2X5XA 4K5QA 4ZREA 2HIHA 1TRHA 2ZYIA 4HRYA 4NZZA 3DYVA 3PUHA 4HXEB 3H1BA 5AI9A 4HXFB 3HLKA 2B20A 2GZRA 4MYSA 3HABA 3WJ1A 5HKBA 2ZSHA 3T4UA 1J1IA 4HVTA 4CIBA 1NU6A 1G5FA 2JGIA 4U2CA 2XB6A 1M33A 5AM2A 2C58A 1H2WA 3WA6A 5K3AA 3PE6A 5ALIA 1ZGCA 4ZXFA 2JF0A 2BUAA 1B41A 2H7CA 4ROTA 4UHDA 1VJ5A 2QUBA 3B3QA 4C4ZA 3BJMA 3PFCA 1VZ3A 3FLAA 1F8UA 1THGA 4UFPA 4TVKA 4P08A 3V1LA 1XRQA 4FBLA 1DWOA 4I19A 3ESCA 3WYNA 4IH9A 4MJ3A 1EVQA 3KXPA 3V1MA 1Z68A 2C4HA 4PF1A 4X71A 1WOMA 1MAAA 2XQIA 1QZ3A 1VOTA 1JJFA 4GECA 4UFNA 3SX4A 5H3HA 4DNQA 2OCGA 4RPCA 3IBTA 2HL6A 5HFAA 4S0XA 4UBIA 2V9ZA 2WILA 2C0PA 5BOVA 1S8OA 1FFBA 2C0QA 3FBWA 4I4CA 3M3DA 3FOBA 1TCAA 3ICWA 1MX5A 4H18A 3A2MA 2XUPA 2WFLB 3QM1A 4RE6A 5I9IA 1BCRA 4MWTA 5IKXA 3SK0A 4H7FA 1O6GA 1ORWA 4BE9A 3LIIA 4UBMA 1QIJA 4GI1A 1DWPA 2V98A 5DTJA 2WHPA 3R3WA 4W9RA 2YXPX 3K2IA 5HF5A 3DNMA 3QITA 4B6GA 5DLPA 3G0GA 1BRTA 1K4YA 3VKFA 5EHNA 3KDAA 2DFPA 3P2MA 4BAGA 1CUVA 3RARA 5A7GA 1UT6A 1JFRA 5KBYA 3W05A 3WI7A 5CH5A 1YAJA 4OSEA 2XUIA 3AZQA 2RI6A 1K63A 5E2IA 1UWCA 3WIBA 3TRDA 1MO2A 5CT9A 1XZDA 1SCKA 3WQHA 4G4JA 1EXWA 4G8CA 2XE4A 4Y9SA 5LKAA 3F9CA 3WK7A 1UZAA 4P92A 4CCYA 1ZD2P 2OCIA 1XRPA 4FLFA 4GLBA 2HADA 5C81A 1CUZA 1GQSA 3WKBA 3Q0TA 3HZOA 5JIBA 5HF9A 5JANA 5FV4A 5ALTA 4B81A 1GT6A 1VA5A 2OQVA 2JBWA 3SC2A 2GZSA 4FNGA 1NX9A 4UHBA
chains in the Genus database with same CATH superfamily
1U7HA 1CJKC 3WLAA 3MCZA 3KKEA 4R83A 1TX4B 5JD6A 4XI9A 1WHSA 3LDGA 4UJ5A 4WMLA 1R4ZA 2V7VA 4F3TA 1LS6A 5A05A 2ENWA 4CIXA 1QIEA 3P1JA 1UBCA 4A1FA 1M83A 3DYBA 4HDSA 5A0TA 2HDHA 2Q4BA 3FYSA 1X9IA 2FK7A 2XOXA 2I6FA 2YVAA 1G42A 2GTPA 3NBXX 3NM5A 3RLFA 4OQPA 3V55A 1ADFA 5F76A 2Z83A 3LQ2A 2HQ1A 3MMPA 1UKAA 1SBNE 3BMCA 3DT6A 2C4TA 3G0OA 3V4SA 1Z7EA 4RPJA 3TR5A 3W5JA 4EA8A 2XMRA 2YZ2A 4DCJA 3UK0A 4Z7JA 4YJFA 3OCWA 1P39A 3D8BA 4FONA 4FFPA 2VPWA 2OV8A 3GRYA 3CNQS 1GAWA 4PTLA 4JLAA 4RLQA 2BTQA 3ZDXB 1H69A 5CRIA 4Z0HO 5AM1A 2WY2D 2FX2A 3U44B 3VHXA 2RHJA 5TV2A 2ZT6A 1A9QA 4HGOA 4ZAFA 4L9SA 1KDYA 1JVSA 1NG9A 2Q3BA 1DNPA 2WFAA 3ZWPA 1ICEA 1LVUA 2QX6A 3V8EA 4C29A 1JGTA 2YHUA 1FSGA 3VA7A 4FGKA 1DKMA 4E5VA 2JATA 1JG3A 4Q66C 5TY0A 1GPWB 1ZUNA 3G2MA 4ZC1A 3TB4A 1J09A 4WXYB 1NVBA 3SSNA 3AHEA 4S35A 5B2FA 4GM4A 3I83A 4GU5A 2HGSA 3FMVA 4LDAA 4IOKA 5JFOA 1GFWA 4KQGA 4EQ6A 2I4RA 1BC5A 1G6OA 1O77A 3NUQA 4Z0NA 1UDXA 4Z7QB 3PNQA 5T6BA 1RLJA 1V16A 1O2DA 4O5OA 2BC9A 2CV0A 3EIQA 3TTUA 4IYJA 2C3YA 4P54A 1WPXA 5ALQA 1R4MB 1NNEA 3GQBB 4L02A 1D8AA 1XMVA 1OPRA 1NOKA 2XNKA 2CFSA 5A3JA 5KTTA 3IRVA 3FTEA 5K0LA 4ZHQA 4URXR 4Y2VA 4E13A 2OQ2A 3O2QB 1N5LA 4TUYA 4UVHA 5FHRA 3TFOA 4ISCA 5FX2A 2GHTA 4KE8A 3NBMA 2E5LB 2QD3A 1PKXA 2OHVA 2AEEA 4Q37A 1Z0UA 5C5DA 1ZI6A 3AOEA 4IBOA 5JMOA 5C46F 2XVMA 4E4TA 4HRAA 1OIVA 4X1OA 3S1AA 3DQQA 1PD1A 5K7SA 3QMMA 4QDOA 1T9GR 2X2EA 1W1UA 3UUWA 3N2YA 2OFOA 1FTQA 3G9QA 2OLKA 5T8KA 4D4IA 4B4WA 3BQMB 4C3OB 3FKQA 2DC1A 4RD1A 2DPYA 2BZ1A 2H5LA 3IP3A 4K2HA 1WXDA 1MO5A 5DNEA 3MRXA 3U4HA 1TPZA 4K88A 2VP2A 5THQA 1YULA 2YDYA 3MTBA 3IMCA 4MJXA 4Z0TA 1X3LA 2FQXA 1BQ3A 1V8OA 5FJJA 3TBFA 3VPAA 2WJ4A 2D7DA 3BA6A 4J43A 4NPAA 4YC7A 1JDPA 3AFIA 2E4XA 4D02A 5DEOA 2ZOSA 1Q0HA 3A4LA 4O8ZA 1LI7A 3LT2A 4PHTA 4QX6A 1TT5A 3AQIA 1NF2A 1XFDA 3AHGA 2JANA 4BJ5A 1ZSYA 3PQEA 1YS9A 3R8XA 2W4IA 1I7QB 1DKPA 1URPA 2Z6AA 4OGWA 1M0WA 5D6NA 2C4VA 5GV7A 3TEFA 3ZC3A 5I01A 1TZMA 1KAGA 4B4UA 4UCFA 4NP6A 4YUWA 2GWHA 3JPWA 2JGDB 1J70A 3CN7A 5P8WA 2RI1A 3U9SA 1VRWA 4LMRA 1CF2O 2NV2B 4P4SB 3X1WA 4F8JA 2C57A 2HLDA 4NESA 5L6LB 1Q15A 1ESCA 1I4EB 2PMBA 2YVQA 3JASB 4HDRA 4U39A 3TEJA 4EG8A 3DBHA 5DN6A 3WNVA 4B40A 1EP3B 1SKUA 4KWTA 4ZALA 3NHWA 4I5GA 4EY7A 4UM9D 2JGFA 4NEQA 3S27A 3OQIA 1KC1A 2ZG6A 2BMDA 5IAOA 5FTNA 4JJAA 1JKJA 3A1VA 3FAZA 3CZ5A 2EHJA 3G6WA 2FVXA 5EJIA 1NLZA 4ZYTA 1Z47A 4PNPA 1LDEA 1EFAA 3I53A 5B1EA 1V4NA 2OK8A 4HVLA 2VDRB 1DQPA 3DJFA 5FJIA 1EFRD 1Z8DA 2VNIA 4MK4A 2PZKA 2Q45A 3RWBA 3PDIB 3U61B 5CK5A 5CVTA 2VQDA 2JD2A 3EDYA 3EQ8A 4YV2A 4YK7A 4ZOBA 2Q0QA 1ZXBA 3DBRB 3BJIC 3JQEA 2WJVA 3IHKA 1M9NA 3LK6A 3PA8A 5C51B 3O3OB 1OYOA 2G9VA 3FY4A 3LXMA 4UDXX 1H5UA 3NCTA 5IS2A 1HQDA 4KK3A 1RQXA 1G7SA 3VKGA 3EARA 3H7AA 1Z17A 3JWGA 4EEKA 2KBEA 4MROA 3VR1A 1QX3A 3W6ZA 3Q10A 4U1RA 2ODNA 2H9YA 2YQ5A 3E7PA 1JIJA 3GJ4A 3O5AA 3E58A 4HWSA 4J07A 4LZWA 2OB1A 3Q40A 3IJPA 1NJ6A 3MFQA 3GA0A 4H7EA 3ZV4A 1DJNA 3WICA 5E0OA 2R8BA 4UOEA 4JLUA 4LKRA 4I50A 1I1NA 3GEHA 4FKZA 5IFLA 4HNQA 1J39A 4NQZA 2JHGA 2R1VA 5CT6A 4CM1A 3T0GA 1NDUA 4JJEA 1JQLB 4YP7A 4AW9A 3GJXC 4L8VA 1EXDA 1PJ2A 4CVNA 4EHDA 4MV5A 2B4QA 2EVWX 3PKIA 1YBFA 2KQUA 1SULA 2ID7A 2PLRA 2WJ3A 5TGTA 1D1SA 4X00A 1K5GA 2E85A 3M2TA 5CA0A 5HUHA 3E82A 3AYXB 4LYEA 1BU8A 1JKMA 1M2KA 3B48A 5DBIA 1XTSA 3CN9A 5JSYA 3VNSA 5IVKA 4CF5A 5K0TA 4X20A 3WWOA 3E48A 1TO6A 1YBVA 3LKVA 2DPXA 5D3QA 5CXUA 2NYUA 4IDOA 4G86A 3FIUA 4JVOA 3X2FA 5AVZA 5JFGA 4Z53A 1DE0A 1DIOB 4TKVA 3AIOA 3IERA 2BBWA 3C3YA 3EGVA 2FCRA 2PEZA 5F9HA 4WNIA 4G24A 1EK6A 1WTCA 4OFBA 3NBKA 1TECE 4K8RB 4NZNA 4NNJA 4BZZA 4QULA 4L8YA 1SU7A 3MJDA 2NQ8A 1TIBA 1HSZA 5DHAA 2V45A 4XX0B 3UH0A 4K6KA 5CJJA 2VC2B 3H17A 1UJCA 1WZIA 2GYWA 3QVGB 1JHPA 1E69A 4J9VA 2CMKA 3OMWA 2ZSKA 2EEPA 5MN4A 1PVOA 1NSTA 1TAHA 2RIRA 3H8VA 3N6RA 2QRQA 5JSZB 4RVSA 5CFMA 4P5PA 1NQUA 3BD7A 5EFZA 3IAHA 2G9ZA 1RQ2A 1KH2A 2IODA 1U28A 3SICE 2PUHA 3QFHA 2CJXA 2WMNB 2AOXA 2IFTA 1N78A 5EXSA 5KVSA 4JI3B 2HWXA 2VJNA 3WDSA 2FQYA 2O0JA 1M5UA 2ZWVA 5JQWA 4TKZA 3PXXA 1Q19A 1Q6ZA 1FP4A 2B8NA 2YN4A 2O1WA 2BJHA 3MLBA 1K06A 2VK2A 1Y3BE 1Z74A 3R5TA 1BVYF 2OY0A 3UT5B 1JQ5A 3MJ4A 5IKEA 3S2EA 1EFCA 1IY2A 2ADFA 2AOTA 5EJ7A 2O20A 2CXNA 2YN0A 3V4PB 1OI3A 4NFYA 3TG2A 1G18A 4MUYA 2L0XA 4PSAA 3BL5A 3ELWA 4UZEA 5B3KA 2V96A 1IATA 2VEOA 3IO5A 2C88A 4JP8A 2IYNA 1LRLA 5F7JA 1E62A 4BRWA 4N7BA 1FBNA 5LUAA 2G7MC 1WPRA 3VTFA 1Z5GA 4FT2A 4B75A 2KWIA 4UNRA 4WY2A 1WF6A 3LQYA 4MR7B 1GPDG 1SG9A 4RKFA 3LNCA 2HHCA 3GCXA 4R2WA 4XLLA 4EVQA 2FSHA 2HWWA 2LWIA 2ZTMA 4INZA 3RVJA 3NGLA 2IS2A 3E70C 4M1KA 1TCUA 3ZUPA 1MO6A 5AOAA 5JCJD 1P3DA 5LZ2A 2IA5A 2YZGA 3LP8A 3ETNA 1N92A 2XF8A 2YN2A 4HDKA 1EZZA 2EJUA 1H6AA 4L5IA 3NMUF 3QSGA 3ZVRA 4AP9A 2B34A 3DDOA 2C9YA 5EEHA 3X0DA 1RLOA 5EA2A 3MNFA 1S3IA 2FG6C 2OCKA 2OENG 4F6RA 2B8WA 4RH0A 4CETA 4UU8A 1WLSA 3AUTA 5JJBA 4CHTA 1L4UA 3RUCA 2DH6A 2JJ2D 2Q5JA 4PTYA 5LBTA 3DMTA 2GXQA 5HZHA 4PO1A 4LJ7A 3H75A 3VRHA 1RWQA 4HCJA 4ARAA 4OG2A 4XFKA 1SVIA 1BW9A 1FU7A 3ESDA 5LYJF 4IS2A 3PEWA 4H15A 3N7TA 4M0MA 5EESA 1QOQB 3SQDA 2A84A 4B3IA 5TMBA 3DBOB 1ZRNA 1A5ZA 3V5NA 1M76A 4IEIA 3NJ4A 3WLHA 1HDRA 2YVLA 3K05A 4A2WA 1KP2A 1U8UA 4RPKA 3A3YA 4RVFA 1P72A 2OKGA 2DQZA 4NQRA 4QAJA 2PY6A 4R16A 4YCNA 3I23A 3WB2A 4NJEB 2CEAA 1WE2A 4GX1A 2CDRA 3KFLA 7YASA 3E9RA 1V1MA 4HDMA 2DHEA 5ICCA 4EUNA 5KREA 3QKWA 2O0KA 1Z5WA 4I1PA 2PWZA 4FC6A 5E6RA 3TNLA 1ZCBA 4HDOB 5BPHA 5HM6A 3U1VA 5CDTA 2WM8A 4TLEA 5IJ0A 1RPZA 5ESRA 2A7XA 2HO5A 2UYGA 3EEQA 3KPWA 2WJAA 4BUCA 1N0VC 3THWB 2F17A 1NVEA 4CZ2A 4Y2RA 4BFWA 1CU1A 1N9GA 1TLLA 1ISHA 1UFVA 1FC0A 2AX4A 2IIQA 4C04A 4S05A 2AYXA 1Y7TA 2DRIA 2Q3DA 1GAQA 1YZTA 2RB4A 1S2MA 3HKDB 4NZMA 3DMFA 2XIQA 2Q28A 1GKKA 2HI0A 5CFQA 5GM2A 2ATEA 4D6YA 3TOZA 1HM5A 1LPMA 2IU0A 4RFLA 1XQVA 1HTWA 1DAHA 2H7VA 4ECAA 5KYGA 4JP2A 4ACAA 2YASA 4H1VA 3VKWA 1KI3A 3JTEA 1VKRA 3B8EA 5LYJA 3EMBA 4GPAA 4ZO6A 4P22A 3RC1A 1EFKA 1MJFA 4F96A 1DRJA 1II0A 2ACVA 2X19A 1ES9A 2WUGA 4EB0A 1PBTA 2ZDHA 4XR4A 1KR5A 2ATIA 3TE6A 2BMEA 2W4MA 2Z8XA 4NYJR 4XR9A 4DM7A 2ID8A 2ZQ5A 1RXWA 1SUIA 2VPIA 2BI4A 4JBYA 4C22A 3B20A 5HKKD 4Z3DA 4X5OA 4KR3A 3DDWA 1T8SA 3RGWS 2CDBA 3HWWA 4EL5A 3DVRX 2EJBA 4LRYA 4KXXA 3GROA 1FNNA 2BGJA 3OKFA 3TE7A 1Y9AA 2QK4A 3MW8A 4BX0A 1LF0A 4HB2A 4N6OA 3HPRA 3USCS 1EMDA 4HNGA 4CL8A 4HS4A 3VZPA 3N0RA 3QXSA 1C7ZA 2XRFA 4Q15A 1FTNA 1G3MA 3J80A 5THXA 2AW5A 3OZSA 2OAP1 1V4VA 1V7CA 2I4OA 3AXSA 3CZ4A 1OH8A 4Y6LA 1ZH0A 1T29A 1UPTA 2WHYA 3QG1A 1JZSA 2VZ0A 3D8SA 4Y6PA 1QDUA 2H3EA 2QTCA 3OZWA 4MWOA 1GKYA 1RAAA 3FNHA 4WN9A 3PEVA 1E1RA 1PAUA 3WQBA 1CBUA 4RJTA 1XRRA 1FX0A 3QU2A 5B3LA 5LZ5A 3N7AA 1GL3A 1DQYA 1OV6A 4G89A 4G6ZA 3CVOA 4PIMA 4Q82A 3TI7A 3SQXA 3FPBA 5IK2A 3ZDQA 1KK3A 2OBFA 1AGYA 4ZGGA 1EVJA 4GBGA 3DHNA 4XOIA 4HEQA 2Z2YA 3U3KA 3FCSB 2HF9A 3ZKWB 2JGEA 2EFCB 3W8NA 4B4OA 2GGSA 4IQ0A 5IVHA 4KTTE 4EHKA 4X7PA 1PEKE 3K70C 1NGSA 2AUMA 3O7MA 3X1ZA 5LN1A 1UJ2A 2FPXA 4BKOA 1QGUB 3AF3A 1AH2A 1Z4KA 4WK0B 3ZNOA 1ZM2A 2C3PA 2VHZA 2I2AA 5EE9A 1EFRA 4ZV7A 2X2OA 1SQ0A 2W6JD 4W4TA 3O9ZA 2FQQA 3B5EA 4LVOA 3KXIA 4DDWA 3U4QB 4UNQA 1Z0KA 2G9UA 2RH9B 4ZMSA 2QRLA 2W2QA 3ZLUA 3TTVA 2CD9A 2H7XA 4ZTZB 2I3ZA 4I7EA 1CUXA 2JHAA 3EQ6A 3HYCA 5EOVA 1ZNZA 1IZYA 1W44A 4UASA 4YPOA 5B57C 3EDQA 1BVHA 3D1JA 3UGTA 3L6BA 3HDTA 1JPJA 1H65A 3A1TA 1ENOA 3KZMA 4WACA 3EF3A 5G40A 3SJUA 5B55A 2EC5A 2I91A 4G9BA 2VF2A 3FUTA 3GP3A 4PQRA 2GBGA 3EGWA 1AKYA 2QR3A 2ILTA 3A58B 3JWEA 4GXRA 1RS0A 4KXYA 3F96A 3AIMA 4Q1DA 3S2ZA 4B3DA 1ULSA 4HLQB 2ZKIA 1V5FA 4OCZA 3KSDO 4UEWA 3RABA 1Q14A 3TXYA 1GG8A 2RH8A 3U1TA 4ZFNA 4OOEA 3OEED 1NVGA 1O3YA 4P53A 1H4TA 1ZVMA 2AQHA 2Y4OA 2TSYB 1W88A 5DCUA 3ZXUB 3FOEC 3MVEA 4D3ZA 2BI8A 3ONVA 1GLVA 2GDJA 2VNKA 4CMHA 4DYHA 5C18A 3TLAA 3FX2A 1K5HA 2CEKA 3FMFA 3BE5A 4R05A 4IV8A 3RRYA 4R0VA 1LBTA 3WSWA 3ZYZA 1IHYA 1SCAA 1M7HA 1XJ5A 2B78A 3AWDA 4J0FA 4NHOA 1L5GB 3FHOA 5AD1A 2C2ZA 4UM5A 4CLHA 3I5YA 5HVNA 4H1TA 4DB2A 5G0WA 1T1EA 1OFUX 1EK0A 4QVKA 4W8HA 1MC1A 4GLLA 4ZEXA 2O5EA 1TA9A 3KQNA 1N3YA 2BGMA 2QM7A 2QVYX 4HQRA 5EKTA 3EXEB 3I4LA 3PSHA 1RE1A 3K1ZA 1RJ9B 5MN5A 5C34B 4EK9A 2FZEA 4RQTA 1DX4A 2H2GA 3HM2A 3F1LA 3OT1A 4KFTA 4QPNA 5ALKA 2AFHA 1PK8A 2ISCA 1ID8A 3I0ZA 3GHHA 3ZQ4A 1G1MA 1YDEA 2C2OA 3RSHA 3IKTA 4TRMA 1EUZA 2FJPA 4M1YA 4KX5A 4DCVA 1MABA 3A2LA 3BSFA 1E7SA 4QC2A 2W0MA 3LZDA 1C1XB 2O8NA 1T5OA 1SBYA 4PFSA 1FJ2A 1LLQA 2G80A 1SUBA 2HN9A 3HLTA 3ZU5A 2XB2A 3TKAA 2QRHA 1XAHA 3F5FA 6ABPA 2O1XA 4S24A 1ZQ9A 4MWZA 3ZQUA 4BTLA 5JD4A 2Q9BA 2C7PA 2XW6A 4AXXA 3ZCXA 1G7CA 3PX7A 1JU4A 2TMYA 4DAOA 1DBWA 3MWFA 1E5XA 1KRHA 1F6BA 3ZNPA 5FOVA 2AG6A 4ZJZA 4PY2A 3N39C 4FKMA 4ZP1A 4BNZA 8ADHA 2EP5A 2C5BA 1XCMA 3TLKA 4L9AA 2VJDA 3E9DA 3OURA 4AURA 3B82A 4B17A 4MAFA 3TRIA 2ZR8A 1M2HA 3OQ1A 4NS4A 2JASA 3GLGE 1WXQA 3HA3A 3WAJA 3S2FA 4BO8A 1GPAA 4U7WA 1CVIA 1E9VA 1Z26A 1YH3A 4QQNA 2JDID 4KDFA 4RCVA 5KYYA 3M81A 5LQKA 4E6EA 4J3JA 4DT1B 1Q1AA 1ZNQO 3PJDA 5T67A 3PU6A 1C0KA 4KFSA 2FWMX 2ZRKA 5AKIA 2DG2A 3DQZA 1P7ZA 3JQ7B 1VSTA 1WMAA 3VU0A 4Q1EA 1YV9A 2AZMA 3L0SA 4LXYA 1AN0A 4L07A 3ZVKA 1PZXA 2F43B 1W36B 1LDNA 3E2PA 2CMFA 1ETUA 2ZSAA 3MQFA 3KV3O 4FFVA 2JIPA 3RNOA 3SG0A 4BLWA 4YYZA 3ZHVA 1VE9A 2EBUA 1G9TA 5AJWA 3GPIA 3NTUA 2J0EA 3G85A 3GMSA 4MRRA 3TK1A 4DMKA 2O54A 4Z1MD 4QXQA 1ECJA 3PHHA 3AUFA 2D74A 4RHTA 5AHWA 4M0PA 3Q3HA 1G8AA 2I3BA 4LIPD 3V4LA 5MN6A 5HIMA 1GRNA 3U56A 1DVRA 3EIFA 1YQUA 3PNOA 2YVUA 4Q4DA 1PLLA 3PD7A 2HV8A 4I55F 1TM4E 5G41A 2AOUA 1MH9A 2JJ2A 1D9XA 1SXIA 1Z29A 3COWA 2F2TA 4NDAA 4A16A 3NAQA 3QX3A 1LXCA 1NE2A 2CLKB 1NW7A 3LU1A 5EJ9A 5FOXA 3NWPA 1L4BA 1Q0ZA 1HT2E 3BFVA 3FPLA 1HOTA 1MFPA 3EDOA 1FLVA 4IG4A 3RU9A 3ZLJA 5DYYA 1VPLA 5A4JA 2D0OB 5DHUA 5L7YA 4OMUA 3IQFA 3LT4A 4YRPA 4PGMA 3RAJA 5ISMA 4Y18A 1JXAA 2ZIGA 2DWPA 1GOTA 1DG1G 1PVVA 2JEZA 3C3MA 3E4CA 3IUJA 3JX9A 4L76A 5CM9C 5ED0A 5BWCA 3PSAA 1E59A 3WGQA 3F73A 1PZHA 4HJXA 1ONNA 1RYEA 1TM2A 1VHDA 1OXKB 1ABFA 1W4CA 2ZAYA 3LPMA 1G6HA 3CJQA 1RYNA 5FWDA 1XL0A 2OD2A 4B87A 2TMKA 4B83A 5A0VA 3D6JA 2R66A 4FFLA 1YQXA 4IMRA 5CDYA 2P0EA 2DHCA 4QU5A 2W48A 4JC5A 4AZ0B 1SRQA 1QORA 3IMFA 3PLAE 3K4QA 4C6TA 3K6KA 2ZAMA 3KQUA 3CVVA 2BH2A 3NVAA 4MA0A 4NNPA 5BY2A 2QRMA 3OTOB 2I03A 3M7IA 4WT7A 5JPCA 2XZTA 4Z9XA 5F21A 1YZKA 1JEQB 5CFZA 4RABA 1WCYA 3ZWVA 3NHUA 5FLXA 4GQIA 4YDRA 4YMIA 3WNDA 3EC7A 3FLBA 4JJFA 3FWKA 3ODPA 2BEKA 1QO0D 2K2WA 4GLOA 5JYEA 4I55A 3THXA 3V2GA 4H2DA 3SHWA 4F85A 1E6KA 2BW0A 3KEMA 4XM0A 5CHEA 4M21A 1P9NA 3QELB 3AV0B 1W59A 3V7FA 1SCJA 2A9RA 1UM9A 5D5QA 1IVSA 3PUIA 1B3RA 1NXOA 2I4NA 3KJGA 3NDPA 4U7PB 4QATA 3NHYA 2B37A 3DXFA 4UMEA 4QNRA 3CKKA 7MDHA 4GRAA 4BJ6A 1G5QA 1RAIA 1Q1QA 5M3BA 3V8PA 5A6VA 3MCTA 3OLCX 4HMPA 5E4YA 5HKKA 2RIPA 3QE2A 3S5JA 2Q6VA 2V7WA 3RRXA 4BV9A 3UC9A 2QY6A 4HB4A 4P7BA 1JDBB 4WECA 1L4GA 5A02A 1X38A 1Z3CA 2RCYA 4WH0A 2EZ8A 3OBIA 3T7IA 5KNCD 1GLNA 2X76A 2AXNA 3BMOA 4M87A 1ECFA 3I05A 5EAIA 3LH5A 4BQRA 1QDEA 5AW2A 4MW7A 1G16A 1XTJA 1US8B 3DW3X 4J7AA 5JCPA 2BBTA 2FEWB 2YFHA 5PGMA 1IY8A 2PGIA 1G8PA 1FU8A 4MTCA 1Y7IA 4BXOB 1XDWA 4KGVA 4PLCA 2XCRB 3HSSA 4GNKA 1M2OA 3KL4A 4KR7A 4M38A 3I2KA 2BCGY 1TT7A 3TTTA 4DLRA 2ZYRA 2AZ4A 3T41A 3UHPA 3TLBA 3W2GA 5JOQA 4EX6A 2NUPB 1J24A 3CS3A 1PS8A 1L7BA 4LGCA 1VG1A 4N8EA 4D79A 2XDYA 3RC7A 1QZXA 3CXUA 1JLSA 3VC3A 1A98A 4D9GA 5L3SA 1G5PA 1RI2A 1TPYA 2PV0A 4F2GA 3PWKA 1I8TA 3F3KA 4JT9A 1G8HA 2VDOB 3VZQA 1LB1B 2AT1A 2NVUB 3A3KA 1PFKA 2Q7XA 1T2FA 4GXTA 1UZMA 4BVHA 4G5GA 4JZKA 3R41A 2ZUDA 3GT7A 4PSVA 2EIXA 1ZR2A 2QN6A 2ZE6A 3UMFA 2XD9A 2O5CA 4U6QA 4R8RA 3Q6IA 5DN9A 4JQOA 3MELA 1BDJA 2EOAA 3EZ6A 1NW9B 1U98A 2FSVC 4TYMA 1KAMA 4HGZA 4JCOA 4NE9A 1JR3D 5JH7B 4M0FA 4Y7DA 1KOFA 1GXSA 1DEXA 3KUXA 2YQ4A 2AN1A 1Q12A 3NIGB 3KOWA 4OH7A 3N0XA 4QRIA 1CY8A 4PV7A 3RS3A 3RREA 4JI8B 3AY3A 4OXKA 3H9BA 2PIAA 5CLIA 3EXG2 3RRNA 3UQZA 2ACKA 2IKSA 2X3YA 1MIOB 4K2AA 2J9FA 3IR6A 1WDLA 4CLXA 4ND1A 4R1NA 5KDOA 1UIRA 3I72A 2CZQA 4IWYA 3VDMA 2IZ6A 4CDNA 2XQJA 4B43A 5IH7A 5IXYA 3ZHQA 4O8CA 1LQUA 2OGZA 4X65B 4J1TC 2GB4A 1Z7YA 2IZ7A 4HUJA 4Y2GA 3LHSA 4IIEA 4Q4HA 1MLDA 3C7CB 5EMJA 4E5NA 3JQRA 2P9YA 1RWNA 4L85A 3GFVA 5JHHB 3KX2A 3F90A 3R0JA 2QVCA 1C3OB 5LOVF 1PYDA 3T61A 3W1WA 1YF3A 1YKSA 3PYXA 3BMQB 3FWHA 3OOWA 3R3HA 3SIRA 2Q46A 3GO4A 4GE3A 4PQFA 3TLJA 3WA7A 5GJCA 2CN1A 4EJ6A 4FYJA 4O3FA 1XZJA 3RSLA 1Y9JA 3K0AB 4MI3A 5KJCA 2QRKA 4TYQA 3IJRA 2HMWA 4IIYA 4QREA 5ICGA 4BBZA 5LQUA 1Q0TA 3RFCA 5K3CA 3DBIA 2BEVA 2J45A 3KQLA 5HA5A 4II2A 2E1RA 5FH9A 2I99A 4UQPA 3UENA 3MRTA 4F84A 4KBFA 4G0PA 4L8WB 3WGHA 1OZFA 3ZVMA 4UAJA 2JFXA 5IC5A 3H13A 2XUZA 4EIWA 1FDRA 4W1QA 1OZHA 3PICA 4PNZA 1CEEA 1LZKA 2PLAA 2R11A 1XTUA 1J1UA 3ZHOA 4IG9A 4IL5A 1QCCA 4MPRA 1UBRS 2IE8A 1G8FA 1WDKA 3MQ4A 1VL2A 4I9GA 3H3JA 3BT7A 2ZRAA 4WVFA 3RS7A 3M6LA 3TFWA 3FDZB 4GPBA 1RWVA 1D1QA 1H3EA 4ZPJA 3I62A 3AM5A 1ICIA 3QH4A 2Q2WA 3WTCA 2B83A 2BFDA 1V3QE 1OWLA 2MYUA 3JSXA 3OHSX 4IZIA 1QONA 4OB8A 2ECQA 5D84A 3DZGA 1KOLA 2PGAA 3LFHA 3OX2A 3VDXA 3HU1A 4BP1A 1JR4A 4J6FA 3OIGA 1W4AA 2PT6A 2XTJA 3FRIA 3FHCB 4JVSB 2PSSA 3A28A 2AJTA 2J0UA 1FSFA 5AM4A 5H1YA 2Z9DA 1I1OA 2ZYVX 4N8DA 4OKIA 5LOVA 1D0IA 2I2FA 2RHHA 2O48X 2LV8A 3BL8A 1R6AA 2LGJA 4JI2B 3S0JA 3KPUA 3DT8A 1K66A 4X7RA 3ZGYA 5AW3A 1AF4A 1I7NA 2MOKA 2PSJA 2QY9A 4EPTA 3T9EA 3CUYA 1FQJA 1KFJB 4PW0A 4I9NA 2HHLA 2REOA 3SHQA 2OHOA 3QOFA 1N2ZA 3EPRA 3JYOA 3TTWA 4KVZA 4PZ9A 4P83A 1XR3A 3VH3A 2NPFA 4QYXA 4ZQHA 3T5PA 4P38A 1TCCA 3EVEA 3FDXA 5JZSA 5LJLA 1MR3F 3K9GA 5J4HA 5LWQA 2ONZA 2PGJA 5AQEA 5K8LA 1QC5B 1XFAA 2Q5EA 1E6EA 2GJ9A 4CTKA 4R8KA 4GWGA 1EP9A 2J33A 1LH0A 1W4LA 3DAOA 5FWXA 1MC4A 3G79A 4JNKA 3F9IA 3GLGA 1VGVA 1RJGA 3STHA 3ABOB 3LOQA 1OLOA 3JQPA 1AKRA 3MUFA 5DM60 1I30A 3N2KA 1BHSA 1EVYA 1IAVA 2PXAA 3ESQA 4HADA 1DARA 3H1FA 3IIEA 4TMYA 1IVYA 1SQSA 3SKXA 5I47A 4CT4B 4KXNA 2P1ZA 4IO1A 1FRVA 4C0SA 1T0JB 1YGYA 4OUKX 4ZU1X 4ARZA 5GTDA 2QYTA 4Z1MA 2VBCA 1XD8A 4QLOA 4XWOA 3R8CA 4H0FA 1H0RA 2O7RA 1KYVA 1FDWA 3IPYA 1AIPA 4V3CA 1NFQA 3OD5A 1JF8A 5KVVA 1IEXA 4G85A 4CM6A 3NIBA 3R3ZA 4IQGA 4EB3A 3QXXA 3AILA 4JVLA 2N9UA 1E6WA 4ZOCA 2A0KA 4J1NA 5FV7A 5K0FA 5JJCA 3UIEA 2IPOA 1LS1A 4NECA 1QH8B 2VHYA 1E92A 3PUXA 5AQ1A 3A9RA 2Y99A 3DNFA 5CX4A 5DTQA 1Q7RA 4PCLA 3IAFA 1U3FA 4G1MB 1DBIA 2GILA 3OJXA 1XVAA 5IANA 4DY6A 3DO8A 4O2BF 3OPNA 1HDXA 1Y1RA 4MUFA 3B7PA 3GVPA 2NPIA 4CMJA 3QX7A 2QP4A 2Y0EA 2VRBA 2Y0CA 3ANMA 3DUFA 3A1DA 4L4SA 4OVKA 5CLHA 3ECCA 3RS8A 1F5SA 4YQEA 2OQRA 3I45A 5HGJA 2BIFA 4TS4A 2DJIA 4W1SA 4Z9YA 4RIGA 3SIWA 3ENNA 3EGDB 1Q7CA 3FGNA 3N0TA 3E9CA 4BQOA 4YRKA 4MLPA 4JI0B 1PUIA 1U9IC 3O47A 1V9LA 3OKCA 4QU9A 4ZKDA 5I7SA 3HXMA 5JSFA 3EDMA 4OL9A 4FIDA 2P0YA 2WSIA 5HKLA 5ARDA 1PN3A 1O57A 3BEOA 3DAHA 1U3GA 4PC3A 1Y1LA 3OO1A 3B2QA 1DOHA 2PUDA 3EVBA 2GASA 4YRJA 3IMKA 2XDQA 1W34A 2ZT8A 3ESAA 1SIUA 2Z5VA 4R81A 2HSEA 4CMAA 5KCZA 1UM8A 3PJFA 4MGKR 2PN1A 2XGGA 4F5WA 2GO1A 4MIKA 3HGMA 4CKCB 2O8FA 4EUSA 4MQ4A 2WEKA 4MH0R 4DSUA 3G2NA 2I22A 2P9BA 2XHEA 3IMEA 3O4FA 4MQFA 4DW8A 3WRXA 4P98A 4YPFA 5KNDA 5D3ZA 2IPXA 1OLXB 2RGGA 3GMIA 3OQPA 2OMEA 3GGDA 4JQZA 4UAVA 2EFDB 3ZW9A 4NCKA 5F77A 5C1DA 4C0JA 3KKOA 3VQTA 1Y3DE 2H51A 3LQ4A 2P75A 1JIVA 1O96B 2ZJ3A 4D9KA 5LP6B 3T7CA 1M34B 4WJLA 1IWPB 1EXNA 3BIOA 4H6WA 4O2BA 4A6EA 3FETA 4Z9AA 4IRMA 3RVOA 4B6FA 1YB2A 1AS0A 1CS0A 3BF8A 3OG9A 4NOLA 4UTZA 4RESA 3HB1A 2E6UX 2QORA 1RBZA 1SVOA 5A9SB 1SJ9A 4D8WA 4AJ2A 1YIOA 1XYGA 4MTLA 2HPVA 2C84A 3SFVA 1N34B 2JEYA 1J2UA 1R9MA 3K6SB 1V1RB 2GBLA 3DDHA 3BILA 2D7JA 4KQXA 5E4JA 4XLZA 1ULBA 1R5NA 4HQLA 1E1LA 3PX2A 2F3SA 1MZVA 1X77A 5FULA 1L8LA 4ESOA 4PX5A 3O1LA 4YROA 4ZV4A 3V3KA 1BWRA 5KNCA 1ONSA 3WWCA 1QCZA 2PBFA 3OQJA 4YUAA 1VE7A 1D0VA 4HZUB 4PSKA 2F4VB 2DERA 5AW0A 3IIKA 3KEFA 1JDSA 2IIBA 2C83A 5JTUA 1Z4NA 1E89A 2Q9UA 1VBMA 3I2IA 3JVEA 1X7XB 1K5PA 2JJ1D 4MRAA 4O2AB 1HRDA 2JLCA 1T5TA 2G6TA 3RU3A 3U4CA 5AUOB 3KJZA 1SEVA 2X0IA 3KVOA 1MIHA 3OTQA 4H4CA 2GN1A 3WGMA 3C5EA 3CZRA 4OQZA 2V8BA 1ZJ6A 4MOWA 4WGGA 2C9OA 5FWYB 5TPZA 3WGVA 2X8LA 1BMTA 1GITA 4PPNA 3ZY4A 2UZ1B 2WD7A 5AHKA 1KO5A 5JVDB 5A4DA 2DZDA 3NFYA 4P86A 3K6SA 3UKDA 2W58A 4ZZIA 1SU6A 3GRZA 4ZO4A 3KWJA 5DGXA 4TZKA 1PT7A 1EM8B 1GD1O 1KDOA 1QIDA 4WZBE 3F6CA 5KYUA 3UO8B 1VPWA 2WSLA 1TCBA 3AHJA 4EFLA 5GONB 1KBOA 3IPLA 3AFOA 4E88A 1SUEA 2WF6A 1DHTA 3MS7A 4JK3A 4N0EA 3L4KA 5A2GA 2YWHA 3BSSA 1ZJWA 5EIEA 1KR2A 4R4JA 3O1JC 1DEKA 1QFSA 1W85B 2DT8A 2WVJA 4CDRA 2I2CA 1I94B 2DR2A 4CG0A 4B35A 4CEHA 5BSGA 1YS6A 3PKZA 1U1CA 3ZIUA 4Q24A 1A69A 5FOUA 4DNOA 3RSFA 1WSBA 2VHCA 4URUR 4XTRA 1T5HX 1JB9A 1PRYA 1XT6A 2DBZA 2H1RA 3UWSA 2Z3VA 1QQBA 1FFXA 1QB8A 2IZ0A 4ND2A 3STXA 4EY8A 4Y1FA 3SYTA 1GNPA 1KZHA 1OX6A 3UK2A 1VTKA 5CDUA 3N76A 5J2TF 3TSAA 1QMPA 3AKYA 3QW2A 1VA4A 2O2HA 1L5FA 4UHEA 2XUHA 5AUPB 2YX1A 3L4SO 1NQVA 3BFXA 2XYPA 4MIOA 4MUEA 1NN5A 4NDNE 2CC2A 4TMFA 3SR3A 3VNQA 1CP3A 2RJ3A 3F7TA 1Z6ZA 3R23A 2IYQA 1KI6A 1TKBA 2YUTA 1N5DA 4PXYA 2HJRA 3S40A 3A04A 1M67A 5IULC 4TTJA 4N7RA 1CJSA 1JVBA 1ZJYA 5IWCA 1A0OA 1QFYA 2ZYHA 3VYUB 4C4RA 3MWDB 4NNOA 4L78A 1C30B 4CRWB 3IRUA 4JLWA 4XW2A 3SEFA 5E1BA 1HL3A 1OYWA 1I9GA 2Z5FA 5G0SA 4ZN6A 1VLHA 1O94C 3MFYA 3MYRA 1UBHS 4O29A 2A86A 2XOKD 3CR8A 1LSUA 1WW8A 3DLIA 4W63A 5K1ZA 2IV7A 3W0LB 1QHSA 1U3UA 3OY2A 1NM5C 4V0SA 5F33A 4ZT7A 3BD9A 2SKEA 2W2XA 1UXOA 2H48A 1VSBA 2DWUA 3FKSA 4XFDA 5E8RA 1R0KA 3LA6A 4MVJD 3WIVA 2ZRMA 3ICEA 1S8NA 1T1IA 2FN4A 4B5KA 2NIPA 1E79D 4NABA 4AZWA 2A6PA 4HB3A 1GU7A 1UBLS 1PFQA 3H5OA 3BSWA 5LPNA 1DC4A 3M6VA 10MHA 2CD7A 3EN0A 3GL9A 3E03A 1MAWA 3RFFA 2R751 1NBOA 2LIVA 1A5AB 2BHNA 1YVPA 1PR3A 4PM4A 1FYEA 1VKHA 2PQMA 3QKSA 4JLOA 4KVGA 5B3JC 4CL2A 2NADA 5J2TA 2GDZA 4DILA 4QDTA 1OSNA 2QRUA 3OBBA 3U7GA 1HYQA 2WTNA 1DJQA 3AEXA 4BEVA 2WAMA 1Z5OA 1E77A 4HMQA 1JLKA 5C8ZA 1S96A 1JEYB 2OAEA 3L0ZA 4B4DA 2I80A 3DXZA 3JRWA 2WIDA 4MEJA 1HORA 4LW8A 1QUFA 5LLDA 1EWVA 1NJ2A 1XXHB 2L82A 5BUSA 3IP9A 1CE8B 2Z04A 3NQ41 4X1IA 4AZ0A 4CEIA 2P9QA 4XQGA 4Y2JA 4W9NA 5AK5A 4MUXA 2IYWA 2BMJA 3DTNA 4QTUB 1CJMA 1P9OA 5DW3A 3PBKA 5BO5A 2IYUA 4B6EA 4R41A 1MB0A 1XQXA 4ARIA 4KREA 3TIIA 1PD0A 1KETA 1TTQB 2AZTA 1QPBA 1DC3A 1ZM7A 2IDKA 1L7XA 3IUQA 3RFUA 1KH1A 2FYTA 1LDGA 1ULHA 2P90A 5JDIC 2ZRNA 2EWVA 5KSOA 1E58A 1IHPA 3NHPA 3W3AD 4GC9A 1RM0A 1Z0SA 4MQLA 5CYFA 3JALB 4BLRA 5CT5A 3EUWA 4CM4A 3D7RA 4OI0A 2QHXA 1UOOA 3EAFA 3OC0A 2PU5A 2X8JB 4FT4A 3C6BA 4DUZB 1F3LA 3Q4GA 1TYBE 2YYYA 2DQYA 4BFTA 4HNAA 4R51A 4EW2A 3UA3A 3H9GA 2C42A 1ZHHA 1L7PA 3VR3D 1N8SA 2B25A 3C98A 4P9NA 5A4MS 5I4CA 5KTPA 3ERCA 1RYDA 1STOA 5JH7F 3M49A 1M5RA 5KVAA 4ZAVA 2PSDA 5FNVB 3JQGB 1XMSA 1UKZA 5HF8A 4HD8A 2J67A 3IAEA 4DMUB 3ISJA 1NVVQ 2ZSEA 5JAMA 5ILGA 3R6TA 4OQQA 2EBFX 3W4IA 4BP8A 3HI6A 3FMGA 4BFSA 4E3WA 1NN0A 3AYZB 3JQ8B 1QH1A 4QTXA 4F9GA 2GUWA 4EOGA 2D1QA 2B6NA 3L7MA 4K1XA 4ZK2A 1Y48E 2Z6VA 1UP4A 2X8BA 3L1JA 3NWEA 4MYDA 4FDVA 4OPMA 3SIPA 1MPTA 1T5SA 2EWWA 5LQNA 1QG6A 5C5EA 1X8XA 3KRTA 3H5TA 3PHBE 5KHOC 3OZUA 2Y1LA 4GP7A 1UEXC 1ZOOA 2QI9C 3HJTA 3UHOA 3OCCA 1NKVA 3FD8A 4HN2A 2WE8A 3IR7A 2NU6A 4H08A 1R9GA 5LP6C 2YYSA 4OHVA 3GBVA 1DRWA 1TQHA 4FYXA 5JY1A 3K8ZA 3ZJYA 1D6NA 1N5OX 3CF4G 1BYUA 3U17A 3R4CA 4AG6A 3OIFA 5AO9A 3GPLA 3TW6A 2GJKA 4P4NA 1RE0A 3EXIB 3FJOA 2Y1GA 4AZ3B 3PUVA 5IKOA 1K6XA 3IAM1 4XPZA 2BFEA 1FMCA 1D2NA 2OHJA 3T7SA 1RYHA 2DLCX 1HYGA 4ZVVA 3DB1A 4GPIB 2ZWIA 2SBTA 5AKZA 3I2YX 2X41A 1HMPA 3GPBA 4TWRA 2FEOA 4UC0A 1NT4A 2ZDQA 3BH7A 1Z6QA 4OLJA 3PR1A 3RVMA 2ZR9A 1S3FA 2D3TA 5DEIA 1P77A 2WSMA 4BZXA 3NAGA 3IYLW 3L8ZA 4EF5A 2YHIB 3PRJA 3MTDA 5NLLA 2EZUA 3QKRA 3R0VA 1RM4A 3R0ZA 4WPGA 2C7OA 4F9FA 4O3MA 3W7VA 4G9EA 3TZEA 4FMPA 2QTBA 5MGBA 4EA6A 3VZSA 4R69A 2WHXA 5K6RA 1K88A 3D2CA 2KLBA 4LYAA 4FHFA 5IZCC 4ERNA 3SNKA 4DGSA 1RHRA 4QYIA 2I4MA 3CCCA 3UAZA 3EGEA 5FTKA 4M1QA 2YWGA 3SLRA 1EWQA 4WLUA 3UJNA 3D3EA 4QOSA 2V54A 1JMVA 2ZTSA 3MIZA 3UB2A 4P93A 4F8YA 4Z8XA 5HRUA 3W8FA 4FR2A 3TL3A 1GDDA 3EE6A 4XQEA 1SR8A 2FPGA 4ZPXA 1W47A 1XO1A 1IFXA 3GN2A 2P9CA 3Q3VA 2FSFA 4YP5A 7AT1A 5I7VA 1EXVA 1X1RA 5BQOA 4E14A 3UPUA 5MFPA 1GR1A 2QR2A 2N1BA 2PUWA 2OFFA 2NMVA 4C7KA 2R8ZA 3VYTB 2OO5C 4JBHA 4CQNA 4Y98A 3JQQA 3WWDA 5CPFA 1AB6A 3RHTA 3ZQ6A 1PP4A 4CR8A 4TZ6A 5HBGA 1U2EA 5I51A 4KQMA 3RHFA 3I0MA 3ELDA 3KOOA 5HIKA 3AXTA 4EHJA 3IDSA 1VLVA 1KYIA 5CJPA 1YFZA 2LTAA 2C4MA 3WFIA 1I1HA 4L3OA 1XZHA 4DC0A 3OESA 3D3WA 1I51A 3WGLA 3MF4A 4QOHA 1Y0BA 5G4KB 3U4DA 1K7EB 1PX2A 4Q93A 3C1TA 5JO0A 4CIAA 3SXUB 1ZSVA 1UINA 4LUCA 4WA7A 2QROA 2UV8A 4MYUA 1XCOA 5EXPA 3VR5A 1ORTA 2PD4A 1DI0A 1GVHA 4DYVA 2X2PA 1CQXA 5DB4A 4JB0A 1L7RA 1X1QA 3QPCA 3R3UA 5BUZA 5GOZA 2JJ1A 4DQLA 5B6IA 2IXEA 1FCJA 2XVAA 1GGEA 1RKUA 3A37A 3CT4A 3D4OA 2WF9A 3TZ6A 2F90A 3RJ5A 1XMJA 4TKLA 4F1KA 1NMEA 2X5OA 3C6ZA 3TCXB 1KO1A 1JT9A 1ZK1A 2GVZC 1SVLA 1L7MA 2QW0X 1W6UA 2EZ9A 3C4JA 3G2LA 5IJ9B 3B6KA 2PX2A 2QM3A 4BVBA 4DNXA 4RUKA 1QYRA 2NWQA 2DQ4A 3DFIA 2R68A 3CUEF 3NBYC 3PPYA 4Y2UA 1UPCA 2VI5A 3GJ8A 2DULA 1YL6A 1N2CE 2YV1A 4IZHA 1N7GA 4KAAA 1JEJA 2QVLA 5LLSA 5BMVB 1HTTA 3GFBA 2BR5A 4N01A 3KLPX 1Q91A 4FINA 3D6MA 3LS2A 3N3AC 1T2CA 2EJWA 5EJ5A 1FXWF 1AZTA 1PFGA 4KPUB 5KNBD 1AK2A 4Z4EA 3GEIA 3BWMA 5BR4A 3H9QA 3HYNA 1X1SA 3RVNA 3TEMA 3C85A 3WY9A 3N2NA 3F97A 2G71A 1USKA 3ZGNA 5L3VA 1WUIS 1LV7A 1BO6A 3HG7A 2D8AA 1XYYA 2R6CA 4PX9A 4RKWA 4U9UA 5K51A 3ZCQA 4D74A 1O94A 1VIAA 3MN1A 1IE3A 5HBRA 4RD3A 3T7DA 2PMWB 1WB4A 3AR8A 1NM5A 1IIBA 2SCUA 3H9UA 3R20A 4R31A 4KHZA 4ZT6A 2QL7A 1TJ4A 3H1AA 1WP4A 1YZVA 3OJEA 1TZJA 5DISB 3RASA 4DCTA 2XIJA 4FE7A 4LMPA 4TLLB 1ZC3A 4JHLA 1SU4A 4RDIA 3QOYA 4E2FA 2YDXA 1H1LB 3P4UA 4D42A 4UTXA 2B61A 3BVPA 4RDCA 1QK4A 4GPD1 1AQNA 1R6DA 3LBYA 3TBKA 1GQFA 3CVYA 3ANXA 2Z9BA 4C1BA 2EKPA 1UOPA 1HDYA 1Q3KA 4BIMA 2RK3A 4AQ7A 1JUDA 1OFHA 1S6YA 2UYQA 4HTAA 4BLTA 3KC2A 4K05A 1KEUA 3KYCB 1OT5A 4OUDB 1PDVA 3EGXB 9LDBA 3G1WA 2CFCA 1DAGA 1ONOA 3O4RA 4YT2A 2G1UA 2ZJOA 3EQ9A 4EYKA 1YRWA 3SD7A 3C7AA 4KL8S 4F3CA 1EWYA 5JNLA 1WDWB 3HFJA 1VJCA 3HADA 4WZZA 3ROQA 2KBFA 2UZAA 1FXWA 3SQWA 3WLOA 5JAOA 4GOMD 2A4MA 2ODTX 2NZJA 2Q4TA 2RBGA 2XOKA 1PNTA 1ANKA 2VH2A 3UY4A 2E82A 3WK5A 1G2PA 1HKHA 3DYIA 3OQ6A 2OPHA 5CD1A 1IN1A 1QVZA 5DNDA 4JD5A 4US2R 1IK6A 2QI9F 5CA1B 1YIDA 2ZDGA 4JJGA 2REQB 1P1HA 2RG1A 3O8NA 4MV8A 1MJGM 1V43A 2B21A 5LP6F 2Y76A 1E79A 4PWYA 3NEYA 3VGPA 4DIMA 2C1ZA 1RAEA 2R65A 1SQFA 4R1OA 3KZKA 1HQCA 2P6OA 3REFA 4RMIA 3GA7A 4YMUA 1SG6A 4CMIA 3DWGA 3GLFB 2W37A 1R6TA 3MXTA 1A3CA 3M6IA 4C9BA 1ENZA 2HJSA 3KR1A 4CE6A 3AHHA 4MR9A 1HNXB 3FVWA 4FU0A 2DFKB 1RXSA 3MJSA 1DFHA 1HXHA 4OXNA 2NU9B 4KR2A 1V3VA 1Z22A 1ZHOA 2OC9A 1TU0A 1QTNA 3EK2A 3ZZMA 1MF7A 4ZVKA 7ADHA 1OB2A 4B3MB 3FVTA 1KK0A 2YVKA 3OX4A 1ADGA 2V3WA 4RM2A 1IB6A 1EVEA 3FBTA 4FK8A 4BHTA 1UAGA 1N7HA 3QEBZ 5H4HA 5INTA 3K5HA 4TQGA 4MDEA 3ZXIA 2DHQA 2VWHA 2HCFA 1H1TA 1E3SA 5DK4A 3O7WA 1PZEA 3X2SA 4E3ZA 3TLCA 1S2OA 3I1IA 4K86A 2HCBA 1KSJA 3INTA 1U6KA 3NHFA 2BTEA 3HEMA 2BUCA 2FA9A 4Q1AA 3BK2A 4CMCA 3RANA 2EP7A 4R01A 3WKEA 1XD2B 2CNNA 1PG2A 5B58T 1FP1D 1IHDA 1OH6A 1BRMA 1EUCA 4LXGA 5TS3A 3RQSA 3BCSA 1XCLA 3OPMA 1NA5A 4O1MA 2R4TA 3PFHA 2E87A 2HJHA 2LCIA 1UJ4A 2WT8A 3OE4A 1NR7A 2ZRQA 4WOKA 1XRLA 3A3OA 3NDBB 3DBVO 4LK2A 1M34A 1EFHA 3T5TA 3TZBA 4B6QA 4IVPA 1E1CA 4KJXA 4U3JA 4INOA 1E3WA 3JD2A 1K8XB 1TTPB 4R2MA 3U13A 5F2NA 1XQ6A 3KZOA 5BMOA 1SMKA 3MT0A 2H08A 3WP0A 1ZO8A 4OQDA 1RKXA 3IEUA 3WZMA 1LPSA 5IP5A 5BQFA 1H0HA 2B5WA 1TMKA 2M32A 3LW7A 3UJDA 3MUNA 3VR3A 2Z8YA 3HKCB 3VKUA 2UYCA 1G63A 3AC0A 3NHJA 1YJBA 2I2XB 4DSNA 4PHGA 2ECOA 2EBHX 4UFOA 4D2IA 4TYWA 1GPUA 3H1TA 2HXYA 1JECA 2ZUUA 5DT9A 5EMMA 4FILA 3PTLA 1C4WA 3W5HA 4CM8A 1V7PC 5J23A 2Z0MA 1EDBA 2J6IA 4MEAA 3X44A 4RF3A 4P4UA 4ZD6A 2Z5LA 1T2VA 4A6DA 4P7JA 3K9HA 4RZUA 1IHXA 1ZNWA 4D4HA 2DEUA 2F8TA 4LRTB 2X9LA 1RCUA 1ISMA 2K7ZA 4QAQA 4MQEB 3OQNA 1ZS9A 4N18A 3JRXA 2DKOA 3TVYA 1S89A 4NV0A 3C3JA 2OFWA 1Y1QA 3ITEA 4DADA 4G1UC 3C6QA 3M0EA 2QX9A 3ETCA 1Y3IA 5IZCA 4YI3A 4KXWA 3NANA 4ZVMA 1L4HA 3AEKA 3GT4A 1RJFA 2QTFA 2H4WA 4QASA 4TTTS 5K2MA 5I7RA 2ZTLA 3D6UA 1DQRA 2OL4A 3F6PA 2IY8A 2FPRA 1SZDA 4MWSA 4MRSA 2OBYA 4FX2A 1Y6QA 2IHYA 1EAMA 1W2GA 2PU7A 3RRBA 3TMYA 5AXDA 4WNAB 2RHRA 3AJDA 4G09A 3AHCA 3TQFA 4RTOA 1JILA 1OXUA 2JFNA 4G1CA 2W2LD 2NN3C 5I7UA 1IUPA 3BCUA 2WJPA 1P9LA 4FSDA 5C3UA 2OO5A 4A2QA 3EOZA 3DE0X 4X8MA 1O03A 3EA4A 1FY2A 1LBIA 3B13B 4FOSA 1O95D 3TCKA 4EY6A 4YXWD 3J81k 2VHVA 3ET4A 1A72A 1NJ8A 2FMKA 4KXMA 2P7HA 1G9SA 1R12A 3QU5A 4KQJA 3J7AC 3T7RA 1F2TB 2ZS7A 2GBPA 3CM0A 1X7ZB 5LZ7A 5KU7A 4B3SB 4XSGA 3FGOA 3Q87B 1SC1A 2XA9A 2XUAA 4HDAA 1OBFO 3FWNA 4YV7A 2NW6A 1W87A 5FFMA 4PN3A 2OYRA 1JA0A 5JBNA 3SYNA 1FQOA 3COSA 3IE0A 3ND7A 4ZU6X 4H3SA 2H4YA 1XGKA 5TMEA 1VMKA 3RWOA 5F3WB 2PQ6A 4JBGA 1RRPA 2FWRA 3IXMA 3M82A 2HT6A 3DPSA 4BATA 4JDPA 5ARBA 2RDMA 2F1RA 5DNWA 1UT8A 1UL1X 2OCPA 4DC1A 3QWFA 3L4BA 3I92A 3L0OA 3TZCA 4F4FA 2ERYA 1J2JA 3RSCA 1WV0A 1DIBA 3BRCA 4CG3A 4LJ4A 2R85A 1GCAA 3JAKA 2LCQA 4MUKA 1VBNA 2QTNA 3KZXA 3KHTA 4XQ9A 5C31A 2NP6A 3G23A 2QKYA 3EBOA 1NV8A 2FEPA 2J7PD 2C1EA 1YA8A 4JWTA 4W7HA 4XB2A 1M0SA 1M6VA 1O95C 3FGZA 4HRXA 2AMLA 1EK1A 1K6EA 4A8HA 16PKA 2GCIA 1Y6ZA 4KQ6A 1QVAA 2WWIA 1LRJA 3U80A 1OVGA 1IJFA 1L5OA 1OBOA 2IF0A 2CY0A 5I9SA 3BTUA 3PXCX 1C3LA 4OXQA 4ZJPA 4J4TA 1YZQA 4CG1A 3FNEA 5A71A 3IUBA 3C5WP 3UMYA 1H4SA 5AMXA 4LJ6A 2P7IA 2X2FA 4MUMA 3WLNA 2JIOA 4RVUA 5AK0A 4FMCF 5CK4A 1E1NA 2QLMA 5KKCA 1I6KA 2Z5GA 3TKLA 2WTEA 3QNUA 1ZN9A 5EHZA 2VT6A 1SVUA 4M1ZA 2A58A 4R7ZA 1QLHA 3G2JA 1ZIXA 4HGPA 3E3NA 4E5UA 1USVA 4B0PA 4I8XA 1IN4A 1RC1A 4JY7A 5FNVF 4E1VA 1E3MA 3MGAA 2BT4A 2JIDA 3DA8A 5H9VA 3T3NA 3O3NB 3KTFA 3RRJA 4DMCA 5LNK6 2WWGA 2YOGA 4B7CA 3EYWA 5BN5B 2G0NA 2FMUA 3OOEA 4K28A 2RGRA 3UT6A 4F6LA 1CS4C 5TS2A 3ZK7A 4P58A 3GZNA 3BWCA 2H0QA 4AC9A 2VBFA 4M7OA 4IJ5A 5KNBA 5L4SA 3QI2A 3GNTA 2OKCA 1PDWA 3OU2A 4RZIA 5A5FA 1QSGA 3RIXA 4JU8A 1ZVQA 4YRTA 1EG2A 4RA9A 1XEFA 3W04A 3U62A 1ZC4A 1COZA 5DYTA 1T3GA 1A8SA 4IDHA 4C0BA 3ST7A 1V35A 2IU4A 4RXMA 3CUVA 1JWAB 4C05A 1BCSB 1OI4A 1JIXA 4WTOA 3VO9A 1EIWA 1N2CA 4M9ZA 5C4GB 2IV3A 5HZKA 2AKAB 2VNSA 4M60A 4BNNA 5C53B 5CFOA 1R5JA 2E4ZA 4FQ5A 1OH7A 2GM4A 2GFIA 4US0R 2O2GA 2WYWA 4DJAA 1CQWA 4UNPA 3SSOA 1KH3A 4J0QA 3D4NA 5KYTA 1IXSB 4C7OB 1T4GA 2BFPA 1RHJA 1SURA 2AI3A 3MHPA 3E7FA 2XVXA 5LXTA 2HW8A 1CRLA 3HV0A 2UKDA 4KZPA 3TQRA 3WMRA 4TLCA 4TXHA 4RTNA 1RFGE 3SEZA 2I7DA 2G17A 2WNHA 2B1QA 3U3DA 3KWFA 2VKQA 1EUQA 3I9V6 4GSYA 2XUKA 2OECA 4JB3A 4LOKA 4TRNA 4EHHA 5KTNA 3VUFA 3E1GA 3U37A 2JLBA 4RVHA 1DG9A 1Q7GA 2NO4A 2Y05A 5FNVA 2WFLA 2Q6OA 1M2FA 3N8GA 5TMPA 2LKCA 3B5IA 3KUCA 2OR3A 1G0NA 2QG6A 1S4QA 1H0SA 2V4MA 3PHJA 1MO3A 2QJTA 3NNSA 2JH9A 4IZOA 5REQA 4HXGA 3ZNNA 3D4IA 2HK7A 1A95A 2IDMA 4D7AA 1U4SA 3Q7TA 4HGQA 4K5QA 4W5WA 3IEMA 1GZSA 2Q3JA 2ZYIA 3DMRA 1IDN1 3NM6B 4HRYA 4J2TA 4E5SA 5EQDA 4CL3A 3GFQA 3ZDBA 3P9ZA 2PRKA 13PKA 1NONA 3I32A 1YR8A 4RSGA 3MLEA 3HLKA 4KNYA 4YR9A 5H68A 1XEXB 5KKAA 2FWBA 3RAEC 1A1VA 5TDHA 5J63A 4DDKA 1B8UA 3HVUA 4MVJM 1A4IA 3VH2A 1ZAKA 5ECDA 3VAZA 3CUUA 3NTQA 2X5JO 3P97A 4TROA 4TTAA 1KJZA 4MYSA 3WJ1A 2Y27A 1O7JA 2H2FA 1NC3A 4BKUA 3IBYA 4DWWA 1CY4A 5K8VA 3F9RA 3T4UA 1E9SA 1HEYA 2JZOA 4NJMA 1PTJA 4YO8A 1X13A 1DTSA 3R7NA 1NU6A 1G5FA 4E5MA 1K5DA 4FEAA 2ZM5A 3UV7A 2GAIA 2XB6A 2HTEA 1Z0ZA 3LWDA 4QQRA 1NRXA 1L4YA 2ORIA 5HDBB 3ON5A 4DZTA 3T06B 1FDOA 1PUJA 1TZCA 2ZB7A 1FPMA 4HVAA 1XTRA 2W43A 3P19A 3VFDA 1RQNA 1GUAA 4LSZA 2XWQA 3TIFA 4WWHA 1Y1KE 2X4LA 4MKGA 1ZGCA 3CWZA 4LVUA 4AJIA 3ME5A 4DEVA 5BXYA 1B41A 1FDTA 2H7CA 3TX2A 1E99A 2IIPA 4WLNA 2EERA 2EW1A 1G2OA 2AGVA 1RMQA 1NUUA 3GV0A 4L73A 4UHDA 3DM5A 3EUFA 4WRRA 3DTTA 3RYIB 1J7KA 2QUBA 2QRGA 5DXJA 2UXDB 2PJDA 1U0JA 1WCXA 4JUCA 2CLSA 2ODQA 1P2UA 3B3QA 2GHQA 3BJMA 3FI9A 1VZ3A 4ZCPA 1F8UA 5BMVF 4DIKA 2UAGA 1DC5A 3UV6A 4R9VA 1KFEB 3R6GA 1GQYA 2OG2A 2ZXEA 3CIOA 3GRRA 5CNJA 1T0IA 4QXAA 2YXNA 5ICFA 3S3TA 5HJ5A 3ESCA 1KEPA 1IBLB 2QU8A 3S8EA 1QZTA 1A9XB 4IH9A 3NXKA 2GLUA 3ZHBA 2J32A 1T5IA 1D6SA 2ZQZA 3H11B 2C4HA 4PF1A 5A3QA 4CLEA 3VJRA 4Y7CA 4O1IA 2OCYC 1XJWA 4LRWA 2XQIA 3OFNA 1QZ3A 2ZBRA 3DL0A 1N9KA 4P3OA 2P8JA 3CBQA 4NCAA 2Z8YM 4L9RA 3G1UA 3KB8A 3V8RA 3BJZA 2PMKA 3D4PA 3QJ5A 4DY4A 3IV7A 3GRPA 5EMKA 1F60A 2QENA 4M2LA 3VPHA 1U4OA 3QU9A 4N0QA 3T4EA 2VDNB 1Z63A 4H6XA 2IDJA 3AW8A 3NI2A 2A5LA 2NM0A 2P9FA 2WILA 3A6PC 1LW6E 1WL8A 2O0MA 4IQFA 5EKUA 3ULKA 3O92A 1PG0A 5JLAA 3C6KA 4BV8A 1FFBA 1LJLA 2I1VB 1D2GA 3VSEA 5DI9A 2UVDA 3FOBA 3TO5A 3S2SA 4MRNA 2FPKA 1RHQA 4FW8A 4ENVA 1KQ3A 3ICWA 1J22A 3L18A 3L8EA 5CVVA 1YR6A 1MB2A 1ORIA 3EH2A 4H18A 4RULA 1GNVA 5LMUB 4CEJB 5KSZA 3C3WA 3IUSA 1PSWA 2G8LA 1QVRA 3ECAA 3DO5A 5A4FS 1FDSA 2NO6A 2VYQA 3FSRA 3R7FA 3SXJA 5I9TA 3U7RA 3QM1A 4JUDX 2QBYA 5HCIA 4RE6A 5IM4F 2FDRA 4P80A 2W2LA 2IHBA 4YR7A 4JYZA 1L5QA 1QB7A 4AUMA 4KH1A 4MWTA 4EF6A 5C7OO 2IEYA 5I9IA 4QGGA 3WISA 4CKWA 1E2UA 1EJ0A 2KW5A 3TOVA 2XZPA 4CMKA 2XVYA 4RZ3A 4BE9A 2PZMA 4YAKA 1O95A 3PA6A 3K20A 1A8HA 3OCUA 4R5MA 4YXWA 4XWKA 3BZBA 2R4QA 2V98A 3HMKA 3CZCA 1M1UA 3DR3A 3KJFA 1A9YA 2I4LA 4UE3S 3SX0A 4P0QB 1EE9A 2QAGC 2GK7A 3DNMA 3I9FA 3NHAA 3R2JA 4J9UE 4POAA 5BSFA 1D3AA 2ZCVA 3ET5A 4BP3A 1A5BB 5A3RA 1G19A 3RVDA 4IDQA 2ZT5A 3DVLA 4V0NA 4ZDJA 2CHQA 3PLRA 3PENA 1V9CA 4QPPA 2I2BA 3TINA 3VSBA 4LQCA 1S8AA 2QYSA 1K4YA 3EIWA 2D13A 4QUJA 5EC8A 2ZW9A 3NZEA 2WPDA 4GWKA 4KSYA 2FI1A 4UARA 4BAGA 3S99A 3AJRA 1SVMA 4X41A 1TFUA 3EPPA 4FVTA 3DF9A 4LX0A 3GLHB 3T7AA 1NUHA 4BX9A 3UAVA 1U7PA 1VQ1A 1M1YB 1EBBA 3AZQA 2RI6A 1T24A 1OJLA 1PL0A 3ES9A 3E7WA 4KOEC 1EHIA 2EAUA 5ENVA 3TXAA 3HLYA 4CV2A 1T34A 3OLWA 3Q3IA 4KXLA 1MO2A 3K0CC 3KKKA 4XPIA 5K8UA 4CL0A 2UXBB 3MJVA 1NPDA 1W0KD 3C74A 3NT2A 4FHGA 4XB6B 4W5TA 4HP8A 5JCZA 3QEMA 2I76A 3O8QA 2A7QA 3EW9A 3EAGA 4Y9SA 1C4KA 3RAGA 3RKUA 3F9CA 1PW7A 3WK7A 4F56A 5LKAA 3I61A 4Z4CA 4ALLA 1RBMA 4HH3C 1IM8A 3G6KA 3F7NA 2VAPA 3VO8A 1BNCA 4U0JA 5FBVB 1NOJA 1J8VA 1PR4A 3LCMA 4H16A 1B8OA 1CT9A 2J4DA