4RAOA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
197
Chain Sequence
b'ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSRSIPMTVDFIRLKLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 72
structure length 197
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4raoA00
1QCDA 1ZN8A 5HIAA 1QB8A 4RV4A 3KB8A 2E55A 4F8EA 1OPRA 1STOA 1G9TA 4P82A 5E38A 1NULA 2H08A 5KAPA 1I13A 2WNSA 3ACCA 1QK5A 4RADA 4IJQA 3OZFA 3DMPA 2EHJA 3GEPA 4WMLA 1I0LA 5BRNA 4QYIB 2FXVA 2JKYA 1G9SA 4QYIA 5BQPA 4TWBA 1BZYA 3OHPA 1V9SA 5KAMA 4RAQA 4LYYA 1DKRA 1YFZA 2JI4A 4P3KA 1QCCA 1U9YA 1XTUA 1ECFA 4JITA 2H07A 1O57A 4P80A 4RQAA 1U9ZA 4M0KA 3QW4B 4S2UA 1TC1A 1GRVA 1OROA 3GGJA 1TC2A 3DAHA 1DBRA 3LRTA 2PRZA 2P1ZA 4RACA 4LZAA 4FYMA 1Z7GA 1A97A 2PS1A 2XBUA 5EUCA 4PFQA 1AO0A 4JLSA 2JBHA 5ESWA 1JLSA 4LYGA 4RHUA 1VCHA 3N2LA 3DEZA 1P19A 4MB6A 1P18A 1XZ8A 5ESXA 3MBIA 1Y0BA 1DKUA 3GGCA 4KN6A 1P17A 4X44A 5IPFA 1A95A 3S5JA 1GPH1 1I0IA 1FSGA 1LH0A 1L1RA 4OHCA 4RQBA 4RHTA 3M3HA 1BD3A 1G2PA 1MZVA 5HKLA 1HMPA 1QK4A 1R3UA 1PZMA 2YZKA 4RANA 3H83A 4P84A 1XZNA 1I14A 1P4AA 1J7JA 2H06A 4RAOA 2VFAA 3LPNA 1HGXA 1JLRA 4PAWA 3OZGA 4QRIA 1IBSA 1VDMA 1OREA 1ECBA 3NAGA 1W30A 1UFRA 3G6WA 4ZFNA 1QK3A 1DQPA 2C4KA 1ECGA 1XTVA 2AEEA 4P83A 3HVUA 5JV5A 4P81A 4RABA 1ZN7A 4P86A 1A96A 1O5OA 1ZN9A 4LZOA 2DY0A 2GEBA 4M0PA 1VSTA 1QB7A 3O7MA 1A98A 2HCRA 5K51A 3MJDA 3EFHA 4WN3A 1G2QA 1UPUA 4Z1OA 1CJBA 2IGBA 1A3CA 1ECJA 4LZNA 1L1QA 5IAOA 4X45A 3ACDA 1BD4A 5BSKA 1A4XA 1WD5A 1NONA 4RHXA 5JSQA 1D6NA 2JKZA 4RHYA 1XTTA 3ACBA 5BQOA 1DQNA 1ECCA 1UPFA 1I5EA 2PRYA 4M0UA
chains in the Genus database with same CATH superfamily
4K6KA 1QVAA 2PYIA 2H29A 2GDZA 2EFGA 2GQ0A 1ISMA 4OBEA 4QBKA 3KZMA 3OF5A 2ADMA 3SHFA 4DBLE 3P9IA 3OIDA 1BWRA 2Q6IA 3RVDA 4EHKA 3OIYA 3QENA 4QQ8A 1TAGA 2XITA 3IVRA 1E99A 1GV1A 3GIWA 1NKSA 4JT9A 3W4IA 2ACKA 1QH1A 2YJTD 2ZDQA 2DH5A 3GCDA 1Q21A 3L1HA 4PYQA 3C3BA 4IHJF 2PD6A 4B79A 5JJLA 4EDHA 1T2NA 1C0IA 4I1RA 1XJWA 3RREA 2VJQA 1WLYA 1GZ7A 3K15A 2YY5A 1QE5A 1U2QA 1T3LA 4Z7OB 2A86A 3EDRA 3FHOA 4WXYB 1GQRA 3UCXA 2P0AA 2PIDA 2RG7A 3MAAC 5BR4A 3RYCA 3GH3A 3LQKA 1Q17A 4KIUA 5AW4A 3JCZA 3CNEA 4GWLA 5K0JA 1OI3A 3WIOA 2R1UA 2WVGA 2V58A 4LHSA 4BV3A 1DUSA 2WJ4A 4YV7A 4F11A 1K7YA 4CEIA 2HAEA 3R9KA 5IH7A 1U94A 3ND7A 4H16A 3IPAA 4NMWA 1NSYA 2PWPA 1LVUA 1F3OA 2CJFA 4MINA 3WHPA 5JZSA 5KYWA 3BJZA 2QDKA 2V54A 3DMRA 4QL3A 4ZHQA 5K2MA 2AC4A 1KJIA 1D2NA 4QREA 3R9IA 3T5GA 3TCXB 2A7QA 3DL4A 3IUQA 3AZPA 3LFTA 1P9LA 3OLWA 4K5QA 4REQA 5EPOA 5JQGA 5KJ1A 2RKWA 4X64B 3W5VA 1YDMA 3H2ZA 5JO9A 3TO5A 5A3SA 3PE3A 2I91A 2VPTA 1H9BA 5DM0A 4MARA 1NUUA 3SJAA 4BNUA 4E1VA 4CEJB 1WX1A 3GLFA 1M1YB 1OFUA 3GZNB 1ZM4A 3P9YA 3KT0A 4MJXA 4OQMA 4WKNA 4ZXFA 4Z2AA 1XCOA 4CLRA 3KSAC 4J3JA 4RUKA 2P9GA 1EP2B 2WYWA 3MGKA 3CRQA 5IMBA 4BMNA 2CLMB 3H2BA 5HKLA 1BJKA 1I3LA 2VK4A 3V4PB 2RHBA 2DE0X 3T1YB 2IYVA 3NTXA 4L9RA 1MABB 3CF4A 1K75A 5AI9A 5JH7B 4HATA 6GPBA 3FCEA 3HU1A 1OYOA 5C1IA 1RR6A 1IJFA 3V6LA 5LL6P 1XN1A 4KUHA 1AURA 5HIMA 2WKSA 4GAEA 3FPKA 1QUFA 1E89A 2C77A 2PGAA 2QN6A 1DC6A 3ZY2A 1Q3HA 2QM3A 1MOPA 4CI9A 3WSTA 5KX5F 4O63O 5CCDA 1GPDG 3VI3B 5KVCA 5KYXB 4QTZA 4F2DA 3LOPA 4H6WA 4M0PA 4DCPA 3R8CA 1Z13A 4WKCA 5LC1A 1T5LA 1P9RA 3TFWA 4CDGA 3EGXB 4HQOA 3LT5A 5DX1A 3IIEA 3TUZC 1IHDA 3C85A 4N5NA 2XEXA 1PBTA 4A36A 4KXMA 1K7CA 1QO7A 2AN4A 3F74A 3SQLA 3M1YA 1KI6B 3I04M 4HDRB 2ZPTX 4FIZA 4I9HA 3KSUA 3ZXXA 2ZSJA 1LFAA 2K4MA 1JJ7A 2VK8A 3QU2A 3MJ4A 1F1BA 3TNYA 3TTVA 4BLPA 4WZAB 1SHTX 5AWFC 1DCKA 2Q9UA 4XGKA 1QHSA 2O2SA 4N41A 4ZPXA 2FTKE 2OBYA 2Q45A 3CNQS 3ED1A 5DHTA 3VU0A 5CEEA 2CDRA 1OKKD 4YMLA 2I8CA 3U0VA 1RKVA 4LDPA 4OSOA 4G5QA 1YDEA 3SXPA 4J16C 4V3BA 1O9BA 1RHUA 1M2FA 1L4YA 2XJ4A 5EOVA 3M6UA 4ZEOA 4DL9A 4LJSA 3QYAA 3D2AA 3HGQA 1JG4A 2IZ6A 1N0VC 2ZTSA 3QPWA 4NU5A 1KF0A 2JIRA 2A30A 2XX3A 5L7WA 3FYSA 5BWMA 3A1FA 3M2TA 2WT9A 1A9OA 2GK7A 2EW8A 2JFPA 4KMRA 3GRFA 3WE7A 4U2BA 3GD5A 3NOXA 1PGNA 4RH1A 4B6OA 1P91A 2QSJA 4JWTA 4UFNA 2YNMC 1M3SA 1H8EA 3NHLA 2QG4A 4Y0AA 3U80A 3GHHA 1IOLA 4GFDA 1EUCB 1GZSA 1SC9A 1QIEA 2YRXA 4MQLA 3KTAA 4M0KA 4OAPA 2DKOA 5KCMA 2Q6TA 3R5KA 4Z49A 2G08A 1OD6A 3OCYA 5KNLA 3YASA 4PQYA 5DYGA 3W2IA 1X42A 5DNAA 3UJBA 1GYRA 1OA0A 2Y93A 3P45A 5EINA 2N9UA 4YB8A 4E4YA 5HNKA 2Z6UA 2IP4A 2BYTA 2PT9A 1TT5A 4DVJA 1KYXA 3NBUA 3I6BA 5TPWB 4MEAA 1USGA 2IT1A 1KDZA 4IQGA 3I3SR 4KODA 2DAPA 4MHTA 1TM5E 5I7HA 2CKDA 3LLMA 1BOOA 4XUEA 2FQWA 2PWAA 3X2SA 2FAXA 1FFWA 2R85A 2XVZA 3E03A 4MQ4A 3O91A 1H65A 1HZJA 5KNBH 3QK7A 3S5JA 3M34A 5KMGB 1V41E 2CHEA 2CV1A 1E2EA 1V8DA 2FPMA 3OTWA 1T25A 2VF4X 4O0LA 1P5ZB 4YC7A 4Y1RA 4JLUA 3I1YA 3S1LA 4ZT3A 4Z9AA 1G3UA 1VLMA 1DBWA 2HPHA 3ESDA 5FPHA 4D3YA 3ER8A 3H4MA 4DTCA 4EHDA 3H83A 3D6MA 3UK6A 4HDKA 4KOEC 4D4GA 5KYNA 2C2YA 2OZPA 4DCMA 3RUHA 4RQUA 1E77A 4C7OA 1WVIA 3RLFA 3PP8A 4YQFA 2IE8A 3MTEA 4Z4QA 5EA2A 2X9QA 3QXXA 1DIAA 2XNHA 3EOBI 4X85A 2UXDB 2VHXA 5JO0A 3FPEA 1KPIA 4NYJR 4DW8A 1JIUA 1KDTA 1X70A 2PX4A 3TN7A 5B1EA 5GIPE 2F67A 3MK31 3O1IC 4QU5A 2ZXFA 1IDN1 1XELA 3OPNA 4LWOA 3PYXA 1SG6A 1YL5A 1WBDA 2PBZA 1VA4A 3GJXC 3JQ9A 4BMCA 1VE5A 3IBYA 4XQ9A 3TE6A 4EFNA 4AMUA 2O1EA 3E3LA 4Y2GA 4GEGA 2HK9A 1UPUA 3U3XA 4X6XA 1ZZEA 1G6KA 4Z1OA 3LHIA 3QG5A 4PLGA 3SY8A 5CB4A 3EDCA 2JBAA 4FNGA 3EPRA 2SCUB 2I2DA 3A7DA 3T7TA 5C5EA 3GCWA 1QZXA 3VHQA 1P2TA 1TPYA 2VYCA 1Q6ZA 2BFFA 3G2LA 4CQMD 2C9BA 3B1YA 3E5HA 4X54A 2I3BA 3M3DA 3F5FA 3LHDA 3LGSA 1ZD2P 4JVSB 1GPLA 3PVZA 1NOKA 2WWIA 4WZAE 1DQYA 1CZRA 2C7VA 3FGZA 3TWOA 4ND4A 2LR0A 4HGQA 1OXBB 2IEAA 3C74A 1T35A 3JQFA 1DX9A 4GSYA 3I2JA 1IN5A 4R41A 5BN4A 3MLBA 3D5QA 1AZLA 3U9LA 7AT1A 4ZQCB 2RHJA 1Z0IA 2VTDA 4B3RB 5KWJA 1IZZA 3V2HA 5JTTA 1AA6A 3G5UA 5FADA 2R7KA 2YOHA 1YFZA 2WE7A 3LS2A 2DHDA 3O4HA 2UXCB 1B3RA 1MDFA 2J5XA 1RPTA 4YFYA 1I6LA 1E1LA 5EQDA 5I7OA 2ZK7A 3CSUA 3AU9A 3PQDA 1C41A 2IPAB 4AS2A 5BVGA 2JH9A 3NM4A 1OI7A 1LI4A 3F1KA 4E3WA 3K4HA 3AUJB 2VCHA 3MCUA 1ZJ5A 1A7AA 1U7HA 1N9KA 1VXOA 4QPJC 3K1JA 2DBZA 1GU7A 1YAHA 3U7FB 4KACA 1OWNA 1UDXA 3SNHA 4E4TA 1FZQA 1SUSA 2FN9A 1Q7RA 2NTJA 3NIBA 1F3LA 2W71A 3KR0A 4HPWA 1WSDA 3H5RA 5CYPA 1ZITA 4ZOCA 4B3CA 3R3YA 5F5LA 1Z33A 3RKUA 5B5SA 3S1SA 1UC9A 4HRYA 1D2HA 5JD3A 1EX1A 3D6HA 5DJ5A 3PI6A 3AZQA 2I3ZA 3HCNA 1ZCFA 2JANA 4IVRA 4N7RA 2VJOA 2GEVA 3LYLA 4CM1A 4UTVA 4L57A 3VZQA 1W6UA 4Z3DA 4RDXA 1JJBA 4NLLA 1X77A 2ZROA 3PWTA 2FFAA 721PA 1ZH2A 4G65A 3AL3A 3LJKA 1AHHA 2C07A 2E4AA 5IUKC 3SJ7A 1MR3F 2B82A 4Y30A 5HZHA 2CJPA 1EK2A 2XUJA 3ITNA 4G0ZA 3M33A 4V3CA 1WB5A 1T15A 1TW3A 4Z6KA 1PNTA 1NRXA 1QPGA 1CDEA 1GRCA 2VDKB 5I7RA 2PL9A 3OESA 1E2NA 1Z5PA 2C2XA 2DKFA 5FWDA 5CIWA 4I55F 2IX9A 5EXDA 3O8RA 1P4AA 3L77A 1K5DA 1C1YA 5KDLA 4BO3A 1Z4MA 1M8FA 3WMXA 4WFIA 3HCPA 1ZJ4A 5KJCA 4BEWA 4Q3NA 1T6BY 3FB4A 4H27A 5C31A 2WD7B 3V4LA 2VF8A 3KXDA 4FFNA 1RWVA 5CLFA 3NANA 2KJQA 2XWBF 4LWPA 3A3YA 5F52A 1ULHA 2M6SA 2XNKA 4URXR 5TVKA 3ELBA 5BXQC 5LQDA 3R6WA 2NSJA 4LZOA 2I03A 5ITZB 2AZMA 3E5NA 2Q6VA 4OFXA 1RP1A 3MSXA 4C7XA 4LVUA 1K3TA 1LWNA 1P1HA 4EPVA 2GILA 4HDSA 3O6VA 4LVNA 3WHIA 1B8OA 4MUMA 4CUJA 1ZCJA 1NOJA 2HBZA 3QPAA 4RLQA 1NPDA 3V2IA 3FCOA 4GSLA 3B6JA 4LHYA 2X0IA 2HREA 2YHBA 4MQFB 2ZDHA 3LX6A 3W3AA 2Q1YA 2R44A 4MWSA 1UIMA 6REQB 5IC4A 3TTTA 3BWMA 4RIEA 1JVNA 2B37A 3HV0A 2XDQA 5GVSA 3T99A 3IMFA 1EDOA 1EBUA 4C08A 3E7WA 3MRXA 3HBFA 2P9BA 4GR4A 3RK0A 3HK2A 1J9GA 4N5IX 3P5BA 4PGFA 4BC1A 3D3NA 3TQSA 1E5LA 4FLEA 3K0AA 1J0AA 4DLNA 4EO4A 3I62A 3IPRA 3WLSA 3IQFA 4UUQA 3PDJA 2NV6A 5E6SA 1RYDA 1JHXA 4A3SA 4D9JA 2ZBPA 3T6KA 1JT2A 1AK1A 4ZZIA 4KHPB 4IIXA 4XWTA 3DVRX 1E3EA 3HSKA 1HFEL 2X0DA 5K8VA 5KPJA 4I1PA 4XZ3A 4GI3A 4KLNA 4B85A 2IITA 1W85A 1JPVA 5ALKA 5AJUA 2PD4A 2WHRA 1I4LD 4JLNA 4Q1EA 5HGJA 3REQB 3CVJA 3DULA 1WA5A 1UODA 2L17A 2FP4B 1XQWA 4LV8B 2YZ2A 4OHOA 3R7BA 3N0WA 4N5DA 3DZKA 1X8XA 2C7BA 3K5HA 1S4QA 2ATCA 4H4DA 3RGWS 4PZ0A 2C9MA 1U1IA 4D0SA 1VCNA 4GVXA 1EVYA 2ZKIA 2CE7A 3C8MA 3K5PA 4ND1A 3H5OA 4NCKA 4YPFA 4ACBA 3V33A 2ACVA 4JKIA 1ENZA 3DA8A 1F4VA 3L6CA 4YY3B 5M04A 4L75A 1LS6A 2PVSA 2B8NA 3W5UA 1PFWA 3M4JA 4CW7A 1AC5A 5ICCA 2PLWA 4ODIA 1IBMB 2PT7A 4JLSA 4KPUA 1DDGA 1Y7HA 2VP0A 3A3NA 1BCRA 4YCBA 3T9DA 5K8UA 3QJGA 1WUTA 1SXJA 5EGNA 1YDWA 3JD4A 1GNPA 1QGUB 2VDOB 4I4TA 1YSCA 3T3DA 4TM8A 4CTKA 2E5LB 5DI3A 2ZAOA 1Y0BA 2IDZA 2IYFA 2BTOA 3HU3A 3MS4A 2ZQ5A 2D59A 3Q7TA 2D54A 4J4BA 2NVBA 2XWQA 4JROA 4XRGA 1DIGA 3HTXA 1BSVA 3MCTA 1NN0A 1SBTA 2ILVA 2NQ8A 1DAOA 1L1RA 1MOZA 2AEFA 1NM5C 1HQDA 1NI3A 2ATXA 1L4HA 2J9FB 2SBTA 1OASA 3BXZA 4TV8F 3BE5A 4YROA 4UZSA 5F35A 4WPGA 1DIHA 1DX4A 1WNFA 3DLIA 1QVRA 1MZVA 4DM7A 2PMFA 1BXGB 3B1ZA 1VKOA 2TYSB 2KE5A 4IIFA 4ZDKA 4LX8A 1N8KA 3MMSA 3U37A 2IXAA 4DF3A 4KVGA 2CLIB 2WG0A 2QJTA 2A4KA 1VL6A 2F9LA 2NT3A 2BKVA 2Q4EA 2CJXA 2P9HA 5EWLA 1J20A 2DQYA 4TX1A 2O07A 4IHJB 5K3AA 3WLKX 3L01A 1IMJA 1UBSB 1Y3IA 3CEHA 4M4SA 1KAGA 3VNSA 2ID4A 2QT1A 4ZDWA 4CQLA 2B2XA 4YRBA 5ALQA 3BAFA 1YZGA 2WTNA 1YRHA 3TJMA 2ZRIA 5PGMA 4TRJA 3EXHC 1I2BA 3PKIA 2Y1LA 1E3WB 3NMUF 1MRSA 2Y1DA 3O84A 4BNYA 2P3OA 4IIDA 4UNRA 2D5AA 4A6DA 4ZOQI 1J2UA 2PWYA 3VDNB 3CBGA 4TVKA 2H3EA 3DTVA 5DVZA 5FOVA 1YZHA 1ZVVA 3E8SA 4NC9A 4BMPB 4RW0A 4OF4A 3D1VA 3FPSA 4JELA 4OU4A 2BGLA 2Q5CA 2DBYA 1T9ZA 1VKRA 3D7SA 5EJ7A 1YE8A 1TTPB 5AR1A 5H3LA 5ECYA 3OX1A 1X15A 3GZ4A 4HQ6A 5I5GA 1KAOA 3RK4A 1XZKA 3U7IA 1Q12A 3H75A 1KWKA 1R3DA 3AR7A 1D6NA 2GPYA 4M83A 3WXMA 3GY0A 5JWHA 4H3HB 4HXGA 4XWAA 3I9KA 1THGA 2R8EA 4UFPA 1XDUA 4LZPA 2IEZA 4YECA 4H0FA 3VOAA 1KEKA 4QELA 4KI7A 1BWQA 2HV9A 3HA2A 3PHLA 4XLTA 5JJIA 4M3NA 4UUBA 3VNVA 1HL3A 1PT6A 4BQIA 1V7PC 3H42B 3B12A 3H9UA 5A5GA 4OQDA 1DPGA 2VTKA 3V7NA 5GQSA 3KK0A 3UBMA 1YDHA 4BX0A 1PLKA 2HRQA 1Y82A 2VHTA 4GMXA 3I73A 4K05A 4ER5A 1NI4B 1CY4A 4YV0A 1REQA 1NXWA 3B5IA 3QE3A 3FPBA 4ZO9A 1JJAA 1OYWA 2P2YA 2M6RA 3A1WA 4OUDA 1FFSA 2BN4A 3MJTA 1HMYA 1JG2A 1KQNA 4AO7A 4DV7B 3H0EA 1U8XX 2AR9A 1RWXA 1PFQA 3GYBA 1PTJC 4K1XA 4U2DA 2FCRA 2QJWA 4HXEB 4LI0A 1I1HA 5GPBA 3ZDDA 1V1JA 3CONA 4NENA 1Z6GA 1X9IA 2YVAA 5CT4A 3UJAA 2PH7A 2HA6A 4IM7A 1ORDA 4UZEA 5FI0B 3ZWCA 1EDEA 2YZGA 2IXFA 2VDMB 2YHAA 4NE7A 4ZU3A 5EJEA 2R8BA 4LRTB 2WHPA 2I9PA 1M1NA 3NGLA 4GI2A 3L79A 3LY8A 4NYMQ 1KIFA 1V47A 2FWBA 2OK8A 4JJGA 2DQSA 1U1FA 4GU5A 3ZJ4A 3VR3D 3A9SA 1CHNA 1PNQA 2HJ9A 3ZD7A 1J2RA 4KYVA 2C42A 2IH2A 1LPBB 2QLTA 4HQNA 2JCGA 3X1YA 3DH0A 2D0DA 3MBIA 4JUBA 5A3VA 2FF7A 2WK1A 1EFRA 1N57A 2XSZA 3KG2A 3N87A 5F9MA 4LFCB 3ZC3A 4IZ6A 2C7RA 5MHTA 1P33A 3DBLB 4RGBA 2VOEA 4NPCA 3HDTA 3CVWA 2CMGA 1I7PA 4HH3C 4PSVA 4YV1A 2JFGA 5KSOA 1FEZA 4CV0A 1XYYA 4MRVA 3MWJA 5HUJA 3C41J 4KLZA 4KKXB 3CRZA 3DKPA 1O8BA 4KQ2A 3A0UA 4QASA 4ZK6A 1BEUB 1F6WA 1HE5A 3BMCA 3D2BA 2I34A 4IKEA 5CLIA 4Z9FA 1GA4A 5ALFA 3RUPA 3TBFA 1GTL1 3WIVA 3BMOB 5BR7A 3DBIA 1R6AA 1H4TA 3KJQA 4ZCPA 4BAGA 3NCHA 1R27A 4JL5A 1NW8A 2W2LD 1XRSB 1C8KA 1KNQA 1D8TA 1Z4QA 2VDUE 4GOJA 3QOXA 3VKHA 2J3EA 1FUYB 3DXZA 1GGKA 2CLCX 3W1EA 4CKEA 5K6TA 3C3EA 3ELDA 1GZDA 4RHCA 4KR7A 1O5OA 1GEEA 3NYIA 1KSFX 3KLMX 1ICEA 1CR2A 1Y7IA 3VKVA 1WPXA 2JHPA 2ECPA 2IUEA 2QTGA 1PSDA 2ZTUA 4TTSA 3F73A 1T9HA 4GZ3A 4ZREA 3A6DA 2VUHB 3OZIA 1S8FA 1YO6A 2BFBA 1FSSA 2XNDA 4G8BA 4J0CA 1FXWA 3DOFA 4S1PA 3PJEA 3CZ4A 1QGDA 5AI8A 4DPKA 2GI4A 5EP1A 2WJGA 1FUIA 2J3DA 2PMEA 4B4WA 2D1YA 1E5QA 1YASA 2MYPA 2PWZA 4IOKA 4LNAA 1L3BA 1C4WA 2WM9B 5L3SB 2NXEA 3D02A 1CIPA 1P1CA 2HO5A 1W4LA 3UGQA 1DOZA 5DBGA 4PX3A 3RRMA 5JSHA 3WKBA 1SIUA 1QZUA 4WOBA 2WWGA 4L8VA 4JBIA 2ZVPX 2PMKA 1PJRA 2P2DA 3N2IA 5AIAA 3KKZA 2WTUA 2YINC 3IQHX 3TLKA 2Z8YA 1YA6A 3IOYA 1IYZA 2BV3A 4M86A 2EZTA 2PAFA 4LJ6A 1IMOA 3RBAA 3BFXA 4BQEA 4EARA 2F8TA 3ZWNA 4H31A 4K46A 1DQSA 2P5TB 4PRZA 4P08A 3EXIB 4J4HA 5BSWA 5K05A 5IUNC 5KOHB 1ST2A 1X7ZB 2Z9BA 4I9UA 4A8JA 1GG5A 5L51A 2F8SA 2P2LA 3LBNA 5K0LA 1DRJA 5KAMA 2F9FA 3AOEC 3B36A 1FMLA 1UADA 1LI5A 2EP5A 2IELA 1NT2A 4YUAA 4FBLA 3OWHA 1RP7A 3NHZA 2CL0X 1F2UA 3L0ZA 4BHTA 1KBQA 2PG3A 2QR2A 5B30A 4CKZA 1U9ZA 1GFWA 2NUPA 5CK5A 5K0BA 4PS0A 3CV3A 2AG1A 1MRNA 3VTAA 4B3FX 1H1TA 3QBVA 4GR5A 3RVJA 4WCVA 2FNAA 4KXLA 1T8TA 2EJCA 3L0IB 3QQPA 3ET5A 5A9SB 3VKFA 1LPSA 1RHQA 2MHCA 3HYLA 3DEYX 4D9IA 3UO8B 1Z6QA 3X1ZA 4C43A 1O6BA 2E3JA 1HDZA 3EB9A 3NIDB 4KRYA 5EWMB 4PWZA 1QORA 2WWXA 3H4TA 1S2NA 5EHGA 4EBFA 1XSEA 2JDIA 2NZYA 1YZQA 1VCHA 4RHUA 1B0UA 3VH2A 2C4NA 1WL8A 1M2GA 2ISSD 1QG2A 3H8SA 1MAVA 1D4OA 1MIOB 2XOEA 3BVPA 3OE7A 2IYYA 2V7UA 3F7OA 4P36A 2WG1A 1V71A 3AF4A 3BXFA 2ODEA 4YRPA 3ELWA 4QT4A 4IAOA 2QORA 1NXVA 4OLFA 4PR0A 1US8A 4ITVA 1Z36A 3G9UA 4QJIA 4TROA 5H83A 3ZE9A 2JLVA 2WDPA 2JFXA 2NSDA 2HPZA 1MAWA 1OT5A 1TYCA 1XX6A 3PVSA 1P2BA 3TR5A 2G9ZA 2L18A 3CKMA 3ESXA 4AK9A 3P7MA 1XQXA 1USIA 2R84A 3F6BX 4HUJA 4C3UA 5AKEA 4YRSA 1LDYA 2Q28A 2NO9A 2AC2A 2GR9A 2A1TR 4GX2A 4L7QA 3B3JA 3NG1A 3P97A 4B6FA 1YK0A 1U8FO 3MMNA 2BJWA 3N2KA 1E2BA 3FI0A 2FPKA 2W6JA 4LYHA 2CSUA 1WXGA 3R23A 4D99A 1G8JA 1TA0A 4DRXB 5IM4F 1YOVA 3ZBTA 1PNRA 3X1JA 4YJ2A 4PU0A 4E5DA 3EQ8A 1IH8A 3C6QA 4ZV9A 2IEYA 4JS0A 2PFSA 4WK0B 2IODA 1CE8B 1TO1E 1T1GA 4DIUA 3M6XA 1UJMA 2C2KA 3DFFA 2Q2NA 3DT6A 1KTIA 2K7FA 3NBXX 2K7ZA 1ZP6A 1WDMA 4WBSA 2PD3A 1S9HA 4LKOA 1C3OA 4JI5B 3G17A 4XIFA 2UXBB 5DMXA 2Y77A 2JKVA 4LPSA 4XARA 3ZZMA 3TQTA 5BSKA 1A4XA 2ECFA 3LCRA 1J0BA 4U5XA 3WOVA 2IPMA 2HU8A 3KD2A 1DP4A 3JY6A 3ICOA 5ALHA 3TZ6A 2RB4A 3AHEA 3PC4A 4IDPA 4CMAA 3K6JA 2RGNC 1VL0A 2A7XA 1E7WA 3RVQA 2JD1A 4LVOA 4QDJA 1ZC3A 1ZEJA 3F4KA 1ULTA 3G2JA 3FKSD 4IDGA 4TRMA 4X63A 2F2TA 4JLAA 5DDIP 2FUEA 3IHLA 4EA6A 4ETMA 2P79A 2EXXA 1XLTA 2LW7A 4F97A 5I4CA 3Q12A 4EM6A 5EGSA 4IFBA 5IVHA 2FE4A 3PUWA 2G8LA 3R5XA 5CVEA 1GAEO 4D80A 3WDSA 1MU0A 1J0EA 1YWGO 3IUNA 4ZCLA 2X1LA 4EA7A 3WLNA 3IDSA 1BU5A 1SBQA 3QLUC 4RENA 4RYDA 4DPMA 2RH4A 5DISB 5DSXA 5B3KA 1W2GA 3G2PA 3SC6A 1TZ2A 2BGWA 4HR7A 3MQ4A 2BFWA 3R3VA 3VC7A 4AY3A 8OHMA 1ZY2A 2ZUUA 1TCBA 3G8BA 4CM6A 3CKYA 3W4JA 2C88A 4PSCA 3MCAA 1VSBA 4PY2A 1FFGA 3NDIA 4J16A 5AUQA 2VOJA 1F0NA 3T35A 3S81A 5D7BA 4WASA 1B93A 2V3CC 2ANCA 5H70A 4HLDA 1G21B 1RBQA 1QM5A 4KHZA 4LZAA 4UEJA 3HPQA 5DP2A 4OIMA 1I33A 3QSGA 2X0JA 3OU2A 1ZVQA 3QXJA 1Y7TA 4CHGA 2XMPA 4HVTA 4E5UA 4XYEA 4JI0B 3MQ2A 4NMHA 1OZFA 1YJCA 3DPIA 1N6NA 1QG4A 3NQ41 1M6EX 3DT9A 2JJ8A 3G8CA 3HHPA 4KQGA 1CNFA 1TUEA 3NATA 2YNMA 3SEAA 3A1CA 4P7JA 1KNXA 4RMGA 2P9YA 2YW2A 3EOZA 2FPPB 1JSZA 1Q1EA 4KE8A 4A7PA 4CEJA 3QXCA 5IKMA 3NRCA 1M1YA 3DOIA 4ED9A 4D3SA 4O1HA 2E6KA 3C97A 3FHLA 3NGXA 4L6CA 4WI1A 1J8MF 3EEFA 3HDJA 4K9NA 4WJZA 5HKAA 4CIWA 4GX1A 1C7QA 1BS1A 3EGVA 1NBMD 4B7XA 2CVPA 3G1WA 3P26A 4F3RA 1UDRA 1Z9BA 5FNVF 2Q2WA 4OY3A 1MABA 3OPXA 3RU2A 3FNEA 2IS1A 1E6EA 1QIMA 1EJ2A 1L6IA 1R0LA 1UAYA 2XUQA 4HZUA 1KU0A 1KZ6A 2VT7A 4IINA 4CM9A 3Q3GE 4DXHA 5BSEA 1R4NB 4FT4A 4R8LA 4V0LA 3V9AA 5B4TA 3A2KA 2IYPA 1CUFA 3GEBA 1J0XO 5LYJF 3LXUX 4KO2S 5C52B 4UPDA 3S40A 1U7XA 3GRPA 4ZT7A 3ZDFA 1JEYB 2PSHA 2E4UA 1NLFA 4QAJA 1U3DA 1ZQ1A 1C0KA 1QG0A 3HVHA 4DCGA 1E6CA 2XUKA 5KYXA 3FCYA 3L8EA 3E1GA 1NQTA 4ZAFA 3NV7A 4QOEA 3P0HA 5HZGA 2VBFA 2ZR0A 3FTDA 3NDJA 3TQHA 3BF8A 2R47A 1R6TA 3FB1A 4OGGA 4X60A 5FA8A 1C4XA 1Q0HA 4XEUA 2ZVQX 4Y7DA 1PL0A 5JROA 4COOA 4HDRA 2X5KO 2A9KA 4B4DA 5F9FA 2O2JA 5BURA 1YFLA 1L4MA 4CI0B 4LWQA 1T5HX 3HJNA 3W3ZB 3QOFA 2JFWA 3SHVA 3C8ZA 2VYFA 2V0GA 3ZLJA 4ENRA 1CUZA 2I62A 3R3WA 4QFBA 4DREA 1NE2A 5A7GA 3N1UA 2V6FA 5AKGA 3A26A 3MB8A 2PPVA 4F86A 1T4MA 1Q0UA 2ZZNA 4GI1A 3PTLA 1Z07A 4EA9A 3E82A 5ARCA 2CHUA 4O4LA 2H1VA 2NGRA 1U6KA 3Q5DA 1XD9A 4WKOA 1E6MA 2QL5A 3KAKA 4OFBA 4TV8B 4AI6A 4CCWA 4KQIA 4Z54A 1L4EA 3VR5H 3D4BA 1GZ4A 3N9IA 1D2AA 1HYGA 5ER6A 4EW3A 2I9KA 5A02A 2GTPA 2B78A 2ZI6A 4D57A 3GIDA 4XFKA 4TRNA 1FMFA 5C5IA 1T4DA 1W93A 3V46A 4CF3A 1I24A 3D1JA 1VIMA 1H0KA 1QP4A 1SA0A 3JVUA 3LDGA 4MRMB 4IIBA 2R4UA 2CF6A 3D7MA 1ZGAA 2CLOB 1JPJA 2IEDA 1CNMA 1W36D 1RI2A 1BE1A 2H2GA 3PUIA 3RYHB 2ATVA 1M8KA 1A9QA 1DAKA 4UM9D 5HCIA 2AF3C 1CP3A 1V3UA 2OD7A 4TSFA 4I7EA 1AKVA 2HL6A 1SQ0A 3N0VA 2HA4A 3DHNA 1FQWA 2I2FA 4EI9A 4D26A 3PZBA 2GS9A 5HFJA 4M21A 1OX4A 4OMCA 4WK4B 5L3ZA 4G0XA 1IY2A 4DWJA 1VJ5A 4QU9A 5CFZA 4TTTS 3INGA 4YVFA 1GYQA 2HRDA 5ALZA 2IXGA 1A95A 4D9HA 4MDEA 3S7TA 2GZ1A 2BSXA 4OHCA 4LF9B 2VNIA 4UAJA 4ZP1A 5KMGA 1JVSA 3G49A 4ZCIA 2X41A 5E4JA 4IFIA 1XWIA 4NEQA 4JJ8A 1ZW1A 4YP1A 1B43A 4Q3LA 5DLDA 3ZKWB 3BQNB 3CR7A 4BKMA 2AQ8A 3TTSA 1G6Q1 1WB6A 3OPMA 3QI7A 4L28A 3SK0A 3MBOA 3KFVA 5M7EA 3FOEC 1N6IA 3BZWA 3NBAA 2X15A 4AZVA 1O9HA 1YVDA 3C6XA 5L6MB 4DDVA 2BKEA 2VP2A 1UXJA 5D5QA 1P77A 1I7LA 3D0QA 1M2EA 3EY4A 3L8GA 5EIBD 4CKBA 2B2CA 2WFMA 1E4EA 1JECA 2CVFA 5HRAA 3ORHA 1LVHA 1Z15A 3BD7A 4XDHA 4LCBA 4P81A 5IF3A 2IBTA 2AXQA 2N1BA 1YVUA 1DG3A 5ES4B 1T4GA 1XTSA 1H2EA 3M70A 5E6RB 2MIIA 3LUGA 4Y9RA 3VYVA 5HJ5A 1JIXA 1PJ8A 2RK4A 3LKZA 3GFQA 4QYWA 4A8PA 5K51A 4ZYLA 4X93A 3ONVA 3GT7A 3JALB 3NAMA 2CB9A 4NAHA 4DCOA 5EAIA 3H3FA 5EMKA 2GETA 2HHLA 4E32A 4E6PA 4TS4A 4Z4GA 3IP8A 3G0HA 1L5YA 5LLTA 2Y0DA 2VSXA 1Z8HA 3DE2X 3RBVA 1SVSA 2ATEA 3L06A 3H1GA 5FXMA 4R2IA 3J81A 3A6FA 2X76A 3NP9A 3Q3EA 1G0OA 5JW6A 2QRPA 1R7RA 2EYUA 3K8QA 2WPDA 1E2DA 4LJYA 1FRNA 2WWYA 3PWZA 3RT1A 5ARBA 2D0OB 5HF6A 1RHMA 2MJLA 1KPGA 3HXTA 3LX8A 1LTQA 4O4IA 1ML3A 2JIDA 1CJVC 2AWOA 4JAVC 3EVNA 3G9XA 5EJ8A 5KNBD 1DU4A 1G66A 1QK5A 2BFCA 2E82A 4UTPA 2IUTA 5IN5A 2Q27A 1D0IA 3I9FA 3SBXA 1KEZA 2BKXA 2VHZA 3CUVA 3AKZA 3NTQA 2PDAA 1B6TA 3BPSA 4N6NA 5F7ZA 1KO4A 1MW9X 2FSVA 2ZUVA 4MJLA 2CNWA 5IWAB 4BFTA 3D54D 3D3EA 2H9YA 2Z83A 2ZT8A 2FZVA 5LQMA 5K3OA 4Y1EA 4MPRA 4I8XA 3QFRA 3OOEA 2GWHA 3OQPA 2OAP1 3NM5A 3SZUA 3AEKA 1NNUA 3UWKA 3QW4B 4BV8A 2H2FA 4BMOB 1ZH0A 4FQ5A 3DAHA 2QUIA 3AJEA 1WKVA 4MWZA 3T5CA 3M4YA 3CURA 2R8YA 1BAPA 2NAPA 2DP4E 5CEFA 4EENA 2OCLA 1TK9A 3CJQA 1SVWA 2C3YA 4AZSA 2MSWA 1GKKA 2EBFX 3I5UA 4Y0NA 1IN6A 4GXNA 5ALEA 4WT7A 4HQFA 3JVEA 3L7KA 3KHUA 3NW9A 4UARA 5JY1A 1VRWA 3IKJA 3QFCA 5GOTA 4AMYA 4MWDA 4FBMA 2GCNA 4W6QA 4MCJA 2HJRA 1EAYA 4Q9JA 3RHSA 4F6LA 5FUQA 3BMQB 4FW9A 2ZIEA 3BL6A 4FQ7A 3HLYA 5JANA 3MTBA 4D2IA 2DFDA 3IXQA 3JYOA 4LK3A 4PLHA 1QH8B 1E1RA 1O7JA 5B1HA 3ND9A 4CNBA 3HP4A 2XUDA 3OQNA 1QHFA 2FLKA 3GRAA 5I9TA 2ZWIA 2RJNA 5A4MS 3G8AA 2V65A 5BQFA 1QR2A 4CTNA 2ZB8A 1KY5A 3A6LA 3IV6A 2ZJYA 3EEIA 3G5AA 1V7CA 1ZOLA 2EP7A 1EFKA 3LCJA 4QDOA 4CLEA 4JQCA 1DUVG 1XMXA 2XOKA 3RG8A 1LW7A 3CH5A 1XNHA 1DG1G 1NQWA 4B48A 3I2KA 1ZINA 4W6ZA 4OPMA 1RYFA 2DPHA 3RBZA 3W5HA 5DK6A 3E81A 3P2JA 4A8HA 3HB1A 1NXTA 5EC8A 4KPFC 2RD2A 1W1IA 5B3JA 3FIUA 5L4SA 1UBGA 1ST3A 4PC3A 1MA0A 2OM6A 1DXQA 3EZ6A 1SK8A 1R5BA 1VPTA 1Z7BA 5I7VA 5ITZA 2G9QA 3MFYA 5FPYA 5ISMA 3WO0A 4NCHA 2EGUA 5FUXA 2AA3A 2WM3A 3ABZA 5B3AA 1BDIA 4I6EA 1ADGA 3RUIA 2QE6A 2W2PA 4MI1A 3VYRB 4IXDA 2I65A 5TXGA 4YRRA 1ZOOA 3F7NA 4D6YA 2JJMA 1KOJA 3Q5GA 5G0TA 5GOZA 5TMEA 4KVAA 4KXNA 5FH9A 5ERXA 3FMGA 1WOMA 1RCTE 3A0RB 4MQFA 4PSKA 2PUDA 5C1DA 5T6MA 1RAEA 2FPUA 5EJIA 3VMFA 4O2AF 3VUFA 4W1QA 2UU9B 2ZYVX 1HOTA 4WECA 1Y5NA 2P9EA 3EXHA 4P4GA 2PXCA 1XA0A 3LRXA 2K87A 1M2WA 4BQOA 5A9RA 3EZYA 5GIOE 2NU6A 1YXMA 5DNWA 4FKZA 4EYGA 1X87A 4A0HA 5EMJA 1T6XA 3QGMA 2FU5C 3D2LA 4NECA 5CURA 4WMLA 4YXWA 3RFTA 2ODNA 4ZWNA 1EWVA 2EKLA 3B51X 4WWHA 4W8HA 5A6SB 3FSGA 4R9UC 1IPHA 1AZSC 2Z8ZA 1P7PA 3KSZO 4OJNA 3EDOA 4HLUC 1VXRA 1FVFA 1JALA 1ZMOA 4KZPA 5JNTA 4FKMA 1V35A 3FAKA 3I4FA 4X41A 1PL7A 3PSHA 5D00A 4LF8B 2W2MA 4R1LA 2FK8A 5EERA 2XVYA 3ZX5A 1LKZA 2PKEA 1R0BA 1ZMTA 3IPCA 3ITDA 3Q15C 3FOWA 4GQIA 5DCLA 4NCAA 1TM1E 5CDGA 1MOSA 3CIFA 2DTXA 1WEHA 3HBMA 3UMFA 1QYVA 5KYYA 1QE3A 3PRYA 4JJ4A 3CN7A 4WW0A 5K7SA 1N6OA 1UBJS 2DFPA 3S1AA 3WMWA 3RO7A 1USUA 5FAXA 3R0JA 1HE1C 3VC2A 3CS3A 5LIPA 1L5MA 1KTVA 1N8SA 1PTJA 1XZCA 2ANBA 5HFNA 4DIOA 1QGUA 1UT8A 4CZ2A 2WIDA 5IZCA 1ZGGA 3TQOA 1P72A 1B4DA 2ZREA 4BVJA 4JVLA 4PVCA 4MS4A 3T3OA 1HO3A 1N1MA 3DM5A 3UA4A 1DC8A 4KBGA 2ZU0C 1NN5A 4WV3A 5CEJA 4F71A 4X65B 4OQEA 3OZDA 1XMQB 5EHNA 1PG0A 3OZCA 1N33B 2ZANA 1HDXA 1M2KA 5ALRA 4GLLA 4NRDA 1UWKA 4MA4A 5ALUA 1Y4DE 3O2QB 3OJWA 1ZHOA 1K92A 3VI4B 3FCSB 4F3YA 3OZGA 2XLBA 3UEOA 1Q83A 3VYWA 3KOYA 4TYNA 4WACA 1EZZA 1QO9A 3AFHA 1HT3A 1XK7A 2FMHA 4C4PA 5JZMA 4HAIA 4ZGWA 1GV0A 4JVOA 4L22A 1EFDN 4IHJA 2Z6AA 1SNYA 1V9CA 1O77A 5JDIA 3O7WA 4YCLA 3N76A 1DRUA 2O14A 1AQYA 2WIBA 2FMTA 1Q11A 2B25A 3G2OA 4R1PA 3WIDA 3RJ9A 4ZT6A 2A5FA 4K87A 5AJWA 3P2EA 4ZGGA 4H7JA 1X94A 3FWYA 1KMHA 3BJIC 4LX0A 4EPXA 2B5VA 1QYWA 1RXCA 1FS6A 4Q9IA 2CD7A 3WL4A 4DDTA 4YONB 2RHWA 4UFOA 4RY8A 3WKDA 1L8XA 4LCEA 2AG5A 1ZD1A 2CFOA 1Z0AA 3OF3A 3OQVA 4C22A 1IIBA 1CF2O 1N2ZA 1T2DA 1BH6A 5EXXA 4H0CA 2P6OA 3QUSA 3AW9A 2VPPA 2W2XA 4I1IA 3WLIA 5FEMA 1YR1A 1YZUA 2Q50A 5BQOA 1JB1A 2KLHA 4NOMA 1UPFA 5AM2A 4KFRA 2GWRA 4XOUA 2BFOA 5A0FA 3PUJA 5BYAA 2BEWB 1FF9A 3FX2A 1I4OA 4F7WA 1WDTA 2M98A 4YLYA 2VYVA 2C8LA 1FW8A 2XMSA 3K0FB 1SBZA 4JLVA 5D6OA 1GGFA 3UY4A 1M7BA 5KTKA 3G68A 2A59A 2BZGA 1MAAA 3D2CA 3HWX1 4AM8A 3J80A 4W5NA 3LT0A 2G71A 3Q3IA 4XWWA 3C1OA 3R6LA 4B8ZA 5T8KC 3BQ9A 5ESDA 4BUCA 5AW5A 1F6DA 4DHEA 4DNPA 2LPMA 1EBFA 2N0SA 2YIJA 3I9V1 3MJEA 1NR5A 4K88A 1AKNA 2J6HA 4H6VA 1UFKA 4R8RA 2VP5A 4X71A 1L4LA 1YJ5A 3H5TA 4I9NA 5FNVB 5KJFA 3HY6A 2R5FA 3R0ZA 4A23A 3EULA 4HEA6 3NYRA 5KTOA 4S1WA 1L2TA 1T1SA 1PI3A 1D4ZA 1D03A 3DCYA 3OD5A 3L82B 4JQOA 1W1WA 2GYUA 4R8SA 4UAVA 4X90A 1E1CB 5BUQA 4A5SA 2GD2A 3P0IA 2BIFA 1TEHA 3GGJA 2QG6A 2X9GA 3ZHZA 3C14C 1I7NA 1GZ6A 3V1NA 3THWA 1BMDA 3X1WA 1TQHA 1ZG3A 1BRTA 2CZGA 3RSLA 1O3YA 2O8FB 3PBKA 1NHGA 1G20E 1DL5A 4MHOA 4QU0A 1N1DA 4WZ6A 4X92A 5HILA 4NDZA 3VZRA 1DBVO 2HK8A 4J0IA 2NZ8A 4ZVVA 5HOEA 3T61A 4LF7B 1S96A 3K0BA 3IVXA 1DC3A 1QJCA 4HAOA 5HDBB 1GLNA 4UUOA 1B0AA 4KWTA 2ZYSA 5AD1A 3I2GA 3LIPA 4YJ3A 3E9MA 5JJKA 1DHRA 3R0IA 3D6UA 4G56A 5DLEA 5KSWB 5TS3A 1UKYA 3LSYA 3QOWA 2YY7A 3F8WA 3CVXA 4IF6A 1YTUA 4H9GA 3VRHA 4DDMA 1Z2PX 4WXRA 4JX9A 2GN1A 5B2FA 1HE4A 3X0DA 1V8PA 4DMUB 3RS9A 1JJFA 2HV8A 2O0JA 4TM7A 1NJFA 2H4WA 1L8QA 2FPRA 3C3MA 3ZHSA 2P75A 1X1TA 4JYMA 2UYCA 1GGJA 4K6CA 3RM3A 2BUCA 1R37A 2K6GA 3BMOA 3ES9A 4EG1A 3SYLA 3WS7A 3TXYA 3C7CB 1TMGE 2B94A 4DV5B 2Q29A 1K89A 4QUAA 3CHYA 1BN6A 1ECGA 1MP0A 1IJEA 3GK3A 1UBNA 3HVUA 4I36A 3U0BA 4DQVA 3ETLA 5HW0A 4Z3OA 3A31A 4KFUA 4L9WA 4N49A 4HYTA 1PJAA 4TTRA 3P52A 3N3AC 4WESB 5K1ZA 3WLFA 4DJJA 2XVXA 1Q0RA 5KYTA 4BNDA 4RD4A 2HCRA 1MQ8B 3WISA 5ELMA 1NVUQ 3ZV6A 2JI7A 3IQIX 4KL8S 3AGQA 4FLMA 4H7DA 2QP3A 2OHFA 1U0GA 4M22A 5IT9A 4KJXA 4RA9A 5DBIA 2G88A 3FCXA 1BFKA 4D8XA 3LRPA 2XCSB 4NCXA 4ZI7F 3VVMA 3OC0A 3QLVC 4WERA 2Z57A 4AIIA 2W6PA 5JJ5A 2DULA 3FUWA 4J2OA 2R2GA 3RUFA 2ZRAA 4S24A 4D0GA 5KQPA 5HX7A 3QYPA 2FPSA 2AFHA 4X3CA 1XVLA 3WQBA 3ZWWA 2IHNA 2RHOA 1FTSA 1GPJA 2V7XA 5EN4A 4BOYA 3DKKA 3Q2OA 5CVCA 2X8BA 5ITVA 1EVKA 2VAXA 3K1AB 4NFYA 3L8CA 1Z16A 2PH5A 1GT6A 3BFJA 3SZLA 4AT1A 3AEYA 5AVKA 3HBJA 1E1DA 2EWWA 1QIJA 3MLAA 2VH1A 5HMLA 2CNNA 3C45A 4ARBA 1QP8A 5E9QA 3U44A 2WFLA 3ME5A 3NNNA 3WFJA 2MYTA 2C94A 3EXIA 2A2ZA 3BCHA 4MICA 1X7ZA 4TT3D 4YI5A 3AEUA 5KOHA 5KSZA 3H87A 1SIOA 2EV9A 2G0TA 2Q0HA 4FU0A 3W5SA 1FFXA 3X1MA 4AJLA 5SY6A 5I4KA 1E5VA 5JC1A 2RGNA 2F1RA 3WBFA 3DS8A 2P65A 2OM2A 3WADA 1LNZA 4NCJA 1XLUA 4UCFA 3H11B 2H16A 4JGGA 4UBLA 4C4AA 5FOQA 3HM2A 3OPYA 3TTWA 4YUWA 4E11A 1U99A 1V6SA 1S1MA 3DG9A 3JAWB 1W9HA 1Z8DA 2FHPA 3L07A 4UVIA 3E22A 1T4BA 4ZKEA 4EL5A 3CT6A 1TYEB 1OGYA 4HTFB 1CFJA 1EJBA 1NSFA 5EWMA 3U1VA 2P1DA 2H7VA 3WNDA 2PX5A 3BREA 3EIOA 5ESWA 3GDOA 5EZYF 1UBFA 1YQQA 4LSWA 2VNSA 3QMVA 5HCUA 3DSRA 5IUJC 4HP8A 1NR1A 2AMJA 1W2HA 2H5JA 1MIOA 1GQ2A 4K9DA 2KM1A 4HB0A 3WRXC 5DV9A 5A3JA 5ABPA 5DN6D 5C51B 3T7DA 4OHBA 3IH5A 3TNLA 3VJKA 4C0KA 4DG8A 3U4IA 1L0BA 4IO0A 2RAFA 1JV2B 1NVKA 3A27A 3ORFA 3QVMA 2GPWA 4RGQA 3RSQA 4K6HA 1A88A 2YBDA 3AIMA 2XQIA 4EATA 5B58T 3QIVA 2TMKA 1FU7A 2ZAIA 4RK6A 2CY0A 1K8XB 4TXJA 3ZHUA 1KY4A 2ROQA 2OMEA 5FKJA 3PG5A 4JJIA 1DIBA 2PSSA 1R4MB 2WKWA 5BYKA 1KFCB 3K2EA 5THKA 2P8SA 1ECBA 2WWRA 1VE3A 2COEA 4RDIA 4AYTA 4Z3KA 4ZZ3A 4XYGA 2A9FA 3PQ4A 3CMMA 3G82C 3WYCA 1JXQA 2PZKA 3P9XA 2IV3A 2UZAA 1QRTA 5E3JA 4J6FA 2BEVB 1KE1A 4C06A 2H00A 4FMCF 4UMVA 5CDSA 5JNWA 3RV3A 4OIFA 1EFAA 5JCJD 3AHDA 4DRXA 5A06A 1QO0A 2PTGA 5JD4A 2JNWA 1PJSA 4LXIA 1A9XB 3WLQA 4GL2A 2RC5A 1ZCZA 2XBMA 2WF7A 1YFJA 4PC1A 4M6WA 3A4IA 3DDCA 1FNMA 3WRWA 3ZNOA 5HVNA 2VXYA 2GNAA 2I22A 4KQKA 3UK1A 1L5ZA 4AU1A 1XJ5A 4GP6A 4TYYA 4RTSA 1O97C 1K9SA 4F93B 5FNZA 4UCQA 4MYSA 2ZQYA 1MX3A 3GJ8A 2AJTA 4WUVA 3WNZA 1WKBA 3DC2A 3QMWA 1ZMXA 1FYVA 1U8EA 2ZDGA 2HBQA 3HY3A 3P8ZA 4LDQA 4WFQA 5FB3A 4URUR 4GXQA 5JSQA 1COWD 1QH9A 2QZZA 5AOVA 3ZCRA 5AVSA 1Z5WA 4BPBA 3LL7A 3M89A 3EC2A 4AZ3B 3N2ZB 3O4VA 3UOAB 2BVNA 4JHLA 4TV9A 3ZLBA 4BX8A 3PC7A 2CBGA 4JH0A 3RTEA 3A9WA 1CF9A 3FVTA 2NQ2C 3B6EA 4PLZA 1TCAA 1XTPA 2AVDA 3QQ5A 4XM0A 3RFVA 4AJJA 1N3YA 2ZYTX 3PKJA 3R7DA 2Q4DA 3EEQA 3O1JC 5U9CA 1MQAA 1MORA 4KXVA 4I99A 3OQ6A 4R54A 3I45A 1ZHHA 4QNRA 4ALMA 3QTLA 1CEXA 4ZT5A 2V7PA 1G8HA 2VXBA 4O1IA 4QICA 4XIYA 3UUEA 4NEGA 3CPEA 3KVNA 2WSSA 1HI9A 1VJTA 2C0QA 4XUGB 1SBIA 4EUFA 3I9MA 5CT9A 1T9KA 2ONCA 2RGXA 2EATA 2AI2A 4TS9A 2V6IA 3GHYA 1H3EA 3TUIC 1H2BA 4RVFA 1IWOA 1LRKA 2R8PA 3B6KA 3HUUA 1Z0SA 4KQCA 1B8NA 3TOXA 2WSYB 4DLXA 4V38A 3F2IA 1GZVA 3OAAD 4WN9A 1KRHA 1OTYA 4DR5B 3G0CA 2XTMA 3K72B 4JA0A 2JLAA 4TTPA 1BIFA 3HYCA 4BB6A 5H1YA 1G21A 4UQLA 3FOAA 2RAPA 2NNLD 5DHFA 3RWBA 3C8DA 3L6DA 4HN2A 3HXQA 3Q9NA 4Q7LA 1QRSA 1ZRMA 2GKSA 1PRYA 1RKBA 4NMLA 3LHFA 4LFBB 3AY0A 2KS6A 2C5HA 5C5CA 1EU1A 2REBA 1JKIA 2WIJA 1JI3A 3MWFA 4G26A 4WLFA 2YXLA 3U3ZA 3I8SA 3RIGA 4C3OB 1QKKA 5HYVA 1JR3D 1RJ9A 3ISVA 5DYYA 3NHUA 4YAOA 2FPPA 3RAEC 4LFAB 3F5SA 4FEGA 3R20A 2IYOA 1PL8A 4G0QA 1F2TA 5E3HA 5JFOA 3OO1A 2VYNA 4O2AB 5D51S 5IXSA 4OI0A 1RYZA 3FW1A 2LVBA 1Y9AA 1Z4OA 4DXAA 1ECLA 5C34B 4EO7A 2HDWA 5IDVA 3II6X 1XCMA 2AJBA 3UV7A 2ZYHA 4AG5A 1ZK4A 3CO0S 1Z0UA 4EW2A 3QBDA 2ZAGA 3G23A 4FFVA 1RCUA 3T7KA 2JHAA 1LNSA 1WHSB 1P8AA 2CMDA 2V4MA 3LQQA 1PL6A 1CJSA 3M5CA 4RKRA 1IWBB 4LZZA 1JEYA 2OORA 1ZK3A 4FFMA 2ZBUA 5DNDA 5KI6A 3VR4A 2WOOA 4D97A 2HD4A 3EUAA 3L41A 1E3SA 5FBRB 4ZANA 4LGVA 5G4LA 1R8SA 1QB7A 2XGOA 4FNMA 4OMFG 3C39A 1A8IA 2O7QA 3AW8A 1U2RA 1H8HD 1KI7A 1FK8A 3BIJA 3FMIA 4XPZA 5I9SA 1F14A 1WR8A 1OWOA 3F6EX 2UYOA 3OFND 5LP6F 4XRRA 4AROA 5L6LB 5BSFA 2QOEA 3PQ5A 1Z0JA 4O4HF 5BMVF 2D8MA 1UH5A 1U3VA 5FLKA 1EUZA 1E9BA 1PR5A 2QD1A 4PYNA 4YBRA 3LCMA 1ZONA 3T7CA 4G4JA 3ADPA 1QBKC 1PQYA 3JRXA 3O9ZA 5TY0A 1U9IC 3UMBA 2RBGA 3VHRA 4E2YA 5I47A 4BJHB 4Z53A 2IYQA 3M9LA 5A62A 1EP3B 3MILA 4K28A 4KIGA 4URYR 3DF9A 3VR6A 3ZJVA 5JSYA 3VU8A 3E5RA 3IO5A 2KHZA 1YL7A 4HG2A 4B74A 5IJZA 2BCEA 3PNYA 3UW3A 3CUEF 2Y1GA 1P1FA 2C9ZA 2GYYA 5EQFA 3S99A 4WLUA 3VO8A 5FP0A 1G4UR 2BKLA 2EL7A 4N5LA 2WP0A 4QOFA 5IT4A 3GEPA 1ZO8A 1JHMA 2O3TA 1AS2A 4BIMA 2NQTA 3VPBA 4AL4A 5HHTA 1VMAA 3A14A 3OOJA 3M8KA 4OBWA 4YAWA 1EK0A 1G38A 4ZAZA 5A5EA 4UQOA 2PLNA 3H6HA 4OKNA 5KWEA 2P6MA 1I1QB 4C0QC 4U8GA 2A9JA 3GJYA 1SCUB 4LUCA 2JGNA 3AHIA 1XOIA 2DR3A 2J87A 4UM8B 1WXHA 4MUXA 2H5IA 5GJWC 3N2NA 1N6LA 2EARA 4OAOA 4B2YA 3BHJA 2HHCA 2ZRGA 3OJEA 3P20A 3CU5A 1NJ2A 2X7HA 3L7JA 5DH9A 5ARDA 4B9AA 4EK9A 3OLQA 5DCYA 4YRGA 1NY6A 2RK3A 2AZTA 1QQ5A 5J2TA 4DTIA 5AI0A 4FFOA 2HFKA 5BNWA 4H1WA 3UPTA 3L4EA 4XSVA 1N4AA 4EJ6A 4DKXA 1NPYA 1DS6A 3KOOA 4FEYA 3B3QA 4GM1A 3L4KA 1UKVY 2ZWPA 4F5YA 1IBRA 1U2ZA 1AO0A 3V4FA 3ISJA 3JD3A 1DRVA 4EKIA 5BN1A 1YB4A 1GAJA 4NMXB 2BGGA 1HX7A 4G8DA 4YJGA 3J81k 3CX6A 1KZHA 3GAMA 3NBFA 1G6OA 1MTOA 2N46A 1Q7GA 3G8YA 4AN1A 2GH1A 5IPFA 3L8FA 1D6MA 1VCIA 3MCZA 3N6XA 1QHXA 3LNTA 2RJOA 3CWQA 3IP1A 4YCDA 3UCFA 2P9CA 1AXGA 1T26A 1YI8A 2R97A 1IUNA 1LJLA 1IG3A 1ZD9A 2BGTA 2WF9A 3DNFA 3ILVA 2UYHA 1TVCA 1DBQA 2JBWA 4MSUA 2JRLA 4P7KA 1YB2A 4YCNA 4C29A 4HBGA 4HPXB 2GGSA 4OK3A 3S1AB 1TVMA 3T3GA 2Y4NA 4P1ZA 2ADFA 4JEUA 4LTMA 3A6PC 3G9TA 4QGSA 5ES3A 4TVBA 1T36A 3AIOA 4AY6A 1W46A 1I01A 3HG7A 3VR5D 2MR5A 2R4QA 2EG9A 2VLBA 4EKGA 4QPPA 1TIPA 1MFPA 2WJVA 3PGXA 3AQ4A 3SF0A 2H5LA 2XMRA 3M7IA 2FMUA 2RGAA 4HS9A 4ENQA 1Y34E 4ATNA 4R1QA 1Z82A 2NO4A 4OLBA 1ODTC 4MV9A 2A8YA 4KR6A 1J09A 2WZBA 1GCOA 2BBTA 5BSGA 4YRCA 2G9NA 2CLLB 2O3SA 2V96A 1WVMA 1YGYA 5BT9A 3K5WA 4QQFA 3ZPXA 3QYJA 4QM7A 2CXHA 2O0LA 3FUCA 3PHCA 3HKCB 1XRLA 4M0CA 3A6GA 3Q8MA 1D7OA 1YULA 3JQBC 1NNSA 1BD4A 3MGCA 3VNRA 1AKYA 3BQMB 1H6AA 2VIIA 1ULBA 3BM5A 1Z88A 3WGOA 1T8RA 2GBFA 3QNMA 1A27A 4GYJA 1ORVA 1JJVA 3EG5A 3I92A 1A4IA 3E1SA 4N01A 4MVXA 4AZWA 1GQSA 2DMRA 3PFGA 1XTJA 4HWRA 3MBKA 5DHQA 4EDFA 5ALNA 1ZH8A 1GA6A 5DWDA 4CM7A 3U40A 4EPTA 2VHYA 1PF7E 1H1LA 3B8HA 1ODKA 4QSHA 3V8RA 3EPPA 3T7AA 1T2VA 4FLFA 2CXQA 3LE8A 2BSQA 3FA2A 2O9JA 1ZA2A 3DDHA 4TQUS 1VRVA 1XDWA 2HWWA 2BM8A 4HWTA 3GDGA 3QUAA 2W2QA 2QYSA 3KAPA 2VEOA 1KERA 3ENVA 4P9NA 3IQZA 2QP9X 1Z5UA 4MYRA 5DRYA 5FA6A 3GFBA 2JI4A 4JLWA 4YUZA 4FI3C 2W8ZA 1QV7A 4JLPA 4B2IA 2IP2A 5CFRA 2DETA 3MEQA 3HVIA 3RIHA 1JAZA 3UH1A 4KXUA 4DRYA 1L7QA 3ODGA 3TEFA 4JKYA 4B83A 5MN5A 4QYTA 2Z08A 4KFSA 4KK3A 2DU8A 2A5GA 3LUCA 3JD0A 4ND5A 4A0GA 2HSEA 3IC5A 3QVXA 4GYWA 3ENNA 4IJUA 3N6VA 4U7WA 1PNOA 3KELA 2XZOA 3DQQA 3OQ1A 4NE2A 4ZGBA 4BNWA 3TKLA 2HGSA 3D31A 3FPFA 4QTXA 1OI4A 3KKNA 3LIIA 4QHYA 1Q1QA 5E8JA 2CNKA 4KQFA 3D81A 3HJGA 3LW7A 3QFTA 3HCRA 3T41A 2IOQA 1FLDA 2NU7B 3OQJA 2I2AA 3UGKA 3ZD9A 1PCXA 1BFDA 2V0CA 3DO6A 3HYNA 3IURA 1ZSYA 3MFQA 5E0KB 4Y6PA 1RLTA 2OYRA 3T3PB 4U1RA 4AN0A 4MI3A 4UM9B 3F2VA 5AVQA 1JDTA 1X38A 3KDPA 4RFLA 3MWKA 4M8NE 2HOQA 4E7OA 3LXXA 3PLNA 5K0SA 1LI7A 1P8JA 1MEJA 2WW8A 3KQMA 3LQRA 3NHKA 7ADHA 3VHXA 1CJTC 3WBKA 3FWPA 2PKWA 3WY9A 2A1IA 1ZNQO 3VH1A 3K0SA 4TYWA 3O8BA 3DFMA 3RT9A 5LM3A 1XRRA 2HLPA 2O0HA 1U0BB 1UC8A 1HT2E 3DVSX 4MP8A 2JB9A 4JR1A 4EY3A 3W5AA 2W58A 3MQFA 1XP8A 2G63A 1JQEA 4RIHA 1IVSA 5EI5A 4WFKA 3GPDG 3PHGA 3QUCA 4UHCA 5IAGA 4RK7A 4A0SA 5TPZA 1YB7A 4RNCA 2XT9A 1SC3A 3A32A 3WDKA 3ZI0A 1RRKA 1V37A 1J2JA 3HR4A 5F7XA 3OFKA 4G1BA 5KTSA 1VSTA 1FC0A 3RS5A 4H60A 1N2JA 3NT4A 1L4UA 4BQQA 5IABA 3OM1A 2WC1A 3GEGA 3PXUA 3VZDA 3W2HA 2HRBA 3M82A 3KKMA 2VXCA 5FULA 2IYXA 1OAOA 1NBME 2V6MA 4H7IA 1RVDA 4CQNA 3DAFA 5HZMA 2E5WA 3MF4A 3LF2A 3TIGA 4C01A 1USWA 3G2QA 3GNQA 1C1DB 4HUQB 4IH4A 3OECA 4FGUA 3HKEA 1RMQA 4MYUA 5D7NA 2V9ZA 4XKJA 4IY1A 7REQB 2FW7A 1E2UA 1C29B 3K0HA 3OSZA 4QQRA 4E0BA 3ZIAD 1TM4E 2ZIVB 2CDCA 2HC9A 3PTAA 2FJUA 1YCFA 3RC2A 4FOSA 3C5CA 3WR5A 2GRJA 2H59A 3ACCA 3OMXA 3PVCA 5CFQA 2VC2B 5HK8A 2C99A 2XHEA 1VG0B 4HTAA 3R44A 4V0RA 2B4AA 3PITA 1C8BA 1JHAA 4HWOA 4MW1A 4HX9A 2QX4A 3WWDA 4Y2YA 3PYLA 3SEFA 4CQMA 2CB0A 5A6SA 1UK7A 3VNQA 4IZHA 2H51A 2O0KA 4F4IA 1Z3IX 3CEAA 3PD7A 3NUQA 1PK7A 3FFXA 1YB6A 2YWFA 4P3KA 1QCCA 3C3PA 5AICA 2OC9A 4NZZA 4RJTA 1DTWB 5C7LO 1W36C 3HYTA 4AS3A 3WHKA 1HQKA 3PWSA 4RVDA 3FOZA 5T5QA 3UMJA 1COZA 4WXHA 5D2CA 1YOBA 1B41A 3NOVA 2JGFA 4FMCB 1UMBB 1ZMRA 4IEFB 2HLHA 2P7IA 3RFCA 5JTUA 3AERB 3QW2A 4L72A 4DUGD 1A4UA 1Q1NA 5TC4A 3KZNA 3TOVA 2HMTA 4BQPA 4N3BA 1MB0A 3IEUA 1JXMA 3PD0A 3DDZX 2C2BA 2HT6A 4EECA 2RHCA 2I6TA 4L8WB 4PANA 4MUKA 1RJWA 5CVUA 1AKRA 2XYPA 1OU0A 2ASVA 2PX0A 5EEGA 3KUCA 1SVKA 1VE1A 2LUOA 3CR3C 1P18A 2KQUA 2VTBA 4U0KA 3PJFA 3AM5A 4DJTA 1XCJA 4JJ6A 5SZHB 3VKWA 4DARA 2YWRA 3DMDA 4ZVPA 4Z4HA 4BNGA 3BWDD 2J48A 2V9CA 3D5EA 4R6XA 2OCPA 5EFOA 2VPZA 3DNPA 4OG2A 4PQFA 2VKTA 2B7LA 3FFBA 1TF2A 2FX5A 2QF7A 4ND8B 1AUPA 3HBLA 3PUZA 4UCXA 5BUSA 5EIBC 5HMMA 1P7CA 3PCTA 3SHWA 1H1DA 3TE7A 5HS6A 1E1KA 2X1MA 3PUHA 2FRVA 1G8AA 4FN4A 4JUIA 2FUKA 4YT2A 4ZDJA 3JV7A 4WY8A 1U5AA 4F04A 4EY5A 2C00A 4E5SA 1A04A 2O05A 5ILQA 4BWVA 2DUNA 3OE4A 5JI2E 5AUPB 2P3LA 4DIFA 4TMZA 3L9XA 4BU0A 1Z74A 3HCFA 5AXBA 4B87A 4FILA 4ZYVA 3N86A 3MTGA 1BX0A 5ED4A 1V3QE 4B8YA 4W9NC 9ABPA 1OBVA 2W6IA 2KYRA 1KI9A 1JDNA 4AULA 1T3GA 3UKJA 2REOA 3EDMA 4S35A 5CLQA 1U7TA 4CIBA 4RE5A 5KB3A 2W2TA 4JR2A 2C0CA 3SMVA 1BVRA 3AM4A 1MO3A 1W5EA 1UAGA 2YV2A 4J1SA 3BJRA 4IIEA 3FR8A 3T4EA 4XUDA 3SE0A 1RZVA 3KP1A 4H7KA 3KEQA 2J07A 4OGWA 3FBTA 3K1TA 3K8YA 2V5AA 1EP9A 4PPQA 4BC0A 5MFZA 3K6SA 1PU2A 5A4DA 4O2BA 1VGVA 3RJZA 1U0LA 2ZB2A 3THXB 1VSQA 3L8HA 4ZARA 4CMIB 4WLVA 2Q5JA 1UCFA 2YJNA 4E2FA 2LXNA 3JVDA 3PX7A 1JDBB 1WVGA 2WHXA 3FCCA 1X7XA 3MWGA 2IHJA 1KR5A 1EB9A 3OKFA 4MP6A 4WGFA 5ULLA 2D00A 4FT2A 4RU1A 1WU7A 1YJ8A 4B3DA 1YGPA 1M0EA 2X0KA 2YBEA 4A0FA 2XH8A 1VQ1A 3QVTA 3OHPA 4ZOBA 4NFSA 1QRDA 4W8OA 3TX2A 1TIKA 2B21A 3EVAA 4J91A 4LXHA 3OE1A 1UXOA 3ICQB 2P6UA 2QR3A 2P41A 2XJ9A 3MNFA 3QLVA 2UZ1B 3A04A 2IXEA 4C76A 4IOJA 3PGKA 5D6NA 1QE0A 1Y1RA 3D4NA 4DLAA 2XA1A 1T6ZA 4YNBA 3HL0A 5LQCA 5GAJA 3PFFA 2PXAA 4ZEVA 1YKSA 3UWMA 1JIQA 1MO6A 5B1SA 4H17A 4AUKA 4FB4A 4M60A 1E1CA 2I3GA 2F1KA 3O4RA 1XUOA 3KDAA 5F3RA 1NU6A 4C0BA 2NVWA 3AT1A 4ZV4A 3ZWVA 3A6ZA 4IJVA 4JA2A 3FH0A 4RHFA 4F0JA 4XVUA 1RRCA 1NMEA 6AT1A 1KO8A 1VECA 3A1SA 1EJ0A 1NJ1A 1P5FA 5E4FA 1VLJA 5E2IA 4FONA 4JB3A 2O8FA 3ZJ5A 4Q3AA 1H23A 2PKRA 2BMVA 4KO8A 2MU1A 5LP6B 2AN1A 4D0NA 2A1TS 2L2QA 1JKXA 1YR8A 3LV8A 4J0QA 4JOSA 1CUEA 1GKLA 2OFFA 4B5LA 4EEZA 4F4DA 4O4HB 3RW9A 2IXBA 1OXVA 2VBIA 3ASVA 3VYSB 1XKLA 4RIIA 2IY9A 2Z1NA 3T3IA 1WUHS 2G9VA 5EKUA 4M36A 5IAJA 2PA3A 3NWEA 4NU6A 1CJUC 2AOWA 4RHTA 4J90A 1Y3AA 3AINA 4ROSA 4KYUA 5K09A 3F6PA 5BPFA 2VI5A 3CLHA 4KLAA 2P8JA 4K9QA 7MDHA 1QK4A 4JYAB 1PO7A 3HHEA 4U2KA 5JCZA 1QR6A 2O2DA 1C9MA 4IEIA 3Q87B 3KU1A 1TW2A 1H2WA 1NJ5A 3PDUA 2H7YA 4K86A 3MWEB 2EX4A 3W9UA 4B3IA 4CGYA 2PUGA 2QUBA 3AB8A 3COYA 3BBLA 3HA5A 4EHBA 1AKUA 1B2LA 1Z0ZA 5BORA 1AV6A 1UWCA 4KO4S 1E5DA 2ZTVA 3U19A 1XTIA 2ZG6A 3ASYA 3EZXA 4W5JA 4UUAA 3KEMA 1H3NA 1GG9A 3TD6A 4R3UC 3EXFB 3VH3A 1NF8A 4R1OA 2J0UB 4RULA 1XWWA 2GAFA 5L3RA 1WSBA 2FZWA 1KO7A 1FMTA 1E60A 3JW8A 4WADA 1TQ4A 3QITA 4YI3A 3BAZA 2Q6LA 3TYXA 4G5OA 4YYZA 2BWJA 3NB0A 3CFYA 3BXPA 1M2JA 5IX8A 1X74A 4RPCA 1BE0A 3JZMA 5CH8A 4INPA 4AF7A 3ZVKA 3K70B 2PGNA 1BQ4A 3ZZTA 1NE7A 3K0EA 2K5UA 3FD8A 5JU6A 4GWGA 2OCKA 5CYOA 1DVRA 5KKCA 1FFBA 2JKZA 2RIRA 2YMPA 5LBUA 2IDJA 4UU8A 3LECA 5BQ5A 1IY1A 4XPIA 5K3FA 2PZEA 1NRJB 1QQTA 4FC7A 3G0DA 4BKQA 4YRTA 2HMWA 2P69A 3D6TB 2I6GA 3UWOA 3W8NA 5KYUB 4CL2A 1XRNA 1ZDMA 1CETA 4J0DA 4JXZA 2F43A 2XUIA 2DJIA 4F60A 1V5GA 5IKPA 1V96A 1P7WA 1DMRA 2R9VA 3BSYA 3DCIA 5C4GB 3OIWA 3SZ3A 1RAGA 1D2EA 2Z30A 1KETA 3K1AA 2YDXA 3CM0A 4M54A 4TGLA 1M2NA 5LLSA 3U7GA 3IVAA 4YRLA 5FQOA 4MV1A 3U62A 5E2AA 4PVDA 5FTLA 1JDZA 3WZ2A 1XAGA 2QROA 4FDUA 2QNIA 1JLLB 5BOVA 1OZAA 2RGBA 1W94A 4PLFA 4QNMA 2Z98A 1P75A 2QN7A 3NTRA 1C7FA 1NNI1 4V0MA 2X4IA 5AI4A 3EUFA 4EJSB 2HY7A 2BAGA 2DR0A 2NZUG 3D6FA 3W79A 3ZVRA 4E51A 1IZ9A 2QM8A 4PRLA 2XA2A 3BDAA 3SYRA 1K6JA 4EHFA 4BLUA 1GRVA 3OTOB 3H11A 5C7IO 1DBRA 2HDOA 2R00C 2QZ4A 3ABQB 3CWZA 1NATA 1RXIA 1UMDB 2OV3A 1X80A 3JAWA 4CRWB 3T7IA 1LDBA 2FWNA 1KEEB 4HTFA 2JAOA 3GUVA 3DKVA 3KYJB 3QH4A 3WOHA 2WAAA 4WBNF 1N34B 1D7AA 2VK2A 2QUZA 2VNJA 3K8OE 2CJWB 4N3GA 3ZHRA 3KOXA 4NOLA 4WKPA 3U9SA 5HTOA 1R6UA 4M8KA 4FOLA 3DTYA 1E1NA 4U3JB 5DM1A 4OBBA 4CG1A 4DJDC 4D0RA 3TBKA 1BA3A 3UJ6A 1TD9A 4G8JA 3G59A 4PBTA 3SM3A 4C0WA 5ITSA 1Y3HA 3WJ7A 4TLDA 1M7HA 3RSOA 4BWFB 4XGRA 1VBNA 5A03A 2NVUB 3H2YA 3HI6A 3K9QO 3KYIB 1BD3A 2PU5A 4YAJA 4RQTA 4DG9A 1OHHD 1THMA 1E0SA 2D13A 5AXDA 3VR3A 4RTMA 3RFFA 2Q3LA 3V55A 5CD1A 3WGJA 4NI5A 2UZIR 3Q4GA 1KXZA 2CBZA 3NONA 2ZW9A 3F6SA 1XZMA 4R9RA 1HTWA 4ZOAA 3WI7A 4C4TA 5IDWA 2CEAA 2X8JA 3IT3A 4JYCA 4NS4A 1Q57A 3EEYA 3FYUC 1PKEA 5CYGA 1FB5A 4NJMB 4C07A 3JZDA 2O3RA 1KI8A 5SYAA 4Q15A 1X92A 1ECPA 1MV5A 3EWNA 4FXOA 4WA8A 5DXJA 4C88A 2A5YB 3O3CA 5DK4A 2BEVA 4B45A 5KVVA 3P0EA 3PNLA 3D3KA 5HZKA 9ATCA 4WXEA 4CIYA 4J3FA 3ZHQA 3E61A 3I6YA 2GEBA 2J0EA 4MI6A 4WEQA 4BNVA 2W70A 2NXJA 2PQ2A 1M9NA 2XMZA 1FU8A 2XTJA 3RRYA 3W6OA 3FNHA 4B2LA 2QTRA 1L7XA 4C0XA 5AM3A 1A9XA 2CLFB 3A9CA 3DONA 4RF5A 2WILA 2ZT6A 4XD2A 5C4MA 4NTZA 1R16A 2QY6A 2QM0A 2R7NA 2RHDA 2Z1DA 5LD2B 4RC9A 4OI2A 2HXYA 3IP6A 2W00A 2FN7A 4BO5A 4DQKA 4RJIA 2W2LA 5HRUA 3O1HB 1T9BA 2VL7A 3TDNA 4EUSA 4TLMB 1IEXA 4I81A 2WVJA 2Z2KA 1O03A 2ZRFA 1YR2A 2LIVA 1HNNA 1P6QA 2AXPA 5CPFA 4I9FA 4Z7NB 1NG1A 1I7QB 1AQNA 1ZJZA 1LBQA 1SY7A 1X7WA 3GAAA 1VE7A 2BD0A 5EIAA 4XSHA 5HJEA 3C7DB 3ANXA 2RAVA 3UAVA 1JEDA 3VX4A 1I1NA 4YJHA 3LDHA 4ESHA 4NATA 1PGQA 4G6ZA 2PZAA 3DOOA 4PFKA 2HWYA 3WZMA 3G5TA 4LGMA 2PRSA 2FVXA 4E7PA 4MVJD 1U7ZA 3HACA 4MLZA 1TLTA 3QU7A 4P3OA 1T0BA 2OG1A 4L3VA 4D81A 1VG1A 3HCEA 2ORYA 2FG6C 3KYCA 5ILGA 3GV0A 1PW5A 4EUEA 5E9AA 5JS6A 3ET4A 1D1PA 1U9IA 5F3DA 5GV7A 5JNUA 4NV3A 3EY9A 5DULA 1CUDA 1O57A 4LXUA 2LCIA 4R31A 4ES6A 2W6ZA 2JJ1A 2ZLBA 3MJVA 5LU9A 1U6IA 4N3NA 1WY7A 4DLKA 1T8UA 3R24A 2HRRA 3TIIA 1H4QA 1CUIA 3DYBA 4KQ6A 2D2VA 2E1RA 1DGQA 3IULA 4PNEA 1ISSA 3JQDA 4PIPA 1FFDA 1N2CB 2GZDA 4BRSA 4MW5A 4AKTA 4A2PA 1PS8A 3BRCA 3E70C 4GG1A 2YXPX 1CVRA 3S2FA 1AX9A 3LWZA 2P11A 1T1IA 3SE7A 2P67A 4G36A 1LC3A 4LRWA 4BASA 4YR9A 3JAKB 1TZMA 1TTHA 5L8VA 4JEIA 3WK6A 2BZ1A 4HX2A 3MT7A 3ROQA 5CDFE 2QV0A 5JMOA 2EW1A 3PDHA 2C7PA 1OCEA 1R9GA 5LP1A 1VG8A 3COWA 3DVLA 3MOGA 3M81A 5ECDA 4QYMA 4RVHA 4GKJB 4DEXA 3HB5X 3OT1B 3T1OA 3GZJA 3ADDA 4RANA 1KJJA 1BHSA 2XEDA 3S2IA 4D4LA 4GKBA 1PR1A 4LJ9A 4OP2A 5EKDA 1QGAA 1N9GA 2WFZA 1SVUA 3LPNA 4IRUB 3UJCA 3RNLA 4ER6A 5JD5A 4KR3A 1I4EB 4BB5A 2M1XA 8ABPA 4JEHA 2H9IA 1XYGA 3H2JA 5IJ9B 3AVYA 4PR3A 2JGDB 1UM8A 1GPKA 3AEZA 3PJGA 2J0VA 1WHSA 1F1JA 1USKA 3QVUA 4L4RA 1JU3A 1RXUA 1Z6YA 2G6BA 4PC7A 4US0R 3SZRA 3UMGA 4HPJB 5K20A 5HSGA 3HJHA 5H9WA 1JQ3A 3LHSA 3M6AA 5E1OA 3VPSA 5IBCA 5JBIA 3CNOA 2P2ZA 1ZD5A 2B99A 1MO5A 1KDRA 2RJ3A 1II9A 1EQ2A 1LSUA 1T2AA 2W2NA 2YQZA 1NJ8A 3A1NA 3G0OA 3JWJA 1UOOA 3CWCA 4HNGA 5H8WA 5KTRA 2VNAA 1E1MA 5AJYA 5AK6A 3TH5A 3PQ6A 2QW8A 1CZKA 1AGNA 1MO2A 4TWAA 3FYHA 2AN9A 1RI3A 5IJWA 1KRWA 4PONA 1H2AS 4YMSA 3W8FA 4EB8A 5BMOA 3PENA 1EPUA 2BFNA 1HKHA 3IOEA 1Z22A 5DNYB 3EUEA 4MRAA 4UD6A 1EBBA 3U4AA 1KFJB 2R1VA 1X9HA 2ZI4A 4G5FA 4ID3A 1NW4A 4UMDA 3U4GA 1PHPA 4O02B 4ACAA 4FZ5A 1L4GA 2G1UA 5CTJA 5KNCH 2VK1A 4XASA 2V7VA 4FQ8A 3WV4A 2WA1A 2WF5A 4D6PA 3KEFA 1MKYA 1XRJA 5IT0A 4YGXB 4WXPA 1HRDA 1QV9A 2NW6A 6Q21A 2QU7A 1AE1A 4G9GA 4JU8A 3GA7A 3DDSA 3JQBA 4PLVA 121PA 5BT8A 2QE7A 5JYDA 3KU4A 2RGUA 4JJ7A 1C7JA 3R5HA 2VJPA 4HYEA 3FKSA 1U0NA 1V3VA 3VAZA 4A6PA 4BN0A 1R8JA 4RJ2A 5JNVA 1TAUA 2QIOA 3EGIA 5F73A 3JSAA 3PV0A 4BBJA 4EG3A 5I7AA 1RYYA 2QVCA 3T7SA 4GS5A 1GO2A 3M83A 1XZBA 3FOBA 4DADA 1XFDA 4P4LA 4WE3A 3OHMA 5TJ9A 3ROGA 4YREA 4E30A 2O8BB 1SU4A 4MRNA 1D0VA 4X1KB 1W0KD 1IHUA 5ALWA 4DV4B 1K98A 4EL0A 4FZ3A 4LAFA 2PKXA 3GPCA 3K6KA 3CQ9A 3SYNA 5TIIA 1NMYA 1R0ZA 2YJZA 4BNNA 1FW6A 1L4FA 1RPAA 1ES9A 2PUVA 1QHYA 1N2CE 1KVRA 3UNXA 4DA7A 3EQ7A 3QVGB 1X7YA 1KYTA 5EJMA 5F2KA 4ZV7A 4DQ0A 5J43A 2C20A 1PUJA 4IEEA 1M0TA 1Z34A 1XTBA 2MSNA 3H4VA 4OXNA 3ONDA 4MKIA 3TX6A 4ZI2A 2H65A 2VUTA 4RZ3A 3CRRA 2NXNA 1AVTA 3AI3A 3OEYA 2HA3A 5AKHA 4RJLA 1M2OB 3CX4A 1NW9B 4LS3A 3UAXA 4L0MA 3W34A 3N5CA 1WHTB 5AM0A 1IB6A 2C2ZA 4C1NA 5HRCA 3RAFC 2J4FA 1SOUA 3DD5A 4BFYA 3T4XA 3I5XA 1JPNA 3LBHA 2A1UB 3MN1A 3IA2A 4J94A 4U0JA 1PJ3A 4JJEA 5DCUA 2ZUFA 1IBSA 2GHQA 2HLNA 1NYTA 4IDDA 3OCWA 1R74A 1V16A 1RT9A 2AOVA 2JAUA 3F3YA 1GR1A 3VR2A 4ZCTA 3AVUA 1VIYA 4MJ7A 3HJCA 3E9NA 2NU8A 3VQTA 4ITRC 3L0PA 1P4GA 4J0GA 3GB9A 4BJ5A 4A9AA 4EGQA 5DM70 3DLHA 1MX9A 4MS3B 2FEMA 1N77A 1KXJA 1ZGJA 1TVKB 4U00A 2ZETA 5K99A 2OCBA 2AB0A 4AJKA 4GOLD 2XV1A 3IBSA 3STXA 2VQDA 4IMIB 1W4BA 4NBLA 3VPCA 1A96A 3E9DA 2W4QA 5AVVA 3GOHA 1BCSB 3ZWYA 3OCJA 4OAQA 5KYVA 4JXJA 3L0DA 1JEQB 1UMCB 3F49S 2OBFA 3NU1A 1J2YA 4DMGA 4D1YA 2WI8A 3K9WA 3EPHA 1GU0A 3LBYA 4GW3A 1JR4A 1IG0A 3AHGA 3HLKA 4KMSA 5DYTA 5FUYA 3BJMA 1IEVA 2X7JA 3B1XA 2VDWA 5G3ZA 3L9WA 5D5HA 2WAYA 1K97A 3Q9SA 1E9RA 1Y6FA 1GN9A 3D7NA 4BAZA 2XGGA 2ZIGA 4GQAA 4Q3BA 4RD6A 4I1UA 2X1HA 5JFGA 3HQ4O 4RY2A 1RYMA 3F7MA 4BNMA 1JZQA 1UC5B 4MUFA 2X6RA 1FIUA 4QNNA 3DHWC 4QBGB 4P2GA 3KEGA 5EZSA 1R15A 1NUPA 1RJGA 1XDGA 1Z17A 2JJQA 1R2QA 2NOAA 3HLTA 3P9ZA 3TR0A 2IZ7A 3C5VA 1XZEA 3MVEA 1TM7E 4CDRA 3ESCA 4OMUA 3I6IA 4IIYA 4EKEA 3U4CA 2GYWA 3UGTA 1C50A 2J3MA 2Y71A 4MH0R 3JQEA 2Z2IA 3EEBA 3P4YA 5CCXA 2VAWA 1BZYA 1SAYA 1VIDA 2A5DA 2W6QA 3BE6A 5HS4A 2XUPA 3I1IA 5T7BA 1D9XA 4IV8A 1QTQA 4LTNA 4GF5A 2XB9A 3GNLA 1MJ5A 2NACA 3QLEA 4FGKA 4OYLA 4DLZA 1UM9B 3HEAA 3GO4A 2DFVA 3QXHA 3CKLA 3QVWA 3ZDAA 1HETA 1Z6XA 4LWZA 3HXMA 2OZVA 3FDJA 5JOQA 4EAQA 1NLYA 1ETUA 1V11B 2FK7A 2PO5A 4L6IA 4B73A 3MSCA 3AF3A 4OQZA 4V0OA 4CVNA 2ECQA 4L0CA 5JPIA 1AD2A 2P1ZA 4IKPA 4XH9B 3FMOB 4QIHA 1OZGA 2XUHA 3OIGA 1SO8A 2G0AA 3RYTC 1YBFA 4PFQA 4IJKA 2M9MA 3AB7A 1K5GA 4FD2A 4LSGA 1FOEB 4PYJA 1SCQA 2GPJA 3S7ZA 2VF5X 4KIJA 3SSMA 2NUBA 3NPMA 3W3AH 2OXTA 2REQA 1OJ7A 1XEXB 4IJMA 4QEKA 1KQFA 4GM0A 4OHYA 5FD8A 1F9EA 3OIFA 3ENKA 1A1VA 3NGMA 4P0QB 3EIQA 4A73A 2A9OA 4M9CA 4C0HA 3HVJA 3K73O 3L46A 4OYYA 4ON9A 1CWUA 4LVCA 1SEVA 5CXSA 2LBPA 4Y2PA 3S8YA 3AUKA 3K1ZA 5EWJA 3KUXA 3R0XA 4QBFA 4PLTA 4C3VA 2I66A 1NWCA 3PHIA 5BWCA 1S1CA 3DVAB 3JRNA 1I14A 4Q3OA 5K8IA 2O8EB 4JUCA 4CTOA 4E2WA 3PD1A 4YAGA 1VJCA 2EBHX 4KFTA 3V8PA 2IS4A 1FTWA 1DX6A 3ZDCA 5C35A 3PC8C 3QG1A 5C9ZA 2O6HA