4WY8A

Structural analysis of two fungal esterases from rhizomucor miehei explaining their substrate specificity
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
b'PTVKLKPYCQNIADAATIDSTQYPPEVVRKAEAASIIDDPKALEGLPDVYLEEKTINRKNGSKIELTITRPLDTENQVLPPIVFFHGGGWVVGSKLTHRRTVYELTVRARAAVIFVNYSLSPEVRFPTALEECLDAVVWVAKEENAKSINVDPTKLVVAGDSAGGNLSAVVCIRAKQLGLNIIKGQVLIYPVTDDNFETDSYKQFAENYYLTRKLMVWFFDHYIPDKKDRQSIFACPLKASIDDLRVLPRALVITAEADVLREEGEAYARKLIEAGNDVTAVRYLGIIHGIFNLATLSPTGSEILDHIVAWLQKTWKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords esterase
molecule tags Hydrolase
source organism Rhizomucor miehei cau432
publication title Structural insights into the substrate specificity of two esterases from the thermophilic Rhizomucor miehei
pubmed doi rcsb
total genus 111
structure length 325
sequence length 325
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wy8A00
3BIXA 3IUJA 4X93A 2QZPA 1SCQA 5ALKA 2X5XA 1VLQA 5IVKA 3K2IA 1XLUA 4EY7A 1K63A 3HRHA 2ZYRA 4X7BA 1YS1X 1UOPA 4EBBA 2CUTA 4OCZA 3DL4A 4ZXFA 3GBSA 1XFDA 2PU5A 1PV1A 3STWA 4W1RA 3STUA 4HRYA 1Y37A 3WJ1A 1A8SA 4GWLA 5CXXA 4FBMA 2BGNA 3A2LA 4KYVA 4C88A 4KE8A 1UZAA 5AHXA 2XMZA 4MWTA 2WIGA 3RK4A 1QJ4A 1TK3A 2W6CX 3BJRA 1J06A 1EVQA 2XUIA 1LBSA 3PE6A 4BCBA 1YB6A 3QMWA 4Q05A 5ALOA 4PQEA 1UK8A 4QLAA 1J07A 4FTWA 1BS9A 1EK2A 4D9JA 4DYHA 1WPXA 3VVMA 4UHHA 4BCDA 3ZWQA 1AGYA 5AM0A 3W04A 4FOLA 1QONA 3WK9A 2QT9A 1CUUA 1JMKC 4C4ZA 2VF2A 1ZD3A 3HYSA 3I2JA 5T4FA 4GXNA 1HLGA 4JEIA 3FLEA 3E4DA 3E0XA 3O4IA 4KACA 2JGJA 2WHRA 1XRNA 4W1PA 1ZD4A 3DEAA 5AO9A 5I7UA 4FLFA 2YYSA 1VXRA 5D3ZA 2GYWA 1R1DA 1CUWA 1CUAA 1C7JA 4Y7DA 2VTVA 1K5PA 4Y2PA 2QOEA 4MWSA 1NX9A 1O6FA 3LP5A 3PFBA 3AZQA 2X8BA 4L72A 3AZOA 4Q3LA 1NU6A 1GPLA 3NWOA 3B12A 3HABA 2PSJA 4UFNA 3I2IA 4Y9SA 1YCDA 1CUZA 1NU8A 4O08A 1E8NA 3A2NA 1BCSA 3R3UA 2H7YA 3FBWA 2WTMA 4YPVA 1LGYA 3KD2A 5ESRA 1IUPA 2WQZA 4B85A 5HCUA 5HF8A 4QLOA 4CCYA 2GBFA 2VT6A 2Y6VA 2NW6A 2XQIA 4OB7A 4NZZA 4FLMA 3H19A 3LCRA 2B4KA 4YASA 4EZIA 3WWDA 4HAIA 3A70A 2WUDA 2C58A 2DHDA 5LZ9A 1UFOA 3STYA 1Q83A 4CG1A 2V9ZA 4BTVA 5A62A 1XROA 1WHSA 4FDMA 4Y2JA 2I3DA 1CUXA 2XMQA 4BP9A 1MTZA 4AO7A 3F97A 4LYEA 3WK6A 4DMKA 5IVDA 5HQ3A 1GT6A 1EI9A 2XE4A 1CLEA 5C8VA 1GQSA 2BCEA 2K2QB 3EIOA 5AKKA 4J3JA 3LIIA 3FYUA 4ARAA 1P0MA 2OAGA 1UT6A 2FUKA 2WFZA 4B7ZA 1MJ5A 2ONCA 1L7AA 5KWIA 1ZICA 2HA2A 2XQFA 5JD4A 1CUJA 5JD6A 4UHEA 1AKNA 3WA7A 5CXUA 4ZREA 3AFIA 3BDVA 1UKCA 1S8OA 3BF8A 1OXMA 1BU8A 2ZYHA 4X6UA 5ALEA 4DNOA 3JW8A 4F0JA 1I6WA 4G9GA 3M81A 1MPXA 4FNGA 3DD5A 4AN1A 4G4IA 5DNUA 4KAJA 5HFAA 1UK7A 4H7HA 4OU4A 5C8ZA 4X97A 1TCAA 5AM3A 4FBLA 4KRYA 1MT3A 4BZWA 2WIFA 5AI6A 5JIBA 3C87A 5AJHA 5K3BA 3AIKA 4PO3X 2CB9A 1Z68A 4K6KA 1QIHA 5ALSA 5JAHA 1ZD2P 4F5ZA 4UPDA 2B61A 3H1AA 1LPSA 3OPMA 3OC0A 4LKOA 3F67A 5K3FA 5CH3A 4Y2TA 2Z8XA 2HDWA 4UFPA 3WKEA 1XRLA 4GW3A 1N8SA 1L7QA 4GLBA 4BRZA 2RAUA 1YA8A 2ZYIA 4YK7A 1JMYA 4H7EA 3R3YA 1W6RA 2WHPB 2XUAA 3WWOA 3K9BA 3C70A 3O9VA 5ALUA 4J0CA 3PF8A 2WUGA 5A6VA 2ZYSA 3STTA 2JGIA 5HF6A 3IUQA 1H2WA 2WFMA 4WDRA 1QIEA 5AKXA 5LKAA 5JAOA 3OTQA 5LLSA 1TKRA 2BAGA 4DMFA 1MO2A 4CCWA 3H2GA 2D5LA 1GPNA 2OCGA 1ACLA 1FFBA 4DMCA 4G8CA 4M0FA 3W9UA 5JADA 2WILA 3PF9A 4F60A 1W4LA 3R3XA 5AP9A 1AX9A 4AXBA 3H2HA 1ORVA 1MX9A 4CG2A 5K5EA 3QVMA 1VE6A 1WM1A 2QXTA 4G9EA 3SX4A 4ZV9A 4GEGA 5ALDA 3WLAA 4H35A 2V96A 4FWBA 2RHTA 1A8QA 1VE7A 4DNFA 4IH4A 3G9UA 3I2HA 2VT7A 5HF9A 1CRLA 3GA7A 2JGFA 2DQZA 3AZPA 2IIVA 4X94A 5CW2A 5T4HA 2JGEA 1DQZA 1K8QA 2OGZA 3I28A 5CT9A 1YAHA 2OAEA 4AN0A 5ALJA 3H18A 2QS9A 2PL5A 2XUJA 1HL7A 3ZLVA 5JYCA 1SCIA 4CFSA 2ECFA 3WL5A 1IUNA 2HM7A 1ODCA 2CMFA 3DQZA 1JT2A 1LZLA 4A16A 3A6ZA 2Q0XA 5K3EA 1EB8A 4QNNA 3O0DA 4A5SA 3O4GA 4LXIA 5EIEA 5EFZA 3O9MA 2PBLA 4KJXA 4PV7A 1HQDA 4F21A 2JF0A 1LZKA 1LPBB 2WIJA 2WJ4A 4UBIA 3A2MA 3F98A 3QYJA 4AX4A 2DCMA 2RIPA 4DNPA 5FKJA 3IDAA 3R40A 1X2BA 3WK5A 5LZ2A 1FFDA 2HHAA 2DHCA 2VATA 1ZI9A 3T52A 2WLSA 2C4HA 1XQXA 4BC1A 5FXMA 3MUNA 3PUIA 1CUFA 5ALTA 3Q0TA 1VA4A 4WY5A 3GELA 1QIIA 4E11A 4UHCA 4NVRA 1EH5A 3DNMA 1H22A 4PSCA 4MEBA 3STXA 2I3ZA 4DNQA 4IO0A 1EB9A 5LZ7A 5ALVA 1GGVA 3WKDA 4K2AA 4XWGA 4BDTA 4KEAA 1CFJA 1ETHA 2FJ0A 1F0NA 2PPLA 2W22A 3O95A 3D7RA 4KE9A 4G1FA 4N5HX 4TVKA 3FCYA 4CG3A 5AI0A 4MQMA 1OCEA 1EK1A 2C5FA 2JEYA 3ANSA 1YAJA 5AK4A 1YB7A 5EHZA 3OG9A 5D7BA 1CEXA 1W75A 4B83A 1CR6A 1OILA 4QDUA 2YASA 1WPRA 5K3AA 3EQ8A 2B20A 4RGYA 2J4FA 3V1KA 3IURA 3ICWA 4EY8A 1BE0A 4K5QA 4HXFB 3VVLA 1E5TA 2CJPA 2Z3ZA 4RE6A 1R9NA 2JGLA 2JBWA 4QDTA 5HF5A 2I03A 4BAUA 4NS4A 1R3DA 2XQKA 2BFNA 3D2BA 5FOQA 3CN7A 3W9BA 3VJKA 2XMCA 4Q34A 4G8DA 2XUKA 1ZI6A 5HKAA 3WWCA 2QUBA 4BRSA 3TEJA 2XB6A 4IHAA 3F96A 3BIWA 3B5EA 3PUHA 1A7UA 2ZJFA 1JU4A 3H17A 3DOIA 1E3QA 4XVCA 1UOQA 5E4TA 5AI8A 5K3CA 3D4LA 5A7GA 4L9AA 1AZWA 2UZ0A 4WFKA 4J0IA 1E89A 5JZBA 1KEZA 4Y2VA 1X70A 5BV7A 4A23A 2G5PA 3HEAA 5BOVA 4QDOA 2RONA 2WG1A 5F4ZA 4X6YA 4BB0A 4J0HA 1XZBA 3AUKA 1U2EA 1RP1A 1IVYA 5EHNA 3TRDA 4X3CA 3D2CA 2XT0A 2XUGA 4H7KA 1LNSA 1LLFA 3BXPA 2PU7A 3RKSA 4P92A 2C0PA 1XQVA 5FUMA 4E15A 5EHXA 1MX5A 2HL6A 4NMWA 5A71A 4EY4A 1IZ8A 3I1YA 5AKLA 2WSLA 1DT5A 4Q82A 4AQDA 5EHQA 1LBTA 2VJBA 1HPLA 5LZ4A 3NOXA 1CV2A 1TQHA 4BAGA 1C7IA 2JEZA 3FCXA 5HK9A 5BWBA 3V48A 3V1NA 2CZQA 4MYDA 5A2GA 2BUCA 4PSDA 2ROQA 5AM4A 4X90A 1IUOA 1CUDA 3ZI7A 4DLNA 5JALA 1XKLA 3BF7A 2H1IA 2X76A 1HDEA 5KBYA 2EDAA 3N2ZB 3SC2A 1XZCA 4HZGA 4W63A 1CPYA 1XZMA 3DJYA 4IQ4A 1J1IA 4B9EA 2QRUA 4UBOA 2OCIA 1PFQA 3QM1A 3WK4A 1XLVA 3SWWA 4M0EA 1XRMA 4H0CA 3HC7A 4BCCA 1Y7IA 3QPCA 3WL6A 4JYMA 4DTCA 5HQ3B 3WQHA 4E14A 5JD5A 3I2GA 5K3FB 2XMSA 1AUOA 3WL8A 1PJAA 2Z8ZA 3BDIA 1XZHA 3D5EA 1W52X 2DHEA 4ZI5A 3M3DA 3FVTA 5E4JA 3DYVA 3TGLA 3HACA 4U2BA 3FAKA 1MAHA 3H04A 2PSFA 2ACKA 5CT4A 1VZ2A 2XQGA 3FSGD 4KR0A 4BP8A 1XQYA 1YS2X 2WM2A 1WB5A 4RE5A 4LIPD 4EY5A 2FX5A 5AK3A 2WJ3A 2RI6A 4LYDA 3C5VA 1JI3A 4X85A 4DM7A 4GDMA 5LYYA 4WFJA 3R0VA 2HA3A 1XRRA 1CUBA 5HK8A 5HKBA 3NGMA 1H2YA 5CBKA 4FNMA 3VJMA 5ALXA 3FSGA 1P0QA 3LS2A 3MGAA 5C8XA 3PDCA 4FKBA 3QMVA 3KWJA 3R41A 3FYUC 2WG2A 3HZOA 3HXKA 1QTRA 3GUUA 4MEAA 4JUIA 2XMRA 4UBNA 4QE3A 1BRTA 3KXPA 1LPNA 5FPQA 5DYYA 3G8YA 4KRXA 3NUZA 4UHDA 3G0DA 3AILA 3FOBA 1P0PA 2Y2VA 5LZ5A 3VISA 3ILSA 3I2FA 4OB6A 3H2JA 1B6GA 1EDBA 1UKAA 2XUPA 4X6XA 1G66A 5CH5A 4G4JA 1R50A 5JASA 2HU8A 2XMGA 2JGMA 5KWJA 1XZFA 4B9AA 1Q0RA 2ORYA 2EEPA 4OD0A 2HFKA 4Y2XA 4BDSA 1CVLA 4X92A 5FLKA 2HA0A 4H18A 1ZIXA 3UUEA 3MUOA 1ODTC 2Y2UA 2ZSHA 3G7NA 1MAAA 5LIPA 4C01A 2RGUA 3G0IA 3IUNA 3ED1A 1KU6A 5CH8A 4KE7A 4ZV7A 2VEOA 5C7YA 1QIJA 1B41A 3PFCA 1LPMA 3WKAA 4BTLA 4QDXA 1XZJA 2OGTA 1A88A 1GZ7A 4B0PA 5JZ9A 1MNQA 3IUMA 4L0CA 1JKMA 2DFPA 4UBLA 4W1SA 5FP0A 1CUHA 5FV4A 3YASA 5E2IA 1W76A 1CUGA 3CCBA 3N0TA 3EQ7A 3QH4A 4G4GA 3UUFA 4UUQA 4DSZA 2XUHA 1CUYA 3IB3A 5AM2A 2OQVA 1XZIA 4Y2UA 4CI9A 3ESDA 5LZ8A 3DLTA 2GBCA 2WFLB 1XZEA 1FJ2A 5AICA 4RNCA 4PW0A 2PM8A 1QIGA 4CIBA 2XUDA 5K3DA 3UMJA 2XLCA 4B0OA 1N5RA 2WIDA 2O2HA 3WIBA 1JU3A 5EI5A 1R88A 1AQLA 1THTA 5AKEA 2C5GA 1EDDA 1CUIA 5AIAA 5JAUA 3WYDA 3WA6A 3G9XA 1BCRA 1DTEA 4UHBA 1QO9A 5AKYA 1ORWA 5JATA 3U1TA 4WJLA 5ALGA 1ISPA 3JYHA 2WUFA 2EDCA 1TRHA 1CQWA 4JNCA 4QWMA 3STVA 3QITA 4C6HA 1ACJA 3Q8WA 1K6EA 1G42A 4Y2QA 2QJWA 4C4XA 3WIOA 3IIIA 1LPOA 1QIMA 3W2TA 3DKKA 5AKHA 3G0BA 1TCCA 3F9CA 5SYNA 1XQWA 4XJVA 4U2DA 1IMJA 3C8HA 4W9RA 2BJHA 5AI4A 5KREA 4EUSA 1F8UA 3PI6A 4DSAA 5ALNA 3O4JA 3RARA 1YA4A 3AIOA 5CT6A 4MQLA 4P9NA 2E3JA 1E8DA 5A7HA 2PUJA 1TIBA 1CUEA 3DDUA 1XKTA 4B81A 3KDAA 3H2KA 4MXDA 5ALRA 1GPKA 1SC9A 2XLBA 5C81A 3W05A 4AMYA 2AJLI 4Y2RA 5IVIA 3DCNA 1JJBA 1EA5A 1VA5A 3C8DA 5CMLA 1GQRA 4DGQA 2HA4A 1QIDA 2J3QA 2OPHA 1XRPA 4ZGBA 1VZ3A 6YASA 2WFLA 1R9MA 2PVSA 4I3FA 3AIMA 5HZGA 4ITVA 1BEZA 5ALZA 1ZI8A 1EVEA 4U2CA 2HIHA 2D0DA 1U4NA 4N5IX 5D3KA 4V2IA 5DTIA 2Z3WA 4Z49A 2BUBA 1BN7A 5I9IA 4QEKA 1DX6A 1UKBA 4TGLA 4H77A 3DYIA 1XZKA 2WIKA 4EA6A 2XUFA 4H7DA 3F8SA 1DWOA 1O6GA 5AM1A 1BROA 3V1LA 1LPPA 5ALWA 5DTJA 3V9AA 1XZGA 1F6WA 1P0IA 2XI4A 1H23A 2QR5A 4HVTA 3C5WP 5FDFA 5AM5A 1DT3A 4QA9A 5CT8A 5AIBA 2ACEA 2QM0A 1GKLA 5IKXA 3ZV7A 1VXOA 1J2EA 5AOCA 4UFOA 3ZLTA 3G9ZA 3C6ZA 4B82A 2AJBA 2VAXA 4HRXA 2OXEA 4Q1VA 1XZAA 1MN6A 2G5TA 3FYUB 1QTIA 2OQIA 4U2EA 1THGA 5DJ5A 4ROTA 1RWQA 4AB1A 4J0GA 2HA7A 4PF1A 4LXHA 4BBZA 3KWFA 5JAPA 2QMQA 4WY8A 5AKGA 4C89A 3FWHA 2PUHA 4FLEA 1FFCA 2GBIA 1E66A 3PICA 3O4HA 2HADA 5ALHA 2Y1KA 1AC5A 4XIIA 2DR0A 3P2MA 4KAFA 3I6YA 2HU5A 1SOMA 2OG1A 1CQZA 3KSRA 5ALFA 1HKHA 3G0GA 3WKBA 1R4ZA 3LIPA 4EY6A 1Y7HA 2R11A 3WK8A 4OYLA 2GZRA 3C45A 1ODSA 5T4EA 2YH2A 3E1GA 3WL7A 5AI9A 4Y2YA 4N8DA 5DWDA 4WDQA 2DQYA 2PX6A 1WCYA 4AO6A 1E8MA 3WMRA 1UXOA 1UK6A 4FHZA 4H7JA 3FLBA 2OLEA 1USWA 3D3NA 2HRRA 1W1IA 2XMBA 1QZ3A 3K6KA 3EBLA 1DWPA 3H0CA 5AKIA 1X2EA 1HBJA 3WKCA 5CURA 1DX4A 5ISMA 1EXWA 5AKZA 4J03A 2HU7A 5AOAA 5EGNA 5FPPA 1SFRA 4J0JA 5IVHA 3FYTA 5ALYA 4FMPA 4PSUA 4OU5A 3RLIA 2OCKA 3T4UA 1CUCA 4S0XA 5ALIA 1YASA 3CXUA 3FVRA 5FRDA 4J0DA 1XZDA 3M83A 1WB6A 2VQ6A 5D6OA 3VXKA 3H2IA 1FSSA 4N8SA 4RPCA 2WTNA 2GBGA 4XX1A 2AJCA 2I78A 4BYMA 4K6GA 2JGKA 4UBMA 3HI4A 4CCYB 4EHBA 5DNWA 2YXPX 4HTAA 4MYSA 2ZVDA 5ALMA 2IX9A 3QBJA 3RM3A 4BAZA 5AOBA 3QPDA 2O7RA 3I6MA 3OURA 4KAAA 1TCBA 2V98A 5EIHA 2WJ6A 2PKYX 3ESCA 3BJMA 4L3WA 2PSDA 4TPKA 4X91A 1EDEA 4W1QA 4WFIA 1JJFA 3ICVA 3E3AA 3L1IA 3D2AA 4FFWA 1D07A 4OPMA 5IH7A 3R3VA 5DYTA 3EQ9A 3QPAA 3I1IA 4HS9A 2G63A 1T4MA 3IULA 5HFNA 3C43A 4E46A 3MVEA 3V1MA 4EB0A 3FLAA 2PSHA 1UWCA 3WZLA 4ETWA 4J7AA 1G5FA 3WWEA 5LP1A 4BVLA 3OM8A 5JANA 3QMMA 1KU0A 1QIKA 4KE6A 1GXSA 1H2ZA 2CKMA 1T2NA 4GHWA 3WYNA 3AINA 1CUSA 3C6YA 4UHFA 2C7BA 1EINA 2QJRA 4MJ3A 2GZSA 4G8BA 1A8UA 4ZWNA 2IITA 3B3QA 2OCLA 3ANTA 2VSQA 2BKLA 3SK0A 3C6XA 4ARBA 1JFRA 5AI5A 1QOZA 1FFAA 3OOSA 3HLKA 1BEEA 3R3WA 4J0KA 4QZVA 4GBGA 2VAVA 3ZLUA 3WJ2A 3VKFA 4JYPA 1ZJ5A 4BZZA 1QGED 2PSEA 3WWPA 1H2XA 5A7FA 1L7RA 1MNAA 1VJ5A 3VDXA 2QUAA 7YASA 3GZJA 3ZPXA 4Y2SA 4UBKA 2HRQA 2WHQA 1GKKA 1ZJ4A 4JH0A 3X3HA 5E4YA 2R8BA 3D59A 1N1MA 4BE9A 5JARA 2AXEA 4BVJA 5BWCA 1Q84A 4DMHA 2Y6UA 2VA9A 4WCVA 4PNZA 1M33A 1DINA 4DIUA 1ZGCA 2H7CA 3HJUA 1ZD5A 1ZOIA 4BC0A 3WI7A 1G4HA 1DWQA 2VJDA 3GROA 5AK6A 4GECA 2JIDA 2WUEA 3C6BA 4P08A 4Q3OA 4U2FA 5DYWA 2P8SA 2FJPA 3S2ZA 4K6HA 1U8EA 3LLCA 4BE4A 1YSCA 3S8YA 4ZRDA 1DU4A 4BVKA 2ZSIA 2HFJA 5ALQA 1VKHA 2CEKA 4AZ3A 4Q3KA 3EF3A 3L1JA 4IH9A 4BATA 2G4LA 4M0MA 1EHYA 4LHEA 4X95A 4UBJA 2J3DA 1IZ7A 1XRQA 3BL8A 1QLWA 3M82A 3BWXA 1ZGBA 3L1HA 5CTAA 2QKYA 2WU3A 1UK9A 5H3HA 3I6ZA 2BGRA 1U65A 2AJDA 2O2GA 3IA2A 4IH1A 2Z5GA 1AURA 4H7IA 1N5MA 2H9YA 3HSSA 4I19A 5J3JA 3G0CA 4P93A 2XUOA 4OSEA 1QFMA 5ALLA 1RYYA 3IBTA 3CCCA 4AZ0A 4CIAA 2H7XA 3H1BA 3WK7A 3QZUA 1ZIYA 2WKWA 2DSNA 2ES4A 3I2KA 4QDZA 3D0KA 2RHWA 5AKJA 4G5XA 1QO7A 5AK5A 5YASA 4C87A 3DS8A 1BN6A 3W06A 2XQJA 4YX9A 1MU0A 4X71A 5I8PA 3WZMA 3FNBA 2LIPA 4OB8A 4U2GA 2HA6A 2GYVA 4FFVA 1JJIA 5ALPA 2AJ8A 3DOHA 1FFEA 4AO8A 5LKRA 2OGSA 2XUQA 2ZJ6A 2QTBA 3CN9A 3AJAA 1UOOA 3U0VA 1Q0ZA 4OYYA 5DNVA 1WHTA 1TAHA 4H7FA 4OUKX 3G02A 1QFSA 2VJAA 5DLPA 1SCKA 3GFFA 3DKRA 3JWEA 3G9TA 1C4XA 1DQYA 1LPAB 1CIJA 2HA5A 3VJLA 5T4BA 4C4YA 2BUAA 1QE3A 1WOMA 1XZLA 4I4CA 4INZA 2O7VA 2ZJ7A 4B6GA 4QWWA 1XLWA 2QVBA 2WG0A 4X00A 1YR2A 2B9VA 1CUVA 2C0QA 1K4YA 2WHPA 5JZSA 1AMNA 3R3ZA 3TJMA 4HXGA 3KOOA 2GYUA 3ESBA 2J4CA 2XDWA 2WU4A 1VOTA 1EX9A 4GI1A 1WB4A 2V97A 5EIAA 4HXEB 5CRIA 2XMDA 4B84A 4N8EA 5AH0A 3ESAA 1QIFA 3BE8A 2VJCA 2QXUA 2O2IA 5SYMA 3IVMA 4AMZA 2CBGA 3DL7A 1F0PA 4LXGA 1MX1A 5CT5A 4B80A
chains in the Genus database with same CATH superfamily
4I3GA 1AH2A 1NXWA 2F90A 3QYFA 4JGIA 1EGQA 1Z83A 2JARA 4X93A 1XDGA 1ISMA 2I6FA 1BMFA 1NC1A 2H16A 2QZPA 3EIUA 1YQ9A 5ALKA 3SZMA 3I01A 4DUZB 3PLRA 1PJ4A 1QMPA 3S40A 1U7HA 3L3BA 5T7BA 4Q15A 5IVKA 2XA1A 3IDOA 2DGDA 3ETEA 3V80A 1M0WA 2PVPA 4QUKA 4IJWA 1ZEJA 2WV9A 1N9ZA 4ESHA 4EY7A 2POQX 2ZIFA 4G0OA 4MW0A 4TN1A 1S7CA 1GA6A 1II8A 2ZYRA 2OAP1 3GT0A 3L7CA 1UOPA 4GP7A 5H9VA 3GXOA 1Z8NA 4YJGA 4BFLA 2F1RA 3EGVA 5FF9A 3CLVA 2Q6IA 1TO2E 3DL4A 1U2PA 3QV1A 4M8KA 3TZBA 2QDXA 3ZCPA 3LZ6A 3SR4A 4C4OA 1VHDA 2PRYA 3N2KA 1KI8A 4YHBA 3STUA 2AFIA 2D8MA 4WE3A 4UMFA 1Y37A 2HGZA 1OFVA 2VDRB 5K20A 3PB3A 3PHCA 2XZLA 3KOZA 5AR1A 2FFRA 3CC8A 4BWYA 4BNFA 4DC0A 3WJ1A 1TC1A 1A8SA 1M1YE 4V0LA 2ZIXB 2LTAA 2LNDA 4WN9B 1G2IA 2AG1A 3F3KA 2WKSA 1P33A 1KP2A 1UC5B 5BR7A 4BFCA 4OBBA 3SYTA 4V1CI 5L6MB 2O1WA 1Q74A 2C5LA 3OZXA 1Z33A 4WN9A 5I01A 1UZAA 3GBPA 4LF8B 2W2PA 3GPDG 2PD3A 3ZZNA 3MIZA 3SJUA 5I4IA 2P0AA 4RORA 4MWTA 1Z6YA 2WIGA 1KS9A 1QJ4A 1TK3A 2WF7A 3ND9A 4GX5A 4C2TA 2R2AA 3FNEA 1M2JA 3F6BX 4IS3A 4KX3A 3IMFA 2OK8A 2HRCA 5DCLA 1YGYA 2JAPA 4RA9B 4TKMA 1SZJG 2GKSA 3DBOB 3QMWA 2YYZA 3R7BA 1KMCA 1E0DA 1ZM2A 4X20B 7AT1A 3AFGA 2YJTD 3UPDA 1EEXB 2G40A 4P3NA 4O4LB 2CYAA 3D6JA 1SGWA 1TPZA 3IJRA 4UDXX 3W90A 4Z3KA 2RD2A 1R0LA 4LJ7A 1P2FA 1TQ2A 1N3YA 2WP0A 4DYHA 2DWPA 1GA1A 1JV2B 2CNLA 2CK3D 1N0WA 3KWLA 3SSMA 4YRZA 1KZ7B 2F1KA 1RXSA 2QYSA 1E1CB 2ZSEA 3GWGA 4NJMB 3TQHA 2Y0EA 3KTDA 3MS4A 3NV9A 4MLZA 3IVXA 3BJZA 3L4SO 5AM0A 3P2YA 4DPKA 1CZLA 4Y9TA 3OQ6A 4RTQA 3C5HA 1QONA 1QHNA 4GKBA 4S35A 1GAWA 1MT0A 3IAXA 1FLAA 3NI2A 3WK9A 2QT9A 3OP1A 1D2RA 1USGA 5DYYA 2H7VA 5LC1A 1UODA 3U4CA 3VUEA 3ZLBA 4QOFA 5FH9A 2G04A 5KJFA 4RV9A 2JLVA 5GWXA 1NXOA 2C9DA 2ZIVB 4IJMA 2RB5A 1MRSA 2D4AA 5EHIA 4C22A 1PSDA 1BCSB 1SC4A 3NORA 2I6SA 1SD1A 4MP3A 3U4IA 3MEQA 4CEJB 4JEIA 4JP1A 3N0WA 3PC6A 3FLEA 4PRLA 1K8ZB 2ENUA 3KYDB 4GWGA 1B0UA 3F4BA 1GU0A 3AHDA 3O4IA 4BNGA 4KACA 2J3MA 3V8VA 2I8LA 5AUOB 1GRNA 4EPXA 3PJFA 1KQ3A 2NZJA 2OV6A 2OMEA 1TT7A 1NQAO 3AJRA 3QUBA 2BCGY 5F35A 4UFPA 4LRSB 4IVNA 4YBRA 2PLAA 3EVEA 4R2HA 1QOPB 1A9TA 2OBMA 3EGDA 5DDIP 1OVGA 3CGGA 3N2KB 4CKCB 4UTNA 1MW8X 1L4KA 1Z6GA 5IASA 2GD2A 2AYXA 3ZWDA 2GYWA 4FOPA 2ZRQA 2O8BB 4GBED 3V2IA 3QLUC 4FR5A 4QM7A 3MAGA 1CUWA 5BSHA 2XPCA 3ZXIA 5FAKA 1SN7A 4TV9A 2C4VA 4GLFA 4HG2A 1PR2A 4HX9A 4KO1S 1J09A 3MNFA 1BOFA 1WF3A 2ZOSA 2C2ZA 4O59O 4YONB 2NWQA 3M33A 4B44A 1NHWA 3K0AA 1WNTA 1KI1A 4M1WA 3AI3A 3W2EA 4MWSA 4Y30A 1KOFA 1NX9A 3UWKA 3WP1B 4DIKA 4F5DA 5KOHA 2EFHB 1GRVA 1HYQA 2ZROA 3PFBA 3RU9A 1PT6A 1DG1G 2QG4A 3IAUA 5E6SB 2ZDHA 5FBKA 4Z0TA 5AJUA 5L7TA 4P3YA 4A0SA 1XDBA 4D3FA 5F7OA 3MLEA 5KOIA 3HCDA 4G5OA 3TW8B 4R69A 5IN4A 3HABA 2PSJA 3ABIA 3N6XA 2I7TA 4UFNA 3GLGE 1H1LA 2B7CA 4N0EA 4Z6KA 1USKA 4RK7A 10MHA 2GKOA 2W2VA 4Z53A 4QO8A 5IS2A 2ZAYA 4O08A 1KOJA 3R3UA 3A0RB 5KNDA 3QKSA 3RWBA 1B6TA 1GPWB 1FUYB 1XD9A 2WTMA 2WUWE 5BYBA 4YPVA 3RQSA 1IUPA 2Z6AA 4BEVA 4B85A 4DM3A 3QGMA 5T67A 1EWKA 1PL6A 2P9YA 3Q9SA 4RC9A 3KXDA 1EAYA 5HF8A 5HCUA 2ADMA 2QLNA 5IUNC 3GJ8A 2PNFA 3AY6A 5EINA 2F43A 3I5XA 2ZATA 4HCJA 2CWDA 4RSGA 1JR3E 4YP6A 2IY9A 3C8UA 4AMGA 4HI0E 3HYLA 4LYYA 3E9CA 1BTOA 5KJ6A 1SO8A 3BMQA 5I7AA 4YAUA 3SZOA 4QGFA 2QWXA 4JXKA 3T34A 2QL9A 4C0WA 1Y34E 4ND4A 4GPIB 1OXXK 2GAJA 3U4QB 4LGVA 3LCRA 2WAYA 3VO8A 3W5IA 2E4YA 3D7KA 3DQQA 3LQYA 4EZIA 3ONWA 2MINA 3AFHA 2OBLA 4IIHA 4ZARA 3LVQE 2F7SA 1Q1NA 3PFHA 4P4UA 2F64A 2O3TA 2WUDA 4CLEA 1ZCJA 3ND8A 1JA1A 3STYA 3BYZA 1A95A 4LC9A 3HDHA 4HSGA 3OPXA 4LFCB 4BTVA 1ECJA 3MD9A 1H3FA 5JDCC 4KX5A 1WZNA 2CLMB 2XD9A 2NSJA 2VNJA 3LTEA 2AF4C 2Z9BA 4QTXA 2HMUA 3RUDA 4BP9A 4D8WA 1MTZA 1AHHA 3EVTA 3KB8A 3VGJA 4GIBA 1JDVA 3MINA 1UC8A 1CU1A 4GL4A 3QSGA 2X5NA 2ZRHA 4A8JA 4DMKA 1MCZA 2P2LA 1GT6A 1SVMA 3QA3E 1UWVA 3MTBA 5JMTA 1MLDA 3EZXA 5I9LA 1VYVA 3GD7A 4O2AF 1K3UB 2QNIA 1USUA 3KFLA 5JAMA 1CLEA 3ICOA 1H2EA 2IXTA 2BCEA 1H4SA 1AKUA 4DS3A 4FFDA 4TL7A 4WUVA 2W4QA 5C37A 3GLTA 5AKKA 3ZKWA 3OIVA 1OJ7A 3F6EX 4KPGA 4BMSA 4GOXA 3LIIA 1RZRD 2V8OA 2IEDA 3AONB 2A7XA 4ARAA 2O14A 3PXDA 5DWQA 2DR2A 1O6BA 1P0MA 1XDDA 1UT6A 3BXFA 3CF2A 2PGLA 3GU3A 5EQDA 5EY5B 3USCS 1KMHA 5H82A 5JTTA 2HLPA 4W6ZA 4ND2A 5IMSA 1FFXA 3LE8A 1KPIA 3RIYA 2OO3A 3D3EA 5FI5A 5HTKA 1EZ1A 2ISCA 4JI5B 2JANA 2ONCA 1QBGA 4TTPA 1U9CA 4ZJUA 3LQKA 2MSLA 3BWCA 1FA9A 1RKUA 1D0VA 3BORA 1YRAA 1T9CA 3L1UA 2C2XA 5C7LO 1HR0B 4ZCLA 2AS0A 1CUJA 1P19A 1LBEA 1NAIA 1KVSA 4I8DA 1UC4B 4UHEA 1IAQA 1Q15A 4DCSA 5JD6A 3WA7A 1FUKA 4ZREA 3FNRA 3PD7A 1N57A 3O03A 1UR5A 4ZTBA 4EPTA 4EQ6A 2HAEA 2V5AA 3ROQA 3UJNA 4U7FA 3TVTA 4FIZA 1KMHB 1LDMA 1V5FA 5LPNA 1XAGA 4MKIA 2Y1WA 5D7NA 4IYJA 4PS1A 1CHNA 1O95D 3D7NA 2R68A 2VG8A 3GXBA 4G9GA 3UAVA 4YRRA 2FMTA 4XOUA 3M81A 4MUIA 1L3CA 3UAXA 2OZEA 3CEAA 4G4IA 4UD6A 5DNUA 3I9MA 3LC7O 1ZCZA 4KAJA 1M6EX 2JFBA 3D6FA 3NXSA 4LWOA 5HILA 3H9UA 2BFEA 2EHDA 3EEBA 1TCAA 2QG6A 3SHOA 2UUBB 4O3MA 2H51A 4C0LA 2ZUFA 1TW3A 4FGUA 4HLQB 3OICA 3I9FA 2HBYA 3VHXB 5EWJA 3WNVA 4F4IA 1OXSC 5HIAA 2GWHA 4PICA 3EQ2A 4RACA 3NR2A 4WPGA 2YMLA 1C0EA 1YZHA 5AI6A 4DR3B 3EF1A 4CE6A 4NNJA 1TUEA 2CDCA 4X5OA 2IEIA 4O1HA 4DR2B 1GSHA 2OHHA 3NBKA 3OSZA 3HPRA 1CVRA 1HDYA 1L3IA 1JR3A 2XSZD 3CRRA 4Q9IA 3R7WB 4B6JA 4FYWA 1D4OA 2CB9A 1Z68A 2JZOA 4R8RA 4K26A 4E2YA 1IONA 1EFPA 4K6KA 1RXUA 1UM9B 4CETA 1ZD2P 4TV8A 3I9OA 4BFWA 2FWNA 4U7WA 2IF0A 3LUCA 4BV9A 1OH6A 4LAFA 1OVMA 3ZU5A 5I51A 3STHA 4M9SA 5CLIA 1QHHB 4IINA 3PPYA 2PBZA 4Y2TA 4C7XA 4DJDC 2A94A 1XRLA 2AXNA 4GW3A 5EGSA 3HS3A 3AUTA 2GGSA 1JPUA 2OCDA 5TVKA 3MWEB 4EA8A 1X1QA 8GPBA 1GGMA 3SU8A 4TTTS 5HA5A 3PUKA 4LHVA 2EQAA 1KH1A 2ZYIA 4JUFA 3FPCA 4UCWA 1BJRE 3X2EA 4H7EA 1DIGA 1W6RA 4A03A 4IILA 2I0FA 3VNSA 1XU7A 2XUAA 3U16A 3T5PA 3GGOA 1JE1A 3P9KA 3PHIA 1CY8A 3OZUA 4MTLA 5CX1A 1JYEA 4OXIA 1L5KA 3NJ4A 5ADWA 3GW8A 2VPPA 5T57A 1NASA 1M2VB 2Q0HA 3BMNB 4LA4A 5FL3A 3HVUA 4HT3B 1QRUA 2ZYSA 3RG2A 5HF6A 3KB2A 2B36A 3NC4A 5JH7A 1A27A 2CKDA 5HCNA 4Y1EA 5AW4A 1QYCA 1H5NA 1H2WA 2WWTA 1LI5A 1VTKA 4BP1A 2EXXA 3KYBA 1OYVA 1ZQ9A 4EY3A 5I48A 4MUYA 1QIEA 3BE5A 5AD1A 4KL8S 1UAAA 3GVPA 4ECEA 5HJ5A 1XMJA 4LYFA 2XNHA 1AGRA 4OAOA 5U1PA 3D8RA 3A4NA 4LXXA 2M6LA 5LLSA 4X8HA 3WLRA 421PA 4FUQA 1S3SA 3FIUA 1QRTA 4BKMA 2VQSA 4QYIA 4H1WA 1TEVA 2HUNA 3MAAC 4CQNA 2C9YA 3V8QA 4N54A 4OQDA 2GPTA 4L7VA 3GT4A 3W3AA 1FQKA 3A9VA 3Q6MA 1GPNA 2QVLA 1DAKA 1HT2E 3DH0A 2K7FA 4LV8B 1A71A 3UXMA 2GTIA 4G8CA 4D6XA 4Q7EA 4G0QA 4LPSA 1OWLA 4R68A 1YD7A 1QOQB 2Q9AA 2BRUC 4WD3A 4DCCA 3P0EA 4B7AA 4IIJB 1OYOA 3V1TC 1B26A 3BB1A 2WILA 1KQPA 1V1JA 2JBAB 5KHAA 3E22A 2ERYA 1M2WA 3CT6A 5DN6D 1QPGA 1ORVA 1L5GB 1Y3BE 1I13A 2WMNB 1VL0A 3ZVRA 1MX9A 5K5EA 3WIEA 4ENUA 1Y1SA 2I7CA 1UDXA 1V7PC 1DC7A 1RLMA 3ADPA 4HNAA 3DV2A 4PQRA 3P9SA 4P4SB 3JATB 4GEGA 5AJYA 4FZRA 1KEKA 3RFUA 1HDXA 1M2VA 3IERA 3VNQA 4DV2B 2QUKA 1WABA 2KE5A 5FUWA 2H1LA 3AY3A 3CG0A 4KHPB 1Z45A 2B8TA 5E4FA 3HUEA 2YICA 3V4LA 4IH4A 3G9UA 4PG4A 2VT7A 5MFZA 3DZHA 5CVVA 3BQNB 1JBEA 5B30A 5EKSA 1ZK0A 2X0KA 1LLDA 5H4HA 4L2IB 1TTPB 1RCUA 4G0YA 3GA7A 4PSUA 4XGNA 1PZHA 3VC1A 4WSOA 1A98A 1A97A 1RPNA 3E84A 3LUHA 5C34B 1QFYA 3W6UA 4MIEA 4C0AC 3NW9A 4EF6A 1T5LA 2IIVA 1JBQA 3LT4A 4IG4A 2OXRA 5T4HA 3GCXA 1DQZA 4V02A 3U4QA 1C3XA 1EGVB 2QR2A 2VQ3A 3V6MA 3FYSA 2Y1DA 4NR0A 1WUKS 1KOGA 4RD6A 1F38A 4MVJP 1YAHA 3NHBA 3VGPA 3N53A 2BT4A 3HKCA 5HZKA 1M9NA 3AP3A 2ZE8A 3DAOA 3DFKA 3RG8A 1RAHA 1Y1RA 3OQVA 3UJ9A 3ZTTA 5ESDA 4QXPA 2VH2A 4ZVTA 3SQWA 1UBCA 1FP4B 1QJCA 1R0KA 1BA2A 2K87A 4R1NA 3COVA 4RZQA 3OEED 1GILA 2HIGA 5GOZA 1DIHA 4KVZA 3QHQA 4RK0A 3T4PA 4K9MA 3LPDA 5JYCA 3G5AA 4LF5B 2VT2A 1AE1A 1P7PA 1NYQA 1URPA 3AERB 3E82A 3F7OA 2UYQA 3L7KA 2ASEA 5HOEA 1OROA 2P77A 3ZV3A 1K8RA 2QPOA 4PX9A 4RS4A 3UPUA 1UXJA 2ICAA 2HM7A 1VRCA 5IXYA 1VL8A 2OYSA 1Q2XA 1H1LB 4ZOQI 2D5BA 1XL1A 2PWPA 2W71A 5BP7A 2YY7A 3PNKA 4AWXA 1NP6A 4YAOA 4AD8A 3WJAA 3QKRB 4UU7A 1E5LA 2DBQA 2KS6A 3LUGA 2HCFA 4OJMX 3T38A 4BZXA 4X44A 3AM4A 4JXZA 1EPUA 2Q0XA 1CHDA 2QPTA 3NNDA 2F1JA 3I5AA 5GPBA 1B7GO 2WY2D 5KMGB 1NKSA 2QAIA 3OZTA 3S55A 1R10A 3R2JA 1ZCFA 1NG9A 3K09C 4R1SA 3ZZ1A 4QNNA 4RTLA 2II6A 1LK7A 3R0JA 4HNGA 3UK2A 3SHFA 3OOHA 4A5SA 3QPWA 2GEVA 3ZZ0A 2YZ2A 3GYGA 4Q1DA 1DB3A 2PS1A 4LI3X 5EFZA 3RS9A 5KTMA 3H16A 1ISGA 4KJXA 4F4HA 2JKYA 3N76A 3LPCA 3E8XA 3QVLA 2C8VA 4KMOA 4HUQA 3NHLA 4LVNA 3EGDB 3HWRA 4JYZA 1K5HA 2HSWA 1J1UA 1PJ3A 1PD1A 1Y3IA 3B3AA 1D1QA 3VDRA 3DFUA 4ER7A 2QN1A 1I51A 1UDBA 2E4XA 3WAKA 2CDAA 4J4HA 1PJCA 4X54A 1SIUA 3PC8A 4AX4A 2ZPUA 1S96A 2DCMA 4YJHB 4WQMA 4QRHA 1KDOA 3PUVA 5F2OA 4B7CA 3HXPA 1H2HA 4GSYA 1JIKA 3VYUB 4LY6A 4UC0A 4Y8VA 1Q7TA 1XCOA 2Y1XA 3T54A 2CL6X 4PTZA 2RGRA 3HZZA 1J20A 4QXRA 3RASA 3DEIA 2G1KA 1X2BA 2WKRA 2YJNA 4O8ZA 3RVSA 1D7AA 2P2NA 4H4CA 5AOVA 3TE6A 1GEGA 621PA 3EDOA 1FFDA 3GX1A 4EKIA 5T3UA 5LZ2A 3LPAA 1R12A 2DHCA 1W5SA 3EXHB 3TRJA 4URVR 5KWEA 4GF5A 1XKXA 2E5FA 4OFBA 1J0AA 2BHLA 1DIOB 2FPKA 2V7UA 4Q4JA 3KOXA 1EIZA 1ZAYA 1J00A 1WOYA 5H68A 3WMGA 5B6PA 3VKVA 1N2XA 2VRNA 3G5TA 1OW3B 4G5HA 4FDUA 2VUSA 1D6MA 5BN5B 3RC7A 3W1EA 1YDEA 3IOEA 5KKCA 3PUIA 2G4CA 3H3JA 4EPWA 2QSUA 3D3WB 1XDWA 3JQBC 2ZJ8A 3UAYA 1C50A 4WY5A 2VDOB 1R4MA 4G0PA 2I8CA 4E11A 1FMJA 3NH9A 5GJVC 1WHTB 4OVKA 3PLAE 1KYXA 1NLYA 3IESA 4M8SA 3SKXA 1F3LA 3OJCA 4TMTA 3IQFA 2H1OA 1GPUA 1K66A 4PVDA 2WWXA 1L5LA 2W2XA 1WW3A 1Y9JA 2AN1A 3MCWA 4Q4JB 5FNVF 3RUFA 4BJ5A 4YV7A 3K9FC 5ESXA 3STXA 1J49A 2BISA 2PN1A 3NYRA 2I3BA 4DNQA 2VK1A 4LNUB 2H4FA 2JVKA 2HK6A 1MZVA 3C1UA 3C7DB 4KVGA 4OI0A 2AZXA 4BE7B 1IWPB 1QZXA 3O8CA 1JXOA 2PH1A 4Q12A 1ZDMA 4LNAA 4XWGA 4KEAA 1I7LA 5DM1A 3S2IA 1Y6FA 2XB4A 2PPLA 1KK1A 3G9QA 4MLCA 4ZVUA 3N0RA 3O95A 2I66A 1SUIA 4RVCA 1XCMA 3ZHQA 3FPLA 1NN3A 1GZ4A 4JLOA 1SUFA 4QNMA 5KSZA 3ST7A 3OD5A 4ER6A 2WVGA 3Q3EA 2PKXA 4DN6A 3AF1A 1DO8A 1G8MA 2FPOA 3I2YX 3P9XA 3INGA 4D56A 2DUJA 1KEPA 2RBEA 4KV7A 3RI3A 3WSTA 4C0SA 4DQLA 5TDHA 1OCEA 4RZSA 3RBAA 3A1TA 4B3XA 4BRWA 3G5UA 1ZNQO 2HH9A 3MILA 4MKXA 1QV9A 1RM5A 3BDAA 3EGEA 1NXSA 3ANSA 1SKMA 1YAJA 2NV0A 2AKEA 2VP3A 1WTCA 3DFFA 3DTVD 5JSQA 3CINA 2I6TA 2QL7A 5HKKA 3AF0A 5FTJA 2I2BA 2AR7A 1VLMA 1QYVA 2XTAA 2BH9A 2CZGA 4GM4A 5D7BA 3R24A 1Z63A 5FWXB 2OSBA 1M74A 3HR4A 2X9NA 4BMZA 5A3JA 1W75A 2H0RA 2ZP1A 2WVAA 2WZDA 4UD2A 2Q2QA 4B83A 1CR6A 2VP5A 1XJQA 2CN1A 2PBFA 1ZJJA 4WLFA 3T1VA 2J9FB 4RVNA 1H8HD 3OQBA 4JP2A 2W2NA 1DJPA 4IX1A 3IALA 4F46A 4M7PA 2XWPA 4XIJA 4AJ1A 4QBHA 4Q9NA 1U7UA 1M7BA 4EM6A 1CVIA 3BCHA 1R15A 2WA1A 4QJBA 1Z2PX 2VH1A 3NAZA 4S1OA 2J4FA 3V1KA 2Z3VA 5AVSA 5DM70 3I62A 2YMMA 1SQFA 1LC0A 2JIPA 4FKMA 1DVRA 4BO8A 1RLTA 1BE0A 1LRLA 1HKUA 4HXFB 5GJBA 1R5JA 1ESMA 3GA0A 3LSYA 4FS3A 2H00A 4G07A 1YK0A 4LHWA 5LN1A 4RE6A 4GQBA 2XRYA 3VH1A 3DTVB 1SZCA 1QHYA 1RI5A 2JBWA 1Y9EA 2JGLA 3BOSA 5HF5A 5JCZA 2EBUA 4BASA 1NMSA 1XPJA 2Z2ZA 1RPJA 3O84A 1E1KA 2QP3A 3UYLA 1DXYA 1O57A 2ID9A 2B69A 3JATA 3QE4A 2BFNA 5GINE 1YQGA 3LKDA 4HWSA 2IEZA 3FHOA 1ZIPA 4J6EA 2VZEA 1E64A 1VLZA 3DYBA 3H99A 4PZDA 4G1MB 3T35A 1D4ZA 1MOQA 1RPTA 2XTZA 4GOJA 4RKWA 1SAYA 4G8DA 5KPDA 1CS0B 1ZI6A 4OAQA 1AB5A 1RFGE 1NBMA 3CNEA 2FUG6 3F7MA 4ND5A 1OBCA 4QJIA 4R1PA 5HKAA 1QU3A 3S5UA 4W5QA 4DDHA 2QF7A 3CLUC 2BHSA 2O20A 3D5QA 3I5MA 1V7CA 3FCAA 3P52A 5EZSA 3KVNA 1E9AA 2PFSA 3PUHA 1V11B 4XB1A 1JVNA 4KHZA 3IJEB 1PFVA 2OFOA 1J7JA 1JU4A 4A1OA 2XGOA 4FSXA 4UEOA 1OAAA 1SWVA 3EXIA 1TVKB 1DSSG 1PR4A 2I9PA 3CIOA 3DOIA 3KQTA 4FEEA 4PQYA 3RSZA 4A8HA 4XVCA 3AVQA 3JZAA 4DIBA 2B0JA 1Q3TA 2RCNA 5E4TA 2NNLD 3E4CA 1UJ6A 4G1CA 2I3AA 2H9IA 2J07A 4WLOA 1TT5B 3G0OA 1OPRA 5A7GA 4OMCA 4C20A 4UOEA 5IU6A 1KK3A 1IN8A 2B2CA 3EFOA 3HE3A 4TYNA 1M2EA 3LXMA 1FBTA 1EX1A 2VS1A 1FYVA 3PHLA 4E5DA 4Q3AA 4R40A 2V4UA 3R0QA 4B2YA 1SH7A 3EEYA 2DU8A 3V33A 2B1RA 1PBTA 1JIJA 3FKSD 3HYNA 5JWRA 1PJ8A 5FL7A 3T3GA 2W2OA 1A8IA 3IAM1 2BI4A 2C9ZA 4UEJA 1FNSA 1CY6A 3ORQA 3BL6A 3TTYA 4A23A 1Y4UA 1GAJA 2G5PA 1MEJA 2QJFA 4YT2A 1B4DA 2ETXA 2H11A 1ZJ6A 2GD6A 2P1RA 4IXDA 3WLNA 3GLGB 2PLNA 4POOA 5J4YA 3H7AA 3LKBA 4CLHA 2HLNA 3J7AC 2WG1A 3EWIA 1P45A 5F4ZA 5TGTA 5KTNA 4CF4A 1J2UA 1L7NA 1XVVA 3GH3A 1G2PA 1U28A 4IDHA 1E2GA 3AUKA 5T6BA 2ARKA 3W2FA 1XKQA 3E48A 3EIEA 1UP7A 3LC2O 3MRXA 4WNIA 3EODA 2J67A 2PVCA 1EFVA 3OZAA 5L51A 5EHNA 2B5WA 3L92A 1D9ZA 1GPYA 1JLLB 4X3CA 4DG8A 2FEAA 1EVLA 3GG2A 4MYUA 2CFCA 4H7KA 1VP3A 1UPTA 4FGWA 1T2DA 2IQ5A 2G7ZA 1AKTA 2FK7A 4FEYA 2XCRB 1B6SA 1ZJZA 2XGMA 3FH0A 1E2EA 1QLJA 4NARA 1GM5A 3L04A 2PU7A 5K2MA 5SICE 3B8HA 3QVOA 1E2UA 2CLEB 2F8MA 4ZRMA 2IHJA 3A1CA 4P92A 2NLOA 4PWYA 5A9RA 3THYB 3GVCA 1A9QA 1TKAA 2GPNA 2QT1A 4KXMA 4O5OA 1QS0B 4OKIA 4IICA 5DU2A 3E15A 2HIMA 3IO5A 4E15A 5BV2P 4P38A 4XI9A 2A4MA 4NMWA 4Q4DA 2BR4A 3L4BC 4M9UA 3I1YA 5AKLA 5M29A 4NCBA 3T7SA 1X0VA 4CIDA 3G0HA 3QWHA 3LBYA 2VJBA 4GLLA 3O8DA 2QQFA 3T6KA 1MIHA 4HBZA 1EIWA 4R9VA 4BLQA 3HYCA 3FTEA 5BWBA 4B79A 1NBME 2FZEA 4JIGA 3GHYA 2J6CA 3V1NA 4BOYA 5A2GA 1U7DA 2R79A 3KJZA 3M0EA 4S1PA 1K92A 1XBTA 4MR8A 4NG4A 1CZKA 1I3NA 4PSDA 5EJ7A 3DOOA 2ZUWA 1ZJWA 4NCHA 3EZ7A 3IBFA 3JR7A 4IUYA 4RVUA 3K1AA 1MGPA 4NAHA 2GN8A 3TOVA 4XQ9A 1L4LA 4QU5A 2NO5A 1E5QA 2B4TO 2WYHA 3OOYA 3V7NA 2DFDA 1PV2A 3ZWOA 4FQ7A 2AFHB 4R8KA 5CNMA 5JEEA 2IPOA 4J29A 3G5MA 1ODIA 4AMBA 4K9KA 3EN0A 2B4QA 2NZYA 2WWIA 5AHRA 4HC4A 3Q0EA 5EIFA 4N5MA 1W5EA 3EEIA 4IJ6A 3TOSA 1XD2B 2XYRA 2WFAA 4I1PA 3HA2A 4UTZA 1D09A 3JWGA 1DAHA 3PD0A 2PPVA 3B89A 1KP3A 4GRIA 1XZCA 4DDUA 3ILVA 5CLFA 4IQ4A 4WESA 1FOEB 1MH9A 1YOVA 3O4VA 2JLWA 4DLZA 2WWVD 2ONZA 1J1IA 1R16A 2GFHA 1I4TD 3DG9A 4KAXA 1GJRA 5K4AA 5F2NA 1UEXC 5F2KA 4DWWA 4EI2A 3W6NA 1ZD1A 1JHPA 1GUDA 2VWQA 3D4BA 3RIMA 2IHNA 5BVHA 1Q1BA 3EASA 4TSRA 3M9XA 16PKA 1PL0A 3GPLA 1YCHA 1ZISA 5FBZA 5T5QA 3RC9A 3E7XA 3SKYA 4YRGA 4CW7A 3J81k 2B7BA 3OF3A 4NECA 2JLYA 1M54A 2AG6A 4M0EA 4PGAA 4MPPA 2WR8A 4JLBA 4LDNA 1CE8A 3MHPA 1YKFA 5HM8A 4GYKA 2I2FA 3QPCA 4QX6A 4JYMA 2BE9A 4E70A 3WMEA 1VRVA 4DTCA 2OYCA 3D1JA 1QH1B 4G41A 3WQHA 3KVOA 1YO6A 4QECA 1EBBA 3PXXA 4KWEA 5JD5A 2VH5R 3DMGA 1E3JA 3I2GA 4KFUA 3WL8A 1WZEA 1C80A 1PJAA 1FX0B 2FQWA 1N34B 1CQIA 1XZHA 3V8RA 5BT9A 4G5RA 1M73E 2P4SA 3V3TA 4KIWA 3D5EA 4GC9A 1DOHA 2V1XA 3LUAA 3PTZA 3HB7A 1N6HA 1MGOA 1U94A 4U2BA 5BWNA 3HCEA 1P4JA 4NMLA 1WSBA 4TSKA 5A3SA 3K70B 3ITNA 3FDJA 1LKZA 4EKEA 3DE1X 1E1RD 2P30A 3RNOA 5A02A 3WTBA 1QUFA 2HU2A 1VZ2A 5TEWA 3N2EA 3Q41A 4WECA 5ULLA 4HH1A 3RROA 1KTIA 1SBQA 4R1TA 3C4JA 1OTXA 4WERA 5JW6A 3FSGD 4U5XA 2GBLA 3VZQA 1NUUA 4HQLA 4FWIB 5H1YA 4BP8A 3CVWA 1P5HA 4R2WA 1K7CA 2BF7A 3NRBA 5K3OA 1UDCA 1SU7A 4C6TB 4BEWA 3HLYA 3ANLA 4EG6A 1JALA 3WJ7A 3DB2A 1E3DA 2XTJA 3VR1A 3LBIA 3TZEA 4HLUA 1G6OA 2OFWA 4KQ6A 5HDBB 1S2IA 1RQ7A 5FLXA 3QFRA 2PZEA 4R7TA 4JU8A 1IXKA 4P2BA 3DE0X 3T3DA 3EY4A 4X85A 4EECA 4X1KB 4DM7A 3K30A 2BP7A 4EHIA 1CR4A 2SKEA 3GJTA 3HCNA 3FVQA 1H2YA 7ADHA 5ALXA 3LS2A 3M6WA 1C9KA 3MGKA 5JBIA 1U5AA 4P83A 4BVBA 5IJXA 2BKUA 3U6KA 4IXMA 3HJGA 3D8SA 3P1JA 3KZOA 2BLNA 4F72A 3R8XA 3LG2A 5TR9A 1WV1A 1SCBA 4AK9A 5E1MA 2E5WA 3O0TA 3Q2KA 4F1WA 4ND8A 1O89A 2IS6A 3JPYA 5CCBA 2QE7D 1GTL1 3QOXA 4YV0A 1MH1A 3IQEA 3NFRA 4N9QA 1YF3A 2WSBA 4ZU1X 2O2SA 3KJNA 3QU5A 2H0QA 5FPQA 2QT0A 2Q5OA 5H4GA 3T41A 1XTQA 1HY3A 1K27A 3OU2A 3TAHA 5ELXA 1R7RA 5JYEA 1MC4A 5DSTA 1NJ6A 4Z9FA 2BSQA 1P72A 1C0KA 2NU8B 1YE5A 2KI5A 5F51A 4AJ2A 4D9NA 3FOBA 3T1HB 4KPYA 4EUHA 1XU4A 2J45A 3LGSA 2GJKA 4QQKA 5L4LA 2PJZA 5DBEX 1XXHB 3L4KA 3HWX1 2Z9CA 4GE0A 4JVSB 2ZSFA 1ABFA 1SHKA 1H9AA 4MDYA 3LVRE 4RGQA 3BGOS 2RK4A 1VL1A 4G1VA 2HEIA 3N07A 2FFQA 2WSSA 4ARSA 1B6GA 5IT9A 5TQ2B 4F8YA 1ESCA 2G76A 4DSNA 3X1DA 2XUPA 3SF0A 4X6XA 3RFTA 3I04M 4QFDA 1R50A 3HO8A 4OY3A 3AVTA 4PGMA 4BNWA 3DVLA 5IWCA 4WZBA 4UARA 4Z3DA 5FJIA 1JKJB 1JWBB 1MB4A 1HG1A 2BI8A 4IXTA 5HFJA 2XZTA 3QVKA 4XFKA 2ZYTX 4I4LA 4PSVA 3RIEA 1X1SA 4DTIA 1HRDA 3IAEA 2Q9UA 4MQFB 5EIBD 4GRAA 4BJ3A 3OLYA 2IS4A 1R0SA 4E13A 4OD0A 2HCRA 1I1NA 2A0KA 3O1JC 2IYWA 4RQUA 3Q8XB 2M98A 1CNMA 4X92A 4CTNA 1CS0A 3RVKA 5CXSA 2P6PA 2F3TA 3ACDA 1XA0A 3RD5A 4HNSA 4EX6A 4RDHA 1R0YA 1YNOA 3UJ3X 1ODTC 2GZDA 4OIMA 4F4UA 3HMKA 1WKBA 3G7NA 3RV4A 2VYCA 3QMPA 4AY3A 1W29A 4IDFA 3ADOA 2OCXA 3QELB 3RSFA 4TVSA 3WXMA 8LDHA 3I1FA 4MDHA 3UJ7A 2H57A 1LVHA 3ECSA 4KNVA 2Z6VA 5FTMA 2XF8A 1PR9A 3ED1A 1Z0JA 1KU6A 2QAJA 3C14C 3M9WA 4KTTE 5AHKA 5C7YA 2GCOA 3HP1A 1KORA 3P9YA 4OP2A 4XR9A 3B6MA 3T95A 5CA0A 3AR3A 2AOUA 2CCKA 3O1HB 1JHOA 4JT8A 3KG2A 3I32A 4BIMA 1C1YA 2OGTA 4B6RA 5A6SA 2V65A 3IE0A 2QUJA 5DXAA 3OQ1A 5DEOA 1RI2A 5JZ9A 1RIIA 3KHTA 2KMLA 3FROA 4L0CA 4UZFA 3E7DA 1CR0A 5JNRA 5LNK1 1JG7A 3LX8A 2ZRPA 4FHEA 3GPIA 4V1CA 2VJYA 2XBLA 3D02A 3RS4A 2XTMA 1B1AA 2EATA 1W1UA 3IHWA 4HQ0A 4I50B 1PZGA 4NSNA 1CFZA 5DGTA 3OCVA 3KRTA 2JIOA 5E2IA 2H5EA 4OJQA 3B6IA 3O8QA 4NBNA 2UZ1B 1UMBA 2EERA 2AUTA 1DAFA 3DCJA 1M8GA 3CCBA 3WRXA 2P91A 5EWLA 3EQ7A 4PN3A 2PQ0A 3EW9A 1PEKE 1LNZA 1NR1A 1QKIA 4ZVOA 3SEZA 2XUHA 3UPTA 3THXB 1A5BB 3CLSC 3PT5A 1PFWA 3P20A 4OUDB 2HD4A 1ZH4A 3SDSA 4RMHA 5KNCD 1RMTA 1LS6A 1YHZA 4MA5A 1J0CA 1JS1X 4IEIA 4O2BF 5H3CA 1SVNA 3O38A 2EYQA 2OESA 2A67A 5U4QA 4JLDA 1Z29A 1L5RA 4Y2UA 2OQVA 1R0XA 3W34A 3ZY3A 3UCEA 3ESDA 3A28A 4UJ3A 4WK4B 2QLTA 4F3YA 1ZEMA 3FI0A 4RCZA 3C98A 3M6XA 3K53A 3DE7X 1FJ2A 2OWEA 4E12A 1QH1A 2H2WA 1NT4A 3BVPA 3NWPA 5AICA 4CQMD 1J56A 4JLMA 5E8RA 1OX4B 1ORRA 2W70A 1AGXA 1NJSA 3D6UA 4Q1AA 4TKZA 4ZVNA 4JFRA 5H7XA 2XUDA 1WMAA 2G17A 1YJ5A 2B34A 1YXMA 1N5RA 1OWMA 2VSFA 3Q11A 3JQ7B 1JQKA 1OAOA 1W49A 1RHQA 1PT8A 1KYQA 3DF7A 4CV1A 4BQSA 1RVDA 2J41A 3HJBA 5CA0B 2REXB 1THTA 3K1JA 1DKOA 3HKDB 3PQ4A 1ZK1A 4O4HB 5BW8A 3MT8A 1CUIA 3NH6A 1MOZA 3OEEA 4YUVA 4MMXB 5JAUA 3F46A 2WVJA 4D82A 2NT4A 5EA2A 2VOEA 3SKVA 2YTZA 4OIFA 1Z73A 1UL1X 4AVYA 3IIKA 1BCRA 3D4PA 4GOMD 4G0WA 2ZJ3A 4GU5A 3MFQA 5D87A 2ID8A 3U4MA 1DARA 2YWGA 1Z0IA 4J7CA 1RAIA 5JATA 4EHAA 2NZVG 4O6VA 5G1NA 2Y76A 5G0TA 1ZUNB 5IC5A 3N6VA 3DJFA 4QATA 1CIPA 1BDMA 2AYYA 5FUXA 1GEEA 2ALJA 2JLQA 2PZMA 1RC8A 1XTTA 4RNDB 5ALGA 1TM2A 3KDSE 1ISPA 2E4UA 2IZ1A 3CJQA 1GNQA 3GCDA 5E3IA 2CVQA 5KKAA 2EJBA 3PKZA 3ZWYA 4B7XA 5KVAA 4PAMA 2OO7A 3TZHA 4XUEA 3TKYA 4ZMSA 3D4OA 1C3OA 2AFIE 4JP5A 1CQWA 3BSWA 2IFTA 4PCLA 3TLYA 4M60A 3NX4A 1SUEA 1JHMA 3KZ1E 1H2AS 3BQ9A 3P27A 4QGHA 5JLAA 4A2PA 1P2UA 1UWLA 3WS7A 3HU3A 4REOA 5L3VA 4R7ZA 4TWRA 1TA4A 3G2QA 3CX3A 1UKEA 3MYRA 2CF6A 1N6OA 3NHYA 4GE3A 1KJQA 1LDBA 2GRAA 2P6MA 1YB5A 2ZETA 3DA8A 2BEWA 2X1LA 4P32A 4Y2QA 3NIBA 2QJWA 1EP1B 5I3CA 4KFRA 4R3NA 4C7VA 5DPMA 1E3WA 1Z6ZA 2NAPA 4GICA 5HE8A 1QR6A 2G9QA 4O4HF 5EQTA 4X62B 2D3TA 4DLWA 5JXIA 1PVVA 2QZ9A 3C2QA 3GQVA 2I4NA 2ZI7A 3K35A 1KK2A 1K2WA 1BMQA 1H0RA 1Y3DE 1IZYA 2JFFA 1GVNB 4ME6A 2UDPA 2QORA 4PXYA 1IEWA 1H5QA 2RGNC 4WOPA 1TCCA 3F9CA 2DY0A 3W2HA 2LDXA 2RHHA 4YBZA 1Q91A 1E1MA 2I2CA 3O7MA 1LLQA 2FDCA 4XJVA 1W46A 1JQ5A 1BD4A 2C4MA 2BKEA 3AY7A 3IAAA 3KDPA 1IMJA 4LV6A 4CLRB 1JG6A 2H17A 5EUCA 3P2JA 2AFIB 4B3CA 4EB6A 5CDUA 1P1KA 3MBKA 4H3VA 1PW5A 3D8BA 4ZT5A 4ETMA 1AT1A 2AW3A 3ZG6A 4B87A 3NBXX 5KREA 3C1AA 3L6RA 4EGAA 1YZFA 1ADCA 2NTJA 5JMOA 1WDLA 4Z0HO 3ZE1B 5ALNA 4K9OA 1YA4A 3G2IA 3OLVA 4BLVA 5B4UA 3ZUGA 3AB7A 3AIOA 5J2UF 1DXOA 3LAWA 3P8ZA 5LBIA 4MV7A 8MHTA 2E3JA 4GX2A 5JDCA 3BULA 5BOSB 2L0XA 4RVHA 2P27A 2PUJA 2LE0A 2ZANA 4G6ZA 1C3OB 1BWRA 3EXEB 4HGOA 2V7EA 2NUPB 1I6MA 2JW5A 4XWYA 1DLIA 5T8KC 4P7FA 3Q10A 1XKTA 4B81A 3LCVB 2HMVA 4MVJE 1BW9B 1ZBQA 3KB6A 3LZCA 4GOLD 4N41A 3DVQX 2OXCA 4PZLA 5E2AA 3UBMA 3PGKA 4WTOA 2ZR8A 3ABOB 3IQZA 2HOQA 1XFAA 2QTRA 3URMA 1V71A 1ZXLA 3L43A 4K88A 4YDHB 1YU9A 4D8YA 3LRPA 1EKXA 3TLKA 5KO2A 4EAQA 2JA1A 5FWDA 3GJSA 3TNFA 721PA 1YBHA 4RMIA 1YULA 3I53A 3DCNA 2FFAA 3EXHA 3ZQ4A 4QYTA 2ZT6A 3U4DA 3NRJA 3C8DA 4X6LA 3PGA1 1QSGA 2PCJA 1J8DA 4YMIA 2YZKA 3EZLA 5JLJA 1BH6A 1MEOA 1DLJA 2IYLD 2Q4BA 2VYNA 1RBQA 1UIMA 1XMPA 1O96B 4L50A 1TA0A 2P62A 3QU4A 1QCDA 5C8DA 1TDJA 4NBVA 1WCV1 2J3QA 3LFHA 4JUBA 2GVZC 2E48A 5HZHA 5DH9A 1WS6A 1VZ3A 2HTFA 5GIOE 2QRKA 1FDIA 2MDTA 3HXOA 1T9KA 5C1PA 4CMEA 1R9GA 3SX2A 4ADSG 5HZGA 2H92A 4R01A 2Q5CA 4JFAA 1K8YB 4GXRA 1V8FA 3OE4A 2QMHA 1EVEA 2HDHA 2VC2B 5IUKC 3ZI4A 1H0HA 3NBAA 1YMUA 3KE9A 2WV7A 1E1RA 5C5DA 1WU8A 3GFGA 3VR0A 4B3MB 4LRUA 4C4RA 4QQNA 2PZGA 121PA 3LPNA 4M87A 4U8HA 5DMXA 4ZALA 5IVPA 4F84A 1TXGA 4QBGB 4DV4B 3TKAA 1OI7A 1WY5A 1PRYA 2DY1A 3ABQB 5F7XA 2BUBA 4MRRA 2ILVA 2M32A 4NNPA 4QEKA 5EIOA 4BBJA 4AKEA 4RQBA 4Q9JA 3QE3A 1DTSA 3QENA 3OJFA 4W7SA 1DX6A 3PXBA 1W4AA 2UZ1A 3JWHA 4RWEA 1YNSA 1D8TA 2P9HA 3M5PA 1FFGA 4H77A 4CT0A 2H4XA 3X1JA 3GL9A 1XZKA 2IY8A 5EWLB 3VVCA 4BMOB 4BZPA 4M99A 4HNUA 2WJWA 4RPKA 3OIUA 1EFAA 5JO0A 2QHXA 4YCNA 1LK5A 1O6GA 1RJFA 2PQMA 3QBEA 3CTMA 1BROA 5L7YA 3IDSA 3V1LA 1LPPA 5ALWA 5JXJA 5ADHA 1GTJ1 2AWNA 5A4IS 4N18A 1YR8A 1IXZA 3EZYA 4Y7CA 3AOEC 3KS9A 5KQMA 1OLSB 2DG2A 3ELUA 1NP7A 2UKDA 3AL2A 1XO1A 2VQDA 3K9QO 3CF4G 1H23A 4BQEA 4EGQA 3W4JA 5CJPA 2QR5A 1N7HA 1RYZA 1W8IA 2R00A 3Q72A 4HVTA 4KLNA 5LBUA 5A1TA 5FDFA 1OSNA 2A3RA 2FRDA 4Q18A 4ZQBA 2PA3A 3MIIA 3KAKA 3OFJA 2P2SA 2FRVA 4QA9A 4QQ8A 2H4YA 2PD4A 1BW9A 1XZNA 4R0NA 3RYFA 2HN9A 3HBAA 1NW3A 2DHRA 4GM0A 5AIBA 5IC4A 3S0JA 2RG1A 1XNQB 1SRRA 3NBQA 3TCXB 5AXDA 1GKLA 3RYFB 2OEPA 5CLHA 5BW5A 1L4MA 1W5FA 2OT3B 2I6GA 1T91A 2CLLB 2QD5A 1HA3A 3DONA 4ITRC 5EP4A 3VO2A 2DWUA 4GOKA 1BXGA 1FL9A 3DZ8A 4LYHA 5BW6B 1ZA1A 5AOCA 2C5AA 1DXQA 3G9ZA 4RD3A 3W6ZA 2AZMA 3B38A 4S3MA 4HAOA 5JH7B 2W2TA 2X5KO 3B9RA 2AJBA 4B82A 3QHAA 2ODPA 4KODA 4LXYA 2G5CA 4N65A 3REGA 4WMLA 1ZIOA 1VI6A 5JRDS 2QSYA 3GF4A 2HWYA 1MN6A 2W6IA 1MORA 3GRRA 4IUCS 4JZYA 4MWGA 2DTDA 2HXSA 1U1FA 4TM8A 5L53A 4EB8A 1SCDA 3R5HA 2FMUA 2IP4A 2PEYA 2NO4A 3CZPA 3NDRA 1PLKA 1NLMA 2LV8A 3LCMA 2Q2NA 4HWTA 1T6XA 1U8YA 1V1MA 2ACVA 3TR5A 4AB1A 1ZM7A 3SJCA 2NMVA 5IZCC 1E4EA 2DQSA 2EIHA 5EPUA 4QJ5A 4HUTA 5G0WA 1TJ5A 4BBZA 1FXWA 2CUZA 5AWFC 1VPTA 2JBHA 2O3SA 1ETUA 2OBYA 1L4UA 4G5YA 4L16A 4WY8A 3B1VA 4AJIA 2H2IA 1RP7A 2PKRA 2VVTA 3FKSA 3MT7A 1MXFA 1DC3A 3V4OA 1E3MA 4Z0PA 2R8OA 4TWZA 2B82A 4YVFA 4IHJA 4YO7A 1D2GA 3HM2A 3KQVA 3Q7SA 4XM2A 4D7AA 4CR7A 3DP9A 2NUAA 2XYHA 3VYWA 3D7SA 3OIFA 1WUHS 2VBGA 1TJ3A 4ID9A 5ALHA 4DADA 3MXOA 4NI5A 1V47A 3Q0IA 2HMAA 1OFHA 3QE0A 4A1FA 1CSEE 2ZUUA 1PNRA 1NRJB 1A8PA 4MV0A 4YFYA 4YIKA 4LUCA 4UW9A 2WF5A 4DA6A 3IEPA 3DEHA 2EEZA 2HK8A 3EGOA 1QO0A 3WWYA 4ABTA 2F1OA 2GF0A 4TUYA 5FOUA 1ADJA 4TZ6A 1J2YA 5E1DA 4PO9A 5B64A 3G0GA 3E58A 1G5TA 2HF8A 3KUDA 2ATCA 3M6FA 5LQSA 4HQOA 3LMKA 4NV3A 4HH3C 3GP3A 3MTIA 5KS2A 1ULBA 3FYCA 3KZNA 3D4IA 5A3RA 1EFUA 5DM4A 3T9DA 4MGKR 1X7WB 2ON6A 1QYDA 5SY9A 3TBFA 4BV3A 3OKPA 4AJEA 3IVAA 4ND3A 2GPWA 3BH6A 2R4UA 1TTHA 3E1GA 3HFRA 4XDZA 3WL7A 4L22A 3CF6R 3U09A 2VJKA 2QN6A 3G2PA 5KQSA 5U4XA 4JJ8A 3L8HA 1JSXA 2AV6A 4ZQFA 2CYCA 3RCBA 3U3MA 3RUIA 1CD5A 4I66A 1YR6A 3EDYA 2DQYA 2M6KA 3SVZA 4EYKA 4YXFA 1ORTA 3RRXA 3S81A 3WMRA 3IELA 5JWHA 2Z4SA 1UXOA 2O52A 3KO8A 1CK4A 1QYRA 4HUJA 4KCGA 4RSHA 1KFCB 1N9GB 3OM9A 1GZDA 1TEHA 1SUDA 4BFUA 3IVRA 4EG7A 5I4CA 1W1IA 4MS3B 5F9MA 1IOLA 1L7BA 2IL1A 3NB0A 5I9TA 1KY4A 2AI1A 5JC8A 5LFAA 2H2AA 5IN5A 1DJOA 4OHOA 3H0CA 1F1JA 1O7JA 2G3YA 5SZHB 2J5QA 2WM3A 3MAJA 4QXAA 3ECCA 4ZODA 3W7AA 3TZCA 3C4VA 4HN9A 1CRPA 1R6TA 3IMGA 2VHXA 2PD6A 3KJEA 4RF2A 2GN4A 2Q5FA 4Q1FA 2B4AA 1XPRA 2OG2A 1PAUA 2LKDA 3K15A 1E2QA 3KBBA 4WGFA 2ATIA 3HGMA 4RA6B 2AR9A 3FCCA 2FEOA 3T94A 4OX9B 3FMFA 2WT4A 2C59A 2HU7A 3BKXA 1OHHA 3MTDA 4OXXA 1TB4A 3DPIA 3HFJA 4Q4LA 4RA6A 1E3WB 4CF7A 4L4UA 3PSHA 3ZCTA 3UV6A 4J0JA 4YAEA 3S1SA 2QIPA 4RLQA 4AC9A 4ETNA 3DHEA 1K68A 4YUYA 5E6UB 2CUKA 1G2OA 2COEA 3TM5A 3U26A 3OTWA 2LR0A 7MHTA 1GGKA 5B6IA 4X84A 2CCJA 2ZE6A 3B70A 5TXGA 1R6XA 3RIGA 2IH5A 3Q6IA 3Q3HA 2O57A 3WRWA 3HV2A 4QBTA 3INYA 2ZSJA 1XP8A 2UVDA 3NHRA 4LISA 3ZGXA 1EJ2A 4S0XA 2FF5A 5JAIA 3H6HA 1YASA 4C76A 4WZAE 1CQPA 1VIYA 1ZMOA 3DAHA 4DKXA 4R8SA 1E6CA 4D8VA 2DZDA 2ORWA 3DMFA 5JQGA 3V4RA 1WB6A 2VQ6A 1KE2A 1W0CA 2Q49A 1OLXA 1SUWA 2WI8A 4TYYA 3LLSA 2F3PA 4KQFA 3A6DA 3CLKA 1VJGA 4UVDA 3IP1A 1J2RA 4NXNB 1M6WA 5IF3A 2VBFA 1P44A 1T1JA 4LX8A 2X7HA 4WNYA 4PR3A 4ZU3A 1YCGA 2WTNA 3LRTA 2ID7A 2YHIB 3P5SA 1E7RA 4KMMA 2FK8A 4RJLA 3WO0A 4KXVA 1JSRA 4AKIA 3GMSA 4Q7JB 2QQ0A 2GHIA 4ZXPA 2INGX 2ZTLA 4GI7A 3ZWWA 3ZDDA 1JYFA 3F47A 4L0DA 4IIFA 3H11A 3SF8B 2ZB3A 2FW7A 3M4ZA 1SIOA 1NVVQ 5LBTA 3SBEA 5CFPA 3HJFA 3T0GA 3JS5A 3I64A 1SPBS 2R65A 1LSJA 4P3XA 4YMUA 4NEGA 4YALA 1A72A 4CDRA 1H6BA 1GVHA 2ZSDA 3DV9A 3LOUA 3DFMA 3NWJA 1KVQA 5CD9A 221PA 2NYVA 2IX9A 3H13A 2HPZA 2MSCB 1ZNYA 4I46A 1HEYA 3WLKX 3V32A 5BV0A 2C8JA 3PYMA 3UV3A 4HV4A 4UTPA 2XWSA 1JVSA 1MZPA 3UXHA 1J1ZA 4B3BA 1H85A 2O8FA 1NQWA 5K8JB 3WDSA 1PEYA 1AB6A 1J0EA 5J63A 3WRYC 3H97A 4G84A 4KQ1A 1OGJA 5K0GA 1VJDA 2GM4A 2I55A 1R6AA 3NT2A 3H11B 1W4CA 3HL0A 5LMUB 3N39C 2YIDA 5EE5B 4KK3A 3D43A 3PQFA 3Q7RA 4IKOA 3BWEA 4HK4A 5EXEA 4OXYA 4D9GA 4RV4A 3DEFA 4ND1A 4WK2B 2YY6A 1K6IA 2OP0A 2PKYX 2VP6A 3ESCA 4D99A 5JFOA 5T64A 1Z7YA 4RKQA 3UW3A 5KC8A 5KCMA 3T9FA 1EQAA 4EB6B 4F2WA 3T1TA 3BBPA 3KQKA 3T0FA 5JH7F 3L0ZA 4I4IA 1QK5A 4OUDA 1F3OA 2XCUA 2IPLA 4FDTA 4MGYR 1IY1A 3GWZA 1ONPA 4QPNA 1FW6A 4IDDA 4XIYA 1FJXA 3K1ZA 3ERCA 2VF8A 4WFIA 2HZ7A 4QEDA 1NKVA 2GYYA 2R87A 4A2WA 3AETB 1JDZA 3OPYI 1GTSA 1BOOA 4HLCA 1ZSVA 1QQ6A 1RXIA 2P41A 4MVJI 3AUJB 1N3LA 1BHJA 1BWSA 4FN5A 4OPMA 3C3KA 2PGDA 4XVRA 3H7IA 3BHJA 4YJ2F 5DYTA 3T0IA 3EQ9A 1P1CA 4C5AA 1CEYA 2OCPA 3I1IA 3CJRA 3KJGA 2G72A 3AR8A 4HQNA 1RRKA 1PVDA 1FY2A 1B8OA 3FCUB 5A9SB 1SXJD 2LBPA 3FLAA 1NYTA 1WCWA 4PIVA 1PTJC 4DUGD 1Z5PA 3S68A 3DDZX 2XJ9A 1LDNA 1XCGB 4JA2A 1G5FA 3WWEA 4BVLA 1GPH1 4NHEA 1ZVQA 2GJ9A 4ASUA 1E2IA 3PGLA 3WGMA 2X8WA 3IGFA 4KE6A 4TV8F 4CYMA 1NWCA 3FOCA 3H83A 3NO4A 5A0TA 1H2ZA 2EYUA 2QLLA 2PWBA 2NN3C 2VNKA 4GKAA 2J85A 2ANCA 3BL5A 5E9WA 4YV2A 1F60A 2C7VA 4IJUA 4DV5B 1JEYB 1RWNA 3WBBA 2D1QA 4PTYA 1HE8B 2C7BA 1EINA 2QTTA 3TSCA 1QM5A 2F8TA 5ENVA 1Z25A 3DDOA 2VDPB 2HT1A 2NV2B 2E87A 2QUZA 3PGMA 4S1VA 3DL0A 5G40A 4ZWNA 4D6YA 2C54A 3LBFA 5HHTA 3E7FA 1T8TA 4RA9A 2XZOA 5IUJC 4UNQA 3GLIE 3K96A 2XZPA 3CY6A 2CE7A 1H69A 3R6LA 3C6XA 1MRNA 3O91A 2PYDA 3ZK7A 4KZPA 1JFRA 5AI5A 3BHIA 1UMDB 5H0IA 2ZPAA 4RPJA 4E1AA 4Y6SA 2O05A 2DLNA 1U0EA 4YAGA 3A4TA 3P9IA 5TF0A 1JHZA 3W2GA 5EQFA 1BEEA 4YC7A 1P77A 3LDUA 4FJ2A 1ADFA 2VAVA 2ZBUA 4Y9UA 3MCVA 3MTEA 1IOVA 4QTUB 3WJ2A 3OO0A 2EFJA 2FQ1A 4NBTA 4WCFB 4X60A 3VKFA 3GJ3A 3PR3A 4JYPA 2GNAA 2ZS9A 2QN9A 2WYIA 1NDQA 2J3EA 2G5GX 2WABA 3MFYA 4I55F 2GRJA 2AQKA 1U7WA 1YK1A 4M86A 1V6AA 1ZRSA 4JSYA 2PSEA 3WWPA 1L4NA 2WTUA 5A7FA 5TE9A 2F48A 4JY7A 3HCRA 4U7JA 4QBIA 2YXNA 3AERA 4FB5A 1EUCB 2A58A 2BBOA 4GSLA 3TUIC 3UC9A 2QUAA 2PHZA 4QG7A 3NYQA 3QF4A 4JEHA 3WHIA 7YASA 4J2HA 1YMVA 4NHOA 3PGVA 1WXXA 4CEHB 1YZLA 1PJQA 1ZWLA 4F5WA 2MHCA 2WHQA 2VTKA 1EG2A 1EQUA 3ASUA 1AKMA 1H93A 3ORRA 3FOAA 1M2KA 1G8FA 1ZJ4A 3DT9A 3LQ4A 3O8QB 5EE1A 4EARA 1WZIA 5DCWA 2FN4A 4ZAFA 1GUAA 1YJAA 1DAEA 3QEMA 2A1TR 4JC5A 3VU3A 3ZWKA 3EIXA 3TOZA 3AU8A 2BEKA 1KXZA 2ODEA 2R8BA 3D59A 1EVYA 1ZG3A 1JQEA 4FGJA 2HCBA 2NQ8A 2VZ8A 4BE9A 4D3ZA 5JARA 5JHHB 1IBLB 1CYEA 4JB8A 1OZAA 1U0FA 2W2LA 4V0RA 3P2OA 2IEYA 2CLKB 2N9UA 2ZRJA 4R31A 2DSTA 5HRUA 2J31A 3OHSX 4D97A 2VYFA 1RXYA 5COQA 3BTOA 3PNMA 5CU7A 1OFTA 2OHXA 1DG9A 1OREA 4PZUA 3RE1A 1G8SA 1WF6A 2P9EA 3EGXB 1QF7A 4Y9DA 3MHTA 1G4AE 1S7GA 1WPQA 2REOA 2D62A 3EMDA 3NHFA 2QM8A 4GI2A 4M4SA 1RHJA 2XOEA 4KTVE 4XIFA 4D41A 3WI7A 1Z5ZA 2QRMA 4F5YA 1G4HA 4XJSA 4KXUA 1XVAA 3ZK8A 2IDKA 3GROA 2Z1MA 3LGXA 2W2MA 3KALA 2Q5JA 4MHOA 1RR6A 3HNPA 1NFQA 1SK8A 4XYMA 5E9JA 3VR6A 4CLOB 2Q29A 2EARA 1EUDA 1B8VA 1A7JA 1PGJA 1WW8A 2WUEA 3ESZA 3OZBA 4PM4A 4PSAA 1YZKA 3KBOA 1E2BA 1HDGO 1VMDA 2ZG6A 3WQQA 5BSKA 5DLDA 1TLLA 1VYUA 1LTQA 2GJ4A 3BC1A 3COJA 2FZKA 1PSWA 2QYOA 2O7QA 4J1TA 4RY9A 2BEWB 1JTFA 3SNHA 4DSTA 4U9IS 3BM5A 1TQ8A 2ORED 4F3RA 5IBCA 3FGZA 1TEZA 1V9LA 2ZAIA 2FJPA 2IHKA 1II0A 3AG6A 5KNDH 1RXCA 3KXLA 4R84A 4BE4A 3AF4A 1VKNA 4MCAA 1I0LA 1NXXA 4CVNA 1U2RA 4ITUA 1VKHA 5DK4A 5IAOA 4YXWA 3IT1A 4AZ3A 4EJSB 1KYYA 4N0QA 2W93A 4Q3KA 1D3AA 3DD1A 3EF3A 5DNYB 2XADA 3FDFA 3UJDA 3LQFA 4IH9A 4CXMA 4JLAA 1YB1A 2BFOA 1NE2A 3E7PA 4M0MA 1DRUA 4IVRA 4LHEA 4YDQA 1KAHA 4UBJA 4H1HA 4NOLA 2R60A 4KO4S 1DIAA 4B3TB 5FLYA 2PZBA 1AG9A 1EWVA 3FGPA 2PH3A 3FMOB 1E9DA 1XRQA 1Z0SA 1VKOA 1MRZA 1Z5WA 3NTLA 1VCIA 2N47A 4HD8A 1KSJA 4I8XA 5ECWA 3G2NA 5TY0A 2G82A 2PMWB 3HB4X 4HDOB 3ZY5A 4A8PA 1W59A 3CUKA 2FWPA 2OMKA 3E9YA 3E9NA 2QKYA 3PNYA 2YV3A 2PJDA 3GFSA 3ZW7A 4KQKA 3BS4A 2BR5A 2QM3A 3SFTA 5H3HA 4DLPA 3RTGA 3TZLA 2C98A 3HCBA 4YRBA 1U2TA 5CA0F 1N5MA 3UB2A 2QQGA 3HSSA 2CLFB 1L7XA 4I19A 1GITA 1KY3A 1MG5A 1ML3A 2J5KA 3G0CA 3IQGX 3TLZA 3L8FA 4YRAA 5DGHA 1RYYA 2ZQZA 2RGBA 3CCCA 4AZ0A 2FPPA 4CIAA 1FNBA 4YROA 3QZUA 4FYIA 4RY8A 3PNOA 4REQB 1TJPB 2WKWA 1ZUHA 1KYVA 3UHAA 4C3UA 1VBKA 5IF9A 3CUTA 3N6RA 4KXFB 1NW6A 1IEXA 2NO9A 3H05A 1FTGA 3ZWPA 5EJGA 3AM1A 2O6HA 4I1IA 1GG9A 2TYSB 2XXAB 5IWAB 1DCMA 1ZJYA 4W8OA 1KYWA 2DM6A 1ZFNA 3WE7A 1PG0A 2J0UA 2W0MA 3OQPA 4NZPA 1QO7A 2YIVX 2YV1A 1QF9A 5YASA 3DS8A 2O1EA 3F4KA 2QD1A 3ENVA 3GVHA 3ZE6A 4EJ2A 1G7TA 4S24A 3W06A 2H3EA 3K9LA 3ZJ4A 3K5IA 3OIYA 3HA7A 1IBKB 1MU0A 2LIPA 4BN5A 2NSHA 1TZKA 2UYYA 3IKLA 1BU5A 4CM4B 1AM4D 1W48A 1O87A 4DLYA 2RDMA 4URXR 2V7QA 2WYWA 4U2GA 1PJTA 2GYVA 1XOIA 1ZH2A 4JR1A 3TSYA 3ONVA 4C04A 1GSIA 1TYDE 3RIXA 2VZ9A 3BSYA 3TG8A 3MBIA 2JLCA 4PAQA 3UATA 5ALPA 2C99A 4YDRA 2O5EA 1K3FA 4BNZA 3EEFA 4NF2A 1HFWA 2AJ8A 2EZTA 2FG7C 3RFXA 3RVQA 3UH1A 3NKFA 1Y89A 3FPEA 2Y9PB 3PLNA 2XUQA 3QKIA 5LKRA 1M6YA 1NJ5A 3P4YA 1V48A 4MVJM 4ZT4A 2QTBA 3BB3A 3ZHBA 5HWSA 5J47A 3L0IB 1C5KA 3EXAA 5LWHA 3GY0A 4DCMA 4O02B 5LXTF 4WOJA 4YUWA 1ISFA 1TEXA 5ITZA 3LOPA 4A26A 821PA 1WAMA 3PL1A 1UOOA 1P5RA 1XF9A 4UCQA 1VCNA 1QC5A 1FTQA 5JZVA 4H7FA 2JFXA 4OUKX 3G02A 2JCBA 1GADO 1QFSA 1ITZA 2VJAA 4JOBA 5DLPA 4AMVA 1Y5RA 1IRXA 2AFRA 5CNIA 5JE8A 3LHDA 1TU3A 2J9ZB 3PR1A 3GZ4A 4MRPA 4JBHA 1WD7A 5FHQA 5BV8A 4GMGA 3WMWA 3Q7TA 3DBHB 2XVAA 4WACA 3BWYA 3QEBZ 4KDFA 2VYQA