4RAOA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
197
Chain Sequence
ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSRSIPMTVDFIRLKLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 197
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4raoA00
1CJBA 4WMLA 4ZFNA 4RADA 4M0PA 1U9ZA 1W30A 2H08A 3OZFA 3H83A 1R3UA 1DKUA 2JKYA 1VSTA 1JLRA 2PRZA 3GEPA 1GRVA 1BZYA 1L1RA 2GEBA 1G2PA 4RHYA 1G9TA 1P18A 1A95A 5IPFA 3G6WA 1ZN7A 5JV5A 2DY0A 2FXVA 1OPRA 4QYIA 3EFHA 4JLSA 4Z1OA 1I0LA 2WNSA 5ESXA 4RHXA 1Z7GA 1I5EA 1U9YA 2PS1A 4RHTA 1O57A 1QB8A 4TWBA 1VCHA 1UFRA 2E55A 1QK5A 1XTVA 4QRIA 4IJQA 5JSQA 1A96A 5BQPA 2JI4A 1QK4A 4RAQA 1ZN8A 4LZOA 4M0KA 4RHUA 1IBSA 1XZ8A 1I0IA 1TC1A 1YFZA 3ACBA 1HGXA 1A3CA 4P83A 5HIAA 2H07A 4P3KA 1UPUA 2AEEA 1PZMA 2JBHA 3MJDA 1DKRA 1XZNA 5BRNA 1LH0A 3DEZA 3M3HA 5K51A 1G2QA 4RQAA 3DMPA 1P17A 1XTUA 4OHCA 4RV4A 4P81A 5KAPA 4P84A 1Y0BA 1HMPA 2IGBA 5KAMA 1JLSA 3OZGA 5ESWA 4LZNA 1ECCA 3S5JA 2JKZA 2P1ZA 3QW4B 2VFAA 3ACCA 4LYYA 1P4AA 4RAOA 1A97A 1MZVA 1NONA 1DQPA 1P19A 3KB8A 2H06A 4QYIB 3LRTA 4WN3A 3OHPA 4FYMA 1AO0A 1OROA 1A98A 2XBUA 3MBIA 1QK3A 1D6NA 1ECGA 1QB7A 1STOA 4M0UA 1BD3A 2YZKA 4F8EA 5EUCA 1NULA 1A4XA 1OREA 5BQOA 4X45A 4LZAA 1BD4A 4RABA 2C4KA 4P80A 1FSGA 1L1QA 4PFQA 3ACDA 3LPNA 1XTTA 1ZN9A 4KN6A 4S2UA 1I13A 3N2LA 4LYGA 5BSKA 3DAHA 4MB6A 3NAGA 1DQNA 4X44A 1VDMA 1ECFA 1V9SA 1O5OA 1J7JA 1DBRA 1ECJA 1TC2A 5E38A 3GGCA 4JITA 3GGJA 1ECBA 2HCRA 4RQBA 1QCDA 2EHJA 1I14A 4RACA 1UPFA 4RANA 3HVUA 3O7MA 5HKLA 5IAOA 1G9SA 2PRYA 1QCCA 4PAWA 4P82A 4P86A 1WD5A 1GPH1
chains in the Genus database with same CATH superfamily
4D5EA 4MJ7A 5EXPA 4ER6A 4OYYA 4M55A 1NHGA 2B1GA 2GK7A 1T5IA 3KYCB 3SEQA 4X7BA 2Q7DA 1CY0A 4RA9A 1ZZEA 4ASUA 4X7RA 1XZPA 4FFSA 1GU0A 5LQMA 4GXNA 3LDHA 1EG2A 1KJ8A 4BKMA 1BZYA 1C3JA 1EA5A 4RX1A 1G8SA 3WKCA 1J33A 5CFNA 3GLUA 2GAJA 2R62A 4ALKA 2Y76A 1KEEB 3SIXA 2NN3C 3EG5A 4H7FA 3SQNA 2BZ1A 2G0AA 3WFZA 3ICPA 1QQTA 2F1RA 3ZC3A 1WEKA 4IIGA 3G2NA 4GOXA 2O2YA 2R5NA 4F2GA 4PSAA 3IC5A 2D7DA 2Z1DA 3QKTA 4BEJA 4IIYA 5KMGB 2WYHA 3AKCA 4B3HA 2AL7A 1IDOA 4ZK6A 4ZVLA 4RZXA 3OZDA 4H77A 4HFMA 3CXUA 4JBHA 2A1TS 3O8NA 5JD6A 4US1R 2Q8NA 1BQ4A 5F77A 3COYA 3M89A 1B2LA 1XPJA 2CXPA 2ISQA 3OPQA 4EHBA 5AI5A 3BTOA 4AMZA 7REQB 1PWEA 2WJZB 1K2VN 4UDYX 3FOWA 1EAMA 2I9PA 4LJYA 4X1YA 4D8WA 3LDAA 2I2AA 1Z4QA 3TTVA 3HKCA 2C7PA 4B82A 2QQFA 3GN1A 2IEBA 3OT1B 2D2VA 1YBVA 4FYXA 4P22A 3PNMA 1B8UA 1DKRA 3T4XA 1UT8A 2Z1MA 1B76A 4RC9A 1GDTA 2D0OB 3RK1A 3ZJ4A 4GO1A 1J6UA 3OLCX 3G8YA 2EIHA 3TG8A 3DEIA 2I2FA 1NBAA 1YVDA 5ALRA 3Q2KA 5G1PA 3KOUA 4MS4B 5EQFA 1VYVA 4C0HA 1ZQ1A 3RFTA 1F1BA 4PZYA 4DR1B 1K6IA 4HTAA 2BUCA 1X42A 2PMDA 1W36D 2HW8A 4I6GA 4F2WA 4JCCA 3ZV3A 2JLWA 3KM0A 3GQVA 4WLUA 1NN1A 2Z1NA 3WSVA 1ISHA 2YWHA 3JQ9C 3BMQB 5EWLB 2HO4A 4J29A 4RE5A 1Q22A 1JDPA 2H4WA 2GASA 2VPYA 3BK2A 4CM6A 3QTLA 4CIWA 4FYMA 1PJTA 3OOHA 4LVOA 3J80A 2BAGA 4G9GA 3SYLA 2H1FA 3L46A 4HHEA 2CXTA 3I01M 1EBUA 2PX2A 3V8NA 4IDHA 1XK6A 2ZBEA 1OREA 3M9XA 1KI1A 1PL8A 1CLEA 3ANYB 5HDBB 1EFUA 3EQ2A 3L0IB 5DYIA 1ISSA 1XAGA 3PXBA 4PYOA 3V7YA 3F67A 3IMKA 4GLOA 5IN4A 4AKEA 3DVSX 4LFCB 4PLGA 5J9FA 4B4VA 1VKJA 1U2EA 4MH0R 3WLJA 4XFDA 4ZIRA 5JROA 4BKRA 1BXGA 2CNWD 2NUBA 2RSLA 1Q50A 4H7KA 4UZEA 5DEIA 3S8MA 3RJMA 2PQ6A 1WVGA 5CEFA 3BJEA 4Y0NA 2CFCA 4LKOA 3JWJA 1SA0A 1PKEA 4HZUB 2CHVA 4CEJA 1N9ZA 3E84A 4JLMA 2I87A 1BMDA 3K0FA 1XIVA 1PJ8A 5A3RA 3R5HA 3CR8A 1U9ZA 2EBHX 4B3XA 3FNIA 2P3QA 3S2IA 2PE5A 3DD1A 2O50A 3E8MA 1W1IA 1N7IA 3G02A 1X94A 1TQ2A 3L6CA 4O2BB 5BSMA 5AJYA 1GTRA 3A7EA 1JPNA 3M4JA 1ZD8A 3V1LA 3W04A 3RJ5A 4ZYWA 3TZEA 1VE3A 5E2IA 4KHPB 1PTKA 1EWTA 2CLLB 4RNDB 1S1CA 5DK6A 3G9QA 3ZXUB 1F5SA 1GAWA 1ZGZA 2VP2A 5GINE 2PMWB 3MWDB 1QLWA 4FMDB 2FSFA 1ZG3A 2C3YA 1HT2E 3VV2A 3F1LA 2WNSA 3E0QA 4XQ0A 3RFCA 3VH4A 4M87A 2Q1YA 2OZLB 5AP9A 4GMDA 1CQJA 1CD5A 2OOSA 2D0DA 3A28A 3SSNA 5CD1A 3DE2X 2BBWA 1BGWA 1MDBA 2XGOA 3WRXA 1ZQ9A 3G68A 4UJ3A 5D87A 2VC2B 4KLZA 4MHSA 1RQRA 2P9QA 4NNOA 2K2WA 1SBHA 2UYYA 3HP1A 3R76A 1ISIA 4G0MA 5CFMA 4JI8B 4Z2AA 2RJNA 1EDDA 1U5BA 1W1UA 2AUMA 3BK7A 1EVKA 2BF4A 4TWAA 4FE7A 1B14A 4B4OA 1PS0A 1WUHS 4K1XA 5JR3A 3EQ9A 4CM9D 3W6NA 2M6KA 2OY0A 4RTKA 3T15A 3GAZA 2B4KA 3SSOA 6LDHA 5KREA 3KTFA 4TKVB 3JY6A 2DHDA 1L3IA 1E6EA 1RLMA 2FUNB 4DC0A 1OE0A 5K0JA 3W5JA 3UMGA 2FZKA 3QE0A 5EA2A 4E5VA 3QE9Y 1RHUA 4GLFA 3TGWA 2XWJI 4EGSA 1G1AA 1D6MA 1NV8A 2P0YA 3L6OO 1VIAA 2HI0A 3L8CA 2C5LA 1HLPA 1OAOA 2FMFA 4ALIA 3EWNA 2X58A 3DV0B 3PF9A 4MUXA 2VXOA 2ZPAA 4Z9FA 2I80A 4K7JA 4MWCA 2QL6A 1LZKA 1O94D 2XHEA 3BCHA 1C7RA 3FSRA 1EFTA 2A9JA 1SUPA 1YRQA 1VMDA 3DBVO 4NOMA 1NW6A 3L4SO 2ZYWX 4QA9A 1SXJA 4RK4A 1A2BA 2OD2A 3KFLA 2DLNA 3KZXA 3QX8A 3BH0A 3TQHA 3D2BA 2QVXX 3PEWA 2DRIA 2Q41A 2OXTA 1V47A 2OZVA 1EVYA 1NUQA 3V8VA 1F2DA 3A70A 1XKLA 2XWBF 3W7AA 5IUJC 3PYMA 1XI2A 3LBFA 4J0HA 2VPIA 2VRCD 4MUAA 1JAIA 1U2DC 2KYRA 2PJZA 2WKQA 1SQ6A 3PITA 2DFLA 2JI7A 1IZZA 1P2DA 3T7EA 2YKGA 2H4XA 3IEPA 4ETNA 4PG8A 5I7UA 1L4GA 4QL3A 4QU5A 1WKVA 5K6TA 1MGPA 4CMEA 3HY6A 4DJJA 2Z6AA 1YB6A 2IQIA 1UMDB 2XOEA 2ZBGA 2MINB 1EHYA 1J39A 1UZNA 3D6MA 1R4ZA 4QXRA 5DBOA 2X5OA 5I9MA 4QHYA 1ZOPA 2R4UA 2HUPA 5T5QA 3L43A 2C1XA 3DCJA 5EJ9A 1J8FA 1UZAA 2FPWA 3ZE7A 4A91A 4DUGD 3O03A 3GIDA 5BSHA 4GKKB 2A6PA 1WJGA 4LHVA 3BTSA 4NIMA 3W8NA 4EJ2A 4JENA 1TU3A 2B1IA 3G8BA 3P2JA 4J1SA 1I24A 4UAGA 1MG5A 2EFJA 2FMXA 2YV3A 4OOFA 5AIAA 4EHHA 4YT8A 5IZ4A 2CD7A 3LY9A 3OQIA 1BGXT 2PHZA 3FCYA 1KIMA 4XIJA 5H3LA 3R8FA 2A1UA 5DU2A 4CL2A 3G89A 5IK2D 4EO4A 3FX2A 1N92A 3DOHA 5JAQA 1XZIA 1R5OA 3PPWA 2NX2A 3GFQA 4PLZA 3VRHA 1KKMA 1QGAA 2RC5A 4IGIA 3BRWA 1ZRMA 3VYWA 2X5NA 1PG0A 4UU7A 5I48A 2MSCB 1XZEA 3QPVA 2O2CA 5HCUA 4Y98A 4PRYA 3EFEA 1YKGA 2VN8A 2XB4A 3B82A 4LBYA 4YACA 4CKEB 3GLGA 3SOZA 1Y8QB 2IPNA 4L72A 1LX6A 2G5CA 3H5VA 4BQSA 3DGFC 4BCBA 5DN6D 2XWPA 3IUQA 1LB1B 4NCKA 5DX0A 1JGTA 2WWVD 1G2IA 3OTIA 3WDMA 2IJGX 2JJ2D 1JSCA 1ST3A 1ZJYA 3U3KA 1NJSA 3V6LA 1Z63A 2OGWA 5EWJB 4ZRMA 1HF3A 2EGUA 4BQIA 5K03A 2NTVA 1H1LB 1KO1A 3ICWA 4HGRA 1Z0AA 1I2DA 2VHCA 2MSEB 2VRNA 3EC7A 2HWUA 4ERXA 4EJFA 3VXKA 3KR2A 3PNSA 2FB9A 2Q3JA 1Y6RA 4PX5A 1XP8A 2FNAA 4P98A 4ZALA 3PUYA 4EX6A 3Q98A 2FZVA 4M8LA 1JAYA 1USGA 3A6KA 4WOCA 1HUQA 5LQAA 1PHRA 3BIXA 2HMTA 4AUNA 1FQJA 1T35A 5D2CA 4NZMA 3R9XB 1KS2A 4MZDA 5B7PA 1Y8CA 3ZZNA 2QGFA 4LJ8A 3OZBA 2J7PD 4GWKA 4OU5A 4RSMA 4RY0A 1TZMA 4Y0VA 1SQ0A 1SUBA 3KUKA 1NF9A 1NYLA 1KH1A 2WUWE 3M6XA 3WIUA 5LU9A 3KV1A 1U4OA 2W0MA 2QORA 4R2LA 4ZMSA 3HBLA 2AZTA 1EUCA 3VM6A 1DRVA 5GZ1A 2DERA 1YHYA 1IZ0A 2Q4RA 2QGZA 2PT7A 3BPSA 4OJYA 3UHOA 4E2ZA 1AKWA 4I50F 5I7AA 1IUOA 3I2HA 2RMKA 3HP4A 1B93A 5J5CA 2W2MA 3IODA 4EB6B 2XLCA 2EQAA 3WDLA 1QF7A 2AOWA 2QTBA 5B7GA 1ISGA 3O9MA 1FDTA 4BUZA 2PH1A 2YS6A 2WFAA 4HDSB 5IAAA 5EUCA 3OE4A 3OZUA 2P9TA 4R9NA 3PJDA 4PZ9A 3DVAB 3UMVA 3GPBA 4Q16A 1K6XA 1AQLA 4L85A 4DPKA 1U7XA 4EVSA 1F0PA 1QLHA 4EZEA 3NGLA 1R6UA 4KQMA 5DW3A 4RKFA 5AHKA 1UFQA 1WDLA 4CT4B 1M3SA 2GKOA 1XRSB 1GT6A 2PX5A 1W76A 4DNFA 4C04A 1LQUA 1WAMA 1T0IA 2BFEB 3AUYA 3IXLA 1IHYA 4NESA 3NLLA 1MNQA 4JNCA 4IIFA 1USIA 3A58B 2HCRA 1G16A 2HHCA 2Q3HA 2Y1OA 4M0MA 4P4UA 4TXHA 5DM4A 1CVIA 1F2UB 3K0CA 1C7FA 1K63A 1YT5A 2IYLD 3RBAA 4N65A 4Z4EA 3SHOA 2EFHB 5BNFA 5FOSA 2V7EA 1N2EA 3TLJA 2E4YA 3FDXA 3GHHA 4OHZA 4Z6KA 4ZYXA 1XRLA 2GWRA 2PX3A 4IUDS 2YVUA 2FPRA 2COEA 1V7CA 3TQRA 2BI8A 3R3ZA 4B84A 2ZWAA 3I45A 3TZHA 5D7BA 4JNKA 1V6SA 5F33A 1KI9A 3ESQA 4AI6A 2YXDA 4CKWB 1THTA 2YVLA 1NW5A 4YRBA 3N0VA 3MFQA 2I6XA 3VYUB 3V55A 4AC9A 3PEUA 4REOA 4GL4A 3K73O 4FVTA 3CVOA 4JLJA 1XZGA 2GN0A 1O1YA 2QRLA 3KD3A 3MTBA 1G9TA 3U0BA 3CZCA 2OV2A 3ZHSA 2JGNA 3F6EX 4QPCA 3ZQUA 1QHHB 1KBZA 1UBCA 3DOIA 1X2EA 1T5HX 4ID3A 3TVYA 3UWSA 4KMSA 4BJ3A 4I4LA 4QU8A 5L95A 3UT0A 4YJ2A 1P3JA 2FPIA 5BMVF 3G2IA 1L5RA 1O9HA 4L8YA 4ZTBA 3H5IA 1ZJ6A 4MS1B 2PSEA 5I7VA 2UVQA 1T1GA 1DQSA 1K7CA 2P91A 1DGQA 4OQZA 1IE3A 1WMBA 3A27A 1PL0A 3COZA 4KI7A 2XUQA 4S35A 4P5DA 4BFXA 4DLPA 1L9KA 4DB2A 3VNVA 4FMBB 3EVCA 4PX3A 1PIWA 3CMCO 3C6BA 3LYAA 3PA8A 1SD5A 4Q66C 1GL7A 2EDCA 1PDOA 2JGDA 1IHPA 2VPQA 5A02A 5IM4F 1KHTA 2JHPA 1P7CA 2W2KB 1DLIA 1ZCJA 3IDFA 2ZJOA 4XYLA 4C7BA 3IQGX 2JEYA 1Y9ZA 2HMAA 1LH0A 3HYLA 1S4QA 2Y2UA 3K9HA 4JB8A 2M6SA 3MG9A 1Y9JA 2JLRA 4ZVSA 3IAS1 2VP5A 1G4AE 3BEDA 3T9CA 2G9NA 5BSVA 2QL7A 3F7MA 5LWHA 3VC2A 6ABPA 2UXDB 2HBYA 1XZBA 1T5OA 2OT3B 4NSNA 1JLLB 3PSAA 4OGGA 1NXXA 2ZDGA 1Z45A 5C5EA 5G02A 4KPEC 4LIPD 4A8TA 1BXKA 3B85A 4IWXA 1TQ8A 2QRVB 3C14C 3CLHA 5FHRA 2ZITA 3WLSA 3GFRA 4I9UA 1PKXA 4CU5A 3UQYS 1GJRA 2OA0A 4DCGA 4PONA 2H06A 1LPMA 4PLHA 1NA5A 4RHFA 3W2TA 5DTQA 1Q1EA 1VPVA 4NONA 1J0AA 3D4PA 3WGLA 2DUWA 2V74B 3QXHA 4Q3OA 3B8EA 3L7AA 3KALA 3SD7A 1A50B 3ZI7A 5HKAA 1DMSA 4C4PA 2OOKA 3H3XA 5KDLA 3GA7A 2IYVA 1UF9A 1Z6ZA 5GM1A 3U4MA 3CSUA 1TU0A 3UAXA 4Y3UA 4F4HA 1XZCA 3D6TB 3DLTA 3R5SA 4HMOA 4Q4DA 3VAAA 1GA6A 3DZBA 4FOOA 4C30A 3RNLA 4Z4HA 5EIXA 5CTJA 2J6BA 4FSHA 1W48A 3I9MA 4FFPA 5JO0A 5ALIA 1X14A 1H6CA 4EY6A 1H2XA 3SP1A 3I2KA 5EJ6A 3HCRA 4PU0A 4ZVNA 3W05A 4PAOA 1FQWA 2YJZA 3AESB 3FUCA 4TTPA 2G17A 1JLKA 2OBXA 4YJ3F 1WE2A 3TTUA 4XASA 3RRZA 1PNVA 2X8JA 3AL3A 3FTCA 4S24A 3NT5A 2WTBA 1OFHA 3ZGVA 2PT5A 4BRWA 2GN1A 3UTDA 2H57A 5G4LA 1GV1A 2ZE5A 3A4NA 4B4WA 4YMGA 1HRKA 2V8BA 4NHOA 1A5BB 1LTQA 4GH5A 3I4CA 3OIWA 1CZOA 3BRSA 4FT4A 3FOBA 4CIBA 4D80A 5P21A 3H65A 3A25A 4F2HA 5FBLB 2JFXA 5IZCC 1EPUA 2FZEA 1KY3A 3PNKA 2CE2X 3UV7A 5GGYA 4NBSA 1GFZA 3B38A 1C7QA 3CRMA 3QFRA 3MOIA 4GLJA 2YWXA 2R8XA 2JIRA 1Z12A 2OORA 5TMPA 1QAOA 1OPRA 3DOCA 4KG7A 5EZYF 3EPPA 2YVKA 4Q00A 5D1NA 1Y37A 1XBTA 3KR9A 1YS1X 2LDBA 3KQOA 5FTKA 3EZ2A 3EOZA 5IFLA 3M5DA 2JDIA 5EI5A 1Z4JA 1RYFA 4AZ3B 3TMAA 5KKCA 3QPUA 1MC1A 3PRKE 1HQYE 1SUCA 2R8YA 3ANNA 2R4QA 4GF5A 2QBYA 5CVVA 2WJYA 1QH0A 3AHEA 4MWGA 3VNUA 1W1WA 1PWXA 2XOKA 3ISTA 3ESDA 4P0PB 1N8TA 1BXGB 1PJ3A 1X7HA 3OOJA 3NHYA 3B78A 1G7TA 4O4HA 3MT0A 4IYJA 3ZHZA 1ZNQO 3I34X 3KTDA 2BWJA 1NQUA 3OEHA 1L5HA 4URVR 3SE0A 3DBLB 1D6JA 2A30A 5C5DA 2BRUC 1JMYA 1GN8A 1HEIA 1MV8A 1BW9B 1EFRD 1IOLA 4JMLA 4QAJA 2XTMA 3X1XA 4CKZA 4JQSA 4MULA 3DZGA 4B6QA 4A0RA 2JB9A 2VQ3A 2O8BA 4UE3S 5J5VA 5BRNA 2EKLA 4LZZA 3UTCA 1GKUB 3LJKA 3BDVA 3DBOB 3KAQA 5ERXA 2WB2A 3K6RA 2NVUA 4LOHA 4ZICA 3O3OB 1R0SA 4X1IA 1WHTA 1TUBA 4D9IA 4WCFC 1OKKA 3F3SA 1ULSA 2XCIA 4MYTA 2J07A 3OZXA 3EGCA 5FP0A 3PENA 5KCMA 3TD9A 2D7JA 3MT9A 1DDIA 3K32A 2F55A 4PZPA 4D92A 1CY7A 1O89A 4PNPA 3PP8A 3E9CA 4L02A 4ZT3A 2ENUA 1CS0B 3VA7A 1P44A 1KMMA 3K1AA 3VYTB 2BFDA 2A7XA 1AQJA 1JEOA 2DLDA 3WGYA 1Z7BA 1KJIA 3ASZA 1QQ7A 3G0BA 2AVDA 4FW9A 4C2AA 2VJMB 2HJ9A 5LWQA 2HU2A 2YNMC 2FW8A 1CQJB 2YZKA 2FY8A 3UXEA 3F2VA 1M1NB 2C61A 4IIEA 3ZV7A 1LFAA 2CCJA 2EF1A 1LVUA 1V2HE 4XJSA 4C4AA 3AVUA 1U2GA 2KI5A 3ROFA 3IKMB 2HBRA 4XQ9A 4B5LA 1Y8RA 3AP2A 3DO5A 3HM2A 4AJIA 1SZDA 3QU4A 1UINA 1TJYA 1X74A 2QTCA 1JUDA 5JFGA 5KQLA 1RRGA 1I3LA 4PIMA 5FI0B 2ZVDA 4UAVA 4IDQA 1Z9BA 3ZDFA 1U63A 4BLOA 3FAKA 5JY6A 5FHQA 1HE1C 2QQGA 3NBMA 3TRJA 3ZWNA 1J8QA 1F4VA 4NBRA 4C05A 5LMNB 2YRFA 2CVPA 3HPQA 1OBFO 2ZKLA 4TMWA 3T41A 1RZRA 5DM70 3O7MA 2GLXA 4QEDA 2DWQA 3CLRC 2VI5A 3KJQA 4R84A 4KMRA 1T2CA 3KPVA 2PLAA 5CPBA 5DRTA 3D2LA 1OZFA 4DIBA 2Z2ZA 5EZQA 2F64A 1PVVA 5IVKA 1KJYA 3I5AA 1T9GS 5GOZA 1EP2B 5AM0A 3VR5D 2OV6A 2FFJA 3C70A 2WYIA 1J9EA 2X0NA 4KWHA 4E2XA 2GAIA 4JU9A 5C8DA 1JFTA 3C4JA 3MB5A 3I28A 3HUFA 3EEBA 2OEPA 3JSXA 1SXJB 4C78A 1QORA 1KZ9A 2QRKA 4ARVA 1E79D 3FHOA 1MQAA 3TSCA 5MN6A 2GDZA 3L8ZA 3BWVA 3VUEA 1G3IA 1VHJA 4Z86A 2ZVJA 5M04A 2NV0A 1T0UA 2AXNA 3HR8A 3GJSA 1HYGA 4IV8A 3B1KA 3UV6A 3RU3A 1ZR4A 3S1AB 1JDZA 2L0XA 4Z8YA 3UENA 1MOQA 4C2BA 4EMBA 4FYIA 3BKWA 4HDQB 1NUUA 4WA8A 1U5AA 3L5OA 4CI9A 1FXWF 1M6NA 1SXJE 2C5HA 2Q6OA 3I5XA 1ZVJA 4UTXA 3TLYA 2ZAMA 1AK2A 5AK3A 1J56A 1E1CB 3NH6A 5JAPA 5DTIA 1BS9A 2FPGA 1AY0A 1Y33E 4Z9BA 2FOXA 3LGXA 4I9HA 1PEYA 1DRKA 3C3XA 5CIQA 1E2IA 3WOVA 2UZ3A 4INZA 1RJEA 1XWWA 3CW9A 1Z6PA 5F64A 5H7XA 4H2DA 4BIMA 2RKOA 3SXPA 5HGXA 1WP9A 1PU2A 2ZJ1A 3NIWA 3L7KA 2YHIA 3SMQA 3DFMA 1Z35A 1P0CA 5GIOE 3BXZA 4UNQA 1OIXA 3DZKA 3WR5A 1Q95A 2IZ5A 4NG5A 3QVVA 1K98A 3KT8A 4OA8A 4QUGA 5BSUA 1DAMA 3ZV6A 2BR3A 2A1UB 4D44A 5DBHX 2D5BA 1FSSA 1X39A 3U48A 2W83A 4CIDA 4EMSA 1P7ZA 1PYOA 4GX1A 3O0DA 3KJHA 1T9DA 1YCFA 1E7WA 5KDOA 2F90A 3W5BA 4P3NA 3HA7A 3OCYA 4G0XA 1XV5A 3SS7X 3ZHVA 3MF4A 5L3SA 4GGPA 1K27A 2HQ1A 2GBLA 3A1TA 2BEJA 4JVOA 2EV9A 4QHTA 5C8XA 5C2JB 4M0UA 4GR5A 5CYFA 2ZJ4A 3GLSA 4MGHA 4WZAA 3M1AA 1JECA 1FP4A 2ZQZA 4X45A 2PWAA 3CJRA 2FW7A 4QLOA 1JJIA 4EW6A 4L75A 3CPHA 2IH5A 5CEJA 3BMNA 1WXHA 4XYEA 2X13A 3ETEA 3L84A 4C5CA 3GLTA 2FMKA 4YMIA 3GT3A 4RS4A 3HA2A 2YJ4A 4ILEA 2G80A 4A8PA 1NM5A 1VLZA 2CL5A 3RS3A 3R3WA 1CS4C 5F1KA 4F71A 3MZ0A 3WWYA 1CUXA 4GRAA 4QDOA 2KX7A 3HBFA 1ONPA 1RPJA 4HAIA 3IVGA 3ADKA 4WY8A 1NUPA 2H17A 3A1EA 4D9HA 1BEEA 1Z6XA 2I62A 2JHFA 1Q20A 3CLKA 3OZWA 3OD5A 3V00A 3W3ZB 3NB0A 4F1JA 4KWIA 3FKSD 3Q85A 4IHKA 1FB5A 2BE9A 3SYRA 2IS1A 4WMLA 5LZ5A 1GGEA 2WU8A 4OJKA 3Q72A 3OZFA 4J76A 1Y89A 2YRXA 3H1AA 2A4KA 3NNNA 1I9CA 1KH2A 2PQ2A 1B41A 1V1MB 3CNOA 5CT9A 5DBGA 1ACLA 2XY4A 4ZT7A 3BIJA 2D62A 1HDEA 4YAGA 2B8WA 1NZDA 1OPXA 3BFVA 1BWRA 5T57A 1MVLA 5JBIA 4HQKA 1AE1A 1MJFA 1QE5A 3DPSA 2G70A 4DV2B 3Q5GA 5AKYA 1G6Q1 3SC2A 3SY8A 2BI4A 3CCBA 3RTEA 4ZYTA 1BVHA 2WMDA 5MHTA 4OEHA 3F6PA 4FI3F 1C7JA 4I0WB 1MR3F 3RS7A 4C0QC 1RE0A 3AF2A 5IDYA 2QP4A 2B2NA 3OU7A 4AX8A 2OQVA 4YRMA 4EZBA 5JW6A 4RTSA 1S8FA 3T9AA 2Q5EA 5JALA 1VB3A 3INRA 3ED1A 3SR3A 2ZSEA 5HFJA 2BFPA 5TF4A 4CPDA 4ER3A 1VJGA 2HQSA 2BHNA 3E5MA 4EFKA 1IEQA 1CIJA 3R0ZA 2V7QD 3SDSA 1ODIA 1S2MA 2PR7A 4TQUS 2O7RA 2CXSA 4WN9A 3W9UA 3WXBA 4G1FA 1EFDN 3LBIA 3RUDA 4UARA 3LSTA 4A92A 2Q0HA 1OZ0A 3PL1A 3OWOA 4XX0A 1OV6A 2XMQA 2CKDA 4X5OA 5DGIA 2GF2A 3B89A 2JATA 3HLYA 3LXXA 2AJBA 4DJFC 3U4GA 4I6EA 1MAHA 4O0MA 3N7UA 5FO1A 4KL8S 1KEKA 2IU6A 5EZSA 1AKNA 4E15A 1KFKB 1G19A 2NTNA 3NO4A 4E2FA 1LRJA 3KD2A 1NF8A 4NYJQ 1D0VA 1NUAA 4BHTA 4MDFA 3RFFA 5CVDA 2X8BA 4IVPA 3H2IA 3OCXA 5FTLA 5JIBA 3IKJA 1T36B 4C43A 2NYUA 2JIPA 2YMLA 3EEYA 3ND9A 3KLPX 1O03A 1NLMA 5HZKA 2C4WA 4YJKA 4RFVA 2Q2QA 2JPDA 2QVLA 3HDYA 4GI5A 2ZUDA 4BE9A 4BWVA 3TECE 1J8VA 2NZVG 1USUA 4YJ2B 2CF6A 3RSQA 3PICA 2FPIB 1DB3A 3E9MA 4TPKA 1PD1A 4DYDA 4GMGA 4LY6A 4CJXA 5HQTA 4BO7A 3WL7A 4AKGA 1RLJA 1C3XA 1QTRA 2D1TA 3D0KA 3F4KA 4KU4A 5G1NA 3OZTA 4RABA 1LWNA 3KQQA 3OIFA 2XJ9A 4FGKA 2D54A 5BN3B 3DTVB 3HVIA 4MYHA 1DTEA 3PRHA 1FNSA 1ULAA 4J0GA 4YO8A 5FIUA 4ALMA 3PPVA 4LBWA 4UVGA 4LDJA 4E7OA 1HA3A 1R6TA 1Z0FA 3OCZA 4MWSA 5GP1A 2H9AA 4AJ1A 2WJ3A 4MB0A 4LTDA 4YJFA 4HAUA 4OTZA 2VDLB 5TV2A 1ZKMA 2EBUA 3O8OA 2M9MA 3F71A 4FYKA 3R41A 4ZDWA 4LF8B 2ZRAA 3K3PA 1ECBA 1RU3A 2GH1A 3I3OA 4UEJA 5E3JA 5E6UB 3OCVA 5T67A 3JQ6A 3TW6A 1T34A 1ZW6A 3PC7A 3C16C 4C0AC 3C5HA 4B34A 4C3ZA 1A8IA 2ZUEA 4CCSA 1SOUA 1SU4A 1X1TA 5A06A 4IFTA 3AVPA 2LR0A 3R8XA 1P73A 2OYCA 1XK7A 4RY9A 2AVNA 2K7ZA 1V96A 5I45A 1C9NA 4MIYA 3TOXA 3REQA 2QTGA 4TV8A 4FHCA 1J1ZA 4PN3A 4L16A 3EMVA 3Q7EA 4WI1A 5AJUA 3H86A 3BGIA 4R8SA 4GBED 2LCFA 4LV6A 2ZTVA 4RHYA 1WOMA 3HCBA 3X1YA 1P4HA 2MYNA 3BVPA 4MQBA 3O4VA 3LW7A 2FP4B 3L6RA 3NVDA 3H6GA 4DBVO 4KRXA 4W63A 1OWMA 2KBEA 3NTLA 4YCNA 3A31A 1WY5A 4RHXA 2DFNA 4PLWA 1WPQA 3QVMA 4RPKA 2R5WA 4R2HA 1MVOA 4D9BA 4E4RA 4XRGA 2P62A 4Z3KA 1EFPA 1LPNA 2CYAA 1RT9A 2QZZA 1LF5A 2KHZA 4QX6A 2XECA 1FLNA 1NDHA 5BUQA 4JP2A 1J8YF 2B94A 1JKFA 1E0KA 1M67A 2PSJA 4FR2A 4WHMA 4ZN6A 3OJXA 4N49A 4UC0A 1K5PA 2K87A 3FPCA 4ZQFA 3QXJA 1XC7A 4OF4A 1QAQA 4G4JA 1SCNE 4C4ZA 3E7PA 4F6CA 4NL4H 3C3EA 4H0FA 3MTQA 1CW2B 4M9ZA 2BMFA 3F46A 1BEZA 2ZIFA 2I4TA 2D1FA 3QYAA 4L0QA 4ND8A 4CTNA 4B46A 1ZD9A 3AIOA 3AETA 1ZK3A 2PKQO 3R1IA 3N2EA 4ESVA 1U7ZA 1USKA 2C88A 2VDJA 4H7DA 4MRRA 5DFAA 4NV0A 3HJBA 5ALQA 2BCGY 3OQ6A 5I3ZA 4FXOA 3DBIA 5L7TA 4Y2HA 2V03A 2C2XA 1CIPA 2IHVA 4G9BA 3D43A 2H2GA 3RV4A 4OQMA 1I3OA 2PUAA 5KVAA 3EG9A 1XZFA 2OGSA 2JAXA 3OAAD 3CSDA 5KJFA 2JLXA 4HLUA 3FPJA 5FUQA 1FFAA 1V41E 2ZATA 5JFTA 1K8XB 1A27A 1QLJA 1BE0A 3HZOA 4JX9A 3FKJA 3E81A 2NSLA 4GXQA 4YMUA 1EE9A 2AN4A 4N6OA 1A1VA 5K2MA 4E5UA 5B36A 3VR0A 4TLCA 1LI4A 4YAOA 2VTBB 3A36A 3TBFA 3ZLTA 3L6DA 1E1LA 3BOSA 3NU1A 1RHRA 4UM5A 3D8BA 4ZQEA 1ZL0A 1LRKA 2CXRA 3G9ZA 4RK5A 3L9WA 3M9LA 2VHJA 4LOJA 5IARA 3PDHA 2OCBA 3CS3A 4UU8A 4V0QA 5EJMA 4HNVA 2JFBA 5L7WA 3GAFA 3HXTA 3R4VA 5AO9A 4HVLA 2YASA 1JHPA 1MIOB 1POXA 2HRDA 2PU5A 5DHQA 3ONVA 1FSFA 4M38A 3F6CA 4Q1BA 5E1OA 3TRFA 3WLFA 4DPLA 2PTHA 1WUYA 3G7SA 1QJCA 4GOND 1SZCA 4DIDA 4F60A 4C22A 4F3RA 3GIWA 4PHFA 2XMPA 5HYVA 1DBRA 3M6FA 1UOQA 1X7WB 1G4HA 3HP7A 1CE8B 1X1QA 3QFFA 3BCRA 3F5QA 3I6YA 5FL3A 5JS6A 1LNZA 3MTEA 1SIUA 3KVOA 1X9GA 3CKKA 1TVEA 3D6AA 3EXHA 2C82A 5HKLA 1NKSA 2NVUB 1EGVB 4EG5A 1VKHA 2EWVA 4LBVA 4X1IB 3FH0A 1WHTB 3TW4A 2BGNA 1RFLA 1WCWA 4ARCA 3GMTA 4MR8A 5DYWA 5FBZA 3IDZA 3ORSA 3DOFA 3EWAA 5LR6A 4TTTS 3ETHA 3UXMA 2X8WA 2RE8A 1VOTA 5C8YA 1N2CA 4YMSA 2BSXA 5HK8A 4OUDB 1P61B 4ENRA 1QIGA 3LUJA 5M34A 1W5FA 1YULA 3FPGA 4YQFA 3B13B 3E5RA 4TMFA 2DLCX 1M6VA 1FTNA 2J3JA 1NPTO 3GF4A 1MRSA 4YCDA 3UATA 3WVNA 1MXFA 2PUHA 2ZLBA 5BUZA 3EX7C 1LSUA 4N41A 3RYTC 2O3SA 4YT2A 5CDFA 2LTAA 2CNWA 1Z07A 4GC5A 3SSMA 4G0OA 4BWGA 4DGQA 5IABA 1XHFA 3E0XA 1YZQA 4D9KA 3HKBB 1JS1X 3CBGA 4QT4A 1H4VB 4RK7A 4XDHA 1QONA 2R7AA 3H1TA 3IMCA 4V0OA 4PQYA 3VR6H 3K9CA 2GXAA 3LT1A 2P67A 3ZZUA 2C96A 1JNYA 2PZFA 2AE2A 3NJRA 1YDFA 4JVLA 3R23A 3UANA 1XPRA 1QQBA 1SKYB 1NYQA 1UODA 3CX7A 1BTOA 3B1ZA 3OM0A 4GPEA 4KLNA 3TSOA 4RULA 2R7LA 1XNJA 2EEZA 3AU9A 3H97A 3RREA 1IQPA 1SK9A 3EVBA 1I2ZA 1VMAA 1YK0A 1OGYA 2QTVA 1PJSA 2YY6A 4J49A 3SX4A 1R50A 3ML1A 2IHZA 2R79A 3E3AA 2ILTA 4CMAA 1OFVA 2MJLA 4EI9A 2F3QA 2DT5A 1X7XB 1Z8DA 1UBRS 2GTPA 3INGA 3IQWA 3PQCA 4KO8A 2YYZA 1I7SB 3HHPA 1SKYE 2GZHA 4RWZA 4DIFA 5THKA 1JV2B 2JA2A 3WL6A 1USWA 1BWQA 4YCJA 3ROQA 2CJWA 4OQPA 4Y6OA 4HDRA 4C7KA 2OKCA 3PQDA 3EEFA 3L8YA 2HFKA 3ZY6A 4B8WA 5ILQA 1PJLA 2VBGA 3RS9A 3NIFB 3WA6A 4RMHA 1LWOA 1YS6A 2FFRA 3EE6A 4M3NA 5CH3A 4L95C 1QX4A 3Q9SA 4H3KB 4ENUA 1ZH8A 2MMGA 2XCQA 1JILA 3G6KA 3UIEA 9ATCA 4DV3B 3BL8A 1WKBA 1PR9A 4IRMA 1HO3A 4ODIA 4J1NA 2C4UA 5H82A 3WS7A 1UBOS 4RDHA 3UW3A 1ESEA 1ZGHA 2Y1CA 3F3MA 3M1LA 3LS2A 2P4HX 4POAA 4BO3A 1WB6A 4CM9A 1DX4A 3WWEA 4F8JA 4NFLA 4I3GA 4I5EA 2RK3A 5DIZA 5AW5A 1HYQA 3KSRA 3ETGA 3ZTWA 4EJSA 3AKYA 1Q11A 1BMFD 2YY7A 3IBGA 5AQEA 2VNAA 5L40A 1Y9EA 1OVMA 4S1TA 4D9JA 1A4XA 4LF7B 2X3YA 1BD4A 3FCXA 1ZM3A 4WQMA 1HURA 2QY6A 1R7RA 1ADJA 4WXYB 3RQSA 5B1EA 2OSBA 4WKOA 3I6IA 1DWPA 3KXLA 2MIIA 2R9VA 4RO0A 4DSUA 1HDGO 1XQ1A 1VHDA 2PTGA 2ILVA 3IEUA 4HAWA 4OAOA 1MO5A 2B3TA 3VR3A 1W7AA 1T10A 3R3HA 1XRQA 1O94A 4W1SA 1EUDB 3V3KA 4CMJA 2OV4A 3JYNA 3TBKA 8ADHA 2ATEA 3GGCA 3L0BA 1PW7A 3UMFA 3A6DA 4AY2A 2BEUA 1BDMA 2YHIB 4P7KA 3FWPA 4ESEA 2QEQA 5HMLA 1UPFA 3CT6A 3HJAA 3LVBA 2IH4A 1A9ZA 2XF2A 2I6TA 4HPXB 5CB8A 1JHZA 4YRSA 4ZA2A 3RRJA 2XCTB 1P1FA 5FBVB 1XALA 2P9GA 5FR2A 4EVRA 3ON5A 4JWTA 2YBEA 3QF4A 4M0PA 5DX1A 3BWDD 1D1PA 4XLZA 4DDVA 3NASA 4G67A 6YASA 1BH6A 4C1BA 5KWSA 4DA9A 4UMDA 3JAKB 3WIBA 2EW2A 4R41A 5A71A 2FSHA 3SQLA 1LC0A 3P5SA 2DSTA 3ECAA 3ENQA 1CRLA 4MPTA 4FWTA 4YDHB 6AT1A 2I6FA 1YB7A 2RGBA 3B1WA 4LJAA 4HAYA 1DQYA 3ANXA 3JAWA 4LYAA 5H5JA 2DY0A 3TL6A 3H11B 3PV0A 1R15A 4FQ5A 1LPOA 1NGSA 3P9NA 4ILKA 2CB9A 3LZCA 3AB8A 1OLSA 1P2SA 2G40A 4FNMA 1G3QA 3H5RA 1EQAA 2H1SA 4DUGA 3FLAA 2P90A 3SHWA 1B6RA 3I6BA 3LK7A 3G82C 4UD6A 2YIVX 4YRPA 3VC3A 4J0JA 2BGLA 5COAA 2UVPB 4YAKA 2QYSA 3U5TA 4JJIA 1I4DD 2AOXA 2Z3WA 1IXZA 5IN5A 3CTMA 1OA0A 1QIEA 2BTOA 4N6GA 1YFJA 5A4AA 5IK2A 4TLAA 2O5VA 3ZDDA 3S2YA 2A8YA 4IHJF 3IELA 4MNTA 2I33A 3IA7A 3T3PB 5BQXA 4D82A 4FYYA 1JLMA 1FTQA 1XN1A 2R2GA 3A6FA 5CR9A 1JJBA 4MQ5A 4X62B 3LLCA 2QR3A 1LX7A 4YT5A 4D45A 4QZVA 3O8CA 1XDBA 2DKOA 3ICQB 3AHIA 4TL9A 1SKBA 5DN6A 1CR0A 3WGGA 5KAPA 2OILA 2O06A 3KBBA 4TKZA 1H4QA 3OZGA 4KODA 1P75A 4IS2A 4MPDA 1CJTC 1T13A 5J4VA 4AMBA 2F1IA 4DYHA 3RIMA 1B26A 3I1IA 3LGAA 1J70A 2EW1A 3LFHA 5DSZA 4PSCA 1L7VC 4AKTA 2G9VA 2VFAA 3EGEA 1R6DA 1ODLA 1FLDA 2G6TA 5IAJA 3UICA 5INTA 2AW5A 4TZKA 1QS0A 3PJGA 5E3IA 1FYFA 1PQUA 4YMWA 4F5WA 4ZI7A 2IUEA 5DLDA 1NR1A 5KQPA 4WT7A 3ZCVA 4YRIA 2V1XA 3IYLW 5CM2Z 3EHDA 2B82A 2FFQA 4V0KA 5DJ5A 5JC1A 1SKQA 3PS9A 4B4KA 1THZA 2FQQA 4FEGA 1AGRA 4LF4B 2YIMA 4N0DA 5U4QA 1QOPB 2HXYA 4JR0A 2BDUA 1WQ3A 3KQHA 4JYAB 2J7PA 1AQYA 1Q0TA 2ZTMA 1NNLA 3GK3A 3IPRA 2GI4A 1OAAA 2DVMA 1M1XB 3AFMA 2VHZA 2VQDA 3I1YA 3PUZA 4QOEA 1N7HA 1WSWA 5A4KA 3THWA 3F1KA 2AOTA 4ESOA 1E9SA 4XIYA 1KK3A 4RIFA 4F4JA 1UT5A 2VK2A 3MCZA 4ZEXA 2YR0A 2B8NA 3NAZA 3AY7A 5EKUA 1OIWA 1E6KA 4KTVE 2OYSA 5CB4A 4RLSA 1QZ3A 5LQRA 4UXIA 4UM7A 3PDIA 5IJXA 2UUAB 3U4IA 3VKHA 1M73E 3QBTA 4GMHA 4O4HF 1Z5VA 3ZVLA 4AD8A 1M6WA 4A36A 1FS6A 3E61A 3AEKA 4GKBA 2X1HA 5EFOA 3UJCA 2PUDA 1II9A 4CLRB 5AWFC 3AYZB 2AWNA 3DA8A 4G97A 2ZTHA 1KEVA 2O7VA 2ECFA 1TRHA 4ALNA 2WJ6A 2WHEA 2Y66A 3DEKA 3PXCX 1CT9A 4GPZA 4EG8A 2XUOA 2XITA 3MJ4A 4JB0A 1Y7TA 3IOMA 5EJ2A 4AVYA 5HJEA 1H94A 5JMWA 3NGMA 2FHSA 2VOEA 2VLBA 4L08A 4PANA 1O4WA 1Z5ZA 1QO9A 3KSDO 4FDVA 3A1NA 2WWFA 4EYQA 4HNQA 2RHOA 1FRQA 4G86A 5H3CA 2XZLA 2WIBA 4CN8A 1UBFA 3ORFA 4Y8VA 3WGMA 1PAUA 2W43A 2REXB 2QN3A 3C7KA 4BNNA 4ZHSA 2XVYA 4DW8A 4ITRC 3HN6A 4D8XA 3M83A 3EGXB 4FIZA 2X14A 3KOMA 1EP9A 3H1EA 1CF4A 2VS1A 1XZMA 2G88A 2P0EA 3TX2A 2W6ZA 1U3FA 2H1IA 2UVDA 1CJUC 2D2FA 3I6ZA 4R01A 4JLAA 1X1RA 4FGLA 3ZTYA 4E31A 4F85A 4W5NA 3EUEA 1SEPA 5EHXA 2WG2A 2Q99A 1ZOOA 1WU8A 2PO7A 5JLAA 3V2HA 3R9WA 1L7DA 1M6HA 1OGIA 1U7DA 2PL3A 3MHPA 1SCQA 1FFDA 2H54A 2JBHA 1RWVA 3FPLA 4QDZA 4Y1FA 2P1RA 3Q8LA 1P9NA 1ZUNB 1UM8A 3B2EA 4WD3A 1NXSA 5E6RA 3M4YA 5D3KA 4OHCA 1N6KA 1E1DA 2JIQA 3O5AA 5GY7A 4OHVA 4C1NA 4DIMA 3TDMA 5FTJA 2C5EA 2E49A 1QRSA 2PD4A 3HHEA 4E2WA 5ICSA 5LXTA 5F5XA 4EG0A 3EQZA 2XLBA 2PMCA 3SZGA 5LDDC 5FOTA 4TYPA 5K0ZA 2ODTX 4Y2JA 4D4HA 1EHCA 1I4OA 3ASUA 1L2TA 3CYFA 3N0WA 1JMVA 4V2IA 4DM4A 1T4GA 4W6ZA 4E2YA 4Z1MD 1M83A 1IN4A 2ROQA 4XB1A 3WGVA 3VHQA 3JATA 4TRMA 2J9YB 3UXHA 4CMBA 3MAGA 2R3SA 4UXJA 4CVNA 5KJCA 4BP8A 4B44A 4HGNA 1Q6ZA 4TKUB 5AJTA 2GSWA 3FSGD 5GVRA 1H0KA 1RJDA 1PLLA 3VR1A 1TEVA 4RPCA 4AM8A 1V11A 3AW8A 1CWUA 3SLRA 3ODPA 2PH3A 3Q3VA 4MWEA 1VBKA 4DT1A 721PA 3EIFA 3D0OA 4JC5A 4BFCA 4HNRA 1P5FA 2VEDA 3VNSA 4DR2B 1NVDA 4TTJA 4C5BA 2O0LA 4MKZA 1P74A 2NVOA 3I9NA 2JIBA 2QX8A 1ORVA 3KB6A 4H3HB 4HS4A 4ND8B 5T4EA 1Q0LA 1EE1A 1Q0UA 2CNLA 3AETB 1Y7HA 3JVUA 3PHGA 1J2JA 1SXJC 2I3BA 2VWQA 3EXAA 1YZUA 4ZTZB 3R8CA 2VF8A 1ESMA 3CX3A 4X1KA 5CXSA 4CKCA 5FUXA 3TW0A 2Y1EA 2X15A 5F1YA 2JNWA 3N8IA 5AD1A 5C81A 2PVSA 1ZH0A 4UQLA 4EKEA 2IOFA 1I6KA 1H6DA 2C77A 3I1JA 2HA5A 3EG9B 4E4TA 1OB2A 1MAAA 3VYVA 3ASVA 2JGKA 4AO7A 5CCXA 2JJYA 4PYMA 5ICGA 3R3VA 4J6EA 3WGNA 3IE0A 3DAPA 4GNRA 3OMXA 1Y3AA 3T7AA 2B7BA 3DMTA 2AA3A 3S29A 2WUDA 4PNZA 1IU9A 2LW7A 4CMEC 2ZYAA 3WGUA 3AL0C 1R0CA 3GRAA 1GUYA 3NDBB 1NJ5A 5ED0A 1M2WA 3ZZ0A 1WS6A 4DIKA 2FXVA 4N76A 1TMYA 4KOAA 3GUHA 3K70D 1A5SB 2CLFB 4EYKA 5IG2A 1DPGA 2VSNA 4JZYA 4WLEA 1C8LA 3FLMA 1I5EA 1E4YA 1H8EA 5TVKA 5MFZA 4EVQA 1U99A 4BNHA 5DNEA 4RF5A 4EPTA 4DOMA 3E6AA 1ISPA 2XEXA 3G9XA 1CUVA 3K0AB 1BXRA 3MS4A 2X22A 3DTTA 3ROPA 4ZJZA 5K0SA 2OHIA 2O54A 1VTKA 4HFJA 3FVTA 2V55B 2AS0A 2VO1A 2I8LA 5JASA 5ALTA 1L5QA 2A0KA 2P1DA 3L0CA 3C8DA 1E7RA 2D74A 3EXHB 4I1OA 1M7GA 4BBPA 1TX4B 2JH9A 4YONB 3HWSA 3OWHA 4UHKA 5DCWA 3BWCA 1GDHA 3T4PA 4DNXA 4E70A 1XPOA 3LQRA 3I5UA 4BEVA 4Q24A 1ZRHA 4AN0A 3RG8A 1DUVG 1QU3A 1DEKA 5ESDA 4NEQA 3BD9A 1DNPA 3OU6A 4LJRA 1Y0BA 5AK4A 2CHFA 4OQXA 3GEHA 4G5FA 4KAFA 3TF5A 3ZU5A 1TGVA 5JE8A 4C4TA 1ZRSA 1G66A 2GBPA 3FMOB 3LUGA 2I1WA 1KXJA 4PG7A 2Z6VA 4Y9SA 3VDQA 1N6HA 4DEYA 5FQNA 1GXSA 2B30A 2VUHB 2WOOA 3PC2A 4PTZA 1F1JA 1HBJA 4Q4JA 8LDHA 5KHOC 2O5EA 4ZV7A 4ZZ0A 1M5RA 4PR0A 2R7MA 4X0EA 1EFRA 4NDAA 4K6OA 2A5JA 4Y0AA 2VQFB 1D5CA 3H8SA 2PKWA 1AHIA 3HADA 1YRBA 1ATZA 5GJBA 4G5RA 3A9RA 2R6FA 4M1YA 2REQA 4C0JA 1DINA 3L0ZA 3IAXA 2QE6A 3PD1A 3CLUC 1OHHD 2HSEA 3M33A 4QFDA 1RQPA 3G2LA 2A9FA 4QD3A 3QKRA 2WSLA 3QNWA 4KQEA 4WKBA 4C06A 2ZBPA 1UDAA 3L18A 3PYLA 1J0EA 5DKFA 1NYRA 1EYZA 3GH1A 4K6MA 2D5IA 2HLDA 5D8DA 3TMYA 1H5QA 1R0WA 3AM3A 1YNOA 2BKLA 3EIEA 1DZIA 4L27A 1IBKB 1XSEA 1D4AA 3NVAA 4AMVA 1KF0A 3S81A 4CGZA 3ZV4A 3L2OB 3DUFA 1T4BA 2FPKA 4KVZA 3QPWA 1KDRA 6PFKA 4BKOA 2Q9CA 3TH5A 1DIRA 2QW0X 3CVUA 1L7MA 4NEHB 3FVQA 2GFIA 3U6KA 2CD9A 2JAUA 2WG0A 5IBQA 4LOIA 1VA5A 4Y67A 2O8VA 2XD4A 4PO8A 1V3VA 1KPIA 4RJLA 1PK7A 1IHUA 5ESRA 4GOOD 2IU0A 1UR5A 5CBPA 2AFRA 5HS4A 1U28A 4KLRA 3AR3A 3YASA 3NHSA 4DQVA 1JDNA 1OGJA 2QR2A 5LBIA 2W2QA 1NAHA 1XFAA 3UYKA 3MSCA 1QVZA 3IS3A 1KYXA 9GPBA 1IBMB 3TFWA 1FSPA 1UBUS 2O20A 1O96A 1JN0A 1UPBA 4B85A 1SHKA 4EJSB 4YV1A 3ST7A 1CZLA 4LXIA 4HEQA 1KK2A 1DJNA 4NEGA 4O5OA 4EFDA 3ZX4A 1EM8A 1T5SA 4BU0A 1CUIA 3R5JA 4AURA 3PE6A 2KWIA 4MW0A 1RJGA 1IMJA 3NWPA 5IRCD 1VBNA 1X19A 3OPYI 2ZSUA 1O57A 3RK4A 5ADHA 4XJVA 2RG1A 1L5SA 1VCHA 2YFKA 3IRVA 3IP8A 2COUA 3VR5A 4P33A 4MV9A 4DRZA 2XYGA 4HK4A 3RSOA 4WNCA 1WB4A 3LQKA 3NOVA 1JF8A 5HKOA 1S02A 4TUYB 1KYVA 3O94A 4E6EA 4E51A 4AJOA 1N8KA 4Y1RA 1GFWA 3UMSA 1E79A 3KKNA 1TC1A 3RS5A 1R8QA 2XSZD 4QATA 3ZD8A 5B64A 4PZAA 2HRCA 1P0IA 2FZLA 1UPUA 2VBCA 5HF8A 3RUHA 4M49A 4OL0A 1NBWB 1SBIA 2DBZA 2LRHA 3Q7TA 3RASA 5JBNA 4JOQA 3RBXA 4QBGB 3T5DA 1V48A 4K9LA 3GUZA 4IMJB 3QMVA 3ZVKA 2BEVB 2JW5A 2MCFA 4PYJA 1MW8X 1VKOA 4XH9B 2PAFA 1LSOA 2R11A 3H6HA 2QMHA 5EG5A 3GG2A 4J1TC 2O52A 1ZITA 3I73A 5FPYA 4TYNA 3GJRA 4ZYYA 3UT5A 2CWDA 4B7AA 4IP0A 2ORIA 3SDBA 1WMDA 3H9UA 3QKSB 1DG9A 1I4WA 1PSWA 3TRDA 3UNXA 1E0AA 1VLHA 1B3RA 3K2IA 3JAWB 1R5NA 2C31A 3AX6A 1GSAA 4IX1A 4BKPA 3QLEA 2GM9A 2YIJA 1Q3HA 3DYVA 2VP0A 1SCUA 4CQMA 1CV2A 3JPYA 3CPJB 4TV8F 4I1UA 5JH7A 3QUSA 4NMXB 1OLSB 1N0WA 1IHXA 1SVMA 3F5MA 3MXTA 5FBHA 3T61A 3V8PA 3VH1A 4KZKA 4F4FA 2XA2A 2J32A 1A5AB 1N25A 2NNLD 4U6QA 1ZDMA 1JIQA 2O7SA 3EDCA 2RGAA 5CCDA 4CHTA 3MINB 4P4LA 3BT7A 3OOWA 5G3ZA 4ZHQB 1A9XB 4DDTA 4J9VA 1R8SA 3R3XA 2RK6A 3I1FA 2RHGB 1H65A 3O2SB 1B8NA 4XZ3A 1P9OA 4WESA 1OTHA 4EQ6B 4MR7A 4CV2A 1EXDA 5T8KA 1XWIA 4I36A 1J8MF 2GD2A 1G5RA 4MWBA 5H02A 4CLEA 1E2FA 3V4PB 3JD3A 4AF6A 4DNQA 1EIZA 1JT9A 4OGWA 5ARDA 1EKXA 4LF9B 1AC5A 1TF5A 3ZKAA 4PRKA 3ZLJA 5A7GA 2WG1A 3H4TA 2JRCA 2RG7A 4Y9RA 5ULLA 1W88A 1Y98A 2ZJZA 1MQ9A 4OB8A 3HUDA 4OHOA 1E94E 2C9DA 4RJ2A 3Q3JB 2AZDA 3U3XA 2R87A 4AU1A 5FUYA 2PM8A 3JQDA 4X6LA 3CF4A 4KGZA 5EHGA 4V3BA 1XRNA 3CVJA 2BR4A 4HDOB 1GARA 4OMFG 4MO2A 2H3EA 2W8BA 2WBLC 8ABPA 3ZWVA 2C9ZA 1JYSA 4ZZ1A 3CH5A 4QGBA 4ZI7B 2QA5A 2JK0A 4HP8A 4QOGA 1C9KA 1OI2A 1P4RA 4WUVA 2QMOA 1Z34A 2NPIA 2QS9A 4TVOA 3N6VA 2J9RA 1JIKA 3VPAA 3VU1A 5TARA 2FSSA 2DSNA 2ID7A 1GNQA 2JHAA 2FOLA 3V4RA 1NMXA 2XUJA 3L4EA 3F5DA 5LFAA 2D2IA 4FILA 3HCOA 4Q4AA 1WV0A 4OYHA 1JYFA 2XMRA 1VGVA 1GP2A 1H4SA 4S1OA 3FKSA 2BHRA 1WCIB 2EL7A 1RLUA 2H5LA 5AKZA 4F8YA 4JJ6A 1H69A 1QE3A 1WRBA 3S27A 3O2QB 1QK5A 3ZQ6A 4XWWA 1SBYA 2XIJA 4MR9B 3BK1A 3O4GA 5FTMA 2DUNA 5CX1A 4EEXA 3NC4A 1XCBA 1Y5RA 4EABA 3PNPA 3GOQA 1MMFB 4NK4A 13PKA 3LDFA 2QW1A 2HY7A 2VG8A 1RMYA 5EXSA 1U04A 4DY4A 4KR7A 3MGCA 4KQGA 2H11A 1UFOA 3AEKB 2W6PA 3H5AA 2A5LA 4RE6A 2LKCA 1EQ2A 4PPNA 3TXAA 4NFSA 3TSYA 4IOLA 4DCCA 4DIUA 2GPNA 2RKBA 3E2MA 4XVHA 3AUKA 5A6SB 4ZGBA 1W2HA 5TQ0B 5HZMA 4D56A 3OPVA 1PJRA 3FCAA 1NURA 1ZMTA 4HRVA 4K05A 1L8QA 1M2KA 1GRNA 3V4SA 1TEZA 1D2EA 5C35A 1H9BA 2Z04A 3HJRA 4Q9IA 1NBME 5AR1A 1ADFA 4A1FA 3FA2A 2RONA 1WQ1R 4KYIB 3ZJTA 1FW6A 5DNUA 3ESYA 2AGVA 3RSSA 2D13A 1RKVA 3HGMA 1U0RA 5AVSA 2V7QA 2EKDA 4NCIA 1ZGBA 1Z4LA 2GBFA 1CJKC 1LJUA 3DB2A 4IO1A 1VJCA 2I1QA 3ZR4B 3HI4A 3KKMA 3I2GA 4FQ8A 1NQAO 1RAEA 5CLFA 4BJHB 4R7GA 4FBMA 4TQGA 1FUIA 1RC8A 3LDUA 4R8RA 2JRLA 3JASB 4JEIA 1VKZA 2CC2A 4KNWA 5DLYA 4O2BF 1HE4A 2C9YA 4HGYA 1LDYA 4J75A 5CXUA 4P80A 4PVDA 3KQKA 1LU9A 4GEGA 2QYOA 5AI9A 3OC6A 4I4CA 1IQUA 3GMSA 4E1AA 3Q3EA 3GDGA 5G1OA 1PP4A 4GMFA 1WTCA 4NYIR 2HCBA 2UKDA 3IUMA 3HWX1 3P9SA 3WHLA 4ENQA 5L45A 1HNXB 1PUJA 1JX6A 4BECA 5FI1B 3ZHBA 2WTEA 3T5GA 1R16A 1V5FA 1ZA1A 2R60A 4KMMA 1Z5PA 3DHEA 4LJ5A 3QA9A 4HYTA 3FDZB 2FWPA 3SMVA 5I5EA 1VRVA 3GRPA 3KKOA 4R6XA 3GW8A 5TSDA 4ARZB 3ZD6A 1P5RA 2Z2YA 3TRHA 3IIMA 3X43A 4LKRA 5LXTB 4IVQA 2XT0A 2PWPA 5KYKA 3WI7A 2O4CA 1V6AA 1ZLXA 3QVKA 5EGNA 2FFAA 4AZ0A 4B79A 1RYEA 1TK9A 2J9ZB 2PXHA 4LRUA 4HV4A 1KVTA 4WBXC 5SY4A 2A5FA 1AKTA 1PJ2A 4BVBA 1YR1A 3NRCA 3JARA 2ZSFA 3HU2A 4I1SA 4XAQA 4QECA 2JC3A 2JVJA 3JATB 4KE9A 1JWLA 2B98A 3WO0A 3DKVA 2AW3A 2WMYA 4Q5IA 3RKRA 1MPTA 2ZT5A 1H4TA 1QGZA 1F9EA 1XHLA 2XYQA 1LS1A 3BBLA 4V24A 1D4FA 3JYOA 1TQ6A 3RO7A 4L0MA 1XAJA 4AKSA 5SZIA 5TEWA 1U3VA 3I39X 4AG5A 1M2HA 1V11B 2ZWMA 3EUWA 4LVUA 3IDAA 3FHLA 3ZU2A 2EC5A 4Q3CA 3JWGA 3D3JA 1J9GA 1XTKA 4FT2A 1PO7A 3AVYA 4M9RA 5IT9A 1GITA 2H1HA 1YRWA 5GZ6A 2XIQA 5BVGB 3I64A 3JQAD 4MI1A 4QRIA 1OYOA 3DH0A 4TWIA 3DQPA 1F8XA 4REQB 3KQTA 3H9QA 1QK4A 4PC1A 1V9CA 2FEWB 1SC1A 2V0NA 4RL6A 4LZOA 2DHCA 4X84A 3WQQA 3KFVA 4X1KB 4X91A 1UC4B 4CKCB 1JVSA 4HNAA 3H5OA 4DDHA 1RXUA 4P83A 5C80A 5BNZA 4YMVA 3KR0A 5HILA 1OZHA 2BCJQ 5MDHA 2OD7A 2AD5A 2DFKB 2IPAB 4ENSA 3ZWPA 1SQSA 2X1VA 4BDTA 4JI0B 3K1JA 4BMPB 5I8WA 5CJJA 2QB5A 1PZNA 2VYQA 2ZIVB 3ONDA 1BCSA 4OQLA 1QPGA 4O8CA 5BORA 1JA1A 3UJ9A 3P9ZA 4OJQA 4B74A 1QDUA 3UAZA 3MRXA 4HEA1 2QXTA 1UOOA 2IYOA 1BEUB 1ZWKA 2P30A 2RGWA 2P68A 4CUKA 2NVWA 3GLFA 1DP4A 5K0NA 3SR4A 2WF7A 4P31A 2PL1A 3NEPX 4UQPA 4WN3A 2ZAIA 3PC8A 4U1RA 1CUDA 1M1ZA 3NWJA 3KAPA 4IKPA 3DDNA 4JDUA 1O5TA 4M0EA 2SKEA 4NJMA 2ZRJA 1IXKA 4LSGA 3RAFC 2CY0A 1IBCA 4KFRA 4N01A 3OQOA 4X94A 4MUYA 4HQNA 1N9GA 1TTQB 3K5PA 3LVRE 4H31A 1Z16A 2ODAA 3LRPA 1BJTA 1U9IA 3I6MA 1BXRB 2G5PA 3TM5A 3DEHA 4GLLA 1XQWA 4PLVA 3UB2A 3LIIA 4XXHA 2P27A 1UP7A 1HNWB 1I1OA 3KQYA 1V7ZA 3AEYA 4RNCA 4RVUA 5BWOA 3EXIB 1V3QE 2YJ3A 3NTXA 4R1PA 1ULHA 1YR3A 2WJJA 3T35A 3II6X 3QVOA 2BGMA 5ALKA 3OIUA 3NPAA 5CFZA 2QAGA 2AJTA 4MB6A 3RJTA 3L40A 3QELA 3WIVA 3KT0A 3M6UA 3ZEIA 5ARCA 2IQ5A 4CR7A 4YRAA 3OAAA 2JLSA 2KE5A 4KIGA 1X3LA 4O4IB 4U9IS 3T4UA 1E0JA 1UEIA 4CQLA 4JQYA 1L8AA 3CUUA 3E9ZA 4CU2A 1NDUA 1U0BB 4OXQA 1SURA 1ETUA 4B6PA 5AXBA 3DBRA 2X4GA 3BULA 2GBLC 4NZZA 3Q0IA 4OVKA 4YV0A 3WKDA 3LDGA 5CG1A 3QOXA 5EJGA 1NJGA 4MIEA 5HRCA 2E4XA 4F06A 1VRCA 5GJVC 2PUBA 1YC5A 1FFXB 3IAFA 3TS1A 4ES6A 1HT1E 2AG6A 1RRKA 3QF7A 2P4QA 3LUFA 4Q1DA 4QNRA 1R3UA 1IK4A 4YAWA 3SZRA 4FQ7A 3ZWMA 4CLOB 1OX6A 5G40A 2NUAA 4L4ZA 4F92B 1FNNA 2I22A 1QFMA 2FZCA 1CP2A 3OI7A 3QX7A 1P91A 3I2YX 4M0CA 4L8FA 2ZYHA 5FYQA 4EELA 4OX9B 2OQ2A 1A2QA 1HDCA 1NN3A 3WGHA 1KL7A 2AK2A 5DO9A 1W94A 2V9CA 5BMOA 2WYVA 1RWXA 4HX5A 2XGMA 2IOHA 2Q2WA 2OZPA 4BGVA 5KNCD 2REQB 1XA0A 3GLVA 1DZ3A 3LYHA 2F3PA 3WMFA 1ESZA 1TXGA 1JPUA 1X6VA 5KC8A 1ESCA 5K0BA 3OSUA 2I99A 2C8JA 2IKQA 4HRXA 3W0LB 3H7AA 3HSYA 4AP5A 1DOAA 3VVCA 4R05A 3RTAA 1A8UA 1ZFNA 2JLBA 5TNXA 1VIDA 4I9GA 2AR0A 5CRIA 2REOA 4U7FA 1GAQA 5ITVA 2VHQA 3H9GA 5CU7A 3W5CA 4H27A 4KV9A 2WILA 1F06A 4KXUA 1G8HA 1XMIA 1CJCA 2FWAA 1YI8A 4QJBA 5LIRA 1E5QA 1JU3A 1TAHA 2BEKA 2ODNA 2VJPA 3KO8A 5GV7A 4UOEA 2WWYA 1DUIA 3AXTA 3O31A 1TUIA 4OFBA 5BR1A 5KC9A 1F0NA 3Q15C 3GBPA 2ZTSA 1S4MA 4QXMA 2HWWA 3RM3A 2P4EA 4D3XA 1UBTS 5FNVB 4IJ6A 5KNBH 5CBPB 2WRZA 6ADHA 2QQ0A 4URHA 3HE3A 4BYGA 5CB4F 2H4YA 2G9ZA 2R85A 5B3LA 1IQ0A 2E18A 4JUBA 1XCJA 3RK0A 3RC3A 1R18A 5CURA 2J30A 4IVRA 1CR1A 2P1ZA 1ZK2A 4QYMA 5ILOA 1RXEA 2HJGA 4IY1A 4JQCA 4C89A 1JBQA 1KDYA 4BZWA 4ZC1A 3WC4A 2QJOA 2XUAA 2AQKA 2IODA 2FUG6 1EM8B 1NONA 3PLRA 4LX8A 4MZXA 3UKOA 1P2UA 2DYKA 3DZHA 1JIIA 1FDRA 4ZT4A 1N36B 1NG1A 2Z3VA 2BKEA 4A6XA 3PEFA 4DUPA 2QTFA 4JELA 2XRYA 4NRDA 2VH5R 2GSDA 4B6EA 1AF7A 1ZK4A 1M76A 4F72A 4RTRA 1NULA 1V95A 3I4FA 3FTEA 3N59A 2VBFA 3DPUA 4JGGA 5SV2A 1TK2A 5T6MA 2R8OA 1IMOA 2HV9A 4NK5A 4R1MA 3JQGB 2C7RA 4TL8A 5AW1A 1RYYA 1RBMA 4XR9A 4M0DA 5CA0A 2HT6A 4M9SA 4MDYA 4HC4A 2V7WA 3GT7A 2FF7A 1P6XA 2C9BA 2N47A 1QDEA 4MQLA 4LF5B 3MAAC 4M9UA 3ELWA 5CT6A 5SZKB 3ELDA 4XYBA 4UBKA 3BDAA 5BSRA 2O8DB 1VA4A 2OCDA 2QN2A 3O8RA 2HL6A 4JLVA 1VSUA 2PT6A 2IU3A 4UVEA 4RTNA 4DQXA 2ONYA 4MV0A 4P92A 5DNWA 1T2FA 3ENKA 5CT5A 4BMDA 3KQPA 1QFJA 1GRQA 2VNHA 1BMFA 3LNTA 4WNIA 5DASA 3QJYA 4TRRA 4DWJA 5IDQA 2FVYA 4UHDA 4KV7A 3S55A 5KNDD 2J5RA 2LKDA 4WZZA 1XRPA 1VI2A 2ID8A 4RYLA 4A2PA 4Z7QB 2ZZNA 4H16A 1RXIA 5LOVB 3OE7A 1ZD2P 3GZJA 3EXG2 4N48A 4TGLA 1XA4A 1RC1A 2Q1XA 3ZCQA 4JT4A 4CKYA 3NONA 1SCUB 4CQMB 2Y1FA 1PTJC 4TXJA 2HPHA 2OLJA 5AW3A 4JJGA 4D8VA 1AUPA 2IBSA 1UJ6A 4MV5A 4PHCA 2A92A 1QUFA 2OO5A 1MNAA 2XMZA 3E4DA 3N9IA 4IJWA 4UHFA 1B8OA 5HIIA 3WICA 2OTCA 4TQ9A 4HSEA 3ZWWA 7MHTA 3PFCA 3FAZA 4FN5A 5I9SA 4C6SA 4F3NA 1QOZA 4OFXA 2JCSA 4ZCSA 2BFOA 1J07A 1PE0A 3AV3A 5JCOC 2ZT8A 1RXYA 5FAKA 2FSVA 1U02A 3ZCXA 1UWCA 2OD9A 4X7PA 2QJFA 3I4LA 3K0EA 4HH0A 4MR7B 1LLDA 1FMJA 4QUDA 5C4IA 2ATIA 3Q7PA 5CMLA 1EEXB 2C97A 2PT9A 5DMXA 2GMWA 4AJHA 2A0YA 2D4HA 3DWIA 1KJZA 2JBWA 4Y2VA 1XG5A 4MGEA 1AN0A 2B5OA 1BH2A 3DLAA 1WX1A 2HK7A 3R0XA 3TW8B 3U80A 3WJ7A 4BATA 3FNGA 1N3BA 4JI5B 1J7KA 4HQOA 2WB4A 1KJNA 4WK4B 3M6MD 4IRXA 2JAQA 2CFTA 2WVHA 5KX5A 2E0IA 3ER8A 4U02A 2B3DA 3Q0TA 3FN4A 2I78A 1OXXK 5KVCA 1JLSA 3EIUA 3E2PA 3UEOA 4UTNA 1FFWA 4YP0A 1FBNA 5DYNA 2Y1LA 4UBMA 2R0QC 1D2MA 3JU3A 5G41A 1MX1A 1ZJWA 4X8MA 1Z2OX 1DOZA 4I55F 5C1DA 3MOSA 3PPIA 2CHUA 2XB9A 3I04A 3ZHTA 2OCYC 2XJ4A 4PZUA 1JEQA 4C87A 2BGUA 1PT6A 2I03A 5HX7A 1YF3A 4PRLA 1JVNA 3HVHA 4DCMA 4R2KA 3GVCA 5D3ZA 1G98A 1ZEMA 1JQLB 3KTAA 4Q4AB 3SGLA 5A62A 2NO9A 4HAVA 1Q17A 5AOCA 1ULZA 3NKFA 4H0CA 2VJBA 1JP7A 4MB2A 1QHEA 4LZAA 5FT9A 3ELUA 4X95A 1IB6A 3AKEA 4Z0TA 2P0AA 5HE9A 4LHZA 4Z7OB 4MPJA 4D9GA 1ISFA 1ITZA 1YS2X 2AHOA 3NHUA 1M75A 1PV4A 3N2KB 1NC1A 4P4NA 4BKUA 1QGUA 4G63A 4NDNE 3V1UA 1B73A 4DA0A 5L3QA 1ZIOA 1FNCA 1B4DA 1UKBA 5FNZA 4B3JA 4F2DA 3H9BA 3WB0A 4BWYA 3FTFA 2GQ0A 3BSFA 1RS0A 1IEWA 4HLUC 4LXUA 1X7DA 4BFZA 1QP4A 3KZ1E 2DTDA 3R5KA 4KBGA 4LQDA 5B53A 4JITA 4YUWA 2XRMA 2IUFA 3JD0A 1XU7A 2F8LA 1Z29A 3LM8A 4R1LA 3VH3A 5IVHA 2QTRA 1PFGA 5K99A 3ND6A 2NIPA 5JJ5A 3MBOA 5CYPA 2OFOA 2IE0A 4GM1A 2X0KA 3ZUPA 1W0CA 3G0CA 3GVXA 4KO4S 2QI9C 4EPXA 1GNRA 1XOIA 2JFFA 4W5HA 3EJ6A 1XMSA 3LBAA 1G20B 4B09A 5L4LA 1QPZA 2PL5A 3LTEA 1UKVY 3THOA 2P35A 3IBTA 3B8HA 2NADA 1X13A 3SYMA 3VNAA 3OPYA 5JMPA 4R1NA 4RY2A 3CVWA 2YH2A 4OP2A 2JZNA 2BFAA 4G3XA 4O5AA 1WMFA 3SC3A 3IQFA 1B8VA 3RTCA 5BSWA 3EXHC 3BJIC 1G20E 5CNJA 2EYQA 1JG3A 3ZWCA 3SU8A 1XB2A 4LDAA 3H18A 2DTXA 5T4BA 2WJAA 4E32A 2J08A 1ZVMA 4HI0E 2YV1A 2DXIA 1CB0A 2PXXA 4WY5A 3TIVA 4KR6A 2ZRFA 5BNWA 3RVPA 3E3MA 3LVFO 3CRVA 3PT9A 4DABA 1OYYA 2OQRA 3X2SA 2OMEA 4DCPA 2QTLA 1VJ0A 3EW7A 2ZSAA 5EGSA 4C4RA 4OP1A 1EFKA 3EIQA 4JLNA 3JQCA 4DDKA 3G5TA 3BXEA 1E5VA 1VHWA 3PXAA 4QXOA 4WK6A 3ILVA 1P2FA 3L9XA 1QIMA 4KQ1A 4XJTA 1A71A 1Z0SA 2A3NA 5CB0A 1A4IA 3OKCA 2HWKA 3K4QA 4QBIA 3RRYA 4EX7A 5IWAB 1VHLA 2A14A 2ZRDA 5EE5B 1MVNA 1JFVA 2WHRA 3D3QA 4D0SA 4JLBA 4OHKA 3BAFA 3KB1A 1E9EA 1OC4A 1FTWA 3FFBA 4AZ0B 1W85B 3I52A 1NR5A 1UBKS 1YGPA 2PLFA 2XA1A 1O95D 2XI4A 2XQGA 1FNMA 2YHSA 1A88A 2ZEJA 4FYWA 3VR3D 3NHAA 1LK5A 2WSIA 2ZBFA 3RV3A 3F6YA 2Y0EA 3HY4A 1CG6A 4ZU1X 3QVWA 3GXBA 4B6OA 1GCUA 5H70A 1ACMA 2E5FA 3DYIA 4F38A 3STHA 2FMHA 4QTYA 4MQUA 2ZYRA 5E9WA 4K2HA 1IN8A 5CUQA 2B8EA 2NLOA 2C0CA 3A3KA 3QWIA 1HT0A 1U2SA 3LT4A 1QH1A 3FUTA 1EK5A 4G1UC 5DBFA 3EPJA 4RJTA 2C59A 3S40A 3UFXA 3ABQB 2W2NA 3CKYA 3T3MB 2PS3A 2CLKB 2AXQA 3HKDA 3NCHA 2PUCA 5JEDA 4R2IA 3WV4A 4GRDA 1L7RA 3WLTA 1KRXA 2PKCA 2NMVA 3PWZA 5JJCA 1BU5A 3H5LA 4DMFA 4CIXA 5D86A 2WYUA 2DGDA 3RSGA 3OTQA 3LBHA 1PHPA 3URKA 4AMYA 3O4IA 3TNFA 3MCWA 4BYMA 3TNLA 1LI7A 5C52B 4MW2A 2NO0A 3P9PA 3WV5A 2OBFA 5CK4A 1GZDA 1DQNA 2DBVO 2CE7A 5JNRA 2L69A 1XUOA 3DDWA 3FW1A 4CCAA 4GVXA 3BA1A 1BX3A 1CY6A 1ZD3A 4Z1MA 2VIIA 4LTNA 3QIVA 4KSCA 1NU6A 3HO1A 1E6UA 2NO4A 1UBMS 4TT8A 1OBCA 3W79A 1LXCA 3TINA 3CWCA 2VUUA 1T0BA 4W1PA 3EH1A 1DHTA 4RHEA 3D8TA 4MA4A 3SZ3A 4EYSA 3FSGA 2C7QA 3O8QB 2HQBA 4KDEA 1YQ9A 4O2AA 4URFA 3IBYA 5ERYA 4BLWA 4NF2A 1H2RS 2NU7B 3CLVA 3TLGA 3GLFB 3EODA 1IXRC 2HSJA 2IE8A 1AUXA 1MA3A 1S6YA 4H9GA 2OYRA 2AZXA 2BE7A 1A95A 3C3BA 5IPFA 4TT3D 1WLYA 1HWYA 4B4DA 2VOJA 4QG7A 4KSYA 4PYQA 5T4HA 1RQ7A 3AFIA 1KO8A 4HWKA 4Z9YA 3DZJA 3QBVA 4DMKA 4QJ3A 1F2VA 3KXIA 3F73A 3IALA 4GWLA 1E2JA 3CRZA 1B0ZA 4KRGA 4N03A 3KVYA 3SBDA 3TR0A 3GLFE 1BS1A 4LV8B 3HZHA 5BO5A 3RCBA 3NALA 2IIPA 5JH7F 2V5VA 1Z56C 4BJ6A 1K5HA 4KN8A 5IXYA 1AZTA 3DP9A 4M36A 1U8FO 2TECE 3GT0A 4TXLA 4WK2B 2YINC 3R7WA 1JEJA 1MOSA 3P0IA 5FO0A 2PDAA 2FE1A 4CQLB 5BQPA 4WJZA 3T0FA 3QPBA 5CVUA 1BFKA 4JJ4A 4TL7A 3JYPA 4Q34A 3U7QA 2XF8A 1A9SA 3FBTA 3NEYA 2HHJA 4ARAA 1N7JA 3Q6NA 4FR5A 4MW7A 1A1SA 4DVGA 5IHXA 1S89A 1K97A 1L5LA 5K8JB 1E63A 2HQOA 3C6YA 5E1BA 1NVBA 2IFTA 3PNQA 4H4EA 4JBYA 3AHCA 1NC3A 1QZUA 1NLZA 3KQMA 3AILA 4HDMA 4ZMRA 4JCOA 3AWDA 4MCIA 3C7DB 4WLOA 1YQWA 3B6IA 3U31A 2H8GA 4HDNA 4QULA 4E7PA 3F9CA 2V96A 2X7JA 4DXDA 1YSCA 4TWZA 4K9DA 5LP6B 4M9CA 1X8LA 1BYIA 2DH6A 1VIYA 1WXXA 1AKRA 1VL2A 2D2EA 5CVCA 4AZSA 3VO1A 2V7BA 1L0BA 4I9FA 1C14A 1VJRA 3D1LA 4CKBA 1HLGA 4AYWA 3TAXA 5JAZA 5K8CA 3CISA 5HBRA 5HM8A 3R5XA 5JVDB 4FX5A 4J8PA 2JHCA 1RI2A 3CINA 4AS3A 4Q3LA 2Q0XA 3GJ0A 2BMJA 4DTCA 4RKRA 3H1FA 1HFKA 1OX4A 1W4CA 3N70A 5ALSA 5I9LA 1MEJA 4Q9LA 2OLKA 3FWHA 1JKJA 4JBXA 4KOEC 4L4UA 1AA9A 5K9ZA 5CPFA 5LZ9A 3S7ZA 1KIFA 1IUKA 1LDEA 1KOJA 1P80A 1JA0A 2R8BA 2CUKA 4WZBA 3IH5A 4J4BA 4EF4A 4PM4A 4ZO8A 2EERA 5GGXA 1E6WA 2IHTA 4DDMA 1LBQA 1V2GA 2OUKA 4EW2A 3CZPA 4FMCB 2EBWA 1AXEA 2EGGA 3LA6A 1VKRA 2O3JA 1V16A 4R83A 3AF6A 3WFJA 3LD9A 1TM5E 3CO0S 3DB1A 1GLVA 1XQYA 3H9CA 4RMJA 3VR4D 4HB2A 2GUWA 4QVIA 2EJUA 2FSGA 1CQWA 2QSYA 2PKXA 4LZWA 4QUBA 2IYFA 3JQ8A 2AKYA 2UU9B 1B00A 1GRRA 4E14A 1YC2A 3PUWA 3RIXA 5KQSA 2HDNB 4FN4A 1CUEA 2PG3A 1VZ3A 3SX0A 2DWOA 2RC6A 1PR5A 1SG6A 4F84A 1X77A 2HRZA 3AEQA 3D7NA 4B3DA 1KBQA 2QYHA 1YMVA 1EVQA 1C3EA 2Y68A 3A6LA 4Q7JB 4WH0A 2VF2A 4YJGA 2EP7A 4HCJA 5DWQA 3C6XA 2GPJA 2CL0X 3IQEA 3T6KA 1OHHA 3TCXB 3QVLA 5CDUA 2XNSA 2ZR9A 4B9AA 5TY0A 4EI8A 2C4NA 3PD0A 4OHFA 3FCEA 5EPOA 2Z3ZA 2GAAA 1NXOA 3TLXA 3ZI0A 5JXGA 3CLSD 4I4TB 4XR4A 1EX9A 3UGQA 4TV9B 4B47A 5IS2A 2ANCA 4RFSA 5HGJA 4ZZIA 5A2QA 4DN6A 5JV5A 3RSFA 2CMHA 2J1LA 3IO5A 4KIUA 2PSFA 4IW3B 5J4KA 4H35A 4EO9A 1ZS9A 1RP7A 3ZWAA 1VE1A 3IT1A 3WWOA 1E1NA 1UOPA 3P0HA 1AQUA 1F4PA 2HLHA 3OLXA 3ICOA 1AKYA 2YQZA 5CA0B 5DLQC 3E7XA 2B5WA 3EC1A 3V2IA 2P6PA 2QN1A 2EAUA 4LC0A 1PGPA 2Z83A 4W9NA 3EDOA 1U0OC 1E3QA 1JHVA 3U60B 1NSTA 2BFBB 2HSWA 3O90A 3RT9A 3H2SA 4CR8A 4A03A 2XQKA 4F97A 2YRWA 4AWXA 4PCAA 4X8LA 3G0IA 3KNZA 3KETA 2W6NA 3KVVA 3OPNA 4UM8B 1P29A 4XIIA 2P6MA 4Y6RA 3X1KA 1IN1A 4BY9E 4U2GA 1YHNA 1R37A 3G1WA 3N0TA 3OY2A 3K0BA 3QE4A 4IOMA 1NSFA 1VYTA 3GY0A 4BNGA 2GYVA 3UV3A 2UYQA 2ZI3A 4O3FA 3QEJA 4Q4CA 5DYTA 2HO5A 4PPYA 4O2RA 4DWVA 1VL1A 5B12A 4Y2TA 1EDOA 2YW2A 3V7NA 3P71T 4DV4B 4A23A 4CM5A 1YQTA 1N5RA 1UZLA 2I5PO 2QPTA 1ONOA 4Z3DA 3ZH2A 5FB3A 3VR2A 4IMRA 4EKDA 2E21A 4F2PA 1BG6A 1FIUA 2CMKA 3FROA 4G5OA 3C7AA 1SOAA 3D5QA 1SC9A 2CLDX 3NJ4A 4WNAB 3UJ7A 2JIOA 5EHIA 2Q2VA 4Z4CA 2VDOB 4GYWA 1F48A 5EIWA 1Z0IA 2EX0A 2L2QA 1UP6A 3F0TA 4OO3A 5H9WA 1R10A 4X92A 1PWHA 1K66A 2XSZA 1PQWA 5I7EA 4UHEA 2GVZC 2Q5JA 3ZNNA 3Q2OA 5KYWA 4HX9A 3O4RA 2Y0PA 3H99A 5G53C 1Z4IA 2WNIA 3G1UA 1VKNA 4LY3A 2V7VA 4KW7A 1UXOA 2Z98A 5JCPA 3PEEA 1M34A 1NMZA 5JCZA 3H1GA 3R09A 4FDLA 4XDYA 2ZM6B 2WT4A 3HVRA 1FVXA 1FTSA 4LG1A 3DAHA 5AVUA 1PJZA 4DG5A 2ZVQX 1ECFA 3E2IA 1N1MA 2ZR8A 4KXMA 4WDRA 4EKYA 4YUYA 2FW9A 5A3JA 4PSKA 3EXFB 3QVTA 1NVUQ 3BBPA 3OLZA 1UKYA 4MCJA 5AVOA 3RYHB 3T7DA 4GX5A 3U37A 4PLYA 3NUQA 2O3QA 3F7TA 4WLVA 5E9JA 4ETMA 1BVUA 1Q15A 2ID9A 1RTKA 3LECA 3WGZA 3IKLA 4Y6GB 1MLDA 2VDRB 3JVIA 2H2WA 2QMQA 4D97A 1PQPA 1WVMA 1QIIA 2FK8A 1PJAA 3ZGXA 2QNRA 1CQZA 1K5DA 1W0JD 1KZ6A 4X97A 2FEPA 2PR2A 3MTAA 3LX6A 2ZYVX 2H2IA 1SVKA 3BJMA 3SHFA 2QIPA 2DB3A 1JLRA 3NHWA 2RHRA 2ZJ0A 1JEQB 2QM8A 4S2EA 4X6UA 4C7OA 3KSAC 1G2PA 1YB4A 2PMKA 2DU8A 3KFXA 1FS5A 3OZAA 5G0TA 1WSBA 4F3YA 1YR6A 1OYWA 5JTTA 3PQEA 1EWQA 3B1VA 4RF3A 1JHYA 1FYEA 1GG5A 3STYA 5JU6A 2QT0A 3FNEA 2F43B 4JLSA 5ESXA 1G6OA 1JH8A 2CZQA 2GF9A 2GVDC 1SXQA 3DMFA 3Q0EA 2IC5A 3DTYA 3ZXIA 4RL4A 2XXAA 2DR3A 2FFBA 1EZ4A 2ERXA 2WV7A 3KCQA 4KE7A 4M2LA 3FY4A 4QGFA 5JDIA 2BH2A 3B6EA 1QH8A 3IIIA 3NUGA 4RV9A 2O8NA 3OFSA 1BVYF 3CZ9A 1JKXA 2GNOA 1RYNA 1U2ZA 3O3CA 4MV1A 3T0GA 4DUZB 4WXRA 1A8HA 4NAHA 1JTVA 2CLOB 2DTEA 3R7LA 2R5FA 3DMTC 5CDTA 2IPMA 3HYSA 2XNHA 2N75A 4ZOBA 5D7NA 4F11A 1MO4A 1HV8A 4EFMA 1L7AA 4JYCA 4CUJA 1W75A 1YWGO 1QHSA 3LFUA 4QQ8A 4B1FA 2QUIA 4EOGA 4O4LF 5A9SA 2RBEA 1KGSA 3GJ8A 5K51A 3NTOA 2RD2A 4AF8A 3OBIA 3H2BA 5JXIA 3R7FA 1UMCB 4UJ5A 3WHKA 3ZXXA 1KEZA 4HYQA 3EIOA 2JFNA 2X2OA 3FYUA 1BKDR 3I32A 1PGQA 4LXGA 5FA6A 5BOSA 2O2IA 1UANA 1XTRA 2WSBA 4YJDA 2VDNB 4GE0A 4HYEA 2ZJ5A 4NTZA 3D1VA 1XROA 4RDXA