4RAOA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
197
Chain Sequence
ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSRSIPMTVDFIRLKLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
total genus 72
structure length 197
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4raoA00
1MZVA 4RHYA 5IAOA 3ACBA 4P81A 1QK3A 4P3KA 4RQAA 4RANA 1P17A 4WMLA 3LPNA 2JI4A 4P83A 5KAMA 4Z1OA 1G2PA 4TWBA 1QK5A 2WNSA 1Z7GA 1A98A 1OREA 4P82A 5EUCA 1U9ZA 1XZNA 1QB8A 4RV4A 1DBRA 1U9YA 1A97A 3N2LA 1ECFA 1DKRA 1ECGA 4S2UA 1BD3A 1PZMA 2IGBA 1NONA 1O5OA 3QW4B 5E38A 5KAPA 1JLSA 1O57A 1DQPA 3DAHA 1ECJA 4RADA 1P18A 3GGCA 1ZN8A 3HVUA 3OZFA 1ZN7A 4RHUA 1VSTA 1BD4A 1XTTA 4RAOA 2FXVA 3DEZA 3NAGA 5ESXA 3M3HA 1ZN9A 1YFZA 2C4KA 5JV5A 1DKUA 1GRVA 1DQNA 1FSGA 1I0IA 2PRZA 5HIAA 1STOA 5BSKA 1CJBA 4JITA 4PFQA 4PAWA 4LYYA 4QRIA 4RABA 1A95A 1ECBA 2E55A 3ACCA 4FYMA 3O7MA 1IBSA 2VFAA 4MB6A 1G2QA 1P4AA 1QCDA 2YZKA 1I0LA 4OHCA 2PS1A 1TC1A 5BQOA 1WD5A 1VDMA 1XTVA 1XZ8A 2AEEA 2H08A 3MBIA 5BQPA 1HGXA 3GEPA 3S5JA 1J7JA 2H06A 4LZNA 1A3CA 4KN6A 2GEBA 1A96A 3OHPA 1Y0BA 1QK4A 1LH0A 4RHTA 1QCCA 1QB7A 4JLSA 3OZGA 4IJQA 5JSQA 4X45A 4ZFNA 1L1QA 3ACDA 2PRYA 2JBHA 4P80A 1W30A 2HCRA 1UFRA 1A4XA 5BRNA 2JKZA 1G9SA 4M0PA 5HKLA 5K51A 1AO0A 4M0UA 3MJDA 1I13A 4RQBA 4RACA 3LRTA 1NULA 4WN3A 2JKYA 2EHJA 4QYIA 3KB8A 3G6WA 1P19A 5ESWA 1UPFA 3DMPA 4M0KA 1BZYA 1D6NA 2P1ZA 1XTUA 3GGJA 3H83A 4P86A 4QYIB 4RHXA 4F8EA 2XBUA 5IPFA 1OPRA 1UPUA 1OROA 1VCHA 1GPH1 4LYGA 1TC2A 4LZOA 2DY0A 4LZAA 4P84A 1ECCA 4RAQA 1G9TA 1L1RA 1V9SA 1I5EA 1R3UA 1JLRA 4X44A 2H07A 1I14A 1HMPA 3EFHA
chains in the Genus database with same CATH superfamily
1OLUB 3KB6A 4LHVA 3B7PA 4XX0B 3ZHQA 3KZOA 2XF8A 2X7JA 1L8AA 1J9ZA 3HJGA 3LBIA 3OX3A 2FPRA 3V4ZA 3VM6A 1RQRA 1U0EA 2RG1A 4ER0A 1CHDA 4QBHA 5KREA 1QOQB 1SR8A 3KU4A 2NZJA 1UT5A 3WISA 2ZRMA 3JYNA 4R9VA 5ESRA 1GRQA 3EOBI 3FNRA 3CG4A 1DELA 2R8XA 1KDYA 5JARA 3KZMA 4ZAZA 1FFSA 2FH5B 2QUIA 1DOZA 3QYFA 4KSYA 3E61A 1Y3HA 4EATA 3R76A 5JFGA 3DM5A 1ZM4A 1WB9A 3O4FA 1AN0A 2WYHA 2WDPA 2ZBVA 1NKTA 2I1WA 3LDHA 3MCZA 2ECKA 2PBLA 3WA6A 2JCXA 2VYVD 4Q03A 1L5SA 1JB1A 1V8ZA 1OVMA 1C7EA 5HOEA 3N87A 4UXIA 2R8OA 1WMFA 3FPSA 1TLTA 2JBAA 1W29A 2VPYA 2YJ4A 4MZDA 2A9JA 4OJMX 1I6WA 2FRDA 1T10A 2RH9B 1L7NA 1DGQA 4TUYF 4OCZA 4PR0A 2I2WA 2X9GA 2CV1A 5FBWB 1BDJA 4CGYA 5F52A 1ZUHA 3RS4A 4K1XA 1H2YA 4UHCA 4CWAA 4EKYA 1K6JA 5EJIA 4GR5A 4WY8A 4BIMA 1EWQA 1F5SA 1HDIA 1WHSA 2HADA 1OXMA 4M7PA 1OJ7A 4F84A 1DC7A 1ISGA 3DTYA 3CURA 3EZ9A 4GXTA 5BV2P 1CTQA 2ZTMA 2EZTA 4JENA 5TJHA 1COWD 2FRVA 3KUKA 2WUDA 5AJZA 2IE8A 3UHOA 3V1KA 3HA7A 5JVDA 1C7JA 3ZCSA 2RGCA 2WWFA 1T9AA 4PZUA 3RSZA 4IUCS 4O08A 1G5IA 5H59A 1XKTA 2JGRA 5IJZA 2ZR8A 5K0FA 1PGJA 3NPAA 4WZAE 4J1TA 2EG9A 2Z95A 3MAAC 3D2BA 5SZJA 3ZU6A 3COYA 1XQ6A 1LEHA 1T5BA 4BP9A 3RRYA 5DGHA 1FNMA 1N7IA 1FVOA 3M81A 4ID3A 4Q7KA 2AWOA 3V4VB 1ZK1A 3AHHA 5EQTA 4DLZA 4G85A 1XLUA 4HYQA 4TVOA 1RYNA 4IMRA 3IPYA 2QQ5A 3BRCA 2PFSA 4RPIA 1GGVA 1U9IA 2IOYA 2GPNA 1G55A 5DRTA 2NVWA 3FRHA 2BT4A 3TTSA 4MCHA 1HNWB 1XTJA 4BB9A 4DC1A 1ABEA 3ZC3A 3JD0A 1U4SA 5FBVB 1PV2A 1QFJA 4EGJA 1LBIA 3PYXA 1UFQA 3WYFA 3G23A 4P35A 3K6JA 3O03A 3EGIA 4Q66C 1N8SA 4RMGA 5K6AA 1E4EB 3AY0A 4YMSA 4QDJA 5IF3A 1IN7A 5DNUA 5IX8A 5D7NA 3GMTA 1X1TA 5C2JB 3TR5A 4HDOB 1P2TA 4MRPA 2VBCA 5CX4A 3F3YA 4TTTS 1EGHA 1USGA 1ORRA 2B8EA 5JXWA 1R74A 2VJKA 5TY0A 3R6LA 3OC0A 1P7YA 2RI0A 2IA5A 4JI3B 3VNSA 2X0EA 4C0HA 4LWZA 3WK7A 3ZWBA 4D3YA 1O03A 2ID8A 2VCEA 4MV3A 3UENA 3MLBA 1IPHA 1A1VA 2IU6A 2IU4A 3ROMA 4EECA 1SULA 1UKBA 1Q0TA 2ZWMA 2WZCA 1W96A 2SCUB 4YRGA 4MV9A 3GRFA 3JQDA 1CULC 4TL7A 3DBIA 3V1LA 1SZCA 4LQDA 4XKJA 2QTWB 3U1VA 4A2QA 5JROA 4G25A 5HFJA 2FX5A 1H85A 4BFYA 3G2IA 5EGSA 2VF5X 2A33A 5LLTA 4HQRA 4FE3A 1IHPA 2GBLA 3V4PB 4CMEA 1J0DA 2DPYA 2OYSA 4CG1A 3VBCA 3FCYA 3KQWA 1Z6XA 1J1IA 2GH1A 3DB2A 4BLTA 4G86A 4N0DA 1EJBA 3PLRA 4V0NA 4OMCA 5EMHA 4YJFA 3GEBA 1DQSA 1RT9A 4ENUA 3GPDG 3R5XA 1PGNA 3EF3A 4MI9A 2CHVA 1SOWA 4DNXA 4E22A 2A67A 1Y5IA 1SC4A 2GKOA 3P0EA 2G4LA 3R6GA 1MAAA 3T5BA 3WWDA 4DPLA 2OUIA 3CFYA 3SZUA 1YL7A 3JALA 4GUDA 1JZQA 3VR6H 3NBAA 4NX2A 2PH5A 2AF3C 2FF7A 3TUIC 2CZGA 4NXMB 1IWOA 4EY6A 4I4NA 1L5ZA 4YT8A 4CKBA 5CA1A 3O8QA 4GBGA 3ZWVA 2PZBA 3SG0A 4FDVA 3RS8A 5KQLA 2IXBA 3U7HB 1TEVA 2VDJA 4RXTA 4C7OB 3O5AA 3AHJA 1C8KA 3L84A 5A03A 4EJ2A 1KO7A 4N39A 3D5EA 2JS7A 1DOAA 3RFXA 1X77A 2Z5GA 3NTLA 3OQ1A 4G5QA 3SN6A 1EZ4A 4EW6A 5C52B 3GLGB 4UTPA 4MRAA 5KDLA 2Q49A 1PK7A 1UEXC 3SQWA 3EOAI 4FJ0A 3P9CA 2BGNA 3D7NA 3G9ZA 3H1BA 4ND6A 4OHRA 4OY3A 4UW9A 3I01A 2W8ZA 1A96A 2JANA 3IEUA 3GBVA 3E23A 4DB2A 3PUJA 2XUJA 2VDPB 4MKHA 5E6SB 3WGNA 5I7FA 5KYXB 1X0VA 3RADC 3JYHA 2I91A 2QIPA 4AO6A 3LUJA 3HEBA 4LF6B 1QQ7A 1SK8A 2BM0A 2WU0A 1ZJ6A 4ZGGA 1JB9A 5BMVB 4UFNA 4R05A 3I5YA 3HJCA 4EEXA 3NBMA 4XTRA 1TIKA 1V2GA 4TTPA 5BRNA 4QQFA 4L4UA 3ZKWB 1V9CA 1FNDA 1IN4A 4HGQA 1JFLA 3M82A 5BOSA 5AW4A 4MKRA 3QVUA 4NAVA 4B0OA 2PCJA 4V1CI 1NSTA 3IIJA 2H1RA 3BSSA 1V6AA 3TLYA 4TKMA 4X6YA 3RTAA 1U2GA 2IT1A 4P5PA 3T0IA 4INZA 3ZWXA 3V7WA 2HCBA 3OCUA 1AMNA 1TK2A 3QW2A 1GL9B 4JGGA 2HJVA 4YRSA 3H8VA 1IWPB 2XKBA 2XMDA 3KCNA 1C7RA 4FQ5A 1DJNA 3WMGA 3G2PA 3VFDA 4CR7A 2GAAA 3E58A 2GWHA 3GC6A 1RS0A 1T2VA 2H4ZA 4HZGA 1TEHA 1GGMA 3CX8A 1QS0A 2A6PA 4BO8A 2JGFA 1WL8A 5EHIA 2H0RA 1E1RA 1TA0A 2DUUA 1PZHA 3KOXA 3R8CA 1UDAA 1OASA 3Q5GA 4ACBA 3ZY5A 1A2BA 1U9IC 3DNPA 1JQEA 4WLNA 4HYYA 4HQ0A 2AK2A 1JSRA 2WUWE 3TNJA 3AXTA 3BZUA 3DUFA 4HTAA 4AKIA 1KI7A 1OX4B 2AN4A 4WW0A 1ZWKA 1BS2A 4TWBA 3VUFA 5IVHA 2V7QD 4QOEA 1VGRA 1XZKA 1GTRA 3ETCA 3LPMA 4MWTA 3WWEA 1S2GA 2H17A 3AEQB 3RSOA 4AWAA 1U0LA 4W6ZA 4DGSA 4ZMSA 3CX4A 4X61A 1FRZA 1WB5A 1Y3IA 3GDGA 4RX1A 3VDRA 4UMVA 5J63A 3RPEA 1WEKA 3BF8A 4GD3Q 4U9HS 1W44A 1NXWA 2JIOA 3ZK8A 1NPTO 4B3GA 2VXOA 2C96A 3CNLA 1K3UB 4RYLA 5HS6A 1E64A 2PZLA 2FG6C 3GD7A 5F12A 4DV6B 1U5BB 3GGCA 1QF6A 4RHUA 1H3FA 1M8GA 4NEGA 1H8EA 3DEYX 4RFSA 2C88A 3PX7A 4BLQA 1RI1A 4ZOLB 1XMVA 2AOTB 1HDXA 2XKKA 5KJ1A 4DUYB 1G21A 4EA9A 2QENA 1I0IA 2FW8A 2PWYA 4W5JA 3DL0A 2EKBA 3ZQ4A 1NT4A 5CNIA 2KI5A 4IR7A 3LVRE 4TTQA 3U0BA 2R00C 5KOHB 2BDEA 1J70A 1BXZA 2RH4A 2HU8A 5ES3A 1CJSA 3P71T 1P2UA 2W2LA 5IANA 1Y8ZA 4P0PB 2L42A 4XLLA 4ZOLF 4BEVA 4DCMA 4Y2YA 3CKMA 2DGDA 3NV9A 1MD9A 3KVNA 3QVLA 1OGYA 2HIAA 2QP3A 4N8DA 3AEKA 2WVGA 3UMSA 2K5UA 1HXHA 4BNDA 5CEFA 3GFVA 4PONA 1UP7A 4OMUA 4ECAA 1OX4A 3FHCB 3VHRA 3ILSA 5A3VA 4LSZA 3NX4A 1P9LA 4L8VA 2ZJOA 3GZJA 3WNZA 4KMOA 3K70B 5JDIA 2ODAA 4KN6A 3GRZA 4WESB 4PZ0A 2OZLB 3A6ZA 3CR8A 5KYYA 1ADBA 4EUFA 3ORHA 2RHGB 3VSBA 4XYLA 3KQKA 1OFVA 3Q8WA 3TUZC 1V11A 3HCRA 5J4YA 5CBKA 2VJOA 4EBBA 1T6NA 4R2MA 4O2AF 4Q1FA 1QGOA 4LK2A 4XGKA 1EXWA 2NTJA 1PX0A 4L8WB 4MXDA 5GZ6A 3T3IA 3HCOA 2ZAIA 4HAWA 3WNVA 1VP3A 3VMMA 1IHOA 4ACAA 4PGAA 4E08A 1EAMA 1G5FA 2AJLI 3PFBA 4M1YA 3AZOA 5AVQA 2JGDA 1EGAA 1O6ZA 1O95C 1SUPA 4FZ3A 4C30A 5K5EA 1G3UA 3E3OA 4M2LA 2PX2A 3TSAA 1X7ZA 4ALJA 4EYGA 3O38A 2IDJA 2NXWA 3OF5A 4FGJA 3LY8A 1U63A 4DGQA 1BXKA 1T8WA 4L85A 3QI7A 4YTEA 4X62B 1IEXA 5ICCA 3CVOA 5EN4A 4BXOB 2DB3A 4K9SA 4KQIA 2IYRA 4RIGA 4ZVPA 2FOLA 2I71A 1TZJA 1T9ZA 4BP8A 1GPH1 4ZT5A 3L7JA 2ZQ5A 1VC2A 4TOIA 3TMAA 3KZCA 1PCXA 4ZTZB 3EEBA 1OBFO 3EIOA 5JWHA 3EPHA 2VL7A 2IIVA 5LXTB 2C4VA 1V3QE 821PA 1RRFA 1YONA 3WLTA 5L7YA 2QE7D 4H1VA 1R15A 4M37A 4AIRA 5D51S 1H8HD 2PS3A 3G5MA 4ZXFA 1KRHA 1ORTA 5E6UB 5HKBA 3NQ41 2E85A 3PR3A 4FONA 3I4FA 2JIRA 2GHTA 1ZXXA 1YIAA 1V7PC 5TMBA 3GHYA 1QCYA 1AKVA 1V6SA 3SXPA 2DFNA 1U7ZA 3ROQA 4B44A 2OV1A 4Y6OA 4ZU1X 3VPGA 4BUJA 1M2KA 1SHZA 2GF0A 4RADA 5A4KA 1CRLA 5EHQA 1ARZA 2R47A 3LO5A 3M1AA 5TMEA 3ZLJA 1D2CA 2VSNA 3EXAA 2EX4A 1CG6A 4JR2A 2IEBA 1DPFA 5FLXA 3V8NA 5JY6A 1QZZA 3TL3A 1M2HA 4WDRA 1YMUA 2G9RA 1NRJB 2OFOA 5DYGA 2G04A 3HHEA 4NZOA 5A71A 4AS1A 1CNMA 4C06A 2A78A 3EEIA 1RKBA 3VPHA 2OG1A 2VPZA 4II2A 2VK4A 4G5GA 3K9NA 1PR6A 2ZPAA 1Z7YA 5G1NA 4CM3A 1AG9A 2I2FA 2OE2A 2O3SA 4LOLA 1KBOA 1S8NA 4D4KA 4DDHA 2VYCA 3UXEA 3W7BA 2AEMA 4EHLA 4KR9A 3O4VA 5DYIA 3ZDDA 1X80A 3GYBA 3QA9A 13PKA 2WJVA 3KR0A 4I19A 4Q7EA 4QUBA 4XCVA 5JSKA 4BC0A 2IXDA 3GB9A 9LDBA 2ZRAA 2BTOA 3IMKA 2ZYHA 4JVSB 4KV7A 1W1IA 3EZYA 2CUTA 4PWYA 5I8WA 3GLHE 3HY3A 4PCUA 4UNRA 4Y7DA 3I61A 1QDUA 4FHEA 4RJLA 2A5JA 2A9VA 2QK4A 3KSZO 4PX5A 4X6XA 3ROKA 3OCXA 2A88A 1CJMA 3NLLA 2XVZA 4OSPA 4QEDA 4R5HA 5EZYB 3ZTTA 4JJAA 1YR7A 3JQ7A 3LRXA 1FE8A 1C7FA 3F8SA 2JFXA 1OWNA 1W5BA 3KYBA 3P0HA 5DP1A 4BB6A 3STTA 4DNQA 3B2QA 4HVTA 2Z30A 1L3IA 1REQB 5C0OE 2J3HA 4K46A 1GT6A 1I7DA 4DCOA 2FG5A 3ZJ4A 4EG0A 4RL6A 1Z0FA 4OGGA 3DEHA 2H1VA 1K0UA 3GRPA 4EITA 2HBRA 1YZNA 3PGKA 3UJAA 1TZBA 2RBGA 3JQ7B 1EUCA 4F9FA 3SYKA 1K88A 1LVGA 1K7YA 1WA5A 5JMOA 3IPAA 2FQYA 5B5SA 1CWUA 5KNBA 1ENOA 1B8PA 4U39A 4QQNA 4C21A 1GNTA 1VRWA 2CXHA 2Q1SA 3KFLA 2FQQA 3O21A 5B64A 1G9TA 2PJUA 1G3RA 4YACA 3SQOA 2IXEA 1FFCA 3SXUB 3DONA 4B2LA 2FG7C 4BMDA 1TGYA 3DDUA 4BGEA 2Q5CA 5NLLA 1LTQA 2HRBA 3A4MA 5HZHA 5KX5F 2VXYA 1EWRA 2ZCUA 4TRMA 5KAMA 4QU8A 4JWTA 3PRYA 1AK9A 2GJ9A 1IOLA 3HDVA 4ER7A 1G6KA 3B36A 3S99A 2GZ2A 3CH7A 1QQAA 3LNCA 4TVBA 3OX4A 1EFUA 2FZEA 1AHIA 5DN6A 3A2KA 4EHIA 4LEIA 3VZSA 3D4LA 3R7WB 2YV1A 2ZDQA 4BQFA 3HGMA 4YO7A 4MAAA 1GQSA 3NHRA 1O97C 3A6LA 1TQHA 3OIWA 1D03A 3FOCA 2QY9A 3GR6A 4NULA 4YHBA 4J2HA 3BH7A 4UQLA 4DQDA 2FLVA 2GZRA 5B53A 5ITVA 2MYUA 1KKLA 3F98A 1U11A 1U02A 4FZJA 3GHHA 1Z73A 2RGXA 1LSJA 1HT3A 3F6EX 4J0FA 1KQOA 1U98A 1USVA 4G4JA 4M0MA 3AI3A 3KR1A 5AOVA 1C14A 1KPIA 2JLWA 1J9GA 2O2SA 1Z39A 3TLEA 5KNCD 1W4BA 3SFVA 2IX3A 2EHDA 3ZOKA 4FYMA 3AEKB 2HA7A 4KH0A 1Y80A 4JBGA 5EG5A 1J1UA 4EO9A 5E2IA 1KDTA 1NUPA 2JF0A 2FP4A 2P9YA 4YS6A 3ROFA 3RUIA 1D3AA 1GZ5A 4B6OA 1UK6A 3A25A 2PEYA 5AHXA 3VSAA 3LLCA 2D74A 2LGJA 1B15A 1AS0A 5E7IA 3SXJA 5KSPA 1WG8A 1DRVA 2OHJA 1C1XB 3TECE 1AHHA 5BWCA 2RC5A 2A5YB 2ZK7A 1LV8A 3OD1A 2XF2A 2X0NA 1TZCA 1R4AA 1WXDA 3UT5A 3KB2A 3PF8A 1X15A 4E4TA 4X1OA 1NYLA 3VTKA 3TM4A 3Q0EA 5AXBA 6ADHA 4XSVA 3B70A 2HU2A 2OHFA 4L0CA 3BXPA 5BYBA 2B35A 1D5CA 1PJRA 4MW9A 2FPOA 4P80A 4XWTA 2Q3BA 3FB1A 4L2IA 1N7GA 4TMWA 3T7SA 5JDIC 2JKZA 2W4QA 1WHSB 3Q6NA 4OFZA 2XD4A 3R7LA 1XCMA 1YL6A 1R8SA 1PWXA 1OFHA 1EI9A 4ISCA 5DU2A 4H7IA 1TK9A 4BB5A 2HMUA 4EMTA 3DZHA 3GG9A 1O77A 3E18A 3E2PA 4EHDA 3TLGA 3TAHA 3UGJA 4X8LA 3G8AA 3VZRA 2KX7A 2INGX 5IJXA 2IITA 5GTDA 5DM2A 3BYZA 2ID9A 4UCXA 1Z47A 1FX0B 4KIWA 4S2EA 1RAIA 4RU1A 3U3XA 4QQKA 1A71A 1T15A 4H1WA 1E4EA 3Q5EA 2KM1A 2X86A 2QN7A 4TTAA 5CCXA 3EZ2A 2P6RA 4NU8X 4RHFA 3WFZA 5KQGA 3NMUF 5I51A 4X44A 5CD9A 1H8HA 4COKA 2HHAA 1U7OA 2PZAA 3VH3A 1E60A 4M9ZA 1VE6A 1XQ9A 1LTKA 1O94C 3JQ6A 3EISA 3LT0A 5DOVA 4ZVQA 1C3LA 4O3MA 2JJ1D 2A3NA 3TQIA 3FOAA 4M36A 1PDWA 4MV6A 1ZOSA 2ZWAA 4QKQA 3E5MA 4FR5A 4LYEA 3ICWA 5REQB 3FCCA 3MGKA 2FWRA 3N2NA 1VMKA 3E9EA 3ZY3A 4GZ3A 1SCUA 3WGQA 2LP4Y 2ZM5A 1X6VA 2XITA 2HCFA 2O2DA 2PUWA 2FFQA 2D1FA 3JWGA 3QUSA 1KAGA 4IIJA 4O63O 1M3SA 1U7TA 3CZRA 4CIWA 4R7GA 2VK8A 3O4RA 2E4XA 4YONB 2G6BA 3IESA 1NA5A 1L4MA 2IXTA 5ICGA 2J4FA 4QREA 4CIXA 1MG5A 1Y9JA 2G77B 3SJCA 5K0JA 4TLDA 3SBXA 1L7AA 1FDSA 1ZN8A 2DUJA 2QR5A 1RTTA 4YROA 3CNHA 5IJ9A 5M29A 4PYRA 1QGED 2ZYTX 4UQPA 5K8UA 2QT9A 2IGTA 1YI1A 3CR3C 3L3BA 1YRAA 4PS1A 5H81A 4W5OA 3EPJA 2ZJZA 1J22A 5THXA 4DJDC 1XEFA 4E70A 1JIVA 5FV7A 4W8GA 4BWGA 1A77A 5F7JA 1SUDA 1FPQA 3NKVA 3QNWA 2NX2A 2YHSA 3G17A 1FNSA 5HRCA 2C61A 3CXRA 4RK5A 4U2CA 4C03A 4F4HA 4ZEWA 2X8LA 3NC0C 5EC8A 1JE0A 2P0EA 1N6LA 3RM3A 2BH2A 4JJZA 1KI2A 1D1SA 4G41A 1P9RA 2QN8A 5TX7A 4B6JA 2I4IA 4JSTA 2YJ5A 4L8GA 4YUXA 4N3AA 5EJ8A 1CD5A 1G291 2AEJA 1RIFA 2XQIA 4NQZA 3IALA 4EB6A 4MWOA 1ZH2A 3PC7A 4LZPA 4TKVA 3QLUA 1Z0DA 2HM7A 2ZROA 3A9SA 2XWJI 5DT9A 4CM9D 2IHVA 2O54A 3BILA 4LBVA 3DL4A 3HJHA 2QX7A 3D6VA 3KD2A 3T4EA 4AO8A 3FJYA 4Z9XA 3VO1A 1AKUA 3E4DA 2OKGA 5MHTA 1OYYA 1MX9A 1TQ2A 3D7MA 3FBWA 3W4KA 2YY5A 5JAPA 1QG6A 3SHWA 4RIIA 4F2WA 2UKDA 1TJYA 2FPLA 4FYPA 3F6SA 3NTXA 4JVLA 4NZYA 4TXJA 3NHSA 1IBMB 1HC7A 1CEEA 3CRZA 3UXMA 1N78A 5FUBA 1H69A 4QATA 2Z5LA 1FUKA 4HQ6A 4C14A 5H68A 1YR3A 1GVNB 5L40A 3SS9X 4FMCB 1MGPA 2EHJA 4J94A 2FPSA 1MX1A 4R83A 2X8AA 5FWYB 1ZL0A 2VP4A 4IGKA 4UMEA 1YVDA 4MMYB 4YMIA 5CFLA 1SQFA 1SWWA 4OM8A 1EX6A 3INTA 3SSNA 3WIOA 2DZDA 2GXUA 1CQPA 1F7VA 3L0SA 1UQRA 4RDHA 3USCS 4GRIA 3VKUA 4Z4CA 1HDZA 2F43A 1NQOA 2R1ZA 3IUYA 5F4ZA 2QVBA 4XM0A 3ZQJA 4O4LB 5A3SA 2F55A 3RODA 4DV2B 3UK2A 3M33A 4JUIA 4MARA 2GN6A 1U31A 4KVAA 3GEDA 4HUQB 1E2GA 1W76A 2LUOA 2PKQP 3NGMA 1TPYA 4L08A 3N2ZB 4X84A 4ETNA 5BV8A 1LLFA 4LXUA 4YPVA 2OOSA 1CY6A 5LDDC 1A76A 4PRYA 3ETJA 4IQGA 4O59O 4WBXC 1A9SA 1JXMA 4Q6BA 2DBVO 1SVMA 3KTFA 5DCUA 3VC1A 1XZFA 4B6RA 4HDQB 4IZ6A 5CBPA 3L5KA 4OQDA 4UM9D 3D0RA 4JYCA 3TLZA 5C46F 3FHTA 1MMFB 3DR5A 4LX0A 2GM9A 3DCYA 4GLLA 2IZ7A 4HN9A 5JZOA 4RTRA 3VKVA 1QG2A 2J9XB 3DZ8A 4FP9A 4Q93A 4ZVLA 2GM4A 1CQJA 3FB4A 4S0ZA 1DG3A 2ECOA 5CH5A 3N2LA 3SCZA 4C6SA 4F2PA 2AZDA 1ACMA 3A05A 3PPVA 4TLBA 1MAHA 2P4EA 4TSRA 1DNPA 1KS2A 5AW9A 3O8OB 4U7PB 2ATIA 3KKPA 4A1FA 2DPHA 4MDEA 3KNZA 1EIZA 2E5FA 1JEEA 3DDWA 4QGAA 2CLSA 2QTVA 4GMXA 1NRIA 4IOJA 4EJMA 4YGYA 5K3AA 4MPTA 1J07A 1OPXA 1QYDA 2XEXA 3B51X 3FSEA 3GZNB 1M72A 4YP1A 5F3RA 2QB5A 4C05A 3TAXA 2QAIA 1JG7A 5FRDA 4UEJA 4K2AA 1L5YA 2YJ3A 3AJEA 4EUSA 4HN4B 1W0JD 3MS4A 1T6YA 3EQ8A 3IQZA 5E95A 5SZKB 4C08A 5KJFA 4MQ4A 1W87A 3TG8A 3JAKA 4ENRA 1QR6A 2W6JA 3II6X 3IP7A 2J3QA 1MA0A 3LECA 1UZMA 3KG2A 3G0GA 3KLOA 1ZZEA 5K7SA 4ZXPA 2ASVA 3SJ7A 5SZIA 4DJ5X 4L9SA 5F2EA 5EMJA 3F2VA 5BMOA 4XB6B 4IZOA 3IMCA 5LD2C 1FMFA 3HLKA 1RRCA 3A1FA 3QOXA 3DDNA 2E18A 4NMLA 4Q12A 2ORWA 4V38A 5M2QA 5E8JA 2ZSBA 2BMAA 4DJEC 3ZVRA 4ER6A 1T3SA 1Y9AA 2XJ4A 2O2GA 3LKBA 4D6XA 2AFHA 2YY6A 1XB2A 3W5AA 3YASA 4YI3A 2QD3A 2V7UA 3QXXA 1CR0A 1V5FA 4C6TA 1QLJA 4C5CA 2J32A 4XYGA 5LA6B 1MJ5A 3H18A 3L7DA 3WQSB 5AK6A 1GEGA 2P1DA 3PPYA 3A0RB 3RC2A 4IDEA 4WVLA 4TKUB 2DHQA 3IR6A 4EY3A 4A2CA 1TRKA 5KTKA 4NZ9A 2H1OA 4M99A 2P3SA 1U3VA 3RIGA 2PL1A 3D8RA 3B6EA 3P9IA 4ROSA 4MIOA 3TCXB 2Q4OA 3ZD7A 1DBQA 1G20E 1SPXA 3MJHA 3CW9A 1GNRA 2ZI5A 1YTUA 4YYZA 4LSWA 3F7MA 2ORYA 3OCYA 4DT1A 1MB3A 2HQOA 2JA2A 3F5QA 4Y2JA 2HA6A 4N8EA 5K3FA 5U4QA 2KB0A 1W8DA 4LFBB 2C58A 3DVLA 1B0AA 4JOQA 3FYSA 2YRWA 3H5LA 2VPWA 3I0ZA 3Q7TA 4PPNA 2MDTA 3WZLA 3T1HB 3EH2A 3KL4A 2FY8A 4TKVB 5A0VA 2HMAA 3CLTC 3O7WA 4B4WA 1Z63A 5IVKA 4NXNB 5H5JA 3VPXA 2A5FA 2BFPA 3SF8B 4V39A 1RRVA 5E6UA 4C6RA 1Z6ZA 4WESA 5TPWA 1GVHA 5FUWA 2JASA 1U8CB 2YCLA 5FEUA 1F17A 4GOKA 1SUIA 1E3SA 2QTRA 5A06A 1BHSA 5FUMA 2HWYA 4NL4H 2AW5A 2VHXA 3VX3A 4UPEA 1EK1A 3I2JA 3N07A 4HZIA 5AKGA 5J9FA 3GLIA 1C50A 1NMSA 1YE5A 1BMFA 1G19A 3DJFA 4Y9TA 3GLFA 3R0XA 5ICSA 2BFAA 3B6IA 3ELWA 4N1AA 1UDXA 1C0EA 4YBZA 2ONZA 2J1LA 1KR2A 5I9LA 1Q7RA 1OW3B 2AQIA 3D2CA 3F2IA 1NJ5A 5AKZA 3T7CA 2OSVA 1PK8A 2R6AA 1ULBA 3TDKA 1VP9A 1WVMA 4G84A 4GSLA 4PLVA 3TH5A 4ASUA 4HDRB 3RIXA 1CVIA 4AN1A 1NLFA 1WWKA 1TXGA 2RIPA 5IULC 3AM1A 1XKXA 2YDXA 3MRSA 3QTLA 1QH1A 4BQQA 1X94A 2LCIA 4GLJA 3JVEA 2H11A 1DXHA 3KUDA 3IGFA 5JD3A 1BN7A 5KAPA 2GBPA 5IYZF 3WICA 4M4SA 3ZJTA 2JCGA 4U0JA 4FFBB 1PYDA 1QRTA 2ZOSA 2QROA 3DL2A 1QX3A 1RVV1 1UZNA 4KI0A 3ZI4A 3VJRA 1YZQA 1A9OA 4B7AA 5AW8A 2YV3A 1B26A 2YVAA 3G5LA 4OU4A 1SKYE 2DERA 2X2PA 1B8NA 1SXJE 2I2XB 3KKZA 4K5QA 1KQ3A 3K32A 1UWVA 1JKFA 1NIJA 2JAQA 3O6VA 2Q41A 1EFVA 1ZA1A 5BRAA 3KOOA 2J3MA 4LN1A 4PQGA 2QTBA 1M9NA 1CJBA 3ANSA 2P9EA 2QJWA 4JBXA 1JG6A 4TL9A 5D87A 2HF9A 4X85A 4BVBA 1CDEA 5AFSA 3QKRA 2P6NA 3HKCA 2QGFA 3N39C 2BDUA 5CT9A 4E31A 4FFPA 3K0CC 3X1MA 3SWWA 2C0PA 4AXBA 1MB9A 1P75A 3BAFA 3KB1A 2CV0A 3FZNA 3HCEA 1L1EA 3P27A 1ADGA 1GFWA 2ZJBA 1B1CA 4HS9A 4R98A 1CUFA 3GVIA 3SSAA 2JFGA 1OWPA 4FR2A 1BGVA 1KVSA 1P1BA 4LVUA 5EKXA 4DCJA 1OLSA 3H6HA 3DM9B 3PUWA 4DUPA 3KPJA 5JNSA 1EVJA 4DAEA 3X1JA 2BY4A 1PJCA 2OORC 2GD6A 4PQRA 4COOA 1E2NA 2C84A 2G7ZA 3Q7EA 1KKMA 3U4GA 4CQJA 5C8VA 5IG2A 2FWBA 3VVBA 5BNFA 3CTPA 3WYAA 2ZIWB 2JW5A 3JVVA 1G64A 1KP3A 2JEOA 3IBCA 2JZOA 3VH1A 1Q7GA 3FKSD 2ZJ0A 1K8RA 1YUMA 2CLEB 1E4OA 4C0SA 4WFIA 4BO0A 3QENA 4RS3A 2B1GA 2WYVA 3MJDA 4ZD6A 2C92A 2X22A 4UZEA 2ADOA 1D0VA 4P32A 2V7WA 5TQ2B 3ESDA 4JNKA 4RESA 3DKRA 1MJNA 1WCWA 1H6DA 4LCBA 3P96A 1RM3A 4K8RB 4INPA 3DMPA 2Q9CA 3UAZA 1G6Q1 3ZCUA 1QFMA 4B8WA 4D0GA 2Q0XA 4N3BA 4DSZA 3T7IA 4EG6A 1O96A 5CYPA 1W8IA 1TB4A 4BTEA 2YCBA 2D0DA 4OHPA 4IIBA 3M4JA 4JZKA 4OK3A 3JAMA 2XB9A 4II7A 5DF1A 1JH8A 1NI3A 3WRXA 4E32A 1Y5NA 5HZGA 5A9SA 1JFVA 1Z0IA 1PNRA 4ZP1A 1XLVA 4PVCA 4DIEA 2QUJA 3ICQB 1KC3A 3MTAA 1GGFA 2QZZA 3R6DA 3TQOA 4B9AA 1QR2A 2YXPX 4MVJA 1XEWY 2AW3A 2WJYA 3CH6A 3LBNA 1CB7A 3TKYA 1U0NA 4PNZA 2CLCX 2I99A 4ZCTA 3HUEA 3CUKA 1BU5A 1C7ZA 1DT5A 2V9ZA 1C8LA 3G9UA 3GRKA 1OX5A 1M5TA 4WTOA 3H9GA 4AJJA 5F9HA 3MT7A 1KDVA 4PSDA 3I2FA 3ABSB 2AMYA 2F2TA 1V8PA 3H2ZA 4GEKA 4KFSA 4UEOA 2O5EA 4ZVNA 2AFIB 2XV1A 3V2IA 2YXBA 3R5TA 4TV8F 4R9NA 3V7FA 4FZ5A 1F7UA 1PT8A 5E3HA 1J90A 1E6KA 2HLPA 1DUIA 1U1DA 1D6MA 1F4LA 1VA4A 2R84A 5EVJA 3RRJA 1N8TA 1G21B 3KD3A 5JQGA 1ZN7A 3U39A 1U8ZA 3I28A 1D0IA 1WXGA 2CLFB 2QRQA 4K1LA 3N05A 4GL2A 5EUBA 4KUGA 1CIVA 1JNYA 3QX9A 4U5QA 3UKJA 1AUXA 1Z38A 2A0YA 4V0LA 4Z4QA 3GO4A 2G1PA 2E5WA 3D3JA 5C3UA 2GK6A 4CLXA 2NM0A 2Y4NA 4I50B 1EXDA 1LDYA 1KFEB 3MRXA 1KPGA 1WD7A 2IUEA 2W2KA 3E4CA 2HTEA 3SKXA 3RAEC 2V6FA 5BSMA 1NW7A 1G3MA 2PD4A 4JIMA 1BH6A 5U1PA 1LZKA 1Z36A 2OLJA 5BYJA 3ROEA 3V9PA 3FTEA 1RRKA 3LPCA 2QU8A 5JQGB 1HT1E 1OC4A 2CLOB 2HRCA 3IA2A 1TF7A 2P79A 4CM6A 3W77A 1Z6GA 3VNRA 1UKEA 3I6BA 3I8OA 4RELA 1L4UA 5EIAA 1JQ5A 5AKJA 3TW4A 2GN0A 3NBQA 3MTDA 3HZRA 4ZU6X 1W47A 3BGDA 4LXYA 1MXFA 4BLSA 5DWQA 1S2IA 3CJTA 4K7JA 1RE1A 4YN3A 3OZIA 3JR3A 3P20A 4H27A 2PA0A 4FGSA 4K9LA 1T1SA 1RWPA 2B4RO 4Q1CA 2F8TA 2YWHA 3V97A 3IO3A 1Q92A 2N46A 4UOEA 4YV0A 1L1FA 1VPVA 4FFVA 2XUOA 2PPLA 2VTDA 3E35A 1TOAA 4KWIA 4QOHA 5FB3A 4RVDA 2PX8A 3QKWA 3ACDA 1K0FA 3H2IA 5AM0A 1XU4A 3FLAA 1JA0A 2Q9BA 4MVWA 3Q6MA 4E4YA 4XR9A 2OV4A 1OGJA 3BHIA 4LWOA 1LNZA 2ERYA 3EDMA 1H8ED 4J7CA 1L4GA 4HFRA 1VYUA 1NVMB 1PR3A 4P7KA 4KWHA 2XE7A 3TDMA 3OCWA 1Q6ZA 1YCGA 2QU7A 3PNSA 4PZEA 3UC5A 2IXFA 2Z0MA 1DC6A 2G4CA 3EZNA 4KOAA 4TWJA 5ESDA 4BYMA 1WUYA 2F9LA 1CJUC 4YJDA 4HWGA 1N1EA 2DP4E 5LQAA 4W5QA 2Q3LA 2ZRIA 5JJIA 1KEWA 2MINA 4WY2A 2OVBA 1NI4B 1TM7E 3GAFA 3K4PA 1JVBA 4IYRA 3U7QB 3B12A 2R6JA 4MITA 1NP6A 2Z43A 3LKZA 4ZCSA 4CNBA 1M1UA 1QBKC 3A14A 4URZR 2XCSB 4KXXA 3DVSX 1M54A 1ZKMA 3NIWA 2V7QA 4NP6A 1CP2A 4DLVA 4ZJUA 1E5DA 1J24A 2RDMA 1FXUA 3F5SA 3K2IA 2FVYA 1BMTA 2XOEA 2Y99A 1IQPA 2QV7A 3JD3A 4XGRA 3FYDA 3LPNA 2QNIA 4YV7A 2B1IA 4JXXA 1N2CA 4ZWNA 1G8KA 2OZEA 3RGGA 4EL0A 1TAUA 1DQZA 4JDPA 4BO2A 2DR3A 2CL5A 3VR1A 2QRVA 1SM4A 4FNAA 1B43A 1L4BA 1LLQA 2W8BB 4LXQA 1KK0A 2CBGA 3C8UA 4QPNA 2JLXA 2B5VA 5BXYA 2VRWA 5I4CA 3UJDA 1XHEA 2EG5A 4OHYA 2GK3A 5BQFA 3KWJA 5CJ2A 5MDHA 4OA8A 3L46A 5BN1A 3KE8A 3QOWA 4ZOQI 5GOZA 4ZDWA 1T8SA 3OOEA 3RK4A 2P5SA 3COVA 3CT6A 3AJRA 4RMHA 3NHYA 1O4VA 2C59A 2VAPA 4EARA 1AKEA 1T8TA 1U2DC 3UWSA 4DQLA 4IRUB 2Q2NA 4EDFA 4B3MB 4CGZA 2XLCA 4KDCA 4O1HA 1Z6TA 1JAXA 4YHHB 4BV3A 3SNHA 3UGTA 3W8NA 4LRTB 2H4FA 4W9NA 2IBSA 3GJZA 4DV0B 3ESBA 1T5LA 3AHDA 3I23A 3FZQA 3JATB 4NJEB 1DU4A 3GCXA 3HB5X 4MGIR 5C5IA 2F4NA 4RLHA 4YY3B 2X1LA 1PFGA 2HGSA 3SX0A 3IKTA 5LQKA 3AY6A 5JPDA 1NM5C 3C97A 3EWAA 4QAQA 1DWOA 1YVEI 3IX7A 4B33A 4D3FA 1U1EA 1U2PA 2A59A 1XXHB 2G28A 1MHPA 3IBTA 3HVJA 3OG9A 4JBLA 5ALKA 3WTCA 4PHFA 4FYIA 5EIBC 2QM8A 1HGXA 2HSEA 3LUAA 2C07A 3F3MA 1G60A 3F7NA 2Q1TA 2FZGA 3OSUA 4GKBA 3UFXB 4U6SA 4RVSA 4ESOA 5DIFA 4IQFA 1GHTA 1LVUA 4L3WA 5JAMA 4Y1GA 5A4IS 3TTYA 2ZJ5A 1GCIA 1KGSA 1AC5A 3LP5A 4BRUA 5KO2A 3MINA 2D2XA 5DYTA 1J9EA 3RVQA 2LW7A 3INRA 4Q0MA 3ZX5A 4JI2B 4LVCA 1TJPB 4CXMA 5JJLA 1GQQA 3TDNA 2C7OA 3FSGA 5KMGB 2W6JD 1YS6A 3ENKA 4NG5A 1PS8A 3QU4A 4ANFA 1V5WA 1Z26A 1TVMA 3E5RA 3L0YA 4QIHA 4AG3A 2YYZA 2BEWA 4EWLA 3UFXA 5AVXA 3D3WA 2BBSA 1NV9A 2HBYA 3ECSA 3GAMA 3QU9A 3RVDA 1NW3A 4GDMA 3GLTA 3TOCA 3UWOA 4DDVA 2ACWA 2JFZA 4I5DA 4Z8YA 4ZI3A 1SCKA 2C9BA 1D2AA 4CKWA 1KY5A 3C3AA 4GECA 2DPMA 3IVAA 3KKMA 1WPRA 1YHNA 1YRLA 3M5PA 1K75A 4L0DA 5JHGB 3MILA 3B20A 4A0QA 5JYBA 4EK9A 4B35A 3HYRA 3E9CA 3V4OA 3HCCA 1OTHA 1ZVKA 1Y6JA 3HN6A 2E4YA 1T3HA 2VJAA 4HZUB 2AZ4A 1NQXA 5EAIA 4ZV7A 4ENTA 2PL9A 3C43A 4IXTA 4OHVA 2CNLA 4QLBA 1HFWA 2G5GX 2VWPA 3MWKA 4HX2A 3ELBA 3NEJA 3S70A 1D4AA 3FNGA 3K1JA 2JVKA 4PN7A 4PAQA 4TYPA 1LX7A 3EIEA 4BJ3A 1FS5A 3DTVB 4Q6WA 4TM8A 5EPUA 6REQA 1XMQB 4HWPA 1N0HA 1O58A 2YICA 3AW8A 4JUDX 2EGUA 2F1HA 4JR0A 1V41E 3F6PA 3FF4A 1SOVA 1V47A 2P4UA 3MEQA 4P4TA 4YNBA 5E1DA 4DVGA 4BCCA 2W0SA 5AI0A 5EUCA 1U3GA 1LI4A 3BE4A 3TLCA 4MROA 4P38A 4GWKA 4Q47A 2IV2X 1RQNA 5A7GA 1QIIA 5AVRA 2FETA 2F8LA 2EX1A 1Z2DA 2DVMA 3EQ6A 3HCPA 4QUAA 4QX6A 4ZPXA 4U00A 1C9MA 5LB4A 2JLSA 1YCHA 2ON6A 3KAPA 3O4GA 5E6SA 5KYXA 2B82A 4B2PA 4QPCA 4BGDA 1C29B 4E13A 5B30A 4RM3A 2IYPA 4I66A 4Q01A 1EU1A 2HDWA 3A3KA 3EMKA 1X2BA 1BNCA 4L6AA 4ZVSA 1RYMA 1N6OA 5DM60 4RK6A 4YAWA 4MB2A 1E3EA 2PTGA 1DKUA 2B3DA 4I50A 2P4QA 3I1YA 5ICFA 3S2EA 2WR8A 3V1NA 2DPXA 4EO7A 1K97A 1AXEA 2W2KB 3AEXA 1C3EA 1Q17A 1T9HA 2A4MA 3L6RA 5CX1A 8GPBA 2HO5A 2QD1A 5I7EA 5KTOA 3I37X 4POAA 1MC8A 1A95A 3WJ1A 5D85A 1XJCA 2YFKA 4J4HA 1IBSA 2YQ5A 5EI5A 2P90A 3H1PA 3PGA1 1BYIA 1UBMS 1E1KA 5DTEA 3BWXA 1CU1A 1HTTA 3ZNPA 3BRWA 1JR4A 3WYBA 3OC6A 3EPRA 1AGYA 2G71A 3O8OA 4G9EA 4R1QA 3FTQA 5KHLB 2AC4A 4BMXA 3U7IA 2UZ3A 2XWPA 3BXXA 4YMWA 1CY4A 5B7PA 1NASA 2G1KA 5BW5A 1RBZA 1ODLA 1T4CA 2Y05A 5C53B 5JRDS 3OI7A 5E8RA 4JBHA 1BSVA 3WGOA 4RLSA 2VATA 2QZJA 3L02A 3NATA 2PIDA 3NDJA 1SH7A 1O94A 1U6JA 1XLTA 4ALKA 5K8TA 1E1QD 1P2FA 2TECE 3JX9A 2QLTA 4O4JB 4KMMA 4FT2A 3O2QB 3BULA 2XCRB 3EPPA 4Z4IA 2DTDA 1EEHA 1IK6A 1CP3A 1E8NA 3KRTA 3M6AA 3X2SA 3OU7A 1KFKB 2DWCA 2IW3A 4GC9A 4N7JA 3JWJA 4LCJA 3AM4A 3PQ5A 4EW1A 4L2IB 1GSAA 1AM4D 3L9XA 2QTHA 5ILQA 1BE6A 1X92A 3MJTA 3DMDA 3U31A 3GRRA 3MHPA 4EUNA 4PZAA 5HKOA 5JU6A 3K9CA 5M7EA 3RC1A 3K5PA 1K5HA 4Y6SA 1P1CA 2SBTA 1E6UA 5L4SA 3BGSA 1YBVA 4GX0A 1NMQA 3A7EA 3M6UA 4GPZA 4XUGB 5LOVF 2ODQA 2JATA 4KPUA 2A35A 2G1JA 3QVOA 5MGNA 1NPDA 5KZMB 3EOZA 3F96A 1EHCA 4GM4A 5JSYA 1Z0SA 3SMVA 2NUTA 4WKCA 1JX6A 2ZEJA 2UV8A 5EKTA 5BUQA 1NY5A 1Q14A 2B7CA 1NRXA 1VSBA 1WB4A 1W7AA 4DPKA 1CE8A 1EYZA 2VDUE 3QQPA 2HA4A 4P3KA 1P4HA 1QV6A 2H16A 4IV0A 1Q57A 3HXPA 3LYLA 3UAWA 4MVJD 4N01A 3STWA 1EXVA 5B2FA 3MM4A 2NSLA 4PNEA 1MB0A 2CF5A 3O9MA 2WB4A 1ADFA 1ZGZA 2OXIA 4R40A 1LW6E 3KYCA 1Z5GA 1E66A 2X3FA 2BIFA 3IDQA 2BFDA 2FW0A 3LUPA 4N3GA 2OM6A 4RV4A 2D5CA 1XCGB 2PGIA 4BZPA 1Y9ZA 4CV0A 4DW8A 5I47A 2H4WA 1Y7PA 2ATEA 2WF8A 1VYHA 3CPSA 5KINB 2O8CB 3IH5A 2OB2A 1CZUA 3K30A 2Z4RA 3NVAA 2Z9CA 2EGHA 3IEPA 4P31A 4R31A 3RU3A 1M73E 3EZ6A 3WMWA 4DNOA 4UHDA 5JE8A 1G5RA 2JHGA 1OLOA 2V6JA 3C8HA 3BOSA 4NDAA 1NWCA 4ES6A 1A9ZA 1KYQA 2FYTA 1E3JA 4MTLA 1QIFA 5A02A 2R5NA 3KUUA 2EQ5A 4URUR 4JXZA 1SURA 3K31A 1MDFA 1Z4MA 1JMYA 1GA6A 1GU0A 3O74A 3WK4A 3PPXA 4JQSA 3TBHA 1JR2A 1DUVG 1M7GA 1YIDA 2J5RA 5GIOE 3AG5A 2DETA 3MCWA 3TTVA 2GHRA 2D06A 4DTCA 2DPGA 2X1VA 3VHXB 1ZC3A 1O0CA 3BMQB 1UBGA 4CEIA 2A92A 4PYLA 1LI7A 3ES9A 5EIXA 4CIBA 3OCJA 4RORA 5BPFA 3T5CA 5IAEA 4XD7A 2OGUA 1L5KA 5ITZB 4MLZA 4WLOA 4PAGA 3RU9A 1QDEA 5CCBA 2REQB 2F1OA 2IZZA 4PSAA 2BJHA 1TD9A 2Z4TA 3PD0A 1V43A 1PD1A 3Q0IA 2BEVB 1CLEA 2CL0X 1XMIA 3S5JA 1ZVJA 5HTKA 4O4HB 4FNOA 1J7JA 1OBVA 3G02A 1T4BA 4OP2A 2CFIA 2G0NA 1XRJA 4QM7A 1U7HA 2Q1WA 1BO6A 1UKCA 1XPJA 1G8SA 3IUQA 5IABA 3HU1A 1G20B 2FLKA 2ZIGA 3I64A 1ID1A 4XTCS 3ZHUA 1O6BA 4UU1A 4G5XA 3DW1X 3DEJA 3OBBA 4ED9A 1QCZA 5JPIA 1U8UA 2K87A 3IXMA 4MA0A 5HRAA 2GAJA 1GFSA 2I67A 2I80A 2YL2A 1ANKA 4ESVA 1UBNA 2C2WA 1PJSA 3T54A 5AYVA 3DFKA 1ZOOA 3I01M 3HI6A 4UHKA 3PFFA 4JSYA 1PW7A 3OZTA 3MHTA 3P4XA 4FW8A 4TM7A 1E2IA 1BYUA 5HKKA 2VTKA 3LRTA 3LA8A 2HJWA 2ZI6A 5JMWA 1W4CA 1E1NA 2BEJA 1K68A 2VT6A 3KV1A 2AOVA 2H92A 4HI0E 4PZLA 1X1AA 2QT0A 1P19A 3QUQA 4AIIA 4OX9Y 1E2MA 1U8FO 1S3IA 2XWBF 1M1YE 1SOAA 3ORQA 2A9PA 2XAUA 4TZTA 1U4OA 4DFDA 1XTUA 3FDJA 3SX2A 4F1JA 5ALUA 2A9QA 3W5BA 3O3CA 3Q3HA 4JI4B 4J7UA 2A0WA 5I7AA 4R8KA 3I39X 1S9HA 5BN4B 2HBQA 2EU8A 3SHQA 2XGSA 1TYBE 1K7EB 4ZDIA 3FOEC 4NS4A 3K4HA 3BFXA 4KYVA 3BFKA 4NVRA 5EEHA 3RRZA 3VR4H 2J07A 5EJ7A 3AY3A 4Z6KA 3AVXA 2JGLA 3BVPA 2XT9A 1QVRA 2IIPA 5BO5A 3UHJA 3DE2X 2XDYA 4NHEA 2ZIUB 5G3ZA 4LYDA 5C18A 4UBIA 3ZD6A 1ZGJA 1BMDA 2YVLA 1G20A 1HE8B 1QAQA 3GRUA 3WLRA 5EMLA 3RWMB 1GDHA 1TGVA 1QK5A 3UOAB 4JJGA 1SG9A 3HHPA 4X24A 3F3KA 1GQOA 5EP4A 5LBUA 1KYYA 2BFOA 2DLDA 3KHUA 1U0TA 2WHYA 3KKNA 2ZXEA 1BX1A 4RXMA 2OV2A 1ST2A 4G8BA 4CDGA 3ADCA 1ZBQA 2XNJA 4FYYA 3PFCA 1JJ7A 3IT2A 4JROA 1NYQA 3NHPA 5C5DA 1JRLA 1BW9B 4GP6A 3X1YA 1R6VA 2Z2JA 1IVNA 2OHOA 3MCTA 4YJGA 4C78A 1JEDA 1RPAA 2W6QA 4DZRA 3OEHA 4M0DA 5E1BA 4KWTA 2UUCB 4PX2A 3PJRA 3M9LA 4TN5A 3BKXA 3IMEA 3H5IA 4XQ9A 2BKAA 1B00A 1N2XA 4JA2A 1E89A 2G08A 1QHFA 2JD1A 2PD3A 3G0IA 3N59A 3MTBA 4PLTA 1RYZA 4OIMA 5E6RA 5KBYA 1YL5A 1AGNA 2QE6A 2LD4A 4C3OB 1NJFA 3Q5DA 1JR3A 3F97A 1P33A 2W2XA 2D1TA 2WM9B 4H6VA 3LOPA 4L95C 3TR0A 3ACCA 3BFVA 3LK6A 2VPIA 1Z2PX 3WRYC 3OIUA 3RLIA 1TX4B 2ST1A 4DA7A 1NFFA 3ETEA 4ARZA 3OTGA 4CT4B 3L4BA 1J8FA 1I0LA 3G1UA 4K6HA 2Q7DA 3A9VA 3PJFA 3QLUC 4AAYA 2G6TA 4KB5A 4ZCRA 1G98A 1NE2A 3DLAA 4Q7JB 1JI0A 2HH9A 1GZ3A 4P4GA 3NOQA 4KAXA 1PJBA 2ZBRA 3AJDA 4WUTA 3HK2A 1HLDA 3NC1C 1K6IA 5DHTA 5J4KA 3CVWA 3UAOA 1GZVA 1SUBA 2DWQA 3DWEX 2F3SA 3E7XA 1RD4A 2H5JA 2DJ5A 1XG5A 1R5BA 2FJUA 4J0JA 2GF9A 3O8BA 1AZLA 1UP4A 3MUNA 3L6OO 3LE8A 3W5IA 1ND6A 1PNVA 2GFIA 3S8YA 1JR6A 1XIVA 1F6WA 5B1SA 3LD9A 4Q3EA 5IHPA 1EGMB 3OD5A 1ESMA 1EP1B 3U7QA 3U7FB 3I6QA 4MDYA 3M1LA 5JYDA 5A0TA 4IQ8A 1LRLA 4KDFA 1IMOA 5HM6A 1JLHA 4GDFA 1OJLA 4TWRA 2J8ZA 1JHQA 1JHAA 3QEAZ 2PT9A 2BL4A 2IEAA 3IAXA 3PDIA 4PGGA 4OB8A 1I3OA 2C57A 2BE7A 4OLAA 4QUIA 1UL1X 2PMKA 1JDUA 2HGZA 3M6VA 3R09A 4XUDA 5FA8A 4Q3KA 3TRHA 1D2NA 2CJWA 2P1RA 4FOLA 4W1QA 1PV4A 5BORA 1ZI6A 1Q3TA 4PSCA 2FWNA 2YWFA 1KMHB 3MPOA 1QHGA 1XZPA 2IXAA 4EYOA 3IEXA 1TKBA 1OY1A 4CQMB 1UFKA 4FIZA 4YJ3F 4C4YA 4C20A 4F5YA 4EKIA 4RAQA 3C1OA 3TB6A 4YT4A 4HVLA 3EQ7A 1GZ6A 2FLWA 4Q3NA 1IQUA 5GADl 5F2KA 2PUJA 3I2KA 3KSRA 5JY1A 1OFUA 4WNAB 1ZXBA 4AG5A 1PW5A 4M54A 3UFBA 4IBOA 1DXYA 1Y1LA 2O2CA 2AZXA 1H5NA 5DBEX 4QD3A 1SBNE 5CNJA 5EQFA 4J3NA 2BFDB 5DXAA 1CERA 5AW5A 1Z4KA 3TZKA 4HOYA 2D3TA 1ICIA 1EWTA 1DJLA 2YWEA 3DS8A 4AKTA 2H2IA 2Q5OA 4K0RA 3ECCA 1VIAA 3D2LA 1NZDA 3NYIA 3PUKA 1WDTA 2B4KA 4XDYA 1CUVA 3CVVA 1GYPA 1EEXB 2PMDA 3M6FA 4H3HB 3U3OA 1ZY2A 3KHKA 2FW6A 4JAVC 2A0KA 2WKSA 3JQEA 2C8LA 1IXSB 1NBOA 3TJRA 1QYXA 2OAEA 3L92A 2AF4C 3LIPA 3NWOA 4F8JA 3M4NA 2NO7A 1GG2A 3UAGA 4FYXA 2Y0BA 4B4VA 4MRRA 4KV9A 3O9VA 2WJHA 3D4IA 1I8TA 4CT5A 3E9MA 4GYJA 3WFJA 3NVMB 4OP1A 5JR3A 3IVCA 4YMGA 3I5AA 1OTYA 3FGOA 3HY6A 3PHGA 2IHTA 4G6ZA 4EB3A 3TEJA 5CLHA 2HYDA 2JAPA 1A8SA 1KSJA 2I2AA 2XDWA 3QKIA 4H60A 4I1VA 4LZWA 4Z3DA 4YR7A 1RQ2A 3SZRA 2VQSA 4RVHA 5JNRA 3VVCA 3LBFA 4WBNF 3HMQA 3IUNA 3OFKA 4DCCA 1EFRD 1NVEA 2BZGA 3SYMA 3T1QA 1YUNA 2CFCA 3IHTA 5TLSA 3RASA 2KSQA 4NEQA 2XHZA 3L6BA 2EC5A 1NQ5A 5BQOA 1DUSA 1JS1X 4RVGA 2O2IA 4HB2A 1KSHA 4BB0A 2P11A 3AI7A 4M7OA 1XJ5A 4R0VA 5J2TA 5LD2B 3L43A 2GTPA 1SKMA 1PR1A 3ZE9A 2WFAA 1OSNA 4UBJA 5T67A 1BGWA 2G63A 1E0KA 2WJ3A 3LX8A 3PFWO 4XJVA 2B2XA 5A5EA 3ND5A 5EHNA 4M7WA 3AIIA 4OXQA 1J8QA 2H4XA 5FH9A 3H2KA 3MB5A 1CJVC 2X4GA 4LXHA 2Q4BA 2W2MA 4NMWA 4RA9B 3DG9A 4J0QA 2OHVA 1RYHA 5LQSA 5FJJA 4ZVUA 4EHBA 3QKUA 3VX4A 4YRRA 2UXBB 4KJXA 5GZ3A 1WEHA 4H1UA 4C0KA 1USKA 1B93A 3DMFA 5JATA 3FZEA 1CX9B 1SIBE 3NANA 2HHHB 4DLLA 5LNK1 4Q4AA 4Y6LA 5EWJA 2BR4A 4JBIA 3W2IA 3MWDA 3HKDB 4S1NA 2QTTA 3C15C 5YASA 1N2JA 1I6LA 3MAJA 1E1RD 4E15A 4DBZA 2VTBA 1JE1A 3OE7A 4DCUA 5ALRA 1P31A 2G70A 4GT1A 5IFLA 3U19A 2CLIB 3ER9A 5DHFA 2ZR7A 3DO5A 1E4YA 1GTVA 2QLLA 4HD8A 4QTTB 3ISTA 5ENDA 2Q7OE 3WJ2A 4AMVA 3IP9A 2BFNA 1SVOA 3TNFA 3RSFA 1GQRA 1OFGA 3MWJA 5J4LA 5LQMA 1IXRC 1NF2A 3PCRB 4HLQB 5A9TA 1DTEA 4O8CA 3ZHTA 5FWDA 4OOEA 4FJ2A 5AKHA 1EE1A 3TSCA 1D07A 1P1JA 4FFOA 4LRXA 4PZYA 1CUGA 4D3ZA 2R4UA 3W2FA 5IT9A 1O95D 1HLFA 1USWA 3EAFA 1O87A 1OFTA 1BIFA 4JZYA 2D62A 3MINB 3CX7A 1DRWA 1NRWA 2OKCA 4BKPA 1ZJJA 3ZDYB 2BTQA 3QV2A 5A1JA 3D5TA 1UPXA 2FZWA 3LUHA 4HN2A 4IX1A 1KI6A 4U8GA 5DI3A 3REQB 2FWIA 3W6NA 1XZGA 2W2VA 1M0SA 3GFFA 3CZPA 3GVCA 1M2OB 3ABZA 3L7AA 4HWTA 2VDQB 4L5JA 5DTRA 5KYYB 2PGDA 4PG7A 4FWTA 4N5NA 4GMFA 3Q0TA 1RRPA 3JD2A 3L07A 2FX3A 1G4HA 3G5UA 1J99A 2QTMA 3FKSA 4CUKA 5J43A 5ARDA 3GJ4A 1ZGAA 2O1XA 4MHOA 3WGTA 2NO0A 3SU8A 1X7DA 3DNFA 1FFEA 3AEZA 1YR9A 3WL4A 5CT8A 3SICE 4JLUA 1IWBB 1BCSB 3L6DA 4I4TA 3EXHC 5FI0B 4EJSA 1I01A 1OX6A 2QDKA 2R6HA 4A10A 3I3SR 2GJAA 3ZHSA 4GYKA 3ICPA 4NTZA 4TLEA 3RYIA 4C0QC 1AV7A 1R5NA 1DTWB 3IDAA 4MMXB 3LI2A 3NAGA 1UJCA 2FPGB 3L8GA 1GKLA 1V48A 5E2BA 4FB5A 3H1AA 3U2QA 2I6TA 1GTSA 2IDMA 2OQRA 4ZRNA 2B9VA 1TM4E 2CGEA 2TYSB 2BBTA 2NAPA 1P0FA 5DGCA 1ZEJA 3IMFA 4M53A 5D3ZA 4F4JA 3WAGA 3HTXA 3QTTA 4QFMA 1ZJ5A 4F5WA 3DE4X 3RS3A 2FFHA 5EJ4A 4ZQGA 3OO0A 2JJ2A 3VDMA 3ZI0A 2UYOA 1COWA 5LP6B 5BUZA 4ESEA 3LSTA 3KSAC 3C39A 4A7PA 3GFRA 2W6OA 3FVTA 4XM2A 1AK1A 2ZAMA 4RSMA 4OXKA 4AWBA 2V3WA 1OXBB 4EAQA 5AP9A 2IK8A 4M0EA 3A1SA 1PU2A 3O47A 3H3FA 2CSXA 1UMKA 1KVQA 5TC4A 1CK4A 4ZCQA 3RVLA 1VQ1A 1R8QA 1T5TA 4JXJA 3VHLB 2BMEA 1JBEA 1WXEA 2I55A 4IDCA 3GUZA 1OZHA 4ZMRA 1M6NA 3N76A 1KQPA 2NU8A 3T61A 2VHEA 1H3NA 2P30A 1RWXA 3AL3A 4YXWA 3ZTWA 3L1IA 1Q19A 4RYDA 1VHDA 5DULA 2XODA 2DPLA 2HC9A 4FGLA 1KF0A 3OHMA 1F51E 5DLDA 5ALVA 1IH8A 3WBBA 3GLGA 5LNK6 4CODB 4MS4A 2WG1A 1E7SA 1F8YA 1XCLA 3R3XA 1IK4A 3IT3A 5BSFA 2R1TA 3BWCA 4R1UA 3JQ9A 4K9QA 4KE7A 2GS9A 1FFDA 2W5UA 3CZAA 4ECEA 3K5WA 4YRBA 3ZW9A 4CIVA 3IBYA 4WLVA 2YWJA 3PDWA 4MGHA 4V2UA 4HQOA 1T29A 2H9IA 2X2OA 3Q15C 3TKLA 3NBKA 2CF6A 4PM4A 3DXYA 4MMZB 1JIQA 2G1AA 3IDFA 2IZ5A 4D4IA 2OTCA 1RAGA 1U3TA 3HO6A 3L6CA 5SY4A 3V48A 1G38A 2IXGA 5ALEA 2IJGX 4EY4A 2Y6VA 2GPSA 1P62B 4Q3AA 3VR4D 3FLEA 4DXHA 4IKPA 4ZDJA 4RTPA 3F67A 4RA9A 4JLVA 3GF4A 1FOEB 3BL8A 2YWDA 3IO5A 4AWXA 4WNAA 4MV7A 3PSHA 4B6QA 2O8NA 3G7UA 4PZPA 3U44B 5KSWB 3TKAA 2XQJA 2J5QA 3DDCA 4JLWA 4YP9A 5TDHA 1LGYA 3RYCB 2WZDA 2XIQA 3LT4A 4H4DA 1F2TB 4MDHA 3TVTA 2OBYA 1HBJA 4BKOA 3NHFA 4DARA 4B5LA 3OURA 4NYMQ 4PG8A 2B34A 1YD7A 3PC2A 4LOAA 4WZAA 1GJRA 4I6EA 3MQ2A 4KUEA 5SV2A 1XRRA 4ZV9A 4H3SA 4O4IA 1VXOA 1RI5A 3I72A 3KALA 3T34A 5C4MA 2EQAA 3Q8MA 1JMKC 4L6CA 5DBHX 3SR3A 3BMQA 4F3YA 4EB0A 3QEBZ 3M70A 3FWZA 3BD9A 4KC0A 3AV3A 4BQSA 1VLLA 2ODWA 4WH0A 1U8TA 1WQ3A 2WHEA 4U7GA 2J6IA 2BP7A 3L0PA 4LXTA 4N7MA 4J76A 2IWHA 4AF6A 5AJYA 3MQ4A 1ULUA 3GN1A 2XY4A 5GM1A 1OAOC 1NDHA 1YU6A 3WGLA 3IUMA 2QI9C 1TO2E 2PSFA 4KIFA 5AT1A 4ARBA 2B8JA 1JDNA 3QYJA 1N9GB 5DMXA 1F8GA 121PA 1WNFA 2RJ3A 3MK31 4BRWA 2YZ7A 3RYHA 3KT6A 4FJ1A 3MRVA 4B3BA 2FUKA 2OO3A 1YOVB 3RRMA 3VR6D 1C1DB 4E7PA 3EF0A 3LTEA 3HZOA 3CKYA 1PJ4A 1DIGA 1J8YF 3KQHA 3V8VA 3DCIA 3GEIA 3KE9A 1ZA2A 3GCWA 4IOKA 4QQRA 1BFUA 1LDNA 2BF7A 4UXJA 1OIWA 5EP3A 4FXPA 5CIQA 4Y0AA 2R7LA 2YFYA 3EXFB 5B3JC 1GPKA 2R85A 3MMNA 5E0OA 5AKEA 2CLMB 2Q2QA 4WADA 4H3KB 2ZJ3A 2QKYA 3R3WA 1JG2A 3U3KA 4E5DA 4E5NA 4DR2B 1N2GA 3PQ2A 5FFNA 5BV7A 4ND2A 3VZCA 1YB5A 3WMFA 3C87A 5CLFA 5FHRA 2IS6A 3GJTA 1BE8A 1MQSA 2XCQA 2HIGA 1MIHA 3UT0A 4D7AA 3DBVO 4B40A 4K87A 4MKIA 4RNCA 2Y1DA 1DPGA 2OCPA 4CCAA 3Q7SA 5FI1B 3O4IA 2COKA 4NY1A 3W6UA 2N42A 2ZCJA 2O9JA 1G63A 3VAZA 4TT3D 3SM9A 3FCSB 1ADJA 1NATA 4WLFA 4LSMA 2XCIA 1C1YA 1R0LA 4GZ5A 1U1GA 3FHOA 3QY9A 2H2FA 1PD0A 4PBTA 4OUDB 1YQGA 3E82A 3IAFA 4ZQBA 3HPQA 4WKOA 3WLNA 4N3CA 1ZSYA 2FCRA 4KH1A 4IY1A 3OPMA 3R23A 3I0NA 2YHUA 3QPUA 4RZ3A 2C98A 5DSXA 3SSOA 2OP0A 3KJQA 4FYVA 4DL9A 1BJTA 2PZJA 4KSBA 5FNVA 3AESA 1FP7A 3NP9A 1KZGB 4N6NA 5ERYA 5JLAA 1RWNA 2R8PA 1E5XA 1LPMA 2V3VA 1ZGBA 1FZTA 1Q7TA 3THRA 4R54A 5D3KA 1S2NA 1XL1A 2MHCA 2I1QA 3L8FA 3S40A 4ARAA 5CFZA 4ISBA 4GBED 4P5DA 2I4LA 4BBAA 5AVOA 3JYPA 3OKPA 2R8BA 4IJKA 4RNDB 4AJIA 5A1TA 1A5AB 1P2DA 2F43B 2MT9A 3OUTA 4DZZA 1ZSVA 3HP7A 1R4MA 3TW8B 1X1SA 3LK7A 3OM1A 3QBDA 1OVGA 2OBMA 5LIPA 3BEDA 2FZCA 1RC8A 1NOKA 4NNJA 3ZGLA 5D01A 2GEFA 1AS2A 1M1NA 3UEOA 3ZXYA 3ZWCA 5F9FA 1QORA 1S7CA 2R60A 1M2EA 5ECWA 3E3MA 4NCXA 1GPUA 1DWPA 1UJ5A 3ND6A 3UB4A 4FUQA 2A7QA 2R4QA 2E1PA 2JEZA 2XE8A 4GPBA 4UDYX 1OH5A 3AFHA 4KPYA 5E4TA 5ABPA 5AUNB 4DG9A 3OP4A 2C2XA 3MQFA 2IUTA 1D2GA 3BFPA 2WJAA 4XFKA 5CNKA 5A4FS 2KE5A 2R4TA 5JWOA 5FXMA 4B7XA 5JSUA 4B4OA 4WI1A 1Q0HA 4AJ9A 2PX5A 3CVUA 2H4YA 1SQSA 3VNVA 1GPDG 1HQCA 1ZM9A 4I9HA 4KXMA 4MYHA 4DJTA 1C7QA 3K9GA 4YUWA 4G5FA 2NSDA 2NGRA 4K9KA 1T35A 3G88A 3D7RA 1H2AS 5FUXA 4Z1MD 2FKNA 5M3BA 2RARA 2ZWIA 3VDQA 1Z4IA 2PRZA 1A9XA 4F11A 5K0SA 3L49A 1PDOA 3M9WA 4HTFB 4RZUA 5EXEA 2VT2A 2FWAA 4EJFA 4UD6A 5D6OA 3QIAA 5K8VA 4Q1EA 4E6EA 1ZUNA 1PDVA 5CDFA 4DYHA 1WJGA 1G2QA 1P4AA 3ZE0B 2ZTSA 3NIBA 4N5DA 2RH8A 5IAGA 1OZAA 3PWZA 1JDBC 3T1VA 4D1YA 2JAHA 2VK2A 1VIYA 4UCWA 2FSGA 3VI3B 1RWBA 2VCYA 4ZT6A 4B3FX 3QNUA 1JBKA 2AMFA 2QRZA 2RJOA 1XZ8A 3CF2A 2AHRA 1EFHA 4Q7LA 3GL9A 4QEKA 4TPKA 3T7KA 3CBGA 2Y77A 4MWDA 2HSJA 3E0QA 1DO0A 4L15A 5FFMA 1V5GA 5JECA 3T15A 1U2EA 1OI2A 1LS6A 2CUKA 1KK1A 3AHEA 1FTWA 1SA0A 1I3LA 5TEWA 3MA0A 4YWJA 2C7PA 4EG4A 5CFNA 2CNWA 3S27A 2AMLA 3QU5A 5MGBA 2QNRA 3TBKA 3LF2A 3K70D 2APJA 1LBQA 2H63A 2BHSA 5HJEA 4F7WA 3PWSA 1QRAA 3LF1A 1SN7A 4R2JA 3W5DA 1UH5A 3AF0A 2L18A 4Q9AA 6YASA 1KA9H 1OKKD 1JJIA 2G1UA 3GJ3A 2O0KA 3H1EA 1S2LA 4GYWA 1C1HA 1CDZA 1FSFA 2Q21A 1GUBA 3W0LB 3MF4A 2WFLB 4EHNA 4QGSA 3EVDA 1THZA 3BHJA 3JV7A 2IDKA 3PC3A 1CVLA 4CM5A 3R9XB 5E1MA 1E92A 1GQ2A 4R1LA 3VH2A 4KFUA 1RQPA 2MU1A 1U2GC 5K3FB 2X15A 4MYSA 4ESHA 4HDKB 4AKSA 3ZBTA 9ABPA 1UAAA 3GLVA 2HSZA 1P80A 1YACA 4R6WA 5LYJF 3EQ2A 2ZYGA 2XGMA 3OWOA 5DEOA 3HKEA 1WQ1R 2OPHA 3FVVA 3PC6A 2GXAA 5DO9A 1H65A 4C7JA 1E7RA 3WHKA 2XDAA 2IUYA 3BGOS 3K1YA 1WS6A 1E9CA 4BWVA 3OLCX 1TU0A 4GZMA 4WOCA 3BIOA 1LPNA 1FYDA 2RCNA 4OI4A 1O4WA 3F7OA 4WL0A 3RFTA 3STYA 1NIPA 1CFJA 1CR4A 2AN1A 2QYHA 4C7VA 1YO6A 4BRSA 5AM2A 5FOQA 1N25A 4J03A 3CNOA 4HAUA 1XKQA 5DWDA 5LP1A 1BJKA 2X4LA 3BF7A 3KTAA 2CVZA 3RAGA 4EW3A 4Q24A 3P94A 5DDIP 1G2OA 5ARBA 3IAS1 3NPMA 4AICA 2KW5A 4A4DA 2DSTA 1XWWA 3DV2A 1ZIDA 3VTFA 1IEVA 4IOMA 3NEYA 3FROA 1H0SA 3KWLA 1QGDA 3O8DA 3PGLA 3AP1A 2EW2A 3AUAA 1KP9A 2H2GA 1W581 1Y1KE 4CF5A 4CKYA 1DC4A 2I34A 5JD6A 4JKIA 1ZRHA 3GGSA 2OBLA 2P27A 1W85A 2OCKA 3M4XA 3HXQA 3DVAB 2Q5FA 4MYDA 2PQ2A 1L0BA 5JYCA 1XSEA 4EKNB 3EN0A 5TF4A 1R27A 5BSGA 2CB0A 2X41A 1QBGA 3Q3EA 4HJRA 2P3LA 1H9BA 1Z3CA 2PLRA 3O3OB 3K8OE 3RC7A 4CMCA 1VTKA 2VKTA 1UBJS 2GD0A 3OF3A 3UJ9A 4LJ5A 5IBPA 2ZJYA 1SKAA 4A8HA 2Z09A 1N34B 3CLKA 5T6BA 1E69A 3W06A 4AQ7A 1YA6A 3NYWA 4IWXA 1AURA 1WUHS 4F4CA 3HEAA 1PTJA 1IZ7A 3HZHA 2Q5LA 5IP5A 4CW7A 1U0GA 3NV7A 1Q0UA 1TMYA 3K70C 2PRIA 2ZR9A 1LRJA 1YBFA 3F3SA 3I4CA 3I4LA 1E3TA 4HB3A 3IIMA 3NIFB 4WXPA 5E1OA 4Z4GA 4NPHA 1N2CB 1SELA 1ISPA 1KC1A 1NJGA 1UFOA 4HAIA 4Z49A 4JD5A 3CLHA 3SOZA 4I8IA 4C4ZA 1ULZA 3A6DA 4WCFC 5F2NA 4FBGA 3EGXA 4G5HA 4QYSA 1NV8A 1RKXA 2GM5A 2IZ6A 2GDJA 2R751 2NYAA 3AONB 4CZ2A 5C35A 1NVBA 3K8YA 5DGDA 1C9YA 1KU6A 1NWHA 1BHO1 1QJ4A 2EJVA 2F9MA 2R8ZA 4Z8XA 3QWBA 2L82A 4KO1S 4U7TB 1YDMA 4Z9YA 2QPTA 3USZA 4GOMD 4HLUC 4RY9A 4YRJA 1IUPA 1QF9A 1IY1A 1JHUA 2RK4A 3G0DA 1CUBA 3SIRA 3WIUA 4F86A 1A9XB 3TE6A 3QY0A 3DYBA 4YQEA 2OHXA 1XRSB 5HEKA 1NP3A 1GKKA 4AMZA 3KZXA 5C80A 3FJOA 3CPEA 1N3LA 4IWNA 3UOWA 3W4IA 2GDZA 1KSGA 5LM3A 1UANA 4LQ4A 4GGMX 3WS7A 1M5RA 3GROA 5LQRA 1XTPA 3D3QA 4AM8A 4C4XA 3BG5A 1X9GA 4EPYA 3KB8A 3MTQA 4PX9A 5EJ6A 3RVMA 3G9XA 1RZ3A 3KELA 5IJ9B 3K9FC 1Q50A 2P2DA 3L41A 2PXXA 4WK2B 5FYQA 5BVGB 2BSQA 3FW1A 3IR5A 2YIVX 4HNRA 3JQ8B 5DM4A 1CRWG 3TS1A 1VBFA 3DOUA 3LOQA 4OJYA 5KOYA 2XRYA 3RRBA 4YFYA 3VOSA 3G13A 1M2FA 3QX3A 2UXCB 3C1TA 2HK6A 2CBXA 5BPHA 4HNUA 3NH9A 3TGLA 4FOPA 4J7XA 1TTPB 5D2CA 1QF7A 1V9SA 2HA3A 1RLOA 3DCJA 3E9NA 3K9WA 3MUEA 4R51A 4QSHA 1OUMA 5CW1A 1NC3A 4NFLA 5DYWA 5HQJA 1Y89A 1MZVA 1UBEA 2BFWA 4H18A 5AW1A 3F73A 1YI8A 3ZEIA 3N3AC 4KVZA 2I3ZA 3UK0A 3E7PA 4BNFA 2ODTX 1YOVA 2AZMA 1A5ZA 2FEWB 4HDMB 5EOVA 4NZMA 4EPVA 5IJAA 4P93A 3WAJA 1Q12A 1EFVB 1FRFS 1U90A 3B13B 2VNKA 1JU3A 4XWOA 2JJQA 2D5BA 3EAQA 2ET6A 5JMPA 2FW7A 1FDWA 1G5PA 4URFA 4Q1DA 4ZI7F 1TAQA 3SZGA 2Z3WA 2GLTA 1RJFA 2I03A 4K88A 4X3PA 3RTDA 1OI7A 1ORIA 1BD3A 1W93A 2D1YA 3A1WA 1JGTA 1RQLA 1JQ3A 1O5OA 5FQNA 1FYWA 1QV7A 5HBRA 3OPQA 2ALJA 5K4AA 4KLAA 1OHHA 3BK2A 1M1YB 3RHFA 1K5GA 3B85A 2JCYA 4PFJA 3ZUPA 3SJUA 1ELOA 3VHXA 3WIDA 3PEWA 5L3QA 1MG0A 2RD2A 1RW4A 3SDBA 3IEKA 3LHIA 1XAGA 2WA1A 2IYVA 3QSYA 3T1YB 1JHOA 2XSZA 4FZRA 4RGQA 3GLIE 1WXXA 3OQPA 4GFDA 3N2EA 5LXTF 3WLLA 5F23A 1UXJA 2V9PA 3I76A 5KOJA 2XVMA 2JH8A 5JCZA 1RC1A 3ZY2A 4NICA 5T41A 3P9YA 3ZWNA 2FUEA 1ADCA 2J41A 2QRUA 2QRMA 1MTZA 1LF5A 1KHHA 3P5SA 4NYIR 4MWZA 4O8ZA 1Y42X 2OOKA 3S29A 5JXHA 3O0DA 5L6MB 4G0WA 2I6SA 3GZNA 2F17A 3H17A 4X97A 5SY6A 3E8SA 4A6EA 1Q0ZA 2NP6A 1SPBS 4A1OA 1QTNA 3KUXA 3PLNA 3M6XA 2E49A 5ALJA 3ASZA 2ZETA 4N18A 4YAIA 4LC9A 4CKXA 1P29A 4D0LB 4GPAA 2FNAA 1GCUA 4FYKA 4CMIA 4GPIB 3AKZA 4UUMA 1RXEA 5T5QA 1CE8B 1A0OA 3WXMA 1ATIA 1GZDA 4OJKA 3EC2A 3C5EA 1UBRS 1UKYA 2XUFA 3FR7A 3GJQA 3RYIB 2FN9A 1BKYA 1Z33A 2OAQ1 4CG0A 4W7HA 1VLHA 4C2BA 1I3CA 2D0OB 1JYSA 2IYOA 2RGAA 2X8BA 2BMVA 1IY9A 1FNBA 2YWBA 2ZWVA 3G1TA 3IUEA 3KLMX 4YASA 4FFDA 4LJLA 2PFGA 3L6EA 5PGMA 4P1ZA 1W4RA 1OAKA 3UZUA 2OV8A 3WHIA 3F9RA 1UPBA 3UV3A 2VSXA 4EG5A 1UOOA 1CT9A 4DDTA 4F85A 3N0WA 1QANA 5DBGA 3QLJA 2D0PB 4QLOA 4Q48A 5K99A 1NKSA 4XARA 4I3GA 3DOFA 4QFDA 3ETHA 5EXXA 1O5IA 5GY7A 4BBPA 2CLLB 1NNEA 3A2LA 3QPBA 4B85A 2WTAA 5E9WA 5JWRA 2CLDX 1LD3A 1RR6A 1G17A 1P6QA 4GP9A 1NDQA 3TZ6A 4ETIA 3N7UA 4IIDA 4B48A 4LGCA 2B8NA 4DJFC 1F0KA 3E53A 3SBEA 4L75A 4KVGA 1Y37A 2AT1A 4AX4A 5C37A 1KRXA 3TVDA 2ZP1A 2PKYX 4EJ0A 2VLIA 1HFEL 1C9DB 1I4EB 3I9FA 4YCMA 2WDZA 5FTKA 4JLPA 1H0RA 2JEYA 3EG9B 4U9UA 4X0EA 4IS3A 3ZZ1A 2VH1A 5K3DA 2RBEA 4X7PA 2OZLA 4U6NA 2AH5A 2ZU6A 4W7IA 3T5PA 1CUJA 2Q3CA 4Q05A 2W42A 2O7RA 2ENWA 3RE1A 1JEAA 4BFZA 1O9HA 1DEAA 2J59A 4RJ2A 4GOJA 3VU9A 1JQBA 2TMDA 1SCUB 3BCUA 4KX3A 4X1IA 4EKEA 4XIFA 2B8WA 2UZ1A 3IIKA 5AR1A 3T3PB 4MI1A 1JI3A 2YC4C 3GV0A 4TWIA 4Y30A 2RGUA 3PSAA 1L7VC 3NYRA 4J16A 1C1DA 2PPVA 4D80A 1U0BB 3EASA 4B3JA 1BXRA 2HLDD 1ONSA 1G8YA 2GZSA 2WBLC 3DAHA 3E9RA 4C3ZA 3QBVA 5LP6F 4HXGA 4BVAA 2CEAA 3WMXA 3MW8A 3HFGA 3R24A 3LUCA 3UPUA 5BVHB 3MN1A 4Q9LA 4KNYA 2CFTA 1JG3A 2PMFA 1WBBA 3DXFA 5HE9A 2BGJA 3FAKA 2GN4A 3DBRB 3VV2A 3GFQA 3L93A 3OJFA 1MEEA 3B7WA 1AZWA 3CXUA 6ABPA 1A8QA 4MIEA 3L2OB 1EK6A 2C9ZA 2MYPA 5G3YA 1J39A 4UBMA 2FTKE 3SLRA 3QA3E 1CJTC 5HGJA 3GJ6A 3BIFA 5ANRB 4A8JB 4YPOA 1DFHA 4BVJA 1HYQA 3AFOA 2ODBA 2NZYA 4UMFA 1GNPA 2R65A 2D7CA 1Q22A 1KY2A 4F93B 2NU6A 5JCOC 2UZ0A 3WX0A 3QEOA 5K3BA 2P67A 3ZZUA 5CU7A 4R2HA 1AA9A 1PGQA 2PA3A 3DEKA 3DE6X 4NYIQ 1PUJA 1BU8A 1L4YA 4M8NE 1HDRA 1KQFA 3B9RA 4JLKA 4AU1A 4CKCB 4WECA 2FN8A 3FCAA 3C6YA 1W35A 3I6YA 4U6QA 2L19A 1XD9A 3L1UA 2LR0A 1UKZA 4MB0A 1FQKA 3L1VA 1XTIA 2IHZA 4C2AA 2NUAA 3RJTA 2H1LA 3MIIA 1QB7A 1SB9A 5C8YA 1HV8A 3IQDB 1Z88A 4N0QA 2HQBA 1FLDA 2DQ4A 3F4KA 1YV9A 5BN3A 2YYYA 3AF1A 3DAFA 2NPFA 3TQHA 3SIWA 4BFCA 4TMZA 2WIDA 5BWLA 2HLHA 2IH5A 2CYCA 2FJPA 4DWOA 5CLQA 3OUUA 5G0VA 5B7NA 3R7NA 2NO6A 1XYGA 4IZIA 5DTIA 1JW9B 4E7OA 5IUNC 1T2FA 3I8XA 4L73A 5FWNA 1ZVVA 1E94E 2JD0A 1OH7A 2PQ0A 3GEGA 2J33A 2ZRFA 3DXXA 4UM8B 1Z4PX 1Z6AA 4AP6A 4E5PA 5KVAA 3DF7A 4LVOA 4E14A 3OCCA 2PRKA 4EFDA 2KLHA 1SMKA 5AI4A 4DM4A 2VS1A 2VHVA 3CO5A 1NG1A 4A27A 2CNOA 2HBZA 4ER3A 4HX5A 4K9PA 1CQWA 1TMGE 2Z57A 3C8ZA 3P1JA 4F3RA 4Q4JB 1YAHA 3H9UA 4DSOA 2H07A 5AM3A 1CETA 1MX5A 4KNVA 3P26A 1EXNA 2VP2A 2VQEB 1XLTC 5GV8A 1DEHA 1VSUA 3I8SA 2JAUA 1ZI9A 4KRXA 1FU7A 2O19A 4H4EA 1GPAA 4JBYA 5AD1A 1CY8A 1ZCBA 1WHTA 3GCGA 1LBSA 2GMWA 4H16A 2DFTA 3VR3A 1A4RA 3K35A 3NETA 2OD2A 2R86A 2P2SA 2OK8A 2GUGA 2H4JA 5JZSA 3K9QO 3QLEA 4FGKA 2GX6A 5ALYA 1ESEA 1VKJA 3V42A 2ZBDA 2IPMA 3C7DB 1U9YA 4O4HA 3X0DA 3C5VA 1HYGA 1QM5A 2ARKA 1CDDA 3KYDB 4YCDA 4CMAA 2QGZA 5J5AA 4Q4HA 3R5JA 4JJ4A 4G07A 3CRRA 3OP1A 4E12A 3EVAA 2KHZA 4FWIB 4OF4A 2DCMA 3G2MA 1Q83A 1ZK0A 2IYNA 4YLYA 2ODNA 5K6RA 5CG2A 4JT9A 3OJLA 4QQ8A 1NXOA 3SI7A 4WBNB 4D98A 2I0FA 3WP1B 4H6WA 3VRHA 4E1BA 1U7XA 2C00A 1CUXA 3QUCA 4HX9A 5KYGA 4EJSB 3ZV7A 4C2TA 4C6HA 3BMNA 3NWPA 3KVOA 1EUDB 5TE9A 4MWCA 1RZVA 2P0YA 2XTAA 4NBVA 2ZAYA 2EVWX 2QVZX 4X91A 5H0IA 6CHYA 1Y9DA 1B2LA 4R5MA 5CYGA 1CQJB 1TMOA 1YR2A 1SXGA 1AMOA 3IP8A 2P9BA 2VFAA 2B9EA 1FMTA 3HGTA 4C89A 3E3AA 5P21A 4AYWA 5J2TB 3T1NA 2NQTA 2AOUA 1O95A 4IV8A 2EF0A 1FPMA 1M6VB 1C30B 1LRKA 4HEA6 5EGNA 1PGPA 1M1NB 4B3HA 4CQMA 1KFBB 3MBIA 4PO9A 3U0VA 3THXB 3PEYA 5F5LA 5B2ZA 3OEWA 4RD4A 3D1VA 3HXKA 3EE6A 2GLUA 1AQIA 3IE1A 1JKIA 1GLVA 3BQNB 5LBTA 4E03A 2UYHA 1XEXB 4FIDA 4L5AA 3T12A 5LMZA 3GW8A 2CLKB 4O4LA 4JP1A 5FADA 1YZVA 3E7FA 5IBRA 2IVZA 1KFCB 5CXSA 1KWGA