4NBUA

Crystal structure of fabg from bacillus sp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
242
Chain Sequence
SRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Biochemical and Structural Studies of NADH-Dependent FabG Used To Increase the Bacterial Production of Fatty Acids under Anaerobic Conditions.
pubmed doi rcsb
source organism Bacillus sp. sg-1
molecule tags Oxidoreductase
total genus 96
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nbuA00
4CR7A 1OMOA 2DPHA 4YA6A 4WOKA 4MJLA 3V1TC 1P33A 5FI3A 3S2IA 4GKVA 2FP4A 1DHRA 2HAEA 5G0UA 4DREA 4OQZA 4GAEA 2O3TA 4NDNE 3M1AA 3DBLB 3TZ6A 3DOCA 1YDEA 4HADA 3GA0A 5DZSA 2EGHA 1UDBA 1X14A 3NDJA 3Q1LA 1UAYA 4BGVA 4C4OA 1O95A 5IJZA 4DGSA 3DXFA 3PYMA 2IRWA 2VRCA 2ZATA 4Z3DA 5B4UA 5I9LA 1SO8A 2H6EA 3ZCXA 4XJSA 4AFNA 1ZSNA 1EBUA 2RH8A 3ZWYA 1HWYA 3WQQA 5G2OA 2DTEA 3T7CA 1SAYA 1UXGA 3W4KA 1I3KA 3F1LA 3JQFA 1JKFA 4R41A 3DZHA 5JC8A 1HE2A 2FOIA 4HFJA 1E3WA 4D3SA 2VHYA 3BMCA 1UP7A 3AI1A 1E7WA 4CM4B 3NT5A 3LYLA 3UW3A 1M66A 3AUSA 5KCZA 1F8GA 1L7DA 2CFCA 3QRWA 3NTQA 4BNNA 4E33A 1KBZA 1HKUA 1PS8A 2PGLA 3C85A 4HFRA 4LRSB 2ZYGA 1I2CA 4DC1A 4DPMA 3F4LA 4PG6A 2YV2A 4YRBA 1JKJA 5FYDA 4HX5A 1CYDA 3BA1A 4YJFB 4AJKA 2E82A 4JP3A 4NPCA 3DEYX 3AY3A 1LXCA 5KVSA 1N9GA 2BFOA 1BVUA 3GGOA 3PHJA 5G0VA 5HS6A 5IZ4A 4HY3A 1A4IA 5A04A 4RZIA 5THKA 4FFNA 3CPSA 2NTNA 3PYLA 3IL2A 3P2OA 2OP1A 1ZW1A 1WP4A 4MP8A 4CPDA 2VNSA 3D4NA 3C1TA 4TRNA 2O23A 5F21A 3G17A 5BSEA 1HE4A 4R3NA 1ONOA 2E48A 1DPGA 3SLKA 1JDJA 5THQA 4D42A 3CE6A 3FN4A 4Z9YA 4AG3A 4BMNA 1KVTA 4XQGA 3DTYA 1QYXA 5ILGA 4CMEA 4R1NA 5A4DA 4UVDA 1IZ0A 4R16A 5GZ1A 1RM0A 4LVUA 5IAAA 3D4OA 5ER9A 3NTRA 1UZNA 2Y67A 3V2UA 1A5ZA 1I5RA 2Y05A 4RPJA 4CM7A 1JWBB 1RKXA 1FDWA 1SB9A 1ZNQO 4CM6A 4ESOA 5IXSA 8LDHA 4AJ1A 4XDZA 4CM8B 4RPHA 3PJFA 2VYVD 1UDAA 2Y68A 1V3UA 4OMUA 3RVDA 4NJMB 4CR6A 4D7AA 4KUGA 5FI5A 2OBNA 4CMEC 3P5SA 2NWQA 3PYXA 4IY1A 4DA9A 1UUFA 2YDYA 3JQAD 1Y5MA 5LC1A 1U4OA 4DPKA 2NU9A 3GLQA 3ST7A 3DMTA 3OMLA 4S3MA 3U62A 3ZWMA 4ALJA 5T57A 4XQCA 1C1DB 2UVDA 3GHYA 4CMIA 3EHEA 1RPNA 5JMPA 2AQIA 1GD1O 1JN0A 3H3JA 4CODB 1S7CA 3CUKA 3P2YA 5DN9A 4XCVA 1GQYA 2P5UA 5CEEA 1GCOA 4JN6B 4JIGA 2VHXA 4CV2A 4XYEA 1KIFA 3JTMA 5G4LA 4MVJI 3MJ4A 1ISHA 1FF9A 4ALNA 4DWVA 4JP2A 2O3SA 1IY8A 3ZV5A 5KJ1A 4R54A 1VL6A 4RQUA 1M6HA 1AHHA 4BO1A 4AJLA 3HN2A 2EGGA 1U28A 4J1QA 5DOVA 5EPOA 3PGJA 4JXKA 1P9LA 4BGIA 2DM6A 1R4MA 5JDCC 1B0AA 4PLYA 2P9CA 2FHSA 3RD5A 2E4AA 1ZEMA 1X1EA 2C5EA 4YJGB 4IM7A 2B37A 2YFQA 3G49A 1IULA 3ETGA 5FFFA 1Y7TA 4UVEA 1QSGA 1MX3A 4OGWA 2VN8A 2Q4EA 4A73A 4CQLB 3JQ9A 1R66A 1Q0LA 3FWNA 2VRBA 2VOEA 2A9FA 1AN9A 1GU7A 2J8ZA 4MDHA 4OHUA 4UULA 4EUHA 2NU7A 2CZCA 3AM5A 4WCFA 4Z0HO 5IDYA 1A27A 4E5YA 4RPLA 1B3BA 1XGKA 1IB6A 1I2ZA 5B37A 4U5QA 1EVYA 1MC4A 2CDCA 2JHGA 4EGFA 5JPIA 5JS6A 2GN4A 2Q49A 5ILOA 1EDZA 4NFSA 1X1TA 4R5HA 1WWKA 1R6DA 2H63A 3BTUA 1LSJA 4G81A 1XYGA 4EJMA 1DIHA 4YRAA 4DL9A 4UVHA 1QMGA 4RF4A 1YB1A 3KSZO 3ZWCA 3RBXA 1AHIA 3ADPA 4BNLA 3MOIA 1DHTA 3OIGA 1P1FA 3WICA 1BW9A 2FSVA 1Y9AA 3SLGA 1PJ2A 3TPCA 5LDHA 4M55A 3NTOA 1BXGB 1PJLA 3GDGA 1LTHR 1RYEA 4LMPA 3S2GA 5I7FA 2BI7A 4KOAA 4MP6A 5F5LA 3VH4A 4BNTA 2GD1O 1JW9B 4CMCA 1CETA 2B4QA 3U0BA 4CJXA 4W82A 4PZDA 1J4AA 1NYTA 2RIRA 3MJCA 2WYVA 3EVTA 3VDRA 1HDYA 1QRRA 3DZFA 4CMAA 4DQUA 4PG8A 4F6CA 2Y0CA 4CM9A 1YQGA 5T64A 6ADHA 4QO7A 1N1GA 1CIVA 4BKPA 1PL7A 4DLAA 2GLXA 3I1JA 3IIEA 2O7SA 4I8XA 3RBVA 3PEFA 2PD4A 3TQHA 2X9NA 4XEHA 4OKNA 4AJIA 4BKUA 1LLQA 2WYUA 2EERA 3U4DA 1E7MA 3ITKA 1LBEA 2I99A 3FR8A 3WGQA 4I5GA 2Z1NA 3PLNA 3OIFA 3ZU4A 4NU6A 1SEPA 1DRVA 1NQ5A 3NT4A 2FWMX 3F6YA 3TWOA 3B1FA 1LRJA 1PGNA 4L73A 3I4FA 4CMBA 3BMNB 4IZIA 5L7WA 5IN4A 4Q3CA 2QZ9A 1Y8RA 1QP8A 1UH5A 3KYBA 3DOJA 5EIOA 1GQQA 2GERA 5DCUA 4UEKA 1WDKA 4WLVA 4CLRA 2VZ8A 4AJ4A 4FB5A 5BNIA 4PLFA 1Z7EA 4L4XA 3ETEA 1ZXLA 1B8PA 4HFMA 3LVFO 1GYRA 3B1JA 1I3NA 1R4NA 1M2WA 4O0LA 1P1IA 2DVMA 2BFAA 3UUWA 3WWYA 3TL3A 1Q1NA 4XQEA 4Z9XA 3VKUA 5A3VA 5TRTA 5CAEA 3KO8A 3JQ7B 1WNTA 4Q3NA 4E2WA 3MTJA 1IUKA 3TZHA 1I01A 3EUWA 3GY0A 2FR8A 3IMFA 1H6AA 2ZB4A 5COQA 4BMVA 4GX1A 4DRYA 2O3QA 1O94A 3FD8A 1WVGA 2X5OA 2ZCVA 3OJEA 5KWEA 1Y81A 5IN5A 3TDKA 5JCJA 1FDUA 5CDSA 3H2ZA 1HXHA 1LSOA 1XIVA 1PQPA 2FR1A 1PZEA 4CMGA 1N5DA 2W8ZA 3H9GA 4WLEA 5KJFA 3H5AA 4KWHA 1MC5A 3RQSA 4W7HA 4FFMA 1FXSA 2HMSA 3EGOA 4P22A 2AEMA 1ZXBA 4XB1A 4BNJA 1EUDA 1TI7A 2W2KB 1MFZA 3RJ5A 3U5TA 3OHSX 4BO6A 2VZ9A 3OJFA 4R9RA 2NVWA 5TSDA 3RU7A 4E6PA 3U9LA 4RVSA 4UVGA 4NG5A 3BYZA 1R0LA 3INRA 4XZ3A 3ORFA 2OFPA 2Q2WA 3E03A 4EDFA 4L8VA 4U6QA 1C0KA 3KVOA 2GNAA 3WBFA 1GV1A 4LVCA 2A94A 1HDCA 1YKFA 3BMOA 1VI2A 4BO3A 4EUEA 2GR9A 1JQBA 4XJTA 3C7CB 4WUVA 3CSDA 4DTIA 1KVSA 1NNUA 1BTOA 2B5VA 4F46A 4M89A 5U1PA 3E6AA 3R3JA 3SXPA 4AJHA 3C24A 3GHHA 1DIGA 5EQFA 4FJ0A 1K3TA 4NBRA 5CG1A 1DFGA 2AE1A 4GSLA 1MXHA 3P19A 4RPGA 3EZYA 4BGEA 2P4HX 3G79A 3S2FA 5L45A 3FNEA 2YDXA 1YL7A 1LEHA 4YT8A 1HT0A 1PGQA 3KLPX 1DAPA 1PS9A 3QLJA 4OO3A 5HS4A 4P4GA 3ROQA 4Z3KA 4U6SA 1E3JA 2EKQA 3DL2A 3A14A 1NFFA 3X2FA 4OAQA 2IXBA 1B26A 1CQIA 2G1UA 3GMSA 2VYNA 4ND3A 4UUOA 4WNCA 3DONA 3HSKA 2DBRA 2WD7A 2EV9A 3EAGA 3KOUA 4S1VA 3JYQA 1U3TA 4PLCA 5LCXA 3DFUA 4L4SA 2BI8A 2DAPA 4GKBA 2CMDA 3F5QA 3C8MA 5DDIP 3WTBA 3U4HA 2E49A 4D45A 3F4BA 1ISJA 1XLTA 1ENZA 2X4GA 4A03A 1P0FA 3PHIA 4B79A 1NXQA 1R16A 2AQHA 4RDIA 2HMWA 3ZWPA 3NDIA 1MG5A 3O8QB 4FS3A 1PJTA 4NHEA 4GX5A 2C82A 4YT2A 3KXDA 3F9IA 3OETA 3ZWWA 1U7TA 1E3LA 2B0JA 3AY6A 4CQMA 5ER6A 3FI9A 2V6GA 2B4TO 3QVTA 3ULKA 1YVEI 4E5PA 4KTTE 3LSYA 1E1NA 4J2HA 4CUZA 3JSAA 4BNIA 3LT2A 1IE3A 2FPPA 3LK7A 2WSBA 4J1NA 4J49A 1HTBA 4LW8A 4MOWA 2Y1GA 3JCZA 1EUCA 1TT5B 4BV8A 2BF7A 2BELA 4UAGA 3LQFA 3DZJA 5T8KA 3QW2A 4BVAA 1WAMA 4KQWA 4I5DA 2HU2A 4PIVA 5TT1A 3ZV6A 2BGLA 2D2IA 3GG9A 5IDQA 1N92A 1YOVB 3TOXA 4KDFA 3ZV4A 2I65A 3KTDA 2Y1OA 3AM3A 3VOSA 4O63O 2H9IA 4DBZA 3GZ4A 4DBVO 4ZHSA 5TJHA 2AMFA 3Q2KA 3PPIA 3W4JA 3VPSA 3VVBA 3EW7A 1VRWA 3FF4A 4YYZA 1K0UA 4PVCA 1NAHA 3HDYA 5T8KC 3NRCA 1DFIA 2IZ0A 2PTGA 3RUFA 1NASA 3WQRA 2GRAA 1HE3A 2PA3A 3C1OA 1XQ6A 1PJBA 1K5HA 1E0DA 2X58A 1O0SA 4BNHA 3IP3A 5FEUA 3WMWA 3F3SA 3V2GA 5EN4A 3ZW8A 2Q4BA 1ENYA 2VTDA 4HNHA 3W4IA 2O4UX 1HDGO 2NVUA 2X22A 1SB8A 1A9ZA 1K2WA 3L9WA 3UCXA 4B4UA 1AXGA 1R0SA 1ZK0A 4TROA 4BNYA 4ZICA 1KETA 3GG2A 2GN6A 2POQX 3S8MA 3RIHA 2JCXA 4XQ9A 4CV1A 4MIEA 5FF9A 2X0IA 4U0KA 3BMQA 1GZ6A 1Y9EA 1J0XO 4YAGA 3OP4A 1G1AA 1HSOA 4C7JA 1EE2A 1HDRA 1ZK4A 2VHWA 2TMGA 3GVIA 4IIVA 2VT2A 4IZHA 1CERA 2H1SA 2Q1WA 5BNFA 3Q0EA 2HK9A 4PLZA 3ZNOA 3CKYA 1DIBA 3CIFA 4RLHA 1Y6JA 2F00A 1PU2A 2WEKA 3ROMA 4OKIA 2IZZA 5BSFA 1OZAA 5EINA 1LDBA 1JWAB 2DKNA 3RAJA 4WCDA 3SX2A 3G1TA 1GZ3A 5TIIA 3FNFA 3K6JA 1VC2A 3I9LA 4JROA 5TJ9A 1HLPA 5I7VA 3FTNA 3B1KA 2WE8A 2VZ0A 1PZGA 5CP8A 4PLGA 3KM0A 2OP0A 1YS4A 2IXAA 4Y6PA 1S6YA 3NYWA 2C07A 2DUUA 4IJVA 4Q3EA 1VJ0A 4BO7A 2Y0EA 2CSUA 2X23A 4ZRMA 4CLEA 1T2EA 1E1KA 1YGYA 3SEFA 3WLFA 4JLWA 1GUYA 3QWFA 4WJZA 4FC6A 1OI7A 4KUEA 4IJUA 3NUGA 3LU1A 1E5LA 1QKIA 5EERA 1E7YA 3M2PA 3MCVA 1V9LA 5TX7A 5G0SA 5AXDA 1I0ZA 1LLUA 2JAPA 3VTZA 4E12A 1UAGA 4ZQEA 1PWXA 3O9ZA 3DR3A 3S55A 5K9ZA 5G4KB 3DFZA 3DC2A 2IEDA 4J6FA 1PGPA 2EWMA 3JQ8A 1YXMA 2GGSA 4WEQA 4H3VA 3WIDA 2PKQP 1EVJA 3NGXA 1DOHA 4PLHA 7MDHA 3ZWAA 2ZIZA 4ZQFA 2GCGA 4D79A 5JLAA 1V8BA 5A02A 5A5EA 5AVOA 3H9QA 4E3ZA 3S1LA 4MVJE 5CG2A 2LDBA 2P4QA 1T2AA 3WGYA 4BUCA 3CMMA 5JMWA 3KETA 2CY0A 3AY7A 5JW6A 2HJRA 1T24A 1I30A 1KVQA 1OC4A 1DC5A 1LSSA 1ZH8A 1P44A 4RF3A 2EIHA 4A2CA 2WDZA 4I9UA 1T1RA 2QHXA 4RVUA 2J3KA 4ALLA 4O5OA 3BXXA 1PGJA 2O3UA 2X8LA 5L9AA 3E9NA 2XAAA 1WMAA 4IDEA 2J3JA 3ZWXA 1GFSA 1U8XX 3T4EA 4WPGA 2JL1A 2HDHA 1W4ZA 3CEAA 4IPTA 1LDMA 1HYHA 5JAIA 1FDVA 3AOEA 3EC7A 1FDTA 3QVWA 3OJLA 1AE1A 4I5EA 2Y93A 3JQGB 3VAZA 2YY7A 4P38A 2PD3A 2J5QA 3UFXA 3K5PA 3JYNA 2DTDA 4XD2A 2OORA 3WMXA 9LDTA 2C20A 5F1PA 1NX6A 5A9SB 4IDDA 3ONEA 2W98A 3DZKA 2AG5A 3ETDA 1BVRA 1CDOA 1P1RA 1XHLA 4XX0A 3L6OO 1B3RA 3RI3A 3KYDB 1XCBA 3KRTA 4BL5A 3WJAA 3IUPA 1WXDA 2C2YA 3I52A 4RVGA 4DLLA 1Z7BA 4WGGA 3K9QO 4LSWA 3QV1A 3I6QA 4BB5A 4ZGWA 4XRRA 4CLOA 1BXZA 2UAGA 1IL0A 2ILTA 5FWNA 3HG7A 3FHLA 4D0SA 2OL4A 4J7XA 3JQFC 4BNZA 1ZVMA 3V1UA 3F46A 2CVQA 2IYPA 4TVBA 3U49A 4XYGA 4PLTA 1RM5A 3OFSA 3CZRA 3H9EO 1EMDA 2C59A 2DBZA 4J90A 4URFA 3SBOA 1ZMOA 4NR0A 5CPBA 1QYWA 2SCUA 2Y0DA 2CF6A 3FPLA 2EF1A 1C14A 3INTA 1A7AA 4ZQBA 2BRUA 1HEUA 1H0KA 1KC3A 4BGUA 1PR9A 2BMAA 2NU8A 4DMMA 2B83A 3HE3A 3COSA 5KVQA 2GZ2A 3OIDA 5H82A 4GMGA 1X7HA 3GAFA 5F5NA 3IKVA 3NEPX 5EL0A 3KSDO 1KYQA 5B4VA 4Q3AA 3WFJA 5KIAA 4CV0A 1ISIA 3GGPA 5GZ6A 1LDGA 3DZGA 2E6UX 3HHPA 4BNFA 3QIVA 5I8ZA 3TOZA 4D41A 3K92A 4ALMA 3KSUA 3DAPA 3PQDA 1W8DA 1NFRA 3GF4A 4MVJH 4NH4A 3VH1A 5A3JA 5MGBA 5J23A 3GGGA 4HUJA 3C7AA 1YO6A 3RFTA 2ZK7A 3RC1A 2EKPA 4FFRA 5I8WA 3A06A 3EZLA 1LDNA 3QWAA 3UCEA 4QTZA 5JXWA 3TZKA 1HLDA 4QUKA 3VH2A 3O4RA 4K1LA 4YJHB 3UKOA 2EKLA 2G5CA 4N5LA 1GADO 1XWFA 5HBRA 1H5QA 4MVJG 3M2TA 4DYDA 3GUCA 1HRDA 4TWRA 5U9CA 1WDMA 4ALKA 1PL6A 3AUUA 4QFDA 4QT0A 4M1QA 1A7KA 5T6BA 2C0CA 1YB4A 3JQAA 5TT0A 4C7KA 3TNLA 2OXIA 2JFHA 2FZWA 1LDEA 2EXXA 3UICA 3GNTA 3VZRA 2CUKA 2G0TA 3IQDB 4WOJA 4R1TA 2Z5LA 4BO4A 1HE5A 4J7CA 1BHSA 3DMTC 3GK3A 1QYCA 2JJYA 4GX0A 4DIOA 3DBVO 3DO5A 1J6UA 1XKQA 2NQ8A 2W2LD 3H8VA 1DBVO 3KB6A 4IXWA 4KQXA 4DLBA 1I24A 1IHYA 1QYVA 3FBTA 1DC6A 2XF8A 4W7IA 3D3WB 3G1UA 3ZWOA 4LK3A 3E18A 5L7YA 4JGBA 3RU9A 1SCUA 2XOXA 4MKRA 4BQRA 2J3IA 3W8DA 1HZJA 1P74A 1XQ1A 1ZK3A 2CVOA 3DBRA 4D43A 3BHIA 4WE3A 1VKOA 3DAGA 1B8UA 3F5SA 4MIYA 1B16A 2QYSA 4AICA 5KJCA 2PK3A 4KP7A 4KZPA 4B3HA 1ZO8A 2YQ5A 3PZBA 3K30A 2CDBA 4GLLA 5EJ2A 2QX7A 5K0ZA 1E92A 5KKAA 2QRLA 1PJ4A 1DO8A 1YE3A 1I10A 3GNQA 2VWPA 2J5KA 3I9MA 1Y8QB 3UH1A 1PWZA 5TF4A 2ZQZA 4IS3A 1YH3A 2PGJA 3MWEB 3PJDA 3ZNPA 3LLSA 2HCTA 2DPGA 3HADA 1QLJA 3JQ9C 4BQPA 3PZRA 4NMHA 4OM8A 2QG4A 3O03A 4BO9A 1W0CA 5KVCA 3Q11A 2VWGA 3RUDA 3LT4A 4WCFC 3RUEA 2ZJ0A 2EEZA 4AJ2A 1TT5A 4GMFA 1NPYA 3RUHA 2ZYDA 3RKRA 3KYCA 4GWKA 5AXAA 3HJAA 4XR4A 5BSGA 1KVRA 1P1JA 3GVPA 1HDOA 2WWRA 2NTVA 4J7UA 4ZQHA 2BFMA 4YXFA 1LQUA 2Y1EA 3IP1A 2Q3EA 3QQPA 5C7LO 4WK6A 1Z6ZA 4FSHA 3AK4A 1W73A 1YBMA 4NU5A 4BKRA 1D1SA 4RVHA 1LU9A 1KVUA 2V6FA 2G17A 4FJ2A 2Y1FA 2QYTA 3DBHB 1BG6A 1UXJA 2UV8A 4TKLA 5JSFA 2GUGA 1ZIDA 3JD3A 2G82A 4QX6A 4P8RA 4FR5A 2B69A 3ON5A 3FRJA 5KVVA 4D0RA 2WYWA 4KTVE 3MJTA 4CM3A 1Z45A 5DOZA 2V7PA 1NM5A 3WB9A 3RBZA 1ISMA 1EK5A 1CRWG 1H6DA 1MGOA 1G0NA 5I9MA 7ADHA 5U4QA 3E1KA 1D1TA 1I32A 1VPDA 1YDWA 2D3TA 1E3SA 4QFCA 3U09A 4NI5A 2GASA 2I9PA 2YHIA 2FPGA 3PFFA 2C54A 4XDYA 4YT4A 3ZHXA 1RYDA 1BGVA 2TMDA 1BWSA 1C1XA 4KMSA 4NIMA 4BNVA 3DHYA 1YJQA 2WE7A 1Q0HA 3TZQA 1LQTA 5JDIA 3I9KA 3JD1A 3GEMA 1NBOA 5KKCA 2HMVA 2W4QA 1XELA 3E82A 1NFQA 1PGOA 1U3UA 2JKVA 3DZIA 4FC7A 1B8VA 3AWDA 4Z6KA 1KEWA 4LSMA 3WR5A 3GVXA 4XYMA 4WEOA 4PZCA 2P9EA 1X0VA 4MVJF 3GDFA 3WFIA 2I3AA 4JCOA 1V3TA 1I3MA 3JQEA 5L3ZA 4E13A 1SPXA 4UVIA 2PZKA 1E3WB 3G3EA 3BMCB 1DJNA 4I08A 3NKLA 1MFPA 2BD0A 5JYDA 3R0IA 4N5NA 1EVIA 1NVTA 4WLFA 4J4TA 5KJ6A 2GO1A 2I76A 2IDZA 4IJWA 3UHAA 1DRUA 1TVEA 1T2FA 2FN7A 3A28A 3NJ4A 4D3FA 4FGWA 2QW8A 1IZ9A 1U8FO 3C3XA 2HMTA 3GQVA 1ZUD1 1DJQA 4DYVA 4R9SA 1E7QA 1BMDA 2I67A 4GSKA 2CNBA 2VUSA 4P4LA 3RUAA 5CFZA 3L0DA 3KHUA 1F0YA 5DULA 1RM3A 1KC1A 5JCJD 4XGNA 3PQEA 1N9GB 4ROSA 4RLSA 3OECA 2J3HA 2JHFA 3AU8A 1PJ3A 3ZNNA 1CEQA 3GN2A 1SC6A 2B4RO 2Q1SA 2O4CA 4J0EA 1YQDA 5TQVA 1U4SA 1J49A 3NX4A 1GQ2A 1T2DA 5CEJA 1WZIA 1XA0A 3A4VA 4Y6RA 3ITDA 5ICMA 2VCYA 2AG8A 2Q2VA 4NNJA 3M1LA 1E7RA 2PZJA 4J0FA 4UUNA 4AJJA 1E77A 2ZQYA 1W6UA 4NQZA 1M76A 1ZJYA 1I2BA 2QQ5A 2VOJA 1U3WA 3V1YA 4LGVA 1DSSG 2X9GA 4J2OA 5IXYA 4TMFA 3ANMA 3QWHA 3MJEA 3R1IA 4W4TA 2D5AA 2I5PO 1JAYA 1WZEA 5BT9A 4BO5A 3WIEA 1NHWA 3CTMA 3V2HA 3TFQA 3ZGYA 1X0XA 1MG0A 3D64A 4IS2A 3WDSA 5L53A 1N8KA 2Y99A 3FTPA 4NJOA 1JTVA 2HO5A 2DC1A 4K28A 4II3A 1DIRA 1EUZA 5A9TA 1A72A 1ZCJA 2UUPA 3H9JA 4CM1A 3GZNA 1XU7A 1R0KA 4RCVA 4ZA2A 1OOEA 2RBEA 2GN8A 3WBBA 3ZHZA 1ZK1A 2DFDA 3GOHA 3LT1A 5HTOA 3WNVA 1VLLA 2HLPA 3LC7O 1E3EA 3KUXA 2ZTUA 1YBVA 4U0JA 3GRKA 2WD8A 5KJEA 3KEOA 1T4DA 5DP1A 2B5WA 4M49A 4HWKA 4B4OA 1I8TA 3E9QA 4CMIB 3DBLA 5K6AA 4BO2A 1WDLA 3WYEA 3F47A 4GX2A 1EE9A 1VJTA 4R4JA 1ADFA 4Z0PA 4M8SA 5TS3A 4L76A 1E5QA 1LJ8A 2V65A 3AW9A 2PZMA 4B7CA 2VHVA 3I6IA 4II2A 3GVCA 2NSDA 2RHCA 4L74A 3LLVA 3DZBA 4L4RA 3SC6A 4HV4A 1XEAA 2X9VA 4RV9A 1V35A 4WLUA 4EEZA 3UF0A 4DVJA 5K6AC 1B14A 1PZHA 1YL5A 1R4MB 4DC0A 5L51A 3GUYA 1DDOA 3UXYA 2NLOA 3KBOA 4LN1A 1U5AA 2YUTA 1ID1A 3RROA 4CM4A 1G0OA 4IMPA 5EMHA 4Y98A 1EBFA 1WW8A 4E5KA 3W6UA 2ZCUA 4GWGA 4ITUA 4PLPA 1HYEA 2FMUA 5I7EA 3L4SO 2DQ4A 3OA0A 3GPDG 4QSMA 3U3XA 5JAQA 4JNKA 4WCFB 3EYWA 1LC3A 5ITVA 3Q9NA 1T25A 2IEBA 3N74A 5BR7A 4D46A 3WGTA 1HF3A 3SJUA 4YJFA 2HSDA 3EDMA 4YWJA 1YBAA 4W6ZA 4L75A 4E2XA 3GRPA 5F3RA 3WQSB 1BDBA 3A9WA 5GMOA 5AOVA 3ICCA 1MP0A 3H2SA 4YAJA 1ADCA 3D7LA 4PLVA 3CMCO 4B3IA 2BGMA 3E9MA 3PQFA 4H16A 4RVFA 2DTXA 1YL6A 5HA5A 1AUPA 4MVJD 1MV8A 2DT5A 4GLOA 3PXXA 2H5LA 1H93A 1BW9B 1KEVA 1QLHA 2ZKLA 3K2EA 1NPTO 3ROPA 3L6EA 3DDNA 1SOVA 4L9RA 5JNLA 4MO2A 3L9XA 1GAEO 3TZCA 1UXKA 4OOEA 4HNGA 2ZB8A 2DUWA 2HUNA 3RKUA 3RFXA 3FR7A 4DPLA 3INGA 1LA2A 4OYRA 1JU9A 4E21A 2DLDA 4OL9A 2PGDA 4RF2A 4CL8A 4JJGA 4K6FA 2GYYA 1PX0A 4WECA 2ET6A 1DLIA 2PR2A 2Q1TA 3E48A 4CM8A 4U7WA 5L4NA 3IAHA 1RWBA 2NUAA 4KWIA 4NJMA 1Y1PA 3CH6A 1MB4A 2P68A 2J5RA 8ADHA 1GYQA 4IQ8A 2RCYA 1MA0A 1Q7GA 2Z1MA 4PRLA 3EMKA 4I9NA 3AI3A 3RC2A 3UVEA 2LDXA 4GGPA 1X7DA 3ZW9A 3K8ZA 4IGEA 1IOLA 3VPGA 1LRLA 1GEEA 4QXMA 4PG5A 5JCXA 4IDGA 2ZB7A 2JD2A 1OAAA 2NV6A 1MUUA 1C1DA 1EQ2A 1HSZA 5JE8A 3QP9A 3BHMA 1Z73A 1Y8RB 1TLTA 5JY6A 4LCJA 2BGKA 1NAIA 4YACA 1KOLA 1RJWA 3D4PA 4FW8A 3U4IA 3RASA 2RAFA 4CLRB 3LC2O 1OFGA 5DCWA 3WGGA 3MJVA 1Y5RA 2P2SA 2RHRA 3PDUA 1JLLA 4Q3BA 4EI2A 1HZZA 5C37A 1LSUA 1R4NB 2C2XA 2GPTA 3VPHA 1FMCA 3BAZA 1VSVA 3OEWA 1K6XA 1E6WA 5I7SA 4XIYA 4PG4A 4QECA 1PR3A 1BSVA 1VSUA 4ND5A 4CMKA 3IS3A 3AFMA 2GZ1A 2D8AA 4YJGA 2D1YA 1N7HA 2NVBA 4PZEA 4RO0A 4B4VA 3EVNA 5I9NA 4R3WA 2GN9A 2DU8A 3F1KA 1O89A 4IQGA 4EZBA 1GCUA 1OBFO 3LC1O 4CQLA 3ONFA 4N5MA 5JAZA 4ZD6A 1ENOA 1GDHA 1VJ1A 3HFGA 3HWRA 2YQ4A 3D0OA 2CF5A 2Q1UA 4A27A 3OA2A 1LDYA 1UZLA 3QVSA 1PL8A 2ZTVA 1ZSYA 1EK6A 2NNLD 3AJRA 2E37A 1H6CA 4EUFA 1U2GA 1EVZA 1N7GA 2HK7A 3IJRA 2AA3A 5A9RA 1PJCA 3JD4A 4FDAA 2OUIA 5JFOA 2PY6A 3NV9A 2VUUA 5HRUA 1VKNA 3ZDFA 5A06A 5T5QA 3WWZA 4WLNA 4M87A 4YCAA 5IDWA 5CEFA 1NVMB 2NACA 4XYBA 3VVCA 1H6BA 3T4XA 4E30A 1O6ZA 4NFHA 1GPDG 5G0TA 5IZCA 4NFYA 3ZWVA 1DAOA 4PCVA 3BMOB 3MJSA 3GC6A 4DMLA 2FR0A 3QVOA 1BXGA 5EESA 5DBIA 3NGLA 4Y6SA 5JBIA 2O48X 1YWGO 2AW5A 2I6TA 2W90A 3L07A 1GR0A 1KEUA 2V6MA 4BKOA 4EITA 1PQWA 3TN7A 4TRMA 1Z75A 3GN1A 4BNMA 2YHUA 1ZZEA 1C0PA 2IE0A 3GVHA 2CD9A 3K31A 2HK8A 2O2YA 5IZCC 4HP8A 1IYZA 1KS9A 4UUPA 2NTJA 1XR3A 2G76A 1EZ4A 1U5CA 1BXKA 2OBYA 3ASUA 3E5RA 3S2EA 5HM8A 4N7RA 4FPXA 2VRCD 1WMBA 3LT0A 2VTEA 1JAXA 4GVLA 5EQDA 4XRGA 3TFOA 4XWYA 5IFLA 1T1SA 3C7DB 3U4CA 3K73O 1L1FA 1AXEA 2WD7B 3BMNA 1JVSA 2EP5A 3L77A 3BTSA 3GNSA 4JBIA 3AOEC 2BKAA 1PSDA 4RDHA 3PHGA 1F17A 1YJ8A 5L95A 5LDGA 3PTZA 3TJRA 2ZJ1A 4J9UE 3RFVA 4RL6A 1M6WA 3LF1A 4TRRA 4B7XA 1F12A 4CV3A 1F06A 1NWHA 2JCYA 2O2SA 3QWBA 3RUCA 1ZMTA 4E5NA 1Z82A 1UDCA 4H15A 1ML3A 3JYOA 2V6BA 4HFNA 4DUPA 3QA9A 4Q9NA 3GMDA 1R12A 3CXRA 3DWFA 5T67A 4ONEA 3BTOA 3H5NA 4MPDA 2D0IA 4LRTB 2OZPA 3JYPA 5B4TA 2AE2A 4I1IA 2YYYA 3JQ7A 4Y8VA 3WX0A 5IF3A 4J4HA 4CQMB 3GH3A 3IKTA 3PVZA 3ZHBA 2P91A 5TNXA 4OQYA 3JQ6A 3VPFA 4JK3A 4X54A 4O1MA 2ZB3A 1HL3A 4YAEA 3WLEA 5C7OO 4TZKA 3GR6A 1TEHA 3BZUA 3A1NA 4BNGA 4EBFA 5A1TA 1DB3A 2P5YA 3RC7A 3MEQA 1DFHA 1JA9A 2X5KO 3PIIA 4M86A 4R69A 1ISFA 2D5CA 4E2YA 4DQXA 3IC5A 1PIWA 1D4FA 1V0JA 1CWUA 1JVBA 4J1SA 2FZEA 4IUYA 1LX6A 4WNIA 4JBHA 4JBGA 5F1OA 4YQZA 1GUFA 1VL0A 2W2KA 3QWIA 3W1VA 3ZN2A 4RGBA 3RJ9A 2JFFA 3AOGA 2YFHA 3IDSA 3VDQA 4EYEA 4YJDA 3HZZA 3WGZA 3GDOA 3ZNQA 2NQTA 1P1KA 4E5MA 3H65A 3R3SA 5JO9A 4E4YA 1GEGA 3ZWNA 1A4UA 2EJVA 4J9VA 4CMJA 1H9BA 3PDJA 4IDCA 4ZVVA 4BNWA 4FFPA 3MTGA 2Y1DA 2Y1CA 4YEDA 5ADHA 1A9YA 2VYVA 4BOYA 5BQFA 3IOYA 3PHLA 2NVUB 1E7SA 1I3LA 4IBOA 1UR5A 1WLYA 4MP3A 3DQPA 4OXKA 1DLJA 4A0SA 4LISA 3QY9A 3BIOA 4MKXA 3G0OA 3BMQB 3WG9A 2PLAA 3PIDA 1ADGA 2AQ8A 3I4CA 5ENVA 4ID9A 4Q39A 3OM9A 2P9GA 3NDRA 3ANLA 1J5PA 4BS9A 3ASVA 4NBVA 3PFWO 1KY5A 4YBZA 4IQ0A 5KNLA 3HDHA 1HYGA 3WTCA 1NQTA 4XR9A 2AHRA 4BV9A 2B36A 5JDCA 4BNKA 5GZ3A 4EW6A 4I5FA 1TB4A 2NM0A 3ZWBA 1P3DA 3JYLA 1U1IA 4N54A 4RF5A 3NAQA 4CLDA 4ND4A 2XPCA 2WTBA 1ISGA 2JFGA 3LDHA 3HB4X 2W2LA 3ENKA 3HQ4O 5CPFA 4MIOA 5COBA 3PK0A 3FBGA 4FFLA 4AL4A 2R6JA 3KLMX 1TA4A 3O8QA 5TLSA 3RSHA 1OC2A 1XU9A 2D4AA 4KUHA 4IMRA 1B2LA 2PWZA 3ZV3A 4NBWA 4E2ZA 2AXQA 3VZPA 1PEDA 2PKRA 4PFJA 3FNGA 1O9BA 1UP4A 5G0WA 2QIOA 4IDFA 1NPDA 2GZ3A 2HRBA 2XXJA 4DIFA 4TZTA 5L4SA 4GI2A 4D44A 4OXNA 3OJOA 3OBBA 4DQVA 4QO8A 1F14A 4D3DA 1SBYA 3JQCA 2VT3A 9LDBA 1H2BA 3IUSA 3PGXA 2FRDA 2O7QA 3IJPA 4R1SA 3FCOA 3V5NA 2X6TA 1DC4A 3H4VA 1FK8A 2BFPA 4FN4A 5CDUA 3I83A 3TL2A 3VKVA 3JQ8B 1ZEJA 4O59O 3W6ZA 4RJTA 5A03A 4Z9FA 4YTEA 4PG7A 5CDYA 3WGHA 1P31A 2VWHA 5COAA 3UCFA 1A71A 1TT7A 4R01A 3ZZNA 4G2NA 1X15A 1NR7A 3VZSA 2RH4A 1YOVA 4BKQA 4F3YA 2HKIA 4J3FA 5C7IO 2OOSA 3GAZA 2EJWA 4NK4A 3OQ6A 3ABIA 2QRKA 3KV3O 5C3MA 3OF2A 3PWKA 1B15A 3FSRA 3OH8A 4B8ZA 4YR9A 2QRJA 4XGKA 2X86A 1K6JA 3WJ7A 3HFSA 5IG2A 4CM9D 3Q3CA 4BB6A 1SNYA 3MOGA 4FJ1A 1KEPA 5B1YA 4INAA 4YRDA 1ADBA 3PP8A 3ZH2A 4EEXA 1E6EA 1IPEA 2NADA 5CDTA 2PNFA 1Q7BA 3O26A 1B7GO 3QHAA 1PJQA 3DOOA 4MVJM 4LCEA 3ZHYA 3TF5A 5ES3A 3HNPA 4J91A 2UDPA 1X7GA 1UP6A 2Y66A 4NK5A 1IHXA 1EEHA 2BH9A 1O8CA 4ND2A 1M75A 4YDRA 5DT9A 4MVJP 2DBQA 3AUAA 5A5FA 3DMYA 2EW2A 1VE9A 3QE3A 1ARZA 4RORA 2GDZA 4PGFA 3VZQA 1EQUA 3ZU5A 1DRWA 2VNAA 4IDBA 1P77A 4MKZA 4FIZA 1U2DA 3I3OA 4TVOA 3JQBA 5JDIC 2CDAA 1LUAA 3SC4A 3LZ6A 4R68A 2C7GA 3WGOA 3VC7A 4CUKA 4EJ6A 2PZLA 1JKIA 4FOSA 4JJIA 3OJ0A 4J16A 3W8EA 4CLOB 1EFLA 1QORA 2VWQA 4ZRNA 1YB5A 4B8WA 1LLCA 2O3JA 3AU9A 3NT2A 1LLDA 2PH3A 3RWBA 5JAMA 4G5HA 1E6UA 1NVGA 4YB8A 3WSVA 4UEJA 4DXHA 1X13A 1DEHA 1YONA 3D5QA 1AGNA 2X5JO 3JQBC 3H3FA 4XA8A 1Q0QA 1PJSA 3VH3A 4M54A 4FOOA 1NR1A 1NTOA 2Q2QA 3X2EA 3Q9UA 3OQ1A 4CR8A 4DIBA 3N7UA 1HETA 3WGIA 4YAKA 1GZ4A 3CZMA 3UN1A 5G4KA 2I66A 2YV3A 1KY4A 1T4BA 2BHLA 3UOGA 3AM4A 4FD3A 2C5AA 5A05A 5AYVA 5DCYA 1YQXA 1ENPA 1ZJZA 4B4WA 5F1KA 4K9DA 3RUIA 4BO0A 1NQOA 3B6ZA 3ONDA 4IXTA 3ENNA 3O38A 4YPOA 1KERA 4A26A 2O50A 5KTKA 2JD1A 2YJZA 1NP3A 3PI7A 1R37A 4L0QA 3PJEA 3MWDB 3GFGA 4PLWA 2WM3A 3PWZA 2R00A 3WYCA 4U8GA 5DF1A 5B12A 1UZMA 2VUTA 2A92A 4W9NA 1I33A 4A5OA 2IYOA 2Q45A 2YW9A 4B7UA 4Z0TA 1GL3A 2C29D 5AQ1A 1P0CA 5HWSA 4CLXA 1FJHA 1T2CA 1Q2XA 4CLHA 1ZKMA 3NJ8A 1SMKA 1YRLA 4AJEA 1DIAA 2DBVO 4E31A 4NZ9A 1ORRA 2X0JA 3B20A 3CINA 4IINA 3Q2IA 3T7EA 2ZTMA 1U7HA 2BLLA 3WNQA 4GL4A 4F6LA 2R00C 1N2SA 1NHGA 2JCVA 1SEVA 4GGOA 4HXYA 4IJKA 2ZTLA 4CMHA 1N1EA 1GTMA 3PJGA 4YAIA 3OEYA 3QJ5A 1BDMA 2OMEA 3JQAB 3JQGA 4W9NC 2VYND 3EY4A 4ZU3A 3ZI0A 4FCCA 4XB2A 1PZFA 4ND1A 2X7HA 2XXBA 5GY7A 1ULUA 3AUTA 2Q99A 5A9SA 2ZYAA 3K96A 2PH5A 4UUMA 2F1KA 1HDZA 5CHEA 2OHXA 3C1AA 5TC4A 4BMSA 3WSWA 3KYDA 4J4BA 2D59A 3N58A 5BNTA 1PQUA 5L40A 3GEGA 5JO0A 1ZFNA 3FPCA 4EJ0A 3ANNA 1QYDA 1E1LA 1UXIA 3AFNA 4CL3A 1TXGA 3H6KA 1ULSA 1F8FA 5L7TA 2X1HA 2FPIA 4HKTA 4E0BA 2PKQO 4CQMD 2IODA 5ITWA 3DBRB 4O6VA 3SJ7A 1H94A 3PRJA 2CVZA 2WJPA 1XDWA 4IGFA 1HDXA 3D3EA 4RVDA 1CF2O 2GF2A 3M6IA 3QSGA 1P1HA 1ZSVA 3DAFA 1T26A 1E1MA 2A35A 1O5IA 1H9AA 3GT0A 4XGIA 3AI2A 3TRIA 4PN3A 2R2GA 4UEOA 2WMDA 1EFKA 3BHJA 1LNQA 5TGDA 1V3VA 2HJSA 5BSHA 4RQTA 2EP7A 3PWSA 1D7OA 2Q46A 2GSDA 1QV6A 2Q50A 2AQKA 3UAGA 2HRZA 2VHZA 4N18A 3VTFA 2EHDA 2JD0A 1XSEA 4J1TA 4XIJA 4NBTA 5DBGA 3KYCB 4FGSA 5C5IA 1VM6A 4B3JA 3BTVA 3W8FA 1K6IA 4YVFA 5JY1A 4GVXA 1LI4A 3K2BA 1GV0A 1D8AA 1H2HA 2YZ7A 4ALIA 1DXYA 3MZ0A 4MINA 4BHTA 1UXHA 4MVJA 3STHA 4G65A 2Z95A 4UREA 4R51A 1EDOA 4FFOA 2JAHA 1GYPA 1XG5A 3L4BA 2NU6A 2FY8A 3HDQA 3I5MA 4E32A 2FSSA 1NWCA 2PV7A 2DFVA 3D5TA 3OSUA 1ZK2A 3ADOA 2HQ1A 3DB2A 4R5MA 2QZZA 4W99A 4WASA 3RC9A 1C3VA 4RPKA 3EK2A 4Q3DA 4CUJA 2AEJA 1LRKA 4WKGA 4YJHA 1D3AA 1GY8A 1CJCA 1C0IA 1LC0A 4GQAA 3FNHA 4HBGA 4A10A 3HDJA 3HN7A 2YHIB 3E5MA 3L4BC 4AVYA 1Q7CA 2OGUA 3V8BA 3H9UA 3GEDA 4OSPA 1C1XB 4P4NA 5H83A 1P45A 3GPIA 4XKJA 1IPFA 1G6KA 4BO8A 2I3GA 3I23A 4I9HA 1PTJA 5MDHA 3Q6IA 4JQCA 5AXBA 2A4KA 4OJNA 4AJPA 3I9JA 5H81A 1QG6A 1VL8A 3DHEA 3WYBA 4ZQGA 4ZN6A 1C0LA 3HUDA 4IDAA 2AEFA 4K6CA 4GPD1 1I36A 2YV1A 4OSOA 2PFGA 3I9OA 3I9NA 4OIMA 4PVDA 2O3RA 3VPXA 5CDGA 4RZHA 1NQAO 1RM4A 3ZU2A 4XYLA 4BIIA 1M67A 3WOHA 4KDEA 4BNUA 1MLDA 2HMUA 1MXFA 1V6AA 3B70A 3D3WA 3D1LA 5ICSA 4K26A 4OOFA 5KOIA 1BRMA 1L7EA 1QR6A 2EG9A 4LMRA 4BNXA 3ROKA 1E3IA 3DHNA 5AXCA 1SZJG 4A7PA 1FDSA 4IIUA 2UYYA 4YT5A 4PRKA 4QEDA 6LDHA 3JD0A 3LF2A 4FBGA 1DC3A 4OH1A 3OICA 1WPQA 3JQDA 2PD6A 3UGKA 5DBFA 2OO5A 4J43A 3ICPA 1CQJA 4GH5A 3PHHA 3WS7A 1Y8QA 3H7AA 4AJNA 2VQ3A 2B35A 2UUOA 1R15A 4WLOA 4Y67A 1GUZA 4TKMA 3GFBA 3WXBA 1ONPA 4AJOA 3H5RA 3E8XA 3OQBA 3L6DA 5L4LA 5JYEA 5DP2A 2J6IA 4TSKA 1UJMA 3ZU3A 3FWZA 3KEQA 2EW8A 2X0RA 1U9JA 3QVXA 1U3VA 3R6DA 4QQRA 2IZ1A 4FQ8A 4CM5A 2X0NA 4YQYA 5DNAA 1SOWA 1GPJA 4R1UA 4JX8A 1ONNA 4H7PA 4F45A 1QV7A 4ILKA 3DTTA 4OXYA 4GBJA 4TRJA 1ZBQA 4JJFA 4NBUA 4Y9DA 3DBHA 1PS0A 3RCBA 4ZJUA 3P7MA 3PLRA 5JC1A 1QXSA 3JD2A 5IDXA 5ENDA 3KZVA 3VHRA 3GZNB 2C7VA 1K89A 3JV7A 4TQGA 3HB5X 3TSCA 3SVTA 1Z74A
chains in the Genus database with same CATH superfamily
5U4XA 4CR7A 2Z98A 3Q7TA 1XRRA 5HKKD 3LP6A 4YA6A 2YVUA 4L7QA 1RPZA 1U0LA 1P4RA 5FPPA 4WOKA 3V1TC 4WWHA 5LJLA 1MHTA 1JKMA 2SECE 4KHPB 4WN3A 3VDNB 3KQTA 4RYLA 2QP9X 3LVRE 4R40A 4D9NA 2FE4A 2FP4A 2HAEA 4GKVA 4HTFB 4YREA 4GR4A 2WUFA 4NS4A 4EJFA 4ZYTA 2GPSA 2IYFA 3DBLB 5FWXA 5C8YB 2DHRA 3QX7A 2H9YA 4HADA 4GU5A 1K75A 1S8NA 2EGHA 1X14A 3HUUA 5D3MB 1UKZA 4HN4B 5L6LB 4RMIA 10MHA 3PYMA 1W9HA 3CCFA 2IZ7A 2H5EA 1BWPA 4Z3DA 5B4UA 3ETJA 1PNRA 2XE6A 5F3WB 4E7OA 4TUYB 1ZOOA 4TV9B 3KTOA 2OVFA 4DDUA 1OPRA 1IEXA 4AURA 4LJSA 2GCPA 2G0NA 3ZWYA 1HWYA 1PV4A 3N7TA 1GTRA 4HLUA 2C99A 5KTOA 5CNJA 2DTEA 5LBTA 1BO6A 2WNSA 2XNCA 4JGGA 3WRYC 5KTYA 1UXGA 2QT9A 1E0KA 1YACA 2FG5A 1UDXA 2CC2A 3WYFA 4FT2A 1JEAA 4X7BA 2OK8A 1M2KA 4Q1AA 5ALVA 4HWTA 3QIAA 1AURA 4HDKB 4ZAYA 2WMOB 2YWRA 4JX9A 4D3SA 3GU3A 1EFPB 3NT5A 3E7FA 3L0ZA 4M1YA 4QTTB 3UK2A 2Q4DA 3LYLA 4GP6A 1TTQB 4HNQA 3MCWA 2RC5A 4O4HA 5AFSA 4P4UA 5B5SA 1RJ9A 3D6UA 2BN4A 3I9V6 3QRWA 4G09A 3NATA 3TRJA 4E33A 1SOAA 2O2GA 4GXNA 4OBXA 4HFRA 1COZA 4IIBA 3JPYA 2G6BA 2FW7A 2ORED 4DC1A 4CKXA 4ZHQA 4XTRA 4PG6A 2P0YA 1M2HA 2YV2A 4KYTA 2Q5HA 1E2JA 1U7PA 5CT9A 4YV7A 2H4FA 1RQLA 3BA1A 5FWDA 4DYHA 2COUA 1GXSA 1XXHB 1JDZA 3C97A 4NPCA 4CU5A 3WLAA 2PA0A 1LXCA 3N8DA 4OI1A 2Y77A 1B4DA 4RIEA 2EX1A 2R62A 1L9KA 1Y3FE 5IJ0A 2PIDA 2QPTA 5A04A 2XLBA 5TGZA 5THKA 3AETB 3IL2A 4UJ3A 2DPMA 3P2OA 2OP1A 4TX1A 4WDQA 3V55A 1XDGA 2ZR0A 1CQXA 3P20A 3KKQA 3GLGE 2R8EA 3C1TA 1ILWA 4TRNA 5AI0A 3WFZA 3G17A 3SQNA 3ACCA 3DVQX 4R3NA 3USZA 4ZK2A 3BXZA 2E48A 4GSYA 1T5TA 3H0KA 1JDJA 3IEUA 3TTWA 4EPVA 3CE6A 3JRNA 4ZCIA 1QK3A 1SXPA 2HPZA 4KDCA 1U0NA 4CEIA 4LHXA 1A4XA 5ILGA 4CMEA 4R1NA 4NJEA 4A8PA 5A4DA 4BU1A 2X2EA 3DCYA 3C14C 4LVUA 4XWTA 3D4OA 1V2HE 5JZOA 3FPBA 1EK0A 3ACBA 3LX5A 2Y67A 3CJRA 1U0BB 4D9MA 3NORA 1A9SA 5EZ6B 4TTIA 2GN0A 5B7GA 5HNKA 1FDWA 3P9PA 1RXUA 1ZNQO 2V6JA 4XVQA 1RR6A 5FUVA 2OGTA 4CU2A 8LDHA 1XTRA 3G23A 2H59A 5EQTA 1VI5A 2O8BA 2A8YA 5FI5A 3FCSB 1T2NA 4U7DA 2P2GA 4IY1A 4C2BA 3H9BA 4RTNA 3MLBA 1UUFA 2YDYA 3BAFA 2CBGA 4JUCA 2Q9UA 4S1TA 1U4OA 3B3AA 2BC9A 2C3YA 3OOSA 4NECA 4ZANA 4EG6A 3VR5H 3DMTA 3LY7A 5I9TA 4OQXA 2GM4A 4PS0A 3ZWMA 2WWTA 4IYRA 4EFNA 5IC4A 4PXAA 4EAQA 1V16A 4XQCA 3BOSA 5IF9A 1MX9A 2UVDA 4Q0MA 1RPNA 5BN3B 4M1KA 4NYIQ 5K3CA 3H3JA 3DF7A 5CA0B 5JWOA 1KRXA 3KD2A 4DR4B 5H9WA 1Z16A 3CUKA 4NZZA 3A70A 1MJFA 3BIJA 5CEEA 1DIOB 4R9UC 4JN6B 1JLLB 1NJGA 4JIGA 2QUIA 1KIFA 1CCWA 1MB2A 2DPLA 3A10A 3JTMA 1B73A 3H2JA 4IHKA 4L27A 4MVJI 1ISHA 1FF9A 2DZDA 1LPMA 2O3SA 1IY8A 2BTOA 1K68A 1YCGA 4H0NA 3TFWA 1VL6A 4Z0NA 2C78A 1AHHA 2OBXA 2A9RA 2ZWVA 4GKAA 3HN2A 4HYEA 5EPOA 5DLYA 3FOEC 1DX6A 1NDUA 1V9CA 2BEJA 2GRUA 1A9OA 1QAOA 3LWNA 5JDCC 3QHQA 1FNBA 3RD5A 3AVTA 4YJGB 4I8IA 2PAAA 1Z68A 2VP4A 4IM7A 5FFNA 2B37A 3GLHA 4O5AA 4WV3A 2WM2A 1B74A 3MIZA 1VOTA 4OXQA 4UFPA 1QSGA 2DHDA 3B7GA 4MQEA 4EB0A 4OGWA 1IZYA 1F4LA 4RA9B 2V7GA 3HJCA 1Q0LA 2GCNA 1YZNA 3G0CA 2VT7A 3KQPA 4F1WA 2A9FA 3SDSA 4CDGA 4MDHA 3HWX1 1KK3A 4OHUA 1CP3A 3RPEA 3AM5A 4WCFA 1M9NA 3UHPA 4FGKA 1T4CA 1UBNA 1QRTA 1HTTA 2H7YA 2VYFA 1NW4A 1XGKA 1M8FA 3MW8A 1IB6A 1X7XA 1Y33E 4R2IA 4Q9LA 5F7JA 2JHGA 1TAQA 2RK4A 4TLCA 4EGFA 4PNEA 1QKJA 4MTCA 2YMPA 1KYYA 4BXOA 2FG7C 2ZIVB 3DTNA 3H19A 4LDRA 5F5XA 5EJAA 2WZBA 2ZRGA 4HN9A 3VDXA 2OCYC 5EC8A 2IHKA 3EAFA 1XYGA 4QPJC 3GLGB 1BQ3A 5EAIA 2ZOSA 2H2FA 3B36A 3ZWCA 4DLXA 2CHQA 1YMVA 2NO4A 6AT1A 2HQSA 1GZHB 2FMXA 2ZUBA 1FQJA 4QELA 1AIPA 4ZU1X 4AX8A 4DRXB 2JIQA 4G1MB 5A3SA 3K8YA 3MOIA 1SVIA 3OIGA 1SRRA 16PKA 4RDCA 2FSVA 1Y9AA 3M81A 1DXOA 3T5DA 5LQRA 5FEMA 4G23A 4ZT2A 1ZUNB 2GCOA 3NTOA 4M55A 4PRZA 2W6PA 2VTVA 1UK6A 3GDGA 3S2GA 4Y1GA 1RYEA 4AIRA 1XTJA 4MUHA 3EGCA 5F5LA 1FNMA 5IKOA 3UMBA 4BNTA 4JUFA 4CJXA 1NVEA 4ENWA 2GAOA 3SQDA 2WJZB 1J4AA 2RIRA 1FXUA 1P6QA 3DW3X 5SY4A 3OTGA 4DQUA 2FSGA 4C3UA 2Y0CA 2GZMA 4MMXB 3S29A 4CM9A 2Z1DA 4MGEA 2OGSA 5LNK1 1ORIA 4ZOLF 3LOPA 5I4CA 2Z6VA 2ZUUA 4TLBA 4B0OA 4F5YA 4GO1A 2RIPA 3RYHA 2G1AA 4KO8A 3RKSA 4EVRA 3I1JA 2PD4A 5DYNA 1FYFA 1POXA 2CD7A 1YK0A 3AT1A 4XEHA 4OKNA 4R1LA 4TXHA 1LLQA 2GFQA 4ZOAA 1K66A 2JIMA 3U4DA 4BKUA 3FMIA 2FEAA 4G0VA 3T38A 4I5GA 3PLNA 5TXGA 3OIFA 3W04A 1O0BA 4J0HA 1DRVA 1NQ5A 3KFXA 3NT4A 5IP5A 4Q1DA 3EVDA 1XA3A 1LRJA 1WCXA 1J22A 1G5IA 2OV6A 2PRKA 4L73A 4CMBA 5BPHA 3S0JA 1JFLA 3I61A 3UXHA 4LPSA 1KHTA 2BP7B 1BROA 3TSAA 1YIOA 1U1EA 2C2ZA 4KWTA 3U3RA 3O8OB 5DCUA 1JEJA 2GBLA 2Q6OA 1EHIA 5EIWA 4TWZA 4ABYA 4Z4FA 4FB5A 5IU6A 3F9RA 1BFKA 2JKYA 3FDXA 2H1VA 4L6AA 2PFKA 2H1FA 4BBAA 1GR1A 1ZXLA 1VCHA 4LRXA 3PEVA 1GYRA 3PVCA 1ISRA 1I3NA 1R4NA 3AUXA 4MWTA 4X8MA 4XAQA 1KORA 5BT8A 4O0LA 4A15A 1FYVA 4NDZA 4YRZA 4LNHA 1L5VA 4IQFA 2BFAA 3UUWA 4PC3A 5I45A 5FXMA 1JFTA 1HEIA 4LI0A 1S2DA 3WWYA 4B75A 4RXMA 2QUJA 4D2IA 4FOLA 4TKVB 4AZ0B 2I22A 4XI9A 1WB9A 1I6LA 4V02A 4EY7A 3AUYA 4OLAA 3V4PB 1P2UA 4E2WA 5AOCA 3GGDA 1KZ4A 2VL7A 4EUSA 1I01A 2Q5LA 4EPWA 3U60B 3GY0A 1K63A 2HRDA 3K0CA 4PHHA 1EX7A 1JHAA 1BMTA 4PO1A 2EQ5A 4MQ5A 2ZB4A 2JC3A 3R09A 1D6MA 4GX1A 3O21A 4DRYA 1R10A 1O94A 3W2HA 2F7SA 1N6RA 1WVGA 1XJWA 2X5OA 2ZCVA 2WAAA 4ZVPA 5KWEA 1AM4D 2F8SA 3C3JA 3M9WA 1N8SA 2QQGA 1QQAA 1CZUA 3DDZX 2JIRA 4FNGA 1XIVA 2VXCA 3UMVA 4P0QB 5DGHA 2WFZA 3T1NA 1T9BA 3ZX5A 4Y6QA 3LL7A 5AT1A 4MB6A 4EHKA 5A62A 1MC5A 2PXCA 4O08A 5I9SA 1MDFA 1RWNA 2EX4A 2R7KA 4JB8A 2HMSA 3GLVA 3AGPA 4UOEA 4HH1A 3MHTA 3OT1B 4Q7MB 4Z8YA 1L4MA 3ILVA 1TYDE 2HCRA 2LIVA 4MUEA 4F86A 1EUDA 3Q8KA 3KKZA 3OUUA 3SSNA 3LKBA 4CETA 1P7VA 1VL1A 4P5DA 2BT4A 3RU7A 4BO6A 3X1WA 5IUJC 4E6PA 4AD8A 2ZB2A 3CF6R 3CFYA 3R0XA 5K0NA 1XNQB 3EIFA 3G2LA 3BYZA 1PG2A 3ENZA 1EWTA 1R0LA 3RSZA 1Y5LA 3UMSA 1REQB 3ORFA 4QOIA 2R8BA 1OYYA 2Q2WA 1CZHA 2YNMA 5T3UA 4M76B 4YJ2A 3ND7A 4ATNA 1CZLA 3KVOA 3OTWA 4C29A 4CIVA 2GNAA 5BRNA 3WBFA 2VNIA 3Q41A 4LZPA 1ZN7A 2QG6A 1D5CA 3THYA 1VI2A 2UVPA 3AJDA 4JBYA 3NI2A 3COPA 3E9YA 4BO3A 1SCBA 2IX9A 4XJTA 1N3IA 3L1VA 1FVHA 3CSDA 4WUVA 5FT9A 3UC9A 1KVSA 1BTOA 4MA5A 2QUZA 3EXG1 5DN6A 3RRBA 4YRMA 5IVPA 4DCJA 3E6AA 3L7JA 5HK9A 3GRAA 1SXJC 4UUBA 1OBOA 5CVEA 1DIGA 4LJAA 2FN8A 3NC0C 2KQUA 5EQFA 4DJAA 2XJ4A 3VJLA 2II6A 4GSLA 5KNDA 2I62A 1SHZA 3OY2A 1VHWA 3Q0TA 4PPYA 4R1QA 4RPGA 5EE3A 5CDFA 4N3GA 3E1GA 3JARA 3QX8A 5BN4B 3CLKA 3WLJA 2GILA 2P78A 3BN3A 1IBCA 3E4DA 4M53A 4YT8A 3KLPX 4CDNA 3HL4A 1U8UA 5DBEX 1Q1QA 1T8PA 3PNQA 1M7GA 4Z3KA 4PS1A 2P67A 4ARZA 1XPUA 4V0LA 3DL2A 3RC3A 4Q48A 1UKBA 1N2GA 4K3VA 1QZZA 1SC3A 1XEXA 4G4SP 3ESXA 4F4UA 3CRMA 2C8VA 2F64A 4V1CA 1AGRA 3GMSA 1IRXA 5AHOA 2PM8A 3DONA 1N0UA 4IRMA 2QTAA 1MOSA 3HSKA 2KMLA 1W7AA 3FSGA 3N07A 4JJ6A 2C8LA 3DDWA 3PFCA 5JS7A 1IN6A 4AULA 4OYLA 3CX7A 3I0NA 2DAPA 3VX4A 2CMDA 1MIHA 3C8MA 3O3CA 4LRUA 1G59A 2O8CA 3N86A 4QG7A 4XSGA 2HIGA 4F7DA 1B76A 2E49A 1WKVA 2HI0A 3PDIA 4LC1A 4EOGA 4A03A 4X92A 1ENZA 2QORA 1BH2A 1HBJA 1Z4PX 4PAMA 1P72A 2AYXA 5FL7D 2LTAA 4ZWNA 2J3EA 5SV2A 2AQHA 3ZWPA 3AHDA 3O8QB 1PJTA 1RKBA 3ZDCA 4GX5A 5FDFA 1MIOA 2I7CA 2B1QA 3QLVA 4YT2A 3B6EA 4QUAA 3V32A 3FYSA 5JJ5A 1EFPA 2WHPA 1CQZA 2I29A 4BP3A 4AMVA 3FI9A 1NZDA 2B4TO 2IYVA 4E5PA 5LKAA 1RP7A 4KTTE 1WSBA 1A5TA 3OZRA 3CJTA 3H5LA 3ACDA 4AO7A 3JSAA 1XP8A 2DUMA 4MV6A 2G8LA 5GJWC 3WYGA 1L5SA 1QPZA 1YS7A 1VMIA 4J49A 4LW8A 3ZXSA 3P4XA 1KH2A 3SYMA 4QYTA 1A8IA 5DTQA 3NBMA 3SZRA 5KWVA 3A31A 2VSOA 3QSYA 2QAGC 1K7EB 2IEZA 1RP1A 5ALUA 2Q3HA 4ZI5A 3O4VA 3RRXA 5ESXA 1UKVY 3LKVA 1FVFA 2UUBB 5G1OA 4QNNA 4RKYA 2HU2A 3ZE1B 4FLEA 1DJLA 2WOOA 4OFZA 1CVIA 3PA6A 4I3GA 3BG5A 3FGZA 3KXLA 5JSYA 5FI0B 5IDQA 1HNXB 2JI8A 3HTXA 3IP6A 3T7TA 1IM2A 2Y1OA 2ROQA 1A8SA 1TEXA 4KXQA 3VOSA 4DBZA 3OLCX 2QE7D 1C0EA 1M6NA 1SXJE 2LR0A 5TQ2A 2NV0A 3OM8A 2GBPA 4DDMA 2AOTB 1OLSB 3VVBA 2JVIA 4I4TF 1V8PA 4HXFB 1KI3A 3ET4A 3PCTA 5C9ZA 3ET5A 2CLOB 3IO5A 2ZJAA 3EXIA 3PRYA 1PJBA 5C0OE 2X58A 2AKYA 2N9UA 1O0SA 1DKUA 1EFTA 3FDIA 4OJYA 2DY0A 1OLUA 1F9AA 1HOXA 1AB6A 1OWOA 3WMWA 4JL6A 3C3BA 2RGUA 2V0NA 5F23A 3BSFA 3PB3A 5K99A 1QU2A 3EEYA 2O4UX 1KI6A 1TFUA 4N01A 2GEBA 1A9ZA 3EUEA 3UWDA 1AXGA 4BB9A 3EOBI 2NN3C 1FOEB 1OGIA 4N5HX 2POQX 4PC6A 1K5DA 4QQNA 4M22A 4HB3A 3O4IA 4CV1A 1AZSC 3T95A 3HGMA 4E88A 4BN5A 1Y9EA 2GWHA 3PXGA 2P62A 4K86A 3JPWA 4TVSA 3THXB 2JGKA 1Y1RA 3B53X 4EWLA 2QSUA 2TMGA 2V55B 1TJNA 2VT2A 3A0UA 5KQPA 2PCLA 1X7WB 3Q0EA 3UJCA 1IB0A 3RC8A 1ZRHA 2HK9A 3QW4B 2J41A 2E21A 3ZCUA 3IV9A 4TYPA 3ZNOA 3CKYA 2FQ1A 1DIBA 2CXSA 3I1IA 4GNRA 2PX6A 3HJHA 4HWRA 3CNNA 1PU2A 3K32A 2YBEA 4FDUA 1GUDA 3R9IA 1OH8A 4E22A 2OHIA 2DKNA 2OFXA 3G13A 8GPBA 4TV8F 1ZM2A 2Q3CA 2HY7A 3I73A 3K35A 5HGJA 4OVKA 2O0JA 2PLRA 4J29A 3C15C 5TJ9A 2J4FA 2ZWPA 4M7OA 3WP1B 3ZGVA 4ZYLA 5BMVB 5BRJA 3USES 1XZBA 2VZ0A 2WQ7A 4W8GA 5CP8A 1GSOA 3M4ZA 4IMJB 2P4EA 4BE9A 1J8DA 4N7MA 1LK7A 1BN7A 1Y3IA 3I2FA 2IUFA 4IJ6A 1ULZA 4UNNA 4H7HA 1GG9A 1S6YA 1JL3A 3NYWA 2C07A 2NSHA 3OT5A 2PQMA 3HJBA 4P93A 3OZIA 2Y0EA 2CSUA 2M32A 3C6XA 4B32A 4BO7A 1HLGA 2D1SA 1KIMA 1E1KA 4XXHA 1H4QA 1VHTA 3ME5A 1WP9A 3SEFA 1ZNYA 3RF6A 1OASA 1O03A 1GUYA 1Z4OA 1G7TA 1WULS 2QD3A 1T3HA 1XCJA 4FC6A 5CVJA 3RIYA 5MF6A 3SJBA 1L5LA 3SXUA 5KMGB 5LQAA 5LYJF 3AL0C 3LU1A 4C2UA 4O2RA 3I30X 4KOEC 1E7YA 1Z38A 1ICEA 3LUKA 4MQ4A 3NHFA 4YUAA 5K2OA 3UQZA 2GNPA 1LLUA 5SZJA 4DVGA 2W4IA 1I4TD 1E8NA 2QN2A 2WAMA 3AIOA 2HYIC 3OU6A 4BBJA 1CY0A 3DVRX 3IMCA 1NF9A 1E79D 5GQSA 1F0NA 3RG2A 2M1XA 5CW1A 3UK1A 3OLWA 3ENQA 3FUUA 5LA6B 1PGPA 4TL6A 3JQ8A 3KZNA 1GKLA 4RW0A 3WIDA 4ACAA 2PKQP 5TY0A 4EHJA 1GSAA 4CKEA 2R96A 4P3NA 1G8KA 4ZQFA 2GCGA 4D79A 3JQPA 4EFLA 1BQ4A 3A1DA 4R2MA 3M6WA 3L7NA 1UPCA 4JT2A 5ALXA 1MB0A 1JLSA 1KFKB 1SXJB 5JH7A 3CPHA 4MVJE 3KWJA 3EWSA 5AI8A 5FBHA 1T2AA 4K40A 1T3LA 4BUCA 1CUXA 4NF2A 2Y1KA 3AY7A 5EFZA 2D7CA 1M2EA 2QAIA 1T24A 2ZU6A 3ML1A 4HPXB 4LJ7A 4B6RA 2E18A 2AJDA 1N2CE 2BONA 1XVIA 3M4YA 3OOYA 4HEJA 1LSSA 5CFRA 2QTMA 2WUGA 3D7SA 1ND6A 4WNAB 4RTOA 1NN3A 4G41A 4M0KA 4RZQA 1ODIA 1IG3A 3LDFA 4I9UA 1T3ZA 1TA9A 2PAFA 3N6VA 1D2MA 1IHDA 3HHEA 3A2LA 2QL9A 2C4UA 2XAAA 5IAKA 5K8VA 1WMAA 3ND5A 2J3JA 1WXGA 5CLGA 2J6HA 1U8XX 4WPGA 2HDHA 2IH4A 1GKKA 3FLBA 3HFJA 2YYAA 4WFQA 2GD6A 2FCAA 3CEAA 4JI7B 1IJBA 4RMHA 4I55A 2C2HA 4H77A 4XTCS 2YY7A 3L7DA 3OZTA 1UPAA 5D7NA 2J5QA 3UFXA 4POAA 2CBXA 1ACMA 5KWSA 1O96A 3ZJVA 4ETWA 3QXCA 3UWMA 2HOQA 2JAWA 2LBPA 2C58A 2O06A 4L8GA 4UUAA 1MOPA 5TPWB 1CKEA 1VHLA 3RGGA 3RTAA 3V8MA 2PUJA 3B3JA 3L0CA 4DQKA 2GYWA 1J21A 1T6YA 3ETDA 4LVNA 4ZI2A 1OXSC 2XIJA 4YP7A 5K51A 1AC5A 2EBUA 5IMBA 2ATVA 2JATA 3KHSA 1FDRA 3OE4A 1TYBE 3A1CA 1TMKA 3F7MA 1XCBA 2FSFA 1CX9B 3KB1A 4PHFA 1CS4C 1IK4A 2ZRLA 4BL5A 3DE2X 4C6TB 1JYFA 3I52A 1YDMA 2QLNA 2V7UA 4DLLA 4XWOA 4KAXA 5JCOA 8AT1A 1LZKA 3RSGA 1TJ4A 3I6QA 1DAKA 1TE2A 4G1VA 4KMOA 2QP3A 4D9BA 3NJRA 3JZMA 4GLFA 4X94A 2FPIB 3KDSE 2UAGA 1RXWA 4Y2XA 4MI3A 2VHQA 2UXBB 4O4IA 2H57A 1S96A 2Q62A 3RTBA 4E5DA 4QRHA 4UHBA 1X8JA 1XTBA 2J85A 1NT4A 1RXCA 3MJDA 3ES9A 3JQFC 4EP1A 4L3VA 1BYUA 3E0XA 2YJTD 2GJSA 1IN8A 4JVLA 2HGSA 3BD8A 4TVBA 3RYFB 1XK7A 3PF8A 3QTBA 4XYGA 2QAGB 3MCTA 5BWBA 1BCSB 3EXFB 1RYYA 1VYUA 1UMBB 3CZRA 3H9EO 4PYRA 4IKPA 1IXZA 1SXHA 4WOCA 3DO6A 3ZZUA 3RS2A 2Y0DA 3TRKA 1LD3A 1E8MA 1E9AA 2HIMA 3FPLA 5A5GA 3L7KA 4RHUA 4EA6A 5DGIA 5A3RA 5JU6A 3HK2A 4LVOA 7MHTA 1NW8A 5SYAA 2YY6A 1P7ZA 3DYBA 3TCNA 2CHEA 4BGUA 1P5ZB 1K3UB 2J0UA 5DE3A 4RTKA 2FUG1 4JJZA 1SVOA 1NBIA 2CBZA 1R0BA 5DNVA 4YMTA 4ZCRA 2UUCB 3F3KA 2QM0A 4L5CA 3C39A 4AJ9A 3COSA 1TLFA 5KVQA 1EFAA 3OIDA 3VAYA 2W2XA 1FRVA 4G07A 5F78A 5H7XA 2A1UA 3IKVA 4ZEOA 4FFVA 4K0RA 2RBKA 5DXFA 3GW8A 3EQ2A 3H8WA 2YIVX 2QTVB 2G25A 3KSDO 3WFJA 1DAFA 2BJWA 4F85A 2GEKA 3GGPA 1LDGA 4E15A 2W43A 4KR0A 3R4VA 4NFLA 5DNYB 2AOWA 2GS9A 4DV4B 3O2SB 4AY5A 4U7JA 3LAWA 4D41A 3BWMA 4F96A 2G4VA 3TEMA 4UCWA 1N2CB 2H92A 5ALPA 4MULA 1YZUA 4NH4A 5G3ZA 3WYNA 3GGGA 3QEOA 4HUJA 1IJEA 2BFCB 3IPLA 3C7AA 1OIXA 1P4HA 1Z0AA 1YO6A 2BMFA 4N0PA 3RFTA 4A16A 4BTEA 3WOVA 4RY9A 2YHAA 1NYLA 1SRQA 4FFRA 4LJYA 1XV5A 3RC1A 3A06A 4AZVA 1T9HA 1DOZA 3QWAA 2ZI6A 4JLSA 3UXMA 4E09A 1FW8A 2IP1A 2QTLA 3E9DA 3HA2A 1ESDA 2ZRAA 4K9KA 5AJYA 5EZYA 2V1UA 3TZKA 1I4OA 4QUKA 3VH2A 3ETNA 5AK5A 3O4RA 5F2OA 3VSCA 3QKRB 3T5TA 3IULA 5FPYA 5BWCA 1TA0A 3OIVA 4AUNA 1QTIA 3SQLA 4MHTA 5ED4A 4B5KA 4RU1A 3L7OA 2I1QA 3OQMA 1R3DA 2H2HA 5C2JB 2L19A 1NURA 1D4OA 3KHKA 4BX3A 4IDHA 1E2HA 3CH7A 3A6GA 1PL6A 1SQ6A 4QT0A 2OZVA 3V34A 4ZZ2A 5DPMA 4EHBA 2ERCA 4EK9A 2W0MA 3K9WA 2XTAA 3G2QA 3OAAD 2FZWA 1LDEA 2ZRJA 2XKBA 1G7CA 1KMNA 4UTNA 3GNTA 3NP9A 1CZNA 2CUKA 3P2IA 2YHBA 4JVMA 1BJKA 3P26A 4JU8A 2YJ3A 3RODA 3CEHA 3GK3A 2WKSA 3LDUA 3HC7A 2OK7A 2I3DA 2ORVA 4OQEA 5CGQB 3A25A 3ABSB 1XKQA 5HFJA 2HHLA 1FFXB 1RRVA 2W2LD 2WJHA 3H8VA 3R3YA 3KB6A 2C7BA 1D03A 4IEIA 4IXWA 4KQXA 1XZDA 4DCGA 4DLBA 5JHHB 2PRIA 3R5FA 4DS3A 1R8XA 1N5LA 5C80A 2E1RA 3WB0A 4ZI7B 3F2VA 2M1ZA 2QZSA 2XVZA 1DC6A 2XF8A 2FDCA 4W7IA 1F7VA 4LNAA 2JH3A 2IS1A 5CYOA 1K98A 1U2RA 4P3PA 4QBFA 3WIVA 3EIUA 3ZWOA 5L7YA 4QE3A 4C0AC 4R31A 3QPCA 5IM4F 1SCUA 5HIIA 3KOYA 4RJ2A 4D8VA 2UUAB 2AMLA 4CTJA 4B87A 2ZVQX 1P74A 2LE0A 3PEEA 1H3NA 1USWA 2B92A 2X41A 4QYWA 4ER3A 1QF6A 4N7JA 5G1NA 3UIEA 4PZAA 4HGRA 4Z2AA 2PSDA 1Z63A 3F5SA 4UD2A 2E9SA 3IUYA 4NAHA 3INYA 3PEUA 2WB4A 2Z30A 3CNBA 4KN9S 4Q5IA 3GFOA 5DTEA 5AM4A 4HNUA 4YFYA 4YDHB 1CEXA 4KZPA 5D51S 2XUHA 4B3HA 2V4MA 1TCBA 4DANA 4Z7JA 1Z5WA 2OD2A 4Q9AA 3I39X 1IHPA 5EJ2A 5BSRA 3VU9B 4TKUA 4EG5A 2QRLA 1HT2E 4CVNA 1CQJB 1YE3A 5FUMA 1TUBA 4S04A 4RUKA 2HCFA 3I9MA 5JQWA 3AG6A 3L3BA 2XMGA 4AI6A 5F98A 1A97A 1YCHA 2JK0A 2B98A 2DPGA 1QLJA 3VKWA 4BQPA 3VR2A 4H6XA 1O4WA 2C8KA 4BO9A 2DOKA 4KAFA 3TLGB 3RUEA 3YASA 5LZ4A 1X3LA 2R86A 1OXUA 2VHTA 2ZJ0A 4HNAB 2P9FA 1JGTA 3T3EA 4GMFA 4CG1A 2ZYDA 3KYCA 5AXAA 4X7RA 5BSGA 4R2KA 4MR9B 2I4RA 4QU0A 3R7LA 4J7UA 4MR8B 3MVEA 4ZQHA 3LY9A 5IKPA 1LQUA 1UPXA 3IP1A 2IA5A 2ZETA 4ITVA 1YR7A 2GZRA 2CMKA 1W4RA 2IEYA 3AYZB 4FSHA 2HHAA 5IC5A 3AK4A 3H16A 1YBMA 3VZBA 1D1SA 3EQ6A 4RVHA 1LU9A 2BMJA 5KYUA 4ANFA 2QYTA 2AWOA 3DBHB 3PGKA 4L8LA 3QA3E 4FE7A 2UV8A 1MVNA 5D3QA 3QFCA 2FX3A 4TKLA 5JSFA 4TXMA 3JD3A 4QX6A 4CYMA 4JASB 5HP4A 5J9FA 1E1QD 3R8FA 2B69A 1G55A 1UC4B 2XWSA 4FBMA 2J9RA 1I14A 3ZLTA 1Y37A 3BD6A 3KPUA 4LTMA 3UT5B 1UOOA 2WYWA 2WTXA 1Z45A 5DOZA 5T4FA 1ZGGA 3R24A 1CRWG 2UYGA 4RETA 3FI0A 4XCQA 5EEGA 1MO6A 1BIFA 4DSAA 2CV2A 1G0NA 4MKGA 2RKWA 1POWA 3E1KA 1YDWA 5E9WA 2FPLA 4JJ4A 4BQFA 1Z56C 1NW6A 1VE7A 3BWDD 3LCVB 4QFCA 3U09A 4NI5A 3OQIB 2I9PA 4TS4A 5HQ3B 2FPGA 2G9ZA 3PFFA 4YT4A 2XOEA 2VNHA 4P32A 1NIJA 1Q2UA 1DBIA 1RYDA 2TMDA 1C1XA 3ASZA 2HPVA 3RBAA 3WL4A 1T0UA 2XOKD 3DHYA 3MJFA 2QD1A 1Z13A 2XRFA 5KINB 3W77A 1KI1A 1K8YB 3GEMA 4GZ6A 5IBQA 5KKCA 5IYZA 1KJZA 4RQBA 2W4QA 2R5FA 1XELA 3E82A 1NFQA 4FC7A 3AL2A 1B8VA 1LBSA 1KEWA 2MYPA 2HIAA 2CL6X 3AH8A 4MV8A 4NCHA 3S1SA 1YQWA 2JFXA 3ILYA 4PZCA 4IV8A 1VGQA 3E3LA 4MVJF 1TL7C 1PQYA 3GDHA 1FYEA 3CG0A 4BN0A 3FCUB 2FETA 4QIHA 1SU4A 1VJDA 4LE1A 3EIOA 3SJAA 1S02A 4MGKR 4UVIA 2IYNA 5LMCA 1E3WB 1E8DA 1DTWB 2AHOA 2REQB 3I6BA 1Q1BA 5HZMA 4JC0A 1EX6A 3KG2A 1ODSA 3UHOA 1JJBA 1ZX1A 2HUPA 3R0IA 1C2TA 3MOSA 3O75A 5BP7A 2P6UA 2GK4A 4U2CA 3HO1A 2GFIA 3GLFA 4G1BA 4OU5A 1HY3A 1GPWB 3QVJA 2E87A 3V46A 3BORA 1T2FA 2H1IA 4MV5A 3LLCA 1NMXA 2NZ2A 1Q91A 4B34A 2A57A 2MYNA 2IEIA 2QW8A 2DLNA 3PNBA 2HMTA 2XT0A 3GQVA 1QF7A 5AJXA 1Z07A 4J8PA 4YASA 2IBTA 4B6QA 2FZGA 1E7QA 1X7ZB 2PT7A 2Y3IA 3M33A 3G5AA 1D2AA 5CFZA 3KHUA 5D86A 1RM3A 3D54D 3KZXA 5JCJD 2YCLA 3QYPA 1SHJA 2OBLA 4OJQA 4RLSA 3H2BA 5BUZA 4ASUA 1PNTA 1PJ3A 1QTNA 2W6NA 2Z8YA 4OQDA 4QTUB 3RTCA 2QSZA 3ZNNA 4U5XA 4J0EA 2POCA 5TQVA 1U4SA 1J49A 2ZUTA 3HVUA 5JPDA 3BE5A 2ADMA 5CEJA 2PRSA 4EKIA 1IEQA 1XA0A 3MN1A 1MEEA 3ITDA 4Q47A 4C4AA 5ICMA 3M1LA 2A0UA 1YA4A 1JQ5A 4UUNA 4AJJA 2YJ4A 5FHQA 5KNCH 4N6GA 2ZQYA 3VNBA 3CGWA 3P0HA 3MTIA 1KPGA 1ZJYA 1G6OA 1T9KA 3V1YA 1DSSG 1BEZA 1XLWA 4J2OA 4OL0A 3ABOB 4MGYR 5IXYA 3ANMA 3D3NA 2BM8A 5BNWA 1OFUX 1ZKDA 3QWHA 3W7VA 4PV7A 1F2TB 1H0HA 2G1JA 4LQ4A 2WLSA 5BT9A 1Y1QA 3MC1A 5I01A 5EE9A 2XV1A 4YXWA 1N36B 3ZGYA 2ZPUA 1MG0A 1IVSA 4ZDKA 2HJHA 3JATA 5CMLA 5E6SB 5KS2A 4AZ3A 1BFDA 1KH1A 1N8KA 3ORSA 1V8DA 4BEWA 5L53A 3L6CA 3OLVA 3PPWA 4CKWA 4Q6WA 1OILA 2DC1A 4FLMA 1EUZA 1UWVA 2WJGA 4NBSA 5A9TA 4X7PA 2EIXA 4U7HA 1VBFA 1ZCJA 1ZM7A 4ZQCB 5EHIA 5JSKA 3R8XA 1PR1A 4ARVA 4NG4A 1XU7A 3HA3A 4LG1A 4ZA2A 3NRJA 1D0VA 1OOEA 4FCVA 3C3WA 2CLCX 3ISVA 4NAUA 1XZLA 2IZ6A 5HTOA 1X3SA 3LT1A 4W1SA 3EGDB 3PPXA 4PO8A 3PEWA 1W2HA 3AJ9A 3F8WA 3LC7O 2H0AA 4QBGB 1E3EA 3KUXA 2ZTUA 4F93B 1C9DB 1T3SA 2WD8A 1JE0A 1WY5A 2PEZA 1CB0A 2H1LA 1Z47A 4JNCA 5DP1A 4M49A 1OCEA 1FMLA 4HRAA 3IUEA 1GPMA 3W5VA 1L5MA 1RZ3A 2Q0SA 3RVKA 2BM9A 2INGX 3C8ZA 4G0MA 4F3RA 3GMTA 1MB3A 3QX3A 2IOFA 4YP9A 1FTGA 5D84A 1EFRD 5DM70 1YIAA 2WT4A 1T43A 1M1NA 3KD3A 4CCWA 5IW8A 4R4JA 2F43A 2MSNA 2QXYA 3DFMA 4AY6A 4M8SA 2O59A 1V11B 1LJ8A 2V65A 3GB9A 5HK8A 3PX2A 4B7CA 4DNOA 2VHVA 2XE4A 4EENA 5J40A 4NBLA 2NO1A 4LHSA 4TQ9A 4CIXA 2NSDA 4PHTA 3EGEA 3WLKX 1KJNA 1RDFA 1AUXA 1PLKA 1TVMA 2B0CA 2VHEA 5KHOC 1SXGA 3VNUA 1IDN1 3O8DA 3UWPA 5KHAA 2BSXA 3SC6A 1IXRC 4URVR 1Y3CE 1XEAA 1N5IA 1YR6A 4H4EA 2PX0A 3PNYA 2Y1LA 2NPFA 1VG1A 2WWGA 2P6RA 1V35A 4KXYA 2WHYA 4YS6A 4C76A 8ABPA 3KQSA 3VKHA 1BHO1 3HRKA 4KQKA 4DC0A 4IIJB 2NLOA 3E5HA 2HX1A 1UBUS 4LN1A 1RTKA 1XZKA 1ESMA 3RAFC 3P9IA 1EIWA 4HO1X 5JNTA 2EW1A 2JB9A 4IMPA 3JAWA 4KE7A 5EMHA 2L82A 3FPJA 4FBLA 1RYNA 1YS9A 3WE7A 3V4OA 3IDZA 4RKQA 1DO2A 1HYEA 2NZUG 3U44A 5I7EA 1BS9A 5CBKA 1XCLA 3GPDG 2ISQA 5JAQA 2NU7B 3PUJA 4JNKA 1H5NA 2HTFA 3EZ7A 1CVLA 4QC2A 4EM6A 1JT9A 5JD4A 3B1VA 1T25A 3ZBPA 1KDPA 1NNSA 3KKOA 1MO2A 4FYXA 4DUGA 1W0JA 2PYIA 2VDWB 4YJFA 5CBPA 2VQEB 1L1EA 4P58A 2WWFA 1ESEA 3NETA 1OVMA 3DLPX 4JQOA 1YBAA 4PIPA 2V7QD 4KRXA 4L75A 4MCHA 4U00A 4FNAA 5I3CA 1JE1A 4QA9A 1GAQA 3P1JA 4DXDA 1Q16A 1Y7HA 3AW8A 1IVNA 3B38A 5GMOA 3S4YA 1H1TA 2PYZA 5CNKA 3WWPA 1MP0A 1GN8A 3H2SA 2HSWA 1ZI9A 2F9MA 1HLFA 3CZ4A 5KYWA 1GPYA 3DDOA 4B3IA 2BGMA 4H16A 4YCDA 5HA5A 1C3OA 2XGOA 2WKQA 4XW2A 1BW9B 2XODA 1B8NA 2VUIB 2ZE7A 4HVCA 1M6VA 3SM9A 2V0CA 3A9TA 1AMOA 5IVDA 1JV2B 1NC1A 3S81A 3HSSA 2BFBB 4U39A 5A4AA 3L1JA 2JPDA 4HNGA 2FTKE 2JFPA 1AZLA 5J4KA 1TK9A 1BCRA 3KT3A 4NZPA 1HDEA 5GJVC 3G2JA 1HH4A 1Z3CA 1JU9A 4NCBA 2VK1A 2WMYA 2ZYHA 1EVQA 3HKCB 1W85A 1GGJA 3AEKA 1YDGA 1G8YA 4K6FA 3DE4X 3ZIUA 1Z36A 2PR2A 1SBHA 1OV4A 2P75A 3ZE0B 4CM8A 2G9UA 2A9OA 2CL0X 2EQAA 1KFJB 1N6OA 3G5LA 3O73A 3QU5A 3ADDA 5EWJA 1JDUA 1U3DA 2G5PA 3CH6A 1TO2E 5LP6C 4JC5A 1GYQA 4AF7A 3GGJA 1Q7GA 1U9YA 3BK7A 2CNNA 3VR5A 4YI3A 2QRGA 1OWPA 2LDXA 3D7MA 1X7DA 1QR2A 2O6LA 3QYFA 3MIIA 4GGPA 4QGGA 5EYPB 4BQSA 5CB4F 2WILA 4RULA 1U6KA 2R11A 5DVZA 1EGVB 4Y2UA 1PTKA 2VDNB 3KQQA 3IURA 4K9NA 1ZD8A 3TTTA 3F0TA 3H3XA 2GHIA 1OAAA 2GVNA 2NV6A 1M5TA 2WJIA 5JE8A 3EWNA 3QP9A 1OAOA 2MSCB 1S4QA 1Z73A 3B5JA 4JYCA 4NCXA 5AW6A 2BGKA 1NAIA 3OZUA 1E0AA 1N2EA 1KOLA 3H99A 1NGSA 3U4IA 4G0OA 4EG4A 1CT9A 3MJVA 3PDUA 1Z37A 2XKJE 4Q3BA 1Y3DE 2JVJA 3ZHVA 3QI2A 3VVMA 3CF4G 4EI2A 2I4MA 3IBSA 1N4DA 2ZRMA 4WK0B 1H2YA 1U90A 3FPEA 1RJDA 2GZAA 2VKTA 3BDIA 3C4QA 3KAJA 1E6WA 5I7SA 1CNFA 1JHQA 4XIYA 1VE3A 1M1XB 4FW9A 3GROA 5CAEB 1YTLA 1AH2A 3NOVA 3IS3A 5FOXA 1S9HA 3RWOA 4AP6A 2A5FA 2D1YA 3PUIA 4V0RA 2NVBA 5JMTA 4RO0A 3RHTA 1F8XA 2B34A 1YJAA 4B85A 4X3PA 3NHPA 4BMPB 2AMVA 3ROXA 3MJHA 1UADA 5GVSA 5CCXA 1XMOB 1N6PA 3F1KA 3UEOA 3W5JA 2PMFA 1F48A 4EZBA 1GKYA 2IXEA 2XD4A 5DLPA 1I94B 2QW0X 1CLUA 1GDHA 1VJ1A 3DVAB 3CSUA 2YQ4A 1PVDA 2CF5A 3D0OA 4NCKA 4BPRA 2XGJA 3OA2A 1E3MA 5CVTA 3DT8A 5EXSA 4E03A