4NBUA

Crystal structure of fabg from bacillus sp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
242
Chain Sequence
SRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Biochemical and Structural Studies of NADH-Dependent FabG Used To Increase the Bacterial Production of Fatty Acids under Anaerobic Conditions.
pubmed doi rcsb
source organism Bacillus sp. sg-1
total genus 96
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nbuA00
1Q0QA 3GH3A 3H9QA 4MINA 4ZHSA 2CUKA 1ISIA 3UKOA 1C14A 3V5NA 1E3JA 3ENKA 1IY8A 3BXXA 2BFMA 3NGLA 1SB9A 4HP8A 3IC5A 2VYNA 1NBOA 4FPXA 4CR7A 1NWCA 2GN4A 2NWQA 1GCUA 1VKOA 3OEYA 1KYQA 3DZJA 4UULA 4KTVE 1CYDA 3H6KA 4J0EA 4YCAA 3UH1A 1TEHA 4J91A 4RORA 4EDFA 1FJHA 2JCVA 4R54A 1VSVA 1R4MB 1YKFA 1EFLA 5DOVA 3ITKA 1G0OA 2IXAA 2P2SA 4TZTA 2C20A 4BMNA 2O3JA 1I2CA 1YVEI 2GN9A 4QO8A 4TVBA 3CUKA 4N5LA 4IDCA 1FF9A 5F3RA 1PR3A 5EIOA 3UF0A 4Z3KA 1YDWA 1PJSA 2YHIA 3IS3A 5IF3A 1QG6A 2ZJ0A 4IJVA 1R12A 2I66A 1ULUA 2IEDA 4BNLA 1P45A 3DXFA 1OOEA 1DPGA 3PTZA 3FPLA 3ZHBA 4L75A 1Y8QA 4IXTA 3E8XA 3PLRA 4B3IA 4W6ZA 4DA9A 2IRWA 3OJEA 3WSVA 4LK3A 3WSWA 3UW3A 1U5AA 1KVSA 2R00A 2EG9A 3HFGA 4OIMA 4BV8A 3K73O 3EYWA 4ZQHA 1YBMA 4TRJA 2PWZA 5CG1A 1DIBA 5HBRA 2FHSA 5COQA 2P9EA 1J4AA 3H5RA 5JC8A 4DIOA 3TZCA 3CMCO 1LSSA 4F45A 1MX3A 3MTJA 2HJRA 4J7UA 1Y9EA 3TZ6A 4U8GA 1Q2XA 4NBTA 1GZ3A 1LLDA 1H94A 1LTHR 1OMOA 3TJRA 3MJEA 2VWQA 1VL6A 2NU7A 4A73A 4E21A 4JBIA 4PZCA 5AXCA 1XU9A 1XCBA 4RF2A 1FDTA 1O8CA 4ZJUA 1YB1A 3EUWA 2X9GA 1M76A 3PHJA 3NDRA 1G6KA 1GY8A 5LC1A 3ANNA 3VKUA 1VJ0A 1MLDA 3NV9A 3LYLA 1CJCA 4J0FA 1UZMA 3Q2IA 4HWKA 4IQ8A 1XQ6A 3NTOA 3RC9A 2PGJA 3X2EA 2BRUA 4PZEA 1WZIA 1YB4A 3MJ4A 3P2YA 1DEHA 3ZNPA 2CVZA 3AUUA 1PGJA 3GMSA 3MJTA 3R0IA 4TMFA 4E2ZA 4YAIA 1SMKA 4JROA 3RQSA 3GVPA 3KEQA 3PHLA 1Q1NA 4B8ZA 5JXWA 2I9PA 1IZ0A 1I36A 3VH3A 2W2KB 2C54A 4ZQFA 2OL4A 3INRA 1D1SA 1LDMA 4ZVVA 3EZYA 3GNTA 3WGHA 1MP0A 5H82A 2X1HA 3WLFA 5A3JA 4W82A 2V6MA 3DBLB 3OJLA 2VT2A 2XAAA 1HLDA 4F6CA 2CSUA 3DOJA 5CAEA 1HYEA 4BO4A 1H6AA 1R6DA 3WNQA 3PEFA 1YXMA 2XXJA 4XYLA 4UVEA 5A3VA 2VRCA 2VZ8A 3PQEA 3GAFA 3TWOA 4PG8A 2YY7A 4B4UA 3WJ7A 1N5DA 4CMBA 1PSDA 2EJWA 3MZ0A 1P1KA 1FDSA 4GSLA 5A04A 1DIGA 4OQYA 5K0ZA 3HN2A 3OICA 1EE2A 1NXQA 4PLTA 2POQX 1BXGA 3EMKA 2H63A 1E1NA 4DYVA 3KRTA 4CQMA 4EJ0A 2Z1NA 2C5AA 4DIFA 1A4IA 4CODB 1Z74A 5T8KA 1HDCA 1M6WA 1WDLA 1PZHA 2XOXA 3ONFA 3OBBA 1PZGA 4GMFA 5A05A 2C2YA 4M55A 3W4KA 5A5EA 4JIGA 4QT0A 3K9QO 1SZJG 4NJMB 2WTBA 4EUHA 4DLBA 4R9SA 5AQ1A 1V9LA 2IYPA 3KSZO 1GPDG 5F1PA 3RKRA 3AY7A 1LI4A 2OO5A 3U4IA 4B7XA 1P1HA 4YB8A 1I3KA 2DBVO 2ZB4A 3AUAA 1RYEA 2O3TA 4WKGA 1ZFNA 1XDWA 1BVUA 3DAGA 1QYVA 2PGLA 3JYPA 4YAEA 5BR7A 2NVUA 1FDVA 1KY5A 1F0YA 1I32A 4E6PA 4CMKA 1P1JA 3KSUA 2HLPA 1NFRA 3PJDA 3UCEA 1DHTA 4Z3DA 1JQBA 3OF2A 1ONNA 1BW9B 5JPIA 1T1RA 2PA3A 4H7PA 3ST7A 1C3VA 2J3HA 4BO7A 1DC5A 3H65A 4A7PA 2EHDA 4E5MA 2UUOA 3DZKA 2NU9A 3UAGA 3A4VA 3AI2A 3L4BC 3KO8A 4NBRA 4E5NA 5I8ZA 1HYGA 1Y9AA 3I6IA 2X0NA 2B35A 1ISFA 2PNFA 3KM0A 3OEWA 5GY7A 4BO0A 4MP8A 1BRMA 3NJ8A 3PPIA 4AJHA 4IJWA 5I9NA 4Z9XA 1NPTO 1OAAA 3QE3A 3WR5A 1U2DA 2WWRA 4TSKA 4PG7A 5BSHA 1X1EA 2JJYA 4LGVA 5G0VA 2AG5A 1W6UA 1YOVA 3DAFA 3PGXA 1ZNQO 4CV0A 4CQLA 1LDNA 3BHIA 3IP1A 4WLNA 3AW9A 4ZQGA 3PLNA 4DLLA 3AM5A 1O95A 1U3TA 1FXSA 2ZJ1A 2DTDA 3ZU5A 4Y6PA 1Z82A 4O1MA 1ZBQA 4IQGA 1A7KA 4UVIA 4BUCA 3F3SA 3KYCB 1IUKA 1XIVA 1JVBA 2D8AA 3TNLA 3OSUA 2E6UX 4YQYA 1B3RA 4O63O 2VUSA 2ZCUA 4XRGA 5L7YA 3K31A 4F6LA 4NG5A 3VC7A 1GQYA 4WLFA 3F4LA 5CPBA 5JAQA 2J8ZA 2Y1EA 3JQAD 1XHLA 2VYND 1ADFA 1V3VA 2NTVA 1HDXA 3FWNA 3FTPA 2YZ7A 3KVOA 3RFTA 4AJ4A 1KEUA 4Z0TA 3H9GA 1JDJA 4CMHA 1DSSG 3VTFA 1E6UA 4IGEA 1ZJZA 2X9VA 3ZH2A 1U1IA 4WCFA 3NGXA 3ZU3A 4DBVO 4NFSA 3GFGA 4NU6A 4RF3A 1KVTA 4LN1A 3I52A 2PZKA 1R0LA 2RH4A 3UGKA 4D3SA 1HZJA 5DP2A 3QVWA 3W6UA 2PLAA 2JD1A 1H6BA 1PTJA 1VSUA 2YHIB 3D3WB 3WB9A 1E7RA 2BGMA 4BL5A 4M1QA 4YT5A 3QWAA 4YACA 4GGPA 2EEZA 2VRBA 1M67A 1EUCA 5AOVA 4R68A 4DWVA 3WTBA 3U5TA 4K28A 2IXBA 4PLFA 2HAEA 4ND2A 3S1LA 4IGFA 1Y8QB 1Q0LA 4P4LA 4E2YA 4E4YA 1QSGA 3K8ZA 3HQ4O 3IMFA 1M75A 4ID9A 1MGOA 1NPYA 4M8SA 1NNUA 1IB6A 2VUTA 1U4OA 1PWXA 3DTTA 4MVJP 4Q3DA 5KJ6A 3LVFO 2W2LA 4EJMA 4CM9A 1ZEMA 1KC3A 1QKIA 3D4PA 3F4BA 3GMDA 5EINA 3WGTA 5JC1A 1QV7A 1PL6A 3EK2A 3BTSA 3GDGA 3L4SO 3GA0A 1MB4A 3OA0A 1NVTA 4D0RA 5CEJA 4ZQBA 3VPFA 1T2CA 2I99A 4J90A 4YAKA 3L77A 2NQ8A 5DBIA 3KOUA 3ZWPA 1U9JA 4MIEA 3ICCA 4E32A 1MFPA 4OSOA 4XIJA 2CDCA 1CQJA 5DZSA 4CUZA 3UOGA 4DIBA 4BHTA 1NR7A 4MVJI 1YL6A 5IJZA 3QY9A 5A9SA 4RPLA 5AXBA 3TQHA 1PS0A 1YE3A 5T6BA 4N5NA 4GQAA 3A28A 3QRWA 3DEYX 1PZFA 4ND5A 2X22A 2CZCA 5MGBA 3NEPX 4XD2A 1E7WA 2ZB7A 4UUMA 4NQZA 3JD1A 4FGSA 1T4BA 4TKMA 4YJFB 4D43A 2BI7A 3H5AA 2AEJA 1YL5A 3DQPA 3JSAA 3M2TA 2HMTA 4MP3A 4Y6RA 5HA5A 4BNZA 4DTIA 1UXHA 1QP8A 4K9DA 3Q9NA 2VN8A 1R4NB 3RUIA 4JJGA 2FY8A 3CZMA 2Q49A 3PYLA 3FD8A 3GG9A 3GQVA 1E1LA 1DFHA 5CFZA 3KYDB 3E5RA 4XJSA 2RAFA 1BSVA 3DL2A 1Y8RA 3RUEA 3JYNA 2Q2WA 2PKRA 3H3FA 4K6FA 5CEFA 4PG4A 4FBGA 1LA2A 4I5EA 3KV3O 3ZU4A 4QFDA 4P4NA 3ZHZA 4FGWA 4I5DA 1HETA 2GR9A 1EDZA 1UZLA 3WDSA 2BELA 2CF5A 3PDJA 3WYCA 3FSRA 5JLAA 4PLPA 1C1XA 4K6CA 2FP4A 5KTKA 2HJSA 4F46A 4MIYA 4PN3A 2GUGA 3DHEA 2ZYAA 4JQCA 1BXGB 1KBZA 4R16A 3RASA 3Q6IA 4I5GA 4RGBA 4CQMD 4RLSA 1V8BA 2EKLA 1P1IA 1DC4A 3VZQA 1C0IA 4J9VA 4BNWA 1W8DA 3BTVA 4CJXA 1ZUD1 3KSDO 1ORRA 4N7RA 4YT2A 1FMCA 5T64A 3GHYA 3H2ZA 1ZK3A 3PRJA 2DTEA 3U09A 1QR6A 1E1MA 3HB4X 4P38A 4TVOA 3SBOA 1VM6A 4NBUA 1CIVA 2G5CA 1BTOA 1ADBA 4TRRA 2O4UX 3L6OO 4YRAA 4IUYA 3GNQA 4OXNA 1SEVA 4IPTA 5ITWA 1TXGA 1EDOA 3RUCA 2VZ9A 1XU7A 3VZPA 1K3TA 2NSDA 1I33A 2JL1A 2HO5A 3ROPA 1Y7TA 5IAAA 3C1OA 4PFJA 4FSHA 1B15A 4JN6B 4U0JA 4XCVA 3MTGA 1LRJA 4BNXA 4OOEA 4CM8A 4DL9A 2I3AA 2HK8A 4XR9A 4FJ0A 1SPXA 1E3IA 1Z7EA 5ICMA 1T2FA 4J4TA 4PRLA 3WGOA 4J4BA 3E03A 3GEDA 3BMOA 1T2EA 3OJOA 2P5UA 1DOHA 3AUSA 2X5OA 3FNHA 3WMWA 4E5KA 3TF5A 1FK8A 1J6UA 3JD0A 2ZYDA 1S7CA 1QRRA 3OJ0A 4JJFA 3O38A 3GZNA 5IG2A 2ZQZA 3PWZA 2E4AA 2ZK7A 4L73A 4RDIA 4BO5A 2ZCVA 1JN0A 2FOIA 2FR8A 3R3SA 4OM8A 4YAGA 5L4SA 2BLLA 3VPHA 3DWFA 2ZTMA 2VHXA 3IJRA 4NI5A 2B5VA 3C1TA 4R3NA 3WXBA 4CMIB 2H6EA 3I5MA 1ZKMA 3EDMA 5JDCC 1U4SA 2GERA 3VAZA 4EYEA 2BFPA 4LRSB 1JWAB 5GZ6A 4CM4A 1PL8A 2Y66A 2WD7B 4J43A 2CDBA 4RF5A 3OM9A 5TIIA 1HDZA 1X7DA 3AM4A 4RPJA 3FCOA 2EWMA 3BTOA 1KY4A 3VVBA 4ESOA 4CMAA 4BKOA 4I9NA 2VZ0A 4UUPA 4WPGA 2ZTLA 1JW9B 1A72A 1GR0A 3QWBA 1N9GB 5CDSA 2XPCA 1P3DA 5A06A 2GNAA 2Q4EA 2VTDA 5IN4A 4KOAA 3N58A 1OFGA 1BWSA 5IDXA 5COBA 1U5CA 3MEQA 4L9RA 2G0TA 5HM8A 1T25A 5I7SA 2FZWA 1X1TA 3HDYA 2JD0A 3WS7A 3I9JA 2G17A 3FNEA 4UAGA 5IFLA 4BGIA 4YPOA 2Z1MA 4YT8A 3C8MA 1O9BA 1WP4A 3CKYA 4WGGA 1L7DA 4NMHA 5JO0A 1UXIA 1HZZA 3EC7A 3HDHA 3SC4A 1SAYA 3EY4A 3NTRA 3VTZA 4EBFA 2RH8A 4HFJA 1U7TA 2CY0A 3OIGA 3VDRA 3E1KA 5G0UA 2GF2A 5KIAA 3Q9UA 1AXEA 1HDOA 3MWEB 4RV9A 1ML3A 1RWBA 2Y0CA 2IYOA 3C85A 3ZZNA 4L4XA 4YJDA 1WAMA 2D5CA 1T26A 2OMEA 2CD9A 2CVQA 2TMGA 4I9UA 2Y05A 1F12A 4PLWA 3UFXA 3ZV6A 4HNGA 4KDEA 4CM6A 4DC1A 1JAYA 2GASA 1MXHA 4OMUA 3OIDA 3LLVA 2DVMA 1EEHA 2W2LD 3PI7A 1Z75A 3GN2A 1KEWA 1VI2A 4QTZA 5CHEA 3NDJA 4GLOA 4CLOA 3E48A 3IP3A 3PJEA 4HY3A 1JKIA 3DBHA 3E5MA 3DZIA 4IINA 3UCFA 4FC6A 3U4DA 2HUNA 4O0LA 4Q3EA 3JD3A 4FFNA 4ROSA 4DREA 3QJ5A 3OA2A 4YXFA 3DTYA 3B6ZA 4DC0A 2RIRA 2V6FA 3ZWAA 4BNFA 2GGSA 3VKVA 3O9ZA 4G81A 3BMCA 3GUCA 5JAMA 1ZMOA 5ICSA 5CEEA 4BQRA 1LU9A 3JQAA 3AJRA 4M87A 5TS3A 1O94A 1E77A 1GUFA 3VZSA 2X86A 2ILTA 2OORA 2ZB8A 4XZ3A 1UDBA 1H93A 1P31A 4CMEC 3ZW8A 5CPFA 3WOHA 1PJ4A 5T57A 5C7LO 4YJHA 4N18A 4XJTA 5FI3A 1XEAA 3A9WA 4J49A 1X13A 4J3FA 4BV9A 5BNTA 2DUWA 4IBOA 2Y0DA 3PGJA 4Z9YA 2BFAA 1PGPA 2I67A 2Y0EA 3LU1A 3CSDA 3H3JA 4J4HA 1AGNA 3Q2KA 4BMSA 4QECA 3SJ7A 3V2HA 1LSUA 4FS3A 1AHHA 2DLDA 2YDYA 5IXYA 1K6JA 4MVJH 3L4BA 3K2EA 4LSMA 3NT5A 1A71A 1PGOA 1HRDA 3HFSA 3O8QA 4GMGA 4QO7A 4XB1A 4ALNA 3BMNB 4RVUA 1EVZA 1NR1A 3TPCA 5G4LA 4BS9A 1EK6A 1KVRA 1PWZA 3H5NA 2F1KA 4KUGA 1N2SA 1KEPA 2NTJA 3RJ9A 4EUFA 4BNMA 4CM1A 3RBZA 1HEUA 4Y6SA 1UAGA 4NNJA 2O23A 4RL6A 3CTMA 1GUYA 1I0ZA 2W8ZA 3VDQA 1NYTA 1H2BA 1C1XB 1JKFA 5DOZA 5BSGA 4CR8A 2VHWA 4B79A 1K6XA 2DKNA 4KQWA 2GRAA 4R1SA 2AQIA 1P1FA 3RU9A 3GDOA 3DR3A 1DFGA 4QFCA 5CDGA 2DFVA 1E3EA 4DQVA 4IZHA 2HCTA 2WDZA 4BQPA 3UVEA 5TF4A 3UCXA 3DZHA 4R51A 3ZWOA 1E3WB 2FRDA 1X0VA 3I23A 2X23A 3C24A 4DQXA 4EUEA 3Q11A 4WASA 3T4EA 3TZQA 2YQ4A 2QRKA 4XA8A 2CF6A 4XQEA 2QQ5A 4Q3AA 1ZJYA 2ZB3A 3F1KA 5I7VA 2EXXA 1E6WA 2UDPA 2P4HX 4KQXA 2JFFA 5L4NA 5L51A 5L95A 4N54A 3FRJA 3ASUA 3EW7A 2OUIA 1PGQA 1I8TA 2I3GA 2GZ1A 4PVDA 5FF9A 4ALKA 1IZ9A 1EK5A 2V7PA 1Z7BA 2Y99A 4BKQA 2X0JA 4GL4A 4X54A 3L9WA 3FNFA 3FN4A 3U3XA 1C1DB 4FFLA 4LMRA 2EV9A 3GVCA 1JAXA 4U6QA 3WICA 4E12A 3O03A 3F5QA 3JQ9A 3D64A 2BHLA 4N5MA 1YO6A 2UUPA 3WNVA 4BKUA 3PJFA 1LQTA 3A14A 2C2XA 3N7UA 4PGFA 2PKQO 4DLAA 1HXHA 3EVNA 3AY6A 4R9RA 4QX6A 3GT0A 4PLYA 3MJCA 4Q3NA 4FD3A 5F1OA 3PDUA 3RJ5A 1T4DA 4AVYA 2VNSA 1B8VA 1TA4A 1X14A 3IAHA 4KP7A 3X2FA 2X0RA 4W7HA 2B37A 1VJ1A 4PLVA 3RSHA 1ID1A 1DDOA 5KVCA 5KVVA 2OOSA 3GZNB 4RQTA 3AUTA 4RVFA 1VJTA 1HLPA 2EP5A 3AI3A 4PIVA 1VL8A 1QLJA 2C7GA 3BMQB 3RVDA 2Q50A 4HV4A 2YQ5A 4WLOA 1GL3A 1E1KA 3LK7A 4MJLA 2X7HA 5LDGA 5KNLA 4MVJF 1HSZA 3TZHA 1HTBA 3INTA 2VWPA 1W73A 2B69A 1O6ZA 3G3EA 3ZWCA 5IZCC 3ZWXA 4R41A 2GSDA 4AJNA 2PV7A 2EJVA 5A1TA 3QWHA 2OGUA 5TSDA 4DMMA 2PGDA 3H2SA 4J2HA 3TN7A 3R1IA 4DBZA 4CM4B 1ZIDA 3IJPA 1TVEA 1ZK4A 1ZSYA 2Q45A 3H7AA 2O3RA 4BB5A 4HFMA 3AWDA 4XGNA 4BKRA 1W0CA 3PIIA 2R6JA 3MCVA 4FJ1A 2JCXA 1QORA 3PXXA 4UVDA 3WGYA 2HQ1A 1PZEA 2BI8A 3ZWYA 1I24A 5G4KB 2HMVA 1PQUA 3OQBA 4UREA 2QX7A 4KMSA 4I08A 1HDGO 4BO8A 1UDCA 3JQ8A 1GD1O 1AN9A 2I65A 3W4JA 4ZQEA 2EF1A 1LC0A 3NDIA 3AU8A 4AJ1A 1WPQA 2DUUA 5ER9A 1EFKA 2B36A 3OQ6A 3BTUA 4IDFA 4PCVA 3PK0A 2VNAA 3IDSA 5B37A 5ILGA 3ZGYA 1ZXLA 2PH3A 4IJKA 4UUOA 1C0KA 4E31A 3GRKA 2H5LA 1JLLA 4TROA 1D4FA 1VPDA 2O2SA 2JCYA 2C07A 5L40A 4J1TA 1EQUA 3O26A 2VHYA 3V2GA 1TB4A 3PFWO 4BIIA 4RJTA 3H9EO 2AE2A 3HHPA 2SCUA 2PTGA 3JQ7A 4ND3A 1QXSA 5F5NA 3FI9A 1U3WA 7ADHA 4J7CA 1EVIA 2LDBA 3ZNNA 4CUJA 3IKVA 3KLPX 4D44A 3UICA 1JWBB 3A06A 4FC7A 4YT4A 1NPDA 1SEPA 2B4TO 1D8AA 3CEAA 1P44A 3OIFA 4WOKA 3B1JA 2VWHA 4K26A 4M54A 4MO2A 4W9NC 3SX2A 4YWJA 1DHRA 1GAEO 2WE7A 4UVGA 4CMGA 3TSCA 4FB5A 4CLOB 1UXGA 1Z73A 3E9QA 3S2EA 1Y81A 3LT0A 1B3BA 2DPGA 3MOGA 5EERA 1WDMA 2X58A 3Q3CA 1H9BA 4IJUA 3D1LA 4NFYA 2NUAA 4S1VA 4IDDA 2DBQA 3V1YA 3OFSA 3L6EA 4CLDA 2QIOA 4IMPA 4GX2A 1VL0A 2QW8A 1KIFA 5B4VA 2IE0A 1B14A 1LJ8A 4L0QA 3JQAB 3K6JA 2UYYA 1AE1A 1HT0A 2G76A 4WLUA 2GCGA 3DMTC 1UH5A 3QIVA 4QQRA 4BNGA 5MDHA 1EZ4A 4OHUA 1G0NA 3W4IA 2DBRA 2FPPA 4QEDA 3QWFA 3GNSA 3GOHA 4TQGA 4Z9FA 3RUAA 2VOEA 3WIDA 3ZU2A 1J0XO 1XA0A 3WWZA 4Q39A 5L4LA 4OJNA 4PLZA 4JBGA 3V2UA 2VYVA 3S55A 3VPSA 1QYCA 1KETA 3WGZA 4H15A 4AFNA 3EAGA 3QA9A 4GAEA 1RM3A 3IQDB 3UN1A 1DB3A 1OC2A 3CIFA 3NT4A 3G79A 4NFHA 4E33A 1LRLA 1DRVA 1U2GA 2OZPA 3QVOA 4RZHA 4E30A 3C7AA 4G5HA 2VOJA 3O8QB 3WFJA 3F6YA 3DFUA 2BGKA 1V3UA 2DM6A 4NHEA 4AL4A 3RKUA 4Q3CA 1DC6A 2HK7A 4CMCA 4QSMA 3FBGA 5BQFA 4FCCA 3NT2A 3JQGA 3MWDB 1U3UA 4YJGA 1U3VA 1DRUA 2FWMX 2ZYGA 4KDFA 7MDHA 5ILOA 3W8FA 3IIEA 3LT4A 5I7FA 3D4NA 2FZEA 4RQUA 5JAZA 1SC6A 3ONEA 2D1YA 5IXSA 5JDCA 1TT5A 1YQDA 3ANLA 4GX0A 5H83A 3P7MA 3VPXA 1V6AA 2AEFA 1E3SA 3KUXA 4LSWA 4R4JA 5KJEA 2QZZA 4BNTA 3DO5A 2V6GA 3QQPA 2D3TA 3BHMA 5AVOA 3VZRA 4BGUA 3K30A 1N1GA 4GPD1 2P5YA 4HKTA 3B70A 2XXBA 4DPLA 4B7UA 1XR3A 1KS9A 3QP9A 5DULA 1C0LA 1HL3A 2A35A 5LCXA 3ASVA 5U1PA 3LT1A 2ET6A 1QV6A 2X5KO 4GH5A 4O59O 1P74A 1Y5RA 3DBRA 5KJ1A 2NLOA 3C1AA 1YJQA 3WQQA 1MUUA 4KWIA 2YDXA 5JNLA 3LQFA 4E2WA 5EQFA 3W1VA 1NP3A 2HU2A 4RDHA 1ZK2A 3B1FA 4UUNA 3Q1LA 1NVMB 2Z95A 2HDHA 1O5IA 2CNBA 2O2YA 2C5EA 1T1SA 3N74A 3PYXA 1DIRA 4RPGA 1EBFA 2VUUA 4U7WA 1XWFA 3E82A 4GSKA 4ONEA 1DO8A 1UP4A 2OHXA 1DJNA 4RLHA 1LUAA 3PVZA 1IHXA 5KVQA 4INAA 2P9CA 5F5LA 1R4MA 2DFDA 1EBUA 4O5OA 4ND1A 5G0SA 2HKIA 2FPGA 4RVDA 4GLLA 1Z45A 5BSEA 1I01A 2AA3A 4Z0HO 1GV1A 4EEXA 2RBEA 1RPNA 2EERA 1IHYA 3WX0A 2UAGA 1LEHA 3GHHA 4YBZA 4W99A 1KC1A 1V3TA 2WYVA 4FW8A 3I9MA 3TDKA 1U7HA 5FEUA 1HE2A 1M66A 2WD8A 2CDAA 4J1QA 4R3WA 3DHNA 4LCEA 4PZDA 3ZWWA 4J16A 4A0SA 1C0PA 3AI1A 4XWYA 3QW2A 5TLSA 1FDWA 4MVJE 1IE3A 3M6IA 2HRBA 4IS3A 4OO3A 1T2AA 1YONA 3S8MA 2BH9A 5DT9A 4Z0PA 4OXKA 1LDBA 3ZWMA 4ALLA 4EZBA 4CQMB 3PIDA 4B3HA 2IEBA 2P68A 4B4WA 3INGA 1E7QA 1UJMA 3ZDFA 5CDUA 3QSGA 3CXRA 3ROMA 3FBTA 3K5PA 4NZ9A 4CV3A 5HS6A 1IOLA 4YR9A 2E49A 3M1LA 2EW8A 2QRLA 2PD6A 5TNXA 1PJQA 4G2NA 5B12A 2PD3A 2VTEA 1NAHA 1WDKA 4B8WA 2DBZA 4YRBA 4DMLA 2JAHA 4XYEA 5IDYA 1LRKA 2FR1A 5JE8A 4L8VA 2BGLA 2NVUB 1E7SA 2IZZA 4QUKA 2BMAA 3AU9A 3CMMA 5C7OO 5JY1A 3U4CA 3GLQA 1I3MA 1O0SA 3QWIA 4BNKA 1PEDA 4P8RA 1A9YA 3U0BA 5GZ3A 3ZNOA 1UXJA 2Q1UA 4IIVA 2J3JA 3DFZA 4JP3A 2QYSA 4M49A 4RO0A 4LCJA 3GG2A 1RM4A 3HSKA 3VH2A 5GMOA 1LDYA 4GWKA 4GKVA 4RPKA 1WNTA 1RKXA 1BMDA 2V6BA 1O89A 2YV1A 4I9HA 4DXHA 3ADOA 1H9AA 4BGEA 4IM7A 1NQTA 3PJGA 1GYPA 1K2WA 2HSDA 3HN7A 4KWHA 3NX4A 4G65A 2ZIZA 4FR5A 4WLEA 1CQIA 1SBYA 2AHRA 3JQFC 1DRWA 3DBLA 3GZ4A 5DN9A 5B4UA 3VH4A 4JP2A 4J2OA 5I8WA 2UVDA 4WJZA 1JVSA 1YOVB 2HMUA 3IUPA 2DC1A 4CQLB 4AJIA 2X8LA 5B4TA 2GZ3A 1ISHA 4WOJA 5JS6A 5KWEA 2VWGA 5A9RA 2EGGA 2Q2QA 5JDIC 4AJLA 4Z6KA 1DAOA 1BVRA 2A9FA 3GPIA 4CMJA 1ISMA 3E9NA 3WYEA 1B2LA 3NJ4A 1F06A 4NK4A 5JCJA 4ILKA 4JJIA 4AJ2A 3FR8A 3EGOA 2O7QA 3S2FA 4XYBA 1PIWA 1Q7BA 1GZ6A 3GGGA 4FDAA 1AXGA 5JBIA 5DF1A 1BHSA 2EGHA 3AK4A 4FFRA 1GEGA 2PK3A 2FPIA 1ENPA 1HF3A 3HG7A 1LBEA 1ZZEA 3LC1O 5COAA 4HXYA 2YJZA 1M6HA 3OECA 4L74A 3S2GA 4PVCA 3TOZA 1LC3A 2X6TA 4WCFB 1PS9A 5KJFA 3U9LA 5K6AC 1IYZA 3CPSA 3F46A 3PQFA 2VYVD 1HDRA 2ZTUA 4RVGA 2P91A 1DC3A 3RROA 4YTEA 4ALMA 4L4RA 5JCXA 3FF4A 5HS4A 1R0SA 3LC2O 4CPDA 4ZN6A 3V8BA 3LSYA 1A5ZA 1WWKA 2D4AA 1PGNA 1QLHA 1IULA 1GADO 3WG9A 3D5QA 2GN6A 2HRZA 1BW9A 3T7CA 3L9XA 3FR7A 3WGIA 5EJ2A 4BB6A 1ENYA 1P9LA 2GDZA 3ZV5A 4H16A 2D0IA 3E6AA 2OXIA 3ZV3A 3ENNA 3HNPA 5BT9A 2AXQA 1LLCA 1MC4A 1GV0A 1WZEA 4A03A 2E48A 1VRWA 5L9AA 1K89A 4RZIA 4CLEA 1B8PA 5BSFA 3UUWA 3SJUA 5DNAA 4JNKA 4NR0A 2PZJA 4DGSA 2YUTA 1Q7CA 2PD4A 3UHAA 4GVLA 3L0DA 4BMVA 3ONDA 1LQUA 4R5MA 4CM3A 1I10A 5T5QA 4GX5A 5IZCA 2QRJA 3TFQA 2A92A 4AJEA 4A27A 3D7LA 3GPDG 1UDAA 2A94A 1CRWG 3I83A 4BNVA 3ROQA 3GR6A 1NVGA 5JMWA 4ZD6A 1VKNA 4GKBA 3SLKA 4FIZA 1A9ZA 2F00A 6ADHA 3OMLA 5JSFA 4OAQA 3WIEA 1SNYA 4B3JA 1PL7A 5JW6A 1Q0HA 4JLWA 1A4UA 1WVGA 3GVIA 4WLVA 4PG6A 3ZWBA 5A9SB 2CFCA 3DC2A 1X15A 4UVHA 6LDHA 2JD2A 2AE1A 2G82A 4B7CA 2PR2A 4C7KA 3IL2A 4WK6A 3AOEC 4OH1A 2PFGA 1E7YA 1DAPA 1ZK0A 3RC7A 1CDOA 1BDBA 4OKIA 3OQ1A 3JQEA 4NPCA 2W90A 1U8FO 3H8VA 2FN7A 3D5TA 1GTMA 4I5FA 3RBXA 5EPOA 3RWBA 3FWZA 1XQ1A 4KUHA 4M89A 3SVTA 4NK5A 1P0CA 2WEKA 2X5JO 3HDQA 2QZ9A 3U49A 4E3ZA 1SOVA 4C4OA 5J23A 4B4VA 5TX7A 1XGKA 3DZGA 2Q1SA 4ZGWA 2H9IA 3PQDA 2E82A 1I3LA 2B5WA 2C7VA 2YFHA 4RCVA 5DBGA 1GFSA 2R2GA 1M2WA 1ZSNA 2YW9A 4BO3A 3ETDA 1D3AA 5ES3A 4XR4A 1Y8RB 5DP1A 3KLMX 4XRRA 5IDQA 1LLQA 1PX0A 1T2DA 5THKA 2ZKLA 1DJQA 4BNHA 2FR0A 1AUPA 2X9NA 3GFBA 3D3WA 1ISJA 4HADA 4R1TA 2DQ4A 1IPEA 3GEMA 4E5YA 3K96A 2DPHA 4ZRMA 3STHA 5CP8A 4W9NA 3MOIA 3JQCA 1SO8A 1K5HA 3D3EA 1ULSA 3GF4A 4D3FA 4I8XA 4GVXA 3GVXA 4BVAA 3ETGA 4II2A 2WSBA 4FFMA 1B26A 1U28A 4LVUA 1EQ2A 1YDEA 1UAYA 3F9IA 4MIOA 2OBNA 3GN1A 1NWHA 4BO6A 5TT1A 3AOGA 4XDZA 1MG0A 3I3OA 4P4GA 4BNNA 4W7IA 3RFXA 5L53A 5AYVA 4I1IA 2VCYA 3JYLA 3LF1A 4PLCA 4HX5A 5L3ZA 4CR6A 2NV6A 3HADA 3DMTA 3K92A 2BD0A 1B7GO 1BGVA 5FYDA 5GZ1A 3IUSA 3RD5A 3U62A 1YJ8A 3B1KA 3I9NA 2TMDA 1N7HA 3JYOA 4WNCA 1IL0A 4XYGA 1JA9A 4IIUA 1E3LA 4ND4A 3PHHA 2GYYA 5U9CA 1XSEA 3C7DB 1PJLA 3BHJA 4DQUA 4EEZA 4CM8B 2WE8A 4HUJA 4IQ0A 3PP8A 2GN8A 2JFGA 3A1NA 4AJPA 1F17A 2FSVA 2Y68A 4YJFA 3LF2A 5EESA 1U8XX 3WLEA 2PKQP 1LX6A 4CLRA 3GY0A 3I1JA 3LLSA 2AG8A 3WQSB 2NADA 5KKAA 5JMPA 5I9MA 1CF2O 3C3XA 4GWGA 3BMOB 1DXYA 3JQBC 3KEOA 5TC4A 2RHRA 3VVCA 2ZTVA 1R4NA 4RVSA 2Y1CA 4AJKA 1L7EA 1EUZA 4R1NA 5ENVA 3KYDA 3BA1A 1Z6ZA 3D0OA 2PH5A 4BO9A 4CUKA 2Q1WA 2QYTA 4MP6A 4BKPA 3TL2A 1PR9A 2Y93A 1BG6A 5JAIA 1L1FA 3ZI0A 2GD1O 4IZIA 5DCUA 3ETEA 1NQAO 4TWRA 1MXFA 1AHIA 1CEQA 1P0FA 1SCUA 1Y1PA 5FFFA 3MJVA 1KVQA 1WMBA 4AG3A 4WUVA 3TRIA 4HNHA 5JO9A 4XGIA 4DPKA 3PFFA 2YHUA 4JGBA 4P22A 5JCJD 1UZNA 4OOFA 5EMHA 1RM5A 4AJJA 1UXKA 2D59A 5KOIA 2IZ1A 2IODA 3OHSX 4EITA 1J5PA 3HWRA 2HMSA 2AQHA 4WCDA 2OBYA 1ZMTA 3P19A 4YVFA 2WYUA 2NACA 3IKTA 5C3MA 4NIMA 3GGPA 1PQWA 3KZVA 2QHXA 3OETA 1Y6JA 5JYEA 5B1YA 1NASA 1TI7A 5EL0A 4J1NA 3P5SA 2JHGA 1F14A 4XIYA 4U6SA 3SXPA 1VC2A 2PZMA 1LSOA 3DMYA 3RC1A 3OP4A 4Y98A 3ZHXA 4FQ8A 2DT5A 1W4ZA 4EI2A 4EW6A 5TJ9A 2VHZA 1GZ4A 4BOYA 2DTXA 3RU7A 4CL3A 4D0SA 3BZUA 3HZZA 1PU2A 1K0UA 1LXCA 3QVTA 4XQGA 3NAQA 3W8EA 3G1UA 2PY6A 4IY1A 1GYQA 2GZ2A 3CE6A 5EQDA 1ZEJA 1EVYA 4DUPA 1YWGO 3WFIA 3CH6A 3AM3A 2D2IA 5TT0A 3L07A 3QLJA 4MVJG 2IZ0A 2NM0A 1JTVA 2Q2VA 4MVJD 5CG2A 3DB2A 1GYRA 2YV2A 4GGOA 2BF7A 1NAIA 1YBVA 3GVHA 3PHGA 1BXKA 2B4RO 1ZW1A 4XB2A 5A9TA 2Y1DA 5TQVA 2JFHA 2Q3EA 1G1AA 2J3KA 4GBJA 2NNLD 2CMDA 4AJOA 1N92A 1MA0A 4E13A 3H9JA 1HDYA 2Y67A 4ZRNA 3RUHA 3V1TC 3PZRA 3L6DA 3DBHB 4QXMA 4TZKA 1E6EA 2UV8A 3ZN2A 2R00C 3I4CA 3VHRA 1YH3A 4XEHA 1CERA 1N1EA 2G1UA 2YV3A 1HSOA 1B16A 3JQ6A 4OKNA 1D7OA 4DPMA 2E37A 4XKJA 4YEDA 5KVSA 1E7MA 2QG4A 5ER6A 3WGQA 3KBOA 1N7GA 3BMCB 4XYMA 4J9UE 4CMIA 2EP7A 2WM3A 3ULKA 3I4FA 4KUEA 4NU5A 3RAJA 4NBWA 4OYRA 4A26A 1NHWA 1PJ3A 1ZXBA 1NX6A 4YDRA 3ZNQA 3NKLA 3RI3A 2WD7A 1D1TA 1LDGA 4LRTB 4MKXA 5HRUA 2P4QA 1LDEA 1N8KA 4NDNE 2O4CA 4TKLA 5ENDA 4A2CA 2O3UA 4YJHB 3M1AA 1QYWA 5A5FA 3RC2A 4AICA 4D7AA 4FOSA 1ONPA 1N9GA 3ZV4A 4IDEA 4OL9A 3ORFA 3ICPA 4IXWA 4LISA 4IDAA 2Q46A 4UEKA 1XKQA 2GPTA 3OJFA 3WMXA 4FFPA 1V35A 4NBVA 1NM5A 2NQTA 3NTQA 5LDHA 4XQCA 4WNIA 1OC4A 1YL7A 5ADHA 1ZH8A 4ZU3A 1E0DA 3QVXA 2LDXA 5H81A 2JHFA 4II3A 3JQ9C 4D41A 1ADCA 2AEMA 2JKVA 4MDHA 1R66A 3ZWVA 3ZW9A 4DRYA 3GRPA 4E2XA 4WECA 3F1LA 4O6VA 3JQFA 4CM5A 1BDMA 3DAPA 1YS4A 2C82A 5A4DA 1JU9A 1X7HA 3EVTA 1EUDA 2EW2A 3LDHA 1DIHA 1PS8A 3DOOA 3ON5A 3WTCA 2NVBA 4DYDA 3AFMA 3PWKA 1UR5A 2C59A 3ADPA 3NUGA 4R69A 9LDBA 5I9LA 3LC7O 1H5QA 5JDIA 3VPGA 1VE9A 3QHAA 4J1SA 4Y67A 3R3JA 3VOSA 4J6FA 2AMFA 4PG5A 4KZPA 1H6DA 2P9GA 1Y5MA 3F47A 1KERA 2W98A 4JX8A 4WEQA 3WBFA 1LLUA 1H2HA 3TL3A 2Q4BA 4D3DA 5HWSA 3PZBA 4BO2A 1MG5A 4ALIA 3V1UA 1ZSVA 3I9OA 2O3QA 4LVCA 3G17A 4YAJA 2BKAA 1RM0A 5T8KC 5C7IO 5KKCA 1YGYA 1H6CA 4U0KA 4R5HA 3OH8A 4OGWA 5DCWA 5TRTA 5JFOA 2I6TA 8ADHA 1DIAA 1JKJA 9LDTA 1MFZA 1WW8A 3COSA 5IN5A 2YFQA 5L45A 4GI2A 4RVHA 4BNIA 4ZICA 3DZFA 1DLJA 1Q7GA 3FPCA 3KTDA 3RIHA 3ITDA 5TGDA 5K6AA 4U5QA 1LNQA 1YB5A 3JYQA 2RCYA 1ENOA 1OI7A 4S3MA 4BNYA 5F21A 5IZ4A 5G2OA 1YQXA 1EMDA 1VLLA 1GDHA 1ZVMA 5BNFA 2W4QA 2ZQYA 1CETA 2BFOA 4W4TA 4H3VA 3G0OA 1I3NA 4CLRB 1GU7A 1WLYA 2AW5A 2WYWA 4ITUA 1TT7A 3GDFA 1YRLA 3T4XA 4F3YA 3WWYA 3ZCXA 3C7CB 2O50A 2NTNA 2Y1GA 3WGGA 3WBBA 4PLGA 3IOYA 3JTMA 4D79A 2EIHA 2J6IA 4L76A 2DU8A 4GX1A 5DBFA 1QYDA 3PWSA 4R01A 4YQZA 1NTOA 1GCOA 5ITVA 5FI5A 3G1TA 3H9UA 1P1RA 3BMNA 2VQ3A 1GQ2A 1HKUA 3E9MA 2O3SA 4FFOA 4CLXA 2J5RA 2Z5LA 4ZA2A 3JQDA 1MC5A 2OP1A 4MKRA 1T24A 3H4VA 2CVOA 1IPFA 1YBAA 4IDGA 1F8GA 4URFA 3JV7A 3GUYA 2J5KA 3QV1A 1HE4A 1XLTA 5HTOA 2VRCD 3I9LA 2Q1TA 2B83A 1X0XA 5KCZA 2EKQA 4Y9DA 2I76A 1ISGA 1FDUA 3CINA 3O4RA 1DFIA 3SEFA 3RFVA 3HJAA 3NRCA 4EGFA 1I2BA 4JK3A 1BXZA 1HE3A 2I5PO 3EHEA 3ROKA 4PRKA 1TLTA 4D46A 2HMWA 2YYYA 3ZWNA 3KETA 2GLXA 1ZO8A 1ZK1A 4CMEA 2GO1A 2Q99A 1E3WA 2VT3A 1P77A 1RYDA 2Y1FA 4MKZA 3AOEA 3JQ8B 4TRNA 2HK9A 3RUFA 4HFNA 1XYGA 2V65A 3GGOA 5TJHA 3KXDA 4FN4A 3GK3A 4OXYA 3GEGA 4ALJA 4Y8VA 1PQPA 1X7GA 1SOWA 3F5SA 3E18A 4YA6A 2NU8A 5KJCA 1ENZA 2O7SA 4CLHA 1WXDA 4CV2A 2OP0A 3DHYA 1GPJA 1KEVA 2JAPA 2AQ8A 2NU6A 5DCYA 4L4SA 3I9KA 2DAPA 3M2PA 4LMPA 2FSSA 3BYZA 4WCFC 2WJPA 5T67A 1C1DA 4FJ2A 5IDWA 5L7TA 3JQ7B 1H0KA 3RUDA 1OZAA 2W2KA 1UP6A 3ZHYA 3GC6A 4E0BA 2VHVA 1EE9A 3VH1A 2X4GA 4NH4A 3CZRA 4BO1A 4FOOA 3SC6A 1B8UA 3I6QA 3JD2A 4WE3A 3T7EA 1HWYA 3ABIA 1R16A 2D5AA 5CDTA 2J3IA 1PJCA 3FNGA 1K6IA 4MOWA 4MVJM 4CM7A 1A27A 3R6DA 1V0JA 4C7JA 5G0WA 3Q0EA 3TOXA 5A02A 3DONA 2ZATA 3BMQA 3BAZA 1R37A 4LW8A 1I30A 1DLIA 3HUDA 3LT2A 2C0CA 5AXAA 2NVWA 1NQ5A 2J5QA 4J7XA 3KHUA 4HBGA 1NQOA 4R1UA 3UXYA 1SB8A 1GQQA 5CDYA 1CWUA 3JD4A 2X0IA 1E5LA 2OFPA 1UUFA 2PZLA 1HE5A 5L7WA 2H1SA 1GEEA 3MJSA 3WYBA 1LSJA 1NHGA 3ANMA 3DDNA 1P33A 3PYMA 3WJAA 4HFRA 5BNIA 5DDIP 4NJMA 3WQRA 3LZ6A 3HB5X 3KB6A 3HE3A 1NFFA 4XQ9A 1KOLA 2Y1OA 4PLHA 2B0JA 1NFQA 5EN4A 4UEOA 3P2OA 2FMUA 3G49A 1MV8A 5G0TA 5G4KA 3EZLA 4A5OA 3NYWA 3U4HA 3B20A 3W8DA 1XG5A 1ARZA 2RHCA 4K1LA 4WEOA 5THQA 3S2IA 3DZBA 4IMRA 4M86A 5C37A 3KYBA 4MPDA 4NJOA 5K9ZA 1A7AA 2EKPA 4JCOA 3JQBA 4IDBA 4BNUA 4CL8A 1DBVO 4UEJA 3SLGA 4EJ6A 1GUZA 4BNJA 1PJBA 1EVJA 4MVJA 4RPHA 3FHLA 2C29D 1QMGA 4JBHA 3FTNA 1E5QA 2A4KA 1F8FA 4JXKA 4D45A 1I2ZA 4TRMA 1B0AA 3GAZA 5U4QA 3JQGB 4CV1A 4DVJA 1QYXA 4YJGB 1YQGA 3DBVO 3K2BA 4OQZA 1ZCJA 4YYZA 1R0KA 3JCZA 5AXDA 3QVSA 4Q3BA 8LDHA 1I5RA 1R15A 1S6YA 1XELA 5F1KA 1TT5B 3HDJA 3AY3A 3BIOA 5A03A 4IS2A 3TFOA 2AQKA 1HYHA 3RBVA 5JYDA 4A10A 4BGVA 3D4OA 2XF8A 5C5IA 4XGKA 4XX0A 4B4OA 2B4QA 5JY6A 1UP7A 4XDYA 4OSPA 3DOCA 5I7EA 4CM9D 1ADGA 1E92A 4E5PA 3AFNA 1WMAA 2WMDA 1RJWA 4RF4A 2IDZA 3TZKA 1PJ2A 1KVUA 5FWNA 1ONOA 3RCBA 3PHIA 3KYCA 4Q9NA 1J49A 3DBRB 4D42A 1OBFO 4KTTE 2O48X 4YRDA 1PJTA 3W6ZA
chains in the Genus database with same CATH superfamily
1Q0QA 3GH3A 3H9QA 4MINA 4Q3KA 5JYBA 2LGJA 3L49A 4BN0A 4KIWA 3TLGA 3DAOA 1E3JA 3SE7A 4IDQA 2WFLB 1E4EA 1EGMB 3VR4A 3EMDA 3BXXA 1XZMA 5DMXA 3UYKA 2WKPA 1EEXB 1XN4A 2I6GA 3IBCA 3ILSA 5J2TF 3RW9A 1U9ZA 3G2HA 2YBEA 3M83A 1NBOA 2HD4A 3D59A 2XVMA 3C5VA 4CR7A 4NNOA 4U7TB 3WQHA 2GN4A 1J2JA 1XEWX 2NWQA 3G2IA 1AOXA 3JARA 2Z2IA 3OEYA 5AOCA 2HV9A 1M6VB 3KOXA 2ATIA 1KYQA 3DZJA 3QVKA 1YUBA 1PT5A 2IKSA 3HWWA 3AHIA 1CYDA 4J0EA 2B34A 4J91A 5CR9A 5KAPA 5BW6B 4EDFA 5HR5A 4MZXA 4R54A 2Z98A 4RMJA 2PWYA 2WF9A 5JV5A 3ITKA 1CVLA 2IXAA 1RYMA 3V4RA 3VHLB 2FPGB 5LLSA 2OBMA 4O2BB 1I2CA 3I05A 4A5SA 3N07A 4TVBA 1FF9A 5F3RA 4XPIA 5EIOA 2OZLA 1Y3AA 3UF0A 2ECOA 4RKYA 4FHDA 5IF3A 2QV0A 3CPJB 2WA2A 4HTFA 3FPSA 1M6NA 1XRRA 5SV2A 3DCNA 3D9QX 1DX4A 3GUZA 2D74A 2GHRA 2FFAA 3BC1A 4RZ2A 2IUEA 1ULUA 2UZIR 1P45A 2P77A 3DXFA 1KYYA 3PTZA 4GQIA 5CA0B 2XGJA 5DNYB 3T5MA 4X5OA 1ZRNA 3QOWA 1YAJA 4Q19A 4W6ZA 5DN6A 4DA9A 4NULA 4Y2HA 4EUNA 2CXPA 5TXGA 4D5EA 1ODFA 1ZHFA 1U5AA 4ZRDA 1BQ4A 3WWPA 2COKA 4RULA 1WS6A 3K73O 3MWDA 1HH4A 1YBMA 1B1AA 2PWZA 4UNIA 4H4CA 3AKEA 5COQA 2YZKA 4D82A 1N6IA 1OY1A 4JI4B 1J4AA 4FKMA 4YRPA 1NBHA 3IQGX 4II7A 4UMVA 1XMIA 1XJQA 2QK4A 4ZOCA 3QPCA 5HIJA 4FFBB 2QSUA 2L19A 2ZSUA 2HJRA 4POOA 4AI6A 1Y9EA 2B82A 4K6OA 5DBHX 1OE0A 1PR5A 2ZTSA 4OUDB 1LLDA 2HZBA 1LTHR 2JK0A 2VTKA 3QXCA 2F2TA 2XMZA 2G88A 4IGKA 1EB8A 4Q7QA 2BZ1A 2RBKA 4MARA 1C9MA 4Z86A 4D96A 4PZCA 4GPAA 5FTWA 4M22A 1U7OA 1FMTA 4PX2A 5EVCA 3STWA 1FDTA 3D3QA 1W49A 1YB1A 1M76A 4JLMA 2ZR9A 3IV9A 3JAKA 1S3FA 3EXEA 1GY8A 1Z4MA 3PQ6A 3QPAA 4KWTA 5LC1A 1CUBA 3KU4A 1CUAA 1X1BA 1SHTX 4XTRA 1JDVA 1A8PA 2GZAA 1EGVB 1X94A 4WXPA 1N8SA 5DNDA 5ESRA 4IQ8A 2NU8B 2X13A 1W5AA 3K9FC 1RACA 2PGJA 3X2EA 1Z7YA 4PZEA 1PKXA 1ZICA 4ZP1A 3BRQA 3K09A 1WCXA 4BXOB 4ARUA 4TMFA 1KFEB 1GZVA 3LVQE 4JROA 4FFSA 3GVPA 3IAUA 1RJ9B 3KEQA 3PHLA 4YP1A 5IK2A 3U60B 4QQNA 1IWPB 3HPRA 4UZFA 1WL8A 1EXWA 1G5RA 3MAJA 4IZ6A 1HZZC 4XJXA 1TW2A 1Y4DE 2UZ3A 5ALHA 5FL7A 3L8ZA 3BFPA 2PCLA 2HOQA 2W2KB 2XE4A 2ACKA 1S4MA 4ZQFA 4UDOA 1D1SA 4BLQA 1CZLA 2VBCA 1QO7A 2C92A 2P2ZA 3FPFA 1RXVA 3OZIA 2OAGA 5ETJA 3V8MA 1PE0A 5H82A 3LZDA 2HWKA 3DEHA 4X3OA 3W04A 4BAUA 3WLFA 3VHQA 2IP1A 5L3SA 3HRIA 3HJUA 3LQKA 4W82A 3OJLA 3KZCA 3CE9A 1C7ZA 4IHKA 4F6CA 3KR9A 1HYEA 2HHCA 1R6DA 3F9CA 1D2AA 5D3MB 3B5JA 3WNQA 2CHFA 5ITZB 4G07A 3PFGA 3ORRA 3CSSA 3GLIE 1UEJA 4EQ6B 3Q5DA 1U65A 3F49S 2OB1A 3ZCTA 5EIHA 4MYRA 3Q5EA 4PG8A 1F0NA 4L8WB 3WJ7A 4FB4A 4R7GA 3DTVB 1TPZA 4NAHA 5BPFA 2RE8A 2AOUB 4GSLA 1P1KA 1FDSA 3KOMA 5DI3A 1JDBB 1SOAA 5A04A 4IIHA 3HN2A 5K0ZA 1T9ZA 1SXJC 1NXQA 2Y9PB 1UIRA 2FQ1A 2OCIA 1JEDA 2J9FB 2NZUG 3EMKA 3IULA 3HNOA 4JJ8A 3RT7A 3VJKA 5H7XA 5I01A 2CXNA 5IABA 2ZIWB 3AHHA 1TJNA 2A58A 3GRRA 1TADA 2NTYC 3N2EA 4FZRA 5GV8A 4DIFA 1A4IA 4CODB 1FW8A 1ZM7A 1Z74A 5IJ0B 2M2IA 2DSNA 1HFEL 5LZ2A 4BFCA 4DDKA 1F5NA 1E61A 2JBHA 3OBBA 1PZGA 1TKAA 3C8DA 4PCAA 4C7VA 2VLIA 1B0PA 1P60A 3O93A 4U2FA 1DQSA 1YCGA 5IDVA 2JFZA 1KP2A 2V96A 3TLCA 4ASUD 1OTXA 2GBIA 3BGVA 3T12A 3P4XA 5CXQA 4OFWA 1GPDG 1Z8HA 2BFWA 4RD2A 2ZRCA 1Z6PA 3AY7A 3CX8A 3L1KA 1VCOA 4OQXA 2GZMA 4Y2TA 1E99A 5AKLA 2PT9A 4DSOA 1ZLYA 3SBEA 2DBVO 5KNBD 4JQYA 1MENA 1RYEA 2OORC 4R05A 1QJ4A 3PC6A 1BVUA 3DAGA 1QYVA 5REQB 2PGLA 2MSDB 5BR7A 4YR7A 1KY5A 3PC8A 1I32A 2ST1A 4AZ0A 3RVRA 2QG6A 3MS4A 1GT91 1T0PA 2OGZA 4A3SA 2ZE8A 2G9VA 3IPCA 2W6NA 3PJDA 4WZBE 2HV8A 1ECLA 5EZQA 1D09A 3DXYA 2ANCA 4AP5A 3ANXA 5C18A 1JFTA 2ZJ7A 4LZOA 2PUWA 4AC9A 4BO7A 1U5BB 3LUPA 1PYGA 3OZDA 1RYHA 1N2GA 4UCFA 4X61A 2IA5A 1Q20A 3AI2A 3L4BC 1GKKA 3KO8A 4NBRA 3SVLA 1YZTA 3WLOA 3RSZA 4BE4A 1ESEA 4V02A 1PFQA 1H8HD 2OGSA 1ELOA 3C5WP 1KI3A 3WL7A 1QGZA 1TAQA 4KLCA 4PO3X 1NBMA 5DWVA 3RDPA 1WMSA 1FA9A 1K6MA 2C2WA 1UBTS 3PEWA 3FZGA 2XCRB 1VHJA 3QE3A 3WR5A 2WWRA 3I34X 4OEHA 2WWGA 4QXPA 4ZT2A 5BSHA 5IYZA 4JFRA 5IMSA 3LHSA 4OI4A 3A9TA 4DSZA 1G98A 2FW7A 2V97A 2ZIUB 2Q41A 2B8JA 1K7EB 2HK6A 3AM5A 4ZOLA 3GV0A 3TLAA 2PLWA 4RD1A 1WCYA 3LX6A 3OOHA 1WX1A 4U2GA 3THOA 4PNEA 4RVOA 4BLUA 4I4TB 2EFEB 2PBLA 4NC9A 4O1MA 1W34A 3EZFA 4EFNA 4ESVA 2EDAA 4KNVA 2I78A 2H9AA 1IK6A 1IUKA 1XIVA 2AMYA 5GQSA 5IBQA 2EX0A 5FD8A 3F3MA 3OSUA 5CT5A 2GCNA 1E2UA 1FLNA 2ZCUA 3QVGB 4AN0A 3BRCA 5D5HA 1QCZA 5CFNA 3V4VB 1NW9B 3K31A 3LKBA 4F6LA 2QXUA 4NG5A 5KNCA 3VR4D 5BOSB 2A5YB 1J07A 1RQLA 2XCQA 3M6XA 4ZI7A 5CLGA 3BERA 2GFQA 5K0CA 5LQNA 5CPBA 3I61A 3ZLVA 2J8ZA 4NTZA 2B3TA 3DP7A 4M0EA 4O2LA 4DUZB 1ADFA 2PXAA 1HDXA 1K06A 1YB6A 3V80A 5KKNB 4R40A 1E60A 3FWNA 3FTPA 4JSRA 4MA0A 1RHJA 1Q74A 4U2BA 3KVOA 4QJIA 3NIBA 1XT6A 3RFTA 4PYRA 4DCUA 5FLXA 4QJ5A 4RD4A 4ZVSA 1N3YA 4WTOA 3R6LA 2FFQA 2C5SA 1EDEA 1SBCA 1M1NA 1MW8X 2QW1A 4RV5A 4DBVO 3RVMA 3GFGA 4NU6A 4RF3A 1XWWA 4PO9A 4J3NA 2PZKA 4YLYA 1R0LA 2RH4A 2Y6VA 4D3SA 4BFLA 2ZYUX 3QVWA 1UBUS 3NHJA 4JKYA 4DDUA 1XD2B 2AHOA 4PX3A 1SKAA 2OZLB 4G0XA 1PTJA 1VSUA 4GRDA 1UK7A 1W94A 1R10A 2A9PA 2BGMA 1N5MA 2XCIA 4JIMA 3SMQA 2EEZA 1R6TA 1PFVA 1SKYE 4I4LA 2GKOA 4X8LA 3WTBA 3H99A 1W30A 5CFRA 1JZTA 1T91A 2HAEA 1BD3A 4ND2A 4P4LA 4P7BA 3S1LA 3T5AA 1KO5A 3PNLA 4MW2A 3F7MA 4MHOA 5DN6D 5JBNA 3SY8A 3DTNA 1N75A 1X39A 4RXMA 3M6FA 3OIWA 3TNJA 3GEBA 1UOPA 3NPMA 5BOSA 3CVVA 3OESA 4M1OA 3EVAA 3HGTA 4IO1A 3DTTA 2XQKA 1Z2NX 2P0YA 2FW8A 3LVFO 4QXQA 5D00A 3TLXA 2JGDA 1JDSA 4BO9A 4DCCA 3BK7A 2EQBA 4Z9BA 4EJMA 3OZWA 1LI7A 5CA1B 3LPCA 5EINA 5EHZA 4U9IS 1GA1A 1GUDA 4WA7A 1USUA 1TZCA 4EHAA 2AWOA 3ZCPA 3GA0A 2OZEA 3MJDA 3C3KA 3NVMB 3OA0A 2FPWA 1NVTA 2XNHA 1JB9A 4Q1BA 2H57A 3A1FA 4I0WB 1RWQA 4IQ4A 5ALKA 4IKOA 1PVDA 3WBKA 1GTRA 3SBXA 1GA6A 3EN0A 4J90A 1PR1A 1FUYB 3MJRA 3FCYA 2X2PA 3RRXA 2XDQA 5JVDF 5B1SA 1GKLA 3KOUA 5IUNC 4E32A 1CE8B 1S2MA 2MWMA 2QAGB 4MCAA 2FEPA 3QKIA 4MV3A 5JMOA 3EGEA 3CLUD 1WV0A 2C4VA 1H8EA 4ZVPA 4L5JA 4PTZA 4C4AA 5DMHA 4XIJA 4G67A 3TOCA 1CQJA 3EY9A 4M36A 4CUZA 3A26A 3G9ZA 2VJQA 2IXTA 1P75A 1CJUC 4MR7A 4X71A 3QY9A 1A4RA 1OBCA 3HCBA 3IUNA 5AXBA 5A9SA 3DMPA 1L5FA 1UK9A 8OHMA 3KXKA 1UM9A 3A28A 4GQAA 1GG9A 1I1OA 1PZFA 1UKAA 2P1DA 3AYXB 3EQ2A 4ND5A 4YO7A 2CZCA 1A9QA 4XD2A 1QHFA 1RE1A 2A1IA 1OWNA 4D43A 4IGAA 1A2KC 1WUJS 2ZM5A 1V25A 3H5AA 4KN8A 1AHPA 1ZQ9A 3G8AA 3JSAA 3Q7RA 1KDVA 3W5DA 3GJ7A 3MG9A 2Q5HA 1XHFA 2YCBA 1WCIB 3IDQA 4DTIA 2B21A 3VR2D 2VP5A 1V5FA 1QP8A 1AKTA 1YDMA 2LBPA 3O4FA 4I4IA 5CVTA 5IK2D 1KQFA 1R4NB 2JI6A 1YK1A 2GMWA 4JJGA 1W5SA 5DM70 3AXSA 3SYLA 3NHAA 4DV0B 5FL7D 2N3ZA 5DGTA 1Z34A 3DHWC 3QMPA 3ROFA 4JMLA 4RZUA 5H8WA 1JLRA 4EO7A 5CFZA 5U4XA 1WXWA 4KQ1A 1URPA 3CX4A 4L7QA 4XJSA 5L3SB 2X41A 2HPAA 3A3YA 4M99A 1Y8RA 5LQUA 4E5DA 1EXVA 1JE0A 1X7YA 1Y4AE 3R5XA 4BIMA 3F4KA 4X93A 3I8OA 1R74A 5CB8A 4PG4A 1JJ7A 1Q77A 2BJVA 2I4IA 3KV3O 2O19A 3ZU4A 4P4NA 4RMHA 2HWWA 2I1LA 2OG1A 4YMWA 1ZD5A 2HYDA 4FGWA 4I5DA 1HETA 2II6A 5BT8A 3WDSA 4KGVA 2BC9A 1W4CA 4BV3A 4EZIA 2CF5A 4F21A 2Q6VA 3J80A 5IKMA 2LR0A 1HOXA 2WICA 3WYCA 4UUQA 5DI3B 1C1XA 1JG3A 2LWIA 2HJSA 1G7CA 1NDHA 4GOXA 1DP4A 2BM0A 5J2TA 4JQCA 1KBZA 4N41A 3B6EA 3TTVA 1FMLA 5E3HA 4IOJA 2WUDA 2XQVA 5B1HA 1DQNA 3E9YA 3PX3A 2FCAA 3T7JA 4F2GA 5FR2A 4FDUA 3ID6C 3BTVA 1JSZA 1R9JA 3QUTA 3IILA 4YJKA 5ERGB 1KZ7B 1SXJE 1TC1A 3K1AB 5T64A 4KGDA 2WAAA 2YV5A 4GMHA 3H2ZA 2OK7A 1ZK3A 1XYVA 1RAAA 1VG1A 3HB4X 4P38A 4PZPA 1ZM3A 3EWNA 2XLBA 1VM6A 2G5CA 3SE0A 4M1MA 5BV2P 4YMUA 2LXNA 2AYYA 3GFFA 4R8LA 3QKWA 3N6RA 1C8BA 1QHYA 4L08A 5G41A 1DZIA 4LYAA 1SEVA 1X42A 1PQYA 4RENA 1ZVQA 3M70A 2X1LA 4AIIA 3ZGLA 5CCBA 4UDYX 5ITWA 5DRYA 2OC4A 3DEKA 4H6WA 1R6AA 5GP1A 5GONA 3VZPA 4EK9A 4EMUA 1RZVA 3RIYA 3P2MA 2OQIA 2HU7A 1SVWA 2RKWA 1R6BX 1KMQA 1MEOA 4AZ0B 2ZIAA 4ZEWA 3C1OA 3FYUC 5IAAA 5JJBA 1MX1A 4FSHA 5EOVA 3FVWA 2CFIA 3EDOA 4CW7A 1W25A 1IN6A 4AZTA 2C7PA 2IC5A 2JLBA 2Z9DA 2QQFA 4F3KA 1Q84A 3LT5A 4FJ0A 5FWYB 5I9SA 3V97A 4LJAA 2G63A 1YU9A 3VYTB 3RAFC 2GBPA 4INPA 3KL4A 3OM8A 4G5FA 4PRLA 4RFLA 2J48A 2ZUDA 1IBLB 4WI1A 4J4BA 2XNDD 4ZXFA 5J2UB 1ZRMA 2HADA 4M0DA 1U2GC 1JIQA 1PG2A 2P5UA 2X77A 1J1UA 3ZQKA 2X5OA 2PL1A 1LX7A 1J6UA 3B36A 1S7CA 3P9NA 1QONA 5M34A 2WLSA 4D97A 3IELA 2QTMA 4QOHA 3IO3A 4CIBA 2XVXA 5TV2A 5K8LA 1JA0A 2PMEA 1AK1A 4RDIA 4BQNA 3KJGA 3UJBA 5M04A 1SUFA 2QP9X 3R3SA 4NX2A 2ZWIA 3L8EA 4OM8A 4YAGA 3A1EA 4F0JA 3K9WA 3AGPA 3FFBA 3VPHA 1G21E 3LUKA 1AA9A 2CMGA 3DP9A 2B5VA 3C1TA 4NI5A 3K6KA 5EJMA 4ENUA 1RRFA 3FMOB 3W05A 3EPLA 1G59A 2C1EA 3I5MA 2Q6TA 3N2NA 2WHXA 3VZCA 4C4TA 1M0TA 2GERA 1JILA 2XMDA 1C9JA 1HFJA 2PU7A 3DOHA 4M53A 5C53B 4LOHA 2OQVA 5GZ6A 1ZISA 2HRRA 2IXGA 4LKRA 3FYHA 4QOJA 4RADA 5AKZA 3M9LA 1PL8A 4CM4A 2JAXA 2O5RA 2WD7B 3QE9Y 1HNWB 3NW9A 4PU0A 1X7DA 3AM4A 2J6HA 3AYZB 3UJ3X 2EWMA 3GCDA 3VVBA 5KDDA 1I7DA 5JSZA 3WWOA 2EZ9A 4I9NA 4NL4H 2VZ0A 2YJ6A 4UUPA 3FGZA 5AHWA 1JW9B 3IT3A 1A72A 1LCIA 1W52X 3MRXA 2Z8YM 3QWBA 1L7RA 1N9GB 5EA2A 3V7NA 3X1JA 1Z6QA 1FUKA 2XPCA 4UOQA 5A06A 3FJOA 4Q02A 4MUBA 2GNAA 2WV7A 4U9UA 3TVTA 1YI0A 2P0EA 2YWCA 5IN4A 5JXGA 4Y9UA 4KFSA 4QTUB 5HM8A 1NN0A 3RS7A 2GUWA 1T25A 2ILVA 4EABA 4RTMA 5BRNA 2JD0A 5HF8A 2CBXA 2G17A 2MR6A 2QD1A 3AWIA 3BB3A 1QKKA 3HCAA 1IJKA 2PU5A 3L18A 1D5WA 3OG9A 1T1EA 5M3BA 2Z1MA 5EWJB 1TCAA 4D74A 3NBZC 2W37A 1AQLA 1WP4A 1DXQA 2XYVA 4M0LA 1L7DA 1M1NB 2QVYX 4LA4A 4EW3A 3ESAA 4WIAA 2ID8A 1HZZA 1I14A 3HDHA 2EJCA 3A6EA 4GLBA 3Q3GE 3VTZA 3LHIA 2UZ4A 2RH8A 2FP3A 2P6UA 4BZXA 1U7TA 3BIXA 1PR0A 3E1KA 3I12A 4EECA 4ZHQB 1XPRA 1M5RA 1NXXA 4F06A 2XAUA 1VLHA 2R8YA 2B25A 3MWEB 5SY6A 1G4UR 5HDBB 3DZ8A 3PA8A 1GRNA 3C8HA 3T1YB 1A2OA 2JEOA 3VU8A 4YJDA 3HBMA 2VH2A 2RJOA 1QNLA 3RYTC 2QLLA 5EPEA 1L3BA 1NJ8A 2C4UA 2BKUA 5C1IA 5TMEA 1F12A 4N5IX 4IFTA 3UFXA 2O0MA 2MR5A 4OJKA 2YS7A 1YRWA 3UJ8A 2FN8A 4DC1A 1UK8A 3VX4A 1S2NA 2RHBA 1QP4A 3IAM6 1FU4A 1HURA 4CKWB 4E6EA 1P3JA 1CEEA 2AC4A 1NW7A 4MB6A 4ZT3A 1Z35A 3DOEA 3EBPA 1EEHA 1P4AA 2XWJI 1H4TA 3GN2A 3HU5A 1VI2A 1P4SA 3AEXA 1RD4A 4XLLA 4XXHA 3AFGA 3NETA 4FFWA 3WGKA 5LQDA 5CHEA 2Z8YA 3E48A 3PFHA 3PJEA 4JLPA 2Q7DA 2RC5A 3DBHA 4ZCLA 4O2AB 2JLVA 3QVUA 2CCGA 4PX9A 4QDOA 1ABBA 2FSHA 3E7FA 4DLYA 4UU8A 3VDXA 3ZE2B 3EMVA 1MVOA 1RTTA 4OG2A 1UWKA 3ZHOA 4DREA 4YXFA 3DTYA 3B6ZA 5DNVA 4DC0A 5KYKA 3H1AA 1PNTA 4BNFA 2GGSA 3U4AA 2GK3A 3Q0TA 3TSAA 1Y9ZA 3ZHTA 3BMCA 1UJ5A 1NU6A 1CQJB 1U90A 4TL7A 4LNUB 5EZYA 4EGCB 5ICSA 5JAMA 3JQAA 1QUEA 1YFKA 4M87A 3W5SA 4HG2A 3VZSA 2VBGA 4BEJA 1UM9B 3RS4A 5CXUA 2Q62A 2OORA 3L5KA 1MRSA 3HYLA 2FDCA 3BCSA 3ZW8A 2W4MA 4P93A 3JVIA 2OV3A 4NFLA 5CPFA 3WOHA 5D6OA 3I09A 3G68A 3IT0A 1FMJA 4YJHA 5T41A 1P9NA 1IQRA 5T57A 5C7LO 5GJBA 2O8CA 1FFAA 3A7EA 4J49A 1X2EA 5BNTA 2AYZA 5KSYA 2GHQA 4Z9YA 3TD2A 2JIMA 1NL3A 3HA7A 2PT6A 1S8OA 2I67A 1UKVY 3GEEA 2WQ7A 3TOVA 5C1DA 5LMUB 1HOTA 3U3ZA 4QECA 4I5IA 4YRRA 4GHWA 1MTZA 1GU1A 1Z3IX 4HNAB 3SJ7A 4E5SA 4IH9A 5IXYA 2YDYA 3HL0A 2HR1A 4W5NA 1P7VA 3DF9A 2CJXA 1AK9A 3TUJC 3L4BA 4QEKA 4Z1OA 4Z2AA 4P83A 4ZT4A 1N0UA 4XB1A 1QRTA 1O6GA 3LPLA 2ICAA 2G9RA 3JY6A 1A88A 1KAEA 3O8LA 3OY7A 4F5ZA 4RVUA 1G21A 1H1LB 1P6QA 5AJYA 4JU8A 1NT4A 2FMIA 3BD8A 5G4LA 3TPCA 3O90A 2WHRA 4BVJA 4Y0NA 4DT1A 3H5NA 3LM8A 4KUGA 3LI2A 4BWVA 1KEZA 1B42A 1JEQA 1KEPA 1Q92A 1TIPA 2HBQA 2NTJA 4FGZA 1YJBA 3K72B 1KFCB 4Q4JB 3IV7A 4BNMA 4CM1A 5LN1A 1PAUA 1A0OA 5A4AA 5H16A 4B45A 5CM2Z 1AQNA 1UAGA 4NNJA 4RJJA 5FR1A 2O23A 4UAGA 1E1QD 4GVPA 2FG6C 1EXNA 1JYSA 2W8ZA 3VDQA 2DCMA 4B3TB 2FSGA 3Q9LA 4LQ4A 1C1XB 1JKFA 1H1TA 3HMQA 1BMFA 1PDOA 2VDOB 3BJIC 3IPLA 3UMCA 3RJZA 4FYVA 4NATA 2VHEA 5DCLA 5EE0A 2WZQA 4JENA 4MCIA 1GPH1 3OCZA 2I6FA 2JLAA 5HCNA 4G0VA 1VMDA 2P11A 1NVXQ 2IUFA 2OAQ1 4IVNA 4ZYTA 4IZHA 2HCTA 1Q7RA 4G1CA 3NC4A 4AJPA 3HY6A 5C8DA 4BQPA 4B2LA 1SM4A 1SZDA 4I6GA 4IFBA 4X8HA 5AO9A 3PQ7A 3ZWOA 1LK0A 4YGYA 1ZHOA 2HPHA 3RV4A 3TZQA 5JAHA 4TWJA 2N9UA 4Q3AA 4RE5A 4L2IB 2Q3CA 4MRAA 2FMFA 4GMXA 2JFFA 5KYNA 2BYTA 4N54A 5KB3A 1PZNA 3ASUA 4RABA 3EW7A 1PGQA 2YFKA 4FE4A 3VPDA 1DDGA 3I42A 4PAMA 1SD5A 3VR0A 1G3QA 3IQFA 1XTPA 3OU7A 4U7JA 3V7UA 5GONB 5HE8A 4LVOA 4X54A 1CEYA 4J03A 2WPDA 3P94A 3TBHA 5HQ3B 2RGGA 2VJDA 3KD2A 1NZDA 4F3TA 3SKYA 2C2BA 1GSOA 3U3XA 1C1DB 1V4NA 2C3YA 2Y77A 3GVCA 4FFLA 1DT5A 1EFUA 4LMRA 3WICA 1RTKA 1U9CA 2YJ5A 4I19A 4E12A 3JQ9A 3H75A 3D64A 5DTMA 3IHKA 1G6Q1 2C7BA 4B8ZA 2IS6A 4S1WA 4ZVLA 3WNVA 4BKUA 1USKA 5GINE 2QRVB 5KOYA 1GPNA 4JBYA 2C2XA 1Y80A 1OHHD 3BFXA 2YIJA 2ZUCA 5P8WA 3A4NA 4BKQA 3FHTA 4KB5A 4RE6A 5IKOA 3LQ4A 2ANBA 4PLYA 5EJ6A 5JMTA 2UZ0A 3MJCA 4KO3S 4Q3NA 3MMSA 3QVVA 5ED4A 2RHLA 3ETLA 1T4DA 3RJ5A 1XL1A 2D2XA 2VNSA 1B8VA 1X14A 4KP7A 1W36B 1RQRA 5HRCA 1FFGA 5FNVA 1VJ1A 4A1FA 4P32A 5KU7A 2UYGA 1F4VA 4HWPA 3GGSA 4OJQA 5KVCA 5KVVA 5AKKA 3GRVA 4RQTA 1NXSA 2ODQA 3AUTA 4MUAA 4RVFA 4JI6B 3SS8A 4UTVA 1IG0A 2I2AA 1XTIA 4PIVA 1VL8A 2X3UA 4G5XA 2EWVA 4IJ6A 2C7GA 4YCCA 4TTRA 3VDNB 4DTCA 1F6BA 3H19A 2R44A 3DE3X 3IA7A 5JXHA 1W2HA 1UWVA 2YOFA 4GNKA 4EGSA 3HN6A 4BNDB 2B69A 2XCUA 4ZAXA 4BDTA 2L18A 4R41A 1PWEA 5CHYA 3QG5A 3WMEA 3ZWXA 5HRAA 2EJVA 4E46A 3NM4A 3R40A 3DULA 2OGUA 4JBNA 1BCRB 2JFQA 2QUKA 3IEIA 3HFJA 4J2HA 4JYBA 5ERYA 3R1IA 4IOMA 3TN7A 3K4QA 3UJDA 4CM4B 2XW6A 5G3YA 2O1SA 3PTLA 3ML1A 3OJXA 2X3FA 1ZIDA 3CPEA 4P84A 4PFSA 3IJPA 3SYNA 1CNFA 3V55A 3BJZA 1MZPA 2GJ8A 3CVJA 5IVKA 2HRQA 2FN4A 1YQWA 2IBMA 4G0MA 1CC1S 1Y6ZA 4XGNA 3G5UA 2NP7A 2DUJA 4HDMB 1RXYA 3MCVA 4Q4AA 3PXXA 1QORA 4Y7DA 3KQQA 4J0QA 3WGYA 4DEXA 4HS9A 1PZEA 5DXFA 3ZWYA 4YJ3A 1FTNA 2ZBFA 1UOOA 2HMVA 4MYTA 1SCNE 2JEZA 4UREA 3GLFE 3OO0A 1IXRC 1HDGO 2J3LA 3LX4A 1WY7A 2I65A 5H0IA 3W4JA 2FSPA 3CLVA 4RVCA 4FNOA 1LC0A 2V3CC 4G0YA 1OFIA 2GAFA 2Q6KA 3NDIA 4TKVB 1G63A 2MCFA 3CVWA 5HZHA 2IU3A 2DUUA 4Y2JA 16PKA 2HMYB 2PUHA 3DF7A 4UCWA 2B36A 3UQZA 4KFTA 1THGA 3I92A 5JT1A 4PCVA 5E1BA 2LVBA 4F93B 1AUQA 5B37A 4KQ2A 3L43A 4G8JA 3QU7A 5JZMA 4IJKA 4UUOA 4NOKA 1JLLA 1D4FA 1YI8A 1LK7A 1NVWQ 2VT6A 2JCYA 3QF4A 4HNRA 2C07A 2IUSA 4MYSA 4OLJA 2I2WA 3VNSA 721PA 3O26A 4P08A 4PZUA 3RC3A 3RWMB 1FZTA 2BM8A 2PGIA 5K3EA 4OHCA 1C9EA 1P7YA 5B2EA 3KQLA 2G40A 2EJBA 2SCUA 3EE6A 1E9FA 4US1R 4ZK6A 1O87A 2HH9A 3HDGA 2EP8A 4FYPA 2V7UA 3L84A 4UD6A 4YIHA 2ZWMA 1U3WA 4GO1A 3WDKA 1BKYA 2OD7A 3MS2A 4LV8B 1ZP6A 4EA8A 2WIAA 1Q7TA 4TV8B 3IKVA 4BFTA 4LRQA 2Y6UA 4D44A 2J31A 1C7QA 3UICA 2IX9A 2K2QB 4JEMA 3A06A 2GWRA 4NEHB 2KJQA 3MK31 4Z7OB 4MWZA 2VQ6A 4MROA 1YASA 3K0SA 5KTPA 3CEAA 4L4UA 3B1JA 4W9NC 4FI3C 4YMTA 1SXJD 3RWOA 1EWTA 4D80A 4MVYA 4ETIA 1JLMA 2QSJA 4NESA 1C9KA 2W8BB 1EHIA 3MINA 5EG5A 1N2BA 2F64A 2H1WA 4H9GA 4Q12A 5DM4A 5SZIA 3MOGA 4OHOA 5EERA 3S4YA 5EHQA 3WV4A 5I3CA 2ABWA 3EWIA 3WDLA 2ZUFA 1A76A 3D1LA 1Z47A 1MU0A 2NUAA 4NFYA 2QNRA 5MF6A 3ICEA 1A9XB 4S1VA 4L5AA 1QQ6A 4YC7A 4IDDA 1CUYA 3RYHA 2FEKA 3Q8KA 4FI3F 3IMKA 1G9TA 4GX2A 1FXWF 2JJQA 2QW8A 1KIFA 2J59A 4OUKX 1V39A 4GE0A 4Q7EA 5AM4A 4M9QA 5DX8A 5EZYB 4D8WA 3JQAB 4I1UA 3K6JA 2DP4E 2BP7B 1RMQA 2Y4OA 1HT0A 2GJKA 4EHHA 4YRFA 1V1RA 4LF7B 1O97C 2WI8A 3V8QA 2H1IA 3ZPXA 2A2ZA 2BEUB 2QJOA 4GNRA 2I1QA 4WZZA 1MH1A 1JT9A 1NRIA 1QK5A 1FZQA 1NONA 3GOHA 3KSAC 3ZU2A 1J2YA 2RGYA 4BX9A 2LUOA 1XA0A 3U1BA 2JGRA 1Z2DA 3PQ8A 1EWYA 2ZPTX 4PLZA 3TRJA 3V2UA 5LUBA 4EMTA 4LBYA 4NECA 3RNOA 1ACMA 1Q1ZA 4QTXA 4K46A 2R1UA 1YIOA 3UB2A 1SCKA 1EHYA 2DHEA 2GWHA 3E3AA 1CBUA 1VP3A 2DWPA 4M4SA 4UM7A 3WDMA 1MN6A 1T10A 2LW7A 3PEEA 3KQHA 2FEMA 3NT4A 3G79A 5C8VA 3W1WA 2NV2B 4BVEA 2QQ0A 1LRLA 1B93A 1L4FA 1W59A 3CTPA 1U2GA 2OZPA 2WU4A 2VJYA 3N0VA 1G16A 1QH9A 4U2EA 3X2SA 3RE1A 4E30A 1DAKA 1B76A 4N8EA 1Y6FA 4E51A 1F6DA 2H7XA 2DM6A 4KH0A 3U48A 4KDCA 1PSWA 2IU4A 4O08A 2PFKA 2YWHA 2VEDA 4TLMB 1L7PA 5LBTA 2HK7A 3LNCA 3BQ9A 3ODGA 1RWVA 4QSMA 3TQTA 2G04A 1T3TA 5DRTA 4FCCA 2XOKA 5KYXB 3L01A 3JQGA 3NT2A 1SXQA 1T6XA 4YJGA 7MDHA 1DRUA 1KHHA 1XL0A 4QG3A 2OXEA 4D9CA 3D6TB 3EPJA 4D5GA 1FP6A 1HPLA 5A6VA 3AR2A 4TX1A 1DKRA 2WYHA 4UQOA 5CW1A 5JAZA 3WLHA 2D1YA 4EPTA 5IXSA 3H1GA 2P9BA 3MYRA 5ALJA 3UAXA 5AHOA 4IV0A 4MEAA 4LECA 3E1GA 3GDWA 4OBBA 3P7MA 3TLEA 2AEFA 1E3SA 3KUXA 4LSWA 4TLLB 2YC4C 1TJ3A 3R6GA 1MHTA 5AVOA 1FDRA 3Q5GA 5EE1A 3GLFA 3WV5A 2VDLB 4L16A 4XOUA 2QDKA 3VNVA 4S2EA 4HKTA 3E3LA 2VSQA 1FSZA 4E5VA 3B70A 3ZZTA 2XXBA 5F9MA 2WJYA 4IEEA 4BJ1A 3GT3A 4HS4A 1FYFA 2W2QA 4OJYA 1XMJA 1HL3A 5LCXA 1E2NA 4CCYA 3C5HA 3LT1A 3SD7A 5JSYA 1P2BA 4HGYA 5JWOA 3Q10A 2M6KA 2NLOA 4MR8A 5D7BA 3WQQA 2XZDA 3R9KA 3LQFA 5CITA 1I0LA 1XI2A 2D0DA 1E9EA 1T1IA 2YIMA 3ESXA 5EQFA 3FXAA 2HU2A 1CX9B 2QPAA 4IH1A 4JI7B 4RDHA 4UUNA 3EWSA 1NVMB 4L0CA 1TUBA 2C95A 1NI3A 2CFTA 1V4VA 2HDHA 2Z95A 3JQRA 3NCTA 3IEXA 1CFZA 1TO2E 5JALA 1LZLA 1H4VB 2C5EA 2WPDD 1ESZA 1RWPA 1JG4A 5JS2A 4CE6A 4RIGA 1YR3A 4F4FA 4EO9A 2I8LA 4MV1A 1JUDA 1GN9A 1VCIA 2IPMA 1U94A 1DJNA 1LUAA 2WDPA 2HQSA 2TS1A 3PVZA 3VHXA 3THXA 3M6LA 1ESCA 4B1FA 1CY8A 2FPRA 1R4MA 3IDZA 5C8YF 1RZRA 1LB1B 2CVPA 4HX9A 1M2OB 2DFDA 4AWXA 1WIWA 3RRFA 3QTBA 4M0KA 1GZHB 1S4QA 1DBSA 4ZC1A 5CAEB 5B7NA 2F3PA 3RHSA 1NULA 4PAOA 3WX0A 1W5TA 2UAGA 2NZ8A 3EQZA 4YMLA 3PF9A 4OGLA 1RXCA 5FNVB 2O0HA 1Y3DE 4B76A 5AMXA 3GCXA 4TMTA 1VHLA 1V3TA 2WYVA 1NBWB 1B2RA 2YVAA 2DFKB 4FW8A 1MPTA 5FL3A 1M66A 2QBYA 2CDAA 2E4WA 1PYOA 5ESXA 4OXIA 5B5SA 3KCNA 2RJNA 5JI2E 3ZVKA 1C0PA 1T35A 2EFHB 2HA5A 3A9SA 3KOOA 5FB3A 3BQNB 5CM8B 3B1XA 3SEAA 3M6IA 3RJTA 2G8LA 4G4IA 1TQ6A 2FPXA 5DT9A 2R7NA 2CNDA 4ZVUA 2OHVA 1W5EA 3OZGA 4BE9A 1V9CA 2P68A 3DT8A 4B4WA 5BR4A 3ZDFA 3N2LA 1YJAA 1I2MA 1KP9A 4YI3A 2JDID 3NLLA 4BB9A 3AGQA 5EMLA 2R8BA 3NHLA 3DMDA 4X63A 4OA5A 5AUOB 1RPAA 2E49A 3EIQA 3QYPA 5CVJA 4A2WA 5TNXA 1PJQA 3CLKA 1ST2A 4ZEMA 5CB4F 3KBBA 3R3YA 4M3NA 4V03A 3LY5A 3EBOA 5AR1A 1RRVA 2DBZA 2V74B 3QMVA 5TQ2B 3IE0A 3SOPA 1I7QB 2W6JA 2ETVA 4FWBA 4MXDA 2UVQA 5KI6A 3DZCA 3JAWB 3ONNA 4Q4HA 4D0LB 2FR1A 4FBMA 2EARA 2DY0A 1OT5A 1DO2A 2IZZA 3H5OA 2H4FA 2A33A 3UCFA 2WJIA 2PWPA 1KIMA 2WPNA 4M7RA 1VXOA 4IV8A 1IWOA 3LK6A 1IK4A 2AMVA 2WSIA 4MS4B 2ORED 2EGUA 3A3PA 3IA2A 1A9YA 2WWWA 4V0OA 3U0BA 2X8JB 5JZ9A 2DBYA 4ZQIA 1SKUA 1JJBA 3IKJA 2IYRA 1T5OA 2Q1UA 3R74A 5FAKA 1JLLB 4A0GA 1TTQB 4HVCA 2VSNA 3W2HA 1EXDA 2NMVA 1P62B 2DWUA 1ZD4A 3GG2A 1X74A 1FY2A 2RHMA 1FFBA 1ZIPA 10MHA 2ZJFA 4ZI2A 4GKVA 4GLJA 4EB8A 1XMPA 1RKXA 1BMDA 3M4ZA 3V8VA 2XBLA 5JPCA 4C4PA 5EZSA 4WNAB 2QN7A 3TQIA 4I9HA 5DW3A 4DQKA 4KITB 3EPHA 1KJJA 3OF5A 5AM0A 4BGEA 4PONA 2AF4C 1WZ2A 3W0LB 1QV9A 3HN7A 3FPHA 1SWWA 4G65A 2B7BA 3JASA 2WWVD 2W0MA 4WLEA 3V4ZA 2W4IA 3LUCA 1GUBA 1YT5A 3JQFC 3QE4A 4V2UA 3WYNA 3ZHUA 1TMYA 5B4UA 3RIMA 2WIBA 2QTCA 4JGGA 3G59A 3CHYA 4J2OA 4BN4A 3T7KA 3IUPA 1YOVB 1BMTA 1N7IA 3RARA 2DC1A 1OB5A 1IDOA 3T99A 1XB2A 4R2JA 2HTEA 2WHQA 4CQNA 2EL9A 2H1OA 1X7XA 1WPXA 2GZHA 4WOJA 2WU0A 3WMGA 1WXIA 4NYJQ 3G2KA 1RHRA 2Q2QA 1PDVA 4J0GA 5JDIC 4EG4A 1L7MA 1K6EA 2A9FA 2ZAGA 2Q0HA 2IT1A 1U2EA 2ZT6A 3FOFC 4S12A 2H1FA 4NK4A 4ILKA 3RSCA 4KKXB 3TPFA 3EGOA 4YAOA 3O1LA 4C7OB 1OT3A 4MLPA 3RYHB 3C74A 5F12A 2A5FA 4URWR 3JS5A 3UIEA 2C84A 4OQMA 3BMXA 3MRSA 4FDAA 3WE7A 1AXGA 4HDRA 4IX1A 1Q0UA 2CL6X 3SKVA 3WSTA 3AK4A 5HP4A 2VP9A 1GEGA 2I4MA 3V42A 1N6LA 1Z56C 4UU0A 3BWYA 2R1VB 1HF3A 1YB2A 5CJJA 1DQRA 1V1RB 1WB5A 4WVLA 3RK4A 5AW1A 1N2HA 3SMVA 5F35A 2ZXEA 3D2CA 4Y6OA 3LKVA 3GBPA 3N0TA 3FSGA 4R8KA 2IV3A 3WI7A 2TMKA 2EG5A 1M6HA 2XMSA 1QIMA 3H4IA 5TPWA 4IZOA 4R9UC 3S2GA 4PVCA 3BXGA 1LC3A 1UKCA 2R60A 1ZN9A 4HQKA 3SS9X 1PS9A 2WTEA 3NRJA 4RU1A 2ORIA 4RYLA 4BRWA 5K6AC 3CPSA 1AU9A 4UBNA 2Z5FA 1Q15A 1E3MA 1XALA 4TKUA 3KT3A 4N03A 2P69A 1U8CB 5A7FA 2C04A 1M1YE 1TA9A 2IYYA 1CP3A 5CVDA 2ZRIA 3NBQA 4NV0A 1L6RA 1VIYA 2WJAA 1EX9A 1R0SA 1OR8A 3DV0B 3K0HA 5E0OA 5GM2A 1G7TA 3P8ZA 4KSYA 5BQ5A 3TAXA 3V8BA 5DM1A 1F2UA 1PGNA