5CB6A

Structure of adenosine-5'-phosphosulfate kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
173
structure length
173
Chain Sequence
b'RGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable adenylyl-sulfate kinase
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transferase
total genus 69
structure length 173
sequence length 173
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb6A00
2CK3D 2PCJA 1KO1A 3T61A 5FI0B 1VCNA 1D8TA 2HYDA 4G5RA 3ONWA 2BBTA 1FPMA 2I1VB 1OH6A 1G41A 2BBWA 3WP1B 2WSSD 4KSCA 1KK1A 5BQ5A 2YC4C 3MWJA 2VYFA 2OBLA 2HXSA 2UVQA 1UPTA 5DN6D 3D6TB 1KZGB 2GBLC 4MGZR 1GOTA 2VHCA 1JPNA 2VA8A 2ZIAA 4KI0A 4MUAA 3ADKA 4Q19A 2WV9A 1T0HB 4HAUA 4Q5IA 1UADA 2FFBA 1AGRA 1J2JA 1XWIA 1HT1E 2QSZA 2VIIA 4XVQA 4BE7B 1R7RA 2IHYA 3U6KA 3A4NA 3KJHA 4G5QA 1NN3A 1ZINA 3GJ8A 4JS0A 2ZRAA 4C0BA 1XTQA 1GIAA 1YR6A 5C4GB 3FMPB 3BORA 2Q9BA 2QG6A 3CF2A 1G5TA 4JLVA 1G5RA 4BZXA 1UBFA 2BMEA 4GMXA 1W49A 4B3GA 2AWOA 5IRCD 1IXSB 4Q21A 2H5EA 1EFUA 4AURA 1UF9A 3DM5A 1KKLA 4H1VA 3VAAA 3ZZ0A 4JJKA 1ZIPA 3H4MA 1AZSC 1X6VA 3NTUA 1KI4A 221PA 4AD8A 3I8SA 3W90A 5LD2C 1GNPA 3P20A 4CEHA 5LDDC 1UJ2A 4RCYA 2D7DA 1NBMD 3BAFA 4KVGA 1XJ0A 2J7PA 3TVDA 3T35A 1M2OB 3U3OA 2ZI5A 3DPUA 4OHVA 3FMFA 3X1DA 2QPAA 2A3RA 1WBDA 4D26A 2IA5A 4C0KA 3AVQA 4GDFA 2RGGA 4IVPA 2WWHA 3W8NA 2O8DB 2HYIC 1OHHD 4DSTA 4TYPA 1ELOA 3DEFA 1E2PA 4ZO4A 3SR0A 3U3RA 1W0KA 5HKKA 3OHMA 3NBZC 1KI9A 3K1JA 2DB3A 3BIFA 5EUQB 3A37A 3OEEA 3Q72A 1GL6A 3I8XA 1ZU5A 2XTMA 2ZRGA 4Q47A 2O8FA 1YR9A 2A9KA 2ZRFA 4MYCA 3RS2A 3WYAA 5HTKA 1G3QA 5BW8A 2A2ZA 1FTNA 2W00A 2Z0MA 1ZRHA 2P2LA 2PMKA 1G1MA 3U4QA 1FP7A 5JI3E 4JLOA 2GILA 2C99A 4BGDA 2W2TA 4XTRA 2CEAA 3PG5A 1ZNZA 3WBKA 1LS1A 2BKEA 5EP2A 1P6XA 1JJ7A 4TLEA 3SHFA 2J0VA 5L3QB 4PPNA 3SU8A 1SQ5A 2O8CA 2XOKA 1U99A 1J8MF 3B7GA 1TQ2A 3IILA 1JXMA 3K0CA 1H8ED 1N6RA 5L3SA 4LV6A 1XCMA 5F9FA 2Z4SA 4DRZA 3AVVA 2J45A 5JBQA 5B2ZA 4MRVA 4X8OA 2VSFA 2O8FB 4JKYA 1E2IA 2Z83A 2XEXA 3K09C 2AXPA 4O25A 2N1BA 1TAGA 2D2EA 4B3DA 2CLDX 1TADA 5AUOB 1SVOA 4PHFA 4DVGA 4R7ZA 1MKYA 3EAQA 3SI7A 3THOA 2IYTA 3LBHA 5H68A 3AVWA 1P4SA 2XAUA 4MYHA 3ZGXA 1RKBA 2WPDA 3ADDA 2ZE8A 4UJ3A 2EQBA 1SXJD 1DAMA 1QVRA 2QPOA 3K9GA 1YJ5A 2V54A 3SBEA 2QTFA 5TDHA 4C0QC 5FOVA 2WOJA 3PITA 1Z0KA 3QF4A 4IEEA 3WHLA 4TL7A 3E2IA 3AVXA 4DLZA 4EIWA 2QP3A 2IYWA 1NLFA 2DPXA 2AD1A 1QHHB 1XD9A 2OZEA 3B85A 3FHCB 3GFPA 1AKEA 4UKDA 2JJ1D 1VG8A 3AM1A 3PEWA 1R0YA 2O8CB 3HYTA 2Z43A 2IF2A 4B3BA 1E2HA 2ZI4A 4LHVA 4YQFA 4MDFA 1A2BA 1TUEA 3PENA 2R62A 1Z47A 2AFHE 1EWRA 3QKSA 2XTZA 3DZDA 3LQQA 4EFLA 3LV8A 1X8KA 2YNMA 3EG5A 4QM6A 1GAJA 4TTPA 4TYNA 4ZIRB 5FOWA 2W0SA 4JL8A 5DH9A 1NY5A 2QL6A 4G0NA 4URYR 2AHOA 3VU9B 3EIHA 2XSZD 4QJ3A 1FOEB 2WWXA 4MKFA 1I4DD 2HF8A 4RKFA 3REFA 4IFBA 3SYKA 4N0EA 2GTPA 1ETUA 3QF4B 2J1LA 1ZIOA 3WNBA 1Q3HA 3GMTA 3K0SA 2HCBA 2ZYWX 2KI5A 3LNCA 4YMUA 821PA 2CHGA 2REOA 4CEJA 4YXWA 1IHUA 1W1WA 2ASEA 4A9AA 3EARA 4M8NE 1YZKA 4BPBA 2OAQ1 5FR2A 3CWZA 1EFHA 4L15A 1A1VA 4X8HA 2VP0A 1R8QA 1HUQA 3WY9A 3QKSB 2D2FA 3KQHA 1L4YA 1M7BA 2QE7A 3I3SR 1PLJA 1FMLA 2ZEJA 5B30A 1E1QD 1T91A 1D5CA 1XPOA 4PHTA 2ZYVX 3CX8A 1KDOA 3LBIA 4JSYA 3BOSA 1U9IA 4I1SA 3RANA 1FQKA 5EXPA 2Q3MA 3NEJA 4BLRA 4HLDA 1TQDA 4HAWA 1X86B 3KZ1E 4TTQA 1FNMA 4B32A 3GLGA 1PLKA 3IBGA 4URVR 1MABA 5GVSA 4ILEA 5EUMA 5B57C 5CLLA 1FMJA 3SDZA 4MKIA 3PQCA 5CIWA 4CEJB 4OQXA 4C7OA 5IHPA 3A1VA 3WYFA 1XP8A 2P65A 3HU3A 1NRJB 3EX7C 5CITA 2IS2A 1H8HA 1NL3A 2DR3A 3OAAD 3MJHA 3OIVA 2FZLA 1E0KA 4A0RA 4Q1CA 4KFRA 3EPKA 5EP3A 4AKGA 1FTSA 4US2R 4M21A 5JWRA 3KQNA 1GM5A 4M1YA 1NMZA 3M4YA 1CS4C 1TPZA 1Z22A 4CVNA 1Z0AA 1KMQA 4KLNA 1GFIA 4DCSA 4LJ8A 1XCGB 4QC2A 1VHTA 5KOYA 2KB0A 5J4YA 3W9YA 3O8RA 1G6HA 2JLXA 2R6CA 3GLGB 3X1YA 1Z5ZA 2QU8A 5A0FA 1NJFA 5TMPA 3B1XA 2BKUA 1E0JA 2RGDA 1NVVR 4DLSA 1E2MA 5JS8A 3FFAA 4BFZA 3MLEA 5AJWA 3RSLA 2JGNA 5SZKB 3VTKA 1O87A 4JZKA 1IQPA 1NVXQ 2D7CA 2EFEB 3GJ7A 1KSJA 4JBXA 5JHGB 1SVSA 2EFDB 1VKJA 5KPDA 3AP2A 1J7KA 1AS0A 3KX2A 4G1UC 1YZUA 1KI7A 2WICA 2RGCA 4V0NA 3GLIE 1UEIA 2A5YB 3HDTA 4M9SA 1W46A 1TUIA 3R8CA 4V0MA 4DEYA 1TQ6A 1GTVA 4HLQB 2B6HA 3RS7A 2FFHA 4D4JA 3GFOA 3SFVA 1W7AA 5JJIA 1OV4A 4QJ5A 1K8RA 1E2EA 4W9MC 1N6LA 2OO7A 2G9NA 2XB2A 1MO4A 4Q48A 2NOAA 2QA5A 2VRWA 2XXAA 2R9VA 4JSTA 2ZROA 1MOZA 3JVVA 4LJYA 3IPXA 4Q7LA 5E7MA 3RVBA 1IY2A 3QBTA 5TVKA 3OE7D 1DAGA 1EX7A 1Z2AA 4LBZA 2LWIA 3QOFA 1EFRA 2MSDB 3CO5A 4DDUA 2OCPA 3L0SA 3TW8B 1P62B 1NN1A 4BWYA 5BN3A 4NCKA 2J0SA 2QTHA 1IY1A 2BM0A 4BRWA 1ESNA 1US8A 4NKRA 4F4CA 1NMYA 3RS3A 2JAQA 1E98A 3B5JA 1UKVY 4RJLA 1U0LA 1R0ZA 1XEWX 3IIKA 4Y0AA 1VPLA 3I61A 3LY5A 4WZAE 4B76A 4BLPA 3K0CC 1UEJA 2C2HA 3QKRB 4PAQA 1W36B 4B6FA 4TMWA 2FSFA 3ECCA 1G7TA 1R5OA 1SVIA 4QHYA 3P4XA 4KITB 1YQTA 2GETA 4DUGA 4OBEA 1N6PA 5DHFA 1SKYE 3U7HB 3OIUA 2D4HA 4M9QA 5AJYA 1VCOA 2OFWA 3EA5A 2IBMA 5AJZA 4GBMA 1Q1ZA 3LXXA 3U44A 5FL7D 3OEHD 1OFIA 3P27A 2ZJBA 4FCWA 4JYCA 4WAUA 5JECA 1P60A 5B64A 1W48A 1C1YA 2ORWA 4HDCA 2H92A 4M53A 1TU4A 2WKRA 5BN4A 3PEVA 1PV4A 2CMKA 2WTUA 3AP3A 1KYIA 4HB3A 5FOXA 5IDVA 2Z5FA 2ZRNA 2A78A 1GKUB 1WF3A 3CONA 5HR5A 1M6NA 1OIWA 2OXCA 2ZREA 4ARZA 2CXXA 2GHIA 3SFZA 2ATVA 2G83A 4R98A 3VR4A 3AF2A 2GESA 3AF1A 3BJIC 2ZJZA 3TAUA 5BXQC 2NO1A 2W0MA 4C2UA 5DYIA 4Q7MB 1ESMA 4NP6A 2VEDA 5F98A 1F60A 1R5BA 4BEBA 5FTNA 3X1WA 1PLLA 4BZQA 2N42A 1GZSA 2E87A 3K0AA 3QSYA 2ZRPA 3Q7PA 4B74A 2WMOB 2J87A 4TL6A 1NLZA 4B75A 4LBYA 2BJVA 2AX4A 2P5SA 1YZLA 1E0AA 4LYHA 3CX7A 5KU1A 3ZIAA 4WVFA 1ZYUA 4LGMA 4UXIA 2V6JA 2GKSA 3V4FA 3A1WA 4D25A 1SHKA 1D2EA 5A5GA 3K8YA 2FPKA 1BYIA 4DBLC 3K9LA 4OQFA 4P3YA 3LFUA 3P26A 4IFEA 5A4JA 1KSHA 3U7FB 1EWQA 3IO5A 4Q1DA 2ZRHA 3FMIA 3QKTA 1YZQA 2JA1A 3DMDA 5EZ6B 1KAGA 1V43A 4EAQA 5JFGA 2QENA 2F6RA 4P4SB 1VMAA 2GJSA 4XTCS 3N70A 5AWFC 2IC5A 4DHEA 3DZ8A 1T3HA 3A1UA 5E7IA 3RRMA 5KUTA 1CLUA 1W5TA 2WKPA 3FKSA 4ABYA 2CHVA 2W83A 4MYUA 1VDZA 5EE3A 2D62A 1EG7A 4F4JA 2DY1A 4Q9HA 4OHYA 3K0AB 2ZETA 1EFTA 3RRYA 3LX8A 2QQEA 2OE2A 1Z6YA 5JZVA 3KQUA 2EFGA 1VCMA 2WVJA 5FTLA 1CRQA 2R6DA 1UFQA 2EFHB 2ZRCA 1R2QA 3A4LA 4QGFA 1QG4A 4NCHA 1A4RA 3TAHA 3GJ4A 3EZ9A 3SYNA 2C9CA 1W0KD 2FSIA 4HZUA 5HKKD 3MD0A 4D0LB 4G3XA 5G3YA 4LZZA 4L16A 4KCGA 4P31A 4KFSA 1G6OA 3RC8A 2F1RA 2OXRA 3OEED 5AUQA 4OHXA 1Z29A 4TYYA 3K9HA 1S8FA 3ZVMA 3AGPA 2YVUA 3MSXA 4L9WA 1ZCBA 1IN4A 2IHBA 3QVVA 5DI3A 3EW9A 2A5FA 1W47A 1XD8A 2DHRA 2OCYC 1NLYA 4WBSA 2GVZC 2P3SA 4PPGA 4EJSA 5JSZA 2O0JA 4YDSA 1YR7A 4EKDA 5KSYA 1C9KA 1GILA 5FPYA 3VNVA 621PA 1N0WA 4DSOA 1PVOA 4Q01A 3W3AA 4GZLA 2MMGA 4DDTA 2XITA 4OI2A 1VG9B 4JLKA 5IT5A 3GLHE 4C9BA 5ANRB 2OCBA 4V0LA 4KHZA 5CM9C 1W4RA 4P0TA 1D9XA 2XZPA 5JCZA 4QGGA 1ZM2A 5CB6A 5FUVA 4W5HA 1R5NA 4Z54A 4FINA 2R6AA 5TARA 4BRUA 5AUNB 2XOKD 2O52A 4NHOA 4RZXA 3CRW1 4TMXA 4XWKA 2GAOA 5JJLA 1ONBA 4MGIR 2WHXA 2QTVB 2XB4A 2QMOA 3AQ4A 4YDHB 2YC2C 3FHOA 1NI3A 1U98A 1JR3E 5DI3B 3EZFA 3PEUA 4HYYA 1HQYE 1UKEA 2AKYA 3GEIA 4PPQA 3O8CA 5KTYA 2JLQA 1KO8A 4RVCA 5L8VA 4EJSB 1W36C 2IF0A 4ZDWA 1IAQA 4D4MA 2BVNA 2WPDD 1VIYA 4CDGA 1KKMA 1VG0B 4FMDB 3EXAA 3BBPA 4NZYA 3QXHA 1OE0A 2B21A 1GVNB 2C9OA 5CYOA 3TQFA 1KI3A 4LHYA 2OBMA 4AY2A 5J4HA 3ZLJA 1FFHA 1KI6A 5KSZA 4QJ4A 1GDDA 2AL7A 4OQMA 2BBOA 1RJ9A 2QRNA 4D4LA 4BASA 3SS8A 2XZOA 4IOMA 4LSGA 5DO9A 4I1VA 1G16A 3GD7A 1DS6A 4JBYA 3NBFA 4ZPXA 2CDNA 1DAEA 1QHYA 1XEWY 1KMHA 4KODA 5DISB 2AK2A 3IGFA 3VMFA 3CRVA 1DE0A 3F8TA 4IVRA 2FPLA 1NKSA 2GAAA 3GLIA 4EDHA 2HUPA 4OI0A 1UKYA 1IXZA 3THYB 3LW7A 2IXEA 4AYTA 1HE1C 3H2YA 3NDPA 5K8UA 4IOJA 5FOSA 5SZIA 3NHBA 4JLBA 3NVAA 4MDEA 1L4UA 1XEXA 2VQSA 3KKMA 3KTAA 1OXTA 2QI9C 5GJBA 4A4DA 5FPHA 4WZ6A 4URXR 2OG2A 4ERNA 4RFSA 4YXWD 3AVPA 1EGAA 1RJ9B 3CH4B 4UJ5A 1LV7A 3WP0A 3RS0A 3ZVRA 2FG5A 3OIYA 2C5LA 3VR2A 4QBHA 1N0VC 1U8YA 4JT2A 4P4UA 3OIWA 3ASZA 3T5GA 5DIFA 4DIEA 1U0JA 1NMXA 2QBYA 2JLWA 2QE7D 1OXSC 4NCNA 4PR0A 4OI4A 1HV8A 4IDQA 3X1XA 1F6BA 2ZJYA 3KDSE 3T34A 5E3HA 2F55A 1S96A 3AVOA 4QM7A 2CCJA 3U61B 3AVYA 2FFQA 2QROA 1P2TA 3CPEA 1AGPA 4S2EA 4CW7A 1T8UA 4D2IA 4L8GA 3QE0A 1E4VA 1KI8A 4B2IA 4EFNA 5CB8A 5H8WA 1NY6A 4QBFA 1JAHA 2GF0A 2NQ2C 4Z8YA 4BFXA 4V02A 5H1YA 4PANA 1II9A 4RFSB 3NDBB 2RGEA 3LLMA 1E2LA 4NCIA 4C0AC 3TH5A 2HXYA 2VF7A 4HLUC 4Z1MA 2QNRA 1H8HD 2QT1A 2ZRBA 1LVGA 2ZUDA 3BWDD 2BHRA 3C41J 3HP1A 2CVHA 4WOPA 1A2KC 2FSGA 5EZ5A 2ZI6A 2QBYB 3TGPA 1Z2CA 2QEQA 4BFWA 2ZE6A 4YONB 3B1VA 1KOFA 2VSXA 3JVUA 3IIJA 3X2SA 1OSNA 4NYJR 4KBGA 1GITA 1SKYB 2DWPA 2X8AA 4DLVA 4XVRA 1VCIA 1YE8A 4V0ME 4QFMA 5JMTA 1RC8A 4CIDA 1XTSA 5L3RA 4XOIA 4XWAA 1Q12A 2E1RA 2VP4A 2ZRLA 1KI2A 3LD9A 5TV2A 1OB2A 1TNDA 1DG3A 2BCGY 4QOSA 2AN9A 1G18A 3AGQA 4ITRC 1HYQA 1OYWA 2Z4RA 2X2FA 1UBCA 3IEUA 4QL3A 1FL9A 3VX4A 4PC7A 5DYGA 2J0UA 4UXJA 2XNDA 3MRSA 3TNFA 4LYFA 4ZDKA 1ZNYA 5CJ2A 3NBXX 3IEVA 2WSMA 1ZUIA 1G19A 3BB1A 5KHOC 4X8MA 3MWLA 3RNLA 2MSCB 1W36D 1M8PA 2GWHA 2QAGA 1E9RA 1G64A 4PZYA 2VP6A 1KSFX 2JLUA 4O2RA 4WIAA 421PA 3PUXA 4LV8B 4C2TA 2WOOA 1BS1A 4C0SA 5JJKA 1QZXA 2I4IA 5GADl 2B7CA 4EJSC 3QENA 4LRWA 2HLDA 3AEZA 2F1IA 1OH5A 2FA9A 5JEDA 3B78A 4JLAA 3TBKA 3CX6A 5CIQA 1J8YF 2ZM5A 1KI1A 4TMTA 3RWOA 4CEHB 2QY9A 2IYUA 3QXCA 2JATA 2FU5C 1EFRD 3W5JA 1VTKA 3QEOA 2I3BA 1ZM4A 1S1CA 1Q1QA 2G0TA 2IT1A 3QI2A 3BRWD 4JKIA 3FMOB 4A2WA 2RMKA 1VHLA 3ND9A 1QVAA 4PSVA 3NC0C 2J0UB 5IF9A 2IYZA 4BFTA 1KK3A 1EXMA 3Q9LA 3RRZA 4JVNA 1Z83A 2KE5A 4PC2A 4GSYA 1E2QA 4LC0A 3PR1A 1FQJA 4M0LA 1NF3A 1CEEA 1AN0A 1E69A 2XZLA 4ZV4A 3MMPA 2FSHA 1JAIA 1LFDB 2GZDA 4UNNA 2OCAA 2CLSA 3ZDQA 1JB1A 2QQ0A 3QPWA 4DUGD 5AJXA 4CYMA 2NZ8A 4K46A 1KK2A 2FEOA 3W6PA 5FI1B 5JRZA 4CEIA 1Z28A 2V7QA 1SGWA 1FUKA 2RGAA 3B6EA 4DDVA 3FDIA 4HB2A 1TQ4A 2PJZA 2CLCX 4NYIQ 3GLHA 2ANCA 4QXAA 1ZC4A 2BM1A 3HYRA 1GRNA 1ZM7A 2D06A 1ODFA 5HZHA 5JCPA 4AWXA 2IL1A 2GNOA 4B34A 4O3MA 3B82A 4GPTA 4GP7A 3U4QB 3CIOA 1NJGA 5HE9A 1E9EA 3E1SA 1M7HA 4ON9A 2QZ4A 4HUQA 2ZUBA 4Q4AA 4F4IA 2GCOA 2ZR9A 5M04A 2PBRA 4C3ZA 4JLPA 3UXMA 1FP6A 1JR3A 2IUUA 1JXOA 2ZRKA 3UMFA 2FMXA 2ZJ5A 1G7SA 2EYUA 4UNRA 5L3SB 5FBRB 4DLRA 2QMUA 2RHMA 1F2UA 2JDIA 4NMMA 4CEIB 2AXNA 2R6FA 4MA4A 3KUDA 4C4PA 4QHSA 1P2VA 1YZNA 3TUZC 2VBCA 1NN0A 3LH5A 2CL6X 2X19A 2PEZA 4AYWA 2YOFA 3EZ2A 2CL7X 3IHLA 4O0MA 5FOTA 4OJQA 3U7GA 1N5JA 3BH7A 2XJ4A 2PT7A 3IQXA 1OH7A 3FTQA 2RGNA 1GL9B 1MRNA 1G17A 2OFXA 1JNYA 4AKHA 1W0JA 4Q7JB 3UKDA 2GCNA 3AKCA 4LJ7A 5FPSA 1P9RA 2PZFA 1AK2A 5F3WB 4Q03A 4DLUA 1KO4A 1P9NA 4RY2A 4DLWA 4M1TA 4YMWA 4M1KA 4LHZA 3WXMA 3A4MA 4I99A 4NYMQ 3EZ7A 4I1OA 4A82A 1F2UB 3FKSD 2IEYA 5FOUA 4RFVA 4Q9JA 3R9IA 1XMVA 2VHUA 1N25A 2WMNB 4WXPA 4E09A 3DKVA 2PZEA 2RAPA 1T0JB 4QGAA 2AR7A 2FE4A 5D3QA 4DCVA 4PC3A 3QXSA 2ZE7A 4U7DA 2JJ2A 4I81A 2YWEA 4M2LA 1WBBA 2JLVA 3MG9A 2EU8A 5C18A 1DO2A 1M74A 2P5TB 2ZI3A 2KBFA 3DM9B 1G8FA 1Z3IX 4KJZA 2BBSA 1II8A 2ZJAA 4PFSA 3LRPA 4LV5B 1BMFA 1R10A 2YV5A 2O8EA 4UXHA 2H57A 2ZVQX 3PCRB 3E5HA 2A5JA 2X1VA 4GOXA 4MH0R 4C30A 3QJYA 2WWYA 1ZNXA 2ZI9A 3RDPA 4CT4B 8OHMA 1ZD9A 1NVVQ 2CVFA 3AKDA 2ONJA 1TTTA 2VF8A 4AKIA 1AJEA 2YKGA 1XX6A 2H7VA 2GVDC 3T1TA 2OLJA 3SC3A 4D80A 3CRRA 4AIIA 3QNUA 3SOPA 2P67A 4HAXA 2ECKA 4RSGA 3MWKA 2YOGA 2A30A 1HQCA 3ZZUA 5HPYB 1X1SA 4M1SA 1RRFA 1T3LA 3HPRA 4IDNA 4KU4A 4E07A 5KYKA 2HJVA 2Q3FA 1ANKA 5AR1A 2BEKA 3CR8A 2H18A 5DNYB 1UDWA 4DLYA 2WIBA 2PCLA 4HAZA 1E1RA 1Z08A 4R9UC 4FWIB 1CKEA 2BMDA 1P9WA 1MABB 5FPTA 2FH5B 2GF9A 1CTQA 1KJZA 3AF0A 3REGA 1QRAA 2HCJB 4PC1A 4DCUA 1XTRA 3NC1C 1II8B 4C7OB 1Y3AA 4ZI2A 1IN7A 1N6HA 3QF7A 1HURA 4C0LA 4TLBA 4HUTA 4CF7A 2ZTSA 4B48A 3NEYA 3NKVA 3A8TA 4IEIA 1EFCA 1NG1A 4ASUA 5G53C 4HAVA 1CXZA 2JIZA 2OLKA 2QAGC 3IBYA 4JJZA 2P0EA 3VKHA 1P5ZB 1OT3A 3CNOA 2IW3A 5JEEA 3SHWA 3SEAA 1Z0IA 1KHTA 3TLXA 4MQBA 3U6BA 1CP2A 2W58A 2O0HA 2DBYA 3BFKA 1G5PA 2G77B 4A6XA 2Q9AA 2QUZA 2NPIA 4Z8XA 2PZGA 4ZKEA 1F2TA 2RH5A 1N0UA 2GZAA 1G291 2W6IA 1G7RA 2MSEB 4TMKA 3VHXA 4DSNA 3K70B 4B3FX 1G3UA 1FX0A 5J4KA 4PO8A 1P7CA 3TSZA 1E4YA 3QIAA 2YYZA 2ANBA 4HDOB 3TR0A 4HAYA 4AYXA 1G7CA 1XZPA 1IM2A 4FIDA 1DTSA 3B9QA 1VYUA 2EYQA 3D31A 3Q3JB 1XDBA 3EIEA 1ZC3A 1AZTA 1B23P 2UKDA 1LF0A 1JBKA 4G5GA 2C95A 1EK0A 1VYVA 1NP6A 2NMVA 3GEEA 3FWYA 5FPKA 1R8SA 4NDZA 3WHKA 2LKCA 2PEYA 3FPAA 4JLNA 1A82A 1RYHA 2Z6VA 4A1FA 5KSPA 4B33A 2QSYA 3BB4A 1JQJC 2ZYTX 3CB4A 4Q7KA 4YMTA 2D3WA 3GJ0A 4OJKA 2IYYA 4Q9KA 2BV3A 1OFTA 3TR5A 4XH9B 5AK0A 3Q5EA 2FF7A 4KAXA 5J4VA 5TY0A 4M22A 1XB2A 2J9RA 3THWA 1E9AA 2XXAB 1R0WA 1GG2A 1YHNA 1N5KA 1FX0B 2V55B 4R71A 2CE7A 4E5UA 2FJUA 5H70A 1JALA 1NIPA 1QHGA 3G5UA 3A1SA 3PXGA 2FEMA 4BFSA 3IO3A 4A92A 2G88A 4GNKA 1S2MA 1US8B 3K0FA 2V9PA 2E9SA 3J81k 6Q21A 1X8LA 4B3XA 4EFMA 4A2PA 3KQLA 2V4ZA 1V5WA 5FBVB 4U02A 2CHQA 3EIQA 2F7SA 4B3CA 1MO5A 5C46F 5K8LA 3DVLA 1RRCA 4URUR 3C8UA 4POAA 3UANA 1DADA 2UZIR 3B1WA 3UMSA 5DGXA 4RD6A 2JJ8A 4IKEA 2DWOA 4Q4LA 1T6NA 1Z6GA 1YZTA 4E22A 2ZRIA 5SZJA 2WAYA 1P75A 3THWB 4RCZA 3U44B 2EWWA 1FNNA 3C16C 3CUEF 4P33A 3FFBA 1AQYA 2ZXUA 4HI0E 1G4AE 3AUYA 2RGNC 2Y8EA 1RW4A 2YWFA 1CR2A 5G3ZA 2WIAA 1IXRC 4A0FA 2CE2X 3WMFA 4H1UA 4US1R 4FI3C 5FBQB 1F5NA 1XTIA 4F91B 3R9XA 3QXXA 3ZJYA 4L5BA 3B1ZA 1NSTA 3Q85A 2G6BA 4G01B 2JLRA 2GA8A 4GRAA 1JEDA 2O8BA 2X2EA 2CJWA 1Q1BA 3D3QA 3I4LA 2NG1A 2C03A 4ARZB 4TL9A 1ZD1A 5KDLA 3T5DA 4B47A 4FD2A 4LDJA 3ZQJA 4LBVA 1QG2A 3C15C 1TEXA 5HCIA 1QF9A 4YC7A 1U81A 3RRNA 5D3MA 3CBQA 4TWZA 2GCPA 1G9XA 1XFAA 1XXHA 1VYTA 2ZSDA 4IOKA 5DSZA 4IOLA 4PO9A 3WYGA 3GPLA 4TQAA 4YMVA 3EC1A 2IUTA 1XNJA 4PAMA 4TLCA 1K5DA 2VP5A 1U9IC 2ZJ8A 1MT0A 1NKTA 4JL6A 2J7PD 3N2EA 4V03A 3B13B 1UAAA 2PT5A 3GJ5A 4V0OA 4DEXA 1IY0A 4AG6A 4D81A 1X1RA 1IN5A 2GEVA 2XNDD 3EZ6A 4PXAA 4PSKA 3MGCA 4RD0A 1W4CA 1T5LA 1U8AA 2CBZA 4LI0A 3UG6A 4A0HA 4HB4A 3KB1A 4ZI3A 1E9FA 1Q57A 3AKEA 1CJMA 1E9BA 2J46A 2CL0X 2CJWB 4UNSA 1RPZA 4TLDA 1XEFA 4Q9LA 4B35A 1T5IA 5EXSA 2QT0A 4KVAA 1J70A 2WJGA 3P32A 1DVRA 1MH1A 3LO5A 4NE2A 2HLDD 2REXB 4EPTA 2FDCA 4EPWA 3OZXA 3L8YA 4CGZA 3R9WA 2IEZA 1TL7C 4BFVA 4TQ9A 3VNUA 5L3VA 1G4UR 1KK0A 2OAP1 3VFDA 4XVUA 3KKOA 3T12A 3TK1A 2JLZA 4TLAA 2ORIA 4HATA 2G1JA 1LB1B 4CT5A 4ZDIA 1JI0A 1OFHA 721PA 1HT2E 2ODBA 2VP9A 4Q4JA 3K70C 5JWHA 4LJ6A 4Q4HA 3DMNA 3RABA 5JRJA 2W6JA 1XTKA 4EUNA 4ACBA 4X8LA 1Q21A 3BH6A 4UNQA 4OL0A 4AC9A 2OBNA 3ICEA 1Q0UA 4JYBA 2LKDA 3R8FA 5JI2E 4HZUB 4LY6A 2N46A 1QHSA 1Q3TA 3KJIA 1P73A 2WJIA 3C4JA 2F1HA 2ZS7A 4DT1A 4HLCA 4KSBA 4A15A 2V8OA 2X77A 2V7QD 5TXGA 1HA3A 4FXPA 4IDHA 4W7SA 2IXGA 2ZI7A 1YR8A 5FUXA 3IDQA 3VX3A 4DCNA 5JSZB 5DI9A 3FYHA 1YKSA 4NCJA 4O2LA 1OYYA 5G40A 4KO8A 3H86A 4LHWA 2RCNA 4W5JA 1NG9A 3FGNA 3VHLB 1NIJA 3BH0A 5FBWB 4DXAA 1N2CE 4BFYA 4FMBB 4LPKA 1WDTA 3QG5A 2OFOA 4N0DA 3KKPA 4Q4HB 4RD1A 1PZNA 1R6BX 2HF9A 3MFYA 4R2HA 5ELXA 3DDCA 5BYKA 3K09A 121PA 1JR3D 3GCGA 4JLMA 1DAKA 2JDID 1G8YA 1E3MA 1WCV1 1YRBA 1DARA 4QKQA 2FWRA 2QP9X 3CR7A 2GXSA 4V0KA 1CR0A 1AS2A 5EXXA 4TMVA 3R7WA 2RB4A 2YINC 3BK7A 4JT4A 2DFKB 1W2HA 2ZPTX 1FW6A 4NPHA 1UKZA 2MMCA 2VO1A 1RYFA 1DAHA 3WRYC 3PUYA 2PLRA 1CJKC 3TSOA 1MRSA 1W0JD 3L0PA 2H17A 2J41A 4LYAA 4BZPA 1E79A 2AD5A 1LS6A 3FE2A 3RLFA 1XJCA 3P1JA 2ZRDA 4LJAA 4MGKR 1KI6B 4EQ6A 1GKIA 2QN6A 4H9GA 1COWA 4YLGA 5DLQC 4TZ0A 4DJTA 2R2AA 3I73A 4OI1A 2OEPA 4OHZA 2ZRMA 3T15A 3GLFE 1G8GA 1Z06A 4LJ5A 1HE8B 4FWTA 3RSOA 3QQ5A 2FGKA 1KMHB 1NVWQ 3IUYA 1W4AA 1OF1A 4WA7A 1S3GA 3CW2A 4JMPA 3GLIB 2V1XA 1SVKA 4LK2A 4YMSA 5FTMA 1NNEA 2IXFA 2QMEA 1UDXA 2H16A 3RAPR 2IS6A 3GJ6A 5HCNA 2JJ2D 4KYUA 4TSFA 3CPJB 3QUSA 1FZQA 1W5SA 4NU0A 4NYJQ 4PPFA 4IDPA 2Q9CA 1XEXB 2AWNA 3KTAB 2ODNA 5HE8A 4A8JA 1JPJA 1S1MA 2IYSA 2ZRJA 2YZ2A 2BOVA 3RHFA 1R0XA 1BMFD 4EQ6B 1UBEA 1XJQA 3KXIA 4Q1EA 4XWOA 3PV0A 5C1BA 4KFTA 4B71A 2A5DA 1XPUA 1I4LD 4JLDA 3CF6R 3WMGA 2P6RA 4N1AA 1PUJA 2VLIA 2YHSA 3W34A 2EWVA 4WW0A 1Q44A 2ZE5A 4M9XA 4B43A 4KFUA 3QXJA 4A6PA 2QGZA 1Q22A 1T4GA 4MYTA 2BJWA 2ZSAA 4ZCLA 1ZM9A 2GK6A 2VHJA 4RZ3A 3TJZA 3CWQA 1IN6A 4FMDF 3IPYA 4DB2A 4TYQA 4GL2A 1ZP6A 2G3YA 4TTRA 3PJRA 1E1RD 1NBME 3K70D 1A7JA 2B7BA 2OHFA 3E70C 5J40A 3PEYA 3R20A 4F7WA 2IYRA 2ONKA 2O8DA 5EE5B 2ZAOA 4A8JB 1ZUNB 4AK9A 1DAFA 2WWGA 4K81B 2C78A 4OK6A 4TN1A 3SQWA 3KFXA 2GJ8A 2ERYA 3QPUA 1Z0FA 3BC1A 1E2NA 4QNMA 1IOZA 1H65A 2IUSA 4ASUD 1XD2A 1S9DA 2JIZD 3ZS8A 3PVSA 2LCFA 3G82C 2P6NA 3T06B 4B44A 4ZKDA 5KDDA 2CCKA 1ZU4A 2L0XA 4B2PA 1BIFA 5BWMA 2WZQA 1S9HA 3K0EA 3A58B 4D82A 2DFLA 4RD3A 1E94E 3OFNA 5EE1A 3L82B 5GVRA 4G5OA 2W6ID 1NVUQ 4M9ZA 4HDQB 1HH4A 1DELA 3FB4A 4KXFB 1WE2A 5E4FA 5TB5A 5L3QA 3ASYA 4M4SA 2VPPA 1Z63A 2F43A 3I92A 2VHTA 2ZR0A 2F3RA 1F48A 3Q5DA 4FMCB 3PUVA 4LJ4A 1N5IA 1BYUA 3UWKA 3BFVA 1ZAKA 1BKDR 2GJKA 3CRQA 5EP1A 5J47A 3EPJA 1RIFA 1KDTA 1K5GA 1XD2B 3CPHA 3THXA 4JIMA 1HY3A 3KQKA 2ZQ5A 2HDNB 2FFAA 4OQLA 2QAGB 2AFIE 3AB3A 4QNRA 4OKSA 2WWFA 1KO5A 1Q1EA 4B2LA 4FW9A 1DBSA 2RGBA 4I1UA 2WJYA 4NONA 4RD4A 1TX4B 1J99A 1OXVA 1CULC 4Q02A 4D0GA 2FOLA 4FCTA 2EVWX 3VR3A 3T1VA 3VR5A 4G5SA 1SXJE 3QBVA 5BN5A 1QHHA 1TMKA 2D74A 3DOFA 2R8RA 4MKHA 4MUBA 1SVMA 4M1OA 2PMDA 5FR1A 2F43B 4C0HA 1IN8A 4R2IA 1PJRA 3VR1A 3AP1A 1JECA 1LY1A 2ZS9A 3EWSA 1I2MA 3HWSA 5AUPB 4TT3A 1AS3A 1GUAA 3CLVA 4PZLA 2WM9B 3K9NA 4DLTA 1X8JA 2A5GA 5CDFE 1U90A 2HEIA 3RWMB 1VECA 3O47A 4IXNA 5K8IA 3THXB 4GP6A 3FVQA 1B0UA 3K53A 2BCJQ 4ZIRA 1U2RA 1KDRA 3BERA 3UG7A 2QM8A 4Q18A 2WJVA 4LBWA 3VU9A 5GJWC 3U3JA 3Q8XB 1MO3A 1ZBDA 2WBLC 5FBLB 2QMHA 3U2QA 3W5IA 1WRBA 1WMSA 2J7KA 1AM4D 1SHZA 2ERXA 1XXHE 2CNWA 2ODWA 3D8BA 4PAOA 4PQYA 4DKXA 2PH1A 2B8TA 4LYJA 1IONA 3EA0A 3GLHB 5LB4A 1OKKA 1Z0JA 4A2QA 2KBEA 5JHHB 3B1YA 4QRHA 2NZJA 3VQTA 2JLYA 3KKQA 1LTQA 1J90A 3TKLA 3ZIAD 1CJUC 3MUFA 4JL5A 4LPSA 2B8WA 4TMZA 5IK2A 3SJZA 4NYIR 3TRFA 2ZVPX 1YZGA 3PFIA 1M34E 3LDAA 3ADBA 5FTKA 1Z0DA 3C5CA 4HUQB 4Q9IA 4WXRA 3WBJA 3F5FA 1AA9A 1PUIA 4Q4AB 1KIMA 2C9YA 2GCOB 3SE0A 1KNQA 1GP2A 4KBFA 1JR6A 4PHGA 4ZCIA 1IBRA 1LF5A 2R44A 3KXKA 3AVUA 4BQSA 5KNCA 1KJYA 2J59A 1G3IA 4RKEA 2ZYUX 4XD7A 2GEUA 1RVDA 1E2FA 1XBTA 1ZM3A 4XSGA 5CM8B 3V4RA 3QY0A 4KV9A 1X3SA 4OK5A 4P32A 4GOKA 4D6PA 5B58C 5UKDA 5EXTA 2ZU0C 4FMCF 4C0JA 4PHHA 1KY2A 1RFLA 3SYLA 2VHQA 3AVTA 1W2GA 2GK7A 3HU2A 4JVMA 3ZQ6A 3EPLA 4A8JC 2XX3A 3SN6A 1DG1G 4IRUB 4RZUA 1OFUX 3WNCA 3FHTA 1XMJA 1XMIA 2RKOA 5DHAA 2AK3A 3ZZTA 3GLFA 2QRZA 5FFMA 1CJTC 2GXAA 1HTWA 2FX3A 2NIPA 1Y63A 1ZJ6A 4BECA 2KSQA 2V6IA 1GRQA 1S0UA 1IJFA 5EE0A 1W44A 2IYXA 2QPTA 3A1TA 4I4LA 2ZJOA 2CK3A 3M0EA 1CJVC 1P72A 2ZJ2A 5P21A 4LOAA 2WSSA 1YVDA 3L0IB 1MR3F 3BGWA 5FL3A 5EE9A 2FGJA 4MRRA 4GT1A 1CR1A 5DN6A 1P3JA 4AI6A 2ZUCA 1FUUA 1XPRA 1GSIA 1UM8A 4DB4A 5SZHB 3W8RA 2YWGA 4L9SA 2DCUA 2K5UA 4NYMR 2F9LA 2RHDA 2J3EA 2OV2A 3L43A 4OK3A 1MO6A 5KO2A 3PUZA 2XGJA 1DOAA 2W6JD 1WP9A 3AF3A 3H0KA 521PA 3LX5A 1KTVA 2IYQA 3GLFB 2J5XA 4NBSA 1Z6XA 3UATA 2R65A 4DWJA 5K8TA 1SKQA 2OILA 5AJVB 2O8EB 3O8DA 3BXZA 3HU1A 4NL4H 1D9ZA 3CM0A 1UBGA 1AKYA 4HEJA 5CK4A 3EASA 3C7KA 3UIEA 4B73A 1E96A 4UNPA 4ACAA 1IJEA 3D7MA 2OUKA 3LA6A 1QBKC 4GMDA 3SJAA 2P6UA 2R6GA 4BEJA 3T1OA 3IHWA 2IS4A 1E9CA 3QPVA 1NBMA 1U0HC 3IQWA 3WRXC 5KPJA 2Q0HA 2HT1A 3CZQA 1EX6A 1DO0A 4KYIB 3V00A 4ESVA 4S35A 5JWOA 2ATXA 2NO0A 1RRPA 2DYKA 2OT3B 3V9PA 2NO6A 1N6IA 3EC2A 2JLSA 1M1YE 2VTKA 3RC3A 3SQXA 1EESA 5KDOA 3F3YA 2EFCB 5LBIA 4W5WA 3Q7QA 1Z6TA 1OHHA 4ZDJA 1E9SA 1KY3A 3DKPA 4QGHA 3QKRA 1JEEA 1TF5A 3L2OB 3L0OA 1KZ7B 4CZ2A 1GL7A 1OB5A 1KJWA 1ZD8A 1QHXA 2ZU6A 1W4BA 3JZMA 3CZPA 3VKWA 2VH5R 3ETLA 2PX0A 3NXSA 2ZSFA 4IVQA 1OIVA 5KNDA 3NH6A 4DC9A 4MGYR 3I72A 3CNLA 2RGXA 4GOJA 3NG1A 2GRJA 2JCSA 2GXQA 1GKYA 4EPYA 4DZZA 2VL7A 2H1LA 3FOZA 3N5CA 4MITA 4BLTA 2WJHA 3DHWC 4J0QA 4LWZA 3GP8A 1N5LA 2C04A 3U5ZB 5G41A 5BYJA 5KSOA 1VG1A 1F2TB 1E79D 2IS1A 1N6OA 4LX0A 4PX9A 4Q1AA 4IHQA 1OIXA 2BMJA 4QBGB 1L7VC 1COWD 2PLFA 3UMRA 1JJVA 1WA5A 1CRPA 4F92B 2WWWA 5GJCA 2FN4A 2NGRA 1L8QA 1O3YA 4FN5A 2OESA 4URZR 1H8EA 1ZUHA 3KXLA 2YJTD 3LLUA 2GEDA 3SZRA 2J0QA 1RE0A 2GZHA 1KGDA 2BIFA 2F3TA 2F9MA 3KFVA 3O8BA 3QVUA 3QKUA 4OHWA 3ND8A 1S3SA 1K6MA 1YU9A 5C2JB 3W3ZB 4K8OA 4M1MA 1E2KA 3ICQB 3CF0A 5F9HA 3VKGA 2KWIA 2Q21A 4L4UA 4TSFD 3S1AA 3DO6A 3I62A 4MRNA 1G3MA 3GFTA 4D0NA 2NO9A 2BDTA 2ZS8A 1SXJA 3M6AA 4EPRA 4LC1A 3H84A 3MCAA 3ADCA 4BLQA 3GJXC 1KSGA 1U94A 3WMEA 2QAJA 3TVTA 3L8ZA 3ZYCA 3FKQA 1TF2A 3G0HA 5EP4A 1N6NA 3IKJA 1QHNA 4AG5A 2V3CC 2NO7A 4Z51A 2JJ1A 4Z1MD 2V1UA 1SULA 4RZ2A 3HPQA 1L2TA 5JLJA 5CDFA 3U3MA 5GJVC 3TUIC 4U5XA 5CLQA 1XTJA 3C14C 4P4SA 2CCGA 1MV5A 4PO1A 1E0SA 1N3BA 3AKYA 4BLSA 3K0FB 2C96A 1BO6A 1E99A 3NIBA 5KNBA 4LCBA 2GXUA 1ZVQA 2GBLA 4LJ9A 3ZH9B 3ZS9A 4PTLA 5J4LA 3DOEA 4US0R 2AKAB 2GJAA 4Q00A 3S1AB 5FH9A 1GWNA 2QORA 2XSZA 5JS7A 4HLUA 1SXJB 2YWHA 1DAIA 1WQ1R 2NTYC 3KKNA 2QM7A 4PQFA 4UQOA 2FZ4A 2GDJA 4PC6A 3NBYC 2JEOA 1OW3B 3I32A 1Z07A 4JVSB 4QG7A 4ZCMA 1S4QA 2FV8A 2KJQA 4MRSA 1XU4A 2Q6TA 4BUJA 3HJNA 2G1KA 1Z8FA 2OM2A 3QG1A 2ZAMA 1QHIA 1G8HA 4GZMA 2HV8A 2IYVA 3SNHA 4EPXA 2O5VA 3HR8A 5FUWA 1R4AA 1LW7A 3TE6A 1E32A 3A6PC 1CF4A 3LVRE 4QBIA 1SVWA 2ODEA 3P4YA 2O8BB 3CKLA 4TL8A 5LPNA 2UZ3A 3U60B 2YOHA 1E1QA 1QDEA 3JZAA 4E03A 2G0NA 3B2EA 3OFND 3EPHA 3MJRA 1P2UA 2QP4A 5D3MB 1XXHB 4ESHA 4IJMA 3KUCA 1AQUA 1ZCAA 2IYLD 1T3SA 3BE4A 4DIDA 3BFXA 3CH5A 4DCTA 1G8PA 3HR7A 5CYPA 5CK5A 2PJRA 3BB3A 3TW4A 1E2GA 2PX3A 2REBA 1AIPA 2H8KA 1KO7A 4IW3B 1GRRA 3AUXA 2IX3A 3TQCA 1RZ3A 3LVQE 4M1WA 2ZITA 3OAAA 2ZANA 1XCPA 1N6KA 1DEKA 2PL3A 2Q3HA 4PSAA 3NWJA 3LBNA 2I1QA 2SHKA 1JQLB 1T8TA 1HEIA 1E2JA 5LD2B 3LW8A 1CU1A 1YRAA 2A7QA 4RD2A 2WAXA 4Y0VA 3UWOA 1DPFA 2XTNA 1TU3A 3LWNA 4Q1FA 1D2MA 4F93B 3CNNA 3M1IA 4LHXA 3LAWA 3GQBA 3OESA 3PIRA 4HSEA 2FNAA 3GJ3A 3W6OA 2C77A 1P61B 3B9PA 1XZQA 3WNDA 1TF7A 4MKGA 3RS5A 3UK6A 2BMFA 1BOFA 4EPVA 3SJCA 2JASA 4GFDA 5J5CA 1II0A 5FUYA 1I4TD 5F2EA 1KDPA 1LNZA 4IDOA 4TT3D 1G21E 1OXXK 4KLZA 4Q4JB 1U8ZA 3U3KA 2DFTA 1CR4A 1P2SA 2XJ9A 1D6JA 4D4KA 5EJEA 3I1FA 4WZBE 3TUJC 1E6CA 4PQRA 3ZD6A 4A36A 3PUWA 3C5HA 2XNSA 3SBDA 3RYTC 3KJGA 1VIAA 4LUCA 2ZR7A 3THYA 3TSWA 4N3NA 1C4OA 4HZIA 3CRMA 1SZPA 3U7EB 3B60A 4F38A 4A0GA 1A5TA 3H1TA 3NH9A 3X1ZA 1OXUA 4DT1B 4JVLA 2WJJA 1OLOA 4MRPA 5E7JA 4Q66C 3W6NA 3MWYW 3QEJA 2CNWD 3AH8A 5FTJA 2ZSEA 1XF9A 4URWR 2IWHA 3VR6A 1WXQA 2O0KA 3GEHA 4DSUA 4XIGS 3SJBA 1OKKD 5C4MA 1F3OA 3RS4A 2ZSBA 3OE7A 5EQTA 1SVLA 2NPFA 2TMKA 1OPXA 4BFUA 4OYHA 5IK2D 1NN5A 3KB2A 3IIMA 1E9DA 2B92A 4IXMA 3I5XA 2W2VA 3ZD7A 4DLXA 1BH2A 1G3RA 1WB9A 1E2DA 1Z6AA 5CJPA 1CBUA 2DFNA 1OJLA 2BEJA 4HB0A 4FCVA 2BC9A 2C98A 3MAAC 3LQRA 1XRJA 2ORVA 4XJXA 3OF5A 4TQUS 3BD9A 1I2DA 3DL0A 2OSBA 1GNQA 4PZZA 1ZW6A 2IK8A 4B6EA 3A36A 2WKQA 1NSFA 2VP2A 4XD7D 4Q1BA 3AF4A 1ZMXA 5DE3A 1KAOA 4GI7A 3BS4A 3KL4A 1CIPA 1GNRA 1RRGA 2C8VA 4II7A 4QHTA 2W2XA 4CRWB 1KNXA 1T9HA 3EWAA 3I5YA 3ZVNA 3N2IA 3AV0B 4XSHA 4TYWA 3R7WB 3F0TA 4P4TA 3GLGE 4DDWA 4U00A 5FL7A 5HZKA 2EW1A 3OEHA 5LB2A 4BLOA 3KJEA 3TMKA 1SXJC 1XMSA 1OH8A 1M7GA 2VSOA 2WWIA 1D2NA 5E95A 3NHAA 2FPMA 4AKEA 4JBWA 2IWRA 4JLJA 2GJ9A 1Q20A 4TZ6A 3TIFA 1G20E 2BWJA 4NH0A 2F1JA 2QGNA 3T1QA 4NTZA 3UPUA 1TEVA 2HJGA 2HT6A 3B8HA 2DWQA 3LXRA 3ZVLA 1ZNWA 4OQNA
chains in the Genus database with same CATH superfamily
4GXRA 2PCJA 2I2AA 4IDBA 4E21A 1FPMA 1B76A 1UOQA 1OH6A 3LF2A 3K1AA 2JGJA 1CUEA 4MUIA 3IA7A 2VYFA 1UJNA 4MA0A 2RHOA 1UPTA 4MWDA 3E4CA 3OURA 4OQ4A 4IS2A 1Z7WA 2GBLC 2JGKA 2PGIA 1PZEA 1ORDA 1VKNA 2VHCA 1RYDA 2ZIAA 3HB7A 3I1IA 1WW8A 2OAEA 2RG7A 4MK4A 4MUAA 5HWSA 4O59O 4Q19A 2F8SA 4B87A 5JZSA 2P40A 1AGRA 1J2JA 1ZH0A 2YQ4A 3BE8A 1HDIA 1MB9A 2VIIA 2VSNA 2H52A 4M6WB 3T8YA 4FB4A 2IHYA 1UFRA 2C4NA 2VS1A 3U6KA 4TV9F 2CD7A 1TK9A 1ZINA 3GJ8A 3P2MA 3OOHA 3GUCA 3H9GA 1GIAA 1UP4A 1SQSA 2B20A 3FMPB 3M6LA 5CMLA 3LSYA 4Z4HA 4H77A 3FPGA 4C03A 1E4EB 1XZEA 3WWCA 3NGMA 4UULA 4HGPA 1G5RA 4BZXA 3ZBUA 4ZK6A 1C3EA 4XQ9A 1RI2A 2ETXA 3HNRA 4I8IA 3P96A 5IRCD 1IXSB 3NAQA 4Q21A 2VPZA 4OFBA 3E1KA 3LBFA 1GCGA 3DM5A 3V8BA 3ZZ0A 4JJKA 4UAVA 4IUCS 5JRDS 1T5TA 3H4MA 3T7CA 1XQ9A 2R7LA 2X9NA 3MGBA 3NTUA 5LJLA 4E1VA 1KI4A 1MDFA 4R3UC 3CINA 5KMGB 4AD8A 3I12A 3EOZA 1NOIA 3DLHA 3P20A 3FOAA 4CEHA 3H17A 1PK9A 3ESDA 3QWHA 5EQDA 1BEEA 3K9CA 5IM5A 1THMA 4ID3A 4NS1A 1MQAA 1TW3A 2Y1DA 2ZYAA 4NK4A 1OAKA 3JS5A 1ICEA 2QPLA 3C39A 3DPUA 3ESAA 5HP4A 3X1DA 1ZN8A 4WLFA 3LQYA 1NX9A 3HXTA 2PTHA 4OPMA 4GRIA 4GDFA 1F0YA 1O58A 5JO9A 2WWHA 4P81A 4ZOLB 3NP7A 1E3LA 4YJHB 5IJXA 4CMIA 2O8DB 4L4RA 3C3XA 1BCRB 1B6GA 4GYJA 4ZO4A 3U3RA 3VH2A 3ZWQA 2G7ZA 3O91A 2ZZNA 5KYGA 3LT4A 1BJKA 1S2OA 2JKVA 4W8OA 3VO2A 2M1XA 4UMVA 2WJ4A 1KI9A 4YMGA 5LQUA 5CFNA 3DV0B 3MBIA 2JGEA 1GTJ1 1SC3A 4JQZA 3A4TA 3I8XA 2O0LA 3PNVA 3SYTA 3TTTA 5LQMA 3RSGA 4Q47A 3FBTA 3IEMA 3O2NA 2O8FA 2JLAA 1YR9A 3DMTC 1YOVA 1N7HA 3U31A 2I7VA 1JKFA 3ECAA 1QNLA 1NR5A 5I9NA 2YYSA 1JE1A 5B58T 3EMDA 3B6JA 1EK2A 3MXTA 3FNFA 3HA2A 3UMYA 2V7TA 4NI5A 3ILHA 3AEUB 3HV2A 3V7NA 3U4QA 1E6MA 2PGLA 2YJNA 3BKWA 5E3JA 3VPHA 4JLOA 1O0SA 2W2TA 4L8FA 3INTA 4EUEA 3HVRA 1HQKA 4CNBA 3FGZA 4DQKA 2FJPA 4GR5A 3JD1A 1P6XA 3WGZA 4H16A 3GFRA 4LNAA 3SHFA 3TPCA 2WJ3A 1X1BA 2DAPA 3C74A 1RZRD 2W2KB 2XZDA 3UJDA 1U99A 4QDTA 1JXMA 1LPBB 3EXIA 2P8SA 4EELA 1AD2A 2O2CA 4DRZA 1KS2A 3IBSA 4PFQA 1EJ0A 3RV4A 2V5UA 2EBUA 5JBQA 1E2BA 2PPLA 3A6JA 3TOSA 1UXKA 4RHXA 1CIJA 1E5TA 4O25A 4A6DA 3WWPA 4F8YA 3EXG2 4TQGA 1WX1A 1G2OA 1TADA 2CLDX 2G9VA 1SVOA 3O4IA 4G2TA 4RJJA 4WDQA 3WB1A 5AUOB 3WK7A 4PHFA 4R7ZA 1MKYA 1OZFA 3THOA 5H68A 3G2KA 3SZLA 4GDMA 3AVWA 1P4SA 2XAUA 3WQSB 4UM9B 1RKBA 2IFTA 3DTTA 3KDPA 5KREA 3K9GA 3SBEA 1TAHA 2XQGA 2V54A 2OBBA 4XJSA 3S2FA 4U9UA 1K7XB 5KWEA 3IRVA 1PQWA 3QF4A 4IEEA 1UBMS 3UZUA 2WABA 4KFCA 5AK6A 3MMZA 2GPAA 2SICE 2QP3A 4EIWA 3E7DA 5B1YA 3DFMA 3FAZA 4UOEA 2AD1A 1I7QB 1T2FA 4WH0A 1XQXA 3KLOA 4HC4A 4MARA 3AERA 3ETJA 4MVJH 2A14A 5B36A 4O4HB 5I6DA 1QE3A 3D1LA 3DD5A 2Z43A 1I2BA 1U0BB 4WZBA 3B1KA 4EYQA 3RTEA 3AI1A 1GG9A 4L4XA 4MDFA 1DLJA 1A2BA 5DW3A 1VLZA 1Z47A 5FAKA 1T4MA 4TRJA 2XA9A 2I7XA 4ENVA 2ZYGA 2B8JA 3LQQA 1XKTA 3L7NA 3LCUA 3AFHA 5KNBD 3S2YA 5KTOA 3EG5A 1CY7A 4YP6A 4IR7A 1PTJC 1X1QA 4KQXA 5BOVA 2JKZA 3OUTA 4BCBA 1C3VA 4ZIRB 4BDTA 2A8YA 5DH9A 4UZFA 2NU7B 3FOBA 3NOVA 2JVIA 2AHOA 3GPCA 3VU9B 4FKBA 4PE5B 1I3KA 4D9GA 2VZ0A 1C7FA 2XPCA 4MKFA 3ZEIA 2BE7A 3H8VA 3OEYA 4IFBA 4KRYA 4NENA 2B2XA 3G1WA 2IGTA 1GQOA 3WZMA 3ZLVA 2PD3A 3VSDA 1RZVA 1IY9A 1RD4A 3PPIA 3BQ9A 3GMTA 4FFLA 3EIFA 1ECCA 2WHRA 2ZYWX 2KI5A 4ZO6A 4D9MA 1LCIA 2Q6IA 4P5EA 2C07A 4YNBA 1ULAA 1R4ZA 1XNGA 2CHGA 2REOA 3S0JA 5BRJA 4CEJA 3J7TA 4W8HA 2HKIA 3OI7A 3GEGA 4MHOA 4W7IA 3PFFA 2FXVA 4IJ6A 5CCEA 3PZBA 4Z0NA 1EFHA 1SAYA 2VF2A 4L15A 2ZAYA 4OYYA 5AKHA 4LS3A 3L41A 3NHJA 4BQOA 4X8HA 2VP0A 2R751 4BY9E 1HUQA 1PEYA 2C2YA 2IIBA 1PG0A 2QHXA 3OLWA 3QKSB 4AKSA 4BC1A 2XF8A 3R40A 2JFOA 1L4YA 3KTFA 3PL5A 3TQOA 2JHPA 5B30A 1FMLA 2DBRA 4XWGA 1H69A 1XPOA 4PHTA 3DNMA 2GBPA 2OD7A 3AHEA 1RBZA 4KXWA 4HVCA 1KF0A 2AG5A 1SKUA 1TJPB 3EVTA 3NEJA 4BLRA 4HAWA 3PXXA 2QUHA 3UHJA 2VXOA 3G9UA 4RH0A 4TTQA 3ZX5A 1TCVA 2GR9A 4ND2A 3ZWPA 3GLGA 4G8CA 1PLKA 1SCUA 2XGMA 3IBGA 3M6XA 1HORA 3TFQA 4DILA 3EGXA 1Q19A 4YRGA 5JAOA 3PRHA 3JTEA 1E6UA 2RHLA 2CLMB 3MFQA 1RSZA 2ZM6B 4KVFA 3PQCA 3ZUPA 1Q3KA 5CIWA 3QY9A 1N2SA 2EJWA 3EDRA 4F60A 3A1VA 5B37A 3WYFA 4LXUA 2B4RO 1DPGA 3H6HA 3HU3A 4RGBA 3EX7C 1G20A 3ZDEA 4PONA 4MUFA 5AYVA 3R0QA 4DQDA 2Q3EA 1RCTE 3OAAD 2UVPB 4MJLA 3MJHA 4RS4A 3FFXA 4AS3A 5DTEA 3CVOA 2I8CA 4KQMA 4Q1CA 3PLNA 4WLVA 4CKWB 4RIFA 3H8JA 1FTSA 3KQNA 2WG1A 3R74A 3BXXA 3TG8A 1DQNA 3EF1A 1CS4C 1GNLA 5LMUB 1EP1B 1UMCA 4MR7A 4CVNA 1Z0AA 1IWOA 1KMQA 3PYXA 3JQ8B 4KLNA 4OMUA 4DCSA 3UMCA 3NAMA 4MVJF 5K6AC 1Z56C 2I6SA 1QZUA 2KB0A 2UDPA 3JALB 1WJGA 1C7EA 4KXYA 4Y9SA 5HM6A 2VDJA 2FAXA 3NTVA 2FRDC 2H4WA 1AC5A 3W79A 5ALHA 1L4NA 2B36A 3JQ7A 1E0JA 1EM8B 2H1SA 1BN6A 1EVQA 1RBQA 3HADA 3HUFA 1CUBA 1VXOA 4TX1A 1F1BA 1HTTA 3AK4A 4JGBA 3LOQA 3G79A 1Y4SA 2YJGA 5DYTA 5SZKB 1A9TA 2OHHA 1O87A 2QNIA 4JZKA 1KJJA 1PFWA 1NVXQ 3JQBC 1I5EA 1O6BA 1V1MA 2VK2A 1M5TA 2Q8PA 2YW9A 4QU8A 5JHGB 3ER6A 3R3JA 1NUUA 2Z30A 4ZV7A 1PE0A 3S2UA 2W11A 4YCNA 5KPDA 4WPGA 4N48A 2F4VB 1L1RA 1DTWB 1OFGA 3OP4A 1U7PA 1XAHA 3IVCA 4GOND 4OP2A 4GP9A 4UBIA 1P9OA 4DIFA 3GLIE 1TLFA 2ZLBA 2CT8A 1W46A 3R8CA 4BHTA 3TI7A 1KMMA 5GV7A 1I3CA 1AQNA 2B6HA 4D4JA 5CDTA 2UUBB 3GFOA 4X00A 3I30X 4C4ZA 1KE1A 2OV1A 3V2GA 2QTWB 3KWLA 4AICA 1M1NA 2FW8A 1EDBA 1SRQA 2FG7C 3FFTA 2G9NA 4ALJA 4D4GA 4POOA 2XB2A 5I3ZA 2G5TA 3MEQA 1XZFA 3UCEA 2XXAA 3EH1A 1QWOA 3ENWA 3JVVA 4Q7LA 5C1PA 1C5KA 1QOPB 2Q1YA 4Q3OA 3OE7D 1DAGA 1EX7A 3FDZB 3FH0A 4R2LA 5TVKA 4NULA 3MHPA 3FLBA 1JJAA 1M2VB 3EQ9A 3HHEA 3LCCA 1EFRA 3GHYA 3HYNA 3PZRA 4QDUA 2FW0A 5CTAA 2OCPA 1EVYA 3I2KA 3L0SA 2DMRA 5A4AA 1P62B 4RO0A 4NCKA 4BRWA 4P1ZA 4G97A 3LUDA 4NKRA 5J9FA 1FSZA 1CRWG 1NMYA 4MUGA 3U7JA 4BNKA 3B5JA 3WAKA 1U0LA 1R0ZA 1XEWX 2BGKA 1R0RE 1YJBA 3INGA 3FLMA 1YL7A 4JR2A 3T0IA 3FVVA 3JYLA 1UEJA 1GUFA 3VNRA 1EGMB 1MF7A 2FSFA 3BCSA 3VO9A 4G0ZA 1G7TA 5E4TA 3RBZA 5AVXA 1YQTA 2O3JA 1N6PA 1NAHA 1NDHA 4HRXA 3U7HB 3IB3A 1Y7HA 4M9QA 4BWVA 2K7FA 1U0OC 2F67A 4DRXB 3LXXA 4FFDA 1NQXA 1BXZA 1UZUA 3FRHA 3IR5A 3BYZA 4KH1A 1ZMTA 3CNQS 1OFIA 1O5TA 4IIGA 4NBUA 3P7MA 3GC6A 4JYCA 4KPFC 2PUHA 5JAUA 1MCZA 4R8VA 1C1YA 2YY7A 1HZZA 1T9GR 1XZGA 2ORWA 5EN4A 4DCJA 5ILOA 1U0FA 1TU4A 1RXWA 1UZAA 4QYXA 1XRRA 1ZN9A 2OBYA 3AP3A 3GW8A 4DGQA 3GBVA 2YWDA 3G8CA 2Z5FA 1FC0A 4KR9A 1N77A 2A78A 2ZDHA 1RRVA 1GKUB 4HNAB 3CONA 1U5CA 4TGLA 5LA6F 1T26A 1MX3A 1ATIA 3SFZA 1Y9DA 4RVOA 3HI4A 1FU8A 1IZ8A 2WF9A 4IIBA 2G0AA 2ZJZA 3BJIC 3L46A 4X7BA 3UJNA 3FPBA 2ZWIA 1KQGA 2ID8A 1HNNA 3DDOA 3C5EA 1R0CA 2OD9A 1FFSA 3LFHA 4K9LA 3RFFA 4DLKA 4NP6A 4E30A 1ONNA 1TUBB 5AI9A 3QEBZ 2I3GA 5ER6A 3UJ7A 3P0HA 1OR8A 4RK6A 4HDMA 4O4IA 5KTKA 5K03A 4LTNA 4IH4A 3VVLA 1KAHA 3F67A 5K6RA 4KK3A 1GZSA 3K0AA 1AHIA 3QSYA 2NV0A 4YHHB 2ZWPA 1MJHA 2Q2VA 4KAFA 3NVKI 3GZNB 4TL6A 2H4HA 3OJLA 4JUAA 3HEBA 4PX5A 2X0FA 5A06A 4ZCRA 5LXTB 3QEAZ 2VKQA 4Y6RA 3ZIAA 1PYDA 3HDHA 4ZAGA 1XDGA 4UXIA 1QFJA 2RJ3A 4EGQA 3V4FA 1D2EA 1WNTA 1YQUA 4X64B 1MQ9A 5CAEB 2H4YA 3HE3A 3KR1A 2BFFA 4DBLC 1GZVA 4QUIA 5EIFA 3ZUGA 1U2DC 1MB3A 3BF7A 2XA2A 1R8XA 2AC4A 3ZDXB 2ZRHA 2HK8A 1Z37A 4QUAA 3STUA 1YZQA 1Y3IA 5BR4A 2M6RA 5EA2A 1ISJA 2GJSA 1QB8A 4W1RA 5AWFC 4NSNA 1GDHA 3DOHA 2XQKA 3DZ8A 3RRMA 3QVSA 4MQFA 1R74A 2I9KA 1VI6A 2KPOA 1XI2A 5E6UB 2FUG1 4TVKA 3FKSA 1G9TA 1VDZA 1E1LA 3NRCA 2F4NA 1JQBA 2WMYA 1GNVA 2AMVA 4YJ3A 5G0UA 2DY1A 2ZETA 1FF9A 2G04A 2OE2A 4K3UA 2P2YA 1B3BA 2EFGA 4MVJI 2W6QA 5FTLA 3KQUA 2RHRA 4Q93A 5KNBH 3LY8A 1JAYA 1AXEA 1JT9A 4KPUA 3BXHA 2JFZA 1PG2A 2ZRCA 1ORWA 2QJOA 3KB8A 1JU4A 3N7TA 1O89A 3DYIA 3PS9A 1H3FA 3I3OA 4HAOA 4ND8A 1XZIA 4FEYA 4E88A 4ARSA 1EXDA 2PLNA 1AX9A 2DF8A 3GJ4A 3HJHA 3WSWA 2C9CA 2WMDA 5IC5A 4N5MA 4WRRA 1Y1TA 4G3XA 2LZ0A 4V3BA 4P31A 2WTEA 4I9HA 3RC8A 2AFHB 2OXRA 3B6ZA 2YXPX 3F78A 4LGCA 3RM3A 3TNDA 5FT9A 3KYDB 3ROKA 4BO3A 3ZVMA 3MSXA 1ZCBA 4B3HA 1DXQA 2QJTA 5EJGA 1MAHA 5C8ZA 4DBZA 2HWXA 2NO5A 3DE6X 1CZLA 4WBSA 3ZCUA 4BV9A 1PJCA 1EU1A 4LXXA 4NE7A 4EJSA 2J3JA 2JIMA 4Y6SA 4YDSA 1R8YA 1JQDA 5KSYA 4AZ3A 3KBBA 3ILXA 3TLZA 3K4PA 2XUJA 1YBHA 1LI4A 1SN7A 2YJ6A 5FD8A 4DDTA 3BGVA 4ZPJA 4HJXA 1VG9B 1YK1A 2D1YA 3EOAI 5IT5A 4JU8A 4XASA 3O3OB 1SXIA 1DBIA 1F8FA 4R9VA 2OCBA 4V0LA 1Y34E 4KHZA 1V5GA 1D9XA 2Q8QA 4N4AA 4P2BA 4NAVA 5JCZA 2JVJA 3ZNPA 3WLMA 1ZM2A 5FWDA 4P9NA 1GTL1 3BRCA 4F9EA 4YT2A 1EXNA 2B4KA 3PE6A 4Z54A 2O3TA 2VAPA 3PHCA 2O52A 4NJMA 5AW0A 3CRW1 3UGTA 5FWAA 4PG4A 2WAMA 3ZY4A 1P77A 1V96A 1MB2A 2NQTA 1QYVA 2QTVB 2QMOA 1YJ8A 3AQ4A 4CG3A 5BSWA 2NU9B 4QU5A 3AHCA 2G40A 1X7WA 3ABZA 3PX3A 1XT6A 4NAHA 3EZFA 1PV1A 3Q41A 4RANA 4YO8A 1HQYE 3T5MA 1O95A 3GEIA 5F33A 4PG5A 5KTYA 2JLQA 3DDWA 1KO8A 5D3KA 1W36C 4KMMA 1P7ZA 4M76B 4TM7A 2F59A 5DXAA 2ISCA 4D4MA 1CUXA 3CKYA 3T95A 1VIYA 1LPSA 2UU9B 5EPEA 4M60A 1DCMA 4Y9TA 5BO5A 2UXCB 1CJSA 4KIWA 3HJAA 3QXHA 4J9UE 3BM5A 4AY2A 4GE0A 1GPBA 3TX2A 4HV4A 1DI0A 4YJGB 3H6KA 4P35A 3KOXA 5BNZA 4HLNA 4JXZA 1JEYB 4LF8B 5I8WA 1BRTA 3LO8A 4UUQA 3WGHA 3VPGA 2BBOA 5CYGA 1T2CA 4MV4A 3SS8A 4W99A 1L4HA 1Y98A 1LPPA 4LSGA 5DO9A 3FYSA 3UC5A 4I1VA 1G16A 3GD7A 4XX1A 3DR3A 5T6MA 1YT5A 3OF3A 2CDNA 2XDAA 2F3QA 1DAEA 1FDIA 2JGLA 1E1NA 2XHEA 4U6SA 4XDHA 2ET6A 3VYSB 4PWZA 3VMFA 5HQ3B 4EGAA 1NKSA 1MGPA 3I0MA 2GAAA 5KJCA 1TFRA 5DSXA 4ALKA 3D3NA 4F97A 5JUWA 3WGUA 4E5DA 2ROQA 3HSYA 3IDFA 4B7CA 3TLCA 2PUWA 4ENSA 3LW7A 3OPYI 4AYTA 5AJTA 1Z5UA 4DQUA 3O26A 2E4YA 5CW1A 4BO1A 5K3OA 3AR4A 4Q9DA 1M1ZA 3EC7A 1I8TA 3GRYA 3NVAA 1ZRNA 4BVBA 3SICE 5HHTA 1GLNA 3TR6A 2RGWA 2AKEA 4MDEA 3SKVA 5FORA 4EHDA 2GMWA 1RP7A 2BMAA 2MWMA 5BNFA 3LTEA 2JG3A 4A4DA 4DZRA 1FLVA 4RFSA 1EUCA 2MDTA 2OV6A 3EQ2A 1XAIA 5HF6A 2EKBA 3ZHXA 3HBNA 3L8MA 1RJ9B 5EQJB 4C3VA 5F5XA 1U6IA 4U7FA 4ALLA 4D0RA 2RHJA 5A4FS 3WIOA 2FG5A 3HCWA 3HUUA 1N7JA 5CG1A 2CC2A 5DXJA 4EUSA 2PT9A 1N0VC 3Q6IA 4P4UA 3PQ6A 3LUFA 1XTUA 4JT2A 1XOIA 3ASZA 3AHGA 5ALXA 4R6XA 5G0TA 4DA9A 1WOYA 4DIEA 1RLMA 1DBPA 1U0JA 2J32A 4G5FA 4NVRA 4NCNA 3U4GA 1XYGA 4KWTA 4JROA 4EA6A 2EFJA 2GM4A 3MOSA 2BUBA 2C88A 1HQDA 1X7XB 2JFHA 1QCYA 1YJQA 2N47A 4GX2A 4IYRA 2BFAA 3H1BA 2ZJYA 1DDIA 1P29A 2K7ZA 2CB0A 2YH2A 3PD7A 3T34A 3OTOB 1JJBA 1TO6A 1TZBA 2QRVB 3K16A 2YN0A 4U8HA 3AVYA 3TEMA 5I7WA 3V4OA 1BH6A 4IIJA 1AGPA 3HKBA 1JFFA 4CW7A 3PQ3A 5AVOA 4DC1A 4D2IA 5GOTA 1V26A 3V1UA 4ZI7A 3GRPA 3IOYA 5CB8A 4MGEA 4FOTA 3LT0A 2JHFA 2HZ7A 4JVOA 4V02A 4DR2B 2BFMA 4PANA 2XB6A 3KAKA 3TTSA 4I2VA 4C0AC 3U4QB 2VT3A 3OCWA 2HXYA 1I5OA 2FWBA 4HLUC 4ILKA 3F4LA 3VKUA 2ZYSA 2QT1A 1X13A 2E82A 1C41A 3U5TA 2CUZA 2BE9A 1SH7A 2BHTA 3BWDD 1ULTA 3C41J 4ALNA 1R0LA 2CHUA 2HHLA 2FSGA 1WY7A 1ZOIA 4R3WA 5CH3A 3S1SA 2C3YA 4CTKA 4RQAA 5TEVA 1K2VN 4OP3A 3JYQA 4MJ7A 4QQKA 1SURA 3TIXB 3B1VA 2O8NA 1KOFA 4AY6A 5CB4B 3O03A 2VSXA 3IIJA 1OSNA 4S24A 1RXUA 2O2XA 4DV4B 4KBGA 2W70A 4EHIA 3ZDDA 1ZHHA 3H42B 1FJ2A 3R3YA 3COPA 1T9BA 4XVRA 4DLVA 5LM3A 1NMEA 2DM6A 1EXWA 5JMTA 4AY4A 2HIGA 4RXMA 1QIFA 1RC8A 4FNOA 4KIJA 2ZWAA 4XOIA 1LC3A 2FSPA 5FLKA 4XWAA 4P7GA 2RD2A 1Y82A 2GZMA 4MW5A 4BZWA 2Y1FA 1P2BA 3PCTA 3STXA 2YWJA 2FPGB 5I7FA 1R9MA 2J6CA 4G67A 3C24A 3K9BA 3NNDA 3O0TA 4B8YA 3JAKB 1YZVA 2B5WA 1OYWA 3G0DA 3K6KA 4MEAA 4UBLA 3ZDZB 4QL3A 4BNNA 3H13A 3LBYA 1VOTA 6ABPA 5H02A 2ZUFA 4PC7A 4UXJA 1ZXXA 3HZOA 4FK8A 3AHIA 2DE0X 3TNFA 4YJ2B 3TN7A 1HT3A 3ENZA 5CJ2A 4ZDKA 5ABPA 4IJKA 1RLJA 4X84A 3OKAA 3TQTA 5HG0A 1E6WA 4AJPA 5KHOC 3MWLA 1F0NA 1QU3A 3FNRA 1KJQA 4Q15A 2GTIA 3NOXA 1A96A 1W36D 3FWPA 3C1OA 4A73A 3JQAA 2QAGA 1A9SA 1FFWA 3Q2OA 4A27A 3QKIA 1BDJA 4RHCA 1OX5A 421PA 4UHDA 2I67A 4ZAXA 5A4IS 3TB6A 4YP7A 4CCYB 3ZWDA 3DOCA 4C2TA 3NOQA 1BS1A 1SOVA 2NXWA 2V96A 3H9JA 4R5HA 2XT9A 3UOWA 4OAPA 3JWGA 3GEMA 4N54A 4LF5B 4OHMA 4HH0A 2E21A 1RPTA 2FCAA 2IKSA 3CUSA 3MILA 3Q7RA 5ALNA 5BSTA 4M7PA 3T4XA 4DAOA 1GA6A 4EKIA 4AQ7A 1GGHA 3NKFA 4EVSA 2AFRA 5CIQA 2ZM5A 4R54A 4HNUA 4PY2A 3RWOA 2BR4A 1Z7YA 4MVJM 3QXCA 5CXSA 1WBJB 5LWQA 1EFRD 2VJCA 3N3AC 1AHPA 1VTKA 3REOA 2CLHB 3D8TA 2HHJA 2G0TA 2GOYA 2P78A 2VT6A 4HFRA 2R5FA 2QTRA 2WDPA 4A2WA 1DWQA 3KJQA 4RM3A 3QMPA 4UPVA 2GLUA 3ND9A 3DC2A 4L85A 2OQ2A 2J0UB 7GPBA 2FWMX 4N3CA 1EXMA 3Q9LA 3IP7A 2KMLA 1FFXA 2QD3A 3I9FA 2PWZA 5G1NA 2HPZA 1V5IA 5FTWA 1QGUA 1UPBA 2GVNA 2IPXA 4EITA 4GRDA 1XZJA 3QRWA 2PYZA 4WZZA 2XZLA 1I32A 3FCCA 3G2QA 2FRVA 1SHTX 2FSHA 1JAIA 2VWPA 3KDAA 3IFSA 3ZDQA 1T8PA 1ND5A 1PGOA 4CYMA 4OUDA 4K46A 2FEOA 4RH1A 1NPTO 3O0DA 2JAXA 3VPAA 5EJ7A 1JTVA 1Z28A 2P9GA 4OQQA 4QULA 4RNCA 2RGAA 5M34A 3OLCX 4IX1A 1NKVA 1ISRA 1STOA 2KW5A 2NSDA 3M89A 3GLHA 4NYIQ 5A3JA 2OHGA 4RORA 2G06A 3ELWA 1E58A 2QM0A 1GRNA 2DSNA 2CD9A 1PEDA 1NTRA 5F7ZA 3CIOA 4OL9A 3DVRX 1VJRA 1E9EA 1I2CA 3E1SA 4J43A 4XFKA 3Q40A 3LT2A 3ZLBA 2FMIA 1M7HA 4ON9A 2QZ4A 4N5DA 3A9WA 4IHJA 2ZUWA 4MV8A 3DEAA 2M6KA 5BV8A 4TWJA 4MV3A 3R0VA 5KKNB 3BGSA 2ZUBA 1BDHA 1CT9A 1JIJA 3QMMA 4F4IA 5NULA 3HSSA 2EWMA 2PIAA 3ABQB 4HNRA 2ZR9A 4IJ5A 4JU9A 4WJLA 5M04A 3RUHA 3QX9A 4L4SA 3UXMA 4BNTA 2PUAA 2O05A 5EPOA 1LPOA 2W8BA 2RGYA 2ZRKA 4H59A 4OD0A 5L3SB 1GU1A 5FBRB 4DLRA 4BB5A 2PKQP 2QSUA 4Y2YA 4LNUA 1SBNE 1CHDA 5GQSA 1NVDA 2REQB 4N39A 1JB9A 2CLIB 4QSMA 3S8MA 3FCYA 2Y0EA 5KS2A 2IOQA 1NN0A 2CL6X 5DWVA 5E6SA 4AYWA 3RHSA 1X3LA 4LZJA 3IHLA 1UFOA 2CUTA 3K1YA 1PX0A 4O0MA 4OJQA 3HB4X 3QWIA 2PL9A 4J7XA 2PT7A 3IQXA 4EHLA 1OH7A 3NGXA 1MRNA 1T36A 4AB1A 4XPZA 1L7PA 3HCOA 3DUFB 4Q7JB 1HDGO 2JFXA 4MULA 3NM5A 5DCYA 5E8JA 5HBRA 5ILQA 5ARDA 3AKCA 3C8ZA 2Z1MA 1KJ9A 4E5KA 2EL7A 3C6XA 4HH4A 4XIIA 3GFSA 4XFDA 1P9RA 4DN6A 1AB6A 4JI6B 4ND1A 1JUDA 3DZIA 4E2WA 3K6SA 5F3WB 1Z62A 2FZGA 4DLWA 5IXJA 4MB2A 3NDIA 3IUQA 4KQHA 4M1KA 3A4MA 3DQZA 1ONSA 4A82A 1C4WA 1F2UB 1BEZA 3FKSD 1AK9A 2GN2A 4KRXA 2R00A 1FB5A 4YRAA 3LIIA 4J1SA 2HNAA 2MJLA 1XMVA 2VHUA 2W98A 8ATCA 4DR5B 1YS9A 1XA0A 1QQBA 2O5CA 5AM0A 1P7WA 2IOYA 3R41A 1ZA2A 4FFPA 1T0JB 4CV0A 1XHEA 4FX2A 4BVLA 2C9BA 4F4UA 3H65A 4DCVA 1XCOA 5C3MA 3LY7A 4PC3A 3PRJA 4KO3S 1Z0ZA 4U7DA 2YWEA 3IPCA 2PJUA 3I4CA 4M2LA 3DJYA 1QRTA 4FGSA 5AFSA 2O59A 1DO2A 1M74A 5EVCA 4ZT6A 2B94A 1FFEA 5KQLA 1GGFA 1N0HA 2FOIA 1MENA 3OZDA 4CKCA 2FPUA 3NXKA 4KJZA 4D6YA 3M70A 4UXHA 5L7WA 1MAAA 1XZHA 2O3UA 4K86A 4QPDA 3CZ4A 3QEKA 3VKGA 4B7ZA 2X1LA 2WRZA 2QLBA 1NVVQ 4YECA 2ONJA 4EO9A 4AKIA 3KJNA 1LDMA 1IC6A 2BISA 3AFGA 3T1TA 2FDRA 2OLJA 5J2TB 3CRRA 2HI0A 1Z0SA 2HLNA 1HI9A 4KQ9A 2Y4NA 5T4FA 4HAXA 1Q7EA 3QLEA 3IP5A 5LBTA 5LBUA 3S7ZA 2A30A 1V3TA 4XARA 4CFSA 1XTZA 2L17A 4Q3DA 4KU4A 1HNZB 2Q3FA 5AR1A 2ZB2A 3K31A 3LECA 3ZHTA 1VE5A 3CR8A 2H18A 3E58A 1PFKA 2C20A 2NZWA 1FRZA 1JXAA 2PCLA 5EKSA 2CV2A 1Z08A 2NW6A 3HLYA 4PVCA 3DVAB 4YAEA 5DULA 3WLSA 4HR7A 3TSCA 3U4HA 4Q37A 4EHAA 1J0DA 4LFBB 1UBUS 4PC1A 3S7TA 3IT1A 4DCUA 1F1JA 3SC2A 4HQ0A 1EKXA 3W2HA 1Y3AA 4BX3A 1NVKA 3CVUA 3N5KA 3QF7A 3BIXA 4DIMA 1L7DA 1N5DA 2Z5GA 3C8HA 4HUTA 5BY2A 1FNCA 1UBTS 4B48A 3EGDB 1M1XB 5KJ6A 2Q3JA 3ZKWA 5JS2A 4X7RA 3S2GA 4ASUA 5G53C 3WKEA 1SOMA 1CXZA 4F56A 2QAGC 3IBYA 3VKHA 1OA1A 1LBIA 2Q4DA 3ED1A 1SXHA 1OT3A 1YB4A 2HMWA 1QRDA 3IPRA 5DX1A 1T5BA 5B1EA 1RKXA 3SEAA 2PX6A 3HKEA 1VJ0A 2FZWA 4CQMA 1PR2A 4BQIA 4YJFA 2F1OA 3TECE 4AX4A 1UQRA 2DBYA 7YASA 5MN4A 4FW8A 3ZLTA 3DDUA 4Z8XA 2NPIA 3EG9B 4KO1S 2ZCVA 2RH5A 3EISA 3EZNA 5K0LA 2RI6A 4QOEA 4TMKA 4QEDA 1IN1A 4EFDA 4DSNA 3C4QA 3K72B 1P45A 2BDUA 1INLA 5CLIA 1CUHA 1FX0A 3KS9A 5EOVA 3VRHA 4YCSA 5J4KA 3BDIA 4PO8A 1NE7A 2DPGA 4DWOA 4BJ6A 4EARA 2O7RA 4HDOB 1JX6A 4DIOA 3JAWB 1O54A 4J3FA 4NXMB 1ZS9A 8ADHA 4YAUA 4FIDA 3GJTA 1QC5A 1YHYA 3I04M 3D3KA 1SBYA 3PVCA 4GBGA 3HVKA 3OEWA 5AHXA 5BVGA 2EW8A 3BMOB 5M29A 4DMMA 3A6DA 1OWNA 2C7VA 1VYVA 1NF8A 2BSQA 3GEEA 1F17A 1K6IA 3DBHA 3W7BA 4BVGA 4Z5XA 4RSRA 1JIQA 3NASA 3LTNC 3FPAA 1X7YB 1SD1A 1RYHA 2UYGA 3NDRA 4KOAA 4PYIA 3A6ZA 5KSPA 3ZGLA 2NU6B 3QJGA 3ROGA 2B3DA 2IE8A 4Q7KA 3D2AA 4OV6B 3GJ0A 1WCXA 2VXCA 4H60A 1JTEA 5DHSA 4ZO8A 1GPNA 1F4PA 1RWXA 1SHLA 2DBZA 1MFZA 2B0JA 3EY4A 3Q5EA 4UFNA 4XH9B 4EYSA 2J9RA 1FLNA 3E27A 3THWA 4YLEA 1P91A 3FCOA 2FN9A 1T2DA 1N5KA 3SSNA 2Q4EA 1KP2A 2D1FA 4I9UA 3WADA 4BGIA 2QZJA 3K3PA 2GD0A 3SZ3A 2P3OA 4QUDA 1YRYE 3FOCA 2VK1A 1NIPA 4MVJG 1FRQA 1QHGA 2X86A 3A2KA 2K2WA 2DU8A 3PXGA 2Z8XA 2R1VA 1K66A 1A7UA 5BN3B 3HCEA 3IO3A 4HYEA 2DHDA 2BGUA 3OCCA 3FNHA 2CYCA 1X8XA 3OT4A 2H2AA 1PSZA 3B53X 2QVLA 3KU4A 2G4CA 1Z34A 2AFIA 6Q21A 5KYXA 1TJ3A 1X8LA 4KIUA 4MS1A 5IKMA 2ZBPA 2HADA 2AW3A 2OOKA 5FBVB 2GX6A 5C0OE 2EV9A 2HMTA 4B3CA 3TM5A 2AEMA 2WE8A 3R5JA 1DWUA 3IVGA 5C46F 5K8LA 2VAVA 4CM8B 1MFPA 1Q83A 1QS0A 3L1JA 3JQ9C 3PSHA 4L2IA 4NATA 1Y5MA 1HSOA 3PIDA 5TQ0A 4BV8A 4ZVLA 1DADA 4EYGA 2UZIR 3B1WA 3GFGA 5DGXA 4IGKA 4RD6A 1U9CA 2JJ8A 5DM60 4CDRA 4TSKA 1CERA 1JHAA 1Z6GA 2PVSA 3CTPA 3PC3A 4Q4LA 5ALQA 2AMLA 2CFOA 5DMHA 4XX0A 1DZ3A 1E7YA 1JNXX 3U44B 2QYHA 1FNNA 1EWYA 3N0RA 2WFLB 4P33A 3V1MA 3FFBA 1U1GA 1MEEA 1WTAA 1KMNA 1ZL2A 1RDFA 4Z7QB 4LW8A 2CKMA 1YL6A 1X0XA 2Y8EA 2YIDA 1DV1A 1CR2A 4I2NA 1N1EA 1RWOA 5G3ZA 1YULA 3F5SA 3RVNA 5F12A 3RT1A 5FBQB 4ZQIA 4F91B 5EESA 2YV2A 2DQ4A 1UP6A 3QXXA 1IZYA 3L1HA 1O77A 1B42A 2G6TA 2MYUA 3E22A 2JLRA 1U28A 3GA7A 4QXMA 1MVNA 1UZLA 1JEDA 1Z18A 2X2EA 4JP8A 2O8BA 1Y8RB 3ONNA 2YXEA 2G07A 5EJ4A 4C88A 2D2IA 1CRZA 1AGYA 1CUGA 3L92A 2PUDA 2NV2B 4ARZB 3N53A 4D9EA 4FD2A 4JQSA 1JHYA 2WJZB 4J0FA 4R1OA 2O2SA 5DN9A 2CNBA 4ZI5A 2XKJE 4BKMA 1TEXA 1UJCA 1QF9A 4WGGA 4YC7A 2R00C 1XXHA 1XFAA 5T5QA 4IOKA 1RP1A 3FCXA 4S1PA 4LISA 2OVBA 3BWMA 2IUTA 1XNJA 3DXFA 3WDKA 5IAGA 3HL4A 2VDKB 3Q3GE 1GQFA 1K5DA 1U9IC 2GM3A 2ZJ8A 1X42A 3NBAA 4JL6A 3K8OE 4V03A 4MTCA 1WP4A 1UAAA 3FFWA 5KVAA 3QMVA 3FCUB 5DX0A 4RHFA 5LZ8A 2GEVA 1NV8A 2HQRA 2WNIA 1SBQA 3NV9A 2EJTA 3P9NA 2GA9A 4PSKA 1EFKA 4RD0A 1U8AA 1SOUA 4I3HA 2J9YB 3BCUA 1WQ3A 3KB1A 4ZI3A 1Z5PA 2PL5A 3DLIA 1ZD4A 1I9GA 3PKZA 4OXRA 1BQ4A 4Z9AA 3T99A 4FP9A 5BW6B 2XBLA 3JQAD 2WW8A 2J46A 5K3DA 2CL0X 1KEVA 2CJWB 4BLVA 4MWEA 1A9XA 3G17A 4Q16A 2DTEA 4XEHA 3OMWA 4B35A 1T5IA 3G2JA 5EXSA 1ZVJA 1RXYA 2ZSJA 4PNEA 1ZD2P 1USVA 1WULS 1FS5A 1PL6A 1QGDA 2REXB 4EPTA 4RJTA 3RIYA 4EPWA 3L8YA 3U4AA 4D6XA 4EJMA 4H1WA 4BFVA 1ZOSA 3VNUA 5E4YA 1G4UR 1N2IA 1ZZEA 2ZR8A 2CY0A 4YWJA 3VFDA 4QX6A 1F9EA 4II3A 4P7KA 4ZAWA 4XVUA