5CB6A

Structure of adenosine-5'-phosphosulfate kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
173
structure length
173
Chain Sequence
RGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable adenylyl-sulfate kinase
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transferase
total genus 69
structure length 173
sequence length 173
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb6A00
1D5CA 1DG1G 1SVLA 3I3SR 3UMRA 4F7WA 4QNRA 2QROA 2IUSA 5JI2E 4F38A 1P4SA 2BEKA 4M21A 2JCSA 4HAWA 1GWNA 3PITA 5C46F 2V9PA 3OEHD 1UBEA 1KSHA 2ZJBA 3C5CA 2PEYA 5UKDA 2VYFA 4RZ3A 3CRRA 4OI0A 2BJWA 2FGJA 2ATXA 2BC9A 2F43B 1Z6AA 4QG7A 3VHLB 2Z4SA 3MWKA 3TKLA 4G5RA 4FMCB 2JJ2A 3MJHA 1N5JA 1XD9A 2GAOA 3FKQA 5KSOA 4ZIRB 1W47A 2IS2A 1XZQA 1ZD8A 2GA8A 4RD1A 1JJ7A 2BEJA 5FOVA 1BH2A 4YXWA 4AKEA 4ACAA 2EWWA 1RC8A 1GKIA 3ICEA 3UWOA 1SXJC 4NE2A 2IUUA 4GFDA 5EE1A 1CJTC 3IILA 1L8QA 3IUYA 2QM8A 1P9NA 2ZIAA 1OB2A 4URZR 2BCJQ 2PMDA 3WNDA 1HURA 4NYJQ 3AUYA 1C4OA 1M7GA 4A36A 3CZPA 4JBWA 1JXOA 1XCMA 3I1FA 1OFTA 1U90A 4M1OA 4L16A 3U3MA 2V1UA 2ORVA 1ZMXA 5FOXA 1Q1QA 1W44A 3WMFA 1KO8A 5TVKA 4M9XA 3KQNA 2G0TA 3WYAA 1DELA 5EXXA 2F7SA 1AS3A 4MRVA 1RVDA 2H8KA 3AF4A 4P32A 3CH4B 2OCBA 4XVQA 1DS6A 4GSYA 4QOSA 4NYJR 4BFVA 2ZRHA 1W36C 5JJLA 1Z6TA 5J47A 4HZUB 5KNDA 1S9DA 2YWFA 1KMHA 4XVUA 3MD0A 2I1VB 2VF8A 3TH5A 1NF3A 2RAPA 5LB2A 1O3YA 3CPHA 3IHLA 4M1SA 2OCPA 4CDGA 4LYFA 5JS7A 4JSTA 4MYTA 1OIWA 2HCBA 2ZYUX 3T1OA 4D0NA 4YXWD 1W4AA 5C2JB 2IF0A 4MDEA 3WBKA 1UKEA 2IYLD 1GSIA 2B7CA 4TQUS 4HATA 2OO7A 1SHZA 2W6JD 5ANRB 3WNCA 4BFSA 2FJUA 4IJMA 1G4AE 2QE7A 2QPTA 4TTPA 4OQFA 1KJYA 1P5ZB 2YWGA 5FFMA 2OSBA 3U44A 2VEDA 2V8OA 1DVRA 3KQHA 1XDBA 3GLHA 3WMEA 4DC9A 1ZU4A 5DH9A 4DLZA 4ITRC 3SFZA 4NCHA 4OI1A 2GVZC 2FSIA 4EJSA 1G7CA 3I32A 1H8ED 3LH5A 4ESVA 2C8VA 3ZH9B 5JRZA 2GETA 2J0SA 4PAOA 4BRUA 2ZI6A 4JBXA 4EAQA 3ADKA 5EXPA 1KSFX 2O8FB 2JEOA 1U9IC 1CRQA 3U5ZB 4EQ6B 1R5OA 4RD0A 1MOZA 3BH0A 5G53C 1FP6A 4ASUD 4DDVA 4TMZA 2BMFA 4GOJA 5G3ZA 2RHMA 4US2R 3A1SA 1NIPA 4FMDF 2ZRFA 2VF7A 3IO3A 4R7ZA 5P21A 1U0LA 2NG1A 3B8HA 1HUQA 3TQCA 4C0SA 3GLGE 4NCIA 3BAFA 2ZXUA 5JJIA 1A1VA 1T5IA 3KFVA 4IDQA 3A1WA 3RNLA 2B8WA 2J46A 3SJZA 4QGHA 3AP3A 1E9SA 3DM5A 1SGWA 3FKSD 5FTNA 3W3AA 4QGAA 1GG2A 1GAJA 1QDEA 1W1WA 1NN3A 2F1JA 5JEEA 1JR6A 1CR1A 4JMPA 3W5JA 2O5VA 3OE7A 2RMKA 4FD2A 4UXJA 5AJZA 1IN5A 1PJRA 2ZANA 1GILA 1KSGA 2JLYA 1MT0A 3G82C 2GF0A 3RVBA 1DAGA 3SBDA 5AJVB 4DVGA 1R0WA 2MMGA 4PPGA 2ERYA 1XP8A 5DI9A 5E3HA 2WJVA 3OIUA 4LJ7A 4HEJA 2IYQA 1G7TA 5JMTA 4C7OB 4WAUA 2DR3A 3LWNA 2DFNA 2HYDA 1AA9A 1ZUIA 2FPKA 4B3CA 1E4VA 4UNQA 2DBYA 1KMQA 4GZLA 1U0HC 2IL1A 4JJKA 4A8JB 3Q85A 1ZBDA 2FSHA 3OF5A 3PV0A 3U3OA 1QBKC 4QM6A 2AXNA 2PZGA 3AV0B 4PZZA 4JVMA 3FDIA 4E22A 2ZUBA 3SJCA 2R65A 3GFOA 3GEHA 3RRNA 4KBFA 4L5BA 2O52A 3REGA 5L3SB 2FFHA 3EPLA 4DCTA 2ZRLA 5KO2A 1T8UA 3RS7A 1IXSB 1KDTA 4F4CA 5BYKA 4V0OA 4JS0A 2PBRA 1Z47A 2NO1A 3W3ZB 2ZE6A 2C2HA 1NY5A 5DI3A 3QKTA 4KXFB 1L2TA 1NJGA 4C0BA 4DDUA 2J0VA 4LYJA 2VHUA 4LSGA 1QHIA 3IQXA 3X1YA 5FTJA 2AD5A 4Q00A 5FUYA 4FXPA 2YNMA 3ZVNA 3K9GA 1BYUA 2A7QA 4HAXA 1K5DA 2QENA 4Q01A 5ELXA 4O2RA 1XMVA 1E2MA 5FBVB 1CXZA 2QQEA 2R6CA 3MWYW 5AJXA 3QNUA 1XTKA 5HR5A 4YMTA 1CU1A 1KYIA 3ZQJA 4DWJA 2CVHA 4HUQB 4OHYA 1PVOA 5JSZA 4B47A 4TL6A 2Z43A 3GQBA 4HB4A 2AK2A 2H16A 4Q1AA 3GD7A 1DPFA 2IWRA 1DE0A 2W0MA 3CF2A 1ZIPA 2DWPA 4UNSA 2H5EA 1E79A 2CCGA 2NZ8A 5FBQB 4DHEA 1SXJB 2IYSA 3LQQA 2QP9X 1AS0A 1IY2A 1KI6B 4Q21A 3VMFA 1IY0A 3DDCA 4A0RA 1R0YA 2XNSA 3E70C 4FW9A 4KCGA 4Q03A 4B48A 5JBQA 4FCTA 2NIPA 2QT1A 3LBHA 4KFSA 2OE2A 2VSOA 2W2TA 3SYNA 3OIVA 3Q72A 4US1R 4DDWA 1P60A 3NVAA 5E7IA 5FR2A 4YMUA 5HPYB 1XD2B 1NVVQ 3NBXX 5EP1A 2GZHA 1G17A 4UJ3A 1GL7A 3VQTA 2C03A 2AFIE 4DUGA 1K5GA 4C0LA 1HYQA 2AFHE 3AGPA 4AD8A 2GEVA 2W83A 1O87A 4WZ6A 4LGMA 4W9MC 2VLIA 2OHFA 3V9PA 2WSSA 4B74A 2ZPTX 2ZRBA 3T1TA 2QBYB 4QBHA 1YR8A 2VHCA 5KNCA 1W36B 2XITA 4FWTA 2J5XA 4UNRA 1MO5A 4QNMA 2YZ2A 2QSYA 4LJ5A 4G5SA 4CF7A 1X8LA 2B6HA 2VP2A 5KTYA 1HT1E 4LCBA 1E79D 4G1UC 5AUQA 4II7A 3PFIA 1VHTA 1AQUA 4ZPXA 2YWHA 3U4QB 4KI0A 5JS8A 3MWLA 4PC1A 2FDCA 2D4HA 4LHVA 1E2LA 5DHAA 1SVSA 2VHTA 1IN7A 2QAGA 1M2OB 1P2TA 3BERA 5EE3A 5JEDA 4URUR 3CW2A 2UZ3A 2NQ2C 3ICQB 1N0UA 2EWVA 1F2UA 2PEZA 2CHVA 1J8YF 3HR7A 3WYFA 4JJZA 4UXHA 1ZYUA 4GMDA 4M9QA 4PXAA 4A9AA 1G21E 4PX9A 4TMWA 2WSSD 1BOFA 5AUNB 2EFDB 2G1JA 2VL7A 3AP1A 3BGWA 3QKUA 4JL5A 5CK5A 1EWQA 2W6IA 4Q9LA 4GNKA 2C78A 4I1OA 3MLEA 2EVWX 5CJPA 2GILA 1II0A 2XJ4A 1ZRHA 2VH5R 3OEEA 3UPUA 2F55A 4CGZA 2PLRA 1IOZA 4UXIA 1XF9A 1ONBA 3DMNA 3KXIA 4C30A 1SVMA 2IYTA 1F48A 1WXQA 3IBGA 1GM5A 3SFVA 2KWIA 1AN0A 3RWOA 1I4DD 1XU4A 3L8YA 4POAA 4TL9A 4BQSA 5B58C 1KI1A 5FUWA 3LY5A 4B2PA 1Z07A 2IA5A 1KO7A 2C5LA 2JLQA 5EXSA 3R7WB 3Q7QA 3FMFA 3IBYA 2R62A 1DO2A 4IEIA 2WWIA 1AIPA 2QQ0A 4LHYA 1HTWA 5IDVA 4IFEA 4TT3A 2PLFA 5GJVC 3KQUA 3PUWA 4Q4LA 3F8TA 3EASA 5B2ZA 3WRYC 4AKIA 3A37A 4ZI2A 2XZLA 4ZCIA 2IX3A 3FB4A 3BFKA 3GJ3A 2X19A 3IIKA 2EU8A 3QXCA 2O8BA 1W4RA 1V5WA 4LV5B 3PEUA 5EP4A 3VAAA 4ZDIA 5FPKA 3SHFA 1NN1A 2VIIA 5JCPA 4PZYA 2RGXA 1MRSA 4HLCA 4BZXA 3GJXC 1SQ5A 4DLSA 3PIRA 1E9CA 1A82A 1TEXA 2OEPA 1FNMA 4OHXA 4UJ5A 4U5XA 1GUAA 1Q12A 3SHWA 5F9HA 2Q3FA 2G88A 5DGXA 1OB5A 4YMSA 5TV2A 3THYB 5LD2C 2A5GA 1B0UA 2IHYA 1T4GA 2IXGA 2X2FA 1E0SA 4HAVA 3VX4A 2D3WA 4RFVA 4E5UA 2H18A 1GRRA 4TZ6A 1KAOA 3B7GA 1XMIA 2VO1A 4X8LA 2RCNA 1IN4A 3M4YA 4TT3D 1JEDA 1TADA 1ZW6A 2YVUA 1YRBA 4IDOA 1Q22A 3GJ6A 2O8FA 2QI9C 3AQ4A 2ZSEA 3GLIE 3R9WA 4XWKA 2JGNA 3KUDA 4QHYA 4DLTA 4EKDA 2VTKA 4C0JA 1YR9A 5J40A 1NMZA 4DT1A 5TY0A 3K0EA 4G5GA 1R4AA 4O0MA 4GI7A 2YKGA 2F6RA 2CL7X 1UKYA 1OJLA 4B6EA 5BWMA 1N6LA 2WKPA 1Y3AA 1MABA 1S8FA 3E2IA 1BO6A 2GJKA 2GJSA 4MA4A 3QJYA 5G40A 1E1QA 4EPWA 1UFQA 4TLCA 1J7KA 1W0JA 1E2QA 1U8ZA 1W2GA 2GCNA 3CRVA 2R6DA 4V0MA 4IHQA 4BFXA 4DIDA 4RD3A 3EARA 2MMCA 1OW3B 5JJKA 2JLVA 1QVAA 3SYLA 4LYHA 3OIYA 2YINC 2MSDB 4OYHA 1AKEA 1IONA 3HU1A 3QBTA 4V03A 2HF8A 2VQSA 3B1ZA 2GF9A 3TW8B 621PA 1TF2A 3ZD6A 3MSXA 2W00A 3GMTA 4KLNA 4LHZA 1FPMA 1LTQA 1VECA 5CDFA 4O3MA 2VHJA 2JLRA 2ZE7A 4JVNA 3HR8A 2H17A 3MJRA 1ZCAA 2QM7A 3CRMA 3BBPA 2JLUA 1G6HA 5CJ2A 1DBSA 3OFNA 2H92A 4C7OA 1CLUA 1BYIA 3EZ2A 4M53A 4OHVA 3V4FA 2AN9A 3IPYA 1DAIA 4QJ4A 4U02A 2ERXA 4KU4A 5L3RA 3LXXA 2FOLA 4IOLA 2YOHA 4A8JA 1G3RA 3A4LA 2A9KA 2AHOA 4QHSA 5HZKA 1IAQA 2I1QA 4F92B 2XZOA 3T12A 1Y63A 4LRWA 3ZS8A 3GLFB 2JDIA 3QBVA 1W0JD 4CEJB 4BGDA 3MFYA 3P4XA 5KU1A 2EFGA 1RYHA 2P3SA 3M6AA 5FH9A 1A4RA 1OHHA 2RGAA 4PQRA 4DSTA 4YDHB 3LO5A 4M22A 3BORA 2GCOA 1P2SA 2GEUA 5JWHA 3QPUA 5SZKB 4D2IA 4YQFA 3RS3A 4LC1A 1KSJA 1PLJA 3HPRA 4E07A 1XPOA 2PL3A 3L0IB 3ASYA 4XTCS 4M1KA 2ZR9A 2O8CB 3IO5A 2NGRA 3B85A 2OZEA 4W7SA 5BYJA 4DLYA 3AVUA 2R6AA 1TQ6A 5JZVA 3PEWA 1DAFA 3VKGA 3AGQA 3K0FB 3OFND 4PR0A 2CDNA 4E09A 2BHRA 5FOWA 4DIEA 2CHGA 1VG0B 2ZJYA 3OIWA 4PHFA 4G0NA 1IN6A 4RVCA 2FFQA 2RGGA 5DI3B 1DTSA 2QL6A 3D3QA 4V0KA 3ZS9A 5DHFA 2QSZA 4ARZB 2ZVQX 1HT2E 4LPKA 4BFTA 3B78A 3L0OA 3K70D 1QG2A 4TYQA 4LOAA 4S2EA 1DAKA 3GLHE 2JDID 3QG5A 2HJVA 1E2EA 2I4IA 2ZJZA 3AF3A 1SXJA 5FUXA 3X1XA 5BN5A 5DLQC 2EYQA 3AKDA 2DCUA 2DHRA 2ZSFA 3CF6R 3JZMA 5DSZA 2BMDA 4RSGA 1E9EA 1YZUA 2HV8A 3BFVA 4DB2A 1VCOA 3DOEA 1C9KA 1NJFA 1XNJA 1Z6XA 4W5WA 3VR3A 3ZVLA 1KNQA 5DNYB 4L9WA 4TYPA 2QEQA 4RZ2A 1LFDB 4Q47A 1A7JA 5BXQC 2HF9A 3CWQA 4M1WA 3LW8A 2B7BA 4B44A 5HKKD 1ZNXA 1D8TA 2OAP1 3ZGXA 2WPDD 3ZJYA 1JECA 2F1RA 1FW6A 1LY1A 1KK2A 2UKDA 4G3XA 2NMVA 2WM9B 1AGRA 2HLDA 1Z8FA 3NH6A 4HDQB 3AVWA 1N6IA 3F0TA 3LLMA 1RZ3A 1AKYA 1NMXA 1Z63A 1IM2A 1WRBA 3NG1A 3R8FA 3TBKA 2G0NA 4L9SA 1GNRA 2BOVA 1HA3A 2OXCA 3TUZC 3ZDQA 2YOGA 3QEOA 5LPNA 4NCJA 3C4JA 4LK2A 3CR8A 1OPXA 1TQ4A 1VG9B 2RGCA 1SXJD 4HUTA 4TTQA 1VIAA 1TEVA 1RFLA 5FR1A 2C9YA 3CX6A 5CK4A 1ZCBA 2AKAB 3U4QA 3THXB 4PAMA 4D0GA 1UDXA 3CM0A 5GJBA 2CLDX 2GK6A 4TQAA 4Q7MB 2G1KA 4OKSA 3X1WA 1CS4C 4S35A 4A2WA 1EWRA 4KFRA 2VP0A 2WWFA 5BW8A 2PCJA 1XTQA 2FN4A 3DM9B 5LD2B 4V0NA 2JLWA 5HZHA 1ZNYA 3EPKA 4PHTA 2GRJA 5KDLA 4BFUA 1MO3A 4D81A 1G41A 5DYGA 3PXGA 1QHYA 3Q3JB 4ZDJA 1WCV1 1FMJA 2XTNA 4LV6A 5IHPA 1G3UA 2JJ1D 4Q9JA 1KY3A 2A30A 1CF4A 1GRQA 1RRCA 1US8A 1AK2A 4BLOA 4I81A 2DFKB 4EPYA 1W36D 2ZRJA 4QGFA 3DZDA 4M2LA 1R0ZA 1VIYA 4BLTA 2O0HA 2QAGB 1ANKA 1U9IA 2WJIA 5AK0A 3TLXA 2Q0HA 2AR7A 1ZVQA 3WY9A 2R6GA 5FOUA 4BE7B 1F2UB 2ZUDA 3Q5EA 2XGJA 2BVNA 4PANA 3WHKA 4Z1MA 4FI3C 1EFCA 2Q9CA 2UVQA 4DEXA 4MYHA 4PC7A 3R7WA 2ZRPA 1L4UA 1QRAA 3RSOA 1WBDA 4Q4JA 3P26A 3W9YA 3AKEA 1E2JA 4RY2A 1T8TA 3SDZA 4LJ9A 1BMFD 1GOTA 4DZZA 1NLZA 1W49A 1SKYB 4EPRA 1WP9A 5KYKA 4IVRA 2NO0A 3N2IA 3C41J 3ZYCA 2RGNC 3AKCA 1QVRA 2FFBA 1VTKA 4PPFA 3EIHA 1NIJA 1KJZA 4B3XA 2JLZA 3RAPR 4MGZR 1LF5A 3IIMA 2ZR7A 5EUMA 3RSLA 3O8RA 3MG9A 4B43A 4AYWA 2V3CC 2AX4A 4WW0A 2IUTA 5EJEA 1E2GA 3U7HB 2QU8A 2Z83A 2JJ2D 1SVKA 1SVWA 2QP4A 4HAYA 4AYTA 2QTVB 2GZAA 1WMSA 2ZU0C 3QVVA 3JVUA 2XNDA 1UJ2A 2PZFA 3EA5A 1MRNA 3K9LA 3VKHA 3THYA 1FX0B 1Z0AA 2ONKA 2QT0A 4MKGA 2O8BB 2GJ8A 5JWOA 3HYRA 4B3GA 1QHSA 4MITA 2ZYVX 2XB2A 3D6TB 3K0AA 3GJ5A 4HB2A 5GADl 4Q1DA 2CE2X 5EZ6B 4TL7A 5DN6A 1RIFA 2WAYA 4KVGA 4LBYA 2J3EA 4R2HA 2F3TA 2OBNA 4FMDB 1NVXQ 4HLUC 1HE1C 1P72A 1NG9A 2WOOA 2N1BA 3RANA 4F4IA 4HAZA 2KB0A 3SBEA 5K8TA 4GZMA 1D6JA 3U7GA 2GHIA 2BKEA 2AL7A 1KI4A 4XD7A 1NSFA 4XSHA 4B3BA 4DB4A 1V43A 3P32A 1YZNA 5TDHA 1Z3IX 2MSEB 1KOFA 3CB4A 3EZ6A 2WIBA 3L0PA 1JB1A 3B1VA 1T3HA 1SVOA 4D0LB 2A2ZA 4Q19A 2IYZA 5EQTA 2CXXA 1P3JA 2GTPA 2V54A 2V7QA 1K6MA 4DT1B 5LBIA 1N5IA 3B9QA 3EXAA 1W48A 3SEAA 4B2IA 1WA5A 4A1FA 3VX3A 1MKYA 4L15A 1OFUX 4YLGA 5L3QB 3QENA 3CH5A 3QKRB 3RS4A 1NN0A 1OSNA 2ZTSA 1MR3F 2QE7D 5DIFA 1MABB 2JATA 2QY9A 2R9VA 2V1XA 3U6BA 1YZLA 3GPLA 5FTLA 1DAHA 1G18A 1OXVA 2Q6TA 4RKEA 4AYXA 4RD6A 1VG1A 3AB3A 3A8TA 4NKRA 3V00A 2KBFA 4QGGA 1N6NA 4BLSA 1ZC3A 4KODA 4IDHA 3QXJA 4JLDA 1R0XA 5KDOA 2WWGA 4I1UA 4RKFA 1E2DA 3F5FA 3FYHA 4X8MA 1I4TD 1PUJA 1RKBA 2XZPA 1GTVA 5GVSA 5KPJA 2CL6X 4AIIA 1SKYE 5AUOB 1KZ7B 3RABA 3TVTA 4KJZA 3QF4B 2XTZA 3CLVA 1KDOA 1ZU5A 4UNNA 4WOPA 2IYXA 4BFWA 2REBA 4B6FA 2QMOA 5FUVA 3GLFA 3QKSB 1TUIA 1UEJA 3T06B 3T5GA 4CEJA 2P5TB 1HQCA 4PPNA 3QQ5A 3VR4A 3PENA 2CMKA 4BEBA 3EWAA 3U3JA 4D4LA 1JR3A 2HUPA 3V4RA 3HDTA 2WSMA 1P7CA 5CIQA 1JJVA 1E9FA 4IW3B 2ZS7A 3WMGA 4ZKEA 2N46A 3H86A 3KKMA 5C4GB 3KQKA 2O8CA 1U81A 5KSZA 2BV3A 3LXRA 3KKQA 4DCNA 1RPZA 2YOFA 4AI6A 1DO0A 2IYWA 3C16C 3RRMA 1GDDA 1GFIA 5B64A 1D9XA 1EFUA 3B82A 1WQ1R 3EW9A 3K0FA 3PVSA 2QRNA 5A5GA 4TWZA 3FGNA 4PC6A 2GCOB 1Q20A 1KO5A 3WNBA 3OE7D 1KDRA 1Q21A 2IS1A 3K9NA 2JAQA 3HJNA 4NCKA 1ETUA 3GJ7A 4LJAA 2ATVA 1VMAA 4ARZA 1N2CE 4JT2A 2ZR0A 4TMVA 4B35A 4JL8A 3QF7A 4PQYA 4BLQA 1RYFA 1E32A 1VCNA 3T5DA 2HXYA 3NKVA 4R71A 5F2EA 4MRPA 4P33A 3BE4A 4QJ5A 1XXHB 5FPSA 4X8OA 3T1QA 3RS0A 1G5RA 2A5DA 3LA6A 1G291 3SS8A 2ZE5A 3LX8A 2ZJ5A 1C1YA 1XFAA 4RCZA 4UNPA 1XTRA 3UANA 1T3SA 1G9XA 1VYUA 1ZAKA 2EFEB 3UATA 3VKWA 1LVGA 5F98A 1BS1A 5GVRA 3GJ0A 2PX3A 1L4YA 4AWXA 2DB3A 1T9HA 3C15C 3HWSA 4DLVA 1W5SA 2D2FA 1E96A 2IT1A 4Q9KA 2FPMA 2Q21A 1E2NA 1XEWX 3CZQA 1DADA 2R6FA 2HT1A 3Q9LA 2PJRA 3AEZA 2BDTA 1R6BX 3B5JA 4B75A 3UMFA 2QRZA 1PLKA 3LVQE 4BFZA 2PT5A 5FBRB 1GITA 3T61A 4GMXA 3SJAA 2KJQA 2JASA 1XEXA 4BZQA 4D25A 3BK7A 1XZPA 4Z8YA 2RGDA 5BQ5A 1ZUHA 2DPXA 4YDSA 3BB3A 3KTAB 3RLFA 1WB9A 2CK3A 4CZ2A 3R9XA 1JBKA 2QTHA 1T0JB 2ZI3A 2GJAA 3AVOA 3THXA 2Z4RA 4MRSA 4IKEA 1FTSA 1KHTA 4PSKA 5CDFE 4NDZA 5IRCD 3C8UA 3IHWA 3RC3A 2WIAA 2XOKA 1X3SA 2ZRNA 2AXPA 4YMWA 4RJLA 1I2DA 2YC4C 4AG6A 1U94A 5HE8A 1D2EA 2WVJA 2AWNA 3C7KA 3B1YA 3FE2A 4TSFA 4JL6A 5EZ5A 3U60B 3LV8A 3THWB 3AM1A 4NTZA 2A5YB 1KGDA 3EC1A 4HB0A 4A2PA 5D3MB 1KI2A 4G5QA 1KKMA 3NBZC 4JYBA 1IXRC 2VSFA 1S96A 1GKYA 5JRJA 2ZS8A 4NMMA 1ZM2A 1OKKA 3K0CC 4MGYR 4TLEA 4PZLA 2ZRKA 1II8B 1TMKA 4D4JA 1RE0A 2ANBA 3CIOA 2FFAA 4XWAA 2C95A 1L7VC 4DUGD 5G3YA 2DWOA 3KXLA 3L2OB 5C18A 1YVDA 3PEYA 2WJJA 1R2QA 2GJ9A 4U00A 4B3DA 1T0HB 2OESA 1GL9B 3CPJB 3FFAA 1EFRA 4A0FA 2DYKA 2D62A 3AVXA 1US8B 2EW1A 4AKGA 5CYOA 4GP6A 4NP6A 5CB8A 1VKJA 4L4UA 3ZVMA 5FOTA 2AK3A 221PA 1U2RA 3KDSE 3RHFA 1Z28A 4BUJA 1AQYA 4MKHA 4PO8A 2WWYA 3LD9A 4TSFD 1VDZA 3DPUA 4FINA 4LJ8A 1XEWY 1TQDA 4OK6A 2ZI5A 4JLOA 4DCVA 3EPHA 4FIDA 2J1LA 2E9SA 2Z6VA 1J70A 1M74A 4Q4JB 3NHBA 4PTLA 3GCGA 5DE3A 3MMPA 4GDFA 5JECA 4WXPA 1XMSA 1U8YA 3B1XA 3SI7A 4EPXA 2ZRIA 2CLSA 5FPHA 1GIAA 3FHOA 2CE7A 4UKDA 4ESHA 1E99A 2WV9A 1NY6A 3I73A 1ESMA 1ZUNB 5EE5B 1E2FA 2QA5A 4CW7A 3T1VA 2D74A 2F1HA 1SXJE 1WE2A 2ZS9A 1FX0A 3RWMB 1OIXA 2A5JA 3GEIA 1EFRD 2KBEA 5G41A 3AF0A 3ZIAA 3BB4A 1P9RA 2W6ID 1KO4A 2IXEA 3IQWA 4C0AC 1W0KA 1N6HA 1WF3A 2R8RA 4LC0A 2PX0A 3OEED 3E5HA 3B9PA 1P2VA 3I8XA 3ETLA 3L82B 4LBWA 2H57A 4IOKA 4AG5A 3CNNA 1GNPA 4D6PA 1ZJ6A 3QXHA 1KKLA 4IVPA 5AWFC 1J90A 2ODNA 2IWHA 2PCLA 3K0AB 3U7EB 4RFSA 1OXXK 4NL4H 4LHWA 1XCPA 4CRWB 3LNCA 2RHDA 2IEZA 1EG7A 4KSBA 4URVR 5FTKA 3W34A 5FL3A 2QPAA 3ND9A 3P27A 1J99A 3QPWA 4TZ0A 3FPAA 4QXAA 4DCUA 3LVRE 1G3IA 1E9AA 2HXSA 4IFBA 3WBJA 1LNZA 3K53A 4QL3A 4KV9A 4IVQA 4MUAA 4HLQB 1TX4B 1OH5A 1TPZA 4NBSA 4AY2A 3SN6A 3WHLA 5FBWB 4LYAA 3ZIAD 5L3QA 1TNDA 2ORWA 4XVRA 3QKRA 1G5PA 4Q18A 4LI0A 3PQCA 3EX7C 4HYYA 2ZSAA 2G83A 3VNUA 3H1TA 2RB4A 3KJIA 4TMXA 3LW7A 4QFMA 5TMPA 1NRJB 1NVWQ 1Z08A 2IYRA 1N3BA 2XJ9A 2ZSDA 3DHWC 3IEUA 4B32A 4BFYA 1ZNWA 1G8GA 2OT3B 2DFLA 4ZKDA 6Q21A 1OFIA 2KSQA 4EUNA 1ZM7A 4HDCA 3G5UA 1S3SA 3L8ZA 3HP1A 4M0LA 1OV4A 1RJ9B 2W2XA 2YHSA 2J9RA 2J41A 3KKPA 1TU3A 3QXSA 4TLAA 1SULA 2ZJAA 1DARA 3QF4A 3TR5A 5A4JA 1YZTA 1E2PA 4MRNA 1LF0A 3K9HA 1XEFA 3LDAA 2FEMA 3SOPA 2O8DA 3QKSA 4UQOA 2ODWA 2W58A 3A6PC 4BLRA 1YKSA 3FMOB 4D80A 2D2EA 4XH9B 1GRNA 2LCFA 1M1YE 1E1RA 4A0HA 2IC5A 1FMLA 5SZJA 1N0WA 3IKJA 1XBTA 1S3GA 1G64A 1SHKA 1U98A 3BD9A 3PUZA 4MRRA 4P0TA 1IJEA 4FWIB 2XSZA 2GXSA 2ZRMA 4EPTA 3NBYC 4C3ZA 4LWZA 3CX7A 1SZPA 4A82A 4NPHA 3I62A 1E1QD 4B2LA 4DSUA 4CEHB 4RD2A 1CJUC 1PZNA 1FL9A 1CJKC 1XTSA 2O0JA 1YRAA 4PQFA 1Q3TA 1YHNA 1H8HA 3EG5A 1I2MA 1UAAA 4EDHA 1S2MA 3I5XA 1P75A 1YZQA 1Z0KA 4BECA 1E9DA 5TARA 2AWOA 2ZI7A 4KSCA 4AK9A 4YMVA 2FG5A 5E95A 1EFTA 4TMTA 2G77B 3VR6A 1E3MA 1JAHA 4NYMQ 3UG6A 1XRJA 4H9GA 2ZYWX 1YZGA 2PH1A 5EUQB 1E2IA 2P6RA 4LJ6A 2WBLC 2E87A 4O25A 4Q4AB 1G1MA 4QKQA 1TAGA 2MSCB 2OCYC 4H1UA 4Q7KA 2ZJ2A 3U3RA 2ZYTX 2BM1A 5J4LA 4LUCA 2ZRDA 3W8RA 3KQLA 1XXHA 1Z0FA 3C14C 4B3FX 4GRAA 4NU0A 2OFXA 4ZV4A 2C04A 1E1RD 3K09C 1QZXA 2ANCA 2IK8A 4I1SA 3SJBA 1RRGA 4NYMR 5K8IA 2XSZD 3CPEA 4D4KA 2CNWA 1OXTA 3AVPA 3EZ9A 1IBRA 4QBIA 1AZTA 1NKSA 1X6VA 4C0KA 3A36A 3A1VA 1GP2A 1KK3A 4PSAA 5FPYA 3CONA 1E0AA 3B1WA 2FZLA 3BS4A 2BJVA 4OL0A 1H8HD 1NBMA 2YV5A 4JIMA 3X2SA 1H65A 1Q0UA 3PUYA 1OHHD 4IRUB 2ODBA 2FWRA 2WKRA 4ILEA 2HJGA 1E69A 1P2UA 5EE0A 3PR1A 2CJWA 3KZ1E 2RGNA 2I3BA 3KUCA 1XTJA 3ECCA 4GL2A 4Q66C 1CKEA 2IBMA 4QBFA 3VHXA 5IT5A 2RGEA 3Q7PA 1F6BA 4JKYA 4OQLA 4G5OA 3BWDD 2J59A 4Q4HA 1TQ2A 1Q57A 5DO9A 4BPBA 3KTAA 2OXRA 1S9HA 1ZC4A 1Z0JA 5SZHB 4IXMA 4RZUA 3QSYA 4QC2A 5J4KA 2GVDC 3ZQ6A 2J7PA 4KAXA 2V6IA 3BH7A 1DOAA 1GL6A 2X8AA 1D2NA 1N6KA 3QOFA 721PA 3ZVRA 3CX8A 3NEJA 4ZDKA 5J4HA 4JLMA 1T6NA 1KK0A 1Q1EA 2J45A 4OQMA 3E1SA 3MAAC 1QHHB 1XEXB 3KX2A 5JLJA 4OHZA 2ZE8A 4KITB 3AVVA 5F9FA 1ZM9A 1UF9A 3GEEA 3SYKA 3T34A 5CB6A 121PA 3HU3A 2K5UA 2VBCA 4US0R 1NG1A 2GBLC 2GZDA 3B6EA 3THWA 2D7DA 4LBZA 2D06A 2IYYA 4LJ4A 5CITA 1T3LA 2XAUA 1OH6A 2WICA 4XWOA 3FVQA 1E98A 2WJGA 2D7CA 2WZQA 2GEDA 3CO5A 3EWSA 5D3MA 4J0QA 1DEKA 1UEIA 3KKOA 1XPUA 2ZQ5A 1E2HA 1AM4D 4HLUA 2Q3HA 1T5LA 4A0GA 1II9A 3MUFA 1JXMA 2PZEA 3D8BA 3DMDA 4B33A 3PUXA 4OBEA 3GLFE 3K70C 3GJ4A 4ON9A 1OH7A 1II8A 2GKSA 1HEIA 5IK2A 3FOZA 2O0KA 3VTKA 1XB2A 5KNBA 2L0XA 2WWHA 2ZU6A 1JR3E 1IY1A 4LBVA 1VG8A 3CUEF 4XIGS 2HLDD 1UKZA 1W46A 3MWJA 3IDQA 4JVLA 1GZSA 5CM8B 2F1IA 4JLAA 1KO1A 2J0UA 2R44A 4PC2A 1YQTA 1E0KA 4KYUA 3Q8XB 1FP7A 3NH9A 4XJXA 3RDPA 5JHHB 4GOKA 4JLKA 2GCPA 1E9BA 4Q9HA 1GVNB 3JZAA 1CBUA 3RRYA 3TIFA 4C0HA 3L43A 2YWEA 3QY0A 3O8CA 1JPNA 2QGZA 3QVUA 3SU8A 3M0EA 2NO9A 2WWWA 2P6UA 3R9IA 5L3VA 1S4QA 1FUUA 4FCVA 3GLGB 4OQNA 1FZQA 1NMYA 4Q1BA 2G9NA 1WBBA 2RKOA 4KFUA 3AVQA 4Q48A 4V02A 5AJYA 1G5TA 5JWRA 1R10A 4P4SB 3S1AB 5AUPB 1F3OA 1UADA 4I4LA 4QM7A 1FQJA 5IK2D 3DKPA 4C4PA 2CBZA 3TUJC 3OESA 1G19A 3N2EA 1NSTA 1KI8A 2XXAB 1PUIA 1IXZA 1MO4A 2P67A 2QG6A 2EFHB 4DLXA 4M1TA 2VSXA 2NTYC 3ND8A 3FHTA 1A2KC 5KHOC 2W6JA 4DRZA 1HV8A 5JFGA 1I4LD 3DO6A 3H0KA 2OV2A 4G01B 5FL7A 2BMEA 3SC3A 5C1BA 4LPSA 1QHXA 2CCJA 4JVSB 2GWHA 4RD4A 5LB4A 3W6NA 4CT4B 4Y0VA 3BXZA 3ZZ0A 4X8HA 1JI0A 1N6RA 4WIAA 4LJYA 1HY3A 1G6OA 4Z1MD 5LDDC 2YJTD 4TYYA 1XJ0A 1W7AA 4FMCF 3ADBA 4N1AA 8OHMA 2JA1A 2OFOA 1H8EA 3RYTC 2FNAA 5KUTA 3EZ7A 3KJGA 2QMUA 3LX5A 4MUBA 1UBFA 5EE9A 4FN5A 2GESA 1XWIA 1D2MA 4OJQA 3EIEA 1YU9A 3QEJA 2BMJA 3WRXC 5E7MA 1G8HA 2FH5B 2GXUA 4NH0A 2IYVA 2Q3MA 5EP2A 4C2TA 2EQBA 2CL0X 3GP8A 3KB1A 4IOMA 3P20A 5FI1B 4FCWA 3BIFA 4Y0AA 4ASUA 4AURA 4RFSB 4MKFA 1XJQA 4MGKR 1SKQA 2FV8A 4CT5A 3Q5DA 1W4BA 1N5LA 3NXSA 5FL7D 4ACBA 1J2JA 4GOXA 1IHUA 4B73A 1ZIOA 5AJWA 2VA8A 3CR7A 3TVDA 3CRW1 4LV8B 2OLKA 2IYUA 2V4ZA 3ZLJA 2XNDD 1CTQA 4KLZA 5HTKA 1Z0IA 3FKSA 2FSGA 4JLBA 3UWKA 2WJYA 2REXB 4GP7A 2QN6A 1XD8A 2H7VA 2WHXA 2ZITA 5JI3E 4AKHA 2ODEA 5DN6D 2ZRCA 1RJ9A 4FMBB 2HCJB 2E1RA 1COWA 3U61B 1HE8B 2V55B 3FMIA 2R2AA 4ZCMA 3I92A 2HEIA 2C98A 4L8GA 4D4MA 2IS4A 2DWQA 2F3RA 4EFMA 2UZIR 2CCKA 2YYZA 4B34A 3PUVA 1OH8A 4A6PA 3H84A 4OK3A 4YC7A 2WMNB 2LKDA 1Q44A 4CVNA 3KKNA 3UKDA 1AZSC 4XD7D 2REOA 4K46A 3KJEA 4C2UA 3TSZA 2X77A 5A0FA 3X1ZA 2A3RA 2DY1A 2BBTA 3RS2A 1KY2A 2FF7A 3TSOA 3OHMA 5FTMA 1P9WA 2O8DB 1NL3A 4CEHA 2NOAA 3BB1A 2P0EA 2KE5A 4YONB 1KDPA 1M6NA 1P61B 2V7QD 3TSWA 4F4JA 4BLPA 3TJZA 1EXMA 4JT4A 4JLVA 2ZREA 4Q5IA 1JAIA 3QUSA 1PLLA 2C77A 1EK0A 1R8SA 4NZYA 4R98A 3IGFA 5L8VA 2OLJA 1KZGB 3DVLA 4QRHA 3AVTA 2XTMA 1ZM3A 1OXUA 3T35A 5B57C 4HLDA 1COWD 4R2IA 2WWXA 4LHXA 4PO9A 4Q4AA 1LW7A 2OBLA 3EA0A 3VU9B 1CR2A 5J4YA 3CBQA 1G7RA 3A1UA 3LAWA 4JKIA 4IDNA 1FQKA 3AH8A 1G8YA 1OXSC 4WZBE 1D9ZA 2IHBA 2AKYA 3LQRA 4WBSA 2GXAA 5JHGB 2HYIC 2ZEJA 4CEIB 2ORIA 5E7JA 3U6KA 3OAAA 3JVVA 2J0QA 3NBFA 1JQLB 2X1VA 3VFDA 1F60A 4BZPA 1UKVY 3K0CA 5CM9C 4QJ3A 3TW4A 3K70B 3CKLA 3ONWA 4A15A 2ZAMA 3NC0C 3N5CA 3TMKA 4P4UA 1MH1A 1G4UR 3IIJA 2GNOA 1CP2A 4Q02A 4HDOB 3FMPB 3FTQA 5GJWC 1E6CA 4ZI3A 1CRPA 3B2EA 1NNEA 3FWYA 1Z6YA 2PMKA 1E0JA 521PA 1VPLA 2WOJA 1GNQA 1JR3D 3A4MA 1QHNA 2ECKA 2Q9AA 2QGNA 3PEVA 3DKVA 4MGIR 3TUIC 2A5FA 4TYNA 4EJSC 1XMJA 1ZNZA 2C9OA 1EX7A 4Q7JB 5FBLB 2KI5A 2V6JA 4DBLC 5FI0B 5M04A 2WMOB 4JZKA 1EX6A 5KSPA 1G16A 5EXTA 4RZXA 4LY6A 4Q1EA 5CLLA 1KJWA 2FPLA 1U0JA 4KFTA 1M7HA 2VP5A 5TB5A 4A4DA 3OAAD 2IF2A 3WP0A 1LB1B 5KSYA 1JEEA 1RRPA 2CJWB 1X1RA 1UDWA 3TRFA 4TMKA 4NHOA 1T91A 1QHHA 3BFXA 4M1MA 4F93B 3X1DA 4V0ME 2Y8EA 4DLRA 3UMSA 4Q4HB 2OFWA 2OBMA 4NCNA 3I5YA 3PG5A 4JLJA 3VR2A 1HH4A 4EFLA 4N0EA 821PA 3VNVA 3UXMA 2IXFA 1G20E 3GFPA 2O8EA 1CJMA 4PO1A 1UPTA 3MGCA 4IDPA 1R5BA 3TNFA 1YJ5A 3TR0A 1F2TA 2OUKA 1P6XA 2FGKA 421PA 4OI4A 3KJHA 4TQ9A 1B23P 4RCYA 5FOSA 4M8NE 4R9UC 3SR0A 1R8QA 3HPQA 1A5TA 2ASEA 2BIFA 2WTUA 4BASA 4CIDA 4Z51A 2C96A 5F3WB 1JALA 1IN8A 2QORA 1E2KA 2P2LA 1NLYA 4A6XA 1AJEA 3NTUA 1N5KA 4DSOA 2RGBA 4P4TA 1ZM4A 1NVVR 4QHTA 2FZ4A 2QMHA 3TAHA 2HDNB 1S1MA 4BEJA 2BBSA 3TGPA 3EIQA 1UBGA 3WYGA 3GLIB 4WVFA 2GDJA 2IEYA 1U99A 5KOYA 2CK3D 1G8FA 2F9LA 4PHGA 2GAAA 4M1YA 1UBCA 2G3YA 3O8DA 3QE0A 1M8PA 1Z0DA 1Z22A 2Q9BA 4K8OA 4Z54A 3EAQA 3UG7A 3GLGA 2F43A 2J0UB 1R5NA 2PJZA 4LZZA 4XTRA 1ZINA 4P31A 2XOKD 4IXNA 2IS6A 2VHQA 1NN5A 3LFUA 2A78A 2H1LA 3ADCA 1TUEA 4TL8A 4EIWA 4ZIRA 3KL4A 3PCRB 3R20A 4P4SA 5H1YA 3S1AA 2JIZA 1Z06A 2XB4A 1U8AA 1XXHE 3B60A 3BJIC 4TLBA 2XXAA 2ZI9A 4IEEA 1TL7C 1J8MF 2CVFA 3NEYA 4HI0E 4OQXA 4W5JA 1KI9A 3EC2A 3FHCB 4Q1CA 4OI2A 3CNOA 1OE0A 1KK1A 5D3QA 2QNRA 2GXQA 2ZROA 3TK1A 2OCAA 2BBWA 5TXGA 3VR1A 1W2HA 2VP4A 1DAEA 1OKKD 3ZZTA 4DJTA 3RC8A 1FUKA 2OILA 3UIEA 1N25A 3KXKA 1WDTA 1NBME 4WXRA 3RRZA 2BWJA 1OFHA 4E03A 3W90A 1UM8A 1A2BA 4BWYA 3QPVA 4Z8XA 2FMXA 3UK6A 3O8BA 4C9BA 5J4VA 3DEFA 1X1SA 1Z6GA 2FA9A 1IQPA 3MCAA 1OLOA 2BBOA 3P4YA 2LKCA 1BIFA 4F91B 3I72A 4HZUA 2W0SA 1N6PA 1YZKA 1ZD1A 2NO7A 2QPOA 4ZO4A 3NC1C 2GK7A 4Q1FA 4EFNA 1IJFA 1K8RA 2JIZD 4HB3A 1AGPA 1N6OA 4Q7LA 4MYUA 1M34E 4JLPA 2RH5A 4IOJA 1XPRA 4NYIQ 1VHLA 2ZETA 3QI2A 2Z5FA 4XOIA 4PPQA 3DZ8A 3DL0A 4MQBA 1CEEA 1KMHB 3I4LA 3RS5A 2CLCX 1VCMA 2C99A 1CJVC 3KB2A 2X2EA 1ZD9A 4PSVA 4B71A 3ADDA 3EPJA 1G7SA 4JYCA 3I8SA 2WKQA 1RRFA 2BKUA 3NWJA 4XSGA 4U7DA 4TYWA 1CIPA 1CULC 3K09A 3ZD7A 4QBGB 2QZ4A 4NYIR 1LS1A 3AP2A 2AD1A 4D82A 3IEVA 3LLUA 4A92A 3NDPA 2P6NA 5HE9A 1W0KD 3J81k 3U44B 3DOFA 4D26A 1KTVA 1HQYE 4WZAE 2QAGC 2NPIA 3GLHB 3W5IA 4JLNA 4DEYA 2FU5C 3W6PA 4ERNA 5H70A 4EQ6A 4URXR 1OT3A 3A4NA 2DFTA 1CR0A 2ZRGA 3U3KA 1OIVA 3BOSA 3AVYA 4K81B 3NDBB 2ZI4A 3HYTA 2NPFA 3TQFA 3PJRA 1X8KA 2C9CA 4ABYA 1TU4A 4EJSB 2OM2A 1W4CA 5IF9A 1KAGA 1Q3HA 2F9MA 4TLDA 1FFHA 3LRPA 2ZJOA 3U7FB 2YC2C 3NHAA 4N3NA 1ELOA 2CHQA 4I99A 1KNXA 1EFHA 2ZM5A 3LBNA 4A2QA 3MRSA 1Q1ZA 1KIMA 3TE6A 4BRWA 4Q9IA 3H2YA 3W8NA 4DCSA 3N70A 3GFTA 5BN3A 3FFBA 1JPJA 3D31A 1G3QA 1AS2A 3OZXA 5K8LA 3P1JA 3T15A 2NO6A 2OG2A 3CF0A 3BRWD 4LX0A 1KI7A 1F5NA 2PT7A 4MDFA 4I1VA 4KYIB 1ZP6A 3CRQA 4EPVA 3AF2A 4V0LA 2ZRAA 1VYTA 2SHKA 5KDDA 1N0VC 5FPTA 1P73A 4M9ZA 1QG4A 2FEOA 5J5CA 1ODFA 3VU9A 3A58B 4GT1A 1CR4A 1GKUB 1BKDR 2GBLA 3C5HA 4JBYA 2JLXA 1LS6A 4URWR 2N42A 3QXXA 1FOEB 2XEXA 2FSFA 4CEIA 2VP6A 4HAUA 1XCGB 3QG1A 2B21A 5KPDA 5DYIA 1VCIA 3K8YA 3GJ8A 1E4YA 3IPXA 5AR1A 1G8PA 1OYWA 3THOA 2JJ8A 1Q1BA 4PHHA 3QIAA 2QP3A 1NKTA 1OYYA 4PFSA 5K8UA 1MV5A 1MO6A 4ZCLA 1KI3A 3W6OA 4KBGA 3ZZUA 5CLQA 5L3SA 3LBIA 1YR6A 2NZJA 2EFCB 3H4MA 4W5HA 4MH0R 1NLFA 5GJCA 2B92A 4AC9A 2BM0A 5H8WA 4JSYA 2W2VA 4HSEA 5H68A 1YR7A 3AF1A 4P3YA 1TTTA 1JNYA 1PV4A 4ZDWA 3WXMA 4GPTA 4PAQA 4DSNA 2VP9A 2IW3A 1QHGA 2CEAA 1XTIA 5HKKA 4URYR 1NI3A 2WPDA 3CWZA 5BN4A 1TF7A 2EYUA 1S0UA 3F3YA 3AKYA 3WP1B 4HZIA 4WA7A 4TTRA 5JCZA 4CYMA 4M4SA 1VYVA 4MYCA 1Z2AA 1FNNA 2TMKA 4C0QC 2J7KA 2OAQ1 2FE4A 4HUQA 4DXAA 1SVIA 4GBMA 1DAMA 2G6BA 4KO8A 4DLWA 4M9SA 1G3MA 1Z2CA 4DLUA 1FTNA 3AUXA 1EGAA 2ZJ8A 3VR5A 4N0DA 1DG3A 2J87A 1KI6A 4OK5A 4KHZA 3A1TA 4H1VA 1R7RA 2QUZA 3D7MA 1TF5A 1RW4A 1ESNA 2XX3A 3REFA 5B30A 2ZSBA 5HCIA 4LDJA 5JSZB 1XX6A 3I61A 2CNWD 4B76A 3K0SA 3BC1A 2VRWA 1Z83A 1YE8A 2QMEA 2ZAOA 1XD2A 3R8CA 3B13B 4TN1A 2VPPA 3EZFA 1NVUQ 4DKXA 2LWIA 2Z0MA 1XJCA 1X86B 1NBMD 3KFXA 4OHWA 5SZIA 2HT6A 3K1JA 3OEHA 2B8TA 3HU2A 1QF9A 3M1IA 2JJ1A 3SQXA 2WAXA 2O8EB 2QBYA 2BCGY 2P65A 4OJKA 3ASZA 1E9RA 1Z29A 2ZVPX 4NONA 2JLSA 1E94E 4MKIA 1F2TB 4A8JC 3G0HA 2QTFA 1S1CA 5E4FA 2ONJA 5DISB 1OF1A 5HCNA 2P5SA 1JQJC 3SE0A 2ZUCA 1EESA 3U2QA 1X8JA 3GLIA 3NIBA 4PC3A 2QAJA 1LV7A 5CIWA 2FX3A 1M7BA 3SNHA 5EP3A 5CYPA 1W5TA 4DDTA 2J7PD 1NP6A 3BH6A 3CNLA 1Z5ZA 4KVAA 3TAUA 4O2LA 5C4MA 3L0SA 1BMFA 1P62B 3SQWA 2WJHA 3SZRA 3O47A
chains in the Genus database with same CATH superfamily
4RV9A 2D2XA 1D5CA 1SVLA 3E53A 2R8ZA 3FWZA 1AXEA 3OBBA 4FE3A 3UYKA 4QNRA 2IPAB 2IUSA 1CK4A 4F38A 2BEKA 2ZTVA 1JAXA 3H6GA 4YK7A 5EFOA 3DBRA 3K0KA 3L7NA 1GWNA 4PV7A 2CLIB 4X6LA 1Z7BA 3ND6A 1GNSA 2ZJBA 1B8OA 3G5AA 2VYFA 4RZ3A 3Q5GA 2FGJA 3LKDA 3S8MA 3ANSA 5E9WA 2F43B 2DETA 3TKLA 4S05A 1E5QA 1Z75A 2JJ2A 4P5PA 3UV6A 4N3BA 5ALEA 3STXA 2VSQA 5E2AA 3KT3A 1NBEA 4TUYA 5KSOA 4OQ4A 1W47A 3IAS1 1IZYA 1AQ6A 2GA8A 4RD1A 3GMDA 3P9KA 2P75A 4H0FA 4QQKA 3SLGA 4YXWA 4AKEA 3LVFO 3MRXA 1RC8A 4OG2A 3P5SA 5MHTA 3FH0A 5HTOA 1UXHA 2NLOA 3SM3A 2OHJA 3ICEA 1SXJC 2IUUA 3HDVA 3VGJA 2P5YA 3WVNA 2C5SA 5EN4A 3D6HA 4KXQA 4Z4FA 1FJGB 2IPMA 2JG3A 2ZIAA 5EMMA 4URZR 2OR3A 2R6HA 1H6DA 4ZAFA 5I51A 3IL2A 3AUYA 2UZ0A 4JBWA 3TTVA 5LFAA 3MUEA 1U90A 1HQKA 4F84A 5E1BA 3PQ8A 4C22A 1W44A 3FIJA 5TVKA 1M1ZA 1SKBA 1L7MA 3D4IA 1R66A 1JG7A 2Q1YA 1XQ1A 4BWFB 1ZHHA 4WECA 4WFKA 1RHJA 4CLRB 4RPGA 3OJLA 4CU2A 5K0ZA 1RVDA 1V1JA 1YKFA 1R4MB 2H8KA 3IVRA 3H87A 3CH4B 3KSRA 3H1AA 2LXNA 1DC4A 2NADA 1DS6A 1N9GA 2OCBA 1BRMA 2CXQA 2PK3A 3D7RA 1I0IA 1SKAA 3L07A 3O73A 1FUYB 2Q1UA 3G8AA 3ZTTA 4D9HA 1KMHA 2ZVDA 4LRUA 4F2HA 1DCTA 4X41A 2VF8A 3TH5A 2WMDA 1X7XB 5LB2A 5FPPA 4FS8A 4HDSA 4M1SA 4BN0A 4J0DA 3MMNA 4GX1A 3V32A 3HLYA 1JLSA 4YXWD 1MIHA 1UBUS 1Y1RA 2HPZA 2PM8A 4XFKA 4GM1A 4EGJA 5CA1F 1A9PA 1UKEA 4G25A 3D1JA 4XLZA 3LY9A 4TRNA 2JD1A 4Y1EA 4TQUS 4HATA 3WNCA 1U1EA 3AR2A 3DQQA 4BFSA 2FJUA 5EHZA 4KH1A 5ES3A 4EYSA 1NV9A 1PJCA 2XCOA 4N65A 1NXTA 2QPTA 1H2FA 1KJYA 5FFMA 3L7KA 5LP6F 3AU9A 2XAAA 5JG7A 4KAJA 4B6PA 3A1DA 1WPQA 4R5MA 5DX8A 1R37A 3GLHA 1NBAA 4N3CA 1HNZB 3ZOKA 3T95A 5KYWA 4KQFA 4TXNA 3CEAA 3BM5A 1DX4A 1L8OA 5CCEA 4MRMB 4DXDA 1YI8A 3SFZA 4YRMA 1VJRA 3AYXB 3CH6A 1J33A 1RP7A 2AF3C 2YMLA 5DFAA 1PN3A 1MN6A 2POCA 4HRYA 5E6SA 1BEUB 3NM6B 3I32A 5DZSA 3ZE0B 4EJSA 4Q7QA 2FAXA 3EZNA 3RSHA 3ZH9B 5JRZA 2Q5JA 4PAOA 1VMEA 4RVDA 4C2UA 1CV2A 3GRAA 4YUAA 5E9AA 3WJ2A 1VGVA 4B1FA 5D85A 2O8FB 1KP3A 1D2CA 4G1FA 7YASA 5BOSB 3BH0A 3MRVA 5L4LA 4MK4A 5DOVA 2R86A 2FK8A 1C1XB 4ASUD 4DDVA 3E9DA 4GOJA 2RHMA 4MKXA 5ITVA 5EZQA 4CIBA 2B3DA 4FMDF 3UAZA 2WHRA 5TQ2B 4RQBA 1U0LA 1YFKA 2NG1A 1HUQA 3B8HA 3LT0A 3M49A 4L6CA 4TWBA 5JD3A 4TZTA 3ZWOA 3KFVA 2K2QB 3EQ7A 3JASB 4ZYXA 1D2HA 1NDUA 1B8NA 4RVSA 5HQJA 4DS3A 1W73A 4JI4B 1QAMA 5KYTA 1F1JA 2P62A 3DLCA 2B8WA 1M33A 1Y80A 2J46A 2B1QA 2OFPA 3A4YA 3SJZA 1JWAB 1FDWA 4IGFA 1XZCA 4LE1A 1V16B 5IM4F 1ISGA 4MJ7A 4QYIB 3PC7A 4EY7A 3TDNA 1W1WA 1WV0A 2P11A 5T3YA 1LUAA 3IQGX 2QGFA 4ZOBA 4OEHA 3EGXA 1XTUA 4NBVA 2RMKA 3C8ZA 3RFFA 4E4YA 1E6LA 5KQPA 5IS2A 1C8BA 4P4GA 3J81A 1M76A 4F21A 2NUAA 3WOVA 1J2EA 5LXTA 1GILA 1KSGA 5KKCA 3VJRA 4Y6RA 1N36B 2I33A 3RVBA 1AB5A 3HABA 3NHMA 1YT5A 1XP8A 5JXIA 3OPNA 3OIUA 1H85A 1PG0A 2C2ZA 2IV3A 3M6XA 1NFRA 4B31A 3HHPA 16PKA 3MQ2A 3U17A 3KLBA 2JGJA 4WAUA 2C4HA 4BP9A 2DR3A 5IC5A 3LWNA 5JNVA 2OXEA 4AX8A 2VDPB 1E3IA 5KINB 2M9MA 5CFMA 4UNQA 2DBYA 5AXCA 2X4LA 2IL1A 2D3TA 3QE2A 1LBIA 4NBTA 4MICA 1KJ8A 1QPGA 1RBYA 5J63A 1I5OA 2OA0A 2FUNB 2OD9A 4JI5B 2R8YA 4PZZA 4X62B 3SJCA 4ESEA 1PZHA 3RRNA 2CKMA 3P52A 4KBFA 2O52A 5IJ9B 2A4MA 4HY3A 2FFHA 1E3WA 2X3UA 4QPPA 1WKCA 5T5QA 4AN4A 3LP5A 1NUUA 4DCTA 5KO2A 1T8UA 3Q10A 1Y37A 2BTOA 1X1DA 4OXYA 2OV3A 4IDBA 1AUVA 4G67A 1I14A 2PBRA 4FYXA 4HJXA 4O1HA 5IAKA 2VQDA 2C2HA 3D0OA 3GL9A 3GC6A 3I04M 4LVOA 3LZCA 3S5UA 4KXFB 3ZHOA 1L2TA 3DMHA 4GMKA 5GPBA 4LYJA 1EFVB 4O4HF 4LSGA 1OVMA 4IJ6A 3SE7A 4F5YA 5KQGA 3IS3A 2QQ5A 2I65A 2AD5A 2H9AA 1X1TA 4QTZA 3P19A 5TPWA 1BYUA 3FYUA 5JTTA 2Q4DA 5H81A 4FC7A 2HDOA 4FZ5A 1JFLA 3BHIA 2II6A 4EGFA 2R48A 3LTNC 2P9BA 2QY6A 3BWBA 3CGWA 3MWYW 4JOCA 3ZHQA 1EVLA 2BMWA 3OURA 3LCMA 1VMDA 4XE5A 2NWQA 3EXIA 4P7JA 4NBWA 1UODA 9ATCA 1AU9A 1EA5A 3ZQJA 1JF8A 2CVHA 3TLMA 1U7WA 4ZQEA 4AF7A 1AX9A 4QUAA 4IH1A 4B47A 5JSZA 3GQBA 4D9FA 2H16A 4KZPA 2XHEA 3OKAA 1U2SA 2YRFA 4IJVA 1BXGA 3HKCA 3RC9A 3ZE9A 3CVUA 3GD7A 4BX9A 1Y48E 1UDCA 5KAMA 2IWRA 2PL5A 4LTNA 4UNSA 3TZHA 2H5EA 4RPIA 5D3ZA 1SXJB 2IYSA 2NT3A 3RTEA 4C4XA 3E7FA 4YCBA 2Q5LA 2ASVA 1JAZA 3DVAA 5TQ0A 5B6IA 3WLNA 3DDCA 1R0YA 4CUJA 3VDRA 4QT0A 2HRBA 3E70C 4KN6A 4NOLA 4DDKA 4N5HX 4KCGA 1C2YA 5LZ7A 3HCEA 5FORA 4B48A 5JBQA 3T1YB 4YRFA 3ZDYB 2NIPA 2ABWA 4G8BA 2QT1A 4B7UA 3MGAA 2IZ5A 2VSOA 4WKNA 3WIUA 1P33A 2OMEA 4S1TA 4US1R 4DDWA 5JADA 4IIGA 1QH1B 5HPYB 1XD2B 3OTGA 1G17A 2WNHA 1YZFA 1JU9A 5EP2A 3VQTA 4WBNA 5GIPE 1RE1A 1UIRA 1TK2A 3HKEB 1YNSA 3T7JA 1UPBA 4D92A 5JDIA 3GCXA 5JISA 1E2BA 3E35A 3PRJA 1I2BA 2BGUA 3ZE7A 3E1GA 1Y3DE 4LGMA 3EMKA 3FX2A 4W9MC 3V9PA 1QRDA 4EBBA 4B74A 1N5DA 1PS8A 5LDGA 4GLOA 2Y1FA 3GA5A 3H2BA 5K3FB 3R75A 2JFBA 1XQ6A 4FI3F 4LJ5A 4G5SA 2WYWA 1NSYA 3OQ6A 3COSA 1EBUA 3NHWA 4CDNA 4ZALA 1ZVKA 2O2HA 5KZMB 2XGMA 4PX3A 1JSXA 2DECA 5KTYA 4UUBA 2H4YA 3WAKA 3VDMA 1DI0A 1B93A 3RIEA 1EUQA 3DEKA 1GKKA 4U8HA 2EP5A 3GMIA 2BEVB 3S3TA 5ILOA 5AUQA 3PFIA 1NI5A 2CNOA 4R6XA 1U8CB 2WZBA 2YWHA 3L77A 4KI0A 2HU8A 5HBGA 1ADCA 5LMCA 2QTTA 4PYMA 1TO2E 3AEKA 2HO5A 4MUMA 1HFKA 4RPHA 5DHAA 2PMCA 2OMKA 2WWVD 4R1QA 1WSAA 4E5KA 3B7WA 1M2OB 1Y3IA 3T0GA 3CNEA 4DLBA 1TYCA 1J00A 1S2LA 3CW2A 5HOEA 1ENPA 2NQ2C 3QUCA 4DDHA 1C4WA 1MCZA 5CA0B 3ICQB 1XDZA 4CM7A 3ET4A 2J3KA 4JJZA 1WV1A 4GMDA 1SOWA 1JW9B 4IDEA 4S04A 2BZ1A 2DQZA 5DULA 4X1YA 2Q6OA 1DHTA 3NIWA 5IZCC 1IEWA 3LDFA 2AEJA 2G1JA 3AP1A 3CNHA 3GRCA 3FPFA 1OA0A 2XVYA 1C30A 3F4BA 4JL5A 4Q12A 4GNKA 3UM9A 4C76A 2UYQA 1RZVA 4WOJA 1N34B 1QX4A 2VH5R 4CGZA 2AOTA 2Q3LA 3GT3A 4Q3LA 5FF9A 4C2AA 2QV0A 3P0FA 2AEFA 3N2GB 4ZOAA 5DK6A 1SG6A 3VC2A 1BEZA 2WF5A 4NJEA 4OQPA 4YRNA 5LMZA 1AHPA 3DTVD 3CKMA 4ZPJA 1Y7IA 4BQSA 1FSSA 1B8VA 1QDLB 3DE1X 2XLBA 4XB2A 4B2PA 1VBFA 1I3MA 1Z07A 2CBXA 4PR3A 3P9YA 4B6OA 4BO4A 4ECEA 3ULKA 2VJPA 5AHRA 4F4HA 5HQ3A 1YIDA 2YRXA 2Y66A 3QYJA 4MR7B 1HTWA 4IFEA 3PUWA 1AA6A 1RKVA 3A28A 3D6MA 3DT8A 3EASA 3WRYC 4AKIA 4ZI2A 1RBQA 2ENUA 3QWIA 3HXLA 3FB4A 3N58A 3BFKA 4JP2A 4NV1A 4PZAA 5IBQA 4KGXA 4PZDA 1IPFA 4U0KA 2L17A 3O91A 2EU8A 4ICIA 2YIJA 1PUXA 4BGIA 1ENYA 1FNBA 1W4RA 1V5WA 2JFGA 5CH8A 2OO3A 3HKBB 2O2CA 3BD7A 3FVRA 2YXBA 2CVOA 3H42B 5EP4A 3VAAA 1K0UA 2WUVA 1N2BA 1L5YA 4ZDIA 2E3JA 2WFLB 5C8YB 2EL7A 2A1IA 4LQDA 2VIIA 2HMUA 4TVKA 4ZQGA 3I12A 2VPZA 3GJXC 5CGZA 4EHJA 3WWCA 2OEPA 5HGXA 3UK0A 1IHPA 2V03A 1GGKA 4U5XA 2X0JA 3UT6A 1GUAA 5B7PA 3KSMA 5D5PA 4HQLA 5KHLB 5F9HA 5DGXA 2CNKA 1I4OA 3MM4A 4F3TA 3HB9A 4XLLA 1GT91 2A5GA 1PS0A 1HBJA 3PHIA 2JCXA 2EKLA 2FPUA 2FKNA 5WRFA 1GRRA 2P40A 2FPIA 4KQEA 1KE1A 4TZ6A 3R7NA 1XMIA 5C4IA 5F33A 1IN4A 3A04A 3M4YA 3T8YA 1WBJB 3HVRA 2YDXA 3G2JA 3CUSA 1YRBA 3QH4A 4YJKA 1YXMA 5GIOE 1CNFA 3D5EA 5EZSA 1ZJZA 3AQ4A 1CUUA 4RPLA 3SPXA 4BNMA 5JNTA 3R9WA 4JFAA 2PYZA 4DLTA 4EI7A 4OHOA 1R6VA 1HT0A 1YR9A 1Y9AA 4C0JA 4DT1A 5ADVA 4CG0A 4TKLA 1WZUA 2VDMB 3W2TA 4TVSA 1J22A 2Q3CA 1Y5NA 4L6AA 2VTBB 4FFBA 4X3OA 4O0MA 3WLSA 1SR8A 2GPNA 4KH0A 5DYTA 2A9PA 3FTNA 2YFHA 4RZHA 1ZGGA 1VPWA 1IJKA 1BZYA 1WUKS 2ID7A 1GTZA 1N6LA 3LC1O 4QAQA 5YASA 1H0KA 3A7EA 3GNLA 4DMFA 3QJYA 1DJMA 4F96A 4OFBA 3Q3VA 4EPWA 3A6EA 3FD8A 1JJIA 1W0JA 1XELA 1GAQA 1Y3CE 5K3OA 2R6DA 4KDRA 3NVMB 4TXLA 3RUFA 4DW8A 1Z4KA 1E4OA 3WGOA 5JJKA 3F78A 4UHCA 4LYHA 1PR3A 1YCDA 4AL4A 3CEPB 1B00A 1IONA 1XMXA 1ZKDA 5ICGA 1MB2A 2HMWA 4B4VA 5JNSA 2HF8A 2RHRA 2RH9B 2XPCA 2XUHA 3B1ZA 3M2TA 2PU7A 5BNTA 3VU1A 3AY0A 4QFBA 5HA5A 3L1VA 1ZEMA 3A70A 4UEKA 1A7AA 4J16C 5TGTA 2Y77A 4TKUA 4UBKA 4W63A 2H17A 3IDAA 4X6YA 3EEQA 3BBPA 4QECA 4XB1A 1XZGA 3R6LA 4WXMA 1GAEO 3ITNA 3Q12A 4C7OA 1CLUA 3EZ2A 2GYYA 4LSZA 4M53A 4B3TB 2AN4A 4U4AA 1A2OA 2AN9A 5HUQA 2VZ9A 3IPYA 3PE6A 3TD2A 3GUHA 1MB9A 3QK7A 3SVZA 3TFQA 2QHXA 1VFNA 3IXQA 5ITWA 3HCAA 2PLAA 5A3VA 1DXYA 1OXBB 1VPVA 2YOHA 4KE7A 1G8SA 3DCJA 4Q9AA 5DBHX 5EKXA 4QUIA 2HIAA 2ZULA 2AMLA 2AHOA 4QHSA 2P6MA 4K2AA 3H6HA 3TIIA 2I1QA 2JGIA 3A27A 2H2GA 4XJVA 2GZ2A 4F92B 4IJWA 4K8RB 3KO8A 4LHEA 3P9ZA 4G86A 4LRWA 4RXUA 1NR5A 1A8HA 2W2OA 4EF5A 1W0JD 3ANLA 4DN6A 4CEJB 4ZGGA 1N8TA 4Q4DA 1KR2A 2EFGA 4Y9DA 3OHSX 4RXTA 1CEXA 3Q0EA 3GEBA 4JSRA 1M75A 4YQYA 2GCOA 3L7DA 4D2IA 4KQXA 3RS3A 1JEYA 4AO6A 1T10A 1B2RA 1PLJA 2WV7A 3A6JA 4RJ2A 2VQFB 4OM7A 4M1KA 3PQ6A 3OVMA 2O8CB 1D4OA 2Z57A 3C6KA 3GEGA 3VBEA 2NXWA 2F3UA 1K08A 1ODIA 4AJKA 5KQLA 3FCYA 3PJFA 3BK1A 3H5TA 3BKWA 4DLYA 2ECQA 4M37A 1RU3A 3DDSA 1C4XA 2EBUA 2O5RA 3RU7A 4EHIA 4M0KA 1SB9A 3K1AB 1KDZA 3J7AC 4PR0A 2BEWB 3BL8A 4ZU3A 1X8XA 4E09A 3PNVA 1B76A 4JLUA 4MWGA 3ZV5A 1G38A 1VI2A 1TGYA 3PZBA 1QRUA 4PHFA 1IN6A 2FFQA 3CRNA 1N92A 5DI3B 3LK6A 4WOBA 1DTSA 1Z12A 1NYQA 1ZK3A 3OM1A 4D8YA 1JLMA 4V0KA 4QFCA 7ABPA 4F6RA 1O6GA 1QYXA 5DHFA 5I6DA 1L4LA 2QSZA 3MWDA 2ZVQX 5FULA 3WADA 4ARZB 1A2QA 4U2GA 4WERA 3TVYA 2IGTA 5IU6A 3WHPA 1LTKA 3EIOA 1V9LA 4TV8B 2HJVA 4FSHA 4IXTA 4NBKA 1WVIA 2Z56A 4WSOA 13PKA 3QU7A 1EE1A 3QVGA 3CF6R 2YJZA 4BNVA 1BA3A 1SPXA 1T5BA 2BMDA 2J31A 4RSGA 5E2BA 5EFZA 4G0MA 3QHQA 3EUWA 1UC4B 1C9KA 3CW9A 3V8PA 4PM4A 2XYPA 5DNYB 4NNJA 3WK5A 4EYEA 3CO0S 4L9WA 4O4JF 4TYPA 3ICWA 4R3NA 4K7JA 2A59A 4KIJA 4MV9A 4U9UA 4XCXA 5BMOA 1GTG1 3E5NA 1KRHA 2HF9A 5EMLA 5IC6A 3T3MB 5JZSA 3STYA 3NBAA 1N0IA 1O8CA 2WPDD 1JECA 3REOA 2A92A 2NMVA 1J9GA 3JZIA 4D9JA 1XZJA 4AZ3A 3NOVA 3K35A 4Y2VA 1N6IA 1V6AA 2CLMB 1VKZA 2HU7A 4R8SA 1C3OB 1AXRA 2H2HA 1NMXA 3ZJ4A 4EEZA 2O59A 2NZXA 4KQHA 3WJAA 2PUBA 4K6GA 5BV2P 2GLTA 3UXYA 3OPYB 1CUZA 1E63A 2WHEA 3DBLA 1YCGA 2G0NA 2VJMB 2DBQA 1GNRA 4L9SA 5TNXA 2SICE 3TUZC 2PGOA 1ZGAA 1LPSA 2JKZA 5F73A 5LPNA 4PZPA 5I4KA 5KREA 3C4JA 4RANA 5CTAA 3L7LA 1Z37A 4UTOA 5AJTA 4R2KA 1VG9B 2JGDB 4WH0A 4ZOEA 2ZJ1A 2VBGA 3PNSA 4HUTA 1OGIA 3LQ2A 2OC9A 3EQ6A 4GPEA 4H3HB 2JZNA 1TEVA 1UBTS 3JALA 3D4OA 1RYYA 4HQNA 2C9YA 2Z8XA 4KUGA 4OM8A 5C1DA 4NENA 3THXB 4B81A 3CM0A 3R0VA 2GK6A 2VZEA 3K30A 5FWDA 4AFNA 1H0SA 3N53A 5DNWA 5DNDA 4TV9A 3ZC3A 3GEMA 4KFRA 3B3GA 1KZYC 5HP4A 1N2OA 4DUYB 1Z7GA 4WZAA 4L4RA 2PVCA 3BMQA 3T3NA 1M73E 1BS9A 1OC2A 1ZNYA 4HADA 4PHTA 5KDLA 3HGQA 2YWRA 1MO3A 4BIMA 3PE3A 3EMVA 2X2PA 2JHFA 4M0CA 4ZDJA 4LV6A 3HA7A 1G3UA 2JJ1D 2A30A 1GRQA 2PV7A 2MYTA 4JELA 3D8RA 3EQ8A 2DFKB 2ZK7A 4I81A 5KS2A 2O0LA 5G4LA 5HS4A 4I55B 2O0HA 3QEMA 1OPRA 6AT1A 1ECFA 3PVCA 4WX2B 1ANKA 1ZLYA 2I8AA 1PEAA 3GFFA 4Y1RB 2O1XA 2WD9A 2DAPA 5HF5A 2ZCJA 1H94A 2C5AA 2XGJA 1BCSA 3AIIA 4JR2A 3ZV6A 1FB5A 4Z1MA 1YZYA 3GJSA 2UVQA 1N8SA 3SC2A 4MYHA 4DEXA 4OHKA 3T7SA 1O96B 1WBDA 1DKOA 5DNVA 3IEXA 1YB5A 1HMYA 3P26A 3AKEA 4I50B 4GVPA 4X20B 5EHGA 2JD2A 3SDZA 4LJ9A 5IW8A 1W49A 4EPRA 2O3RA 4G0XA 5KYKA 3TCNA 4IVRA 4LDQA 5EQJB 2PR7A 1BE8A 1SIOA 5LLTA 3C41J 4KTTE 3KQMA 3LM8A 4XLTA 3HN6A 4HH1A 1BW9A 1JYFA 1R18A 4U3JB 4DAOA 3ORRA 2FP4A 3N3AC 4BL5A 1VTKA 3IUJA 4HDRB 4PPFA 5HIAA 1KJZA 4EY6A 4F5EA 1JXQA 4AJHA 2GPYA 3GH3A 3T7CA 3MJCA 4Y1GA 2WAMA 5HHTA 1MAHA 1EP9A 2P9GA 3O4GA 3RBZA 1ZJ5A 3KEMA 1VB3A 3TQOA 1PT9A 3WL6A 3H04A 2IUTA 1F9EA 3W5CA 3N39C 1HNNA 2X5KO 4C7BA 5C1OA 1E2GA 2QU8A 2WT9A 1VMKA 1YQGA 1VXOA 2Z83A 1EX1A 1U2GA 1LBSA 4JBNA 4O08A 2X4DA 4CMBA 1SOUA 3LY7A 3QU9A 2WP0A 3HZOA 1WMSA 2ZU0C 3NJRA 3QVVA 1QF7A 1C0IA 1H6CA 4ND2A 2I4MA 2WUDA 5FWYB 1YDEA 1FX0B 3GGOA 2G1PA 1V26A 3KIPA 1QHSA 1VLMA 4G24A 5HS6A 1RXVA 3QVSA 3E3OA 3IDSA 3WQHA 5IG2A 3GJ5A 4HB2A 4HH4A 5K0NA 1G60A 2OKCA 4Q1DA 4YJ2B 4G89A 1SQSA 4INOA 1YB7A 2HLHA 3DGEC 4OOEA 3W8EA 2NAFA 3IX7A 4YO7A 2XUPA 4YP9A 5BQXA 3D7NA 1FMCA 1K1EA 1QXSA 3TRJA 2UYYA 1P72A 3TOXA 1NG9A 1W5BA 4C6TB 3RANA 2EW2A 1LRKA 2PX6A 2CFSA 2CUKA 4MV5A 1AVTA 3Q2KA 1FRNA 4OYRA 4TTVA 4B7CA 2CXRA 5LZ2A 3KR0A 2BKEA 2AL7A 1HOTA 1YAJA 4XD7A 4XSHA 4XQGA 4BATA 2MWMA 5EWMB 4DPKA 5A02A 1M8GA 1L5ZA 2G25A 2MSEB 1YDMA 3HJTA 3DCNA 1H69A 1RP1A 1OU4A 2G9ZA 2X5OA 2PZAA 2PRSA 2YXPX 4D0LB 5K7SA 1JKJB 1YDHA 2QD1A 4L8LA 2C5FA 2INGX 2BLLA 3Q98A 3N6RA 4RFLA 2IBSA 1P3JA 3JATA 3TIGA 3WLEA 3PICA 4K9MA 5CVJA 5JO9A 5AT1A 1K6MA 4ND7A 4HDKB 1L6IA 3O6VA 4PLPA 2W2KA 1K5PA 3B9QA 3G7SA 3NM5A 3EXAA 1W48A 2EX4A 4M0MA 1WA5A 4KHPB 4BHTA 1GEEA 1MKYA 3VX3A 1OFUX 1U28A 1HZZC 3JRNA 4HFNA 4U7JA 4YLGA 3UN1A 3R5FA 4EEXA 1G5FA 4LKOA 1OAOC 1PGPA 3TW8A 3CH5A 4C4YA 1AV6A 5IAEA 1NN0A 1XL1A 2VJLA 2QE7D 1CS0B 5AKIA 5DIFA 2UUPA 2GI4A 2IYOA 2WAOA 4AZ0B 1A77A 5AD1A 1QB8A 2CSXA 1YZLA 1DQRA 2EARA 2JK0A 4K9DA 4KO1S 4AP5A 1DAHA 1OXVA 5FTLA 1ZD2P 2FR0A 1YVPA 4JT9A 4QGGA 1H9CA 3RYIA 2YJ3A 4ILKA 1GEGA 4WN9B 4DRYA 1N32B 3LY8A 4R69A 3QXJA 5EPUA 5AH0A 1P9OA 2O57A 4B3GA 4LI3X 3P7MA 1E2DA 2NV2B 3N76A 5K2MA 4CF4A 1NPYA 1G20B 2V58A 3FYHA 3LT1A 4X7BA 1I4TD 1FLDA 4JXJA 4QUDA 5EHNA 4AIIA 2QTRA 2AKEA 1D5WA 1KZ7B 3L46A 3D5QA 3SAJA 4KJZA 1OBCA 3TVTA 1KDOA 2VATA 1ZU5A 3IDZA 3GGPA 4NMWA 1GA4A 2IYXA 4JQZA 2PFGA 3KZNA 3GLFA 3QKSB 2ZIXB 1R6DA 5DYYA 2P5TB 3PXDA 3X1MA 3E9EA 4QG3A 2VWPA 4ZOLF 2Z2JA 5ESWA 4ZC8A 4B0PA 5BUSA 5L9AA 3V4VB 3RFXA 1TO6A 3LWZA 3A2LA 2HUPA 2VPYA 3OJOA 5JYDA 1M10A 4GQBA 2YWDA 3OKCA 1P7CA 1NNLA 1TDJA 3VAZA 3KE9A 2SKEA 2ZS7A 4IW3B 2N46A 5C4GB 1D2RA 2CFOA 2Q2OA 1U81A 3EEFA 1WD7A 2BV3A 5KSZA 1LRLA 2FMUA 4TS4A 3RAEC 1EH5A 2IYWA 1X7GA 3FI0A 4D97A 3SQOA 1F12A 1XL0A 2XYHA 3AIKA 3K15A 1D9XA 1EFUA 2H5LA 3QHAA 5LQAA 3NNSA 4XIFA 3EW9A 2NSYA 1BXRB 1MC8A 2C8JA 4TWZA 1ZRSA 1Q3KA 1VCHA 2PQ6A 3ZE8A 4PC6A 2AEEA 4FILA 5JCJA 4J75A 3OE7D 1XEAA 4ND8B 4RA9A 2Y0BA 4W1SA 4JP8A 3K9NA 5AVWA 3F7MA 1X1AA 4NCKA 3HJNA 1IJBA 3EN0A 3VYSB 4R84A 1WHTB 2F8MA 1RQNA 1N2CE 4D46A 3EB9A 2OHIA 5EMJA 2AG5A 3QF7A 3OJ0A 1R50A 1RYFA 2Y1OA 2WHPB 3VH3A 4R71A 1GN8A 5F2EA 2IH4A 1XDUA 1V41E 2WF7A 2CD7A 1GG8A 1NWHA 3PTLA 4MV7A 4QJ5A 4D6YA 5FPSA 4X8OA 2CXTA 1C50A 4I4TB 3CVXA 1MC1A 4H27A 4UM9D 4UNIA 4LGCA 2A5DA 2MU1A 1H9AA 2HY7A 3LA6A 2ZE5A 3SS8A 5I5EA 4PNHA 2YN0A 4QZVA 5IKMA 3R3ZA 1FP4B 1NYLA 2LTAA 2IU0A 1ID8A 3PK0A 5KU7A 1K68A 4ZEOA 3G9UA 4FHCA 1XTRA 4HFRA 1EIZA 4PLYA 4MKZA 4XX0A 1VLLA 3PI6A 3UATA 5JH7F 3MF4A 3VKWA 5M3BA 2RGWA 2W9XA 3DXFA 3PHJA 2GEBA 1FFEA 1I2ZA 3I1JA 3C15C 1P29A 1KQPA 3DOCA 3OA2A 5BN5B 2IV2X 4B6GA 2IHTA 3D7KA 4DANA 2D2FA 4Q9KA 5DW3A 2FPMA 1G5QA 4BNIA 3SHTA 4AAYA 1XEWX 2WDZA 1DADA 3WLQA 2Q5QA 4RDXA 4BBAA 3AEYA 1HGXA 3AEZA 1F8GA 5DT2A 4ENTA 3U0VA 4BX8A 4ZEXA 3ZDXB 1HF3A 3WQBA 3T7EA 2CZGA 4NF2A 4PZCA 1LJLA 1Z68A 5LYYA 4DRXA 3RLIA 5ALDA 4ZVOA 1J6UA 1K3FA 1Z38A 4LQ4A 2RAUA 4CQMB 1XEXA 4D25A 3BK7A 1DRUA 1P0QA 1XZPA 3MAJA 1IUPA 3NYRA 3R23A 4Z8YA 2ISQA 1QF6A 1WKVA 3O92A 1ADGA 1LVUA 1ZX1A 2P9HA 1LPBB 3EFBA 1TLTA 3JTEA 4ZEWA 1NOIA 4H0NA 4MQEB 3ZX4A 4CI0B 4HNQA 2HQRA 3JYNA 3AVOA 5KMGB 4G9EA 1TEHA 2Z4RA 1E8DA 1MOPA 3U39A 2XCRB 3ETNA 4XXHA 4HGYA 3IHWA 5K0CA 1KH2A 4I2NA 2WIAA 2R7MA 3AG6A 1SUCA 4L2IA 1I3CA 3EXHA 2NU7A 4GMHA 4HAOA 1AQIA 4NEQA 4YMWA 4BVFA 1U94A 2GLXA 4DV2B 5EZYA 1D2EA 3BXPA 3NWEA 3IIEA 4GM0A 3TL3A 3ROKA 4JFRA 3T4UA 2B3TA 2XEDA 1F0YA 2FOIA 3HSYA 4R05A 1E1CA 1W52X 3NIFB 3V1UA 3AM1A 1DIRA 3CUVA 4QUBA 4YV0A 4ALKA 2OXFA 1DWOA 1KI2A 4G5QA 1KKMA 1Q14A 4JYBA 1B14A 1IXRC 4UHBA 5B1EA 4YDRA 3O8QA 1RRVA 4ER3A 3ZTWA 1LBQA 1WCWA 4KLRA 4PEVA 4EHNA 3L84A 4FUTA 4NARA 1KVTA 1XYYA 3EA4A 4MGYR 1J23A 1YBAA 3EXG2 4BLVA 4EY3A 4TLEA 4PG7A 4HN4B 2ANBA 2FFAA 4XWAA 3OT1A 5CHYA 5DT9A 5G3YA 5CMLA 1B6RA 1DQSA 2DWOA 2O2YA 3BSWA 3MCTA 5TQJA 3TBHA 3PEYA 2GJ9A 4KIFA 1L5RA 4HGQA 3CPJB 3FFAA 2X0DA 3JQDA 4A0FA 5FQNA 4DQVA 4CV3A 4K87A 5KNCD 4WGGA 2EW1A 2R7NA 3PWTA 1P5RA 4OP2A 3K7EA 5CB8A 1ZLXA 1VKJA 2G0AA 2I8LA 2VYVA 1JKMA 4L4UA 4MIEA 4KXLA 1O6CA 2Z2YA 3TZEA 3UENA 3R7SA 1NXXA 1O03A 3OT5A 2B5VA 2NV6A 221PA 3KDSE 4BDSA 3G79A 1Z28A 4Z6KA 3SZ3A 2VTVA 3EEBA 1Z7EA 1VDZA 4LJ8A 3SKYA 2WP8J 3M6LA 2K7FA 3CLSC 5DLYA 1ST3A 3UKOA 3DPSA 5CVDA 4FUQA 3O1LA 4Y2QA 3WZLA 1J70A 2GFHA 2X7JA 1X1EA 2BZGA 2JZCA 1JSRA 3L0ZA 4OLHA 1M1YB 1N2SA 3VPAA 1NXVA 3VSDA 4AJNA 5T4HA 1T6BY 2SKCA 5DE3A 2OPHA 1MQSA 2VCYA 3DBHA 1PFGA 3ANMA 1CUWA 4GDFA 1XLUA 4BO5A 4F2WA 3ZZ1A 4GS5A 5KYVA 1W1IA 1J42A 4UUQA 1NFFA 1XZIA 3B1XA 1THMA 2ZRIA 3M5PA 3KPUA 4WY8A 3FHOA 1V6SA 3IUMA 2FLWA 4S0XA 1PGOA 2WV9A 4ZZ1A 3I73A 1FJXA 3KSDO 3QKUA 2AQIA 1XRSB 2ZS9A 3BRQA 1ORWA 1BJTA 4WFJA 3ZLBA 2CY0A 3ODPA 3RD5A 1RQ2A 2X3FA 1TZMA 3IT2A 3KOZA 3ZNNA 3KCQA 5JNUA 3CN7A 5U9CA 5G41A 3AF0A 3BB4A 2BFPA 3JQEA 2D5AA 5EJ9A 2PU5A 1WF3A 4RJJA 1BEEA 2VYVD 2R6R1 5AQ1A 1WHSA 5ABPA 2J33A 1SOVA 4Q15A 4PG4A 4L22A 1I33A 1K0FA 5A7GA 1ZBQA 4P38A 3DR3A 1EGVB 2I6GA 4LBWA 2AYYA 3BWMA 1F17A 5EG5A 2V7XA 4K6OA 3ZDBA 3ITEA 1HDEA 4IQFA 1YS4A 1GARA 2OCDA 1GNPA 4QU5A 4B40A 1ZJ6A 3QXHA 4D6PA 4C7MA 3WV4A 2CB0A 4IVPA 2AS0A 4RELA 5AWFC 1J90A 1CY1A 1DRVA 2LE0A 3KJXA 5FYQA 3BRSA 2SKDA 5HG0A 4RFSA 2V8BA 3QW2A 1R0CA 1P18A 1GGJA 1CQZA 2ILVA 5D8DA 3TB6A 3W7VA 2RHDA 3EVZA 4QYXA 3E22A 3DS8A 3ROXA 1GUZA 4ME6A 3AR4A 5JUWA 1XMOB 4RS4A 5FTKA 3W34A 1ARZA 1ODKA 3KKEA 5J2TF 3IVAA 2ZTLA 3QPWA 4TZ0A 3HP7A 3BN3A 3LVRE 1P4AA 1RJFA 2PSJA 3R41A 5D6OA 3MBKA 3RU9A 3WBJA 1TKBA 4L5CA 5D7BA 1L9KA 4KV9A 4IVQA 2QW8A 2NAPA 4MUAA 1CB7A 1NZDA 4H08A 4YFVA 2HWKA 1SKUA 4MR9A 4W9RA 4KRFA 1TNDA 3N9IA 2B4RO 3QKRA 4Q18A 3ZXSA 1AGXA 4N3GA 1UMBA 2YZGA 1E5XA 3EY4A 4RBNA 1G42A 4ETMA 2FI1A 3LDGA 2IE8A 1SFRA 3ZY2A 3KJIA 5TMPA 1SWVA 2ZDGA 3AC0A 3EVFA 4CKYA 4LDZA 4MEJA 4P86A 1Z08A 3EXEB 5KB3A 2WLTA 3CXRA 4B32A 3IAAA 1TTQB 1ZNWA 2QR3A 1K4YA 3LLSA 4D3XA 1G8GA 1NRIA 4X7RA 6Q21A 2P9ZA 3ZV4A 4EO9A 1UPCA 1Y1SA 4HDCA 4RA6B 3LOPA 2X0FA 4BKOA 3WQSB 1S3SA 3AOEA 4GWLA 4J2HA 4M0LA 4CKCA 3IKMB 4G36A 3KALA 1RJ9B 2VHVA 3S0JA 2AFRA 1DAPA 2DJIA 2PKYX 3BWEA 1C29B 2J9RA 4MCIA 3QEAZ 4QJIA 4NI5A 3BT7A 4TLAA 4E7PA 1JE0A 1JUDA 2WYHA 4BP1A 3GH1A 4LTMA 4YCNA 3FNIA 4IYRA 5LVAA 4MRNA 3SOPA 4BNWA 1XEFA 4L95C 4YI3A 2EXXA 2XQIA 4NPAA 1D4ZA 1KRXA 3ZK9A 1MQ8B 2DJ5A 4PXYA 2HWUA 4BLRA 1VE9A 3KEOA 1FYXA 5D5QA 3FMOB 4GBJA 3GNQA 2A9RA 1GRNA 4XH9B 5TT0A 2LCFA 1W2WB 1M1YE 1L5WA 4UM7A 4A0HA 5SZJA 5JVDB 3IKJA 3EIUA 4BMSA 1JFFB 1S3GA 1G64A 3BD9A 4ZT7A 3PUZA 3OQMA 1IJEA 1AKWA 1A4IA 2GXSA 3O3MB 5KHAA 4Q3BA 4HMOA 3ANNA 3WSTA 4EPTA 4CXMA 1I94B 3A3OA 3NBYC 4PGHA 4C3ZA 4RORA 1SZPA 4A82A 3I62A 4DSUA 3N0XA 2FW7A 2PR2A 3MAGA 1FL9A 1CJKC 1DWQA 1T6ZA 3F1KA 1Q3TA 3HJBA 1GFSA 3BEOA 3PT5A 2H0QA 3TLGA