1ZIYA

Crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
232
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
molecule keywords Carboxymethylenebutenolidase
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 80
structure length 232
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ziyA00
1XRQA 4F60A 1DWQA 3HXKA 4Z49A 2CMFA 2GBGA 3C5VA 5ALIA 3WJ2A 3STXA 1DT5A 4K2AA 2PM8A 4YK7A 3C6YA 2D0DA 5AK4A 3PFCA 3ILSA 3WI7A 4UBLA 4Q3LA 2AXEA 3O9VA 4GECA 3V1LA 2WM2A 4BZWA 1QONA 4IH9A 4G4IA 1GT6A 4G8CA 4H7IA 3F97A 4N5IX 3ED1A 2XMBA 3PFBA 2Y2UA 3K9BA 3WK5A 1XQWA 2G5PA 3N2ZB 3WL8A 2XLBA 1LPMA 3F67A 3G0IA 2B61A 1ODTC 4L3WA 2CUTA 1BN7A 1WB6A 4K6GA 4ROTA 4WFIA 1Y7IA 2ONCA 4XJVA 1JU3A 2GYVA 1QIHA 1QFMA 2DHCA 1J06A 3ZV7A 2V97A 3D7RA 1U65A 1LLFA 3WL6A 2XUQA 1TKRA 1BRTA 4J7AA 4CG1A 1XRRA 4QLAA 1MO2A 4PSUA 3JYHA 2HA0A 1X2EA 3C43A 4UBIA 1YS2X 1TCBA 1WM1A 5EHXA 1XZMA 1CUDA 3OTQA 1XRNA 4L0CA 5CH5A 1WHTA 5IVDA 1ORWA 2XUKA 2V98A 3WK9A 2XI4A 1Q84A 2O2HA 2WHPB 4F5ZA 2RHWA 3W04A 1VXOA 4W1QA 2I03A 4BTVA 3K2IA 1H2WA 3I2HA 1VJ5A 1SCIA 4H35A 3EQ8A 2VAXA 2WU4A 4C88A 5AK3A 1E89A 3QVMA 3A2NA 3W2TA 2OPHA 5HFNA 3D3NA 4DSAA 2Z8ZA 3CN7A 4Y2XA 3NOXA 3O95A 4RGYA 5FRDA 4BP8A 1TQHA 4X91A 2VJBA 4ZGBA 1TIBA 4MYSA 3VJKA 1DX6A 1L7AA 1CUJA 1E8NA 3FYUC 2C7BA 1JMKC 1ZD4A 3GA7A 5LZ7A 1WB5A 2X76A 4XX1A 1CUHA 2D5LA 2OCIA 1CIJA 3C6ZA 2PBLA 4QDXA 5CT8A 4IH4A 1K8QA 2VATA 2OQVA 3H04A 3IUNA 3PUIA 5FDFA 4FBMA 1VE6A 1UK6A 4H18A 5DNWA 4UHFA 5AI8A 1FFCA 1ZJ4A 2EEPA 4DMFA 3TRDA 2VEOA 2DQZA 5BOVA 1MAAA 2WJ4A 2XB6A 2QTBA 3FAKA 3KD2A 4X6UA 3IURA 4J0HA 4HXFB 1ISPA 4EY5A 2XMZA 5ALFA 4KR0A 2E3JA 5DYYA 3G0BA 4C87A 1W76A 1GPKA 3E0XA 3D2BA 5DWDA 2J4CA 4FFVA 4IQ4A 5AP9A 5FXMA 3DCNA 3BF8A 3NUZA 4Y2JA 2HU5A 5DLPA 1S8OA 4QDTA 3QH4A 2WILA 3AIOA 5CW2A 1BCSA 3F98A 5I9IA 1QO7A 4L72A 3DOHA 3W05A 5AKEA 2XQIA 3PICA 4G9GA 2BAGA 4B84A 2WSLA 4DMHA 3BIXA 4MQLA 3JWEA 4K6HA 4HXGA 4B9AA 2WTNA 5HK9A 3STTA 1AQLA 4UFNA 2H7XA 1QOZA 2OCKA 3H2KA 1TRHA 4P93A 1VZ2A 1YAHA 5AI0A 4J0JA 3HYSA 1W4LA 1E3QA 1XROA 4FTWA 3LS2A 3O4IA 1WPXA 3M81A 5JD6A 4OU5A 1QIEA 5AICA 1EI9A 4W9RA 3GUUA 3KDAA 4N8SA 4CIAA 1E5TA 2H1IA 2Y6UA 4U2BA 5CTAA 4GI1A 4AN0A 1EA5A 4B7ZA 1ZIXA 4DMCA 3WIBA 5DYTA 3IULA 2OLEA 5AH0A 3WKEA 3VISA 4B9EA 4BC0A 1UK8A 3WJ1A 1RP1A 2OCLA 1WOMA 2J4FA 3R40A 5EIHA 4KRXA 2BGRA 1ZICA 4PSCA 1XZEA 3WL7A 3IUJA 2XMRA 3BIWA 3B12A 4IHAA 1DT3A 3V9AA 4PQEA 3BF7A 4C4ZA 2FUKA 1XRLA 3OPMA 2PSEA 5IKXA 3STVA 1M33A 4GW3A 4UBKA 1U2EA 2VAVA 4MYDA 5JZ9A 1CUGA 2VA9A 3NGMA 4BVJA 3OM8A 4DLNA 1QIIA 4KAFA 4WCVA 2JIDA 2GYWA 1AGYA 5CT9A 2YYSA 4Q3KA 1CUWA 5LZ5A 2Y2VA 5KREA 2BKLA 3I2FA 1IUOA 4B80A 4AO6A 1QGED 3PUHA 3QZUA 4G8DA 1G42A 1YA4A 1EB8A 4W1SA 5K3DA 4B83A 2Z3WA 2R8BA 3IUMA 5IH7A 1W52X 5ALXA 3BJMA 1ZIYA 1XZFA 1J2EA 2BGNA 1MX9A 3AILA 1CPYA 1L7QA 5HKAA 4MWTA 2DHDA 4WY8A 1EK1A 5EHZA 3WKDA 4C01A 3FCXA 3HLKA 4YPVA 1A8QA 1VZ3A 2BFNA 5A62A 4FLEA 3WWOA 2EDCA 5AM3A 2QM0A 2Y1KA 4EA6A 1R4ZA 1EK2A 2G63A 3FCYA 4N8EA 5ALZA 5K3FA 4ZWNA 4HXEB 4UUQA 1ZI8A 4GLBA 4UHBA 1WHSA 1AMNA 3HJUA 1JI3A 1UZAA 3AZQA 4EBBA 5C8XA 1ZOIA 1TCCA 1JU4A 1E66A 3ESCA 2JGLA 2DR0A 5DJ5A 5ALTA 1G5FA 1JJFA 1BCRA 2RIPA 1IUPA 2X5XA 3RK4A 5AKYA 4W1PA 4K5QA 4JUIA 4EHBA 1GKKA 1BEZA 4UFPA 4WFKA 5AHXA 3UUFA 1CUVA 1Z68A 5HF6A 1G4HA 1I6WA 2V9ZA 3I2IA 3WYDA 3O4GA 1CQWA 3O9MA 5FP0A 1CFJA 1UOQA 2XQJA 5ALPA 1EX9A 1A7UA 2PUJA 4WJLA 2AJLI 1QZ3A 1THTA 2B4KA 3D59A 3HC7A 4FMPA 3VJMA 4BZZA 4H7KA 4CIBA 1EDBA 1DWOA 2RHTA 1W1IA 4AO7A 4BVKA 4X92A 3S8YA 4D9JA 4BAGA 1Y37A 1EDEA 3EQ9A 2LIPA 3B3QA 1QIKA 4IH1A 4BAUA 2JF0A 2QJRA 3D0KA 2GZSA 1L7RA 4KRYA 1ORVA 2XQFA 3C70A 2WG0A 1QIJA 5DTIA 1JFRA 2OGSA 3FLEA 1CUCA 4XVCA 3WIOA 1A8UA 2WFMA 4ZREA 2VSQA 4HRXA 4X90A 1XZJA 4EB0A 5H3HA 5AM2A 3C6XA 1O6FA 4J0GA 3R3XA 2XUOA 2Z8XA 3U0VA 3KXPA 4WDRA 3VXKA 2XUHA 5ALSA 1WPRA 1HQDA 3L1HA 2FJ0A 2UZ0A 2PUHA 3W9BA 4N8DA 4QDUA 1N5RA 4BP9A 4W1RA 1EXWA 3DOIA 4W63A 1TK3A 1D07A 4QDOA 3KWJA 3CXUA 4A23A 1QJ4A 2WJ6A 5ALEA 3I2KA 2PKYX 1EHYA 4GWLA 5K3FB 2GBIA 3HEAA 3H0CA 5AM0A 5HF8A 2B20A 3EBLA 1J1IA 5KBYA 2JGIA 4KE9A 1W6RA 2QJWA 4MEBA 5ALHA 1BROA 1HPLA 5JAHA 1XZDA 1XQVA 4Q34A 4MQMA 1XZAA 3FYUA 2PVSA 4BDSA 3C8DA 3I6YA 3I2JA 2AJCA 3PF9A 3E4DA 3HRHA 3DL4A 3QPAA 2W22A 3LIIA 3ZLUA 3YASA 5AK5A 1PV1A 1XRPA 1N1MA 1EINA 1TAHA 2YH2A 1MN6A 1O6GA 3LLCA 1P0PA 3FWHA 1XFDA 1LPBB 5C8ZA 4CCYB 2BJHA 4X94A 4B0PA 1MPXA 1LPNA 4EZIA 4X6YA 5E4TA 5K5EA 1MJ5A 5AKLA 3WK4A 4EY8A 2CJPA 3LP5A 3ZWQA 5AOAA 2XQGA 4H7HA 4U2DA 4BC1A 5A7FA 1EDDA 2XMSA 3WWPA 3ESBA 4AMZA 3I28A 5AI6A 1KEZA 4MXDA 1YSCA 4NS4A 5JARA 2GYUA 2QUAA 2XUIA 4I19A 1IZ7A 4TPKA 3ICVA 4JNCA 5T4BA 2AJDA 2XMCA 4OSEA 3V48A 4V2IA 3V1MA 1XZCA 3QYJA 1QIFA 2K2QB 2XUPA 5LZ2A 1DWPA 5CT4A 2JGFA 3UMJA 1FFDA 2WIGA 4KEAA 4CFSA 5A7GA 3X3HA 3D5EA 4FNGA 4QA9A 2HA5A 5K3AA 2JEYA 4BDTA 1LGYA 4KE7A 1UKAA 1CUBA 4OD0A 5IVKA 4X93A 1HDEA 2QZPA 1UXOA 2WFLB 1YAJA 4OU4A 5T4FA 5JALA 2AJ8A 3EIOA 1E8DA 2ZJ7A 2C5FA 2HA3A 4RNCA 1H2XA 2H7YA 5JAPA 4G9EA 3WK8A 5ALYA 4O08A 2R11A 2ZJFA 5CH3A 1MX1A 1X2BA 2H7CA 3NWOA 3G0CA 1W75A 3IBTA 5I8PA 2JGEA 4LXIA 4PNZA 4Y2VA 5EGNA 1CR6A 4U2FA 3AJAA 5D7BA 4OYYA 3BXPA 1NU6A 2QXTA 1XRMA 4B82A 2C0QA 4ARBA 4ZXFA 3FYUB 4U2EA 5EHQA 4F0JA 4KE8A 3EQ7A 3WA7A 4WY5A 3E1GA 3R3UA 5EI5A 1H2YA 5IVHA 2Q0XA 3G9ZA 1KU0A 2PU7A 1H22A 2VJCA 1ZD2P 1XZGA 5ALRA 3VVMA 4AB1A 3F96A 2HL6A 2YXPX 5AKXA 1F0PA 4HAIA 2QS9A 3HABA 1F6WA 4EY7A 4INZA 1F0NA 3L1JA 3GELA 4UHHA 1AZWA 1JJIA 5DYWA 2FJPA 5C81A 3QMVA 4J3JA 3CCBA 1IVYA 3DNMA 1N8SA 5EIAA 3QM1A 3UUEA 3C87A 4KYVA 1Q0ZA 2WIKA 4EY6A 2DHEA 1SCKA 4AX4A 5AKIA 1G66A 4OYLA 3IIIA 4X95A 3WWDA 4H7JA 5AKZA 5FOQA 3WWEA 4BAZA 1E8MA 2VTVA 1CUUA 3CN9A 5CURA 5KWJA 3DYIA 4LIPD 2HU8A 5A71A 4BCBA 1USWA 2XUGA 2FX5A 5FUMA 3WWCA 1K6EA 1GPNA 1DTEA 3MUOA 3AUKA 3R3VA 1B41A 4QNNA 1SC9A 2DSNA 4H77A 5JASA 5A2GA 1UT6A 3ZI7A 2OAGA 1IZ8A 2PX6A 4OUKX 3QITA 1ACLA 4X7BA 1IMJA 4YX9A 5HF5A 4Y9SA 1UFOA 3LCRA 4JEIA 1QIMA 1VLQA 1A8SA 3WZMA 4GBGA 4AXBA 1CUIA 3WKBA 2AJBA 5CT5A 4L9AA 4E15A 1CUFA 3BWXA 1HLGA 2QUBA 3SWWA 4X00A 3F8SA 2WQZA 5ALOA 4OB7A 2JEZA 2WFZA 3GROA 3WYNA 3O4HA 1NX9A 4B81A 4HVTA 1CUSA 1NU8A 5ALGA 3RARA 4JH0A 4NMWA 2ROQA 3KOOA 4BCDA 4M0EA 3K6KA 1QIDA 4NZZA 4QDZA 5SYNA 2ZYRA 3WL5A 5LKRA 4G4JA 2VF2A 3DJYA 1EVEA 5AKKA 3I6ZA 5KWIA 3D4LA 2RI6A 4OB8A 1LBSA 4M0MA 3H17A 3Q8WA 3Q0TA 3M3DA 5K3CA 5JADA 1UKCA 2GBCA 2G5TA 2WUFA 4FNMA 3GZJA 3DDUA 1VOTA 2HDWA 4WFJA 2RONA 3D2AA 3PF8A 5T4EA 4OCZA 4ZV9A 4QZVA 5HZGA 5BWCA 4KE6A 3ZLVA 4PO3X 4E46A 2OG1A 3TGLA 3H1AA 4C4YA 3V1KA 1VKHA 1DU4A 4I3FA 3AIMA 1CUYA 3A70A 4WDQA 2VT7A 1CEXA 2XUDA 2C4HA 4BRSA 3FYTA 5LIPA 5CXXA 3C8HA 5K3BA 3I2GA 4BBZA 4EUSA 1QFSA 4DNOA 2ZSIA 4BCCA 4UFOA 5BV7A 2IIVA 2HM7A 2I3DA 2PU5A 2W6CX 1U8EA 5AM1A 5ALWA 1QE3A 5ESRA 3HSSA 4P08A 3WK6A 3VDXA 5HKBA 3H2HA 4EY4A 1A88A 1DX4A 3B5EA 1R1DA 2WHQA 1SFRA 1U4NA 5T4HA 5FLKA 4CCYA 1ZJ5A 2NW6A 1BEEA 3FNBA 4QE3A 1CRLA 2RGUA 3VKFA 3BE8A 3MGAA 4CI9A 3PI6A 2OQIA 1QIGA 5BWBA 2JGJA 2BUAA 5YASA 2ORYA 3A2LA 3FLAA 5I7UA 4XWGA 4X6XA 1AUOA 1FFBA 1LPSA 1JMYA 5DTJA 3FSGD 4DMKA 3W06A 5AKHA 4AO8A 1SCQA 2GZRA 3H19A 4B6GA 3OG9A 2C5GA 2HRQA 1AKNA 3WQHA 4Y2PA 3CCCA 3IUQA 2ECFA 2OXEA 1GZ7A 2BCEA 3A2MA 3PDCA 4RPCA 3BJRA 4FWBA 4C89A 2P8SA 4G5XA 1CUXA 1BU8A 3MUNA 3DKRA 1PJAA 2QVBA 4DIUA 5E2IA 1WCYA 2PSHA 4PF1A 4UBNA 3GFFA 1T2NA 3R3ZA 1CUZA 3QMMA 3AIKA 2XDWA 1QTIA 1H23A 5EIEA 4GDMA 2OGZA 1UK7A 5IVIA 3A6ZA 2XT0A 2WFLA 5JAOA 1AX9A 5FKJA 1C7IA 4FFWA 3F9CA 1P0IA 1YB7A 2XMGA 3V1NA 2RAUA 2WUGA 1K63A 3G9UA 5CRIA 2OAEA 3BDIA 5HFAA 4CG2A 2VT6A 1XKLA 1ZD5A 4A5SA 4UPDA 1C7JA 3N0TA 7YASA 4MWSA 3TEJA 3OURA 2HRRA 4FLFA 5AO9A 2CZQA 1H2ZA 2J3QA 1GPLA 2HA7A 2QMQA 3OC0A 1SOMA 1UKBA 1CLEA 4LXHA 5EHNA 3KSRA 2HADA 4ETWA 2HFJA 5AM4A 4DTCA 2Z3ZA 4C4XA 3AZOA 4ITVA 1XKTA 1YS1X 3FLBA 5A6VA 4U2CA 3ESAA 3SC2A 2J3DA 3R3WA 1XZLA 4X71A 4XIIA 3WMRA 4OPMA 3U1TA 4PW0A 5JYCA 4AZ0A 1F8UA 1YASA 3I1YA 5K3EA 1ODSA 5JZBA 1CV2A 1QTRA 1LPPA 5E4YA 3C6BA 1AURA 4G1FA 4GHWA 4B85A 5F4ZA 1YB6A 2QXUA 4S0XA 2WLSA 4NVRA 4BE9A 3VJLA 1R50A 1UWCA 2WUEA 1DINA 4DYHA 1PFQA 3DEAA 5CMLA 4X3CA 4J0KA 2HIHA 2XUAA 5JD5A 3RLIA 2HA2A 2BUBA 3GBSA 2ACEA 1HKHA 1MTZA 5AKJA 4AN1A 2PSDA 4E11A 4UHCA 6YASA 2G4LA 2CB9A 2XE4A 5ALLA 4QEKA 1FFAA 5AJHA 4HS9A 3C5WP 1WB4A 4BE4A 4G8BA 2ZJ6A 2QR5A 3SX4A 1P0QA 3TJMA 1EVQA 2PPLA 4BVLA 5CXUA 4F21A 4DNQA 1B6GA 4B0OA 3G0GA 1ZGBA 2QT9A 1MT3A 2PL5A 4KJXA 1XZHA 3H2GA 4I4CA 1GQRA 2ZSHA 3MVEA 4KAJA 4FBLA 3FVRA 2O7VA 4AMYA 1VA5A 2OGTA 2ZYHA 4RE5A 5AI4A 4H7FA 1FJ2A 5HQ3A 3IVMA 3ICWA 3G9TA 4Y7DA 1XZKA 4HTAA 1JT2A 3E3AA 2WHRA 1LZKA 3FSGA 5FPQA 4TGLA 3WZLA 5D6OA 3O0DA 2QKYA 1XZBA 5LZ4A 1TCAA 1R9MA 3H2JA 3R41A 4Y2QA 4Q05A 4Y2RA 3EF3A 3IDAA 2JBWA 5ALNA 5ALJA 4JYMA 3D2CA 4CG3A 2C0PA 3FVTA 4P9NA 1JKMA 5ALUA 5LP1A 5HCUA 5AI9A 4FHZA 2VJAA 3T52A 5LZ8A 2EDAA 4ARAA 2VJDA 3P2MA 2HFKA 5JANA 4P92A 5ISMA 5ALVA 4UBMA 1UK9A 3PE6A 5LYYA 5JZSA 2IX9A 3WK7A 4DNFA 4K6KA 1DQZA 2B9VA 2O2IA 1HBJA 3H2IA 1BE0A 5FV4A 2WKWA 1N5MA 1QO9A 5ALDA 5C8VA 1LPOA 5LKAA 3WKAA 3KWFA 3AINA 2ZVDA 3DL7A 3W9UA 2ZYSA 4X85A 2HA6A 1XLUA 3G02A 5LZ9A 3HACA 1XLWA 2DFPA 4Q3OA 1YA8A 1HL7A 4H7DA 2WIFA 3H1BA 4G4GA 3M82A 5SYMA 1OILA 4FKBA 1R3DA 1BN6A 1R9NA 1CVLA 5D3KA 2X8BA 4AZ3A 1KU6A 3G9XA 5JD4A 4CCWA 4UBJA 1LNSA 3DQZA 2ES4A 2WU3A 5EFZA 4UHEA 5E4JA 5HF9A 1K4YA 1FSSA 4J0DA 1YR2A 1EB9A 4LYEA 4RE6A 5J3JA 1VXRA 4N5HX 3ZLTA 5AOCA 1JJBA 2WG2A 1Y7HA 4J0CA 3L1IA 3SK0A 4UHDA 4QLOA 1MU0A 3IA2A 3WA6A 3G0DA 4LYDA 5HQ3B 5AI5A 5AK6A 4FOLA 1DQYA 5CBKA 3DYVA 2JGKA 3QMWA 1Q83A 1LBTA 1RYYA 3G7NA 3QPCA 1GKLA 3STUA 3DD5A 2HHAA 2ACKA 1MX5A 2H9YA 3ESDA 4PV7A 3RKSA 2ZYIA 3QBJA 3ANTA 2WTMA 4DM7A 1ACJA 4MJ3A 2CBGA 4IO0A 4ZRDA 3HZOA 4BTLA 3QPDA 1VE7A 4M0FA 3LIPA 5AKGA 1UOOA 2I78A 1YCDA 1RWQA 1IUNA 2I3ZA 4DNPA 4TVKA 2PSJA 1UOPA 1GGVA 4FLMA 5ALMA 4U2GA 4DSZA 3M83A 1Q0RA 1GQSA 5ALKA 3C45A 4FDMA 3IB3A 2HU7A 1MNAA 2WUDA 4BATA 3FBWA 5JATA 4HZGA 4ZV7A 3G8YA 4J03A 1CQZA 2WG1A 3DS8A 5DNUA 2XLCA 4H0CA 1R88A 1OXMA 2IITA 1ZI6A 1P0MA 2XMQA 4Y2SA 4DGQA 1XQXA 2BUCA 2XUJA 1QLWA 1ZGCA 2O2GA 1XLVA 5AM5A 4A16A 4KACA 3FOBA 4QWMA 4Y2TA 4Q82A 3JW8A 4BB0A 3AZPA 3S2ZA 1XZIA 1BS9A 5A7HA 3H18A 4Q1VA 3DKKA 1VA4A 4J0IA 5LLSA 2XMDA 1EH5A 2C58A 3R0VA 1X70A 4LKOA 4Y2YA 5JAUA 3BL8A 1GXSA 5CT6A 2YASA 4HRYA 4BYMA 1AC5A 1CUAA 2Z5GA 4UBOA 2WIJA 3I1IA 2WIDA 3DLTA 2VQ6A 2OCGA 3WKCA 1MAHA 2QOEA 1T4MA 3RM3A 1THGA 3OOSA 4GXNA 3BDVA 2DCMA 5C7YA 3R3YA 2Y6VA 4LHEA 2QRUA 2XUFA 2XQKA 3VVLA 4X97A 4ZI5A 5HK8A 3ANSA 5DNVA 1LZLA 1ODCA 1C4XA 1ZI9A 4BRZA 5D3ZA 4PSDA 1K5PA 3WLAA 4JYPA 4H7EA 3STYA 2WHPA 5AIAA 1CUEA 5JIBA 2V96A 4C6HA 1XQYA 5ALQA 3T4UA 3STWA 4GEGA 2HA4A 3AFIA 5AOBA 4MEAA 2O7RA 3O4JA 3ZPXA 1FFEA 2JGMA 4Y2UA 3HI4A 2GBFA 4OB6A 2DQYA 4AQDA 1OCEA 4KAAA 1ZD3A 4LXGA 4E14A 5AIBA 2CKMA 2PSFA 3I6MA 5FPPA 5CH8A 1LPAB 4QWWA 1J07A 4YASA 1ETHA 2WJ3A 1MNQA 2CEKA
chains in the Genus database with same CATH superfamily
2O2YA 3AEZA 3ZK8A 3CLSC 2JK0A 3EGCA 4F60A 4LRXA 2AQ8A 1P4GA 5HGJA 4KSCA 4R9RA 3W90A 2FUNB 1QMPA 3EGDA 3EZ6A 2OC9A 5AUPB 2J3EA 2ZJYA 3RQSA 4HNAA 5KSOA 1FDIA 3KZKA 4MS1A 3STXA 4ZJYA 3L01A 1T6ZA 5JJBA 3R5HA 1N36B 2PJZA 2F8MA 5CVDA 2PZGA 2D0DA 1LXCA 2G5GX 4AKEA 1E5DA 1XTBA 1WXHA 1ZN8A 3IV9A 4PRLA 4AW9A 1PS9A 2CLDX 2AVNA 2C57A 1ZD8A 4HOYA 1E2JA 3KG2A 2QL7A 5ADWA 4WFQA 1J1ZA 4H17A 4O4IF 4URUR 3ZCQA 1F6BA 3VR5D 1XO1A 4NICA 3QUAA 4M22A 4RJIA 4W7IA 1UPUA 2PVCA 4G4IA 3OZGA 1CRQA 1GTL1 3SEAA 4GNKA 4RMHA 3BZUA 5GTDA 3QHPA 2QDXA 3GLIA 2UZIR 3BWEA 2EKQA 3CUEF 3G17A 5KINB 1VRCA 3RVOA 1D6MA 4NBWA 2FEWB 3L4BA 4E08A 1I7SB 5A1JA 5BRNA 2X77A 4MVJA 2I4LA 2VRWA 5C7OO 1JG1A 5J5AA 2HNBA 1PLJA 4QUJA 2GEVA 2OAQ1 4AXXA 1QDEA 3IAAA 3WK5A 1QP7A 4XUDA 1UM8A 2A3NA 4UCXA 1DG9A 1KTVA 2AFIE 4N0PA 3N2ZB 3WL8A 4EW2A 1X7GA 1PFUA 4ON9A 4H16A 3P94A 4HNSA 1G17A 3LZDA 5CB8A 4IFTA 1FRQA 2JA2A 2UUBB 4QPDA 4PGHA 4TV9A 1ZX1A 1NFQA 4DZTA 1PJSA 4GGMX 4IKOA 4URFA 2CUTA 4GMGA 1BN7A 4HDMA 4YGYA 4EF5A 1Q6YA 1NLFA 1PI3A 4E2FA 4EPRA 1YQTA 1VRWA 1JLRA 1WDKA 4JT4A 4WFIA 4EO7A 1IQUA 1DFHA 1ZMTA 1XDBA 1P6UA 1ZEJA 5EY5B 3DZBA 3I5MA 1MC1A 3G5AA 4NULA 1WF6A 4NEHB 5EQDA 1W36D 1DS6A 1O96A 2Q6IA 3TRJA 3JASB 3K73O 1J06A 4NOKA 3AQ4A 2HRDA 4B3FX 3DFFA 4K2HA 4FILA 1AA6A 1XUOA 2JASA 3ETHA 1HDOA 3D7RA 4AQ7A 1GQQA 4EVQA 3K6SA 1PHPA 2W8BB 2XUQA 4NENB 4QHYA 1BRTA 4J7AA 4X8LA 5DPMA 3RUHA 3DMDA 1C9JA 2AFHE 7ADHA 1HE1C 1T26A 8LDHA 5KKNB 1HQYE 1MO2A 1TCUA 2DQ4A 1PWYE 1XU7A 4RVGA 3U7IA 3X44A 5F3RA 2NSHA 2C42A 4IXDA 2PT6A 4EITA 4MDYA 1NYRA 2FEPA 1ZMRA 1EZ4A 1FNMA 3QVSA 4AKSA 2Q4TA 1WM1A 3JQEA 1XZMA 3A6FA 3IHWA 1EUYA 1XRNA 2QVCA 2C5EA 4B2YA 1AUPA 2O2XA 3DMHA 2EX4A 3V4PB 3FI9A 5J43A 2NUTA 2XI4A 2PKQO 3P20A 4GGOA 4M76B 4BQOA 2JI4A 2ONYA 2YZNA 3BUSA 5KYXB 3SEZA 4G36A 5DI3B 2ALJA 3FOZA 2D62A 3KQVA 4IHJF 3TMKA 1AMUA 1TLTA 3LUGA 3FFTA 3GCWA 3WGOA 4DSTA 5LWQA 4BO4A 2ID8A 1P2DA 2ZANA 5EE5B 3I2HA 1J4AA 1M2NA 3TFWA 1COWD 1VJ5A 1SVNA 5IBQA 1M54A 3CEHA 4HPWA 4D9FA 3GFSA 5C1PA 1ZVJA 4BB6A 4Y9UA 5E38A 5EIBC 4G6ZA 5C5CA 3NHAA 3S7ZA 3RC7A 2VAXA 3MQ2A 3K4PA 3SZMA 3JR3A 1DEAA 4OO3A 1RBQA 1UXHA 5JO0A 4W5OA 3HP7A 5GY7A 3A9CA 2CYBA 2MYNA 1H65A 2VR1A 4DSAA 1NBOA 2EL9A 1XELA 4EA9A 4GF5A 4LSZA 4NEQA 4S1PA 5EJGA 1X7WA 3T0GA 4EQ6B 1N7IA 1UT5A 2HF8A 3EF1A 1KJWA 4UVGA 3VU9A 5L3QB 3NOXA 2V7TA 4XD2A 1D4ZA 2ADOA 3S99A 5K0JA 2PLRA 2CLKB 4OQEA 4AX8A 4CKEB 1KOLA 4COOA 1VHTA 3M5CA 4Q4JA 4RGYA 2VSFA 4URYR 2P4HX 4YREA 2X3FA 1DJQA 4A10A 2G0TA 2JHAA 2Y0EA 5CJJA 4F9FA 3JQRA 1J21A 1TQHA 4P36A 3T9FA 4JR0A 5AUQA 3A3NA 1U7UA 1JTVA 4MYSA 2BMDA 3V7WA 1G41A 3WGZA 1DX6A 2X5NA 4Y2JA 3REQA 3SQOA 3DXFA 3JRXA 3OQ6A 1E8NA 3KELA 2C7BA 1JMKC 3NDPA 1WUTA 3GA7A 1FP2A 3OT1A 1OMOA 1ZZEA 2D5LA 2OCIA 1JE0A 1CIJA 3DXXA 1YVEI 2MHCA 3N8NA 1BKSB 4I6EA 4UATA 4UXIA 2P5SA 4P7JA 1JPNA 5EQFA 5BP7A 1TZMA 1UZUA 2CXXA 2E4YA 2IHYA 2PDAA 4UAJA 4POOA 2QNBA 4EEZA 1N3LA 1OAOC 1YZKA 2HK6A 3SF0A 1K8QA 2WMOB 5LQNA 1IZ9A 2VATA 3IDOA 3LA6A 2HCTA 4PICA 3SJUA 6REQB 2GXQA 4QPJC 3H04A 1DC7A 4HPXB 4JL6A 3IRUA 1NBME 3TAXA 2QI9C 1MQ9A 3IVCA 4H18A 2DXIA 2OHXA 4ZAYA 2X3UA 2ZRGA 1EGVB 2POQX 3V5NA 2ST1A 3OQPA 3TRDA 1ZN7A 2VEOA 2G7ZA 4IX1A 3SYLA 3IDQA 2J31A 4I36A 1VJGA 2GTPA 1PFWA 1W8DA 4LBVA 2WJ4A 5H59A 2M9MA 2QW1A 2FMHA 2GAIA 3I3SR 2XKJE 3PC7A 4OHZA 3L49A 1NQTA 2XJ4A 4BO9A 2BH2A 1KY4A 1U8CB 3U48A 3JU3A 1VL0A 1HQCA 2FP4B 3MK31 2OP1A 3B1WA 4E3WA 1RCTE 2GAJA 3L8FA 1PZHA 2XMZA 3GCXA 3WLHA 4I1VA 4DUYB 1LSUA 2R00C 5E3IA 7MDHA 4G0WA 3HKEB 5ALFA 3A7DA 4C87A 3G0BA 2BELA 3TB4A 1R9JA 1JAHA 4DILA 4UAUA 3SXPA 6ADHA 2P62A 1Q1AA 3T5BA 2PEZA 1I33A 1LNZA 3TQOA 1GPKA 4CTKA 1GT91 2WJGA 3AR3A 3VPHA 4HX5A 4GS5A 5D00A 1BHQ1 1LBEA 2NO9A 2PLFA 3FJ1A 5LBIA 2CFIA 4ZK2A 4YJDA 4C4RA 3BD8A 3K3PA 4K9QA 3HFJA 2MDTA 4U1RA 2Z4RA 3L46A 1SBNE 3N07A 4M55A 5FWDA 4UASA 5FTJA 1QGOA 1GQFA 5DO9A 5DHFA 5UKDA 3PEYA 3SQXA 2HMTA 1RYZA 4PX2A 3V7YA 5I7SA 1X1TA 3EXAA 5EVJA 4XI9A 1TIKA 1YR7A 2CXUA 1UKYA 2REBA 4OJMX 2ZTLA 2GUWA 5FOUA 1A5AB 2C3UA 4JJEA 3OC6A 5DLPA 3S8EA 1J8DA 4QDTA 3E5MA 1ZJJA 1EG7A 3QIAA 5FYDA 3QH4A 3QE4A 1I1NA 2WILA 1XTQA 1G98A 1BCSA 5ED4A 2QAGC 5GV7A 1FL9A 4I8IA 3V00A 5I9IA 5IK2A 3DOHA 3MILA 1VG0B 1T9GR 2PGDA 2VPYA 2O3RA 4IG9A 4UARA 2DM6A 1B23P 2GEBA 4MCIA 2XQIA 1JWAB 3TCNA 2IIBA 3PICA 1EFPB 2IYNA 3GLGB 1ESMA 3ETLA 3JR7A 2GN1A 4PR3A 3O3CA 4DR7B 5ARCA 4BFTA 2QP9X 4FMDF 3BIXA 3QNWA 1LLCA 1GU1A 2H08A 3AV3A 4MQLA 5CYFA 5G53C 3SBOA 4AYTA 2IY7A 2QN1A 3LQRA 3F6CA 2TMKA 1XLTA 3FZQA 3B8EA 3OTIA 1WHTB 2GN4A 2OCKA 5M5BA 3ZVMA 1TRHA 3PDIB 1TTHA 2GGSA 2D1RA 2QZ9A 1SVKA 2QW0X 5L7TA 3LT5A 2BSQA 2QLJA 2YXBA 1L5WA 4DKXA 3IL2A 1W4LA 3BFKA 3SDZA 4EG3A 1C30A 2AKEA 4UNNA 2JIBA 3C1OA 1BJRE 3UA3A 4FTWA 1FVXA 3LVFO 1L7VC 3M9WA 5DNYB 1BX1A 4UCFA 5IARA 4ZGWA 1HM5A 5JR3A 3PEWA 3RV3A 1GJRA 5JD6A 5KSPA 2ZRLA 4IMJB 5KNCA 2V7UA 4JN6B 4FGKA 1HE2A 3PRYA 5AICA 5HJ5A 3CW8X 3GUUA 3TR5A 2EF0A 3NDIA 3SNHA 2W71A 1GL3A 2PMCA 5F12A 4MRPA 1E5TA 5HNKA 2HTFA 2H1IA 2Y6UA 3BJEA 4Y0AA 1SQ5A 1LDBA 1SQ6A 4YDRA 1E1CA 4RV4A 1I3KA 1EA5A 4RCZA 2PL3A 2YVQA 2HHJA 2HXGA 3RVQA 2W6IA 1V5GA 3IULA 5AH0A 4R1UA 4YT5A 1WEKA 2E9SA 1SD1A 3VISA 3K8YA 1V3QE 2X6RA 3PITA 3NPAA 5EQTA 2ZAGA 2Y66A 1N5LA 4LJ4A 4BC0A 4F5DA 4CKWA 3QLVA 4NCAA 2G9NA 4CKXA 1W1UA 4K9RA 4EI8A 3IOBA 5JAQA 1RM0A 1DBPA 1XMIA 4LKRA 1T34A 3THYA 1Y3IA 2C8VA 1WSAA 2KHZA 1XDDA 1XZEA 3I9V6 3Q3IA 5TQ2B 1C8KA 2E85A 4NJEB 1T1GA 4OG2A 4F5EA 1U9CA 2WSIA 3G88A 4BX3A 3CLUD 2REQA 5KYKA 1QQBA 2C2KA 3JQQA 3S29A 3G0OA 4FMBB 3VU3A 3DEKA 3V9AA 4C20A 4ZYWA 2V3VA 3RSHA 1AK1A 4PQEA 3BF7A 2EX1A 4IFEA 4FQ7A 3KHKA 2ISSD 2OOKA 4P4UA 4NK4A 3NJ4A 3KYIB 2F3QA 3EYAA 3MA0A 3TZBA 1EG2A 1G18A 3H6GA 1H6BA 5BN4B 4CU2A 5A3RA 2CJXA 1MBZA 2Q8NA 2DBVO 1U2EA 3HJHA 4Q0MA 2VAVA 3MQFA 4TKZA 4G5QA 3ZZUA 4JA2A 1SJ9A 2RC6A 5SZJA 1FJXA 1U8ZA 2Q3BA 3F2VA 1RPAA 2JIRA 3FUCA 4BX0A 3FOEC 3TVTA 3UAWA 1X1AA 2VXBA 2IZ6A 1W85A 4A6XA 2ZATA 4E13A 3AW9A 1UFQA 2C1ZA 1L4NA 5IHPA 3OU2A 2I2BA 1ZNYA 2HBZA 4JSRA 1C2TA 3S7TA 3BRSA 3IXMA 3URMA 2YCLA 4P3NA 2IYRA 2Q5IA 1K66A 4R4JA 4QELA 4HEA6 1WABA 1MC5A 4GD3Q 4OXRA 1QIIA 3TNLA 3TRHA 3ZOKA 1YQGA 2YIDA 3KPVA 4QG3A 1R5JA 2ICAA 3P2YA 4LFAB 2AI2A 3PDUA 4LBZA 4AU1A 4R1SA 2UVDA 2FSIA 2W2OA 5JS7A 3NBKA 1AGYA 5SY4A 3RS3A 1B1CA 2YYSA 4Q3KA 1CUWA 4BFCA 1EVJA 5LZ5A 4XWTA 3ZHZA 4JGBA 1WUIS 3HE3A 1BDMA 1FCJA 1QGUB 4NKRA 5F21A 2IDMA 2O7QA 3DTVB 5G0SA 5IG2A 3EXHA 1U1FA 3QZUA 4G8DA 3VYUB 3C74A 5C2JB 4ZI2A 3TGWA 2CFSA 3GVIA 5CD9A 2AE2A 4D0GA 1CJSA 4CN8A 3RIYA 3G8CA 4L6CA 2C5AA 1YZLA 3OMLA 2JFUA 4PPFA 3AWDA 4QRIA 2RH9B 5GAJA 4ZGGA 1MABB 4Q7KA 4ZO9A 2QSUA 3IP5A 3IPYA 5DN6A 4M21A 4ZHQA 3ZW8A 1YA4A 1EB8A 1NF2A 1BHJA 3UK7A 3THOA 4R9UC 2ZVQX 3KXIA 3QKRB 3GH3A 3P2EA 2R8BA 3R75A 3RI3A 3WXBA 9GPBA 5IH7A 4XM0A 4LAFA 1IRIA 1HG0A 1Z4PX 3DR3A 4WD3A 3ZUGA 4YAIA 3DLBA 5CFOA 1JQAA 2GNOA 3KJNA 4D2IA 1ADJA 1MC8A 3Q11A 4YJ3B 4YP7A 2RI1A 2QE6A 3PNQA 2CDAA 1RMYA 4ND8A 3UGQA 1PTJC 1KRWA 1JSCA 2Q3LA 3OPQA 3AL0C 1F3OA 4L4YA 4DLBA 1YQXA 3V2GA 4HWSA 1OI4A 1TYAE 3FA2A 2JW5A 1E9BA 4J7UA 4TTAA 2BGNA 3CSDA 1GIAA 3AILA 1UFKA 1CPYA 4HAOA 3OZCA 4I2VA 4ZN6A 3P9IA 4OYHA 1GGEA 3EF0A 3KIPA 1WMAA 4MWTA 3GRFA 5IABA 2CEAA 4P32A 1L7XA 1XEFA 2WJHA 4EP1A 5DM60 1FFXB 1EK1A 3DFUA 5E1DA 1PZNA 3T1YB 4EUEA 4FJ2A 1RNLA 5ADVA 3WADA 3N8DA 3T3DA 3HBNA 1P6QA 1GD1O 2AXQA 1K7XB 3HLKA 4X3PA 3H8JA 3ZCTA 4F4UA 1E32A 3MOSA 3P0HA 2ZYAA 1L7DA 2OV2A 4DM3A 4EX7A 1NVDA 1TJ4A 3S1AA 5B3KA 3EVFA 2JLYA 3NGLA 3PIDA 3D0QA 2LUOA 1ZCBA 4G63A 1NVXQ 3T7JA 5DEIA 2H3HA 2QGNA 4Q4HB 3FGPA 2RJ3A 4JYBA 4Y98A 3S40A 1ECCA 4EB3A 4FLEA 1EP9A 2EDCA 5IZ4A 2LRHA 2QM0A 3PX3A 2AW3A 4FR5A 2IP1A 4U39A 1WV1A 4W99A 2AEFA 2PA3A 2NXWA 2Y1KA 2ZSBA 3E7XA 4EA6A 1M8FA 3E35A 3CLRC 1KDRA 4K0RA 3OJWA 3D6UA 3IQHX 2RARA 3HADA 4ITUA 5ALZA 4E5NA 2NXCA 3TTXA 5JVDF 4FDAA 3NWEA 3NDJA 4TQ9A 5JDIA 3DULA 4RW0A 4ZCTA 3F6PA 1MB9A 1RHKA 4RTJA 2O8DA 4R1MA 4OBEA 1XTPA 2NPIA 3A31A 1VLJA 1NRXA 5AW3A 1GSAA 1JI3A 1I13A 2ORVA 3FWPA 4IVPA 3QIVA 5EEHA 4Q4CA 1ISIA 3X1DA 1NKTA 4GLJA 3ZE2B 4OKIA 5CLGA 3LC0A 2ZBDA 2CL0X 2C4WA 4G5RA 3AGQA 1HYQA 4DRZA 2F17A 4EENA 2GAAA 3ET4A 4FR0A 1Y98A 4DPMA 1JLLA 1AN0A 4O2BF 2Z57A 5A9TA 1JHVA 1JU4A 1L4HA 1QG6A 2JGLA 4REMA 2DR0A 1PSZA 3TPZA 4YAKA 3CNHA 5IJZA 2AZDA 1G5FA 2EHDA 2Q5OA 2R97A 4XYMA 3JVUA 3K9QO 2RIPA 1W36B 3HFRA 2E6KA 2V6MA 2Q0QA 2VNIA 4U7PB 3SS7X 3RS4A 2O2JA 2AMFA 1W94A 4JUIA 4ZDKA 2QPTA 3LK6A 3O26A 3LWDA 4I55F 1GKKA 5DNAA 3EIFA 3IBCA 1BEZA 4UFPA 1M0WA 2FPPA 3NHRA 1O97D 3NUGA 4P33A 5M34A 3O8QB 1CUVA 2BDTA 1S5PA 2YHIB 1C3OB 1SCDA 1TYBE 1FU4A 3IB6A 3PBKA 4OY3A 5HF6A 4XD7A 5KNBH 3L0OA 4QBKA 1LU9A 4MUGA 3RTBA 4FFMA 1Q19A 1I6WA 1JSLA 3I2IA 4C9BA 5FHRA 1CQWA 2VT2A 1P1RA 3O9MA 1H0RA 2NVWA 3D4NA 3GGJA 1VP3A 2ZRIA 4N6GA 5TDHA 3I58A 1Y8CA 3ENWA 3A04A 4CMEC 1B76A 1CEQA 3NKLA 2VSXA 5AJVB 5EE0A 2FFJA 2QPLA 4BMSA 1KF0A 1JR4A 4QBHA 3MGBA 4WJLA 2FMIA 1M5TA 3EDOA 2OXCA 4RQTA 2M1ZA 3R6TA 3WLNA 3EJ6A 3KSBC 3WGKA 3GCZA 3D59A 2EX0A 4PS0A 1MORA 5CB0A 3FHJA 5SV2A 1YKGA 2OUIA 4H7KA 4CIBA 1VPTA 2X7HA 1DWOA 1ZUIA 2HRCA 3PE3A 4LA4A 5FWYA 3TEFA 3BX1A 4DA0A 4DDHA 5JH7B 1O87A 4DUZB 2RC5A 1KGSA 2W6PA 4X7PA 1DC5A 1W1IA 2JH9A 4AO7A 1QQAA 3PUYA 2WOOA 4BAGA 4D9JA 4FB5A 2DE0X 1EDEA 1ORIA 4AWXA 5IX8A 1R16A 3B3QA 2VS1A 4G65A 4PX9A 1L5OA 1JEDA 3LX5A 2QJRA 2MTBA 2O3SA 2AKYA 2ZM6B 3HVIA 2YQ4A 3WLFA 1KBOA 1D0VA 3I9V1 2JFQA 2JBAB 2VBFA 4PSKA 2XB8A 1L5VA 2GZSA 2VK8A 3MJHA 1G8JA 1ORVA 2NPOA 3F46A 3NX4A 1EFKA 3ZGLA 2PRZA 2WG0A 2PMEA 1E1MA 4XVCA 3FSRA 5BNFA 3D5TA 2YOFA 3U1VA 2O2SA 2HNKA 4ZREA 2O5EA 3L5OA 2R1ZA 2IXFA 5FO0A 2AWOA 4YRKA 1JG7A 2Q3EA 1N2SA 1N0WA 1MJHA 2CK3A 3WB1A 3DH0A 4YCJA 4ZPXA 3U3OA 3FNEA 4X90A 5K8VA 1P4JA 2DLNA 1JLHA 4NF2A 4RDHA 1KP9A 5B1HA 3ZE9A 4BO8A 5AM2A 2JVKA 3NHSA 1HZJA 4LC9A 1ODLA 4V0QA 5GIOE 4GLFA 2VYVD 3U0VA 4JB0A 5H8WA 3FNHA 4WDRA 3FJOA 1LUAA 3V8MA 1UM9B 2BFWA 4EUHA 1Y7PA 1H0SA 2XUHA 3FROA 3ZU2A 1NJFA 3RANA 1RAAA 4LZAA 4JLAA 3NC4A 3QX3A 1LJLA 1TK2A 4R83A 4OHYA 2FF7A 2QX9A 4PLGA 4CKCA 1K6JA 4F6LA 4QO7A 5C7IO 2PZBA 1RWNA 4DHEA 3W9BA 4EO9A 3DPUA 4HEA1 1NC3A 5GPBA 3T3PB 1MQAA 1G8PA 2IYUA 3OOHA 3WO0A 5P8WA 1T3TA 1OX6A 3KQYA 2J9RA 5I5GA 3AH8A 1VI6A 1SVLA 3JCZA 1TK3A 5MGBA 1D07A 3OIWA 4RK0A 5TEWA 2WMYA 4QDOA 1A9QA 1R74A 3KWJA 5DNCA 1NVAA 3CXUA 5JDCC 3WRYC 2C3YA 4KLNA 1U2GC 3N5CA 2JIPA 2OFFA 2FDCA 5ALEA 2WWYA 3I2KA 4MTCA 4NV0A 4WZAB 3Q5EA 4MIOA 2ZB7A 1M6VA 3OTOB 3EFOB 3AM4A 1KFBB 3IBSA 3OQNA 1UKZA 2HSZA 1VKNA 2BEWA 2F9MA 1JLKA 3BPSA 3NTXA 4MMZB 4YCBA 3UJ6A 4AJOA 1YZFA 5C34B 5LXTA 3MCUA 4F4JA 2P2ZA 1EHCA 3FKQA 5ITZB 2QJWA 1WHSB 4U9UA 5CEFA 3F4BA 4RGQA 3QELB 3PKJA 2OBFA 1HPLA 2A9VA 2AQHA 4IZIA 1XGKA 2EJCA 3KOMA 1QC5B 1EK6A 1JS1X 3ZY2A 1CFZA 3E61A 5TXGA 1XZDA 3KU1A 4WN9A 2BI4A 1LLUA 3WYFA 4ATNA 5D7NA 3I45A 4PYNA 3SCZA 3COJA 1WZUA 4M7PA 2PVSA 3E2MA 5K8JB 1OJLA 3FUTA 5JJCA 1I2DA 2RKBA 3HXMA 3HYNA 4CF4A 4BNFA 3TVYA 4QDKA 5DP2A 4Z2AA 2VNKA 4QYWA 2JPDA 3EK2A 4UVHA 4MW9A 1G8YA 1G3IA 1RHJA 1L7EA 3MWDA 2HDOA 3QYAA 4IUDS 3IAM6 3KYCA 4OXNA 4TQAA 4F4DA 3PF9A 4PO9A 3E4DA 3HRHA 4PRZA 5BV8A 4BMDA 1BRMA 2GZ3A 2Y1GA 3GVPA 3B1KA 2X0EA 2WVGA 2JLCA 3GRKA 4G1BA 1OAOA 3T7KA 1FJHA 3PHGA 1V43A 4E1AA 3R6GA 3TR0A 1H85A 3CUUA 4G1CA 3IAEA 5AK5A 5K3OA 3EZ2A 1XRPA 4MUAA 3TUIC 1NULA 1XTJA 4D4KA 2WYOA 1KXZA 4MVJP 3HCOA 2DWUA 2XKKA 1KJQA 4G4SP 2D8AA 4IKPA 2ISCA 3T0IA 4E7OA 5LOVF 1NXTA 5LDHA 2RBEA 4UUBA 4BRUA 1LDMA 5DRYA 2NSLA 4GKJB 3VHXA 5DTRA 2ZYVX 1E3EA 1RKXA 2XSZA 3GGPA 4P3KA 4X94A 3RNOA 1MPXA 4B0PA 2GLTA 3DMFA 1QV7A 4RVUA 1D2AA 2NX2A 3RVKA 3JQ7A 3PJFA 3CUSA 4LVOA 5LB4A 4ETMA 3IKJA 4QSHA 1GM5A 5K5EA 1MJ5A 2J87A 2ZQYA 5EMMA 3KEQA 4S04A 5AKLA 2WD7B 3WK4A 4EY8A 3DZKA 3GPIA 5FORA 5AYVA 2G9ZA 2GDZA 5EZYB 2G70A 2QRVB 3AM5A 3P8ZA 4A26A 3QX9A 4BC1A 1NLYA 3BMOB 2HEGA 5A7FA 1BXGA 4MS3B 2R00A 4B6FA 1SKUA 2FPGB 1EDDA 1ISGA 5DHUA 2EU8A 2D0OB 2QMHA 2ANCA 3VZDA 2E18A 2GPBA 3ESBA 4P4SB 4Z1MD 1F2TA 2MSCB 1ZNXA 4BV2A 2XWBF 1X7XA 5M04A 1ZY2A 2R8OA 3UK2A 1E0SA 4CM8B 1KEZA 2NU9B 4DWWA 2C95A 5JARA 4KQ9A 1WKVA 4GP9A 1M83A 5TF0A 1WTAA 4ER3A 4WBNF 1IZ7A 3MOGA 4TPKA 4D99A 3SLRA 3ICVA 2F3SA 3O1HB 2JFFA 1TKAA 2ZREA 4KH0A 4DSNA 1J97A 4BS9A 1L3IA 3HKDB 2XZOA 4C05A 3DWGA 1OH8A 2GLUA 5CB4B 5K0CA 2AJDA 4FDLA 2KSQA 1PEYA 4MVYA 2G9VA 3S2EA 3TGPA 1QZUA 4QOEA 4V2IA 3RFCA 2XXAA 3G5UA 4OAPA 3QYJA 4RLHA 1OPRA 1OQAA 1CY1A 2K2QB 3BK7A 2J0QA 1KOFA 1G7RA 2QAGA 3AP2A 3TZHA 4B3JA 3OP4A 1VE9A 1XAGA 3DV9A 4A8JC 1MDFA 2Q5CA 3MJDA 1Z6AA 4MV3A 4BKUA 3UXHA 1ZK0A 2YWFA 3B52X 3RF6A 1XTVA 2AV6A 4MULA 1VB5A 2CHVA 4QOFA 2IU3A 3KVOA 5DSTA 3WQQA 2QTZA 3D5EA 1IHYA 4TT3D 2WAYA 2F7SA 1CY7A 4FNGA 3LVBA 4QYMA 4JU8A 4QBTA 1VSTA 2VZ9A 3OI7A 3PHIA 3E58A 2HA5A 1A9ZA 3N53A 3PGJA 4PNHA 3U5ZB 2JEYA 1LSOA 3LL7A 4MKZA 4EJMA 2FPWA 3K5WA 1UKAA 2OWEA 2R8ZA 3N8KA 3PQ2A 3G6WA 5KJCA 1XR3A 3BFPA 4OD0A 5IVKA 2QNIA 2GCGA 4X1OA 5TV2A 1FXWF 1AF7A 2IVFA 4OIFA 4DMMA 4CMHA 4YRCA 2LZ0A 1OFTA 1PVVA 2O1EA 2JKVA 5BYKA 2AFIA 3FM9A 3GRPA 5D1HA 1SVWA 2WFLB 3GJ3A 1ZLXA 2FWBA 3A4MA 4FYIA 4OHRA 1RXUA 5T4FA 5LMUB 1J8FA 2CNWD 3PIRA 1E8DA 5BUSA 2AW5A 1H2BA 5IJ0B 3U4QA 1Z2CA 1H2XA 4F1KA 1QG2A 3ZNOA 2UYHA 5GOZA 1U9JA 5G3YA 5CA0A 4PO1A 5BSVA 4M53A 3LYLA 1F5SA 3I8SA 3N3BC 3WK8A 1HT3A 4HKTA 4M9XA 1G16A 3BT7A 2QP4A 3CZRA 2Z08A 1GZ4A 1X2BA 2ZWIA 2Z9CA 5SICE 4IO1A 3RC8A 2J9ZB 3QUQA 1YR8A 2OXTA 4RF3A 3TZCA 1GRCA 4KQXA 2FZ5A 3DEFA 4LXIA 4U2FA 1R27A 3HQ4O 5HDQA 4ZYVA 1GSOA 2CW5A 3L3BA 4WVFA 1SCAA 1YJCA 4Q1FA 1YDGA 3H8WA 2F2TA 5EP3A 1Z5ZA 1JV2B 1DX9A 3EDQA 4QGBA 2ECQA 4H7PA 1XZQA 5G1OA 4B82A 1NMYA 2G8LA 2L17A 2SCUB 5DASA 5JQGA 3CR3C 1KTIA 1LK0A 5BQPA 1H4TA 3FYUB 2AC7A 3KU4A 1DXOA 1A9XB 1XVVA 2YZ2A 3D7SA 3LI2A 1RACA 1HOTA 3AL3A 4NH4A 3ROMA 3WA7A 2ZZMA 4F46A 3JQAD 1NR5A 2NNWB 3VNBA 4WKGA 2HCJB 5L4LA 3R3UA 5H9VA 3WX0A 4Z9FA 2WVHA 5IVHA 4AQYB 2Q0XA 1HT1E 1Z2NX 3R20A 3UAZA 1P91A 3G9ZA 1MR3F 3MIZA 3WLJA 5E7JA 1PZFA 2Q8PA 2VPXA 2YINC 2PGNA 3VZQA 4LJSA 4DXAA 4CEJB 1C3VA 2QUHA 4KNWA 4GZ3A 1T4GA 3EVTA 1WG8A 4H3HB 3TEMA 1VIAA 4A9AA 1I2ZA 4EM6A 5IKPA 3O8LA 4F6RA 1MF7A 2PA0A 3AB3A 3NHWA 4F8YA 2R6AA 3VVMA 4LECA 1G38A 1II9A 4Q9NA 4AVYA 2HL6A 2YXPX 4ZEOA 2PZJA 5I4IA 1EUDA 1Y81A 1WXDA 1ZKMA 3EXEA 2O2ZA 2WJWA 1F0PA 1RW4A 2Z2ZA 2YFYA 3EFEA 4NHOA 2JHFA 1FLNA 2QMOA 2W2MA 3HLYA 3HABA 4M86A 4QRDA 5DW0A 4CM9D 4EY7A 4HTFB 4LCEA 3PUVA 3PGVA 2O0KA 4BVBA 2V7PA 1P4HA 3IT0A 1TX4B 4NEGA 3C98A 5CFMA 1E0KA 1F0NA 4IDFA 3L1JA 5HIAA 5CJPA 3VBCA 3AUXA 3DR5A 3VZSA 1Z2PX 4M99A 2BT4A 5JE8A 5BUZA 1AZWA 1JJIA 2YFHA 4N9QA 5F33A 2X1VA 2Q5QA 3KETA 3GA0A 1Q15A 1JP7A 4R5HA 4ZEVA 3ZIDA 2TSYB 2RGGA 4JP5A 5C81A 1CJVC 1DEXA 2WSSD 4FQ5A 1X0XA 1J5EB 2H1LA 1BWRA 1WNFA 2FGKA 2MYPA 3BD6A 4J3JA 3KQUA 3CCBA 3IKVA 3DNMA 1I0ZA 3M7IA 1VQ1A 4MRRA 4CLOA 1OGIA 3SXUA 2DZDA 3ZGXA 1FZQA 3OO1A 2QENA 3FH0A 3QM1A 2EBFX 2C07A 2D3TA 4I7EA 4X1YB 5JRJA 3FNRA 5K0EA 2QM3A 1WXFA 1KP3A 5ICEA 1FUIA 2PX8A 3C87A 5EL0A 3CR8A 4NX2A 4YJHA 4KYVA 1CQXA 3RVNA 1DG1G 5CB6A 3H5AA 4HVCA 4G5HA 4EY6A 2JLWA 2P6MA 1AHHA 4IILA 2OPHA 1N6LA 1P5FA 4FFRA 3S1LA 2KX7A 2QHXA 3KEFA 1T0PA 1TE2A 1WD5A 1I4OA 2ATVA 3IERA 2FI1A 3KT6A 4X1KA 1OASA 1XDZA 2QUIA 5A0VA 4XSHA 3WNZA 2JG3A 2PQMA 4YQZA 3PPXA 2BBTA 2J6IA 1SWWA 2OKCA 2WU0A 5AKZA 4HWKA 2C92A 1VYTA 4IJMA 1JHUA 4B6RA 1RKQA 3HJBA 4X20B 2PAFA 3DLCA 1KKMA 2BIFA 3IAM1 3UGJA 2NTJA 3CRQA 3KEOA 1CUUA 4RFLA 1IN6A 3Q5GA 5KTTA 5KWJA 3AB8A 3IQGX 4LIPD 1QWSA 3NYQA 5FA6A 1F2UB 2OZLB 3D0OA 1AIPA 3NC1C 5EKDA 4LX8A 2E2WA 2RGAA 1L5HB 1YI0A 2FX5A 2ZRJA 1PTJA 3BH6A 3JY6A 1R37A 2B2CA 2J33A 4JJIA 4JIMA 4ZRNA 3ZCPA 4GIBA 3AKDA 4I5DA 5TB5A 1USVA 4E22A 3UF0A 2W6ZA 5BQ5A 5ANRB 4KXWA 4PX3A 3RNLA 1ECGA 2FPRA 5EE9A 5BR4A 1ZGZA 4K9NA 4RV9A 3EEQA 4Q00A 3ZQUA 2AD1A 3C5CA 3COYA 1SWVA 2VQSA 1B41A 2P3LA 4QNNA 4WMLA 3ZCXA 1T2UA 2R7NA 4D8WA 3BGIA 4H77A 1UT6A 4ZFNA 3LC1O 3ODGA 3ZI7A 4F11A 2FRDA 3PA8A 1G8MA 5MDHA 4LNAA 3NHJA 4OGGA 2FN8A 2BJVA 4P7FA 2PX6A 1RBYA 3IA7A 5HKOA 1ACLA 4QULA 4X7BA 1TNDA 3RTAA 4ZYZA 4LF6B 3ESRA 5KOYA 4IMPA 1YQQA 1RLTA 3K0KA 4RMGA 5HP4A 2FV8A 3O8OB 2GDJA 3OICA 4IG4A 3BVPA 1XKXA 2QT0A 1AKTA 5JSYA 1S7GA 1HL3A 1LW6E 2FOXA 2JGRA 3B6MA 3L40A 3DFIA 4XPZA 4WVLA 2OFOA 4BKRA 3BEOA 2BM1A 1JIIA 4JEIA 2C7PA 1ST2A 4FNOA 1JAXA 4GBGA 2KQUA 1SBZA 2ZUCA 4LEIA 4RU1A 3HBJA 3QQPA 4HDKB 2AJBA 2XOEA 5K1ZA 3VSDA 2C7OA 4X65B 3RFFA 3HMQA 4E15A 1CUFA 2GRAA 2H2GA 3BWXA 2X4DA 4A1OA 3CYFA 2P9ZA 6LDHA 3Q9SA 4NK5A 4LCBA 2Z43A 3SWWA 2I80A 1NASA 1ZUHA 4X00A 4EHKA 3AK4A 3VNQA 2GQ0A 3OE5A 1YGPA 3D8BA 4GMKA 3LYAA 3G2JA 3JYNA 1CQIB 1RKUA 3LV8A 1ESEA 2OAP1 5FWXA 2P6PA 2WWWA 1BE1A 1RI5A 5AUOB 2P6UA 4WLFA 3M1AA 1FOEB 5KVSA 2BFCA 3PS9A 1DCKA 4ILKA 4LJ8A 2HAEA 3T35A 2VYFA 1NU8A 3LO8A 5A3SA 4WNCA 5ALGA 5HXAA 2VWGA 4JH0A 1ZUWA 4NMWA 4RY2A 1JSRA 3MMNA 1NQXA 2QROA 4I0WB 3PD0A 4R5MA 5GOTA 5HCIA 4R7GA 3RQIA 4UVDA 4B33A 1KO4A 1OV6A 1BKYA 3T9EA 1LSJA 5KQSA 1Z7GA 1ZITA 4M0EA 1UAAA 1JIVA 1O5OA 2VHXA 2PX2A 3GV0A 2GSDA 4IJWA 3L7MA 4YALA 2VHCA 3NEJA 3NR2A 1AY0A 3EDYA 1UAYA 2PSSA 1Q1ZA 1Q3TA 4TWZA 4BUJA 2BONA 4B45A 3T3HA 4EMBA 5LKRA 2F3RA 4YWJA 3A36A 1UODA 3SDSA 2HH9A 3NEPX 1B00A 4KUHA 3P5BA 1LNQA 2XYQA 1RLJA 4CV1A 5IYZB 5D51S 2W2PA 3SR3A 3CVOA 1A5ZA 2QD2A 3GMDA 2PBZA 4GI2A 1G7TA 1VGRA 2Q9CA 3OX4A 2YMMA 3DMGA 5C53B 5DK6A 3HJAA 4C7VA 3NM5A 5FL3A 3PQDA 4HH4A 1XCLA 3PXUA 3HB1A 4TTSA 2ONJA 5HTKA 4ALIA 4CMEA 4L07A 3ZWNA 3U3KA 1JXAA 3EVBA 3GFGA 5I8ZA 1IY1A 3L41A 4DLUA 4ZT5A 3TQTA 1MHTA 1XTRA 4EQZA 2GAFA 5AW4A 1IJEA 3MGCA 2BEJA 3MRSA 2GBCA 1EM6A 1XYVA 3DV0A 3ZX4A 1MD9A 3J7AC 1GTVA 1LV8A 2PYZA 4A0FA 5BOSB 4J90A 4X62B 1J9EA 5KPJA 1QHXA 3GZJA 3MLBA 4C76A 1H42A 2QA5A 5J47A 4ZVQA 3AVYA 4OXIA 4WFJA 3TMYA 2AEJA 3V55A 3LCMA 1CLUA 1VCHA 4PYRA 5SY9A 1O9GA 1Q3HA 3VPAA 2ZSJA 2BW0A 4J43A 3DMRA 1LBIA 2BDUA 4JI1B 3BE5A 4RFSA 5A6SB 4PO3X 1WQ1R 1P1BA 1YK0A 2OG1A 4XR4A 3D4PA 4O4LB 1ZEMA 5DHAA 3D3QA 4IDGA 4YRIA 5JT1A 2HQ1A 1OC4A 3IIKA 1BMFD 4I3HA 4PTLA 3P9SA 3K6JA 5I7OA 1Y1PA 2DBYA 1VKHA 3EDMA 3A05A 3QFSA 4ROSA 4NQZA 1EX7A 4N1AA 9ABPA 4TYYA 2VHZA 3I64A 3H65A 3QVOA 1CEXA 4YFYA 1FEZA 3ZGNA 1EWKA 4BGUA 4BRSA 2R65A 2RMKA 3K9NA 2GN2A 4C6RA 2ZRPA 4C2BA 4RCVA 5K3BA 2PUDA 1IG3A 1FTWA 3UM9A 2GCEA 2H0RA 3OPVA 4BBZA 1U1EA 3O03A 1QFSA 1X80B 2Y1CA 5HG0A 3SHVA 4DNOA 2QD3A 5BW5A 2I4TA 1ZRNA 5KYYA 4XWYA 4RD0A 4ZVKA 1JA9A 3BGWA 2HM7A 4GXQA 2I3DA 1J00A 3L04A 3EIQA 1UDBA 4UUOA 2Q1TA 4I50B 4IVQA 2IHNA 4D9CA 4BO3A 1C7RA 3JWHA 3ORQA 5ALWA 3KSMA 1U80A 1YO6A 4QTUB 4KKXB 1B43A 1PZMA 2QTLA 4HFMA 3CX6A 4FHFA 3VDXA 1G8KA 4P1ZA 5CDFE 5GZ1A 3ZZ0A 4E21A 3G23A 1PSDA 5BSRA 3CLKA 1DB3A 4UE2A 3I4CA 4NYMQ 3U7QA 2A7XA 3ZV4A 4B46A 5FH9A 1R1DA 2WHQA 1FDVA 1SFRA 3TQQA 2O8EB 3OEED 3KZXA 3THRA 3CLHA 5FLKA 3L79A 1PTKA 1KRXA 2CSUA 1U3CA 1JIKA 5JCXA 1GRRA 4CIYA 3GVCA 1Q11A 4NP6A 1K0UA 1IEWA 3RUEA 5JDCA 3WRYA 1CRLA 2RGUA 5JI3E 3VKFA 4HQLA 1U2GA 3KUUA 4CI9A 2QQFA 2UZ3A 3W8RA 1C3XA 4OP2A 3PI6A 4XX0A 4RX1A 5DB4A 1U3FA 4ZAZA 2BJWA 2V65A 1SA0A 3OHSX 1BH6A 2FHPA 1AS2A 2O8NA 4REQB 2BUAA 2PWPA 2Y05A 3VR0A 4JI0B 5YASA 1ZIOA 4LJKA 1GTJ1 2J5RA 2GCOA 3FLAA 3PYMA 4N5MA 4FYKA 1GCIA 1Y80A 3B1YA 3WLPA 1JEYB 1TTQB 1XTSA 1DMRA 3LUBA 4MVWA 4WXRA 2E4ZA 1M6EX 1KZ4A 3R3SA 3TTUA 1NNEA 4CKBA 3Q8KA 1C4KA 1ECPA 5LLTA 1CB0A 4X6XA 1CG6A 2VZEA 3KT0A 1AUOA 4NS1A 5JS6A 2WTEA 1YI8A 1LPSA 1P7VA 3OOYA 4K7JA 1VL2A 4RTSA 3AVTA 5FTKA 4G0NA 1JMYA 4YO8A 1NFRA 5CAEB 3AEUB 4AF8A 1QCDA 2FYTA 4II2A 4QYIA 4BNYA 4DMKA 3D1LA 2YJ4A 3LLMA 4IWNA 4AO8A 5C46F 4MW7A 2I34A 2HK7A 1RR6A 4MR7B 4NFSA 4KSBA 1C8VB 1CQPA 1WKBA 1PJBA 1EVIA 1S2LA 1TXGA 2GZRA 2VK2A 3GUCA 2XWQA 3IODA 3L6CA 1UZNA 2HRQA 3KZMA 4IIEA 5GM2A 2JIZD 3WQHA 3ERCA 1OFUX 3CPSA 2BHLA 1B26A 1XEWX 1FMJA 3IUQA 4O2AA 4QTYA 5KOHB 2PE5A 1G64A 3FFWA 4YBRA 1X9HA 3FYSA 3BXZA 1KE2A 4MVJH 3BJRA 1P4AA 3MFYA 3ADKA 3B6ZA 4FWBA 5CG1A 2A3RA 1ND6A 4P4LA 4PNPA 2P8SA 5BNTA 4C3UA 4CLHA 2FQWA 4DCUA 5TMPA 5K8CA 4M0CA 2J0VA 3N8HA 2H54A 1BU8A 4OQMA 3MUNA 2YBDA 5JPIA 3L7YA 4EFKA 2HK9A 4Q9AA 1DO2A 4TRNA 1U0NA 1A5BB 3UTDA 4COKA 5KC8A 4FFBB 4IIUA 4FYJA 4Q02A 2DTXA 3SYTA 1V16A 2Z04A 3LDGA 4FGLA 2PSHA 3WGNA 3N2GB 1N5JA 2QM7A 1K7FB 2ZE5A 3FHOA 5CVEA 1STOA 4CFYA 1XNQB 3LPNA 3M4JA 1R5OA 2VH2A 4RABA 3KUXA 4LSGA 4LWQA 3F5QA 2GZAA 4X60A 3DAPA 3MS2A 3ZDQA 3BMQA 3ZBPA 1EMDA 3QMMA 3OZSA 521PA 2O8BB 1OYWA 4NBLA 2Q49A 1Q1BA 3AQIA 1MA3A 5IK2D 2CMKA 2CNDA 1ECFA 1TT5B 4FE3A 3B5JA 3A9UA 3GRYA 2IP4A 1G8SA 2AD5A 4YJ2A 4WLUA 2ZUWA 4DR4B 4WQMA 1XFAA 4HYTA 4CMGA 3EPHA 2VDWB 5A4JA 4HFRA 4E12A 5JAOA 2EFHB 5J2TF 1LC3A 5FKJA 1PU2A 2HYIC 3ASYA 3WGGA 4MUEA 3U80A 1IN4A 2VHYA 3EGEA 1SHLA 3W5BA 5A06A 2WJJA 1F1JA 5DOZA 2I3GA 4I4TA 4MPPA 1KDVA 4PZYA 3K71B 1M2FA 4TWIA 1GPJA 5EKUA 1K63A 2XVYA 1EFVB 4ZYUA 1E69A 3IAHA 2VJLA 1CZOA 1FS5A 5IT9A 4CG2A 3NWJA 1KY2A 5E7QA 1ZL0A 3GH1A 1Q92A 4GZMA 4UU7A 2X6QA 2Z2YA 2I91A 3MOIA 3HB5X 4O4IB 3EW7A 4RDCA 4ZICA 1J42A 5FULA 4E4YA 4A5SA 2VRBA 1GUYA 1O94D 2G80A 2QRGA 4GICA 4UPDA 2Y1OA 3N0TA 5JROA 4MWSA 3VAYA 3OURA 1MAVA 3ET5A 1OB2A 2CZQA 1PR3A 4H15A 4A8JA 3N05A 3GC6A 1GPLA 2PX0A 1YQUA 4GZ6A 4LC0A 5F78A 1ZFNA 2J4DA 3FKSA 5K4AA 3OC0A 1CJBA 1UKBA 5EHNA 1J2JA 2HWWA 3AETA 4HGRA 5T67A 4LG1A 3T7SA 3VNSA 1UC5B 1SOUA 1YR3A 4ETWA 4LRYA 1JXMA 5E6UB 4DYDA 4TVOA 1NMQA 5HUQA 4EHIA 1PKXA 1P9NA 2VPPA 4LZWA 2QN7A 4DTCA 3ZY5A 5K0SA 1JSZA 2IYLD 1KYZA 3R5KA 3AZOA 4ITVA 1Z2EA 1QNLA 4FONA 5DCLA 4IIJF 1DAKA 5ER6A 4F71A 2C9YA 3T3OA 1YS1X 3I6IA 1TFUA 3B51X 3VPBA 3BXXA 1CZLA 2NXEA 1CDDA 2HJRA 1KDPA 1U81A 1YMQA 2QTFA 3ESAA 3SC2A 2W90A 3LHKA 4YAWA 3NFYA 4BNGA 4ZZ2A 1LI7A 3VUFA 4DLVA 1CETA 1MXHA 3TW6A 4UHJA 1CNMA 1KQ3A 2I6FA 3UHOA 3ZHTA 1P8JA 1U1GA 4P4TA 4WI1A 1VC2A 3H6HA 3LY8A 3FOFC 3SIWA 1ZK1A 1Y34E 3AY3A 4F4CA 5CITA 4JCCA 3QA3E 1EK5A 4HQNA 1N5KA 5JZBA 3C6BA 3R8XA 5LN1A 1WAMA 4AECA 3FZEA 1YZUA 3CZ9A 1XL0A 2QRHA 3O3OB 3KYDA 2XH8A 1Z06A 3P4YA 4MARA 2OECA 1YB6A 4U7TB 3O6VA 4WXEA 1YZVA 5B2EA 2WLSA 3T06B 5CDTA 4LW8A 4ZVOA 4E03A 2C99A 1T8PA 2B8JA 4WXYB 1TVMA 3U4AA 5K9ZA 1D8AA 5I7RA 2FEXA 3UXMA 1YT5A 1O58A 3HP4A 3VHLB 2FLWA 5EXDA 2FZGA 1DINA 1JN0A 5KYVA 3JWGA 1LTHR 4J07A 4K46A 1PFQA 1FSGA 3LTNC 2IPXA 1MW8X 3HBMA 3SU8A 4NOMA 5CMLA 4X3CA 1B2LA 2O2EA 4MQFA 2ZTMA 4LJ9A 3MBOA 3Q0IA 2HIHA 2XUAA 3FPBA 4RIIA 3R9KA 3T7DA 4Q39A 2BV3A 3RLIA 1TO6A 2IPAB 2OYCA 3AJEA 2R84A 5KU7A 3N75A 4PXSA 1E3MA 4WLNA 3EMVA 4G25A 4IHJB 5ETJA 1FNSA 5DXAA 4NNJA 2ACEA 1L5RA 2I6QA 1C3JA 1HORA 1K68A 3OM9A 4X63A 3ZG6A 3ZWOA 4C0JA 1F06A 4EB8A 5HQJA 1RCUA 1IY2A 1E3IA 2P91A 3IOMA 5MGNA 3TKLA 2XIQA 3Q41A 1C9YA 3BIFA 3L77A 4UM7A 5BSMA 3EQZA 4CM5A 2IOYA 4AN1A 2A35A 2OBLA 1F0KA 3C15C 4LPSA 4LK3A 2C1EA 2RHHA 4DCCA 3EUEA 4HQ0A 4QL3A 3J81A 2VWHA 3OIGA 4YYZA 2C1XA 2I2XB 2XUZA 2YWRA 2UKDA 2CB9A 1Y3CE 5DN6D 2PJUA 5AHRA 3S6JA 5AJHA 3WRXC 4OX9Y 4PAQA 4CUZA 4JUFA 1MOQA 3GLTA 1C7QA 4BE4A 1QE5A 1AO0A 1D7AA 4G8BA 3RH0A 2HMYB 3QU2A 3SX4A 4CLXA 1WBBA 4PX5A 4ZVPA 1P0QA 2V0NA 3TJMA 4Z6KA 2PPLA 1I80A 1KERA 3JS5A 3EVEA 1QFYA 4E5KA 1V5FA 2EERA 1SXIA 3H13A 4R3UC 5E7MA 2DR3A 5TS3A 2DQKA 3RC9A 3V6LA 3WYEA 4DNQA 4F21A 1B6GA 5REQB 3ZWCA 1CJUC 2JFBA 3G0GA 3O74A 1T43A 4QUAA 1GPWB 1I9GA 1Z12A 3CU5A 4YJ2F 2QT9A 4Z86A 4UNSA 4Z0PA 3M4ZA 3ROPA 5JNWA 3U3DA 2G1UA 1I94B 1MT3A 2OT3B 2PL5A 3O1LA 3AEKB 2DJIA 3L0PA 4KJXA 4X7RA 4DS3A 1XZHA 4KL8S 4BMCA 5JBNA 3VRHA 4O25A 3KLNA 2O8FB 4LE2A 3PXCX 4Y18A 1P5JA 3KTFA 4NDNE 3EH1A 3E22B 5JPDA 5DXFA 4H1TA 4Z9BA 2JI7A 3ODPA 3RK0A 3RR2A 5LU9A 5IZCC 4IMIB 2BI8A 5G4KA 1IATA 3A0RB 3CM0A 5JJ5A 1IOLA 8MHTA 4AWBA 1WDWB 1S1CA 1P73A 5AI4A 2PS0A 3OTGA 2PUAA 4H7FA 1PQPA 4JXZA 4ZARA 5F5LA 5HQ3A 2M32A 1JFFB 4QUBA 2A0FA 2PRYA 2VLIA 3ICWA 1XVLA 3AI7A 3G9TA 1NHGA 4Y7DA 1XZKA 2PK3A 1SG6A 1JUDA 2VJNA 2NUPA 4NSNA 3K30A 1RD4A 1SKYB 3OIUA 4GVPA 4WKNA 4C7JA 3FSGA 5K4HA 1QKIA 3WVNA 3WZLA 2JGAA 1KL7A 2RBGA 3PRHA 2I7VA 3RYCA 1BIFA 5D6OA 3MMZA 1Q7CA 1RQGA 2QKYA 3M70A 4O5AA 4RSMA 4S1WA 2Q4EA 5LZ4A 3ZY4A 1QDLB 4DQVA 5KNCH 2XVZA 4KPUB 2Q6LA 1HTTA 3W0LB 3U3JA 2BFPA 4Y2QA 1JJAA 4C4AA 2VXOA 3IQIX 4Q05A 3H11A 4V2UA 4BFUA 4DR1B 3D4BA 4KI0A 3DAYA 3DBLB 3ST7A 4BZPA 2ZSKA 4DC9A 2PZMA 1UMBB 1YDHA 3DYBA 1PJTA 2IDZA 2JFPA 3CIFA 1VSUA 4H9GA 5BV0A 1LJUA 1ZONA 1U1IA 3VOTA 1XTIA 2DFDA 2FWAA 1XK7A 3HNPA 3ES9A 1C9MA 4CDGA 5ICMA 3HTXA 4G85A 3QI7A 2Z1DA 4GVLA 3B36A 3CLSD 4J6FA 3KVYA 4RPIA 1JDBC 1NXVA 3VUEA 3VNUA 1Y9AA 2WR8A 2ZWMA 1QHYA 3CA8A 4RDIA 5HCUA 4ER5A 2OQRA 4L57A 5B7NA 2NO6A 3TZKA 3UMRA 1GAJA 1RABA 3ECAA 4FFSA 3TCKA 5LZ8A 3D8SA 2EDAA 4ZAWA 4F86A 2HFKA 1ZCFA 2NAPA 5JANA 3DDOA 1J25A 1USIA 5JU6A 1G1MA 2QAIA 4M1QA 1H1TA 1VPLA 3B9PA 4MWOA 5ISMA 2LGJA 1H0HA 2I2DA 1P0CA 3S5UA 1UK9A 4FDVA 5IMSA 4YECA 1DO8A 5GZ3A 4UJ3A 5HGXA 5LYYA 1WMFA 4AY5A 3ZCUA 4F8JA 3GJZA 1UXGA 5HIKA 2VH1A 4PLPA 5CLQA 4AS2A 2FR8C 4DNFA 5CTJA 1E2HA 3OFVA 3HKBA 4XD7D 3FTDA 3CG0A 1YZTA 1RAHA 2EVWX 2VHJA 3OAAA 5FBQB 1BE0A 1HURA 3LG2A 3SC6A 3SM3A 1F12A 4FT2A 5B2ZA 4J3NA 4PNEA 3BCRA 5FV4A 4FMDB 4FE4A 4HCJA 3WV5A 4DCSA 4DZRA 4GQAA 1Q17A 1B14A 2VJYA 3HO6A 3WQSB 1YJXA 1RJFA 3HA2A 3UHPA 5KPDA 3LF1A 2JCBA 3K4QA 5MHTA 1UANA 2JCSA 2UXBB 1YCGA 4A92A 4BN5A 3TNFA 3WLLA 5F73A 3GNTA 1UPXA 3GQBB 3IEPA 1JJ7A 1WP4A 2AUMA 2UZAA 4TV8F 5IXSA 2ZYSA 4X85A 3B2NA 1DCFA 4O29A 1QAQA 3IBGA 3LM8A 3HACA 4S2UA 4JMPA 4U3JA 4EB6A 5BMVF 5LZ9A 2W70A 3LQ4A 5DEOA 4PCLA 3O31A 4F45A 2OORC 1HL7A 3NCTA 2NU6B 2H9IA 3H1BA 2ZBVA 5L95A 3X1JA 1OILA 2N47A 3INNA 1D9ZA 2NV2B 1E6UA 3GPCA 4HLDA 2AN9A 4QRHA 3ZGVA 4B8YA 1PX2A 3I3OA 1BN6A 1CZUA 1UBCA 2Q9BA 2IEYA 1ONSA 1SM4A 2ZVJA 3I1JA 4AY3A 1ML3A 4ZOLF 3RJ9A 3DAHA 1OLXA 3G8AA 1V7ZA 1UP7A 3GFVA 2XA1A 1KMMA 3OCCA 4LE0A 4E2WA 2AYZA 1S3SA 4G4SO 4AZ3A 1NOKA 5KTOA 5H4HA 3G9XA 4D42A 3QW2A 5HZHA 1RI2A 3COPA 4N0MA 5FNZA 5JNLA 2QTRA 1GCOA 1TM2A 1KZ1A 3CKYA 5DM4A 2AG6A 2FCAA 4ERNA 1X7ZA 3K1AB 1NF3A 4UHEA 4IHQA 4LRTB 1LJ8A 1KQGA 4AF7A 3REQB 4WZAE 4J0DA 1V2HE 5GGYA 3LO5A 1Z0SA 4WZBE 1YR2A 4C6TB 2WKSA 1XSEA 2KPOA 4Q48A 5J3JA 3ZDEA 4NI5A 3UENA 5IW8A 2NXJA 1ZSNA 3T38A 2R60A 3OT1B 3BXGA 4QTZA 1CK4A 5TE9A 3V3TA 1VXRA 4UD2A 4N5HX 5AJWA 4OH1A 4J16C 4F2HA 1K9SA 5JZVA 4TLEA 4FN4A 1N6IA 3GPDG 1FTQA 2QW8A 2VDJA 1U8AA 1E60A 1KZYC 2IZ5A 2AFVA 1YQWA 2VWPA 3PQ8A 2V5AA 4F92B 5MN4A 1C9DB 2DF8A 2P35A 4RD1A 3RU2A 1MIOA 2WG2A 3O2SB 1Y7HA 4K9PA 5E1MA 2GWRA 3KE9A 1RYNA 2YYYA 4J0CA 4MWCA 3WO1A 5CD1A 4XVQA 2XD9A 1K3TA 1X1SA 2JIQA 2R79A 4PZEA 4RA6B 3QVTA 4UHDA 3DE6X 4ZQBA 1L8XA 3LQFA 3SK0A 3OE1A 3U3XA 1QP8A 4B3IA 3GRAA 3IA2A 3QBTA 4BQIA 3ZVNA 1Z8FA 2G9UA 1DRUA 2I5PO 2QLFA 3G0DA 4LYDA 2YR0A 5AI5A 3WA6A 3AXTA 3F2IA 3K1TA 5CX4A 3BHJA 2FPSA 3UT6A 4YAUA 1B6SA 5T5QA 2Z6QA 2LTAA 5EIBD 3EBPA 2JJ8A 4ARZA 2G28A 2PZAA 5LVAA 1AGPA 1Q83A 3EDCA 1K75A 3CSSA 2Y3IA 4OHOA 2W42A 2JRCA 4Y9TA 3JXEA 3QFRA 3K8ZA 1IPFA 3QE3A 3GZNA 2NV6A 3G7NA 4LGCA 1P80A 3FTPA 1VCNA 2PUTA 1GKLA 2JARA 2REOA 3N0WA 2GPYA 3AYZB 3H87A 3STUA 2J5KA 2QU7A 4NBNA 5EJ4A 3T5GA 1LBQA 3VYVA 2H9YA 1Y89A 3HDHA 2QPAA 1EJBA 1I0IA 4DIDA 2Q07A 1DV2A 3ANTA 3AESA 3QY0A 2AUNA 3M6LA 2H16A 5CHEA 5GP1A 2ORWA 1L4FA 3WOVA 4CLRA 5C5DA 5I7FA 3GRUA 1S6YA 5J4VA 2VQEB 3ZHCA 1ILEA 4IO0A 4B3DA 4EGJA 3CBGA 2IYFA 2J5XA 5F64A 4PR0A 5AW8A 4UJ5A 2P9CA 1UDCA 2CC2A 4JL8A 4L4UA 3GEGA 5BYBA 2GUGA 1U9IC 3KUCA 4YLGA 3IBYA 4PPYA 3HCFA 4EMTA 3HCCA 3ME5A 1CE8B 1P17A 3MJRA 4GWKA 3HWWA 2CLSA 4HLQB 4IZ6A 1L8OA 1ECLA 2AZ4A 3FI0A 1MC4A 2ZB2A 1J0BA 2XT9A 3FPEA 1M76A 1U02A 4OHVA 1VKRA 4KO1S 2HF7A 3IVRA 2CV2A 5GONF 2WTAA 2H5LA 1IAQA 4GR5A 4YI3A 1O6CA 5B6PA 2R8RA 2I3ZA 621PA 2I4MA 2DKNA 2PSJA 1UOPA 1T9DA 4D81A 3V4RA 2PD6A 4U2GA 1BAPA 2VDKB 3MRXA 4DSZA 3O9ZA 4OHUA 3BMCA 2X6TA 1E79A 4BTEA 3FY4A 3F1KA 3VAAA 5KWVA 1U7WA 2YXLA 2VDVE 1I6KA 1ZH0A 2F1OA 4FDMA 1D0IA 2BHRA 4IGAA 3VOAA 4M38A 5BRJA 5JNVA 1I4DD 1XMJA 2HU7A 3C8UA 1OWPA 1VKOA 1KO8A 3MS7A 1D1QA 1EA7A 3QFHA 2H8GA 5AXDA 3OF2A 2BY4A 1E2DA 2IXTA 2XSZD 4B4VA 2GF0A 4BATA 4Y1EA 5KEIA 5LQJA 4U0JA 5BWNA 1YFJA 1I6LA 4Z54A 2X0FA 1PL8A 2AMLA 3OF5A 2VDUE 4ZV7A 1KZHA 2P67A 2QX7A 4KBGA 3HCPA 5JSFA 3ZEIA 1HFEL 1K3FA 1YTLA 5E1OA 1IHDA 2FMTA 1QVVA 1T15A 5CFPA 4ZD6A 1PDWA 2W8ZA 4DGQA 1C30B 1AU9A 3B7WA 4JB8A 1YBHA 1GQYA 1FX1A 1Y8QB 1ZK4A 2G1PA 4HL6A 3RYIB 2FSFA 1QLWA 4BNDB 1XLVA 5LQSA 3L0IB 1E3SA 4KACA 4QWMA 1N5DA 2FPXA 2ZW9A 3IAFA 4BEWA 1T9CA 2PLNA 3PDJA 5DHTA 4V03A 3NIWA 3RTCA 3OCWA 1U0EA 3S44A 1T9HA 4IRXA 2IA5A 5HR5A 3A1NA 3BQMB 3EJWA 3KJIA 1YK1A 3BZWA 5A7HA 1IEVA 2VF7A 4Q1VA 2F48A 4KDCA 5JVDB 3BA1A 4EAAA 2C58A 3R0VA 5EJIA 5DIFA 3TW8A 1G6KA 4QFMA 2MYTA 4ZVRA 1XDSA 2XCIA 3IQWA 3UICA 1DADA 3TSWA 2QRNA 4FHCA 2W4QA 3A4NA 1W4BA 3GRVA 4I46A 4JWTA 4YFVA 1YHNA 1E3LA 1U9ZA 5THXA 1O1YA 1S8AA 3GN1A 2JJQA 4ID9A 2YASA 3QEKA 1SG0A 4KXNA 4RC9A 3V9PA 4MWGA 4X9XA 3DMYA 3NV9A 4HRYA 4B7XA 4RSGA 1AC5A 1CUAA 1AHIA 2B99A 4ZAFA 3WB0A 3IC5A 3EYWA 4D4JA 4CQNA 3ZTWA 4X1IB 5IJWA 2CJFA 2E5FA 4O2BB 2WIDA 5KTKA 1BHSA 3LUHA 3Q3CA 2GKSA 2UYQA 1ZU5A 2RAPA 2WSMA 3CF6R 3SQLA 5IPFA 4PWYA 2NTYC 2OTCA 5EMNA 3R8CA 4FYPA 2NZ8A 3ZQKA 3OPNA 5C7YA 5AVTA 3GP8A 1UJCA 3JASA 3IAS6 4UTOA 3UAOA 1VG8A 1GTMA 1XD9A 2H4YA 2Y6VA 4I55B 4L8LA 4BZXA 5M7EA 1CEYA 1IY0A 3GAFA 4PO8A 4R1NA 2UU9B 2O59A 3OBBA 2W8BA 4NENA 4WOCA 6Q21A 4ZCRA 3Q8MA 4IP0A 1O2DA 4M8LA 2XQKA 3TLJA 4X97A 5FPHA 1H94A 1JR2A 4MPDA 5L53A 1DJNA 4AAYA 1FU8A 2HCBA 2P2CA 4IDOA 3R7LA 4KITB 5B57C 2WT9A 1SO8A 2OCYC 2WOJA 3ANSA 5DNVA 1LZLA 4P83A 1YJQA 1JB1A 3L0BA 2BGGA 1NP6A 2AG5A 3EGVA 4HBGA 1K5PA 3WLAA 4JYPA 3IVAA 2NZUG 2VKQA 5G41A 1U7TA 5TJHA 5JMOA 4KO4S 1SZJG 3STYA 3C1TA 2Z9DA 4PIMA 1R5NA 3V1UA 2JJ2D 1WDLA 2YRXA 3WMFA 3U1BA 2WWRA 2VN8A 3P2KA 1CUEA 5KYXA 5HQTA 2R7KA 5DI3A 4C6HA 4IDQA 1M8JA 3T4UA 3BH0A 2BZ0A 5AOBA 1JLMA 4FOSA 4MP3A 2PMWB 2JH3A 2O7RA 2RG1A 3KR9A 4RHTA 3BAFA 5CFQA 2AGVA 1Q0SA 5CR9A 5G4LA 3ZPXA 3R8FA 1GSIA 4DUGA 1Z62A 4Y2UA 3WY9A 2C2WA 2GBFA 4U0KA 3VR4A 4MGIR 3A7EA 3BC1A 3CBQA 4AMVA <