5KQMA

Co-crystal structure of lmw-ptp in complex with mes
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
153
structure length
153
Chain Sequence
TKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Inhibition of low molecular weight protein tyrosine phosphatase by an induced-fit mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 153
sequence length 153
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kqmA00
1CYEA 3S99A 4NQRA 3VNAA 2HSGA 2X7XA 1K66A 3QLVA 3ROTA 2FQYA 4EY3A 3BRSA 4G0QA 1IIBA 4JASB 5FWYA 3GBVA 3N0WA 9ABPA 1SXGA 4L4UA 2MYNA 3OLWA 4RKQA 5FWYB 1E6KA 1NXWA 1NXXA 1ZY2A 4RZSA 1W9HA 4Z9BA 3SY8A 1FFGA 3RQIA 3NHZA 5CNKA 4MGEA 5CNJA 3I42A 1P8AA 3HEBA 3ROFA 3H5IA 1FSPA 2FKAA 1DCMA 2PL1A 5T3YA 4TN5A 4KFCA 4O1HA 1NXTA 4G0MA 8ABPA 1QQBA 1OXBB 5TPZD 1TMYA 4DN6A 4RSMA 1U2QA 3TMYA 1MB3A 1DJMA 1LJUA 2FMFA 3JS5A 3F73A 4RU1A 4PEVA 3CLKA 2FLKA 2LBPA 5IEBA 3CS3A 4MRMB 5KQMA 1WETA 3C3KA 1Z13A 5TPWA 2N9UA 4LX8A 2QW1A 5B3JA 2JK1A 1Z2DA 2OENG 3RVKA 3KCNA 1EAYA 1MIHA 3O74A 1QQAA 5PNTA 3IP5A 2CWDA 3CTPA 1U0SY 1Z2EA 2E4XA 4HNQA 1ZH4A 2VK2A 4XASA 4XAQA 5JNWA 2WB4A 4MLCA 2GX6A 2LPMA 5E3JA 3TO5A 2FW0A 2E4YA 4WXEA 4YV7A 4Z99A 1VLZA 4YWHA 4LDZA 2VUHB 3MQ4A 1EWVA 1QP4A 4Z4HA 3HV2A 1JLKA 2NT3A 3NNDA 3G1WA 4MR7A 2JCGA 4D6YA 1E2BA 3I09A 5FBKA 3CG4A 4QPJC 1JDNA 3KLNA 3SM9A 1YS7A 1GUBA 2FMHA 3JPYA 4ETMA 2JVJA 3OO1A 5T7BA 1URPA 1QMPA 5KQPA 5CHYA 1EWTA 4WT7A 5JS2A 5BR1A 4QICA 3FFTA 4ZPJA 3T95A 1W25A 2NUBA 1SD5A 4Q7EA 2R4QA 5FWXA 5EWJA 1YIOA 4JA2A 1BAPA 2L19A 4RY9A 5FWXB 5EWJB 2JVIA 1A0OA 1JYFA 3ILHA 2LP4Y 5EWMA 4KV7A 2F8TA 4ETNA 4NICA 2JBAB 2VYCA 2FN9A 3NNSA 4PZ0A 3EDCA 4G86A 2FLWA 3MIZA 5IEJA 2CHEA 2OQRA 5D2CA 5DCLA 4XFKA 5DGCA 1P6QA 4LZLA 5C5CA 2MSWA 3GWGA 4JAVC 2WJAA 5BQ3A 4MS3B 2PAFA 1USGA 1BDIA 4RS3A 3HJFA 1YK1A 4IRXA 2J48A 3A0UA 3K4HA 3O1JC 5CNMA 1SXIA 1QO0D 1ABEA 4O1IA 1Z12A 3QLVC 4LE0A 4Z9AA 2PJUA 2A9PA 3Q7SA 5HM6A 4KQ9A 2JB9A 5JNRA 3OQOA 2GWRA 1JDPA 1YK0A 3Q7RA 4Z4IA 1YMVA 5GQSA 1ISSA 1ZGZA 2L17A 2MSLA 4S04A 4LE2A 3EJWA 4EVSA 3LOPA 3IPAA 2VUIB 5JNSA 3RVNA 4OG2A 3QELA 4KK4A 3RVPA 3DLHA 3H5OA 1BDJA 5IX8A 3MM4A 4KK3A 2PUEA 3GBPA 2PUCA 4M88A 3HO1A 4XARA 4RK5A 1B00A 4HYEA 4G0YA 5TQ2B 1AB6A 1RNLA 1I3CA 1F4VA 2CD7A 3QLUC 4XXHA 4EGSA 4PYRA 3FFXA 5HSGA 4RXUA 1GUDA 4G97A 5BRAA 4HNSA 1VKRA 3HK2A 4W5OA 1NXOA 1ISRA 1C0EA 2PMCA 3C97A 2BGGA 2RDMA 4NCAA 1U2PA 1DG9A 4RY0A 2HQBA 1PNTA 2E4VA 4GNRA 2HPHA 4IGAA 3W9SA 3G85A 3TB6A 4N41A 5KWSA 3SG0A 4P1ZA 3NNNA 6CHYA 1LBIA 2HJ9A 1ZGGA 1RXIA 1ZH2A 4QYMA 1QPZA 4YRZA 3BRQA 3E3MA 3KSMA 3O2JA 3TX6A 2B4AA 5KQLA 1NXSA 1PEYA 2JRLA 5DKFA 4KNYA 3DBIA 4N47A 2ZWMA 4KVFA 1SRRA 2WWVD 2A9OA 2XDYA 2HQRA 3KG2A 4RWEA 1FQWA 3RVRA 2IDMA 3QK7A 3KTOA 4RKRA 3H6GA 4PE5B 5TPWB 1KMIY 4KZKA 1CHNA 3C6QA 2PLNA 3H5VA 3H5LA 2I6FA 3QLTA 4MQEA 2PUFA 4EVQA 2E4ZA 3OM0A 1JWLA 3N8IA 5KQGA 3FMVA 2A9RA 4RXMA 3URMA 1L5ZA 3H5WA 3LUJA 3OMXA 5TPZA 4QYWA 4W5TA 1EWKA 4JOQA 4JP1A 4N0PA 5TQJA 3LUGA 1Z26A 4MS4A 5EWLA 1NXVA 1EHCA 3M9XA 3HUUA 3JY6A 3T38A 1FFWA 1D5WA 3LUDA 5EWLB 2QVGA 4RK0A 2AYXA 1NY5A 4RXTA 1HEYA 2PKXA 1D1PA 3UKJA 5C5EA 3KJXA 3HDGA 4MR7B 2GKGA 2IPMA 1Z17A 3QX9A 3LUKA 2AYZA 3H1GA 4P98A 2FSPA 3TD9A 1YMUA 1JBEA 3H5TA 4RK4A 1M5UA 3A3KA 4NCBA 1KGSA 4F3TA 4RV5A 3CZ5A 4MQFA 5HKOA 3DGFC 1JX6A 2E4WA 3E61A 3GV0A 3HXMA 5EWMB 4Z4CA 5IBQA 3EODA 1TLFA 3HCWA 2TMYA 1P6UA 2QZJA 3CRNA 1USKA 4ZMRA 3CHYA 2QVCA 4Y9TA 1A2OA 4EVRA 1DBQA 3OLVA 1DBPA 3RVOA 2RJNA 4W5RA 2MYTA 1DCFA 3RH0A 1DC7A 2RGYA 4YGXB 5GOTA 3RVJA 2GI4A 3LMKA 4F8JA 1AB5A 2LUOA 1YS6A 1VRVA 1DRJA 3O2QB 4EUKA 4FB4A 4OLBA 2HQOA 5KC8A 4RY8A 3LTEA 3N75A 1DC8A 4OATA 4KREA 2R47A 4EYKA 4RK1A 1PNRA 5TE9A 2QR3A 3D8UA 2M98A 4N03A 1JFSA 3CNBA 3LUAA 4IF4A 1ZN2A 1DRKA 3RVQA 3CKMA 4LDAA 4MLDA 4WXMA 4OLAA 5IUJC 4O5AA 4G0OA 4NV3A 6ABPA 1RZRD 2L18A 4G0ZA 4ML3A 4WZZA 4H3HB 3UK0A 2PUDA 5KC9A 3T8YA 4MS1A 3FDFA 4OBBA 4MS1B 1JL3A 1MVOA 3KYIB 4Q6WA 4YS6A 3OLYA 3QELB 2FQWA 2P9HA 1YTUA 4D6XA 1QO0A 3IP6A 4MYRA 1JFTA 4JB2A 1ZAYA 4KRFA 2E4UA 1Z16A 4IMJB 3OO0A 2R48A 2WMYA 3Q15C 4Q6BA 3FFWA 5ED4A 2ID7A 3EQ2A 1JYEA 3BBLA 4RK6A 3DGEC 3O1HB 2FN8A 3L49A 3QX8A 2IOYA 1EFAA 5B3JC 3HSYA 1MB0A 1KRXA 4W5NA 2R25B 3GL9A 1NATA 5DLEA 1KRWA 1ZHHA 1E6LA 5DTEA 3R0JA 1DCKA 1QP0A 4F06A 4MAAA 3CZCA 3OLZA 5JNVA 4TLLB 3IP7A 1R8JA 3BREA 3FGZA 3HS3A 3HDVA 3O75A 4FE4A 1C4WA 4MR8A 4G0XA 4YCSA 4W5QA 3A10A 2A9QA 4OTZA 1ZVVA 4MR8B 5ABPA 1RPJA 2JVKA 3JPWA 3IP9A 3ILYA 4WUTA 3D02A 5IULC 1JH9A 4EYOA 1M5TA 3JTEA 3KKEA 4EYQA 3H6HA 1GCGA 1PHRA 3EGCA 4Z4GA 2IPAB 4UHJA 2WY2D 4H3KB 1JFVA 1QP7A 4G0PA 3DLBA 2QXYA 4MQEB 4S05A 3I45A 1D4ZA 4F12A 1S8NA 4KPYA 4KMRA 1U04A 4WWHA 3RVSA 1ZDMA 3KYJB 4UHKA 3O1IC 3QEMA 4YP9A 1XHEA 4XLTA 4MRMA 2LIVA 3B2NA 2PL9A 4DQDA 4N76A 3QEMB 1VPWA 4MS4B 2B1JA 2FEPA 3LKBA 3QLUA 4EYGA 2PUBA 2YHBA 1ABFA 3GT7A 1M2EA 2RJOA 1Z18A 3JVDA 3EQZA 1MAVA 1TM2A 3HZHA 3M6MD 2NZVG 2FMKA 3MMNA 2P4UA 1T34A 5JS1A 2PUGA 3C3MA 4IILA 4LRQA 4H60A 2WRZA 2MYUA 4IMIB 2FVYA 3N0RA 1L5YA 3LFTA 3SNKA 4ETIA 3IPCA 4ZMSA 4E7OA 1BDHA 4PICA 1TVMA 1SXHA 5IC5A 2CHFA 3LUFA 4GPAA 3P9YA 3OQNA 3H75A 1ZITA 3GRCA 4YLEA 3MA0A 1ZESA 3LKVA 1Y1LA 1BVHA 2MYPA 4MQFB 3F6CA 2QSJA 3LUCA 1YVUA 2GBPA 3RVMA 3NHMA 3RVLA 4Z4EA 4JB0A 3H1FA 4LE1A 3Q9SA 5HQJA 3N53A 1JF8A 5FBHA 5BRJA 1XWWA 1CEYA 2IPLA 1A04A 4YO7A 2YHAA 3O2SB 4MPTA 3JVIA 3GA5A 1K68A 1APBA 2DRIA 2H0AA 1LK0A 1M2FA 1F51E 2IYNA 3CG0A 2L2QA 3KHTA 1USIA 3I5AA 2JBAA 4RDCA 3MYYA 3M9WA 4CBVA 3F7NA 1DBWA 1E6MA 2NT4A 3VNBA 4E7PA 3A0RB 3KLOA 1DZ3A 5CNIA 3CU5A 1BA2A 1J56A 4ZYLA 4N0QA 3Q7TA 4KQCA 5IUNC 3HM9A 2IKSA 1JHZA 1TJYA 2KYRA 3H1EA 4FE7A 1LBHA 1Z25A 3OQMA 4F11A 4MS3A 3OMWA 2IPNA 2NZUG 1DP4A 1QKKA 1QNLA 3DZDA 1OXKB 1RXEA 3EULA 3O21A 5KI6A 4RK7A 1GLGA 3EAFA 2PUAA 3OM1A 4Z4FA 2H3HA 2ZAYA 1FFSA 4HNRA 1D1QA 2Q5CA 1UDRA 4Z0NA 4DADA 3OLXA 1H9CA 2O20A 1NXPA 2FEKA 5JNTA 5JNUA 3SQNA 5IUKC 2QU7A 4YR7A 1Z15A 2FEWB 2V0NA 4ZJPA 7ABPA 3MF4A 3QEKA 3CFYA 3SAJA 1RZRA 3GYBA 5F64A 1U8TA 4MR9A 4TLMB 3Q41A 2WJWA 1D2AA 3N6VA 3NBMA 2FMIA 3L6UA 1XHFA 3K9CA 2MSKA 4MR9B 3HVRA 4TMYA 3KS9A 3T6KA 2ID9A 2M1ZA 2FTKE 1LJLA 1PUXA 2FXIA 4L85A 2W42A 1PEAA 5TQ0A 4D74A 1P2FA 1GCAA 3UUGA 2QV0A 5TQ2A 2F8SA 3IDOA 3C3WA 2FQXA 3F6PA 3N0XA 5TQ0B 4B09A 3BILA 3HUTA 2PE5A 5I4CA 3LUHA 1NTRA
chains in the Genus database with same CATH superfamily
3HCFA 1CYEA 4NKRA 1FVXA 3Q1LA 2HA0A 2JS7A 4H3VA 4P4TA 1YOBA 3PDCA 2X8JB 4D9KA 2P79A 2OZEA 3LHFA 5BSTA 2B98A 2OSVA 4LXUA 1E6KA 4RAOA 1YBHA 5E0OA 3V3KA 1KS2A 4JN6B 4FMCB 3NHZA 1RBZA 3G2HA 3LHIA 3PENA 4CM6A 4K2AA 3RTDA 4G07A 2XVAA 2QXTA 2V58A 1Z34A 4XGIA 2FKAA 2QAJA 2PL1A 3P9KA 1BDBA 1GPBA 4BB5A 2AX3A 1HDZA 4GM4A 1Y3HA 1Z74A 3L4EA 1N2XA 3B1VA 5IJAA 4DDTA 1GZUA 1IG3A 1U2QA 2Q5JA 1IM8A 2ZJ4A 3EZXA 5IKXA 1LJUA 1VA4A 3JS5A 1PN3A 4Q5IA 3KHUA 3H2HA 2YZKA 3T34A 3H4MA 1ILWA 3N8DA 4ID3A 3YASA 5KQMA 2CMKA 4HAXA 2W6ID 5EVJA 4LBZA 2H9AA 2X0DA 1VQ1A 4E07A 3RIXA 1J8QA 4G3XA 4PSVA 4Q16A 4B46A 1DX9A 3I61A 4OUKX 1T5HX 3CPEA 1ZLYA 3PHHA 1RTTA 1O94D 3D8NA 3DD1A 1UPBA 1SU7A 1Z2EA 2G8NA 3HN7A 3IP5A 2B9EA 3JZMA 3N3AC 4HNQA 2VP5A 3TSOA 5J5AA 5FOUA 3O84A 4LSZA 4US1R 1PGOA 3EEOA 3OFJA 4TZ6A 2VCHA 1JEQA 2AR0A 2CNKA 2H48A 5IABA 2IDKA 4NDAA 4QOHA 1CIVA 2OBMA 4Q3EA 1ZRNA 4TZTA 3P0RA 1OPRA 3H3FA 4F5WA 2CUZA 1ZGBA 3ZHVA 3LP6A 4C06A 2OD2A 4U2EA 2BLLA 2HM7A 4MR7A 3RAJA 2GXUA 4JUIA 4WCFA 2PLAA 3W7AA 4D9NA 1E2BA 4AJ4A 4UPDA 2VHQA 1J06A 4TQ9A 3EVTA 4RHXA 1L2TA 3FNGA 3M6XA 2QMYA 4PCUA 4G6ZA 4HJRA 5EE1A 4GKBA 2KS6A 3RPEA 3DT6A 3TL6A 4DCTA 2ENUA 5ILQA 4ETMA 1VP9A 1X7ZA 1R8XA 3MFYA 3PFBA 2COUA 2DCMA 1E5VA 4CHGA 4A5SA 3GJYA 1P2SA 2QXUA 2AUNA 2IIQA 2IZOA 2VPPA 5CVTA 5HIMA 1HE1C 3EVFA 2JGAA 5DM60 1W34A 2JHCA 4AXXA 1BE6A 1VHQA 2VHWA 2IU6A 1DJOA 3NXKA 3W3AA 4I4NA 3CX7A 3UH0A 4CF6A 4WNAA 4LFCB 5DM70 2UXBB 1NV9A 4OGGA 2FKNA 2PO7A 2V9ZA 1FP4B 2VJAA 3A1DA 2RARA 3B5JA 1LBEA 3DZBA 3FWNA 1X0VA 2HV8A 4MPRA 4P53A 2Z6AA 2QN9A 1RE1A 3TLAA 4GM0A 3TZQA 3U1BA 1NRWA 5TXGA 3NJRA 1M1YB 1X1EA 3ZVKA 1H4VB 1YZGA 1Y8QB 1KSGA 4ENUA 1VRCA 1WZIA 3T7EA 2G4LA 1U8UA 1KORA 5HDBB 3EF1A 5NULA 2XE6A 3NORA 5KJEA 4KR2A 4IQ0A 3EX7C 1A4UA 1BMFA 1A8UA 2AC2A 5F7ZA 4Z51A 3NTQA 4C2UA 3D3KA 5AW5A 3A3OA 3GFSA 4IDGA 5L53A 3HJHA 4UHHA 2RGDA 4O1IA 2Q21A 4KDEA 5HM6A 3QKRB 4Y1FA 1V8OA 3F6BX 1QBGA 4US2R 5LU8A 4BJ3A 2R1UA 3P5SA 4AXBA 4FHDA 5B3KA 2VRCA 2E2WA 4IDNA 2VYFA 4X41A 1QC5B 3BWXA 3CUUA 4OAOA 2BMVA 5DTRA 4DMKA 2QRGA 5LL6P 2WF6A 2GCEA 1ZW1A 2EX1A 3L93A 3PNYA 5ENDA 1GXSB 1H1LB 2P65A 4IIXA 1PX2A 4F3NA 2ZIGA 1Z0JA 3FOBA 3QELA 5ICGA 4Z5XA 3RASA 3DLHA 2H9IA 2YMQA 1AF7A 1Y5MA 4JLPA 4WIAA 4IFBA 4CIBA 4ZOBA 1KMHA 1PF7E 1TUEA 2D0DA 4XIYA 1RPZA 2EYUA 4RMHA 3SS9X 1W2WB 3QOFA 1YONA 3E18A 4DQ0A 1KKUA 4GBGA 1WSDA 5F7OA 3UJBA 3GLQA 2I2WA 1I3CA 2BMDA 3U4QB 3QOYA 2BEVA 5CT9A 1WVMA 3IS3A 3W8DA 3QYFA 1ZBDA 4HBZA 1TFRA 1CLEA 3I6QA 2F2TA 3H83A 4OVKA 2FEMA 2PBFA 3AEKA 2YN4A 2D6FA 4A7PA 3B48A 3K5WA 5DP1A 3PGJA 3PQ4A 5L9AA 1FFYA 1GTZA 4JOBA 2RBEA 1KPIA 4DCOA 2XCSB 4EEXA 1V2GA 2RH8A 2OPBA 3E9MA 3W9SA 4ARCA 3P9RA 3LY8A 1MZPA 4HH4A 4PBRA 2WU0A 1B6SA 4D9BA 1RACA 3OZUA 3PVSA 4HWRA 4N6NA 4OI1A 1ONPA 1UAAA 1HM5A 3FJYA 1GZVA 3VR6H 1P1CA 3SVTA 4ZTBA 2KJQA 2C4KA 1VZ2A 3TI9A 3AZPA 3TX6A 2I3GA 1RWWA 3M33A 3K8YA 5DKFA 5JYBA 2H07A 3A2LA 4Q1BA 5F4BA 4F92B 3WQBA 1E1RA 2P9QA 2WF7A 3CPHA 1QE5A 3I2YX 2O3RA 1GYRA 4XVCA 2HR1A 2CXTA 3BGIA 3QK7A 4FJ1A 4OBXA 1ATZA 1II8A 3DJYA 3EXHC 4MMYB 1H2XA 2W58A 5CP8A 3WB2A 3WR5A 3PT9A 4MHTA 1QR2A 1C2YA 3T1VA 2OBXA 3C6BA 2C77A 3QLTA 4Z8YA 3F4LA 5JECA 1OF1A 1CEEA 3M8KA 5C0OE 5AVKA 4EG8A 221PA 4JXKA 5KQGA 1XPRA 4RBNA 4DSZA 4LOKA 5C3UA 3KD3A 1M10A 2GVDC 4LYGA 4JOQA 4JP1A 3G9XA 2QQ0A 5EUQB 1FOEB 1OX4A 1QK3A 1UQTA 5EHQA 2X8AA 1LNQA 3DOCA 4KPFC 3EMVA 4M8IA 2DBZA 1D5WA 1LQ2A 4JSRA 5KYUA 4CL8A 5JEEA 3G2NA 3NHYA 1RQ2A 2IQIA 3RAFC 2GPSA 4G8BA 1T6XA 4PX5A 2ZU6A 3M2TA 2FHPA 1UKAA 3FIUA 4WK0B 4BVFA 2K7FA 3MAAC 1JI0A 4EEZA 3MWFA 1GNTA 4TVKA 3PEWA 3HZRA 5K3BA 1WSAA 2Q07A 2WI8A 4P98A 3D7LA 5FO0A 2GN9A 4NCBA 1Q20A 3B3QA 4OQQA 4XQEA 3HYNA 5ELXA 1MPXA 4JUCA 1F60A 1FRZA 4RIHA 4RJTA 3HXQA 5J2UF 4IHJA 3AFHA 3MS2A 2Q4OA 2ZYDA 2UYCA 4XWTA 5A0VA 3ZDEA 5AM1A 6YASA 2DWCA 8GPBA 3JYLA 2EHJA 3FG9A 4EJSA 3A1WA 3ANSA 4GLBA 5HFNA 3E61A 5BORA 3R75A 3TE7A 5JZSA 2FFHA 4CMEC 2A84A 2ZXEA 1RIFA 3QZUA 3L41A 4HTAA 3W3AH 3G82C 4EPWA 1DLIA 1SKYE 3NUZA 4ZPXA 4W5JA 4N65A 1ZGHA 4PZLA 4L1KA 1RSZA 3I4CA 3SHTA 1DBQA 3MT8A 2CBXA 2RJNA 5AXCA 2SHKA 3IPYA 5H1YA 4YPFA 5CDUA 5JXHA 3JWIA 2XX3A 3QVXA 4HBGA 1NU8A 2DKFA 2GN0A 5EPEA 4F5ZA 5CBPB 1T26A 2HHJA 4R1PA 1KRHA 1MJGM 3DL7A 2ZRHA 3ULKA 4MV1A 1IBRA 4O2AA 2P5UA 3DE2X 1G5TA 4CFZA 3DVRX 5FKJA 4IL5A 4AFNA 4GOOD 2XIJA 4OATA 4WI1A 3TW4A 4AKSA 4BIMA 5JALA 4LTDA 3RUFA 5CGZA 4TMWA 5DXAA 3RSCA 4QOGA 3U2QA 4NMHA 1JA0A 2GBFA 2QM3A 2PA3A 2YNMA 3BCHA 3ASYA 3CLUD 2CNLA 5LBTA 4EG4A 4ZGWA 5IANA 4BBPA 4BNFA 1RYMA 1AQYA 1T1IA 3DHWC 2AOXA 3EIEA 3I32A 4DLSA 5KKNB 6ABPA 3UICA 5E6UA 3K9FC 1Z5OA 3BFJA 4GYKA 4GYJA 2RC6A 4PYNA 4QUGA 3HC7A 4XQ9A 5LA6F 3W34A 4A8JA 1DC6A 1LK5A 2GNAA 1E9RA 4D5GA 2OCKA 4HT3B 1UP7A 3HJAA 1SMKA 3HEAA 3GGGA 4YRLA 3NEAA 1NLUA 4N40A 3IMEA 3SJCA 2ZJZA 3NHLA 1J2EA 2GN4A 3FNRA 2WMYA 1IRXA 1JG1A 3EXFB 4AJ2A 4ERXA 2ZWOA 4ZQBA 4XM0A 1U5BB 1JYEA 1RRMA 4I19A 3E0XA 2Q4BA 3VHXB 3ZW9A 5ALPA 1AK2A 1VLMA 4OXKA 2YZGA 1N6KA 1GN9A 1EFAA 4DJ5X 5D7NA 1JLSA 1FB5A 3CRW1 3IMFA 1J2UA 1V4NA 3ESAA 1AQJA 4HLQB 1IJFA 2JI8A 1K0UA 5GZ6A 3VTAA 5KPDA 3D6TB 4A23A 1B8NA 1XTTA 2A86A 4RZUA 1A9RA 1G2IA 5IT9A 2P1RA 1RXCA 4DV3B 1H69A 3CM0A 3AIOA 1M6NA 2R6CA 2ZIEA 2AHOA 4Q9DA 1ZJJA 4TWJA 3RU7A 1SEPA 3HKEB 3UBMA 3HDVA 3R24A 4PLWA 2SKDA 1XEFA 3FYUB 4CMIA 3AJRA 3BUSA 1VZ3A 4ZCPA 5G1PA 4BYGA 2HGZA 2VF7A 1E94E 3LW8A 3EGIA 3IJPA 4DCPA 2YMLA 4LYHA 4DPLA 4M1EA 1G8HA 3F71A 4MW9A 3CISA 1JKMA 2OSBA 4OM7A 4A91A 1A7UA 2YJNA 1I4OA 1U7UA 3EXIA 3ZU5A 3HLKA 1H8EA 5BYJA 1H2RS 1F2UA 1RQXA 3HI4A 5IYZF 3T15A 2AN4A 4BKOA 6ADHA 3V1YA 4G0PA 4XWYA 1JH8A 1IEVA 4MQEB 2WSLA 2X3UA 4HN4B 2XF2A 4QVGA 5JCJD 3U39A 1IM5A 3A6HA 3LC1O 3ZVLA 3RVSA 3HJTA 1ZDMA 3P0FA 4J1SA 1Z4KA 1SN7A 1U0OC 3EG9A 1N9GA 4JUAA 4O3FA 4PAOA 4Y1RB 5ARDA 4TV8F 4RTKA 2KLBA 2G83A 2AFHB 2OFOA 5LP6B 3T4XA 3D6NB 2UZIR 2HQSA 2PD4A 4G9GA 5HBRA 2WHRA 2X8WA 5FQNA 1W36C 3DAPA 1KDRA 1XP8A 1Z06A 5IK2A 3AHCA 4DKXA 1ESNA 3O9MA 5DNEA 4PYQA 2AQIA 1PR3A 1NQ5A 3ZIAA 3K0SA 1ORIA 4HN2A 2QYHA 5B1IA 1U2DA 1UBTS 1Z4NA 3LFTA 2VTDA 4G4SP 1JXQA 1KJQA 1N5JA 1NONA 2Y0DA 3V34A 4FVTA 5ITVA 1H2HA 3B53X 4K6OA 4RA6A 1DAFA 2C5SA 4AJOA 3VO1A 2B6NA 1I32A 2QLBA 4HDMA 1YD7A 4MWGA 2HA5A 3C5HA 5LYYA 3PQ6A 1JKXA 2HPVA 2W6ZA 3R5KA 2WVJA 2UUAB 8ATCA 4FQ8A 2HF2A 3WWPA 2B8EA 3CWCA 4HHEA 1VJRA 2WABA 4MI1A 3E9NA 1AD2A 1WMBA 4G81A 3NHBA 3TDNA 1C5KA 1U3FA 3A1UA 3JWPA 1IZ7A 1OXVA 2AL7A 2R8BA 1QF6A 1GNPA 3TJZA 3ELDA 3PQ5A 4ENPA 2OCAA 2D7DA 1RI5A 3PFCA 1PR2A 1SWWA 2EU8A 4KODA 4QBTA 3RS3A 3W7VA 4EHHA 4O1MA 3JWJA 4FGUA 1K68A 1GSIA 2DPMA 1SPBS 3LQ2A 1C29B 2FEAA 5H4GA 4JI2B 4R40A 2C97A 3TR5A 3Q3GE 1MENA 5G41A 4QPCA 2YICA 1KSJA 3OTWA 3THYB 1ZC4A 4LG1A 2MWMA 4AJLA 5NLLA 3HY6A 1E6MA 3QMWA 3V8PA 2XE7A 3JQQA 4Y6LA 1SUBA 1MOZA 1Z28A 1R15A 3FHCB 3T5TA 4BJ1A 2KPOA 3G6KA 3IXLA 4YCMA 4G0VA 1M2WA 1A76A 2JDIA 3AQ4A 4CE6A 3BX1A 1G59A 2DCUA 3W1VA 4O59O 1PP4A 2HQ1A 1M2KA 1JAHA 5KTSA 1QIFA 1Z4PX 1Y4ZA 4I5FA 4KP7A 3HO6A 1CFZA 4ZU3A 4O29A 3GNTA 3NHFA 1J5XA 3K05A 2P6NA 1UANA 2ZR8A 3PZBA 2BTEA 3IXMA 2CXHA 3ZWCA 4KUEA 1Y3BE 3S55A 1G2PA 2HXYA 1WMEA 3SIXA 3GUYA 1ZM7A 2HRBA 3CH5A 5HRUA 1CX9B 2B4KA 3LI2A 5JSUA 3K0KA 2PGXA 3I04M 2X76A 4H7KA 4ES6A 1MABA 4N39A 3QVJA 5LOVB 3DJFA 2NO4A 1PZGA 4Q4AB 4C0KA 2CNWD 3OD5A 4TL6A 2JL1A 2Q4TA 4MRPA 3L0OA 3M34A 2XA9A 3U16A 5LP6F 4TMVA 3NBMA 4H3SA 2WMOB 4M22A 1V71A 4DTIA 2J5KA 5LUBA 3TAXA 1DKQA 2DMRA 4UXHA 1YDFA 4HPWA 3HVRA 2WTUA 5JXIA 3VJKA 2HA2A 2V54A 4I3FA 4L22A 4XYBA 3VI4B 5K8IA 1W0CA 2RG7A 3GRRA 3RG8A 1E4YA 2PZLA 3GC6A 4DMUB 2JFPA 2IDZA 2O2IA 3JWHA 5TY0A 2YJ4A 4YRMA 2IU0A 2IXAA 4PIMA 4O3MA 1W4LA 4F6RA 2R60A 4KLZA 3THWB 2W2PA 4YRCA 4EUHA 4NQRA 3ROTA 1MD9A 1IATA 1BWSA 1QE0A 3QPCA 1OHHA 1NMXA 1W6RA 3R0VA 4O2BF 2FOXA 3GT4A 1NUSA 3N0WA 3Q0TA 4QDXA 5ER6A 4EFLA 9ABPA 1F6WA 1QUFA 3EWNA 5H9VA 2O7RA 3K8QA 4QXAA 1VCMA 1O0SA 3AUYA 4TMZA 1RD4A 5DBEX 3HBMA 1E4EB 1G20B 4U7WA 3RQIA 1GTVA 4MWCA 1VRWA 5CLHA 1T1JA 3LQFA 2BL4A 4H6PA 1OLXA 3OQ6A 3O26A 2M6KA 2J32A 4PZUA 2VNJA 2D5BA 2FPUA 2FGJA 5TF4A 1HRDA 1U90A 2HY7A 2HZ7A 4NNJA 3K31A 1OXBB 1JG7A 4TL7A 2ZYTX 5BV8A 2YWGA 1L7XA 1M1NA 5EKTA 1DC5A 1M67A 2HPAA 1AZSC 1PZEA 1LZLA 2JJ2D 2X0KA 3EGOA 3OCUA 4MICA 3RFVA 3QEAZ 1P5ZB 4HDRB 2ZSDA 5A02A 1OH5A 4QUIA 1G41A 2Q3EA 1H2WA 5LQDA 2G72A 1USUA 2BCGY 2JH9A 2QW1A 3G1UA 1GTL1 4FGWA 4FYVA 2EVWX 4P4SA 3MOGA 5AJWA 1QLJA 1PIWA 2UZ4A 1ZJ5A 2B5OA 3R7SA 3OZDA 3WLJA 2QMOA 3CTPA 1CHDA 2H00A 4R0VA 1JSRA 4WINA 4AYTA 3F97A 4NC9A 4Y3UA 1IXSB 2DFKB 1A2BA 1DKRA 2POCA 3ZLTA 1PWXA 4JYAB 1HGXA 3ONFA 3NYRA 1RZUA 3HXLA 4NU6A 1C14A 2P30A 2IJGX 2WDPA 2FUG6 3PA6A 5BR4A 3BULA 1QYXA 1O5IA 2PGAA 1KYXA 3LXRA 4CEHB 1GV0A 1UFQA 3AL3A 1CB7A 3S1AB 1DUVG 3NNDA 1TZ2A 4X44A 1ODFA 1GAQA 4UE3S 1KYYA 1UBCA 4DR6B 4QPJC 1DMSA 3EZYA 3H0KA 3I2IA 7AT1A 4ADSG 1E2QA 1EDDA 3AKDA 5LOVF 3OE5A 3LLUA 3SLRA 2APJA 2C54A 3FOCA 5FFFA 3AHDA 5CHYA 1EWTA 1FDTA 2DY1A 3GLTA 1EQ2A 2KSQA 3I5UA 4PAGA 5FT9A 2NUBA 3UWKA 3R6TA 1AQ6A 4ARSA 1CERA 1K7XB 4KJZA 4X1IB 1ZL0A 4WY5A 4RY9A 4V1CA 1N6PA 2J87A 3AOEC 1A7JA 4JOCA 4PYKA 2MSDB 4U9IS 1YFJA 3T1HB 1VE1A 3AF6A 5P8WA 1XCBA 2JLSA 2ZS9A 2FUNB 3G2MA 3D7NA 4QYSA 3WOVA 2H2HA 1P1BA 2PRIA 4FBGA 1KYQA 4YO8A 1EFRD 3HVUA 4E5PA 1LC3A 3OE7A 1GNVA 2RFLA 2REOA 2WFLA 1BFKA 5IVPA 3P94A 2CHEA 1K8XB 5DPMA 3FOWA 2RAUA 2O0LA 3KU4A 1B1AA 1TF5A 2A9FA 1C50A 1MF7A 3GYGA 1NHGA 1NSYA 3ZDBA 4LJYA 1VL8A 2EFYA 4C30A 2AG1A 3THRA 3W8FA 4GVPA 1KQFA 4QKQA 3NHPA 3OTOB 3EFOA 1N5IA 2QVXX 3BTOA 2AI2A 1TAHA 3EPLA 1K3TA 3ZKWB 4Z4QA 3RHTA 1A2QA 1YQWA 2OQ2A 4JP2A 5IM4F 2XTAA 2FP4A 2PJUA 5HBGA 4IINA 4WASA 1UFOA 2JARA 4LNHA 2PX5A 2QYTA 3PNKA 4CKWA 4UHCA 1NMZA 1FS5A 4M89A 5CH8A 2HGSA 4RGVA 5DIFA 1NVTA 2ZEJA 3DF9A 2WHYA 4X0EA 4B6RA 3CIOA 2ZYHA 3Q3IA 3HEMA 3N2KB 1PX0A 2CXPA 4C4AA 1BU8A 2CDNA 4K0KB 1W44A 2ADMA 2WINI 1N6IA 4CTMA 1V25A 4P86A 2JKYA 2ZT8A 3H5OA 4Q7KA 4WFQA 3RVPA 4DA7A 5CCXA 2YX1A 2G70A 3KSDO 3DAOA 1T4DA 4JR0A 5EMJA 3WGVA 4X93A 5KSPA 2O8BB 5DT9A 4C3UA 2YFKA 3SOPA 3REQA 3JQCA 3DOJA 3G2IA 2VDNB 3RARA 4DVGA 4RK5A 3W8RA 4Q4HB 2J0UA 3WFJA 4IO1A 4PXYA 1KC3A 2ZLBA 5CTAA 4ZMBA 3OFSA 2V0CA 4O4JB 3UV7A 1ULTA 2X41A 1T35A 1ODLA 1V95A 2JFYA 2JJMA 3VR2A 3ZJYA 3WKEA 4B3HA 4CF4A 4EB8A 3I2FA 1SVOA 2CWWA 4DPKA 3RYFA 1ISRA 1G8MA 2PMCA 2QL9A 3A25A 3LCVB 4R6XA 3E9YA 4M9SA 3Q8KA 1ODSA 1U99A 1YMQA 3GG9A 3IAEA 4JX8A 3HRKA 1OH8A 2WFMA 3SJBA 4B6QA 4RF2A 4UE2A 1T9ZA 4NLLA 5D3ZA 3QXHA 3S29A 2O0HA 1ZH2A 4YP5A 1KDTA 3GCWA 2JGRA 3VR3A 1YB7A 4F2GA 4YRZA 3RS4A 3ZCVA 2R11A 2WZDA 4WFIA 4DTCA 4EQ6B 3QI7A 5JXGA 2JRLA 4ME6A 4EA7A 1KPHA 4KXXA 1SCJA 2BMWA 3O6VA 4NJMA 3WFIA 1EUCA 2FCRA 1O77A 4JKOA 5EA2A 4OD0A 5IXSA 1V9LA 2QMQA 4KIGA 5IRCD 2DBYA 4CM8A 1F3LA 1V5EA 1XTQA 2C1EA 2A4MA 4DEYA 5LQAA 2EJCA 1JKJA 3ZGXA 1NJSA 1OV6A 2C94A 3FMVA 1W29A 4CQMB 1L5ZA 1XLTA 3OMXA 4QYWA 4B3DA 4J94A 2X8LA 3KHSA 2RGXA 4GRAA 4LUCA 4ZOLB 3KAPA 3EEFA 3M9XA 3U7IA 3JY6A 1Z3CA 5AXAA 2VYNA 4L27A 1C9DB 2ZCUA 2PZAA 2NGRA 3AY7A 1U31A 3B1KA 4GOLD 1HPLA 1SD1A 4I1VA 4IVQA 4R2XA 5EQDA 3N8KA 1PGJA 3RD5A 1D6NA 3OQ1A 5EIBC 5DU2A 2AR7A 4LK2A 3N7AA 4V2UA 3UMSA 3HR8A 3ZJTA 1PBTA 1A9XB 1ZYUA 4RZQA 5DHTA 3W6ZA 3WISA 4HN9A 4IDPA 1Y3IA 2ONYA 2YZ7A 3H19A 4UTXA 3WHIA 5I6DA 3PC3A 1KNQA 1UT8A 3NWJA 4AZ0A 4K28A 1L4NA 3OWHA 4B4KA 1XVVA 1GNLA 3U37A 1F4PA 3CZPA 2QBYA 1BXKA 1QP8A 3M81A 3OPXA 1ZA2A 5FD8A 2XZOA 1C1DA 1QO7A 3A1CA 5L3SA 4GX1A 3MB5A 4P58A 4PSUA 4XH9B 1VLVA 2KI5A 2X9GA 4RF3A 3VTKA 4ZXPA 3RTBA 4DANA 5CAEA 2P2DA 3CW2A 5EWMB 3HL4A 2G1UA 5ALQA 3QVWA 2WMNB 3G6WA 3MRTA 1JZQA 1TJ3A 2QG6A 4OHKA 3FNIA 3IP1A 2O14A 5ES4B 2D3WA 4GWGA 4MUYA 3WE7A 5PGMA 5FA5A 4J0HA 4O4JF 3M3DA 1YH3A 3ORHA 3W9UA 4RMNA 4KPEC 3RB8A 1DBPA 4B3XA 1R0KA 3TLKA 2XB8A 1G19A 1DKMA 3FLAA 1E60A 3GXBA 4I2VA 2CVZA 2D59A 4P3XA 2FSIA 4XLLA 2AVDA 2BCJQ 3GQVA 4J4BA 1UK9A 5CTJA 4HUQA 4EUKA 1GTSA 2H1SA 1Z08A 2C9YA 3H86A 1ODTC 3ADDA 1J20A 1FP6A 2FOLA 1ZD4A 3MTGA 2Q9CA 4D3ZA 3A06A 5GJVC 5JPCA 4D57A 2YUIA 4IPTA 2IBMA 4H0FA 4QA9A 3CVVA 3DZGA 4IF4A 3GT0A 2QIOA 3QBJA 4JELA 1OR8A 3PQ2A 4OLAA 2ECPA 4KMOA 4MV7A 4O5AA 4YT2A 1E3QA 4NV1A 4Y9UA 2C5BA 4G0ZA 1RZRD 4DIBA 2GPWA 3PKJA 4DV5B 5AUPB 3CRRA 2HZBA 3LT1A 4C7BA 5BW5A 4YRSA 4EPTA 4MS1B 3DFFA 3DP9A 1NUTA 4JQCA 3NIDB 3U44B 2VJMB 4Y6QA 2PV7A 3I6MA 4WY2A 3WMFA 1M8PA 2I66A 3ZS9A 5J58A 1LPMA 2H57A 3ETGA 2XQVA 5EZ5A 1I2CA 3CRZA 2ODEA 1JFTA 3EYAA 3L9XA 4YRJA 2FW9A 1ZMXA 1EUQA 1KJ9A 3CZ4A 4LBYA 1J9EA 2WIKA 3FFWA 1BXGB 4ZOLF 3LYLA 2OECA 4I1RA 4NBVA 2FN8A 3NHJA 3SN6A 4BECA 1AY0A 2AXEA 2PQ6A 4KZPA 2IOYA 2QP3A 2X2OA 3GFGA 4P6VF 1A88A 4GLJA 1RVV1 3P2JA 5DGDA 2XB2A 4TV9F 3K1AB 1RFGE 4FU0A 2H59A 3KFXA 1VG9B 1ADCA 3QVKA 2FR1A 2I34A 2XEDA 3K8ZA 5SY9A 1EQUA 3RUCA 4ZHQA 1JECA 2X3YA 1CCWA 3AW9A 3RTCA 4DUGA 1FTGA 2F3UA 5DHSA 1DCKA 4CF7A 4FYHA 1C7QA 2AWNA 1PWYE 2FRXA 2WSYB 2Y3IA 2BFNA 3KK0A 1YXMA 2F1HA 2CVHA 2ZJBA 3IBFA 3KR1A 1IVSA 3ANLA 4IH9A 3OCYA 3TM4A 1R8JA 4H35A 3GN2A 4AX8A 1GGEA 9GPBA 4LDQA 3IOEA 3SYMA 4F9EA 3TRJA 4LKOA 1CE8B 2HT6A 1DPGA 5AM5A 2WE7A 3PL1A 4NMMA 3WGOA 3ILYA 2NN3C 2Q0QA 3PNOA 1AS0A 4RELA 3USZA 4BP1A 4F46A 1I7SB 1GT91 1NW9B 3GFTA 3H6HA 4LOHA 2E85A 4BFYA 1Z8NA 4S2EA 3TRKA 2ZROA 3JQGA 1KBZA 4EZEA 2HYDA 2F43A 5CIYA 1C7FA 1Q91A 1G0NA 1ZNYA 2ORIA 1P62B 5EVCA 4ZV9A 3A2NA 1J0XO 3I45A 1EX6A 1YJBA 1M2JA 4LWOA 4KMRA 5C51B 3FI0A 3F2IA 3KJNA 4N5HX 4B76A 5E6RB 3HFJA 2WHPB 1NNLA 3IC5A 1TX4B 4P5PA 2LIVA 5UKDA 4GE0A 5BN4B 3W6NA 4DQDA 1M0WA 3E4CA 3WGUA 5B1HA 3WK8A 4BZZA 1FW6A 4M9QA 3CRVA 4OGFA 2PUBA 4MVCA 4QOIA 1U0NA 3U7EB 3GLIE 4U0JA 2DYKA 3GUVA 1AMNA 3VHRA 1NOKA 1CF9A 3EGXB 1Z0DA 4X9XA 3SIRA 3K1YA 1C1HA 4LNUA 4EW1A 1RABA 2IWHA 4BRWA 4II2A 2ZSBA 2C2WA 1YI1A 3ISVA 1F5NA 1WHSB 4GZMA 4PLZA 3NRJA 4RD3A 2XTNA 4HRYA 1GTG1 1FU4A 4PLHA 5TIIA 1DQPA 3NTUA 5HF5A 1MRNA 1ZVQA 3SSMA 3WJAA 3W79A 2OTCA 1O96A 1UADA 3LKVA 4I7EA 1PJSA 4N12A 3BMXA 4JBWA 1N7HA 3NASA 5AOVA 5ESRA 4LXTA 2VJQA 2C96A 4QULA 2O2YA 1MX1A 4CKBB 1DXOA 1MGPA 1LSOA 1HYBA 1N5LA 2NPIA 3ABZA 3OF3A 1SXJE 4JB0A 4NK4A 2O8CA 4M8NE 2XKAA 5J23A 1QTRA 4WN3A 3VDXA 4M21A 4ON9A 3PXUA 1J22A 3UQZA 2X22A 3RAGA 1ZKMA 2CLOB 3PC7A 4LTNA 4P4NA 3JVIA 4YO7A 1UDBA 4GMFA 5AQEA 4A03A 5BQXA 3A6LA 4ACAA 3CXRA 1IHPA 4PIPA 3ZW8A 3QF4A 3WSTA 1Z5UA 5CVUA 1IPEA 4EWLA 2QAGB 2L2QA 3EZ2A 3QPAA 4FBMA 3WB1A 1USIA 3D0QA 3I3OA 3NOXA 2FAXA 3G23A 3SLKA 4JUBA 1MB9A 4I9UA 2GEDA 3R74A 1W73A 5I3CA 3RYIA 3KLOA 1RWBA 3N1UA 4LY9A 4OMFG 3FBTA 2ZKLA 2RAVA 1QAOA 4ZK2A 3Q72A 1X8LA 1BA2A 1T25A 1Z4MA 2EC5A 3LRXA 1ZKDA 3HM9A 3V4LA 4TN1A 2QLJA 2EOAA 2C82A 2WC1A 3VOBA 2Q0XA 1NF3A 4XZ3A 5CBKA 1NP7A 5EXXA 1JFFB 1BS1A 3QEJA 4GGPA 4HAWA 1M8JA 3SJZA 1BHQ1 1XDUA 5B53A 2PPVA 4YI5A 3R3WA 5AHWA 1GPJA 3CUKA 1ARZA 4MVJM 3X43A 1LBTA 4V0SA 3A2KA 1EFPB 1V5GA 1TB4A 2NYAA 1V7CA 1MO4A 2D5AA 1O6ZA 2BY4A 1GZ4A 3QTTA 1NQXA 1Z2NX 3QEKA 5ICSA 1IHDA 2BGLA 2ZI4A 1RM0A 2DUMA 2VNIA 3CFYA 3G9ZA 4JC0A 3WYNA 1ACJA 1S8OA 2CVOA 4DJAA 3IVAA 4D80A 1ZP6A 1UDXA 4EB6A 1RXYA 4D9FA 4LYEA 5HQ3A 3ETCA 2XITA 1PJ4A 3L7JA 4QYIA 2ODAA 2H1RA 3T5GA 5EL0A 2LVBA 2ZSKA 3HCDA 2M1ZA 4G25A 5BUQA 2FTKE 3KB2A 4WXYB 1W1IA 1EG2A 2AQ8A 2XCQA 4JP3A 1R3UA 4N8DA 3T3IA 5C18A 4UFPA 5CDFE 2NADA 1T1SA 1MG5A 3OJCA 3OZTA 1V1MB 4LV6A 1RLMA 2OCLA 2G17A 3VPSA 4D74A 1DPFA 1FJHA 1RYFA 1TZBA 2QV0A 1KO8A 2R3SA 4DYVA 4LZNA 2PE5A 1I2AA 3NEJA 1IOZA 4QUDA 4P4LA 1OY1A 4L4YA 5C7LO 4UQLA 3F9IA 4CMAA 4C2TA 3FZEA 2OD9A 3BERA 3LT4A 4X84A 3WGLA 4WNIA 3S81A 2WD8A 1UDWA 1H2BA 1SCUB 4D9CA 1E5TA 5I7FA 3UK6A 2FEXA 1WV1A 3HUDA 5AW8A 1ISGA 4A2CA 2PPLA 4UMVA 5IF3A 1XKLA 1N2CE 3ZGYA 4E12A 3PNQA 3GZTB 2CUKA 3PHGA 5K6TA 1XU9A 3DEAA 5C4MA 3I9KA 3NHAA 4LKRA 3CCBA 3GUHA 1RBQA 2P11A 1NNEA 1QQBA 1DIGA 3QW4B 2XGGA 5TPZD 4Y2XA 5FHRA 2VHEA 1NE2A 3ZCPA 4DMHA 1AURA 2V6BA 2OFWA 2ZBVA 4RYDA 2GAOA 1YC2A 2PG3A 4GQIA 4ATNA 3MINB 1BD3A 1ZD3A 2FLKA 4MKHA 4NFSA 3TD2A 4FCVA 4OP3A 4RUKA 4BMOB 1XJ5A 4H1WA 5AQ1A 5FOXA 3ND6A 5KB3A 1U0EA 3IE1A 5HGJA 2ZTVA 2ZT6A 4RSRA 5CURA 4NOLA 2JEOA 3BL8A 2YFQA 4K6FA 5ADWA 2NPOA 2Z4TA 4GVXA 1XQWA 1ZBQA 3QYPA 2WM8A 4PTZA 2NTYC 5ALYA 2Q5EA 3PXCX 1QG4A 1X86B 3V8VA 4IVRA 4M1ZA 2AK3A 3LM8A 3H9GA 3BQMB 2IE8A 3B3AA 3GPCA 4WXEA 5CFOA 4YJ3B 3L6DA 3X1KA 4ZV4A 3ZDXB 4FEGA 2HMYB 2HUNA 5DISB 5I7RA 1QIJA 1AKTA 1UOEA 1VPEA 2H08A 3HV2A 1E66A 5FNVB 5LQRA 1JLKA 1PUIA 1GQSA 3TOVA 3B6KA 4O2LA 1NVAA 2C29D 3JX9A 3W6OA 3ZD8A 1S8FA 3UTCA 5AJTA 4TTSA 4DLXA 4B6FA 3OTQA 1I51A 2Q2QA 1OLSB 2XNDA 4CLRB 2HMWA 3R7LA 3H17A 2W4QA 5M5BA 2BBWA 3H8VA 3I01M 4UTNA 5KYKA 2O8FB 1DFIA 3REGA 4MTLA 4KBYA 4M1KA 4CMBA 4B3GA 4BFLA 3RLIA 2O8DB 2R4QA 4DWVA 1UBKS 3CVOA 4PQGA 9ATCA 3DMTC 3LBIA 3TTWA 3LT2A 4LCBA 3QMVA 2ZRIA 5DM1A 4FINA 1OWNA 4FGJA 3NC0C 4ZVVA 3VSEA 2V1UA 1UJCA 2V96A 1CJUC 4ICIA 2DR2A 3FPBA 4HQLA 1JNYA 3F67A 5DCYA 3IVRA 4UZSA 2GR9A 2XUHA 1A50B 3MMZA 2BIFA 4H6VA 5FLYA 3WNCA 1DZIA 1LBSA 2C2XA 2HK6A 1H0RA 2GYUA 3GGDA 3L7MA 4AYXA 1XTUA 4HWGA 4XRGA 1KXZA 1VHWA 2VTKA 3EDQA 4QRHA 2JJ1D 1DFHA 4ZKEA 4F7WA 4AP5A 1OFIA 4C2AA 2W6NA 2H29A 5JJ5A 1N2SA 2RHJA 1CUAA 2WJAA 3KYCB 4RHTA 5ANRB 5BQ3A 3UH1A 1EIWA 4MI9A 3WP0A 3HJFA 1BDIA 2BFMA 3KLPX 4UCWA 1WB5A 3OA0A 2VR1A 1Z5PA 3PRKE 1RHJA 4C4RA 2VDWA 2C8KA 1X1DA 3P2EA 4IM7A 1P75A 2OR3A 2DQKA 1F9EA 1O6FA 2NQ8A 4HS9A 4MIYA 3V2HA 3ACCA 3VO2A 4B6EA 5DM2A 2BFDA 2FG6C 4QRIA 1A4XA 4O4LA 1WZCA 4G5SA 1KEKA 5GJCA 1G3RA 5CM2Z 5THXA 5EYPA 4N6OA 3IPAA 3X2FA 4C4TA 3DOHA 1SKYB 1T1RA 2XECA 3VU0A 4KXQA 1LX7A 5BYBA 1S2OA 3MJRA 4DW8A 1BCSB 2AG6A 2ODWA 3E0QA 3G2OA 3MM4A 5C31A 3LG2A 2P2LA 4BO4A 2ZB3A 1UBOS 5ECWA 4JJGA 1IY8A 1KK1A 3F7MA 4PWZA 1WQ1R 4MV9A 4KV9A 5THKA 1YA6A 4DUPA 4B7ZA 1MV5A 3AVOA 3COJA 4EITA 1PVVA 3F9RA 2JLRA 1L1RA 2A5LA 3D7RA 3C48A 1EDZA 1UMBB 3GOHA 3JRWA 3LBAA 2GQ0A 1IBCA 4ILKA 2PMFA 4OK5A 3SYLA 1JG4A 3V4OA 3FFXA 4YREA 3HBJA 2OAQ1 1MQ9A 4ZYXA 5FNVF 3EZ6A 5FWNA 1G9SA 4LXXA 3HK2A 1FTWA 4XOUA 3CINA 2AJTA 3V46A 1PWEA 1Y8CA 2D0PB 2BBSA 2IOQA 3CIFA 3K9BA 3RE1A 4US0R 4L5YA 3CCFA 1L1EA 5BURA 1Y81A 2Z5FA 3GUUA 3RSHA 1Z7GA 1CNFA 2CFIA 1KQ3A 3EZ9A 1AVTA 2YV3A 1QGZA 4BVLA 3KSRA 5IWAB 1MRZA 4BNGA 2Q8QA 3PQ8A 4ACBA 1FS4A 2FWIA 3DC7A 1XRLA 3PL5A 5J2TB 1QCZA 1YS2X 2AS0A 1P4RA 1R6DA 2NV6A 5LCXA 4CDGA 1BYIA 2R7NA 4WCFC 3ASZA 1VJCA 1Q0RA 3HLTA 3EVAA 3KG2A 3R0QA 1Y37A 1QB7A 3E7XA 4TOIA 4IJ6A 4TXLA 4TYYA 1LKZA 1NVBA 1X2EA 1JJIA 2PN1A 2I4MA 3GJ4A 5AI5A 3O4IA 5D8DA 1WUYA 2PKEA 4LJ5A 1TJPB 2IKQA 3ONVA 3QI2A 2O54A 5IF9A 3H11A 3R9WA 3RBXA 4WGFA 4HNHA 5LP1A 5L3QB 1QYVA 2X9LA 2QSZA 2CHVA 4XIIA 1WNTA 3OIYA 4JA0A 2C92A 1I6KA 3AB3A 2NQ2C 2ZJ1A 2GRUA 5TQJA 1KIAA 1UJBA 3IELA 4TWBA 1Z26A 5DN6A 1G6Q1 3NHUA 1GKIA 2PGJA 3AUUA 4IJUA 4E3ZA 1BJTA 4UASA 3T38A 1GSOA 2QE6A 2W2KB 2P6PA 2EATA 4GQAA 4X85A 5EFOA 5CM9C 2AYXA 3ROMA 2VUTA 2WU1A 3AESB 3DVAA 4JJ7A 2YOFA 2VBGA 5EMMA 3DM9B 1PL0A 3O47A 1Y1KE 3LZ6A 2I8CA 1DWOA 3GPDG 5C5EA 3FGNA 2ZB7A 2XXAA 2DVMA 3H6KA 4ND2A 5C8YA 4HSEA 1R10A 3ZXXA 4ARZA 4B87A 2ZYVX 3KOWA 3T35A 1T3HA 4UXIA 3H1GA 1F1JA 2FF5A 4E31A 1KBOA 3TL3A 2C3PA 4PRZA 1C4KA 4RK4A 4F0JA 5LPNA 2YR0A 3ME5A 3G79A 2AG8A 4PG5A 3ZU6A 5J4YA 1DINA 1JZSA 3LDGA 4FNOA 4F3TA 5G2OA 1ZONA 4HG2A 1Y4SA 3ZG6A 3GVCA 4RV9A 4GL4A 4FI3C 5EJIA 2VK1A 4DZZA 4NJEA 2WOJA 3ADPA 2M6RA 1A71A 3D6MA 4BMYA 3P2OA 3TTXA 1YDGA 3C5CA 2P8JA 4MARA 4JSTA 4MW6A 1JSZA 2ZBUA 4GMHA 2P9YA 1SHLA 4WOCA 3VU3A 4AZVA 1C41A 1USKA 3WK4A 1OLUB 3OECA 1IMOA 1U7DA 4EJ0A 4GFDA 3A1SA 5DK4A 4RA9B 3STYA 2IRWA 1CY0A 1O4VA 2WJZB 4JUFA 4KG7A 4HVCA 5HZHA 2UZ1B 2DKNA 2RGAA 4MIKA 1J97A 4J3JA 3Q3EA 1L5GB 3RH0A 1ONSA 2BDTA 1Q0TA 4YGXB 1FQJA 1UKEA 2RB5A 1M1UA 1R2QA 3MWYW 3NAZA 5BMVA 3O2QB 5CW1A 2DFPA 4HGOA 4J6EA 2ACKA 3EFBA 3DO8A 4MKRA 4RIIA 1JHQA 4DS3A 1B14A 2WMDA 1WLYA 2A35A 4U5XA 3Q8LA 1BE8A 2IHBA 4UBMA 3JASB 4EYKA 5KINB 4YMIA 3CSUA 4D9JA 3VYTB 4NBUA 5J2TF 2DT5A 1PS0A 3QKSB 4LJKA 3VX4A 4D2IA 4M9XA 4B82A 1R66A 3S2UA 4QUKA 4F2PA 1QFXA 5IASA 3T9BA 2F1JA 3I1JA 3UGKA 3C43A 2EV9A 3EEYA 3KR0A 4LZJA 2F4NA 1LWNA 2V6MA 4QL3A 4ZIRB 2PUDA 1KE1A 1IY2A 2EEZA 2R7KA 3WJ2A 5C80A 1O97D 2HW8A 3O03A 2I7XA 1T9GR 2MIIA 2Y0BA 3IA7A 5FL3A 1X7YB 3LXXA 5TS3A 4HX9A 5LXTA 4KVAA 5JSFA 4MV4A 3OLYA 1W6UA 1GA6A 1MX5A 5EE3A 1GRVA 2OHIA 3TFQA 2OLEA 5JSZB 1X1AA 1LPSA 4IXNA 3AR4A 1PI3A 4NS1A 3LL4A 1PJ3A 4TT3A 4KRFA 4IH1A 4X62B 3G9QA 4WL0A 3GLFA 1ZCZA 3VC7A 4CCYB 3BWBA 2JD2A 3FUXA 2HF9A 3BBLA 2ATXA 2PRSA 1X70A 1RWKA 1L9XA 5FA6A 2G4CA 3UWOA 1VKNA 4PHFA 3CEAA 1D5CA 2GKOA 4B43A 1HFWA 4ASUD 3TW8A 5EJGA 4EGQA 3AYZB 2ZIXB 3CO5A 3VYRB 5L3VA 4LPKA 1N34B 3LRPA 1Y6FA 2WM3A 1GGJA 3PE3A 3RBZA 3WNVA 1NJGA 2C98A 3W9YA 2XVYA 2A67A 5MGBA 4PO9A 2FZEA 4D44A 3PFFA 2Y1GA 1MA0A 4ZI3A 3NIGB 4N18A 3OTGA 2YWRA 1PQYA 1XZLA 1KXJA 4FJ2A 4O33A 3DT8A 3AR7A 4FFWA 3WLQA 1E3MA 1TI7A 3BREA 3WYGA 4EI8A 3S27A 1QLWA 4M3NA 1E3JA 4OMCA 1LSSA 4AUKA 1YNSA 3LCCA 4HVLA 3UUEA 4TLAA 3L9WA 1TC2A 3A10A 2ZCVA 2YIDA 3GLGE 1DJLA 4HNAB 1Y8RA 4HF7A 2N1MA 3IAFA 4A2QA 3T3HA 3C6YA 1EVYA 4U02A 3VV3A 2P9FA 2ILVA 3TUIC 4BP9A 1FJXA 2QRVA 3KKEA 4CIYA 5JSYA 2R8EA 4C2BA 4EYQA 2VF4X 4OJYA 4ZOCA 2X6QA 4ND7A 3VR1A 1JFVA 3C24A 1T9BA 5CA1A 4S05A 2PMDA 2ET6A 5KNCA 2WJHA 4I4TB 4TUYA 4O63O 4EGJA 4EK9A 1E2MA 3HCRA 4TROA 5FUQA 1TM3E 5KOYA 4YY3B 3S7TA 1ULZA 2ERYA 4K6CA 5F9HA 4EJSC 4UEWA 3L02A 3RF7A 5KYTA 1ZIXA 2BFPA 4KHZA 2CK3A 3QLUA 4DUYB 3KT3A 2C9CA 4M9CA 5DEIA 5A3JA 5BW4A 5C5DA 4GP9A 4ND6A 3RSQA 2QI9F 1DELA 3D31A 3O8QB 4ZJZA 2NZVG 2ZM5A 3I62A 1XDWA 4E94A 1KARA 5F7JA 4GRDA 2E37A 2IPXA 1STOA 3N0RA 4IX9A 3B60A 1Y98A 2PO5A 2WUVA 2YWDA 2CLEB 2HEGA 2R4UA 2G9QA 3ST7A 2BGMA 1U9YA 4OA8A 1SXHA 4KOAA 3BH0A 3K8OE 4DHEA 3HDHA 4N5LA 2XNSA 5IW8A 2WAXA 3O4GA 1CZHA 6NULA 2VZ8A 3PDIA 4ALLA 5KTOA 1JSLA 4RULA 3I2GA 2VNKA 4ALIA 3L6CA 3PE6A 4WKGA 3ZVNA 1DMRA 1E5DA 3IIMA 1CR6A 1LDEA 1YJAA 2OXRA 2V59A 3DDZX 1Q7EA 1XA0A 4L7QA 1Z0AA 4YAIA 4UVHA 2X0FA 1LF0A 3NHMA 3DMRA 5BQOA 1MUUA 2P5YA 3UAZA 3OZBA 4IIJF 4NCHA 4Y7CA 2QOEA 2ZPTX 3G8AA 3MWJA 5FAKA 2BHSA 3SVLA 1UJ4A 2V65A 3DXFA 4R71A 4DDUA 2YRFA 4DQVA 3C6XA 4ALNA 2QMEA 4OYLA 1VSTA 3PEVA 1LLUA 1H1TA 3UC5A 4IUDS 1Q21A 1Y48E 2DRIA 2H0AA 4ZYTA 4MWSA 3INNA 4R9SA 2QP4A 4DMMA 1EFKA 2CCJA 2B78A 3PEUA 4FGKA 4RDCA 3TLXA 4X3PA 5A4FS 3T5PA 4E5VA 1DKLA 3H2SA 3STWA 2YOHA 4BWVA 5F76A 2GZAA 3KQHA 2HSZA 1A8SA 3JYPA 4MB6A 4UNRA 3RSLA 4BNTA 2I3BA 4KAFA 2VP4A 4Q01A 1SWVA 2HCTA 4P8RA 1U1CA 1XZQA 3NETA 4QFMA 1LXCA 1BFDA 1YB6A 1PS9A 2YN2A 1J7JA 2PXXA 5K9ZA 4LF7B 2DSNA 1W47A 3IUBA 3EG5A 2JGIA 4B2IA 2KE5A 1J1UA 4B3CA 4IQ8A 2INGX 1RXEA 1R16A 2BR3A 2GRAA 3B9QA 3TIVA 3A3PA 2XQKA 2NZXA 1VYTA 4WOPA 3W5UA 4EMTA 2IC5A 3IALA 4NZ9A 1E6WA 5HKLA 4A0GA 1SB9A 3C41J 5HIIA 1A9YA 3L8EA 1R0SA 3MTQA 5EN4A 2PXCA 4I4TF 4HXGA 5B57C 2RE8A 3MHPA 2JLZA 3TS1A 1Z9BA 1K97A 1EDBA 1XRPA 1SXQA 4AAYA 4UXJA 2PSHA 3IUMA 1UK8A 2O3UA 1YQUA 5EIHA 2ZYAA 4BO3A 5AJZA 3RKUA 2QSYA 3F6RA 4P22A 1WCWA 1W0JD 1HLPA 4BRUA 1YVPA 1GM5A 1ZJ6A 4KKXB 2WWTA 4MVJA 3ZR4B 2DY0A 4PC1A 5GONB 4PCAA 5IXYA 4RIFA 1VE9A 2P67A 4XLZA 1D4AA 4TYPA 5JO0A 1E2FA 2AOTA 2OGUA 3JAKA 3ONNA 5ALUA 3AVYA 2Z3ZA 3L1UA 4L50A 5BSFA 1WW8A 2XAUA 3HUTA 4DLWA 4I8DA 2I9PA 4YRPA 3WGZA 1QHGA 2C2BA 4OX9B 1Z2PX 2NZJA 2E0IA 1W4ZA 5B58T 2A94A 1IYZA 1Q6YA 1XHLA 2A6PA 2IHVA 3BRSA 1SGWA 2XBUA 4N7MA 4I1PA 2Z09A 3ICCA 3R41A 1FZQA 2JRCA 3GDOA 1OGYA 1VJ0A 1T8TA 1P0QA 2QRNA 3K96A 4RKQA 1Z68A 5EIAA 5F2NA 1YKGA 4OM8A 3SJAA 2R1VA 4RGYA 5DYWA 1TD9A 2VF2A 3H2ZA 1ZMRA 2H2AA 4X7PA 1LD3A 2A0UA 3AR9A 1WU7A 1U2DC 2W2VA 1GG5A 4OYYA 3QY9A 3PG5A 1JLRA 1UP4A 4E4TA 4PVDA 2YL2A 2X58A 3FZQA 5JJLA 4KXNA 2BOVA 5F77A 2LCIA 5ALEA 2G82A 2WVGA 3CUSA 2FPKA 3TOXA 3NYQA 3IKMB 2TYSB 1DG3A 4ZAFA 1UXIA 4DWOA 2FMFA 4R01A 4ZRNA 4F45A 1FP1D 1XAIA 4A8HA 2OV6A 1R9JA 3W1EA 4KR7A 1SQ6A 4JGBA 2F48A 2XVXA 4LDNA 5JBNA 2VBIA 2Z8YM 1IEWA 2O1SA 4LX8A 1K8QA 3BTSA 3HKDA 5HCNA 4ZCTA 3SEAA 4NFLA 2NSHA 3D8TA 3B12A 1F7VA 1SC3A 3WBKA 3N2EA 1KJIA 4RSGA 2WBLC 3RRMA 4EW6A 3ESCA 1C3OB 1DEXA 5ITZB 2PFKA 3ZY2A 2C84A 2H6EA 1QRDA 5ALOA 5FI1B 4BVEA 3UT6A 3IYLW 3DOOA 3I73A 2FW0A 2BKXA 2XLBA 2XBLA 3F3KA 3GOQA 3HUFA 2GJAA 4FC7A 3MUFA 1JEJA 4YRGA 2DETA 1QK4A 1ZL2A 4WZBB 4UULA 1DKPA 3FNQA 5EZYB 1R18A 1KEUA 3BWVA 4X6YA 1G66A 3TLBA 3FRJA 5B7GA 1EUDB 4JNCA 4D6YA 3GJQA 3GQBB 1UZLA 1E0SA 3OFKA 4HDCA 1AKQA 4DSAA 5C3MA 5ITSA 1UQUA 1DOHA 4E14A 2WK1A 2WUFA 1SXJC 1T36A 5K0LA 1URPA 4D42A 2QX7A 1CJBA 2IHKA 3C8ZA 4PZ9A 1MVLA 5FJIA 5FWDA 3FFTA 1TCVA 4RHYA 3Q2KA 3HJBA 1Z5WA 1YU9A 2Y0PA 4ZT2A 2AWOA 5C46F 4D97A 3LX8A 3OFNA 1JP7A 5EWJB 5GONF 1T2AA 3NVMB 1CDOA 3BRWD 3ILHA 3AFIA 3DNMA 5J1SB 4Y0VA 2H4XA 3EBOA 3INRA 3NHRA 2F8TA 5JAOA 4RTPA 1G2QA 4FYWA 2JBAB 3GO4A 3KQQA 1VC2A 4FYYA 2ICAA 4JKYA 3BMNB 3I01A 5BN1A 2UXDB 2ZIFA 3OU6A 1XA3A 3MB8A 4FOSA 1OREA 1QRTA 5F23A 2OQRA 4QDZA 4Z3KA 2JBHA 3GDWA 5ALHA 5DCLA 1I36A 4H1UA 1X7WB 3I39X 2G6TA 2QE7D 4B6GA 1YULA 2QW8A 1Y4AE 2H0QA 2JGJA 3G0GA 2KQUA 4NHOA 4NFYA 4O4IB 421PA 4MJLA 3B70A 3PRYA 3QOWA 4L2IB 1XDGA 5JROA 1QVVA 1NRXA 4QELA 3C7KA 4B3RB 1USGA 3UK7A 5I5GA 4J3FA 4E70A 1OAOC 3TTTA 4A4DA 3G0HA 3SOZA 1ABEA 1AIPA 1I1HA 1MJHA 1RQNA 2NV0A 1RT9A 3FJOA 4Z9AA 3SICE 4KQ9A 3ZJVA 4O2RA 5D84A 1H23A 1VMIA 2PRYA 3M83A 3IQHX 1VMKA 1U8XX 3IE0A 4OK6A 2G09A 4H0NA 4ZI7A 3DKRA 3N70A 4C76A 2MSLA 4U0KA 1XSEA 4I1OA 3LFUA 121PA 2IYTA 3G5MA 4WADA 1H9BA 1NBIA 4OQMA 1V37A 2ZAIA 3K6JA 5CPBA 1O57A 4LQLA 3TBKA 3TK1A 2GK6A 2J5RA 3TLMA 4F4FA 4DUZB 3QPVA 3T3GA 4OIFA 4FZ3A 3R9XB 4LA4A 2BKAA 1BDJA 4BWYA 3ZLUA 3FWZA 4A9AA 1E9VA 1BVYF 3BJMA 1FNCA 1HOTA 2YRWA 1CC1S 2ZQYA 3V9PA 4XARA 1CW2B 1RYBA 3L8MA 2AFIB 1EP2B 1B00A 1I13A 1XXHA 1ZEMA 2A88A 2CF6A 3VR4A 3L8CA 4NBNA 2C8LA 3WP1B 1AOXA 3A04A 2AOUA 4UQOA 1R6UA 1NDQA 2F62A 3GZJA 5KTPA 4YI3A 5C37A 5EZYF 1MX3A 1I10A 3TEMA 4MUJA 1T5DX 1NXOA 2WJJA 2Q4EA 1KO7A 2I7VA 3KE9A 3OOJA 4QHSA 4ENTA 2G88A 1L5LA 4EAAA 3ZEAA 3V1KA 2MR6A 4Q1CA 2EX0A 4RL6A 3DEKA 3VR0A 3O83A 4EDFA 2AZXA 4N41A 3FHOA 2ZTUA 3RWMB 1I5OA 4ISBA 3USCS 3DE1X 1JR3E 3DSRA 1HEUA 4D0GA 3T06B 1GILA 3VAAA 1LTQA 4Z8XA 1IY1A 1I3MA 1MAWA 2UVPA 3NM5A 5ESXA 1EG7A 2OO5A 3OPVA 4KGVA 1U9IC 4XQCA 4JV5B 1AZWA 2BJVA 1ZD8A 4ALKA 1J9GA 1N6HA 4U2CA 3GJ6A 3VNQA 2ZWMA 4PG7A 1U0RA 4QQNA 1V9SA 5IG2A 1R5OA 1ZFNA 4HFJA 5EXSA 4DM3A 3IILA 2IDMA 3PJRA 4AJEA 3OX2A 1YFKA 4ERNA 3RUEA 1IQUA 2ZP1A 3FIJA 2FRVA 4NAUA 1E0DA 1VG8A 3GUZA 2WA1A 4TYMA 3NXSA 2PKCA 3H5LA 3GP3A 1GGMA 2WTNA 1G7SA 1Z5VA 4KN9S 4UFOA 1QM5A 1IWOA 3N8IA 1Q1EA 3LWNA 3T5BA 5JQGF 3EB9A 3AY3A 3R5XA 4F9FA 1DTSA 1P3Y1 1TEVA 2A5GA 5AESA 1EVIA 1T2CA 2W8BA 2EX4A 1UMCA 1I14A 3FLEA 3UIEA 4E11A 1UWLA 3GHYA 4TTIA 4MMZB 2OUKA 4RH1A 2BGJA 1IUKA 2G28A 2E55A 1PJTA 5HS6A 4RK0A 2AT1A 4DJDC 4J75A 1CR1A 2VXBA 2NO9A 2J09A 3K20A 2QD1A 5LKAA 1HG1A 3NT4A 4TQGA 2WNSA 5CX1B 3FVRA 1T9CA 2XQIA 2D0IA 5AJVB 1SOWA 3V1LA 3ZK7A 2GEJA 2WFAA 4YCJA 3DBVO 1P4SA 4YAGA 2QUJA 1ZGJA 4OLFA 4K9PA 4WECA 2XUFA 5KTMA 1TADA 2AYZA 5GVRA 3W2EA 1XIVA 3GMIA 5LMCA 2J08A 2OLJA 4GP6A 4AQ7A 1IQ0A 2BGRA 4U7HA 3TLEA 2CMFA 3KSAC 1BW9B 2XW6A 3UHAA 4DBZA 2GCGA 3L7BA 4XIFA 2QTVA 2JGLA 3KKMA 3LF1A 4JDUA 4NAVA 2B3TA 4E09A 2FP3A 4CV0A 2BONA 3L0PA 3HMKA 3SDBA 1NVVR 2Q1XA 1ZXBA 4AZ3B 1P2UA 4CL3A 3DPUA 2HAEA 2E3JA 4I6JA 1HBJA 3WJ7A 3CEPB 1HT0A 3B51X 3E9ZA 3KQTA 4BQQA 5ALJA 2FX5A 2D8MA 2FPLA 2WZBA 3AM5A 4U8HA 2PSJA 2NUAB 2K5UA 3L84A 3AEQB 1RMTA 3T1TA 5HCIA 1FQOA 3HFRA 2G5TA 4LJ9A 4LGYA 3MJFA 1E62A 3BB4A 4UJ5A 4Z0TA 3I64A 4ZT4A 4FB4A 4UTPA 1XDDA 4AC9A 2AEMA 4FONA 4GUDA 4LXQA 4YDSA 1QGAA 1KEVA 1I1OA 2ZITA 3HA3A 4S1WA 5BMVB 2V7PA 2ZPUA 3QHPA 4MO2A 4OF4A 2I4OA 1PSWA 2GH1A 4KWEA 1SKMA 3SS7X 3OJOA 3C4QA 4D4GA 1MFPA 3DDSA 3LPCA 3PEYA 4GBJA 5A4JA 4I14A 3KUUA 4NI5A 2YZMA 1CK4A 2H7VA 2OPHA 3B2QA 3U26A 5L7TA 1XMIA 3FDFA 3OEHD 1YUBA 4G65A 4HXFB 2UYGA 3QKIA 1WEHA 2QR2A 1HDIA 1FLDA 2FFQA 1HF3A 3GA7A 3PQDA 4GOJA 2IOFK 4CM5A 3QE4A 5A3RA 3MGGA 2P9HA 3RRZA 4PINA 2YYYA 3EOBI 4RW0A 2PH3A 5HZGA 1QO0A 2IYQA 5IH7A 4ANFA 1F0KA 3OO0A 1ODKA 2ZI3A 1G8YA 1HZZC 1NMEA 2FUG1 3D8RA 3EQ2A 3M70A 4RK6A 4DJJA 1WF6A 1VBMA 2QTFA 2P90A 2WNIA 4AO7A 3ETLA 5EXTA 2ROQA 3CGGA 4P54A 2VOJA 2CL5A 3KM0A 3NHSA 2XCRB 2FZGA 2CLCX 3EVBA 3GXOA 3KUCA 3VR4H 4C3ZA 5B4VA 3U61B 1JHDA 1B15A 4FS8A 2W2LA 4OB7A 3UCXA 4BPBA 3HP7A 5A9RA 1OT3A 2WUDA 1ADJA 1QWOA 5LYJA 3DDHA 3IEKA 3SS8A 3JQ9C 1MJFA 3G2LA 3KKNA 2P69A 3N05A 5BWCA 1X2BA 5HZKA 1JEYA 1S3FA 1QANA 3B7PA 4PCVA 2W6QA 2C61A 3IBGA 5HEKA 4PGFA 5FPQA 3A9RA 3OZCA 3L4KA 3WMXA 4FCWA 1F5SA 3LCMA 4L16A 4W5QA 1T4MA 1N1MA 1TQ8A 3MJDA 1X9HA 4C01A 1N78A 2J4DA 3TX2A 5B1EA 4ENSA 4FW9A 1ZVJA 2O2ZA 3NOQA 4WUTA 4Q15A 5H83A 2Y0CA 1TEHA 2FJUA 3GCGA 2EFHB 5IVIA 5EIEA 1M5TA 5CFRA 5DTMA 2QRPA 2RCYA 1QG2A 4P84A 4OP1A 4BBZA 1OBOA 3JQAD 4E4RA 4LZZA 4R9RA 1FA9A 4TWAA 4ZAXA 2I22A 2YXLA 1N1DA 4UOQA 1QP7A 6GPBA 1LPBB 2R87A 3JATB 1GGFA 2XXBA 4IGFA 2AXQA 5IBRA 1DWQA 2FDRA 1EB9A 1WIWA 3O1IC 2QPOA 4CLDA 4MRMA 3IXQA 3VAZA 3U60B 1J00A 3U31A 1QZXA 1F8FA 2Z3WA 5D51S 4UDNA 3IUJA 4B2PA 3IEUA 3MMXA 2G7MC 1VHJA 2WYVA 2FR0A 2PWZA 2WV7A 3L79A 1P7CA 10MHA 1KI1A 2EIHA 4DJEC 1SIWA 2GZ2A 3DTVD 4IYRA 4RVDA 1OILA 5A04A 4O4HB 1XLVA 2YY7A 4KXMA 1C0IA 4F4HA 4AMBA 2B4RO 3D3WA 5F3RA 1U7ZA 5FDFA 1AE1A 1HTTA 2IOFA 2OGZA 3E1KA 4EG7A 1R0CA 3P2MA 3AJEA 1IDOA 2DR0A 3E22B 3QJ5A 4KEAA 5E7JA 3KVNA 1FXSA 1R9GA 2A5FA 4CKCB 3H75A 3QSGA 1Y7PA 4QEKA 2F55A 2PUWA 1TYBE 1VI5A 2IEBA 4LRUA 2D8AA 5ALVA 4X24A 2G1KA 3WDKA 2W9XA 1YF3A 4BBJA 4MP8A 3TAUA 4ZVMA 1M5RA 2UAGA 1VCOA 4C4PA 4LX0A 1QGYA 2QSJA 5IC4A 2DLCX 3DZJA 1Z6QA 5I5EA 2GBPA 2WNHA 1KEPA 3GIDA 1XA4A 3D9QX 1DNPA 1PFWA 4UQPA 2Q7OE 3RVLA 3RVMA 5JANA 2Q41A 4N3BA 3EARA 4LXIA 1VPDA 3T1QA 2X5OA 2YZ2A 2ZULA 5D86A 1O87A 2PMBA 3JQ6A 4YRQA 4EX7A 3TEJA 1OX5A 3VU9A 1SAYA 2HYIC 5FBHA 2ZZNA 1YQGA 3IQXA 4QUAA 3KSZO 3UATA 2GNPA 4V3CA 1APBA 2R5WA 2ONZA 2M6LA 1MW9X 2IYYA 4QBIA 3BPSA 5DO9A 3W5AA 2GF0A 2Q62A 1HWYA 4NCIA 1BO6A 2HJVA 4BO8A 4Z1MD 3PUZA 2K7ZA 4JU8A 3BHMA 4XWWA 2UUBB 4RQTA 2F3TA 5SY4A 3QX7A 1KZ7B 3PC4A 2PT9A 5F78A 3U7RA 2I4RA 4DY4A 1N75A 4RWZA 3LW7A 3OZIA 1Z5GA 1J56A 2CLMB 1EMDA 2BE7A 3A6GA 4N0QA 2R65A 4XDZA 1E2NA 1XB2A 4PPNA 4XX0B 1FVOA 5CIWA 3X1MA 4D3YA 4H77A 4BFTA 1QH0A 1SEVA 2H06A 4QXOA 3AP2A 4RK7A 3B13B 3EAFA 3HU1A 1EE2A 1XEAA 1TVEA 4Z0NA 2OC9A 1VIMA 1WAMA 1TTPB 1AUPA 4KPUA 1SO8A 3U62A 621PA 1EK5A 3I0NA 3F49S 3GNQA 1K7SN 3PYMA 3IAUA 3SQNA 3TJRA 2QVYX 2VEOA 4YQEA 7ABPA 2C8JA 5ALKA 1E98A 1U8FO 3BCRA 3EDOA 4P3NA 4RPKA 1QF9A 3BORA 4F3KA 3MYRA 2AG0A 2Q2NA 3A4MA 4QLBA 1XFAA 2R68A 3PFWO 1T43A 4FSXA 4I8IA 4RPLA 2I2FA 4A6PA 1WA5A 2P3LA 3JSXA 1T13A 2PD3A 4HI0E 4KFRA 5CIQA 3TLCA 3X44A 1VSQA 2PS3A 3N6XA 4TMYA 5CJ2A 2EJTA 1TTTA 1A8IA 3H13A 2BV3A 2C0PA 3COPA 3B5IA 4HDNA 2J6HA 4EUNA 1E61A 1JKIA 2FPPA 1JR2A 1JWBB 1WO8A 5ES3A 3ORFA 3UHPA 4CLHA 5BNZA 1JDSA 1UZUA 1Y3FE 1SC4A 5TQ2A 3QEOA 1H6CA 5TQ0B 521PA 1YA4A 1LW6E 2II6A 2W4IA 1HSZA 1NV8A 3IA2A 4N0MA 3EEQA 5CUQA 3WKCA 4Z7JA 1E2DA 4C4OA 2X8JA 1L7EA 3D1VA 2PEZA 4I50A 2XUZA 2OYCA 4ZYWA 3TWOA 1N6LA 5B4UA 5F12A 1YR7A 1GPYA 3UVEA 1T4CA 1T9KA 1M7HA 1LGYA 3O9ZA 1W9HA 4BO5A 5LMZA 4FHEA 4CIDA 4ZOQI 2UYQA 4FOLA 4MGEA 1P8AA 4ND5A 2OC4A 2WJ3A 4WXHA 4BU1A 3K0FA 5B64A 3OIVA 4ZALA 2ODNA 4NU8X 3DMGA 5K3CA 4YJHB 1E7RA 2DFDA 4Z3DA 4YAFA 1CNEA 3B9PA 4PBTA 3P9PA 1UWCA 2EBHX 3WWDA 5SZHB 3NEPX 3TMYA 5FFMA 3HWSA 1W5FA 4K5QA 1UBNA 4WOJA 1OA1A 1Q1AA 3K73O 2RHBA 1NVGA 4OXIA 4TXMA 1ML4A 4RZ3A 4RDIA 3WK7A 4E32A 3HBLA 4KIWA 3SZMA 1P72A 1ZRHA 3DTTA 2WKSA 4OGLA 1HDYA 3RBVA 3VSCA 1SK9A 1ZWLA 4LMRA 2GSDA 4HEQA 2R2GA 1ZS9A 5DYNA 1CJSA 2HIAA 4L4RA 1EK1A 4KAXA 4L73A 5FI3A 4BLPA 3LKDA 1XMQB 2VHCA 1ZK1A 2CMHA 2EGGA 4X8MA 3ZBUA 3SZRA 3TCNA 1DAIA 3K6SA 3C5VA 4GZ5A 1NULA 5THQA 3SDZA 6Q21A 5I4KA 2P9BA 1JBQA 4DIDA 2GPAA 2OAEA 5IJ0B 4EA9A 1RQRA 1PT8A 3QUSA 4FFBA 3U4DA 4WCVA 4RLSA 5AMXA 4XYLA 1I4WA 1GA1A 2I33A 4ABTA 7GPBA 2FSSA 4X7MA 2IXEA 4D8XA 3MTIA 4LBVA 3UMRA 1CLUA 2EQBA 4BGDA 1XQ1A 3LOQA 2WVHA 2FFRA 5ICMA 5HZMA 1ZM4A 4QGBA 1U0FA 1YUNA 1HR0B 4CRWB 4KR9A 4JBXA 1OZAA 1KAMA 4YCAA 4FJ0A 4QAJA 2ORVA 5EP3A 5C7YA 3SYKA 2FG7C 2IL1A 4HNVA 2C8VA 1U5CA 1SOAA 1AHIA 1NG1A 4CLOB 5KNBA 1G60A 2H4ZA 3K09A 4GEKA 4R8KA 1DGQA 2GEBA 5E6SB 2VCEA 4U2GA 2GRJA 4HH1A 1O9GA 1NIJA 4L9SA 2ZUBA 4OOEA 1IXYA 1WOYA 4YV0A 4GP7A 3P9QA 5AYVA 4H08A 5DTIA 3B9RA 4HRXA 2EDCA 3EIOA 5AM2A 3SR0A 1P9NA 2FSVC 2Y8EA 3IBTA 2MSNA 2X6TA 1H5QA 1PR1A 3ETHA 4G1CA 4LK3A 4NS4A 5D2CA 3S1LA 3VAYA 2WJIA 2ZKIA 4DLTA 4DLYA 4DNPA 3PB3A 1BIFA 3R9KA 3GEMA 5T8KC 1OXTA 4F85A 1FX0B 2GM4A 1EE9A 4R2IA 4NH0A 5HGXA 2J6CA 2QPLA 4YPOA 1WZNA 4UNQA 1NPYA 3LSYA 1HEIA 2YRXA 1XXHE 3K0AB 2A1TS 3PITA 3SF0A 3UV6A 4CU5A 3QKRA 4DZTA 2IPOA 3AF0A 2XUPA 5E7MA 3BHJA 3QM1A 3K53A 5FUXA 3QF7A 2AUTA 2QQEA 1PS8A 4DCUA 4EZBA 3PS9A 1KI3A 4E2ZA 3TQSA 1ISSA 2O2XA 2PK3A 1YR1A 4X20A 5JH7A 2O5RA 1H1LA 3PFGA 2QW0X 5DHAA 4EVSA 2CN1A 1UR5A 2Q1YA 2GYVA 1COWD 4D8TA 1VXRA 3KOXA 1GFWA 3HP4A 5F52A 3SIWA 4WLUA 4BTVA 1P17A 3EVNA 5DNUA 3JRNA 3LT0A 4BEWA 3GRZA 3HWX1 2CV1A 5D87A 4NF2A 1XTRA 2B34A 3HJUA 5BXYA 2FR8A 3QLJA 3JAWB 2I71A 2GZHA 4YR9A 2QDXA 1HUQA 4FDTA 4YECA 2BGNA 1YB2A 1NVMB 3DQPA 3TPZA 2A1IA 1H4QA 2B8WA 4DV0B 2PAAA 2B5WA 1D6JA 2QAIA 3LGAA 4RYLA 3UA3A 5DCUA 1OTHA 4XXHA 4YYEA 4PYMA 3WICA 4CF5A 4YJ2B 2XTMA 4MB2A 1EP3B 1LV8A 2ANBA 1DKNA 4G97A 4AWAA 1YU6A 1YTUA 2Z43A 1VKRA 1TYAE 2D1TA 1TMGE 1DI0A 1F8YA 1YGPA 2FA9A 1A8HA 2P7HA 1SUWA 4MVJP 3VKFA 1I6LA 3EMDA 3RYCA 3ZDAA 2PXAA 4XPIA 2GXQA 1PNTA 4WDRA 4B6PA 1G4HA 5AICA 3ESDA 1LVHA 2D1YA 3G85A 1M75A 4J90A 2F00A 4EPXA 2J7PA 4FSHA 5EI5A 3WGMA 3UUWA 4UOZA 1UPCA 3EVDA 3FUUA 4AIIA 2J8ZA 2TMDA 5KJCA 2ONKA 4PCLA 3P7MA 1QPZA 1WHTB 1IZ8A 3CBGA 3KSMA 3GHHA 3K35A 3X1XA 5IDQA 1VM6A 3T7TA 3SU8A 4R3WA 1KSHA 1U1GA 4YROA 3SC2A 1P80A 1KVQA 3A1FA 3CKYA 3V7YA 2VJPA 2QYSA 2M9MA 4Q34A 4ENRA 4KX3A 1OTYA 2RI1A 4G84A 5DB4A 4L6AA 3DLTA 3RSSA 3SWWA 4RKRA 3FUWA 3H6GA 3O8OB 4DA0A 1EX1A 2FQ1A 3T3NA 3P96A 4WESB 3CR3C 2XJ9A 3Q4GA 5LWHA 2AE1A 2PLNA 4ZQCB 5FR1A 3TECE 1V26A 2FPMA 3H1PA 3OSUA 5DN9A 4JP5A 2E4ZA 3DAHA 3OM0A 1Q84A 3H2BA 4U9UA 1Y6JA 4C7VA 1LS6A 3G9UA 4A16A 2WWRA 4JI4B 4IKOA 4FX5A 1TTQB 4IEFB 4OHBA 4JBYA 5CB4B 4DLKA 4BJ5A 5AP9A 4QM7A 2AF4C 2EW2A 2PX4A 2QRHA 3GARA 3DE5X 2FZWA 3MG9A 5DSZA 3LUDA 1KO4A 2IV7A 3EPJA 2QVGA 1KE2A 3A4LA 4G0NA 1RLUA 4DNXA 4X54A 1JB9A 2CZGA 1X13A 2PLFA 2RGUA 1NBWB 1KZ1A 4IKEA 1PLJA 1TYDE 3THSA 3N3BC 2AN3A 4G63A 4I3GA 4RIEA 1BWPA 2GKGA 1KDYA 3MQFA 2HFJA 1DS6A 2C83A 2Q5OA 2ZW9A 3DTVB 4G23A 3QFCA 3BK7A 3HKBB 3GZNB 5BVGA 2R5FA 4CV1A 3FPJA 4ZREA 5IARA 3CJRA 4A27A 2OOKA 5DX8A 1IBSA 5AHXA 3RNOA 3AJ9A 4NOMA 2X40A 4Q4JA 1CR2A 4RV5A 5LD2C 1Q1NA 2D1QA 1Z33A 1P0IA 4R81A