1ZIYA

Crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
232
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 80
structure length 232
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ziyA00
4P92A 1L7QA 1U8EA 1YAHA 4HXGA 3DYVA 1VLQA 3OC0A 2Y6UA 1SFRA 3G9ZA 4B9AA 1GQSA 1R4ZA 3R41A 1QZ3A 2X76A 5AI6A 5CT9A 1LPMA 2ORYA 3GFFA 3WKAA 5AI0A 2XLCA 4FLMA 4PSCA 3IUMA 3FYUB 4PF1A 2CBGA 1F0PA 3LIIA 1K6EA 3GZJA 1TQHA 1TK3A 4OPMA 4Y9SA 1XRMA 4X3CA 4BDSA 4H7IA 4U2CA 1GKLA 3F67A 2WIGA 5AO9A 4DNQA 3KWFA 4H77A 1DWQA 2OXEA 3DNMA 4B84A 3I6YA 1AURA 4H35A 2BGNA 3E4DA 3AZPA 5JZSA 4QDTA 4GBGA 2HA0A 1QO9A 4J0CA 2OQIA 3M3DA 5AM4A 1P0MA 1XZKA 3P2MA 5JAHA 2ROQA 5AIAA 1E8DA 4WFJA 5FPPA 4PW0A 1QGED 1DTEA 3BDVA 1P0IA 5BWBA 3DKKA 1GZ7A 4G4IA 2FJ0A 4HVTA 4X00A 3H19A 2IITA 1QIIA 3H2KA 3WZMA 4M0EA 2X8BA 5K3EA 4OB8A 1QIFA 4FMPA 4UHCA 3R3VA 4OB7A 1AZWA 3IULA 2XUPA 2CEKA 3DDUA 3MUNA 1LBTA 3G9TA 1JJBA 2OCLA 4BVJA 4QZVA 1S8OA 2ZVDA 3IIIA 2OGSA 1HQDA 3WJ1A 2QTBA 3KXPA 5DJ5A 1ORVA 4DLNA 4EB0A 1K8QA 1U4NA 3R0VA 5AP9A 3V1NA 4HTAA 4GHWA 1CVLA 5CH8A 4GECA 3FWHA 3STTA 2I3DA 1USWA 1IUOA 1VXOA 3DQZA 1E66A 3D2AA 5FUMA 4H7KA 3KOOA 3KD2A 5HFNA 2XUDA 3HXKA 1GXSA 4X94A 4L0CA 5AI4A 2IIVA 4FFWA 3ZLTA 5LZ9A 4X6YA 1DT3A 2HA2A 3FSGA 2Z3WA 4CIAA 3WL5A 3BXPA 4ZI5A 2ZJ6A 5LZ5A 2JGMA 3ED1A 1EVQA 1UOOA 1ISPA 3IURA 1FSSA 1UKBA 5KWJA 1EINA 3D4LA 4J0JA 5T4BA 4CG1A 2XQGA 3CN7A 2HADA 2B61A 5ALDA 3WQHA 5HQ3A 2GYWA 2HU5A 4N8SA 2ZSHA 3FCYA 1ZI6A 3WJ2A 2VJCA 1ZOIA 4N5IX 2ZYSA 1KU0A 4GI1A 1VE6A 5HF5A 4CIBA 1MAAA 3CCCA 3UMJA 1QO7A 2WHRA 1XRNA 4TPKA 3VISA 5JD6A 1WB6A 3L1IA 2DQYA 2GZSA 3C43A 4BCDA 3ESBA 5ALVA 1DQZA 4OYYA 4C4YA 1VXRA 3FLBA 1O6GA 4H7HA 2I78A 3A6ZA 1UKAA 3IA2A 3ESDA 1UK6A 1L7RA 1SC9A 1G5FA 4P08A 3VJLA 4FOLA 4Q3LA 5E4TA 1MNQA 4J7AA 1Q0ZA 3D0KA 5CT8A 3E1GA 2Y6VA 3ZI7A 2XMSA 4XIIA 1H2WA 2RIPA 3MVEA 3QYJA 5AKZA 1ACLA 4C4XA 2B4KA 3L1HA 4W1QA 2JEZA 2JGJA 1ZJ5A 2XMGA 2ZYHA 1FJ2A 1QIEA 1XQXA 5EIAA 3F8SA 2XUGA 2HFJA 4HXFB 1U2EA 1N1MA 4XWGA 2G5TA 3DOHA 4UBOA 4EY7A 3H18A 3WK8A 4WDQA 5JD4A 2X5XA 5CBKA 5AM2A 5LIPA 5C8XA 4GLBA 4DMFA 1A7UA 3WIOA 5AI9A 3PI6A 3V1LA 1CUSA 5CXXA 4OD0A 4MQLA 5HKBA 1X70A 1QJ4A 2WU4A 5AI8A 3O9MA 1NU8A 5LZ2A 2XDWA 2ECFA 5H3HA 3D5EA 5AOAA 1KEZA 1QIGA 4OU4A 1LLFA 1HLGA 3HSSA 3ZLUA 5AKLA 2YYSA 1SCIA 1CUZA 3D2BA 3HJUA 5ALIA 3LP5A 2PKYX 1A8QA 1OILA 1E8MA 4Q82A 2OGZA 3QVMA 1ZGCA 4W1PA 1LPPA 3LCRA 1JT2A 4EY5A 1TAHA 3O9VA 2PSDA 2Q0XA 3PE6A 5CXUA 1W75A 2HU8A 2XUQA 5HKAA 4B85A 3IUJA 4V2IA 4J0HA 1ZD4A 4DMKA 3C87A 4FTWA 3O0DA 1CLEA 1JJIA 1BCSA 3H2IA 1MU0A 4RE5A 1ODCA 3IDAA 3C5VA 2BJHA 4NMWA 4BCCA 3WWPA 2E3JA 1XZAA 1JMYA 2BUBA 1UT6A 3DYIA 5BOVA 5JANA 1W6RA 1AX9A 3ICVA 3FSGD 4IH9A 5DTJA 1CR6A 3WKBA 1XQVA 2QOEA 1HDEA 1YAJA 2ACEA 2YH2A 5ALSA 1R9NA 5T4FA 5KWIA 5DYYA 2DHCA 1XRPA 3H1BA 3WWCA 4EUSA 3WZLA 1EXWA 1LPAB 1W1IA 3FVTA 5CT4A 1ACJA 3M81A 4F60A 3OPMA 1NX9A 4G8DA 1O6FA 5JARA 3RKSA 3PF8A 4BTLA 4JUIA 4AO7A 1ZJ4A 3CCBA 2WIKA 4JYMA 5FLKA 3H2HA 3G0DA 1MAHA 1LGYA 4FHZA 4CCYA 2JGIA 1CUYA 3BDIA 2QMQA 3EQ8A 5J3JA 4ZGBA 4GWLA 4G4JA 1FFEA 2QRUA 2RGUA 4X97A 1P0QA 4AB1A 2WQZA 4N5HX 3I2IA 4ZV7A 1DX6A 2WLSA 2XQKA 4K2AA 4C6HA 5DNUA 1CUHA 2WIFA 5JAUA 3VVLA 1LNSA 2ZJ7A 2H7XA 4OU5A 5AM5A 5C8VA 1C4XA 5EHNA 4P93A 4RGYA 4I4CA 3A70A 4DM7A 1A8SA 4Q05A 2WM2A 3N2ZB 1TRHA 4JYPA 5DLPA 2XT0A 4MEBA 4UFPA 2WJ3A 1XZDA 2WU3A 5CH5A 1EK1A 1JU3A 2K2QB 1TCAA 2B20A 2XQIA 5ALZA 5CW2A 1WCYA 2OGTA 1THGA 5F4ZA 3BE8A 3QBJA 3AUKA 3EIOA 5HF8A 3EBLA 1H2XA 4NVRA 6YASA 3WLAA 5A6VA 5FOQA 4AO6A 5JASA 5T4EA 2XE4A 2R11A 4BP9A 3WYDA 1W4LA 1UK7A 5DNVA 4AN1A 2H7CA 1CUXA 4LIPD 3O4JA 3I2KA 5ALNA 4HZGA 4FLFA 3TEJA 2C7BA 1VA5A 2PL5A 2P8SA 1XQWA 2GBCA 2VT7A 4BYMA 2JEYA 4AMYA 2WG1A 5AKJA 4PSDA 1XLUA 1EI9A 3I2HA 2QS9A 1TKRA 3OTQA 1M33A 3YASA 4UBLA 4UBIA 5AKEA 2EDAA 1XLWA 1I6WA 2J3QA 3BIWA 2B9VA 4KRXA 4KYVA 3OG9A 3R40A 4BATA 5CH3A 1DQYA 1R88A 3C5WP 4E11A 3FOBA 4DNOA 4G8BA 3DL4A 3TJMA 3HABA 3FYTA 5HQ3B 2VJAA 5SYNA 1AKNA 4B81A 4X85A 1BCRA 4YPVA 2VT6A 4B7ZA 3PF9A 1N8SA 4U2GA 4M0MA 1Z68A 2PSHA 5IKXA 3R3ZA 4IO0A 4KRYA 4UBNA 4HAIA 4UHEA 3H1AA 5DYTA 5ALLA 4TGLA 3AJAA 2QVBA 2WFLA 4OCZA 4QDXA 3E3AA 1J07A 4AX4A 1MX5A 4B82A 2Z3ZA 1AQLA 2GBGA 2OQVA 2XUKA 2RI6A 3E0XA 3DD5A 2AJLI 2GYUA 1IUPA 2IX9A 2YXPX 3BJRA 2DHDA 1B41A 3NOXA 1FFCA 2VSQA 3LIPA 4K6GA 4YK7A 4WDRA 4UBMA 4BZZA 4DNPA 5EIEA 4C4ZA 1XZFA 2V98A 5IVIA 4M0FA 2EDCA 4K6HA 1J1IA 3PICA 5JALA 2HRRA 4FNMA 5KREA 4UPDA 1RYYA 1ZD3A 1BN6A 4DNFA 4MQMA 4MEAA 2BFNA 5CURA 1BS9A 1P0PA 4K6KA 4FBLA 4Y7DA 2AXEA 2DSNA 2CJPA 7YASA 2XUAA 1BU8A 3QPDA 3I2FA 2QJRA 1IVYA 3ESCA 1BN7A 4QA9A 3BWXA 3TGLA 3ZLVA 1X2BA 1XZHA 2HFKA 4G1FA 3DJYA 1YB7A 3M83A 5FP0A 3V1KA 2JBWA 5I8PA 2WG0A 4YASA 3QZUA 3HC7A 3DKRA 5AHXA 2J3DA 4ARAA 3G0BA 4DSZA 3T52A 4U2EA 2QXTA 3WKEA 1T4MA 4Y2PA 4AMZA 5IH7A 2WUFA 1MTZA 3PFCA 4HRYA 5K3FA 1N5MA 1RP1A 4QLOA 3DCNA 4FLEA 1MPXA 2CB9A 2OCKA 3L1JA 5AIBA 4C89A 3EF3A 1A88A 1ODSA 2DR0A 2OCGA 2C0PA 2DCMA 1NU6A 4LXGA 3QPAA 3HEAA 5HF9A 4I19A 3H17A 2QXUA 4AN0A 2OCIA 5FDFA 3CXUA 1J06A 4A5SA 2Y2VA 3FYUA 1XRRA 4BRSA 5JIBA 2HM7A 4X6UA 5YASA 3C6YA 1GPKA 2WHQA 3G0CA 5CTAA 3SK0A 4FDMA 3WWDA 5ALUA 5LYYA 3GUUA 1XLVA 5AK5A 2YASA 5ALXA 4BB0A 1ZIYA 5LKRA 4BZWA 4LYDA 2QM0A 1CUFA 3F98A 3BJMA 4NS4A 1QOZA 1CUWA 4CCYB 2LIPA 5EHZA 2HA6A 1HPLA 1XZLA 1XFDA 4CI9A 1LPNA 1LPBB 1TCCA 1WB4A 1YASA 3GROA 3G7NA 4KE7A 4XJVA 4LHEA 4X7BA 4P9NA 1JFRA 1EVEA 5E4YA 1LPSA 3BL8A 5CT5A 4N8DA 4J0IA 5EHQA 3HRHA 3PUIA 5A7HA 4U2FA 3D2CA 4Q34A 2C5FA 1YR2A 3IVMA 1MNAA 1WB5A 4B9EA 1WPRA 2D5LA 3S8YA 3JWEA 4QNNA 3H2JA 4KE6A 4DIUA 3KSRA 3NGMA 4G9GA 3ZV7A 1VA4A 4J0DA 4BAGA 4AQDA 1MX1A 3SC2A 3C45A 3VJKA 1CUGA 2OAEA 4X92A 5JYCA 5I9IA 4XVCA 1YSCA 2VF2A 1XQYA 5K5EA 4K5QA 1GGVA 3I2JA 1Q84A 2CMFA 1G4HA 5FXMA 3O4IA 2AJDA 1CV2A 1BRTA 5EFZA 2VTVA 2H9YA 1VKHA 1UFOA 5DTIA 3WKCA 3G0IA 4DGQA 1Y7IA 2VJDA 3V1MA 4Y2JA 5EI5A 1K4YA 3QMMA 5AKIA 1YS1X 3BF7A 3F97A 1OXMA 4QWWA 5I7UA 1FFDA 3D59A 4W9RA 2QUAA 5ALOA 1CQZA 1EDBA 3WKDA 3G0GA 1DX4A 3WL7A 4U2BA 4QDUA 1EDDA 5LLSA 4PSUA 3FVRA 4EA6A 1E5TA 3K9BA 1XZEA 2BCEA 4JEIA 3FBWA 3AINA 2PX6A 3WWOA 1CQWA 1XKTA 1ZD5A 2UZ0A 1MX9A 2ONCA 2WJ6A 1E3QA 4CFSA 3Q8WA 2JGLA 5JATA 1G66A 1BEEA 2BGRA 2QT9A 4QDZA 3EQ9A 4F0JA 3JYHA 2CUTA 5DWDA 4MWTA 4Q3OA 4B80A 3QM1A 3LLCA 5HCUA 1MT3A 4LXIA 4E15A 3WA7A 4ZV9A 4QDOA 4W63A 1H2ZA 3H0CA 2ES4A 3C8DA 2BUCA 4Z49A 5AKXA 2OG1A 3SX4A 5AOCA 1C7JA 4H7FA 4UFNA 2WTMA 5LZ8A 3C70A 2XMDA 5ALPA 1SCQA 2WFLB 3C6BA 3ZPXA 1EHYA 4IQ4A 2XUIA 1XROA 3R3UA 2HRQA 4J0KA 3A2LA 2HDWA 4KJXA 2PVSA 5AKKA 4DMCA 4UHHA 1EDEA 2WUGA 5AK6A 3S2ZA 4ITVA 4EY6A 1EX9A 1ETHA 4FBMA 3FLEA 3VDXA 5JAPA 4UHDA 2BKLA 4G8CA 1IZ8A 3QPCA 4HRXA 1T2NA 3G8YA 4RNCA 4ZWNA 5JZ9A 1ZIXA 5ALTA 3O4GA 4OUKX 2PU5A 1PJAA 1XZBA 2ZYRA 2J4FA 2PUJA 4OB6A 4CCWA 3A2MA 1CUUA 3STUA 5LP1A 2FJPA 3X3HA 1AGYA 1LZLA 3B3QA 5IVHA 1QIKA 2WFZA 1DWOA 2C5GA 1MO2A 4ARBA 3QH4A 3ICWA 1VZ2A 4GDMA 2FX5A 2XB6A 3NWOA 2VA9A 2QZPA 1YA8A 4JNCA 2W22A 1GQRA 3C6XA 3VJMA 4RE6A 3WK7A 4OSEA 3G9UA 3I1IA 2O2GA 4BVLA 3T4UA 3VVMA 1J2EA 1HL7A 1RWQA 5ALQA 4EHBA 4L3WA 3STYA 1QFSA 1GKKA 2ZYIA 1C7IA 4BE9A 4Y2UA 4Y2YA 3RARA 4ZREA 4DTCA 1XZGA 4U2DA 2PPLA 2PSFA 5A2GA 2XMZA 4MYSA 1QTRA 2VJBA 4KAFA 3RM3A 4J3JA 5ESRA 3WL6A 3OURA 4H0CA 2QR5A 4QEKA 5K3FB 2C0QA 3M82A 3B5EA 1D07A 2HA7A 4FWBA 3RK4A 1UZAA 2H7YA 2O7RA 2XUFA 2XI4A 3C8HA 3ESAA 1EB9A 4UHFA 1BE0A 1WM1A 1QIHA 4L9AA 2WIJA 3HACA 3D7RA 1KU6A 4H7JA 4W1RA 4BAZA 4GEGA 1B6GA 4DSAA 3GBSA 3HZOA 4QLAA 3C6ZA 5A7GA 5ALHA 3QMWA 5D3KA 4H7DA 3CN9A 4WFIA 4OYLA 3ILSA 2HIHA 3MUOA 1R9MA 4TVKA 3UUEA 4DMHA 1VZ3A 1BEZA 1VJ5A 2HL6A 5FPQA 1SOMA 2WHPA 5HK8A 2WUDA 3W05A 1F6WA 3W9UA 4ZRDA 1N5RA 2WSLA 4B83A 2FUKA 1F0NA 2DQZA 4A23A 5AK4A 3OM8A 4GXNA 2GBIA 4I3FA 3WWEA 2Y2UA 1JKMA 1CPYA 5ALFA 1YS2X 2XMQA 1QIMA 4WY8A 4BCBA 2CKMA 4FFVA 3U1TA 1ORWA 3EQ7A 3QITA 1DT5A 2XUJA 4Y2TA 5HZGA 2WG2A 3WMRA 1QE3A 3D3NA 5ALMA 5C81A 4UFOA 3RLIA 1WHTA 4LYEA 2OLEA 1TCBA 4UBKA 5EIHA 1ZI8A 5EHXA 4Q1VA 1VOTA 5AOBA 5FRDA 4FKBA 1GT6A 3AIOA 3SWWA 4FNGA 1CUVA 3W2TA 3ANSA 4X91A 3KWJA 2ZSIA 5ISMA 3GELA 2W6CX 1DWPA 1WHSA 2G4LA 5AM0A 2GZRA 2HHAA 2QJWA 4LXHA 3IUQA 1G42A 2PSEA 2Z5GA 3MGAA 3QMVA 2XMCA 4RPCA 4MXDA 4EY4A 4J03A 2HA4A 2DHEA 3K2IA 1JU4A 2DFPA 1UK9A 3R3YA 4EBBA 4XX1A 4G4GA 4MWSA 3PFBA 3O4HA 2JGFA 2XUOA 2VAVA 4MJ3A 1A8UA 3H04A 4PV7A 1FFBA 3N0TA 5C7YA 2PM8A 5A7FA 2I03A 4F5ZA 4Y2RA 3AZOA 5AKGA 3GA7A 3DS8A 4BP8A 3AZQA 3WK6A 4EZIA 1MN6A 1LBSA 3PDCA 4BAUA 2JGEA 2Z8ZA 4UBJA 3H2GA 3DEAA 3PUHA 1XKLA 1CRLA 2RAUA 1F8UA 4IHAA 1CUJA 1YB6A 2O7VA 4BC0A 3ZWQA 3AILA 4UHBA 5ALEA 1CIJA 2XMBA 3FNBA 4G5XA 2QUBA 3R3WA 5T4HA 3FLAA 1TIBA 4J0GA 1XZIA 1ZI9A 5AKYA 2WUEA 4PO3X 4B6GA 2CZQA 4DYHA 1EA5A 4IH4A 4QE3A 3I2GA 5ALWA 1CUCA 3I6ZA 2VQ6A 3HI4A 4YX9A 2PBLA 3WK9A 5JAOA 1YCDA 2WTNA 3AIMA 2C4HA 2HA5A 1R1DA 2RHTA 3KDAA 5LZ7A 5C8ZA 5BV7A 1Y7HA 2BAGA 1THTA 3W9BA 2WJ4A 4BC1A 4C87A 2V97A 2HA3A 3STXA 3W06A 3DOIA 3VXKA 4AO8A 3IBTA 1MJ5A 3JW8A 3AIKA 2AJBA 4WFKA 3FYUC 2PSJA 2VAXA 1UOQA 4WY5A 5JZBA 3G9XA 1PV1A 1PFQA 3A2NA 1XRQA 3O95A 5ALGA 4X93A 2XQFA 4JH0A 3DL7A 1HKHA 2RHWA 4WCVA 1XZMA 4BE4A 1OCEA 1SCKA 2Z8XA 3U0VA 4KR0A 2H1IA 4BRZA 2AJ8A 5LKAA 4H7EA 4IH1A 1UKCA 1UWCA 3B12A 2NW6A 5K3BA 4S0XA 5K3CA 3IB3A 3V9AA 2OAGA 2PUHA 1AMNA 3NUZA 2WILA 5HFAA 4HS9A 5JD5A 5HF6A 1QIDA 2O2HA 1L7AA 2XUHA 1EH5A 4GW3A 1AC5A 2JF0A 3UUFA 4AZ0A 5K3AA 1UXOA 1H23A 2GYVA 1JI3A 2I3ZA 4Y2QA 4WJLA 4QWMA 1IZ7A 3FCXA 2C58A 5AICA 2R8BA 5LZ4A 2RONA 5D6OA 5ALRA 4INZA 5HK9A 3G02A 3F9CA 3Q0TA 4E14A 2ACKA 1E89A 5IVKA 3I28A 2Y1KA 1H22A 4NZZA 3I6MA 1EK2A 3F96A 5AH0A 1JJFA 5CRIA 1XZJA 5KBYA 5E2IA 4N8EA 5CMLA 5FKJA 4MYDA 3WI7A 3WK4A 4PNZA 4ETWA 3WK5A 5AK3A 3ANTA 2XLBA 4KE9A 2XQJA 1K5PA 5CT6A 5SYMA 4KAAA 5DNWA 1XZCA 4F21A 1CUBA 4A16A 2EEPA 3V48A 1R50A 4CG2A 3K6KA 2OPHA 5DYWA 1R3DA 4UUQA 3WYNA 5FV4A 3HYSA 5EGNA 2AJCA 5E4JA 4CG3A 4BVKA 1LPOA 4Y2VA 3WL8A 5A62A 1W52X 1CUIA 1GPLA 1IMJA 4PQEA 1VE7A 4B0OA 4BTVA 1BROA 4KEAA 3BIXA 1Y37A 5IVDA 4X90A 4Q3KA 3STWA 3WA6A 1QIJA 1QLWA 2WHPB 5K3DA 1ODTC 1FFAA 5AM1A 1CUAA 3STVA 3WIBA 1JMKC 5ALJA 3AFIA 4X71A 4C88A 3R3XA 5A71A 2V96A 4KACA 4BDTA 1CEXA 2VEOA 1XRLA 3IUNA 2HU7A 5AM3A 1QTIA 4X6XA 4D9JA 2G5PA 1CFJA 2GBFA 4ZXFA 4HXEB 3LS2A 2WKWA 1GPNA 5ALKA 2JGKA 5ALYA 2PU7A 4Y2XA 1Q83A 1DINA 1X2EA 4LKOA 3W04A 1Q0RA 1U65A 4G9EA 2ZJFA 4KE8A 5JADA 1H2YA 4AXBA 1ZD2P 3BF8A 3OOSA 1WPXA 2V9ZA 5AJHA 1WOMA 1DU4A 1IUNA 3TRDA 2O2IA 4KAJA 5D7BA 4ROTA 1HBJA 3FAKA 3VKFA 4E46A 4C01A 5AI5A 1E8NA 1YA4A 4L72A 1CUDA 3HLKA 1ZICA 2WFMA 2WIDA 4Y2SA 2JIDA 4H18A 3DLTA 4X95A 4EY8A 2D0DA 1EB8A 4BBZA 4AZ3A 1QFMA 5D3ZA 1UK8A 4W1SA 2J4CA 1AUOA 1ZGBA 1K63A 2G63A 2BUAA 1CUEA 4O08A 1LZKA 2VATA 1W76A 5BWCA 1QONA 2XMRA 5AKHA 4B0PA 1UOPA 2QKYA 3I1YA
chains in the Genus database with same CATH superfamily
3ZTTA 1L7QA 3KKPA 1QG0A 4CTJA 1PYOA 2FRDC 2ZYGA 2Z1MA 3F74A 4GI5A 3EODA 3EVCA 3IKMB 3WNQA 1YACA 3PD7A 4KIUA 3WTCA 4YMGA 3IXMA 1SVUA 1W96A 1SQGA 2VHJA 4JLMA 2A0WA 4GL2A 3OC0A 2NU8B 1J6UA 2F3UA 1SFRA 3B7GA 1E79D 4PZEA 1LRJA 1JQLB 2GZ1A 3SKXA 5CBPB 2R25B 5I3CA 4I5IA 1IDN1 1SOVA 3LMKA 4IY1A 1V1MA 3H2YA 3GLFA 1QZ3A 1J9GA 2WT8A 2A5YB 2XNDD 3AVVA 1NMEA 5IT9A 2X76A 1L5HA 1RAGA 1Y33E 1ID8A 2GBLA 2NSHA 4FD3A 3WKAA 8ADHA 4YWHA 3NO4A 2C7PA 5HIJA 2M6RA 1IBMB 4XEHA 2EKQA 2HJGA 4IS2A 4WL0A 4L4XA 1N9GB 4LVNA 4YB8A 1RJEA 3IUMA 5H7XA 3TKAA 4WW0A 5K8VA 1X1TA 3ACBA 1GQYA 3MWKA 2B2CA 2XADA 3OY2A 2FVYA 2UVPB 3JQFC 3MB8A 4MI6A 4B2YA 4WBNF 1QQAA 2LV8A 2R6R1 1U7HA 2ZSBA 1D2GA 3DWIA 2J7PD 1VLHA 2LKDA 2Y1GA 2D59A 3PHCA 4WIAA 5I4CA 1K6EA 1NM5A 3NTLA 5HEKA 3VUFA 1C8VB 3FTFA 1WEKA 2BFMA 1U8TA 1VBKA 3IO3A 3QIVA 1WXQA 4Z1MD 4U2CA 4MR8A 4U7JA 1E1YA 3SDSA 1SO8A 3LDHA 1H9BA 5TIIA 2IYUA 3DT9A 1A27A 3ETDA 2A92A 1VCHA 1HYHA 2VQSA 2MT9A 3K09A 2A84A 4B2IA 2ZIXB 3KWFA 5CJ2A 4YGYA 1SKBA 3L0DA 2FR1A 2ZG6A 1W8DA 4DA8A 4ZVMA 3DNMA 3EXIA 5LJLA 2QP4A 4D44A 3E4DA 3EIEA 3I9JA 5JZSA 3CKLA 1CU1A 3ZTWA 3ZXUB 1LBQA 1JAHA 3CUVA 4REQA 3E3MA 3NVKI 1U7XA 1RWBA 3KT8A 4ZV4A 5FOXA 1CJSA 1NR1A 3OQJA 4M87A 4ON9A 3DF7A 1MHTA 1E8DA 3GV0A 2D7DA 1C1XA 2W2LD 3PHJA 4GIBA 1G3MA 3OFVA 4PW0A 1J8DA 3ZWNA 4C04A 3HM9A 3U4QB 3BDVA 2Q5CA 3GH1A 1HK7A 5CYGA 1GZ7A 4YJGB 4REOA 1D9ZA 1Y4ZA 1Q0LA 2CK3D 2PKEA 5AVZA 3V4RA 4QOSA 3UA4A 1PWZA 1OWNA 1Y5NA 2FPIB 3ZIAD 2QA5A 4GICA 3VTZA 5JPCA 1UJNA 3U1BA 1D7AA 1YHNA 4KGDA 3WZMA 4OHOA 4M0EA 1LFDB 5K3EA 3COWA 1ZIDA 1NZDA 1P9NA 2E5WA 1QIFA 1V11B 1YZLA 2VSOA 2VYVA 3KFXA 1YTLA 3P2YA 4FMPA 4JS0A 1BE6A 3N39C 3R0JA 4PQYA 4Z9BA 3B9QA 4XX0B 1Z7YA 3LYLA 3R3VA 5CCEA 3U61B 3VMMA 1BXZA 2REOA 5ELXA 1NR5A 3DE3X 4JLKA 2PDAA 5E0OA 5BN5A 3SVTA 2XUPA 4RL4A 3RW9A 1T4CB 1ZYUA 2EZTA 2Q0QA 2YCLA 5DYIA 2CEKA 3DDUA 2GTPA 4UNQA 3L0ZA 2VLBA 4LJ6A 4N0DA 4DXAA 3TEMA 3GUZA 3C39A 1JJBA 2OCLA 1XJQA 2QN3A 4BVJA 1PQWA 1OXUA 1B1CA 3BZUA 5ITSA 3ORFA 4LXYA 2CLFB 2GXQA 4R3WA 4X65B 3N6VA 2JFYA 5KS2A 1HQDA 2A3NA 3SHTA 3EA4A 4L75A 1JEJA 2Q5LA 3M2PA 3CJTA 1M5RA 2WVJA 4OQDA 2PS9A 3KXPA 1OPXA 4EB0A 3NTVA 3Q72A 2Q9BA 1ABBA 4MZXA 3R0VA 3HCPA 3V1NA 1TT5B 3BFVA 2R1TA 1BGVA 4GOND 4R0VA 4UOZA 3Q87B 5CH8A 1GLGA 1L8XA 4ZAFA 2G6BA 1OH5A 1DBVO 4GECA 4D8YA 2G1UA 5CB6A 3BC1A 3C1UA 1KY5A 4PLGA 3L1VA 2CY0A 1OWOA 4FX5A 1RJ9B 5KI6A 5BUSA 4JWTA 5EMKA 3TIXB 1IUOA 3DQZA 3P0RA 2ZRJA 3S7TA 3K6SB 3HN6A 2OKGA 2QQ5A 4WZBB 3K1TA 5T67A 4Q3BA 5LD2C 2JH9A 3EDRA 4G63A 2ZGVA 3GGSA 4YJHB 4BLTA 2X2EA 5K8IA 2ZUTA 4AY4A 1G19A 4XTCS 5C18A 3D5QA 3PIRA 1TM4E 4IWNA 3GLGA 1SU6A 1SXJD 3ORHA 3RFXA 3D8RA 1NUQA 1NFQA 1NI4B 4NF2A 4OA5A 4DJJA 3LXRA 2WF9A 3HXKA 4LWQA 1Q74A 2FVXA 2IYSA 3Q6MA 4JOCA 5H82A 3W2HA 3ZY5A 2W2VA 4CV1A 5T6BA 3V97A 1SVKA 2ON6A 4TXLA 2EEZA 2Y1XA 2IHKA 1E7WA 5BN3B 5JROA 3K70B 2W2NA 2BM9A 3B1JA 3OZ7A 2HT6A 4ZHSA 3QBVA 1K98A 4B4KA 2YQ5A 4QBIA 3QKRB 5LZ9A 1K06A 4E4YA 1CRQA 1K7XB 1ZH4A 2C88A 3DWGA 2H1CA 5TMEA 5GP1A 3VKUA 5MFPA 4PLTA 4BMOB 5C9ZA 4LSWA 3FSGA 2ZUDA 5I47A 5DM1A 3V3TA 1ACMA 2HB6A 3RSQA 3VTKA 4JY7A 5A4IS 3C3BA 4DWVA 4OJYA 3VR6D 3WWYA 5LZ5A 5LMZA 1G2QA 3DE2X 5C32A 1RACA 2YN2A 3ED1A 1OH7A 1F48A 1UOOA 3V34A 1V48A 1X1RA 4UU7A 2HV8A 1X94A 1BZYA 1FSSA 4RFSB 1VHDA 2RARA 2X6QA 1V1JA 2XVYA 3OY7A 1R8QA 4LI3X 4QUEA 3CLSC 5G02A 1YL6A 1EINA 5CLJA 3NHPA 3EYAA 3LY7A 4YJ2A 3CE6A 2WJWA 4QYIB 4J0JA 1PJ8A 5T4BA 2XQGA 1M8FA 3ND6A 1RRKA 4PGAA 4ZAGA 5JRJA 3C3DA 4JLJA 2O0JA 2QAIA 1NW9B 4Y0VA 2B61A 2WOJA 5KJEA 4GE0A 1L4KA 4YYEA 5CA1B 3PUKA 2GYWA 5M3BA 4F71A 2WQ7A 3RSSA 1XNJA 1JVNA 3OM0A 1Z7GA 4DLAA 3C0KA 4XD7D 3TZQA 2CNNA 2EBUA 3DAGA 3EBOA 1H5UA 3Q3GE 1YMUA 1J25A 3KTDA 3TLCA 2GKGA 4BO5A 2VT2A 2FP4B 4RSRA 1PS8A 4N5IX 2PRKA 5TGTA 1Z36A 1KU0A 5JWHA 5F76A 2I2BA 5DM4A 1A9QA 2X0FA 5EJ4A 5C8YB 1NZJA 5KTNA 4CDMA 4Q1DA 2GM4A 1CKEA 5DHFA 5IYZA 1FDUA 5EPEA 1WCWA 2C77A 3A26A 3KKEA 3QPBA 4Q21A 2IV3A 4E5DA 3HBAA 3IDQA 3DBVO 3PQ8A 1REQB 1IY2A 1ORIA 3GEIA 2V9CA 4EF4A 1RZRD 2GEUA 4WUVA 1YR7A 2W2KB 2A35A 1KZYC 3OJ0A 4LJKA 1NHGA 2B3DA 5ARBA 5GGXA 5HRCA 5DZSA 5BV0A 3E4CA 4MRPA 2DE0X 4M37A 3ZV3A 3WLQA 1KQPA 1WB6A 1ND5A 2D13A 4XIGS 5HE9A 2OKCA 3EXEA 3PFNA 1OKKA 3C43A 4BCDA 5BNFA 3CUTA 2CL7X 3W3AD 1IB0A 5HOEA 1R0SA 5JSFA 1SH7A 4YAUA 5ULLA 1FFGA 1PVDA 3LAWA 3MYRA 1B8VA 5I9TA 2TMKA 2WD9A 3CRQA 3NBQA 2D1TA 3R9XA 1T1RA 3K9QO 3KYDA 1R27A 5FO1A 4EK9A 3I62A 3TLGA 3G13A 3KJXA 3A6ZA 4MV0A 3WQSB 2H85A 4M9UA 4C0BA 1QVAA 1YK0A 2Y71A 1XN4A 1L7RA 3DZJA 2AFHE 2FU5C 2WOOA 2J5RA 4H6PA 2GEFA 3UCXA 1RHMA 1V26A 2Z2ZA 4Q3LA 1DV2A 1M1NA 1Q0ZA 1OIWA 5JWOA 4LVUA 4XDYA 5EIBD 1MC4A 5CT8A 1S2DA 5TPZD 1WR8A 2H2DA 2SBTA 1OLXB 1WLYA 2ZETA 5CDYA 3FH0A 5TT1A 1UT8A 4OGGA 3K4HA 5J23A 1IJBA 3C6QA 1F1BA 1H2WA 3D64A 4MV5A 3QYJA 1SD5A 5CEJA 3TPCA 2XYGA 4KXWA 1J9EA 3ICCA 4LWOA 2GCOA 3BQNB 3SKYA 3ZIDA 4AUKA 2B4KA 4KDRA 1M74A 2JEZA 4DZRA 1ZJ5A 1PNQA 3EVZA 4P80A 4RWEA 1T8YA 1KYIA 3EJWA 1II9A 1QIEA 1GAQA 1P3JA 2IJGX 2JK0A 5A3RA 1E32A 2XUGA 3F8SA 4W5HA 5DX0A 4HXFB 2OFWA 2QLFA 1JIXA 1KOJA 4E32A 2QSYA 3KQHA 3KHSA 4N7RA 4UBOA 3ZX5A 1KBZA 3H18A 1YQUA 3WK8A 4UU0A 4AKIA 2P27A 2AFIB 3UMGA 4IIDA 1MA0A 4FE3A 1M66A 3KOYA 3TG8A 4ENWA 3RDPA 1RXSA 2FR8A 2I4MA 5EMMA 3AY3A 2C4VA 1MB0A 2FPKA 1M2VA 1Z4QA 2PGNA 4G0XA 5AI9A 4CLXA 4R9RA 1XGKA 1X70A 3ODPA 4KN6A 4QAJA 1LLQA 4ZVVA 5IK2A 2ZJOA 3A1TA 4DT1A 7REQA 3GMDA 4KW7A 4UM5A 5AI8A 3V33A 4ZI7F 3ZU6A 1MZVA 5FEMA 3NEJA 1NU8A 3V4SA 2ECFA 1T9ZA 4WK6A 5H3HA 5TQ0A 2IYZA 3D5EA 3ZE2B 5AVVA 1KEZA 1QIGA 3CX8A 4JUAA 5FA6A 1MHPA 2WF6A 4PS1A 3BBPA 5IJ9B 1HLGA 3PCXA 4LHSA 3W34A 2QRLA 4R9SA 3HSSA 4HNHA 4OFZA 2ZI3A 2M6LA 3KQUA 4LC0A 4YJKA 2BY4A 1TW2A 2YYSA 2I2XB 1UC9A 1J2JA 1GRNA 2W6ZA 4KPUB 1O9HA 3E8MA 4IXTA 3HJUA 2Q4OA 5ALIA 4PG4A 3N9IA 5F7XA 3LP5A 3BE6A 1PRYA 1W25A 1OILA 2V3WA 1GDTA 4KHZA 5KTMA 2GEVA 3RC7A 2IDMA 3WB2A 4XUCA 2YYYA 4R0MA 4YMTA 1M34B 4MO2A 2LE0A 3JQAA 2D6FA 3B6MA 1TL7C 1W0KD 5I4BA 4HLCA 4DSNA 4EHJA 4LXXA 4KR2A 4A0FA 2C8VA 2BKUA 3MNFA 3GA0A 4M2LA 1V6CA 4LBVA 2WINI 3A3NA 4MHOA 1IJKA 3L0IB 4BNIA 1EE2A 4LE1A 4RIGA 1P2GA 1VLJA 4B4VA 1SBNE 4D41A 1F4VA 3LBNA 3S68A 3HY3A 4EX7A 4F4IA 4N40A 5CYPA 1EZZA 1UZNA 3H84A 2FR0A 2XUQA 1LJ8A 1F6DA 4FCVA 2G09A 2EKZA 2Z04A 5FT9A 1XCPA 5TV2A 4RD0A 1CDEA 1M8PA 4EO9A 3M33A 3KVNA 2P2DA 1ZW1A 3WRYA 3BL6A 4E1VA 4WZZA 3FKSA 4LPKA 1Z6GA 4ODIA 1ZD4A 1L7MA 1DKMA 3CQ9A 3B1KA 1UJ6A 4N7BA 5M5BA 1HEYA 4Y0NA 2YYZA 1JIJA 4RJ2A 2W8BB 2WAMA 3PK0A 2OHXA 1CLEA 2QTVB 1JHZA 5KZMB 1CJBA 3AI3A 4KLNA 3E9QA 1I2CA 3HZHA 4RVCA 1BCSA 1R0ZA 5AUQA 3L7IA 1ITZA 4K8RB 3RS7A 2MSDB 4NMWA 2BMWA 4WZ6A 5KC9A 1N57A 4WWHA 4BCCA 3WWPA 1N32B 3DZFA 4IEFB 4RELA 3CNNA 4B3XA 2WJAA 1L4GA 1UT6A 2PAAA 3DYIA 3QKIA 2HF2A 3G6KA 3HVJA 4IQFA 1XD8A 4MW9A 1WVGA 4JUBA 1E4EA 5NLLA 3VNQA 1WPGA 1SBZA 3CZ4A 4BGVA 2FEMA 1Y42X 1V1RB 3FUVA 1TMKA 1RCUA 1Q14A 1CR6A 2FUNB 3SIPA 3GPBA 4NEQA 3DPSA 5HVNA 1WDLA 1RJDA 4PZ0A 2YH2A 3MCTA 2YDXA 3V4ZA 1PS9A 1RI4A 3OJFA 4HZUB 5D3MB 4AULA 1E20A 1PX2A 1R9NA 5T4FA 4AIIA 4IICA 1H1DA 2X8JA 4Q7KA 2G76A 1KZ1A 2PBZA 4DMRA 5EN4A 1DUSA 4M99A 1QGUA 3OCXA 4CGZA 3L18A 3RASA 3SQOA 4BNVA 4JI8B 1EJBA 5L4NA 2GXSA 2DT5A 4I8XA 1CQXA 1WVMA 1YQ9A 13PKA 3FHOA 4TWZA 3TBFA 1PTKA 3EVTA 5IN5A 3O7MA 1J0DA 3FVTA 4ASUD 1TIPA 4GX2A 3M81A 2PAFA 4PR3A 3CVWA 3T3HA 4B6RA 4CCAA 3EEOA 4INAA 2AEFA 3DL2A 1U3FA 1QH1B 4DJDC 1O6FA 1M67A 4HVLA 1XXLA 1S3IA 4LBZA 5LQAA 3RKSA 2B7CA 2V74B 2ZVJA 1Q3HA 2ZE8A 3T1YB 1NUPA 2YVUA 1ZJ4A 5TQVA 3IMEA 2HEGA 4DCCA 2RDMA 4NOMA 3R20A 4O4LB 4RKEA 5C31A 4GC9A 4KKVA 4N4AA 4LRWA 3OOHA 4Z4CA 2ANCA 4CLRB 1KHHA 3G0DA 1KZ9A 2AMJA 4FHZA 3DFFA 1ZCFA 1SK9A 1CE8A 1KEUA 1CUYA 2G0AA 2JGIA 5THXA 3AR8A 4YRCA 2J9YB 2AZXA 3ITEA 4BX9A 2XF2A 2H29A 2YMQA 4QYWA 4G4JA 3ZWXA 3ZCRA 1TKCA 2QRUA 2RGUA 4N7MA 3QYPA 5TGZA 1VDZA 3RYFB 3EDCA 4CBVA 5L9AA 3FGZA 4ZV7A 3VHXA 1H2EA 2JA2A 1JXAA 2XR1A 5G0WA 2JNWA 4C6HA 3ITKA 1CUHA 1H6BA 1AQ6A 3HYNA 3GRCA 4MMYB 5DNUA 2QK4A 3SSNA 2ZJ7A 3CE9A 3I52A 5JAUA 4C3ZA 2BFPA 3GJXC 4G8JA 4OU5A 3E9YA 4KXVA 3TCXB 4AS2A 4IVRA 4E5MA 4TLBA 4OM7A 4B4WA 2WDZA 3ZR4B 1RQ2A 3T7KA 4AQYB 4V39A 2JVIA 4C0SA 3A70A 3IAS6 1CNMA 3OLZA 5LYJF 2RGBA 4HB2A 2R00C 4HR7A 4JT4A 2H8GA 1Y5IA 3PD0A 1WY5A 4PYIA 4TROA 4FIDA 4CE6A 4DM7A 1K3UB 2ZAYA 4FIZA 4HH1A 4E1BA 1UXJA 4Q05A 3WC4A 4DEXA 1XV5A 3GJ7A 1QZXA 1RZ3A 4IOJA 4Y9DA 2W42A 5HE8A 5JI2E 1G5QA 3BX1A 3Q3JB 1QR2A 1IPFA 4FI3C 4AY3A 4HBZA 3HO1A 3OHSX 3EA5A 1CDZA 2X3UA 3IMCA 3GJ4A 4N5DA 5HTKA 1SOUA 5IG2A 1EK1A 1V7CA 1ZUIA 5AYVA 4FONA 5D6NA 1I5OA 2DCUA 2GM9A 3PV0A 4L4RA 4MW1A 4CI0B 1TCAA 4TTJA 1JDBB 4IFEA 3NGXA 3V42A 1YVUA 2OT3B 2BM8A 5KO2A 2VTKA 4NHOA 2V6JA 3H83A 4I81A 3SFTA 2O8FB 3PZBA 2Z09A 1U1EA 1THGA 4RVSA 5HW0A 1QYVA 4NICA 5CFOA 4HV4A 1Z6YA 4ZK2A 4EA9A 4E22A 3AUAA 4M9XA 1F6BA 4MS1B 4Q7MB 1JALA 1F17A 4G24A 2GEKA 1SQ5A 4HEQA 4XQ9A 3AEYA 4GMKA 2RGDA 4JT2A 4LNUA 3I61A 2W2TA 2NV6A 1MRSA 3Q0EA 3DMTA 1BQ4A 2H0RA 1A9SA 2QL9A 3DPIA 3IP9A 3P9YA 4WV3A 4IUDS 4IXDA 4CV3A 5C5IA 5G3ZA 2AS0A 3JVDA 3L4BA 5FOQA 4AO6A 4I5GA 4I6GA 4JKYA 2M1XA 1GEGA 3OCWA 3VOBA 2P2GA 1FYEA 1JKJB 1O94D 1WSAA 1UPAA 2O9JA 2R11A 2QRGA 3L6RA 4OLJA 4RV9A 4V0MA 2GTHA 5K4AA 3WGTA 4FGUA 4HJRA 3PSAA 3DB1A 3MJRA 5JSHA 2XT9A 1A1VA 6GPBA 3MWYW 2HPHA 4OMFG 4KR7A 4OAPA 2BW0A 2H7CA 1IOWA 1QOQB 2QE7D 5JS7A 1YTUA 1LJUA 1X1QA 5JSZB 3C2QA 4P3PA 1KZGB 4HZGA 4CKCB 1D6MA 1EZ4A 1LV7A 2QI9C 4FLFA 1VP9A 1DC4A 1V96A 1MBZA 3R6LA 4GP6A 1O2DA 3CONA 3TEJA 3VI4B 4BWFB 3THYB 1BGWA 1D4OA 4HMOA 4I4TF 3HCAA 4MGZR 5F12A 3WGJA 1T2DA 3WLKX 4A6DA 1NW5A 3HYTA 4BFLA 1ONBA 2V8OA 1XQWA 1GZUA 2GBCA 3ZWVA 4BFXA 1MMFB 2PA3A 2RHRA 3KTOA 4L3OA 3SE7A 4ZICA 1J4AA 4WVLA 1OJ7A 1HQKA 2CZCA 3U9SA 1A2BA 4ONEA 1NURA 5JS1A 2ZRPA 2YWXA 3MAAC 5AKJA 3JYPA 1NJGA 2O1WA 1SRQA 4H1VA 3W5VA 1I8TA 2QS9A 4M9CA 4L6IA 2B0CA 3ZWPA 5B7GA 1VB5A 2X23A 3OTQA 3A3KA 1K08A 1U8UA 3AKYA 4RPKA 3VYRB 4ZIRB 2P3QA 4PFQA 4OSOA 3M3HA 4ALJA 5C4MA 5JTTA 3GGOA 1RPAA 4IQGA 5DLEA 2EDAA 3ZJUA 4BE7B 1JTVA 1RWVA 3CG4A 4NR0A 4IWYA 1I6WA 2J3QA 3FPEA 4MPPA 4DJEC 1P1CA 1HDGO 2B9VA 4Y1EA 3DBHA 4D2IA 4F1JA 3M5DA 1T1IA 1LTHR 3KEMA 4GPZA 4R8LA 3T9AA 2ACWA 3R40A 4IXWA 3ZLJA 4CM6A 2VSNA 4XCXA 1TB4A 8MHTA 1QHIA 4ZFNA 3FCCA 2YFKA 3NNNA 1JG1A 2QX8A 3AR6A 3FOBA 3T3MB 3M49A 3QXSA 3NW9A 4TYMA 4RVHA 4DNOA 4LGCA 4ZHQA 1EFCA 2GNOA 3H5IA 3HABA 5BT9A 1OHHA 1SUPA 4HQKA 4KC0A 4R01A 1VSTA 3N28A 4R9NA 4MB0A 5DM0A 1I9GA 3GLHA 2RGEA 5AUOB 3RVBA 1EFVA 3UWKA 2OFPA 5K8LA 3SYMA 1Z4NA 3TOSA 1J24A 1UDXA 4NZMA 2ZWOA 1BA2A 1ENYA 2ZBUA 1A76A 2BHLA 1PZMA 3KYCB 2OV6A 4B7ZA 2FK8A 2I8CA 3ORQA 4U2GA 4IDFA 4M0MA 5DHRA 1EQUA 1Z4PX 2H11A 2YYAA 4LY3A 1W35A 2OORC 4BFYA 5IKXA 3OFND 3R3ZA 1R6BX 2P35A 3PIIA 4KRYA 3SHOA 3SJZA 2P30A 4RVGA 1C41A 3EY4A 4R8KA 4BO8A 1HETA 3G0OA 1K5HA 1OZGA 4UBNA 3PA6A 2SNIE 1NTOA 2BGTA 4FFBB 3AF3A 3SSOA 4ADSG 1U0EA 3F1LA 2ABWA 3F6BX 4FZ5A 2BEVB 5HIMA 5KVAA 1JS1X 1UQUA 5DYTA 2H4ZA 1GNRA 3V4FA 5B3KA 1C0EA 1ODIA 3A06A 2EFCB 3AJAA 4R1SA 3UWOA 4OCZA 4QDXA 1I2AA 3BGOS 3RR2A 2CHGA 2LDXA 5H3LA 5JDCC 2M32A 2ODNA 1NRJB 4S1PA 1SIUA 3DZIA 1Q7GA 3DR3A 5F1OA 1KJJA 2ODTX 5BYJA 2BHNA 4GKBA 4MWCA 5DGDA 4YREA 3IKTA 4F56A 1AQLA 1TD1A 3C8MA 5HJ5A 4LF6B 3OX4A 5IF3A 3OCJA 2J6IA 2JGDB 2O2JA 5ED0A 4KWEA 3HR8A 3DA8A 1NDQA 2AJLI 1NULA 3T0GA 4FYVA 2PO7A 2Q3MA 2Z3VA 5PGMA 1IQ0A 1JEQA 3FNFA 5KNLA 4Z9YA 1W94A 1JHUA 4DNPA 4WDRA 4UTRA 1PJZA 4QU0A 3D43A 2GBLC 2GFIA 4IILA 2D4AA 3PHHA 1YZYA 4NI5A 4XKJA 5EIEA 1PV4A 2I62A 3K8YA 3HNOA 4ARUA 3GEPA 3MTAA 3CZMA 4G0YA 2PXHA 4CEIA 4Q03A 4RQUA 2C1EA 3DZKA 3TD9A 3AF5A 1HR0B 1A9TA 3NHWA 2P4UA 3GEEA 5BO5A 1R0LA 3HVHA 1RHQA 3F7MA 2FEKA 2VS1A 2AOTA 2X19A 1OC4A 1Y4DE 2VRNA 4YV1A 2FH5B 2BCGY 3FPJA 4M0FA 1NM5C 1W48A 1UMDB 2REQB 3H5NA 5A9TA 3H5LA 1U02A 2F67A 3L9XA 4BLOA 1YFZA 3M6MD 5AMXA 3P2JA 3T5BA 4DAEA 3OF2A 1USVA 4L16A 3PICA 4UM9D 3GRPA 3TTUA 4E4RA 1HXHA 4WAUA 3FTDA 1C50A 2HHHB 4OSPA 5HA5A 1GGKA 2ICAA 5KJFA 3NETA 4H27A 1UEXC 4FNMA 3T5PA 1ESZA 5DCUA 1F1JA 1QLHA 3MRXA 4C6TA 3AG5A 4GKAA 2EFDB 4QDJA 5DV9A 2P9FA 2BBSA 5E9AA 4RSHA 1BN6A 2FCRA 3T1HB 4KFTA 3I5YA 3EOAI 3HJGA 5BVGA 1QPZA 1J8VA 1SIBE 4LOIA 4RSGA 4HDSA 4OXXA 3OWXA 3LU1A 4K26A 3HA5A 3SLGA 1J22A 2GHQA 4Q00A 4AWXA 3OEED 1N6PA 3NHBA 2Q3LA 4Y6OA 4CTNA 3VHLB 4IR7A 5JOQA 2YDYA 1QGAA 5FBWB 4XH9B 2YJ6A 3LM8A 1FTGA 3PX2A 1E3MA 2AXEA 2RAVA 5E8RA 3C3JA 1HEUA 1YBVA 1ZD9A 1G21A 1RAHA 1XN1A 2D2EA 2P65A 1U6KA 1OXVA 3H87A 3HEBA 3HKCB 3JVEA 4B6QA 3RWMB 2XUAA 1BU8A 5EMNA 3ZCSA 2CNWD 4JLAA 4K9OA 1ZAKA 3GVXA 4LOHA 3AI7A 2QJRA 4DARA 2IS1A 1WP4A 2HAEA 3D0RA 3DVLA 5BRJA 2PVCA 3H86A 1E62A 3O4VA 4YR7A 3O1JC 1AKEA 1X8JA 2BZSA 2CSXA 3L7AA 2A58A 3L06A 2AC4A 3EZGA 1PNRA 3M1AA 3ZLVA 3N2KB 4DVGA 2GETA 1XZHA 2HFKA 4NDZA 4L9RA 4YT2A 4Z2AA 1AK2A 3D0QA 1QUEA 1O6BA 3DJYA 3GIWA 4OP2A 5CB0A 3GDGA 1D2MA 1YB7A 4LRQA 5F5XA 3M6WA 3SIWA 4UW9A 1YIOA 4AY2A 3GT3A 3G3EA 4O4JB 4K7JA 5I8PA 2E4AA 4WZBE 3TOZA 4YASA 5TMPA 5B6JA 1WCIB 3AEQB 4XSGA 1H4SA 1MENA 1ZNZA 9LDBA 2NSLA 1CVIA 1C1DB 4UU1A 1JI0A 4JJ8A 2YXBA 1FP4B 4EUEA 1EHIA 4RD2A 2JFXA 5KNCD 3CURA 3NXSA 2BE9A 2DKFA 3ADPA 1SQSA 5ENDA 1Z8FA 3CTMA 4NFHA 3T94A 1Z0SA 4ESVA 5ALUA 3KKQA 3E8XA 2Y77A 3JAWB 3G0BA 1A9YA 4ARAA 4QKQA 1GTSA 1DG1G 1NJ5A 2E4ZA 4C3UA 3VHQA 2Q49A 2A6PA 3KUUA 1UJMA 3UO8B 3K0SA 3N8DA 3WKEA 5NULA 1T4MA 1EGAA 1IQRA 3ESRA 4TSRA 3S29A 1G4AE 2AW3A 1OZAA 2WUFA 3QELA 1L0BA 3N59A 4IX9A 4ND5A 4O2RA 5ECYA 4ZCIA 3AUTA 3DFIA 5CFMA 4LF9B 1EUDB 1MTZA 2ZUUA 3EMKA 3PFCA 3PTAA 5IDWA 1XAHA 2OILA 5BR8B 2DUWA 1U5CA 2Q1XA 3BJIC 3QBTA 4M9SA 4HB4A 5IDVA 4DA0A 4YHBA 4HGQA 3EIXA 3W5UA 4C43A 2CB9A 2OCKA 4X1KB 3L1JA 4Y30A 3NAZA 1B8PA 4FXOA 4G36A 3TXYA 4XWOA 1JYFA 2IZOA 1A69A 1GITA 1X87A 4QJIA 2H2HA 4IIEA 4RDCA 2ZYWX 2HNKA 1YO6A 2ZIAA 3TLMA 1A88A 4FMBB 3WQQA 1ODSA 4Q7LA 1JIVA 4MUBA 2DFKB 5BWOA 4JBLA 1MC8A 4LA4A 1Z08A 3U31A 4YRQA 3PL1A 4OJMX 1LI4A 2OCGA 2MYUA 3KQOA 1T91A 2HCJB 3K1JA 3CNEA 3R5TA 1VCMA 3CWQA 4YRIA 2DCMA 3GJYA 4I19A 5EKXA 5HS4A 1Q22A 3C15C 5I7AA 3UV7A 5C1PA 6PFKA 1T8WA 4AN0A 3QPUA 4K0RA 4UUBA 1MJGM 1SD2A 3IUBA 3CXUA 5FDFA 4RWZA 5IJXA 2UYHA 4A5SA 1LDEA 2PMFA 3NYQA 1A2OA 3AEZA 4FEAA 3FYUA 2C2WA 1O96A 4ZPJA 3HDTA 1JAXA 4BRSA 2AF3C 1VPDA 3DDSA 4NE7A 4Z6KA 2JFNA 3GCGA 3L8DA 5H59A 4A2QA 5TDHA 5DBGA 5KYVA 4CKYA 1IQUA 3PBKA 1GPKA 1NRIA 1EFRA 3F47A 1J8MF 1USUA 1FNDA 1P3DA 3HKDB 4IF6A 4G0PA 3AFHA 1U0NA 4UDXX 2CYCA 4ND7A 4QPCA 3RSLA 2Y9PB 4D9CA 1FK8A 3AGQA 4UHJA 4B3CA 3HGQA 5JQGB 4JSYA 1PT8A 4DXDA 2AKYA 1LI5A 4LG1A 5LA6A 3GUUA 2GFHA 1EQAA 2ZSKA 4M0PA 2O8DB 3S4YA 2YASA 3U49A 1NOKA 2PNJA 4BB0A 3AEKA 4PQFA 3B70A 1MFPA 1JPVA 1U2DA 2HH9A 3WBFA 5FADA 1CJMA 1IDOA 1ST2A 3MM4A 2CXTA 3EAQA 3FE2A 1EK6A 3O83A 3LDAA 3NVMB 1NLUA 4LMPA 4L51A 3ACDA 1E3WA 1QAOA 1T0JB 3A6KA 2VYNA 1GZHB 1U1GA 4NS4A 2TMGA 2VPZA 4R1LA 4WOJA 1EWYA 4WXEA 4EUNA 3L07A 1CUWA 1N4AA 4CCYB 2LIPA 4BUZA 3AVXA 3ONDA 3ROKA 4Q4LA 4BGDA 4ERXA 5JR3A 4FEEA 3MTEA 2GCIA 1C5KA 3ZVKA 4I4NA 1SULA 2GQ0A 3T3DA 4AJ9A 2R8OA 3IP3A 4F4FA 1B23P 3MQFA 4PTYA 2DH5A 3BEDA 4FOTA 2PJDA 4Y18A 4KE7A 4OHKA 1UFQA 3ILYA 1JA9A 1JWAB 3A10A 4TLDA 3LHFA 5B6PA 2ZRMA 1SURA 1KZ6A 4P9NA 5FPYA 2GCPA 1K8YB 3ESXA 3FZNA 4II7A 4R1QA 3OM1A 4ZVLA 4BQNA 5CAEB 3A4VA 4GGMX 3C5HA 3PWSA 1IM5A 1FP7A 4YAGA 2Q2NA 3VYVA 5EHQA 1GCAA 4AAYA 2FZ4A 4ITRC 5FLEX 1PVOA 1XQ1A 2OSBA 5H0IA 3VU8A 4LOAA 1USKA 4Q34A 4E7OA 1T0IA 4D43A 3TAHA 1ZGHA 3BWEA 2IPXA 2Q7XA 1DKNA 4HLNA 5FI3A 3IVMA 4X66B 1WB5A 2CXNA 2QL7A 1NN0A 4B6SA 3PUJA 1E6UA 3OQIB 1PFYA 1VYTA 4LDAA 4JL5A 2IPNA 5D3QA 4N0MA 4F2PA 3JWEA 1QS0B 5D2CA 2AUTA 2DUUA 4D4HA 4EG1A 5LP6A 3NOQA 4UDOA 2CEAA 2Q4TA 4HWPA 1K75A 4ALLA 4OK5A 4RQTA 2AFIE 1QYDA 4EHAA 2QYHA 3ZXXA 4MLPA 4OQ4A 1Q7RA 5EJ2A 3COPA 1U80A 1FZTA 2QW0X 2L82A 5JNRA 3ONVA 3SC3A 2VNJA 4BASA 1C9NA 4BV2A 1YK1A 1KYZA 2OAEA 4MITA 2NO9A 4HP8A 4BP1A 4WRRA 1TPZA 3KYBA 2VAPA 1YSCA 4BKQA 1I7LA 3KR2A 4I3HA 1C29B 3SKVA 1PJ2A 4F04A 1M1UA 2I1WA 4N3CA 3DTVB 3GMTA 3IESA 1Q84A 4Q3CA 2AI3A 2DY1A 4MJLA 2B9EA 4ZVPA 2YWDA 4W5JA 2BBWA 2HBRA 1ZITA 1RM0A 3CLVA 3LK7A 1M6WA 1MOPA 3HJRA 3RVRA 4F3YA 4A15A 2QP9X 4WQMA 2PRYA 2ZTLA 4E51A 1FQWA 3CNBA 4E2FA 3QA3E 3NRCA 4FINA 3LFTA 2ZT5A 1FDWA 3ADCA 1EYZA 1WXEA 2Z6VA 4LDPA 5EFZA 4PCUA 1XD9A 1AKUA 1L9KA 5DTIA 1CY1A 1NF9A 4PWYA 4P31A 4DGQA 1IY9A 1KR5A 2YY7A 2FR8C 3C3YA 1V5EA 3CVJA 3P0EA 1UDCA 2B3TA 4EI8A 1VI5A 2PZGA 1M34E 1RR6A 3IOEA 3M1LA 1WW2A 3C3PA 1JDUA 3IOCA 1A9ZA 3UJ3X 4QO7A 1XHLA 3GX1A 3DE6X 5KSPA 2NP7A 3I37X 1DDIA 3F97A 1OXMA 4R8RA 5EKUA 3FDXA 3WMXA 4RTQA 1SUIA 3BCUA 3KAPA 4QWWA 3NHZA 5I7UA 3IRUA 1FFDA 1X8KA 1Y9AA 4S1TA 4KXYA 3F3MA 3GVCA 4YRLA 3HG7A 5ALOA 3CKKA 1DBRA 2VHZA 4NL4H 3ZCTA 3P9SA 4JJKA 2FE1A 1EDDA 1GUBA 5B1HA 1MLDA 2MMGA 4PSUA 3R7WB 4J91A 2DEUA 1N6IA 5T64A 2O3UA 3RRJA 1XTUA 4BZXA 3NWJA 1AS0A 1XVLA 2O57A 3MLEA 5SZKB 3H0KA 3GWGA 3I9V6 4YMVA 2X4GA 1Y9JA 1R4AA 3FBWA 3AINA 4U9HS 2PX6A 3HWRA 3JWJA 4WCFA 4Q19A 4DCPA 1Y82A 5B37A 4P86A 1XKTA 4W5QA 3DNPA 4KJZA 1H4TA 2V6GA 4I1RA 4NJOA 1EP2B 1UJCA 2UZ0A 1MX9A 2ONCA 2WJ6A 3MTDA 2VDNB 3X1YA 1G66A 4L27A 1EX6A 1LKZA 1NYRA 1Q1NA 1Y3DE 3EQ9A 5LB4A 4F0JA 1MO4A 4EF5A 5DWDA 5F7JA 4Q3OA 2H07A 3O82A 3QM1A 1PEAA 4MUKA 2HTFA 5K0TA 1CETA 3KO8A 4OFWA 3R7SA 3HL0A 4E15A 3WA7A 4H7PA 3KB2A 4QDOA 2JG3A 3H5VA 1H2ZA 2LVBA 2ES4A 2H2GA 3X2SA 5FI1B 1P17A 4MUAA 4WZAA 4NXMB 1LSOA 2G9ZA 2Q3JA 3LC0A 5CFZA 3W5SA 2E5LB 1SCAA 2FRXA 4M22A 5B2EA 3SI7A 1P1FA 2Q6IA 1ATIA 2XZPA 1H3EA 4MB6A 1A7KA 3LQYA 1SD1A 4Y2HA 1ZJWA 5FOWA 3HCOA 5E6SA 2FZLA 3OPNA 2HRBA 4FI3F 1O95D 1VC2A 2XMDA 3Q3CA 2V5AA 5ALPA 3CMMA 4OHFA 2A57A 3C6BA 1NSTA 1Y7PA 1NQTA 2P0EA 1Q7CA 4I1SA 4RK7A 1P61B 4FE7A 4M7WA 2X0NA 1R0BA 4GNKA 4R2XA 3RRYA 4LZNA 3RWOA 3DXZA 2VHQA 3SZRA 1MRZA 4IFIA 1JSZA 1E0KA 3HXPA 5DXFA 1VMDA 2HRQA 2W48A 3E9RA 4J0KA 4G5RA 1ZGAA 3ZLBA 4DDKA 4TM7A 1ZM4A 2YWHA 1LSJA 4KJXA 2WMDA 1JDPA 3PUWA 2SKEA 1D2RA 3VUEA 3RB8A 1XIVA 3IT1A 1NUUA 3PRYA 4TWBA 3W6OA 4DLLA 3LSYA 3ZGXA 4I6JA 1K88A 4D9NA 1R7RA 1Y0BA 3HYCA 4URYR 3GDWA 3G1WA 2GXUA 1CY7A 3QE9Y 1NDHA 1ZMTA 3E0QA 3P20A 4WVFA 5DI9A 4LFBB 1E9DA 1G98A 1H8EA 2WE8A 5L4LA 1EX9A 1TYAE 3E9DA 3VR6H 1ETHA 1OI3A 1J49A 4KR9A 3PB3A 3ZWYA 2VF8A 2D2XA 4ZU6X 4H6VA 3VU0A 3SDZA 1X7YB 5A9SA 3G8YA 4RNCA 4YRSA 3JQ6A 3E84A 4LJAA 1VCNA 5ALTA 4NABA 4AMVA 1RM5A 3THWA 2JI7A 3LL4A 4HAVA 3DM5A 4D8WA 1SQFA 4D8UA 2GPJA 1W4RA 5BV8A 4C6RA 1A9XA 3BSYA 1JLLA 2PWYA 1PJAA 1AB6A 4RH0A 4YQYA 4R1MA 1W5TA 4PPYA 2PJZA 2HPVA 1WSDA 1CLUA 1MJFA 1KPGA 1XZNA 2QI9F 3ETEA 4HDCA 2IIPA 3HFJA 2ZKIA 4RKRA 4DQUA 5JAMA 1L5MA 3OAAD 1PLKA 2WWHA 3HCEA 4O0LA 5DP2A 3G5LA 2XAUA 1DTWB 3ONNA 3A2MA 4CCWA 5GIOE 4MA0A 3ZG6A 3LKZA 3CZ5A 3V7YA 3MJVA 2R8PA 3OOWA 4MLDA 1HL3A 4IW3B 2BGJA 3BRQA 4DCSA 1AGYA 5JNSA 4L8YA 2LKCA 4YAFA 3KB1A 1ADBA 4QOFA 1ENPA 4YJ3F 5FJIA 1I94B 1OR8A 3E61A 4XSHA 5ES4B 2G7ZA 1B6SA 3KSMA 4HDMB 1X7XA 4V0OA 4C08A 4QGSA 1MO2A 1X9HA 2B92A 1PCXA 4BNNA 2AOWA 3N5CA 1DIGA 4AF6A 4H60A 4YAWA 4ALMA 3FG9A 4DHWA 3SSAA 3RC3A 4EVRA 2XB6A 4QATA 1VMKA 1OTHA 2QZPA 3PQDA 4CM1A 1YA8A 3CNQS 4EELA 4IKPA 1GQRA 4Q15A 3W3AH 1F5SA 2I33A 2WYUA 4C4YA 1TQ8A 1KXZA 3H97A 4RE6A 2VCEA 1AY0A 1HMPA 2M6SA 4AG6A 1MA3A 1HRKA 2WTBA 1RD4A 3BMQB 4BVHA 1CX9B 4OSEA 3ILHA 1KP9A 1PHRA 1H3NA 2CXSA 3M5WA 4YEDA 1GXSB 2E4WA 2WP8J 1KAQA 3EMDA 4BVLA 4CR6A 5KYNA 3H9CA 3JQ7A 1J2EA 1HL7A 1KO4A 1TF2A 3LGSA 5ALQA 3VVMA 4RV5A 4L3WA 4B3HA 4CM4A 2I4OA 3AVTA 3H6KA 1E99A 4U0KA 4BN0A 2VDKB 2N75A 5KNBD 1QFSA 2VZ8A 1GKKA 3OFJA 2EZ8A 2V7TA 2ZS8A 5H8WA 1RRMA 1W85B 3WNVA 4K9PA 1BMDA 1T5LA 4HAXA 4UU8A 1P1HA 3NHFA 2CHFA 1W29A 4RZQA 3R4VA 4UEQA 5JXJA 3D9QX 5REQA 3KHTA 5KX5A 3S7ZA 2OFFA 4A2PA 4I9FA 1FUYB 4MA4A 1TTPB 1LVUA 1MB3A 2HZ7A 4UXJA 4EGFA 4MQFB 4YAEA 1V3UA 2FFQA 1E58A 3GVPA 5CX1B 3RFCA 3AHDA 3TE6A 4U2DA 4GOOD 5FQOA 1VKZA 2PPLA 5A2GA 2O2YA 3JV7A 1W4BA 4MYSA 2LCIA 2Q1TA 2WD7A 5LQDA 4H3VA 1KDZA 1XEAA 2VH1A 1NYQA 1HYGA 3C7TA 2XSZD 4TRJA 4TXJA 1RQGA 3N7AA 3QX9A 3DMTC 3HXLA 4JBNA 4PLCA 4JN6B 1DIBA 4LF8B 2AYZA 4F9EA 1HZJA 4AKEA 2IYPA 4JLNA 3BT7A 5G41A 3L4BC 1RPJA 1EXMA 4DUPA 1WA5A 3DZCA 2G82A 4IXNA 5DW0A 4CIYA 1KEKA 3IJPA 2HO4A 2XOEA 4MKHA 3WNCA 3IIJA 2JLBA 1SG0A 3A1WA 4Q3EA 3IHTA 4IHQA 5GJWC 2XUFA 1BXGB 3G5TA 3S2EA 2ZXFA 4RF5A 4J90A 3V32A 3FCAA 2P2YA 4HQLA 3BG5A 2NN3C 4X7RA 1YQQA 3MJHA 4YDHB 2NUAB 1SKYE 1W7AA 1F3OA 4NENB 3PCRB 5AJZA 3IDFA 3ANNA 4GMGA 3W2IA 5K8JB 2WIJA 1WP9A 4DILA 2ISCA 5DOVA 2AK2A 1ZEJA 3P26A 2GH1A 4D4IA 1Z8HA 3JD3A 4W1RA 3QRWA 2QY6A 4MIYA 1FU4A 2IUSA 3ZY4A 4BKOA 3E5NA 5HJ7A 3KZKA 3OJWA 3TGWA 1TFUA 2R2GA 3LX8A 1G2PA 2BFBB 1B6GA 1QFJA 1KI8A 2QBYA 3HZOA 2CFIA 2Q2OA 2OE2A 3TL2A 2W2PA 2REBA 3GIDA 3EZ2A 2JI9A 4QLAA 3UK6A 4NBUA 4F5WA 5ALHA 1VHLA 4CHGA 4KQKA 4PYNA 4ACAA 5BYKA 1YCGA 1DOHA 3ND7A 3PJDA 2WPDD 4H7DA 2PRIA 4HTFA 2ZWIA 2G77B 4IJ6A 5EJ5A 2RD2A 3Q4GA 3QEKA 4K03A 4KR3A 4RETA 4H4EA 2DP4E 2V3CC 4S2EA 3FR8A 1DMSA 2C7QA 1I32A 1YRHA 3MUOA 4WLVA 3DLAA 1PG0A 1S4MA 4ARCA 1VZ3A 1VJRA 5C3UA 1OASA 1C7RA 2HL6A 3PFGA 4YFVA 1AKVA 4MUFA 4A5OA 2BYTA 2NXWA 5AVRA 3NOOA 5FPQA 2VJMB 4OY3A 2QL6A 4GOJA 5K2OA 3EYWA 3OTGA 2WHPA 2IELA 2WUDA 1KDVA 4AIRA 3RUIA 3W05A 3PRJA 1GN8A 4PPFA 4HWOA 5L53A 4K0KB 4LGYA 3ZOKA 4IZHA 4UAVA 3UV3A 4J29A 4MR7A 1L1FA 5JLJA 4R7TA 1N5RA 4ETMA 1MVOA 2FUKA 2DQZA 2FGJA 2QLNA 4B48A 4JJAA 1NWCA 2I7DA 1KE1A 1G3UA 1M0SA 5DYGA 2GBIA 2R1VA 3DV0A 4FYMA 2YZ2A 1CPYA 2N3ZA 1YS2X 4Y6LA 2XMQA 3WB9A 2XNHA 4FMCB 3AI1A 1W93A 4L4SA 4HX9A 5HBRA 2ZJZA 3MWEA 1C4OA 5F2NA 2PYIA 1P81A 1CQIB 1QM5A 2CKMA 2Q6TA 3U1TA 4KVGA 5J2TA 3CLHA 2OXCA 2GXAA 2VQDA 1OGIA 1PV2A 1ZMXA 1Q17A 4DV0B 3FTQA 5HZGA 4LK2A 2EGGA 1ISHA 2AN9A 4B74A 3WMRA 4M7OA 1AUPA 3S3TA 2XMPA 3CFYA 2YJNA 5G0TA 1T0PA 4QTYA 1RAEA 2VTBA 2Z08A 3MTJA 3FRHA 4F4JA 4HMQA 3IVAA 4J4BA 4M1WA 4CDGA 4YXWD 3QLVA 4ZCTA 1CRZA 3RLIA 4L5IA 1QZUA 4QXRA 1YJAA 5EP3A 3RV3A 3S27A 1NATA 3UJ9A 4B5LA 4EENA 4X54A 4WD3A 1Z0JA 3NHSA 1TEVA 1KFJB 1ZI8A 2FWNA 1QH8A 3JATA 5G1PA 1YE5A 3O26A 3WP0A 4NBTA 4YUAA 3W5CA 4IVNA 4Q1VA 1VOTA 1Y5RA 4ZOBA 5FRDA 3GLQA 4MV7A 3WDSA 4FKBA 5JU6A 4MNTA 4K87A 3AIOA 4N41A 4DYDA 4RH3A 2DWQA 3B1ZA 3B3AA 3KJFA 3QG1A 2QNBA 4MP6A 1CUVA 5KIAA 1FUUA 4L5CA 4G2NA 3F6PA 3OD5A 4Q39A 1WMAA 2ONYA 4RA6A 5K99A 3AJ9A 2XOXA 4OGKA 4LBYA 3GBPA 2OFOA 3KWJA 5F33A 3H4TA 3IIKA 2ZSIA 2ZZMA 4U6NA 3LC2O 4A73A 3BXFA 4I66A 4PO1A 4J7UA 3TM5A 4EJ0A 1KERA 1DXYA 3A4IA 3ONEA 1JKIA 2HHAA 4FD2A 3A9RA 5GZ6A 4CFYA 1L7EA 4LXHA 3I76A 4AMUA 1UANA 4XWTA 1EVYA 3HGMA 2PSEA 3M4YA 1DLJA 3F3KA 3AY7A 4CLHA 2XUZA 3BXXA 2OLJA 2A4MA 1YJCA 2Q8NA 3R6DA 4G5OA 4EY4A 3AWIA 2HA4A 2X5KO 1D4AA 1E2KA 4X45A 3AYZB 4FMDF 4FPXA 4UVEA 1WZ2A 4KPYA 1GTZA 3K2IA 4G0OA 1JU4A 1YE3A 3WRXA 3ZGNA 3H65A 1UK9A 3R4CA 3RQIA 3WLMA 3PQ3A 5HKOA 5KSOA 1IWOA 2YZMA 3PHBE 4HNAB 4PZLA 1Y1PA 1RAIA 2ATVA 3R3YA 4KQ2A 3S2YA 2DKOA 2DZDA 1KMHA 3DVSX 3I0NA 4HNGA 4NAUA 4DIBA 3IUYA 3EZLA 2OBBA 3E9NA 3UUGA 3FYHA 3IGFA 1OXSC 4XX1A 4HPWA 3F7NA 4NMLA 4ZT4A 2Y4OA 5EE9A 2OHIA 3UOGA 2XUOA 1GUYA 2Z43A 3QKWA 2H52A 5FOUA 2NNLD 3AESB 4CN8A 5CD9A 2VAVA 1W0JD 3ISTA 4MJ3A 5KUTA 1A72A 2BIFA 3H04A 1FFBA 1ZVMA 2IVFA 3L4SO 2J0EA 3N2EA 1FX0B 3UFXA 4D7AA 4F6RA 1NQOA 5IJ0A 2II6A 1RRFA 1F8YA 2CLSA 3DAHA 3SCZA 1RYBA 1GYRA 1EBFA 1U7DA 2VDLB 3FDJA 2CVHA 3P52A 4NRDA 4TSFA 2GZ3A 1NKVA 4V0LA 5HIIA 4Y2RA 1XOIA 4P4TA 2OTCA 4IDDA 3AZOA 4OMDA 2CD9A 3LJKA 1E9EA 3WGUA 2ZP1A 2FUEA 2H1WA 3H8JA 3SIXA 1TK9A 4PICA 4DABA 4M53A 4XUEA 4AUNA 1L3BA 4YJ2F 5H5JA 4ZDJA 1ZA2A 2NPIA 4QULA 1W47A 1YR3A 2R3SA 1ZD1A 1LXCA 2RHGB 2VBIA 3IB6A 2WV7A 3ZJ4A 4RJJA 4A1OA 1FBTA 1MN6A 4EZIA 5BWLA 1A5ZA 3WDMA 2O3QA 2NU8A 3UT5B 2I7VA 3C7KA 1RXVA 1G8FA 4NNPA 4LC1A 3QJGA 3OZEA 4YROA 2OSVA 4UBJA 5BW8A 3R0XA 4DWWA 2APJA 3TDMA 1QO0D 1H8HA 4U6QA 4QFDA 3ZGZA 2B82A 2O6LA 4IXMA 1YOBA 3PPXA 5ECDA 5ER6A 3PLRA 5AVUA 2O3JA 1YKGA 1N9GA 2P5TB 2YHIA 3OEYA 1EBUA 3AQ4A 4R6WA 5HMLA 5IYZF 4IHAA 2IHYA 4MVJE 3KEFA 1CUJA 3CUEF 2RKBA 3MG9A 4OK6A 4R9VA 2R8YA 2ACVA 1VKRA 3AILA 3THXA 2G1KA 3ELUA 3ICEA 5CDFE 4P81A 3JZAA 5T4HA 4WN3A 2I99A 3FLAA 5EXPA 5HR5A 4BECA 2VC2B 3TQQA 2GOYA 1TO1E 5B36A 2GLUA 5CM8B 3TINA 2AC2A 2Y99A 2EX4A 5F9FA 2PH1A 1G3QA 1WIWA 4MKGA 2CZGA 4PLYA 1ULZA 3CPSA 3K1AB 4RHCA 1NC1A 2F59A 1JJVA 4KQMA 3F73A 1XDSA 4IUBS 4QE3A 2F1KA 1QSGA 4LW8A 2A1TS 3C3EA 3KCNA 2HK6A 2RGGA 4JI5B 3I6ZA 4JP1A 1TZCA 1EIWA 1WPQA 2ONZA 1P45A 1IIRA 3ABRB 4LAFA 5D00A 4ZN6A 4ER0A 2WMYA 1SBIA 4QUJA 2HR1A 1T5BA 4G1UC 4G67A 3SMVA 3WK9A 1YCDA 2WTNA 3L1UA 2CF5A 3HDVA 4YAOA 4TLMB 3ZJYA 1EPUA 4JQZA 3V4PB 2J9ZB 4BO3A 3PVZA 2V9PA 1MQ8B 1JFFA 2I4RA 2VPPA 3F9IA 4F46A 721PA 2X0JA 1B15A 4RH1A 4O1MA 3U4QA 4QYSA 1Y3IA 4D9EA 3QK7A 4J6FA 3L6EA 2YHUA 2Q5OA 1E3DA 4YV2A 1OBHA 4PR0A 4DPLA 2ZWMA 3W6ZA 4MUNA 1C3OA 1GCUA 1KS9A 1W49A 1RKUA 2FN9A 2FPIA 2GJSA 2QGFA 3M6IA 3HRKA 3OHMA 3STXA 3DOIA 5KWVA 4YMIA 3B6IA 1CJCA 2OCYC 3QJ5A 2Q29A 3PTLA 3ZNQA 4KV7A 3W1EA 1AIPA 3AIKA 2AJBA 3K2EA 4BRUA 5A3JA 2X7XA 3FYUC 3AY6A 1R15A 1DKLA 2PSJA 2RG1A 1F2VA 4ZMBA 1UOQA 5EERA 2DY0A 1AUXA 5ELMA 3G9XA 3HI6A 4PC3A 1MXHA 3B85A 3H05A 4BJ5A 2BBOA 1T43A 1PV1A 3BVPA 2XQFA 5JPIA 1JDSA 1L4NA 3DL7A 3OIFA 2WT4A 1P4HA 2HXSA 2RHWA 4HX5A 5A0FA 5I5EA 1T2UA 3UPTA 4PZ9A 2V45A 1XZMA 4NCAA 1T5OA 3FR7A 1A4UA 1BU5A 4O2BB 3MWLA 4XLLA 4I99A 4MWOA 2PR7A 1B14A 1EWVA 2RGCA 2Z8XA 3FPHA 4PU0A 5ARDA 1E1QA 1YRQA 4P54A 3KYJB 4BRZA 4EB3A 5ERYA 2P6UA 1WRBA 1GJRA 1I0LA 1K97A 1N5KA 1U04A 4H7EA 5JAQA 1DL5A 3R0ZA 2C20A 4WOBA 3NC4A 4DN6A 2NZWA 1U2DC 3B12A 2NW6A 3BFJA 4KGXA 4L5JA 4F9FA 1DAGA 3WDKA 4S0XA 1XCMA 2G08A 1P2BA 4LJ5A 1TT5A 5DBOA 3SX0A 3U4MA 3KTAB 2R8XA 2KM1A 2YZGA 4OP1A 3INYA 1KSGA 3TRJA 3SVLA 5KSZA 2O3RA 5B1SA 1Q92A 4YT4A 3NP9A 3MQ2A 2EX1A 4HEJA 3WNZA 2JFOA 3A4NA 3KRTA 2DMRA 3GOHA 4YRJA 1SB9A 2VYVD 1D1TA 1G9TA 1CB7A 3KLNA 3LZ6A 4HS9A 4QOGA 1MAWA 4GQBA 4RZ2A 5DBIA 5HFAA 2VXCA 1Y81A 4MVJH 4CV2A 4XE5A 4WZBA 5JD5A 1NSYA 2AH5A 2Z6QA 2EKDA 4PO9A 1C1HA 4L95C 2J0SA 4K05A 3JARA 4WBXC 1AC5A 4YJHA 1TEXA 4JA0A 3OJXA 1OA1A 2GZAA 1S8AA 4YALA 1GYPA 2NPFA 2HRDA 4JHXA 4MVYA 1H23A 5B1DA 3INGA 3FPBA 3DGFC 4N3BA 3HP4A 5B53A 4YYZA 1G6HA 1L5SA 1ZC3A 2PRJA 3SXPA 4ZQGA 2GN8A 4QWMA 1XF9A 1IRIA 1YXMA 2C58A 1Z33A 2I8AA 1MDFA 2H7VA 1G8YA 1OYOA 1WCXA 2AD1A 5CJJA 3FKQA 3HKEB 4D74A 3VPFA 2QVCA 5E3JA 3QEOA 4Z8YA 3BIFA 4J1SA 1OF1A 3JALA 4HN9A 2AQKA 2I65A 3FDIA 4A8PA 2PUTA 3QKTA 5ALRA 4INZA 1QP0A 4G2TA 3B5IA 4MP8A 1HT1E 3IAS1 3SQLA 4G86A 4HEHA 5T5QA 5THQA 5JBIA 4E14A 4NBWA 1I6MA 3MJ4A 4TRNA 4N39A 2ACKA 5LP6C 5IVKA 4DRZA 2K7ZA 3BHNA 5B58T 4B3IA 4C4TA 2Y1KA 3EFOB 3FPSA 4YO8A 1XA0A 2QMYA 4AKHA 2PGIA 2X2PA 4YP0A 3OKPA 1AD2A 1AXEA 1NLYA 1KSJA 3GP3A 4FEYA 5B6IA 3DBLB 3UIEA 1A96A 1SZCA 3LI2A 5AW0A 1U7ZA 3AW8A 1QFXA 2WLTA 1ABFA 1X7ZA 4ZEVA 1L4LA 2I4NA 4TMTA 3DTYA 5SV2A 1GSOA 3AJEA 3D4IA 5FKJA 3SOZA 3T1QA 2M2IA 1JDZA 1GUDA 2HIMA 5CFPA 4DLUA 1EJ0A 1PBNA 4IMPA 4JMPA 2PUGA 2CXXA 2YW2A 5FFNA 1JEDA 1PWEA 3OC6A 2VHWA 4BJ1A 2DHQA 3I04A 2XTAA 4IIUA 4JOBA 1DCTA 2DTXA 1MXFA 2J32A 2WM3A 1FW8A 3NTRA 3JAKA 2YJZA 1YU9A 5AOVA 2NM0A 2AYXA 3VAAA 4YUZA 4FN5A 2GDZA 3Q8XB 5DE3A 1S9DA 4CKWB 1CRPA 2WTXA 4KNYA 5K0FA 1UM9B 3TRFA 1BCRB 1VDMA 3CW8X 2AHRA 5AHRA 3RC9A 5CT6A 2C5HA 3PC6A 2AI1A 4AY6A 3RAPR 1M1ZA 1XZCA 3GGDA 1CUBA 2X40A 4Q16A 1YT5A 4A16A 1DB3A 1QKIA 2IDZA 3S1AB 2XZLA 1GR0A 1FFXB 2XGSA 1B42A 3EOZA 4FHGA 5CNJA 1WY7A 1E1RA 3NP7A 4X6LA 1T6NA 5DYWA 2W2LA 5JS6A 2PMKA 5ITZB 1X80B 5H70A 4PYKA 1DAPA 1T4DA 4Q7JB 1HFWA 1Y3AA 2CE7A 3IVXA 2CE2X 1ZUD1 5FV4A 2ZYVX 4TSFD 1LFAA 1MT0A 1SJ9A 2JFPA 3CUWA 3PXEA 1DEHA 5FPSA 1T5IA 3LL7A 3VFDA 4BVKA 3OTHA 1JFTA 3DDOA 3WX0A 4F92B 1LPOA 1M1XB 3DKVA 1P1KA 1TJ4A 1UBNA 2EG5A 4LEIA 3WL8A 1Y4UA 4BNDB 3MGCA 1U1IA 3ZTYA 3F5MA 1CUIA 4KB5A 1GPLA 4CEJA 2HV9A 5DLDA 3L8EA 5DI3B 4B0OA 1L1QA 2IYFA 3PC3A 4OKNA 1G5HA 2AG0A 1UBJS 2DFLA 3FIJA 3I53A 4GD3Q 1WD5A 4WCFC 3WZ2A 3VNVA 5KINB 3ZOZA 4F3KA 3BRCA 5KOHA 5F5NA 2ET6A 4KKXB 1GUFA 3OE5A 3CYFA 3STWA 5ICGA 4MUGA 3IEIA 1PQ4A 3ROMA 4ENVA 2C54A 5KNCH 1QIJA 1DCKA 3R0QA 1P7PA 1WBBA 5FH9A 1QMPA 2COUA 1TI7A 3D6TB 4L85A 3HKBA 1XHEA 1K8RA 4G1CA 2YQZA 4UCWA 2C9DA 3EAGA 2J0UB 3WIBA 1JMKC 2GUGA 4DWJA 1XVUA 2EFYA 2JAHA 3AF4A 1G9SA 1RPNA 4D46A 2X3FA 3OE1A 4C88A 2ATXA 3K9NA 4DRXB 1OKKD 3R44A 4PLFA 2AA3A 3EIFA 4KACA 3AB3A 1KI9A 5BSUA 4BDTA 3E1KA 1F38A 3BEOA 4XGKA 5ERGB 3UWPA 1MB2A 5LWQA 4AN4A 3CVXA 1O03A 1BC5A 5BMVA 3COZA 1CEXA 3JVUA 2ZUFA 3QFHA 1DEOA 1UDAA 1J23A 2VHEA 2Z4RA 1NNSA 1W5FA 1KJNA 2HU7A 4MQEB 5COAA 1KMNA 2AZMA 4QGHA 2IYWA 4D9JA 2E89A 3HUFA 3UKJA 1OTXA 3L3BA 2IP1A 4YAKA 2QB5A 4K81B 1U8XX 1JR3E 3OO0A 3DGEC 4FJ2A 3NTOA 4EW6A 1EZ1A 3LS2A 3BL5A 1U8FO 2WKWA 2D5IA 1FRQA 1ZQ9A 5DB4A 1C80A 2VDQB 2JGKA 5FF9A 1SM4A 2EJVA 2PS0A 2JRCA 1NPTO 1PJSA 2GK7A 2ZRFA 2GX6A 4C22A 3FMVA 4S35A 2HMTA 3W04A 3BA6A 2Q3BA 5BSRA 3WYFA 4V38A 3TJZA 5D5PA 4BLQA 4GZMA 1NBWB 1DQRA 4G9EA 2HGSA 1ZXXA 2EP7A 3P9KA 5IJ9A 3HR4A 4MOWA 2RHOA 1Y8RB 3RYTC 3I5XA 1E2JA 3GFVA 2YWJA 4AKGA 4FZVA 1F20A 6ABPA 3GJ6A 4P34A 3BCSA 3CTPA 2QZZA 5FBKA 1MOSA 4R16A 4W5TA 3DO8A 4OI0A 2O1XA 4HFRA 4YCJA 3TRDA 1ZK2A 3HPQA 4WX2B 4YRTA 3NYRA 3AM5A 3HGTA 3UB3A 1TJPB 2R8EA 2VP9A 3IQXA 1XTSA 3QEMB 3T41A 4AP9A 1QDLB 2O2SA 3MT8A 1ESCA 1HBJA 2AC7A 4ROTA 4YAIA 3SD7A 3C7DB 1JL3A 2C97A 2HF9A 3UPDA 3M70A 1M34A 2A78A 4C01A 1FNSA 1JE0A 5AI5A 1KETA 2AQHA 4OO3A 4EECA 2J85A 3A32A 1OIXA 4Q24A 4F91B 4DKXA 2A5FA 2XKAA 1Z5WA 4GPIB 4JB3A 2R6FA 4AURA 1AV7A 1LY1A 2WIDA 3SBOA 2QTGA 1HC7A 4Y2SA 3VC1A 1WSBA 3KVYA 4B3BA 4JJ6A 1JSLA 3M4ZA 2QTLA 4GVLA 4X1IB 4K6FA 5E9QA 4QHSA 1OB2A 2N46A 4V0NA 4DSUA 2H2IA 1RRCA 4IDNA 4A8JB 3MSXA 3H4IA 4ITUA 5JCXA 2VK2A 4EY8A 4EPTA 3ETLA 3NAGA 2W2MA 3VR3A 1AM4D 2H4WA 3VNRA 2DBYA 1D4FA 1IFXA 1NY6A 2XB9A 1UK8A 2J4CA 3GXBA 1AUOA 3UMBA 4XFDA 1K63A 2VZEA 4HUQB 4XWYA 1BHSA 1ZGZA 3G89A 3LUKA 3NYIA 3JD2A 4HDKB 1C1YA 1AQYA 2QTVA 3A3PA 1ZINA 4BB9A