4NBUA

Crystal structure of fabg from bacillus sp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
242
Chain Sequence
SRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of NADH-Dependent FabG Used To Increase the Bacterial Production of Fatty Acids under Anaerobic Conditions.
pubmed doi rcsb
source organism Bacillus sp. sg-1
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
total genus 96
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nbuA00
4YWJA 4RZIA 4W6ZA 2HMUA 2VYVD 2OGUA 1AHHA 1R0SA 1W4ZA 3ON5A 5KVVA 1Q7CA 4KUGA 4RVDA 1P1IA 3S2FA 5IZCA 2AW5A 4YTEA 4DA9A 1MA0A 3U4HA 3BAZA 4FC6A 3RBXA 3TNLA 4QXMA 3BA1A 4XX0A 2OUIA 4E0BA 4IY1A 1NPTO 3FTNA 2NVUB 1FDUA 1LI4A 1SOVA 1QYCA 4CMHA 4B3JA 4XYBA 4YAEA 5U4QA 5C7IO 3WGQA 1C0LA 1J49A 3CTMA 3M2TA 1ARZA 1E1LA 4FJ2A 3G0OA 4GQAA 4P22A 5CDUA 4CM4B 4YCAA 3V1UA 3DOJA 4I1IA 1C1DA 5FI5A 5KTKA 3AY7A 3ZWCA 2NV6A 4NDNE 3JQ8A 1GYQA 1TA4A 1H6DA 4DLAA 3AY6A 1GZ3A 3ZWPA 1ZEJA 4HV4A 4HFJA 3I83A 4I9UA 5B37A 3SLGA 1Q1NA 3WICA 4DIOA 2XOXA 2C2YA 2NM0A 4FJ1A 4CLOB 4OH1A 2B69A 1JAXA 2VZ9A 2EERA 4RDIA 4U6SA 2A9FA 3I1JA 4DLBA 3TRIA 1G6KA 3PGXA 2GUGA 1Y81A 4R51A 1Y7TA 3RIHA 4NU6A 4OL9A 1I33A 5G0WA 1NX6A 5L4LA 3ZH2A 4MPDA 4W9NA 5TJ9A 4BNFA 3M1LA 3QWFA 4W7IA 2YHUA 4B8WA 4D46A 1KC1A 4QSMA 4TVBA 5ITVA 2PV7A 3I6QA 1LLQA 1NR7A 1U28A 2GNAA 4PLHA 3CXRA 4FR5A 2O3UA 2A35A 4BO1A 1QXSA 1UXGA 3OHSX 1PZHA 4NH4A 1UH5A 4BOYA 1ONNA 1U9JA 3PIIA 2YDXA 1YOVA 2BH9A 2DBRA 1VE9A 4J4HA 1JKFA 3ZV6A 3JQBA 1VC2A 4GX1A 1XEAA 2O48X 2NQTA 4CV1A 3F3SA 4YACA 5ILOA 1Y8QB 3C8MA 2HCTA 2ZYDA 2UVDA 2X86A 1MXHA 4G2NA 3WGTA 1C0PA 1E7SA 2EG9A 1ULUA 5A9TA 1BXZA 1ADFA 1QMGA 4WECA 3VZQA 4MOWA 2ZK7A 3OA0A 3L9WA 3PK0A 3PFFA 3H2ZA 3H8VA 1MB4A 2P91A 1JTVA 1DRWA 3WTBA 4HY3A 3AI2A 5F5LA 3HN7A 3DMTC 1N8KA 4YB8A 1Q7BA 1EFLA 1DJQA 4GGPA 3RROA 3DHEA 1CRWG 2AG5A 1B16A 4FQ8A 4E5MA 4RJTA 1SEVA 2OP0A 3C1AA 4WNCA 3TQHA 4UUNA 4RPGA 2HJRA 2X0JA 1IHYA 1GEEA 1NP3A 1Y5MA 3A9WA 3JSAA 5AXAA 3AI3A 4AJJA 1E1KA 3VPHA 1RM3A 1ZSVA 1H94A 3LQFA 3WJ7A 1VL6A 4RPHA 3GNSA 3ZU5A 2XF8A 4Z0TA 4JBGA 3HADA 4JJGA 2OBNA 4WK6A 1V8BA 1IUKA 2R6JA 3E1KA 1PU2A 4HNHA 1V6AA 3W8DA 2VNSA 1CQIA 4DREA 3EW7A 2OBYA 4E32A 3D4PA 4RVUA 3WG9A 1ZH8A 3P2YA 3FD8A 4EW6A 4UVDA 1ONPA 3M1AA 3WBFA 4XJTA 4J7UA 1DAPA 3GVCA 3CMMA 1W6UA 5EIOA 1JKJA 5DN9A 3L4BC 3RC2A 2YFHA 3GFGA 5F1PA 3JQAA 5ENVA 3VH4A 3I9MA 4D42A 1DIHA 3JQFA 5TIIA 3BHIA 1LDGA 3GVIA 3WSVA 3JQFC 2UAGA 2NACA 2PA3A 4IDEA 5A4DA 2W2LA 3EDMA 5DCWA 3A4VA 3GNQA 1WP4A 4MO2A 1Q2XA 3RUEA 2X58A 3DZGA 5JMPA 3RKUA 4BV9A 1T2CA 3LDHA 3K31A 4RQUA 4R01A 4TQGA 5B4VA 4IMPA 1E6EA 3VPFA 4RLSA 2WD7B 2P9GA 4Y6SA 4E5KA 1NFQA 2X9VA 3G17A 1VPDA 1BXGB 1JAYA 3MJVA 5G0TA 2TMDA 1AE1A 5A04A 3WIDA 2PR2A 4IUYA 2JAHA 4MVJD 4J7CA 2QW8A 3F46A 5JAMA 2BRUA 4U0JA 4UEOA 4B3IA 1QYDA 1YONA 1Z7EA 2E48A 2VTDA 1BDMA 1HLDA 5T57A 2ET6A 3RWBA 5L4SA 5HS6A 3JQBC 3GMDA 3VPGA 3I23A 4IPTA 3ETDA 3PJFA 4PLYA 5LDGA 4BO7A 5L45A 1YO6A 4LISA 1GV1A 3ASVA 1NNUA 5JYEA 2Y1DA 3O4RA 4C7JA 3VH2A 2Y1FA 4E21A 2EW2A 5A9SA 1Q0LA 1RJWA 3OP4A 3NDRA 2IZ0A 2NUAA 1OMOA 2BHLA 4CV2A 2I5PO 1CWUA 3AOEC 1NASA 5DT9A 4XA8A 3W1VA 4BB5A 2FPGA 2HQ1A 3DTTA 3EAGA 1C1DB 1PS8A 4KTVE 1EMDA 3V8BA 3PQEA 3PWZA 4LSWA 3OSUA 1UZNA 3JQ8B 2Y0EA 2Q1WA 4OYRA 2HAEA 3NTOA 1Q0QA 4E2YA 4B4OA 1K0UA 4NG5A 3AOGA 1FK8A 1D7OA 2YZ7A 1U3UA 1LDYA 1TXGA 3PLRA 4CLEA 5DDIP 4WCFB 3RU7A 4GI2A 4KP7A 2YUTA 4EDFA 4MIEA 3D0OA 2EGHA 2J3JA 3IJPA 1DJNA 2Q3EA 5CP8A 2AQ8A 5K6AA 4XQ9A 1I30A 1UXHA 1MX3A 2YHIB 4WCDA 4BIIA 2H63A 4DVJA 4FN4A 4A73A 5C3MA 2I65A 5U9CA 2IDZA 3GPIA 4TRJA 5HS4A 3HDHA 4BKRA 4K26A 2JCYA 4J0EA 1D1SA 3U9LA 1O94A 3DBHB 4GMFA 3ZWWA 3AM4A 1A72A 1CDOA 2V6GA 4M86A 3ZHBA 4K6FA 5DF1A 1DAOA 3L4BA 2DPGA 1HRDA 2DUUA 5IDQA 5JFOA 1KY5A 2V6BA 1ZSNA 1ENYA 3AW9A 3JCZA 4A10A 2GF2A 3P19A 4UEJA 1E5QA 1I3NA 1Y8QA 1HYHA 4CM8A 5CHEA 1RYDA 5CEEA 4ZRMA 5LC1A 3KBOA 3CPSA 2V6MA 3UICA 1A27A 3JQ6A 3RASA 3PWKA 1LBEA 2GPTA 2RIRA 3GPDG 4B7UA 1E7QA 2D1YA 1P1RA 1T2FA 4YRBA 4CM9D 4XJSA 2OO5A 3H6KA 3PJEA 2GN8A 3VZRA 1U3VA 1H2BA 1U7TA 4LN1A 1KC3A 4I5DA 4XR4A 1DC5A 1KBZA 1NFRA 4RF5A 4CMAA 5KOIA 1EBUA 3PHHA 3OIFA 4E30A 4II3A 4TMFA 4BNKA 5BNIA 5I8WA 1WW8A 3HNPA 4PLVA 5COBA 4CMEA 2OMEA 2Z95A 4XDZA 2PKRA 1TI7A 3EVNA 3CEAA 4E2XA 3AY3A 1YH3A 4RQTA 5BSFA 1H0KA 4L4XA 4NBVA 2E37A 4DWVA 4PVDA 4GGOA 1F14A 1ZBQA 4NI5A 4E5YA 4EUEA 1EDOA 5I8ZA 1PWZA 5JAQA 2C59A 1HTBA 2P68A 2NNLD 2C7GA 3VKUA 4CMCA 4L0QA 5JCJA 4II2A 4I9HA 5HBRA 1E92A 5AVOA 4FFOA 3WLFA 3NT5A 3Q2KA 3GUCA 1ZZEA 4ZRNA 1ADCA 4J7XA 5JBIA 1TB4A 3X2FA 1UJMA 4NJMA 3E03A 2DKNA 2ZIZA 1HYGA 5TJHA 2NVUA 2WEKA 1N7GA 4CUZA 5JAZA 1P1FA 3GG2A 3I6IA 3T7EA 3INRA 5BNFA 2C2XA 5KNLA 4GLLA 4L9RA 2W98A 1IB6A 4RPLA 3F6YA 2EIHA 1R4MB 2W90A 1E7RA 1PR9A 1L7EA 3DZKA 5AOVA 1HZJA 4GSLA 1VJTA 4ALMA 2RH4A 3S8MA 5ILGA 3ZV5A 1FDWA 3ETGA 1PZEA 2X0NA 1V3TA 1J5PA 3T7CA 3FNEA 2CF5A 1HDOA 3DAGA 3DC2A 3DEYX 4YJDA 3WFIA 1BXGA 2RBEA 3PGJA 4HFRA 1SC6A 1M66A 3RAJA 4H7PA 4PLGA 3AM5A 4HFMA 4GPD1 3DXFA 1ULSA 3I9NA 2GN9A 5THQA 2IEBA 4I9NA 2HK8A 3OFSA 4WUVA 3VTZA 2PKQP 2CY0A 4PZCA 3WIEA 3ZNOA 8ADHA 3RC1A 4IM7A 4E5PA 2FR1A 5G0UA 1B14A 4CM9A 4CL3A 3AU8A 2NU6A 4BMSA 1MG0A 2X23A 1VL8A 2DTXA 1H9AA 3HFSA 5A9SB 1ML3A 3U4DA 1NPDA 3HDJA 1VKOA 4H16A 2OFPA 3KTDA 3GDGA 2I67A 1C1XB 2Q2VA 1KIFA 4AG3A 4BO9A 4DC1A 3PEFA 1BRMA 2BFAA 4CQMD 3CINA 5GMOA 4KQXA 2NWQA 4QTZA 4PRLA 5JDIA 1Y8RB 2PGJA 4NZ9A 1OC4A 5TS3A 1DC3A 1V0JA 4OMUA 4YQYA 4C4OA 1XSEA 2EEZA 1GZ4A 2J6IA 1SB9A 3NJ8A 4KQWA 3NDJA 4KUHA 4N18A 5IDYA 4RVHA 5JC1A 1SOWA 3UN1A 4B8ZA 3GAZA 2Q1SA 5MGBA 2PLAA 1BDBA 1HWYA 2G0TA 3LVFO 4CR7A 4MVJP 3L6EA 3B1KA 4HFNA 2IXAA 4R5HA 3AFMA 2NVBA 3WS7A 3L77A 4XDYA 3JQGA 5TSDA 2A92A 1PJCA 4D79A 4BUCA 1FF9A 3RI3A 1KVSA 4LRTB 2QHXA 3D4OA 4IBOA 2ZTUA 3UF0A 3ZI0A 1LTHR 1ZMTA 2XPCA 1XKQA 1YBMA 3AUUA 1PGOA 1P44A 1EE9A 1HXHA 3KSUA 1UAYA 4W99A 4MKXA 4U8GA 2HK9A 1T2AA 4LCEA 3D7LA 4G81A 1P31A 1QV7A 4IIVA 4CUKA 3AM3A 2D59A 1E6WA 4TRRA 3GC6A 2CF6A 2F00A 3JYPA 4Y6PA 3TZQA 4CODB 1TT7A 2JFFA 4PLTA 1X0XA 4YBZA 5JO0A 1CF2O 2W8ZA 4ND3A 3IIEA 3H5AA 2VHYA 1YGYA 1G0NA 4F46A 2ILTA 1LSOA 1QYWA 4BGIA 1XA0A 1J0XO 1PL6A 4OXYA 4Z9FA 5C5IA 4ZA2A 2Q45A 4GKBA 3QVTA 1P1JA 2J8ZA 2I9PA 4WLNA 5EJ2A 4MKRA 3F1LA 3QIVA 3OETA 5H81A 4R1SA 5F3RA 5KVCA 1X15A 1ZK1A 3TOXA 3VPSA 2ZTMA 1ZCJA 4D0RA 2DFVA 3KYCA 2EJWA 1ZXLA 1DLIA 5LDHA 4A5OA 1E0DA 1YQXA 2CMDA 4LSMA 4UVHA 1PQPA 4LK3A 3OA2A 4UVEA 5T5QA 4BHTA 1HSZA 3QW2A 1XLTA 3K30A 5AXBA 5CAEA 5EESA 1ID1A 2X22A 3LK7A 5EN4A 3OQBA 1HF3A 4O59O 4E12A 2FSSA 2OZPA 2X9GA 4R3WA 5IDXA 3KB6A 2B4QA 2VNAA 1D4FA 4E4YA 3Q2IA 4A27A 2QZZA 4ROSA 5CDYA 2O7SA 4BO4A 1P33A 5A06A 1XR3A 2X1HA 3KEQA 3MWEB 4RVFA 3G3EA 2HLPA 2HMVA 1V3VA 4JJFA 2V7PA 1KY4A 1B8PA 1EZ4A 4DQVA 1Z74A 3ZWMA 4H15A 4DPMA 2BELA 3NJ4A 4M8SA 1D1TA 3TZCA 1C3VA 5ITWA 3L6DA 1O89A 3WTCA 4CJXA 3RUIA 4BNIA 1YQGA 3EYWA 3IAHA 4BGEA 1WMBA 4JCOA 3MCVA 1ZK0A 1JVBA 2IRWA 1R4MA 5LCXA 1PJTA 3MJEA 4ALLA 2CVOA 4D3FA 2VRBA 3JV7A 1JA9A 5JDIC 1NVMB 3CSDA 4CQMA 3R1IA 5B4TA 3F9IA 4L73A 4BNMA 3WJAA 5I9MA 5DULA 5B1YA 1PL8A 1PSDA 4LRSB 4ZU3A 1GCUA 1MGOA 3MTJA 4FC7A 5T8KC 4BNJA 4GL4A 1LUAA 5GZ1A 3KV3O 4FGWA 1U2GA 1B8VA 3F47A 1PJSA 1EVYA 2WE7A 4NIMA 2Y99A 4Q3CA 1UP4A 1UDBA 5G4KB 4I08A 2IODA 4BO3A 4KTTE 3I9OA 1RM5A 1XCBA 2G82A 2WDZA 4PZDA 2C5EA 3Q6IA 4S1VA 1I32A 1R66A 1ZK3A 4Z9XA 1GPJA 4ZJUA 4J90A 1LDNA 1U8XX 2YFQA 3JQ7B 1UUFA 2PD6A 4ZD6A 4J0FA 1KOLA 4IXWA 4DMMA 1HKUA 2P9CA 4MVJE 1EEHA 4OM8A 2VT3A 3H4VA 4JN6B 3UOGA 3FBTA 3JQ9C 4OAQA 3U0BA 1B2LA 3B70A 1Z6ZA 3KXDA 1D3AA 2BF7A 3BMNB 4NR0A 1O5IA 5JY6A 5H82A 3VKVA 4MP8A 2O3QA 4PIVA 2EWMA 4LGVA 4ND1A 4BKQA 3WB9A 3A14A 1GTMA 3F4BA 1PQUA 3H9QA 1GV0A 2QIOA 2C29D 2YV2A 3EZLA 4FS3A 3HZZA 3DZBA 3E5MA 3PHIA 3DMTA 2WE8A 3ZWBA 2QX7A 1AGNA 2Y66A 4TSKA 4DL9A 3GH3A 2ZJ0A 1ZXBA 3HB5X 2I6TA 4HUJA 1DDOA 4NBTA 2E4AA 3NAQA 3OQ6A 5JS6A 2X6TA 3G1UA 4MDHA 2PK3A 3D64A 2NTVA 1E3JA 1NAHA 1BMDA 1TT5B 1NVGA 2AEJA 2C07A 3BTSA 3DDNA 3O8QA 3OBBA 1KVUA 4R1UA 3TFQA 4GAEA 3TDKA 4CMIB 3V2UA 5EPOA 4Y8VA 4L76A 5ER9A 3DBLB 3DZHA 3LC7O 3PQFA 3DTYA 5JDCC 1IL0A 2VQ3A 3FI9A 4IJWA 1OC2A 1ZK2A 2B35A 4IGFA 4PCVA 1DRUA 1EUDA 1LX6A 1BHSA 1UXJA 2JAPA 4R1TA 3WOHA 1EVZA 4I5GA 2JD1A 1LC3A 4AJLA 3D3EA 9LDTA 4BNVA 2GCGA 3GGGA 4XD2A 4BNWA 4DBVO 2PKQO 4Y98A 4YVFA 4J6FA 5B12A 3DFZA 2VYNA 3NKLA 4M89A 4J49A 4D3SA 2O4CA 1T4BA 2PY6A 1AN9A 1YJQA 1F8FA 4JROA 3AJRA 2DFDA 4D0SA 2HK7A 3QHAA 4MVJH 1UP6A 4DYDA 3BHJA 1QG6A 2Y1OA 2EKPA 2WWRA 2DBZA 1JKIA 4FFMA 3GFBA 3S2GA 5T8KA 3QWIA 5JXWA 2HDHA 4JX8A 4TZTA 3E9QA 1JU9A 3BTVA 4HXYA 1BW9A 1Z75A 1BWSA 3BIOA 2CVQA 5DP1A 1P0FA 4GSKA 2C20A 1SZJG 2RHCA 4JQCA 4L75A 5T6BA 2C54A 4UAGA 3DR3A 1TLTA 4CR8A 4BNZA 4QFDA 2CDAA 3ST7A 2DQ4A 4TZKA 4CM7A 1JN0A 4E2ZA 1TVEA 3NT2A 4J4BA 3ANMA 3GDFA 1AXGA 4WKGA 5FWNA 1PJ2A 1U5AA 1DPGA 2O3SA 2QRJA 4TVOA 4ND2A 3INGA 3UCFA 1LLUA 3K6JA 2G76A 4Z0PA 5L7TA 3JD1A 1Z73A 4EEXA 1HT0A 1M67A 3FBGA 4ESOA 1DXYA 3BTUA 3GZ4A 4BGVA 3GN1A 5A03A 1DIRA 2WYWA 2YYYA 3CKYA 4RF3A 3JQAB 4BNXA 5HRUA 3OJFA 2GD1O 5DP2A 5DBGA 1N9GB 4I8XA 3ZU2A 4BQRA 2AQHA 5L40A 2FRDA 4Z9YA 3OH8A 1R0KA 4J16A 4EYEA 5I9LA 1IZ0A 4CMGA 1UDCA 1U2DA 1EK5A 3ZWOA 4CM4A 4XIYA 4Q3NA 3ONFA 1YL7A 3PHGA 2F1KA 4YJGA 1ZK4A 2NVWA 3TL2A 3W4IA 2P2SA 1DEHA 2B4RO 3DO5A 4Z3KA 2P5UA 4WLFA 2GN4A 3U4IA 1NQTA 1NQOA 3HWRA 1T2EA 3WMXA 3WMWA 3R0IA 4N7RA 4QECA 4AJEA 4DRYA 5JSFA 3DOOA 3TFOA 2ZTVA 4HADA 4IMRA 3VH1A 2Y0DA 2R00A 3LZ6A 4F6CA 1BVUA 5KVQA 2RH8A 2X9NA 4D44A 4XYGA 3P7MA 4J43A 1FJHA 2GZ2A 2Q4BA 3HDYA 1AUPA 4CLDA 5I7SA 1N1EA 1IPEA 2GSDA 2Y0CA 4WJZA 1GPDG 3L6OO 3AOEA 4FJ0A 3ZNPA 4EJMA 5KJEA 1VJ0A 3GY0A 1YRLA 4AL4A 1HETA 4DPLA 3OIDA 1ZVMA 2HO5A 1N7HA 1I3LA 2BFOA 3G79A 2AMFA 2VRCA 4BNLA 3D5TA 5ER6A 1LU9A 3PVZA 3PYLA 4DBZA 1H2HA 4YT2A 4CMJA 2HJSA 3JD0A 5JC8A 4P4GA 3O26A 1R12A 4MKZA 5DCYA 3RUAA 5COAA 2H6EA 3RC7A 1B8UA 2JCXA 1ISJA 1C0KA 1DIGA 4NBRA 4YT5A 5EQDA 1YOVB 5C7LO 4GVLA 1B3RA 1V3UA 4IS3A 3ICPA 1HEUA 1MC5A 4FD3A 4R5MA 4Q9NA 4R4JA 3H9JA 2NU8A 2HSDA 2WYVA 4BVAA 1QLHA 1PJQA 3P5SA 3VDRA 1MFZA 2PGLA 3UFXA 4AJOA 1PJ4A 2FY8A 4IZIA 4XYEA 5DCUA 3FPCA 3DBRB 4XQGA 4IINA 1DHTA 4K1LA 4WE3A 2JKVA 4UREA 4L4SA 1NTOA 1X1TA 1X7GA 5L51A 1D8AA 1ZEMA 1SPXA 3GEDA 4WASA 2BMAA 2NLOA 1EBFA 3NRCA 3UUWA 2VOEA 2QG4A 1HSOA 1OI7A 5JE8A 5BSGA 2FR8A 3QWBA 1MLDA 3GGPA 3QJ5A 1EUZA 1E6UA 2UV8A 3SVTA 2Q2WA 1R6DA 3K9QO 4OXNA 4IGEA 2NSDA 1WNTA 1K89A 1JWBB 5TRTA 4AICA 4BKPA 4RZHA 2QRKA 2FHSA 3V2GA 1X14A 1CIVA 1N92A 3LYLA 4NMHA 5C7OO 1DFGA 1E3WB 2J5KA 5TGDA 3S55A 1I5RA 4U7WA 3RUHA 1PJLA 2X0IA 8LDHA 4Y67A 5DOVA 3DAFA 1LRKA 4XYLA 2Y1EA 3PIDA 3SC6A 1PX0A 1BSVA 3PI7A 4UEKA 4FPXA 5G0VA 3QVSA 4OQYA 2OHXA 4DPKA 2V65A 3JYQA 4CM8B 3TL3A 3E5RA 3UGKA 2DC1A 4IDFA 1T1RA 4KUEA 3RFVA 2G1UA 5JCJD 1HE5A 5KKCA 5JW6A 4FDAA 1A71A 3WR5A 3U49A 1E1MA 3JYOA 3GRKA 5L7WA 2EKQA 4MVJF 4W82A 5C37A 3V1YA 5KIAA 3LF1A 1K3TA 1A5ZA 2IYPA 1ZKMA 2WD8A 2NTJA 1A7KA 4XEHA 2A94A 5FYDA 4EITA 3HQ4O 4Q3EA 3PZBA 2DUWA 4WLUA 4UUPA 3FNHA 4CQMB 4D3DA 4PLWA 2C82A 2VWGA 3Q3CA 4A0SA 5KJ6A 5AXDA 3I3OA 5TC4A 2ZB4A 3RJ9A 4EGFA 5CG1A 5JMWA 1Y9AA 3SXPA 3P2OA 4R16A 2EGGA 1YJ8A 2OP1A 5DZSA 4XCVA 2AHRA 2AEFA 2WTBA 4O0LA 4FBGA 1HYEA 3ITDA 5IG2A 4MIOA 3BMOA 4OJNA 1RM4A 5L9AA 1HDZA 1EVIA 3EGOA 2VWHA 4L4RA 5G4KA 4BMNA 4NFSA 4D45A 4IS2A 3S1LA 4IQGA 1XELA 3ZU4A 5CFZA 4J3FA 5AYVA 1JQBA 5MDHA 1PIWA 2BD0A 3IMFA 4TRNA 4YJHA 1UZMA 2Q50A 5L53A 2O2YA 3MEQA 1WZIA 2JD0A 2PZJA 3ZNQA 3TSCA 3C7AA 3H3JA 3BZUA 5TQVA 1E7YA 4XR9A 3JQ7A 3NTRA 3GHYA 4E33A 5TT0A 4FW8A 1M6WA 3L9XA 4NK4A 1MV8A 4RPJA 3CE6A 5A3VA 1N1GA 2NTNA 2HMTA 4EEZA 4YJGB 3MTGA 3I9KA 3GVPA 1P3DA 3OQ1A 2PH3A 3BMNA 4M55A 3WQRA 5TT1A 2JHFA 4N5NA 1O0SA 3ADOA 4R54A 3NT4A 5BQFA 1NPYA 2ZB3A 2I3GA 1EK6A 2TMGA 4KWHA 2ZYGA 3ASUA 3KLMX 4CM6A 3F5QA 2FPIA 2JHGA 3JD4A 3HE3A 3FR8A 4OSPA 1Z45A 4UUMA 4WCFA 4D43A 2AQIA 1GY8A 2Q2QA 4GBJA 4YQZA 5JLAA 4ILKA 2QZ9A 4A26A 1ZW1A 2NQ8A 3AWDA 3JYLA 3I52A 3AK4A 2VYVA 1H6BA 4GX0A 1GFSA 3WGIA 1ZJZA 2D5AA 1FDSA 1GU7A 3DONA 4TRMA 3RUFA 2GZ3A 3ZV3A 4Y6RA 4F6LA 4J1NA 5GZ6A 3CH6A 1XWFA 3QA9A 1A9ZA 3LU1A 4MIYA 1GUYA 2E49A 4ALNA 4C7KA 3UCXA 4OOFA 1XYGA 1Z82A 3L4SO 4I5EA 4K9DA 3UHAA 4L74A 3U09A 1KVRA 4DQXA 3DHNA 1Y8RA 3OECA 3GZNB 5G0SA 2EP7A 1MFPA 1U4OA 3O38A 3RBZA 4E31A 2GGSA 4IJUA 1R37A 2X5JO 1GQ2A 3MOIA 1S6YA 3E18A 3ADPA 1F06A 4EBFA 3TN7A 3B1FA 4XYMA 3ZWYA 4RV9A 3H9UA 1X7DA 2YQ5A 1S7CA 3LLSA 1Z7BA 4UVGA 3GGOA 4YXFA 4UVIA 3WWZA 3GN2A 1LLCA 4I5FA 5I7VA 3BMQA 3D4NA 2CD9A 3KEOA 4FFPA 2CFCA 2PWZA 4ZQHA 4KDEA 3TF5A 3S2IA 1NVTA 3E9MA 3GEMA 4N54A 3FNFA 4PG7A 1BW9B 1YE3A 2YW9A 3PQDA 3CZRA 4QX6A 4BV8A 4YRDA 1E3WA 5IZ4A 3GAFA 1K6XA 1CEQA 3E6AA 1HL3A 2W2LD 3DB2A 2ZJ1A 4TWRA 1XIVA 3F4LA 4CL8A 3FWNA 3NDIA 4RORA 1I3KA 4E2WA 5U1PA 3D3WB 3HB4X 3TWOA 5T67A 1BGVA 5J23A 5H83A 1BXKA 4RF2A 5A3JA 3N74A 1W8DA 4S3MA 4B79A 1E7WA 1DBVO 2SCUA 2B5WA 1GUZA 3JQCA 1GYRA 3NGLA 1UAGA 2YV3A 3FTPA 1VJ1A 3IUPA 3SC4A 3T4EA 1H6AA 2EF1A 3I4CA 2Y1GA 5F21A 1OBFO 5JDCA 2POQX 5I7FA 2JL1A 2VCYA 4YYZA 5AQ1A 1LXCA 1R16A 3KYCB 3NX4A 4M54A 1YB1A 4CMKA 4QO8A 2P5YA 4MP6A 1KEUA 3UCEA 1UDAA 4YJFB 2YV1A 3GR6A 2BI8A 2C5AA 3KYDA 2QRLA 3SX2A 3ONEA 1P1KA 2VHVA 3I9LA 3C7CB 2WJPA 3V5NA 4Q3DA 2AEMA 3B1JA 4ALIA 4NBWA 4AJ1A 4IQ8A 1QLJA 2EV9A 4RO0A 1U5CA 4J9VA 4BQPA 5BSEA 1JW9B 5L7YA 4IDDA 4NK5A 4YRAA 3VAZA 4QFCA 4CQLB 4Z6KA 3UXYA 4XQCA 5BSHA 3BMOB 1E1NA 3A1NA 2J3IA 5BR7A 1B7GO 4JBIA 1NQAO 2JFGA 2O4UX 3QLJA 2X5OA 2AQKA 4UULA 2X5KO 3PXXA 4FGSA 1YQDA 4M87A 1VRWA 4XKJA 5ADHA 1WXDA 4BNUA 5HM8A 2Y67A 4DYVA 3C85A 3BHMA 4IDBA 4J1QA 4YJHB 4DIBA 4JJIA 4R3NA 1LSJA 3LT1A 4WLEA 3I4FA 1YDWA 1PR3A 3JD3A 3MOGA 4FB5A 1DC4A 3MJSA 1YL5A 2JCVA 4B3HA 2DTDA 3Q0EA 3TZ6A 4TKMA 2EXXA 3PHLA 3RFTA 2AXQA 1LNQA 4BKOA 4ALJA 1QSGA 1C1XA 2FZWA 3VTFA 4DIFA 4DTIA 1PGNA 4CPDA 4YAGA 2J5RA 5A1TA 3ZW8A 4E3ZA 4YT4A 1K5HA 3JD2A 1I36A 1OOEA 4P4LA 4AJ4A 4CLHA 4HP8A 5HWSA 2O3RA 1LJ8A 2UYYA 3ZN2A 2IXBA 2JJYA 1U3TA 4HWKA 4RVSA 1M75A 4L8VA 3DOCA 1CETA 2B37A 1NHWA 1WDMA 3K92A 5IXYA 1R4NA 4ALKA 3QVOA 3JTMA 4MP3A 1DLJA 1ZNQO 4R1NA 3RJ5A 2DVMA 3EY4A 1ENZA 3WGZA 3JQGB 1C0IA 2NU7A 2DAPA 1A4IA 5ICMA 3PDJA 2GYYA 5CPBA 2Q46A 3OICA 4U0KA 4DLLA 1F8GA 3RKRA 4F45A 4LMPA 4OXKA 1HE4A 1O6ZA 3K73O 3ZU3A 5ES3A 3Q1LA 1ZIDA 3ZGYA 4CM5A 1VM6A 3DZIA 5CEFA 5IAAA 2FOIA 1XGKA 5L95A 4YT8A 3ZDFA 1T2DA 2HU2A 4NNJA 5EQFA 1J6UA 4XZ3A 4FSHA 3ETEA 2HRZA 3UVEA 1P1HA 3K8ZA 2VOJA 3GHHA 5IJZA 1MUUA 1NWCA 1LRJA 4DUPA 1TEHA 7ADHA 3GZNA 1EDZA 3KSZO 2DU8A 1EE2A 3ZHZA 3Q11A 4FIZA 4JNKA 2WYUA 4J2OA 3LT0A 4X54A 1PZGA 1PS9A 5TNXA 2PD4A 1CERA 4BNYA 1P74A 3GEGA 1O95A 1T26A 2B36A 1JLLA 1IHXA 1MC4A 3GVHA 3W8FA 3ROKA 4P4NA 4NQZA 3EC7A 2E82A 3U62A 3PWSA 2Z1MA 2EW8A 2JD2A 1HDCA 3O03A 2HKIA 3ITKA 2ZYAA 4WCFC 4XGIA 5A05A 1MP0A 4MVJI 4QEDA 4HNGA 5CDTA 3IUSA 4WOJA 1TT5A 4LW8A 3O8QB 1ISMA 4CMIA 3WXBA 5KJ1A 3UW3A 3R3SA 4ID9A 2HUNA 4KOAA 3W6UA 3SJUA 3D3WA 4PFJA 1YB4A 2BGKA 1P77A 1HDRA 2IYOA 4BO8A 4XRGA 1AHIA 3H2SA 1GUFA 3V2HA 2G5CA 4F3YA 2CDCA 3QV1A 4ZGWA 1HLPA 2UUPA 3H7AA 5L4NA 1CYDA 3HJAA 4RL6A 2Q99A 2Z5LA 3C7DB 2A4KA 1UXKA 1DOHA 2DLDA 2VZ0A 3CIFA 2B5VA 3QVXA 4INAA 2BFPA 5IF3A 3WYCA 1QYVA 3LC2O 3OEWA 2VHWA 4O6VA 3KUXA 5IZCC 1IULA 1HE3A 3RVDA 2I99A 1P45A 3ZZNA 3GA0A 1IOLA 4PG6A 3PJGA 2ZB8A 2B4TO 3FHLA 1I10A 2RCYA 4GMGA 4RVGA 3G49A 5T64A 3MZ0A 4ZHSA 3EHEA 3U4CA 3KYDB 1FDTA 1DRVA 1HDGO 1I2BA 1UZLA 5FFFA 5A5EA 2LDBA 3SEFA 1CJCA 1SNYA 3WGOA 4BKUA 3GDOA 3FCOA 4AVYA 3BYZA 3TPCA 4URFA 4FFRA 1HZZA 4NFYA 1NYTA 4CLOA 1IYZA 3FRJA 2P9EA 3F1KA 4B4VA 1PGQA 3VVCA 4FFNA 2DTEA 4XWYA 3DZJA 2D3TA 2FN7A 5IN5A 2FSVA 3IKTA 3F5SA 3LF2A 2B83A 1P0CA 5KWEA 3WX0A 2GDZA 3EZYA 4RPKA 3VHRA 2CVZA 4NHEA 1RM0A 2PH5A 3GRPA 4LCJA 2IZ1A 1QV6A 4YR9A 4XB1A 1T25A 4EUFA 3A28A 4IXTA 1N9GA 4ND4A 9LDBA 3U3XA 3OJOA 1H5QA 3PHJA 4GKVA 4GVXA 3U5TA 2EP5A 1KYQA 5FI3A 3ZW9A 2YJZA 4GWKA 3IC5A 2G17A 2LDXA 3HSKA 4PVCA 1E77A 4P8RA 4EUHA 3IP3A 2XXJA 3HUDA 1L1FA 3R3JA 3ROQA 1SMKA 1B15A 1GADO 4BL5A 1U7HA 3GQVA 3GT0A 3WYEA 5CDSA 2VUTA 1BG6A 1SCUA 3Q9UA 1GEGA 1LQTA 1ENOA 1UP7A 3ORFA 4BNNA 3ONDA 2O50A 1K2WA 5EINA 3HFGA 3E8XA 3VOSA 2H9IA 3JQAD 3IS3A 3FNGA 1GAEO 5JCXA 1YXMA 1KEVA 1WAMA 4J9UE 1SO8A 2GASA 2VRCD 4QO7A 5CDGA 1DHRA 2XAAA 3E48A 2X4GA 4JIGA 1UR5A 3OEYA 2VTEA 4RGBA 2RAFA 1VSVA 4LVUA 3FF4A 2YHIA 3OJ0A 1P9LA 2UUOA 2AG8A 4XIJA 1YBAA 4AJHA 4MJLA 4WOKA 1CQJA 3NUGA 5JPIA 3DQPA 5L3ZA 2V6FA 3D5QA 3H9GA 3HN2A 3W6ZA 5IXSA 5KVSA 1GZ6A 2IEDA 4G5HA 2FP4A 2H5LA 3H65A 1A7AA 3M6IA 3O9ZA 1E3LA 4OO3A 4JGBA 2D5CA 1OFGA 1SBYA 1XQ6A 4GX2A 3QRWA 3BMCB 1I24A 4NBUA 2FZEA 4PG4A 1GDHA 1DSSG 1IY8A 1YKFA 3IQDB 3CUKA 1E7MA 2O23A 4A03A 1KS9A 3WLEA 2PFGA 3K5PA 3PFWO 1KVTA 5JY1A 4R9RA 1I2CA 2Y1CA 3ZHYA 3EVTA 5FEUA 1UXIA 1XHLA 2DPHA 2R2GA 4R69A 4J91A 3LC1O 3Q9NA 4Q3AA 1E3EA 4IJKA 4W7HA 4XRRA 3ROMA 1KVQA 2HMSA 1O8CA 2P4QA 4CLRA 3A06A 3GMSA 1N5DA 1KEWA 2BKAA 3GNTA 3KOUA 2ZKLA 5GZ3A 4JLWA 1ZJYA 4GLOA 5TX7A 4IZHA 3MJ4A 4O63O 1ISHA 2OOSA 4RLHA 4CR6A 3C1OA 4LMRA 4K28A 3OM9A 2R00C 1YL6A 2DM6A 3IJRA 3IL2A 3L0DA 1L7DA 1H6CA 4U5QA 1PEDA 2QYSA 3C3XA 3KYBA 5EERA 4CM3A 4PLFA 1Y9EA 2OORA 3NV9A 1ZMOA 1LA2A 2GERA 4CQLA 3ICCA 1Y6JA 3KZVA 1WDLA 3RCBA 3I5MA 2BLLA 2GRAA 4K6CA 3DHYA 5G4LA 3VVBA 5A02A 1R0LA 3PDUA 3FPLA 2J3HA 3TJRA 1GR0A 4PZEA 5THKA 4BO0A 1OAAA 1LSSA 3KRTA 2BI7A 1BVRA 2YQ4A 2EJVA 3C24A 4BNHA 3KVOA 1PJBA 1X13A 4ND5A 3ZCXA 1W0CA 3AFNA 3INTA 4J4TA 1DIAA 4KZPA 1G1AA 3FSRA 1H93A 3H5NA 1T24A 1A9YA 1PJ3A 1ZSYA 2VYND 4XQEA 3PZRA 4WEOA 5JYDA 2Q4EA 1PGJA 3T4XA 2ZATA 1XQ1A 5F1OA 6ADHA 2PD3A 4A7PA 1RYEA 1AXEA 2DBVO 3H9EO 4PLPA 2ZCUA 3LSYA 2OXIA 1WLYA 4BB6A 1B26A 1IPFA 3DMYA 3RD5A 2CSUA 1LSUA 5I9NA 4MVJM 2YDYA 1F12A 1KERA 1MXFA 2GLXA 4GWGA 4Q39A 1FDVA 2HRBA 1HDYA 2W2KB 5KCZA 4NU5A 4ONEA 2B0JA 3B6ZA 4FCCA 4OGWA 1QORA 5A9RA 1ZO8A 2IZZA 1SEPA 4WNIA 3WQQA 3ANLA 3RC9A 1ADGA 5CPFA 1R4NB 2O7QA 4B7XA 3LT4A 2D0IA 1U3WA 1LDBA 3RSHA 3GF4A 3W8EA 4IDAA 4YAKA 4PLCA 4R41A 3JYNA 2FPPA 2ZQYA 1U8FO 2H1SA 1M6HA 2ZTLA 3GOHA 4PG5A 3C1TA 4XB2A 4YDRA 4FFLA 3VZPA 3PPIA 4BO2A 3RBVA 3WGGA 3VZSA 1W73A 2Q1UA 4RCVA 3ZV4A 1Y5RA 3DAPA 2AE1A 4J1TA 2Q49A 4A2CA 4AJ2A 4DMLA 5K6AC 4CV0A 4ZQFA 2I66A 1H9BA 2Z1NA 2ZQZA 4LVCA 4JK3A 3S2EA 3ROPA 4OOEA 4QQRA 2BFMA 1ISIA 1PGPA 4KWIA 1QP8A 3W4KA 1WVGA 3DZFA 3FN4A 5DNAA 4PG8A 3DBRA 2PGDA 3I9JA 3DWFA 1IZ9A 4PRKA 1F17A 2OL4A 1E3SA 1R15A 1U4SA 3GG9A 4WEQA 5JAIA 2EKLA 1LEHA 1WPQA 4B4WA 3COSA 1E5LA 2BGLA 4KMSA 4KDFA 4EI2A 5DBIA 1LRLA 5CG2A 1B3BA 1FXSA 3AUTA 1DC6A 5COQA 2AE2A 7MDHA 1QYXA 4ITUA 4O5OA 5AXCA 3AU9A 3HHPA 5KKAA 3SLKA 3WQSB 1XU7A 1I2ZA 3ENNA 4OHUA 4OIMA 2QQ5A 2GR9A 5B4UA 3H3FA 3NGXA 2EHDA 2E6UX 1YBVA 4CMEC 2W4QA 4ZQGA 5TF4A 3ABIA 1EUCA 5BNTA 4R9SA 1V9LA 3OJLA 5ICSA 1T4DA 5ENDA 1PWXA 4FOSA 4ZQBA 5CEJA 3QSGA 2VWQA 3IOYA 1GQYA 2PZMA 1GD1O 4MINA 4TROA 4QUKA 1M2WA 1LC0A 1ONOA 4B7CA 1NHGA 1GCOA 3BXXA 1K6JA 4CMBA 3OIGA 4NJMB 3ANNA 1N2SA 3TZKA 2VUSA 5DOZA 3R6DA 2VHXA 3QE3A 3WYBA 2IE0A 2CNBA 4CLRB 3FR7A 1NAIA 3GLQA 4DXHA 3FWZA 4Z0HO 5JO9A 3UKOA 2Q1TA 2WMDA 3B20A 5TLSA 2VHZA 2UDPA 2WM3A 3M2PA 3JQDA 3JQ9A 3MJCA 1YVEI 3ENKA 3WGYA 2ZCVA 2CUKA 1NR1A 4WGGA 4E5NA 1ENPA 1NFFA 4NPCA 1GYPA 4JXKA 2ZB7A 4UUOA 4D7AA 2VZ8A 2GN6A 3ZNNA 1BTOA 1LDEA 1O9BA 4CM1A 3ZWAA 1FMCA 4Y9DA 2WSBA 3QQPA 2GO1A 2XXBA 4W4TA 2VUUA 5HTOA 1LQUA 3E82A 1SB8A 3ZWVA 3VPXA 1KETA 4OKIA 3ULKA 1GL3A 4Q3BA 3RQSA 1V35A 1SAYA 3GUYA 1NBOA 3KETA 1QR6A 4EJ6A 4XGNA 1G0OA 3SJ7A 2YY7A 4D41A 3KLPX 3UH1A 4YAIA 3KSDO 1YDEA 1E3IA 2PZLA 4YA6A 2CDBA 1PQWA 3WWYA 4YPOA 2VWPA 3NTQA 2J5QA 3K2EA 3SBOA 3N58A 4BMVA 1QKIA 3DBVO 3H5RA 1B0AA 1KEPA 1PS0A 2NADA 1PL7A 2DBQA 1EVJA 3CZMA 3IDSA 4M49A 4AJNA 2D2IA 4YJFA 4J2HA 2BGMA 6LDHA 3VH3A 4DQUA 5I7EA 4ZQEA 1J4AA 1DO8A 1HDXA 1JDJA 3WDSA 4JP3A 1XG5A 3GK3A 3NEPX 3RU9A 1LDMA 3EK2A 4BNTA 3LT2A 4RDHA 3RFXA 2WD7A 2W2KA 4E6PA 1VKNA 2NU9A 1NXQA 2RHRA 3RUCA 1ADBA 1EQUA 4IIUA 4YEDA 4PLZA 3NYWA 3OJEA 2J3KA 3QP9A 1YS4A 4IJVA 4Z3DA 1K6IA 3RUDA 4WLVA 2X8LA 1IE3A 4OSOA 3WBBA 1X7HA 4R68A 4JP2A 1GQQA 3QWHA 1VI2A 4O1MA 3BTOA 4MVJA 4OQZA 3V1TC 3WNVA 4EJ0A 5K9ZA 4CLXA 2O2SA 4AJKA 3D1LA 1X1EA 4IQ0A 3WNQA 1A4UA 4B4UA 5F5NA 1WZEA 5DBFA 4W9NC 3QVWA 1Q7GA 3WGHA 2DT5A 2P4HX 3CMCO 1F0YA 2I3AA 3AUSA 3KHUA 3IKVA 2PTGA 4WPGA 1I8TA 4QT0A 3BMCA 4G65A 1HE2A 4ZN6A 3PLNA 3ZHXA 2HMWA 3UAGA 4H3VA 2VN8A 2JFHA 5G2OA 4AJIA 2D8AA 1ZUD1 2CZCA 3AUAA 3DFUA 5EMHA 3TOZA 2GZ1A 3HG7A 1DFIA 4CV3A 1ISFA 4P38A 3VC7A 5K0ZA 3N7UA 2VT2A 4BNGA 2C7VA 4EZBA 4AJPA 3IP1A 3OF2A 4IDCA 3KO8A 1WWKA 2PNFA 2PZKA 1RKXA 1PZFA 3LLVA 1JVSA 4NFHA 3BMQB 4JBHA 2D4AA 3ZWXA 4GH5A 2FWMX 1DIBA 3W4JA 1I01A 1RWBA 3OMLA 1M76A 5JNLA 3HDQA 1EQ2A 1RPNA 2FR0A 3JQEA 3EMKA 4HKTA 3DL2A 4IDGA 5FF9A 5KJCA 1MG5A 3DBHA 1VSUA 5EL0A 4WLOA 4ZVVA 3DBLA 2I76A 4PGFA 1PTJA 4HBGA 2Y05A 3ZWNA 2X0RA 3AI1A 2X7HA 3KM0A 5KJFA 4MVJG 3MWDB 2QYTA 1I3MA 2O3TA 3WSWA 1LLDA 5IFLA 1DB3A 1YB5A 1NWHA 4NJOA 4BS9A 4AFNA 5IN4A 4YAJA 3PYXA 3E9NA 1Y1PA 3VDQA 1ZFNA 3STHA 1OZAA 3MJTA 1YWGO 4RF4A 4XGKA 4ZICA 1ISGA 4PN3A 1VLLA 4FOOA 4HX5A 3K96A 3PRJA 1ORRA 4BGUA 4DGSA 1XU9A 1WMAA 5IDWA 3GVXA 5A5FA 2Y68A 3WFJA 1WDKA 4E13A 5F1KA 5GY7A 4N5LA 3QWAA 1NQ5A 4J1SA 1T1SA 2Y93A 1X0VA 1I0ZA 3G1TA 4N5MA 3PTZA 3PJDA 4U6QA 1DFHA 3PP8A 4GX5A 1C14A 4CUJA 1NM5A 2AA3A 3EUWA 4TKLA 1XDWA 3QY9A 5HA5A 2O3JA 3K2BA 5BT9A 4OKNA 1VL0A 4DC0A 3L07A 3PYMA 4BO5A 1U1IA 1JWAB 1EFKA 2C0CA 3TZHA 4BO6A 1Q0HA 1QRRA 2FMUA 4M1QA 3X2EA
chains in the Genus database with same CATH superfamily
2H2IA 2AMVA 4MQEB 2E1RA 4R6XA 4EARA 5KWSA 4B09A 1FTSA 3QE4A 5KVVA 1AHHA 1W4ZA 3ZGXA 4NYIR 5J2UA 3GJQA 1KQGA 1JIXA 1FVXA 1NVXQ 3KDSE 4QJIA 5AKHA 1H4TA 4YQEA 3W5DA 4CN9A 3VJRA 4DA9A 1MA0A 2FETA 4Z7JA 2EJTA 5FR1A 2JGDA 4JB3A 3L7NA 2PH7A 3SYKA 2DF8A 1ZVVA 1EB9A 3GA5A 4XX0A 4IY1A 3FTNA 1NXSA 1YUNA 3WO1A 3M9XA 1B8OA 2AMLA 1I94B 2NUAB 3KJZA 4ZV7A 4YAEA 3WZMA 5AW7A 3WGQA 5LU8A 1J49A 3CTMA 4GQAA 5BUSA 1SELA 2YOFA 3R74A 3V1UA 1DMRA 4I1IA 4UXIA 2G25A 3E58A 1RHKA 3I39X 4JOBA 1UJ2A 2Z04A 4UATA 1IJBA 2OYRA 3WRXC 2NV6A 2O2HA 1AK1A 4NJEB 3ZWCA 3ZIDA 3AY6A 5ALHA 3A7EA 221PA 5FPTA 4DV2B 3K0FB 1QQTA 1ZEJA 2VXOA 1YRQA 4XSGA 2GFHA 4TV9B 1VYTA 1Q1NA 3PE3A 3T3EA 4Z2AA 2B1QA 1VLJA 4FJ1A 4PYOA 1JHOA 2B69A 4B3BA 4FOTA 2EERA 4RDIA 1FDRA 4GICA 1CS0B 4P58A 1KIAA 3NIGB 1E4EB 1G6KA 2GUGA 2XYPA 1MRNA 4RIGA 3WLJA 4DLTA 1M6NA 6Q21A 3VAZA 5GMOA 4OL9A 3LL7A 5D86A 1LVHA 3IIIA 1L8QA 4MPDA 2TSYB 5JFTA 5L4LA 2QAIA 4IDOA 1Y3IA 4JLBA 5B1DA 5TJ9A 4HUTA 1GLVA 3M1LA 1LS1A 5ILQA 4RZXA 1KC1A 1CUFA 4Q1CA 2HYDA 4TVBA 1FYXA 1K2VN 2ZIWB 5ITVA 2HBZA 5ESWA 3N1UA 5FKJA 1UKEA 2OFWA 3ONWA 4H60A 2VATA 4BU0A 3MLBA 2GNAA 2X4DA 2GXSA 3CXRA 4QRDA 3T3OA 4NE2A 2YZ2A 1V95A 5ECDA 3VDNB 3W3AD 1SXJA 1FP4A 4W63A 1EFRD 2XTNA 4NBKA 1I80A 2YIDA 1FDIA 5CVEA 1U9JA 2Q5CA 5M7EA 2OCAA 2YINC 1RCUA 2LV8A 2BH9A 3KQOA 3RYCB 1W7AA 1NP7A 5JHGB 3PTAA 2QTRA 3JQBA 4ZVKA 1PLLA 4IYRA 5E2BA 1XEAA 2O48X 2P6UA 5ILOA 4NKRA 4NNPA 1Y8QB 5LP6A 2AD1A 3NS7A 2UVDA 3AHHA 1NI4A 2P90A 3AEUB 1AGXA 3DKKA 1SXIA 3M6UA 1E2GA 2EG9A 2JH3A 3QU2A 2ZIXB 4RA6B 4BWGA 1SKYB 1O54A 5A9TA 5EP3A 1ADFA 3VZQA 3QLUC 2VP3A 2IXGA 2VPWA 2O2GA 2ZRFA 4OQ4A 3VYUB 1Z5NA 2OZLA 4MOWA 3RVBA 1PVVA 3L4KA 3W9UA 3PFFA 4AKEA 1JQEA 1MB4A 1F9AA 1UINA 2QD3A 2R6ZA 1TZMA 2FH5B 4RD2A 1RAHA 4RHFA 2NUBA 4L0DA 4GOLD 1VL1A 4UCXA 4OI0A 1P0MA 4HY3A 3AI2A 3RT7A 4U2EA 2BMDA 1QB7A 3DMTC 4K6OA 4LHWA 1DUSA 3T34A 3N6VA 3IERA 3Q9LA 5J4KA 1EFLA 4DXDA 4KNYA 3CNHA 1I14A 1CRWG 3C6ZA 4PTZA 4FQ8A 3GLIB 5JBQA 1L7MA 3LCRA 3MYYA 2OHJA 2CJXA 1W0JD 1WXXA 1TQ2A 2FFQA 4KO4S 2MSWA 1O96A 1IHYA 4HBZA 2IZ5A 1NW9B 5AKZA 1NP3A 1Y5MA 4C21A 1E1KA 1ZINA 5JSKA 2W6MA 4A0FA 4DSNA 2AB0A 2FP4B 4KVZA 3S4YA 3O3CA 4R2IA 5HILA 4QGBA 2B8EA 2QN1A 1TQHA 2ZYIA 1DCKA 2XF8A 4BP1A 5C8YA 1V8OA 4Z0TA 4JBGA 4CKEB 1P8AA 4JJGA 2W2XA 5IJWA 1SVUA 4O4JB 4WY8A 4X62B 4BASA 4INPA 1JJAA 1NJ5A 2R6JA 4ZK2A 3E1KA 1TD9A 4MUHA 3FWPA 3W8DA 3CHYA 4Y0VA 3Q7PA 4ARAA 1FZQA 1Z28A 1CY6A 2JZNA 2PVSA 1TA9A 1YI1A 3D4PA 3NVMB 3OPYI 1JI0A 3QMPA 1P73A 1CVIA 2OBFA 2AYXA 3LT5A 5JZSA 4LGCA 4X45A 2ZTHA 2KWIA 4RTSA 4LRYA 1GZSA 3B53X 4E94A 1W6UA 1U3DA 3C14C 4KAXA 1V1JA 1M2EA 3DZDA 1JKJA 3RC2A 3L4BC 2YFHA 4OL0A 3EZFA 1WS6A 3PQ4A 4BJ5A 2I2WA 3BHIA 5GINE 4FNGA 1BJKA 3EXG2 3GVIA 3UIEA 5A4DA 1H3NA 1ILEA 3OX1A 1TU3A 2CYCA 3EDMA 4R31A 5DJ5A 1L9KA 4EKGA 4ES6A 2FN3A 3AVWA 2O52A 5J1TB 4U63A 1J22A 1GQSA 2W2TA 4GZLA 3RKUA 1JEOA 4BV9A 1EFPB 2ZBDA 4RQUA 3LDGA 4R01A 1FFDA 2XNHA 2PCLA 3U5ZB 4W1SA 1WY5A 4U00A 3VPFA 3N59A 2RKOA 1AXRA 2PSEA 1REQB 1GN9A 1V39A 2X9VA 2IUTA 2QENA 3G17A 3KZ1E 2EKBA 1VPDA 1JAYA 4IFBA 3FOAA 3LECA 4LYDA 4WNAB 2G4LA 2Q5QA 2E4ZA 2IYNA 3AG6A 3MJVA 5G0TA 4GM0A 3WIDA 5A04A 1BWPA 3SXJA 1V8DA 4S0XA 5HJ5A 2G70A 3SS9X 1HO3A 1ZY2A 5GOZA 4D4IA 1WU8A 1ZOIA 2LKCA 1TUBB 4OHYA 2ZIVB 2Z5GA 4AKTA 1KK1A 1BX0A 4UBMA 3RLFA 3ZDYB 5KTRA 3K9BA 2GAIA 4AU1A 2YWJA 4NULA 1YONA 2IY9A 3ICWA 1V4VA 2E48A 4PEVA 1TJNA 2VAWA 5M2QA 2ET6A 3IVGA 2QIPA 1E3TA 4TS1A 2H31A 3TMAA 1NULA 3QEOA 1AHNA 3GMDA 4IPTA 4PLYA 4EHLA 2CLDX 1XYYA 1GV1A 3COJA 3ASVA 1NNUA 4GLFA 2XNSA 3CO5A 3O4RA 4G37A 4BU1A 4C7JA 4ENTA 3KWMA 5BXQC 3ZJVA 2EW2A 4PFQA 1AS3A 2IL1A 1JPVA 3EA5A 1W4AA 2PZEA 3R8CA 3K5WA 2NUAA 2OILA 3NDRA 4JELA 1U31A 3TPFA 1OXMA 4FDTA 4CV2A 3AOEC 3EXG1 3K9GA 4X66B 3BSWA 1N4AA 1B6SA 4Q7LA 1NVEA 2HQ1A 3V3TA 4KTVE 2IIBA 4MKHA 3ZXXA 5HKKA 2VJCA 3PWZA 4J29A 3UK1A 4DFDA 5BWLA 2I4OA 4QFMA 1SN7A 4AULA 2R85A 2R7NA 4P86A 2Y0EA 3PDWA 5E9WA 2WA1A 2Q3JA 1M10A 3ISTA 4HDRA 1Q0QA 4LHVA 4B4OA 1G3QA 4YJ3A 3T7SA 3HCPA 2WINI 3C16C 1CUIA 4REMA 1V45E 5J59A 2YZ7A 1K9SA 4PIMA 3RE1A 3D9QX 1TXGA 3PLRA 3GJ4A 4ENWA 4CEHB 2FEMA 2FPIB 2G08A 1A0OA 4GI2A 4GO1A 2BUBA 2Y1KA 1A9TA 3EPPA 3EIFA 4PPFA 3VUFA 3EGXB 2Q3EA 1ZRSA 1EFCA 1FQJA 1SUAA 3PD1A 3E0XA 2AOUB 4JJ7A 4QJBA 5K6AA 3K0CA 5H1YA 1V16B 1I30A 1VLHA 3CH4B 3KZOA 5AKXA 4UASA 1ZD2P 5CYOA 1FMFA 3HLYA 2DSTA 3C6YA 4WCDA 5IKXA 2Z6UA 1PX2A 3VJMA 4L9SA 4FN4A 1NJSA 1U8EA 4A73A 2FE1A 4QHTA 2R8RA 4QJ3A 3HDHA 4BKRA 4BX0A 3IBGA 1D1SA 4LXTA 2FSHA 1PZXA 4RGQA 1CDOA 4M86A 2ZJOA 2HSJA 3ZHBA 4XPZA 5MN5A 1V6CA 1T6BY 2DPGA 4WV3A 4ZARA 3MGBA 3VKHA 3ND7A 1EWQA 2V6BA 3NHRA 5JROA 4D6XA 4TSFD 4ZAFA 5K0FA 2NX2A 2KW5A 5DH9A 4Q12A 4X61A 1I3NA 1NF2A 4JVSB 3C74A 3KPWA 3VMFA 5LQAA 5FA6A 4LOJA 3Q87B 3Q88A 3CVWA 1HGXA 3BC1A 4ZRMA 2X3YA 3WL8A 3K8OE 4OLHA 3UICA 4RA6A 4B5LA 4C03A 2XQVA 3HK2A 5EWLB 3A6FA 2BLNA 1XLUA 1X8LA 4CMHA 3PWKA 3SS8A 1LBEA 2EZTA 4H6VA 1N3YA 1VHTA 4B7UA 5JEEA 1JPUA 1GAXA 3HA7A 5DIFA 5J4LA 5F9FA 5AVQA 2L42A 2G1PA 3HO1A 2PWPA 2O5CA 3LUCA 1NMXA 4CM9D 2NXWA 1GSIA 3G2MA 9GPBA 5JCXA 1GTJ1 3T7IA 4LWOA 4JEUA 2QUKA 3P27A 1JHQA 3CNBA 3THSA 5JJKA 3PXDA 4S1PA 1Q7TA 3SOZA 1DU4A 1PDWA 2PIDA 3K6KA 4XR4A 3RRYA 4RF5A 1PT9A 2RKWA 3EEYA 5KOHA 1EBUA 1PLJA 2Y76A 5C3UA 1UOOA 3CX8A 4QGHA 4MVWA 5LZ8A 3HJCA 1JIIA 3HNPA 1E64A 4KLRA 4YO7A 2IH4A 5ICCA 1DV2A 2Z95A 2CV0A 5E3JA 2PKRA 2WG2A 2BGTA 4QTYA 5DTQA 1WMFA 3VNBA 1MCZA 3RPEA 1FLNA 1H0KA 2CXXA 1JHAA 5BW4A 3PR3A 1ODKA 2C2OA 4S2UA 1DCTA 1FYVA 1XVUA 4A16A 3QOFA 4KAFA 1WSDA 2ARKA 4QIHA 1UPAA 5GIPE 3ZKAA 5I8ZA 4F7DA 3I8XA 4IEFB 5ALTA 1GNSA 3WGNA 2NNLD 3ESRA 2JGLA 4CMCA 3C3JA 2DEUA 3KKOA 4L0QA 1CLUA 4BNDB 3VAYA 2OECA 4FMCB 3FJYA 4J0IA 4RESA 4X7RA 1GKLA 1PFUA 3SX4A 4FKZA 1E92A 4FWBA 3GLHB 2BR3A 5E6SA 2V0NA 5HBRA 3TLZA 3VO9A 3K6SA 2YYAA 4EENA 2WC1A 2Q1YA 5KSPA 1JZSA 2GVDC 4XIFA 1ZZEA 3MIZA 1XCPA 4UTZA 5JAUA 3OOYA 2I62A 2Y0BA 4TTAA 2FK8A 4X3PA 3E4CA 3DMPA 4GDMA 4AI6A 4K05A 3NWPA 3E03A 1DJLA 4BFSA 2DKNA 2ZIZA 3LL4A 3QW4B 1UWVA 1N7GA 2NVUA 5JAZA 3CVVA 1P1FA 3I6IA 2RB4A 1GFWA 2C2XA 2P9YA 5BNFA 3RTEA 2XE6A 4U2BA 4YRIA 3AKYA 3LP6A 4N3CA 1L7EA 1MQ8B 3W77A 2XKJE 4L7VA 3GJ5A 4JODA 1HZJA 2F3RA 2J0UB 3AV0B 4M6WA 1OXSC 1A8QA 4B32A 4DCJA 3X1ZA 4DYHA 5DB4A 4P34A 1FDWA 1OA0A 3D2LA 4KIFA 4P82A 2YHSA 3H6HA 4EKDA 2CFIA 6ABPA 3JZFA 1K8QA 1CZUA 2REQA 4YASA 3T7CA 3FNEA 2CF5A 4M9QA 2FEOA 1WHSA 4MDEA 5JANA 5E7JA 1WULS 2VK4A 2AUTA 2DFPA 2G0NA 3K70B 2L69A 3ACBA 4M0MA 3AM5A 2BF4A 4HFMA 4BZZA 3PB3A 4FMPA 2GN9A 1Z5OA 2IEBA 1NC1A 4HH1A 4I9NA 2HK8A 4F5DA 2FFRA 1XKLA 4CDGA 1RJDA 4JI8B 1K63A 2H9AA 2X13A 3GJXC 4FCTA 4L9WA 2CY0A 4UCWA 2PMEA 3DCNA 3WIEA 3ORHA 2WIAA 2QEQA 1QO7A 1KXJA 1YS9A 2MSLA 3V8QA 5LLDA 3VNVA 2FPPB 2QM8A 3NOOA 4IM7A 4NOMA 5JXHA 3P45A 2P4UA 4DA6A 4LF9B 5B57C 4ZEXA 4FZ3A 3G2IA 4CM9A 2QE7A 4M76B 2NU6A 2D1RA 1MG0A 4WDQA 3OPVA 2DTXA 2X23A 5H16A 1M2HA 5LBTA 3S0JA 4FE3A 3S2YA 5A9SB 1ML3A 4LGMA 5JSYA 2AKEA 2BTOA 4MR7B 3ZCPA 1NPDA 4TLCA 3HDJA 5AOCA 3TGPA 5EUBA 4QYIB 2P5SA 4AG3A 1FYDA 3PUXA 4LJLA 4DC1A 4YDHB 2BFAA 5AUPB 3N2YA 1GDTA 3CINA 1OUMA 4G1VA 4KQXA 2PRIA 4LV6A 1Y8AA 2NWQA 4QTZA 1WQ4A 1T3HA 2RC5A 4EMUA 3GLGA 2PGJA 4E11A 2N75A 4NZ9A 1YDGA 4CIBA 2IOFK 2YHAA 1OLUA 3W7VA 3PX7A 1KI3A 2JI7A 1C7IA 3T1VA 3ZXUB 1AH2A 3UT5A 2KB0A 1GZ4A 1I4DD 1Z33A 1R9NA 4IP0A 2QSUA 2CK3A 2OM2A 1QOPB 2QBYA 2QMEA 2Z83A 2IVFA 2B25A 1P0QA 3GW8A 4B8ZA 5JNRA 4G5OA 5EFZA 3T7KA 3WE7A 3JRNA 4A0GA 3LVFO 1T0UA 1QIIA 4L5BA 5FUVA 3VC3A 3B1KA 3P0IA 1TOAA 4MARA 4HDSB 3L77A 4R40A 3CRW1 3UMJA 5K01A 2NSLA 3MVEA 3REFA 5E9JA 3RI3A 4LRTB 4DMRA 5KQSA 2QHXA 4IBOA 4MS1A 2VSXA 1KAQA 3SF8A 3UF0A 3ZI0A 1ZMTA 3KQHA 3N5CA 1YBMA 3OCUA 4CEJB 5F3WB 3HWSA 4W99A 1QQAA 1WXGA 3CB4A 2E21A 4M2LA 5FL7D 3JQPA 3MWYW 4ZYVA 1C8KA 2QYOA 1XP5A 3D7LA 4PYRA 1V7CA 1FRFS 2OVBA 2WHYA 3I76A 4WA8A 1RHQA 2WP0A 1P31A 1EFRA 1Q74A 1QV7A 3GCXA 4IIVA 1NT4A 2D59A 1LCIA 3JPWA 1G8KA 3M7IA 1XD9A 1G59A 3DH0A 3ESAA 4YRKA 2ZCJA 1TT7A 4NABA 2RSLA 3KQSA 4G36A 4PLTA 3G1WA 1NN3A 1X0XA 3ZHRA 3EXEA 1CF2O 5EJ8A 2IVZA 5JO0A 4LFAB 3NP7A 2GEBA 4HVAA 1CY1A 2K2WA 1XC7A 2YYSA 3BGVA 3FPFA 3GRFA 3IV7A 3N7AA 4FN5A 4LSZA 1UOPA 4DMKA 4EWLA 3AFGA 3FWYA 4FMDF 3TCNA 1RRKA 1PL6A 3VNQA 1QYRA 4GKAA 4Z9FA 4MW6A 4ZA2A 1VTKA 3LE8A 1DAKA 1ODLA 1P1JA 3X1XA 3MIIA 1P6QA 2I9PA 4LHXA 2OQIA 1JKJB 1V2HE 2WSSA 3BKXA 2RG7A 2WSIA 4GXNA 4WLNA 4QM6A 4MKRA 5D5PA 4UE3S 5H81A 2QM7A 4B2IA 1X15A 2VAMA 3C8UA 4KXLA 3VPSA 4Q4LA 3TQIA 3KYCA 1OLOA 5IFKA 4B85A 2PVCA 5LDHA 1W34A 1L3IA 3NEAA 3HA2A 1E58A 1E0DA 4MK4A 2CMDA 3VBCA 1JDBC 1PQPA 1MB3A 1WB5A 2HA7A 1O97C 3NQ41 5T5QA 4JBXA 1PV4A 1HSZA 3VDMA 1KNQA 2W4MA 3OOEA 2IDKA 1EGAA 2R7AA 4HN4B 3WLQA 3VSEA 1TE2A 2QUHA 1G17A 1AY0A 1WF3A 2X22A 1GA6A 3IHLA 3OQBA 4RKRA 4WKNA 5FTNA 2AYZA 2B8NA 1BX3A 1REQA 2CJPA 3C2QA 1SBNE 3AETA 4Q21A 1IOWA 4RCZA 3T61A 3I2IA 3ES9A 1USWA 1J8YF 4TWIA 4R3WA 5IDXA 1O95C 2VNAA 4H4CA 2XYVA 4KODA 3V4FA 2J6HA 1WE2A 1Y37A 2E4YA 3DVQX 1QBGA 4BJHB 2PJRA 1T4GA 2V74B 3R3WA 3SE7A 1RVDA 2IA5A 4HK4A 1RKBA 1ECFA 1CQWA 1ZNXA 2O7SA 3D2BA 1KJNA 5LJIA 2HUPA 3KEQA 2X1HA 3COWA 2VPQA 5FCDA 1GLNA 2HLPA 4ZOLF 3UA4A 5C8DA 1Q0RA 2GETA 5J4VA 3ZZMA 3R7FA 1IWBB 2V7PA 3O75A 1B8PA 2GS9A 1A2QA 3USES 2O8DA 3ZWMA 4H15A 4WZBB 1QPGA 1LTQA 3ZXSA 3Q6NA 4Q93A 4F5ZA 5B2EA 1D1TA 2R68A 3O82A 4FYPA 3L6DA 1BHQ1 1O89A 4GZ5A 2IGBA 3AHJA 4MQ6A 1RQ2A 3PUIA 3RUIA 1QIGA 2CW5A 2ZE7A 2PX3A 5ALFA 4A91A 4RZ2A 4BGEA 2BYTA 4RE6A 2PN1A 2M32A 1CR1A 4KEAA 3AB7A 2ODAA 2P0AA 3SYNA 1NW4A 4R7GA 3AR3A 3G8AA 3I04A 4OQPA 3T1HB 5FJJA 2NSJA 4UQPA 3WGMA 2OBMA 4JT4A 3IHTA 3DEAA 4HH0A 1EESA 2AC2A 4L73A 4BNMA 3WJAA 5B1YA 2WVAA 5DULA 2IHVA 4JJAA 1DXOA 1QTNA 5TGZA 2ZUCA 3JARB 4NYMQ 3UENA 5JSHA 3JALA 5HZHA 4A6PA 1WHSB 1QK4A 2A67A 2DJ5A 1X8KA 4FC7A 4ERNA 3TLGA 4DV6B 1MZPA 1M5UA 2ZKIA 4YCDA 4FGWA 1BMQA 4JLNA 5I7RA 4KR6A 2DP4E 1S1CA 2HLDA 4N7BA 5FORA 2B8JA 4DKXA 5LIPA 3T1TA 1B8VA 2H1IA 2K87A 1H65A 4Q3CA 1Z4NA 1ZGZA 1QCZA 2AOUA 4I08A 2JI8A 2CE2X 1XDSA 3QNMA 1GNQA 5EVCA 4KTTE 1RM5A 5WRFA 3AVOA 3I53A 5CB4F 3L92A 3SBDA 4N47A 1KO1A 4JC8A 2C5EA 3A10A 2C5HA 1R66A 3PV0A 3ZBUA 3E1SA 2NXNA 4J90A 4PANA 1F51E 2XUFA 4P92A 1PNVA 1GQOA 2XMGA 3I2YX 5CJJA 1CZNA 3IIKA 2PD6A 4M1WA 4J0FA 4YNBA 5B6JA 3LYHA 1B6GA 3KNZA 3FNQA 4GOJA 3EQZA 5AVTA 4KRFA 1WMDA 2KBFA 1NXVA 1WRBA 3U7FB 3O8BA 4PSUA 2VT3A 3DE2X 3K72B 3BAFA 4HTFA 4I50F 4NZYA 1KU0A 1T15A 4RY0A 3UOGA 4CF3A 3D31A 3SVZA 4D9CA 3HGTA 3F9CA 1B2LA 4QUIA 1Z6ZA 4F1WA 2HCBA 4U7GA 1JHZA 1JQKA 3JTEA 1GL6A 1LVUA 4LXGA 1OLUB 3HGMA 1SCUB 4H18A 2AV6A 1I3CA 3DT6A 4O4HB 4ZOAA 4TS3A 3KPJA 3U81A 4PIVA 3UATA 3VKVA 1OXBB 3FFTA 1ODTC 2EDAA 5FL3A 3UMYA 5AM3A 4ND1A 1ZJ4A 4BKQA 5GJCA 4A8JB 4CF5A 3A3YA 1L4KA 3UJCA 1OHHA 1Z17A 2B8WA 2GN1A 3EUEA 3P0HA 3EZLA 1HDEA 1L3BA 5BWMA 1NUPA 3EHDA 4RBNA 2IOHA 3EIXA 4I19A 3B9PA 4HDSA 4Z53A 2QX7A 1A97A 3H1AA 4RSGA 3S99A 4HQOA 4DL9A 1XRQA 4BBPA 5JS1A 4EQZA 3QK7A 4AZ0B 2IZ6A 3HCBA 3MUNA 5TMEA 3RRFA 1CSEE 1UKAA 1U6JA 5JS6A 3ZQUA 4MDHA 1G8MA 121PA 1XFDA 2AX4A 2NTVA 2WIJA 3HUTA 3OJWA 3DQZA 4U8HA 4ZREA 5F23A 1NAHA 1YCHA 1MX1A 3P2KA 4G8JA 4HZUA 4OHRA 4PX3A 4LWZA 4CMIB 1CIPA 1DTEA 3C5CA 3ZVKA 1DQZA 2VDPB 1KFJB 2OV8A 4RM2A 2JGRA 1MR3F 4Y8VA 3DBLB 2NZUG 3R20A 1N8TA 3LC7O 3HVIA 4L4ZA 5BYAA 3AZOA 4G01B 3HJUA 1F5SA 1ZCFA 1XEXB 2WM9B 3PR2B 3SZGA 4BQOA 3EEFA 1ZK2A 2ACKA 2WZDA 3V7NA 4N41A 2NYUA 1JT9A 4K9RA 2ON6A 4IGFA 1MV5A 2H7VA 2ONYA 4EYOA 4JFRA 4R1TA 1BHSA 4LYHA 3ZQJA 4I5GA 1OPRA 4XI9A 1Y9ZA 4X1IB 5HOEA 1KP2A 1LC3A 1M6YA 3IQGX 3EFOA 2LRHA 4IHQA 4UU7A 1ODCA 1MEEA 4ZKEA 3WWEA 3ZZ1A 3GGGA 4BNVA 4GEGA 1E8MA 4BNWA 5IC6A 4YVFA 1C9YA 3DFZA 4S1TA 4BAZA 1KE2A 2PUFA 2ZUSA 4BVEA 3N2GB 3AJRA 3RREA 5C51B 1T36A 2Q5EA 4MW4A 3L6UA 4C4ZA 2FPKA 3Q0TA 4LY0A 5FAXA 1XJ0A 4YMHA 3OEEA 1E1CA 2RHBA 2BDUA 2PS3A 3WL5A 2EKPA 4L2IB 1CRQA 5CM8B 4FHCA 2DBZA 3GT4A 3N9IA 5JNSA 3GFBA 2OT3B 4FU0A 1XZCA 5T8KA 3WA6A 2J0UA 4M6WB 1UPXA 2KMLA 1D2RA 4JX8A 2ZT6A 4OI4A 3HKDA 4OXXA 4TMZA 5MHTA 2AN4A 1XMQB 1CUGA 4HXYA 4OXIA 1DBIA 4U2DA 1LTKA 4YUYA 3U44B 4MNTA 5CHYA 1FNBA 1H2EA 1TM4E 5ALRA 3B3GA 2NZYA 3G6KA 1YUBA 1ZM4A 2AXEA 2CDAA 3RJZA 1XTBA 3NT2A 4FVTA 5G1OA 3M3PA 1NM5C 1E2QA 1WG8A 2Y2VA 5K6TA 3SFVA 4N8DA 3T7TA 4YJ2A 1U5AA 2E5FA 2QRJA 4JI2B 1T5DX 3WL3A 3HWWA 5TARA 4JQZA 1LLUA 4R2XA 3UCFA 1MJNA 5B7GA 3AB3A 3QE2A 1UK9A 2GNOA 1A2OA 2CHGA 3VU0A 3FBGA 4A8JC 3AP3A 2BTQA 3SZOA 4RPIA 2YYYA 3CKYA 2OXFA 3ABOB 3G0DA 5DBGA 1N9GB 1YSCA 2XMDA 5DLYA 3FXAA 3ZU2A 2BR4A 4AWXA 3PCTA 1QIKA 1S89A 4J16A 5IUNC 4I1VA 2AC7A 3AEQA 3ONNA 4QYIA 1UDCA 1U2DA 1EK5A 2NG1A 3CLVA 3WKCA 2XWQA 1F2VA 4CM4A 4XIYA 4YV0A 3KQVA 5TB5A 2FTKE 2ZQ5A 4JSYA 5FOSA 2ZANA 2PUEA 3L05A 1C4WA 1IN4A 2YY5A 3NG1A 2DFKB 2NVWA 1OBCA 3MGGA 2B4RO 3H19A 5HCNA 2IPNA 3T94A 5AW5A 1SIOA 3IEVA 2GOYA 1KYIA 1H2AS 1Z6XA 2GN4A 4WLFA 3K1JA 1LB1B 1NQTA 1YDMA 2LTAA 1JR6A 4Q4JB 1NQVA 4X00A 1KMNA 5UKDA 3V48A 2M2IA 4AJEA 5KOJB 1N2IA 1CV2A 2SKEA 2PXCA 4KN9S 5FTWA 2ZTVA 4HADA 3LFTA 1QF7A 2R1ZA 3LZ6A 2QDXA 4KQJA 3QKSB 5KVQA 1XKXA 4URUR 5A6SB 5LBUA 4YRMA 1KBOA 3SD7A 3U4GA 3HDYA 1AUPA 1DG1G 3IEIA 3FTFA 3SP1A 4L6IA 1XLVA 4BN0A 3MG9A 3TD2A 3GJ3A 4EJMA 1YJAA 3NH9A 3OU6A 2QGFA 4EY7A 1YRLA 2XRYA 5BURA 1IZYA 3OIDA 4DPLA 1YZTA 1D1QA 4FLEA 1VHDA 1ZVMA 2HO5A 1S96A 1N7HA 1W581 1I3LA 2PAAA 3EQ2A 4UD2A 3G79A 3SYTA 3V7FA 4BTLA 1XZHA 4CEJA 1E2LA 3D5TA 5KREA 2QR5A 1MGPA 3PYLA 3UV3A 1EJBA 4HGQA 1JALA 4CMJA 2HJSA 1IBKB 3OIYA 4KFRA 4W1RA 2MYTA 4US1R 3RUAA 2V4UA 1IY0A 3RC7A 3DAYA 1L6RA 1PR5A 2JCXA 1CB7A 1EVQA 3E5NA 3I6MA 1TRHA 3P96A 3RYCA 4MV3A 4DG8A 1B3RA 3NV7A 3ICPA 4N0MA 4YHBA 1MC5A 2A0UA 1KARA 4R5MA 2FDCA 3CUSA 4BVJA 3NBZC 1G7SA 2R8PA 2XCUA 1QWSA 2HSDA 2OY0A 2ZYVX 3AONB 2XQKA 4RHTA 1SVOA 3OM0A 4WTOA 5LP6B 2J6CA 1XDGA 1W94A 2PGLA 3UFXA 5BSWA 2DUNA 4IZIA 2QTBA 3W6NA 1K7EB 5DCUA 3GEIA 3FUXA 2D1TA 4Q82A 1QRSA 5KYWA 4BMOB 2JKVA 3IEPA 1CUWA 2HXGA 2EQAA 1NTOA 1YS7A 3LQ2A 4GT1A 3KKLA 3UUFA 5BV2P 1NIPA 3ZE1B 3W0LB 5ALLA 4CI0B 2NLOA 3NRCA 2CDRA 2QG4A 2VXCA 3QWBA 1YR9A 2P9ZA 4X65B 2ZSUA 1J09A 3ESBA 3QX8A 4LC0A 4Y9UA 1EUZA 1D5CA 1TZCA 4MW2A 5HFJA 4B46A 5CVJA 4UOEA 1JLMA 1AF7A 2NZVG 3OD5A 4RK5A 5C35A 1R8XA 4CQNA 3K9QO 4E14A 3IP7A 3RRJA 1Y7IA 1IM8A 1CULC 1DG9A 1JWBB 2X0KA 3GLSA 1AVTA 2JRCA 3OCVA 5EIWA 3FWKA 4BKPA 1QH9A 4BPRA 1N2EA 1JLHA 3D2CA 2QRKA 4GW3A 4ME6A 3EVDA 3CCFA 4NMHA 1CIVA 1N92A 2VH1A 4RCYA 4YWHA 2ZS7A 1XDUA 3U9TA 4DANA 4KO3S 5CURA 5DRYA 2ES4A 1W48A 3QPCA 2Z2KA 2IV3A 3DAFA 1RRPA 4F5WA 1P7ZA 3IBTA 2R8ZA 4X24A 2PYIA 5DBEX 2J0VA 2OHIA 3TG8A 1P1BA 1SBCA 3VR6D 1USIA 4LE0A 2Q4RA 2HRCA 1EB8A 3MBIA 1ZIXA 3PI7A 4ZCQA 4DPKA 4NYJR 1IU9A 2V65A 4J0CA 4C7MA 2GWHA 2OO5C 5JS8A 1CR6A 2JGKA 2SHKA 4H7EA 4TYMA 5ICFA 4V03A 3BWMA 2RBKA 4MUBA 4M9CA 4XWOA 4DVGA 2GUWA 4IHKA 2R6GA 1EVLA 1ZX1A 2O5VA 2ZFUA 2ZAYA 2ZBPA 4OAOA 2Q6VA 1NVAA 2QRZA 4BNUA 1E2EA 4OBXA 3WR5A 2DQYA 1NJGA 2H52A 1DCMA 1II0A 3PNBA 3PRHA 3GRKA 3L8CA 3R0QA 2EKQA 4MV9A 3WK6A 3FIUA 1KFCB 2GM9A 4MVJF 3PFCA 4W82A 3VNAA 2EW1A 1T3GA 4U7DA 1AB5A 1NMZA 2MDTA 2RI0A 3LX8A 4GNKA 2JLWA 2IYPA 5IDVA 3RRMA 4Z5XA 1RKUA 1BVYF 3BL6A 1HORA 3DDUA 4G4SO 4WMLA 2H1FA 4MJ7A 2NO1A 2A94A 3DPIA 4L28A 1JBEA 4OXRA 3BB1A 5FYDA 3HQ4O 4EITA 4E5UA 1IONA 4Q3EA 3PZBA 4UUPA 1U9IC 4TXMA 3VZDA 4PX9A 3NFRA 1ST2A 3L7AA 1RWOA 1UL1X 2DETA 4OU5A 1Q15A 4CKCA 4N1AA 5TC4A 5JMWA 3RJ9A 1QNFA 1QHHB 4R16A 3TKAA 1QZ3A 2C31A 2EGGA 2OP1A 3LHIA 4ISCA 5GONA 5H3LA 1S02A 2QPOA 3Q8XB 3RVMA 1CDZA 4ZJPA 2UUBB 3TH5A 2RHHA 5DZSA 1JU4A 1XZIA 4MCHA 4LJRA 1G16A 4BP8A 2H4HA 2FZLA 2OB1A 3AIIA 1NE7A 1T9DA 4MYHA 2G9RA 4OJNA 3GGDA 5KYTA 3VR2D 1CR0A 3M4NA 4X92A 3EGOA 3EQ8A 3OQPA 1RYBA 4L4RA 4QDUA 3ZE2B 4BMNA 2C97A 5KZMB 1UMBB 1P6XA 3FZQA 1CUCA 3S1LA 4EJFA 1RXVA 1ETHA 3A1SA 3PUJA 1SCKA 2QN9A 3OT1A 1Y80A 6CHYA 1PIWA 1YZKA 2BD0A 2W00A 2RAVA 3G6WA 1YBFA 3IMFA 4QGFA 1DOAA 4RD0A 2C4MA 4L5CA 2Q50A 4TRNA 4YJHA 5DHRA 2O2YA 5L53A 4N4AA 3L46A 5HF8A 1QQ6A 2A0KA 2CHUA 3WDLA 3K70D 1T0HB 2VQFB 5JRDS 3T38A 3IAS6 2GF0A 1JG4A 4PIPA 3GHYA 4E33A 5AO9A 4OSEA 1EP3B 2HQRA 1WO8A 3L5OA 3L9XA 4NK4A 2DLCX 3CE6A 1MW9X 5YASA 3DQQA 1KZ9A 3CNLA 1ZAYA 2ASEA 3O91A 3AVVA 1ZXXA 2NPIA 3UV6A 4EEZA 2FPWA 4X0EA 4CHGA 1CXZA 4YJGB 2WSLA 3VNRA 1P3DA 3OQ1A 5AIAA 1W85B 3WQRA 4EAQA 5TT1A 2JHFA 3V55A 4OHMA 1IBMB 5BQFA 4BCDA 1QMPA 2ZB3A 4IH4A 3U7QB 4D9FA 3BJEA 4TZ6A 1CY4A 3ME5A 5KOJA 3ZBQA 4ENUA 1M3SA 2PT7A 4EBBA 4YLYA 3F3YA 4L07A 1MJGA 1J39A 2P30A 3F5QA 5LUAA 5IK2A 3COZA 2SICE 4M7PA 2BKUA 4DXAA 1VCIA 2AQIA 1EP2B 4YQZA 3QTBA 4V0KA 2PS9A 3EVZA 1K7FB 3DW3X 4ILKA 1L4FA 3KFLA 3PQ6A 4OQQA 5C8YF 1QDEA 2PR7A 4A26A 5C5DA 4BC1A 2FN8A 3FOEC 1ZW1A 1ZC3A 2BOVA 4W5HA 2L2QA 3AK4A 5HIJA 2HH9A 1A7UA 4ESEA 1UIRA 1GVNB 4RVOA 4PICA 3ZV3A 3FNBA 3N70A 4GL2A 1U63A 3QF4B 3A05A 2PLRA 3AEKA 1XWFA 3AF1A 1R27A 4KDCA 4QXOA 5SY4A 3LU1A 1BEZA 1RPZA 1IVSA 2VYFA 3UAYA 3GRVA 4C7KA 4FYYA 2VK8A 5FWXB 5K0BA 3UCXA 3L7OA 1F8XA 4G5FA 1Z82A 1TVMA 3L4SO 4OOFA 3UHAA 3U09A 3KHKA 3ZWDA 4F2DA 3IMEA 4JVOA 3BD6A 4U7JA 3OECA 1A9XA 1UJBA 4TT8A 1X86B 2BHSA 1H2XA 4Z8XA 3SSNA 2FX2A 3ERCA 2IQIA 4PPYA 4KYTA 2WVHA 2GGSA 1D4ZA 3A4NA 3ZX4A 3WYDA 3ZIUA 3H04A 2N9UA 2Q3LA 4MX8A 3ADPA 1F06A 3HXKA 1W19A 3PGKA 4ENPA 3TN7A 4DABA 1EKXA 4XYMA 5E8JA 1F3OA 1WF6A 3D6VA 2IIPA 3H9UA 2ZZMA 4G0VA 1X7DA 3A6DA 4C0HA 4DY4A 1V8ZA 3KLNA 2ZB2A 3O0TA 4UVGA 4DN6A 4YXFA 2HADA 5BYKA 3BCUA 5BRNA 1EM8A 3WWZA 4ZEVA 1LLCA 1WX1A 1V25A 2EEPA 3X0DA 3D4NA 5J2TA 4LOAA 3L1UA 4JASB 1R50A 3QVVA 1DELA 2HBQA 2HSWA 2WMOB 1NNI1 5EVJA 3S2IA 2V9CA 4RZUA 4AT1A 4B6GA 1U0BB 4IZ6A 4JVLA 4ML3A 2AXNA 4N54A 5CU7A 2YW9A 3UOWA 4GUDA 1C81A 4QX6A 1IEVA 4HG2A 4BV8A 3LQYA 2JBAA 1RDFA 2O2IA 3V1MA 5JZVA 2M6RA 3DB2A 3QUCA 4IHJB 4TWRA 3F4LA 2G07A 1SCDA 2K7ZA 4WKBA 4Z1OA 1XF1A 3NDIA 4RORA 5BPHA 3FMFA 1C9NA 3EG9B 3EQ9A 1JB1A 5JTUA 1KYYA 3D3WB 1CW2B 5AHWA 2C9BA 4A2QA 3FCCA 3T1QA 2QTZA 5A3JA 2ZZKA 3REQB 2FHPA 4S3MA 2PQ6A 1OSNA 1YQWA 2SCUA 2Q9BA 4NAHA 2UZ0A 4YN3A 1ZH6A 1JIQA 5IVIA 2OV2A 2V5UA 3HEMA 2Y1GA 3DJFA 1OBFO 3C3EA 4HXEB 2POQX 3DWIA 1ZNYA 3H3XA 4B87A 1FU7A 5DGCA 3GQBA 3DBOB 5AQ1A 4FMCF 1WEKA 4HLUA 1YB1A 2WSMA 4QO8A 2P5YA 2VHJA 4I2VA 4GHWA 1KEUA 2P69A 4H31A 7AT1A 1SC4A 3JQQA 3KYDA 2X7JA 3H1PA 2VBCA 2ODQA 1QGAA 2XKKA 5FQOA 1VCOA 1P1KA 3V5NA 3LHSA 5LZ5A 1EVKA 5EE5B 2AEMA 1XTRA 3VBEA 1JS1X 5KMGA 1DQSA 2DKOA 1JXOA 4Q7MB 4US0R 4BQPA 5GV7A 3SE0A 3DZ8A 1Z5VA 4NK5A 4WT7A 1H4SA 4BMZA 1O08A 4HHEA 4CZ2A 4YRAA 2Q4OA 3LZDA 4OHWA 2GN2A 3KPYA 1D2NA 1PJZA 4LY9A 4QFCA 3EXFB 3KDPA 1JR3A 1XRSB 4UM7A 4Z6KA 3NIWA 3FVTA 2JJ2D 4GF5A 5TPZD 2I1QA 3M0EA 1ODJA 5BR7A 3QLVC 5F4ZA 3DNFA 2JFGA 4WVFA 4IWNA 2X5KO 4D82A 1QOQB 1JSCA 5A62A 4HAOA 1T5HX 3PXXA 4RK6A 1Q2UA 2W93A 4LXQA 1VRWA 5HM8A 3OT1B 4DYVA 1IUOA 5BOSB 4A3SA 1QHEA 4JBLA 4QOSA 1MO4A 2IEGA 2F62A 4YJHB 4CU5A 4DIBA 1FXUA 3P0RA 2BFEA 2I6FA 1GPYA 2KLHA 3A8TA 3MOGA 4FB5A 1YL5A 4B3HA 3Q0EA 2WILA 3L8MA 3RTCA 2N3ZA 3F3MA 4BKOA 2FLWA 2I8LA 2QQEA 4TPKA 3WVNA 4ALJA 3UJNA 1QSGA 2FZWA 3VTFA 1FUIA 4M0CA 1PGNA 3EAQA 4AZSA 2IY7A 3I04M 4LQCA 1YGPA 5DSXA 2VTBB 3ANTA 5A4JA 3QUAA 3OZEA 1I36A 1YNOA 4MH0R 4P4LA 4AJ4A 4CLHA 3Q3VA 4HP8A 4L5YA 3RGGA 1U3GA 1LJ8A 1OFIA 2O3RA 3H1GA 3T7RA 5BVGB 2FJPA 4QBIA 4NOKA 3I0MA 2UYYA 5HUQA 2OB2A 1W0KA 2JJYA 3U7QA 2IKSA 3COYA 2R48A 4HWKA 3N2IA 1V4NA 5K3FB 2V0CA 3L1KA 2Z3WA 1MD9A 3HRHA 1JH8A 4EVRA 2NQ2C 2B37A 2QLTA 4TQAA 4UJ5A 1NHWA 3CVXA 3FTCA 1R4NA 2VAPA 3KJNA