4WY8A

Structural analysis of two fungal esterases from rhizomucor miehei explaining their substrate specificity
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
PTVKLKPYCQNIADAATIDSTQYPPEVVRKAEAASIIDDPKALEGLPDVYLEEKTINRKNGSKIELTITRPLDTENQVLPPIVFFHGGGWVVGSKLTHRRTVYELTVRARAAVIFVNYSLSPEVRFPTALEECLDAVVWVAKEENAKSINVDPTKLVVAGDSAGGNLSAVVCIRAKQLGLNIIKGQVLIYPVTDDNFETDSYKQFAENYYLTRKLMVWFFDHYIPDKKDRQSIFACPLKASIDDLRVLPRALVITAEADVLREEGEAYARKLIEAGNDVTAVRYLGIIHGIFNLATLSPTGSEILDHIVAWLQKTWKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate specificity of two esterases from the thermophilic Rhizomucor miehei
pubmed doi rcsb
source organism Rhizomucor miehei cau432
molecule tags Hydrolase
molecule keywords esterase
total genus 111
structure length 325
sequence length 325
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wy8A00
2QMQA 1ZOIA 2HA6A 4QDTA 4IH9A 4MYDA 1B41A 5HF9A 4NZZA 3O95A 3VISA 4AB1A 5AK3A 3D2BA 4MEAA 1H22A 3G02A 1A7UA 3ESDA 3V1NA 2QT9A 3G0IA 5I7UA 1CUJA 1HPLA 5CH5A 1E8DA 5ALUA 3MGAA 3FCXA 2X8BA 4GEGA 2RGUA 5DNUA 4UFNA 5F4ZA 3D5EA 5LZ8A 1W6RA 1LLFA 1YSCA 2OCKA 4EB0A 3G0DA 1YAHA 3QMVA 1U8EA 1TCAA 1H2XA 1ZI9A 3R3UA 4AO8A 1VKHA 4D9JA 3ESCA 3K9BA 3AZQA 5AP9A 4MQLA 5IVIA 5A2GA 3U1TA 2G5PA 4LYEA 3V1MA 4ZI5A 1VOTA 3E3AA 1Q0RA 2JIDA 4PV7A 1GPLA 2H9YA 1CUCA 4H77A 3BIWA 2CEKA 5EIAA 2QRUA 4DIUA 5ALIA 1CUGA 2FX5A 1NU6A 2JBWA 5DYTA 4MQMA 5IKXA 4RE6A 4KR0A 4F0JA 4UPDA 5IVDA 2XUQA 4I4CA 5KWIA 1IZ8A 5HF5A 4JYMA 2PSDA 5AIAA 4YX9A 5E2IA 3QPCA 4W1QA 2J3QA 4QWMA 4H7JA 3DQZA 3V9AA 2EDCA 5DYYA 2RIPA 3OC0A 2OCIA 1XZGA 3FLEA 4BVKA 4UBNA 2G5TA 4FFWA 3I6YA 1XZKA 3PFBA 2I3DA 5AKYA 3PI6A 1H2ZA 4UHEA 4X7BA 4DM7A 3LIPA 3BIXA 1A8SA 2YYSA 5AKIA 4KAFA 1ZICA 5JALA 2PU5A 1LZKA 2XUJA 4G9EA 2XQIA 3FVTA 2XE4A 3EF3A 4I3FA 1DQZA 1G42A 2O2IA 5AK4A 4UUQA 1K5PA 1E8MA 2ZVDA 2XMDA 4Y7DA 4GDMA 3WKEA 4X91A 5ESRA 2PSHA 3EQ7A 1EXWA 4Q1VA 2GBFA 1L7AA 4DTCA 5E4TA 5EFZA 1ORWA 1GKLA 5C8VA 5AICA 3MUOA 2XQFA 4UHDA 3A2LA 1CQWA 2OG1A 1CUSA 2C0PA 2O2GA 3KD2A 2BGRA 3GROA 1XQWA 1UK8A 4FKBA 5C7YA 1K8QA 4B0OA 5EHZA 5K3EA 2Z3WA 1W52X 4L9AA 1WM1A 2XUPA 5T4BA 1ACLA 3WKDA 1DWQA 5FPQA 5CT5A 2HIHA 4DNOA 2WHPB 5K3DA 3RLIA 4ZV9A 4CIAA 2YH2A 4Y2QA 3GELA 1DQYA 2B20A 4DMCA 4Y2VA 3I2HA 2XQJA 3FSGA 5JAUA 3NWOA 2PSJA 5KBYA 5AM5A 4UBIA 1RP1A 2RONA 5AM1A 4NVRA 2Y6VA 1AC5A 1Y7IA 5ALMA 1XROA 3WK9A 3LS2A 4AZ0A 2PU7A 1LGYA 2OPHA 1GQSA 1OCEA 1QTIA 3QH4A 2VSQA 4LHEA 1HQDA 4Y2PA 1BRTA 1UK7A 1TIBA 4Y2TA 5ALKA 4FDMA 2OCLA 2DQZA 2WTMA 3G9ZA 5DNVA 4UHHA 4J0IA 3F67A 1QIIA 3VJLA 5BWCA 1ZIXA 3C70A 1MPXA 4G4GA 2JEZA 2WU3A 5AJHA 1XQXA 3A2MA 4OYLA 3CCBA 4DNPA 2HRQA 5FPPA 2PM8A 3WWPA 1R3DA 2WLSA 3UMJA 4BVLA 1QLWA 4J0CA 1ZJ5A 5AI8A 3A2NA 3DL4A 1R88A 2GYUA 4BP9A 2J3DA 2FUKA 2DQYA 4OB7A 2WJ4A 5T4HA 4PF1A 1XFDA 1ZI6A 4I19A 1GQRA 5ALYA 2QR5A 3D3NA 5LZ9A 1J2EA 1TKRA 1Q84A 5IVKA 5HFAA 3WK6A 4C4ZA 2JGKA 2WIDA 2VT7A 1EVEA 1GPNA 3H1BA 2C5GA 2AJCA 3E1GA 4X71A 5JZBA 3DYVA 2XUOA 2RHWA 4BRZA 3NGMA 1GZ7A 5D3KA 1ZD5A 1QIKA 4X00A 1T2NA 1EI9A 5CBKA 1YS1X 4INZA 5AKEA 2WJ6A 4G1FA 1UK6A 4GWLA 1XZAA 4W1RA 4YASA 4B81A 3BL8A 2BUAA 2YXPX 2JEYA 1YAJA 3IIIA 4J3JA 5CT6A 4M0EA 4BCDA 4C87A 1WHSA 4QDUA 5I9IA 2EDAA 3O4IA 3FSGD 1YA8A 3Q0TA 4X93A 3WK4A 2EEPA 1JU4A 1N8SA 3L1HA 2O2HA 3I6ZA 3EQ9A 5JAPA 5JD4A 1W1IA 3WA7A 1ZGCA 3F98A 3OG9A 3C87A 4DNQA 2E3JA 5CH3A 2QM0A 4EHBA 1GGVA 2VJDA 1RYYA 1A8UA 2WHPA 2V98A 3BJRA 3G7NA 4YPVA 4X95A 5HZGA 5DNWA 4KE8A 1XZIA 4WY8A 3E0XA 3IBTA 2WUGA 2VA9A 3ANTA 1LPSA 1YB7A 4CI9A 2QJWA 2VTVA 4HXEB 4X90A 5JAOA 2XLCA 1PV1A 2BJHA 4C4YA 3AZPA 2WG0A 4OD0A 2ZYHA 4ROTA 1J07A 1FFEA 2WJ3A 2XUIA 5ALFA 4ZREA 4JUIA 5AKZA 4GW3A 3GFFA 7YASA 3BDVA 3I1IA 1VZ3A 5JADA 3M81A 3C6ZA 1QZ3A 3WL8A 5ALRA 3S8YA 1A88A 4J0HA 3O0DA 3F96A 5ALNA 2XUKA 2DHEA 1UWCA 4FLEA 5E4JA 3I2IA 1WB5A 1QONA 1CUYA 4ITVA 5DWDA 2JGLA 1THTA 4LXHA 1K6EA 5CTAA 3AIOA 3BE8A 1CIJA 3HEAA 3R0VA 4UBKA 2HU5A 5JD6A 5K3FB 1VE6A 1UOPA 4BCCA 4FFVA 4EBBA 1RWQA 1EH5A 4K6HA 4Y2JA 4B6GA 3N0TA 1MAHA 1W76A 3FLBA 4FLMA 5ALPA 3OPMA 2AJBA 4P93A 2DFPA 5FXMA 3C6XA 3DNMA 2I78A 4F5ZA 5JARA 2WUFA 1CUVA 1YB6A 3LIIA 1MAAA 3G8YA 4C4XA 5LZ4A 4G5XA 4DGQA 1BROA 2O7VA 4Y2UA 4CG3A 4X3CA 4BE9A 1U65A 2PUJA 1FSSA 2BFNA 4ARBA 4BBZA 1UKCA 4Y9SA 1F0NA 1CUZA 1R50A 5BWBA 1MN6A 1HLGA 2Y2VA 2C7BA 1LBTA 3WK5A 3H04A 4HTAA 5JZSA 2AJDA 2IIVA 5JYCA 5ALSA 4KYVA 3ZWQA 5A71A 3L1IA 1CRLA 4CG2A 1EDBA 2VATA 3KDAA 3WWEA 2XUDA 5ALDA 4HAIA 2GBCA 1QIHA 2WUEA 1SCIA 3AIKA 3T4UA 4WCVA 1BCRA 1JJBA 4Q05A 1KU6A 2HA5A 3C5WP 3MUNA 3GZJA 4OU5A 3I2JA 3RKSA 4J0KA 4F21A 3L1JA 4E46A 2ACEA 3JW8A 1E5TA 3EBLA 5K3AA 3G9XA 3VVLA 5AH0A 4ARAA 4P08A 4JYPA 4P9NA 2QKYA 5AO9A 2XMBA 2AJ8A 4L72A 2ZSHA 5T4EA 1UKBA 5AM0A 5JASA 1LNSA 4Y2SA 4OSEA 4EZIA 4Q3LA 2GYVA 4DMKA 3K6KA 2GZRA 1AQLA 1TAHA 4N8EA 3STVA 4BAUA 3DCNA 1P0PA 3STYA 5AI6A 4WY5A 3CN7A 2PPLA 3IUJA 3WLAA 3IUQA 4RNCA 3JWEA 2ONCA 2X76A 3I2FA 1QOZA 1LPAB 5EIEA 2UZ0A 2WM2A 1LPNA 3R3ZA 1G4HA 2H7CA 4AXBA 1BS9A 3D4LA 1OILA 1S8OA 5FDFA 2VAXA 4C89A 5E4YA 4IO0A 5FOQA 2QS9A 3H19A 3KOOA 2HL6A 4BZZA 2WFLB 1DX6A 3RM3A 3W06A 4M0FA 5ALVA 1EK1A 3HXKA 2R11A 2GZSA 4G8DA 1YR2A 4OU4A 5JATA 4U2BA 1ACJA 1W4LA 1XRNA 3FYUB 2BAGA 3FNBA 5CH8A 1AX9A 3WK7A 2LIPA 2V97A 1X2BA 2HFKA 1GKKA 1XZLA 3ZV7A 1OXMA 1E89A 2JGJA 3DOIA 3I6MA 3IVMA 4BTLA 1BE0A 1CUUA 5I8PA 4Y2RA 2VAVA 3A70A 5HFNA 5JAHA 1XLVA 1TK3A 3H2IA 5EHQA 5LLSA 1CV2A 1DU4A 3F9CA 2D0DA 1KU0A 2Y6UA 4K2AA 4CIBA 2OAEA 3D2AA 3BDIA 2PSFA 5H3HA 5ALZA 1CFJA 1QE3A 1QIJA 5K3BA 2OGSA 3B12A 3W9UA 3R3XA 1LZLA 1N1MA 1BN6A 1EVQA 4BC0A 5HK8A 4FNGA 3O9MA 4X92A 4AMYA 2Y1KA 3DKKA 1DINA 3C43A 1QO9A 2ZJ7A 1HDEA 4C6HA 4KACA 2XI4A 5ALOA 4A5SA 3QMMA 5HCUA 3QPDA 4H35A 3G0CA 4FNMA 2XMGA 1R9NA 1BEEA 2OLEA 4FWBA 2CJPA 5DJ5A 3C8DA 3G0BA 1DX4A 4U2FA 1MO2A 2WFZA 2J4FA 3HACA 4BYMA 2ZYSA 1F0PA 3QBJA 3WI7A 1VA4A 3FLAA 3IUNA 5AKKA 4K5QA 4UBOA 1UFOA 1XQYA 1IUNA 2ZYIA 2RI6A 3OOSA 4AN0A 3OURA 3U0VA 1MX9A 4WFKA 4DMHA 4J7AA 1PFQA 2H7YA 4X85A 2ECFA 1B6GA 1QTRA 4BZWA 5AKJA 4EY7A 5AIBA 5ALTA 1XRLA 3BF8A 4G4IA 1KEZA 4E11A 5LIPA 3ZLUA 3WL6A 3AINA 4DLNA 2HDWA 5CW2A 1LPOA 1Q83A 3PFCA 3ICWA 1XRQA 3V48A 3PF8A 3H2KA 3PUIA 2WIKA 1XZFA 3DEAA 3ZLVA 5AI9A 1EB8A 5AI5A 2B4KA 3STUA 1TCCA 1UXOA 2WFMA 1BCSA 3WWOA 1H2YA 1WHTA 4JNCA 4QNNA 4UHFA 2GBIA 1DT5A 4ZV7A 4BVJA 3GA7A 1QIGA 2XMCA 3QITA 2QXUA 5DTIA 3WWCA 4BCBA 3H18A 3VKFA 5HKBA 3DLTA 1VXRA 1CUAA 2WFLA 1DWPA 4CCYA 3DL7A 3FBWA 1SFRA 4BP8A 4X97A 5AOAA 5YASA 4EY4A 1YASA 3FAKA 1XZEA 6YASA 4P92A 1WCYA 1YA4A 1TQHA 4ZXFA 2OGZA 4M0MA 4H7KA 1JU3A 4FBMA 4BATA 4QE3A 4H18A 4U2CA 3W05A 5CT9A 1JKMA 1K63A 4E14A 4BRSA 2PVSA 3DOHA 2DR0A 4FOLA 2VT6A 1FFDA 5FUMA 1JT2A 5D7BA 4AO6A 4UFOA 2WHQA 1THGA 2CBGA 4XWGA 5AOBA 5ALLA 1UT6A 2XMQA 5ALWA 4PSUA 3Q8WA 3D59A 2XMSA 3F97A 2ACKA 1QGED 1LPMA 1WPXA 4IH4A 5C8XA 2FJPA 4HXGA 1FFCA 4N8DA 4TPKA 4C01A 3HC7A 4B7ZA 1EDDA 3EIOA 3QZUA 4OYYA 4WJLA 3K2IA 1NX9A 4FTWA 2HA0A 3FVRA 4X6YA 5AI4A 2W22A 4TGLA 5SYNA 4WDRA 4X6UA 1AURA 3WYDA 5AHXA 1XLWA 5DTJA 4FBLA 2Y2UA 5CXUA 1QIDA 3AIMA 4UHBA 2YASA 1CUHA 1FFBA 5CRIA 2VQ6A 4B84A 5D6OA 2OCGA 4Y2XA 1LPPA 1IMJA 4H7DA 2WG2A 3V1LA 5LYYA 5ALJA 3WWDA 1CUBA 2PSEA 3NUZA 5BV7A 3O4HA 1C4XA 1CR6A 1QIMA 4OCZA 3STWA 2Q0XA 3D0KA 4BE4A 4UBMA 2HA4A 1TRHA 4IHAA 3O4GA 3FWHA 1R9MA 3KWJA 3O4JA 3WIOA 3JYHA 3S2ZA 4J03A 5A7GA 3SK0A 4UHCA 2OGTA 2D5LA 2XMRA 1F6WA 4OPMA 3DJYA 2BUBA 2XQGA 1CLEA 1MJ5A 2WG1A 2VF2A 4O08A 4WFIA 3CCCA 1IZ7A 5AKLA 4PO3X 1N5RA 3QVMA 5JIBA 3FCYA 3G0GA 2K2QB 4BDSA 2RHTA 1Z68A 5HK9A 1L7QA 1EK2A 3M82A 1XQVA 3N2ZB 4PSCA 5DYWA 4HRXA 3TGLA 2GYWA 3D2CA 3ZI7A 4V2IA 3IDAA 4RGYA 2OXEA 4TVKA 1WB4A 1JJIA 3WZLA 3HRHA 4PW0A 3WKAA 4Y2YA 4IQ4A 2WTNA 3HYSA 3V1KA 4H7IA 2C5FA 4OUKX 4BB0A 5EGNA 5FLKA 4B80A 2Z5GA 3VDXA 4UFPA 2CZQA 3PE6A 3FYUA 1E3QA 2P8SA 2FJ0A 3R40A 1BEZA 1FJ2A 5D3ZA 3KWFA 1BN7A 3H2JA 1EX9A 1UZAA 3D7RA 3I2KA 2PUHA 4QLOA 4EUSA 1T4MA 4Q82A 3GBSA 4YK7A 4B9AA 4HS9A 3QMWA 5CURA 3QM1A 3YASA 4QDXA 3X3HA 1G66A 1ETHA 3KSRA 4G8BA 3W2TA 2DHCA 4B85A 3C8HA 5ISMA 1GT6A 4W63A 1YS2X 1ZD4A 3VXKA 3CN9A 4F60A 3M3DA 5K3FA 4KRXA 1L7RA 2IX9A 4OB8A 3NOXA 1JJFA 2HADA 2XMZA 4WFJA 3I28A 2GBGA 3HABA 1VE7A 4AO7A 2VJAA 3G9UA 3OTQA 3EQ8A 5ALEA 5LKRA 4GECA 4AMZA 3FYUC 2PX6A 3B3QA 3UUFA 2JGEA 4U2DA 1E66A 4LYDA 4BDTA 3HI4A 1USWA 5KWJA 1CUDA 3IULA 1ORVA 5JD5A 1ODTC 4CCWA 1XZMA 4KEAA 4EY8A 4FHZA 2ROQA 4B9EA 2XB6A 1ODCA 2BGNA 1JI3A 3HSSA 4LXGA 1I6WA 1NU8A 4L3WA 3ED1A 1TCBA 1U2EA 1MT3A 1EINA 5AKHA 5CXXA 4DSZA 2V9ZA 4XIIA 1XZDA 5AM4A 1VLQA 2B9VA 4BAGA 3GUUA 4MXDA 5A62A 3F8SA 3DS8A 2CUTA 1XRRA 1ZD2P 4GHWA 1P0IA 3WK8A 2C4HA 1XZCA 2CB9A 2XQKA 3VJMA 1VZ2A 4H7EA 3AUKA 1SCQA 4S0XA 2DSNA 5EHXA 2WIFA 4MJ3A 3IUMA 3DKRA 2B61A 1MNQA 5HQ3A 3SC2A 2WHRA 2XT0A 2VJCA 2C0QA 1VXOA 4LIPD 2H1IA 5HF6A 5LZ7A 1Y7HA 1A8QA 3RARA 2BUCA 4PSDA 5ALQA 4EA6A 2QUBA 1R4ZA 5EI5A 2WILA 3TEJA 5SYMA 2I03A 3H0CA 1U4NA 4XJVA 1DT3A 1DWOA 2WSLA 1AUOA 4AN1A 3T52A 2CKMA 5AK6A 5EHNA 4K6KA 5K5EA 3WIBA 4W9RA 5CMLA 4QEKA 1DTEA 2VJBA 3W9BA 5LKAA 4LKOA 2Z8XA 1ZIYA 1EA5A 4DSAA 1PJAA 3PICA 4IH1A 4QA9A 3ILSA 1WPRA 5ALXA 1XZBA 3H2GA 2QJRA 4KRYA 3BJMA 4A23A 5JZ9A 1O6FA 4QWWA 3LP5A 4MYSA 4X6XA 2O7RA 1XRMA 4HZGA 3WJ1A 4Z49A 4AQDA 1ZJ4A 4H7HA 2XLBA 3A6ZA 2HRRA 2AJLI 5AKGA 4K6GA 3WYNA 4HXFB 4KE7A 1E8NA 3AILA 5AOCA 2XUHA 5ALGA 3R3VA 1C7JA 4J0JA 4GLBA 4UBLA 1H23A 1XRPA 1CEXA 4MEBA 5FRDA 1LBSA 2HHAA 4G4JA 1VJ5A 5HKAA 4XVCA 2OQIA 5AI0A 1SC9A 4KJXA 4U2EA 5KREA 5CT4A 3IURA 1QIEA 1LPBB 1IUOA 1UOOA 4GBGA 4G9GA 4Q3KA 2BKLA 3OM8A 4ZRDA 4AX4A 2X5XA 3G9TA 5J3JA 4H7FA 4B82A 2WU4A 2AXEA 3AJAA 1GXSA 3R3WA 3H1AA 1X2EA 4BTVA 1CUIA 1HKHA 3QYJA 4PQEA 3WZMA 5LZ2A 3M83A 1N5MA 3WA6A 3E4DA 4E15A 3WQHA 4BAZA 1F8UA 3BWXA 3WJ2A 1XKLA 1W75A 2R8BA 2HA7A 4EY6A 1FFAA 4FLFA 1CVLA 2W6CX 3P2MA 4KAJA 1BU8A 1QFMA 2XUFA 1XZJA 3I1YA 1SOMA 2J4CA 2QUAA 2WIJA 4ZGBA 1MNAA 2BCEA 2QOEA 3KXPA 1WB6A 1JMKC 3FYTA 1JMYA 1Q0ZA 2ES4A 3WKBA 2V96A 1ZGBA 4B0PA 5AK5A 3AFIA 2JGMA 4AZ3A 4HRYA 1ZI8A 2HU7A 4CG1A 1XKTA 5HQ3B 2HU8A 1X70A 4U2GA 4HVTA 4UBJA 3QPAA 3STTA 1CUFA 4BC1A 2NW6A 4MWSA 2PKYX 1QFSA 2Z3ZA 1QIFA 3DDUA 3ZLTA 2IITA 1XLUA 5AKXA 1CPYA 1K4YA 3H17A 5K3CA 4QDZA 3ESAA 2HFJA 5BOVA 5A6VA 4MWTA 3H2HA 1AKNA 3DD5A 5AM2A 3SX4A 1MX1A 1H2WA 3ESBA 1MU0A 5IH7A 4JEIA 1YCDA 3I2GA 5CT8A 4ZWNA 3TRDA 1HL7A 4J0DA 2WUDA 4KAAA 4FMPA 1MX5A 4EY5A 3WMRA 1AGYA 2DCMA 2ZJFA 3HLKA 3DYIA 4X94A 3AZOA 2CMFA 1G5FA 3WL5A 2G63A 2PL5A 3C5VA 1VA5A 3IB3A 1R1DA 2QVBA 4GI1A 1Y37A 1SCKA 1AZWA 2HM7A 3FOBA 2QTBA 1GPKA 4RE5A 5A7HA 3IA2A 1CUWA 5EIHA 1ZD3A 3R41A 1M33A 3C6BA 3O9VA 2H7XA 5AM3A 5JANA 3CXUA 5ALHA 3B5EA 4NMWA 2XUAA 3LLCA 2QZPA 1UK9A 1AMNA 5A7FA 3C45A 2OQVA 5LP1A 4C88A 2RAUA 1XZHA 2G4LA 1P0MA 3BF7A 4DMFA 1P0QA 4ETWA 1CUEA 5T4FA 3VVMA 4GXNA 3SWWA 3ANSA 3LCRA 4QLAA 2HA2A 1J1IA 4QZVA 1CQZA 3WL7A 1HBJA 3HZOA 4N5HX 1ISPA 1IVYA 4WDQA 3R3YA 4QDOA 3STXA 3ICVA 2WKWA 1UKAA 1ODSA 4G8CA 2ZJ6A 2DHDA 2WIGA 1QJ4A 2OAGA 3W04A 4H0CA 4N8SA 1QO7A 2VEOA 3BXPA 3VJKA 4DYHA 4RPCA 3HJUA 2XUGA 3RK4A 1EDEA 4CFSA 2ORYA 4OB6A 1WOMA 3ZPXA 2PBLA 3C6YA 4DNFA 2I3ZA 1EHYA 4XX1A 2HA3A 2ZSIA 1EB9A 5FKJA 5LZ5A 2Z8ZA 5IVHA 4W1SA 4N5IX 2QXTA 1O6GA 3PDCA 4L0CA 5C8ZA 4PNZA 4KE6A 4CCYB 5C81A 1C7IA 3TJMA 4Q34A 1MTZA 5FP0A 5FV4A 1D07A 1J06A 3WKCA 3PF9A 2ZYRA 4JH0A 5DLPA 4KE9A 4J0GA 2JF0A 4W1PA 3UUEA 2XDWA 4A16A 2JGIA 3MVEA 2JGFA 4NS4A 1CUXA 1JFRA 1UOQA 2C58A 3PUHA 4B83A 2WQZA 4Q3OA 5HF8A 1IUPA 4LXIA
chains in the Genus database with same CATH superfamily
2W6OA 1OLXA 4XSHA 3K5IA 1HNNA 2QMQA 1BAPA 4OHBA 1KKMA 4CUKA 2ZSDA 2HA6A 2EQBA 2XH8A 4BWYA 3TSCA 5FORA 4IH9A 1TJNA 2DETA 3GDWA 3DUFA 5JS6A 3ZI0A 4NZZA 2ZAYA 3O95A 1A9TA 1X19A 2NTJA 4K6MA 1FBTA 4LA4A 4KN8A 3OKFA 3D2BA 1TT5A 3RYTC 2C4TA 2IHBA 3H5OA 3TIFA 3D8UA 4CUJA 2WTUA 3HU3A 3O8BA 4MV3A 4EAQA 2VOEA 4FYKA 2Y0CA 4BU1A 4DB4A 1IONA 2ID8A 2X2FA 1W34A 1X7WB 1ZHHA 2FWRA 3A6GA 3NXSA 5TB5A 1EUQA 3QEKA 1CY2A 4RVFA 1KZ4A 1PRYA 2PVPA 2CB0A 4IWYA 3G0IA 3UK2A 4RHTA 4GO1A 4YRAA 5KYYA 2UXCB 1YQGA 2X8JB 4IXMA 4QOSA 1E8DA 5ALUA 1KY5A 2XNSA 3MGAA 2H85A 1B0PA 2PTHA 1QF9A 2XW6A 4ZVSA 1RQ7A 3K1AA 4RA9A 2AFIE 2WMYA 4WUVA 1P73A 1U1EA 3CUVA 2B1JA 2FEXA 2RGUA 5DNUA 2I2AA 1C7EA 4KQHA 5I9BA 3VO8A 4YAUA 5JU6A 4DSNA 4LNAA 1LLFA 5KHAA 1MJNA 2ATIA 5LOVB 4IZOA 1NTRA 2ZI7A 3E15A 2CL0X 4YECA 4M9RA 3LPAA 3MTGA 2DWCA 1QGAA 3U0BA 4RA9B 3CEMA 1CZKA 5EZSA 3IYLW 4NDAA 4WKPA 5GMOA 1RAGA 4C21A 4YCLA 2IIBA 3PFNA 1SCUA 1Q77A 3BRSA 3HXMA 4M9UA 4QVIA 3R9XB 3GLIB 4KPFC 2JFQA 1YK0A 3MJDA 4PSAA 4XH9B 1PJ2A 1QK5A 1PE0A 2EW2A 2O8VA 2ZVJA 3HNRA 5H83A 2CD9A 2H9AA 3O31A 1ECGA 2VPTA 5AP9A 1U2GC 2IXAA 3RQSA 5IVIA 3VR1A 3SZGA 5EMNA 5KTKA 4LYEA 2XOXA 4DYDA 3KQVA 4I1OA 2QI9C 3D6VA 1P44A 1XMXA 1OBFO 4FFRA 2IUEA 1NUHA 4PU0A 4X1IA 1OZHA 2BGIA 2JIDA 2O50A 3JVUA 3NOVA 1NSFA 1TXGA 1KJIA 1MXFA 2AMFA 3VDRA 4HK4A 1T1SA 2R8RA 2VHEA 1ZBDA 1ZCFA 2QRUA 4GC5A 4N18A 1XWFA 4HEHA 1OWLA 3KKOA 4P4GA 4PZCA 1V4VA 4PX3A 2OCXA 4R2XA 4UVGA 5AR1A 4ZIRA 2XCRB 4ZVMA 2IDZA 2QTCA 3C8MA 3GG9A 5A04A 1C0LA 4MQMA 221PA 3AOGA 3EEOA 1Z6QA 3AKCA 3C7KA 3TOCA 3V2IA 4A03A 1FTGA 2JI4A 1DBIA 4KTTE 1NQVA 5HGXA 4EGCB 4M3NA 1V41E 4FU0A 3NHFA 2GPAA 4N4AA 1TNDA 2VP5A 1E0JA 4OL9A 2OHGA 4B73A 3FUWA 3EGXB 4JUDX 4NYIR 1ZM9A 3EQ2A 4F3YA 5IVDA 2AMVA 4I4CA 5F3WB 4MUYA 5GZ6A 1NZJA 5IZ4A 5FWYB 3TLXA 2GLXA 2FSIA 3DV0B 5HF5A 1T6XA 5LA6A 4LJ9A 3LKZA 3ISVA 3IXMA 3EXIB 1EWVA 1ULTA 5GPBA 2POQX 4B47A 1DADA 3U4HA 1CS0B 2R7KA 3OZDA 4MPPA 5E2IA 1I0LA 2J3QA 5J2UF 3DB2A 4H7JA 1R0XA 3HCBA 1J24A 4I1SA 3LPNA 4Z4GA 5IUKC 5ABPA 2CNOA 1OI7A 4ZCSA 1KRWA 1E1QD 1TM4E 2O8DA 5DYYA 2R7NA 4WNAA 3BSWA 4J1SA 2ZB8A 4WXYB 2RIPA 4UQPA 2GFIA 2OCIA 4JFAA 1VLHA 2H4ZA 3U3KA 1TQ8A 1TQ2A 2ZBEA 3EW7A 3NBMA 4GLFA 2G5TA 1SUIA 3ZYCA 4BVKA 3ETCA 3I6YA 1XZKA 4NAUA 3MZ0A 2R79A 4HI0E 1E7RA 1H2ZA 3GNTA 4BQFA 1OH5A 4PINA 4OX9Y 5LBIA 3LV8A 5K2MA 3N8IA 1VIVA 1GG8A 3MWYW 3MMPA 4OOEA 1MR3F 4B4VA 4DM7A 5HX7A 3B6IA 4J6EA 4KIGA 1PJQA 2QNBA 1RJWA 2QMEA 1JQDA 3VYWA 1KY3A 1L9KA 4IHJA 4RPJA 1O5TA 2DR3A 4KAFA 5G0TA 5I9TA 1NQ5A 2JCBA 5EJAA 4Z0TA 2GAFA 1PGQA 5FA5A 3C3JA 1PGJA 1VSQA 3ZLJA 1IC6A 3FFAA 1MP0A 1R8SA 3FVTA 2NTYC 3TG2A 2DQSA 2NU8B 1LC0A 1M5UA 4WUTA 3QUTA 3R20A 3EF3A 3PWKA 5IC6A 1PHPA 5G0SA 5HQJA 5EJ4A 1DQZA 1G42A 1OVGA 1ZVMA 2X23A 2OV6A 4ZC8A 4UOEA 4FXOA 4S1TA 3E9ZA 3JVIA 2FPIA 4MQ4A 3KR9A 1G60A 2DX7A 1RRFA 4E6EA 2OORA 4NE9A 1YUMA 3GOHA 4L16A 3NTXA 4X91A 2CY0A 4J7CA 1JQ5A 3GK3A 4RGBA 2H08A 1ESEA 1E2BA 2PSHA 2ZVPX 1QCCA 2R4TA 2Z8YA 3DPSA 3DVRX 3I3SR 3FPEA 4RUKA 3G13A 4PIVA 1E3EA 5DN6A 2W70A 3S3TA 1F1BA 2FMFA 1Y8RB 4QTZA 3UF0A 2W6IA 2WVHA 1M6EX 4K8RB 3T8YA 3U3RA 3ZDQA 1K68A 1HX7A 1T8RA 4P3XA 4DBVO 1V7ZA 3FRJA 5C52B 4B3IA 2YWRA 3D3KA 1K7XB 3GMSA 4QL3A 3ZCXA 5L4SA 5AXCA 1P4SA 3WNCA 4LVCA 3GFVA 3A2LA 2G08A 4KXQA 5B2EA 5H9WA 5LM3A 1EK0A 2REQB 3D8NA 2QF7A 1CUSA 1W0KA 1B00A 2AF3C 1UK8A 2P3OA 2Z3VA 5C7YA 1Y9AA 3EASA 4L5CA 4B0OA 2PZJA 3DBHA 1G2IA 2QG9A 2RHRA 2Z3WA 2QT0A 4B3BA 4F7WA 4RTQA 2P9QA 1YB2A 1NVWQ 1W47A 2XUPA 5BYKA 3GEGA 2XZDA 1G8PA 3Q4GA 1SA0B 3KPUA 3RE1A 1PUIA 1A8IA 1TUEA 3WKDA 5CT5A 4IDGA 1YO6A 4ITRC 5EJEA 1SKUA 1Z7GA 2BHNA 4A73A 2OCBA 4DMUB 3O4VA 4DNOA 3U17A 3M9XA 4KOAA 2WIAA 3LBYA 4MR9A 3PS9A 5F5XA 5L7YA 4B7AA 2QN9A 1YZVA 3UHAA 1WRBA 1SXGA 3GA5A 1A5ZA 5KYUA 4FFPA 5IM4F 1VTKA 2B20A 2FSFA 3HA2A 3WV5A 1FRQA 1FYWA 3AHDA 2VJOA 3CW9A 3I2HA 5KQRA 1V5WA 4FZRA 4TTAA 1UMDB 3BOSA 3HSYA 2FPPA 3NT5A 5K8JB 4HO1X 2GLTA 1A2QA 3A04A 4PLTA 2VK1A 4G5QA 1ZC3A 5FWXA 1I8TA 2HMSA 2YUIA 4UBIA 3VA7A 4HAWA 1GN8A 1RP1A 3UAYA 4HNHA 4NVRA 2Y6VA 3PEUA 1U2ZA 3BIOA 1G7RA 2G70A 4NNPA 1E3JA 4XWYA 5DHFA 3TX6A 3EMKA 5IDXA 2IYYA 3PC4A 4HBZA 5D01A 4I1PA 1Y8QA 2I1WA 5THKA 2JLRA 1GQYA 1K4MA 4GM1A 3PDUA 3VC2A 4KH0A 2CLHB 4KFSA 3KZCA 1QG4A 1C81A 3B60A 2LUOA 1G1MA 2XUZA 5DHQA 3ABQB 2PX4A 3ZXSA 3E9EA 3ZXYA 4GH5A 1IIBA 4JJ4A 1FNDA 3M2TA 1FUUA 1T2UA 5AJXA 5HA5A 1DAIA 2VYVA 1HQDA 2Z95A 3ESZA 4RDHA 2J9FA 4QRHA 1UK7A 3LLUA 4Y2PA 4YIKA 1O08A 2CMGA 3WLPA 1OW3B 4AJIA 1U28C 1P17A 4B7UA 2G72A 4CV3A 2OCYC 5AVUA 2RMKA 2CLEB 2WTMA 2NPOA 5ERYA 3A32A 3AUSA 4BNVA 1NFRA 5DNVA 5M3BA 3BZBA 2WWFA 5EZYF 5C37A 1JIIA 4EUNA 4JASB 1DJNA 4RTOA 4M76B 2HWXA 1WWKA 9LDBA 1IRXA 4I3HA 3TNLA 3WXBA 3WYCA 1YJAA 3NTLA 1P33A 1QIIA 1ZDMA 1ADYA 4I9HA 1ZP6A 5BWCA 5JNWA 2KBFA 1ZIXA 1XZNA 2F3TA 5C1PA 2DVMA 2R00A 2JEZA 3TOXA 2OY0A 2CLLB 3KHTA 4ZJZA 2YMQA 1YHNA 4L8GA 4BLOA 2FETA 1A9ZA 4DV6B 5KNBD 2I4RA 4Z9BA 3D4PA 3QPVA 2A9PA 1LSSA 4MW7A 4F4DA 2XZPA 5BR4A 3BHIA 4EB6A 3IEIA 2O6HA 3UWDA 4A8TA 2WLSA 1A4RA 1B73A 3MUFA 3UM9A 3UMJA 2A14A 2XZLA 2GYYA 3LQQA 4XOUA 3EVZA 5HNKA 4HEA1 4PRYA 2C00A 3GPLA 4ZU1X 5LB2A 1DAPA 3FXAA 3RVOA 2P41A 3TW8B 1R8JA 3HB7A 3GFGA 4F3RA 3RANA 2GYUA 5CVTA 3LXMA 4NCHA 3LT2A 2PLFA 1RZRA 2HJ9A 5MGBA 3WAJA 1FZTA 3OCVA 3Q1KA 4M1QA 2XOKA 3AFNA 2FZEA 1G7TA 1EGMB 5T4HA 2WUVA 2BFCA 1RBYA 4H1HA 2P6OA 4PF1A 4Y1RB 1TO1E 1T9GR 1ODJA 2AOTA 3P71T 4PG6A 1Q44A 4S3MA 1ZI6A 4RJIA 1GQRA 2PQ2A 4EP1A 3WQBA 2BGJA 3HKEA 1RPAA 3A9SA 1JZTA 4IVPA 3P9YA 2PBZA 2G80A 3R0XA 5JXHA 1GTG1 1W0KD 2W8BB 3A0RB 4OI1A 2ANCA 1G5IA 2HZBA 3M2PA 4TUYB 4G1CA 3SBXA 1I2ZA 1KOFA 4X5OA 4ND8A 4FPXA 3VHXA 2PCJA 1H5QA 4JB3A 3H4MA 2JGKA 2ZUDA 3MMNA 2Y76A 2VT7A 1EVEA 1GPNA 2OD7A 3EVBA 5JSZB 1NRIA 4ZYXA 3EF1A 1L5LA 2RGAA 3RKRA 2AJCA 5EOVA 5JZBA 3UMBA 1NUSA 5I4IA 2X0FA 1Z4JA 5AHWA 3AM4A 4MR7B 2UKDA 5EWLA 4BNTA 2H2WA 2G6BA 4PFQA 4RY9A 4X20A 1ZXXA 3I62A 1SZJG 1BWPA 2Z2JA 1QIKA 5BOSA 1L8QA 5HIIA 1Z0KA 4KQ1A 1CP3A 2NUPB 4DBLC 4YI3A 2IH5A 1AK2A 1CRPA 4YJ3A 1BHJA 1H2FA 1RCUA 5IAKA 1DBSA 4YRCA 5KYWB 2XKKA 2HEGA 3VHRA 4INZA 4E94A 4YHHB 1PR9A 3HY3A 3ILVA 1JH8A 4NF2A 4GWLA 5G02A 2NAPA 3K1JA 2WF5A 3TI7A 4YASA 3DPIA 2WA2A 2F3SA 1DDIA 2A5GA 2RHOA 3BL8A 4GICA 1KEPA 1KFBB 3G68A 3LP6A 3VUFA 3N7AA 2KB0A 1YAJA 1SIWA 3IIIA 4ETMA 3WRXA 4MGZR 1O57A 3FMIA 4LPKA 1THMA 1WHSA 4QDUA 1F9AA 2EDAA 2YV5A 4P98A 3FSGD 3ZGXA 3V32A 4O29A 2EARA 3ECSA 2R6FA 3UN1A 2QVXX 3MFQA 5CVEA 4G5RA 4BJHB 1EXNA 3M49A 4IJ5A 2IUSA 2ZXUA 2EEPA 2P79A 3OFNA 4JLPA 4NENB 5ADHA 1CS4C 1IBCA 4NCBA 2SCUA 3C6KA 1A0OA 1G20E 2O2HA 3LBAA 3W79A 2JJMA 1GPWB 2B9EA 3EQ9A 5B57C 1YGYA 4EPVA 4AY5A 5JAPA 1GPJA 3TMKA 1KI6B 1W1IA 3S7ZA 3WA7A 4N5MA 1Z6GA 3QP9A 5DLQC 4BGVA 4W5NA 4G23A 5FPKA 5M29A 2ECPA 2FSHA 4W7SA 2Z09A 3IAEA 1TYDE 1Y4AE 2QZZA 6LDHA 3T3EA 3VGJA 5KX5B 2WV9A 3B2QA 2BC9A 4QQKA 1ZW6A 2PNFA 4UUOA 4BE7B 2QM0A 2VJDA 4CF5A 4PBTA 1TZJA 2WHPA 3BJRA 4ZO8A 3G7NA 4RVGA 1K75A 4FNOA 2ATEA 1B23P 2B1QA 1KH2A 2HQBA 3DGEC 1KO5A 4WAUA 5KNBA 2VDVE 3NBYC 1XUOA 2R84A 3WLKX 1O7JA 2F9MA 4FCWA 3OCJA 1QGUA 1D7AA 1KWKA 3PEEA 2RAPA 1T36A 1WP4A 3CX3A 3H75A 1KO7A 3ABOB 4CE6A 1TQ6A 3LQ2A 5AUQA 2Z5LA 1ZMXA 3G2MA 1PFVA 3OETA 3DVQX 4Y0AA 2HNBA 2AQHA 1UBTS 4M1YA 5DMHA 1NPDA 5H1YA 3QUBA 4FGKA 2YN0A 2JCVA 1G21E 3L7LA 1XZIA 3PENA 2FR0A 3LCMA 4YCSA 3DLCA 5DI3A 1CDEA 1XCOA 3PQFA 1RWPA 1BYIA 2B0CA 2C0CA 2PGNA 2QRJA 2VA9A 4OF4A 1WPGA 3AHJA 5ERXA 4LTNA 5TQVA 1O97D 1XNHA 1YB7A 1UMCA 1P1FA 1H93A 1ULAA 1Y3HA 3AEKA 3OY2A 4ARVA 4CI9A 1AB5A 3JVEA 4I5FA 1CE8B 4WT7A 3W5HA 2EJBA 3IMGA 5HEKA 4PVCA 5AVSA 1E9VA 5K4HA 4GOMD 4LRYA 4LRWA 1L8AA 4ZQGA 1KYVA 2BJHA 4BL5A 4D0NA 4EYKA 1MX3A 2Q41A 3M3PA 2DMRA 4JJFA 4ZEVA 5DM70 3QOYA 4C76A 2P2CA 2FHSA 3WJAA 2JVJA 1PQYA 1RYDA 1I4TD 2WG0A 3L43A 4OD0A 2ZCJA 3EG5A 1M2NA 2A30A 1R18A 3EAGA 3KKLA 1IBRA 1FFEA 5LJLA 5CFPA 1TX4B 3AM1A 4Q6WA 4OP2A 3PIRA 2VZ8A 1DJPA 4FE3A 5KOIA 1E77A 4RFSB 2XTJA 1EXVA 1LXCA 4ZREA 4JUIA 1OMOA 3N5KA 3EYAA 3Q7EA 2IBTA 1KEEB 1DARA 3ANYB 3H9BA 1W5EA 4INJA 3CYFA 4AY3A 3GFRA 2HSGA 2DPXA 4ES6A 2ZI3A 3I1IA 4N03A 4CMKA 1DZIA 3ORHA 2CHVA 4RVCA 5EE1A 1GKIA 1X92A 2NG1A 3ME5A 2QRQA 4H3KB 4S0ZA 3KQLA 4TKUB 4J0HA 3F96A 3MLEA 1W36C 2CXOA 2XVXA 3SJZA 4RTMA 1UWCA 3R6GA 5E4FA 2P5UA 1TC1A 1KA9H 3DJFA 4FLEA 2AFIA 5KQGA 3N8HA 4PYKA 1P77A 1QONA 3FMVA 1OYOA 1GPH1 1ZMOA 4LJ8A 4Z7OB 2VH1A 2CNBA 1RXWA 2PH3A 4MS4B 1IZZA 3RVDA 3U37A 1JPNA 1LVGA 2G7ZA 4Z3KA 5JRDS 2AR7A 2WA1A 3ZGOA 2H4WA 3BCRA 3AIOA 3QFRA 2BGTA 2COEA 3KZ1E 3BE8A 4GLLA 1H4TA 4LJKA 3SHOA 3HEAA 3R0VA 3LC0A 3B78A 3OT4A 2PLAA 4YC7A 4FI3F 3ZY5A 4WN3A 1QRUA 1FJHA 1ZQ1A 2VNHA 4CL3A 3AVYA 1MAHA 1F2VA 2Q5JA 3TH5A 4HQOA 3KUXA 4K9DA 5JNSA 4BFVA 1RLIA 1AOXA 1O54A 1VLJA 2R6HA 2D0IA 1U8YA 3S6JA 3OPMA 1C3EA 4ZT2A 4QHYA 4BNJA 5JNRA 4P8RA 4DTIA 1A3CA 2NV0A 4IYRA 5B1IA 1YBFA 3BWYA 5JLAA 1Q1QA 3GJ3A 4P7BA 3SF0A 1UKVY 1ZR2A 1M5TA 1XTSA 4AJLA 4CTOA 3I0MA 1KYTA 4GPD1 2ID4A 2WUFA 4GBED 4JUAA 1CUVA 1QNFA 3L7NA 3O1IC 4XIFA 2BM8A 2Z83A 3G8YA 3HB5X 3SC4A 1GZ4A 1BZYA 5E3HA 3KYCA 3RSFA 5LZ4A 3FVWA 1LW6E 1XTZA 4AP5A 4J0FA 1XJWA 4JL6A 3LQ1A 4ZYUA 1XCMA 2QVYX 5JS7A 3LT4A 2IK8A 4KGVA 3E2IA 4Y2UA 1VMIA 4X3CA 4BE9A 5JH7F 3OIYA 2RJOA 4JY7A 5H80A 3ASVA 3OE7D 2WW8A 1IEXA 1PFUA 1RJFA 1SNYA 3GL9A 3CBQA 4BBZA 4D0LB 5B36A 4BJ1A 3AO0B 1QHEA 5KVAA 4OKIA 4Y9SA 1CUZA 2JCSA 5FUQA 1N2IA 4OAPA 1HLGA 1M7BA 4O2AF 1HDZA 2Y2VA 4HLUA 4PO8A 4ZHSA 5HOQA 4RF2A 4ZTUB 1VPEA 3HH8A 4E31A 2C7BA 1DWUA 4IHJF 4PHHA 1UBJS 4U2KA 4TZ6A 2A5YB 2V1XA 3AP2A 4UXJA 2HXGA 3TLKA 4BRWA 4RJKA 5C4MA 3RWMB 3D1LA 4D81A 5IT5A 3EWNA 4MIKA 5JYCA 4KQ6A 5ALSA 3EDCA 2H7VA 1QDLB 5IN4A 1XOIA 5A71A 5K51A 1XAGA 2WSYB 1LRKA 3HJRA 5ICGA 3RG2A 5TF0A 2BFEA 3SC3A 3AF2A 1TZBA 3GT7A 3SQLA 3OPNA 1NJSA 2AUMA 3IR5A 3M4YA 3SHFA 4OHYA 2B4QA 3PC8A 1QIHA 2QX9A 1CJCA 1X1QA 5JDCA 3N87A 2PR2A 3I9KA 3KZXA 1BCRA 5H68A 1X8LA 5ELLA 3ADPA 2NXNA 4OGFA 3RSZA 3PFKA 4BFUA 1RIIA 1R6AA 4R1NA 3CVWA 4XWAA 4MTLA 5J4KA 1QR2A 4JLUA 1DFGA 3HCWA 2F55A 5HCNA 2NV2B 4YUWA 1E1KA 2P9HA 2C2HA 3BKXA 5K7SA 2P91A 2J46A 2AC7A 1AY0A 4MW4A 4UZEA 1JRLA 3LL7A 4YMHA 2EZTA 2I6SA 1HZJA 4Q1BA 5DHUA 5DT2A 4AS1A 3JQBA 3VKGA 1B8NA 2BRUA 4CKEB 1E5TA 3OJ0A 1QPBA 3WLTA 3A1SA 5H9VA 1V3TA 3MCZA 2P5SA 2ODAA 4EARA 5KOHA 1TJ3A 1E1DA 5SICE 1O0BA 1YL5A 2PJUA 4XFKA 2AB0A 5FUBA 4I0WB 4P08A 2YMMA 2IU0A 1P18A 2M9MA 4P9NA 1NW9B 4XGNA 5TLSA 2X1HA 5AO9A 3T7AA 3FX2A 2A4MA 5SZJA 3IJPA 2J30A 1EWYA 4IHQA 2BF4A 3KU4A 2I6UA 4FN4A 3HI6A 3H5IA 4TTPA 1RADA 3I9JA 5LXTA 2J0UB 2UYQA 4LBZA 1PJCA 4MVXA 1JV2B 3OICA 4ZO9A 2OBXA 4DA0A 5AM0A 2FH5B 1LNSA 3PD7A 2NM0A 4Y2SA 2P30A 5FFFA 3TBKA 3DV2A 3LWBA 1V7CA 2NUTA 3MTQA 3UHPA 4HS4A 1IWPB 1A7JA 2N46A 1FLVA 2PKRA 2VDMB 3C3EA 3JAKB 1Q3TA 2GYVA 4J9VA 2VF4X 4ND4A 3SGLA 4DMKA 3R2JA 4RDCA 1IK4A 2I34A 1AQLA 3WQSB 2Q3FA 3MTIA 1XPOA 5JCOC 3ASYA 2PGLA 2E55A 2YQ4A 4X41A 2NTNA 4O4IB 5LMUB 4N41A 4YTEA 2ZBQA 2V3VA 3DCNA 4XVHA 5EYPA 3O7WA 4OX9B 2HJWA 4IDDA 3DE0X 4HGNA 3HDQA 4OQQA 3PI7A 2BSAA 1V2GA 3OKCA 1IJEA 3VR0A 1R0ZA 1SUFA 3L7CA 3PC3A 4H31A 5H3LA 3PQ8A 3MT7A 4UHJA 5DLDA 1OLSA 1T2EA 1QF7A 2OZPA 4RSRA 4CFZA 2Y0PA 4L2IA 1FDTA 4NMXB 2CYCA 2XWBF 1E3TA 4YDQA 2XZTA 5E6RA 2Y3IA 4DBLE 5EJ6A 2R6JA 4FOSA 2A5JA 2QE7A 3I2FA 4ZU3A 4EG1A 2C54A 5IJAA 1C30B 4YRGA 3OE7A 3E23A 3FCUB 4PPYA 1KR2A 1WB9A 4JJEA 2WM2A 3MJFA 1LPNA 3R3ZA 1N8TA 1L7EA 4FUTA 4MA5A 3E58A 3IEMA 2GZAA 3WYBA 4AXBA 2P6NA 2CV2A 5DYGA 3KAQA 1OILA 2BMAA 2ZETA 1L5WA 3GNQA 4AJOA 1Z0ZA 2MR6A 1J2YA 3TQOA 4MQEA 3FIJA 4M1KA 3U7JA 4LE1A 2G8NA 2HL6A 1CS0A 2R7LA 3KOOA 4J76A 4BKMA 1ISGA 4H08A 1EAMA 2WFLB 3EDMA 1VCMA 2C9MA 1DX6A 2LPMA 1BMTA 4OSOA 1SWVA 5E2BA 1HTWA 4M0FA 4NSNA 2BJWA 1FS5A 4JYBA 1NVGA 1QS0A 4J6FA 4O4JF 3PRYA 4Y2GA 1HEYA 4UNRA 4IWNA 1UPBA 3QVKA 1JPJA 3PE4A 4R8SA 4WADA 2Z9CA 3F7MA 3PFWO 1YS9A 4MLZA 4R3NA 4G8DA 4DV0B 1CDZA 2HN9A 2O7NA 1BS2A 2J31A 3N58A 4N0PA 3SP1A 2X6QA 3AXTA 3PRJA 5JATA 5EMJA 5T7BA 3JYOA 2NUTB 1UC8A 3PLRA 4OJQA 2BAGA 3BB4A 2OD2A 4XCVA 1U2GA 2JIPA 2CW5A 4CFYA 2AYZA 3GP8A 3UMFA 4HHEA 4JXZA 2H54A 1OXMA 3NHMA 3CKYA 3KL2A 2DUMA 2VWGA 3GJQA 1R6VA 4R7TA 2EW1A 2X41A 3I6MA 4F5DA 2V55B 4G0QA 3F73A 3D4OA 4JI6B 5BNTA 1A77A 2P9ZA 3IVMA 4JBLA 3O3NB 2QAGB 3P2OA 3KB6A 3TQIA 3R8XA 1ENYA 1IB0A 2YXEA 1BE0A 2YMLA 2M6RA 5DZSA 4FI3C 2IA5A 4Y2RA 4AUMA 4AZSA 1NXVA 1AO3A 1XLVA 1JSZA 1TK3A 2ZQYA 3FZQA 4KV9A 2HRDA 5LLSA 1OF1A 2CDCA 1N36B 3F9CA 4Y9DA 1V4NA 3RYHB 2XADA 3L7MA 4XYGA 3KWMA 4FYPA 4WK2B 2OKCA 1Z0JA 2FGJA 5KOYA 1SCDA 3PQ7A 3TLZA 2Y1FA 4J4BA 2C7VA 3HV2A 3BWEA 1M6WA 2P2YA 2ZIXA 2ZPTX 2H5JA 5E6SB 4YQEA 3SYRA 5CEEA 1VIMA 2B4YA 4QG3A 1KAQA 2OAEA 3D2AA 2AFVA 3N05A 1QFJA 2NNLD 1LDEA 2Q3MA 2R60A 2PYIA 3FR8A 3IV9A 1TOAA 1HOXA 4KPUA 5DLYA 5KB3A 4U7FA 5H3HA 3VH4A 4C7KA 1KKUA 1GPAA 3DCYA 1EX7A 3KLOA 5K3BA 5CLHA 4EG6A 3CNHA 5FAKA 3MWEB 1J09A 4C0XA 2GF2A 4TRRA 2VDQB 4OP1A 2Y1WA 4F9EA 5GZ1A 2A5FA 1F51E 4QUJA 5IXJA 4S12A 1VBKA 5AMXA 3U7QB 5CG1A 1BN6A 1O77A 4C30A 2MINA 5JO0A 1OPXA 2IYUA 2YZNA 3QBEA 5AHRA 1CRZA 4FS8A 4HDMB 3H5NA 2WAOA 1FU4A 2Q6TA 1W4ZA 1S9HA 3FPHA 3KPVA 4GKAA 4XX0B 2BHRA 3ZDAA 2NO7A 3GY0A 4BASA 4LC9A 1CR0A 1RQ2A 2LCQA 3V7NA 2WZQA 1QO9A 3H2ZA 4C0HA 4W8OA 1N6RA 2E48A 4Q6BA 5DWVA 3DCJA 1GD1O 1JXAA 2H59A 3W6PA 3THXB 2O8BB 5KKNB 1YK1A 3MPUA 4LXQA 5ALOA 2FSGA 3CHYA 5KQLA 3H3XA 1OFGA 1LBHA 4LTMA 1RRCA 2WD7A 2I6TA 3O8OB 4LYGA 3KT6A 3LBNA 4PR3A 4TSKA 4YONB 1TJYA 5DTQA 3D8SA 5K0TA 4OOFA 3QHQA 2HO4A 3QPDA 3G0CA 5J1TB 5TMEA 3Q40A 4G5SA 3HCNA 4B32A 3CW8X 5LA6F 1FMCA 1WETA 1PAUA 1S9DA 2GFHA 1XPJA 1DKPA 5IKEA 5H7XA 3HR7A 3C3XA 2GXUA 1UCFA 3DO6A 5DJ5A 3VTAA 5H4GA 1R27A 4CU2A 4X6LA 2PGJA 1C9NA 1ZK3A 4RPLA 3EVFA 4L5IA 3T5GA 3W4IA 2J59A 1MO2A 5EGSA 2GPTA 2WFZA 3RJ5A 3PIIA 1A9YA 1UODA 3KSZO 3B51X 4U7JA 4L4SA 2J3MA 5DN6D 4N49A 4L0MA 2BR5A 2LBPA 2H3HA 4LOLA 4WW0A 5B4TA 5F7OA 3PYMA 1G55A 1T5DX 2WSIA 3NUQA 1EJBA 1ZH6A 4B4KA 5FBLB 4DFDA 3BHNA 3HJTA 1EBFA 5JXWA 5I8PA 5AKKA 4RIGA 4UBOA 2WVGA 1XQYA 5LL6P 2GCNA 4XAQA 3F4KA 4XX0A 4DR2B 1DKQA 2MSKA 1G5RA 3OOSA 4QBHA 3CX7A 4AN0A 4CODB 1D0IA 3OURA 4Z51A 3U0VA 5B12A 3OWHA 3W5CA 2QW0X 1S8AA 3U40A 4EELA 5A03A 4UM9B 2CJWA 3B8HA 4PX5A 5EG5A 2FXIA 4WFKA 3SHQA 4OJYA 3SKVA 2JFOA 1MORA 2JAUA 4QGAA 2EFCB 3IO5A 2ZJYA 4CMCA 1E2DA 1PFQA 2H7YA 2FUG6 2QLBA 1X7HA 1ABFA 2C07A 1HDIA 2C98A 4GI7A 4OREX 1B6GA 2YMPA 1ENPA 2GPJA 2V45A 2X5OA 4M0CA 4BZWA 4CR8A 4TKUA 2V74B 4M38A 3U9TA 1Q0LA 2OB1A 5DLEA 3HU2A 3ND8A 3R23A 1KTVA 1DBPA 1P4JA 2GCOA 3H5AA 1N2CB 3BTUA 5JMTA 4MKXA 2HQRA 4QUHA 5EPOA 1JFSA 3BUSA 4ND1A 3EA4A 4QUIA 5KI6A 3SG0A 1IRIA 1M8JA 5DW3A 4CNBA 3CF6R 3CWQA 4IIDA 1BX1A 4IY1A 2H31A 4NYJQ 2VXBA 5D1NA 1TLFA 4UU0A 4DLNA 1E7YA 4E08A 5I7RA 4WLOA 5DTEA 3DOEA 1U0HC 1N6OA 1Q83A 3JZMA 4Q66C 2VJKA 1FYFA 1H3FA 1VYTA 1OUMA 4IJQA 4BBJA 4Z53A 5KCZA 2A6PA 1C8VB 3KUCA 4WV3A 3OIDA 5I45A 2WIKA 3DEAA 1XL0A 3O2JA 1NGSA 4OFZA 2ZDHA 2I65A 2J0EA 4XTCS 5AI5A 5A1JA 2F8TA 5BY2A 1DTSA 4AM8A 1VHTA 3HCEA 1ZL2A 1H1TA 1TTPB 3TAXA 2C5SA 1JLSA 2FF5A 4LMAA 2FXVA 1BEUB 2M6SA 4MI6A 4Q93A 4AKTA 4J4HA 4Z7QB 1N5KA 4XQ0A 1Q7EA 1BCSA 3A3PA 2BFFA 5JQGF 4LECA 3O3MB 4KXWA 1XDDA 5EP3A 3W6OA 1JL3A 4JNCA 3OOHA 4IF6A 4QJIA 3THRA 1KI2A 1E2KA 2GBIA 4UHFA 1DT5A 3CX8A 1FXWF 4DKXA 4ZV7A 5E38A 4TT8A 1KFCB 2YRWA 3WYGA 3LU1A 2O8NA 4IFIA 1GYPA 2AG1A 3GJ8A 3QITA 4N3AA 3JARB 1CVIA 3DFZA 1X77A 5HS6A 3WLQA 3IAM1 4F5YA 1NKTA 2E5WA 2WU8A 3TO5A 4ZI7B 5IYZB 1CVRA 2NO5A 1G8YA 3T5CA 2PKQO 4FWIB 1YOVB 1HDGO 3LXUX 5LP6B 3P52A 4HDNB 1UKYA 4KRGA 3PUWA 3THOA 4D9HA 1OROA 3FI9A 4AX8A 1SFRA 1YXMA 2QM7A 3KNZA 4J91A 4V03A 5CM2Z 3WB2A 3DW3X 4G09A 3LF1A 1EHIA 1E3LA 5KVCA 1PJTA 2ABWA 4UPVA 3R3YA 1JUDA 1YASA 4KIUA 1XZEA 2C92A 3UFBA 1RTTA 2J6HA 1G98A 1K6XA 2HB6A 3EBOA 2R6ZA 1YA4A 3OA2A 4YXWD 4ZXFA 2FPLA 1UBOS 1BWSA 3RIEA 5LU9A 5IXYA 3ASZA 4M0MA 4H7KA 3X2EA 4ACBA 3RRNA 3VKVA 1YFKA 1K66A 3D64A 4QTYA 2BFMA 4YI5A 4DCVA 3HJHA 2IV7A 1GTZA 4TXHA 4BATA 2H4FA 1PK9A 4QE3A 4H18A 5CB4A 1N33B 2GASA 1J0CA 1RAAA 3QVGB 3W05A 1JKMA 4XGIA 4BRSA 2Y0BA 4IOMA 1W0CA 2XOKD 5FADA 1SCNE 3DOHA 4CKWA 4OM8A 3L01A 3T3GA 1GKUB 2DR0A 4UVHA 3TMAA 2PMBA 3DV9A 3HJCA 2BP7B 4FOLA 2ZWAA 4R2JA 5DBGA 3K16A 3CONA 4EGFA 4CXMA 2ETVA 3H99A 1DGQA 4CT5A 3RV3A 2VT6A 2WP8J 1P9LA 3OD1A 1FFDA 1B2LA 2CK3D 2IOYA 3R0JA 3L6BA 4D3ZA 3KQHA 1IB6A 1POXA 1EUCB 1F1JA 1FNMA 2AZMA 1U04A 2QN6A 4BMOB 1TQDA 1XU9A 2ZB7A 1Y6GA 1VMAA 4HN4B 1OLUA 2Q8QA 2V8BA 4DCCA 1DXQA 1Z5OA 1THGA 1YZNA 1BE8A 2DU8A 2HLNA 4A6XA 4KZKA 4CIWA 3MWDB 3BWCA 4WD3A 2XMQA 1OZGA 5ALWA 2OYCA 3Q8WA 3I04A 3LG2A 3M5DA 1LTHR 1Y42X 3U7RA 1YHZA 2RARA 5FBVB 3BTOA 2J9FB 3EH1A 1BXZA 5H5JA 5EUBA 3C3MA 1MW9X 1ZA1A 3NGXA 3AY6A 1CYDA 2ZJ2A 1VLMA 2D62A 2DZDA 2YX1A 3JVDA 3FRIA 4KQFA 2L19A 5E7JA 2QM8A 3V8MA 4JGGA 4BVFA 4CW7A 3U6BA 5C8XA 2J0UA 3OLCX 2FJPA 4B75A 4E32A 3K8OE 4B3GA 1LFDB 2FG6C 4LVUA 1FFCA 1LD3A 1X1AA 4R3UC 5LP6C 3E1SA 3HC7A 5DBIA 4C01A 1EDDA 1JTVA 3EIOA 3QZUA 4OYYA 3T0FA 5DPMA 2NPFA 3ZU4A 3ZZ0A 2HK6A 3F3KA 3CGGA 4FJ2A 3IRUA 4FTWA 2JAOA 4WGGA 4H9GA 1RP7A 1SWWA 1Z5UA 2H0RA 2M1XA 5IJ0B 2ATCA 1PG2A 2WHXA 2E5FA 3IHKA 5ANRB 5I9LA 4X6YA 2DJIA 3PQEA 1ZNXA 1X7DA 4NBTA 2NNWB 3PFIA 4PHFA 5DOZA 2OQ2A 1QE5A 5IANA 4X6UA 5AW2A 5JI3E 2CXXA 1Y81A 4X1YA 2IYVA 2PUDA 2BMEA 1ZUWA 3WYDA 4F4JA 4ROSA 4FBLA 2QX7A 3W2FA 3H0KA 2Y2UA 3QX3A 2ZIGA 3ESXA 4REOA 4Q7LA 3BYZA 1DIAA 3GZ4A 4Q3AA 4ZOAA 4IUBS 1DHTA 2ZZNA 3AIMA 2BM0A 3C98A 3GZNB 4UHBA 2XTNA 4OO3A 1JQEA 2WWGA 1E1QA 1FFBA 3SSAA 4HCJA 3SX0A 2V5AA 4FEYA 1JEYA 5KEIA 2VQ6A 2C5HA 3V4VB 3TW8A 2EXXA 2OC4A 3IPAA 4FYJA 8ABPA 4LEIA 3W6ZA 2O8FA 5KZMB 2I2XB 3OJLA 2QG4A 1D1QA 4NJMB 4XGRA 2OCGA 4Y2XA 5F7XA 2A58A 2QTVA 1YMVA 3DDWA 1RZRD 1E1CB 2I7XA 1M2WA 4GWGA 3NMUF 3M33A 1P2TA 2WG2A 5BN3A 4IFTA 4QPDA 3ZGYA 1XD9A 1C8BA 1RBMA 3RC3A 5DX1A 3NORA 1GZ6A 4KDFA 2AH5A 3WWDA 4E30A 5JECA 3URMA 4E4YA 1FCJA 2E87A 2AF4C 1FSGA 3NHRA 4UTVA 1PU2A 3SVTA 5LQUA 1XL1A 1L1FA 3R7BA 1UOEA 3UJ8A 5EVCA 3WGYA 4D79A 2WEKA 2QT1A 4DRXA 3KQMA 1SVNA 1W30A 5CDYA 4OCZA 4U7HA 1DO0A 2LKCA 1GGHA 2Q0XA 4BE4A 1Z13A 2VAMA 1U31A 2DWQA 3DV0A 4ND6A 4Q9HA 1LCIA 4RPHA 3F6YA 2RGNC 3O4GA 3PDIA 1JSCA 2JHGA 1AE1A 3SD7A 3C3KA 3VKWA 4GGMX 1S3IA 3WFIA 2EHDA 2WT9A 1PZMA 1OLXB 3PNYA 4YXWA 3WIVA 4NE2A 2XNJA 3C39A 2E5LB 4Z4EA 2GZ1A 3SI7A 3RIGA 2YR0A 3KPWA 2Q07A 2C7PA 2G3YA 2GRUA 5FL7D 3NCTA 5WRFA 3JYHA 2BTEA 1P9NA 2EKPA 3A28A 3QEMA 2ONZA 2JG3A 1PKXA 3LHKA 2IOQA 3K2EA 1EBBA 4D6PA 5LP6F 3E5MA 1OWMA 2UZ4A 2PEYA 1W6UA 4FIZA 1DRKA 3GWZA 3CR3C 4BIIA 3BH7A 3IA7A 4YRBA 1SD1A 1NVBA 3CH7A 1CZNA 3DH0A 4M37A 5I8ZA 2YV3A 4YJGB 3RREA 2VHUA 2OGTA 4G26A 4EG0A 4FOOA 1KYXA 4R1SA 4QXAA 3I6IA 4C06A 3OCXA 1L4YA 5B53A 3SHTA 4NBWA 4OPMA 5I51A 1M2KA 3HYTA 4Z4QA 2PRKA 3DJYA 3K0SA 3C7AA 1TTHA 4F71A 3A4VA 5ICSA 3B1KA 1TKBA 1VG1A 3T7CA 3K6SA 2JAQA 4DCMA 1N5DA 1MJGM 1N7IA 4XARA 1SXJB 2RJNA 5J2TA 1QG2A 3K4QA 4RXUA 1HT3A 3ZNQA 1G16A 1JT9A 5CX4A 1U3VA 3G2LA 3ETNA 5J4VA 1EVZA 2ZE5A 4YJHB 3K0FA 1GVHA 4YRPA 2I6QA 1SXJC 5TARA 2EX1A 3NC0C 2WJPA 3B20A 1A9QA 4DWOA 4ESOA 2HT6A 2QTMA 3RC7A 3VDMA 2E85A 2G17A 4PCUA 1HH4A 5CDSA 4LNUA 1UF9A 3N53A 2F9FA 1BHQ1 4Y30A 3TGLA 3GP5A 4XFJA 3FTPA 1YDFA 1T6NA 3MMXA 4PGGA 1AUXA 1XKQA 1TA9A 2FUNB 2DLDA 2W6JA 3DFFA 1J0BA 3O75A 3OZRA 4V2IA 3F4BA 3JAWB 4MYHA 4WZ6A 2JIRA 4BFLA 3A4MA 3SE7A 4E7OA 4PBRA 4MUXA 5G41A 2OXEA 3PGKA 3KSDO 4JR1A 2BWJA 2WTXA 4XCXA 4YB8A 5TY0A 1XYVA 4JI5B 1WB4A 3T5DA 2LWIA 1VDMA 2GJKA 4XD7D 2NZYA 4BGIA 4PW0A 3HXPA 5IFKA 4FIDA 2OMKA 2C95A 2Z1NA 2OHJA 1UEXC 2AKAB 3EY9A 2C99A 3AU8A 3N2KA 2IUYA 4H7IA 1M2HA 3L7JA 4K87A 4HDSB 3V1KA 2P62A 3E48A 4OUKX 4NZNA 3HP1A 3HMKA 5E6UA 5B2ZA 2V0CA 3SM3A 4CM3A 2CHQA 3G85A 3RU3A 4PNEA 2W0SA 3MUEA 2G07A 2Y9MB 1JKJA 3QENA 1NQWA 3HTXA 1NW3A 1X7ZB 2PRJA 1DUIA 3PL5A 2J6IA 2B30A 3DEIA 4PGAA 2CNLA 3FNIA 4R1MA 3WNVA 5E0KB 1YS7A 1SULA 3NX4A 4AF8A 2FJ0A 3A1NA 4F2DA 3G5AA 3R40A 4EG5A 5KTTA 5CR9A 3ACBA 3RSHA 3E3OA 1SHZA 1P7CA 1XR3A 2IYTA 3LZCA 3R0ZA 4PBSA 5HIKA 1FJ2A 1VRVA 3QVSA 5D3ZA 2AGVA 1KBOA 3KWFA 4N76A 1Q14A 2ORVA 3G2HA 1BN7A 2AQIA 3H42B 3ZY6A 2YVAA 3COSA 4I55B 3I2KA 2QTZA 2CLIB 2YJ6A 1VIYA 4AKIA 3JQ6A 4QLOA 2BY4A 2P11A 1CXZA 4EUSA 3UPTA 1SBHA 3LDHA 1T4MA 4Q82A 2APJA 3IKLA 4ZCLA 5HGJA 2CJYA 4GLJA 4A0FA 3A36A 4H6PA 4B9AA 4ZDJA 4EIWA 1LSOA 3TKLA 3WR5A 4N7RA 4Y7CA 5DF1A 2XA2A 4XPZA 3YASA 1Q19A 4FNAA 3ZWXA 4DMLA 1RABA 5IW8A 5KTNA 4OXNA 1NJGA 1MOPA 2QL6A 3ZNPA 1UJMA 2Z2KA 3SICE 3ZJ5A 5KNLA 2M98A 2NPIA 1QPGA 3RF7A 4B4DA 1K2WA 4WZBE 1K4KA 3C8HA 3F78A 4JQOA 4JVOA 4B85A 5E7IA 5ISMA 1FDRA 3ZJVA 3WAGA 3EVNA 3OI7A 1GT6A 1QDUA 3FIUA 2HCJB 3MWLA 1ZGJA 4NYJR 1DRUA 1OYWA 1W5AA 1YS2X 1ZD4A 5IEJA 3AI2A 3HRIA 2WLTA 2ZRKA 3M3DA 4MO2A 4MZXA 4F60A 5BN4A 2ZSFA 5K3FA 1IDN1 3L02A 1GXSB 3PC8C 3ROEA 4Y2HA 4CNQA 3QYAA 1PT7A 2P69A 2CJWB 3RI3A 2VSNA 3V9PA 3KR0A 5C7LO 1OX5A 5K01A 4OB8A 3RJMA 5B4VA 4D4KA 2X19A 5J2TF 3VR3D 1MDFA 4F9TA 3AH8A 4LYJA 1W4BA 4EGSA 4W7IA 2HADA 1NW4A 4WFJA 3P0HA 1GM5A 4FHGA 3HABA 3KVRA 1KYYA 1VECA 1G3IA 2I2WA 3KHSA 5JY1A 1YVUA 1SBQA 3AV0B 4WASA 4AO7A 5DX8A 3SDSA 5E6RB 3DUFB 4TQ9A 3G9UA 1E4EA 2LDXA 3OQ6A 4GKVA 4GM4A 4OHRA 2JDID 2WF8A 3EQ8A 4GUAA 5JZMA 3G49A 1ML3A 3TQSA 2FZKA 4CV1A 1N0HA 5LKRA 3WB0A 2FWBA 2OO7A 2TMKA 5U4QA 1W36D 1W93A 1QM5A 1LH0A 3FYUC 1T5HX 1H4QA 2DEUA 1L5FA 2YV4A 4LN1A 3SQOA 2VP4A 1V9SA 1R0KA 3ANNA 3B3QA 3FI0A 1KK0A 3ZWKA 1G0OA 1UWLA 3N2EA 3K9FC 2FLKA 2FOIA 1XU7A 3ZCQA 5KWJA 1Q7CA 1CUDA 2GD2A 2PUGA 4RIHA 3GYGA 1JW9B 5JD5A 3AC0A 2CNWD 1M2OA 4MYRA 2F59A 4CCWA 2I33A 2W2OA 4UOZA 5DGIA 1XVUA 1FU8A 2AA3A 1CQIA 2XB6A 1ODCA 3OHSX 2B5VA 3HKCA 1PNTA 4QHTA 1RYFA 4Q39A 4KOEC 2QX6A 2JZCA 1VFNA 2ZDQA 1U2EA 1UDXA 1CT9A 1EINA 4L7VA 2IV3A 3FCEA 2EYQA 5AKHA 4LI3X 4MMZB 2PV7A 4AP6A 3U5TA 4MINA 5DK4A 4MUAA 1R6TA 1KVSA 1YI0A 5IULC 2NSHA 4PG5A 4ARCA 3L9WA 1J7JA 1W8IA 3VGPA 1ZCAA 4NDNE 3TRFA 4UMEA 1YKSA 1U2SA 2C2BA 3DQPA 1HDXA 3CPSA 4JLDA 3M6XA 2GSDA 1T0UA 3ZZNA 5KKAA 3S40A 2OENG 2EGUA 3FTFA 1JPUA 1VLQA 2B9VA 2BTQB 5JV5A 4BGEA 1GZ3A 2AD5A 2HD4A 2VHJA 3Q7RA 5DNCA 3RTDA 1HXHA 3TD2A 1MIOB 1L5VA 4ZZ1A 3AW8A 3DS8A 4ERNA 1B1AA 2P7HA 2CUTA 4GPBA 3FW1A 1NQUA 2RDMA 3CIFA 3O2NA 4V24A 4P4SA 3T0IA 2BTQA 2JJYA 1D0SA 1UAYA 2XQKA 3Q12A 3VJMA 2C9DA 2KJQA 3L0BA 4I8DA 5BT8A 1Z8HA 2Z30A 4DY6A 3BIJA 3UJ6A 4KR9A 4D9FA 1USKA 2Z6VA 4INPA 5C46F 4GG1A 1WAMA 4L1KA 1NFQA 1W4RA 4TWRA 1FRFS 4WHMA 2JFBA 2LCFA 3RLFA 4DJTA 2O0LA 1SXHA 4PQGA 1ZH0A 4K86A 1CG6A 1VHLA 2HLPA 3G82C 4R40A 2RJ3A 4PLHA 3VU8A 1V1MA 3EDYA 1W5TA 1J9GA 2O2YA 3QK7A 3F0TA 4G2NA 4IJWA 2NXWA 3UJHA 3GI1A 3V3TA 3EVCA 2GF9A 3E8MA 3FYHA 3IAUA 1UXKA 4OQNA 4C0LA 4BQEA 3PTAA 2X8AA 2XT0A 1WVGA 5EQTA 4HYEA 1TIPA 2C0QA 3AEUB 5E3JA 3ZQ6A 1DCMA 1L6RA 4QPNA 4WEQA 3QVWA 4B4WA 2C3UA 4EQ6A 3DR3A 3ASUA 4C5AA 2A0KA 2DLNA 3BE4A 2UVDA 1GNSA 2GAIA 4FHCA 4RANA 5K0CA 4DA4A 2Q5HA 4Q1EA 4NS1A 4P31A 1A8QA 3RYIB 2H16A 2GA9A 2CXRA 5ALQA 4ZCIA 4CJXA 4ZA2A 3P9KA 1J22A 5FHQA 5KU7A 3EAFA 3X1JA 2WD8A 3WADA 2RH5A 2WILA 2YOFA 2BFBB 4OMUA 5EP2A 5C3UA 1TD9A 2I03A 9LDTA 1U4NA 4CKCB 2DKNA 1XU4A 4KQEA 1DT3A 3EEBA 4D4HA 4A8HA 3V8RA 1ZGAA 3I8XA 4G36A 1AS2A 3FSRA 3TD9A 1FQKA 3AP1A 2RGGA 4A8PA 7REQA 4JA0A 5TIIA 4LUCA 1NSYA 5AW6A 4NYMR 5K5EA 1C7RA 3VNBA 4U7PB 1GWNA 4WXPA 5BYAA 4GZ5A 1ULHA 2P40A 5HKLA 3U39A 1HF3A 4W9RA 3C8UA 3QNWA 4EJ0A 3DXYA 3ETJA 2BH9A 2WD7B 1BH6A 2NU8A 4HH3C 1V1JA 2J0VA 3ISJA 4PS1A 3CJRA 4MEJA 1T43A 3LBHA 4R3WA 4U3JB 3RC1A 5IJZA 4YRFA 3U61B 1N32B 2OHIA 2GKGA 4HAXA 5BWMA 1ZZEA 3RASA 1G38A 4GL4A 3RSSA 2V03A 2WR8A 3V2GA 1EA5A 5KTSA 3MIIA 4YNBA 4PTLA 3D3WB 2QBYB 5J2UB 3X43A 1TKAA 4D8XA 4L2IB 4LYFA 3DBLB 4Q1CA 4BNDB 4Q7JB 3H2GA 2QJRA 3T7DA 3T5MA 4KRYA 4XR4A 1JXOA 1NDHA 1EJ6A 3DWFA 4ZQIA 2DECA 5KX5F 2SNIE 3AEQA 3BJMA 1CERA 1LI7A 1O6FA 3KK0A 2C78A 5EUCA 4QWWA 5CDUA 3TTYA 5IUJC 2JH9A 3CURA 4IFEA 4J1QA 3DE5X 1CEEA 2P8JA 2AZTA 4X6XA 1RRPA 4KQIA 1YQXA 1J0AA 4GP7A 1GZHB 4JFRA 3KKQA 4Z49A 2HSJA 1MB4A 4ZT4A 4QM7A 3FUUA 5EUMA 4V3CA 2OAQ1 3HK2A 2HRRA 4NBSA 3JQRA 4P7FA 2AJLI 2JD2A 1UWKA 2IZOA 3LVRE 1R64A 5EA2A 5F5LA 3S44A 4AYXA 1EUDA 4K6GA 4N5DA 2P2ZA 1M1NA 2CWWA 1XQ6A 5H59A 5IP5A 2VJNA 3UOGA 2NXCA 4KE7A 3ZV5A 2Z98A 4IYJA 1KAGA 5L6LB 1E5LA 2HU2A 4IDAA 4Q01A 2XVYA 5BPHA 4LFBB 4MP6A 1G8GA 2OAP1 1WHTB 2ZRPA 2C31A 1KNXA 2FSVA 4MVJG 3JALB 3IIKA 4NG4A 4AS3A 2BFFB 1G6HA 4RPIA 4OJTA 1Y34E 1E9CA 3AHIA 3IIMA 1BIFA 2PAAA 1QV9A 4Q3BA 1OJLA 2F67A 5CGQB 5JYBA 4BQQA 4EPTA 1JLKA 3HCCA 3O0TA 3TE7A 2P6UA 5CA1A 1W88B 4GLBA 1QAMA 1OAOC 1I3MA 1FP6A 1HG0A 2XF8A 2WRZA 1R16A 3JALA 3NWBA 4BLRA 3GT4A 2FPOA 1MVOA 1QPZA 2CYAA 2ETXA 4UQLA 5FRDA 2HHAA 5HDQA 3HXQA 4R5HA 1SQ0A 5KYGA 4RVSA 4UATA 1DQPA 1CDOA 3TUIC 4HPWA 3IILA 2H06A 2OQIA 5B3JA 2JFGA 1RKBA 4D8WA 2IDJA 5BQFA 4KJXA 2AYYA 2Z08A 4RXMA 2X0IA 3VHLB 4NESA 4YRMA 3ESRA 2RI1A 3EA0A 4XWWA 4CTMA 1LPBB 1Q2UA 1SC1A 3UJ9A 1IUOA 1M6VA 5CVUA 3G7UA 1SJ9A 4LJAA 5GONF 2B36A 4QOJA 4WL0A 4UHKA 2PS1A 3UICA 2ZXEA 3O92A 4Q4DA 3WAKA 4G9GA 3H3FA 3D8RA 4JX9A 1QLJA 2DR2A 1OQAA 2X5XA 2GJ8A 1G3MA 1P75A 1X42A 1W59A 4MJLA 2AOWA 3FETA 4H7FA 1N5JA 2WU4A 5T5QA 4Y1RA 1ADCA 3I8OA 2D2IA 2JJQA 3KAPA 4KGXA 3WLOA 1SQ6A 2L42A 1M7HA 2AEEA 3ABIA 3IQDB 3QXCA 4KI0A 1S01A 4WZAA 4CF3A 1CUIA 2G1KA 5AW1A 4WCFB 1AU9A 1SIBE 4FZJA 4N0MA 4WBNA 1SN7A 1F2TA 4PQEA 4RM2A 3PNLA 5A4AA 1E6MA 2QLMA 3WFJA 4S35A 5H02A 3SSMA 3WA6A 4PLPA 4FDAA 4EL0A 1F20A 2Z57A 4GGOA 5BYBA 5JXIA 3KSBC 5K8TA 2R1VB 4NATA 1HYQA 3KO8A 5FWNA 3WGZA 3BAFA 1IZ0A 3RW9A 4FGJA 1FXUA 1T9GS 3PKIA 2GKSA 4ASUA 3VDQA 1S8NA 4EO4A 1W36B 3WGLA 1KIAA 2NXJA 2RCYA 3VMMA 4LBVA 3X1DA 4A8JA 2SCUB 1FFAA 2WD9A 4K28A 3ZJYA 4D4IA 5HJ5A 1I7NA 3VH1A 2FFHA 1LV7A 2VXCA 1NASA 3CUWA 4JJ8A 4MAAA 4ZEWA 3ONEA 3K1ZA 3UXYA 1U3TA 3WGJA 3P2MA 4KAJA 1E6UA 1BU8A 5LNK1 1QQBA 3ED5A 1NQOA 4G0YA 3DZIA 1H8ED 1KK2A 2XUFA 2PZMA 1T9ZA 2A88A 2CHGA 2J4CA 2QUAA 3AVPA 4JCOA 2BCEA 3AERB 1U3WA 3ZUGA 4EB3A 5FH9A 2QDXA 4K88A 4ZOLB 3FGPA 4TVSA 2O7QA 1I01A 4L50A 2OWDA 3K32A 1RJGA 4EG3A 3FYTA 3IR7A 1BXGA 2SKCA 4RHYA 3CRRA 1Q91A 2Y05A 3O8OA 2J5XA 3PNOA 1T6ZA 2DKFA 4O4LA 4MB6A 2ES4A 2RHCA 3ROQA 4BVGA 2DWPA 1DJQA 3EZGA 5CCXA 3QIAA 2CVQA 2OGWA 4AZ3A 4G24A 3A9WA 1N2CE 1P80A 3QOXA 4WNYA 1IEQA 2ZS7A 4YAWA 2O19A 4AICA 2VRCD 3R7FA 4WN9A 1XZQA 1T6YA 3PTLA 4AMGA 2P6RA 4KBFA 5DFAA 2XRYA 2H2FA 2WOOA 3ZS8A 2Y92A 2DKOA 3AV3A 4M6WB 3TZQA 1G8HA 5HQ3B 2XWQA 2B34A 3ISTA 1ZKDA 421PA 3LA6A 2QWXA 4DV5B 2OB2A 1GR0A 1U1DA 1F8YA 3I9OA 4TQGA 1X70A 3LGAA 4HF7A 1BD4A 1C7FA 1KI9A 2QN1A 2WKRA 4QC2A 4RY8A 4Q4AA 4U2GA 5JJLA 6REQB 3PGMA 2A1TS 3CTMA 4UBJA 2R8ZA 3USCS 3STTA 3TW0A 4D9KA 4DQKA 5EKSA 4IS2A 2PN1A 1N6IA 4EFMA 4F12A 4XWOA 3BORA 2Z3ZA 2FG7C 6Q21A 2OCDA 3KKEA 1HQKA 3JRWA 4P82A 2XCTB 2FPRA 3EDOA 5KYXA 3V6LA 4QELA 2JFPA 4Z3OA 3Q2KA 2WJHA 2IITA 5AKXA 3OLWA 1K4YA 3PUVA 3WDSA 3S29A 4NCKA 5B7QA 1H2EA 3LTEA 4BO2A 3OPYA 3RRFA 2HFJA 5DTRA 5BOVA 4BVEA 1A4XA 4FT2A 1V3UA 5KYXB 1WEKA 3NIBA 2RHJA 3EXHC 1AKNA 1OYVA 1D7OA 4DSOA 3BS4A 3CRMA 1XD8A 4B71A 2QPAA 5U4XA 2I3GA 3D1JA 2P2DA 3NH9A 3LW8A 1H6DA 5TVKA 3H5LA 3HZZA 3TLMA 1R4AA 3PHBE 3SX4A 2V6MA 1W4AA 2E4UA 5IZCA 4CL8A 5MGNA 3CE9A 4M55A 3I8SA 2HHLA 1TF7A 3FZNA 4URYR 3R7DA 4C6SA 1C7ZA 4CDGA 2CHEA 1MU0A 4MV4A 5I3ZA 4REMA 3AW9A 1LC3A 1YTUA 3DVSX 4O63O 1A9RA 5BQXA 4ZWNA 4HQNA 2W43A 4YAGA 5JNVA 3VOBA 5ITWA 4Z9XA 1VHWA 1X7ZA 4ZYLA 1F7VA 3R3JA 1JXMA 1SUSA 1YJ8A 2AUNA 2W6ID 3QLTA 5C7IO 2VTDA 2LNDA 4M89A 4EY5A 2J9YB 4MVCA 4AWAA 3EXHA 1JVSA 4K05A 2PVCA 4A36A 1M76A 4UEQA 4DUPA 4LXUA 4QU9A 3WMRA 4BUJA 1E20A 1FFSA 1LSUA 4PCLA 5CX1A 4Z4HA 2X7XA 4P22A 3FH0A 1BW9A 4YP0A 4HJRA 5DV9A 1CBUA 1II8B 1BJKA 1JE0A 3I9MA 3G5UA 3AZOA 3TZLA 3U44B 1G5FA 4V0LA 3UV6A 5B58T 1EVLA 5BORA 2W83A 3BXOA 3GFSA 3H1GA 1R1DA 1SGWA 1V1RB 1KQOA 2FK8A 4RULA 1UFQA 3RRJA 4BNLA 4UTZA 3DKIA 4QPPA 4UMFA 1VPDA 1O95C 1W85B 1X7XA 2C88A 5JT1A 1V3QE 5DIZA 3FOBA 3GLTA 1YJCA 2HLHA 4O4LF 4RKQA 2B6NA 3D0RA 4O5AA 4MVWA 1OKKD 3COVA 4UVIA 3FDZB 1AKUA 1BVRA 3UOAB 4REQB 4DDHA 5B30A 1U7TA 2WE8A 1XK6A 3ET5A 5EQJB 5EE5B 4MCJA 4P2BA 1LJLA 1BMDA 4LY9A 2D54A 3NKLA 3KE9A 1RBZA 3H13A 5DWQA 1O3YA 3K0EA 1QVRA 4PLWA 1JHZA 4FKZA 2FPXA 1E64A 4R9UC 4IQFA 4BJ6A 4WTOA 3PD0A 1UEIA 1FMJA 3TNYA 3K0AB 3IC5A 1A5SB 4O0MA 4E1VA 4NKRA 2SHKA 4O25A 1KI4A 3MGCA 4XEHA 2H7XA 3UT0A 4Q47A 4UASA 1FFHA 2XEDA 5AM3A 2ZITA 3TFOA 5ALHA 3FKSD 4L15A 3B5EA 4E12A 2DT8A 2NZXA 2JLBA 4A6PA 2YIDA 4YROA 1EJ0A 4Y1FA 1A04A 4CLOB 3KYIB 1Z0FA 3ZX5A 2UUAB 1XA0A 5DCYA 3B85A 2BH2A 4RAQA 3VNUA 2BT4A 4ZYZA 3PC2A 5HPYB 4RMIA 4BN5A 4C88A 1E2NA 3HY4A 2Q46A 4TXLA 1XZHA 1T2FA 1P0MA 3BF7A 1P4AA 1D4ZA 2JFVA 4Q24A 1PHRA 3WYFA 3E70C 3PT9A 4Q4HA 4Z2YA 2QLFA 1CUEA 4P7GA 1OWNA 4WXMA 5T4FA 4A8JB 1YQ9A 4KQGA 3VVMA 4B3FX 1FFYA 1L5RA 3BGOS 3ENNA 5KIAA 3A1EA 2QMOA 4MVJM 4D3YA 1HETA 4EFNA 4KQKA 3DO5A 1RI2A 1I24A 2ZQ5A 2W2QA 5ETJA 1NF8A 3SWWA 5LQSA 3OMXA 4LDQA 5KHOC 2OBFA 1LJUA 3CPHA 3Q85A 1CQZA 2V6BA 2HEIA 3WMEA 4ZDIA 1URPA 1MIHA 1XJ0A 2WWYA 2Q2NA 1R5NA 2XXBA 3L1KA 3E0QA 2BV3A 3HZOA 3QFHA 3RSLA 4PRZA 3UYKA 1IVYA 3KDPA 3NHYA 1PSWA 3GXBA 3P0EA 1WTCA 3HE3A 1AXGA 1JKJB 1OXVA 2WKWA 2B2XA 2ZREA 1R4NB 3H97A 3ICVA 3SZ3A 2Q6IA 4EI9A 4DC9A 2QR3A 2ZJ6A 2W58A 4FR0A 1QJ4A 1SBZA 1CJSA 2H4YA 3P9IA 4I1YA 1OBOA 4FP9A 4UEOA 2OAGA 3ITEA 4Y67A 2WAAA 5KC8A 5DP1A 1IXKA 2P0YA 2XMPA 4N8SA 1GTSA 1Y9JA 5GONB 1I94B 1K7EB 2FZCA 1WZEA 1N9ZA 1ZWKA 1KK1A 2X1LA 1Z62A 4GOXA 3VJKA 3ZKAA 5L7WA 4LVNA 1E2JA 5JI2E 2HTFA 1UZNA 1BGVA 2GEDA 3D7LA 3GRUA 5A5DA 3UK6A 4YT2A 1FSZA 1QQ7A 1EDEA 1WA5A 1YZTA 2FMKA 4LZAA 4YJFA 5ECDA 4YMUA 5C5DA 2H65A 3M4NA 4OHUA 4X63A 3V2HA 1OR8A 2RG7A 4DCJA 5EZYB 1EHCA 4IWXA 3RYCB 1WOMA 4LDRA 2YWBA 3ZPXA 4KVGA 4EDHA 1GGNA 2YVKA 4MCHA 2OO5C 3NAZA 4U1RA 5FPSA 1I80A 3C6YA 4KG7A 1Q0QA 4BYGA 3L4SO 2I3ZA 2CDRA 4K6OA 2PJRA 3N0VA 2HF2A 1L5KA 3UJBA 1WCV1 2PZKA 4XRRA 4L07A 4E4RA 2QVGA 3VU0A