4RAOA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
197
Chain Sequence
ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSRSIPMTVDFIRLKLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
total genus 72
structure length 197
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4raoA00
4JITA 1STOA 1OREA 1P4AA 3OHPA 4LZOA 1DQPA 5BQOA 3NAGA 1I0LA 3LPNA 5K51A 4P83A 1A95A 4ZFNA 1D6NA 1Z7GA 2JI4A 3H83A 3KB8A 4RAQA 2E55A 4X44A 3EFHA 3MJDA 4RHUA 3G6WA 3LRTA 1I5EA 1QB7A 4Z1OA 1CJBA 1AO0A 3DAHA 4QRIA 1LH0A 1L1QA 4WMLA 1ECCA 2XBUA 4P82A 1A4XA 2GEBA 2JBHA 2IGBA 1I14A 4QYIB 5ESXA 3DMPA 1XZNA 1ZN7A 1NONA 2YZKA 4LYYA 4RQBA 1XZ8A 1A96A 4P84A 4RQAA 1ECGA 1QCCA 1V9SA 3MBIA 5KAMA 1BZYA 1U9YA 1Y0BA 5E38A 5EUCA 4MB6A 1ECFA 1VDMA 4TWBA 1XTUA 4RV4A 5BSKA 4F8EA 1I0IA 5IAOA 1PZMA 1HGXA 1A98A 1FSGA 1ZN8A 4M0KA 1W30A 1WD5A 4RABA 4M0UA 5KAPA 4RHXA 1NULA 4QYIA 2H06A 4PFQA 2AEEA 2JKZA 3S5JA 1UPUA 1ECJA 1I13A 3DEZA 4RAOA 3M3HA 5HIAA 1O5OA 4P81A 1QK5A 1A97A 1ECBA 1GPH1 1IBSA 3ACCA 3GGCA 1DQNA 2HCRA 4JLSA 4P80A 5IPFA 1J7JA 3O7MA 1MZVA 1UPFA 2P1ZA 1TC1A 5BQPA 2H08A 3ACBA 1O57A 1G2QA 4KN6A 4RANA 4LZNA 1G2PA 1TC2A 3OZFA 1ZN9A 4WN3A 1G9TA 4LYGA 5JV5A 2PRZA 1JLSA 1QB8A 1UFRA 5HKLA 1OPRA 1HMPA 1P18A 4RHYA 1P19A 4LZAA 2EHJA 4PAWA 2PRYA 1VSTA 1DKUA 3HVUA 2C4KA 3ACDA 2WNSA 1R3UA 1XTTA 2PS1A 3GEPA 1QCDA 3OZGA 1QK3A 4X45A 4M0PA 1A3CA 5ESWA 4RACA 2JKYA 4P3KA 1OROA 1DKRA 1U9ZA 1VCHA 1DBRA 1YFZA 5BRNA 1GRVA 4FYMA 1BD3A 3N2LA 3GGJA 1G9SA 4P86A 1P17A 5JSQA 1QK4A 1L1RA 2VFAA 2DY0A 4OHCA 1BD4A 3QW4B 4RADA 1JLRA 4IJQA 2FXVA 4RHTA 4S2UA 1XTVA 2H07A
chains in the Genus database with same CATH superfamily
1C3VA 2CJXA 4H7IA 4UBLA 3NB0A 3IAFA 2B3TA 1YZKA 1VLVA 2BJWA 5FFFA 4EQ6A 3WIDA 4EHBA 5JFOA 4PFSA 1U1IA 4AD8A 1JHQA 1K5GA 4IRMA 3CVXA 3TTUA 3ZD6A 1Q6ZA 2JJ1D 3TO5A 1SHLA 3RYHB 5CDUA 3EZ7A 4XDZA 1DGQA 3C6QA 3SC6A 4CF6A 1F8GA 2MT9A 2MYUA 4TV9B 4L74A 5AQEA 1XLTC 3ZXUB 2B35A 5COAA 5K3FA 2JC3A 5DM60 2WC1A 4CCSA 4QXOA 3LSYA 3RWBA 1CZKA 2FJPA 4L8WB 4E12A 4LQ4A 1UDXA 3GRKA 2ISCA 4XGQA 2H1LA 1E2GA 3B20A 1SELA 4HAWA 1D7AA 4GOMD 4Q19A 4BC1A 1GPWB 1JT2A 2GZRA 3TW8A 1LW7A 3UH0A 1OBCA 3H9JA 4WY8A 4PLHA 4KDEA 4EX7A 4MA0A 3BXEA 3FFXA 3IHLA 2UDPA 1HZZC 1QOPB 4YECA 1D8TA 2WPDD 5IT4A 4EFMA 4DLVA 2V7GA 5ED0A 4DJ5X 1ZISA 1YGYA 5K0EA 1JQLB 1YH3A 1XEWX 3AP3A 4F5EA 4H0CA 3HV0A 1X1EA 3TOZA 2FK8A 4HQLA 3VJKA 3RAPR 4IP0A 3GUCA 3BKWA 1CQWA 3CTMA 4UUBA 5KAPA 4W5QA 1NBMA 3VMFA 3KXKA 1CQJA 2UKDA 4B3FX 4DF3A 4Z3KA 1DBVO 2GM3A 1ECJA 4ZP1A 2BM1A 2V9PA 1KDZA 1QE5A 2FZKA 3MN1A 2E4ZA 2I3DA 2QN1A 2XR1A 2KM1A 4J43A 1VLZA 2F4NA 3RUEA 4M9QA 1W19A 2XQVA 3C8HA 3DUFA 4R2JA 3RUIA 3TW4A 1H4QA 1YHZA 2CZGA 3KKQA 4ZOCA 5GMOA 4AS2A 4Y2SA 4I9GA 4C3UA 3ZDDA 2R60A 1FRZA 1OT3A 3P0EA 4IV8A 4PYIA 2VP5A 3ZY3A 3VPCA 4MQEA 2Y4NA 2PAAA 3RTDA 3C39A 3CGGA 4PLPA 2WSSD 2B8WA 2P90A 3KSAC 2GYVA 1FNMA 1LJ8A 2W4QA 3AI1A 4QHTA 2FYTA 1W6RA 3AEKB 5DGCA 3HHEA 1D8AA 4KVZA 1Q1EA 2B92A 1TZCA 4FWIB 1I4TD 2K87A 2WSSA 4HI0E 4I4IA 1SKYB 1Z25A 1NR7A 4KO8A 3SQDA 1KHTA 2F3UA 3VR4A 3UMJA 1XWFA 2EZ4A 1G7TA 4EUSA 3L0ZA 3CRZA 3EOBI 2H31A 2JGDB 4CCAA 4OMFG 1YOVA 1LB1B 3N6XA 3NNDA 4N54A 2IYRA 3O94A 3RC9A 3FPJA 4R81A 4F72A 4A4DA 4V0ME 3GEBA 3KKMA 4K9PA 1EP2B 3LPAA 1L8OA 4IFEA 5FTKA 3R6DA 5AT1A 3ZH2A 3UK6A 2B2NA 3L77A 3V4OA 3JYHA 1HE2A 3P8ZA 1JQKA 3IDSA 4JN6B 2E5WA 2ZR7A 1N78A 1I5OA 3SZGA 5JC8A 1G8JA 3OD5A 1S5PA 2DGDA 3SBOA 4LRYA 4O5OA 1MCZA 3P9SA 2FB9A 1IZ7A 2WWWA 3HDHA 2IZOA 2N0SA 5L3RA 3CNBA 5L7WA 5KDOA 4JC0A 4JKIA 2WZBA 3VOAA 4E94A 4BC0A 4BU1A 3KSZO 4C7VA 1QORA 1KKMA 4HNRA 2YOGA 4RXUA 4BEWA 4PQEA 5C46F 3DR3A 2OHIA 1BGWA 1MO6A 3ILYA 3V8RA 1K7FB 3LLVA 3EFHA 4N5HX 3DTNA 4KE9A 3QIAA 5A5FA 4ARCA 1QB7A 4H15A 1TF2A 1M2VB 1VIMA 5AVQA 1RC8A 1R66A 1EK0A 1U7UA 4N9QA 5B7PA 3BJIC 1NP6A 1TZBA 3DYVA 1RS0A 4W5WA 3EVTA 4KLNA 3S40A 3BTUA 1SHJA 1RHJA 1AKTA 4L27A 4NBWA 9GPBA 1HNZB 4V38A 1NZDA 2QTHA 4MWCA 1IN8A 2WU1A 2W2XA 4Y30A 5CPBA 1SXJD 5D7BA 4DCPA 4N6GA 3RJ5A 3F5FA 2QRKA 1U5AA 1T8YA 3BC1A 2IP2A 4YHHB 3PIRA 5L51A 1WW3A 1VRCA 1SXJA 2HLNA 4WVFA 2FW7A 1OAAA 4MQUA 1LQUA 4XWGA 1IOLA 1TZJA 3A36A 1Y5MA 2ODWA 4HBZA 5KJEA 1CXZA 1UBJS 1J0AA 1O6ZA 3R41A 3L4BA 3PPVA 2IF2A 5DNDA 3LHIA 3KPUA 1NKTA 4R1UA 5IBQA 1G17A 3E9NA 4GE3A 1GKKA 1M7GA 2QQGA 3HXTA 4JA0A 3KKNA 1A7UA 1MF7A 1G55A 1T0BA 3JQAD 3M4JA 5ELLA 3EVAA 3TLGA 4DQKA 2XZTA 1BJTA 4NDAA 5A2QA 2HYIC 3O2SB 4IFBA 3RF7A 4B73A 1E2BA 1WZNA 2R6JA 3IIEA 4WEOA 5DJ5A 1OAOA 3O8NA 3E0QA 1QG2A 4D56A 1OE0A 1ZLXA 2OHFA 3B3AA 2GN9A 2QLTA 5L3SB 4A10A 1Q92A 1ZCAA 1XJQA 3ONFA 3INNA 4LEIA 4NBLA 3IT3A 5C1DA 3ZHYA 4B33A 1XL0A 1EQAA 2AVDA 5TEVA 5EPOA 3GLHB 3EODA 1SXIA 1CY1A 4F2HA 3RS9A 2BZSA 2C57A 4C2TA 5IK2A 3BE4A 2Y0PA 2XUZA 5A6SA 1E61A 2QSZA 2VWQA 4P2BA 2JJ2D 1ZH0A 3LT5A 4KXWA 2P9HA 1QAQA 4HEA1 4PXAA 4G26A 3SF8B 1F1JA 4D92A 4XWKA 1USGA 5SYAA 5DSXA 1LV7A 1V5IA 2Z8XA 1QK3A 3TM4A 4ZYWA 5HZHA 4EG7A 1C5KA 2I2BA 2BR5A 2P4EA 3IMKA 4IHAA 4I50B 1WBDA 4BOYA 4DCTA 1DAGA 2NZJA 2W8BA 4QYMA 4CZ2A 3L0IB 3KEQA 5DCLA 4DA0A 3UOAB 3NC1C 3T5DA 3TOVA 4RPHA 3MIIA 3ABRB 2HU7A 1OYVA 2WHQA 3UO8B 3CEJA 4ASUD 2Q50A 2GA8A 3EB9A 3JPWA 4O2AA 1DIRA 1UKVY 1ZDMA 2YS6A 1QYIA 3L18A 1NV8A 3I9KA 3UJDA 3W78A 5DH9A 4AM8A 4WTOA 1WS6A 2AG1A 1BD4A 3SBEA 4B79A 5JVDF 4Q3LA 3HA7A 2Q3DA 7ABPA 2VAXA 1SCDA 3FPBA 1XP8A 2QRVA 4DV3B 4OGFA 1NG9A 3E0XA 4KMOA 3HXQA 1OV6A 5LA6B 1QGAA 3OQMA 3H11B 4QXRA 1Z0ZA 2RSLA 5EWLA 5IX8A 4HQ6A 3CG0A 3G6KA 2X0FA 1NDQA 4OSOA 4PZAA 4DLXA 5KX5F 5JD3A 1MGPA 2XB9A 4FLMA 1M6VA 1RE1A 2GCNA 1TEVA 4RJKA 3JWJA 1Z5WA 1KSGA 5FQNA 3TNDA 2QX7A 3RAGA 3ZE9A 1P8AA 1J0XO 1N2CA 3ITKA 5CBPB 4UHFA 3ZDCA 3D7RA 3JYNA 4L3WA 4HVTA 1H42A 1UBEA 5CNMA 4EDFA 4TYWA 3D2LA 4I1VA 1QR6A 2EGUA 3DZIA 1JSZA 3G9XA 4ALLA 2WYVA 3IKMB 4TUYB 5E7MA 4OHBA 2B4TO 1A5ZA 3LTNC 3JAKA 5JS8A 4MUXA 4OH7A 4C0SA 3EXIA 1JSRA 3VI4B 4DUPA 3L6EA 5B2ZA 2FW0A 3L4SO 4B2PA 1GZ3A 1K68A 1VI6A 1VL2A 3FMFA 4PSUA 3STTA 4AO8A 4E4YA 3KAKA 4MO9A 3PHHA 4EPVA 5J4VA 3LK6A 3H5OA 2QVBA 1YVDA 3MGGA 3PWKA 4IWNA 3L7IA 3NHLA 5H68A 3AR8A 3AMVA 1GV0A 3W4KA 3WRWA 4F0JA 2J3IA 3SYTA 1NOJA 1D2AA 3ZHBA 4CE6A 3GGGA 3NCHA 3GGOA 3TRDA 2PT9A 3D64A 1R8YA 4UPVA 4FN4A 1R5JA 4DWJA 1Z17A 3HJGA 5JWOA 4PPNA 1EK2A 1WNTA 4FT4A 3HYRA 4HD8A 4II2A 3QPAA 4NJEB 3ZHCA 2HDOA 4MPTA 4KOEC 4EH1A 4Z86A 3AETA 5FXMA 3PI6A 1JKMA 4ZT2A 5JISA 4OL9A 4BVFA 1QOZA 3A4TA 3GW8A 4KCGA 3MFQA 1KZGB 4TKMA 3UYKA 3T4EA 1ZM4A 1RMTA 2ZTVA 4WLFA 2ZJOA 4LDNA 5TJ9A 3U7QA 4QZVA 2I4MA 3W5UA 3OWOA 3BE5A 4OUDB 5BPHA 5EE9A 1IUNA 3SHFA 4DUYB 4F3CA 1O08A 1V3UA 2ZQYA 2OO7A 3VYVA 1MH1A 1G291 1UBUS 1RYNA 3G02A 1G66A 2QN8A 5A3RA 2CFRA 1GKYA 1U1CA 1JZQA 2PK3A 1KI6B 4IIYA 5IC6A 4WBSA 1NBMD 3Q7RA 3WR5A 3RAJA 1KOGA 1KA9H 2NXCA 2E21A 3R0ZA 4K1XA 4GLBA 5GZ6A 2C3PA 3K5WA 2JDID 1O94A 4RMGA 3RYHA 3L7AA 1S9DA 2P4QA 3TKLA 3N8NA 3W6UA 3MW8A 2FE4A 4JXZA 2JLQA 1ZHOA 3V1UA 3AR5A 3C45A 2P9CA 3JVDA 5ESWA 1FPMA 1PQ4A 1WW2A 5C18A 2O4UX 1GN8A 2MWMA 3Q8XB 1XZBA 4CFYA 3R9XA 1DTEA 4HZUB 4L7QA 2WWGA 4W5JA 3TSWA 4FR0A 1SUFA 2SCUB 4TRRA 3ZKWA 5F33A 5A3JA 2LW7A 4ZCQA 3E7WA 2OEPA 4X5OA 4LDZA 2QPAA 4I8DA 4RADA 5J5CA 3N58A 3VO1A 5L95A 2XZPA 5CW2A 2GD6A 3DHWC 1KYXA 1T1EA 3LUBA 4HHEA 1CUZA 1X7XA 1CRWG 3DL2A 5D51S 2HMWA 3GCWA 1ZWKA 3UCEA 4Q34A 5A9RA 3CUVA 1W2GA 3IUPA 3JQCA 1K92A 1DJOA 2J46A 2H4XA 1VL1A 3TTTA 3W06A 4ARSA 4O08A 2A0WA 4NMMA 5EPEA 4JELA 2WJAA 5CLFA 5EZQA 2BFBA 4BYGA 3E58A 3IAM6 3GLGA 3T3MB 2IPOA 3QKUA 4LX0A 3NUQA 1FY2A 2ID8A 3NTVA 1IY0A 1Z35A 4PS0A 1DX9A 2FQYA 3RT7A 2MSKA 3COSA 3GT0A 2VRCA 2GZDA 4MKHA 1BDIA 3ZBUA 1SVOA 1ZL0A 2AKAB 2KE5A 3HKDB 3I34X 4GLFA 4NCKA 4ZOAA 1X6VA 4O0LA 1Y42X 5DEIA 2J9GA 2L82A 4V2IA 5TF0A 2C04A 4CR8A 2NZYA 3WNVA 1NW4A 1KVRA 2PGLA 1H2WA 3ZQ4A 4TKVB 4C3VA 1GKUB 4PV7A 5T8KA 1FYVA 4FS8A 2BTQB 1E4VA 2IYTA 2OT3B 1XD9A 4KUEA 1SCBA 3TDMA 4OLAA 1PYOA 1KI6A 1P4RA 4JP8A 1SXQA 1S3SA 3P5BA 4ARZA 2X1HA 1COZA 1X1RA 2BUBA 4JP1A 5IEBA 2B94A 2ZSEA 5JT1A 4GE0A 3GEGA 2EU8A 2WHPA 1Q74A 1T4DA 2YZ2A 4IIGA 3RG2A 3T3EA 3W9YA 4DLKA 4EAAA 1E1MA 3BMCA 3JZIA 3AHJA 3CZAA 4R4JA 1R0CA 3OO0A 2OG1A 3F6SA 4OBWA 4YP6A 3TNJA 2P5UA 4ZMSA 1XAGA 3DH0A 1J9GA 1RHUA 1G59A 3TTXA 2VJMA 1PNVA 5T4EA 3NWOA 2D7DA 5IFLA 3AKYA 4B83A 2E5LB 3GJ0A 1FFCA 3QVLA 5TE9A 1AY0A 1M66A 3EGIA 1ELOA 3H5TA 3T7AA 1Q0ZA 2GPTA 4YJDA 2RCYA 1DAMA 2QQEA 2NU8A 3KLPX 3HFJA 1O6CA 5C7OO 3AVYA 1OYOA 2VF2A 4MGZR 4BEJA 1C80A 3H65A 5DXAA 3I9V6 4ZWNA 3K72B 1OXKB 3QVGA 4HLDA 4UD2A 2I4OA 4GPIB 4KKVA 4KH1A 4TXJA 3RSLA 4HNAB 2YHAA 1VYUA 4DDTA 4JQZA 1W4LA 3GNTA 1E20A 3DS8A 5BOVA 4K81B 1L5KA 4BAUA 1AJEA 5I4BA 3LCJA 2W22A 3BGDA 5JAPA 2O06A 3GH3A 3PXCX 4JB0A 1XFDA 2RHTA 2O2YA 2XF2A 3NS7A 5E0OA 3GLHE 1YNOA 4HH4A 1TRHA 2EHDA 1SCNE 3SGLA 1OGYA 3KJFA 1W0JA 4KMMA 1QQ5A 2IL1A 1LBSA 4JEMA 5LMNB 3O2QB 3JRXA 4S1VA 3JQFC 1TKBA 3VZQA 4LOLA 1UDCA 3UK7A 3MTJA 5GADl 4OI0A 4QVGA 3DFMA 4EFNA 5C7LO 3TTYA 2DR3A 2Q5OA 4L76A 4LZJA 4F6LA 3CEAA 4OA8A 4FQ5A 4CKEA 2QSJA 4YMGA 3A9CA 3OBBA 4ML3A 5CXUA 4ZO6A 5IM4A 3D5EA 5AKZA 4HWRA 5IK2D 1SA0A 2LKCA 4OOEA 5IXJA 1PTKA 3HJRA 4I66A 3H5RA 1KC3A 4H35A 5DULA 2HLPA 1WCIA 2H3EA 3SE7A 4RQTA 3BD9A 5I6DA 2NO9A 2PSHA 2R6DA 4WK2B 3EXG2 3RU7A 2WKRA 1QFMA 4LRSB 1NYTA 5FPQA 2RFLA 1LCIA 2X40A 2I7CA 2OM2A 3GRUA 2CMKA 1D09A 1PF7E 1BSVA 5EMJA 3RUHA 4KLZA 3MLEA 4AY3A 2I7VA 3I9NA 3EY4A 3Q6NA 4IQ4A 4U7GA 5G0UA 2I1VB 3BBLA 3TSCA 2WHPB 3WNDA 5HJ7A 5ALPA 1P80A 2FKAA 1DRJA 1VJGA 2PBRA 2J08A 2FRXA 2I87A 4R5MA 3FTEA 4ZT3A 3HB7A 3E9QA 4Q9DA 4A91A 3LSTA 2IS6A 4N3CA 1H3NA 5EMKA 1FZTA 3RFUA 1THMA 2DTEA 5LSAA 5F2EA 4C7OA 3C8ZA 2PZAA 4QPPA 4UEKA 3UAZA 2OFPA 5THKA 2VF5X 3A11A 1JG4A 4B80A 4TXNA 3SF0A 1W4CA 4UHCA 2WFMA 3HQ4O 1H8EA 1J8VA 1Q11A 3KQTA 1IUKA 2PE5A 4D98A 1J39A 4AY5A 1OB2A 3EVDA 3SVTA 4G3XA 3NHMA 1LZKA 3PX3A 4Z7JA 1BOFA 4JZKA 1W36B 1CLEA 4KR3A 1ICIA 2BEVA 3DULA 3H8SA 3V33A 2PUBA 2CFSA 3OEED 3KCNA 4QX6A 1Y6ZA 3V7UA 1E1QD 4U2CA 4YV1A 5H9WA 5GONA 4ACAA 4U2GA 1O95D 3QU2A 3VZPA 4LTNA 4MW1A 2D3TA 2QUAA 4Z2YA 3VO8A 1PUJA 5TF4A 1BS2A 3KDSE 1Q91A 1D07A 1H05A 5FBWB 4ND8B 3FGZA 1B1AA 5IMBA 1JIJA 2HV9A 5EMMA 4EMBA 4MPRA 2F17A 4O2BF 1ISFA 1JILA 4PLWA 2Z5FA 4ZQHA 2XUKA 4MVJG 4BNWA 5LP6F 1EAMA 3DTVD 1X1BA 1KERA 4R3NA 2VDPB 5C81A 1B15A 1SUWA 1V8PA 2XQIA 3AF0A 5FAXA 2C99A 4YREA 2VBCA 2E89A 1M33A 2F3QA 1B14A 5EL0A 3RD5A 4E11A 1JFFA 4X41A 2YNMD 3PEYA 3PA8A 4CKCA 2ST1A 3PICA 4NBTA 3TLJA 3GG9A 5ITZB 1Q14A 3ABIA 1VZ3A 4IY1A 1K4KA 2JLBA 1WO8A 4HRXA 1D0IA 1G20E 2IYVA 1XZDA 2WJHA 3H5AA 2GEDA 4HDRA 4IILA 3CUUA 4B82A 4Z7NB 2X4IA 1JJAA 2C2MA 3FCUB 3M6WA 2ZAOA 1UP4A 1SC3A 2B34A 2FZVA 2PAFA 1XEXB 3BK7A 1PHRA 2GN2A 3F5QA 3QG1A 4FFSA 4OQXA 5DHUA 3ZBPA 3U7EB 1LNZA 1VC2A 1QHSA 2Q2QA 3WL5A 1OR8A 2ZROA 1NRJB 2Q6TA 2FFQA 2VYND 1FXUA 5KSPA 1XYVA 1NAHA 5C7YA 3RFXA 3MJSA 3AEQA 4EI2A 1X8LA 1RRFA 5DWDA 7AT1A 1OI3A 1WSAA 1GPBA 4CI0B 1OIWA 5DEOA 1UC4B 1TO2E 1K6EA 3B5IA 4BIIA 3QMWA 4MIYA 4YLEA 5KREA 1RZRA 1D1SA 2ILVA 2J7PD 1CF9A 2QTAA 2ZBDA 4W99A 1ICEA 1YHYA 1MOQA 2V45A 4WAUA 4B4OA 4EGFA 3AFOA 3KJQA 4EY6A 4OHCA 5JJKA 1WVIA 1S3GA 4NMHA 3HVJA 3ZTWA 5JATA 3KETA 2PBFA 1QRSA 3KE8A 1B3RA 1MU0A 4MVXA 1P72A 2IP4A 4OFBA 3N1UA 3Q7QA 3G0OA 2YJTD 2AYZA 4U7HA 3WOHA 4BNGA 1LK5A 1Z0UA 2ACWA 4KFSA 1M6EX 4FMCF 3O73A 1PD0A 5DNVA 1Z13A 3INGA 2I1QA 3HB4X 3A9WA 5FAKA 1Y8QA 2QMOA 3G2NA 2VBFA 4R7ZA 5LYJF 3QIVA 1FUEA 1ZSVA 3EQZA 1V7CA 3TQOA 1II0A 2C3OA 2R85A 3OG9A 4J03A 4Z7OB 3EVBA 3U3JA 1XDDA 2QN7A 4DANA 1WVGA 4X1YA 3PJEA 3Q85A 1VLHA 5CCXA 3UC5A 1BW9A 5DISB 2LZ0A 5C53B 2FWPA 2YN2A 4UPDA 2AFHB 5JASA 1FTYA 2IF0A 4GRIA 2RB5A 4WSOA 3U4GA 3R3UA 3QYPA 4BFVA 4Q00A 1M2VA 4RH0A 2XCOA 3CUWA 1L0BA 4NE9A 3NBFA 4UBIA 3GO4A 1HV8A 4RZ3A 5JANA 3GJZA 2X8JA 4DSOA 2XLCA 4B5LA 1QIEA 3HS3A 2WJGA 3PQCA 4I55B 5AKJA 3N0VA 3R7AA 3PFKA 1NN5A 4EHAA 4PY2A 1MQAA 5L53A 3ZCVA 1D1TA 2A58A 1U4OA 3TK1A 1NOIA 3L8YA 1NJ8A 5JH7A 2RJNA 3S81A 1I7PA 1O03A 1Q0HA 1OX6A 2OGSA 3KFXA 1X7WB 3GGPA 3PRYA 2F8SA 1KP9A 3RGGA 2B2XA 3FRJA 1XZAA 1TQDA 3LU1A 3U6KA 3ZVNA 5IDQA 2H06A 1XU7A 2H4ZA 5EKDA 3TSYA 1OYWA 1Q0QA 1Z68A 4BYMA 3IUNA 5FPKA 1MUUA 1E2HA 3HU1A 4YI5A 2RKWA 4D43A 1D2HA 4QXQA 2ZJFA 4NAHA 3JQBC 3SC4A 5HXAA 5E3JA 4BCCA 3LM8A 2YFKA 4ETMA 4Y1GA 1R8XA 2GD1O 3RUCA 1CFZA 4H16A 4U8GA 1IOZA 4G9GA 3FLAA 4LJYA 4D4LA 4WFJA 3TZBA 3UMSA 2BFWA 2V59A 4E3WA 5JDIC 1ZU4A 4KR9A 2VN8A 3C24A 4I50A 2VRBA 5G0VA 3SXUB 3T06B 4RANA 2CVZA 2AXQA 5DHAA 5FUYA 3V8NA 3CN9A 2GB4A 1K5PA 1P7PA 1XMVA 2JFPA 5AM1A 3F3SA 5JV5A 4PIVA 1GG9A 1ZVJA 2QAGC 4INZA 1FDTA 1T0IA 1LZLA 4DJAA 1HMPA 3JASB 4MIKA 4YYEA 1Y1KE 3ZE2B 5JQGB 1QGUB 5E7QA 5FR1A 1YJBA 4H7JA 2AJLI 3BCHA 1Z37A 1VL6A 2A3RA 3OQ6A 2XGJA 1YIAA 4W9MC 1M1YE 1JKIA 1CZLA 2LR0A 2AN9A 2CSUA 2BSXA 4RJJA 4XGNA 5GPBA 1TZMA 3FOBA 4ND7A 4PHFA 2BVNA 4RY8A 4ZAVA 2IK8A 4V3BA 2HNKA 3VFDA 4JSYA 3PIIA 3DWIA 3QMVA 3PYLA 3R44A 2ZYWX 3HDTA 4RX1A 4K5QA 1Z2CA 1QHGA 3AI7A 3QLEA 4JT4A 1RRMA 1UJBA 2NV2B 3E84A 4TV9A 2P6UA 5CDHA 1WHTA 2BL4A 1Y9AA 4NE7A 3ID6C 4DDVA 4XIGS 2JI7A 3GPLA 3B3GA 5HBGA 2A57A 1PI3A 2FTKE 1EFPA 5FWAA 2J0UB 2W6JA 2JNWA 2A1TR 2IEBA 1WRBA 3F9CA 3LL4A 1G3IA 2X8WA 2ZRAA 3GARA 5ADUS 1E1RD 1V25A 3WQHA 2I6QA 1P4AA 2HAEA 1RWVA 2G1KA 2I2CA 4RZQA 3Q2OA 2YHSA 4J2OA 3B9RA 3BRQA 4HX9A 3O38A 5LBUA 3I9JA 4RPLA 1GAWA 2ZJ0A 5EWJA 2VEDA 5TIIA 1E1RA 1I32A 3QVVA 1S7CA 4XJVA 1X1AA 2C9ZA 4LF9B 3UENA 2ZVJA 5E4JA 2HSGA 1B6GA 1OILA 2FN9A 4BX3A 4V2UA 4BO9A 4PBTA 2EBUA 3AUYA 2QD1A 4DLTA 5KTSA 3RVPA 1F06A 4MA5A 3CRW1 4ZT7A 2WU8A 4X7MA 5FB3A 1HY3A 3K2BA 1XAHA 1K63A 2XTJA 4QGGA 1MDFA 3R4VA 2C29D 2YOFA 3AINA 5ENDA 1E9FA 4ZHQB 1GR1A 1ORDA 1IB6A 1TFRA 3TD6A 4LY6A 3E8XA 2LRHA 3DQZA 2PUVA 3RF6A 3NVKI 4KXFB 1I51A 3T94A 4EG6A 5K09A 5K3CA 1HT2E 4M1KA 4OH1A 3HGMA 5KNCH 1WZCA 3F6RA 4MR7B 4Y2HA 5FT9A 3IBTA 3THXB 3KS9A 3O1LA 1M67A 5HF5A 4FHDA 1ABEA 4KXNA 4M1MA 1KVQA 1TA9A 4CEIA 2ZCUA 2I6SA 3RYFA 1U28C 1L7OA 3BHNA 4KQEA 3P94A 4ZQGA 3E2PA 4G84A 4AF6A 2B9EA 4YJ2A 1IZYA 2JLCA 1J23A 2CXOA 4RGVA 3A4YA 4Z0TA 3AWIA 3T54A 1PR9A 2HXYA 1RVV1 1LTHR 3NBUA 1CR2A 5DWVA 4B2LA 3ED1A 3R5XA 3ZEIA 1U0FA 3IULA 4UVDA 3ELWA 1OIXA 1N36B 4UTVA 4KI0A 4AFNA 3COWA 3V46A 3CR8A 1Z88A 3MMNA 4H6VA 1G6OA 3LKBA 4QOGA 4RHCA 1I7SB 4BLUA 1SUCA 1SZCA 4FKMA 4LQDA 3AETB 4WLOA 1N2CE 2J9ZB 5ENZA 1VB3A 1T6XA 2WJVA 3I64A 4Q9LA 3WTCA 3A8TA 3KKKA 5ICFA 3BZBA 3M6XA 1E2UA 3WGYA 2Z9BA 2PANA 5BV2P 4BWFB 3VYSB 4I1YA 4YCCA 3QH4A 2MSLA 1NUUA 3RVSA 3SOZA 3EH1A 2DX7A 1G3QA 2ZI4A 3MPOA 1RMYA 2X4GA 4L95C 3A9VA 4A2WA 4BFYA 3QUQA 5JXGA 1I1QB 3AV3A 4IRXA 4JJ6A 2Q6OA 3IQDB 4L0QA 2EZTA 1W75A 2NXWA 2O1WA 3W2FA 4D0GA 1ISMA 4C03A 5IT0A 2NWQA 1QO9A 2VDOB 2JKYA 3FNFA 3WZLA 3V1LA 1NJ6A 2YV1A 2OCDA 5P21A 4LF5B 1EQUA 1XNRB 3ISJA 4XVHA 4A8JC 1KQPA 3BWDD 5A04A 2DTXA 2DBRA 4MV9A 4CM4B 3EPRA 3C0KA 2BFFA 2ATCA 3QXGA 2ZDHA 4QEDA 3HLKA 1C8LA 3KQYA 3THYB 4XLLA 2R8XA 2IVFA 3OPYI 4WY2A 1LWNA 1E1DA 4V24A 4ZYLA 1A9PA 3LOUA 2B36A 1RCFA 1W581 3A6GA 5T64A 5T7BA 3O9VA 1G9XA 1DAOA 4HKTA 2J3KA 4ZVLA 1RKXA 4KH0A 3ZWMA 1MLDA 3F8TA 2JCSA 1TM4E 4LS3A 4CEIB 3X2FA 2IY8A 3FAKA 3G7UA 4ATNA 3M2TA 1HETA 4MB0A 4R9SA 4XYBA 1ORHA 4QO7A 4DIFA 3E8MA 5K6AA 2ERYA 4V1CB 1AZWA 2ZBPA 2QLNA 4UHEA 1V71A 1VJ0A 2OE2A 1JFLA 4TTIA 1E8NA 3DFZA 4QM6A 4CVNA 3IKTA 1VMEA 3IVMA 5FBVB 2PGDA 1Q19A 2O48X 3OTWA 2V9CA 4WOKA 3VYRB 2X8LA 2QW1A 4DMRA 2EW8A 3C74A 2V6GA 2VDLB 3H2GA 4YMHA 4K9SA 4MP3A 4JLOA 3V7WA 5I7FA 1WQ1R 4BN4A 4KE8A 5JS6A 1GL7A 1U9YA 4O2AB 3ICPA 3V8QA 1NFQA 1TVCA 1GJRA 5E0KB 1U8UA 2ZSHA 4AKTA 1WEKA 3T5TA 2AG0A 1DV2A 5CDSA 4QUDA 4ZIRB 1M34B 1R00A 3BXHA 4JEIA 1NFFA 5CFMA 3KUXA 3TQCA 1GM5A 1NP3A 3M6UA 3NYQA 1NN1A 3C15C 4ND4A 2ZW9A 3IQIX 2NACA 2ZYIA 3UB4A 4GVXA 3BFXA 5AW3A 3MWDB 1KEEA 2ETVA 2V97A 2NU7A 4URWR 2Y92A 4GX2A 1H2RS 2BTQA 4OXYA 3ZDEA 4E09A 1BAPA 2CD9A 2OORC 3H3XA 4JBLA 2WLTA 3Q6MA 1K6MA 1DJQA 2CF5A 2DUNA 3HY6A 1NBHA 3L6BA 3RNLA 1K8YB 5EE3A 4C1NA 2LCFA 1CUGA 1OJ7A 1UBGA 4OQDA 4MJ7A 4P22A 1ZMTA 3VU0A 4KFUA 1L9KA 1GPH1 4AURA 1LX6A 5IN4A 3I2KA 3K0SA 1IXYA 3FY4A 2EFEB 2B8EA 1FDVA 1E18A 4G67A 4U63A 2D54A 1NUQA 1ZNWA 3PWTA 5TEWA 1II9A 2LGJA 2X3FA 3TRFA 2J6BA 3LIIA 3N2KA 2JAOA 3UB3A 1EG2A 5HJ2A 4MKXA 4EVSA 2HWWA 4XGIA 4AJ1A 3WB2A 2HD4A 3DA8A 3HUEA 3AM1A 4Q7KA 1OVMA 1SD1A 3PDCA 1U7XA 2LTAA 1XRQA 4L4ZA 5I7HA 2JIMA 3EEIA 2W37A 1YMQA 3AKCA 2MYPA 1GUZA 1SG6A 3PJDA 4JUAA 4C3OB 2G5CA 3AUAA 2IITA 1GGFA 4IDCA 2Z83A 2P3QA 5T5QA 4RTNA 1Y6FA 4UJ3A 4CMHA 1EP3B 1I94B 1FP2A 2B83A 2Q3MA 3PNPA 1CS0B 3M1AA 2FDXA 3C4JA 2NM0A 2J48A 5LUBA 4F3TA 3GUYA 4B7ZA 4J91A 1EX7A 3ESDA 3LX6A 4AP5A 3UPUA 4L2IB 1BXZA 4P1ZA 3ZOKA 4UVHA 3AONB 1RTKA 2KSQA 2NUTB 5C2JB 5I4KA 2DKOA 1W44A 2DFDA 2FSSA 3QKSA 1QPZA 2EWMA 5KKAA 2R6R1 1FRQA 5SICE 1QRAA 3A04A 4ALIA 4MIOA 1AQJA 3LKDA 2REBA 5BWCA 3OM9A 4LGVA 4EENA 2O6LA 4WFQA 2H4JA 2G8NA 2QYOA 1QLHA 2GGSA 3DVLA 3OX4A 3P2MA 3GJYA 3HZOA 2C7PA 1LK7A 3RS0A 3BJMA 1B2LA 1UWLA 1ZSNA 2JGFA 2MSEB 1NNSA 1U0OC 2OMEA 3I0NA 3N5CA 4MDHA 4OHOA 1M34A 4TT3D 4CR6A 1P2TA 3MG9A 4RELA 4CW7A 4D46A 1GA1A 1DFIA 2Q2VA 3DBOB 4EHJA 1LBTA 2IYLD 1M6HA 1VSVA 1ZGBA 3EXG1 4H27A 1Z75A 1UBCA 5JMOA 3ENWA 2AOVA 3A1SA 1TOAA 2ID9A 3LL7A 1LQTA 1QYCA 1PN3A 1SQ0A 2Q3BA 3EYAA 3O75A 3K1AA 3I72A 3ST7A 5JO9A 3U3DA 4IXDA 2A30A 4UEQA 2REOA 4M86A 5K0SA 4M9RA 3JYOA 3ZWAA 3H5LA 2JVIA 4DA6A 3OLVA 1W36D 3I2YX 2W5UA 2HGZA 2ZBFA 2WMOB 3Q5GA 2DFVA 2FPWA 1XZMA 2VDRB 3MJTA 1KBZA 1V8DA 4K03A 1GCUA 4MEJA 2PZFA 1N0HA 4TS9A 4YAUA 1DKLA 2A9RA 1TJ4A 2EEPA 3QLUA 4JJAA 4RXTA 5JCJA 3R5KA 3RSSA 1I1HA 2LKDA 3ET4A 4X00A 3T3IA 1V5GA 3IDQA 3CRNA 1WJGA 4CTKA 2XYHA 1FC0A 4QHSA 1Y5NA 1FUIA 4NV3A 4ARIA 5CM9C 3UHOA 4YBRA 4OB8A 2DEUA 3A28A 3K94A 1C14A 1KYIA 4D3FA 1WF6A 2ZK7A 3U61B 3ZE8A 1H4VB 1Q15A 2BFCA 4WCFA 2FPKA 3GQVA 2SKDA 3ONVA 3GP8A 5DW3A 5HRAA 4YRFA 4UU0A 1F0YA 1E4EA 3QGMA 4QU0A 2H17A 5EKUA 5GQSA 4LXHA 4I5IA 5TARA 1YC2A 1WUIS 3HLYA 3PS9A 4OJYA 4I1SA 3HMKA 3AKZA 3IKVA 5CIQA 5KYYA 4P36A 4U9HS 3UANA 1HXHA 3U31A 5D8DA 2E3JA 5I3CA 1Y4AE 3E9RA 3QFFA 1R6VA 1D2GA 1X9GA 2AG8A 4L0DA 3ICVA 4QUAA 3I45A 1N32B 1IN4A 2P1ZA 2VAVA 1VSBA 2AFHE 3LTEA 4NICA 2ORIA 2QT1A 2IKSA 3GI1A 5EN4A 1FYFA 4U00A 4D9BA 4ZVMA 3GRVA 1XA4A 1Y7HA 1NUSA 4JLDA 4O4JF 1UP7A 3D0QA 5BSVA 4DPLA 1MJNA 1ZCZA 1AF7A 2YWJA 3K8ZA 2ZRHA 1Q17A 1VP3A 2NUAA 2V0GA 1YZFA 4EBBA 3OEWA 1YQXA 4Z9BA 3HVUA 1L4UA 4WL0A 5KYWB 1P6UA 2FSUA 4DA7A 3LY9A 1V5EA 2Y77A 4ZO7A 5CRIA 4DSZA 4G5FA 1Z83A 4G63A 4OP3A 4W8HA 5L6MB 4U3JB 3B1JA 1VYVA 3KJXA 2HWXA 2PZGA 3C1AA 16PKA 1DWOA 1Y8AA 4O4LA 4ROTA 4Y7CA 4ZQBA 4DCGA 4QLBA 5T4BA 2JGRA 5BSMA 1G20A 4IIEA 1REQB 4JDUA 4BFXA 3Q7PA 4EVRA 2IGTA 2ZVDA 5DN9A 2PX4A 2NT3A 2Q4EA 3L7MA 3P2OA 1BU5A 1G8MA 4G65A 5E2AA 3TQQA 2NO0A 1XQ6A 2WWRA 5BNFA 1JI3A 1R0WA 3KTOA 4B35A 3ILXA 1M1XB 3M70A 4CWAA 4OGKA 1N6IA 1Q3HA 4HGNA 2AN5A 3KAJA 1COWA 5KNCA 4DB4A 3KQWA 1N6PA 1U3UA 1ZONA 3A7DA 5TQJA 3SD7A 2F62A 5C5CA 5FX2A 4H7HA 5AXBA 1U0BB 1O4WA 4ITVA 1N2EA 1NBEA 4MGHA 2Z4SA 3PT9A 4UHKA 4YCSA 2MINA 1NR1A 3LBAA 4DFDA 5KYTA 3MGKA 3ICOA 1Z4OA 3T3PB 4EF6A 4KN8A 5IVPA 4OHMA 5F3DA 2H6EA 3P4YA 4BNYA 3PGA1 3ET5A 1HDRA 5AW1A 3IGFA 3NXKA 3WJ2A 3G6WA 2H9AA 2Q1SA 3KVNA 2JEZA 3R3JA 5FWYB 3WLFA 4DZTA 4YRAA 4YY3B 4JL8A 1YDFA 4M8IA 1LDBA 2XMBA 1WY7A 2ZVQX 1JS1X 4XASA 1JLMA 2ZT5A 2HJVA 3ZWWA 1IHXA 5IAOA 2HUPA 3EWIA 3SR3A 2P2GA 3E3AA 4F4FA 2R00A 4AMZA 2VI5A 3E9EA 1ZBQA 1YZGA 4EG3A 5K2MA 1DEAA 2C3UA 2R7NA 1Z6AA 1N6LA 3SVZA 4BNFA 2HXSA 5ADWA 4PNEA 1JA9A 1OFIA 3L06A 1Q95A 1PEDA 5HS4A 5K6TA 3WGLA 2IS1A 5I7OA 1YBVA 1Y6JA 2PUTA 4MRNA 1GPMA 4Z2AA 5EKTA 1SIOA 3Q41A 3U1TA 4M1SA 2I4RA 3NWJA 4D5EA 1CUVA 1C3OA 1H23A 3P0FA 2J4DA 4D44A 1FX1A 4F9TA 4MI6A 1T24A 1ZM2A 1UKZA 1MIOB 3LCUA 4L72A 2JKZA 3Q6IA 3T1HB 4H6WA 3SYLA 2WILA 1E7SA 2VQDA 4WD3A 5A4DA 4GICA 3AL0C 2UVPA 3I05A 1HDCA 3LPCA 1XCOA 2BI4A 4RAOA 4YHBA 2GZ1A 1UFOA 5IDVA 4H4DA 1WAMA 3EDRA 2JW5A 1UIRA 1JI0A 2V7VA 3IOBA 3LY7A 4LMBA 2XAUA 1YR2A 4P0TA 5B2FA 3NDBB 4G8BA 4PW0A 2PT6A 3OHMA 4BRUA 2V5UA 2DQYA 2VSYA 1KVTA 1XMOB 2OBLA 5IG2A 3CNEA 1BA2A 5JSKA 1JFSA 1F7UA 4BNTA 1YZQA 5KWVA 3BDVA 2CGEA 1OW3B 4H9GA 2XGMA 1S8OA 2ACEA 1VBNA 2NQTA 2QRNA 4QUGA 4EI9A 4G0MA 4JROA 1UFRA 2YXLA 1K6JA 1L3CA 3RYIB 4HQ0A 2IEYA 2Q9UA 4MZXA 5DI3B 3WA6A 3FD8A 1WDMA 4NJEA 4C04A 1R0YA 3MT9A 3EGXB 3O8QB 2DPLA 2GZHA 2X42A 1RW4A 4FE7A 4RVUA 4YYZA 3DO8A 1WOYA 4DM3A 3O1JC 4DR4B 3BMOB 2V7TA 3GJ4A 4QASA 2CV1A 2ODQA 3WHPA 4D4KA 2QPOA 2B4RO 2TRSB 2JJ1A 4TQAA 4GPD1 1LDYA 1SBCA 3DT6A 1U3CA 1NZJA 2YC2C 2ZCJA 4KREA 4X90A 5AICA 4CYMA 1CP3A 3OI7A 3T7JA 2J5XA 3QV2A 4WNAA 1HC7A 2WVGA 2R48A 2ZE8A 4KQ6A 3R0JA 4DDMA 3HSYA 2R6HA 4O1HA 1KNXA 4HN2A 3HUUA 5FA8A 5BT9A 3LT4A 4QUKA 3ROXA 4D0RA 3TZEA 2C95A 4EIWA 3L7LA 3E48A 2O6HA 4LPSA 4PQGA 1DT5A 1XSEA 1Q57A 2ZRMA 3IQEA 4J2HA 2P77A 1APBA 3QSYA 2EJUA 3GCGA 4GXTA 4YUYA 1O77A 2CK3D 4RH1A 1JLLB 1WF3A 3E3LA 4MQFA 1NRWA 3ELUA 3K8QA 1R0ZA 1UKCA 5GINE 3IR7A 2X7JA 3G2MA 5KCZA 3ORFA 3ZQJA 3SLKA 5BP7A 5D3KA 1S89A 1YU6A 4MROA 5CAEA 3IV9A 1Q83A 5T57A 4LYAA 1T9DA 2IQ5A 4G8JA 4IZHA 3L4JA 2JHFA 3WYEA 5G3YA 4LIPD 2JGLA 3LAWA 4NCNA 1C9JA 4JA2A 3DT8A 4FILA 4LPKA 3Q3EA 4Y6GB 5CNIA 2TSYB 1DO2A 5B36A 5FUVA 5BV8A 2V8OA 3OQBA 3N2GA 1E2DA 1I9GA 1LPAB 4MS1A 1AK9A 1LLUA 5IZ4A 5LJIA 3FVTA 1K8QA 1WV1A 3L0OA 4HN4B 4DLAA 4E1VA 5M29A 1V2HE 1Z74A 2QLJA 1H6AA 4LDRA 3WHIA 3NOQA 2BEUA 1XZNA 4YRQA 1VHDA 5FBHA 2VSNA 1YF3A 5HHTA 3Q10A 4OK3A 2HW8A 1K06A 2PL1A 2FEAA 2OTCA 3K9NA 3KFLA 4JKYA 5L4NA 3DOFA 2N75A 1MRZA 3AY6A 2H4FA 1SHTX 1BS1A 2WJWA 1U2PA 4UNNA 2IH5A 2KW5A 2WIBA 5JQWA 5KYKA 2C9MA 4V0MA 5DO9A 4YQFA 4G24A 4J8PA 5CT8A 4MB2A 1B73A 2GJAA 5EE5B 3F78A 1EXDA 1FMJA 4FGLA 1Q21A 5ECGC 3UJ6A 1A27A 3BXFA 4YV0A 1TFUA 4BO7A 4NF2A 1BU8A 3P0RA 5JJIA 2D2EA 1GN9A 4TWIA 2DY1A 2FZGA 2EJWA 5D5QA 1GPJA 3BFPA 3DCIA 1CB7A 1QHHB 4HZGA 3INTA 4YONB 1T35A 1M10A 1WB4A 4WERA 3PLRA 4C0QC 4D9EA 2GEUA 1O8BA 4LG1A 1Q7CA 3ZHXA 4MUFA 5AHWA 4D8WA 5JHGB 3BSYA 2O19A 3A6KA 4F4UA 4ENSA 1VIYA 2WU3A 5HWSA 5K0GA 3SM9A 2RGUA 4BJHB 2ECFA 3MSXA 2FUKA 4WUVA 2QAGA 2Y0EA 3JQGB 5K20A 4FHGA 1WV0A 3D4OA 1GQ2A 4MHOA 1K3UB 1J7JA 4KMRA 1WDKA 1FJGB 5ALYA 4ZRNA 5DK6A 4G07A 2O2DA 2XRZA 2VUSA 4BJ5A 2BZGA 1R5OA 2ZBUA 3E18A 3IILA 3DNPA 3MRVA 2R9VA 2GVNA 1PTJA 4GOND 1OAOC 5KTPA 2DPMA 2PWPA 1ENYA 3PQ2A 4ACBA 2GJKA 3TIGA 4N6OA 5JROA 5JMWA 2BMWA 8MHTA 1WD7A 4Z9FA 4LFAB 5H80A 2OBMA 3CR7A 3CINA 4FJ1A 2PMBA 2VP4A 2GNOA 1J21A 1J24A 4TV9F 1NKVA 3RVKA 3BGWA 4LRQA 3OOEA 4DA4A 3IUMA 1V45E 3TMYA 2PL5A 1RJDA 4BNKA 5JZMA 3PJFA 2QDKA 4FZVA 3WGOA 2JVKA 4HWKA 3U4QB 4OX9Y 4U2DA 3TAXA 4KQXA 2GAIA 3MCWA 2P91A 3DT9A 1XLVA 4OU5A 4LZWA 4BLSA 1RLUA 4OQ4A 2JHAA 5I4IA 2W83A 3R23A 2QBYB 1QH1B 3KO8A 4P32A 5KPJA 4W7HA 2J07A 3GZNB 4XOIA 1GT91 5IW8A 2HYDA 2I67A 2ECPA 3K16A 3EOAI 1SCIA 3VSCA 4KRXA 3COVA 4LZOA 3TL2A 3IJPA 2ODPA 2G40A 4IQGA 4HFJA 4R0VA 1DBPA 3UN1A 4HLUA 2WT9A 4GOJA 1MA3A 1CR6A 2YR0A 4RLSA 5H4GA 1SKUA 3PB3A 4A6EA 3RTCA 3GUZA 4FE3A 5DX1A 2GBIA 3OPNA 3SXJA 3OQOA 1E3IA 5KOJB 1GXSA 4J3FA 4KR6A 1DC6A 2IU3A 5LC1A 2IQIA 3WYAA 2JVJA 3DD5A 2JAUA 3K09C 1MO2A 4WBNA 3EXHA 1L5RA 1WEHA 5A0VA 4KODA 1RKVA 1TPYA 4GLLA 1N2GA 2W4IA 2P75A 4TWZA 4WK6A 1K66A 3KZXA 4IOMA 1GSOA 3WQQA 1SNYA 2O8BA 1AOXA 3CXUA 1NONA 4PU0A 1IZ0A 3ADPA 3QXHA 1OA1A 2D1YA 4JVLA 5C34B 4E4RA 2FF7A 1ULTA 5DX0A 3QELA 2ORYA 3R4CA 3K9QO 4O02B 4BATA 2B98A 1UWVA 2J5RA 3EC1A 1U3FA 1RYDA 4GLOA 4MVJH 3V00A 3URKA 3UKDA 3QBTA 2O8FA 5LZ5A 2QW8A 4XQ9A 4UAVA 7YASA 1FTGA 1OXXK 1QLJA 3QPUA 4BBJA 4CU5A 5JBNA 3W5CA 2B82A 3KE9A 2WE8A 1GAQA 3G2HA 4LXIA 1XA0A 3HZRA 3VR5D 3DDUA 1HDXA 3AOEA 3B1YA 4F04A 2VUUA 1DKQA 5TT1A 1USVA 1ZJ6A 3GRPA 4AI6A 2Z09A 1ADYA 1SK9A 3G5LA 3R6TA 3ADOA 2EX4A 3AVOA 4X3CA 5D7NA 5E9JA 4GBJA 3Q3VA 4OEHA 3LZ6A 1OASA 2OESA 1HYHA 3A9UA 4E7OA 3WAJA 3KEMA 4WH0A 1QZ3A 3D2CA 3MFYA 5LYJA 1XFAA 3L1VA 1GUAA 1I24A 2X22A 4ISBA 4KGVA 2ZU6A 3EQ8A 3N2EA 3QEAZ 1PHPA 2QX4A 2OUIA 1E2JA 4O6VA 2RB4A 1S8AA 5G02A 4AXBA 3GFOA 3R7DA 2PGNA 1Y4ZA 3GEDA 5TMPA 2ZE7A 2WQ7A 3KR9A 4J0EA 5EESA 2OCXA 2WG2A 4Q4LA 4U7WA 5D1HA 4WCVA 3S1LA 3KVYA 4OQLA 3U3RA 2V0CA 4RWEA 1FP6A 5B55A 4C6TA 4PHCA 4TLAA 1HA3A 3ORRA 2Z4TA 3PVZA 3EDCA 1KS2A 2Y1LA 3GEEA 3HN7A 4LJ5A 4UUAA 1IK4A 1VBKA 3HEMA 1XJWA 3PGVA 4FGSA 4MEBA 2YWBA 5IXSA 1DO8A 4ZQIA 1SVWA 2HT6A 3DWEX 4I1RA 4C22A 1OKKD 1GQFA 2JBAA 4NU8X 4MPDA 3M83A 1OOEA 3OLCX 3A2KA 3PVSA 4Q93A 4TVSA 1JJIA 1WP9A 2CNKA 1J2EA 1BXKA 3PD7A 3BPSA 3C3MA 4PC7A 3AJ8A 1BXRB 4AIIA 4YAKA 1UXOA 1CDDA 1QE0A 2HC9A 3GMIA 4NY1A 1PCXA 2EFDB 5IAGA 4CRWB 1HLFA 2OECA 4EF4A 1VDZA 3A06A 4B71A 3K20A 2G9VA 1EFKA 1ZS9A 3BIJA 4J0JA 3F5DA 3B2EA 1NURA 2GJ4A 3R9XB 3W1EA 4HDRB 4S2UA 1AO3A 1X2BA 4QOIA 2P0YA 1IM8A 2Q1YA 2R86A 1NT4A 1Y33E 1VA5A 2REQB 3DOJA 1BMDA 4MR7A 5JR3A 5IAJA 4B9EA 2EKPA 3K0CC 1EEXB 5EY5B 1H2BA 4L9AA 1JKFA 4KTTE 1V5FA 3PITA 2CW5A 1BCRA 2CVPA 1ZG3A 3V8PA 4JJ7A 3C2QA 4CIBA 1V2GA 3ZE7A 8LDHA 1PR6A 1H94A 1OXUA 1WL8A 1ESCA 2JIZA 3W8FA 1MB0A 1YDHA 1FXWA 3STUA 2XECA 2HFJA 4Q48A 5EOVA 3EW9A 2P78A 2FCAA 3N86A 2JIZD 4EHHA 2FLKA 3OURA 2VLIA 3BWEA 2E7ZA 5ER9A 2A0KA 1XELA 2WAMA 1X9IA 3E81A 3VDXA 1D0SA 1ONOA 2CMHA 1R5BA 4EJSC 4PXYA 2NP6A 2CXTA 3R5HA 5K3OA 2P4SA 5GIPE 3HP7A 4RK6A 4DVGA 5F9FA 4R1LA 5DHRA 2IV2X 4RMHA 5REQA 1N8KA 3VZDA 2HCFA 3GHHA 4BPRA 1JJBA 2WNIA 5IS2A 4M98A 4M1YA 1WG8A 4UDOA 3CR3C 1BVUA 3QLVC 4EUFA 1ZW1A 2VAPA 1ZN8A 4C6TB 3P9NA 4HDOB 4JCCA 2BT4A 4AECA 1B00A 2HA2A 2WD8A 4I1IA 4M9UA 5FL3A 1UADA 4QU8A 1Z3IX 4MICA 2YY6A 1E63A 4QUBA 3K0BA 4D4GA 3F4BA 1C1DA 3X43A 2HT1A 4FBMA 5C8XA 3RUFA 1M2GA 2I3AA 4HO1X 1SVUA 3R9IA 1YVRA 4C5AA 2O8CA 1K8ZB 1YRBA 2PQ0A 3PIDA 1MO5A 3IO5A 1IPEA 1BWQA 4CM7A 4IDQA 4RTOA 4HDSB 1NC3A 1ZGJA 4PANA 3LXXA 2DKFA 3IUEA 4EI8A 5GGXA 5KSWB 2J3MA 1PWEA 3HADA 5EQDA 4ZVSA 1J1UA 1I3NA 1GCIA 1MA0A 4RVFA 1ZCJA 5JYCA 4V1CI 4U39A 1G2QA 1XGKA 1ZMOA 3AW9A 2BMDA 1GYPA 4BJ1A 5MFZA 3FHOA 5CFNA 4Q3DA 1JF8A 2YW2A 4TV8A 4UCXA 5ILGA 4RULA 4TLLB 3HP4A 1T9HA 3K71B 4Z1MA 5AO9A 3L4EA 1OUMA 5CT6A 5K0NA 3WGTA 4ZGWA 3K4QA 2Q0QA 4JGBA 3H3FA 2JD2A 2QA5A 1M75A 1D4FA 2GZAA 3S68A 3VHLB 1RADA 1NE7A 2XUPA 3QVKA 2YVQA 4S0ZA 4Q4DA 4PPFA 3LMKA 3PEUA 1M8FA 1Z4NA 2NT4A 4GT1A 2HSJA 4V0NA 1MB3A 4C0XA 4RU1A 1PFGA 2C7GA 3BMQB 3JZFA 2GPWA 2IYQA 3EG9A 4LCEA 1ISRA 1Z2NX 8ATCA 5IYZA 2GTPA 1H3EA 4HRAA 5FV4A 5AXCA 1NUAA 3WVNA 1VTKA 4OYHA 1JSCA 5EPUA 1LDGA 2G9UA 1Y1LA 4UDNA 4N48A 1AGRA 1PYDA 3KHSA 3P9QA 5H0IA 2PO5A 4B6JA 1FNCA 5KQRA 2C4VA 2E4UA 2BDUA 2CCJA 3UMVA 1U2GC 4QELA 1NLYA 3V2UA 3W5IA 4B5KA 4BV8A 1FTSA 3PQ6A 4LGCA 2B4KA 3RQIA 2FOIA 3ISVA 3DAYA 4TPKA 4RHEA 3W8RA 3OHSX 1MORA 4MMYB 3HYSA 3NKFA 4PPQA 3BT7A 2NTEA 2AHRA 4WI1A 4P0PB 4JBIA 3AB8A 4TMVA 5EWMB 1MB2A 2VNIA 4J2TA 4OYYA 5B4VA 3D2BA 3RFTA 2EBHX 2WA1A 1KGSA 1FSSA 3KJGA 4O4HA 4Y98A 5CT4A 3PC2A 4E1BA 4EHDA 3LYLA 5AFSA 1GNQA 4J90A 5B3KA 2H4WA 4PCAA 3LFHA 1BIFA 2F6RA 4BVLA 1F6DA 5I3ZA 1Z6ZA 4Q4AA 3FKJA 2BM8A 2OZPA 1HH4A 3BIOA 4BV3A 4EMTA 4ZYXA 3LP6A 1UMDB 1T4GA 4TL8A 3W8EA 3PJRA 1L4FA 1TGYA 5M2QA 4BRSA 4AO7A 3PNLA 1ULSA 2X5OA 5CFZA 5HKBA 4JOSA 4ZVRA 3SZMA 4DKJA 2HLDA 1HTTA 1TJ3A 1YAHA 3UJCA 3NHPA 1MKYA 4MUHA 2C3YA 3C6MA 3WKEA 4GKVA 4IBOA 1JEQA 1AUOA 4MMXB 2OV3A 4Z4EA 2Z0MA 5EHIA 5BUSA 5G2OA 2VDNB 2CHVA 2RGWA 4D26A 2Y4OA 1W0CA 3HHPA 4RCVA 4AVYA 2GKSA 2Z8YM 2PS0A 3AUSA 6PFKA 3PUVA 4YXFA 1NJ1A 1EZ4A 1T91A 4UM5A 2R1TB 4B8WA 1RLTA 1AQYA 5B6JA 4IKOA 1L5HA 1AKWA 3AK4A 3AT1A 3GJ5A 4Z9XA 3LCRA 2P9TA 2AEMA 4RHFA 4HN9A 2WBLC 4X1IA 3JS5A 4FJ2A 3VGPA 2QTCA 3GDWA 4G0QA 4PZPA 4UFPA 2VAWA 1A2BA 4KP7A 3OF3A 1TTHA 3BWBA 5E3HA 5HTKA 2C42A 3VNVA 4C4YA 5LIPA 2Q99A 2ZIWB 4RPGA 1GAEO 4XR4A 5EE0A 1ZOIA 3F96A 5B3JA 1ZO8A 2OXTA 3UW1A 4EHFA 1KEZA 4B8ZA 2AX4A 3GGCA 2AWOA 2HA7A 2V6IA 2WG1A 4KQ9A 4IS2A 4MR8B 4BMYA 4JHLA 2QM3A 1GPUA 2D5IA 3TDNA 5LD2C 2GJ9A 2G9ZA 3CONA 4BRZA 1MPXA 2DBVO 5DRYA 2JGKA 4IZIA 5F21A 3T9DA 2R47A 2ZE5A 1Z39A 2B8TA 2QW0X 2AC4A 4C5CA 4G5RA 2OK7A 2PGAA 4HJRA 3KZ1E 5KQGA 3SZ3A 5CFPA 1NLZA 2R6FA 3LYUA 3Q1LA 4QJBA 4Y0VA 3L6RA 4CL3A 4LXUA 1SCQA 5AM0A 1B4DA 4INJA 4E6EA 3WDSA 1ZXBA 1M2KA 4HX2A 4QXPA 2NO6A 4EG8A 5LQJA 4H3VA 1EB9A 1GZHB 4DNPA 1P7CA 2YV2A 1DAHA 2VUIB 3DE6X 3UB2A 3EHEA 1D3AA 2VP2A 2LIPA 4KW7A 5ETJA 4ZJPA 4BAZA 2GBGA 1SVKA 1FP4B 1OA0A 4YCLA 1CHNA 1X80A 2OHVA 2BPOA 5JS2A 5EHZA 1MHPA 3O93A 1CHDA 1G4HA 1CRZA 4BMDA 4WT7A 5L45A 1XJ0A 3TQHA 5KOHB 5B7NA 1LVUA 2PYIA 5EINA 4AQDA 5HCIA 2JS7A 4P86A 4X61A 3ZV4A 4DR7B 3AZOA 2G67A 5HZGA 3DHVA 4I8IA 1XE3A 4JH0A 1KI4A 1Z16A 3VYUB 1T0JB 3S8YA 4ERNA 3JZMA 3O8RA 1NTOA 4CQLB 2ZJ8A 4TWJA 5AVKA 1QGOA 2IHJA 1PQYA 3KQHA 4BLRA 1BHJA 3LUAA 3SOPA 1KJ9A 3O4VA 4B7CA 2PDAA 4LRXA 1OX4B 4UFOA 4BN0A 5I9LA 1UJ2A 1GARA 3EAGA 3FWKA 2VH2A 4ALKA 5DFAA 1U4SA 2X9QA 4NCXA 3EUWA 4JCOA 2VSFA 4MUJA 3WWDA 2X4LA 4R0MA 3AO0B 2YXDA 5A71A 2FVYA 1UOPA 2XTAA 1IM5A 2E48A 4DUGA 1BYUA 3SKVA 4INPA 3LDAA 3ZZ1A 1J8QA 4M54A 3H9QA 4HDKA 4RVGA 1G5IA 2MSWA 2IEDA 3VH1A 1QO0D 1PQPA 4AMBA 1UWCA 2RHOA 1KDTA 3B5JA 3FOCA 3I6BA 1LEHA 2ZIXA 3VH4A 4E13A 1N9GB 4DABA 2O3RA 2GVDC 5EMLA 4JB3A 2AF3C 5JNWA 1ODFA 2PRKA 4BUCA 3AEKA 2IYFA 3SS7X 2IT1A 1RWPA 2CVHA 1XVUA 4A8PA 1X7ZA 4CHGA 3BE8A 4YDHB 1KVUA 4DNFA 2XKKA 3GLIE 4IEEA 4QICA 3W2IA 4JJIA 4QQKA 3WISA 2QVCA 4WECA 5IWCA 4K6FA 3D7NA 1OD6A 4E33A 2PXHA 4QECA 1FP7A 1WD5A 5FUXA 2UXCB 1PNOA 2P6RA 1J2TA 4KVGA 1NATA 1Y7TA 2V7XA 3A58B 1G6Q1 1T5DX 1W52X 2JANA 2VDWA 3C6YA 3PG5A 5TDHA 3BREA 1FVOA 1YA4A 3N76A 1T3LA 1JVBA 1PNTA 3F73A 2APJA 5ECWA 1HNWB 4W5NA 1P4JA 3N6RA 2ZRGA 1Q22A 1C7EA 4RJ2A 1JWLA 3ZCQA 1DPFA 1P9OA 2NVBA 3K5PA 2Q0HA 4IDAA 2Z6QA 2AW3A 3ACCA 4BMXA 1YJ8A 4W4TA 1FSFA 5DLPA 4AX8A 2HRCA 2H1OA 1JQAA 5BW5A 2XCTB 4UZFA 1M73E 5IZCC 2FUEA 1YBHA 4RD3A 4MSUA 1BWPA 3KSBC 1O57A 4FS3A 2VPZA 2WF6A 2EJVA 2HDWA 1Y8ZA 5F7XA 4I6EA 3CB2A 3S2IA 3LQQA 4URZR 3NJRA 3ZS8A 3N2ZB 4BTEA 5IASA 3IT1A 3HWRA 3JALB 4B6FA 4BWYA 3TD9A 3QEOA 5ECDA 1EX1A 1WTAA 3MJVA 1NE2A 1RD4A 3OETA 1OLXA 1CDOA 1HYEA 1FS5A 1TCBA 2OGZA 4JOCA 4B46A 1XEFA 4JL6A 2Q7OE 1C0PA 1WKBA 2EGGA 1MO3A 1GRQA 2OXRA 1L1FA 3KPJA 1MD9A 4L0CA 4A26A 1CEEA 1JH9A 1HT1E 2W58A 3IDFA 4EYQA 1CZHA 1PRYA 2QTMA 1PVDA 4LX8A 4TTAA 3ONNA 3IIJA 4CKWB 2W8ZA 2GQ0A 2VHXA 4TV8F 3X44A 2HMAA 4E32A 2AYXA 4DR2B 1MAWA 5FNVF 4PNPA 2FEXA 1W47A 2BHSA 2M1ZA 3I9FA 4QAQA 1E5QA 5EJFA 3M7IA 3QXJA 3ZXIA 1CF2O 3OT5A 5FKJA 2P1DA 2EBWA 2NPOA 2O1XA 2O2EA 2P2ZA 3NEPX 4V39A 5CIYA 1TQ8A 4AAYA 3L7YA 3BD8A 4Z1MD 3HP1A 3MQ4A 3ZH9B 2V74B 4CG1A 1JFFB 1X70A 1ZGHA 4F86A 4NTZA 5CHEA 4ZTUB 4H0NA 3JQ9C 1AIPA 2QY9A 2XYRA 1XO1A 3I58A 1JWAB 2I29A 5DTMA 2D1SA 1QH1A 4EW6A 3JAWA 1Y5LA 2D3WA 1HLPA 4R7TA 3QELB 1E94E 1VLMA 3ELYA 1AV6A 3CUTA 5ARCA 1MNAA 1U0NA 4MUKA 4IHKA 5BSUA 3X1XA 2G0NA 3WK6A 4RK4A 5HJEA 3MYYA 3R8CA 2FG5A 3D7LA 3H0EA 2V6FA 2JFHA 5AJUA 3ZX5A 2PWBA 5KYVA 5K3EA 3EF0A 2Y1DA 3BXPA 5KU1A 1T13A 1S1MA 2JEYA 3UAWA 4BMPB 1WB6A 2H2FA 3NX4A 5DYYA 2YW9A 3O3OB 1CY4A 1IQPA 3OICA 2Q4TA 4HDQB 3VJLA 3BXZA 1MGOA 1SZPA 1XLUA 1FQWA 1MABB 5ADVA 2ZUEA 1EPUA 4EUKA 5I7EA 5AOAA 4NKRA 4B75A 1FQOA 4MWEA 3D6NB 4H60A 2I62A 3E3NA 5EYPB 3AL3A 4YRTA 3WWCA 3LDGA 4R6WA 4IUBS 4N03A 3USCS 1RABA 4BO2A 1RXWA 2I6TA 4UAUA 2DBQA 1W34A 2J0QA 3KTAB 3LW7A 3R77A 4D3ZA 3QQPA 4NXNB 4LWZA 4UQOA 4TQUS 5DMXA 5F2OA 4IHQA 3REOA 7REQA 4JD5A 8ABPA 1SHUX 3I62A 1BWSA 1BVHA 3IOYA 1XPUA 1IY1A 2P62A 3A6DA 4I6JA 2BKAA 2BR3A 1S2MA 4ZEMA 2JFBA 2X9NA 1YOBA 3NALA 1RKBA 2ADOA 2H63A 2OCAA 3IX7A 3O83A 1K4YA 3NW9A 3OP4A 4J0HA 3U39A 2VHVA 4PR3A 5H1YA 4XWOA 1QQ7A 2BEWA 1XL1A 4G97A 5NULA 1RIFA 2Q3EA 3C6ZA 1C9YA 4LV6A 4O8ZA 1WZ2A 3DOIA 2H5LA 3R40A 1ZD9A 3ZDXB 4WZBA 5KVSA 1USKA 2AK2A 2O3UA 2DPYA 3AHDA 1UAAA 2ZJ6A 3IHTA 2ZTUA 1AMOA 2OLEA 4MS4A 4BCBA 2DT8A 2FDRA 3DMGA 4AIRA 5EFZA 2HK6A 3I73A 4RQUA 3SKXA 4KXQA 3WBJA 2Z1MA 4CM4A 1UM9B 1XZIA 1WSWA 2X6QA 3ZNQA 4A8HA 3Q11A 5LM3A 2ZIFA 2PBZA 4LZAA 3BTSA 4LK3A 3ESZA 3T7DA 5I5GA 3J7AC 5EJ9A 3TBHA 1RHKA 2X6TA 3GDOA 4KQHA 1UL1X 1DX4A 4N5NA 3JZAA 5EHGA 3T1OA 3WQBA 1KQOA 4L78A 5KJ6A 1K5DA 1EUQA 4QRHA 5A5DA 4C5BA 3MF4A 1FDRA 2IJGX 4NAUA 3R8XA 2V4UA 3O1HB 1TTPB 1YFZA 2Q46A 1DS6A 4YALA 2F43A 5ALEA 2OA0A 1D2RA 3A1TA 2HL6A 5LN1A 2JI9A 4TKUB 1EDOA 3EPJA 3BF8A 1YS7A 2A9VA 4L07A 1R4ZA 2FRDC 4P4UA 4ZOQI 1L7RA 2P4UA 5GOTA 3U7JA 1R4NB 4JAVC 4YUWA 4WGGA 5KVCA 2DPXA 3MM4A 3CH7A 4Z3DA 1QBKC 3O2NA 1C1XA 3QW4B 2XDQA 3VUFA 4DIKA 1YZUA 4DMKA 1D1QA 2O2IA 2ZTHA 1Z22A 1SKBA 4KACA 1NIJA 2GWHA 1R5NA 1CC1S 3OOWA 1DV1A 2WY2D 2IE8A 1TUGA 3REFA 1KVSA 1XPOA 2NSYA 1EK6A 4IF6A 1E3DA 1XYYA 1JTVA 2H1RA 4TT8A 3AGQA 3HO8A 1IOWA 3ILVA 3PPWA 4D9JA 2FZWA 4PSAA 2JATA 3AY0A 3KOYA 5ES4B 3OUUA 3GRCA 3ZPXA 3W5JA 1AKNA 5JADA 1MH9A 4F6RB 2R2AA 2C8JA 3A27A 1E5XA 1TJPB 3GFGA 3LHDA 4MUEA 4OQYA 1CY2A 1NJ5A 2J45A 2RBGA 2NVWA 3FDZB 3AL2A 3VYWA 4D9IA 3QHPA 4PTYA 4C0BA 3BSSA 3KJZA 3W2EA 1UFVA 2L69A 2HH9A 2RGDA 3A6PC 3BGOS 3MEQA 4B0PA 3TVDA 2ZM6B 1RC0A 1NMQA 5CTAA 4AUKA 3RT1A 5KNLA 4NFHA 3DF7A 2BH2A 1QCCA 1AN9A 1UT6A 2JF0A 2QTZA 2FEPA 2Y3IA 2ZSFA 3BMXA 3DKIA 2R87A 1C30A 3RUPA 3ZBTA 4EK9A 4TZ6A 3FIUA 2QTVB 2YASA 5BSKA 1AQLA 1VG0B 2H48A 2QRMA 3SS8A 1QS0A 3DXXA 3PQ7A 2H7YA 3PKJA 3OJWA 1IE3A 4GX5A 1A9SA 1UAGA 2LNDA 3ANSA 5BVHA 2YOHA 3WIVA 1QU3A 4KXVA 3OY2A 1RKQA 2UYOA 4LRWA 1E32A 4UCFA 2G06A 2BFNA 2QR3A 3DZBA 2BJVA 4NXMB 4G56A 2CLDX 1KE2A 2VLBA 3MTIA 4WV3A 1DC3A 1E9CA 5F3WB 1NN3A 2QMHA 3KDPA 1HFJA 5HJ5A 4PINA 1ODLA 5HNKA 4UU1A 1YUNA 3CV3A 1UJ6A 1J1ZA 1O95A 4G25A 4P7FA 2QSYA 4XM0A 5H82A 7MHTA 3DFFA 2V1XA 3IPXA 1JHRA 2A9JA 1NJFA 3DP7A 1FTWA 4KQ1A 4RIGA 2F43B 4XVRA 3RPEA 3W34A 2B4YA 2Y1KA 4EI7A 1PL0A 3DV2A 5KNDD 3E3OA 3P9IA 3IQGX 2OWEA 5T3YA 1LC3A 5KYUB 3LK7A 2WYWA 2BGRA 5JZ9A 4QDZA 3FHTA 2ATIA 1U0JA 5LBIA 1UMCB 4KKXB 4F4JA 1I7DA 3M6IA 2XUDA 5CB4B 4F2DA 3ICCA 3L5KA 3FOZA 4KIGA 1U98A 4IVPA 1ADBA 4MKIA 4D82A 4DW8A 1IIBA 2Q2OA 2CY0A 1Y3DE 3B6JA 5JAUA 4ONEA 2QR2A 5KZMB 1FFDA 2R8OA 3AEUA 1TPZA 2JAHA 2OV1A 4TMXA 5AVOA 1R8SA 2DMRA 4QATA 1QRUA 2OLJA 3NP9A 2OHJA 4EQ6B 1RPTA 2O50A 1Q0UA 4IGAA 4FTWA 5AYVA 2G08A 2OO5A 4H3SA 2Y1WA 4MRAA 1JHZA 2CLFB 1VRWA 4LFCB 5BSHA 3WHLA 3S8EA 4D25A 3IVAA 4LBWA 4LJ7A 1ZI8A 2ORED 2IPMA 4YAJA 4PZLA 4A36A 2V7EA 4EB3A 1IBLB 3DDZX 2RAFA 2VHQA 3ZI7A 3ZHQA 1IQRA 2I7TA 4CEHA 1IZZA 2YTZA 3K73O 3PGKA 4G1MB 1JG1A 4UUPA 3V8EA 3S2ZA 4I4TB 2AZTA 4QYSA 2OD2A 3TPFA 3H6GA 3W9BA 4IMPA 4K6GA 1QIDA 3HEAA 2DPGA 4ZO8A 2QX8A 4IGKA 3WLJA 3L3BA 5EP4A 5LP6A 1TW3A 4TGLA 3WFJA 5AWFC 4ARBA 2IW1A 4O2BA 4COOA 1PJ8A 1HFWA 4BP9A 3CNQS 1E7MA 2AI1A 2BF7A 1CZNA 4KZKA 4A1OA 3MT0A 3QK7A 3IBYA 4EECA 5C3MA 1PBTA 2P11A 1ZVKA 4N1AA 4ZFNA 5AKHA 1U1FA 3DWGA 3A4LA 3IAS6 4NK5A 4JBXA 2D8AA 2QE7D 5I48A 2GTHA 2GH1A 1V39A 3ECAA 5IMSA 3GD5A 2VK1A 3FSGD 5GZ3A 1ZAYA 1WOMA 2JL1A 1TKRA 2WJZB 3D3KA 3MVEA 3UJNA 1NPTO 2BRUA 2G7MC 3P71T 1AGXA 1EGAA 3M34A 3DEYX 1GCOA 1T2DA 1Z6GA 1KI9A 3LT2A 4P3XA 3GLIB 1TCCA 2QOEA 1NVKA 2W6CX 4P84A 7ADHA 4EPRA 4X7BA 2PUEA 1F4VA 2DBYA 4G0PA 4BX8A 2VKQA 5TVGA 2DFTA 4XVCA 4HAXA 3O8CA 3IUSA 2QY6A 1G1MA 1MIHA 1KSHA 3RVMA 4JI2B 4KNWA 4YJFA 1SCAA 3NM4A 1DUSA 3D8UA 3C7AA 4PCVA 2EDAA 2GA9A 2CDBA 4DXDA 3WXMA 1DJNA 1O8CA 1PL6A 4OKNA 3OTIA 5AKIA 4TUYA 2CE7A 3PXGA 5J9FA 1D2CA 1WA5A 1XVAA 1WDWB 3MTGA 2RK4A 4NDNE 4XGRA 3UJ8A 3HDJA 1E5LA 2D13A 4KIFA 3ZK8A 4EITA 2R1TA 1IXRC 3G89A 1BMFD 2R5WA 3NV7A 2Q07A 1CG6A 2BI7A 2UZ1A 3N2GB 5LXTA 2EJBA 3FZNA 4N3AA 4BNNA 4XTCS 1A1VA 4Y2RA 4K8OA 2ORVA 4Z0PA 1L5NA 1NW8A 1V0JA 4DJTA 1S8NA 3BAFA 3DEKA 4FEEA 1LF0A 4JVSB 3IBSA 4K87A 5IM4F 2ACKA 4HNTA 5G53C 4PHHA 2QD2A 4RY2A 4EA9A 4BNMA 2XXAA 2JIRA 3OC6A 3R7LA 1KOFA 4A0RA 1IN7A 3FFTA 5THQA 4ROSA 3VKFA 4UEWA 3EISA 2Z2KA 5GV7A 1SMKA 3UJPA 4EGSA 3U44A 5KSZA 4WN3A 1TIKA 2ZRIA 1IBMB 1FLVA 1NDUA 1QF7A 4IUDS 4I46A 2QUJA 5B1DA 4EY5A 1C3XA 4O4HF 4MDYA 2EZ9A 1Z6QA 2ATXA 4A73A 1ZR2A 4QVKA 4RGBA 5F7ZA 1QUFA 5KUTA 2NYVA 2P2NA 2PUWA 4FSXA 1E1CB 3CZ5A 4A03A 4CG3A 1X86B 1A8HA 5JSFA 1Q16A 4PIMA 4M89A 2ZIGA 3N28A 2WWYA 1KI2A 2J59A 3NRCA 3LHSA 3UQYS 3GVPA 1CRQA 1ULHA 1RXSA 4IEFB 3PLAE 5DYTA 4N3BA 3ADDA 4UAJA 2IOHA 2MSCB 4B6PA 4KX5A 1KNQA 2PZKA 4Y1FA 2W90A 4JXKA 2P30A 1T2FA 1XIVA 4I5FA 3O95A 3K4PA 3WL3A 1L1RA 3RW9A 2ZJZA 3TRKA 3F3KA 2HA6A 1X80B 3E5MA 5I8PA 3IERA 3L9XA 4BNIA 4OYLA 4J29A 3QTBA 3IJ5A 4I7EA 2NMVA 2HRZA 4UMDA 5DNCA 1I36A 4OQMA 2VH1A 3WGGA 1KFJB 3GU3A 4P7GA 3CLRD 4G9BA 5AHKA 3EWNA 1IEXA 4MCIA 1H66A 2EX0A 2GDZA 4FC6A 5BMVF 5IKPA 2FLWA 2I03A 2B7LA 2JFUA 3KNZA 3ICQB 2XE4A 2YH2A 4MWBA 4Y6QA 1S2DA 3CKYA 3TS1A 1KI1A 1K97A 5FF9A 1M6WA 1X94A 4R0NA 1V3VA 1ZUWA 3GPDG 4OAQA 3R0QA 4HRVA 1R6TA 2EIHA 5CT9A 3N8DA 1YFJA 3GMTA 3V4RA 4B3RB 2W2TA 3GZNA 4KQMA 2G07A 3QEMA 4PS1A 3S2SA 2HQBA 4F56A 1AHPA 4Z4QA 3O4JA 2GN8A 1VCIA 2C2BA 4U7JA 1A7AA 3QYAA 5AXAA 2X19A 1OWMA 1P0PA 4ZD6A 4WLEA 2ZYUX 3V97A 3JRNA 4BB6A 1WCXA 3WGIA 3HVKA 1H22A 4EZIA 3WAKA 3L8CA 1P2FA 4JGGA 2RG1A 3EZNA 4AG6A 2Q4DA 1J8FA 3H16A 3LXMA 2FPPB 1SAYA 3FYSA 2XF8A 5ADHA 3OT1A 3TZKA 3L7BA 4Q3CA 2ATEA 4BEBA 3V7FA 2VNKA 5LYYA 3CXRA 4X6XA 3JD4A 1SEPA 1W30A 3VAZA 1OWOA 4M0UA 3FWHA 1NBME 4QUJA 4R8MA 4UJ5A 2CZQA 1Z5PA 2D1TA 4D81A 1E0AA 1C2TA 1QHXA 5A3SA 4WNIA 1OLUB 1E0DA 3VDNB 4BKPA 2O5CA 1I13A 2QMYA 4B09A 3PNKA 2Q5JA 5L4SA 2JK0A 5DM1A 5DB4A 3K05A 3OQJA 5CB6A 3JARA 1EUDA 3M82A 4OU4A 4EB0A 3VR3A 4BXOA 3CX8A 1ESZA 2NSLA 2OZEA 5DASA 2W2OA 2GPYA 3KPVA 4MULA 1KR2A 4L6IA 1YVPA 4KQKA 3KZCA 4Q47A 1WXEA 1L7BA 3BL5A 1TQ2A 2OORA 1YJAA 2P9QA 2XD9A 4G1EB 3RIYA 1FIUA 3S70A 1F3OA 1XXHA 4RJIA 3RSFA 4FNAA 3RANA 3QUAA 1RSZA 3FM9A 4R8RA 4GX1A 4YAGA 3H2JA 5F1PA 4UREA 1GQSA 3ZWBA 1P5FA 4O4LF 2DR0A 2C2XA 2OFOA 4QRDA 3A05A 4OLHA 5CNKA 3IFSA 2A78A 1TYDE 3LP8A 4RHYA 4F21A 2MU1A 2VA8A 4MITA 1BHO1 4KO4S 5DT2A 4A0HA 4DIOA 1ODSA 5A5GA 4MARA 3SZOA 2NAFA 1RI2A 1Y1QA 1M3SA 3FHJA 5F1YA 4NARA 3LV8A 3QPWA 3FCCA 5JCOA 1ZD1A 5D5PA 3ELBA 2JFGA 1XQVA 3ILHA 3UAOA 5HA5A 2HMYB 3C4QA 3C5VA 4EYGA 1GA6A 2WKPA 3RTBA 3WGHA 3IPRA 3A2LA 5AI5A 3JAWB 5DVZA 5KJ1A 2EZ8A 4PTLA 5A0FA 5IM5A 3BFKA 3O0DA 4EA6A 3HFSA 2X8JB 4G0YA 1JPJA 3M9LA 3OF2A 1A5SB 1FVHA 1P3DA 1XTPA 3GRRA 2Q28A 4HQOA 4RSRA 5DBEX 3BM5A 4REOA 4EB6A 4KE6A 1KO4A 4CCWA 4DQXA 2VT2A 3IEVA 1JHDA 5DHPA 3WC4A 5EIBD 1F8XA 1T4BA 5IH7A 3A2MA 1QHYA 3CZCA 3PHGA 5F7OA 4BTLA 1B6SA 5F23A 2QPLA 3NOVA 4W9NC 1L5ZA 4RMJA 1R6XA 1T29A 3DZKA 4IXWA 4R9RA 4RGYA 2C0QA 2H59A 4M1ZA 3ZD8A 4EAQA 4IV5A 3EDYA 1V3TA 1HLGA 2GFHA 3D2AA 1A8IA 1XCGB 3ZCXA 4XDYA 4RAQA 3CX7A 2WQ6A 3G9ZA 2IOFK 2WIFA 1P0CA 3HPQA 4EPTA 2OV8A 4PG8A 3C3EA 3HXOA 4GR4A 4G1FA 3TTSA 2CJPA 4LHEA 4PYNA 1ML4A 4NRDA 3HCBA 4HPJB 4PZYA 1SQSA 3NQ41 1SURA 5HIKA 5KO2A 1NT2A 3NWEA 1JG2A 4YRKA 1L4LA 3MJRA 1DOHA 4NCBA 4CF7A 5BVGB 2IHUA 4ISCA 2QZSA 4BMVA 4C01A 4FKZA 2D1QA 4H17A 2PD6A 2L18A 3E15A 1BMQA 3N8GA 2HJ9A 4PICA 1CW2B 3QXSA 2R8YA 1YDWA 2Q2NA 3HBMA 3THRA 4DRXA 1YR8A 1JR3D 2ASVA 3G82C 2EG9A 3KC2A 5EUCA 2JHCA 3B5EA 3TNYA 4B2IA 1FW8A 4UTRA 2EJTA 1T8PA 3CFYA 4JB8A 1WLYA 5J5AA 2BKXA 3GRYA 4RL4A 1GTL1 3WRYA 2O2ZA 1WMAA 3G0IA 1XU4A 4UW9A 2DHQA 3TE7A 1I3CA 3G85A 4BQFA 3JD2A 5BUCA 1U65A 2BGGA 3UGJA 3L7DA 1QYXA 2PT7A 3GOQA 1QTQA 1T15A 4K26A 2AEEA 3SX4A 2AOXA 3KEOA 5KYNA 4QNRA 3DLHA 1Y9ZA 4WEQA 4V0QA 5AW9A 3S3TA 4XPZA 1E4OA 5EEGA 1JQ5A 3FPHA 3EC7A 3CHYA 2I0FA 3IDOA 4JLVA 4CEHB 1KZ1A 1LY1A 2ZYVX 2J85A 3OKFA 1I7QB 1V1JA 1PJ3A 2QHXA 3NIWA 2AMJA 2ZOSA 4UXHA 3PHBE 2G5PA 4ENTA 1C0KA 5JVDA 1I6MA 3RRFA 3HU2A 1PSDA 1YFKA 3LT0A 3CUYA 1B74A 3PEFA 1MZPA 2OM6A 2XDWA 2ODAA 1NPDA 3IHKA 3H2HA 5ELXA 2A0UA 4ARAA 1SXJB 2VRNA 2RK6A 3OZFA 2HRRA 3V6MA 2Q3LA 3D0OA 3PC7A 5CX1B 2GXUA 3B1FA 2J9FB 3EMVA 3AOGA 4RKYA 1U1DA 4IGFA 1U3TA 1DJLA 2NTJA 3OMLA 4MQ5A 1G98A 4NBVA 1T4CB 1R1DA 5KWEA 2GPBA 2LWIA 4LI3X 1U8TA 4MAFA 2NUTA 4MVJM 4FFBA 3EIQA 5DCYA 4KWTA 4LVCA 3BWYA 5AW0A 4UM9D 4FNOA 5CB4F 3F47A 4IM7A 1TM2A 2YJ5A 1I4LD 2OQVA 4B7AA 5T6BA 4M3NA 2ZJ5A 1K0UA 4HGQA 3TNFA 2GZ3A 5F78A 2QL9A 2VJQA 1C7QA 3OFJA 4ZAXA 1LTQA 2J7PA 3ETLA 1T6ZA 1P17A 5JSQA 4PSCA 5HEKA 2L2QA 2GM5A 3L7OA 5BRAA 3CKMA 3KR1A 3AM3A 1XJ5A 4Z49A 1MXHA 1BG6A 2IYSA 2R1VA 1ZNXA 3AIIA 5CXSA 4YMVA 3DM9B 1QSGA 1VHQA 4EGQA 1ESDA 3RG8A 5K0JA 1FFHA 1OREA 5CFRA 4J7XA 3PXAA 5KVVA 3OJXA 3TH5A 3BKXA 1UK9A 3AEYA 5BQOA 1CR1A 1W93A 1EDZA 1I0LA 3DMHA 3EZ6A 4M0MA 3SMVA 1WX1A 1JR2A 1C0EA 1CV2A 1DAEA 1QX3A 4JJKA 5AH0A 5FRDA 3T61A 4KPEC 3BZWA 1E8DA 2B8JA 6YASA 2IHVA 1YJ5A 2CUKA 2GT1A 3OZRA 1OF1A 4ZPJA 3PFBA 4LVUA 5ALLA 3WSVA 4F5ZA 2D74A 3DZDA 4L4SA 1VCOA 2H54A 4FQ8A 3D6VA 3RU9A 3QVTA 3E03A 5JRDS 4IO1A 1N2BA 4GBED 1JEYB 4HYQA 1J8DA 2YIJA 4IDGA 1L7EA 2H1CA 2PVSA 3BWMA 3TQFA 1RZVA 1RQRA 1ZEJA 5HUQA 4JK3A 4RQBA 1Z2OX 2OKCA 4DZZA 1I2MA 3C8MA 3DC7A 1L5HB 4Z4IA 1NXXA 4PR0A 4DIBA 1E96A 3CQ9A 1P31A 1OZFA 2AMVA 4G8DA 4B8YA 1UZMA 3K8OE 3CO0S 3CRMA 3PBKA 1H9CA 2VDKB 1TVMA 2X9VA 4YP1A 2O8BB 2HMTA 1CJKC 1X39A 4ZOLF 3EIUA 4BVGA 2NZUG 3C1TA 5JCJD 3ZU2A 1JEAA 5HDBB 2FMIA 2CVOA 2W11A 1KJZA 2WSMA