4RAOA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
197
Chain Sequence
ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSRSIPMTVDFIRLKLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 72
structure length 197
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4raoA00
3S5JA 1VSTA 1QB7A 2H06A 5KAMA 1YFZA 4RANA 3GGJA 4RAOA 3HVUA 1D6NA 2GEBA 2YZKA 2JKZA 5ESXA 2AEEA 4RQBA 1NULA 1J7JA 4RHXA 4TWBA 4LZAA 1G2PA 1BZYA 1ECCA 1A96A 4FYMA 1JLSA 1ZN7A 4KN6A 4LYGA 1O5OA 1R3UA 4QYIB 1A95A 1Z7GA 2IGBA 3OZGA 2VFAA 4MB6A 3OHPA 4WN3A 4ZFNA 1DQPA 1CJBA 1FSGA 1U9ZA 2H07A 5BRNA 3DMPA 4QRIA 3ACCA 1I5EA 1NONA 1QB8A 1A4XA 3KB8A 4M0UA 1OPRA 4X45A 3H83A 2C4KA 2JBHA 5IPFA 1DKRA 4X44A 5K51A 2H08A 1U9YA 5BQOA 4LZOA 1AO0A 1XZNA 4PAWA 3ACDA 5BQPA 1QCDA 1IBSA 3LPNA 4P81A 4P3KA 1P19A 4P84A 2HCRA 3N2LA 4PFQA 1TC1A 4P80A 1G9TA 4P86A 1VCHA 1P17A 4F8EA 3EFHA 1ECGA 1UPUA 1HMPA 5KAPA 1XZ8A 4RAQA 2JKYA 3GGCA 1XTUA 4P83A 1HGXA 4RACA 1W30A 3ACBA 1XTTA 2P1ZA 4S2UA 5BSKA 5HIAA 1UFRA 1GRVA 1OROA 1ZN9A 5EUCA 1VDMA 1UPFA 5JSQA 1Y0BA 4IJQA 4M0KA 4JITA 1P4AA 3M3HA 4WMLA 2E55A 3O7MA 3MBIA 2PRYA 5IAOA 3MJDA 2WNSA 2XBUA 1OREA 1QK3A 4RHTA 1I0IA 1ECFA 5JV5A 1BD3A 2FXVA 1A3CA 4RABA 1P18A 2PS1A 3G6WA 1QCCA 5ESWA 1STOA 1DQNA 1ECJA 4RADA 4JLSA 1G9SA 1DKUA 4LYYA 2DY0A 4Z1OA 2PRZA 1GPH1 4M0PA 3GEPA 3DEZA 1ECBA 1LH0A 1QK5A 3OZFA 1A97A 1A98A 3LRTA 1G2QA 1QK4A 4RV4A 1L1QA 1I13A 1JLRA 1MZVA 1PZMA 3NAGA 1V9SA 1I14A 4RHYA 1ZN8A 3DAHA 4OHCA 4QYIA 4P82A 3QW4B 1O57A 1BD4A 1XTVA 2JI4A 1DBRA 4RHUA 5E38A 1L1RA 1TC2A 1I0LA 2EHJA 4RQAA 4LZNA 1WD5A 5HKLA
chains in the Genus database with same CATH superfamily
4UCWA 5FEMA 1B0ZA 5KAMA 1P4GA 5CCBA 4QKQA 4E31A 3RVPA 5I8WA 4NL4H 2QTVA 1BNCA 4OHWA 4U0JA 2OGWA 2RI6A 3UA4A 1VXRA 1JTFA 2ECFA 4JYBA 4X41A 1EAYA 1ZOLA 3FGZA 3BMOB 4LY6A 3A05A 5DH9A 2XUOA 1VG1A 4O2AA 2O0LA 1T9KA 6CHYA 4W4TA 3DOFA 1YCDA 4J2HA 1UFKA 2ZPTX 1PCXA 2J67A 4FYMA 1ZUNA 1AHNA 2E7ZA 4KLCA 3U19A 3BPSA 2FQYA 3L0OA 3H9CA 1L8LA 4PNPA 4F5YA 3W77A 3ZHZA 3KQHA 3A4MA 1YR7A 1FNNA 3AUKA 4M98A 2C4WA 1JUDA 2DMRA 1E66A 1J56A 3SC4A 3D5EA 3T5BA 2XQKA 3U4DA 3UGJA 3GH1A 3ZV4A 2Q5CA 5JO0A 3AVYA 3STHA 4AURA 1N3YA 1FX0B 3INNA 1N3LA 1XDWA 4KU4A 4RTQA 1J90A 3SWWA 3RFXA 1EUZA 3JATA 4TGLA 2I9KA 2H18A 4KIFA 5LMZA 3T38A 1Z2AA 3M49A 4OGWA 2EFCB 1KPHA 3DV2A 3IE0A 3H99A 4HDKB 1QWSA 5CW2A 3G7SA 3H42B 5AICA 3SVTA 2DSNA 4HWOA 3PSHA 3QBDA 1NAHA 1TQHA 1SCUB 1EX9A 1UIMA 2OO7A 2VYND 4MYUA 1HZJA 5IH7A 5LMUB 3WGVA 2GN9A 2QRPA 3CEJA 3D0KA 2WIJA 3F96A 5F9HA 3ELDA 3GCWA 4DABA 2AI2A 1P4RA 2VP4A 4X84A 2KBFA 2M1ZA 3CS3A 2ZCJA 5U4QA 3IAUA 5F4BA 3K2EA 2ZJ6A 3OHSX 1MT3A 3SZMA 2QVLA 2FDRA 2XA2A 3FA2A 1XQYA 4O29A 2IYLD 1WUIS 3E7XA 1U1GA 4I9FA 3TNJA 1W0KA 1SUAA 1JB1A 4B4DA 3FTCA 1O0SA 5B64A 5KWIA 3GEEA 3WSVA 4B74A 5H4HA 3N0XA 4DLPA 5FL7D 3QUQA 4R8LA 4YRDA 2ZTMA 1FYVA 3JW8A 3ZDXB 5JSZA 2V5VA 4MPRA 3VDNB 1MV5A 4Q12A 1JQAA 1D2NA 3U49A 3ADKA 3V4ZA 4LPSA 4ZEVA 5K0CA 2G7MC 3DOIA 3LHDA 1PR3A 1KHTA 1N6IA 3PUXA 1J42A 4HN4B 4B5LA 4G26A 3B3AA 3NIBA 2DT8A 4NYJR 3VUFA 3TQHA 1QTQA 4Y6OA 2DR2A 2Q5LA 4HFRA 4G65A 1SZPA 4MPJA 4ND7A 5JPCA 5CBKA 3U6KA 4JYAB 1NFRA 3DVLA 1QTIA 3WYDA 1NA5A 3D8HA 2QW8A 3W2IA 4AL4A 3CUKA 2YMPA 1C7JA 3TTVA 2Q7DA 3UJ9A 4ZGBA 4CQMB 2H1HA 2DBRA 1ZNYA 2J48A 4DRXA 4J49A 3QWFA 5E95A 3SHQA 3E3NA 2AD1A 1FYWA 1YB2A 5JWHA 3NX4A 5D3MA 4LNUB 2HSEA 2K7ZA 3QIAA 1L3CA 2H1IA 3CSSA 3FB4A 4QJ4A 3PUZA 4CV0A 1SUSA 5EJFA 2H0RA 4WK0B 3WL7A 2VZ0A 4FM9A 1RPZA 3QXXA 3AL2A 2ZUCA 4EF6A 4AFNA 3TZKA 2QVGA 4KV9A 3ZC3A 1RQXA 3P0IA 3DCIA 3AOEA 4LDQA 4WXEA 1E2MA 2X0DA 3RU7A 1Z0IA 3LOQA 1GTVA 1S4MA 1TFRA 1F48A 2FLWA 2I65A 3LTEA 4XUGB 4YACA 4EJ6A 3B8EA 2LRHA 4OAPA 3RUEA 1RJ9B 1NXQA 3ESXA 4BUCA 2BTEA 1P2GA 2X0NA 1PAUA 3FPSA 4QTTB 1CVLA 3A3NA 1SU4A 5IT9A 1M8FA 3LWDA 4KQWA 4NZZA 2YMMA 3D6MA 2EYQA 4K87A 1XMOB 3NIFB 1CJMA 3QUTA 4MHOA 4MKZA 3UJ8A 3W5JA 4DMGA 2O8VA 2ODQA 4HUJA 5B3KA 7REQA 4BFZA 1SKBA 2NZVG 4LAFA 1HURA 2ATXA 3G68A 1PR5A 4HEA6 1CEXA 4UZSA 5AM2A 3WL8A 1KY3A 1YZ3A 3E82A 4GGPA 2O1EA 4KMMA 4Q16A 4ZVVA 5SV2A 3X1XA 1SHJA 2WYOA 3DULA 2DFLA 2OD7A 3OM1A 2WF9A 2RGNC 5IPFA 3V4RA 3KT8A 3OETA 3TTWA 1UMDB 2V65A 2CJFA 4P33A 5L7YA 4L6AA 5A0TA 3WRYA 1EVLA 3G2IA 4DLBA 3OY2A 4BJ6A 1XAIA 3DZGA 4AI6A 2JAUA 2DBYA 2RH4A 3I9V6 3QUAA 3T0GA 5EJ4A 1JEYA 3D8SA 4R2IA 1MW8X 3DNPA 3CCBA 2Q1SA 2WC1A 4D57A 1O54A 2PX5A 5AVKA 1XTRA 3EOBI 4GZLA 2CC2A 1LTKA 3WTCA 1L4YA 4JVOA 5HFAA 4GG1A 2DXIA 3QSGA 1Q5PA 4D8YA 3CR3C 4R68A 4AF7A 4MYHA 1TLFA 2WJ3A 4QHYA 1ZGHA 1TYBE 4J0HA 2ZYVX 4D6PA 2IH4A 3OZSA 3ECAA 3AZQA 1JAHA 5G0TA 1E2EA 1FFHA 3JVVA 1Q92A 2B5WA 5ALTA 2V0CA 3A0UA 4GKBA 5C1PA 3E5MA 3KB6A 1Y3BE 1AN9A 5FPQA 3OLZA 2FUG1 3MWGA 3W2HA 3V3TA 3V8MA 1VA4A 2SBTA 5IDYA 1U0TA 2O57A 1NW3A 2GXUA 2C83A 5IYZF 2C29D 3CIFA 3L0PA 4W9NC 5K0FA 2EERA 2FQXA 1FF9A 3LA8A 2F55A 3D0RA 2H3HA 1WPQA 2GHTA 1KKUA 1WXXA 4KWHA 4CMCA 4DPLA 1Y8RA 4HG2A 2F9FA 2OV1A 4ZK6A 1TECE 4N40A 1QDEA 2A57A 1KJYA 1FTSA 4P5EA 1N8KA 4JYCA 2QY6A 2FFBA 2HLHA 3F8WA 4OUDA 4G1VA 3HSKA 1KTVA 2IF2A 5L45A 1JJAA 3G85A 2PZLA 2DY0A 1ZK1A 3P9PA 2CZCA 4FONA 3CPEA 2H63A 4KXFB 1XROA 4WT7A 1N32B 4RD3A 4D4MA 4QTUB 4GYKA 5D7NA 2JIRA 5LP6C 3QUCA 2NZYA 4LRUA 1SUPA 2HPZA 2ORED 4IM7A 2PWPA 2XAUA 3W8FA 3H1FA 3ZE6A 5JH7F 1NXOA 1BOFA 1WDLA 3KZVA 2Z6QA 2GX6A 3HFGA 1YRWA 4XB6B 1PK7A 2YIDA 2FWPA 5K4GA 3EXHC 2IZ6A 3F47A 4YRKA 4FKMA 2GD2A 2L42A 3PCTA 4RHUA 4XVHA 3QFCA 4C78A 1E6UA 5BSEA 1KS9A 1RXYA 4MMZB 4M9RA 1ZZEA 2ZWVA 5IMBA 4BBAA 3GJ0A 1NNSA 5A6SB 2IW1A 1GTMA 3O2SB 2WTUA 5I9SA 3FOBA 3PL5A 3G8YA 2Z98A 3G0BA 5CMLA 3A9VA 1EEHA 2UUCB 1M67A 1W85A 1HA3A 4TL8A 5K3FB 3TM4A 4D3XA 2VA9A 1SB9A 4D8XA 3FDJA 4GZ6A 2BDEA 4M89A 4QGSA 2F3QA 3NOQA 1GU7A 1LRKA 2C0CA 4LZAA 3N0TA 4PHGA 1CUCA 3SBXA 3WLSA 4B5KA 3PIIA 1QE5A 3R0JA 4EGFA 2Z0MA 2D59A 3GF4A 3RYTC 2IXDA 1K92A 2G88A 4MAMA 1BJRE 4JL8A 1U9ZA 4R83A 1I6LA 3TINA 3BRWA 2I29A 2XB8A 3NVKI 3TFWA 4UHKA 3LXRA 1IBCA 1ZC4A 2UUOA 5J59A 3EAFA 5EKXA 5I7HA 1B0PA 1QSGA 4Q9KA 1KAGA 1YZNA 1SKYB 3L79A 1OCEA 4JZYA 5F1YA 4CN8A 4EELA 3EIUA 2HB6A 2CVQA 2Q49A 4YAWA 1UDXA 2XX3A 2WKPA 1GGVA 1NR5A 2D62A 3CH6A 1JKJA 1FJ2A 3MUNA 1QIGA 1YL7A 4AN4A 1CUDA 1GPAA 3ONFA 4ZOEA 3FCXA 5DX0A 5AQ1A 5KOYA 3VBCA 3O8RA 4EMBA 3RBXA 1Q44A 4YRFA 4PRYA 4MAAA 1CTQA 4Y2UA 3GEIA 2X8BA 2DP4E 4H0NA 4Q1VA 4QQ8A 4E11A 3EGDA 4LISA 5ECDA 4WXPA 3U26A 2GAOA 2YHSA 3RADC 2UUBB 4CEIB 4NE9A 4FZ5A 2XVXA 5CFRA 1S4QA 1D3AA 4J6FA 1NRJB 3P1JA 4GR5A 4OHPA 2D5AA 3HDGA 3T4XA 3D6UA 1EFRD 2XE8A 5AIBA 5ENZA 2I2AA 4U7PB 4XTRA 2BEKA 1OT5A 1KO7A 1TEVA 2Q46A 4KK3A 4M1KA 3TDMA 5B6PA 2C7OA 1VE9A 2NU6B 4Q9DA 1YDWA 1FJXA 2O5CA 4EUHA 1OGIA 1CULC 1ZSYA 2M32A 5CGQB 4R84A 2I2FA 3RS2A 2P1RA 2GO7A 2HUNA 2OXRA 4WRRA 5JZVA 2GAIA 4X1OA 3BXHA 3Q6NA 1LDNA 1RAHA 2KX7A 1JFTA 3I62A 3TW4A 2VC2B 4J0IA 4O4JF 4EA6A 4M9UA 2Y76A 1OX6A 3VAYA 4FE3A 1N4AA 1OWNA 4UQLA 3II6X 1ORTA 2PNFA 3OCJA 4E94A 4RF5A 1C3OA 1STOA 2WSLA 4PZCA 1JR3A 1QFYA 1H2EA 3SOZA 3L43A 5IYZB 1M83A 4HNQA 5AKKA 1EPUA 1VC2A 3PQ3A 4IIHA 4UUNA 3DW1X 2KBEA 1LX7A 2ZI4A 3HYCA 3I73A 5AM3A 3WADA 5K0GA 2RG1A 3V4OA 6ADHA 1TTPB 4L75A 1ZRSA 2WD7B 1DC8A 3JR3A 2O8FB 1M6NA 2EBHX 4BCBA 2IOFA 3L41A 2QN1A 2IYEA 1UJNA 2YNMC 2XTMA 3DYVA 3DVQX 3FHOA 4PY2A 2QUIA 3EASA 4CMIA 1CUYA 5HILA 4RELA 3RIEA 1CKEA 3BHNA 4J2TA 3RW9A 3AL3A 4E3ZA 3LOPA 3CLTC 4E3WA 2SCUB 1H23A 4G0YA 4L73A 2ZRAA 3I01M 1W88B 3DQZA 4WERA 5DWVA 5E6RB 5L40A 3RTGA 1E2JA 3TLMA 1XKQA 2VLBA 1YO6A 2JHAA 2PRJA 2XNKA 3KU4A 1AK1A 4RVSA 1ESEA 3L7AA 3GRFA 2BSXA 2ZJ1A 4C3VA 2PUWA 2ZBUA 1MMFB 3QBVA 3RUCA 2I2BA 2VHJA 5CU7A 4CKBA 1ZIYA 1S8FA 4Y1GA 4EW3A 1ESCA 3JVUA 2EFDB 2QL6A 2E4VA 4R54A 1DMSA 2JGDA 3CWCA 1QZUA 4U7FA 4GGMX 4UD6A 1UZUA 3LVQE 5IXYA 3CZRA 1NE2A 4YT5A 2J0EA 4D8UA 2IHTA 3U4IA 1F20A 4HL6A 4YDHB 5KYXA 1EGMB 5HHTA 1G8MA 1RLUA 1Z37A 3TDNA 3WOVA 4DDVA 2WJWA 2FEKA 2PKRA 4DF3A 3MTBA 1FDOA 1GPJA 2XPCA 1NKVA 3OX2A 5BUQA 1MXFA 4G56A 3UEOA 3VYVA 2WD9A 2WWTA 4D80A 1JAZA 3HPQA 4KMOA 4P22A 5CCEA 3L7LA 2IX9A 3KZMA 2W2QA 3PX2A 4NJMB 5KZMB 1K08A 3IIKA 5BY2A 3R44A 2CFSA 4DLXA 1RLMA 1E61A 3D5QA 2ZYUX 4HXEB 2NGRA 4IUDS 4EYGA 4S04A 3HKBA 3AJ9A 4TVBA 5JSUA 5CBPA 2BMEA 3GZTB 4MGKR 4M87A 2VQFB 2C2BA 2OV2A 2AKYA 4MS1A 4FLMA 3TEMA 1E1DA 4F91B 4GQBA 3AF6A 5IMSA 5AW2A 1Y1RA 2OO5A 5B4TA 3ETGA 2Y8EA 3DTYA 3GBVA 3DFIA 3I58A 2H48A 1N5DA 1L9KA 3L1VA 3WK7A 4BBPA 5CDGA 5IM4F 4KWCA 5TPZA 3AV0B 3MJSA 3KU1A 2ZAOA 3BCHA 5EUQB 2AFVA 1AA6A 2VXYA 5CXSA 5H16A 2XE4A 5NULA 5BV7A 3GP3A 4KPUA 2YRXA 1Q50A 3ND5A 1Q22A 1O3YA 4JU8A 1EZZA 2XYGA 3VDMA 3L2OB 1MFZA 3ZCRA 3UJNA 2NPOA 1T10A 1DX4A 3LY7A 4JYPA 1WABA 4AWBA 2QORA 4BHTA 2YH2A 3AIIA 5TGDA 4N8SA 3A4IA 1XDSA 4KQ6A 4DA9A 4WUVA 4YXWA 3T3DA 4EY3A 2C03A 2VNAA 4LJ4A 2PR7A 3SX0A 4ZV4A 3P9IA 3LCCA 1CUVA 4D82A 2ISQA 3C3MA 1LDGA 1X9HA 1MOZA 1T24A 1A0OA 2C5AA 1ACJA 2HGSA 2PT9A 3GJ6A 4HADA 2R97A 3S3TA 2O8CB 1GQRA 2HCJB 1IWPB 1DX9A 2QAJA 2POCA 2E5LB 3O82A 3NBZC 1U2SA 4A03A 3OD5A 3Q3VA 3GAFA 1QAQA 1GAWA 2O1SA 1QGUB 1J5XA 3FHLA 5B37A 4D5GA 1W7AA 1VFPA 4KAFA 3EEQA 3UK6A 1HDZA 4KE7A 2WAXA 4KKXB 3FCYA 2WTEA 4DS3A 1N2JA 4J90A 5ALJA 1EKXA 1LSSA 3DDCA 4AP9A 1GL6A 3PGA1 2G9NA 1D6SA 1V16A 4WN9A 3K9NA 1EUDB 4KZKA 5DYTA 4GXQA 1VKJA 5FI1B 5CEEA 1TTHA 5EVJA 2IEBA 2QYSA 3AR6A 3NCHA 2OG2A 3H5IA 1Z0DA 4A91A 3PGJA 5H0IA 4EG1A 4EG3A 5IS2A 2G9QA 5DTQA 1C2YA 1L1EA 5C4IA 1OH5A 1KGDA 2OQ2A 4PX2A 2ANCA 1JQLB 4QUHA 1KNQA 3SJUA 3IPRA 1CJKC 1U8XX 1RXCA 5JJBA 3ZVRA 1B6RA 4V0MA 3S8YA 3MTEA 4OB6A 5A3RA 2ZATA 3TSCA 2AG8A 4OCZA 4C2TA 1PFVA 1FYXA 3O1IC 3OOSA 4FHFA 1DAPA 2H1FA 3OX4A 1X1QA 4IH9A 3UJPA 1TM2A 4NFYA 4O2BB 4U1RA 1KEWA 4ZHQA 1TA9A 1J9GA 3REFA 1L4EA 2VTKA 2GPAA 1MJGA 4HB3A 3GLGB 2F64A 5FAXA 4ARVA 2PZGA 2VDPB 5CM8B 2W2KA 4LWPA 1E0KA 1XCGB 1RLTA 1BE0A 3GLUA 2HJWA 3A27A 4EHDA 2DTDA 4EQZA 2YNMD 4FILA 1MD9A 1T5LA 1AK9A 1TX4B 4AK9A 1GFWA 2W4MA 3DBIA 2PT5A 2Q3EA 3DWGA 4PS1A 5EUBA 4Z0TA 3ZHQA 4TS4A 1G55A 1SVKA 2Y66A 4YRNA 2YJ4A 2TECE 1DV2A 2IZ1A 3HNOA 5H7XA 2O2DA 1BC5A 2RI1A 3CLTD 4K6HA 4QUEA 4YAEA 3KKZA 4ZD6A 3OMXA 1XPJA 3U4AA 1JIXA 4FD2A 2XTJA 1RBQA 1DCKA 2FP3A 2QY9A 2Z5LA 4REQB 1GZSA 4AY4A 4JQSA 5FAKA 5KNCD 2PZ8A 3C48A 1MP0A 2LGJA 1PJCA 1T9BA 3E22A 2J7PD 3EF3A 3PD0A 4L4UA 4LECA 2P9EA 2AF3C 5BWBA 4M1YA 1I4DD 2C31A 4QGHA 1P45A 2JRLA 3W78A 4MPPA 3I4CA 2CE2X 3KE9A 3FVWA 3F7NA 3H3FA 3RV4A 1TCUA 3BJRA 4JC4A 5EHGA 4XCXA 2BGUA 2R4TA 3D2BA 4GNRA 4IGFA 4TWIA 4DTCA 1W5TA 4QM6A 3ZS8A 1E2UA 3GUHA 4R1PA 1G42A 2QL7A 4QTYA 1GPDG 4FW8A 3ZI0A 2JW5A 2X9LA 3CNNA 4PHFA 4DCOA 1VPWA 2YYAA 1K8RA 3T12A 3TLZA 2BI4A 1TIBA 2Z30A 5KYGA 4FW9A 2ZJFA 4TRRA 2QRZA 4MULA 2OBMA 4CF7A 1P7ZA 2J9GA 1CJVC 5BSGA 2FPWA 1JE1A 1SIWA 2B20A 5I6DA 4P4GA 2HT6A 1RYNA 3WAKA 3ANSA 3GZ4A 2OCLA 1Z0ZA 1Z8HA 3PC4A 3PIDA 4G25A 1EFCA 1FJHA 1PGOA 4HH3C 2VYVD 4J4TA 5GZ3A 1YUNA 4HXYA 4BFUA 4EBFA 1L4BA 2E18A 3H1TA 4K9PA 4RTRA 2YIVX 2AXNA 3IOCA 2X0IA 3PA8A 4TV9F 4F6CA 1TCBA 4J76A 3K1AA 5AVXA 2D0PB 2XNHA 2FMKA 2ZREA 1IHOA 3WKDA 2CK3A 4DMCA 3AJAA 4EL5A 1PNRA 4JB2A 2GWRA 2Q8QA 4XARA 4JYMA 2A1TS 4JK3A 4MIEA 2XMBA 4ZAGA 1IMJA 1ZA2A 3SF0A 3PNLA 1SUWA 2AI3A 3JYLA 4RH1A 5D6OA 3ZTYA 1OX4A 1R12A 1TF5A 4YBRA 1RWOA 3QQPA 4IJKA 3G5TA 3U44B 5BN4B 3QA3E 4CG3A 3VBEA 3K05A 2BEWA 2IYUA 5JQGF 1G8FA 2Y1FA 1C3XA 1FU7A 4ZMSA 3M5WA 1N8TA 2N75A 3GLHA 5AI5A 2BIFA 3N6XA 3TCNA 4JUFA 2FG5A 1G291 2RCYA 3AKCA 5IDXA 1E5QA 2BCEA 4I81A 3LX5A 3BM5A 5IZCC 4A82A 2I76A 1BKSB 5KKNB 4JDPA 3A6FA 3W9UA 4D4JA 3V8BA 2EL7A 1LJ8A 5CVUA 1BMTA 1I0LA 4DG8A 1HRDA 2PS0A 2ZOSA 4TN5A 4J94A 5KYWB 4I8XA 1I7NA 1V43A 1XLTA 5TJHA 1S2IA 1R6DA 3GEDA 2ZCVA 5AJWA 1GGJA 2EWMA 2I80A 1X80A 4YCSA 2A9OA 1VBFA 1SELA 2JKZA 1J33A 1XAHA 1YI8A 2R96A 4MI3A 4TSFD 3ZW7A 4BP3A 3K32A 4WECA 4OX9Y 4YAJA 5JW6A 2IYFA 2WVJA 2QRJA 1R8SA 1XXHB 1EFVB 3KEGA 4HGQA 1IONA 4RD4A 4XYMA 4HI0E 4IIEA 1ABBA 5K3AA 5TR9A 4UAVA 3IALA 2EC5A 1NFFA 2CD7A 5JSYA 1K4YA 2X7HA 4KO8A 3H04A 3T3HA 3PLAE 2IUSA 4CM9A 2ATVA 2GFIA 4NENB 1X7WA 2QTTA 1G3QA 1A5AB 1TEXA 3M81A 1GQQA 2HZ7A 1NONA 1JGTA 2CHFA 3RTBA 1M7HA 5AOAA 5GWXA 2BI7A 3SS9X 5DEIA 1SBNE 5L6LB 1Y9DA 2J87A 2GVZC 1GTZA 3UV6A 3Q7RA 4I1PA 1DPGA 3DYBA 3P9KA 1RYMA 1G8PA 4HDNA 1U1DA 4BNUA 2HADA 1RAEA 2W37A 4W5RA 2B25A 3GLTA 1JFSA 2EF0A 5JXHA 2LKCA 3TPFA 1QCDA 4CW7A 2FSPA 3EHEA 3O4FA 5KU7A 2FSFA 1V7QA 3E1SA 4PFQA 3I5UA 3TEJA 4FE7A 1YDFA 1Q7EA 2DKFA 1MOSA 1BXRA 4ZK2A 3CNEA 3VNVA 1CF2O 4UHCA 4OI1A 3R41A 1DFGA 2QX4A 3SVZA 3W05A 3I09A 3F78A 3LVBA 4V1CI 5AUQA 1LVHA 4AJKA 1BFKA 3K6RA 1MO2A 5ELLA 3UGQA 2QVCA 5BNWA 4DQKA 4CV1A 1XOIA 2OC9A 4WBSA 3J7AC 3WYNA 2KW5A 1ESNA 1P3DA 1BKYA 2W8BB 3NM5A 4DZRA 1Y4SA 3L7IA 3ND7A 1RTTA 1FDIA 1TM1E 2QP3A 3PC3A 2C00A 1GV0A 2EIHA 1CJSA 4FR2A 4IV5A 4NZOA 5KVCA 1KAEA 4R3WA 2JJYA 4ENSA 3DAOA 4EQ6A 5JOQA 3WGGA 4M8KA 2XWJI 2JFYA 4JKIA 4QOJA 4CLOA 2H2FA 1XEXB 4HO1X 3VJKA 1OH7A 5K8TA 4KBGA 5LN1A 5LNK6 1ZCFA 4URWR 5FOQA 2RH9B 2D2FA 3HI6A 1VB3A 2ACKA 3NXSA 2Q1TA 3GRYA 4TXNA 3W5CA 3OHMA 5CT4A 4DRZA 5J4HA 4MQ4A 2VHWA 4LSMA 4YUZA 5ADHA 1U7TA 4D9JA 4M2LA 1QOZA 5KBYA 1WZIA 2EWVA 3PQ8A 4RTSA 2BHLA 2EZTA 5E1DA 1Z5UA 2Q27A 4MKFA 3X0DA 5FL3A 1V25A 5AUNB 1XNQB 4IIUA 5AVZA 4G85A 4EUNA 2FWIA 5U1PA 2ZVDA 4WXMA 1VSBA 1SXGA 2Q28A 3N0WA 2WSBA 1X1DA 2WM8A 3OOJA 4RVGA 1Z0SA 1I9CA 3JWPA 1KK1A 3KG2A 3BICA 4H4CA 2J3IA 4OFWA 4TV9B 4A5SA 3S6JA 3KNZA 3GJQA 1AMOA 4DSOA 4JI7B 5EWJB 3DMNA 4EM6A 3TMYA 3IUYA 4OU5A 2PMFA 2HA2A 2NSYA 1DWUA 4LZLA 1JQ3A 2DFTA 1JT9A 4OHMA 2Z4RA 1R9GA 1YBAA 1R66A 2ZI7A 5E4TA 3LIPA 4HTFA 1NVAA 4QOIA 4P08A 3FYUA 1YZKA 3T1NA 1O9BA 4ER5A 3UT5A 1OXUA 3A70A 5DNEA 1E2PA 3IJEB 5IBCA 2VNSA 5B2EA 1M0SA 1NC3A 1TTTA 3NWPA 5CB8A 4Z54A 3EVNA 1ZJ6A 2FW9A 4IV0A 3VR5A 3NRBA 4Z2YA 2IU0A 2FWMX 3VOAA 3Q8MA 1PGJA 1SUBA 3HY3A 1XZAA 3JAMA 3HUUA 4J2OA 3KUUA 4BWGA 4HFNA 2A0FA 3WWPA 1GNLA 1FBTA 1RAAA 2DFDA 2GILA 2BR5A 2PH7A 3A6ZA 2BF4A 5EYPB 4FB5A 5IABA 5FA6A 4ESVA 4LFBB 5CK4A 3GFVA 4OYLA 3VISA 3I0NA 4B76A 4BU0A 2C9YA 4Z9FA 1R6BX 1WZ2A 1Y8QB 1O5OA 1TZJA 4G1CA 1S7GA 4G8DA 4CDRA 4YUAA 1AVTA 2HPVA 3A11A 4DLNA 2H07A 5JADA 3L7JA 5B1HA 2PZAA 1I5EA 2BW0A 4YCNA 4FTWA 4M6WB 1EFPA 1JLLB 4QXOA 3V4PB 3WLLA 3W2TA 2YWFA 3BZWA 4JI2B 2WDZA 3HZZA 4UFOA 2IPOA 5TPWB 1AHIA 5FWDA 1DC6A 1UP7A 3I6BA 2Q5QA 3F5FA 4IQGA 4TT8A 5GZ1A 5GIOE 1UPTA 1RXIA 4GU5A 5I7UA 3K0AB 3EK2A 5JCXA 5MF6A 4A5OA 2WV7A 3FTPA 1FQJA 1NPTO 1TUEA 2W6NA 2QLNA 1M34A 1E4EB 5D01A 3RYIA 4Q01A 4RVCA 1GV1A 1OIVA 4AMGA 2YOFA 2VHYA 3I5MA 1RCTE 2GPNA 3MTAA 4A7PA 2BSQA 3HO8A 5ALIA 3TQSA 1TI7A 5ICGA 3FY4A 3OEEA 4JHLA 2J3LA 3UY4A 4BV2A 2AR9A 3RAFC 4ZREA 1RBYA 1ZONA 3L6OO 4CL3A 1TD9A 1XRQA 4Q24A 3HMQA 2WT8A 3VVCA 4DMUB 1V7CA 1G3UA 1NIJA 2D2EA 3CF4A 1UFRA 1DOHA 2C61A 2A5GA 2KB0A 1GUYA 1ZISA 4G5FA 4J43A 5ECGC 3AKZA 5K6TA 3OQHA 2RCNA 1OYOA 3N3BC 1EBBA 5K0TA 1WSWA 2EGGA 3O8LA 3GLIB 3JASB 3M4JA 2VLIA 2LNDA 4WBNA 4M53A 1GA1A 4KXNA 2XR1A 2HX1A 4LRSB 2IHJA 2OBFA 1L7NA 2Q5FA 2V58A 2HHAA 1FVXA 1T6XA 1YJAA 2BEUA 3KT3A 3PC8C 2Q3BA 1TLTA 4EKEA 1ENYA 1U80A 1TNDA 4UAJA 2JDIA 3P5SA 5CVEA 3JQ9A 2NNLD 2CBGA 1TFUA 1WW8A 1Z5WA 4H4DA 4PG5A 5EMMA 3HS3A 2FPUA 3TLXA 4NOKA 1ID1A 2D5IA 3MRSA 3TB4A 5JFTA 2VKQA 1VHJA 2EF1A 2WHEA 2XCUA 3D4NA 5EZYA 3UWDA 3MSXA 4DPMA 3VH2A 5JDCA 4N12A 2BHTA 1N4DA 2JGAA 1CU1A 5F2EA 3SS8A 5KQLA 3UUGA 1QCCA 4QDKA 2PUCA 2WIKA 4U9HS 2G70A 3WYGA 1M2VB 1L7VC 2IIBA 1SVUA 3JALA 3OT1B 4F04A 4KGVA 3I1IA 3KD2A 3MB8A 5JCJA 1ARZA 1UAAA 2AFHB 1G5PA 3IPYA 3AVQA 4YLEA 2CXHA 3P4XA 4HNSA 5AKGA 1V4VA 1KU6A 3U81A 2XQJA 4MCHA 1A8HA 2R6DA 3EA4A 4L8LA 3ZDBA 3H87A 3DD5A 1PZMA 4RL6A 4BMYA 1JVNA 5EE5B 5KVAA 4IDQA 5L3QB 1DP4A 2V3CC 1CB7A 3AHCA 3AONB 4NPHA 3MCAA 4K9MA 1UC4B 2GO1A 2PWAA 1QG4A 1BQEA 2QRVA 3GRVA 3NHAA 3F5SA 4D44A 5LQRA 4PNZA 4KTTE 4ZTUB 4Q00A 2C04A 3M83A 4EKGA 2ZXUA 2F4NA 1U2DA 1SCBA 3B8HA 4IDGA 3WYFA 1SQFA 2GPSA 4WFQA 5LCXA 2I03A 1QB7A 4ZYVA 2FR0A 2BM8A 5MN6A 2X13A 1ITZA 3VFDA 4OX9B 3NBXX 4JP5A 2XA1A 3HZOA 5ICMA 4E5UA 3HB0A 4IOKA 3E48A 3IAM6 4GP6A 1ZX1A 4M1WA 3D6HA 2NXEA 3CRNA 4I2NA 4EY4A 3BHJA 1L5OA 3AU9A 4ZU3A 1XQ1A 1BDBA 2F3PA 5JISA 2LDBA 1T2FA 5EL0A 2KQUA 1ND6A 1P2TA 1NF9A 3PVCA 1G66A 3KJQA 1RPAA 1SIOA 1R3UA 3ABIA 3GL9A 4GPZA 4U2BA 1H8EA 4MW4A 1KY2A 2WM3A 1DQPA 2DPLA 1I3KA 5AHOA 1YRYE 3VAAA 1J99A 3BE5A 4ND4A 4Q3LA 4C43A 4L0DA 1RI4A 1VGRA 3B1WA 3EQ2A 1MOPA 2Q4OA 2X1HA 4IINA 3K6SB 1X94A 3PUJA 4B3XA 3GRRA 4PO9A 3U56A 3IE1A 3AT1A 2UYHA 1SQSA 5KTPA 5EJ5A 4INZA 2JEOA 4HY3A 1TUBB 3ACDA 4B7XA 1AUOA 3MK31 4YRTA 5ESDA 1KMCA 2FPSA 3K09A 3OFKA 2MOKA 5DYNA 3DWEX 5K2MA 4BVHA 4Y9DA 2YRWA 3MF4A 3K73O 2QN3A 3IOEA 4UAGA 2FEPA 1S89A 1OBCA 2OBYA 3M9LA 5DNDA 1KFBB 1R37A 5EQTA 1CR0A 1CY8A 2EARA 3MMSA 4F45A 1GZ5A 1QIDA 1RVV1 2JA1A 3RSOA 1J0DA 3H18A 4LX0A 2QX8A 4Y98A 4MWDA 3UBTA 1WOMA 3WOHA 4NRDA 3PC6A 3OZCA 4JI5B 1XZPA 3QMMA 4E13A 3EPLA 3JSXA 4Q7LA 4U3JB 3L4BC 2NYAA 4B17A 3JQBC 1VMIA 5GONF 1HNNA 3QVOA 2VOJA 1AQ6A 3MWLA 1JDPA 1S3IA 2GFQA 2Z1DA 3C70A 4FYHA 2FZLA 2PL5A 4L15A 3TRDA 3U40A 3UK7A 4CR8A 1J5PA 4PCUA 2E37A 5IK2A 3I76A 4OXYA 3ADPA 1PJQA 1T0UA 2BJHA 4MZXA 4GI5A 4L5JA 4I19A 3INTA 4Q1EA 2CYAA 1BHJA 2RHMA 2Q5OA 1QQAA 3LPDA 4EPWA 3T9DA 3WGNA 1J25A 3B2NA 2ADFA 2WVGA 1XZBA 4E0BA 4OBXA 3AFMA 1RXVA 5E4FA 2IPAB 3K0SA 4WKCA 1UDCA 2JIZD 3HBFA 1VL1A 3FZEA 4H7IA 4IRUB 3QLVC 2HM7A 4MVJP 4J7AA 4X63A 2O06A 1ELOA 3HWSA 4BN4A 1G8GA 2X15A 1S5PA 4RY0A 4MKXA 2QJTA 2AYYA 3OX1A 4HGRA 3TOCA 4CKZA 1L1QA 2X86A 3ICVA 2ZULA 4E07A 3KKEA 1JQ5A 5AM5A 4ND8A 4F6RA 4M1EA 3EN0A 1JU4A 4AKSA 1HH4A 1N5IA 4GS5A 4WQMA 1FQKA 2WHQA 3TR0A 1XZDA 3V6LA 1QLJA 2BZSA 4F4FA 4URXR 2WKWA 1LCIA 1LRJA 1PNQA 2O19A 2DECA 5IU6A 3LIIA 1WXEA 2QI9C 3LUGA 4I99A 4IBOA 2W00A 2WU8A 4OGFA 4CI9A 5CD1A 4HYEA 1A4XA 2G76A 4DXDA 5ERGB 2OXFA 2UYQA 4ZDJA 3O1JC 4W63A 2LCQA 3QI7A 2ZE7A 2XYHA 3IHWA 2WM9B 4HOYA 4UD2A 4KYUA 2XZOA 3RFCA 3CUYA 2EVWX 2J0VA 4M3NA 4KB5A 1KJWA 1ZD8A 3I9FA 5BO5A 1W5FA 3DE4X 2J5XA 3TW8B 1FX1A 2X5XA 2NXWA 4B79A 5K0JA 5LP6B 1BJKA 2O6LA 4O4HA 4X71A 1DWPA 3FCOA 1VJTA 5D51S 1VSQA 2YXPX 2Z1NA 4ZXFA 1PE0A 2C96A 3VDRA 3T5AA 3LO8A 2XW6A 3L8GA 2AKAB 4KQGA 4GPEA 2OGTA 2F3UA 5DLEA 4JC0A 1UBKS 1P5JA 2WK1A 3UC9A 2IX3A 3THSA 4OLAA 3E9YA 2VHXA 3QEKA 3L5OA 5D87A 3CF6R 1NMQA 4HHEA 3AR8A 4WLVA 2B4TO 1EU1A 3FCSB 3OFNA 1II8A 3UJ6A 4NEQA 4UMEA 5HWSA 1N36B 2QM3A 4JDUA 2GA9A 2A9KA 2HCRA 4Q19A 3LLMA 3KAJA 2ZVJA 3WK6A 4CTJA 5C1BA 3ZQKA 1A9XB 4HEA1 1RPTA 1GUDA 4M9ZA 3U3DA 1I01A 1JIKA 3VPHA 4AD8A 2Y99A 3WJAA 2B9VA 2HBRA 3JARA 4V0SA 3PHBE 3VI3B 3HA7A 5K2OA 2QN9A 3Q2KA 2BISA 2I34A 3EEBA 3EGXB 4EATA 1C4KA 1UZNA 1AJEA 3S68A 1D2RA 5BN5B 4BGUA 2PJUA 2QAGC 3FWHA 1Z4OA 4OQXA 3P2OA 4R8MA 4LQLA 1FSSA 3I9V1 2X9VA 1OY1A 4EA7A 2JKVA 5CJ2A 2SHKA 5H59A 4MICA 3M6WA 1ZBQA 1DKPA 3OE7D 2QVZX 3ROXA 1JFRA 4JX8A 3EY4A 2CLEB 4MGHA 1R2QA 4TWZA 4ZZIA 1FS5A 1T3GA 3D3JA 2C92A 4JBNA 4R1NA 1I24A 4X8MA 1LK0A 3TXYA 1GT6A 2PU5A 4OL9A 2CFRA 4FMBB 5CA0F 4YRIA 4DZZA 3VGPA 4KSYA 1EB8A 2C1XA 4QYMA 2P6NA 4KYVA 2RB4A 3IT0A 1N75A 4O1IA 4TVKA 5CH3A 4RK0A 3UYLA 4GMXA 3G79A 1ZRHA 2G80A 1KFCB 4FJ1A 1FL9A 3IVCA 4I4NA 3AI2A 3AEZA 5GAJA 5CVTA 5FWYA 1WXHA 1ZNXA 4QLAA 2A9QA 3RI3A 5JG7A 1JKFA 1LBTA 5EUMA 1UDAA 2UXDB 4GRIA 3EIOA 3UQYS 3GVHA 4C0SA 3OZFA 3H9EO 3SM3A 4UTPA 1YZQA 1CPYA 1SZCA 1LSJA 4AQDA 3Q6MA 1MJFA 1XLVA 1NMZA 1EVYA 1QE3A 1VYVA 3NBKA 1DWQA 2NV6A 3GR6A 4C5CA 5IX8A 3C8DA 1JQKA 3QW4B 4MARA 1N78A 4NCAA 1HETA 2ZDHA 3H75A 4MUHA 2DYKA 1RP7A 5H68A 3NGLA 1ZFNA 5ULLA 4AO6A 4N3GA 3QFRA 3TKLA 1J6UA 4NCJA 4JVSB 4B4OA 2QZSA 3IXQA 9LDBA 1YJCA 2MYUA 4ZCTA 1O4VA 4CNBA 1U6KA 1P91A 1Y80A 2H7CA 2KSQA 3QX9A 1E32A 5EHQA 1U98A 3SDZA 3IEUA 3ADCA 5CVCA 1A7AA 2ACWA 2WSSD 1BQ4A 1GO2A 1L4MA 2CNLA 2FRDA 4O4IF 1M2WA 3EIQA 1O9GA 1PBNA 1ZYUA 1VGVA 3DAFA 2VP0A 3IXLA 1NNUA 4FOTA 2NUPA 2Z2IA 4A8HA 3VYTB 3R7DA 1CVRA 5JXGA 3IKJA 4KIWA 1TO1E 2P3OA 5LP1A 1ECCA 1PT7A 3ITEA 1JIIA 1K88A 4UBIA 4XR4A 1OLUB 1V35A 2I4LA 2R44A 2IS1A 4JMPA 1VLZA 2F48A 4L9SA 5CP8A 1CG6A 2XWPA 1G5IA 1J5EB 1K7EB 4R9UC 4FR5A 2V8OA 1OILA 3TIGA 2YVUA 4XPZA 1QKJA 1UADA 1ISPA 2X8LA 1R0BA 3DO8A 1Y6ZA 3ZXSA 2PMCA 3E0QA 3IQFA 2H51A 4RD1A 2FPIA 3UMJA 2OILA 4LVUA 4PQRA 2EW1A 4DIEA 3HP1A 1SIUA 2C84A 2H08A 4RGQA 4BFXA 1WCIA 1K3UB 1O6ZA 3T9CA 3T7RA 4HNAB 3A3OA 4J4HA 5DNCA 4X20B 4AJNA 1T5BA 3IMCA 4BNLA 3ITNA 1GTG1 3LHIA 4XWGA 3JSAA 1YB1A 1MC4A 3CURA 4BGIA 5AYVA 3D8BA 4C0KA 4LEIA 4BQPA 5DNAA 4PYRA 1RQGA 3EUAA 3H19A 5DM2A 2F43A 4KVGA 1GGFA 4PZZA 1SQ6A 1NLFA 4KVAA 2OORA 5FPPA 4N7JA 3GUUA 2ZS7A 4GKKB 4RD2A 1FVFA 1EWKA 1V2GA 3DJFA 1V8ZA 3IS3A 1U0HC 5AK6A 4HZGA 1OW3B 2PGDA 1GR1A 4JGGA 1J21A 2HV8A 3RRMA 2WNIA 4IDOA 3KV1A 2ZBVA 1TZ2A 2BLNA 1REQA 3BAZA 3Q98A 1V8FA 4MJ7A 4NOJA 4HAUA 3R77A 1H9AA 2MIIA 2X2EA 1VJ0A 3TAHA 1AM4D 3TIIA 2G71A 2O0MA 2GZ3A 2WZBA 2JEYA 3BKWA 1JZQA 4P38A 4PBSA 3FPEA 4DHEA 4DLKA 1Y8CA 3GG9A 5I7RA 1FRVA 1MAWA 1OYVA 2HLDA 2D1FA 2NZJA 3GI1A 3GRKA 3PPYA 3PQ2A 4M0CA 3WGQA 5K6RA 5CB4A 2P9FA 5CUQA 4QULA 4W5NA 2QM7A 2AMVA 1TM4E 3QF4B 1NKSA 4N0DA 5I3ZA 3MQ2A 4WCVA 5DYWA 4BYGA 1X2BA 1MO4A 1YQEA 1YZVA 2Q29A 3ND6A 5LKRA 1ORDA 4ZEWA 4WKPA 2GZDA 2PRKA 2ZIXB 3RVNA 4XH9B 3EVBA 1CJUC 3C8UA 3PFGA 4AJJA 3AJRA 1QU2A 3ZHBA 3C6ZA 3UGTA 5AW8A 2GM3A 2ZUSA 3AUXA 4KDRA 5T4FA 3D3QA 2D0IA 2GR9A 3THOA 3SEQA 3O84A 1J22A 4UBJA 1NW4A 3IP6A 5HZMA 2PZBA 3OOEA 3R3JA 1AKNA 1PG2A 1OKKD 2EFJA 4BP8A 3KT6A 4EK9A 1INLA 2HSJA 4AJ4A 5IKPA 2YVKA 1WQ1R 1MABA 3D0OA 1FY2A 3ZHVA 1P9OA 4UU7A 3B36A 2H8GA 1S8OA 1Z16A 2ZJBA 1KDZA 3E4CA 1DRKA 2A86A 3A9UA 4JJZA 3FGOA 3MYRA 3MJVA 1DC3A 4H4EA 3GC6A 2HRZA 2Q3CA 3AP1A 1UWKA 3O5AA 4QHTA 2ORIA 1EVKA 1OHHA 3VO1A 4LRTB 2D1YA 1GSIA 1MAAA 4H6WA 1JV2B 1P80A 1I6MA 4N82A 1U3GA 3M2TA 2OXCA 1RS0A 2VH1A 1BZYA 2B61A 5FOSA 4CLDA 3JD2A 4RX1A 1W93A 8OHMA 3LX6A 3K70C 3DTVA 4OQMA 5SZIA 2G08A 3E9CA 1JWLA 1DXHA 4KRGA 3I64A 3KSUA 1Z7GA 1E18A 4WKOA 1SA0A 2YWDA 3PUVA 1CS0A 3PU6A 3PQ5A 4FOLA 3D3WA 4QAQA 3U2QA 4C29A 2QR2A 4UREA 5SZHB 1AA9A 2HJ9A 2I6SA 1EFHA 1EFDN 3WRYC 2OD2A 2JHGA 2X4DA 4M88A 2IZOA 5BVGB 1GZVA 5CXQA 2DE0X 2IBSA 2B83A 3O0TA 2XDWA 1S7CA 3P4UA 3W5IA 1IRIA 3FTNA 3OZTA 1YRAA 2IODA 4F0JA 5F7OA 4NICA 3UT0A 4EGQA 4MHTA 1TZCA 1FQOA 1GDDA 3VVMA 5KEIA 3DMFA 3PFIA 3RS7A 2F8SA 1QGOA 2RC6A 1ZJ4A 3WQBA 5A7FA 1XTSA 3DCYA 2GJ9A 1MAVA 4MQFB 1ISGA 2QTHA 3LYAA 1BGXT 3OWXA 3QOXA 1VE1A 2DTEA 4DCGA 4MWSA 3T7EA 3B2EA 2Q8NA 5K99A 4EUKA 5LMNB 3ASUA 2XKBA 3MINA 3IT1A 4G0ZA 4F7WA 5C32A 2B35A 3KR2A 4YGYA 2F59A 2CXQA 4MW5A 3EFOB 4UUQA 2ZE5A 3BMNB 5D5QA 1HNXB 3F0TA 1XQWA 3ZIAA 4GOJA 5A2GA 5B12A 1U2QA 3HCBA 1XD2A 3PHHA 4HD8A 4JI1B 4DANA 2E5FA 3WYCA 3IURA 3QW2A 3HCCA 2REXB 1NPDA 1KEEA 3ELBA 4LF5B 1BXGB 1WLSA 3B1XA 1VLVA 3CZ5A 1I2MA 2VPZA 5AM1A 5JV5A 2BRUA 4CM3A 2VT2A 3VZCA 1TDJA 1P1BA 3QNUA 4R1LA 2PMEA 3WLMA 3IBFA 3FFBA 2W48A 4RHCA 2ZRIA 3QKWA 3AEYA 1WDTA 4PIVA 5F1KA 1CY1A 5BMVB 1X1SA 5A9SB 1WUKS 3BXPA 3KHSA 5IJ9A 4OGKA 2ORVA 2ZAYA 3QBJA 2QQGA 4Z0HO 5LD2C 4FGJA 3RS0A 2EBUA 3CVVA 2BGRA 2C2WA 4OLHA 3W4JA 1W1WA 1SURA 2AHRA 2D7CA 1TZKA 3OQ1A 1QIJA 2HK7A 3O31A 1W0KD 2DLDA 1KE1A 1GAEO 1QRDA 5G0WA 3SJAA 2X42A 5E9AA 5JYBA 4ENVA 1KQ3A 3S2SA 1CE8A 4B87A 3A9CA 1I2AA 2BM9A 3V2HA 4B3IA 2JI4A 1DBIA 2EATA 3DYIA 1NW8A 1VG0B 3IQGX 4MNTA 4X00A 4RZSA 4OKNA 1EGQA 3ZGZA 3KKPA 4GKAA 3RAPR 1WW2A 1N2SA 1CB0A 1SBIA 2W6JA 4KBFA 1CUJA 1JDBB 1E0JA 1VM6A 2QYHA 2V7QA 2JJQA 3E4DA 3G5MA 4AS2A 4YAIA 3ZWKA 5CVDA 2TYSB 4BFYA 1YJ8A 2HR1A 1M0TA 2P11A 2AZXA 2FP4A 4UMVA 1G16A 4RVNA 1HTTA 2C58A 1U7OA 4W82A 2P67A 3G88A 1JX6A 1NM5A 1UJ2A 2B5OA 3CG4A 3L8CA 4MO2A 3AFHA 4FYXA 2O07A 4XB2A 1KOFA 1UWLA 2P91A 2W22A 2QDKA 2WFLB 4MWGA 3WL4A 3A3KA 4ROTA 5SYAA 5AI4A 1P1RA 3EZXA 1CQZA 2B7LA 3BH0A 3K9CA 2DWQA 2IRWA 1WMEA 1FP4B 1E7SA 1ZO8A 1TADA 2MYPA 4DQDA 4QL3A 4QYSA 4TZTA 2XF8A 3QX7A 1KMIY 3WQHA 3I8OA 4JLJA 1TVMA 1W19A 4B4KA 3FYCA 1A1VA 2VAMA 2JAWA 3RANA 2Q7XA 3GA7A 1OWMA 4ER7A 3IR5A 4BKRA 5AXAA 2R8OA 1AOXA 2AYXA 3E05A 1TYZA 2EW2A 2BGTA 2WMNB 1VJ1A 2CNNA 5LQKA 5FYQA 3K4PA 3B3JA 3HKDA 4EVSA 2G1KA 1I94B 2ZETA 1OX5A 3AMVA 1TIKA 4GSLA 1H3EA 3DCJA 4R98A 4Z0NA 2G9UA 1CZUA 3QEOA 5I4KA 4YP5A 1D6JA 3K7EA 4ZVQA 4B35A 5FLYA 2PSFA 1HDXA 2HV9A 2WILA 2ZIGA 3DUFA 3LDUA 2HWUA 3HCPA 4OM8A 3TH5A 5AVRA 3E7PA 3UPTA 1FZQA 3FPKA 2BBTA 2IP2A 3NO4A 2B30A 3CGGA 2ORYA 3C3DA 3ESRA 3SMVA 3AJDA 1PJSA 3OPNA 5CR9A 2CZGA 4EFNA 2GPYA 4LHZA 1UT8A 2BKXA 2IC5A 1QRRA 3C1AA 1YOVB 1RD4A 1GSAA 5FD8A 4JI3B 4C0JA 4NBNA 3O4VA 2OLJA 4Z9AA 3EPPA 1CP3A 2Z8XA 2IEAA 5KQSA 3VR6D 4OQYA 5LXTA 1QFMA 4TMFA 4OG2A 3AF2A 5JLAA 5ECWA 5DNUA 3ZLVA 5DP2A 3JRWA 3S7ZA 3KRTA 5EHIA 5EJ8A 3KJEA 2E87A 3NU1A 1AC5A 3IJPA 4PBTA 5JAQA 2BGKA 5F7ZA 1N0UA 1VA5A 3IHKA 3DLHA 4AN1A 3SAJA 1DEOA 2IKQA 1QMPA 3GYBA 4CLEA 1KXZA 5IXJA 3KEQA 1V5EA 1HT0A 1QLWA 3TQQA 1O57A 3NPMA 5IVIA 3PPIA 1VLLA 2P1DA 1ANKA 1H4QA 1KPIA 3WG9A 4B71A 4F8JA 4XDHA 1PT9A 3JYPA 4MKIA 1OV4A 4XDGA 1LK7A 3BQMB 1XJWA 5TGTA 1ZNWA 3C1UA 5HF9A 4IEIA 3RIHA 5AK3A 4P32A 4WLEA 1EXWA 4YAGA 5HJ2A 4A9AA 5A1JA 1LEHA 3HB1A 3ER6A 1UJCA 2XMDA 2HA4A 4IP0A 5K3BA 1L6IA 2CD9A 2PD3A 4CQJA 1RMQA 2QSUA 3TL3A 5HXAA 2G4CA 4HYTA 5A02A 3PXBA 4B33A 2XWBF 1TKAA 3EXG1 3OLQA 4YMLA 1XVTA 5E4JA 2UVQA 2NU9B 2P2YA 4ND6A 1IVYA 2J6CA 3IVXA 3QEMA 1ZNQO 1I30A 1Z25A 2FPGA 1QH8A 1XWIA 2W6CX 4Q3AA 2YQ4A 5I5GA 1ADFA 1PWEA 2GA8A 2AV6A 4QYXA 3CF2A 3ACCA 4RM2A 5DNYB 1Z08A 4B45A 3KB8A 2I4TA 3PXAA 3T35A 2C8JA 5TNXA 1I7DA 2YICA 4DNFA 2AJLI 4Z9BA 3MCWA 3Q9LA 4A1OA 4LI3X 5A2QA 1Y8ZA 3AFIA 2JASA 3BTVA 4ZT6A 2N1MA 1YQUA 5ALXA 3IEVA 2WYVA 1GGMA 1L5SA 1EVJA 1VQ1A 4OK3A 2OO5C 4UC0A 1NUHA 3UXYA 4LF9B 2O8EB 5DBEX 4OB8A 2HDNB 2FVXA 3CW9A 1QGYA 2Y27A 3MD9A 3OTWA 4Q05A 4JJKA 3MAGA 1VCHA 1ONOA 4GQAA 3ISJA 1JQJC 1Y6QA 4GLLA 2B3DA 3P45A 4KQ1A 4PTYA 1HMPA 5TS2A 4IEEA 1P4HA 3U62A 3FOZA 5K0NA 3HVRA 4LS3A 2Z04A 2BGWA 1KSJA 2Y1EA 4S24A 4F38A 1A72A 5B4VA 5FOTA 1KWGA 4G86A 2MSEB 4GWKA 2B2XA 1YDEA 3KQWA 3VU3A 1JDVA 1XTKA 4IMRA 4EY8A 5EJGA 5FTNA 2QLTA 1FFGA 1QHNA 3M33A 4M76B 4FZRA 3M34A 4MGIR 5E1BA 3IC5A 5KDLA 2XMQA 3DFMA 3LT1A 1LI7A 2M6LA 1ATIA 4Y2RA 4B47A 1NIPA 2VDMB 4EA8A 1IN5A 4FMPA 1ZH0A 1GFZA 3SJCA 2GM5A 2Q1UA 3A7DA 4JJGA 5JZMA 3OCUA 5FWNA 1FRNA 1T8SA 1ISIA 4X1KB 5AVVA 4N0PA 3OLYA 1AQJA 4LJ7A 3C5EA 2Z57A 4ZQCB 4EIWA 3TGLA 4E21A 3PTAA 1LWNA 2RGCA 3AWIA 4HT3B 4NBVA 3LC2O 4UTNA 1MENA 4KXVA 1D9XA 2GZ2A 3EZFA 1M6EX 1Z4PX 1V1MB 9LDTA 2I2CA 1TVCA 2JGLA 2HHCA 3LMKA 3OH8A 4K3VA 2FSIA 1FK8A 3BZBA 4Y2HA 3HYLA 2H1OA 5LNK1 1UP6A 1P61B 1PZXA 2W2LA 3W7BA 1SCAA 3REQA 2FW1A 3AM5A 2W6IA 3R40A 4YCBA 4CVNA 4JX9A 1ADYA 1L5QA 4Q3NA 3B2QA 3EGVA 1T1RA 1P2SA 2YVQA 3LUJA 3TKAA 4EPYA 1SKYE 4J0JA 3H8JA 4PG4A 4P54A 2G82A 2JFUA 4MR8A 1GLNA 2Z2YA 1H0HA 3PSAA 4YIHA 4IF6A 4CLOB 3QLTA 4KYIB 4Y67A 3R7BA 1PR2A 2QP9X 4BP9A 3W8DA 5DULA 1G64A 3H9GA 4C4XA 1J8DA 1J1ZA 1QFJA 3IMKA 3PS9A 4IOLA 5FCDA 5LJLA 3DVSX 5HQJA 1JR3D 3CX8A 2DBQA 5EWMA 2PBZA 2FE1A 4YRLA 5T3UA 1FSZA 2CB0A 3DPUA 3MCZA 4CQLB 4DC1A 2BGNA 2CHEA 5DOZA 3ORQA 3QOWA 4HAYA 4WI1A 3ROQA 2VL7A 2PX0A 4C7MA 2EP5A 3LTNC 4DA4A 1XTZA 4RPKA 1EVZA 2AE2A 3FDIA 3IOBA 1GVNB 3N86A 2G40A 3NNNA 3P5BA 2ZRDA 3QOFA 1GUFA 4LHEA 5K4AA 2WWVD 4NBSA 3U7HB 5HDQA 4L85A 1IBLB 1EFTA 5GV7A 5E2IA 3IEXA 2WHXA 3KK0A 4PPGA 2BF7A 3Q3JB 2PH3A 5C5IA 2KPOA 5I7WA 2QI9F 1L7AA 4GYYA 3EQ7A 1X39A 4I2VA 4UUOA 1D09A 2FSSA 3A4TA 3GMTA 5CITA 1RJWA 3ANLA 1NLMA 2YXBA 1TMGE 5L51A 3GNLA 4OHBA 3RUIA 1MVNA 1WE2A 3UJ3X 3THYB 3LQ1A 2F1IA 3C3WA 1FTNA 4U7GA 4ZVLA 5JD6A 3LT5A 2Q4EA 3HEBA 4JKYA 3O2JA 3JWHA 1NP7A 2XVYA 3UVEA 4FDUA 2YWBA 4Z4FA 2Z4SA 3R4CA 3U0BA 5HIIA 3ZWXA 4BDSA 4D9NA 4MUGA 1PD0A 4L8GA 3NYQA 4QYIA 2B94A 3I2GA 2RIRA 3NHZA 5EINA 2P9CA 2JBWA 3LC7O 3C1OA 1Z5OA 1YU9A 3CLHA 4FBLA 1O6BA 1TCVA 2WKSA 2OFOA 3HJTA 1QC5A 1G4UR 1Z6XA 2XB9A 3ZJUA 3NNSA 4L95C 1URPA 4WZZA 1R9NA 2YKGA 5MFPA 2QV7A 2XTAA 3B1KA 3BA1A 3JRNA 4PLYA 4OQLA 4RCYA 2J4DA 1KK2A 3Q12A 2BH9A 3PXDA 4HS9A 4PX5A 3T3EA 1FDSA 3LGSA 2PCLA 2WUVA 3I37X 1W49A 4BGEA 3LY8A 1GP2A 4C7OA 2LCFA 3NBQA 3PQ6A 4PE5B 4PO1A 3C5CA 3HB7A 3ILSA 3IJRA 4HWGA 4JLVA 1S2MA 4KC0A 1GG2A 5JSQA 1PYOA 4JP1A 3GEBA 1W6UA 1SCDA 2QR5A 4YWHA 5FPSA 3IBYA 4WXHA 1TYCA 1WB6A 4ND3A 3IP5A 1DRVA 3TMAA 5ALOA 3RAJA 1DJQA 3VZRA 2AZDA 4ZJUA 1ZK0A 3WA7A 4LE2A 4LJLA 1DAGA 5K0BA 3LXMA 3OSUA 3TX6A 2KE5A 1R5NA 3QWHA 1K89A 1RHQA 2A78A 4G0NA 2EW8A 3HJHA 4J1TC 2OYSA 3FH0A 4UNIA 5F3RA 1HG0A 1G20A 5SY6A 1TJ3A 4BFCA 1VZ2A 4RF4A 2PS3A 3U4GA 4CQNA 2DUNA 1HQYE 1CHDA 5TPZD 4Q4DA 1NYTA 5AJXA 5HEKA 3ZCPA 4D25A 3UKJA 2A1UA 1PEDA 1UQTA 2WJIA 1DG1G 1NDQA 1SULA 3DZFA 3IHTA 3OE5A 4GVPA 3ZE1B 1IM2A 3UNXA 4B40A 4K9QA 3OURA 1OU0A 5DF1A 5DGCA 5CA1A 1ONPA 5LDGA 2C9CA 3DZHA 4ZYXA 1ZI6A 2OTCA 1JLRA 2XF2A 4MO9A 1UM8A 3D43A 1EFAA 6ABPA 4H7JA 3RYCB 4YXWD 5E9WA 4FFLA 2ZW9A 3I1JA 1RDFA 2Q9BA 3SY8A 4HJRA 1B3BA 1QQTA 2WJGA 4JLOA 3A6EA 3RVDA 3UAOA 3FNHA 3WAGA 1PF7E 1SVOA 4BNDB 2D1QA 1EHIA 2VF8A 4EEKA 2VJCA 4URZR 5CFLA 1BMFA 2YJNA 1RCUA 5P21A 2UZ1A 1ZHFA 3QV2A 1NW5A 4H17A 5E3IA 1HOTA 4CCYA 2FPOA 1LW6E 2G17A 3R0VA 3UUFA 4EUSA 4IH4A 1VKRA 1QDUA 3H84A 3DZJA 3MGCA 4W6ZA 2HXGA 2JLVA 3G59A 1GRCA 3ILYA 4B6RA 1FMLA 1AS2A 3PUYA 5LDDC 2CDNA 1F2DA 1TAUA 3AEKB 3I2FA 3PCXA 3WWZA 4YCLA 1ZGBA 5D6NA 3TF5A 4JUBA 2IL1A 2IUTA 3K8OE 3TCKA 1Y5IA 1XQ6A 4ICIA 3TLBA 3N59A 4WCFA 4EPRA 6Q21A 3KE8A 4GPBA 2BMDA 1YZYA 1V0JA 2NZUG 2IUFA 4J7XA 4EHFA 3F98A 5IAGA 1I36A 1NRXA 3B70A 3BS4A 4CHGA 2XVZA 5AW4A 4MV9A 5B58T 2NMVA 1MQAA 1M75A 3KAPA 2FZ5A 3RVRA 1WCWA 2HF7A 3L92A 3EDMA 4K46A 1QHSA 2BFCB 1PEYA 3E18A 2Z6VA 4L9AA 4RVFA 4PLTA 1QRUA 2DX7A 4N03A 3ZG6A 3GQBB 4OXXA 1E8MA 2GJKA 4DV6B 1ML3A 2QXTA 3TL2A 3GRZA 1AF7A 1NN1A 1U3VA 4LQ4A 5F98A 2WU0A 1FSPA 2QTWB 2OHFA 1RPJA 2B69A 1YZLA 3M1AA 2JIDA 5B1EA 3KBBA 2QAIA 2PSSA 2FN4A 3DHVA 5JH7A 1LPBB 1HNWB 1RACA 4FFRA 2NPFA 1FJGB 4G09A 2I91A 3KWJA 5L53A 1ZA1A 2VR1A 3AXSA 3THXB 3T06B 5G4KB 1YAHA 1U7UA 3N2GA 4D43A 5TVKA 1DZIA 1JFLA 4JLKA 1OXKB 3V00A 3V1LA 4AULA 3KXKA 5AUPB 2QG9A 3A1EA 4C6TA 1KMNA 2FSVA 3L7OA 3M3HA 3ZNOA 4EHBA 2X8AA 1SUIA 5DWDA 5J2UF 3MBIA 3K0FA 4E32A 4GPTA 1KQNA 2BC9A 2GPTA 1QANA 1UEIA 3ZR4B 1KBQA 4B09A 4ACAA 5BNFA 2W5UA 4C4SA 2Y1OA 4WAUA 3OM8A 3SSNA 1WXIA 1F7UA 2EOAA 4K86A 1KQFA 1SB8A 2XYPA 1OAOA 4GI2A 4LMRA 4O1MA 5ALEA 3O2NA 5FBZA 3PVZA 3ZPXA 3ULKA 4DV4B 5GGXA 4C0WA 2ATEA 2HQOA 1D9ZA 3B3QA 1AKTA 1XEWX 3OEHA 1LKZA 4HDSA 1WW3A 3VX3A 4BNYA 5JATA 4L0CA 3WWEA 5CRIA 3P2EA 3GLGE 1LWOA 5T64A 2IYAA 1BE1A 4FMCB 4BZQA 1HDOA 1DMRA 4AIIA 2QSJA 1FMTA 4JIMA 4RSGA 5CHYA 3SLKA 3FCUB 4CV3A 2QAGB 3U60B 3S1AA 3FYUC 3FPJA 2J08A 3T41A 1H6AA 3ZCQA 2R79A 1ZIOA 2QTLA 3FJ1A 3LY9A 5L7TA 3NHJA 1DRJA 4ZZ1A 2M6RA 2YBEA 3MS2A 3ZVKA 4LZWA 2W2PA 5B3JC 1Y4DE 3F3KA 4DMFA 4BV9A 5B2FA 1XDUA 2QHXA 3W8RA 4J0DA 1E98A 4BZXA 1FOEB 3H7AA 1QP0A 3DOJA 4Q1BA 3IRVA 2OHOA 3C7DB 4IFTA 1PSZA 2QENA 3I28A 4JJIA 1SCJA 3KTDA 2PPVA 4Y0NA 4ZVRA 3WLJA 4N7BA 3GGJA 4Q48A 5ALUA 4DJDC 5A4AA 1WBBA 4YDQA 1LUAA 3O92A 1GJRA 3I2YX 3VZDA 4B3HA 2C2KA 3ZHRA 3NYWA 4LTDA 5HG0A 5HKAA 1NY6A 2XMCA 1RJDA 3U4QB 1Z47A 4GKJB 4RZ2A 4IDFA 3WMFA 1QYVA 1ZJZA 3FDXA 4XFKA 4Q15A 1H05A 5E9QA 3S0JA 3ZI7A 2O8CA 1Z35A 1YHZA 3QF7A 1GVHA 2R8XA 5HIMA 1GZ4A 2DPYA 2AB0A 6PFKA 5GVSA 4KPYA 1P6XA 2RD2A 4F3NA 2XY4A 4AECA 5HBRA 1PL7A 2WF5A 4HK4A 4ENUA 5JNVA 2XUPA 4IUYA 2E1PA 1BYIA 3SJZA 4Z8YA 3CA8A 4O4JA 1QP7A 2OZKA 3D2LA 3IQXA 4OHXA 4XDYA 4BB0A 4IIJF 4LZOA 2QTVB 5JMWA 3NP7A 5I8ZA 4NE2A 3O8DA 1PZEA 3T7IA 4QG7A 1IBSA 1O08A 1DEAA 4B80A 1JHAA 4OP3A 1G9TA 3O3NB 2WG0A 1FRZA 3M0EA 3HU3A 4O2AB 3R7SA 3QVXA 4MP6A 4QVKA 1ODTC 5F7JA 4L3WA 5K20A 2A9RA 1P6QA 2EG5A 1YCGA 3UW3A 1TCCA 3QVTA 2FN3A 5F5NA 2HDHA 3ZV7A 1Q3TA 1B76A 3H2ZA 4ZGGA 1T6NA 4DEYA 5FPTA 2ZJ7A 4CM9D 4JLUA 2DQYA 3R8CA 1BHO1 1XKTA 3I5XA 5CK5A 2ECKA 3RK0A 1BIFA 3JQQA 1E2FA 3KYDA 3SNKA 4DM7A 3LHKA 2P62A 3JATB 3JQ9C 5FTMA 1OYWA 1VE5A 2QIOA 2B4RO 5BPFA 4UVHA 1M10A 5JDCC 4IS3A 3I6MA 2GTIA 2QRKA 1RRPA 1FA9A 2QOEA 3Q40A 4Z6KA 4I50A 3INGA 5DIZA 1T9HA 3IIMA 3DL0A 4JD5A 1Z4NA 3QKSA 5EZ5A 1Q0RA 4G41A 5JS6A 4G0UA 5HTKA 4PQFA 4H3KB 2FV8A 4J0EA 4NP6A 5BWCA 3Q72A 2P6UA 1OBVA 3KC2A 1ZLXA 4MVJH 1VKHA 3W3AA 4EI9A 1RRMA 4LXUA 3PFHA 1XTIA 3SLGA 4DYVA 4JA0A 4RBNA 1KL7A 2QZZA 2ZAIA 3WHLA 5L3SA 3KKLA 2L69A 4IRXA 5HGJA 4UARA 1AZTA 1R7RA 1TO2E 4WNCA 3SQWA 3S40A 3EBPA 5J9FA 5JARA 1RABA 2P4UA 2R3SA 3OC6A 1U3TA 3P9XA 1J4AA 3EOAI 4GOND 4KRYA 4QBIA 4ZVTA 4CMJA 2WW8A 2FW8A 1Y37A 3DAHA 4DLUA 3J81k 5BYAA 1FUIA 4O33A 1YQ9A 4RF3A 4NNOA 1JYEA 3PT9A 5I7AA 1A8QA 1T8WA 1U2DC 3E7FA 4WFKA 3RJ9A 3AR5A 1EA7A 4RXUA 2H0AA 4IO1A 5P8WA 1OVGA 5AOBA 1XN4A 2ROQA 4R8RA 2C0QA 4QOEA 2CXUA 3O3MB 3BFXA 4B4VA 1EG7A 1N6RA 2C3YA 3DV0A 2CGEA 2JAQA 1GAQA 1WD5A 4P3YA 1EUCA 1E0DA 1L3BA 3NC1C 4PICA 5AVOA 3EC1A 1KHHA 1PJBA 1MQ9A 2VZLA 2HNKA 4G1UC 3RHTA 2QTFA 5IM4A 1NLUA 4G9BA 4WIAA 1UK8A 4X8HA 3MWJA 1ULBA 4INPA 4F2GA 1N0HA 4O4LF 3CVUA 1CQWA 5AQEA 3AL0C 2X2OA 2Z8YM 4DMHA 1I1HA 2IVFA 2YY7A 4TTQA 3TZCA 3URMA 4DRXB 1TJPB 3T5MA 4UHEA 5AW1A 1UEJA 4NYMR 1ZJJA 2ZWMA 1UIRA 5D3MB 2IHZA 4MR7B 2UZIR 2VAVA 5EJEA 3TQFA 4N01A 1IM5A 5CAEA 4G0MA 1NT2A 1O6GA 2AC7A 1LTQA 3V8NA 1QRTA 2PZMA 3FNEA 3IP8A 4TKMA 2ZPUA 4ZO9A 1C4XA 4R1QA 1DBPA 1RTKA 3S28A 3S8EA 2E6KA 1FDUA 2F8TA 5JJLA 3H83A 2H0QA 4HRXA 5EOVA 4HVTA 1YASA 3KL2A 5K8IA 1TGYA 3K09C 4GMDA 1LV8A 1DKRA 4BEJA 3QA9A 3F4BA 2EKBA 5JJ5A 4U2FA 3QNMA 8LDHA 3W34A 2IEYA 2WMOB 1NJ1A 2I6GA 4CR6A 2INGX 3PEFA 4J3JA 4KXWA 3VJLA 1N3IA 2HTEA 2WOOA 3DVAA 3QE0A 1JG3A 2IIQA 3HUTA 4HYYA 1DUSA 2B37A 3P0EA 3PDWA 3IPLA 2V1UA 4D7AA 1RZUA 2Q3HA 1MVLA 1BRTA 2GBIA 3N87A 4F2HA 7REQB 3QMWA 2GASA 3WLNA 1X1BA 2B8EA 3H4IA 4C87A 4EJSA 2DF8A 1DJNA 3K70B 1WXDA 2WJPA 3FPGA 2BMJA 2ILVA 3EVGA 4JJAA 4A6DA 1FNBA 1GU1A 2EX0A 1W4RA 4DMMA 4TTIA 2CV0A 2FZVA 3AH8A 2EGHA 4J3FA 3L04A 3PWKA 4U2DA 2XXAB 1Q1BA 2XD4A 1CJTC 5FBWB 1OFVA 1QYCA 2HN9A 5ICFA 4DVJA 2OA0A 1XLWA 4MRNA 1BW9B 1YQWA 4A1FA 1KA9H 1VJGA 1TJYA 1XXHA 2XUDA 4ATNA 4UUAA 1B43A 3KJGA 4H7EA 4AZ3A 5KNDA 2XT9A 3KTAA 3KD3A 5MGBA 4M0EA 3KCQA 4DM3A 1IK6A 2PWZA 1JLMA 4PC3A 3UFBA 3WHKA 4D74A 1K97A 4NENA 3BFPA 1G21A 5KHLB 4LGYA 1PWYE 2QP4A 3MTDA 4Q4CA 1BHSA 4D1YA 4I4TA 3FNFA 4PEVA 5HA5A 1GEEA 1QVRA 1DBQA 1Z6GA 2G0TA 1AV6A 3HKEA 4Q9AA 2NYUA 1VIVA 2WSMA 1KMQA 4KI7A 4KH1A 3PYMA 3VRHA 4MRMA 4LX8A 1QTRA 4RKRA 2AW3A 5GOZA 3G7UA 2J30A 3AYZB 4N6OA 1F8UA 5AVUA 2OZLA 1UBFA 2C5FA 4B3JA 1A97A 2IPMA 5D7BA 4BC0A 5C18A 4IDNA 1M3SA 3KPUA 3WLIA 1YULA 4AZSA 1Y1LA 5C5CA 1MORA 2FF5A 4GX1A 3U3JA 1ZJYA 2R62A 3TE6A 5TQVA 2WJVA 3AQ4A 2MT9A 3OOHA 3DFUA 4HH1A 1ZUIA 1T2AA 2C42A 4QGAA 1Y8RB 4EZIA 3LRXA 1XMVA 5KTOA 1NI4A 1NDHA 4OHVA 2JH3A 2ON6A 1KO5A 3BIJA 4P2GA 1T4MA 4OUDB 5HE9A 2OP0A 2PMKA 2X76A 4S1TA 3WQRA 4IIXA 4EHIA 2GK4A 4CM8B 1PL8A 1S3FA 1P7WA 5FPYA 3DZIA 1KU0A 3D8RA 2EKPA 4ZP1A 3QKIA 2Y92A 4MLZA 1U8YA 1S1CA 3UPUA 1XEXA 3CPJB 4UULA 3VHXA 1LI4A 3U16A 3ZHTA 1G7SA 4GPD1 4OJQA 2QUHA 3FYHA 3UHJA 5LD2B 2FH5B 3O0DA 4DIBA 1VSUA 3FW1A 1CZLA 2GEFA 5T8KA 2HQSA 1N5KA 2QE6A 1KS2A 1P2FA 3A9TA 3DNFA 1JG1A 4OSEA 3W3ZB 4AMUA 3VOBA 1C0IA 2EJTA 3GLIE 3HXMA 1ZP6A 4IAOA 4NMHA 1ZAKA 4KFTA 4B85A 2FA9A 1KOLA 1UAYA 2IHKA 3GIWA 1S8AA 1H1DA 3NGXA 1Q57A 3K1JA 2EX4A 2JAHA 1W48A 3PPVA 1EMDA 3LKDA 1EM8A 5JE8A 5JBQA 3FCAA 4Y6RA 3WMXA 4N6NA 3GARA 2FZKA 3U3OA 6NULA 5EWJA 2G0NA 4AS3A 2CUZA 3Q9NA 2ZSAA 2WU3A 4FZJA 5D1HA 5BQPA 3HBMA 2HJSA 3TOZA 2ILTA 2OCPA 2W58A 3KQSA 1WCXA 4M8LA 4FFDA 1TEZA 3SEFA 1ZUD1 4N48A 3ORRA 3HEMA 1S02A 4RAQA 2AFHE 3GGCA 5LZ8A 2PG3A 3DLIA 3VR4A 2R6HA 3PNPA 4GFDA 4KRXA 2I78A 2YXEA 4DDKA 5JQGA 1YS6A 4A0FA 4NAHA 4DV0B 2DKNA 1F14A 1P1IA 4XAQA 4D26A 4FKBA 1KO1A 3F49S 2X2PA 5DTMA 3CKMA 3QWAA 4URUR 5DHAA 3G9QA 4Q4AA 2XCQA 4JQOA 3EDQA 4XX0B 1AZSC 2R8RA 3TZ6A 3TVYA 3ZJYA 1THMA 1L6RA 1X9GA 1XG5A 2C0PA 3MW8A 3GBSA 3DZBA 4CKEA 1I3MA 2ZZMA 2EQAA 1E69A 3PRJA 2WFMA 1DJOA 4QU0A 3MJDA 1XP8A 1NSYA 4PX9A 1KI1A 1UQUA 5IWCA 1JKJB 3OIGA 3GAAA 4JOQA 1Y8QA 4BNNA 1A7UA 1A9PA 1OE0A 2EBWA 2B21A 1T2DA 2GHRA 4QLOA 5JC8A 5KKCA 4G0VA 1NV9A 2DUMA 3GZJA 4IJ6A 2YZ7A 3EAQA 3Q3HA 3EGDB 3GMDA 3S70A 4J07A 4N1AA 2VTDA 1ISRA 1AY0A 2OXTA 2QRGA 1XMQB 3QJGA 2A0WA 3I32A 3SDBA 2HDOA 4EYQA 5CB0A 3V3KA 3TIXB 1G6Q1 2HQRA 3PNBA 5K9ZA 1H65A 4YP0A 3JZMA 1V6SA 3ZGNA 4BQRA 4WXYB 1L7BA 1FFDA 2XBLA 3ETDA 2C5SA 1AZLA 3NPAA 4P4LA 4CMKA 4BRUA 5IJ0A 1KI2A 1LBHA 2FMIA 4R41A 2REOA 5K3DA 1X1TA 1XZKA 3SM9A 4C22A 4P0QB 4H7HA 1NQTA 1RE1A 2IEDA 4ZOLF 5JNUA 1QTNA 2XCRB 3KXIA 2FPPA 5ADWA 3LNCA 4PZLA 4R31A 1CUSA 3T0IA 1TJNA 1ULSA 1D4AA 4IMJB 1XD9A 1VRCA 3UK2A 5J2TF 1CIJA 1DIHA 4MRAA 5D84A 4EI7A 2ERYA 2QB5A 1SFRA 5LMCA 1R5JA 1I3OA 1NVFA 1XVAA 16PKA 1C3OB 2J8ZA 2OGZA 2FRDC 1H93A 2ENUA 3ZHOA 4DR7B 4QXRA 4YPFA 5BYBA 1KAMA 4YAKA 4P3NA 1PFGA 1RW4A 1VL6A 2EDAA 2PKCA 2WWXA 4TLBA 1YIOA 5BR1A 3IBSA 4GP7A 3ROTA 1K6EA 1UQRA 1O89A 1UDWA 1NULA 3L1KA 2O3SA 1QIEA 3GZNB 4KWTA 2OAEA 4QT0A 2W0MA 1N2BA 2GESA 3Q7EA 3NKLA 4AF6A 1ZU4A 1O5IA 1SXIA 2C5LA 2CVHA 1NNI1 1ZC3A 4X0EA 4AG5A 4D41A 2P9TA 4N65A 4YPOA 1NLYA 4IFIA 1PJ3A 1UKAA 2PGIA 2QRHA 4PPQA 5CDFA 3FPLA 3ICOA 3MNFA 2DFVA 1PSWA 4RK5A 1IQ0A 1QZZA 4ZAFA 5KNBH 4JLMA 3LAWA 2V1XA 4H1TA 1PX0A 2CYCA 2GXQA 3Q6IA 1JDJA 3JQPA 4ZRMA 4FNGA 1SU7A 1A82A 3W5VA 4CKBB 3TG8A 4YA6A 2PVCA 2JGDB 3N39C 5LOVF 2OORC 4X3OA 1E62A 4GKVA 1Y89A 1H2WA 1XLUA 3PENA 5DV9A 4DXHA 3RV3A 2YINC 4BRWA 1KYZA 4YRJA 5KYXB 3W7VA 2TMDA 3LNTA 1X8KA 2K2WA 5F21A 3AEUA 2NADA 4PWYA 2JIPA 3GJZA 2LZ0A 3BK1A 4IWYA 3WO0A 1YBMA 4L8YA 1ESMA 4CLRA 2JI8A 2VJMA 3WKAA 3CVYA 2N46A 3HPRA 1P1FA 1Y98A 3F5MA 4MJ3A 3H9BA 3V33A 1UPFA 2B36A 1ZJ5A 1T6ZA 3OCCA 5KX5F 1X77A 2AJDA 3VNSA 1CY2A 1JQDA 1G41A 3PKZA 4N5IX 1MTOA 4KH0A 5ESRA 2YXNA 3W2FA 3FNQA 5DT9A 3HKBB 1Z29A 3ESBA 3QV1A 3BTUA 2FX3A 1YOBA 2IPXA 3K8YA 3PICA 5CBPB 3GGPA 4C4ZA 3F5QA 3OFND 4MS1B 5A6VA 3QNWA 5LQMA 4MDEA 4YCMA 2Q2NA 3NORA 3WK8A 4WADA 1HX7A 1KYIA 3MWEA 2QRNA 4LA4A 4N76A 1HYHA 4AWXA 4EW6A 4RH0A 2O2XA 2CCGA 3FVVA 4D9CA 1ESZA 4EHNA 4ER6A 3R6DA 2NP6A 4HQNA 3QHPA 4UFPA 4OI0A 1DUVG 2UZAA 1ZUWA 2CKDA 3ETNA 5IZ4A 4HH0A 1Q12A 2VTVA 1ZWLA 3T0FA 2C9BA 5BV0A 3O3CA 1I80A 3ZD7A 4LMPA 1HM5A 3PF8A 1L5VA 3D9QX 1TUBA 3RARA 1BX0A 4RIIA 4AICA 4KQKA 1FW6A 1KI6A 5ALQA 2GZAA 4PO3X 5LPNA 1AKWA 1I13A 1G4HA 5JEDA 3ZDRA 4I4CA 1K9VF 1L7EA 2VHVA 5AI9A 5F23A 3EZ2A 1BDJA 2GK3A 3A26A 4S0XA 5BSRA 3V4SA 3ZGVA 1ZOIA 5C8YF 4CETA 3RWOA 4LV8B 3T52A 4NCIA 1E58A 2MSLA 4B8WA 3NG1A 3PLNA 4ALJA 5EPUA 3EYWA 4WK2B 5CLLA 4LZNA 2I2DA 3LGAA 4BFWA 4BJ1A 4L8WB 2VSQA 1VIAA 3A32A 3LLUA 3QKUA 5DTEA 2J3KA 1YA6A 5I9BA 3C4VA 1VKNA 1PQ4A 4FN5A 2D6FA 3ES9A 2OMEA 1Q0SA 3HADA 4Y18A 5A4MS 1GN9A 1PJLA 1UPXA 3E15A 3ED5A 4RENA 1H2YA 1UBHS 4DG5A 1U3FA 4DC9A 4PXYA 3AVUA 3LP8A 2VDKB 4CODB 1HEYA 1NW9B 1V16B 2GETA 1A2KC 2Q2QA 4WN9B 5DSXA 3MMXA 4Y2SA 1CP2A 5EXEA 5FNVF 3SQNA 2JATA 4F5WA 1K7FB 1TVEA 3WYAA 1E6KA 3DCNA 1FZTA 4BKQA 1PNVA 2XQFA 3C8MA 1GARA 2GWHA 1PR9A 3IPCA 1F9EA 4MP8A 3QWIA 5DYIA 3H17A 1FSGA 1Y7TA 1IN8A 1Y7HA 1JS1X 5DBIA 4OH7A 4TQGA 3SMQA 3WRWA 2K7FA 5EJ6A 2ZK7A 3WWOA 4N39A 5CNIA 4CG2A 2H2HA 4TT3D 1U0OC 3RD5A 2ODAA 3I34X 5F35A 1H5UA 2WLSA 4X85A 4G23A 2AMJA 3C16C 3R3HA 1QF9A 4EDHA 4N8DA 1P9LA 4ZJYA 1MA3A 3L0CA 5JY6A 4JIGA 1SG0A 3IJ5A 1JSRA 5F4ZA 1T15A 1MG5A 5HS6A 4ZHQB 1A8IA 1JXOA 3LUKA 3JYQA 4M46A 5LUAA 4DQ0A 1BKDR 2IS2A 2N0SA 4DY4A 2JGRA 3IH5A 4M99A 2FFAA 2JCGA 4PCLA 2O54A 1Z9BA 4GDMA 4PW0A 2VAWA 3ICWA 1AQUA 3GDFA 1NQOA 2CFTA 1TL7C 4L7QA 4QYTA 4H1WA 3UKDA 1HYGA 3VPCA 1QGZA 3E0XA 4L6CA 4HNTA 1ZICA 2OWDA 3DMYA 1TYDE 3B9BA 1X1RA 1YB4A 1EE2A 2F1KA 3HG7A 1ZD9A 4JJEA 3OZEA 5KTYA 4PRKA 1M5TA 3PHIA 3ZWDA 2NSHA 2IYRA 1IQPA 1DV1A 2ARKA 1R9MA 3AI7A 3I0ZA 4J1QA 1SD5A 4QQRA 4R1UA 2Y1WA 2BRUC 1WEHA 1I2BA 1NF3A 1RAFA 2A5FA 2Y2UA 4ZC8A 5IG2A 1ZI8A 4DRYA 4E1BA 1VIDA 5LYYA 3X2SA 4DTIA 2CUNA 4ML3A 2NUAA 3MXOA 4RFVA 5JXIA 1VJCA 4CTOA 4MW7A 5F64A 4RIFA 4HUTA 1H0RA 1ORRA 1ORVA 3AI3A 3ROPA 1KAQA 3ROMA 2P9HA 1RHUA 4PFJA 1WG8A 3VM6A 3M6IA 5HS4A 1T8UA 1NBWB 2MSWA 1I4TD 2QPTA 1Z8NA 5JS7A 4EG4A 4RQUA 1YR2A 3LWNA 5G3ZA 4AY3A 2J07A 3AUJB 3Q1LA 5JI2E 2PZEA 4OJKA 4F3YA 4ETNA 5AH0A 4JSTA 3JQAA 2VS1A 1EDBA 3RFVA 3TIVA 1A27A 4LV6A 2GRAA 3DEJA 3K96A 3STWA 3R7FA 3L07A 3SN6A 3JWEA 4ZODA 4MQ5A 4MV6A 3AR7A 1OAAA 1UP4A 1QR6A 4XWYA 3MJRA 5I3CA 5C51B 1EI9A 2HLDD 1SKQA 1CHNA 4WDQA 4NONA 4BRSA 3GP8A 3PNMA 3CX4A 3ZW9A 5LQNA 3G9TA 3GJXC 2IS6A 3K1AB 4D81A 2JLUA 2EEPA 5G1PA 1ZRMA 2O7NA 3KYIB 1Q17A 1NBOA 1RFGE 2ZM5A 1LA2A 3RC2A 3EY9A 4GWLA 1JHUA 3IDFA 1QV6A 3WZMA 2ZFUA 4I8IA 4EECA 1B74A 3I52A 2CNDA 3EDOA 2PMWB 1T9AA 3RT7A 2PBFA 4Y2YA 1CQJA 2X14A 3FVQA 3MMPA 4LHVA 3K1ZA 4NARA 5IVKA 2ZITA 3MOGA 1QYIA 3ZN2A 1SXJB 3RGGA 3RAEC 4UTRA 5ICCA 1F4LA 3ST7A 3ICCA 3X1DA 1D0SA 3GLHB 1KQPA 4V1CA 2O9JA 1HK7A 3I04A 1RYHA 2GCNA 3VKHA 2BUAA 3OM0A 2G5PA 3ORSA 2ZWOA 4Q9IA 3TLYA 2D8MA 4W7SA 1LX6A 2V4ZA 4OL0A 5GONA 1NJ8A 4AO8A