1ZIYA

Crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
232
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 80
structure length 232
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ziyA00
1CV2A 2CMFA 4KEAA 1KU0A 2WG1A 3WK4A 5AI4A 2VATA 3WI7A 2WSLA 4UBJA 4L0CA 5JAUA 4AO6A 2PL5A 1XZDA 4UHDA 1QO9A 2J4CA 1R9MA 2WUFA 1TKRA 1YB7A 3SX4A 3WJ1A 3R0VA 5F4ZA 3E1GA 4PO3X 4HXFB 5EIHA 2OG1A 5DNUA 4K6GA 4W63A 3N0TA 2EDCA 4TPKA 2WJ6A 1GPNA 4AXBA 4UBOA 3DL7A 1UFOA 3AIKA 3O0DA 5ALNA 3ESAA 2JEYA 3FYTA 4V2IA 1XQYA 2C5GA 2WTMA 1HKHA 3KXPA 4UFOA 4XVCA 1CUVA 1KU6A 3I1YA 2XUJA 4JUIA 5IVHA 5AM5A 2HU8A 3FSGD 4PSUA 4DSAA 1H2ZA 3D0KA 2PUHA 4CCYA 1CUIA 4H7DA 5AM0A 4XX1A 1XROA 5HKBA 1QE3A 3PF9A 3V1LA 1VJ5A 1QIKA 1X2EA 1CUXA 4EA6A 3W06A 4BP8A 1BN7A 4U2EA 3STUA 5E4JA 4UHFA 4XIIA 3H2KA 3IVMA 4PF1A 3SC2A 3IUMA 2IIVA 3GBSA 4Q3OA 5FPQA 1U8EA 2AJLI 1YAJA 5CT5A 4X95A 1XRQA 2Y2UA 3BL8A 2JGKA 5AKIA 2HL6A 4N5HX 1UT6A 1Y7IA 5AOAA 2HHAA 1T4MA 4O08A 1FFAA 5EHQA 5HF6A 4OYYA 3FCYA 3WQHA 3C70A 4X90A 4FLFA 4DNOA 1NX9A 2BCEA 1QGED 1H2XA 4J0HA 5ALFA 1P0QA 1J1IA 5AKXA 2HADA 1M33A 4J0DA 1XZJA 1CR6A 3QPDA 4BCCA 3KWJA 5A6VA 1QZ3A 3EQ8A 3KWFA 5SYNA 2DR0A 3H0CA 1LZKA 2H7XA 3WK5A 5D3ZA 5CH8A 4KE9A 5AKLA 4ZGBA 3L1JA 2VEOA 3WK7A 3C5WP 3WLAA 5A7FA 4S0XA 4J0CA 3V48A 2WG0A 4I3FA 2HU7A 5LYYA 2V96A 4BVJA 3ILSA 5AOCA 4GEGA 1DQYA 1P0PA 1QIJA 4KYVA 4N8DA 5CH5A 4AZ3A 3IUQA 5EGNA 2IX9A 4DSZA 2OAEA 3GELA 1PJAA 2YYSA 1UXOA 4Y2XA 3O4GA 4EY4A 3WKCA 4DMCA 3AIMA 4X00A 4PV7A 4Q82A 5LLSA 3NWOA 2XLBA 4TGLA 2QM0A 2WU3A 1CPYA 4MYSA 5LZ2A 4YK7A 3OOSA 1UK6A 3FVTA 2OQIA 1ZD3A 5ESRA 3UUEA 3O4JA 1Y7HA 4BAZA 1QIDA 2OGSA 3G0BA 3FWHA 1W75A 4H18A 1FFCA 5ALLA 3Q8WA 2JGEA 4UPDA 4BBZA 1SCIA 3AJAA 2PVSA 4FWBA 1EDEA 1XZEA 3U0VA 3HEAA 3G7NA 1XRPA 3STXA 5JIBA 1R1DA 2BGNA 1THTA 1DINA 2WG2A 3O4IA 5ALUA 1XZHA 2V9ZA 4BRSA 3R3YA 3TEJA 1GGVA 4DLNA 4PW0A 4X3CA 1VZ3A 4J3JA 1SOMA 1P0IA 3CCBA 2GZSA 1XZFA 1VA4A 5CT9A 4UHHA 2B61A 3PFCA 2QJRA 2GYWA 4H35A 3DEAA 5JASA 4X91A 2WHPA 1T2NA 3ZLUA 3WL5A 4EZIA 2HRRA 3R40A 5JYCA 1X70A 4E46A 5BV7A 3C8DA 3WYNA 1UOPA 3VJMA 5AKZA 5FOQA 5ALVA 1FFBA 3D3NA 2QJWA 2XUOA 2JGFA 3G0IA 4DNPA 3TJMA 1CUSA 4E14A 2XB6A 1JMYA 1ISPA 4QLAA 1F6WA 4H7FA 1THGA 1GPKA 2DFPA 4GBGA 3ZLVA 4IH9A 1WOMA 4DTCA 2QXUA 5C81A 3WWDA 5T4BA 4Y2JA 3L1IA 2WUGA 3F67A 4WDRA 3C6XA 2XUAA 2JGIA 3FYUA 2HFKA 2PKYX 5AK5A 4IH4A 1DX6A 3K2IA 3UMJA 4B83A 5AHXA 1LNSA 4KACA 4OB8A 2W6CX 1XLWA 3A6ZA 2QMQA 3HYSA 3JYHA 1MU0A 1BE0A 2QKYA 3G9TA 3EF3A 3F96A 4LXHA 4FLEA 5CW2A 3ANTA 4PNZA 3H2JA 4RE6A 4P9NA 3HLKA 3U1TA 1SC9A 2J3QA 2QTBA 1N5RA 4Q34A 5ALKA 3HRHA 5ALMA 5AKKA 3D5EA 2GBGA 1TCAA 3V1NA 3BF7A 2QOEA 1YAHA 3YASA 4Q3KA 2PUJA 2AJCA 4NMWA 2OCGA 1NU6A 1EB9A 2XMCA 1VXRA 5FPPA 4H77A 1YSCA 2YXPX 4Q1VA 4EB0A 3WWCA 4WFKA 3QITA 1E3QA 1RYYA 4UBKA 4GXNA 1CUBA 2WLSA 1QLWA 4BCDA 1GKKA 2EDAA 4EY7A 4J0IA 2Z8XA 2WFLB 3QZUA 5C7YA 3LIIA 3VKFA 1IMJA 5JATA 4RPCA 5LZ9A 4Y2VA 1LGYA 4WFJA 2FJ0A 2VTVA 2ZJ6A 5EHXA 1DWOA 2Y6VA 1QIEA 4A16A 5T4HA 4P92A 1TQHA 3PF8A 3RM3A 4FMPA 5AKYA 3R41A 1JJIA 3ESBA 1ZIYA 1B6GA 4UHCA 3AILA 1DT3A 3I28A 3M3DA 3A2NA 4BB0A 2XQIA 5T4FA 2C4HA 1DWQA 2VQ6A 4E15A 1QTIA 3DCNA 3QH4A 2XMBA 2YASA 3T4UA 1LPMA 1CUEA 1DT5A 4BAGA 4BC1A 1F0NA 5K5EA 3E3AA 3HXKA 4AX4A 4HXEB 2H7YA 1HLGA 1ZI9A 2X8BA 3SK0A 5IH7A 4B0PA 3MUOA 1LPSA 2CB9A 4W1SA 1MT3A 2DHDA 3IBTA 4UBLA 4X97A 5C8XA 1HL7A 4X85A 1PFQA 4AO7A 2AXEA 2WM2A 4U2BA 3D4LA 3PDCA 5ALIA 1J2EA 2CEKA 1SCQA 4OD0A 4ETWA 3G02A 2OAGA 1O6GA 4H7IA 5FUMA 4ZV7A 3VXKA 5CTAA 1XLUA 2O2GA 5DJ5A 1J07A 1F8UA 2HFJA 2GZRA 3H1BA 1EINA 4F21A 1EHYA 4FBLA 2JBWA 4X6UA 5AO9A 2XT0A 4NVRA 1HPLA 3WK6A 1R4ZA 2HA7A 3IUNA 5AM1A 2EEPA 1L7RA 3STVA 5EI5A 4IH1A 2B4KA 2C0PA 1XQXA 2GBIA 2WUDA 4AO8A 2ZSHA 4EY6A 3C43A 1EDDA 3C8HA 5CXXA 3WWPA 3CCCA 4KRYA 4BC0A 1WPXA 1UK9A 4J03A 3H19A 3R3VA 4BE9A 1XLVA 3MUNA 1CQWA 3BWXA 4KJXA 4G9GA 2WTNA 3R3UA 1G42A 3HSSA 5ALQA 2WQZA 3G0DA 1ACLA 3I2GA 2OGTA 1EVQA 1QIGA 3DYIA 1UOOA 2WFMA 4AQDA 3ZLTA 5AP9A 4B7ZA 5AKHA 1ZOIA 1W76A 4FFVA 4U2DA 1LPNA 4CG2A 2OCKA 1HBJA 3RLIA 3A70A 4G5XA 1VZ2A 4U2FA 4CCYB 4BDSA 5HZGA 1MPXA 1HDEA 3WA6A 2B9VA 4U2GA 4ZREA 4UBNA 3S8YA 3WWOA 3D2BA 2D0DA 3F98A 5CH3A 2XLCA 4K6HA 4EY5A 3EBLA 1KEZA 3O9MA 5AI8A 1VOTA 3WWEA 2HM7A 3VDXA 2BUCA 3O9VA 4MYDA 4QDOA 5I9IA 4FKBA 7YASA 3FLEA 1MNQA 4L3WA 3OTQA 1QTRA 5JZ9A 2DSNA 4CG1A 1BN6A 1CVLA 2VAVA 2C7BA 3NUZA 1MTZA 3ICVA 3X3HA 2QRUA 4ZI5A 5CURA 1OXMA 2V97A 4OU4A 3TGLA 3W2TA 1BS9A 2VJAA 4QWMA 5K3EA 1YCDA 4Y9SA 5CRIA 2JGMA 5AOBA 5E4YA 3PI6A 1RP1A 3FOBA 1UKCA 4QDZA 5K3FA 5EHZA 4UBMA 2D5LA 5FRDA 3PICA 5I8PA 3HC7A 5CXUA 3I6YA 1UKBA 4BE4A 1XZAA 2WHRA 4CI9A 4CG3A 4WY5A 1WB5A 1IVYA 5K3BA 2HA2A 3WL6A 4I19A 1RWQA 4Y2QA 1JJBA 1YR2A 2WIGA 1XKTA 3WKEA 2ZSIA 5KREA 1AC5A 3PE6A 1C7JA 1QIFA 1CRLA 1K4YA 3LCRA 1BEEA 2OCLA 2DQYA 2VAXA 1WCYA 3WKAA 4BVLA 4RGYA 2WKWA 4F5ZA 4KAFA 1XZCA 2XUFA 3R3XA 1DTEA 5AM3A 1VE7A 4HZGA 3I2JA 1LPPA 2WUEA 5HF5A 2XE4A 5IVKA 1EVEA 4MQLA 4K5QA 3ZI7A 3FLAA 1H23A 1X2BA 2Y2VA 1XZMA 1XRNA 4FNMA 4G8DA 1WB6A 1XZKA 4B80A 2Y1KA 3LLCA 1CFJA 4BZWA 4KE6A 4B0OA 2HA6A 4I4CA 1NU8A 4FNGA 5HFNA 1A88A 1FFEA 5AM4A 4MWTA 2PM8A 1BCSA 5LP1A 1C4XA 3F8SA 3KD2A 3PFBA 4H7HA 4HXGA 1DWPA 2DQZA 3IDAA 4BDTA 1J06A 4G9EA 5CT6A 1Q0RA 3DS8A 4OYLA 1S8OA 3STTA 4UFNA 5KWIA 1TCCA 3DL4A 3D2AA 5LZ7A 1Z68A 1N1MA 1ODCA 4QDUA 1N5MA 2B20A 2PSFA 1UOQA 3H17A 2WHPB 5E4TA 3ED1A 4BYMA 3OG9A 4Y7DA 3AFIA 1CUYA 1AX9A 3W04A 2O2HA 3KOOA 3D2CA 2XUDA 3H2GA 4FDMA 5IVIA 3FAKA 2O2IA 4BVKA 1AUOA 2I3ZA 4MEAA 4BAUA 4M0FA 3IULA 1XFDA 1YA8A 3I1IA 4DMFA 2J4FA 4NS4A 3FCXA 3JW8A 4MXDA 2UZ0A 5FLKA 1TAHA 1MX1A 4DYHA 2VJCA 5JAPA 4QDTA 5KBYA 2CZQA 1GT6A 1CEXA 1R9NA 2WU4A 3A2MA 3LIPA 4BRZA 4WY8A 5AI6A 1EK2A 4JEIA 4A5SA 4LKOA 1MX9A 1LPAB 5JD4A 5HQ3A 5CT8A 4RE5A 4QDXA 4BATA 3NGMA 3FYUB 2RGUA 1TK3A 1A8UA 1CQZA 4YPVA 1B41A 1H2WA 3V1KA 5DYWA 3QBJA 3EIOA 5LZ4A 1LPBB 5D3KA 4N5IX 5JAHA 3VVLA 2AJDA 4PQEA 3WK9A 3KDAA 3G8YA 1QFMA 1ZD5A 4IO0A 1ZJ4A 2WJ3A 3FBWA 1SCKA 4C88A 1USWA 2JGJA 1XRRA 3K9BA 5DTJA 4B9AA 3WZMA 2X76A 2AJ8A 4H7EA 6YASA 3M81A 3QMVA 4N8EA 4F0JA 1C7IA 5A71A 1IUPA 2K2QB 3GROA 5BWBA 3ANSA 1WHTA 1L7AA 1ZIXA 2PSHA 2ZJFA 3C5VA 2C5FA 4W9RA 1TIBA 2PBLA 3WL7A 3WL8A 1UKAA 1EX9A 1YS1X 1CUHA 1JI3A 2BKLA 2VA9A 1AGYA 1P0MA 4QE3A 3FYUC 1ZICA 1MN6A 5ALTA 2WJ4A 1E66A 3I2HA 5JANA 5AI0A 3WJ2A 2PU5A 3EQ7A 1K6EA 4BCBA 2WIJA 4J0JA 4CFSA 2VSQA 4UFPA 2O7RA 2WHQA 4X7BA 4HS9A 3STWA 3QPAA 4A23A 1MNAA 5ALXA 5AIBA 2ZYRA 2G4LA 2RONA 3OM8A 4Y2TA 4KR0A 3B3QA 2WILA 3ZWQA 3JWEA 4YX9A 5FV4A 3MGAA 2I3DA 2XUHA 2WIDA 3WKBA 1JU3A 4JNCA 2Z3WA 1MX5A 3GFFA 2XQGA 1LBTA 5ALWA 1FJ2A 4Z49A 4BP9A 3BF8A 2XI4A 4CCWA 4GWLA 2G5TA 1CUFA 2WIKA 2ES4A 5DNVA 2Q0XA 3M82A 5LKRA 4ZXFA 1OILA 2YH2A 3GZJA 4XJVA 5JAOA 4KRXA 3IIIA 2X5XA 3W9BA 2CKMA 3G0CA 4ARAA 2PSJA 2ZYHA 5JARA 2RI6A 3DDUA 3WKDA 3H1AA 3DLTA 4UBIA 4AN1A 1EA5A 1E8NA 5AK3A 2G5PA 1A8QA 4H7JA 3V1MA 1VA5A 1F0PA 2H9YA 3HACA 3W9UA 3BDIA 5HK9A 1G66A 3ZV7A 2O7VA 2XMDA 2DHEA 2R8BA 2RAUA 2QUAA 3H04A 1XRLA 2Z5GA 1PV1A 3AUKA 4KE7A 3TRDA 5K3CA 4KAAA 1IZ8A 1JJFA 4G1FA 3K6KA 1YS2X 4P08A 3A2LA 4K2AA 3BXPA 1VKHA 4BTVA 5HF9A 5CMLA 3AZQA 3FVRA 4OU5A 5K3AA 3FSGA 4N8SA 5JADA 1Q84A 3OC0A 5FKJA 3AINA 2JGLA 5ALDA 5IKXA 3R3ZA 5AK6A 2VJBA 3B12A 2QXTA 1A7UA 2QZPA 3STYA 2WFZA 1ZJ5A 1L7QA 1ORWA 1XRMA 3B5EA 3OPMA 1FSSA 5A2GA 1CUAA 3AIOA 2OGZA 3H18A 1GQRA 4DM7A 4TVKA 1CUDA 2GYUA 1WHSA 1ZI8A 3IA2A 3WA7A 3DKKA 2I78A 2OPHA 4JH0A 3H2HA 4Y2SA 1WPRA 2H1IA 1JKMA 1IUOA 4K6KA 2I03A 4E11A 5LIPA 3OURA 4G4IA 2VT6A 1UK8A 2AJBA 3C45A 4AZ0A 5JZBA 2ZVDA 3VISA 3BDVA 3G0GA 1LLFA 2HRQA 3ESDA 5LZ8A 2CJPA 4QA9A 4J0GA 3D7RA 4HRXA 4B9EA 1ZGBA 1JT2A 3DOIA 4H7KA 4DNQA 5BWCA 5D6OA 4B82A 1EK1A 5AKJA 5E2IA 4C4YA 5A62A 5HFAA 4CIAA 2HA5A 4UUQA 2XUGA 5T4EA 3SWWA 1CUWA 3T52A 3UUFA 1E5TA 3MVEA 1O6FA 3C87A 5ALZA 1BRTA 3QM1A 2GYVA 3WMRA 2VT7A 3F9CA 4X94A 5K3FB 2JIDA 2ACEA 1QJ4A 1AKNA 3R3WA 1YA4A 1Y37A 3QMMA 5IVDA 3GUUA 3L1HA 1G5FA 5AKGA 3Q0TA 1R3DA 3AZOA 1W52X 1ZD4A 4IQ4A 4D9JA 4C89A 1OCEA 3I2KA 3VJKA 2XMQA 1QFSA 4IHAA 4L9AA 2E3JA 5ALGA 3IB3A 5ALRA 1BCRA 2OLEA 1U4NA 1I6WA 4DMHA 4U2CA 1ACJA 1UWCA 1XQVA 2ZYIA 5DYTA 2XUIA 4CIBA 2C58A 2HA3A 4Q05A 1Q83A 3IURA 1D07A 4Y2YA 3CN7A 2GBFA 4LXIA 3I2IA 1QIMA 4DIUA 2DHCA 4F60A 5FDFA 4XWGA 4P93A 2V98A 5JZSA 4FBMA 1G4HA 1IZ7A 1JFRA 3WIBA 4GHWA 4BTLA 1XKLA 1JMKC 3WYDA 1DU4A 2HU5A 3AZPA 5ALOA 1WB4A 5JD5A 4GECA 5JALA 3O4HA 1ZGCA 4DGQA 1BEZA 5HKAA 1MJ5A 1CIJA 3F97A 3VVMA 2XUKA 5HK8A 1ETHA 1MAAA 4AMYA 4LYEA 3WZLA 1A8SA 5EHNA 5I7UA 4QWWA 2PSEA 4PSCA 4HVTA 2QS9A 3HI4A 2ORYA 5AICA 5CT4A 2RHTA 2RIPA 4LYDA 4M0MA 1EXWA 5D7BA 3W05A 1ORVA 4B84A 1EI9A 3G9UA 3D59A 4DNFA 3BJMA 1AZWA 2BUAA 5AH0A 2XUPA 4OCZA 4G4JA 3DD5A 5A7HA 5AJHA 5DWDA 1AQLA 4ROTA 1WM1A 5C8ZA 1GQSA 2XUQA 4OSEA 2BFNA 5ALEA 1CUGA 3BIXA 2C0QA 4X71A 3G9XA 2XMZA 3QPCA 2HDWA 3ZPXA 3H2IA 2HA0A 3FNBA 5EIEA 4WCVA 5AIAA 1FFDA 5HQ3B 2IITA 4MEBA 3WK8A 3LS2A 5ALPA 1H22A 3QYJA 4ZWNA 4JYPA 1AURA 2QR5A 3RARA 3WIOA 4QNNA 5EFZA 3DYVA 5AM2A 4HRYA 4ARBA 5AK4A 4G4GA 4EHBA 4JYMA 1R88A 3M83A 1XQWA 5EIAA 3LP5A 3PUHA 4KE8A 2CBGA 4QZVA 4X93A 4FFWA 4GLBA 3DNMA 2ECFA 1QOZA 1R50A 1BROA 4FHZA 3V9AA 3CXUA 3DOHA 1QO7A 2JEZA 1QIHA 2BJHA 1K8QA 1ZD2P 3DQZA 4QLOA 2LIPA 3EQ9A 4M0EA 5A7GA 5FP0A 2XQJA 1EH5A 1U65A 4C01A 1QIIA 3BIWA 1UZAA 4FTWA 2QT9A 3CN9A 2ZJ7A 2XMRA 1GKLA 5KWJA 1GPLA 2XDWA 1K5PA 2RHWA 4MJ3A 4OB7A 1CUUA 3E0XA 2G63A 5YASA 4MWSA 3RKSA 3G9ZA 2ZYSA 1YASA 4Y2RA 4OPMA 1XZIA 1LBSA 3IUJA 5CBKA 1E8DA 1GZ7A 4HAIA 3HJUA 4GI1A 2WIFA 4HTAA 4BZZA 3ESCA 1EB8A 1TCBA 1XZGA 5AKEA 2R11A 1U2EA 3RK4A 3C6ZA 4L72A 4AB1A 4X92A 4X6YA 4W1PA 2OXEA 3S2ZA 3O95A 3FLBA 2QVBA 1GXSA 3N2ZB 4INZA 1E89A 4WFIA 3GA7A 1MO2A 4DMKA 1HQDA 4B81A 5ALJA 1CUZA 4C87A 2XMGA 1XZBA 1BU8A 1SFRA 4KAJA 4QEKA 4H0CA 1VXOA 4AMZA 4FOLA 4AN0A 1W1IA 1H2YA 5H3HA 1LZLA 3HABA 4B6GA 1ODSA 5LZ5A 5HF8A 4G8BA 5DYYA 2ONCA 4OB6A 4WJLA 1DQZA 1VE6A 2H7CA 1LPOA 1N8SA 3C6BA 5JD6A 2JF0A 3QMWA 1TRHA 3KSRA 3DKRA 1W6RA 2ACKA 5LKAA 1XZLA 3C6YA 1JU4A 4W1RA 3I2FA 4LXGA 4LIPD 4NZZA 5C8VA 5ALYA 4UHEA 1MAHA 3PUIA 5DNWA 3I6MA 2BUBA 2XMSA 5BOVA 3QVMA 2OQVA 2PSDA 2DCMA 4Q3LA 2VJDA 4G8CA 4Y2UA 5AI9A 4OUKX 3BE8A 5J3JA 3BJRA 2WFLA 4GW3A 2GBCA 3DJYA 1ODTC 3ICWA 4MQMA 1VLQA 2XQFA 3VJLA 2HA4A 4ZRDA 2ROQA 4C4XA 1UK7A 3E4DA 2Y6UA 2W22A 4GDMA 4X6XA 4ITVA 5DTIA 1W4LA 1YB6A 5FXMA 2PU7A 2PX6A 1IUNA 1Q0ZA 4C4ZA 1E8MA 4UHBA 1K63A 3NOXA 2BGRA 5SYMA 4EY8A 5K3DA 2Z8ZA 3HZOA 5HCUA 4C6HA 1QONA 2OCIA 2QUBA 4W1QA 1CUCA 2VF2A 4LHEA 4RNCA 2FUKA 3P2MA 1CUJA 5AI5A 5ISMA 4B85A 2HIHA 5ALHA 2FX5A 5DLPA 1ZI6A 4YASA 2J3DA 5ALSA 4J7AA 4EUSA 1EDBA 2BAGA 4J0KA 3I6ZA 4EBBA 4ZV9A 1CLEA 1DX4A 4Y2PA 1AMNA 2FJPA 2XQKA 4PSDA 4WDQA 2P8SA 4FLMA 2NW6A 2Z3ZA 2CUTA 2PPLA
chains in the Genus database with same CATH superfamily
1FNSA 2G9UA 1BJTA 2OHFA 1EVLA 1KU0A 1NURA 2L69A 3OZFA 4JBWA 4DZRA 5H02A 2VATA 3WFJA 1WPGA 1P8JA 4MRVA 4RD0A 4Q9LA 1E4YA 2ALJA 2I34A 3QE0A 3USES 2W83A 1KEUA 2FZVA 3QY0A 3LBFA 5F21A 4BECA 1F0KA 5HR5A 4MVJE 2FI1A 5NLLA 1HE4A 1C9MA 4LNUB 3EK2A 4AKEA 4CG0A 2OFFA 1G38A 1QVAA 3MHPA 4IUCS 2PL5A 1KYQA 1XZDA 1U1DA 4NV0A 3WS7A 4FHGA 2BFDA 1L5HB 3B1ZA 2G5CA 3IKLA 1J99A 3CUVA 3OCYA 4XDGA 2Y1WA 4JA2A 1BX0A 4MVXA 5CDFA 3RFTA 3L9XA 1ECPA 1TVKA 5CFZA 2DU8A 4JIGA 5LUAA 4ZOCA 3V4ZA 4YUYA 2WKRA 5F4ZA 2X4GA 3L5OA 4G09A 4R68A 1UFQA 2PZ8A 3TX6A 2OORA 4K6GA 1XJQA 4TV8B 3TNFA 1L7DA 2CXRA 2EDCA 1LVUA 2ST1A 1VKZA 4JLNA 1GPNA 1F9EA 3K1JA 3HJNA 5TQ2B 2UVDA 1OA0A 4UBOA 5EJ6A 4DIFA 3CVYA 5AW6A 3GCXA 3L8EA 4K3VA 4MI3A 4WZAE 3ITKA 3MWGA 1K88A 5DCYA 5ALNA 1M6VB 1BQEA 1LQ2A 1FSZA 1GEGA 1JR2A 4LJ6A 3WMEA 4DCTA 1YKGA 4LRWA 2J33A 1EE9A 3ONNA 4LDRA 3PQEA 4JP8A 4L7VA 3KXPA 4B8ZA 4MI1A 3UKDA 2ZCVA 5DHSA 4KN5A 3OJOA 2BGLA 2F3PA 2H00A 3EMDA 2EFGA 3O21A 4KLRA 1C0KA 3IEKA 3M9LA 1TOAA 1A9YA 5LMCA 4XVCA 1R4AA 4NJEB 4YRQA 2LRHA 4N12A 1KU6A 2ORVA 3PE4A 2ZUTA 5CA0B 1CJSA 2TSYB 4MR7A 3EJ6A 4P5PA 1JWLA 2H4ZA 2VP2A 3CBQA 4JUIA 2GPTA 3T5AA 4IKEA 3SQOA 4GMFA 3LX8A 5AM5A 2HU8A 1M76A 3MPOA 4B40A 3ND8A 1DMRA 4ALMA 3KCQA 4DSAA 4O2BF 4BMOB 3CMMA 4J4TA 4I4TB 4LXYA 2PUHA 3EPLA 1CUIA 5ADVA 3M6FA 1BCRB 3GGJA 4WBNA 2AI2A 4V1CI 1DCTA 1ANKA 1QB8A 3DNFA 1XROA 2PKCA 3BZWA 4GP9A 3ZHXA 2ZJ4A 1T3HA 4BEVA 5IKEA 1Q17A 1P2UA 2ET6A 2FPMA 5EIOA 1IPHA 2GHTA 3NAZA 2GPWA 4U2KA 3PF9A 2I33A 1VJ5A 1QIKA 3W5VA 4Q02A 1CDOA 3U3ZA 2HF7A 4IZOA 2JARA 3SKYA 5I48A 1JR3D 5FOTA 3LT0A 4FBGA 5MN6A 4R6XA 2RKBA 4KPFC 4KXWA 5EJGA 1X0XA 1S5PA 2HV8A 4W5QA 3ZS9A 4C0KA 3DE0X 2VK1A 1QFXA 3SC2A 3L6UA 2OO5A 4QD3A 1EZ1A 3LBIA 3RG8A 1U8EA 4BB6A 3CVUA 1XRQA 1VMDA 1YHNA 1YQDA 3D7MA 1UCFA 3DBRB 5FBVB 3QXSA 2PFKA 3JWGA 3FGNA 3MCTA 1GG9A 2ZBGA 3P97A 3QLTA 4A7PA 2HL6A 4N5HX 2GD2A 2WINI 4YI3A 3IR6A 1PK8A 2R85A 4WPGA 3TRHA 4EHKA 4EG5A 5KQLA 3N6XA 4KIFA 1GG5A 1I6MA 1JFFB 1YJ5A 1WMSA 2AR7A 4NOLA 4DNXA 4Z5XA 2V7PA 4O08A 1P29A 4HEHA 3SOZA 3LZCA 1G6HA 1ORIA 5KUTA 4YROA 1GAJA 4XOUA 4QDJA 2G1UA 3WWZA 3CS3A 4RFSA 5EHQA 1TJ4A 4ZDWA 2PS0A 3I12A 2GJAA 3SS7X 3BWBA 2IS2A 1JJ7A 4PFJA 2X2FA 4WK2B 4R84A 2BGWA 1OD6A 1FDWA 1J2UA 5GV8A 3AI2A 1LB1B 2HMVA 3BXOA 3E81A 3L0CA 4QUHA 1Q7RA 3FRIA 5T6MA 3K0SA 1VC2A 5KOYA 3S0JA 4FLFA 3EFOA 5K45A 1NX9A 5JNUA 3MFYA 1IQRA 3RWBA 2OHXA 1P3DA 3RB8A 2VUTA 2I54A 2IZ0A 3FUVA 4N03A 3A6GA 1DKQA 1JDZA 3PDUA 4HQLA 4KHZA 3EOZA 4A0SA 4J0HA 5ALFA 2GF2A 1W9HA 3MRSA 2I4OA 1RBYA 3DPIA 1P0QA 2FEOA 3FCAA 1AZTA 1MXFA 4IDFA 2AUMA 1J1IA 3VKUA 4B6RA 3AEUA 3RS7A 2ABWA 1VPLA 1Z38A 2PSSA 1M33A 4GMGA 2X9VA 4EF6A 1BG6A 2R7LA 1J4AA 1XA0A 4BMYA 1CR6A 4BGIA 3QPDA 1R9JA 4COKA 3TEMA 1ZK2A 2GN9A 1XEAA 2G9QA 1I7QB 1QZ3A 5J63A 5LN1A 2J0QA 1TMYA 2OOKA 2WWXA 2DUUA 4QXAA 1V8OA 3H0CA 4KUEA 3WXMA 2AXPA 1NQUA 1LZKA 4E07A 5JBNA 1Y6GA 3SNKA 2RI1A 2W42A 2P6MA 5D3ZA 2ZEJA 1P5ZB 1ZX1A 4LYYA 2PGAA 1W0JD 5AKLA 4UU7A 1UBUS 3R9XB 3L1JA 2VEOA 2PMDA 3IMEA 4GE3A 4QBFA 1GPUA 3WK7A 5F64A 4ZK6A 4CM9D 3TI7A 1YONA 3WRWA 4MW9A 1C8BA 2HU7A 4MULA 2DZDA 2EQ5A 3C3PA 4BNDA 5K8UA 4FE3A 1UBSB 4ZZ3A 1ZGHA 4EYKA 4KYVA 4MH0R 4RNDB 1O9GA 1ZZGA 1N25A 3IUQA 1SEPA 4LY3A 4NFHA 4AZ3A 4DC0A 1AF7A 1L8OA 1QBKC 3COYA 2P3SA 3H87A 3QPVA 1B43A 3GELA 4DV6B 3G59A 4FNAA 1ADGA 1PJAA 1RWNA 1U8TA 2NTYC 3G5LA 3QIVA 2P90A 3LP8A 1Y5MA 4NABA 4CM7A 4Y2XA 2CLCX 3EEBA 3ILVA 1XPUA 4IFBA 3ZKAA 4I46A 3VPXA 3WKCA 1TU3A 3QNMA 3AIMA 1J2TA 2BGKA 3FF1A 3PC8A 2NZYA 2GLUA 1P7VA 3F6PA 4UC0A 2GTPA 5EPEA 2XLBA 1QGAA 2QM0A 5E9JA 3BFVA 1C1DB 2P6NA 2CJFA 3G8AA 5EJAA 4MYSA 1NE2A 2CD7A 5ILOA 4IY1A 5TB5A 2YVKA 4YK7A 4A8HA 4NU8X 4DA9A 4DJAA 1X3LA 4E4TA 1O9BA 3T99A 5BVHA 1FSPA 1DRUA 3EUFA 4WOJA 1J7KA 2QPLA 2V6JA 3UUEA 1ZBQA 3UAVA 3GLUA 1QIDA 4NL4H 3QWAA 1UAGA 2RHLA 3HA5A 3NV7A 1RU3A 4B6PA 5EJ5A 2RE8A 5JYBA 2DPHA 4MPTA 3BEOA 2G40A 1SIBE 1VLHA 3QWBA 4LY0A 1FFCA 4BQSA 1F3OA 2PT7A 3Q8WA 2JGEA 2PZGA 2A5FA 3I5XA 1DEAA 4BBZA 2RHMA 2PVSA 2YBDA 5B7QA 3I6QA 1CDDA 1P9LA 3LL4A 1NVAA 1D04A 3I3OA 2Z2IA 2YXDA 3FUXA 3U0VA 2W6JD 3HEAA 4R9RA 2IP2A 3W6PA 1O5IA 1XTIA 1GUYA 5JEEA 1AKTA 2QTTA 1RPZA 4LBWA 2JLCA 1EJ6A 2C3OA 2A86A 3I45A 2V6FA 3LXUX 2AWNA 1HEYA 2GRUA 5TPZD 3B1VA 3T9BA 4B7AA 2ZULA 5M5BA 4YDRA 2ZJOA 3U4DA 3L4JA 1R1DA 2I8AA 2JLVA 1A98A 1KAMA 2CNOA 2V45A 3L7KA 4BWFB 3GB9A 3DJFA 4M1KA 4BE7B 4B33A 1YD7A 3OLVA 5ALUA 3CVXA 1EBBA 4MLPA 4O33A 2FF7A 5IT9A 1Y48E 3QUQA 2QPOA 3MCVA 2ZS9A 1Q0LA 4XDHA 4Q9KA 3U7JA 1W0CA 2CL0X 4KXXA 1EU1A 3EIHA 2FUCA 1T3TA 2PRKA 4G1CA 1NXVA 4MZXA 4YRLA 3Q3HA 4AMVA 3V8QA 1CNEA 1XXHB 4NCJA 3DHWC 1DKNA 1GGVA 2RJ3A 2IH4A 1E2DA 3N86A 1V3TA 1BVHA 3HEMA 2FGJA 3EA4A 1HNZB 4OP2A 4RD4A 4FK8A 4WHMA 3TQCA 2GZSA 3S28A 1BA2A 3GPIA 3NYRA 2WY2D 1A0OA 1IOZA 3HN6A 1GTG1 5E38A 3TSZA 4CEJB 1J5PA 3A25A 4RHUA 1JEDA 3CJTA 4NHEA 1GVHA 1VA4A 3IQDB 3GI1A 1B6SA 1I4DD 1NVGA 3WGKA 3WFZA 1WCIA 2QJRA 4M2LA 2GUGA 3A27A 2GYWA 2N1MA 3DFIA 4H35A 1OAKA 2P2CA 4PQFA 2G9NA 3PLNA 1ZN7A 4NDAA 2M6KA 5ECWA 4MJXA 1T2NA 4KQJA 4D9KA 5KNCD 3GEGA 3MTBA 3R40A 2Q29A 3D4PA 5JYCA 1CKEA 4UE3S 4ZDIA 3L79A 1CZOA 2JFNA 4G0YA 2FWIA 1H8HA 5DI3A 1UOPA 2C9ZA 3QLJA 4NBTA 4UOEA 3ZDAA 2Y67A 3DWIA 2MT9A 4Q47A 5AKZA 2XHZA 3KB6A 3MJ4A 5DM60 3TZQA 5ALVA 1FFBA 4O2AF 1MEOA 1DBSA 3D3NA 3U3OA 4V3BA 3WNDA 1UXIA 1TW2A 5FWDA 1IYZA 4ZQEA 2JJ8A 3KR0A 4TXNA 3AUSA 4E2YA 3C3DA 1KY4A 1PS9A 1SK9A 1UBRS 2AN3A 1R74A 1A5SB 3AY0A 3DMRA 3FOWA 3HCPA 2YINC 2E5FA 1HRDA 4UCXA 3TJMA 1DB3A 3HRIA 4PHFA 1RXIA 1HLDA 1P91A 1S4MA 1R3UA 1YTLA 2BI4A 3B60A 1GU7A 1XJ0A 2FH5B 4QNRA 5LWQA 1GV0A 4FVTA 2EL9A 3EZ2A 1Q7CA 3N5KA 3F8WA 2Z5LA 1P1HA 4IXTA 3CKYA 2JLBA 4EO7A 3HJFA 1QMPA 4IH9A 4NBRA 2A0WA 3K9GA 3U3MA 1C8VB 3VMMA 1WOMA 4FGWA 4DTCA 2A94A 1OBVA 4OI2A 4DF3A 1ABBA 3F4BA 5CDGA 3AYXB 4F1WA 4YCLA 1QHNA 4UU8A 4L9RA 1QUFA 2JC3A 4R7ZA 1P1IA 3T5GA 1X7ZA 4CLRB 1AA6A 1SC3A 3GJ3A 3LE8A 1VCMA 3LU1A 1M8KA 2J6BA 4H59A 2IYEA 3NATA 4RL6A 4H3HB 3SYNA 5J2UA 1TO1E 3BG5A 4U63A 1PJ3A 1T4CA 2B4QA 4KCGA 4MR9A 4PG8A 1HR0B 2HFKA 2PKYX 2V58A 5AK5A 1AUXA 2FJUA 2B94A 1NZJA 2PX3A 4H2DA 1UMCB 1XEWY 2QVXX 1QKJA 3K2IA 3RTBA 1G4UR 1OTHA 3GJ0A 3GNTA 3VKVA 1MZVA 2COUA 5AHXA 1FRVA 4KACA 1GL7A 1POXA 2YJZA 3GXOA 1XLWA 3A6ZA 2QMQA 2FMFA 1LH0A 2R60A 2W2QA 3JYHA 1KYVA 4TKLA 4UW9A 3NEAA 5CDFE 3HA2A 4O4IB 5FV7A 1UMKA 3PUYA 3GBPA 2QTGA 2CJWB 3ULKA 4YLEA 2DOKA 1MU0A 2G09A 1NKTA 2QP3A 3PPVA 5BV0A 3ZU2A 2AKYA 1RWKA 4E1BA 5JMOA 1KPGA 2Z2JA 1SCBA 4GOKA 2K7ZA 2JJYA 4I1PA 1G7SA 1CQIA 4GL2A 3H2JA 3IELA 3QW4B 1PT9A 3F4KA 4MW4A 5CM9C 2ID4A 2I2WA 1NSTA 1XMVA 2ENWA 1XL1A 2IHVA 3GGGA 5G0UA 1H2FA 5WRFA 4CKWA 1YA6A 1W5FA 3HLKA 4UM9D 1C7RA 4R51A 4X8MA 4EIWA 3WGVA 2ICAA 2GD0A 3U60B 1XWWA 3HBLA 4M8KA 1EK6A 4YRGA 4UEOA 4CUZA 5ALMA 2GBGA 5GMOA 4D3SA 1Z5PA 1P1BA 4CN9A 3HH8A 2OBBA 2UZ4A 2QLBA 5BMVF 1LD3A 4IICA 2NVOA 2WLTA 5FA8A 5C7LO 1GAEO 4P82A 3ESRA 3F6BX 1IONA 1YAHA 3Q2IA 3YASA 4NU0A 2PUJA 3L06A 3A05A 2IZZA 3LH5A 2YMLA 4LF4B 1UMDA 1O95C 2QRPA 4NMWA 1EFPB 3EAGA 1N57A 2BFEA 1EBFA 1NMZA 1UBNA 2DB3A 1L7VC 4RTJA 2NUTA 5G02A 1NU6A 3AR7A 4OXXA 5D6NA 2QTZA 3NDJA 4LRYA 1VXRA 5FPPA 5LB2A 2E4VA 5FADA 5I7WA 1WKVA 1R8SA 2HB6A 1O8CA 1NYRA 2I7VA 1FOEB 4KU4A 1DRJA 4TX1A 4YP5A 5B58T 3ZHBA 3OC6A 5KQMA 3BA6A 2E7ZA 4B6SA 4H1HA 4L8WB 4QPZA 3PLRA 1M1ZA 1J24A 1OLUB 1T8UA 4CL3A 1RYYA 3ZZNA 4GPEA 1ZH6A 4Q3BA 2EZ8A 3VNUA 1KC3A 1ZD8A 2WLSA 2YOHA 5E9QA 1JR4A 1XRSB 3LNTA 1W5SA 4ZODA 5K2MA 3WOVA 4CLOA 1B23P 4BCDA 1EXNA 4L5IA 5AXAA 1NWCA 4H7FA 4JQCA 3TR6A 3TF5A 4OMCA 1X1RA 4R5HA 2GZ2A 5EJ8A 4J0IA 2QAJA 2V7TA 1JXAA 4X9XA 4B2IA 2Z8XA 4OK5A 5KO2A 1N34B 1I2MA 1URPA 2B36A 4ZCSA 1GJRA 5H3LA 3ZXIA 2PUEA 2WFLB 3B5IA 1TK9A 3EVCA 2P1ZA 5AVKA 3DO5A 4CJXA 3IHWA 5C7YA 3LIIA 2ZPUA 3VDRA 3EWSA 4QVIA 5CK5A 1TT7A 1NNSA 2DYKA 4KXUA 5LZ9A 4IIYA 3TM4A 2Q3FA 4NWIA 5IAOA 1IY0A 2FJ0A 3VVBA 3GU3A 1DWOA 3X2FA 5BY2A 4MHSA 1LBIA 2NTJA 1QIEA 1T9AA 2B25A 4P6VF 4DA7A 4QRIA 2CNKA 3PHGA 3ZU3A 3QGMA 4WKBA 5F1KA 3PQDA 4JOSA 3GRKA 4PHCA 4YRIA 3OUUA 3K6RA 3ND9A 1P80A 2JKVA 1NJ8A 1Z2EA 3ES9A 1W7AA 5E1OA 2B3TA 3HYNA 2BGGA 4FMPA 1R0KA 3ESBA 2EOAA 5AQ1A 1R0LA 3CQ9A 2BR5A 1W4CA 1CNMA 3AILA 3IODA 1U7UA 2EYUA 5EQDA 1HDYA 2YDYA 2XOKA 4AJEA 4Q9AA 4J94A 1PQYA 1WW3A 4ISBA 4PO8A 2XQIA 3WGNA 4BB0A 3D0OA 3ZZ1A 3WIUA 4CM3A 5LXTB 2NO5A 4WIAA 1DWQA 4KR9A 3ORQA 3UCXA 4G5SA 3CSUA 4E15A 3IT1A 2DPXA 1I3LA 3TOZA 4B3GA 1P31A 2WUWE 1BKSB 2C3UA 1KVRA 2QZSA 4RY0A 3E3NA 3P52A 1BHO1 3PEFA 4XGRA 4GOOD 4NFLA 5DCUA 4BC1A 4X7PA 1SVNA 1UBEA 1LTHR 4WOBA 3FPCA 3LSYA 3V5NA 4NBVA 1OI3A 3WISA 3D8TA 3P94A 2B99A 1NJFA 2HHCA 4RDHA 3SXUB 4CR6A 5BUQA 3SK0A 5IUJC 5IU6A 4W9MC 3GUVA 4UVEA 4B45A 2AVNA 2FV8A 1G21A 5JSKA 3GPBA 3MB8A 3F1KA 3F47A 3NAQA 2C82A 1X86B 3AOGA 1OZGA 4ENVA 1XNQB 1L0BA 4FFLA 2IYLD 3B20A 4JZKA 2X8AA 3WGHA 1XD2B 4DCSA 1U0BB 3NBMA 5DLDA 2NO6A 4MW7A 2HAEA 1Z07A 1VM6A 4II3A 1KGDA 1XAGA 1BX3A 1PSWA 4NDNE 1PFQA 4Z51A 4Q1FA 5TEWA 4AO7A 3WAJA 1Z2CA 3DXYA 3VNVA 1UKVY 1YB2A 3EVDA 3JQQA 3OICA 4GYKA 1W5BA 1SC6A 2MYPA 3EVNA 1KFCB 3P9CA 3I0NA 4UMEA 5J5VA 4FZRA 5CYOA 1PZFA 2NVUB 4EEKA 1HG0A 2FXVA 2JI6A 3LRTA 1JAYA 3RU3A 1SZDA 2GILA 2D0IA 1C9NA 2BVNA 4WOKA 3FI9A 1T1IA 4JT4A 2VP4A 4H7IA 1NVDA 3TUJC 2W9XA 3V4FA 5J1SB 2AYXA 2D62A 3OQPA 1P7ZA 3UT0A 5FUMA 5H9WA 2X9QA 1T0IA 1JQJC 2GM9A 1CE8B 3K6JA 1PNTA 2NAPA 3DAGA 2V59A 5CLLA 4TKVA 4PZLA 1DJNA 3BA1A 3E27A 5DZSA 5ENVA 3CNLA 1RNLA 1CHNA 5C53B 3VXKA 1E9CA 1TUIA 4XAQA 5DJ5A 4CTOA 1F8UA 2P8JA 2GZRA 3DZ8A 5GOZA 4E2XA 2CSXA 3WB2A 2Q28A 2WV7A 3X2SA 3UPUA 1REQB 1WE2A 1KP9A 3WWYA 4DN6A 3S2UA 4AJ4A 1Z6AA 2C5BA 3CLTC 3K4PA 1FS4A 3WLHA 1F7UA 4TYMA 4HNQA 5ES4B 5AMXA 3JAWA 1ZESA 3KT6A 4IIJB 1SQFA 4PFSA 4YREA 3LAWA 4E3WA 5IAEA 2OBFA 4AP5A 2I8LA 1U3UA 3MGCA 2JFBA 2ZFUA 3AEKA 3L49A 4QO7A 2QPTA 2FSIA 3QW2A 4BNHA 4NENA 5SZJA 4AF8A 3DDSA 2ZB8A 1BE1A 2CL6X 3BN3A 4GWKA 4KWHA 1HDZA 1Z3IX 3AU9A 3ILHA 2EW8A 4GQIA 5DGDA 1YJBA 3IAAA 2JA1A 5AOVA 5CCBA 3NVMB 4MW1A 2WDZA 1ZEMA 3RYTC 4AJOA 2GBIA 5F5XA 3BSWA 2GM4A 1ARZA 1NI4B 3JVDA 2IPOA 2VF8A 2BISA 4ZMRA 1AV6A 3WWPA 3P2KA 1NYQA 2NO1A 3CCCA 5JHHB 4PQYA 1EX1A 3VRHA 3TH5A 2YMPA 1T6NA 3ZD9A 4DCVA 1CQPA 2FEMA 5CAEA 2QN1A 3E35A 1G5QA 3QV2A 2FMXA 3HB9A 2O8EA 3R3VA 3Q41A 4K1LA 4BE9A 3D3QA 1UT8A 3MUNA 1CQWA 5FTNA 4KJXA 3DP7A 1EM8A 1TJNA 3OQIA 3EC2A 1GY8A 4DSTA 1IEXA 2R6JA 2YZ2A 3IVCA 5CEEA 3H75A 2WQZA 4A0RA 2A0KA 1IDN1 2HQ1A 3A7EA 3G0DA 1ACLA 3OLQA 4HRAA 4NYMR 2JGDA 2IELA 2Y05A 3I2GA 1N0VC 2OGTA 4C0BA 3OM9A 1M0EA 1CS4C 2ZRIA 1JAXA 1E79A 2DMRA 3I8OA 4FYJA 4OBWA 3KEGA 2QD1A 2ZI6A 3KB8A 3OWXA 1IAQA 2BBSA 3DYIA 4OJQA 5AWFC 4I55F 4E5NA 1UOOA 1EUCB 3LLSA 3LBNA 5K0LA 5LD2C 2NPOA 2BEWA 2ZB7A 1ISHA 3NBUA 1BXRA 4GFDA 1H8ED 2GFQA 4I1OA 4WBSA 3ZLTA 4QTUB 4B7ZA 2C2ZA 4ZVLA 4JBLA 5AW7A 3EBPA 1T6YA 1BMTA 1I4OA 3C7KA 4QQ8A 5EZ6B 4R2XA 3W1EA 2N47A 2ZJ8A 2CDBA 3ITNA 2REOA 3KQTA 4GT1A 1ONPA 3SLGA 1LPNA 2GESA 3DH0A 4L5JA 3ZWCA 3AL0C 4U2FA 5JNVA 4AS1A 2IU6A 1BFDA 1YVDA 4NEGA 4I1YA 5DOZA 4BDSA 1IM5A 4BZXA 1NNEA 4C3OB 2B9VA 4D5GA 5LA6B 5BN4A 1UBHS 3ADBA 2JATA 1NQOA 3G2MA 3GFPA 3V2IA 1Z0KA 3D2BA 2I66A 3F98A 3O8BA 1G5TA 1JIUA 1ZWLA 2Z2KA 4MGYR 4UAGA 5GZ6A 1KEWA 1MZPA 5CH3A 4DLRA 2XLCA 4GLJA 4QUBA 4RMJA 3LQ4A 4HX5A 4DCOA 1IC6A 1PFYA 2BFBA 1PG5A 4K6HA 2P9GA 2SCUA 1EMDA 5DBEX 1FRZA 1VPWA 3GLGA 3D3EA 5KYUA 5AI8A 4DZTA 3KHTA 4QRDA 1AO0A 1PT7A 1CQJB 1VOTA 3B8EA 3WWEA 4OHZA 2H29A 3IXQA 1FDSA 3FGZA 3QWFA 5TR9A 4ZT7A 4NXMB 4Y0AA 5EYPA 4B8WA 1ZDMA 1YUMA 2WE8A 4MYDA 4P4NA 4MS1A 3U3DA 3JATB 3AHDA 5HTOA 4K28A 2ZPAA 3C85A 2VNSA 4FKBA 4PSVA 1WR8A 2ZOSA 1ELOA 4OGFA 2B6NA 1C2TA 5EIBC 1U5CA 4MPPA 3SJAA 4AULA 3JQDA 3OTQA 4B35A 1D03A 4XQCA 2D1TA 1K66A 2P0AA 4R98A 4P98A 3DZKA 3REOA 2W98A 3IBYA 5FULA 1U0EA 1DPGA 1JDUA 3L1VA 4XQ9A 4YMWA 1A9XB 1CVLA 3N2KB 3RSOA 2C7BA 1HE3A 2CVQA 2IDMA 3EWAA 1AZLA 3NUZA 4QIHA 4GKAA 3TTTA 1D5WA 3Q0EA 5CYFA 2HQBA 4ZI5A 3EVGA 3I0MA 1A7AA 1IPFA 5CURA 2H51A 3TS1A 1OXMA 1QQ7A 1QVWA 4Y1GA 5F33A 1RW4A 1KYIA 3R7WA 4CDRA 3WSTA 4DJDC 4F91B 4LF9B 4LJSA 5BUSA 1S96A 3LMKA 3U7IA 1Q3TA 1DVRA 1D9XA 1BS9A 5BW8A 3Q8LA 1ZD9A 2CC2A 1UWVA 3E2MA 1IG0A 1ADFA 2VYVD 4L8LA 1R9GA 3J81k 2IYNA 3I83A 3U62A 4ITUA 1RM0A 4WNIA 1DC6A 3C1TA 2ZAOA 4LN1A 2O8CB 2PT6A 5CTJA 1RP1A 1ZLXA 3FOBA 4TSKA 4BP1A 1YQTA 3VZDA 4QDZA 1P74A 2P9YA 3ZHTA 3OZWA 5EHZA 3FPEA 4S0ZA 1VJCA 3PICA 1LDNA 2Q3JA 2QRHA 1A9QA 1RPTA 1U4SA 2IC5A 3F6EX 3OM1A 2LPMA 3RCBA 3RYCA 2PUDA 1TU0A 4FSXA 3T7JA 1DAPA 4DLUA 1EUZA 1DOHA 3ANXA 4FHEA 3HC7A 5EA2A 4BLSA 4LDNA 4F6RB 1PJSA 2JLSA 5C8YF 1I01A 1UKBA 2GWRA 1JSXA 1W87A 2HTEA 1J21A 3K9QO 1PYGA 4BE4A 1ICIA 1E2MA 1E1RD 2I7XA 3PJEA 4N5NA 2VSXA 4DGSA 3AHHA 3S8MA 5IPFA 5JWOA 1RMYA 1J23A 1UT5A 3E58A 1WZIA 2POQX 3EZLA 4CI9A 5H9VA 1I6LA 1ZVQA 4CIWA 1Y8RB 4LV5B 3NHRA 4D0NA 5M29A 1QWOA 2EJTA 2GEUA 2WJIA 1EUQA 1E1KA 4AZSA 2VDWB 4B75A 4BQIA 1K3UB 4RWZA 4FP9A 1RWOA 1J6UA 2D2IA 2K87A 1L5FA 5C31A 1E0SA 3KRTA 3BD9A 2W2OA 4X1YB 3LECA 1HWYA 1QS0B 4LSGA 3WQRA 3WLOA 2O5CA 4KDEA 1G8YA 3RVKA 2IEIA 2QTVA 4K05A 1AC5A 1VL5A 3FHOA 3GC6A 1JDJA 4LX8A 3S1AA 2FPOA 1HSZA 2QLJA 3F5FA 2ZWAA 1DADA 5BQ5A 4CTMA 5FNVB 3ICQB 1DO8A 3PRJA 5ICFA 3LCRA 5FOWA 1E7YA 3DUFA 3PQCA 3WKAA 4OUDA 4BX8A 2J3JA 4O4HA 2CUZA 3MSXA 4DDUA 1YOVB 2JJ2A 2JIZA 3MG9A 2MINA 3RU2A 3BM5A 4PLFA 2G4VA 1NLZA 5K3OA 1QDLB 4EVSA 5JOQA 4P1ZA 3K8OE 1GNSA 4CLXA 1GZ3A 1XZCA 3LF2A 2Z0MA 2BFCB 3EUAA 5GJVC 2QF7A 2XUFA 4WECA 3LQRA 4WL0A 4CEHA 1WDKA 3WP1B 1RVDA 3EIEA 3KU4A 4O1HA 2NN3C 4J2OA 2O2DA 1DTEA 5CDYA 1O03A 5AVWA 3GZTB 6LDHA 3OM0A 3UFXA 4JYAB 3CX4A 5DGTA 3I2JA 4TRNA 1PD0A 2YRWA 1BS1A 4JI0B 4IMJB 4EMUA 5A1JA 3L01A 5IT5A 1K7SN 2O1SA 1EVEA 5A5FA 2VRBA 1YS7A 1G3IA 1M1NB 4NE7A 4Z8YA 2BW0A 5CX4A 4K1XA 3C7AA 1U0GA 2HK8A 3ONVA 1H23A 4NKRA 1T9GS 1JIIA 3IEPA 4WN9A 3T4EA 1D6MA 1J97A 1FC0A 1KH1A 2HLDA 2ZT7A 2QQGA 2WD8A 2OHGA 1WPQA 2J6HA 2RCNA 3KPJA 1NUPA 2QX9A 3GL9A 3HDYA 2Y1KA 5D3MB 4B80A 1XTUA 4K8RB 4LOAA 1YE5A 2W2PA 1L4FA 3LLCA 1W4AA 2CLHB 4GP6A 3VNQA 2FGKA 5AW4A 5IT4A 2QG9A 2OK7A 4Y9TA 1MQAA 2ZZKA 2R1ZA 1XN1A 1JVNA 5BVGB 4XLZA 5JS8A 1KZ6A 2Q46A 3KC2A 1Z12A 3LBYA 5ARCA 5HGXA 4FNGA 3A37A 1V26A 2KI5A 3W5UA 1B2RA 1M7BA 3Q2OA 1IG3A 4CZ2A 5EWJB 4HGOA 3L2OB 5AM4A 1FUUA 4P35A 2F3UA 1C4XA 3PFBA 1N2CA 3WYFA 1ZM4A 1Y1SA 1SHKA 3QVGA 4C43A 1BD3A 3IP7A 4MIYA 4E51A 1DC3A 3Q5GA 2KBFA 4W5WA 4R8VA 4QT0A 4A36A 2PTHA 2VL7A 3QENA 2R87A 1LY1A 3FJ1A 3P0EA 2HDNB 5CGQB 2E85A 3D2AA 4IWNA 1DEHA 2GAFA 5ES3A 3JY6A 5IH3A 2QIOA 3FFWA 3QEMB 5BSVA 4C7OA 3X1DA 5LOVA 1FXUA 2ONKA 4ZQGA 4I8DA 4QDUA 1N2SA 3N1UA 4P0PB 4KO4S 3S5JA 1N5MA 2B20A 1T36A 2PSFA 2OZKA 3RS5A 1Z6QA 2FZLA 2ZTSA 4BNJA 4Q18A 5KB3A 2QMEA 1PV2A 4I6EA 3T7RA 3F2IA 2NWQA 2UDPA 3Q8MA 1AX9A 3KOXA 1V96A 2R7AA 4NBNA 2B1JA 4BQOA 5C32A 3KOOA 3V55A 2OBMA 3OD5A 4UTOA 4DR3B 2Z6UA 4FT2A 3UK0A 4LGCA 2XUDA 3IJRA 3V8NA 4GICA 1CFZA 4FDMA 1YZYA 2I55A 4BY9E 1N0HA 3FAKA 3QE2A 2CV0A 3IAFA 3RT1A 3OFNA 5HE8A 3CKKA 3CINA 3I9FA 4WE3A 3NM4A 2VT2A 1T34A 4TYWA 4M0FA 1EP9A 1FF9A 2IU3A 2UZ1B 5E8RA 4BMXA 1Z4JA 4EUNA 3IULA 3UWDA 5CCEA 3LCUA 1NVWQ 1HNXB 3JVEA 4LAFA 2WTXA 3Q5EA 3S2GA 2PGIA 3WMGA 1EHIA 3NYQA 2EXXA 2BFPA 3QFTA 2ZUDA 4F8YA 4ZZ1A 4N0PA 4NG5A 1PO7A 2YWCA 2NV2B 3PQ8A 4EG7A 4E31A 2RHRA 2OWEA 4BZQA 1MX1A 3RBZA 2VJCA 4DYHA 1Z6TA 5KCZA 2FFQA 1H6AA 3AP3A 5A4KA 3E9DA 4TZKA 3RREA 1QP0A 1K7CA 3WX0A 4KV7A 1XNJA 4YJGA 4MCIA 3UJ6A 3W8RA 4B2YA 1HDRA 3THWB 1Q57A 4RSRA 1KOGA 2PZMA 1SHJA 3CNQS 4KO8A 2G5GX 1FNNA 2W8BB 1XMPA 4C7BA 5IBPA 1U4OA 3QPUA 4OA5A 3BCHA 3VFDA 4YRMA 4D42A 1SBCA 1Q77A 5CT8A 4CM1A 2A9KA 1M73E 2LDBA 1UM9B 3SQDA 3EHEA 4QDXA 5DP2A 3BQ9A 4TTRA 3FYUB 4KSYA 2VIIA 3GOQA 2GFHA 3CUYA 4QTXA 3NBFA 4LISA 2WAMA 1MIOB 2VXBA 2YQZA 1PVVA 5CA1B 1J8YF 1DJPA 2ZIXA 4YRNA 4AICA 2Y4OA 4HWSA 4BKUA 3FPJA 2ZK7A 3GAAA 4GPBA 4G2TA 4PZAA 4ARIA 1G8MA 4RLFA 4BFVA 2IY9A 2VYNA 4KQ6A 2J41A 2VBIA 1OTYA 1FFXB 1MV8A 1RHRA 1RM4A 2R25B 3EIOA 1KDPA 2XEXA 1FDOA 3EXIB 3NXKA 4J7UA 3ZGVA 5JVDA 4JFAA 4HGZA 2D2VA 4PRLA 2B1RA 3H11B 3E05A 1OGJA 2YRXA 3E7WA 1NF9A 3IDOA 1W85A 4LYAA 3T7SA 3AFGA 3Q7SA 1DRKA 2QEQA 3FTQA 1J8DA 1I24A 4IJQA 4LRQA 5EHGA 5BR7A 1CY7A 1IN6A 2A14A 1L1EA 2H9AA 1MH1A 1MTOA 1FYEA 2FPPB 3EG9A 3ENKA 1NXOA 3VR6D 5EKSA 4RKYA 2LZ0A 1A9RA 2PMFA 4H27A 1CC1S 2GI4A 3K2BA 5FUXA 4D9CA 4MAMA 4W5OA 3HBNA 1U8CB 4OQZA 4E88A 1Q0TA 1XTTA 3W2GA 3FBWA 5DNDA 4JJEA 4JXXA 4TQ9A 2LVBA 1WU8A 4D1YA 1ZIDA 1AKRA 2H4WA 3EGCA 1USWA 2R62A 3KZCA 2C3MA 3VOTA 4OQFA 4TZTA 3DWFA 4TMFA 2KMLA 2C2YA 4B9AA 3T1YB 1D9ZA 2AJ8A 2CMGA 2E4XA 2IL1A 1SULA 3D3WB 3ZUGA 2G83A 2O5EA 6YASA 1H9BA 4UASA 1ECCA 2XBUA 3D6JA 4EYGA 3BCRA 1XYYA 2VT3A 1MB9A 3EEQA 1CB0A 5BWBA 3ANSA 4LCBA 1XR3A 3BMOA 2DH5A 2RHBA 2PSHA 4C5AA 1Y8QB 4TUYA 4ZAGA 4E2ZA 3DBLB 1A9SA 3MD9A 2AQHA 4DE5A 4F04A 1TIBA 5K4GA 2NIPA 2VC2B 3QPBA 4GPTA 3W1WA 2G0AA 3O82A 2CBXA 2CVPA 4OL0A 3K6SB 1YS1X 5A9TA 4E7OA 3AR6A 3HBAA 2WF7A 5DCLA 1WDLA 3T7AA 4X64B 5C5EA 1P0FA 4J1NA 1JHYA 2ZE8A 1R5BA 2VA9A 1UOEA 2EGGA 2I7DA 2RKWA 1GQOA 1M9NA 1P0MA 3AFHA 3PA6A 1JTEA 4XPIA 2QVZX 3AETB 4ED9A 5IZCA 3CFYA 1LX6A 3K0FB 3L8DA 2C4UA 4KH0A 1DBWA 1OROA 4B3CA 1X1SA 3AVOA 3HXMA 4Q7KA 2WJ4A 1W2WB 3CEHA 3EB9A 3K9CA 3KFVA 3I2HA 3LDFA 4ICIA 2F9MA 2J9XB 3LM8A 4QPNA 2OBXA 1OLSA 1NX6A 1FTNA 2BMJA 2PU5A 3KWLA 4L28A 5KU7A 3EQ7A 3EX7C 1KRXA 1E0JA 2OAQ1 4IJ6A 2Q2NA 1E2UA 3X0DA 1ZK4A 2WIJA 4MQ4A 3RYHB 3PB3A 4CFSA 2FHPA 3MIIA 5KJFA 4HYQA 4RTSA 1VJ0A 2HCJB 4HWKA 4OGLA 1TD9A 3GUCA 3I73A 3STWA 2R7MA 3QPAA 2HRBA 1EWRA 3GEIA 4J3FA 4C4OA 2PZKA 2D1RA 3LUFA 3OTHA 1HYGA 3QG1A 4H3KB 3UJCA 4BFSA 4ECAA 2ZUEA 1Y82A 3F5DA 3W6UA 1R10A 221PA 1GZHB 2RONA 2OBNA 4FYXA 4WA8A 3ZCTA 5IULC 4A9AA 5JO9A 5LMZA 4CCAA 4IIGA 5B3KA 1BVYF 1PSZA 3TIXB 4KFRA 2OV2A 1GARA 4YX9A 1QDEA 2P69A 1LFAA 1H8HD 1PZNA 2IUTA 2ZW9A 4FFPA 4HG2A 2R8YA 2C7PA 1B0ZA 3GVCA 5TX7A 3N0WA 3ZQUA 1DQSA 3IKJA 5MGNA 2WJPA 2JLUA 1WVIA 4TRJA 3G2KA 1JU3A 4QEZA 5JH7B 3CZPA 3T9DA 4JNCA 4KFSA 4H1TA 3GX1A 5GADl 2R6FA 1MX5A 5HWSA 1DJLA 3HO8A 5EWMA 3OT5A 5JFTA 4PEVA 3NDIA 4MQFA 3ENZA 3LHFA 1GFSA 2GARA 3R0QA 3THRA 2AC4A 2AQIA 2Y0DA 1W35A 3A3OA 1NLFA 3TLEA 5DYNA 1BFUA 4UXHA 3D02A 3G2QA 3TUZC 1QHHA 2VPWA 1Z63A 4PYQA 1DXOA 2V4UA 2A5YB 2H1HA 3C7DB 3BF8A 3IRVA 1Y3AA 2O7QA 3EGEA 2G5TA 1QHGA 4R1SA 3SC6A 5CCXA 2QUKA 3O94A 4FYIA 4CR8A 1S2GA 3I52A 3HVKA 4B6FA 2F90A 5ICEA 5JV5A 1JDPA 3Q3JB 3WGZA 4HDOB 3AF6A 4Z0HO 3RC1A 2Q2OA 2I1LA 3N76A 1IIRA 1Q0PA 4UM8B 3PC4A 5LDGA 3B6KA 1T4BA 2YH2A 1FP2A 4HO1X 1U2DC 2H4XA 1W36C 1ZH8A 3SIRA 1WAMA 4FJ1A 5E9WA 2BWJA 2QXYA 2B4TO 3G0CA 3RC2A 4ARAA 2ZYHA 1ILWA 3WNBA 4C4TA 4EZEA 5EMNA 5IJ9B 4BLPA 2P2ZA 1ZM2A 1KHHA 5HZMA 2NQTA 4PHGA 4EQZA 5KJEA 4WV3A 3EZYA 4ALKA 4TSFD 1Z15A 1FXWA 2W4QA 5HMMA 3TMAA 3DPSA 3ME5A 4L4XA 4LHVA 3EMVA 5DTRA 4F4UA 1H5UA 4GOXA 3UF0A 4Q9HA 4YAFA 1VFPA 1G2QA 5TS2A 4TMKA 1UZUA 4E7PA 1YCHA 3RS8A 4WXPA 1FTWA 3R0XA 1E8NA 5EKTA 5C51B 1YB1A 5L3VA 1SXGA 3OJWA 1A8QA 1Z0IA 5CIWA 3V1MA 2JIBA 2H08A 4RZHA 4Q4HA 1JLLB 2CDAA 2ATXA 1KL7A 4MB0A 3HACA 1RAAA 5JSQA 1RHKA 5EWLB 1H9AA 2O8VA 3B9BA 1G66A 2GJ4A 3H9UA 1U7HA 3KZOA 4O25A 2B7BA 3IVAA 1A1SA 1G0NA 1WTAA 2DHEA 2IYOA 3EOBI 4MS4B 5DYGA 3TJZA 1RHQA 2RAUA 4JJ6A 4RQUA 3GP8A 4ZT4A 4L2IA 3H04A 2PS3A 3GGSA 4A2CA 5C4GB 1KOLA 3TRDA 4KE7A 3EEFA 4MP3A 4V2UA 1L5GB 4EENA 3R44A 4NZPA 3U9SA 4S05A 1T9CA 4RA6B 3AESA 2VTKA 3HYLA 3JQBA 4G1FA 4INAA 3K6KA 3HMQA 1M8GA 2A58A 4GDFA 1I3KA 3A2LA 1S1CA 1P2GA 1GZDA 1NRWA 2C88A 3AVQA 3HPRA 1RXWA 1AZSC 3AUXA 3OIVA 5EUCA 5MFZA 2V8BA 2WZCA 5HF9A 1PGNA 4P80A 4PC1A 3T5TA 1VBMA 1MMFB 1EXMA 5GJBA 1Z17A 4OU5A 3EW9A 5A02A 5CT6A 1CB7A 2HHJA 4ZYUA 5AW0A 1U80A 2YQ5A 3JZIA 5AJZA 4CKZA 2QLTA 5A03A 4WBNF 4UUNA 5IYZA 2IX3A 1TA0A 1X8KA 2FNAA 1T5DX 3KZNA 2A78A 1H65A 1XHEA 3K0KA 3KT3A 5IFLA 2WYIA 3A6FA 1DJMA 2OXFA 3CEJA 1GLVA 4LXTA 3O3NB 1ODJA 5AK6A 2FN7A 3EDMA 3ZYZA 2VJBA 4JKOA 1H2EA 3CSSA 3SHTA 2QXTA 1CJBA 3FD8A 1UPBA 3DWGA 2QZPA 4JKYA 1JILA 2XKJE 4RH3A 2JLRA 3EPHA 2GPYA 1PYDA 1O94D 4L85A 3UJ3X 4Z7QB 3CCFA 4EQ6B 2NVWA 3DZDA 1E61A 3PXBA 3RASA 1ORWA 4GRAA 4KQGA 5SZKB 3I01M 3OPMA 1M5RA 1FSSA 5A2GA 1ADCA 1SKYB 4M60A 4MUJA 5BWLA 2DY0A 2MSEB 2QQEA 4POAA 4TM8A 1QFZA 5BSGA 4DCCA 4QHYA 2Q5CA 2AWOA 2Y1XA 3A3KA 4NMMA 3ED5A 3KR9A 4MW0A 5EKUA 3UTCA 1CY4A 1TKAA 2BZSA 1G8PA 1JHVA 2BR4A 3ZCPA 1ZI8A 1N2CE 4RBNA 1G9SA 3A0UA 1NW4A 4NULA 1KBZA 3QVTA 3HDHA 5HA5A 3RO7A 3RSFA 4BGUA 3GCDA 3WA7A 2I78A 3DWEX 4EMTA 2EZ9A 3LDGA 1Q1BA 4DUGA 2JANA 5HS4A 1NRXA 3K20A 2HPVA 2YIVX 3GJZA 4GYWA 4DLAA 4DDMA 4QODA 1L3CA 4Y2SA 2AQKA 3Q1KA 3IEVA 1WPRA 4EEZA 3FAZA 4OIFA 3K53A 1XWFA 1KBQA 3GFOA 6ADHA 3EGVA 3ZE2B 3RADC 1LWOA 3EASA 3OY7A 2Z3VA 1K75A 2YZGA 1RRVA 1NXPA 1T8TA 5KYWB 2XSZD 5FI1B 4DLVA 4D97A 1K5DA 5LIPA 3N39C 3GP3A 3OURA 4QSHA 1QBGA 4G4IA 1HETA 2VT6A 1M2WA 1RQ2A 1V8FA 1XP5A 2XXJA 3PKIA 4CLEA 1SKMA 4RQBA 4OK3A 1K5GA 4ZQIA 3FUCA 4ZVQA 3ZTTA 5ULLA 4B6OA 3PR1A 2W2VA 2ID7A 5I4IA 4FGJA 1KNXA 1MCZA 1XPJA 3J7TA 4UCFA 1V6SA 1PHRA 3C24A 3MJEA 2JNWA 2WNHA 1YIOA 3GQBB 3H6HA 3TL2A 4ACAA 3EA0A 3HL4A 1B42A 3G0GA 3MTIA 4HFJA 4M53A 4NESA 3OT1A 1D7OA 4YQEA 5IUNC 1FDRA 1HE1C 2IOFA 3VR5A 3ESDA 5GM1A 3JSAA 5JO0A 1DXHA 2XADA 2IYUA 3D2LA 3QTLA 4MZDA 4CMJA 1BSVA 2E4WA 4B87A 4LDAA 1GADO 1BXGB 3FCSB 2FMUA 1ZGBA 3DOIA 3EFBA 2M9MA 5TMEA 2HJHA 4ZI3A 3W8EA 3UYKA 2DECA 2DVMA 3W5JA 5C34B 3IHTA 4JJ8A 1JQ3A 1KAQA 3Q9LA 4BU0A 1U11A 2V1XA 3PNBA 3I09A 4ZCQA 4C4YA 4UJ5A 4NZOA 5A62A 3BD6A 4NONA 4RMIA 4RKFA 2DPGA 3DLIA 4YALA 1RYFA 5DNAA 3SAJA 3KL4A 3LPAA 3SWWA 2V7VA 4KW7A 3C48A 4DLXA 3MT8A 4IQFA 4RV5A 4WSOA 3AEXA 3JYOA 2NXNA 4I6GA 1X7YB 4P7BA 3T7IA 2JRCA 13PKA 2AUNA 1DXYA 2LCQA 1E5TA 3CR8A 1ZUNA 1RYZA 2TS1A 3BE4A 2OYSA 1ZXLA 4HY3A 2AR0A 2IHZA 3RSGA 3ETEA 3GAFA 5BYAA 3PFNA 4US2R 5SYAA 3V8EA 1YNOA 5B7GA 3T7CA 2C5AA 3F9CA 5HILA 3I05A 1FYXA 1PJ8A 1T8PA 3NTOA 1F2VA 3U4IA 4JT8A 4RA9B 4X94A 3LVFO 4YAOA 1QJ4A 1U28C 2V6GA 1KF0A 2OOSA 3KKMA 5KNDA 4D96A 4QFBA 4L4UA 2XCIA 1B15A 2IQ5A 4C3ZA 2NXEA 4TZ0A 1WZCA 1YA4A 3ZHQA 4BBAA 1NZFA 3QSGA 1Z5GA 3KKOA 4GPAA 4QPCA 1SIUA 1CY0A 3HP1A 5GONB 2VPXA 5IN5A 3R7NA 5B3LA 4RHFA 4FONA 3RRNA 4XD7D 5EZYA 5IVDA 3GUUA 4TMWA 3ZTWA 4H7PA 4Z0PA 2HWWA 5B1SA 2OD2A 1QLJA 1LSJA 4RANA 4D44A 4F6CA 3COJA 3GJTA 3IMGA 5JG7A 2DXIA 5A5EA 5AKGA 2BDTA 4IJMA 4IXWA 3UAYA 3EG5A 1W52X 3TQSA 1OY1A 1IOWA 4D9JA 2HZBA 3NUQA 4B34A 3TRKA 4UDXX 4JVLA 3G2PA 4NICA 1X94A 3I2KA 5AVVA 3MXTA 1GGJA 1ZNQO 1FFGA 2XMQA 3JQAA 5EMLA 3QX3A 4PAWA 1AK2A 2EFCB 3VPFA 3HU2A 2J9YB 1EXVA 2ZBVA 3EUEA 1X9HA 3BIFA 4NCHA 1MBZA 2VJNA 4NIMA 5ALRA 1O58A 2G04A 3ONEA 1ZJWA 4OXYA 2JCXA 1PDOA 3R7DA 3E9EA 1T35A 4G84A 1XQVA 1RKQA 1VLVA 1ADJA 4CXMA 3N59A 2BCJQ 1V9CA 2POCA 4DQVA 2IE8A 5JC1A 2XUIA 3F73A 4YFYA 4XRRA 3GJQA 1QRUA 3SEQA 3C6KA 2NV6A 3WJAA 3CV3A 3FHLA 4L5AA 7REQA 4DWWA 4LC9A 3CUWA 3TQOA 3H2BA 1QRTA 3U6BA 3GLSA 4JX8A 2I3BA 5GPBA 2NQ8A 1PT6A 3CN7A 5FO0A 2AEMA 5KKAA 4BTEA 3EPRA 4ZAYA 2Z04A 1NXWA 2Q41A 4IOMA 5C7OO 3IBFA 2IS4A 4YV0A 1D3AA 1W6UA 3ZE1B 1MLDA 4YHHB 2JBAB 1Q22A 2VOJA 1Y7PA 2YN4A 3GT0A 1GPBA 3X1KA 3K70D 2RB4A 3BAFA 4XWGA 3ZIUA 2H8KA 4PICA 1Y5RA 2TMKA 3QUBA 1B8OA 5EPUA 3T0IA 2H59A 3ROFA 2QG6A 3RV4A 2QN8A 4TKUA 3C3XA 4A91A 2ZREA 3BFPA 4TWZA 1E0AA 3EZ7A 4YAGA 1WETA 3UAGA 4O2BB 2PA3A 3DEJA 3D54D 3UQYS 3X1WA 1GRCA 4KXYA 1N4DA 2OVBA 3F74A 4G07A 4JA0A 1J09A 1F48A 3BMCA 1XWIA 3AZPA 3LP6A 3R6GA 4K6CA 4M3NA 3KKZA 2EARA 2MSLA 5LPNA 4IDDA 1LU9A 3M6UA 2D4HA 5JSZB 3OZAA 3E61A 1R4MA 3BAZA 1D4FA 1ZGCA 5KSOA 2QTNA 3NYIA 1X8JA 1C7ZA 5MFPA 2WSSD 4NJMA 5HRCA 1MJ5A 3P0FA 2O2SA 3QPWA 1R64A 4A73A 4TYYA 2R1VB 3GUHA 3ABSB 1AN0A 2VAMA 2RB5A 2YVUA 5EVJA 1SD2A 1ZK3A 4N39A 1UKZA 5DFAA 3VVMA 1BW9B 4CQLB 3R9WA 2ZYUX 4K6FA 4U5XA 2MCFA 1SBHA 1G8SA 5EN4A 1RYHA 1H4TA 1C0EA 1T10A 3Q7IA 1CIVA 4WJKB 3FFAA 5F78A 4QYTA 3SFZA 3HKCB 3ELBA 1D8TA 1VBKA 1VG8A 1XGKA 4TMZA 1A8SA 3RRFA 4RK4A 5I7UA 3GJ7A 3ILYA 4PHTA 2PSEA 3N9IA 2BEUA 2BMDA 5HZKA 3ZY6A 3PDIA 4C08A 4NZNA 4DR2B 2JKZA 1NONA 3A3YA 3MOIA 4O4LF 2HPAA 2CNWA 5C7IO 4I5EA 3VSCA 3EMBA 5THQA 2ADFA 3I30X 1L4HA 1N92A 3E9CA 2B2NA 3KOMA 1QF7A 1XTRA 2J46A 3U1VA 4ITRC 1X92A 2GPJA 3JZFA 4EVIA 1A1VA 3ZJYA 3CNOA 2RIPA 2AFHE 4LYDA 4IIBA 4Z4EA 4TV9F 4YJ3B 5J2UF 2XYPA 2Q3DA 4HXYA 2P9BA 1M2NA 1Z0JA 3M6MD 4B84A 3SDSA 3ZEIA 4BV8A 2O2EA 5LP6A 3FKSA 1EI9A 3CLKA 3L7OA 4RZIA 4ALNA 3C39A 3D59A 1BEUB 4LW8A 3URMA 4DNFA 3L0YA 1U2GA 2YW9A 1OH8A 4IBOA 2PZEA 4HAXA 2EW1A 5A9SB 3P9NA 4GUAA 2WD9A 4JR2A 5AH0A 3WHKA 2ZYVX 4QL3A 3M2TA 1OLOA 1RACA 4DIOA 2VZ0A 1YDFA 4JSYA 4K6OA 3A31A 3HYTA 5A1TA 4PGGA 2GETA 1H69A 2ZJ2A 5BSHA 4HUQB 1TUGA 2GXQA 2Q6KA 4ROTA 3ZK9A 5F51A 5FUVA 2A59A 1Q44A 2CFCA 4YQZA 1E69A 2PJZA 5A0TA 2YS7A 4JZYA 3OAAA 1TQ2A 3WLMA 2C9YA 2Q0QA 2GH1A 5COBA 1YFLA 2DTXA 3U4HA 1A77A 4OV6B 4EG8A 4CQNA 4YJKA 4JSRA 1CRQA 1ABEA 4N6GA 4XTRA 2QAGA 1G5RA 1PD1A 2RJNA 4DQXA 1P6QA 4DW8A 1KC1A 4X71A 1GNRA 4KH1A 3QPCA 2HNKA 2A0XA 2AN9A 4FFBB 3ENQA 1JDBC 1FDIA 2VHCA 3C4VA 3H2IA 1SWVA 1XD9A 3ISVA 5E1MA 1U5AA 1WY5A 5ED0A 5M04A 4BNUA 1K7FB 3EDCA 5HQ3B 2IITA 4KMOA 1ZKDA 3BULA 3ABIA 4IIDA 1WCWA 5F52A 4TWRA 4WLOA 3W7BA 5EIWA 5TT0A 4HFMA 3JWIA 4JBHA 4RENA 3ADCA 1AQIA 4EBFA 2CT8A 4Q0MA 1JLHA 3JR7A 4EX7A 5TMBA 9GPBA 3U5TA 4GI5A 4TTTS 1Z4PX 3N0RA 4PNPA 1X13A 4L95C 3LUPA 3WIOA 4QM7A 4Y6PA 5EFZA 3TPCA 5DGXA 2ERYA 3N8NA 1OX6A 2CCJA 2Q5JA 4WZ6A 1J56A 5I9TA 3V33A 1ULHA 3L8FA 4MS3A 1Q2XA 1E2GA 1ZSVA 2OV6A 3H8JA 2DBVO 4NMLA 4OQYA 1UODA 4Q1DA 4Z1MA 2PUWA 3RBXA 5B2FA 4G4GA 4EHBA 1U3VA 4ID3A 1YR6A 3WLIA 3ABZA 3DAFA 2JJ2D 3S2SA 3VAZA 1VIMA 4FFSA 1GA1A 5GIOE 1JFTA 4KE8A 3TLAA 2XHEA 4XX0A 4V0OA 1GLGA 4P4SA 3BWVA 2QI9F 3UJ8A 4X20A 5DHFA 3LW7A 4PRKA 3AVVA 4X8HA 1WZ2A 2JASA 3C4QA 3GFBA 3LGAA 3R7BA 3H3JA 4EB6B 1BROA 3LYHA 1B8NA 4MQEA 4CGZA 2ZIWB 3BC1A 4MPJA 4RUKA 4FZJA 4R2HA 3CXUA 4NBUA 4EAQA 2WW8A 4V0KA 3ORYA 3T15A 5JFGA 2W11A 1V8DA 1L7MA 2Q9AA 3MTJA 3NNNA 1HDCA 1QCZA 4IOJA 3I9JA 3IRUA 3NBZC 2OXIA 5HRAA 3RSZA 4MNTA 1OGYA 1BKDR 4FEEA 5AJWA 1K8QA 1DEKA 3NT5A 4QTZA 5IABA 2WIAA 4US0R 4LFAB 1A69A 4RDIA 5E6SB 2R65A 3C8ZA 4K81B 2B83A 1NJ2A 4RZ3A 3MSCA 1TYBE 4U7DA 4CMIA 1TUBA 5HM6A 1EH5A 3TQRA 5L6LB 1Z73A 2GZ1A 2XGJA 4C01A 3T5DA 3BIWA 1NMSA 1L4UA 1G41A 2QT9A 4ZXPA 4YRKA 2CLEB 4K9DA 1H5QA 4NG4A 2XMRA 3IQWA 1GKLA 4LG1A 1DS6A 1J0BA 2C8LA 1RI1A 5LVAA 3UB2A 1VI6A 1SU8A 1U8UA 4YWJA 5D00A 3L8HA 3GGCA 1HE2A 1CUUA 4U7GA 3WGJA 4DAOA 4RIIA 1DXQA 1RYMA 4HB3A 4D3XA 5BOSA 3I04M 4OPMA 1QP7A 1F4LA 5MN5A 1E8DA 2ZSAA 5LC1A 1U0RA 2F2TA 4FGKA 1XTZA 2C8KA 3CX8A 3DMYA 2VF7A 1ZWKA 2ZRJA 3HJUA 3ORRA 3B38A 3M33A 4Q01A 3IEMA 1H94A 2QE7D 1H2AS 2FDRA 2WIFA 3D1LA 3IQHX 3N3AC 4HTAA 3VJRA 5IX8A 1UKEA 2H7VA 4Q4JA 4RZSA 3TQHA 1E62A 3BD7A 2LGJA 4PIVA 1TF7A 4N0MA 2VZEA 5AKEA 1KAOA 1XTPA 1DIGA 2R11A 3IOMA 3KNZA 3R3JA 4P58A 2HK7A 1F60A 2AOUA 2D74A 1M2VB 1C41A 1HMYA 2Q6VA 3ZU5A 1C3OB 1E3TA 3AJRA 2C29D 2X6TA 3I01A 4ROSA 2XNHA 3OPNA 4Q6WA 1SUCA 3OJ0A 4D45A 4FFNA 3C3WA 3QBDA 1KI1A 3S2ZA 3FNHA 4QULA 4KVAA 4RL4A 1LNZA 2QVBA 1GXSA 2JFQA 3PIDA 5E2AA 1KYYA 1S8FA 4QJBA 4WOCA 1TT5B 2A8YA 5AVJA 3UOGA 1NXSA 3OFND 1EFRA 4LECA 3RU9A 2BHTA 1PDVA 2HD4A 1WB9A 3L6OO 3TVYA 2J3IA 3R1IA 1UZNA 2EQBA 4CQMA 4DMGA 3FDZA 4YRJA 3FGOA 1QMGA 4JJIA 3TTWA 4GPZA 3U7RA 4X61A 5CB4A 4O2AB 1SFRA 1GAWA 1I1HA 1M2EA 4L8GA 1PFKA 1JKFA 1JFLA 3F7OA 4MIOA 3KYIB 2GN1A 1ZH2A 2GD1O 2FRXA 2WJGA 4FMBB 6NULA 2W2MA 1IM8A 1YQWA 2CJXA 2Q2VA 4UQPA 3VC7A 1WL8A 3BGOS 2EZ4A 4JWKA 1IBSA 1Z37A 1UXJA 1ISMA 2BEVA 2EJUA 3HABA 5A4FS 3GLFB 3FZYA 3EPKA 1DFIA 1QGOA 1V5EA 2AKAB 1ZW6A 2V5VA 4FYPA 5T6BA 5UKDA 4B6GA 4DXAA 3WGQA 4RKWA 2JI4A 1XEWX 2ZVJA 2WPDD 3KXLA 3VZPA 1KK2A 1A9ZA 5DBHX 2IBSA 4DR1B 3S2YA 4FEYA 1ZW1A 1QX4A 5HF8A 4YYZA 3UGJA 4BN4A 4WJLA 2ZT5A 1Y4SA 3CLSC 4KGZA 1OIWA 5FD8A 2HWKA 2R0QC 1M83A 4FUQA 4OLBA 3R3HA 5A6SB 1LW7A 1KSGA 1GU1A 1DQZA 3I1FA 4GVLA 3CLRC 5KTNA 1LPOA 3RVDA 1DFGA 4NCIA 2PMEA 4DJ5X 4IVPA 4R3WA 3PEVA 4MCHA 2C4MA 2I2FA 5D5QA 3RTEA 4PZEA 4MGKR 3UCFA 5CFMA 3QP9A 4Q3DA 2SKEA 3NG1A 1KMHB 4RPGA 1B2LA 1W6RA 1XIVA 2EU8A 2VWHA 2RGGA 1A5ZA 2XOXA 1I0LA 4TLLB 1NVMB 3RANA 2HEGA 1RHJA 3C6YA 3X1MA 1K8XB 1JU4A 1OZAA 1V5IA 4JENA 4UAUA 4URHA 3DYBA 1ZJJA 2R8ZA 2VYND 3OPYA 1E2IA 1PJBA 4RM3A 4Y7CA 4ZEOA 3VR3A 3JQRA 1JLKA 4JEHA 3CX6A 4P33A 3L4KA 3AB8A 1JYFA 2TECE 1KI2A 4LIPD 5ECGC 2G36A 4FZVA 3EVBA 1V7CA 1Q91A 1TPYA 4G81A 3CVJA 5ALYA 5FWNA 1Y4AE 4UHEA 1W9MA 3NTXA 1WLSA 3NJ4A 3FTDA 4C2BA 2R2AA 3MTGA 4M36A 2NU6B 4XM1A 5DNWA 3RNOA 3TE6A 5J4KA 3T1HB 2BUBA 2EJVA 2ZXFA 3SDBA 5BOVA 1GDTA 4MYCA 1SCUB 4QGAA 2OQVA 1NJ1A 2DCMA 4XJXA 1WBJB 4H31A 4G0NA 1HNNA 4NJOA 4YECA 10MHA 4NTZA 4COOA 1GRQA 2PFGA 3E7PA 1P0CA 5TQ0A 2JJ1D 3QA9A 2D7CA 3KLBA 3T61A 1JHZA 4JB8A 2AFRA 4MO2A 3NIDB 3ZY2A 2XV1A 4IZIA 1RMQA 2BFAA 2MHCA 2XB8A 3OHPA 2AE2A 5JU6A 3DXZA 4LKRA 3G23A 4WLNA 2PV7A 3SQWA 1KWKA 1AUVA 3DJYA 3Q15C 2D00A 1ODTC 1EM6A 4RD6A 2AOWA 3ICWA 1D5CA 3IQFA 5EXTA 2B1QA 2V0CA 4LWZA 3T3MB 3DB2A 1JDNA 5BMVB 2ETXA 1YTUA 4ARUA 3VJLA 1UL1X 2FRVA 2WTEA 5B6IA 4C4XA 4RXUA 3IT2A 4A2PA 3L77A 3PR3A 2YC4C 1N5JA 1KJQA 1UFRA 1O96B 1HSOA 4PGFA 3B48A 4X6XA 1ESEA 3FUWA 3FFTA 3KTAA 4PTYA 5DTIA 3TM5A 3QX8A 1KSJA 4RZ2A 3U26A 2LR0A 1DJQA 1ZRSA 1L1QA 2IEBA 2PU7A 2VI5A 2VXYA 3ETGA 2JZNA 2XXBA 3N70A 3HPQA 5CBPB 3CZCA 1U1EA 3NBKA 4R9VA 1EXDA 3ZE0B 3AB7A 1WCXA 2CEAA 1IHUA 1QHYA 1JBKA 4LHXA 4LHYA 3V7FA 4UHBA 4YUVA 2ZIUB 1E96A 3UMVA 2VP6A 4MR8B 2HWYA 2AZXA 2NM0A 3V4RA 3Q8XB 5CFLA 2BGRA 2I2AA 1TC2A 3KJGA 1XYGA 2I4RA 3CW2A 2A5JA 1GDHA 1RYDA 2J5QA 3HWWA 3MAAC 4I9HA 5D1NA 5EUMA 3A1WA 3CRW1 1YOBA 1E0DA 3ANNA 1SZCA 1KI6A 1X87A 1Y0BA 5SYMA 4YQFA 1N8NA 5JCXA 1KP2A 3FVWA 3LTEA 4QUDA 1QYWA 3K72B 3ZDYB 1NUQA 4XXHA 1FX0B 2G8LA 3H0EA 4DXDA 3FTNA 2CDRA 2QN2A 3RJMA 3AHGA 1F0YA 3BB3A 3PFKA 3HZOA 1EEXB 1IXZA 2X7HA 4LJKA 5ENDA 4C6HA 5EEHA 4I5FA 4PYNA 2HX1A 1WHSB 2WIBA