4RAOA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
197
Chain Sequence
ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSRSIPMTVDFIRLKLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 72
structure length 197
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4raoA00
5BQOA 1NONA 1G2PA 4X45A 2JI4A 4PAWA 2PRZA 4RHTA 3LPNA 3N2LA 3OZFA 3DMPA 1D6NA 3G6WA 3KB8A 4MB6A 2EHJA 4P86A 4QYIA 2E55A 4LZNA 4QRIA 1QK3A 4WN3A 1QB7A 1HGXA 1ZN7A 1O5OA 2AEEA 3DEZA 1ECJA 4QYIB 4RANA 1AO0A 4LYYA 4LZAA 4RAQA 1ZN8A 4WMLA 4Z1OA 1O57A 1QCDA 2JKZA 2H06A 2YZKA 2JKYA 3GGJA 1TC2A 4RQBA 3MBIA 4RADA 2DY0A 4RV4A 1ECGA 5ESXA 1G2QA 1G9SA 2PS1A 3H83A 2H07A 1XZNA 1R3UA 1P4AA 4M0KA 2WNSA 1ZN9A 4RHUA 1A95A 5EUCA 1GPH1 1P18A 4M0UA 2PRYA 4P84A 1NULA 4RAOA 5ESWA 1DBRA 3NAGA 5IAOA 1IBSA 1QB8A 1XTUA 3EFHA 3ACBA 4JITA 1DKUA 1MZVA 3ACCA 3LRTA 1FSGA 2HCRA 3S5JA 1UPFA 4F8EA 4M0PA 1BZYA 2VFAA 2H08A 1A96A 5BSKA 1YFZA 5KAPA 5HKLA 2JBHA 4P3KA 1ECFA 3OHPA 1W30A 4JLSA 4S2UA 4IJQA 1Z7GA 1I13A 1Y0BA 1WD5A 1QCCA 2GEBA 4RABA 4RHYA 1BD3A 5E38A 1ECCA 1V9SA 4PFQA 3OZGA 1U9YA 4LZOA 3O7MA 1ECBA 3HVUA 5HIAA 2C4KA 3DAHA 5BQPA 1QK4A 5K51A 1A97A 1HMPA 1UFRA 1P19A 3ACDA 1I5EA 1OROA 1I14A 1I0IA 1VSTA 1P17A 4P82A 4P81A 1G9TA 2P1ZA 1J7JA 2FXVA 1BD4A 1DQPA 1OREA 4RQAA 1XTTA 2XBUA 1STOA 1XTVA 3GGCA 4FYMA 4P80A 1U9ZA 4KN6A 5KAMA 4X44A 4TWBA 1A98A 4ZFNA 1CJBA 3QW4B 4LYGA 3MJDA 1VDMA 1L1QA 1QK5A 1VCHA 5BRNA 4RACA 1DQNA 1A3CA 1A4XA 1JLRA 1DKRA 1UPUA 1JLSA 1XZ8A 5JSQA 1LH0A 5IPFA 4RHXA 1TC1A 4P83A 1GRVA 3GEPA 5JV5A 2IGBA 1OPRA 1L1RA 1PZMA 3M3HA 4OHCA 1I0LA
chains in the Genus database with same CATH superfamily
1U8CB 3C5VA 3EVNA 1MB2A 3EZLA 4GE0A 1O94D 1U11A 1ZWKA 4QVKA 4D6YA 1EGVB 3OZCA 4JUFA 5KPDA 2X9LA 1BO6A 3IDQA 3KKZA 4X8MA 1C1HA 2NYAA 2W11A 5TQ2A 4ZKDA 5LU8A 3BFPA 4AF7A 2DFLA 2JGRA 2O07A 4RSHA 5DP2A 1EFRD 2QAIA 4DDUA 4WDRA 3QVSA 3WL8A 4D4HA 4QBFA 4HNUA 4Z1OA 2WYVA 4S12A 3K4HA 4K40A 3IUNA 4LYDA 4Z9BA 5A0FA 1TEVA 3D0QA 1Y7LA 4GM4A 1SVIA 1TC2A 2F8SA 2NUPA 3ONDA 5DYIA 1NBMD 1QIFA 2J32A 5LXTA 1XJQA 2VWQA 1CYDA 5DWVA 5D2CA 3V9AA 4FSDA 5AW1A 1OWNA 4FFWA 3ESQA 4FFNA 1ZHOA 2GCNA 5EP3A 1SVSA 3HJHA 2JI7A 3BGWA 3OCYA 1A9PA 4UUMA 1B43A 5H4GA 3T5TA 5IWAB 2IH2A 5EWMB 1GO2A 4P84A 4JEMA 5H3LA 4N5DA 3D2LA 1NOJA 1QB8A 1AH2A 1KKMA 2DU8A 1NN0A 3BGSA 3GLGB 4C2UA 1HZZC 5AW8A 1QGED 1B2RA 3VYUB 3BWVA 5BT9A 3ZS8A 1PGOA 2VH5R 1P9NA 1QO9A 1N8SA 3LKDA 3W77A 1I7NA 3IA2A 5LB4A 4F21A 1O96B 5BW5A 1IK4A 1IHDA 3I34X 4ZVMA 4E21A 2JZNA 4OLHA 1P2DA 1UINA 1GZ4A 2C4TA 2QRKA 1IUNA 3A2MA 5BYAA 2AXPA 4NQZA 3MCTA 4PC7A 2WWGA 4KR0A 3VDQA 1AZTA 3E22A 1LFAA 2NTNA 3G9ZA 3Q72A 3H2GA 3KXKA 1P2SA 2ES4A 3GROA 3SQXA 1PVVA 4M1QA 4PYMA 3O1JC 3RLFA 5CHYA 2PAAA 3FZEA 1SZDA 4DLWA 1YGPA 1VL2A 2NTYC 2X23A 2OM6A 3K0CC 2SICE 3QIAA 4EF6A 3VR5A 2ZT6A 1VJ5A 3QXHA 2IZ7A 1SVUA 4RMGA 5AUQA 2PZAA 2QG6A 3WDLA 2QTFA 3QEMA 1TKCA 2N3ZA 3AKEA 3B12A 4NBRA 1UK6A 4OHWA 2O8DB 2Z04A 1GWNA 1PKEA 1ZJ6A 3QE9Y 4BFZA 1LSJA 5KMGB 2C3YA 1WMAA 4LXQA 1OF1A 3AVXA 4Y2VA 3TGWA 3IC5A 1BXRA 3WYCA 1G5FA 3FHTA 3ZV6A 7MHTA 2PGAA 4NJMA 1RT9A 1EUCB 3L6OO 3DDUA 3GGCA 4OMUA 1WXIA 3H7IA 3I8XA 4QPPA 5F3DA 1MT0A 3K70D 3H19A 4WFQA 2GA8A 1A98A 2A4MA 2XBMA 2O2DA 5FA8A 1E66A 1NLUA 1YQ9A 1KO4A 2EFYA 1R10A 3CH4B 2IELA 4OHVA 5F73A 1FUYB 5HE9A 3RCBA 5HMMA 5KVQA 1MAVA 1G3MA 2PPVA 1MQSA 5CTJA 4YAJA 2SKCA 1Z39A 3RU7A 1ZM3A 2XQVA 2WF9A 3A1EA 3GLRA 3D9QX 3IO5A 4W5JA 2I03A 2HSEA 1Y34E 3M82A 5F12A 4NV1A 2WABA 3IERA 1I7SB 4HWGA 2IY7A 1JQJC 4BWGA 2ZRHA 1B0ZA 1C8VB 1SXIA 1DBSA 4IGFA 1RBQA 1T36A 3VR4A 1OPRA 1P9RA 2C0QA 4JT2A 3BF8A 4K1LA 5E8RA 5GGXA 4AF6A 1YB2A 3G2NA 3HXOA 1Y3CE 3GZ4A 1TU4A 4ZA2A 2JFPA 2NM0A 4DA6A 2EKLA 4MUBA 2MMCA 4KO4S 4PU0A 4LJ7A 3OPMA 3RYIA 1EVQA 1OGJA 4Q3CA 2EARA 3WV5A 1BA3A 4HNAA 1TMOA 3UOGA 6ABPA 1M83A 3D6HA 1KDPA 2APJA 5CB4A 1C8KA 1ISSA 4PO1A 3ZLJA 1J5EB 1ZUD1 2VF4X 4PEVA 1P2VA 2XCUA 5E2AA 1PUIA 1DAIA 2ZROA 4ZD6A 2C2MA 5T4HA 2YXEA 1SRQA 3QLEA 5DNUA 3GQVA 3Q6NA 1NLMA 1Q0TA 9ATCA 4HBGA 4IVRA 3TN7A 3L8CA 1R6AA 1H2BA 4Z8XA 2NAFA 1TM2A 4IDAA 2CDAA 1BS1A 2V7XA 2I1WA 5JXWA 2FPIB 1FJHA 5FFNA 2F00A 4Y0AA 1U6KA 4I5IA 1ECPA 2BI7A 4FUQA 3K32A 1SIBE 3PFWO 5SZKB 1H5NA 3KZXA 1E4OA 1TIPA 1GQRA 4GI1A 5F78A 4J0EA 2DC1A 1DEOA 4R1QA 5EUBA 4MJ3A 4L22A 1GTRA 2AN3A 3TLGB 1G5HA 4E5PA 1KJZA 4CEIB 1XDBA 2J09A 3G2KA 4ED9A 2QRLA 2HRZA 2O6LA 2WWVD 2Y67A 4QUGA 5GONF 3LHFA 5K05A 5KNDD 3H3XA 4KAJA 1PR1A 1XRRA 4CCSA 4QTXA 1EVLA 2B8EA 5C3UA 2F64A 4WBNB 1EFKA 5JEDA 1Y63A 3EC1A 1MGOA 4PR3A 2P6NA 3KM0A 4YV1A 5I6DA 3KZVA 4L7QA 1P1IA 4Q19A 5CJ2A 5JROA 3GQBB 3PEWA 2C61A 5EN4A 2QQGA 4OYHA 4QXRA 2W43A 1QCCA 5AKZA 1G9XA 1RIFA 2EGHA 1OQAA 2WVGA 3R0QA 5JSHA 3ZN2A 1TK2A 1M0WA 2V7VA 2GPBA 4BPRA 3N2IA 1Z4IA 3B9RA 3O7MA 2VNKA 1BX3A 3TX6A 3WJ7A 5J2TB 5EP2A 1JLMA 2WIJA 3S55A 3MERA 3IIJA 3UJ9A 3R8FA 5DWDA 4I50A 4NFHA 3AEQB 4P92A 1PJBA 3DYIA 5HFJA 4ESEA 3BAFA 1UP4A 4X62B 2A9RA 2QPLA 4G1FA 1F0NA 1UBRS 3ENZA 1T9AA 1NN1A 4J1SA 1J7JA 3IMCA 3NHPA 3MRTA 2BMVA 4V0ME 4FE4A 4CIXA 1G20B 5BSEA 1WVGA 3R5KA 5C2JB 2PUBA 4UXJA 3G85A 2QW0X 3MT8A 1N7JA 4YVFA 5JS8A 4PAMA 4LYGA 5DSTA 2AR9A 4JLUA 1D09A 4Q3BA 3K53A 2DSTA 5C80A 1V45E 3A58B 3U13A 3VR2D 7REQA 5CVVA 4YV7A 3BFXA 4I66A 2NXNA 3HO6A 1EXDA 2JIZA 4JJ7A 2BGJA 3U7QA 4A5SA 4YT2A 2ZXUA 4IDQA 3RE1A 3CR8A 4CGZA 3FF1A 2VG8A 4C4YA 1YJ5A 3L4KA 2EJTA 1FFEA 1AS2A 2RHTA 3GBVA 4PBSA 1FPQA 4ND8B 4D0NA 3PFNA 3WQRA 1VFNA 1DWUA 3DTVB 4X1YB 4ZRNA 4GR9A 2YC2C 4PNPA 1UL1X 1G17A 1XQ9A 2WAMA 1KY5A 2M6RA 3GP8A 2C07A 2PS9A 1P1CA 1W8IA 4HGZA 3TQOA 4LMPA 4MB6A 3PKIA 1ZMBA 4YP9A 3TZEA 1U7PA 2R4QA 4IOKA 3MFYA 3TCKA 3D1JA 4LZNA 4P2GA 3VHXB 4JNCA 3PNLA 4OOFA 4MAFA 3RI3A 2E2WA 2GVZC 2OGUA 3OP4A 1K75A 2VLBA 3AESA 3BAZA 3PR3A 5FPHA 4A0SA 1ECJA 1V5FA 3EGCA 3FPSA 5C5DA 3QBJA 2FJPA 3ES9A 4IHQA 1Q3TA 4C5AA 3O8NA 1PHRA 3BCHA 3B1FA 3RAFC 3DAGA 1Z07A 3LQ1A 8GPBA 3EB9A 3VKWA 5IF3A 4ZEWA 5LA6F 2R8PA 2IYWA 3LZCA 3HR7A 3REFA 5HM6A 1RLOA 4EATA 1RP1A 4ETWA 4F4FA 1P7CA 3BX1A 4C0KA 4KMSA 5A4AA 5AP9A 4PZZA 5EXXA 4UEOA 4QDOA 2FG6C 4RTNA 2OPHA 3N2GA 4M0KA 4OM8A 2IJGX 4U7TB 2NOAA 5FBHA 3LYAA 4UEJA 1B3RA 2DUUA 5IVDA 4GBGA 4KH0A 4R1SA 4LZLA 5CNJA 2FEMA 2C77A 2B1IA 2J0UA 3ZX4A 4XLLA 3O4HA 4XCXA 2NGRA 2Q49A 1CDZA 1DKUA 3O21A 1ISGA 4DUGA 2XRZA 4C21A 4AG6A 3KJQA 4HUTA 4ZJPA 5FUWA 2DUJA 1I4DD 5L4NA 5JNSA 4H59A 1U8ZA 4B73A 3GRAA 2E4YA 1DIHA 3JYHA 1NJGA 3WNBA 1DXHA 4WA8A 1AK9A 1UZNA 4RF5A 1LWNA 1PG2A 2Q1YA 1LPSA 1PLKA 4OXQA 5J2TF 4C0QC 5JT1A 2P68A 1G6KA 2OYCA 4MVJP 3HEMA 3RIMA 3S2EA 1HL7A 3DFKA 1WU7A 3GRZA 3FFXA 3OFND 4R7TA 1KWKA 1TPYA 1L5ZA 2PQMA 3SGLA 2D1YA 4Y67A 2ZU0C 3R3VA 4LWZA 4OPMA 5FI0B 3OT4A 3O38A 4CCAA 1RBZA 3D4LA 1YB1A 1W76A 1ZESA 3AFGA 3JZMA 3UFBA 1OB5A 1ESMA 4OLAA 2VDWB 3G89A 4W9RA 4IIEA 1QNLA 1EMDA 4KFTA 4FCWA 5CK4A 3O8CA 1IMJA 1NNEA 2AEFA 2Z9BA 3QU7A 3B48A 4PXAA 3TBHA 1IWOA 3W2GA 1E7RA 4PSAA 3DXZA 4HXFB 2VOJA 4NDAA 4P82A 3RSQA 4HNGA 2HRDA 4RXTA 1N2SA 4NULA 1KZ6A 2W6IA 3FWZA 2PGNA 2QXTA 3NBZC 2GCOB 1KORA 2NSYA 2YBDA 3OIVA 5I8PA 1UR5A 1J2RA 1RDFA 3IIMA 3OO0A 3BBLA 4QHTA 4RY8A 2AF3C 2GK3A 4O2AA 2XDQB 5EUQB 5FULA 2NUBA 1WS6A 1JNYA 1Y6JA 2DHEA 1L4NA 1JV2B 3PA8A 1AU9A 2PK3A 4GPEA 5KQPA 2Z6QA 3COVA 3I64A 5E4JA 2PLFA 4DIOA 1KH2A 4JZKA 4EA7A 1KYQA 1NVVQ 2QR2A 3GLQA 3BGOS 3GT7A 5KSOA 3I76A 1K4YA 5FXMA 3RUCA 3UT5A 2BEVB 4OQLA 4D4MA 1IM2A 1DCFA 2XQIA 3T7TA 2P30A 4YRBA 1EVEA 4LK3A 4NG4A 3GLFE 2NZJA 3AHCA 1EWQA 2F1OA 4ZIRA 3H5VA 5DM2A 1FTGA 3JQ8A 3GYBA 3E03A 4FFOA 4QLAA 3DZ8A 4L4YA 2Z30A 2DT8A 1RJGA 2X14A 3HP7A 4HUQA 2VZ0A 1V7CA 3IPRA 4H17A 1YRQA 4CEJB 4NP6A 3O2JA 3X2SA 1WW3A 1P7PA 3SHOA 1KKUA 4C22A 2DP4E 1JEQB 1S3IA 3GEDA 1QVWA 4HAUA 4EHKA 5FWDA 2AQ8A 1J9ZA 1NM5C 2Y92A 3AHGA 1KYZA 1BKSB 2VNHA 4J29A 5IKPA 2UVQA 2Q5HA 3I4LA 1DGQA 2FU5C 2JCVA 2V8OA 5I7AA 3Q9SA 2VSOA 4NH4A 2HO4A 1GA1A 2PBLA 4JI8B 4KV9A 3V00A 3LOQA 4BATA 5IH7A 1WZEA 3LYUA 4C7MA 3CISA 2FPOA 3WTCA 2QA5A 2OQRA 3P45A 4H0FA 2L19A 3W3AD 1QCZA 4GDMA 3D43A 5DN6D 1PSDA 4CLEA 5BPHA 5DISB 2O7NA 3JQFA 1X2EA 2DFPA 1U28C 2H48A 2WK1A 1ZZEA 4V0SA 4ZC8A 5JNRA 1NJ8A 3N6RA 5KOJA 4M76B 3UMMA 2E5LB 1CVRA 3I2GA 1T4BA 2BTQB 5IW8A 1U7XA 3PUJA 3LDUA 4JC0A 3ET5A 2WM9B 4MQLA 4F5ZA 5U9CA 5F98A 2PXCA 2WSSA 3HCEA 4AKHA 2WJAA 1HH4A 4AULA 2ATIA 1JLLA 3DGEC 3CW8X 2JHPA 3DWFA 3ORQA 1P31A 1WXGA 2QYSA 1JZSA 2DFVA 2QRUA 3FPEA 4HOYA 1ULSA 5GV7A 1Q95A 5CEJA 4RGQA 3UPDA 3NWEA 2V1UA 4MGEA 3KQKA 2PN1A 1UT8A 1V6SA 3HKDB 1SXPA 4C3UA 4XYEA 1YIAA 4IFIA 1U8AA 3QBVA 2RBGA 4ZANA 2O23A 5TF4A 3KPYA 4RABA 2ZRNA 1R8QA 3H8WA 2FWBA 2I3BA 3ITKA 4RKFA 1T4DA 1VG8A 3RO7A 5JASA 2CLHB 4MHOA 4RM2A 3HA7A 1KQ3A 2XCIA 4KGDA 1X38A 4QTYA 1NTRA 2RGXA 1L7BA 5E6SA 1SUAA 2FUKA 3V8MA 2WWRA 4G5OA 2H2FA 4WZBB 5CYOA 4FKBA 2AN1A 4W82A 1FFDA 4X92A 1ZMRA 3TD9A 3P7MA 4IJVA 3U80A 3AERA 4AT1A 1CZKA 4O3FA 4CEHA 4H2DA 1TVMA 3WNCA 3MJFA 3X1XA 4NONA 2FAXA 3G0BA 4K9OA 2UVDA 4BO9A 5K45A 4B3FX 1PZFA 4DCGA 2B34A 1B4DA 5BNFA 3KQLA 1E5DA 3GAAA 2GS9A 4AO8A 2WIDA 3HYNA 4YJFA 4DRXB 4ARSA 2WJYA 3D02A 4EPVA 2WHQA 2A1IA 1FVHA 3IOMA 1NBAA 3BQNB 4KDEA 3DHVA 5TY0A 4EBBA 1RJ9B 1T8UA 2XCTB 4R69A 1XRMA 2ODBA 2W22A 1I3NA 1L4UA 4TX1A 2BW0A 1QYRA 1V96A 5HK8A 4J6EA 2YNMD 1NXTA 3DB1A 4R3WA 3N6XA 1EH5A 1KDOA 1T0HB 4WXPA 3K5WA 1QZXA 2IPMA 4WVLA 1EDOA 1MJHA 2R44A 2IS4A 2WJVA 1QBKC 2H16A 3L0BA 1XF1A 1CP3A 3KYCA 2Q27A 4K87A 1K7EB 2Q2OA 3EPRA 4R84A 5BUQA 2WLTA 4GYKA 4JBIA 1ZISA 4DLZA 3QYFA 1P74A 1ZY2A 3WFIA 1A8IA 1G55A 1ZNQO 1RNLA 2B3DA 2Q9AA 1ZVQA 2B3TA 3WNVA 5BXQC 5LDHA 2JCSA 1WSDA 4A1FA 1I4WA 3BWXA 2C96A 2DHCA 3P4YA 3UC5A 2E37A 3JQAA 3LLSA 3RVSA 3ZBPA 3FVVA 4ITVA 4MQ4A 3D59A 4MW5A 1T9BA 3WGHA 2IV2X 3WA7A 3GLHA 3FOEC 1NW6A 1VMKA 3AIKA 1UJ2A 3KVYA 1DBWA 2IOQA 2Z5FA 3UB2A 3C8UA 5BNTA 2NZ8A 2QTGA 3AM1A 2R2AA 3FG9A 1RM4A 1SBIA 1VSQA 2ADFA 1FRNA 3AO0B 4QX6A 5DE3A 1FW8A 4F4UA 5A71A 4KFUA 3EDQA 4F6LA 3GYGA 1PJSA 4GKVA 3BF7A 3LCJA 1HETA 4OP2A 4D5GA 3WRWA 1ZJYA 1WSAA 2QROA 4OXNA 3KUUA 4R3NA 3VISA 3ZCVA 3IOBA 5A5VA 4O63O 3D8TA 3HMQA 4DYDA 3RF7A 4JI5B 4UHKA 3C5EA 4E94A 3PHLA 2VN8A 2JDID 3PWKA 4XWGA 4JENA 2G07A 4ENQA 1LTQA 1V7QA 2ZYHA 3OZ7A 5CFQA 3ZK9A 1SOUA 4OD0A 2Q4EA 1GARA 4F4CA 3DHEA 4US0R 3KELA 1USWA 2C3PA 2JGIA 4FYIA 4PRYA 1KI3A 1ZA2A 4JGBA 4MUIA 4BNHA 2CHUA 4D02A 5KKCA 4B6OA 4BGIA 1ZD4A 3EXFB 3TFWA 1F8UA 3UUFA 1MXFA 1U0BB 3QEBZ 4L95C 1WDKA 4IXNA 4NMMA 4ZCRA 1OASA 2W4IA 2X7HA 1MB4A 2FCAA 2XUOA 4L3WA 3LW7A 1QQBA 3CUTA 4QL3A 4GP7A 1PEKE 2ZRIA 3DJYA 3Q1KA 3BD8A 1Z2EA 1NMXA 5BV0A 4DNPA 1QE5A 3KR9A 2JHAA 3KTDA 1BQEA 1CS0A 3S27A 1MB0A 3W1WA 1ODSA 3BJZA 4FE3A 2W48A 4TS3A 3RSFA 3NRJA 2C2BA 1SA0B 1RZRD 4WD3A 5HR5A 1JDTA 4HRXA 5JDIA 2QN1A 1IBMB 2CLMB 4REMA 2QE7A 2B21A 2OV1A 1JS1X 2ZT7A 2EQAA 4OATA 5LDDC 3QXSA 4HXEB 4D44A 621PA 3B5JA 4REQB 1FRQA 2ERCA 3ZZ1A 3G9QA 1EPUA 3JZDA 3E5HA 4D46A 4DIBA 2ZYSA 5LZ4A 3FI9A 3IVCA 3P2MA 1DUIA 4M8NE 2JLVA 5KOYA 3AVQA 2REQB 3QY9A 2BN4A 3OM0A 2A9FA 1QS0B 2WHPA 4PSUA 2HYIC 3Q85A 4PV7A 4MRMA 2R84A 3EMVA 4YXWD 3CLHA 2HK9A 2XAUA 3AINA 4GOOD 4WOBA 4YCMA 4GYWA 1UIRA 1PEDA 1EYZA 3VH3A 2HC9A 3IT3A 3QYPA 2ZM6B 4OHZA 1H3FA 2QL6A 4N7JA 1YR3A 3NC0C 2YQZA 2EP8A 3IQZA 4IF4A 2CEKA 4J0QA 4R1LA 4WAUA 3LPLA 1WTCA 3F2IA 3CKKA 3QMMA 5ADVA 2K2WA 4D4LA 3EFEA 5KWIA 4J0JA 1WZCA 3L0PA 1O94C 2YXBA 2NQTA 3GUZA 3SEFA 2BM1A 4JOBA 3OOHA 3V4LA 1UWKA 3G5TA 5JH7B 1L3IA 4Q9JA 4ZQGA 1WPXA 1XVVA 3C43A 3HKBA 4RK7A 1L7NA 4Q34A 4HZUB 4EX7A 4NAUA 1JSLA 3ZUPA 2FNAA 3GLIB 5KO2A 1GNSA 1HR0B 3CU5A 3ZE8A 3K5PA 5KTOA 5K3SA 2ZBQA 3KFLA 4B7XA 1X8KA 1HV8A 1ODJA 3DAOA 3LCCA 4C05A 3RSCA 2CZGA 5T4BA 3W5DA 1G291 2HJRA 1C2YA 2OVFA 4Q00A 3E8MA 5AHKA 3HRKA 1OH7A 5FUMA 2E7ZA 1M6HA 2R1VB 1DEHA 3BORA 3SFTA 3TD6A 4V1CA 1X9GA 5FWYA 1A9YA 2QUIA 2GKOA 3KC2A 5K8UA 1ISMA 3COZA 3PD1A 1G60A 3ZY3A 4D9BA 1N6IA 2CHEA 4QYSA 3WL5A 1TO1E 2AZXA 3UCEA 1VKRA 3A2NA 3ZDYB 1X0VA 4WKOA 1II9A 2HBRA 1P44A 2J5KA 1KOLA 2J08A 5DM0A 5CYGA 4QU8A 1B16A 1EFPA 4HX9A 1R0ZA 4W6ZA 3TSZA 3LP6A 4HGNA 1XQ6A 1XZNA 1E64A 3KCNA 2ZWPA 5DI3A 3TW8B 3V55A 2VLIA 4NOMA 1DLIA 2NXEA 4M4SA 4DA4A 2RGBA 4FYPA 1IBSA 3C15C 3BA6A 1I5OA 3ZV3A 2VZLA 1VPTA 2WA1A 5EJ7A 4IVNA 1JIVA 3ACCA 3SZMA 3F7TA 2DB3A 2C8VA 4BQIA 5HW0A 5HCUA 2HIAA 3BK7A 1U1GA 2A9PA 1H1TA 1H3NA 1ZHHA 4RDHA 3A6GA 1WSBA 1DTEA 3MZ0A 1RACA 4B4WA 1YI8A 4F1WA 1DAOA 3CVWA 1FP7A 2ZI9A 3I2IA 1OIWA 4Q1BA 5C8DA 4X91A 3IQFA 3OECA 4ETMA 3PDWA 2E85A 1JDJA 4MHTA 5IKEA 3CLSD 3PYXA 1QG2A 1WXFA 4M37A 3F6CA 5LLSA 4E5YA 3NFRA 4ZJYA 2V7QA 3HCDA 4OL0A 5B7PA 3GCWA 1BE6A 1UT6A 2C84A 5F3WB 1XV5A 3AK4A 2W0MA 3ZXUB 1XU4A 2REBA 3E8SA 1YS1X 2O1SA 3WLJA 4PR0A 3O03A 3K70C 5AR1A 5CFOA 4WQMA 5CP8A 3GPDG 1ESEA 5BYBA 4U2BA 1FLNA 4XEUA 2Y05A 5AW7A 1NI5A 1Z5NA 3GZTB 1GNLA 3AL3A 4PN3A 2OHGA 4WADA 5IVKA 3KD3A 2OCBA 3UAYA 5L7TA 1QLWA 3THXA 1W0CA 2P9BA 2LPMA 2QM3A 2UVPB 3NQ41 5LD2B 1BD4A 2V8BA 5T64A 4E08A 4NU6A 1WUIS 4YLEA 4IHJA 3RYHB 1J8QA 2JATA 3ETCA 7AT1A 4O8CA 2DPGA 4B2LA 5K8TA 4PM4A 4R1TA 3F6YA 1K7FB 5E1DA 3R3ZA 1NRWA 4KYVA 4I9FA 3ETDA 2WB4A 3CFYA 2W83A 4RZQA 2F59A 2NQ2C 4GSYA 4NEHB 3G9TA 1F2UA 4U9IS 5CPBA 4X8OA 3L49A 2A0WA 2H54A 2Q45A 2ZUSA 4K3VA 4KPUA 4P54A 2H1LA 4BX3A 1Y5RA 2GEDA 3T3NA 3W2TA 4I6EA 4FFMA 4PC1A 1VCMA 1E59A 2CXSA 4RSGA 1T5IA 2R66A 3H11B 2ACKA 5AH0A 3UFXA 5K0SA 5FPKA 1G1MA 1UPXA 5INTA 1KKLA 2X8LA 1GZ6A 1SK9A 3LE8A 5HUQA 2F9FA 3UICA 1DFHA 1TCCA 4NU0A 1RPZA 2AYZA 1N78A 5JMTA 2PUCA 1MPTA 2FH5B 4RJLA 1KU6A 3RT9A 1TAQA 1WUJS 3TTUA 4CMIA 4QRIA 2AWNA 4LVUA 2REOA 2BUAA 4QUHA 1L7QA 1RADA 4EJ6A 1A7JA 1CUHA 2XMRA 3C41J 3PIDA 2ZR9A 3QVMA 3L9WA 3PF9A 2BDEA 3SBEA 2J0SA 3C4JA 2PKWA 3ELDA 3SVZA 3TTYA 2D4AA 1CUDA 2QLTA 4DAEA 1NC3A 2FYTA 1SKMA 3K6JA 2FMHA 4ZQIA 4PBTA 5EYPA 3ZGXA 4AJ2A 4OL9A 1VKJA 3I4CA 4PLCA 5CT8A 4OHOA 5BVGB 2R6ZA 3BEDA 4P4TA 1TYAE 1WZIA 1Z73A 3EF0A 3R3YA 4RJKA 4UM9D 2VT7A 1ZN9A 2BFFB 2J3JA 3RVRA 4C20A 5BW8A 3W5AA 4C4ZA 4YPFA 3SQNA 1QSGA 1ZIXA 1OX4B 2FR1A 2K7ZA 2D0IA 1WMSA 2HF7A 2AI3A 1V2GA 1GEGA 4LZWA 2BFNA 4QXPA 5G3ZA 1O9BA 3ROZA 3CW2A 3NIWA 3W78A 3DEYX 4WLVA 1G4AE 5ALGA 5DIZA 3TSYA 4FYXA 3TLMA 4BRWA 2P4UA 2R97A 2E4ZA 2GD0A 5JVDB 2VC2B 4Y2JA 3VU8A 1W85B 5AFSA 2Y4NA 1C3LA 3K92A 5EXEA 1U63A 2QHXA 5KAPA 4Q4HB 2FUNB 4NYJR 1FRVA 4XYBA 5HKLA 4BQQA 3DUFA 1FMJA 2EWVA 1FU4A 3PEUA 4NAHA 3T7DA 3P9SA 4TWAA 1GRCA 3II6X 4DIDA 1ISFA 2ZWOA 4MS1A 4YP6A 1PNTA 1UM9A 4RHYA 4DSAA 3AUAA 2BM8A 3TIFA 3GVCA 4FT4A 5FTJA 1XZMA 3QLUC 3DF9A 4O4LB 3PQDA 4YASA 3NLLA 3CNLA 3ZE6A 1ORWA 1YB5A 1YNOA 3AJRA 4E3ZA 1SZCA 1OH8A 1B0PA 3Q3EA 4LKOA 1XD2A 4WASA 3EDCA 3BL5A 3MK31 3X1YA 4QWMA 1V41E 1FP6A 3W5CA 4ZQFA 5DHPA 1WBJB 1CUXA 2EATA 2FUG6 3U7FB 2M9MA 1COWD 1SU7A 2VQ3A 2WD7B 2QTZA 3A6HA 3R0XA 3R5HA 4EL0A 2BLLA 4YDRA 4WNYA 1WTAA 2VDKB 2CJFA 2A9OA 3SYTA 1ZX1A 2NP7A 2V1XA 4KZKA 3FDIA 3KKNA 3C5CA 4MYTA 4HQOA 3T7KA 3BVPA 4S35A 2J6CA 3UGQA 1GGJA 2V6GA 2PO5A 4UBNA 2F8MA 2XXBA 2BBSA 4N0MA 1E9SA 5I47A 5JCXA 2AMVA 3QW4B 4ESHA 3F78A 2GD6A 2PX3A 1U1EA 4ZI7A 4AJ1A 2FA9A 3QWHA 4UXIA 3Q15C 1VCHA 3SDZA 3IE1A 1U1CA 1GM5A 4IGKA 1M5TA 3DE2X 1X94A 4HX2A 4QUDA 3DA8A 3U40A 3HMKA 2C7RA 3E5NA 1XF9A 4AXBA 2MYUA 1U90A 4CDGA 3S2UA 4XW2A 2HBZA 2B98A 4OIMA 4QGBA 2ZWMA 4MB0A 2QRJA 2NN3C 3NBUA 1JIIA 5JYEA 1EKXA 2DWUA 3P9PA 4MVWA 5F33A 4DSOA 4EB3A 6LDHA 3S2SA 1SULA 4TUYA 3VPFA 2LKCA 2XVYA 3BXZA 3DDSA 4GS5A 1HYGA 1P45A 2WVJA 4CWAA 1JQBA 1O97D 4RE5A 3WYAA 4I8XA 3CW9A 2RH9B 3BXOA 2P2LA 5AVZA 1D3AA 2CXQA 3CZ5A 1JU3A 2AEEA 3IQXA 4TTSA 1Y4UA 1G64A 4O2BA 4D8TA 5MN4A 3TM5A 1JPUA 3VBCA 5DLEA 2FEPA 4E11A 2XVZA 3EZXA 3G9XA 5E95A 1T8YA 3LNTA 3B2EA 4DEYA 1JECA 2GSWA 2R87A 3IRVA 1N6HA 1VL6A 5ESXA 1JFTA 4KAFA 2W71A 4R5HA 1FZQA 2ZK7A 4RCVA 1BXKA 3LNCA 2CL5A 2E4VA 5JVDF 2EBFX 5EMNA 1L1FA 2BCEA 2JD0A 3EGDB 1SFRA 4F46A 2O5CA 3HBAA 1YJCA 4U2EA 5BWNA 1VM6A 3P0IA 4JITA 3V8BA 5AM3A 5AW5A 2IUYA 2UZ1B 4N6NA 1FVXA 2CNWA 1H1LB 5AVUA 4HLUA 3AFIA 4JC5A 4TVKA 2FUEA 1JJBA 1FUEA 3DZGA 3JQ9C 4UNNA 5KDDA 4IP0A 2XGSA 5DNAA 2VEOA 1LSUA 3OA0A 1UMBA 5LIRA 4O4LF 1ZM9A 3CZRA 1O58A 1H2ZA 4ZU3A 3IPAA 1X1RA 3RANA 4YYEA 1I2BA 2GAIA 1C1DA 3FSEA 1SJ9A 2JVJA 1PP4A 3DEAA 3OEHD 4KXVA 4ZOLB 5LZ5A 3KE8A 5KREA 5KYUB 3O1IC 2OC9A 2VTDA 3NM6B 4G5SA 4JYBA 1IY1A 3E7FA 4YXFA 2PUJA 1SXJE 3ZJTA 4J49A 4F12A 1W581 2DBRA 3R0JA 4OV6B 4LY6A 1KPHA 3MQFA 2PNFA 2QZ4A 1WKCA 2PX6A 2EV9A 3KT6A 3P96A 5HF9A 1JHVA 2YMQA 2JBWA 1TJYA 2OAQ1 3C1OA 4I2VA 1Y1LA 3CG0A 3L9XA 3KQMA 3A2LA 1ZXBA 4JUIA 3SIPA 5HIMA 2DCMA 2DRIA 3PDIB 5FNVB 4AJOA 1EXNA 4R0VA 5DRTA 1DT5A 3QSYA 1U2EA 1HDCA 1WLSA 2HXYA 4ZKEA 3MWDB 4US1R 5KNCH 2FX2A 4LF7B 4I55A 3RU2A 2AFVA 4IS3A 2OCYC 2YY5A 4Q7QA 3THYB 1VDMA 1Z4JA 2QGNA 4ITRC 1E6EA 3KWJA 3QLJA 4R9VA 2HCFA 1UXIA 4RXUA 3T0IA 5CA1A 1Y8QB 3EXG1 4KRXA 4G9GA 2ZXEA 5LP6B 3EY9A 4W7IA 3A3PA 1JB1A 1CLEA 1SKAA 3ET4A 1X7GA 4PYQA 1BNCA 1TPZA 4IV5A 1Q20A 3M7IA 3DCJA 1EAMA 3LUJA 3FHJA 4YCAA 1E1YA 3P0RA 5EMHA 2PGIA 2ZE7A 4EB6A 1CUWA 1JR3E 1YJXA 4HYEA 3T7RA 3TVDA 3W4JA 1D2HA 3E3NA 3KKEA 2HQSA 3AFOA 4EAAA 3KBOA 4NJEA 3F7NA 4FMDB 4IF6A 2OR3A 2P3LA 1ZJJA 4N4AA 5EZ6B 1VRWA 1EFVB 3TQSA 1NMQA 1RQGA 1AKRA 2JL1A 2WZDA 5H68A 4B2IA 4BLVA 3PICA 3AJ9A 1D8AA 1EWRA 3JY6A 3N7AA 1V5GA 2FW7A 3OWXA 2J6IA 4JGIA 2B5WA 3D3NA 3LWNA 4BIMA 3CTMA 3EJ6A 5JJCA 1Q1QA 2P2CA 4YWHA 5TQ0B 3QNMA 4Z0PA 2NUTB 1NI4A 1VL0A 1XMXA 2Z5GA 1TM1E 2FJUA 1SKUA 2FPXA 2I6QA 2Q3FA 3PPXA 1ZRMA 4GKJB 1DJOA 1JKXA 2NU6B 4YYZA 3OFKA 4Z4IA 3B20A 4UBMA 4BLTA 3I61A 3CRQA 3JARB 1V4NA 2XYGA 1KP2A 4HZIA 1G9SA 3U3DA 1R8XA 3RNOA 3RODA 1S8AA 3N58A 4N1AA 3DOFA 2VKTA 4IIJA 3SLRA 1I0ZA 2HI0A 5G3YA 1X1EA 4J7CA 4OHFA 1KI7A 3E0QA 5JISA 1SH7A 2DFKB 4RZ3A 1QR6A 4AIRA 4B8YA 1PS9A 3DH0A 4MWDA 2QP3A 4P98A 1W29A 2PUHA 1MC8A 4ZOLF 5T4FA 3RTEA 2XKAA 1M2NA 4K2AA 1IOWA 5H81A 4GSLA 4HCJA 5CX4A 3W9YA 2MDTA 3WGMA 4AMBA 2QLMA 4RDIA 5LZ7A 4C3ZA 3D3EA 3OQHA 2XF2A 2H7CA 4DE5A 2B25A 6AT1A 4ZI3A 1TM4E 2VSQA 3JPWA 5HKOA 4C08A 3EODA 3G1TA 4I4IA 4C30A 3VXKA 3W9UA 1FA9A 1YQUA 3HS3A 1IZ8A 2EKDA 2GDZA 4FIZA 1N5JA 4MB2A 2LD4A 1Z08A 2VTVA 4QPNA 3QITA 3C7KA 2JA1A 1W93A 2Z95A 2A0YA 3WADA 4LNAA 3ND9A 2P9YA 4J90A 5TMDA 1FRZA 1M2OB 1VSUA 3NS7A 4GI5A 4IIUA 1E1LA 4PLYA 3KK0A 3ONFA 2P0YA 3RG8A 3BRWD 5BP7A 1BVHA 5FUVA 4DFDA 3C3EA 3HDQA 4XUDA 4N9WA 1KE2A 3FPGA 3PD7A 1JI0A 1S2MA 3HA5A 4GPD1 4QTTB 5CDUA 2QPTA 4R16A 3GDGA 4YALA 4BE4A 2YNMC 2RKWA 4UE6A 1G66A 3LMKA 3I72A 5ALOA 2VH1A 4EPYA 4LBVA 5CVCA 3U31A 2XMSA 1ZK2A 3NM4A 1LLDA 1YE3A 5GY7A 2JFGA 1F5NA 5LP6F 2ZXFA 3MAJA 3TPFA 4L4SA 4URVR 1O8CA 1M8GA 1T5TA 3OIFA 4S1NA 2VDPB 3PGJA 3WLLA 4Z54A 4CQNA 4HDMA 2YHAA 1VDZA 5JMOA 3BSWA 1JG6A 4WY8A 4ZT3A 3LDFA 3NHAA 1UKAA 2AQHA 3SZ3A 2XOXA 1WV1A 2LRHA 2AX3A 4MR7B 1Y89A 2JAPA 1FTWA 1LBIA 1U3DA 4UZEA 3GUVA 3MTDA 3SXPA 3NAQA 1REQA 4ZYUA 3H04A 4H60A 4JKOA 4FMDF 2G76A 4ZHQB 2Q46A 1OFUA 4FOPA 4OLJA 13PKA 2AQKA 3VYSB 2WR8A 3R9XB 1G6Q1 2CNDA 2BJWA 4IQFA 3KEMA 4X63A 4K6OA 3MIZA 1G0OA 2I4RA 3KFXA 4XPIA 3IB3A 5FJIA 3V1YA 5ICEA 5KS2A 2VNAA 2O4UX 1AUOA 1BCSA 1EJ6A 2B7BA 1JDBC 5DDIP 5TNXA 3SG0A 1YR6A 1QTQA 1IL0A 4J7XA 1ZR2A 2YHIB 4LDJA 2GBIA 2XUDA 2GFHA 4GRIA 4O4JB 3FJOA 1YZVA 4MRPA 4F9EA 4MV8A 4BO3A 5ADWA 3OZWA 4ER0A 1HFEL 3SC4A 5G02A 3G0IA 4K6MA 4OHXA 2KJQA 5CUQA 1X7XA 4IDHA 2WTUA 3K0EA 3V1LA 4Q48A 2MSKA 5TQ2B 2AJ8A 3HC7A 3Q8XB 3CH5A 5HQJA 2JVIA 3OOYA 1PFYA 3WGUA 1KYTA 1FUUA 1N3IA 1NVTA 2ZBDA 2DECA 1RQPA 2J9ZB 2CNNA 4IQ8A 4ZREA 3OSUA 3KBBA 3KQVA 1JQLB 3FYDA 1JI3A 1G4HA 2JJQA 2O14A 1CJMA 4WKNA 4CR7A 1AF4A 4YR7A 1EUYA 1A95A 1N0HA 2GN1A 3U39A 5ITSA 5AI6A 5LUBA 4WJLA 3BRSA 5AVYA 1KU0A 1U0HC 2NQ8A 2XX3A 3N0XA 4ZYXA 3EAQA 4FOTA 3W2HA 3ZD9A 3W5BA 4V24A 4L1KA 3WGKA 1VTKA 1WCV1 1TAGA 1IUPA 3WR5A 2ZSFA 5FWNA 4CQMB 1WB9A 1M6NA 4A2PA 1R12A 2RH4A 3KUXA 1NJFA 1ZNXA 2OXEA 1O95A 3ZCXA 4N8SA 4AUKA 4DDKA 1B1AA 1YTLA 1I7PA 3ORRA 2I1QA 4OMDA 1FQJA 1J0EA 1J0DA 1J2YA 2ZJZA 3OD1A 4X7PA 1AF7A 3V1KA 3MCVA 3LDHA 4M36A 1DBPA 1FXUA 3DZCA 2JGKA 1AGNA 4L8FA 4OQNA 1GL9B 4UAVA 2D5IA 3EXIA 3GF4A 1AG9A 4UHCA 1GKYA 5ADHA 2VZ8A 3BHIA 4LI3X 4OKIA 2MSCB 2VSNA 4P3YA 1U2ZA 2EG5A 3UMFA 1SUSA 2GGSA 5TRTA 1RHUA 5J4KA 4F8JA 1TW3A 4FW8A 4E12A 1P4SA 5F7XA 1UXHA 3VSCA 1WB4A 2GYUA 2WD8A 1YK0A 4EOGA 4RK6A 3N8IA 2FK8A 2V03A 2ZJ0A 4RY2A 5DTIA 1RLMA 3G2IA 1ZNYA 1WCWA 3LPCA 3QEMB 1TQDA 4Q12A 5SYNA 4DARA 3D6VA 1L2TA 5LBIA 1PFWA 1TZCA 3REGA 5LZ2A 1M1YE 2QPAA 2VR1A 4EGAA 2Q5EA 3N5KA 5FTNA 4C03A 3IJPA 3PTAA 3K09C 3OMXA 4M99A 3V1MA 3TEJA 3RHSA 2IODA 1M5UA 1VYVA 1MX1A 3BYZA 4Q1DA 1YWGO 1M66A 4ALIA 4CR6A 2DBYA 1Q0HA 2DYKA 2Q9UA 2R5FA 2I7TA 2VJOA 3MMXA 4H9GA 3Q0EA 4B6SA 1CJBA 3ZVMA 2EFHB 4H6XA 4L8WB 1XC7A 3E2PA 2H00A 2VJNA 4UU0A 5DYNA 4NSNA 1OBCA 4JQZA 3STWA 3WWZA 1F8FA 3EG5A 2R2GA 2KSQA 2ETXA 3OPYA 3U3KA 4R8RA 1T34A 3NVDA 4UCWA 4F71A 2I9KA 3UHFA 3WLEA 4X00A 3O4RA 5FX2A 1U8UA 3DE3X 4OB7A 1KWGA 2I8CA 4CV3A 4JVLA 3QWIA 2XDWA 4O4JF 1UKVY 5CEFA 2PBFA 2D13A 1RXSA 1XNQB 3UM9A 3EPHA 5ARCA 1Y7TA 5A9TA 2OD2A 3IOEA 5FORA 1H2EA 3NGLA 1ICIA 4BJ1A 4ZHSA 4PG5A 3AR4A 3TRFA 3WWPA 5F3RA 3P2IA 1T36B 5MFZA 4CF3A 1EXMA 1FYEA 4E2YA 1Q1EA 3VSEA 5CGZA 3LX8A 1ENPA 2BKUA 2EX0A 2MIIA 2YWRA 3H2YA 5DBOA 3HCFA 3RV4A 5IM4A 2IP1A 2J9RA 2WP0A 2Z9CA 3JASA 5G4KA 3TBKA 4YY3B 4LCEA 2FOIA 2FFHA 2TECE 3A27A 1N2CA 3MJTA 3RYIB 1ZH8A 3U4GA 4ND3A 3WLSA 4HNAB 1E32A 2CMHA 2PH7A 2VJQA 1VKNA 1W6RA 2MWMA 4HYYA 4WXRA 5F2EA 5CB4B 3HVJA 1IATA 3N7UA 3H9CA 4R2HA 1E7SA 1FYVA 4HR7A 6CHYA 1JWLA 3N86A 1SC4A 2HDNB 3R40A 3E9QA 1GZ5A 3LC1O 1ID8A 3T3GA 2GWRA 2DETA 1YDFA 2FQXA 1E1KA 4MW1A 1E0AA 4QSMA 2ZJ7A 2QRQA 1DAHA 3AUJB 3F5FA 4OH1A 4XWYA 5K3FA 3RK0A 4BO5A 5JW6A 3EWNA 2I87A 2V7EA 1TYZA 3KLNA 1SIOA 4LFCB 4EKGA 1RWWA 1X80B 2VDLB 4OXYA 3T54A 1DUSA 3TRIA 4A92A 3P26A 5EWJA 1D2EA 1U0LA 2G83A 4MO9A 4GKKB 5TPWA 1W46A 5FLYA 2XD4A 3Q7RA 1L5RA 3KOXA 2CHVA 5FA6A 3CLSC 5IP5A 3VGPA 1EI9A 4UNRA 2AVDA 2YS6A 4BN5A 3P9XA 1M2VA 4IJ6A 4C89A 3ZV7A 1JAXA 2ZJ6A 1W6UA 3C1UA 4ZAFA 5FBWB 2ID7A 3BC1A 3SYRA 4RUKA 5G0WA 3LL4A 3G8AA 4OXRA 5UKDA 5DXJA 2O2XA 4E03A 2O2ZA 1W30A 2WJJA 4XQ0A 5K0BA 4Q7LA 4KHPB 2I6FA 3D2BA 1LV7A 3JTEA 3P9ZA 2NAPA 5KWJA 1R6XA 3VUFA 4KR7A 4TMWA 1XTRA 5BSTA 1IBRA 5T57A 3HBJA 3DNPA 2WUGA 3AL2A 3IVMA 4OK6A 3T1NA 5EHZA 3H2KA 3L7AA 2DH6A 5EOVA 3I9LA 1U0FA 3GT3A 4W1SA 3DMHA 3SVLA 3C6XA 3I62A 2PL9A 4UU8A 1OOEA 3I8SA 4H6VA 1V6CA 3TZHA 2X1HA 5F9MA 1QK4A 3WC4A 2FPWA 1UPTA 3GA0A 3I9KA 3NW9A 2GFIA 3FPHA 1HK7A 2CGEA 3K2QA 1Z45A 1QH8A 1TJ5A 3QPDA 3SIRA 4D8VA 4GXQA 3HSKA 1N9GA 3TTVA 3D81A 1FUKA 1YZKA 3R20A 5LNK6 3OOSA 3O8DA 1KERA 1SCIA 2GR9A 5ILQA 5AHXA 1Q16A 2JLWA 4FFRA 4EH1A 2RCYA 3WAJA 4JLMA 2P90A 1BXZA 4AZTA 3C8ZA 4DMFA 1NV8A 3EUWA 1A4XA 5E1MA 3QA9A 1PWXA 3QFSA 4M1KA 1HE1C 1YC2A 1YA4A 2Z6VA 3FPJA 4WDQA 5AVKA 1IC6A 3CNBA 7REQB 1CF2O 4AWAA 3TQQA 1KEEB 1AUQA 5J59A 3L41A 3U7QB 5I51A 2H6EA 4JOCA 1T8SA 2FMKA 1I8TA 4HWSA 1C1YA 1F2TA 3FYHA 1DHRA 1MJGA 3WRYA 5CB4F 4E07A 1FQKA 3F6EX 4HGQA 4RYDA 4V0NA 5IFLA 1J07A 4Q0MA 1N8KA 5IZCA 2HLDA 2ODPA 2BJHA 1FIUA 3ZGZA 3W8EA 1HMYA 1A5TA 5TS3A 4DCNA 1P7VA 2FLWA 1LLUA 1TYDE 4D4GA 3JQRA 2C8KA 1TK3A 3HPRA 1JHDA 3UMVA 1G4UR 2IK8A 4NCJA 4X93A 3MUFA 2VYVD 4NR0A 3MHPA 1AO0A 1XCOA 2WWWA 1T4CA 2P9TA 3UMBA 4NARA 3EAGA 3D5TA 4B5KA 2X4IA 4JCOA 4JT8A 2BMEA 1QUFA 5FCDA 5JLJA 1T24A 1SXJC 3K1ZA 3ORHA 3PI7A 3I9V1 4UBOA 1PLLA 3HJGA 2I91A 1C7IA 5FR2A 4YGXB 3DCIA 1UAAA 3X43A 3LQRA 3A26A 2C9ZA 1RC1A 3LC0A 1DG1G 3N2GB 3ME5A 5GOTA 4ZOBA 1VA5A 3RV3A 4DLXA 2H11A 2G36A 2ZBVA 3GJ0A 3IBYA 5FIUA 1IUOA 3SX2A 4CMEC 3BDAA 4DCVA 4JYZA 2CT8A 1VC2A 3CIFA 4PZLA 2X41A 3IP9A 4WI1A 4WOPA 4S2EA 1KO1A 1GL3A 2D8MA 2RE8A 5KTKA 4NX2A 1A77A 1WXXA 2IU3A 2W00A 5A3RA 4MW6A 3NV9A 2BFEA 3CZPA 4OQDA 3LJKA 2DFDA 3FSGD 5DKFA 2NYVA 2JJMA 3K3PA 4LOKA 1UBTS 2MSDB 4YI5A 5TIIA 1WBDA 2WT4A 4GH5A 4BLUA 4R1MA 1RC0A 7ABPA 4B43A 3DFMA 1WD7A 4KXNA 3OQ1A 2FPGB 1Q7TA 5JZMA 1U81A 5CD1A 1C0LA 2DCUA 5DPMA 4RPCA 2HF8A 2PQ0A 3A32A 3JQBC 2Q3LA 2P27A 4CKEA 4ISBA 2R8XA 4I50F 4KDFA 3AKCA 3DFFA 4HPJB 4JLPA 4OQMA 5FOXA 3KD2A 3TR5A 4V39A 3PQEA 4UD6A 3X1KA 1U0OC 1JIQA 4GW3A 4QYWA 4MJ7A 2ZSHA 4EFNA 5F1YA 1P60A 4LYJA 2ATCA 1AUPA 2O20A 2B99A 3ED5A 3D8BA 3RBZA 1CK4A 5KTTA 1KOGA 5IUJC 3KQWA 2QJRA 3QE4A 4XD7A 3PE3A 1G41A 3WNQA 1AA9A 4J43A 1XTTA 5KAMA 4IOJA 1QKIA 1VYHA 4WBSA 1FQWA 4I9GA 4UVEA 3WHLA 5GADl 5D86A 4IIHA 3F46A 5B1HA 4K6FA 3HO1A 4LDNA 2HMVA 4BFXA 1I24A 4O2AB 1RJFA 4OREX 3P2KA 2JF0A 2I1VB 3DHYA 5C5IA 1O97C 2A9QA 4H1TA 4TTQA 4WUTA 2JARA 5ILGA 4MCHA 2BH9A 2RFLA 1J20A 1CUAA 4TSFA 3UCXA 3FNQA 4DDMA 2C78A 1QO7A 1QO0D 3H9JA 3UT5B 5IX8A 4N5LA 2JJ2A 3KQNA 2HJVA 2AOVA 3EC7A 4JJ4A 4BFWA 4E2ZA 5C4IA 1H4SA 2GYYA 4HAYA 3ZTYA 5EEHA 1N5OX 1RHMA 4PQYA 2Z8ZA 1CQJB 4FJ0A 1AMNA 1PRYA 2I2DA 2BGRA 1I3KA 1JHZA 2I34A 3L6CA 2VZ9A 5T3UA 3JQ8B 4PC2A 4RKYA 5LU9A 4P86A 2O8BA 4RVFA 1ES9A 2ZREA 4BNMA 3CWCA 3WYNA 3KG2A 4HUQB 5F7JA 1JAZA 1QDEA 3NEJA 5LQJA 1BDIA 4UTRA 2AMJA 3Q2IA 5EXDA 4AG5A 4DPKA 1YQQA 2YQ4A 1MD9A 5JJBA 5K5EA 3B51X 3CHYA 2ST1A 1TXGA 2ZT8A 3CX8A 3RKSA 5B6PA 2GN2A 1SXQA 2P75A 2ONZA 2R6JA 2YZKA 3CCBA 4EHJA 3CLUD 3MT0A 4ZGGA 1FC0A 1GCOA 4PZCA 1ADCA 2J41A 5FUXA 4CIVA 2J4DA 4RV4A 4Q4CA 2OV6A 1NW5A 1TJ4A 4ICIA 4URHA 2FP3A 4YP1A 4Q7MB 3K6RA 2IS6A 3ESRA 3NBKA 1SR8A 2PUVA 3B85A 3RDPA 1AMUA 1YDGA 3HXMA 3NBXX 1Z7WA 4R2LA 1ZVJA 1QG4A 3JCZA 2R1UA 1ISPA 1DCMA 3H42B 3HACA 1QG0A 4HQNA 1XEWY 5KOJB 5GJWC 4M1SA 4I14A 4EHIA 4MWCA 2Q5IA 5FLEX 3U4MA 3OZXA 3LWDA 5B58T 1XG5A 4HBZA 4XYGA 2QX9A 2JIDA 1MO6A 2XGMA 5FL7A 1N9KA 1M8JA 4HQ0A 4QPCA 4BP1A 2WWYA 1UJCA 2WIFA 1ZMTA 1YK1A 1ONOA 1CR2A 3SQOA 3CEHA 4A8JA 1VG1A 2FWIA 1UC8A 3ZDAA 1IVNA 2QUZA 3DMTC 4Y2PA 1Y0BA 3IPLA 1XHEA 2R25B 3IXMA 5ALVA 2AK2A 3GWZA 3NHKA 4FWIB 4OJNA 4WACA 1MX3A 3EGVA 1V8ZA 3EWAA 4XA8A 2BR3A 5CJJA 3A1SA 3GELA 3WYDA 5KDOA 4B3TB 1JP7A 2QENA 3HJCA 4ZZ0A 4QVIA 3ENKA 4CTMA 3ZHYA 3MCAA 4FX2A 5HQ3A 5MDHA 2XSZA 4GOMD 3WLIA 1INLA 1UBUS 4LHWA 4XASA 4LXYA 3SLKA 2PKXA 2N46A 1ORRA 4INJA 1F38A 1VE3A 2YDXA 4MS4A 4XGIA 4CKCA 1Z5OA 5LXTB 4D0RA 3AERB 1JBKA 1M2WA 1U7UA 4MH0R 4PZEA 5A06A 4CEHB 4NYMR 3QUBA 4HS9A 4I3FA 4LK2A 1WB5A 1H8ED 1YS4A 2RB5A 3O4GA 4JEUA 4MJLA 4O2AF 5AICA 2W2MA 5JO0A 3NDJA 2G67A 2XCRB 1JTVA 4YJFB 2I2FA 2YV5A 4RIHA 3G9UA 5ECGC 3ZBQA 3KQUA 1VB5A 4C4TA 4F97A 3ENVA 4MI6A 4H18A 1USKA 3WFZA 3DTVD 4CLXA 2BSQA 3TRDA 1YULA 1HZZA 4XSVA 1OE0A 5EL0A 3WXBA 2ZJ4A 3EWSA 4KH1A 1JPVA 4KGVA 1JLSA 4LX0A 4YACA 1PW7A 3ROMA 2CK3A 3INTA 3W1EA 1JMYA 5AKKA 3WZMA 4XSGA 4FNOA 2RH8A 2XB6A 1EE2A 3WGJA 5COBA 5I9NA 3KIPA 4JOSA 3RUHA 2ETVA 3NBAA 3KYCB 5DNWA 1TLFA 3T7SA 1XUOA 1NNI1 2ZTLA 3HFRA 1KSHA 2QY9A 3GJTA 3MWGA 3W3AH 4ENRA 1DKNA 4LEIA 1EQAA 2XA2A 4WZZA 3RC8A 5AOCA 4MRNA 2AHRA 1RHRA 1DP4A 4WA7A 4TKUA 3TSAA 3JQAB 2QTRA 4Y2XA 4BEWA 2ATVA 5AWFC 2I2XB 3P19A 5IHXA 4NIMA 3B6KA 4RK0A 2XB9A 2JFHA 4BDSA 2C29D 1KJ9A 2BFCA 1KPIA 4FSHA 2C5EA 2H5JA 1Y3BE 4OCZA 2DT5A 3QTTA 1PNRA 5IT9A 1S89A 1THGA 4QXOA 3R8XA 2AMYA 2Z9DA 3H6HA 3M6WA 3PUHA 4KVFA 2UU9B 2GRUA 2IV3A 2AK3A 2RBKA 1XA0A 4J76A 5JDCC 5B3JA 3O8RA 3RC7A 1ZK1A 2VYCA 1DFGA 4RCZA 2CV1A 3E1SA 2VDQB 4L6CA 4ENUA 4EG0A 5NULA 1X6VA 4FQ8A 5AK6A 3GJZA 3GGDA 3O1HB 4QE3A 4UKDA 4A27A 1NXWA 2GEFA 2I3DA 4LRYA 4JL8A 4HAOA 1N77A 4HWRA 2RK6A 4WXMA 2XNJA 2BHRA 4KACA 3A9TA 4CG0A 4UPVA 5E2IA 4DVGA 4JLBA 4L4RA 5KC9A 4LF4B 4WK0B 1E6KA 3J7TA 2ERXA 1QGAA 5T4EA 1M67A 1SD1A 1XU7A 1VA4A 4K28A 3TR0A 1GA4A 3ZVRA 4TLLB 3MGBA 2LUOA 3S3TA 1VHQA 3G0HA 3OFVA 4GICA 3WBFA 3FYUA 5THQA 2AUTA 3LBAA 5B58C 3C85A 4QO8A 4RVCA 1U2TA 1AKQA 4ETNA 4H7FA 1M2HA 4QDTA 5FOTA 1MX9A 2Y66A 4FR2A 2E21A 1KQFA 2BR5A 3C1TA 2O2EA 1CS0B 2P78A 2I55A 3OQPA 5LXTF 1UANA 1VIMA 5JD6A 1F48A 4AVYA 2K2QB 1JJFA 2QJTA 2IZ5A 4D26A 2BFAA 1UBHS 1ZLXA 4PNZA 3H1TA 1GAQA 1H85A 3IP5A 3LLVA 3MSCA 4LSGA 4TPKA 4CG2A 1YE8A 4D1YA 4RJTA 2Y1KA 2XE7A 3EXEA 3EGXB 4MGKR 5J23A 1GNVA 1WF3A 1D6MA 1K7CA 4PGAA 1ZVVA 2AFIA 2C9YA 2JB9A 3ABRB 3VVMA 1CULC 2OV3A 5K3BA 1Z63A 1AKVA 2CN1A 1SU8A 2XUGA 3AVOA 4N40A 2WHPB 1MP0A 1UBNA 1WQ4A 4Z3OA 1Z6GA 2CDCA 4MRMB 4N5HX 1TF5A 1DU4A 2D54A 2MYTA 5EJ2A 4ATNA 5JRJA 3GGSA 5FWAA 1S96A 2A67A 2RHRA 4MR8A 5BWCA 1CJKC 1KI1A 3VDNB 1Z3IX 3I52A 5BR7A 5LJLA 4L0MA 2VYQA 2YMLA 3KOYA 1V11A 4QQFA 4ME6A 1VLVA 3HSSA 3DTYA 2QMHA 2AOXA 2O2HA 2EYUA 1L1EA 3EC2A 4JKIA 1JXOA 3HFJA 3KSRA 3FTFA 4PS0A 1PO7A 4MIYA 1GT6A 1J33A 1XE3A 4L0CA 4DIFA 1HE4A 4NZ9A 2G06A 3MN1A 3RTBA 1A2OA 3X1ZA 3OUTA 4EW6A 1WP9A 1P5JA 2AKAB 3ISJA 4JJZA 4PRKA 3T1HB 2PKQO 3IP6A 4FR0A 5IK2A 1FS5A 2OZLA 3QUSA 4HFJA 4DGSA 1Y6QA 4XVHA 1O6ZA 2RK3A 4LSMA 3SC2A 2E55A 1CDDA 3ELUA 3R77A 1XTZA 1PDVA 4CM8A 1RWNA 3NDPA 4PGHA 2I71A 4OMCA 4XARA 3FHLA 1JXMA 4ESOA 4HRAA 4IGIA 4DYVA 3NXKA 4I3GA 2H3EA 4I5EA 5FWYB 4V1CB 1IN1A 3GEMA 4FQ7A 1F7UA 1K5DA 5AMXA 3VO2A 2VRNA 1OWOA 1B2LA 1O6CA 1HOXA 4ALLA 1JFFA 1FRFS 1QDLB 4TM8A 3ULKA 1SUEA 4NY1A 3ZWMA 5KU1A 4Q03A 1ZK4A 3ISVA 3V5NA 5KNLA 3QMWA 4XR4A 2PKCA 3L7IA 4CPDA 4EHDA 4F6CA 1EFPB 3C6YA 5HKBA 1E1RA 1OWPA 4RL6A 1Q12A 4MDEA 4L3VA 2A9KA 3BL6A 4KDRA 4NBTA 4CCYA 1Y4DE 4K6CA 1KHTA 1MMFB 1N7IA 1Z28A 4M46A 3WKCA 4CMAA 3ASUA 4AN4A 3FA2A 4U7HA 5BRAA 1T1IA 3TO5A 1H2YA 1OBOA 4NU5A 1EX9A 2TMDA 4KPFC 2GLUA 2VFAA 4AURA 4CR8A 3K9BA 1OLXA 1V8FA 2QK4A 2V7GA 2ZTVA 1N6KA 4G2TA 4RULA 1XTIA 1PL0A 1R0CA 3HCOA 3L7YA 4Q9DA 1NNUA 2VUHB 3AGQA 4IJQA 5KQLA 1OIXA 1VBNA 2E48A 4IVPA 1J5PA 3FYTA 4NXMB 2DLCX 3NC1C 4TVBA 3RVKA 3ZU3A 4JSYA 4DB2A 3SN6A 1RRVA 3R41A 2VQFB 3NTXA 2ODQA 4RSMA 5A1TA 1FXWA 2IP2A 1SCUA 4GEGA 2V65A 1TUBA 2PRIA 5CDTA 3ZW9A 4ZGWA 3Q88A 4IW3B 4CLRA 3V34A 1YRHA 3OX1A 2B1RA 3I6QA 3IJ5A 4G56A 4Q93A 1XPOA 3DYVA 3H4VA 2JCYA 2H7XA 1E60A 1E8NA 2QRHA 2WBLC 3IXQA 1XZQA 5EWLA 3X2FA 4X8HA 4CMGA 3RYCA 3SJBA 4F3TA 2ONCA 1DBIA 1QWSA 3IAEA 3THXB 2QTVA 2D0DA 5K0CA 2BZSA 2VZEA 4WJZA 3ZXIA 1H22A 3STVA 2X0DA 4TS9A 2ARKA 1TCUA 2VA9A 3QYAA 4IHJB 2DUWA 2W6NA 2XNDD 3CX6A 2YV3A 4KN8A 2CVHA 2GK7A 5IYZA 1ZL2A 2G3YA 3OM9A 3QF7A 2QS9A 1W48A 4TQUS 2C03A 3FSJX 5LWHA 3KVOA 1LF0A 3IELA 1XK7A 1HY3A 2C4MA 2XQFA 2XUPA 1OIVA 1Z4NA 1Z6ZA 3AILA 1DJPA 4GRAA 4JUCA 1BWSA 1L9KA 5C7YA 1E3SA 2Z4SA 1F2UB 4JZYA 1EINA 4KPUB 3D3QA 4G0QA 4KSYA 1XVLA 1K9SA 3DW1X 1YB7A 1CQXA 4QTUB 1QMPA 4TROA 2HIMA 4YEDA 1BFKA 5DB4A 2EVWX 3Q3CA 4Q9IA 4L27A 2GBLC 3UFXB 3LYHA 1NATA 1MO2A 1TM3E 2ZUDA 3HL4A 2HFKA 2EFCB 2LP4Y 5HOQA 1ZVMA 1U0JA 3IULA 3ZWXA 3PZBA 1R0YA 1R4MA 3H4TA 1UXKA 3KHSA 1FDIA 1PJ4A 3GMDA 4Z7OB 4LDZA 5D6NA 2KMLA 4YRPA 5BOSA 4LN1A 3NVMB 2RB4A 5EY5B 3ZPXA 1JHAA 3WO1A 2QWXA 1XRSB 3LIIA 3LUPA 4CMIB 5HOEA 2XLCA 5EC8A 2XECA 2JG3A 1ZI6A 2XKBA 3H18A 3NIBA 3HGMA 1KMCA 2GT1A 2PTHA 1H2FA 3FMOB 1YL7A 2FVXA 3QXXA 4HH0A 4W4TA 3OTHA 1KEWA 3I05A 3A4NA 3HCAA 4MVXA 5FEMA 5SZIA 2XLBA 3ER6A 4KO1S 1KQGA 2P2NA 1Z2AA 2VF8A 3SHTA 2FLKA 3O3CA 3CUKA 5BN1A 3K6KA 3VR1A 1J90A 5KTMA 2PWPA 2QQ5A 3L6RA 2VAPA 4B2PA 1BMFD 2VP6A 1QGUA 2UZ0A 1DBRA 1U8TA 1GLVA 2G82A 4YRQA 1RI2A 4OA5A 1B0AA 4C76A 5LZ8A 3S1LA 4RPGA 3HN6A 2X58A 3KR2A 1TF2A 4HXGA 4N41A 1CD5A 3OE4A 1YZFA 2CW5A 3AY7A 1QDUA 3NX4A 4RGVA 5AOBA 3UV6A 4DMRA 3K5IA 5C0OE 2Z98A 4AIIA 1VL1A 3W79A 4RVOA 4R68A 2RGDA 5E7IA 4ZDKA 3OHSX 1MC1A 3MCWA 4NBLA 2JBHA 4UOQA 6YASA 2XMBA 2D5CA 1VCIA 4XVRA 1J2JA 3A4IA 3NATA 4OXIA 4MO2A 1K6EA 4QOEA 5IUKC 1S0UA 3GR6A 3TTTA 1F0KA 1V25A 1F14A 3EZ9A 2IUFA 4ZOQI 3DUFB 4MITA 5KJEA 1TCAA 2Q2WA 1T29A 1V7ZA 3TRJA 3M9LA 3QWAA 3V8EA 3ZU5A 1B1CA 1ZOLA 5K0NA 4MS1B 4DWWA 5TB5A 2ZI3A 4IZ6A 5JIBA 3W2IA 5JADA 1XRNA 1NM5A 3OWHA 1RPAA 3IVRA 1N1DA 2QYHA 3OJLA 4V1CI 4Z6KA 3WICA 1DE0A 2FMTA 1G8JA 1MA3A 3GJ7A 1Z8FA 1Z4MA 4V0RA 3PLAE 3CYFA 2XWQA 1XD2B 3H4IA 4IHJF 4J7UA 3BRCA 3M89A 4Y2YA 4PG8A 3RLIA 5KNBA 4MSUA 1TIKA 2H9YA 2J1LA 3DW3X 5LQAA 1XTVA 1J21A 3JU3A 3JR3A 3F8TA 1V1RA 3TLZA 3WKDA 1CWUA 2V55B 1LPMA 2QUHA 4I3HA 2O8CA 1KFJB 4FFVA 2DGDA 3RD5A 2XOKA 3QFRA 4RIIA 4MUHA 3AM3A 4XSHA 1U1DA 1LI7A 4TTVA 4RU1A 4A26A 1JB9A 3IMFA 2IUTA 4ZI7B 3T5DA 5FKJA 4BOYA 4DEXA 3OE5A 1NP7A 1DZIA 4Z9YA 4KUGA 4WFKA 3U2QA 2C8LA 3INYA 1SHZA 1XP8A 5CFZA 2ISQA 1YOBA 4JSTA 4H7PA 3RFCA 3A9SA 3A28A 3UXHA 3J80A 5JS1A 5JNVA 2R6FA 2IX9A 4OK3A 5H1YA 4CLOB 2E6KA 5I3ZA 3F4BA 4WKGA 3VKVA 2FFRA 5SYMA 1WZ2A 3QV2A 2W90A 4S1WA 1E2KA 2JJ8A 1BYUA 2WKWA 3WIBA 1NVKA 4WLNA 1NVGA 3BKWA 2QDKA 5JR3A 3HKCA 1VLZA 3WLOA 4PFKA 3X2EA 1DFIA 2BISA 2UYGA 3C3AA 1ZJWA 4INZA 4K9LA 3CF0A 4TUYB 1Y3IA 3B6MA 5M3BA 3T5GA 2ZPTX 1QYWA 3P0EA 4J3JA 5KCZA 1VIVA 4KIGA 3BE6A 3OAAD 2GHRA 3HYSA 1NJ2A 1S7GA 4KEAA 3JQCA 4X90A 2A1UA 3R9WA 1EE1A 1MA0A 2PM8A 2ZIUB 1ULTA 2XGOA 3S1AA 3SS8A 2C95A 3R3WA 3W4IA 4YUYA 4WZAE 3H1EA 2KBEA 4I81A 5JCZA 2YW2A 2I6SA 4O2BB 2VPYA 4D3ZA 3WK5A 9ABPA 5IG2A 4R6WA 3RJZA 2PYIA 3ZHUA 1BYIA 5D1NA 1C3VA 2NZVG 1MJGM 2AEJA 4Y7DA 2Q1UA 4I4NA 1TE2A 1E0JA 3GAFA 3M1LA 4M0CA 1B6SA 4K9KA 4PX5A 1WDTA 8OHMA 1DB3A 1YC5A 2IZOA 2Z5VA 4AZVA 4BVJA 4EITA 4XD2A 2V97A 3QVTA 1S01A 4MS3A 3LHIA 4GPZA 5DM4A 1N3BA 3TKAA 1O1YA 5BV1A 2VWHA 4KN9S 2WU4A 4NBVA 4O29A 1G3RA 3TSCA 1CEXA 3PTLA 2YVQA 1YQGA 3ZJ4A 2QAGA 1B15A 2WTMA 1F1BA 4OBXA 3SZGA 2BR4A 1IULA 2FK7A 4I9HA 1S4MA 3UJ6A 3VTAA 5FUQA 2J6HA 4YP0A 3SJAA 4HGRA 4L9SA 1QRSA 4DR6B 1ACJA 1SURA 4FKZA 1SVNA 1L5OA 1XFAA 4HHEA 1Z6YA 5JZ9A 4ARCA 3WGOA 1YF3A 4M0LA 1UMBB 3PDJA 4Y9UA 4LG1A 4YRAA 1T8PA 3BGVA 3ZD6A 4LE0A 3WK4A 1C1DB 1NF2A 1LPNA 2AB0A 1KJNA 4HDSA 2DTEA 4LOIA 1NW7A 3Q12A 1E2FA 3IR7A 4LV5B 2ZJAA 3E9MA 4Y6SA 3WMEA 1DX4A 2OLJA 3PLRA 4XIGS 5AKXA 1KS9A 2CVPA 4FGWA 4HATA 3BK1A 4ZT7A 3FZQA 5C1BA 4C5BA 4YMGA 3ZNNA 3R75A 1W5SA 1GAJA 2WMNB 2P3SA 4YONB 4P4NA 5H59A 4AMZA 4CUZA 1QUEA 3NDRA 1E99A 1YZLA 1GTVA 4OO3A 1V1MA 1ZSNA 4BB6A 1DINA 3EIEA 2PCJA 3EN0A 4FYJA 1MTOA 3WSWA 5HGJA 1MOPA 3QH4A 1WUTA 3K0KA 5ESRA 1CUVA 1DQPA 4C78A 1RYFA 1TJ3A 3PUWA 4ZI7F 3JD1A 4IRUB 1OAOA 4W9NC 1V8PA 2XEXA 3LXXA 4Q02A 2F6RA 2PLRA 2QMOA 3GUUA 3TIGA 2FWJA 3KKKA 2A9JA 4KKXB 4BN0A 4TMZA 2X8AA 5B1EA 5KB3A 2ZSJA 4IX1A 3EVZA 2OM2A 3RS8A 3C3MA 7YASA 1IEXA 1SBQA 4ITUA 4BKUA 3NNNA 3FPBA 2IT1A 4DWVA 4IPTA 1ESDA 5JSQA 5CA1B 2RAVA 2CDRA 3WWYA 1TC1A 3U3XA 1EK5A 5T8KC 3TE7A 2WJHA 1SO8A 4MW2A 1OYYA 1VCNA 5JV5A 2V4MA 1E2PA 3FR8A 4BZZA 3WLFA 1QANA 1VZ2A 2PVPA 3MYRA 2J5XA 1TKBA 3U17A 2VXBA 4EB6B 1H8HA 3JRXA 2X4DA 3EWIA 4P1ZA 3UYKA 2O6HA 5AUOB 3D0RA 1NHWA 4O2BF 5L3ZA 4DDVA 2O2JA 1K7SN 4NJEB 1G8MA 1S5PA 1IBKB 1ICEA 3M4ZA 3IESA 3DAFA 4EA9A 1GYPA 3PIRA 3FKSA 1R8SA 2R68A 3S70A 4G26A 2E18A 2BCGY 1GVHA 4U2CA 3H9BA 3PHIA 4ZP1A 5JD4A 3D7KA 4JB8A 1E9EA 1HM5A 1II0A 2XE4A 3QHAA 1PQYA 1HBJA 1THMA 3QU5A 3AJDA 4G1EB 1DHTA 4HDKA 1DDGA 1OXSC 4PONA 2A58A 1U0RA 1K89A 1MIHA 1NI4B 1V3TA 2Q4OA 4G09A 4AKGA 3ZWAA 1FXSA 1HORA 3N07A 3O84A 4CVNA 1HURA 4EI2A 4MW7A 3AUUA 2FFQA 1ZGZA 1DC8A 3EQ9A 4NZPA 3CRRA 4QUAA 3LQFA 4U8HA 2JGFA 2X8JA 3DP7A 4J0CA 4H31A 2R8OA 2RHWA 3SWWA 1A1SA 2X0KA 5ALEA 1HRKA 5BSVA 4K8RB 1FFAA 1WM1A 3BTSA 4IIJB 4TXNA 3F5DA 5IT0A 2JCXA 5E7MA 3KAPA 4IEEA 2PMFA 2VHUA 4EMBA 3O83A 1E5LA 2NIPA 4RA6A 1A5ZA 5AJVB 1UBSB 2AYYA 1TO6A 3A6DA 5EZ5A 1EFRA 2BI8A 2BGMA 4K9DA 4KNYA 3QV1A 1XIVA 4L8YA 3H84A 4XM0A 1YBFA 1MH9A 1WW8A 4MWSA 2DHRA 2EEPA 3EY4A 1J8YF 2G80A 1HFWA 3MOIA 2WHYA 3FGZA 3MYYA 1Q3HA 1VLJA 2AH5A 3CRMA 1RM5A 2PXAA 3NALA 3UY4A 1QOZA 2I4OA 3LG2A 3RHTA 1RXVA 4M49A 3QKIA 4TTTS 2W4MA 3MB8A 3IHKA 1WKVA 5P8WA 1JIUA 1Q0SA 2P79A 4C7XA 1IH8A 1Y9JA 1Q7CA 4FC7A 4TKVA 4MVJM 1IJFA 4TVSA 4IX9A 1D9XA 4TMXA 3H5TA 4YO7A 3IQEA 1GG8A 4B80A 1RW4A 3TUJC 3KJZA 4FIDA 4I55F 1I2MA 2I29A 2ZSKA 4UCXA 1U31A 2PNJA 2GXSA 1JDPA 3KKQA 3AIIA 5HF6A 1KZ1A 3KSMA 1LA2A 1NG9A 2O2IA 5CA1F 3EVBA 4G84A 1EQUA 1H65A 4B6EA 1H2HA 1ISRA 2C92A 1H5QA 2WWTA 3KZ1E 5TXGA 5IT4A 5K99A 4YUAA 221PA 3OFSA 1EK6A 4HDMB 1C3JA 3ZDXB 3NHBA 4FNMA 4E2FA 3T38A 2ZAGA 4TZKA 4UOEA 3M6MD 4V0MA 5DF1A 3E2IA 2SHKA 5HNKA 1Z17A 2A0UA 2VDNB 2YZ2A 2FZ4A 1CUUA 3K0BA 5DRYA 5HS6A 2XB2A 4F5EA 2W6JD 1OKKD 2GN9A 1IVSA 5BQ5A 1K6XA 3DP9A 1D2GA 4BLQA 3X44A 1Z0SA 2YY6A 2I78A 1KC3A 1T0BA 2ZTSA 1JQDA 3MJHA 1E79D 1NQXA 1NG1A 2ZYDA 4IJWA 4R5MA 4XPIB 5GIPE 2IYZA 3DPSA 3NOQA 1BCSB 2YXLA 1RRPA 3MC1A 1Z68A 3RJ9A 5DEOA 1JEDA 3DKVA 1YB6A 3JQEA 4AUEA 1IAQA 1U2DC 4EVSA 2DULA 3K1JA 2DERA 4FLEA 4DS3A 3HWWA 2VL7A 5BWMA 3C24A 1CDEA 2J3DA 2J4FA 3I3SR 1X92A 1NP6A 2AR0A 1U2SA 3B70A 3W7BA 3F4KA 2A5FA 2RCNA 2WMYA 4ZVOA 3ZWYA 5LJIA 4JP1A 4MLPA 3PJRA 3O3MB 4H3VA 3CVXA 4DIUA 1L5HA 2Y93A 4IIJF 1UK7A 1RE1A 2OY0A 3BDVA 4ROSA 4A3SA 3URKA 4ZC1A 1BWRA 4CU2A 4EG1A 3C39A 3Q2OA 4LQDA 4FFDA 4EJMA 4E32A 3G59A 4QRHA 1YAHA 5LOVA 1G6OA 2Q9CA 2XADA 1ZL0A 3GRVA 4HK4A 3U3ZA 1QIEA 2LIVA 3HO8A 1PBNA 3WDMA 4Z7JA 4QOIA 3EMBA 3M5CA 4NOJA 3F47A 4U7GA 4DLTA 1ZH0A 3UG7A 3I73A 4Q9NA 3N8DA 3ERCA 2Q5OA 1GTZA 1FSGA 2YWGA 1EM8A 3EMKA 4AK9A 2J7PD 2IP4A 3PXAA 1P29A 4TYYA 5TARA 4D4KA 4OSPA 4BQOA 3ADBA 2AKYA 3DM5A 4PX9A 4E14A 3STTA 4RM3A 2FZ5A 1AURA 1GP2A 2B8TA 2YV2A 3OJWA 4QUIA 5E1OA 3G82C 3WYFA 3VV2A 1I51A 3D54D 1Q7GA 3PX7A 3ZXYA 4AI6A 2IWHA 1FLAA 3RAEC 3IQHX 1CEQA 1XQWA 1NQWA 1DKPA 3EXIB 3HG7A 1Y4ZA 1C7JA 3K94A 4KQGA 4M9XA 4N6GA 3QPWA 4E2WA 1YDMA 1MAHA 3QBDA 4A23A 2GM5A 2RAFA 3BE5A 3GLVA 1P8JA 2WPNA 5HJ7A 2CXRA 1FFXA 1WPRA 5BNZA 4Z4QA 3NFYA 1G98A 4LRXA 4DMGA 3TSWA 1K3FA 4MWGA 1P6UA 1QFJA 4HS4A 4LF9B 2VSYA 4OB6A 1P6XA 1DUVG 2B7CA 3OF5A 5A7HA 2GETA 1IN6A 3V2UA 1U99A 4E15A 3S81A 2XCSB 4YAIA 4LRQA 2JFFA 2GB4A 4RS4A 1D4ZA 4RK5A 2VHXA 1MF7A 2IEIA 5D1HA 1LPAB 1ZEJA 4QJ3A 4KLRA 4DV0B 2I33A 4C7VA 1ONSA 4YQYA 1JG1A 2ZP1A 3LIPA 5CJPA 4MP3A 3RPEA 4L8LA 4OIFA 4U0JA 4BV8A 3ILHA 5AKIA 4FS8A 4XH9B 5JAPA 4W9MC 5HBGA 2HQBA 1PTJC 1RQ2A 1WY5A 5LCXA 1QOQB 5I4KA 5KKNB 1ABBA 1ZYUA 3H5OA 1H2WA 4NABA 1Z7YA 4W5WA 2ZAYA 4XWKA 2GBFA 1UWLA 2FSVA 2IEBA 4MWBA 3OPYB 2OZPA 4QFBA 2QT9A 3Q9UA 2C2KA 4XWTA 5JSKA 2DPLA 2FW8A 4NDZA 3P9YA 3LCUA 2PJDA 4OUKX 5CURA 2C7BA 4NNPA 3ICVA 3TLGA 4PF1A 5CT6A 4PFSA 4Y1RA 1OXUA 1JG7A 3PNSA 4X45A 3W1VA 3ABQB 3W8RA 4D8UA 1MZPA 1KSFX 1HFJA 1VP3A 3TI7A 1S2DA 2FR8A 3KEQA 5U1PA 3CWQA 1ZRHA 3TOXA 2IPAB 3QLUA 1P8AA 4HADA 4R1OA 3K1AA 2HW8A 1XLWA 3DDWA 2KX7A 2Q21A 2OXRA 3GLFA 2PEYA 1GCGA 2QW1A 3ZHZA 1HT1E 1R7RA 4ASUA 5CVUA 2OO5C 4D9KA 1FU7A 3BGDA 3JASB 3ZHVA 5G4KB 1G42A 4ZMBA 1BJRE 1N2CB 4YMIA 2PSJA 5BWOA 1GZSA 2C1ZA 1Z4QA 1WW2A 2GWHA 4I2NA 3RVDA 1L3BA 2ENWA 2GM3A 5JHGB 4RPHA 2BTEA 3VR2A 4DCSA 2CFOA 2J31A 3E27A 1L5YA 3AH8A 3LGSA 4J9UE 4W8GA 5CTAA 5I4CA 1ECGA 1ZGBA 2ZRAA 4W7SA 4BUJA 1LLQA 4JUBA 1DIAA 5JARA 3O91A 3ED1A 4MGHA 1QVAA 2C1EA 1SBHA 4XCVA 1TNDA 1T2DA 5K3FB 4GAEA 4L9AA 3WP1B 5DM60 1FEZA 5JD3A 2V0CA 1C1XB 1LLCA 2A2ZA 3DT6A 3LV8A 3AEQA 3SSMA 2IUEA 4MRRA 1R4ZA 4PW0A 4UNSA 5K3AA 1NY5A 2JEYA 3VR6D 1GUFA 4MUFA 4YV0A 5EWJB 3DKPA 4F8EA 4D8YA 1NUAA 2A1TS 4NCNA 4WTOA 5EE1A 4L6AA 5FO1A 5TPWB 4M0PA 2Z2YA 3RT1A 1N1MA 5DK4A 2R1TA 3THRA 3R5SA 3MMPA 1EDDA 4RH1A 4M21A 1C8LA 1A4IA 3HLYA 1M2VB 1O0BA 1KF0A 1IB6A 1UM8A 2D74A 2PS3A 4ZT2A 2IU6A 3B5IA 3V4VB 1Z34A 3VDXA 5GJBA 3ZIDA 1WMFA 3W6OA 1CIPA 3E9CA 3FF4A 5LYJA 3ZH9B 1O9GA 3PQ4A 3D0KA 4BU0A 2Q3CA 4BIIA 2EQ5A 1M2KA 1RFLA 3KHTA 4B6JA 4UNPA 2CHFA 4L78A 4AMYA 4MAAA 3WXMA 3TEMA 4L74A 4LJ4A 3KUCA 3MW8A 5BV7A 2EFEB 1TI7A 4AXXA 5B7NA 4YBZA 1YV9A 1GDHA 1T1JA 4DJTA 1KMQA 4ZARA 2OQVA 3WIDA 2V4ZA 4PZYA 3I6ZA 4NTZA 1UMDA 3CSUA 2IS2A 4PZAA 1ST2A 3GHYA 1TMGE 2ZZNA 2UUPA 5J5AA 4DQUA 3HA2A 3DHWC 3QVWA 2X19A 1WMBA 3SI7A 1JXAA 2CZCA 3AFNA 3F3MA 1ODLA 5FT9A 4FJ1A 5CNMA 4QDJA 4MVJG 1ZI8A 3UWDA 1UDCA 3KOOA 1MPXA 1W75A 3UQYS 2BHSA 1QH8B 1L8QA 3GNLA 4I5FA 2B36A 4YCDA 3DQQA 1N9GB 3AY0A 2WDZA 4JHLA 4RVUA 4KQ6A 2ZETA 3OIDA 4DLYA 2EZUA 2RHJA 4ZQEA 3LGXA 3T5PA 4RZIA 3I0ZA 2I7VA 2JK1A 4I4TA 1JDSA 3WIUA 1CYEA 3OIUA 2G25A 4QGFA 1BJKA 2YVUA 3JQ9A 3LECA 2MMGA 4JXJA 1CY8A 1ZDMA 5EE0A 3R7DA 3U4DA 4DSZA 1TEHA 2JC3A 4LTNA 2B2XA 2NZUG 1E9VA 2OWDA 2P6OA 2IIVA 3KNZA 3KWFA 1JG4A 1T2CA 1G19A 3OFNA 4IKEA 2XNHA 4IUYA 2VCYA 3F3SA 1W25A 1QFZA 4TV8A 5E2BA 2ZYWX 1FK8A 3OKPA 3WVNA 1NVUQ 2D2VA 4DV4B 3ZWCA 3IUQA 3VRHA 2ZJFA 1IOLA 4N39A 5C7OO 1HYBA 1ONBA 3L6EA 4P7BA 2OO7A 2A7QA 1PWYE 3H6KA 4OHUA 3PGLA 4DDTA 2B83A 1YS6A 2DMRA 2H1FA 1IN5A 2NXCA 3P2EA 3TOCA 4Z4GA 1X8JA 2ZJ2A 4B3RB 4D3SA 1NYLA 2OV8A 4Z51A 1KMNA 3ESYA 3RASA 2J3QA 4HEQA 1CP2A 3CKMA 3GVIA 3M34A 5DTQA 4CI0B 2IZ6A 1MEOA 4LC1A 3EIOA 3B8HA 3WGNA 2C4VA 1ODCA 3R0ZA 1KXJA 3E70C 3HM2A 1T4CB 4AO6A 2L82A 1OXXK 1OFIA 3HLKA 3W9BA 4EL5A 5JBQA 4TYNA 3EPLA 1WXDA 2L69A 1TFRA 1KVTA 5IXYA 2BUCA 2PJUA 3H97A 4S1VA 1HF3A 1Q1GA 3RFXA 3FCEA 5L3QA 2BTOA 5CD9A 4S1PA 4ZVRA 3T4UA 1GTL1 1SU4A 3RC3A 1P18A 4EW3A 5IVIA 3PQ6A 3EZFA 1BE8A 5A6VA 2F7SA 1PJRA 1QHNA 1M3SA 5KZMB 1KQPA 4M55A 4QO7A 3ZWDA 3RJTA 4OP1A 4NPCA 3OPYI 2C9MA 521PA 1I80A 2D1RA 2WJIA 3JWEA 1JQAA 1SU6A 1VCOA 4NK4A 4R2JA 1MEJA 4V2IA 4A0RA 4NDNE 3EIQA 1G5PA 4EUHA 3FOCA 1PTKA 3ZQUA 1Z0AA 4WPGA 2BELA 2WUFA 1XVTA 3SOZA 4FWTA 4G0OA 3DE5X 1VSVA 3H9EO 3X0DA 3BMCA 3TTXA 2IUSA 1TT7A 1ZQ1A 1FSZA 2BFEB 3Q5GA 3GFOA 1FY2A 1I1QB 1ZOIA 1GV0A 2YW9A 2ZB8A