5CB6A

Structure of adenosine-5'-phosphosulfate kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
173
structure length
173
Chain Sequence
RGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable adenylyl-sulfate kinase
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
total genus 69
structure length 173
sequence length 173
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb6A00
1IQPA 2RGCA 2OAQ1 3FFAA 3KKPA 4IEIA 1R6BX 3GEEA 4OQFA 1GM5A 1AZSC 1XNJA 2QMEA 3CH5A 2GXUA 4RJLA 4NU0A 1IN7A 1S4QA 2YHSA 4HUTA 3KXIA 4JLNA 2H18A 3A8TA 1YU9A 4JS0A 3B82A 1NJGA 3DOFA 1NY6A 4GZLA 1H8ED 3U7HB 2WJGA 1I4DD 1KO4A 1U8ZA 1XZPA 4KI0A 2ZVPX 4J0QA 4Q4JB 5B58C 3O47A 1G8HA 2Z83A 4A9AA 2QQEA 4A36A 2OV2A 2WPDA 3CZPA 4AYXA 1G3IA 3CPEA 2GXAA 2GCOA 2VHUA 3QBVA 4L9SA 1AS3A 3TKLA 1KI1A 4A1FA 4BUJA 3R7WA 4QNMA 2W0MA 3NC0C 4F7WA 2V8OA 4HI0E 3U44A 4MGKR 1X8KA 2GBLC 5FOXA 2YOFA 1KK0A 4C7OB 2AXPA 3K9GA 2C98A 4P33A 1ZW6A 1O3YA 3A4LA 1AKYA 4B35A 1NVVQ 2QE7A 4JLPA 1EESA 2OUKA 1J70A 2N46A 2QT0A 3C15C 5DE3A 4XWAA 3BB4A 1OFTA 1UBCA 2ZSDA 1NBMA 3JVVA 2BOVA 2QI9C 3EPLA 4KSBA 4V0MA 3MWYW 5DI3A 3RRZA 1GRNA 1AJEA 1KK3A 3QKSA 2J87A 4TYPA 2J7PD 1H65A 4TYWA 3DOEA 3TQCA 3NBZC 4Q1DA 1CR4A 3HPQA 3GJ5A 1DAMA 5ANRB 4D0GA 4G3XA 2PH1A 4PAOA 2RGXA 5J4KA 2O0JA 3UANA 5FBWB 3ZYCA 4TYYA 3BOSA 2QAGA 3ZVLA 4ILEA 3NKVA 1X86B 3JVUA 2JLXA 5EZ5A 4UKDA 3UG7A 4BRUA 5FBQB 3EA5A 1P72A 4RZUA 2D7DA 2ZQ5A 1ZNYA 4LSGA 4JVLA 2BEKA 1E2GA 5J47A 2P2LA 1C4OA 3DHWC 1ZU4A 4BLQA 2MSDB 2ZSAA 1M74A 1HYQA 5B57C 2D62A 4KBGA 2ONJA 3E1SA 5AUPB 2QPTA 4TMXA 4ARZB 2XXAB 1W4AA 1W44A 4PQYA 5A5GA 3WYAA 2VYFA 3WMEA 4MKIA 4CEJB 2ANCA 2QMUA 1CR2A 1M8PA 4DSUA 3OZXA 1XMJA 2OO7A 3KXLA 4OI4A 1W5TA 5DH9A 4YMSA 4PQFA 4WVFA 3UXMA 3QEJA 3K9NA 1Z0DA 3IIKA 2CLSA 4QXAA 5FUXA 2H92A 1YHNA 1GOTA 1PUIA 4HAUA 4RD4A 3UIEA 1VG9B 4F4JA 5ELXA 3U4QB 3WBKA 1JQJC 3IIJA 4HEJA 1W0JA 3A1TA 5FOWA 2ZR0A 4B2IA 1G7TA 1G5PA 1AKEA 2YJTD 3BGWA 2VBCA 3Q5EA 1IHUA 1TTTA 4IHQA 5EUMA 1Q20A 1ONBA 1LV7A 3K0CA 1S96A 2IXGA 4XH9B 1OH5A 4OK5A 3MAAC 5DYGA 2P65A 1JB1A 1E0SA 3QXJA 3TW8B 1SVMA 2C9CA 4UQOA 2DFKB 1FTSA 4HZIA 3LQRA 1SQ5A 4TQAA 1VG8A 1SVLA 4P4TA 1R7RA 4URYR 2BV3A 5HE9A 3W9YA 3PENA 1D2NA 4DLTA 2YYZA 1P5ZB 2BEJA 2J41A 1TAGA 1NBMD 5D3QA 4Q7KA 1MO5A 3TUIC 4FINA 4Z51A 4LHWA 4LHZA 4TMKA 2D4HA 2IS4A 4RFVA 4XVQA 2GJ8A 1DVRA 2RGBA 2VP9A 3QUSA 1X6VA 3U3KA 1KKLA 2GDJA 1FX0B 3NEJA 1KKMA 1CTQA 2DB3A 4GPTA 5FR2A 1IY2A 3U6BA 2IYUA 3FHTA 4IJMA 1Z06A 3OEHA 1A2BA 4WXPA 3I5XA 2XEXA 4TTRA 4AYWA 5KTYA 2YNMA 2GHIA 4JL5A 3GJ8A 5JI2E 2DHRA 2JGNA 1U9IC 1TU3A 1YR6A 2E1RA 1G18A 3PEWA 1DO2A 4M9ZA 1ZM9A 5L3QB 1WRBA 3MLEA 5JEDA 2ZPTX 2EQBA 2KB0A 5J4LA 1WBDA 1VPLA 2Z0MA 3L0IB 2CEAA 1KI4A 3EZ6A 1SZPA 3BFVA 4OKSA 1U90A 2PL3A 1XTKA 1R8QA 1G4UR 4F4IA 1ETUA 1R0XA 2G6BA 3MMPA 1ODFA 4Q9JA 2FDCA 1EX7A 4WAUA 1N6IA 1J99A 1JR3E 1PZNA 4ZKEA 4UJ5A 621PA 2GK6A 1R2QA 3SHWA 5FPSA 4LJAA 1W2HA 4M1MA 3K70C 4OQXA 1W5SA 1NN0A 5E95A 3GFOA 4BFYA 3BH6A 1JAIA 1FQKA 4JYBA 2PBRA 3EG5A 2EFCB 2QTVB 3PEYA 1RYFA 3QE0A 1P9NA 1Z6TA 3VMFA 2O8BB 4JJZA 3HYTA 4M1WA 1WDTA 4C9BA 3THWB 2VP4A 2ZUBA 4GP7A 4H1UA 4W5HA 1A5TA 4B44A 1KDPA 1CJVC 4TLEA 4R71A 4RZXA 1L4UA 1UJ2A 2ZRLA 1ZIPA 1B23P 4YDSA 5EE0A 2HCBA 2BM1A 5JRJA 2JJ8A 5HZKA 3SR0A 3RRMA 3LBNA 3KKQA 4QKQA 2WICA 1EFRA 1TQDA 2BMDA 3NVAA 1UKVY 3GD7A 3HU2A 5JJIA 4JLVA 4I1OA 1G8YA 4C7OA 1E9SA 3D31A 2IEYA 5BWMA 2JEOA 3L8ZA 1YZUA 3CPHA 4I99A 1N5LA 1Q3TA 4F93B 1DS6A 3TAHA 5LDDC 3AEZA 2GF0A 2N1BA 3KTAB 3P26A 3UMRA 2QPAA 2VHTA 3CR7A 2VH5R 2W0SA 1QRAA 1CR0A 1XFAA 3WBJA 1NN5A 3HPRA 3EAQA 1Q21A 1J8MF 4M9XA 4D0LB 2ZI9A 5JWOA 4Q48A 1KO5A 1X8LA 3BXZA 4JBYA 2O8EB 4KLZA 2GETA 2GZAA 3THXA 1KK2A 3R8CA 4NP6A 1XF9A 2AN9A 2OAP1 2ZUDA 2W6JA 4DLYA 1G5TA 2VSOA 2GJAA 2BBOA 5HCIA 1E9RA 1GG2A 4KLNA 4AIIA 1XEWX 2J1LA 5IDVA 4A4DA 3WNBA 4M0LA 1WA5A 3AP2A 4ESHA 1S1CA 3HP1A 5BN5A 1YQTA 2D7CA 4HLUC 3BH7A 4MUBA 5CM8B 4KBFA 3GLFE 1V43A 4MYHA 1VIAA 4QOSA 3W5IA 2VF7A 5H68A 1I2MA 3Q3JB 3FKSA 2YWFA 3MCAA 3FGNA 3TE6A 3K0AB 4A0RA 2PX0A 4QC2A 4G5GA 4URVR 2C78A 2HXYA 3G82C 2QP3A 5BYJA 4PX9A 2WHXA 4ARZA 2XXAA 2GVDC 1OH7A 2ZE8A 2B8WA 1RYHA 2ANBA 4CEJA 3TR5A 4TLCA 1E79A 2GJKA 2AWNA 1M2OB 3SFVA 1LY1A 1CS4C 1HH4A 4PXAA 4ZI2A 2XSZA 3C16C 3FHCB 5DNYB 3DEFA 1N6HA 1FOEB 2G1JA 2QRNA 4EPXA 4P4SB 4ZDKA 3EPKA 4B3XA 3AKDA 3CB4A 5B64A 3EPHA 5CIWA 1NVUQ 1TF7A 4JVMA 3B1VA 4Q5IA 1E96A 3U4QA 3W3AA 3QVVA 2F1JA 1MABA 2PMKA 2C2HA 3DDCA 2AX4A 1KSJA 1EG7A 2ZAMA 3BFKA 4KODA 3SQWA 4A0GA 1U0JA 2EFDB 2BBSA 4Q9KA 5A4JA 3B1YA 1NI3A 3PUZA 2V9PA 3WNCA 3B7GA 2PT5A 3C5HA 1OXUA 4A8JB 4M9QA 3TUJC 3U60B 4MQBA 1EWQA 4OI2A 1KY3A 4MRPA 4G01B 4FIDA 2WIAA 2G77B 2QMOA 4AI6A 1DTSA 2WJJA 1D5CA 1HT1E 5TMPA 1TPZA 2ZRNA 2IYWA 2VQSA 2REBA 1FUKA 1TEXA 4M53A 2CLDX 4U5XA 3WP0A 2IL1A 3SJAA 1E9BA 4GNKA 5SZIA 3WHKA 2B92A 2DFTA 2WSSD 1W48A 1T8UA 4PZLA 1KO8A 1UEIA 3AF3A 2W00A 3T1OA 4Q9LA 4A2WA 4MRNA 2W6JD 3EZ7A 2C8VA 1CJKC 4PHHA 1ESMA 3KZ1E 1IN8A 2NIPA 2G9NA 4LZZA 4GFDA 1G3UA 2CL7X 1R0WA 2RGEA 4X8OA 2CDNA 1FMJA 3FHOA 1CLUA 1UBEA 2QRZA 3QG1A 4PFSA 2EFGA 4CZ2A 1GVNB 1N6OA 1BYUA 3MG9A 3PCRB 3C41J 3FKSD 4YMWA 2OXRA 3FFBA 5SZKB 2AKYA 3ZZ0A 4O2LA 4U7DA 3C7KA 4FMCF 3PUXA 3KQHA 2ZREA 5FTJA 1W7AA 5J5CA 5DSZA 4O2RA 3SQXA 3CBQA 3TUZC 2DWQA 3P4YA 1XTJA 4IOKA 4TN1A 2XZOA 2J7KA 5L3QA 4MRVA 4OHWA 2MMCA 4F91B 1GP2A 5IF9A 3HYRA 2J0SA 1E79D 5F3WB 3RVBA 2HCJB 1XJQA 2WWYA 4YQFA 4FD2A 3VHXA 5HTKA 2XSZD 4OL0A 4LUCA 3TSOA 4FWTA 4GOJA 1O87A 2N42A 2GNOA 1JQLB 3REFA 3VQTA 1P2UA 1S9HA 2AFIE 4KAXA 2OFOA 4ESVA 4I81A 2WSMA 3I8XA 2IUTA 2BKUA 4Q4AB 4PHGA 4HZUA 5IRCD 1NKSA 5JBQA 4QGFA 3JZAA 5FPHA 4C2UA 2J0VA 1AS0A 3ZH9B 5HZHA 5L3VA 2ZXUA 1MKYA 2AK3A 3BWDD 3S1AB 4ASUA 2A7QA 4B47A 3THWA 1Z28A 4M1TA 1OYWA 2GXQA 2DFLA 5LPNA 5DHFA 2JLVA 4B3BA 2JDID 2YOHA 3LO5A 1M7HA 2REXB 4IKEA 5KDLA 4DBLC 1IY0A 3Q5DA 2ZYWX 1VYVA 3EIHA 4JJKA 3VKGA 1YR8A 4FI3C 3OHMA 5GADl 4US0R 1GILA 2HDNB 2H7VA 4BEBA 1XEWY 2J0UB 2HXSA 3LWNA 3UKDA 3B1WA 2RB4A 2CL0X 3GFTA 1JXMA 2BHRA 3WMFA 1VYUA 3AV0B 4BFWA 1F2UB 3QKTA 4KITB 4V0NA 3VX3A 5G41A 3LV8A 3LW8A 2F6RA 3A4MA 2DCUA 2NO0A 4LJ4A 3QG5A 2W2VA 3KTAA 1E1RA 3FE2A 1TX4B 2BMEA 3LRPA 3I5YA 3X1DA 4Q21A 2I1VB 4TSFA 4Z1MD 1KNQA 2IWRA 3L0PA 1KOFA 3MSXA 4YXWA 5TV2A 3PFIA 2O8EA 3AB3A 4LYFA 4K8OA 1NN1A 3DMNA 4MRSA 2HUPA 5F2EA 3JZMA 4DSTA 2XNSA 5BN4A 5JS8A 4HUQA 3VFDA 3KQUA 4L4UA 4WXRA 3IO3A 4WBSA 2ZJ5A 2G88A 2X2FA 3DO6A 3CO5A 2QGNA 5C1BA 3NIBA 2VO1A 3MFYA 1CR1A 4ON9A 5AK0A 2ZRBA 3KUCA 3TNFA 3U7GA 3PIRA 3RS4A 4TMWA 4HB4A 2TMKA 3K0AA 1ESNA 1GUAA 3GLFB 3I8SA 4A6XA 4DC9A 3BAFA 3THYB 1NLYA 5HKKA 2OCAA 3OAAA 4FN5A 4LV6A 4TYQA 1Z6AA 4FCTA 1Z0AA 1ZINA 1Z22A 2NMVA 1P9WA 4CIDA 1ZCBA 4LHXA 4C0SA 2FSIA 3VU9B 1VCMA 3HR7A 3KJEA 1X1RA 3SBDA 3TJZA 4XVUA 2O8DB 4R2HA 2PJRA 1BMFD 2HYDA 2A2ZA 3EARA 3FOZA 5FPKA 5KSYA 2YVUA 2Z43A 4ASUD 3I61A 5SZJA 4P4SA 4BFSA 1HT2E 3DVLA 4YDHB 2ZRJA 1ELOA 3U2QA 4EPTA 2R44A 2X2EA 4XOIA 2JATA 4RFSB 4E22A 4PO1A 1XBTA 4BZXA 4HDCA 2WMNB 4KYUA 4ACBA 2C04A 1H8EA 3A1WA 4B3FX 3C4JA 1Y63A 2G0NA 4B2LA 4D4JA 4L16A 1PLJA 3WXMA 4Q1CA 4Q03A 4A8JA 5KU1A 2W2XA 3AVPA 4CW7A 4M2LA 5CLLA 3IQWA 3U7EB 1U81A 2F1HA 1RVDA 4OBEA 2BKEA 3GP8A 2C99A 1KDTA 1KJWA 2FMXA 4TQ9A 4R2IA 5FPYA 2FGKA 4C0AC 1PLKA 4MKHA 1UBFA 4IW3B 3RWMB 121PA 1E1RD 1N2CE 2ZROA 1E2DA 4HAWA 3TIFA 1XXHE 2UZ3A 2GA8A 5EE9A 2EW1A 4PC1A 3CZQA 1E99A 2J45A 3SOPA 4EFMA 4YXWD 4MDFA 1DAEA 1EFHA 1HQCA 2OLJA 5E4FA 3BB1A 4DDVA 3AP3A 3AF2A 5EE3A 4P32A 1II8A 5K8LA 1U99A 2ZI7A 3P32A 3ZVRA 1OPXA 3KB2A 4AC9A 4MGIR 2BBTA 2GCPA 2RH5A 3EX7C 2BMJA 5JWRA 3UWOA 1Z0IA 1P3JA 2XJ4A 3ZLJA 4UNQA 4JYCA 1S9DA 2C03A 3C8UA 5JEEA 3EIEA 3IBYA 1N6LA 2IWHA 2ZE7A 4BFVA 1XEXB 1GNRA 3BS4A 4FMBB 1MT0A 2P3SA 4PC3A 2NG1A 5HKKD 1N3BA 3UWKA 3A1VA 2IT1A 3OAAD 4JSTA 4GRAA 4NZYA 5SZHB 4DCUA 1MO4A 4TMZA 4MA4A 4IOJA 3VNUA 3LBHA 3SYLA 1UADA 4KSCA 3PJRA 1QF9A 1XU4A 3NXSA 5FBRB 1NN3A 2DBYA 2BC9A 2CHVA 3PUVA 3TR0A 3MRSA 3SC3A 1EFTA 3KQKA 1IOZA 1E9EA 1MH1A 5FL3A 4F4CA 5AWFC 2WZQA 4NPHA 3AVTA 3HU3A 1OE0A 1G8PA 1SHZA 1YZGA 2WOOA 1XTRA 1NNEA 2C5LA 2ATXA 1D2EA 2OEPA 3GJ4A 1JR3A 2B8TA 1G3QA 4DVGA 5CLQA 2A5JA 1BO6A 1JJ7A 1P73A 4D4KA 1BOFA 2IYZA 2P67A 4O25A 2VP6A 5EXSA 421PA 1IN6A 1ZP6A 4TLBA 3IILA 1YE8A 2ZE5A 1SULA 4DB2A 2HT1A 1OIWA 5KDDA 4DHEA 4QRHA 2PX3A 4PSVA 1TEVA 3ECCA 1AQYA 1OV4A 4A2PA 3ZS8A 1QBKC 4DSNA 3BRWD 3OIUA 2HJGA 2ZR9A 4HLDA 4KFRA 4LRWA 3OEED 2A3RA 1LS6A 4H9GA 3GLHE 2Q21A 2J0UA 4E07A 4KVAA 3E2IA 2CK3D 2KSQA 3K9LA 1E69A 2ORVA 1F2UA 3RWOA 1XTSA 1E98A 3A1SA 4M1YA 1KDRA 1N5IA 3AP1A 2F3RA 4XVRA 3BORA 4OI1A 1E4YA 5TDHA 2KBFA 3K70B 1E9DA 3I72A 3K1JA 4IDQA 1ZNWA 5GJVC 4DB4A 1JI0A 2VTKA 4BWYA 1SVWA 2ZIAA 2C95A 4MKGA 2EYQA 4W7SA 5GVSA 1E9AA 2G3YA 4JLBA 3WNDA 3GLGE 721PA 4LWZA 2R2AA 5AUQA 3D6TB 1G6HA 5AJXA 3PEUA 5K8TA 1N6KA 3K8YA 3KB1A 1N0VC 3Q8XB 4CYMA 1QHYA 3ADBA 1UDWA 2IYVA 4JKIA 1L7VC 3W6OA 5DHAA 4BE7B 5TXGA 3I1FA 4Q18A 3WYGA 4TT3D 4DJTA 3GLFA 3B1XA 5EXTA 3THYA 2GBLA 3K0FB 3A1UA 1T3SA 1Z29A 4Z54A 2NO7A 3BERA 3OIYA 4B34A 3KKMA 5JCZA 3QIAA 1WXQA 4KJZA 3W3ZB 2OBLA 1XD2B 1JR3D 3T5GA 1F60A 3F5FA 3WP1B 4PC6A 4AYTA 2NPIA 2NO9A 2V3CC 1KMHB 2VP5A 2O8DA 5DYIA 4HLQB 3H4MA 5D3MB 1R5NA 3TAUA 3D7MA 2QY9A 3RSLA 3ZVNA 4BASA 2EFEB 4QBHA 5FUVA 3RHFA 5FFMA 2R6DA 1WBBA 4LOAA 2FEOA 5C46F 4NCJA 1CBUA 3SEAA 2VSFA 1GL6A 3QY0A 5L8VA 1KSFX 2IYSA 2IYTA 1EK0A 4IXNA 1G5RA 1JPNA 1KY2A 4JT2A 1UDXA 1KSGA 1P4SA 1KAGA 1RIFA 821PA 3NEYA 1T4GA 4I4LA 4WIAA 2O0HA 3K09C 4IEEA 3ZQ6A 1LS1A 2VIIA 3EZFA 3ZJYA 4KYIB 4JKYA 4QM6A 5AUOB 2KBEA 1Z08A 1LVGA 1Z0KA 2ODWA 4M8NE 3ZZTA 4JBWA 3EASA 3HDTA 4Q4HA 2PZEA 2HLDA 2DFNA 4CT4B 6Q21A 3FMPB 2F9MA 4II7A 4LJ7A 4B48A 3LAWA 5HCNA 4DLWA 2KI5A 2EYUA 4RVCA 1NVXQ 3BBPA 1SGWA 2R8RA 5LB2A 3V4FA 5KSOA 1HEIA 3ASZA 1FTNA 2IX3A 3FYHA 1YVDA 3MGCA 2W83A 4G0NA 4ZIRB 5CITA 1J7KA 2ZI5A 2JLWA 1HUQA 3QBTA 5G53C 1L2TA 1MRNA 2AHOA 2ERXA 2GTPA 4D80A 4GI7A 3L8YA 5H8WA 2WJHA 1XXHB 1Z5ZA 1KZGB 2MSCB 4HAVA 3AH8A 1ZM2A 1OF1A 3CF2A 1X1SA 3QKUA 1VG1A 1Y3AA 4LPKA 3CX8A 4LV5B 2XGJA 4TLAA 3ASYA 4A92A 4Q1EA 1I4LD 1KNXA 5JCPA 4B3DA 1EFUA 3VAAA 2PZGA 3ZS9A 4CEHB 1T91A 4PQRA 2IXFA 2QA5A 1SKQA 4WZAE 4LDJA 1UFQA 2XTNA 1E32A 2YV5A 2XZLA 3EA0A 5BW8A 2Z4RA 4MDEA 2IF0A 4IFEA 2EVWX 2C77A 3IBGA 1XEXA 1KK1A 1NKTA 2IYYA 3KL4A 4TMVA 3Q85A 4EUNA 2FZLA 1RPZA 2ERYA 1UM8A 1FUUA 3I62A 5EXXA 2VF8A 2AL7A 1MO6A 4JLAA 1LFDB 1QG4A 2QN6A 4X8LA 2WTUA 2XJ9A 2XNDD 1XMSA 3GEHA 4PZZA 4YMUA 3D3QA 1UKZA 2R6AA 3W90A 3GLIA 3GCGA 3Q7QA 4Q1AA 3ZZUA 3T1TA 2D06A 3CUEF 2JASA 4MGYR 4MGZR 4LBYA 1ZM3A 1N5JA 1JEEA 1JJVA 2CE2X 1PJRA 3UMFA 2ZI6A 4BFXA 1F2TB 1P9RA 3TK1A 2WKRA 2Q3FA 5JJLA 2F43B 4FCWA 4Q47A 1W47A 1Z6GA 1OKKD 2CNWD 2FFBA 4KFSA 2O8CB 5JSZB 4AKHA 2XOKA 1ZYUA 1Q1EA 3QQ5A 2ZJBA 1OFHA 4KCGA 4Q4JA 4FMDB 3A36A 2OHFA 3CWZA 4TZ6A 3AVQA 4XJXA 3TBKA 2J59A 2OBMA 2HLDD 3IO5A 5J4HA 1U2RA 4XTCS 3SJZA 1W36C 2FFHA 1UAAA 2BCJQ 1FNMA 5LD2C 2AXNA 2IYLD 1Q44A 1JR6A 1G20E 2ZAOA 1NF3A 1U9IA 5TB5A 4XSHA 1G1MA 2WJIA 5G3ZA 5BN3A 4PAMA 1WCV1 4JIMA 3SFZA 4ZCMA 4LJ5A 5BYKA 3T5DA 1FQJA 2ZM5A 1E9FA 4AKIA 5CK4A 2IS1A 2FX3A 2MMGA 1OXTA 3CPJB 2JA1A 4DT1B 3B1ZA 4NYMR 1GSIA 2WSSA 4MKFA 3T35A 1DEKA 4TTPA 1LF0A 2NO1A 2LWIA 4GOKA 3VR6A 4A82A 5IK2D 2Q9BA 1GNQA 1G9XA 4QG7A 2QPOA 3K53A 4MYCA 2ZS8A 5JZVA 2BVNA 2IBMA 2Y8EA 1G64A 2ZE6A 2HV8A 4HB3A 3CNOA 2KJQA 4G5OA 5FOTA 2ZS7A 3U5ZB 2ZJOA 3ZD6A 2OESA 3PXGA 2OFWA 2F55A 4O3MA 3L0SA 4OHZA 5J4VA 3A6PC 4M4SA 4B76A 1VYTA 1CRPA 1XTQA 5M04A 2ZITA 3TSZA 2V1XA 3UMSA 2WVJA 2ZYUX 3LQQA 2VA8A 5A0FA 5CJ2A 5GJBA 3GLGB 2GK7A 1TF5A 1YKSA 2P5TB 2ZJAA 1QDEA 4Z8XA 4YMTA 2NGRA 2Z5FA 1OFIA 4JVSB 1E2EA 3X2SA 2D2FA 3RLFA 2DY1A 1FP6A 1N6PA 3BH0A 3CX6A 3K9HA 4PO8A 1KIMA 2RHDA 5CYPA 4OHYA 3K0FA 5CM9C 2Q6TA 4D0NA 5K8IA 1ZIOA 4GT1A 1A4RA 1E94E 3SJCA 1XJ0A 3RDPA 2XOKD 3SU8A 1NJFA 2CCKA 2WOJA 3IIMA 1KMHA 3SI7A 3DKVA 4XD7D 1BYIA 5EP3A 1GITA 1RW4A 1YZQA 2GAOA 4RCZA 3ZDQA 1XWIA 1N25A 1ZC4A 2BIFA 2I4IA 2RGGA 2E9SA 4EPWA 1AN0A 4E09A 3RAPR 4A6PA 4DLXA 3H84A 2LKDA 1SXJC 3FMOB 1W2GA 2WWFA 4PPNA 2PJZA 1KI7A 2VLIA 3MWJA 4QGGA 4EPVA 2VEDA 2FSFA 2A5FA 3QKRB 4JSYA 2FFQA 3PUYA 3IEVA 3RANA 4B2PA 2V4ZA 3DPUA 3HJNA 4DSOA 2JDIA 2OT3B 3K0EA 4EPYA 4ZDIA 4B75A 4XSGA 2ZS9A 4NYIR 1S8FA 2V54A 4HLUA 4FCVA 3VR2A 4DEYA 1XCPA 3NWJA 1T8TA 5CDFE 4PZYA 4EQ6B 1Q12A 1PV4A 5JHHB 3AUXA 2LKCA 4V02A 4K81B 2PEZA 4LC0A 2JJ2A 5TVKA 3RSOA 1CJUC 4BLTA 5EZ6B 4D6PA 1JXOA 1R0ZA 3M6AA 1RRPA 2EU8A 1L8QA 4OYHA 3TLXA 1CXZA 4OJQA 2O0KA 4DCNA 3K70D 1YR9A 4H1VA 1BS1A 1FX0A 4LPSA 1AGRA 3O8RA 1K5DA 1UKEA 1OIXA 3QI2A 2DPXA 2GESA 3T34A 4DIEA 1XXHA 1C9KA 2PCLA 2ASEA 4E5UA 2BM0A 2ZR7A 4Z1MA 3VKHA 2IHBA 1OW3B 1V5WA 1RZ3A 5L3SB 3TMKA 2CVHA 1OJLA 4CEHA 4DLRA 2ZRCA 4G1UC 1M34E 5GVRA 3AF0A 3P4XA 1XCGB 1IJFA 3KXKA 2Q3HA 3AF4A 3ZQJA 3LLMA 2IF2A 3KKNA 4ERNA 1E0JA 4NKRA 3CRVA 3CIOA 1W1WA 1G7SA 2WV9A 3A58B 3HU1A 2ZJ2A 4UXHA 1HA3A 1ZNXA 5CK5A 3R9XA 2PLRA 2GZHA 2IYQA 3IUYA 4EJSC 2QENA 2V1UA 1HQYE 5C4GB 4JLMA 1XPOA 2P6UA 1E2KA 1KGDA 5FOVA 1ZUNB 4LHVA 3UATA 1NLZA 4PPQA 3IEUA 3ZIAA 2ZSBA 5FBLB 2A9KA 3NG1A 1CIPA 3ADDA 1E6CA 1CJMA 4A2QA 5FTKA 3R8FA 3QPVA 1NIPA 2X19A 4LX0A 2OXCA 5L3RA 2REOA 4C0JA 1E4VA 3AVYA 4P4UA 1BMFA 1W49A 4QL3A 2QTHA 1KTVA 2ODBA 5GJWC 1Q1QA 2O8BA 3CONA 3UK6A 3QF7A 3U61B 3NH6A 4LJYA 3TQFA 4IFBA 3KKOA 3FDIA 2X1VA 1KO7A 1ZUHA 3CW2A 4Y0AA 5LB4A 3QENA 1W0KD 4Q7MB 3LLUA 4ZCLA 2O8FB 5JI3E 2D2EA 1Z0FA 2AFHE 3V9PA 1NLFA 1Z83A 3Q72A 4IOMA 4NTZA 4NYJR 5E7MA 3SN6A 5CB8A 3ADCA 2VP2A 2ODNA 4V0LA 4DCSA 5CJPA 4PC2A 3TW4A 4BLPA 4PC7A 2JJ2D 1TADA 1H8HD 5AJZA 1JEDA 2GCOB 2IUSA 2OCYC 3WMGA 3NH9A 4Q1FA 2SHKA 4HATA 3R7WB 1NG9A 2EWVA 3U44B 4US1R 4PHTA 2G83A 3GJ7A 3GJ3A 4NONA 3B9QA 2BMFA 3F0TA 3VKWA 3PR1A 4DLVA 5K8UA 2GCNA 3SBEA 3GJXC 3B60A 4XTRA 1A7JA 4U02A 1E1QA 2AD1A 2CJWB 5GJCA 1G8FA 2A5DA 1U8YA 3LBIA 4MYUA 4BQSA 1B0UA 2ZETA 4EDHA 3QXXA 4IDOA 3VR5A 2OG2A 3BD9A 3H86A 4GMDA 3OIVA 4IVRA 3H0KA 4KVGA 4A0FA 1FZQA 3QXSA 1KI3A 2FU5C 1DAGA 1KZ7B 4XWKA 3VR4A 2YZ2A 3LH5A 4OK6A 4AKEA 3I3SR 4CDGA 2QAGB 1NG1A 3TSWA 2ZRPA 3LFUA 3ZIAD 3FPAA 1W4CA 3TGPA 1S3GA 3GMTA 3DKPA 4N0EA 3NC1C 4TYNA 2OBNA 3P20A 2Q9CA 5KUTA 1VIYA 4EFLA 1Z07A 2HT6A 4DKXA 3QSYA 2C9OA 1WE2A 3QF4B 2FPMA 2NZJA 3QJYA 4NHOA 4AK9A 3LD9A 4GBMA 2D3WA 1SVSA 3LVRE 2EFHB 1YZKA 4RKFA 3WRYC 4OK3A 3U3OA 2P6NA 1CULC 2PEYA 2UKDA 3N5CA 2WWWA 4LYJA 4QGAA 1R8SA 1NMZA 3FMFA 4Q1BA 3ZGXA 1SVOA 5B30A 4ZO4A 2FEMA 4PPGA 4Z8YA 5BXQC 1K6MA 2Z4SA 1GKIA 2ONKA 5KHOC 1QHHB 2RGNC 4BZQA 1TF2A 1E2IA 2IA5A 4I1SA 3CWQA 1AIPA 4RZ3A 4JL6A 1DOAA 4RD1A 5KYKA 2ODEA 5AJWA 4YMVA 3BC1A 1MV5A 5KO2A 4X8MA 4TLDA 1DAKA 5DN6D 4HSEA 1NVWQ 2IW3A 1QHIA 4O0MA 4L15A 1TL7C 4PSAA 2G0TA 1Q3HA 1FPMA 1G4AE 1A82A 3AVWA 1WQ1R 1E1QD 2O5VA 4DLSA 4M22A 3OEEA 1Q0UA 4RY2A 5KSZA 4EKDA 4DDWA 4HDQB 4JL8A 1G6OA 4UNSA 3AVVA 3KJGA 5FI0B 1Z63A 1U8AA 2CK3A 1BIFA 4B71A 3EW9A 1CRQA 1U0LA 2IHYA 4BLRA 4EIWA 2BWJA 2XB4A 1ZM4A 3B8HA 4GOXA 4Q02A 4IVQA 1D8TA 3TH5A 4Q7LA 5JRZA 1FL9A 2W6ID 4V03A 5C2JB 3IGFA 3IPXA 5H70A 1SXJE 1P61B 5UKDA 3LA6A 4D4MA 4QFMA 3RS3A 3ICEA 3EZ2A 5L3SA 1TU4A 3Q9LA 2W58A 4Q01A 3QNUA 1ZJ6A 3EXAA 4D2IA 1N0WA 2A30A 3O8BA 2CHGA 4HAZA 1XPUA 1AM4D 4TMTA 3GFPA 2JLQA 4C2TA 4DLZA 4NE2A 1XMIA 4RZ2A 4HLCA 3CKLA 5IHPA 4ZDJA 2XAUA 2CXXA 2XZPA 2G1KA 4RCYA 3LDAA 2I1QA 2QP4A 3ZD7A 1TNDA 4A15A 5E7IA 4C30A 4UNPA 1DG1G 3NHAA 4MH0R 2R9VA 3AVOA 3KJHA 1KAOA 5EQTA 3OE7A 3X1ZA 4TT3A 2RAPA 1MO3A 3SJBA 4KU4A 4IXMA 4YC7A 1IN5A 2HJVA 4DWJA 2JLUA 4Q4AA 1N0UA 2J0QA 4P3YA 3DZDA 1BH2A 2QG6A 3CRRA 4KFTA 3M4YA 4JMPA 4LK2A 4QBIA 4TWZA 4BFZA 2XB2A 2B7BA 4OJKA 2ZSFA 4G5QA 1S3SA 3S1AA 4BRWA 3RS0A 2JAQA 3BFXA 1XEFA 2J3EA 2QAGC 4IDNA 4Y0VA 1GNPA 1PLLA 3DM9B 3F8TA 1R5BA 2O8FA 2ZU0C 5G3YA 1KMQA 3BIFA 4MYTA 5TARA 5E3HA 2K5UA 5DIFA 4QM7A 2JLZA 1HE8B 1S1MA 4LHYA 1VG0B 2V6JA 1VHTA 1A2KC 4QJ4A 1N6NA 4ACAA 1DADA 1FNNA 3HR8A 4URUR 5CYOA 4A0HA 4C0LA 1G7RA 1YRBA 3MWLA 3V4RA 2WMOB 1G41A 1T6NA 2Z6VA 5P21A 2IUUA 4C0HA 3R9IA 2WAXA 4FXPA 2F1RA 1N5KA 2AD5A 1T3LA 4Q66C 2GKSA 4HYYA 3J81k 3C14C 2CJWA 4KHZA 4C4PA 1COWD 4CT5A 4C0BA 2YC4C 2AWOA 1E9CA 2AR7A 2C9YA 4QHSA 2OCBA 3GPLA 3DMDA 2QAJA 4DUGD 3CRW1 1HTWA 1M7BA 2F7SA 3K0CC 5FTMA 2CBZA 4GDFA 5FOUA 1QHNA 3AGPA 4ITRC 2YINC 3THXB 2HF9A 3ONWA 1RFLA 1E2LA 4W5WA 3BB3A 2PMDA 4G5SA 2ZYTX 2DYKA 2ZI4A 3VX4A 1W36B 4JZKA 4NL4H 5FOSA 4RD6A 4B74A 4KXFB 4NCNA 1OHHD 3OE7D 3UG6A 5LD2B 4KV9A 1U98A 1XMVA 1E2NA 2R65A 4HAXA 4ZCIA 3FKQA 1TMKA 4HAYA 2XNDA 2QM8A 2ZRIA 3LY5A 4S35A 1F3OA 4UXIA 1IJEA 2B7CA 3LX5A 1CJTC 1HE1C 3VU9A 3GJ6A 1GKYA 4X8HA 1ZC3A 2JCSA 3FMIA 1ZMXA 3QF4A 2WJVA 1Q57A 4Q9IA 4BFUA 2FGJA 5IT5A 1RJ9B 2OSBA 4MUAA 2QORA 4URZR 2VSXA 4BGDA 5DO9A 1E2QA 2WWIA 1S0UA 4RFSA 4POAA 2B21A 2BCGY 2RMKA 2OZEA 3OF5A 2MSEB 1IXSB 3U3RA 5JWHA 5F98A 3U3JA 1KJYA 1OKKA 2CNWA 5J4YA 2EWWA 4WA7A 3TVTA 1XTIA 3VR1A 2IS6A 4NYMQ 1QHHA 2V7QA 3EC2A 2GEVA 1MABB 3R20A 4L5BA 1R0YA 1UKYA 1YZNA 2WPDD 1IN4A 1DG3A 3T1QA 4TL6A 4GZMA 2R62A 4CEIB 4ZV4A 2GEUA 1OT3A 3FWYA 3NDPA 1ZCAA 5AJVB 1J90A 2RCNA 1C1YA 4K46A 2FE4A 3GQBA 2BBWA 1Q1ZA 4NH0A 1KHTA 1DBSA 2VP0A 5G40A 1I4TD 5KOYA 2P0EA 3AKCA 4N1AA 1NMYA 2QE7D 1ANKA 1J8YF 1G19A 3B2EA 4OQNA 2CMKA 3NTUA 4G5RA 1G3MA 3FVQA 4IRUB 4JVNA 3H2YA 4M1OA 1W4RA 1U94A 2NOAA 3MJRA 2I3BA 3QVUA 4R9UC 3T1VA 1T0HB 1P2VA 5CDFA 3T06B 1EWRA 3VR3A 2ZRMA 3K0SA 4QJ5A 3PEVA 1KI2A 3CNNA 4FW9A 3NDBB 2H5EA 2FF7A 2ZTSA 5C4MA 4B6EA 1FP7A 5IK2A 3N2EA 521PA 2WKQA 3I92A 2P5SA 5F9HA 5FBVB 1ZU5A 2HF8A 4M1KA 3FTQA 2LCFA 2ATVA 3LNCA 1E0KA 2FSHA 5AUNB 2JIZA 3OFNA 1SXJB 2WM9B 2X77A 3IHLA 4QGHA 1QHXA 8OHMA 2QP9X 4NCKA 2CCGA 2A78A 5E7JA 1S2MA 5CB6A 1NVVR 1UBGA 3K09A 3OESA 5JHGB 1ZAKA 3PQCA 4NBSA 1Z2AA 1KI8A 2FA9A 2QQ0A 2PZFA 4NCHA 4F92B 4NCIA 2FPKA 2JLSA 1WB9A 2QTFA 1ZRHA 4DRZA 2FH5B 3W8NA 2RHMA 3V00A 2L0XA 2IC5A 5C18A 4PAQA 2OCPA 2XTZA 4NYIQ 4S2EA 1E2FA 4DDTA 4DDUA 1US8B 3E5HA 1GL7A 1SHKA 4D25A 2QEQA 2UVQA 5FH9A 4CF7A 4URXR 4IDPA 1IXZA 5H1YA 2V7QD 3M0EA 1DAHA 1LTQA 1W0JD 1QZXA 5HPYB 1GL9B 4XD7A 4L9WA 1CU1A 4HZUB 3SYNA 1JBKA 1GAJA 1YZTA 1IXRC 4W9MC 1JECA 3L82B 4NDZA 4JT4A 4EPRA 3F3YA 4W5JA 5LBIA 2QBYB 1Z8FA 1WF3A 3NBFA 1X3SA 4TL7A 1AK2A 3DZ8A 4Q7JB 1N6RA 3I4LA 4E03A 1KJZA 1I2DA 3WRXC 3AUYA 3EWAA 3RYTC 2A5YB 1WP9A 4IDHA 4LJ8A 1OH6A 2ZRKA 1XPRA 3VNVA 3B78A 4JLJA 1WMSA 3X1YA 1GKUB 1NBME 1A1VA 3N70A 4PANA 4V0ME 3P1JA 3GLHB 3WY9A 1OB2A 4EJSB 4M1SA 3LXXA 1SKYE 3B9PA 4V0OA 4ZI3A 3VTKA 3QPUA 2PLFA 5EE1A 3A4NA 5JLJA 2BDTA 1VKJA 2ZRDA 3ADKA 3KFVA 1VHLA 4EFNA 4WW0A 2QSYA 2X8AA 2GAAA 2JIZD 3OFND 2B6HA 2QU8A 3RC8A 5JJKA 2CL6X 3OEHD 2NO6A 4IVPA 2ORWA 4N3NA 1RC8A 1R10A 1JPJA 1ZUIA 5EUQB 1G17A 2ZRGA 1RKBA 2QM7A 3ZVMA 3MWKA 1GRRA 2F3TA 3BK7A 3B6EA 3AF1A 4DZZA 2QL6A 3GJ0A 4M9SA 4AG6A 1ZBDA 3CRMA 1CEEA 4HUQB 4QHTA 3TRFA 3GEIA 1UPTA 1TUIA 4FMCB 4QHYA 2JJ1A 1KI6B 2VHQA 4OQMA 3IDQA 2AK2A 4AD8A 1NSTA 2IXEA 3W5JA 1FMLA 4PR0A 4KFUA 4F38A 4RD2A 4LY6A 3M1IA 1GIAA 1OYYA 4NYJQ 1P7CA 1MR3F 1D9XA 3RNLA 2VPPA 3B5JA 1YZLA 2FNAA 2QMHA 1XD2A 3B85A 4JLDA 3QOFA 5KPJA 1GWNA 4B3CA 2OE2A 2R6GA 1NL3A 2NZ8A 3PV0A 5D3MA 1P2TA 5KSPA 1Z3IX 2PT7A 1M7GA 2Q0HA 1E2JA 1EFCA 1RJ9A 2ZUCA 3NBYC 3X1WA 4BEJA 4UNRA 4IOLA 1F6BA 2GVZC 2FSGA 2YOGA 2JLRA 5JMTA 3I32A 1K8RA 2IS2A 4LYAA 4WZBE 1J2JA 4FMDF 4D26A 2QUZA 2J46A 1Q1BA 3RRNA 1MOZA 3AVXA 2PCJA 3ETLA 3G5UA 1RRCA 4M21A 2GEDA 1RRGA 3UPUA 1W0KA 4UXJA 1DARA 1OSNA 5FL7A 1EGAA 3WYFA 4R7ZA 1IAQA 1YR7A 1GFIA 1OIVA 2AKAB 1M1YE 2FWRA 2WAYA 1QHGA 1OH8A 5EJEA 4LJ6A 1U0HC 1E2MA 4CEIA 1P6XA 3N2IA 3KJIA 2VHCA 1D6JA 3L2OB 1DELA 1G3RA 1TQ2A 3CLVA 3MJHA 4TL8A 1EFRD 3CM0A 2CE7A 4DIDA 3EZ9A 1IONA 2KWIA 4QJ3A 1H8HA 1XJCA 4ZIRA 4LI0A 2J9RA 1M6NA 3WHLA 5B2ZA 1OFUX 4RSGA 1E3MA 4LGMA 3SS8A 1GTVA 3DM5A 4ZKDA 4LBZA 1XRJA 1LB1B 2FG5A 2YWEA 3NBXX 1VTKA 1KI9A 4BFTA 3AM1A 1GRQA 1XX6A 2NQ2C 4XIGS 2GJ9A 3RS5A 4B6FA 5EP2A 1ZVQA 3O8DA 5EXPA 1DAIA 1II9A 1P75A 4MITA 3CX7A 1W4BA 3RC3A 1II8B 3RABA 3KQNA 3FB4A 2WBLC 1AQUA 2WWGA 5FTNA 1NRJB 1W36D 1IBRA 2CLCX 3HWSA 2JJ1D 2FV8A 2IK8A 4RD0A 4TZ0A 4PO9A 2GILA 4HB0A 1SXJA 3ND9A 2OM2A 4PPFA 1UEJA 5DISB 3IKJA 3OIWA 1VCNA 1TQ6A 1ZD8A 2H16A 4JLOA 4PHFA 1CF4A 3REGA 2IEZA 4LJ9A 3H1TA 4BECA 5J40A 4GL2A 3GLIE 2HYIC 3MUFA 1ZNZA 1XDBA 4JLKA 4XWOA 4WOPA 2GF9A 4B33A 1R5OA 3KUDA 1R4AA 5AJYA 2Q3MA 3CR8A 2YKGA 2H17A 4HB2A 3G0HA 1F2TA 1AS2A 4Q00A 1JAHA 1NP6A 4I1UA 1US8A 2F43A 2HEIA 1T5LA 4RKEA 3IQXA 2RGDA 3B13B 2O8CA 2DR3A 5JSZA 1VMAA 1Z0JA 4R98A 1HURA 2QZ4A 2VL7A 1DAFA 2D74A 1T9HA 4GSYA 3D8BA 5FL7D 3QEOA 2WIBA 1KYIA 2ZYVX 1TQ4A 4C0KA 5FUYA 1XP8A 1QVRA 4V0KA 4TTQA 2E87A 2FZ4A 1LW7A 2W2TA 3SE0A 2ZEJA 4BLOA 3LVQE 2OILA 2FN4A 2FPLA 3AVUA 3EPJA 3SHFA 1VDZA 1IY1A 2QBYA 2GJSA 4OI0A 3TVDA 1T3HA 4KO8A 2Q9AA 4D82A 4EAQA 4ZDWA 1E0AA 2R6FA 2FJUA 3A37A 3W8RA 3RS7A 4BPBA 2ZJ8A 5DN6A 3QXHA 3Q7PA 4B73A 4C0QC 1XZQA 4Q9HA 3KX2A 2F9LA 1NIJA 1QG2A 1OXVA 3W34A 4C3ZA 4AKGA 3KQLA 2WJYA 1NMXA 3EIQA 3LW7A 1E2PA 4CVNA 4AY2A 5F9FA 4DT1A 3GLHA 5DLQC 1AA9A 5EP4A 4EJSA 4B32A 4PSKA 1ZD9A 1BKDR 4CGZA 4B43A 2YWGA 5DGXA 3X1XA 2VRWA 1KDOA 4OQLA 1Z6YA 5HR5A 5DI3B 4WZ6A 1SVIA 2WWHA 2DWPA 2GXSA 3QKSB 1XD9A 3PUWA 2C96A 4ZPXA 2JLYA 2BJWA 1DE0A 1XD8A 3MD0A 3RS2A 2ZU6A 1T0JB 1SKYB 1Z2CA 2W6IA 5CIQA 1SXJD 1XB2A 3CRQA 1JALA 1PVOA 3C5CA 3LXRA 4OHXA 1NSFA 1ZM7A 1G7CA 3R9WA 2RGAA 2ECKA 2KE5A 1JNYA 4U00A 4UNNA 4A8JC 1F48A 2XTMA 3QPWA 1CP2A 2H57A 2P6RA 1NY5A 2XX3A 1RE0A 4LBWA 1AZTA 3EWSA 4QNRA 3GLGA 1HV8A 3U6KA 4OHVA 5AR1A 4D4LA 221PA 2WWXA 1KI6A 5KNDA 1F5NA 1VCIA 3I73A 1GZSA 5HE8A 3AKYA 3T61A 1P62B 3CF6R 3NHBA 2H1LA 3BJIC 1K5GA 5KPDA 1G291 3SYKA 1OLOA 2F1IA 2ZI3A 4DCTA 1HY3A 4Q19A 2IYXA 3W6PA 3SDZA 3SNHA 3CNLA 2BJVA 2FOLA 3U3MA 2QNRA 5KNBA 1VCOA 3CH4B 4DEXA 3PVSA 4L8GA 3T15A 3PG5A 3LX8A 5JFGA 2ZSEA 4US2R 3ICQB 4YONB 4I1VA 3L0OA 5TY0A 4BLSA 2CVFA 1LF5A 3IPYA 4B3GA 1KSHA 2YWHA 1YRAA 4P31A 1W46A 3QKRA 2O52A 4GMXA 4PTLA 3AGQA 4GP6A 5FI1B 5KDOA 1DO0A 4D81A 2CCJA 1IM2A 2ZRFA 3W6NA 2NPFA 1TUEA 4DXAA 5EE5B 1FW6A 1KO1A 2H8KA 4LV8B 4UJ3A 4EQ6A 4YLGA 3KDSE 2UZIR 3IHWA 1PUJA 3KFXA 2ZVQX 2CHQA 1CKEA 3RRYA 4Q4HB 2WKPA 4Q4LA 4DLUA 5FR1A 3THOA 1T5IA 5KNCA 2OFXA 2RKOA 3ND8A 2ZJYA 1VECA 1II0A 1XCMA 1Z47A 4JBXA 4P0TA 3CF0A 2IYRA 1COWA 4TSFD 4RD3A 2NTYC 1ZD1A 4AURA 1D2MA 5FPTA 3AQ4A 4AG5A 4DCVA 1GDDA 1FFHA 3L43A 4LBVA 3PITA 1Q22A 5EP1A 1YJ5A 3DL0A 4DUGA 3P27A 2ZANA 1D9ZA 1SVKA 2GWHA 2J7PA 2ZRAA 1X8JA 2OLKA 5FUWA 1G8GA 2FFAA 2GZDA 4MRRA 5DI9A 2GRJA 3EC1A 1OXSC 2RGNA 4LC1A 2ORIA 1L4YA 2R6CA 5JECA 2J5XA 4N0DA 4BZPA 1Z6XA 1OB5A 2V6IA 2DWOA 2ZRHA 2XITA 3BE4A 1EXMA 2V55B 4ABYA 4CRWB 3QXCA 2VHJA 4FWIB 1UF9A 3E70C 3VHLB 3AKEA 4LCBA 4QBGB 1OXXK 1EX6A 1OHHA 1G21E 5BQ5A 3SZRA 1QVAA 1LNZA 2QGZA 4NMMA 1RRFA 5FTLA 4QBFA 4HDOB 4URWR 3T12A 1P2SA 3U7FB 1MRSA 2QROA 1QHSA 3O8CA 1G16A 4TQUS 2QSZA 2QT1A 4TL9A 1P60A 4AWXA 4LYHA 5JS7A 2ZJZA 3GLIB 1E2HA 2YC2C 1AGPA 1DPFA 2A5GA
chains in the Genus database with same CATH superfamily
1IQPA 2JC3A 1XTZA 2C2KA 3HA7A 3RPEA 5LKRA 4XWYA 3G2PA 4TS9A 1DRUA 2GXUA 4RJLA 3HN6A 2N0SA 1IN7A 2DSTA 3W9UA 4BV2A 4LE2A 2H18A 1NJGA 3DOFA 4IIYA 4GF5A 1U8ZA 1K97A 4BYMA 1C7FA 2D1QA 2Z83A 4A9AA 1YT5A 4PRYA 1COZA 1KF0A 3MS4A 5D2CA 4ZXPA 1ADJA 1SFRA 2NU6B 3ETNA 1QGOA 3EVNA 4IUDS 2GXAA 2GCOA 4J1TC 4BVEA 4EI7A 1ZJJA 1KI1A 4A1FA 4HYEA 3NC0C 4EZEA 2LIVA 4HI0E 4IRMA 3U44A 4MGKR 1RWXA 2H2WA 4GKKB 3CTMA 5DWDA 1WD5A 2VYNA 2YOFA 1V11A 2NU9A 2ZTHA 3HCRA 3K9GA 4DLLA 2C98A 2ORYA 1HYHA 2ID4A 5LQUA 1JA0A 2IZ6A 3VJLA 1T4CB 3R1IA 2CWDA 4MR7B 5I51A 4JLPA 1BDIA 4XYGA 1W88A 3PFGA 5EMMA 1EESA 2N46A 5JVDF 2RH4A 1T15A 2PU5A 5FF9A 5K3FB 3FI0A 3D0QA 4IJWA 3RT1A 3T94A 4YJDA 1HPLA 2ZSDA 4MP3A 1GDHA 3ISJA 4MV3A 1ZKMA 2PXXA 1VI5A 2B35A 2BOVA 3WMRA 3LU1A 4ZCIA 3EEOA 4S0XA 4B1FA 2J87A 4IJUA 2C5HA 3UA4A 4ZGWA 4JXKA 2XWSA 5FLKA 4TYWA 3BE8A 4BS9A 2I6UA 1NQ5A 1OFGA 3GPIA 1O94C 2B5VA 2EC5A 3HPQA 3NBZC 1CB7A 3OZIA 3LUFA 4KMOA 1DWOA 1X3LA 2VPXA 1DAMA 3P2JA 2VQDA 2A1UA 3DQPA 1B8VA 2OGTA 2AG5A 4YO7A 5ECDA 4BV9A 1WWKA 4PAOA 3EE6A 4EI2A 1ZCFA 4FFBA 1MHTA 1H9CA 1Y9DA 4FGLA 5AK4A 3OZVA 4CFZA 4J49A 1JIUA 3MQFA 4Q9DA 2E5LB 2P75A 3ZVLA 1LK0A 5C5IA 3B52X 1F17A 1O95D 3OJXA 1E5XA 4QJIA 3WBFA 4DBLE 1ZJWA 3ADPA 1C1DB 4RZUA 1ZNYA 2IEDA 1F06A 4LSGA 1QGED 3CG4A 4XAQA 1YZVA 2BEKA 2P2LA 3DHWC 3I0NA 1ZU4A 2MSDB 2ZSAA 4YEDA 3L6DA 4FZVA 1FK8A 5EYPA 3EF1A 3HBMA 1X7YB 2FY8A 3KE8A 3NHSA 3PDIA 1YS4A 5CLHA 4ARZB 3SDBA 5IHXA 2LXNA 2JHFA 4JXXA 3V6LA 4DA4A 2W2KA 1K98A 4ZN6A 4QSHA 1ISSA 3OOSA 1O03A 2RHJA 3VKVA 2AMLA 3HXPA 2ANCA 1WEHA 1WUHS 4UPDA 4FDMA 5EEGA 3OQ1A 1F0YA 2XPCA 1U9YA 3CB2A 3FVRA 2FRXA 4GW3A 3ZH2A 2D6FA 4YMSA 1SUAA 3H4IA 2YMPA 3ZN2A 1H6CA 4E5DA 4QXAA 2CLSA 4DV2B 4FZJA 3L40A 1IPEA 2WYOA 4JZYA 4KXUA 4Y1FA 1JT2A 5DOVA 2W6MA 4F4JA 3TFOA 3U4QB 3HH8A 1JQJC 1NATA 1Z4OA 4HEJA 3U1TA 1W0JA 3CVXA 3ZEAA 3R2JA 2JFOA 4N01A 4MJ3A 2DKOA 2NVUB 1G7TA 3RUFA 3RFVA 4U2GA 4B2IA 3DUWA 3Q41A 4B6QA 1TTTA 3Q5EA 3A3YA 4HXGA 4IHQA 5COBA 4RL6A 3DBHA 1Q20A 4LWOA 4C3VA 2J30A 3K0CA 1S96A 3QE4A 3E7WA 4M36A 2ZFUA 2AB0A 3TNJA 1Z88A 2B8EA 2OK8A 4FNOA 2YWXA 2B82A 4UQOA 4DG8A 3H2SA 4ZZIA 1CS0A 4L4YA 2XUFA 1ZHHA 2V7GA 3H42B 3LQRA 1RWKA 2Q29A 3GG2A 4UCXA 1VG8A 1GN8A 1EGVB 2H9IA 1C3OA 2X5NA 1JFSA 1CK4A 1UL1X 5CIYA 4RJIA 3N9IA 2J41A 2EGHA 1Z9BA 1UWKA 4JHLA 2P91A 3OMWA 4Q7KA 1BMTA 3OH8A 4TV9F 2WZCA 2DG2A 3A4YA 3DE5X 3TUIC 2WR8A 4LHWA 4YAOA 1WPGA 5TMEA 4F3TA 3ST7A 1U28A 1D0SA 2VBGA 2IS4A 1OU0A 1ZWKA 1X7WB 4RFVA 4CCSA 3BMCB 5DXFA 2SNIE 3CLTC 3IXLA 4RORA 4WFIA 2YJ5A 1X6VA 4HCJA 4C5CA 4F1JA 1ZUWA 3H2KA 5H9WA 1EK1A 3GNSA 2CB0A 2BE7A 3CXUA 4CBVA 5TEWA 1NTOA 2GDJA 1E3TA 1L5VA 2A88A 1KKMA 1Q77A 2H4HA 3MWGA 4R8KA 1ISJA 3DH0A 5FKJA 1B41A 1SEVA 4GPTA 2AZDA 1I6KA 4ME6A 5I3ZA 5H4HA 1MB2A 1IY2A 3K1ZA 4DZTA 3U6BA 4IJMA 5EJ8A 2AZXA 5KIAA 1ZPDA 1EI9A 4TUYA 5J2UB 2XRZA 1TT7A 4MEAA 2C9DA 2RFLA 5FWYB 3QU7A 2OPHA 1TOAA 2GHIA 4IQ8A 4YMHA 2BI7A 3JAWA 2OGWA 3QE2A 1J4AA 2ZBRA 2DHRA 3GJ8A 2E3JA 4N4AA 4RJJA 4MPPA 3MYRA 4UUMA 1TCUA 1N0HA 1G18A 4RZIA 4A1OA 1FPQA 4G1EB 3PEWA 4IKPA 1HNZB 4CKCA 3IDFA 2IEAA 5L3QB 2W93A 1H6AA 3M1LA 2ZPTX 2BAGA 3PVZA 3M7IA 2YIDA 2IDJA 5J4LA 1WBDA 3ZUGA 2ZSIA 3CN7A 2FOXA 1UJ5A 2ZBUA 2WI8A 3RVMA 1SZPA 4FFSA 1R8QA 4XVHA 4M98A 4RPLA 2FDCA 3MMPA 3AI3A 5ALWA 2VRBA 5EXEA 5BSVA 4BNIA 1ZJ4A 4FU0A 2GBPA 1JR3E 3BJRA 3O7WA 4J9UE 3UCXA 4DCJA 3U19A 2P3LA 1PSWA 4AZVA 4F46A 1R2QA 4LJAA 4M1MA 3K70C 2G4CA 4BNXA 1BX3A 3D7KA 3LM8A 1Q95A 5FQOA 3C8DA 5E95A 3U4HA 2XQJA 4ZZ2A 3H83A 4KPUA 1GTSA 3DE2X 1WZ2A 1WEKA 1NQUA 3Q3CA 1Q0QA 4NV0A 3SZ3A 3N75A 4GLLA 1GA4A 1JGTA 1P9NA 2XE7A 4L8LA 5HFJA 2P79A 4EHKA 4M1WA 1WDTA 1CERA 2CBGA 5FUBA 3FRIA 4W5HA 1E3LA 3KT6A 4MNTA 4YJGB 3R3UA 4MS1A 5SV2A 4DTCA 4TLEA 1ZMBA 1Z6QA 3QYJA 3ZWBA 4M0MA 4PU0A 3KLOA 3U56A 2QD5A 2UYCA 1N9GA 1H4SA 4K3VA 4Y6GB 1ZIPA 4RETA 1K86A 3W4IA 1ZGCA 4JD5A 1Y9JA 1JLLA 1C0PA 1TKCA 2LTAA 4PFJA 4AXBA 1VE6A 2C2OA 3ZU4A 1SIWA 2Q3JA 2O14A 4QKQA 1YB1A 3QKIA 2V7PA 5LA6A 1SUEA 4UD6A 1DBVO 1UKVY 4INJA 4IFTA 3SKYA 5JJIA 4I1OA 1CY4A 4C7OA 2V5AA 3DFMA 3ZQ4A 1E9SA 4YRPA 2PZAA 2IEYA 5CDTA 2JEOA 1U4NA 3K73O 3L8ZA 3MA0A 4GVLA 1N5LA 1Q3TA 1WMBA 2XDQB 4ND6A 1BWRA 3AEKA 3G7SA 3K9CA 3DKRA 2GF0A 4YT5A 3P26A 4CIVA 3K6SB 1ECGA 1P29A 2VHTA 3MPUA 4Y3UA 4O4IF 4FYIA 3KEFA 1NN5A 3FAZA 1IZ8A 3AHIA 1J8MF 3EAQA 3IS3A 2ZI9A 2G70A 2X8JA 1KO5A 2E4UA 3B7PA 3BXZA 3N5KA 4CU5A 5JWOA 3NHYA 4DSUA 1IBKB 1IPFA 2R7AA 3F3MA 5AP9A 1PKXA 4F6LA 2VSOA 3W8DA 1LBHA 3RR2A 2ZIGA 4NE9A 1XSEA 1JR2A 3IOBA 4ML3A 4WFKA 1F6WA 1RQ7A 5D1HA 4AN1A 2G67A 1PHPA 4BMPB 2B4TO 1QP8A 4GAEA 2ZZNA 1WA5A 3AP2A 2X8WA 3JARB 3LKVA 4HY3A 4MUBA 3BH7A 5EWLA 2MR6A 4KBFA 1MB4A 3HMQA 4BKMA 4J76A 1ISHA 4QOSA 1EVZA 1JA9A 5TGTA 3GLUA 3FKSA 1DDIA 3Q3JB 4M6WA 5BV0A 5DNCA 4A0RA 2JIPA 3ACCA 4QC2A 4K6CA 4MV6A 1QPBA 1KVQA 5AI9A 4AP5A 3G82C 3KP1A 4JY7A 3W2HA 1L5NA 3F90A 1TUBA 2TYSB 3M33A 4F8EA 3AF6A 3F3SA 2Q1SA 1TC2A 1EVJA 1UIRA 1H2ZA 1ZD2P 2F4NA 4YCJA 4CEJA 1GG5A 1HQDA 5FULA 1BE8A 3C24A 4JJGA 5HRAA 3DL7A 1Y81A 4ZI5A 3WI7A 1C8LA 1CS4C 1VLVA 1FFGA 3W78A 3PQFA 2XSZA 3C16C 5COQA 5DNYB 3DEFA 3FBTA 1V7QA 3LCJA 4RIHA 1QR6A 1FOEB 2QRNA 4WK4B 4ZDKA 4P4SB 5JDIC 2ATEA 5MDHA 1RBYA 1Y5LA 3CWCA 4MKXA 3EPHA 1J8QA 2LV8A 4JVMA 3ZLBA 1JHVA 4ZYYA 1MABA 3T4XA 2PMKA 1RWQA 3AY6A 2C2HA 2P9JA 3DDCA 3FLBA 3Q9SA 2AX4A 3KKLA 1A5AB 1KSJA 4PLGA 4XASA 4ALJA 1ECJA 4FVTA 2BBSA 4NULA 1RQPA 2Q7XA 3GJTA 2O3RA 2VJNA 4BCDA 4YALA 3IUPA 1M0TA 3WNCA 1NJ2A 5LYJF 1MAWA 1E8NA 1OXUA 1UBKS 1HYGA 4FFWA 4TMFA 3T4EA 3TUJC 3VJMA 4BCBA 5DK4A 8AT1A 3UQZA 4A26A 3CA8A 3MQ2A 3OLZA 4V24A 4QG3A 4YT8A 2G77B 2HWKA 3RU7A 5CYGA 4AI6A 1CETA 5BSEA 1D5CA 1P31A 3C74A 3ANXA 3Q88A 1UDBA 4P98A 3A04A 2A33A 3DT8A 1C3EA 4ARBA 1JDVA 4U5XA 1NPDA 2IL1A 3M6MD 1R0KA 4Y30A 5FQNA 1T1JA 1E9BA 4GNKA 4LY0A 4TLMB 5KWSA 3AL0C 5H9VA 1W48A 3S70A 1KO8A 4UM8B 4X71A 1KBZA 4EGJA 4UHCA 2OHJA 3T1OA 1XNQB 1EGHA 4Q9LA 1AHPA 4MRNA 2C8VA 3UBTA 1ESMA 2RHBA 1E66A 4CL8A 2BGRA 3PFHA 1O6ZA 2GH1A 4YRCA 5HILA 3Q7TA 5DK6A 4UMVA 4OUDB 1FMJA 5CEJA 2QRZA 3TPZA 3ESRA 3JAKA 4PFSA 4O4LF 4ZQEA 3OBBA 4AULA 1U7HA 3D8SA 4DIBA 3VPBA 2JFVA 4DR6B 4DWWA 4B6GA 3FKSD 5LWQA 1B6RA 4E4RA 3U1BA 1NQXA 2Z3ZA 1L7DA 4P93A 1W7AA 3KQHA 1O9GA 3C8ZA 2JAUA 3E9CA 2B25A 3I3OA 4JJ6A 5KSWB 2H3EA 3CBQA 4BX2A 1R4MA 1CYEA 4TN1A 4JUIA 4OHWA 2QVZX 2ZRQA 3QOWA 1GP2A 3LKDA 4RUKA 5KVAA 4KREA 2MYTA 2J0SA 3LDUA 3O4RA 4AICA 2HWYA 1LQTA 1XHFA 5CFZA 4FD2A 3N53A 3GBSA 2XSZD 2R1TB 2Y9MB 2C54A 3LPMA 4ZP1A 1BSVA 2P77A 3B1KA 3H05A 1O87A 3OWOA 5ECGC 2GNOA 1JQLB 4BNTA 2DLCX 3J7AC 3VDNB 1XDGA 1P2UA 2AFIE 3UT5A 3SNKA 1CVRA 2OFOA 3JQFA 5KAMA 4B4KA 4F3NA 3ORYA 4I81A 1UJMA 4UUBA 3RGGA 3GJQA 3I8XA 3PC4A 4RA9B 2O2GA 3RJMA 4HZUA 5BSHA 4I5GA 3TIVA 2HWWA 3JZAA 1J23A 2J5KA 2YHIA 5FPHA 4MS4B 3GFVA 4WLOA 3ZDBA 3QFRA 2R6R1 1USVA 1MKYA 1UCFA 2AK3A 4K3UA 1EP3B 1AKVA 4QELA 1YGYA 4QQKA 2HPAA 2L42A 5CX4A 2A7QA 2IZOA 3T1NA 5A06A 1M75A 4FHEA 1GQRA 1KFCB 1AGYA 1V1RB 4E5NA 3N76A 1JQEA 3EBOA 2JLVA 4B3BA 4FFNA 5FA5A 3LO5A 5CNMA 2REXB 1E20A 4IKEA 5KDLA 3RKUA 4DBLC 3NBKA 3OCYA 5E6RB 2F90A 3H97A 3BGOS 3Q5DA 4U8GA 1HSZA 1PKEA 2O59A 3DV0B 4UCFA 3EIHA 2C7OA 1WKBA 1B73A 1PQPA 3A9SA 3EEBA 3GH3A 2GPSA 3RIGA 1UMCB 3OU2A 3SY8A 1J0BA 1YR8A 4GXQA 3BA1A 2QJRA 3AR3A 4ILKA 2HDNB 3FVWA 1ZQ1A 3RYIB 3LWNA 3UKDA 2RB4A 1LH0A 3N8KA 2FMHA 1XNHA 5CNJA 1KRXA 3WMFA 4FFRA 1VYUA 1L4EA 2OSVA 1DLIA 2BR4A 1JV2B 4J6FA 4RGVA 5F4ZA 4KITB 2C4WA 5G41A 5AFSA 3LV8A 4HMQA 1ZLYA 1Y1TA 2R2GA 2ZIVB 2F6RA 3A4MA 2NO0A 2ZBFA 3LW8A 2QW1A 4LJ4A 1X92A 3T5CA 3BBLA 3HMKA 4EW1A 4YP9A 1A8IA 3RC1A 1NVFA 2PGLA 1IK6A 2XUQA 2BMEA 3LRPA 1QIIA 1Q16A 3NGMA 1PGOA 2I1VB 4Z9BA 2YWBA 2WFAA 3MSXA 4YXWA 1PI3A 1U0OC 5TV2A 3I34X 2O8EA 1BKYA 3O4HA 1RLTA 3OT5A 4JJFA 4KGDA 3UB3A 3OFKA 4YROA 1E7WA 2WUEA 5F2NA 3DD1A 3LT1A 4OHRA 1NONA 4MRSA 3KJQA 1BHQ1 2PGIA 1CVLA 1T8SA 4G26A 3L6EA 1IB6A 4WXRA 4WBSA 3IQFA 4X1YB 1I30A 2B36A 1UQTA 3H9BA 4GEKA 3CO5A 2HBZA 2QGNA 2VO1A 2NXJA 3Q0EA 3DOIA 1CR1A 2YWRA 4LF7B 3BCRA 4HFJA 1CUDA 2NT4A 3PIRA 1WXHA 2HDWA 5ES3A 3TNFA 3V1YA 2UZ1B 1KBOA 2TMKA 4ZAZA 4WINA 4AX4A 1FZTA 1IY8A 4J0DA 3DVQX 1ESNA 4LYYA 2ZZMA 4KNVA 2X8BA 3AHCA 1TK2A 5DTQA 4A6XA 3BAFA 4CLDA 3EXG2 1VFPA 5C3MA 3AM5A 2YN2A 3OJ0A 2OCAA 3E22A 4GMKA 3TM4A 3OAAA 1VHJA 1POXA 4FN5A 4LV6A 4FCTA 3UAVA 1ZINA 2NMVA 3OZTA 4CIDA 4LHXA 4ER3A 1B42A 4BMZA 1PAUA 2FSIA 2O2YA 3LBAA 1I6WA 3VU9B 2HDHA 1V5FA 3KJEA 1L9KA 2VQ6A 2V6MA 3TJZA 4XVUA 4HOYA 2OHXA 1VSBA 4R2HA 1RBMA 2NXWA 3MRTA 1ZN7A 5IBRA 5FPKA 1R37A 2YVUA 1HLPA 2Z43A 4DIKA 5KSYA 1Q7EA 4YRGA 2X42A 1Q92A 3DVLA 3TXAA 1WM1A 5AW3A 5HKAA 2R44A 3G79A 3ZDFA 5F9MA 1NW5A 3EPPA 2JATA 1GPNA 4YGYA 2P3OA 1PJBA 2E4VA 4MK4A 1XYGA 3F6YA 2NYVA 4PO1A 4EG5A 3MAGA 4DADA 4RV4A 4KYUA 5JD5A 3ND6A 4NBVA 5DCYA 1H8EA 2O1WA 4FYPA 4BQFA 3WWZA 1Y63A 3HHEA 1Z7GA 2D1YA 3RQIA 3U13A 3N2NA 4TVKA 2VPQA 4Z3KA 1USWA 2GDZA 3H1PA 5HKBA 1KERA 2TMDA 3GUVA 3LGXA 3BL5A 3Q7IA 5CEFA 8LDHA 3S55A 3SAJA 1RS0A 2HQBA 1AB6A 3V32A 5EL0A 3U7EB 1RMQA 2GN8A 1YB2A 1D6SA 5ALZA 3GP8A 2OOSA 1KJWA 4XEUA 2RGRA 5HUJA 2V7VA 5A4AA 2OO3A 4YJ2B 3P0IA 4MKHA 1T2CA 3WR5A 2V8BA 121PA 1RYZA 1FSGA 4EDFA 1H2EA 1NE2A 1UFOA 5AKXA 1V16B 4EA8A 4TWJA 4I55A 4X3PA 1DC4A 3RU9A 4BMXA 2EW1A 3KDPA 9LDBA 2MWMA 2B1QA 2J45A 2XMZA 4YXWD 1CF2O 1O0BA 3OQIB 1HQCA 3SOZA 1QRDA 2W42A 3RU2A 4RKWA 2DH6A 4QPPA 2Z1DA 3K71B 3V48A 4NMLA 1XWFA 3MWEB 4QO8A 9GPBA 3GZNB 1EM8A 4I1PA 1VC2A 1II8A 3TG8A 3NKLA 1DUSA 4GSKA 2FVXA 3R09A 3H8WA 3IULA 2PO7A 3AM4A 4L8VA 4RX1A 2LPMA 4I6GA 1H0KA 1XOIA 2BMJA 4M55A 4Y2YA 4A8PA 2GBGA 1RYBA 5JAOA 3UWOA 5HDBB 1FVXA 1VGRA 1Z0IA 3WIDA 1UDCA 1ZA2A 5DGDA 5HCUA 5D3ZA 1IWOA 4ZJYA 1I36A 4JYCA 2EAUA 2C03A 2G0AA 3C8UA 3IBYA 4LWQA 3PSAA 1N6LA 2GEFA 2IWHA 3QVJA 3U81A 1PJCA 3HYNA 3RVSA 2XDYA 1F51E 1GTRA 1N8TA 1GNRA 4DYHA 2PD6A 3BS4A 3R5KA 4F2PA 3U9TA 1X7XA 4FMBB 3TDKA 3IUMA 4PLTA 4OJTA 2IV3A 4MVJP 3L4SO 2NU7B 1SU7A 1K06A 1Z8NA 2IT1A 2RBEA 2ZBPA 3F7MA 3KPUA 3L1JA 3NETA 2OBBA 1T5BA 3OLCX 3PIIA 4GRAA 1OWPA 4MROA 2NQTA 3JRWA 5FJIA 5SZHB 3WWEA 4TKVA 1LRKA 4QBKA 1Z12A 5JR3A 3ZIUA 1VA5A 1DIAA 2HJSA 3LBHA 3ENWA 2ZWVA 3H6KA 1MN6A 4KSCA 3PJRA 1XU4A 1SHLA 2HHCA 3QVMA 1NN3A 2GZ3A 1QYRA 2DPYA 2VTVA 2BC9A 2Y1LA 2I71A 2QSUA 4YJHA 5IZCC 1BFUA 1MENA 5CHYA 5F73A 1GR0A 1FUIA 2AQKA 3LP6A 1EFTA 1SG0A 2HA2A 5FFFA 2IDZA 2OHGA 4I5DA 5K4GA 3TECE 3PCXA 2UDPA 2WZQA 2P7HA 1DRWA 2ALJA 3K96A 5LQNA 4XLZA 3WKDA 1YZGA 2WOOA 1XTRA 1NNEA 4KDRA 3B6IA 1B6TA 2AFIB 4ZAVA 1D2EA 3GJ4A 2IYNA 5IAAA 1G3QA 3G8YA 4MTCA 2WYUA 3W7VA 4BVJA 3VPCA 1X0VA 2QN9A 3DTYA 4LF6B 1I3MA 2QNBA 2VP6A 5KOJA 2AOUB 5A9TA 4YMLA 3A31A 4TLBA 5CLGA 3C3KA 3MT0A 1EBBA 4U9IS 1XLUA 4AJ2A 4C4RA 1SULA 2Z5LA 2G8NA 4F5DA 1OIWA 4F4FA 2HT1A 1JIVA 2NUTA 4DHEA 1BS2A 3U39A 4QRHA 4MB0A 4CM1A 8ABPA 4FFVA 5I7AA 3HSKA 1SZDA 1TEVA 2VXBA 1GGNA 2RHOA 1OV4A 3L6OO 4WQMA 4A2PA 3BWXA 3BRWD 3K6JA 3LUKA 1C1XA 1JU9A 4YO8A 1WO8A 2ZR9A 4C3OB 4DC1A 1I7QB 3JXEA 4H08A 1Y7HA 4LRWA 2WNHA 1L8LA 3A3OA 3OEED 4BP8A 2A3RA 3GUHA 4HDKB 4H9GA 4Q34A 4PNPA 2OPBA 1KXZA 2QN8A 4DDHA 1QC5A 2YJ6A 5AD1A 1YL7A 3E2IA 4GRDA 1IUNA 1TJ5A 2ZIXB 2ZJ1A 2X1LA 4PYOA 2ORVA 1A7KA 1F2UA 3E9ZA 4KR2A 4KK4A 1XTSA 5EXDA 4N0MA 2I9PA 3WDLA 4XM2A 2F3RA 3BHNA 2CW5A 4XVRA 3CZCA 1E4EA 1E4YA 2DT8A 1Z13A 2JFFA 3E81A 3HB4X 1J06A 1QXSA 2G17A 2WT8A 3N2KA 4MGEA 2I7XA 1E9DA 4BWVA 5BUCA 2C31A 4GR5A 1A97A 1DJLA 3GDWA 2AFVA 2A0KA 2W2QA 3ADOA 4OXRA 3C98A 2VTKA 4B17A 4UEJA 4KN5A 3ZY5A 4DY4A 4DA9A 4Z7OB 1IHPA 3I45A 4G5XA 4MULA 2I62A 3EGIA 4MKGA 3ZX4A 4W7SA 1E9AA 2G3YA 5DNEA 4JLBA 3JYPA 2C7VA 3GLGE 1JKMA 1GTMA 2J32A 2ST1A 1KJNA 1XZHA 4LWZA 5AUQA 2Q3EA 3ZXXA 1CEQA 3G2QA 5KYWB 1YCFA 1N6KA 3K8YA 1DXOA 4LJLA 2QS9A 3TI9A 1UDWA 5BQ3A 2VHYA 1S2NA 2X3FA 1VL1A 1Q7CA 2XXJA 4HSGA 1P3Y1 2HU5A 2WIDA 4OJMX 5ALSA 3WYGA 1NJ1A 2XRYA 1V7ZA 2DQKA 3ECSA 4DJTA 4EQZA 4Y2RA 4ZHQA 3THYA 3GWZA 4HBZA 1ZNQO 2C2GA 1Z56C 2VOJA 4J07A 4EO4A 3ZWKA 3RUIA 2FLVA 3AIOA 4Z54A 1JJIA 2Z2IA 2XGOA 4N8SA 3UMGA 1NOKA 3KKMA 3OTOB 2MT9A 1WXQA 4KJZA 3WP1B 1F60A 3F5FA 2WM2A 2CSXA 1G1AA 4YB8A 4ZVMA 2NO9A 5ICFA 3SXUB 1KMHB 4AJEA 5DRTA 4JEUA 5E6UA 4O2BF 5I7UA 5EHGA 4NARA 3RSLA 3PQEA 4RK1A 1A04A 2EFEB 4ZT7A 4ZT4A 2R6DA 4LOAA 2FEOA 1WB6A 5K3EA 4NCJA 2B0CA 3WBBA 2O4CA 3KKZA 3K0HA 5L8VA 3UJNA 1JZQA 1EAYA 1KSFX 5GTDA 1EK0A 3M9WA 1HLGA 1JKIA 2ETVA 1RIFA 1EIZA 2A0YA 2CLFB 1SK9A 1OAAA 4MA5A 821PA 5GQSA 3JWHA 4TV8B 3CE6A 5EKSA 1LS1A 3R0XA 1ZI6A 1JZSA 1M83A 2AG1A 4Z0NA 4C7KA 2PANA 1YUNA 1BH6A 1FSFA 1Z62A 3M5CA 3LS2A 4AT1A 2YHUA 4YCMA 1C3JA 1ZWLA 2NZUG 4P2BA 4ZD6A 3EASA 4O1IA 1OAOA 1RMTA 1L5GB 1JQDA 2E4ZA 3UO8B 1KETA 1B0AA 5EKTA 1YE3A 4DMRA 3P9CA 4DLWA 4QA9A 1MLDA 2FUCA 1EVIA 5DP2A 4RVCA 1NVXQ 1SGWA 2BFMA 2R8RA 3H5TA 3RFCA 4F45A 5JZOA 3CW8X 3MJTA 3R7SA 1PR3A 3BRCA 3U0BA 1NUPA 4ZIRB 1DIBA 2UUPA 1J7KA 1V5IA 3AUFA 2R6ZA 1HUQA 2PSFA 3FCCA 4JUAA 2CJFA 3OOJA 4D80A 4HVAA 4RHFA 5K0BA 2ZCJA 3SZUA 4K0KB 4JC0A 5CBPA 5H8WA 4GOND 4GX2A 2NN3C 4E14A 4LYGA 3TRJA 5HJ7A 5JFGA 1K2WA 1ZM2A 1OF1A 3DJYA 4ITUA 3SLRA 5GIOE 2CNLA 5JD6A 3CNBA 1EYZA 3C1TA 4TLAA 3ASYA 3FPBA 4KAJA 3K2IA 2WU8A 4WBNF 5JCPA 1UKAA 2OWDA 1SZJG 2PZGA 3LC0A 3QPBA 3WADA 5B5SA 3I0MA 2PM8A 4HN2A 4PIVA 2IHZA 1P33A 4WZAE 4LDJA 2XTNA 1E32A 4ZQFA 5AW9A 3UUFA 4J2HA 4DA6A 5JXJA 1NXWA 4YAWA 1Y1KE 2BI4A 1WUYA 5IAJA 3IBGA 4CM8B 2HMAA 2AG0A 4FLMA 2X5JO 2I6GA 3UJ7A 2VQEB 3C1AA 3KL4A 3AESA 1KR2A 4BU1A 1HETA 1JPVA 1PV2A 1HTTA 3T7EA 3KCQA 3O73A 4OUKX 4UW9A 4CM4B 4BZZA 2ZULA 5ALKA 1AV7A 3I04A 4K9SA 2J5BA 1SWWA 2XJ9A 1JDBC 1FVFA 1GTG1 2XNDD 3ESXA 3FOAA 3L8EA 4E94A 3GEHA 2PZ8A 3R7DA 3GCWA 2VUTA 1Z0UA 4YMUA 1RJWA 5G4KA 3VSAA 4B7UA 1U63A 1REQB 3G1TA 3Q7QA 3BXPA 4M87A 5JANA 4KTTE 2JK0A 4BVKA 1RXEA 1EQAA 4FIZA 3TRHA 3T1TA 2D06A 1XIVA 3REQB 2QUJA 4MGZR 3IIEA 4HGRA 5DHRA 2JZNA 3A7EA 4MEJA 2BH9A 4OF4A 4HWSA 1QRTA 4HQRA 2CKDA 1U11A 2ZI6A 3TK1A 3UK0A 4BFXA 4YCNA 2BFNA 2PKQO 5K0CA 2EBHX 5JJLA 4HNVA 2PUDA 1U2QA 1KVUA 4J16C 2FFBA 1NXXA 5HJ5A 4FEAA 4INAA 4MUXA 1CUZA 3MGAA 4EP1A 5KJCA 2QTMA 4Z4IA 1E60A 1RQNA 2ZJBA 4YAEA 4C0WA 4UE6A 5CGZA 4HXEB 4FMDB 2B30A 1VPEA 3ILHA 3L7MA 2OHFA 1S2GA 2VZEA 1ZKDA 1GZVA 3FUCA 3IIIA 1NF2A 5BURA 2ZT5A 1HLDA 3EY4A 4FEGA 3BSWA 1U2RA 2W6NA 5A9SA 3B1FA 1WLYA 3FLAA 4C89A 5KJFA 1FNMA 2YIJA 3QLVC 4WD3A 3TTXA 4I9HA 4HQLA 1Q44A 4N5NA 4A8TA 4DKJA 1JR6A 4L5JA 3H2ZA 4K7JA 3TFQA 1U9IA 5DU2A 2OK7A 5IDQA 2Z8YM 5FLYA 3UKOA 2OLEA 1RJEA 4JIMA 1S7GA 4M7RA 3V4PB 5A4MS 2JFPA 3B9RA 1PFWA 3DCIA 4H6XA 3OQOA 3UN1A 4QWMA 1WHTB 1WZNA 4AKIA 3IODA 2FX3A 2AVDA 2OXIA 1OXTA 2GASA 3UCEA 1A69A 1SZCA 1YK0A 3DBLB 3ZE0B 2H2GA 1QOPB 1VMEA 1DEKA 4HN9A 4GNRA 2WU4A 3DMTA 4TPKA 3RCBA 4KR0A 4AG3A 1PS8A 4DRYA 4GOKA 2PZJA 3GOQA 3VR6A 4A82A 2Q9BA 5E1DA 3DW3X 1GT6A 3RHSA 4HR7A 3MD9A 4FKBA 4O29A 1RCFA 4BE9A 4HNHA 1PDVA 4YAGA 2XKJE 2FMUA 1W29A 4ZVSA 4OFZA 1FNDA 5T64A 4ARVA 5JSHA 5JZVA 3KXPA 2VZ9A 2FUKA 3F5MA 4HVTA 3H18A 3HJGA 1JIQA 3PRHA 2Y8EA 4N7BA 2ZE6A 2HV8A 5FOTA 3CNOA 4WL0A 3ZD6A 5I7VA 2ZJOA 2OESA 3PBKA 1Z73A 3AINA 3A9TA 2ESRA 1RWVA 3PXGA 3CMCO 4ZVLA 1HZJA 4XWWA 5J4VA 3O8OB 3A6PC 4B76A 4AJNA 1W8IA 2CKMA 3F9IA 2V98A 2FDXA 2WJAA 3WDKA 3FWPA 2EEZA 2H51A 3JPYA 3MT7A 3PRKE 1GAWA 1ML3A 2GZMA 2VA8A 3LQQA 4UMEA 2MHCA 3GLGB 1R4NA 3AEQA 2ZJAA 4HNSA 5LNK6 1P7ZA 2OORA 3RBVA 3SF0A 3WJ7A 4AW9A 2CFTA 4A27A 1TFRA 2BGMA 3HDQA 1JFLA 1ZXLA 4IDDA 4J0HA 1N2XA 1N6PA 4OU5A 1KIMA 1SCUB 5E8RA 1Z4LA 1RPTA 4YJFA 4ECAA 1WNFA 2VHEA 4H3KB 4AZ0B 3EIOA 3ZZ1A 1L7BA 5BOSB 3CLUC 5GV7A 1C7JA 3G0DA 3SJCA 3RDPA 2R60A 2HUNA 3OQ6A 2B37A 2JIBA 4F5EA 5AESA 2WOJA 3ZBQA 3PHCA 5A3JA 4JA2A 3SI7A 4XD7D 3TO5A 1PWZA 1VL0A 5HQ3B 3QBJA 1A8SA 1TQ8A 5CAEB 5LLSA 1V4NA 1OI4A 1MZVA 5IM4A 2PWYA 2I4IA 4R1TA 2I6FA 4MV0A 3G8AA 2PPVA 3IV9A 4JDUA 4KRGA 4MRMB 3RAPR 3WLIA 4E09A 3PUIA 1GFSA 2GN2A 2WWFA 3RTCA 2HPZA 1KI7A 2NM0A 4QGGA 3PB3A 4XUCA 2VEDA 2FSFA 2A5FA 4XUGB 3JS5A 2BL4A 4JSYA 1HYBA 3HM2A 4GPIB 1EDEA 3FYUB 2OQIA 3RANA 3AB8A 3MJ4A 2EARA 3BICA 2QYSA 4WT7A 4B2PA 2JDIA 4OHOA 4DSOA 1PV1A 4CF6A 2O8NA 3FOCA 2ZS9A 2HK9A 1EZ1A 2I80A 4KIUA 4N40A 4RF2A 4H6PA 4ICIA 4YP1A 1LLFA 2P9FA 1V5EA 2HLNA 2NPOA 4DWOA 3IP6A 2A92A 2FWAA 4FCVA 3FPEA 1TMGE 4DEYA 3EODA 5HWSA 2XHEA 2QY6A 3PXXA 3QU9A 3BA6A 1PV4A 2DRIA 1UBRS 4JFAA 1CJUC 4RGYA 5ELMA 4D6PA 3LLCA 3E7DA 1XZMA 1RRPA 3VR6D 1CT9A 3TLXA 1GPH1 1ZOIA 2X0IA 2CB9A 4EGCB 5IYZA 1YR9A 3HA3A 2X41A 1BS1A 1FX0A 4PSUA 4D4HA 5CDUA 1H0RA 1K5DA 4E2WA 4II3A 3ZDAA 5K0LA 1Q3KA 4DA0A 3K05A 2XKBA 1JDNA 1IZ9A 3SXPA 4KKVA 4DIEA 1XXHA 4CTKA 1RLOA 3DW1X 3TEFA 1ULHA 4E5UA 3FROA 3C85A 2BM0A 5E2AA 4Z1MA 3SDSA 5IFLA 1CB0A 3WGYA 4X94A 5L53A 1OW3B 3HKCB 1V5WA 4UHBA 1RZ3A 1AO3A 5E4YA 2XQKA 2GN9A 2JIMA 4Y2GA 1FXUA 1OJLA 5DW3A 3L4JA 1WB5A 5EPEA 4CEHA 3D2CA 4NABA 1JHDA 4IWNA 4E5KA 2JFBA 2M1ZA 3AF0A 4L8YA 3LL4A 1DKQA 5H81A 1CP3A 4HDRB 1G2OA 5IVHA 1UBLS 4TV9B 1W5FA 3T9BA 2GPYA 3ZQJA 3OPYB 4QUBA 5HF6A 4WE3A 2FG6C 2MJLA 1QIFA 3CIOA 2YRWA 4P53A 4R1UA 4WZAB 4ZTUB 4H4CA 2D54A 3OD5A 4D8WA 2APJA 4REQB 4XPZA 3R9XA 1DB3A 2HH9A 2PLRA 3L0ZA 5DJ5A 5C5DA 4OXIA 3DWGA 3IUYA 2QENA 4F84A 5D00A 4JLMA 2HBRA 4R2KA 2OQVA 5CA0A 4AS2A 4AF6A 2IXAA 2W2MA 1YIAA 1X15A 2ACVA 2ZSBA 2ZUWA 1ZG3A 5JNWA 3NG1A 3DT6A 4W8HA 4EENA 1E6CA 1KPGA 1YHZA 4OHUA 3LXUX 4UU0A 1F8GA 2H1IA 2P4HX 2DHDA 1BW9B 5FTKA 5WRFA 2Z30A 4IGFA 2BGKA 2OG1A 4MMZB 3LUGA 4XFDA 2QTVA 3IRUA 4P4UA 1VBKA 3PNMA 1W49A 5K3AA 1KTVA 1L4BA 2FXVA 1Q1QA 2ODBA 3FYCA 3KUKA 4YK7A 3H2GA 5GJWC 3U61B 1STOA 2UV8A 4O33A 4C21A 4YPVA 1QAOA 2ONYA 4FR2A 1E5VA 1GSOA 3HZHA 4JP5A 4I3HA 1HNWB 5LB4A 2ZQZA 1DTWA 2VCYA 4YRRA 2W6ZA 2XA9A 4MVJF 3F98A 4P1ZA 4C43A 2XA1A 4F4UA 1ZH2A 2D2EA 3LPAA 4MW7A 3X1MA 3V9PA 1JHRA 1Z83A 3Q72A 3JD1A 4I9NA 4NYJR 3ZWVA 4YH1A 3BUSA 4CTNA 1Y34E 2ODNA 1KEPA 2WHRA 4YQEA 3W5UA 5CFNA 2VF2A 1TYCA 2CMHA 4E33A 4XCQA 2OZLA 4HNUA 1UDAA 2VUIB 4FOSA 2EIHA 5AJZA 3UWDA 2GCOB 2OCYC 3NH9A 4Q1FA 3U9SA 4AVYA 4I1RA 1NG9A 5CP8A