4NDNE

Structural insights of mat enzymes: mata2b complexed with sam and ppnp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
IPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase isoform type-2
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 309
sequence length 309
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ndnE00
3GNSA 4DPLA 3RUDA 5I9MA 5TT1A 1B7GO 3RU7A 2G0TA 2Q50A 2Y99A 3L6OO 4RLHA 3TOXA 4BNJA 1XDWA 5JDCA 3GMSA 1PWXA 3NTRA 4CM8A 2O23A 1QP8A 2YZ7A 4QQRA 4XYMA 5CAEA 1ONPA 3U4HA 4OGWA 1RM0A 5EJ2A 4N5MA 2EV9A 5C7LO 3ZWVA 1ZH8A 3ASUA 3OHSX 3UCFA 1B26A 1N1GA 1ULSA 4FW8A 1OBFO 2G5CA 1LSJA 2VRCA 4FOSA 2Q49A 1T2AA 2JD1A 4WLNA 3ZHYA 4UVDA 2BGMA 4A5OA 5BQFA 1I0ZA 3H9QA 2DM6A 5DDIP 4FFLA 2BHLA 5KKAA 4D79A 3H9GA 3DBHB 3E9QA 4GGOA 2WSBA 1R66A 4YJDA 1I33A 1X0VA 4YT8A 3I9OA 1ORRA 1HYEA 2X23A 4HKTA 3D0OA 4TWRA 4I9NA 3B1KA 4IGEA 1KOLA 4XJSA 3C85A 5BT9A 3DBHA 1H5QA 2JCVA 3OP4A 1FDSA 2HSDA 4KDFA 1X1TA 4HFNA 3WQQA 1BHSA 4CUJA 3C3XA 4DQUA 3CINA 2FMUA 4I9HA 1TXGA 1O0SA 3GEDA 1QORA 4PLWA 3SXPA 3G0OA 2CDCA 1F8GA 4P22A 3GY0A 1VM6A 4CR7A 4S3MA 5K9ZA 5KVCA 4O63O 5IXYA 3EHEA 1PS8A 2EKQA 1PGPA 1HXHA 4RO0A 1VL6A 5EQDA 1Z74A 1Y9AA 4PLYA 1OOEA 1CJCA 4GH5A 3OIGA 3JCZA 3ONEA 4BS9A 4UUNA 1Z82A 1YL5A 5L4LA 1ZO8A 3I9KA 1LDEA 1PJQA 1N1EA 1QLHA 4Z3DA 3O9ZA 1ISMA 1D1TA 2D5CA 2P91A 5COQA 3KLMX 4XKJA 4IXTA 5A5EA 1PL8A 2ZQYA 4BMNA 1E3IA 1NTOA 4K9DA 3JYLA 1JDJA 1DEHA 1DRVA 1VKNA 2Q1SA 3JYOA 4GVXA 4XQ9A 3RASA 3NDJA 3WTBA 3HN2A 1UXIA 1ZBQA 3VZSA 1FXSA 4E4YA 4LRSB 4WJZA 4IGFA 3ANMA 1O5IA 1UAGA 2I9PA 2C7GA 2J3KA 4YPOA 1PQWA 4WOKA 4B3HA 3DOOA 1QRRA 3LLVA 3HHPA 3M6IA 4ALNA 2WYUA 1CF2O 3IUSA 1KBZA 1RJWA 4L73A 1O6ZA 2GYYA 4YA6A 2YW9A 3NYWA 2DAPA 4B3IA 2PD4A 4EZBA 2ILTA 4CQMB 3TZKA 1UH5A 4E32A 1E6EA 1DJNA 1NPDA 1PIWA 3AUUA 2PFGA 3WJAA 2O3RA 3Q11A 4JNKA 4OXYA 2PZLA 4L75A 1WAMA 1SMKA 3G1UA 4UVGA 4Z9XA 5IDXA 2DTXA 3K6JA 1EQ2A 4AJ1A 5IDYA 3I5MA 3U4DA 4Q3AA 4CQMA 4BKOA 4OKNA 4RVFA 3EDMA 1BGVA 4M87A 4U0JA 3WYCA 1UXJA 1VSUA 2X0RA 4CMHA 3H7AA 3QJ5A 1L1FA 3JQ6A 1PR9A 3GVPA 2D1YA 4MKRA 1U8FO 4E13A 1B15A 1OAAA 3GA0A 4IZIA 5T8KA 3U5TA 4EUHA 1EE2A 3UCEA 5B4VA 4FJ2A 4W9NC 1LBEA 1N7GA 1T25A 1U9JA 1ADFA 1A27A 1PZHA 4AJ2A 3F47A 3EZLA 3EW7A 2PD3A 3LSYA 1YH3A 4K6FA 4ZA2A 1PJTA 3K30A 4A26A 4B79A 1CRWG 5F21A 5T64A 3E9MA 1DAPA 2W90A 2Z1NA 4FGSA 5JDCC 4R1SA 2VT2A 4BGIA 4ILKA 2B0JA 4BO5A 3GK3A 3PWKA 4GX0A 2A9FA 1YDEA 5IF3A 1NXQA 1JN0A 1XIVA 4MVJH 3WX0A 4BQPA 3BMOB 4B8ZA 1AHIA 4DIOA 3P2YA 1EFKA 1NVMB 3SC4A 1NASA 3ZV3A 3P19A 3AUSA 4XD2A 1G6KA 1CQIA 5A06A 4IBOA 4WCFB 3WB9A 1YL6A 1HL3A 3BMOA 4L4XA 4BKQA 4XJTA 4Z0TA 2O2SA 3HE3A 2VZ9A 2CNBA 3TF5A 3ITKA 4JLWA 1FDWA 2Q46A 3JYPA 2ZJ0A 3MTJA 1GTMA 4WCFA 5C5IA 4NBUA 4LCEA 4RPKA 1K3TA 3PJGA 3VTFA 1GYPA 2JCYA 1OC4A 1P0CA 3GDFA 1U3UA 3L07A 4KP7A 1KEVA 4IQ0A 4GKBA 2BMAA 1ISHA 1Y1PA 2P9GA 2VOEA 1Q7BA 4I5FA 5KJFA 3V1UA 1M6HA 4XIYA 4YT5A 3P5SA 4AFNA 4OAQA 3WGIA 2B36A 3MOIA 4BNUA 1I2CA 3DO5A 2IZZA 4A2CA 3E8XA 3K73O 1GYRA 4RF5A 4UUOA 1ISIA 4HP8A 4N5NA 4F6LA 3NTOA 3PJDA 2D59A 3KM0A 3VOSA 1GR0A 5EL0A 1HT0A 4IDAA 2ZTMA 3VAZA 4L74A 1P1JA 1PWZA 4FFNA 1ISJA 2J5KA 1ZJYA 4BO4A 2RH8A 2O2YA 2O4UX 2RIRA 3PZRA 4J2HA 4XQGA 4LGVA 3D3WB 4RV9A 3RIHA 5JNLA 1TT7A 2D0IA 3GC6A 2DVMA 4UEKA 3RC9A 1D7OA 1DFIA 2PZMA 3GN2A 1XHLA 4RDHA 3PXXA 2NUAA 1JKIA 1LSOA 2D2IA 4RZHA 3GVHA 2CVOA 2OZPA 2P4QA 5JS6A 5EIOA 3OJFA 2XF8A 3NDRA 3KZVA 1GDHA 1I2BA 5ENVA 3D3WA 5JPIA 3LU1A 3RI3A 4CODB 1ZUD1 1Z7BA 1HSOA 1E7YA 5KNLA 3PK0A 1JTVA 4DGSA 1MXFA 2FZEA 1EVYA 1X15A 2JFHA 4X54A 3RWBA 4LN1A 4LCJA 2HDHA 3OJLA 2GN6A 2R00A 1H9BA 4WASA 5DBGA 1E1MA 2WEKA 4NFYA 4EGFA 1YKFA 1LDYA 1C0PA 3I9LA 3B20A 4YT2A 2OO5A 4PZCA 4DLAA 2NTVA 3IDSA 4DC1A 4L4SA 8ADHA 4J0FA 2VWPA 3CTMA 3EUWA 4CM6A 1U2DA 4E3ZA 1PX0A 2HKIA 4RZIA 4BMVA 1LLUA 1C0KA 4FR5A 4MVJA 1E7SA 1KEPA 1G0OA 1Z75A 5T8KC 3FSRA 3W6ZA 5KJEA 4MIEA 3QWFA 1J5PA 4FDAA 1A7KA 3LC1O 2X5KO 4XRRA 2C5AA 1XU7A 1RPNA 4D45A 3FHLA 3GPDG 3WICA 3IL2A 2WWRA 1UDCA 2EW8A 4J16A 3EK2A 3D5QA 1UXGA 3DAFA 1YB5A 2OUIA 3VTZA 4D44A 2JKVA 2C0CA 1VL8A 2AE2A 3DFUA 1GQQA 1NP3A 4Q39A 1AXEA 1ZSNA 1PGJA 4HBGA 5U9CA 2OGUA 1H6DA 1RWBA 2P2SA 1LDBA 2BKAA 4KZPA 1Y6JA 4BGVA 1YRLA 3ROQA 3UH1A 1QYVA 1T2EA 2Q1WA 4UULA 1HETA 1MXHA 1FF9A 3WSVA 2FY8A 4ND5A 1U3TA 3RUCA 2EIHA 2ZTUA 1HE5A 1J49A 3ENKA 1JQBA 5G4KB 1QXSA 4Z0PA 1WW8A 3GUYA 3I4FA 1TLTA 3HB5X 5G0VA 1A5ZA 4NU6A 4YAEA 1WDLA 2A35A 4OOFA 4ESOA 4MVJP 1EUZA 4CJXA 4N7RA 5TGDA 4CV2A 1PZFA 1YVEI 2GF2A 4R5HA 5B12A 5G4KA 4WCFC 3N7UA 2A94A 3D4PA 4LSMA 3W8EA 4Z3KA 1WDMA 5JDIA 2IODA 3VDQA 2X6TA 3ITDA 3AUTA 5T5QA 4IDDA 4ZICA 2P9EA 3G3EA 3TZHA 3E6AA 5KKCA 2B4RO 5KIAA 1VKOA 2EXXA 4GX5A 2JHGA 4KQWA 4NBRA 4RF3A 2WYVA 2UUPA 1E5QA 2ZK7A 4IJKA 2QRKA 3TOZA 4E2XA 5JY6A 3WXBA 4DLBA 1DXYA 3MJSA 3I23A 1UZLA 5DCYA 3WYEA 4BV9A 2YHUA 1LA2A 1E3WB 4MVJM 4RQTA 3X2FA 4A03A 4IQ8A 3KV3O 4XGIA 2I5PO 4DPKA 3WNQA 3IP3A 3QSGA 1IY8A 2Y05A 4GX2A 4GSKA 3W4IA 1M75A 4XGNA 5AVOA 5EESA 5BSFA 1NBOA 1SC6A 5EINA 3IMFA 1E3WA 2X58A 3WGTA 2Y0CA 2O4CA 3OECA 4FB5A 4HWKA 1NYTA 4O0LA 4BNTA 3L4BA 4C7KA 1LDGA 1C0LA 4YBZA 4YAKA 2GSDA 4WEOA 3OJEA 5I9LA 3ZWCA 4EJMA 5K0ZA 3O4RA 1NQOA 3DAGA 5KVQA 2Y1EA 4DYVA 1HDZA 4EITA 4KMSA 4QO8A 3R1IA 1DOHA 5HM8A 5KOIA 5KJ1A 4NHEA 1ZJZA 3PHHA 1P1HA 5DBIA 3SEFA 4BNNA 3BXXA 1GV1A 4R9SA 1IL0A 1GUYA 4D0SA 3RCBA 4D43A 1D4FA 1NVGA 3E03A 4OHUA 4QXMA 1LC3A 2R00C 3I4CA 4Z9FA 2WD8A 5ITWA 1GQ2A 1KVQA 3W4JA 3WWYA 2NQ8A 5JCJA 3ZU3A 2X0IA 1I3MA 1HDCA 4Z9YA 1EZ4A 1K5HA 3DWFA 4BNFA 3TZCA 3ZU5A 4CM3A 4TZTA 3E18A 5FEUA 4OSPA 4OYRA 3LYLA 1GPJA 3ANNA 1X7GA 2YFHA 5DP1A 5A9TA 3DZJA 2O50A 3NGLA 1KY5A 5DCWA 5CG1A 3VKVA 3H8VA 2ZTVA 2CF6A 3H5NA 1M67A 2ZATA 3M1LA 1UJMA 1YJQA 5A03A 4BNWA 5GZ1A 4TKMA 3R0IA 4RCVA 4PRKA 5G0UA 4EI2A 4NPCA 4XQEA 3TZQA 3PDJA 3AW9A 3AM4A 5CPFA 4OMUA 2ZTLA 4G5HA 2QRJA 1E3EA 4W4TA 2BELA 4XR9A 5F5NA 3VH3A 1VPDA 1LDNA 1KY4A 2GZ3A 4H3VA 2QG4A 2CDBA 2Y93A 1Z6ZA 3ICPA 5IJZA 2POQX 1NFFA 3C1AA 3FNGA 1LLQA 4D3SA 1EVZA 2HRBA 1XR3A 2Y1CA 4I1IA 1LDMA 5DBFA 3BHMA 1BSVA 3VZQA 4CL3A 3NJ4A 1NHGA 1P1FA 3OJOA 3JQAD 5IFLA 4QX6A 1NR1A 1LC0A 4U6SA 2O48X 2Y1FA 4P4GA 1HF3A 4FIZA 3SJ7A 4ALKA 4CPDA 4WLUA 3O8QB 2UDPA 4DREA 2Y67A 2I66A 3HFSA 3ZV5A 1HEUA 1BVUA 1XQ1A 3HG7A 3NKLA 4ZN6A 1I01A 5JC8A 1VC2A 1CETA 4TKLA 3K2BA 5LC1A 5JDIC 1F12A 3O8QA 1QYWA 1ZIDA 1HDYA 4TMFA 3VZPA 3PWSA 4QEDA 1L7DA 1DIGA 1P0FA 2TMGA 2WMDA 4ND3A 3CMMA 4DLLA 1ZK1A 1HZJA 4INAA 3BMCB 2DTEA 1T4DA 1E5LA 1ISGA 2Q99A 1A9YA 4P8RA 4A27A 3ADOA 2J5QA 2V6FA 4JJFA 2X8LA 3NT2A 2W2LD 4Q9NA 4YJGB 5HS6A 5CDYA 5U1PA 3NEPX 2IXBA 2BFAA 3JQGB 3BMCA 4BV8A 2Y0DA 2GASA 4KTVE 5U4QA 3SVTA 3I52A 3OM9A 5TT0A 1IHYA 1OMOA 1NHWA 4BUCA 4YJGA 4II3A 1DLIA 3I83A 4FD3A 4NJMB 2BH9A 4NG5A 1HDXA 3KYDB 2XAAA 1GADO 1NVTA 3T4XA 3JQGA 3LT4A 4MVJE 4IS3A 1EVJA 4DUPA 3L4BC 3C24A 1VJ0A 4H7PA 1GYQA 4BO2A 4R1TA 3QWIA 4Y6SA 3WLFA 5DP2A 3FBTA 3H2ZA 3E48A 2YQ4A 4NJMA 3NX4A 3KYDA 3ULKA 4OL9A 1D3AA 2J3JA 2YV2A 4WEQA 1PZGA 1GEGA 2H1SA 1Y81A 4Q3DA 3VPXA 3I9JA 9LDBA 4JX8A 1TI7A 3TN7A 4OQYA 1W4ZA 4J1QA 4IDBA 3WS7A 1MG5A 1AUPA 1GUFA 1MV8A 3AK4A 3W6UA 2NADA 3GGPA 5JY1A 3DBLB 3GAZA 3JYQA 1DC3A 4E5YA 2NU7A 3E9NA 2VHYA 1MGOA 5CPBA 3D64A 4EDFA 3WSWA 2GUGA 2PKQO 3F9IA 2ZIZA 4RPGA 3PDUA 1DHRA 4J7UA 3VPHA 3A4VA 2C07A 4XX0A 3RU9A 3RFXA 1PJ3A 4R16A 3RQSA 4YB8A 3DBLA 3BMNB 2AW5A 3L6EA 5TJ9A 5FYDA 1RYEA 3GGOA 4U8GA 1JLLA 4AJKA 4MP8A 1JU9A 4YDRA 3C1OA 1WP4A 1CYDA 5I7FA 4XZ3A 5AXDA 4RJTA 3PP8A 2EF1A 1P1IA 3LT2A 3D4OA 5MDHA 3FNFA 3M1AA 1I8TA 1K2WA 4PG7A 3RUFA 2P5YA 1WNTA 3Q0EA 3BMNA 2BD0A 3DDNA 3LK7A 4CUZA 2DTDA 4PZEA 3PLRA 3I6IA 4AJLA 1NFRA 3GH3A 1OFGA 1LJ8A 1E0DA 5L45A 1ENYA 3DZBA 3H2SA 5I9NA 3QVTA 5L7YA 5C7OO 4ZGWA 4UVEA 2AQKA 4R54A 2OOSA 2VUSA 2GERA 2QW8A 3B1JA 3MEQA 3Q2IA 4J0EA 4M89A 1N8KA 2CDAA 1PJLA 4W7HA 1EBFA 2J6IA 1YBMA 1E7QA 4MVJI 1N7HA 2DC1A 3ZV4A 4L9RA 1LEHA 2RH4A 4GI2A 1I3NA 3KETA 4E2ZA 1A72A 1YB1A 4LVCA 2YQ5A 4OM8A 4TSKA 5DZSA 2O3SA 1DB3A 2PKRA 3NAQA 4QO7A 5CP8A 1DFGA 4AJNA 5IDWA 3GZ4A 5F1PA 1I3LA 1W73A 2P4HX 2YFQA 4N5LA 4FS3A 4FFOA 1K89A 4IJUA 3PZBA 1RYDA 3DZHA 1GCUA 3NV9A 4PLCA 3WJ7A 4A0SA 2IYPA 1P1KA 5A9RA 2VYVD 1E3LA 4J7XA 3C7CB 4MVJF 1ADGA 3ON5A 1LSSA 1ZSVA 2YJZA 3OA0A 4RVHA 4AL4A 4MPDA 3V2GA 2IDZA 4P4NA 4YQZA 3ZWXA 5JFOA 5HWSA 3LT1A 2XXJA 1NQAO 4XIJA 2D5AA 5AOVA 3Q3CA 1ONNA 3BHJA 3GR6A 4BO0A 3DMTA 1UP6A 3VH1A 2VUTA 3AI1A 3NDIA 4E12A 2O7QA 3U09A 2DFDA 2VHWA 2YV1A 3KRTA 2G76A 4WE3A 1R16A 2P68A 3C1TA 4DIBA 3V2HA 3WGYA 2G1UA 5TS3A 2NWQA 1U7HA 2HUNA 2J3HA 4OIMA 4E31A 3PYLA 1ENOA 1TT5B 1BRMA 3TL3A 4PLPA 1DDOA 1SB8A 2VOJA 3Q2KA 3KEQA 2LDXA 1NPYA 1EUCA 3UKOA 3GOHA 2Q4BA 4CLOB 4CM1A 3FTNA 1ADCA 2I3GA 2PH3A 5DCUA 1KERA 2IXAA 3ZU2A 4F45A 4CMIB 1UXKA 2B4QA 1EE9A 1TT5A 4B4UA 3WWZA 4P38A 3C7AA 2FPGA 4CLEA 4CLOA 5A3JA 4MDHA 3NGXA 4CMGA 1J4AA 3UICA 3N58A 4GAEA 1X7DA 4AJIA 4CM7A 4CMIA 3DBRB 3N74A 2Q2WA 1EVIA 3IKTA 4K26A 5JMPA 3ZNPA 3IUPA 1XSEA 4HFRA 5C7IO 5I8WA 4J4HA 3WFIA 2V65A 3H6KA 1U28A 3MJVA 5TJHA 3DBRA 3D7LA 3ETEA 3DONA 4R3WA 2CVQA 3JV7A 3DEYX 1YL7A 1JAXA 2DBQA 2XXBA 3OA2A 1L7EA 3DMYA 3O26A 4FC6A 8LDHA 3A9WA 2HJSA 3ICCA 3WGGA 3GHHA 5BSGA 4J4BA 1FK8A 1T2CA 1MB4A 1ZK4A 4RVDA 4YT4A 1NPTO 1ENZA 4JQCA 2FHSA 2VTEA 3PTZA 4DMLA 2X0JA 4PLTA 1D8AA 1ZMOA 4GMFA 1Q7CA 4Y9DA 5HTOA 2GN9A 1B8UA 5LCXA 4C7JA 2HMUA 4II2A 3W8DA 4UUMA 4BO9A 3FR8A 2DUUA 5I7EA 4BVAA 5TF4A 3V1YA 4ZJUA 1W6UA 1NQTA 2JHFA 3EYWA 3QV1A 3S2IA 2AXQA 3U3XA 5DN9A 4ROSA 2HMTA 2OBYA 3RD5A 1KC1A 4EJ0A 4EW6A 3INGA 4MP3A 9LDTA 3H3JA 4TQGA 1UXHA 4KWHA 3KTDA 4G2NA 1Y7TA 2CZCA 4M8SA 3FPCA 2IZ0A 4IUYA 3WNVA 1E92A 3GUCA 3ZNQA 3ZWWA 3ZWBA 3AU9A 3PPIA 1QG6A 4BNLA 4GLOA 1BDMA 1PJ4A 3NUGA 4FC7A 3UGKA 3RKUA 4P4LA 2BGLA 5DOZA 2NU6A 4EBFA 3WTCA 3I1JA 4YAIA 4I8XA 3S55A 1ZK3A 2X9NA 3PYXA 3DL2A 4GBJA 3DZIA 1M6WA 1Q1NA 3DZGA 4IJWA 3VH2A 3TPCA 2PZKA 5EN4A 1YONA 3U4IA 1ZK0A 4XYBA 3RFTA 4IM7A 4NBVA 4IDFA 2GR9A 4YAJA 4F3YA 5EPOA 3QVSA 1R15A 3TL2A 3IC5A 5FF9A 2E82A 4DC0A 3GN1A 2ZKLA 3KYCB 5ES3A 4M54A 1M76A 1V0JA 1ZEJA 3EGOA 6LDHA 1PJ2A 2C2YA 5JLAA 3HZZA 2VYND 1TVEA 4CMCA 3UCXA 1BXGB 2ZYAA 3P7MA 1T4BA 5TSDA 1CIVA 1W0CA 3ANLA 1XLTA 2DBVO 4MOWA 1QYXA 1E1NA 3JQ9A 3QVWA 1DAOA 3KYCA 4ND1A 2X0NA 3QW2A 1GPDG 4Q3NA 5HBRA 2HLPA 4XYEA 4CLHA 4NDNE 2HK9A 2PNFA 3DMTC 1BXGA 2RHRA 1NWHA 3ZWPA 5JE8A 4GWKA 1EEHA 2C54A 4DYDA 3QVXA 4O5OA 3QWAA 2CD9A 1Q0LA 5ILOA 4AG3A 5H83A 4E5KA 1X1EA 3GQVA 5CG2A 4DWVA 3AU8A 1IUKA 1DSSG 3QE3A 3ZNNA 1PGQA 1E3SA 3ORFA 3JSAA 4JBHA 2HRZA 3L4SO 2VWHA 4HY3A 4TRJA 5THQA 2WE7A 2VRBA 2WJPA 4E6PA 4BKRA 1U3WA 4NFHA 3T4EA 1DPGA 3R6DA 2Z5LA 1QYCA 2B5VA 4QFCA 5KJCA 3I9MA 1H6AA 1UZMA 2NV6A 1XELA 5CFZA 5GY7A 5A9SB 1NX6A 4GWGA 3KBOA 2PKQP 4CV0A 2ZYGA 3ZN2A 1T2DA 4PRLA 3ZDFA 3OQ1A 1VE9A 2PZJA 1C1XB 1XGKA 4DRYA 1V6AA 5A9SA 2GZ1A 3CE6A 3VH4A 1DIHA 1Y8QB 4EUFA 3ENNA 5DNAA 3OIDA 4YXFA 4BHTA 1RM5A 1LQTA 3IP1A 2O3TA 2GCGA 1ZMTA 2J5RA 4IXWA 5B4UA 5L51A 3RUAA 4CM9D 1C1XA 4IZHA 5IDQA 2Q1TA 4OXKA 1Y8QA 4R69A 1Q7GA 3GDOA 3O03A 2FSSA 3OFSA 3DXFA 3DC2A 3KXDA 3PGXA 4YRDA 3HDHA 4Q3EA 3RUEA 3LLSA 3G1TA 1IB6A 1EQUA 4J1TA 3AY7A 2AEFA 1YQXA 1JVBA 4GX1A 4NK4A 1E77A 3L6DA 4EJ6A 3OEWA 4KTTE 1WLYA 4ALMA 3D5TA 2PD6A 4ALJA 4KQXA 3MJEA 4LSWA 3M2TA 3PQDA 4WGGA 4WLOA 3CH6A 2HMWA 4IINA 3INTA 4B8WA 2PR2A 2UAGA 4AJ4A 1KIFA 4LISA 3KYBA 2RBEA 4YQYA 1PR3A 2QYTA 4IDCA 4NNJA 2ZB8A 3PYMA 3DFZA 3UXYA 3DOCA 3VZRA 4WCDA 3WIEA 3FN4A 4IDGA 1UZNA 1PQPA 3JQAA 2FP4A 2JJYA 2RCYA 4GL4A 1J0XO 2PY6A 4OXNA 2W98A 3I6QA 3L9XA 4PLFA 4Q3BA 2QHXA 4Q3CA 6ADHA 2B4TO 2X7HA 3CZRA 3W1VA 3KSZO 2EW2A 2I3AA 1E1KA 2OXIA 1HE2A 4CLXA 4DTIA 1JVSA 1TEHA 2DFVA 1MC5A 2BFOA 3EY4A 3PIDA 1WWKA 4FJ1A 2VHVA 2EWMA 1CERA 3OBBA 3K96A 4DL9A 2PA3A 3DOJA 3FD8A 5FFFA 5L4NA 4D0RA 5BSEA 3C7DB 1LLCA 2BFPA 2IE0A 2X22A 3PQFA 2VZ8A 3FWZA 4LW8A 3A06A 4GLLA 1EBUA 1MP0A 5L40A 1BMDA 4MKZA 4B7UA 1EK6A 5GZ6A 5TIIA 2W2LA 4IIVA 4FBGA 1FDUA 1Y5MA 3PRJA 4NR0A 3V5NA 1UP7A 4BNYA 3JQ9C 5A02A 3UVEA 4QTZA 3JQEA 3GAFA 4UVIA 3H5RA 3QVOA 4WUVA 1E1LA 3FTPA 1SB9A 1MFZA 1YS4A 2P5UA 3K9QO 3PFWO 1E7WA 1PS0A 2UVDA 5COAA 4D46A 2CVZA 3GNTA 1DFHA 5JO9A 3RSHA 1WXDA 4FCCA 2W8ZA 1PU2A 5CDGA 4YR9A 1ZCJA 3KB6A 2DLDA 2F00A 2CY0A 1R0SA 4XWYA 1E7MA 4HADA 3EAGA 4GGPA 5B4TA 1I5RA 1U3VA 2EKPA 3Q9UA 3F1KA 3DAPA 1I10A 3RUHA 3GMDA 5AXBA 2VTDA 2XOXA 5ILGA 5BSHA 1JA9A 3CSDA 3ZWAA 5JC1A 3ZZNA 4WKGA 4E21A 1IPFA 4RDIA 3H9JA 4URFA 3PLNA 4NFSA 2DT5A 2OHXA 1C0IA 4Y6PA 4FJ0A 1GEEA 4MP6A 3AY6A 2X4GA 1Y8RB 3HQ4O 2DPGA 4EEZA 4RPJA 1C1DB 3GG9A 1R0LA 4YVFA 3ZWNA 2AHRA 3ABIA 4IY1A 2FRDA 1SPXA 2V6BA 3PEFA 1Y8RA 2WTBA 1QV6A 3U4CA 7MDHA 4FSHA 1SEPA 2DU8A 1LSUA 3OETA 4J9VA 1C1DA 1AGNA 1P1RA 5JBIA 3H4VA 1EMDA 2B37A 1NQ5A 3L9WA 4R68A 3DHEA 2NSDA 2TMDA 3WLEA 4F46A 1LLDA 4ZQGA 3S2GA 5IZ4A 4IMRA 1DHTA 2F1KA 3BHIA 4G65A 1GZ4A 2BRUA 4PG5A 4Y6RA 3WBBA 4XRGA 1DO8A 1SNYA 5C37A 2NNLD 1DRUA 5G0SA 4M49A 1DC6A 2FSVA 1B0AA 4J6FA 5DT9A 5BNTA 3VHRA 1I36A 3FNEA 4E5NA 3UHAA 5FI5A 4CL8A 4TROA 2IEBA 3BTUA 1LNQA 3WGHA 1PS9A 3ZWYA 1GCOA 3QRWA 1WMBA 4K6CA 4CMBA 4D3DA 1P45A 3K31A 1Q0QA 1Q0HA 2B5WA 2VNSA 4I5DA 2A92A 4NQZA 3PHIA 3SC6A 2BGKA 3LC2O 4CR6A 5KJ6A 4R01A 1DBVO 5KWEA 3V2UA 5KVVA 4MINA 4M86A 5GMOA 5FWNA 4YRAA 1R6DA 2HU2A 4J43A 1BW9B 2AMFA 3PIIA 5CEEA 3WGQA 3FBGA 1EUDA 1U4SA 3H9UA 3EC7A 1FDTA 2YY7A 1PEDA 4NK5A 3RKRA 5L7WA 2CSUA 2JD0A 3ZHZA 3CUKA 5CHEA 1U7TA 4NIMA 2X9GA 3AI3A 3IIEA 4XGKA 1BW9A 3JD2A 4BO3A 2BLLA 4UVHA 5AXCA 2H6EA 1LXCA 2Y68A 5TRTA 3ZHXA 2AA3A 1U2GA 3HJAA 3GVXA 4JP3A 3UOGA 4ND4A 1A4UA 1Y5RA 3MCVA 3WYBA 3QQPA 1H9AA 3JQ7B 4CM5A 1R37A 2GD1O 4BNGA 2PGJA 4EYEA 3OICA 2Q2VA 3SLGA 3U9LA 1R0KA 1ULUA 3BYZA 3FCOA 5K6AA 2HAEA 1ARZA 3F4BA 4HFMA 3JQ7A 1PGNA 3U62A 1VJ1A 2I76A 2XPCA 3JD3A 1GUZA 2QRLA 2VWQA 2CMDA 3ZW9A 3QHAA 4YYZA 5L9AA 4R41A 2E6UX 3AI2A 2AEJA 1VL0A 5HRUA 4AVYA 1A7AA 4B4WA 1IE3A 4H16A 1GV0A 1OC2A 2GLXA 1MFPA 3SLKA 4AJJA 3WGOA 1UDBA 3JD0A 3CEAA 1PJBA 4CLRB 2VT3A 4FQ8A 3MWDB 2V6MA 1YXMA 2C82A 4JXKA 4HV4A 2NVUB 2YHIB 1VRWA 4MVJG 3TWOA 5JW6A 1MUUA 1U4OA 5EMHA 4CLRA 2PTGA 5JSFA 2GRAA 1H6CA 1QLJA 1PTJA 2NVUA 2YHIA 1YE3A 3VPSA 4WLEA 5TNXA 3FNHA 1OZAA 4IIUA 1P9LA 1EFLA 1V3VA 4WPGA 4TZKA 2HK8A 4AJOA 4PVDA 4JJGA 2BI8A 3E5MA 3JYNA 2EHDA 2HCTA 4J91A 4RVUA 2ZQZA 3INRA 4RVSA 4ZQEA 2GNAA 5F3RA 4D42A 3RVDA 5L3ZA 5HA5A 4I5EA 1PJSA 4R9RA 3S8MA 3UFXA 1B14A 3ROKA 2E49A 5F5LA 4K1LA 4PN3A 2EJWA 2J3IA 2X5JO 3KVOA 4FN4A 2BFMA 4PG4A 4BGUA 3A1NA 5I8ZA 4BO1A 4W6ZA 3TQHA 2HMVA 1ZXLA 4BO6A 4RLSA 1RM4A 5BNIA 5B37A 1ID1A 3AOEA 3GF4A 3H65A 3MOGA 2WM3A 3IQDB 1N2SA 5ICSA 3GT0A 1UR5A 3VPGA 1DLJA 3KOUA 2FN7A 4HFJA 2O3JA 3GEGA 2CFCA 1LU9A 4QSMA 1HDRA 3WQRA 3OH8A 3B70A 3LQFA 1BVRA 4OJNA 1I24A 4KUGA 2CF5A 3JD1A 4PZDA 1IYZA 7ADHA 2I65A 3UW3A 5IG2A 3GPIA 2QZ9A 2HMSA 1R12A 1HDGO 4ZD6A 3AY3A 4C4OA 4J7CA 3KO8A 1FDVA 1KVSA 4DXHA 4DIFA 1SOVA 4XB2A 4BO8A 1EK5A 1N5DA 2OFPA 2PH5A 2R2GA 1IZ0A 5JAQA 1XQ6A 2YV3A 1HWYA 4D7AA 4F6CA 3HWRA 4J1SA 1DC5A 3VPFA 5COBA 2BI7A 2QYSA 4O6VA 1KETA 3RROA 4E2YA 1Y9EA 3G49A 4XR4A 4BB6A 2D4AA 1WZIA 1DIAA 3IJRA 3T7EA 4CMJA 1LRKA 1XG5A 5IZCA 5EQFA 4YWJA 2JAHA 3GLQA 4BNVA 1WVGA 2GPTA 1YQDA 3DR3A 5F1KA 4UAGA 3ZWMA 4BL5A 2FZWA 3RC7A 5F1OA 3HDYA 2NQTA 4HX5A 2OORA 3SBOA 2Y1GA 2VYNA 3VVBA 4CUKA 2AEMA 3H3FA 1A71A 5AYVA 5ER6A 5CEJA 1P74A 3WGZA 1IULA 1K0UA 4R5MA 1UUFA 2Q4EA 3JQDA 2X86A 1XWFA 4J2OA 1ZXBA 3PHLA 3QWHA 3QP9A 4WK6A 3B1FA 1F8FA 4N18A 3MWEB 4OSOA 3TNLA 4LRTB 5TLSA 4YAGA 3MTGA 1BG6A 1X7HA 3OMLA 3NT4A 4IS2A 3Q6IA 4XYGA 2DUWA 3F5QA 2DQ4A 3HADA 3HDQA 1ZW1A 5KCZA 3DHNA 5K6AC 1V3UA 3IOYA 3UF0A 5JXWA 4U6QA 1P31A 3D1LA 3GRPA 4RORA 3GRKA 5B1YA 1HE4A 4BNXA 2UUOA 4RF4A 1FJHA 3K92A 2EJVA 5J23A 1LUAA 3NT5A 5T6BA 2NTJA 2VUUA 4L4RA 2FR1A 4YEDA 2ZCUA 3PFFA 2Q45A 3MJTA 1GAEO 3GG2A 4R51A 4IQGA 2SCUA 2BF7A 3JD4A 2HJRA 3ZV6A 3DQPA 5BNFA 3SJUA 3ZCXA 1CEQA 1LTHR 3HN7A 4YRBA 1HLDA 1N92A 2P9CA 1HDOA 3JQCA 4J9UE 3AM3A 4LK3A 3ONDA 4HUJA 2AQIA 4FFPA 3M2PA 2VN8A 3KUXA 5CDUA 5I7SA 1EDOA 1XCBA 3DZKA 4ZU3A 2I6TA 1ZNQO 1AE1A 4KDEA 1DRWA 4CM9A 3AJRA 2B69A 2X9VA 2EG9A 2Y1OA 2YDYA 3WFJA 4MIYA 1H0KA 1O95A 4DBZA 1QKIA 3LC7O 4E30A 4ID9A 1GD1O 4B4VA 1SCUA 1ZSYA 3DTTA 2DBZA 3EMKA 3LDHA 3GNQA 3STHA 3W4KA 3WIDA 3AOEC 1HLPA 4XYLA 1WMAA 4BNMA 3QIVA 1I3KA 1VI2A 2EP5A 3I3OA 4JIGA 4YJFB 1YBVA 2NVWA 1P77A 1Z7EA 2GO1A 4L76A 4QT0A 5TQVA 3ROMA 3FRJA 4Y67A 3ROPA 3RBZA 2I67A 1O94A 1O9BA 3EZYA 2NU9A 1IHXA 3TFOA 1I32A 1H2BA 4YJFA 2J8ZA 2B83A 1P3DA 5LDGA 4CR8A 3F6YA 3GVIA 3ZWOA 1K6IA 4E0BA 2VRCD 1KC3A 4DVJA 2V7PA 4MKXA 5IAAA 2GN4A 3VKUA 4UREA 2AG5A 4DA9A 5CEFA 1F17A 1H94A 2FPPA 5TX7A 5L4SA 1YWGO 1SEVA 3DBVO 3AOGA 1Q2XA 1D1SA 4Z0HO 2PV7A 1GL3A 3PVZA 1GQYA 3D4NA 4OQZA 4ZQFA 4ZVVA 2O7SA 2V6GA 1V3TA 5ER9A 1DIRA 3F46A 4JCOA 3NTQA 2WD7B 3KLPX 2UYYA 1AHHA 1O8CA 3EVNA 3P2OA 2EGHA 2Y66A 3HNPA 5IZCC 2AQ8A 4NMHA 5BR7A 2O3QA 3L0DA 1LX6A 1H2HA 3OF2A 5I7VA 5DULA 3O38A 3FF4A 4BGEA 3MJCA 3RBVA 5IN5A 2WD7A 3PWZA 1QV7A 3AM5A 3CKYA 4BKUA 1X13A 3ADPA 4S1VA 2ZCVA 1MG0A 1YBAA 4WOJA 3KHUA 4TVOA 3E82A 1V9LA 3OIFA 4B4OA 2IEDA 2VZ0A 2PLAA 3RC2A 4PG6A 2G17A 1YQGA 5T67A 3A28A 4TVBA 3QLJA 1F0YA 5AXAA 4PLGA 1KEUA 3QY9A 3LF2A 3RUIA 4JK3A 2RAFA 1U8XX 2OBNA 2EEZA 2QIOA 4UUPA 2WDZA 4DBVO 2GGSA 3S2EA 2FPIA 3TFQA 1SBYA 2Q3EA 4FOOA 2C2XA 4GMGA 4BQRA 3H9EO 3BTVA 3AWDA 4BNKA 5DOVA 4YTEA 1E7RA 2DKNA 3E1KA 3GVCA 1RKXA 4AJHA 3AFNA 1PL7A 1PL6A 4IJVA 1SAYA 4QUKA 5G4LA 3FI9A 4AJPA 3WQSB 5C3MA 4ALLA 1NAIA 4B7XA 3PJFA 1ISFA 1A4IA 3CXRA 3AFMA 4NZ9A 4ZRNA 5G0WA 3AUAA 5G0TA 4DQVA 1CQJA 3T7CA 1F06A 4FPXA 4A73A 3MZ0A 1YB4A 4XEHA 1RM3A 1G0NA 2ET6A 3CIFA 3DHYA 2X5OA 2HO5A 1JW9B 4KWIA 4BB5A 4EEXA 4XDZA 3OQ6A 4CQMD 1HSZA 4Z6KA 1P33A 1KYQA 3K8ZA 3NRCA 2E37A 3Q9NA 4ND2A 3V1TC 4J1NA 2Q1UA 5H81A 1E6UA 3ASVA 1ZZEA 2VHXA 4Y98A 1BTOA 1M66A 1NM5A 2D8AA 3E5RA 3KEOA 3F4LA 1WZEA 2C20A 2NTNA 4FFMA 1UAYA 3BTOA 4UEOA 2NU8A 1FMCA 4PLZA 3K5PA 5CDTA 4E2WA 1KEWA 1NNUA 4U0KA 1SOWA 1F14A 2AQHA 2C7VA 4NBTA 2B35A 1NR7A 3JQAB 3BTSA 3CZMA 3MJ4A 1HYGA 2ZYDA 3G17A 5JAZA 4CMKA 4J3FA 3RJ9A 3UAGA 3F5SA 2JD2A 2AG8A 1VLLA 2YDXA 3PJEA 2YYYA 2NACA 2YUTA 3U49A 3WMXA 1YO6A 1ZVMA 4CLDA 4LVUA 5JAMA 5A05A 1LRJA 4IMPA 1C14A 5JCXA 4BNHA 3SX2A 3TZ6A 4B7CA 3CMCO 2IYOA 5L95A 3ETGA 4YJHB 2JFFA 3H5AA 3F1LA 1DJQA 4G81A 4D3FA 4JROA 4KOAA 3GGGA 2DPHA 3DZFA 4KUEA 2VQ3A 5ICMA 1IPEA 1CWUA 3F3SA 1PGOA 2OP1A 4CV3A 4CV1A 1WPQA 4J49A 4YJHA 1ZK2A 3PQEA 4I08A 1JKJA 1QYDA 1QSGA 3WG9A 4ZRMA 2NM0A 4JP2A 4U7WA 4U5QA 4FFRA 4BO7A 3UUWA 3HSKA 1QR6A 2I99A 5LDHA 4Y8VA 1AXGA 1B16A 1BWSA 3IAHA 4MIOA 3BZUA 1B2LA 1IZ9A 1K6XA 2X1HA 2FR0A 4R4JA 1JWAB 4OH1A 5THKA 3WBFA 3ZGYA 1B3BA 4PCVA 4I5GA 4GSLA 4HXYA 5JO0A 3COSA 3ZNOA 3D3EA 4K28A 2VCYA 3LVFO 4A7PA 3EVTA 1XA0A 1ONOA 3HUDA 1K6JA 3JQFA 3HB4X 1HE3A 1KVRA 1IOLA 5DF1A 4PGFA 2GDZA 1ZFNA 4QFDA 5CDSA 2H5LA 2VHZA 1MX3A 3RFVA 4ONEA 3LF1A 2UV8A 1E6WA 2JAPA 2AE1A 2H63A 3A14A 2HK7A 1DIBA 1GZ3A 1NFQA 1UP4A 3GHYA 1YGYA 2QZZA 2Z95A 1TA4A 3QWBA 3OJ0A 1U5CA 4W99A 3GFGA 4NU5A 1N9GB 1PQUA 4BOYA 1S7CA 4R1NA 4W82A 4CQLB 2E48A 3DB2A 4RPLA 3WR5A 4CMEA 4BIIA 1NAHA 3JQBA 1I2ZA 1VJTA 1BDBA 3TDKA 1SO8A 1T1SA 3ONFA 3WMWA 4NH4A 3W8FA 4ZQHA 1N9GA 1MC4A 2C5EA 2Y0EA 1OI7A 4R3NA 4I9UA 4CQLA 1R4MB 5A4DA 3UN1A 2OMEA 4YCAA 4UEJA 3ZHBA 1WDKA 3FWNA 1HYHA 1X14A 4RGBA 3ZU4A 3NJ8A 1HKUA 5EERA 3RC1A 2FWMX 2VNAA 3GZNB 1R4MA 3DTYA 1YOVB 3WOHA 2IZ1A 2QQ5A 5T57A 1AN9A 3PGJA 1A9ZA 1T26A 5IXSA 3OSUA 3G79A 4IDEA 4MVJD 3RAJA 1ENPA 4J90A 3KSUA 2JCXA 1BXKA 3C8MA 2W4QA 2GN8A 1EDZA 4L8VA 1W8DA 3ZH2A 2DBRA 3GZNA 2JFGA 5JAIA 1YOVA 1LI4A 3ST7A 4RPHA 1JAYA 5A3VA 4AICA 2Z1MA 2ZB4A 1B8VA 4CMAA 4E33A 5L53A 2G82A 1XEAA 1E3JA 4WNIA 4E5MA 1BXZA 3HFGA 2ZJ1A 2WYWA 4RQUA 2VWGA 2PGLA 4OKIA 5KTKA 2W2KB 4HNGA 1GZ6A 1YDWA 4BNIA 3S2FA 1M2WA 4M1QA 1TB4A 4PFJA 4BNZA 4N54A 4B3JA 2FOIA 3JTMA 1MLDA 2PK3A 4DPMA 2EERA 4TRMA 2Q2QA 4JN6B 3RBXA 5A04A 4DMMA 1G1AA 3BAZA 2OP0A 3ZW8A 3PHJA 4H15A 1MA0A 2W2KA 1PJCA 3IS3A 1H93A 3IJPA 1J6UA 2OL4A 4A10A 3GFBA 5JYEA 2ZB7A 2VYVA 4FGWA 4XDYA 1B3RA 4XB1A 1KVUA 3CPSA 4RL6A 4WLFA 4YACA 4RVGA 4PIVA 1CDOA 4E5PA 3X2EA 5A5FA 4JJIA 1ZEMA 4CM4B 1JWBB 1P44A 2H9IA 4LMRA 4WNCA 3TJRA 3RJ5A 3TRIA 3LZ6A 5G2OA 1ADBA 3BMQB 4IPTA 4OO3A 3ETDA 3B6ZA 2D3TA 4NBWA 2C29D 2EP7A 3BIOA 3JQ8B 4CM4A 4PLVA 3QA9A 1KS9A 2O3UA 3HDJA 4NJOA 3KSDO 3VDRA 1V35A 1H6BA 1VSVA 3GEMA 4XQCA 4ZQBA 5HS4A 4ALIA 5ITVA 3BMQA 5KVSA 4JGBA 2C59A 1DC4A 1SZJG 1U5AA 2EGGA 5AQ1A 1PSDA 3WDSA 4OOEA 4BMSA 3FR7A 1QMGA 1B8PA 2WE8A 3JQ8A 1V8BA 2RHCA 4L0QA 3OEYA 3LT0A 1T24A 3GDGA 1U1IA 1C3VA 1I30A 1XKQA 1HRDA 5H82A 1YJ8A 2PWZA 3JQFC 4O59O 2E4AA 4TRNA 4R1UA 3OQBA 5ENDA 4XCVA 1KVTA 1S6YA 1GU7A 4ITUA 4RF2A 5FI3A 4KUHA 3U0BA 5JMWA 3K2EA 1R4NB 1GFSA 2GZ2A 2JL1A 1GY8A 1ML3A 3R3JA 4QECA 5TC4A 1T1RA 2A4KA 2QX7A 3TSCA 4ZHSA 4WECA 1XU9A 2HQ1A 1Z45A 1PZEA 4GQAA 4EUEA 2FR8A 2PGDA 3FPLA 3ZI0A 3Q1LA 3R3SA 1HZZA 2EKLA 4D41A 2NLOA 2IRWA 4JBIA 4WLVA 1T2FA 1UDAA 4PVCA 5ADHA 5A1TA 3S1LA 1R4NA 4XA8A 3I9NA 1LRLA 4J4TA 4CMEC 3PHGA 3JQBC 4M55A 2ZB3A 4PG8A 1HTBA 1X0XA 4JBGA 1JKFA 3VC7A 4PLHA 5MGBA 4O1MA 4GPD1 4LMPA 4GKVA 1O89A 3IKVA 4HNHA 1LQUA 3PI7A 1ZKMA 5L7TA 3V8BA 2CUKA 3BA1A 4GVLA 5IN4A 4W7IA 4TRRA 4W9NA 4BKPA 5JCJD 5JYDA 4CM8B 4DQXA 1NWCA 4MJLA 4AJEA 4NI5A 2R6JA 1XYGA 1Z73A 2LDBA 4MO2A 2Y1DA 5GZ3A 2NVBA 3L77A 3VVCA
chains in the Genus database with same CATH superfamily
1DMSA 3RUDA 2YWRA 3LCJA 5TT1A 1B7GO 3EBLA 2G0TA 3GROA 1AQIA 5TARA 3RU7A 3L6OO 2JJ2A 3TOXA 1XDWA 4C6TA 4CG1A 2W7TA 2NAFA 1SD5A 3KQWA 1C81A 4CM8A 3EUAA 1QP8A 2YZ7A 2D6FA 1ONPA 2OBFA 4ZIRA 4FYYA 5C8YA 1SU6A 1MABB 3G59A 3GJ0A 2EV9A 2B21A 1N4AA 1ZH8A 3ZWVA 5C7LO 5JUWA 3QFCA 2PS0A 3V4LA 2O2ZA 3QVKA 1N1GA 4GEKA 2G5CA 1ZNYA 2Q49A 2JD1A 1JNXX 3E84A 4UVDA 5IBPA 2BGMA 2ZIVB 3WK4A 1GGEA 2EZTA 3H9QA 5DDIP 4Y2GA 4C0QC 3HCRA 2AT1A 1O6GA 4OLFA 4MGKR 1MZPA 4HGZA 1WO8A 3DBHB 3E9QA 1MABA 4M9ZA 4Q9LA 4PF1A 4TS3A 1X0VA 4WXRA 2DYKA 1S3SA 5ALYA 2GEDA 3MXTA 4HNSA 1C2TA 2QTMA 5D86A 4HDSB 3AVQA 1HYEA 2AK2A 4R1QA 4RESA 4J6EA 1QQ6A 2CLFB 1FFAA 2CVFA 4BEWA 1NMEA 1AQNA 3R5TA 1KDTA 4RZ3A 3T4PA 4DQKA 1J70A 2BONA 3IGFA 1MT3A 3R40A 1SVMA 4G4JA 4YRRA 4FINA 3DBHA 2GZHA 1QCCA 1H5QA 3B1YA 3EMDA 4PE5B 4RK5A 3OCYA 2HSDA 1AKQA 3BJRA 4KDFA 4S1WA 2FFAA 3TTXA 2CUNA 2X1LA 4PQEA 4BC0A 1Y1TA 1YFJA 4HDSA 4CUJA 1RP7A 3MA0A 4YJ3F 3FUWA 3B3FA 3IO3A 3FRHA 3BD7A 3T95A 1I6MA 2HL6A 3CZ4A 1ZOIA 1Q3TA 3GIWA 3G0OA 4UHBA 4URWR 3E81A 4GD3Q 5FIUA 3GY0A 5IJXA 4CR7A 4ZCTA 2QP9X 1XZKA 5KVCA 3H99A 4B3XA 1PGPA 1EXWA 4A8JB 4K81B 3AR9A 2O2HA 1Z74A 1BWQA 3OIGA 3ODPA 4KKXB 4NS1A 3ONEA 4IHJA 1YJAA 4BS9A 1TVCA 4DUZB 4IGIA 4F4FA 3NALA 2MJLA 2F9MA 2FDRA 4ARBA 2G1AA 4E5SA 3SJAA 1ZO8A 3I9KA 1IPHA 1N2JA 3TG8A 4GI5A 4QU0A 5HBGA 5BR4A 2EDCA 5HGJA 4LXXA 1NJ8A 3ODGA 5FUWA 1D1TA 2D5CA 4A8TA 2P91A 3HSSA 5COQA 4YMGA 5JANA 2WP8J 1A8QA 1ZOLA 4ZAXA 2H1OA 4HDRB 4IXTA 2GOYA 1E3IA 4FHCA 1NTOA 3E7XA 4S2EA 5LNK6 2HU7A 4CWAA 1VDMA 2WU4A 1DRVA 4UBLA 2PJRA 3QVGB 4GVXA 1PUXA 3WTBA 3PRYA 2WWYA 4WJZA 4OA5A 5EYPB 4GP7A 2XUGA 1ZOOA 2C58A 5AW1A 2B61A 3NHAA 4DV1B 4HDRA 2BW0A 3HPQA 2R66A 1QRRA 3LLVA 1IDN1 3HHPA 1ZJWA 4GS5A 2WYUA 2NOAA 3IUSA 1IJFA 4TXLA 3ZY4A 5IANA 1O6ZA 4LEIA 1IRIA 3NYWA 3QVGA 4QBGB 1GO2A 2PD4A 4N5HX 4YA6A 3LQ4A 4HN9A 5JYBA 5EYPA 3AQ4A 1E6EA 1DJNA 1I4EB 3M4NA 5IBQA 3AUUA 5G3YA 1ZL2A 2XMZA 3Q11A 3OC6A 4BGDA 1EZ1A 1MW8X 4EG6A 1XN4A 3B82A 4L75A 2VSFA 2QMOA 3D02A 5HG0A 2CFIA 2ZRQA 3G1UA 4B75A 2FR8C 5HZKA 3K6JA 1HZZC 3NETA 5IS2A 4X95A 5DNWA 2IHTA 1C7ZA 5CA1F 3NWPA 2YXBA 1P7WA 4ZXFA 4Q3AA 3SF0A 5J4HA 1G6OA 2Y1KA 1GN9A 1F2VA 1KH2A 3EDMA 4ZGGA 1S0UA 5CFNA 3NWBA 3LCVB 5CLQA 4EPVA 1ISRA 3WWPA 1ZQ1A 4HF7A 2DQKA 5ADVA 1JX6A 1SCDA 4CN8A 2WG2A 3H7AA 1K68A 1T6ZA 1IJBA 5EE5B 1GM5A 5JXGA 2O57A 3BGDA 3RS4A 3E5HA 3ETNA 4YYEA 3HVRA 3CWZA 4KIGA 2D1YA 1SUAA 2HTFA 1KDZA 2EFGA 3UFBA 4P34A 1B15A 3GA0A 4ZWNA 5T8KA 4URVR 4IGAA 4EUHA 5DJ5A 2OD9A 4KNVA 1M6VB 4NL4H 4W9NC 2FPOA 2LIVA 2LRHA 3K9GA 3KQTA 3O8LA 3CO5A 2YN4A 4IYJA 4F2DA 5B2EA 4CFYA 2C99A 4ATNA 1MZVA 1ZA2A 4JP5A 1GZHB 1M54A 2LKDA 2OAP1 3F47A 4YO7A 5DE3A 4NYMQ 4ZPXA 1Z5NA 5AM2A 2PD3A 2N1MA 1YVPA 4KQ1A 2H7XA 1ESDA 4KV9A 3U44B 1QTNA 1XVAA 4B79A 3CG0A 5F21A 5T64A 4EW3A 3GP3A 3E9MA 1M6VA 1X1BA 1YDMA 3D8NA 3EG5A 3GFSA 2AN1A 2Z1NA 4FGSA 4RTQA 4QG3A 1DUSA 3IBTA 3K6SB 3KALA 3QIAA 4TXJA 1ODTC 2VT2A 4RABA 5D3ZA 2M32A 4TKVB 4BO5A 3IERA 4MMZB 1CQIB 1EK1A 1YC2A 2X40A 1QOPB 3U44A 1Q0UA 5IF3A 2Q3LA 2RGBA 2YMQA 4BQPA 1OFVA 3BMOB 3V1MA 1AHIA 2HT6A 4EH1A 2Q2NA 2RB5A 4RKRA 1NASA 3K6SA 5CIWA 2P0YA 2VP4A 4XVQA 4QOHA 3ADKA 3OZBA 4TKVA 1NBMD 1H5UA 1CQIA 2ZYWX 5A06A 2EZ9A 2EZ4A 2QVGA 1FVXA 2E7ZA 1P5RA 1Y33E 2J4DA 1YL6A 1RVV1 2JGJA 2QR2A 1W29A 1WV1A 3BMOA 3KSMA 4L4XA 4MS3B 4YH1A 4AWAA 3WLAA 4CKYA 4UZFA 4D9FA 3G7SA 1A8SA 3IV7A 1ZY2A 4EUSA 5K7SA 1JPUA 1LI7A 2KLBA 4RIEA 2GJAA 2IZOA 5JCOA 4D56A 3NMUF 3ZD7A 4Z53A 1MPTA 3NUZA 2P3OA 3ITKA 3GGDA 4JLWA 3RM3A 3V8QA 2Q46A 4V0KA 1SU7A 1TE2A 5AHWA 3JYPA 2K2WA 2DFTA 4FYPA 5M34A 1MOPA 1CUFA 1O08A 1UT6A 4MS3A 4NBUA 4D96A 4RPKA 2PSEA 1AZLA 4XX1A 5CT6A 3RHTA 3VTFA 5EXPA 4PNZA 2Z2YA 2V9PA 3T7KA 4ZO7A 3S40A 1U3UA 4IV0A 3G0CA 1MNAA 5TF0A 3VNVA 1VHJA 1Z28A 4UUAA 2F3PA 4GKBA 3RT1A 1I94B 1J1IA 4MRNA 5AM5A 2VOEA 5IW8A 2QVCA 1TO1E 2A4MA 1HFJA 3UATA 2F8TA 1UOQA 4OHXA 3V48A 4NS4A 3V1UA 4D9NA 3CONA 3GZTB 3WGIA 3MOIA 2XNCA 3SX4A 4BNUA 2C9BA 2IXTA 3E8XA 3K73O 1AIPA 4CIAA 4RF5A 3V8RA 3ZCQA 1UADA 2FCAA 2PMFA 5EP4A 4DA4A 1JDUA 2XNDA 2IPNA 3NTOA 4MRSA 5T7BA 4KVGA 1MHPA 4EG8A 1IWOA 1W2GA 2D59A 1FTSA 5C8ZA 2EU8A 4TL7A 4H27A 1CQPA 4FEAA 5BUZA 1DBSA 2QAGB 4LWOA 4C03A 4QOGA 2PEYA 4N76A 2CLDX 3QBJA 3LCMA 3ACCA 3FCAA 1P80A 3D5EA 3FMIA 3I73A 1RZRA 1V5GA 1KE2A 1ISJA 2XWPA 4L0MA 5AJZA 1IHUA 1ZJYA 2H4XA 2DSNA 3FIUA 2PQMA 1VCMA 4HLCA 4U7TB 3QOFA 3D3WB 5EEHA 3N2IA 3RIHA 5JNLA 1N34B 2D0IA 3U2QA 4DR4B 2ORED 2QAGA 3DE1X 3RC9A 5AJXA 2JLVA 4RIFA 1MGPA 2PUGA 1KNQA 3FFAA 1U8AA 3V46A 1KR5A 4PM4A 3IBCA 1HMYA 2XWQA 2VJQA 2P4QA 1B93A 5JD4A 2R65A 1V5WA 2HM7A 2XF8A 3K7EA 1GDHA 4P5PA 3BGWA 1W85B 4UAJA 3D3WA 5DHPA 4CODB 1ZUD1 5FL7A 5C7YA 1HSOA 4KE7A 5KNLA 2VJPA 3PK0A 4ZYTA 2RARA 1X70A 1YUBA 2F1RA 2JFHA 1AS0A 1C8VB 1SELA 3JVUA 4QJBA 4X54A 3RWBA 3DMHA 5I4KA 1Z62A 4LCJA 3VR3D 2H07A 1YU9A 3AW8A 1SUDA 5KYNA 1W85A 2Q6IA 2R7KA 3D6AA 1BEEA 4K8OA 2D7DA 4A9AA 4FLMA 5K51A 1ZJ6A 3P4YA 2IH2A 4ZKDA 5IDVA 5B3JA 2WVGA 4YLYA 5KQLA 1QG2A 3HB0A 1RRKA 4RH1A 4L4SA 4O25A 3VR5H 3HYLA 3L0CA 3PUYA 1D6NA 1V4NA 6GPBA 3I61A 3FDIA 3N8NA 5EJIA 3ZUGA 4E3ZA 2QI9C 3CPEA 1EFVB 4BMVA 3IJEB 4RVCA 1E7SA 3AFOA 1KK2A 3DLIA 5E3JA 4I7EA 4C4PA 1BS2A 5LL6P 1JPNA 4FXOA 4KO4S 4ZJPA 3IBFA 5T8KC 3FSRA 2JGLA 1EX6A 3TMYA 2H1WA 3UB2A 1WUYA 1FFXB 3P2EA 2ZJFA 2N1BA 3NXKA 1W46A 3QWFA 1DG1G 4ISBA 3AR6A 3JZFA 4HAYA 3BCUA 3LC1O 3SYTA 5JMTA 4MYCA 5AM3A 3A9UA 4G01B 1EFVA 1UKAA 3OTHA 2WWRA 3EBPA 3I30X 4HQKA 3L04A 1A95A 4PNHA 2PWBA 4K9MA 3PXGA 2DGDA 3DAFA 3JVVA 1YB5A 2OUIA 5E7JA 2V7GA 4LGYA 1FFXA 4JDUA 2OECA 1UMBB 1FZQA 2P8SA 3DL4A 3MM4A 1HFKA 4KEAA 4KIFA 4UOEA 1VL8A 2AE2A 3DFUA 3OWHA 1GL6A 3BJEA 4UD6A 1AXEA 3ESBA 5U9CA 2QQ0A 2OGUA 1RWBA 3MRTA 4KZPA 3B51X 1Y6JA 2Q8NA 3HVIA 3ZV7A 4I55B 4CIWA 3QI2A 4X24A 4DR7B 3BS4A 1NI5A 1UMBA 4HZIA 2X9LA 1ZPDA 1HETA 1SWVA 3LV8A 4IF6A 1FRNA 4K3UA 4IEEA 3WSVA 3C6ZA 3ED5A 2XT0A 1S8FA 1XZMA 2IH4A 3NHSA 1N2HA 3TTVA 3M3PA 2YX1A 1J49A 3ENKA 1RQ2A 3HB7A 4I55A 1YACA 1QXSA 3EOAI 4WSOA 3GELA 4K05A 4BQNA 4AZVA 1UC8A 2V7QA 1A5ZA 4QASA 4YAEA 4DOMA 5LOVB 4KR6A 2HA6A 3U40A 1GZUA 3R6GA 5B7PA 2NXCA 3HCWA 1G4HA 2OOKA 2WR8A 4PIMA 5D3QA 4R1OA 5CT8A 5JCOC 4N7RA 5HMLA 2D0PB 2W2TA 3OCZA 1VKJA 4GPIB 1Z2NX 2FZCA 2RC5A 3IVCA 4W5HA 4WESB 5FTNA 1WMFA 3N7UA 4LSMA 4G0MA 2XWJI 4IJ5A 2FLKA 5DT2A 4YJ2F 3T1NA 2DEUA 1EP9A 5LOVA 2R4TA 1SBTA 2QN6A 4R2XA 5T5QA 4YRMA 4J07A 5J4VA 1LPBB 1YZGA 3KTFA 2F6RA 4DEVA 3E6AA 3HR8A 3VNAA 4JGIA 1KIAA 3G2IA 1VKOA 2EXXA 5DM1A 4EVIA 1W9HA 1XPRA 3ZU6A 2B8EA 4REQB 4WESA 3C4JA 4HPJB 3TOZA 1GG2A 4B17A 4WKCA 2RFLA 3WXBA 3DB1A 2BMVA 1DCKA 5D7BA 3WYEA 1UZLA 2HC9A 4OHOA 1W4BA 2GMWA 2YHUA 1ZJ5A 3VOAA 5HZHA 3B3JA 3TJZA 2VFAA 4G0VA 2RKWA 4PR3A 1YT5A 5AICA 2WJHA 4YMUA 4RL4A 4REQA 2I8AA 2QA5A 5E0OA 3MRSA 3OJWA 3CEJA 1DEKA 3KWJA 4OK3A 4GSKA 1Z4NA 3QPVA 1M75A 1UC4B 2DKFA 2WG0A 3WNCA 5EESA 5BSFA 2BDTA 5EINA 3W7VA 3AV0B 5JROA 2RK3A 4IEFB 2O4CA 2OHGA 2XKJE 2FG6C 4FB5A 3G2PA 1NYTA 1XTJA 1B8OA 4HWKA 4O0LA 4DCOA 2CCJA 1LDGA 3TKLA 5ICEA 1P4GA 3LKVA 3SFTA 3DEIA 3OM0A 1YR9A 1XAHA 2QUJA 2VDMB 3T7IA 2HT1A 2QAGC 1K7YA 4Q5IA 4XFJA 2PE5A 2WDPA 4JVMA 1FQJA 3I8OA 3BFJA 3Q5EA 4JUCA 3WL3A 2CNDA 1O0BA 3G6WA 4LECA 4MWEA 4ZCPA 5UKDA 1HDZA 2J9YB 3GA5A 4KMSA 4U39A 4BPRA 2C4VA 2YS7A 3HU1A 3Q7EA 2PA0A 2ZW9A 4FZJA 3WRYA 4DBLC 4NHEA 1ZJZA 4M0FA 1K7EB 4XD7D 1PVVA 2IDJA 2IZ7A 3DBIA 3L7JA 1WP9A 2JAXA 1JIKA 2P69A 4IP0A 3E27A 3LOPA 4R9SA 3TAUA 1GA6A 2QX9A 5EXDA 4ZU1X 1GUYA 3C87A 1VP3A 2D1FA 4Q18A 4L8LA 4WZAB 1NMSA 5K5EA 3UHFA 4KPEC 3R6TA 2VPWA 3L7CA 2XVYA 4OHUA 4QXMA 3H75A 4Z9FA 3I4CA 4E70A 3THXB 5H3LA 1PP4A 1HX7A 1FYFA 1KVQA 3W4JA 1Z83A 1XFDA 3PA6A 2X0IA 2JLWA 3KR0A 4DJTA 2ZRHA 3HA2A 4Z9YA 2P40A 1K5HA 2JF0A 3DWFA 2JCGA 1UOEA 5B3JC 3ZU5A 4WL0A 1D0IA 1R9GA 3OURA 4WZAA 4DSNA 1DIOB 4Q47A 5FEUA 2VJDA 4OYRA 4FB4A 2VDVE 2WOOA 3BL6A 3HXQA 2M6KA 5JADA 3THXA 5B1SA 4JXZA 3D6MA 1T9BA 3Q9SA 4RBNA 3WZLA 4NX2A 3AHJA 2Q3DA 1Y1LA 2CLKB 1ZN9A 4R1MA 2ZTVA 4B8YA 4EO4A 1M67A 1RD4A 3F67A 4BQIA 5HUJA 4F71A 4R71A 3KE8A 4PSKA 1UJMA 1YJQA 4LC9A 2D2EA 4BNWA 4Q7QA 1VL2A 4TKMA 4N7BA 1QV9A 3BICA 3CB4A 5G0UA 4EI2A 2UXCB 1OHHD 2PMWB 4EHNA 2P4UA 2ZBVA 4WI1A 1M5UA 3AM4A 1H05A 3D59A 5CPFA 3MGBA 4P54A 1YS6A 2FWBA 2GK7A 4UHKA 3ICOA 3S3TA 4CG2A 3M5CA 1E3EA 4W4TA 4XR9A 5CT4A 5DX1A 5F5NA 3UPTA 2BMJA 5KTTA 1PFKA 3DMNA 1P9RA 1X87A 3DKIA 2QG4A 2CDBA 4AP5A 1J33A 1Z6ZA 2IPOA 3CCFA 4HXGA 2POQX 4JFRA 3C1AA 3RGWS 3A3YA 2Z2IA 1RJEA 3GIDA 3PFGA 1EFTA 1EVZA 1P5JA 3ZE9A 2IWHA 1K27A 4LYDA 1QJ4A 1RQNA 3WMRA 2Z5VA 4IJQA 2A59A 4X9XA 3V7YA 1X1SA 1A3CA 3C3WA 5DBFA 5ESXA 2FF5A 1BSVA 2D3WA 3BHMA 3VZQA 1NHGA 1YZFA 1P1FA 1XZLA 3CCBA 3W2HA 2EBFX 5CVTA 5IFLA 5JZVA 1LC0A 3L82B 2VF7A 2QD4A 3X1YA 1DO0A 4QM7A 1N5RA 3HV0A 1D6SA 4WLUA 2GESA 1BN6A 2D13A 2I66A 2SNIE 2RHBA 3AF4A 3HK2A 3BJMA 2I54A 2P1DA 2WT8A 2JVKA 3E1SA 1EVLA 2HU8A 3PV0A 5EWJB 4AUNA 4EWLA 3I05A 4L1KA 3NKLA 4GBGA 3FDZB 1U2QA 2IOHA 2RHTA 1UC5B 4KK3A 4EHHA 1CETA 4L02A 4P81A 4TKLA 3BGOS 2DR3A 1PEAA 3PE3A 1Y3AA 5KWVA 3ELYA 1NW9B 3OLWA 2J6HA 1OZ0A 2RCNA 1ONSA 4NCKA 2WUEA 3VZPA 2Y77A 3ZLUA 1V6SA 2DY0A 5EWJA 2WMDA 1ZN8A 4URYR 2VP0A 3CMMA 4EUKA 3FDZA 3VZBA 4QU8A 4ENTA 1J09A 2PJZA 3BMCB 3BGIA 4QGBA 4X60A 3CJRA 2FK7A 1T4DA 1X9IA 5HE8A 1UFOA 5GONF 3L8EA 4RSHA 5KSZA 1GFIA 2EJUA 5KHOC 5ANRB 2BBSA 1TAHA 1E4EB 4WACA 3A9RA 3EULA 3S4YA 4QDZA 1JG6A 1VHDA 5ERYA 3CF4G 5ALLA 2VDQB 3PNBA 4FZVA 3BMCA 2XUZA 2CZGA 2Y0DA 1LBTA 3NYRA 5FPYA 3WL7A 2BEVB 3TS1A 4XWKA 2IH5A 3OM9A 2R4UA 1OMOA 3SSOA 1R6XA 4BUCA 3AF1A 2HEIA 3FYUC 2X1VA 1E4EA 2UVQA 4LHVA 2FW9A 3W1WA 2BH9A 1RACA 4BWVA 1GADO 3R74A 3T4XA 1SURA 1N7JA 2PUTA 3ZGNA 4GDFA 3C24A 1VJ0A 3ETCA 1GYQA 1NKTA 5ECDA 3VDNB 2BEVA 3SQLA 2JKYA 3TAXA 3UJNA 2XX3A 4MAFA 2JK0A 2RGRA 4RADA 3GXOA 3KVYA 5AOCA 2VDUE 3L8CA 4DSAA 4RQAA 1E2KA 4W1QA 4PO1A 4OBXA 4PZ0A 3ULKA 4CBVA 2A9KA 2VXCA 3CZ5A 5AW9A 3PR1A 4WEQA 1CU1A 5AUNB 5GIPE 1CJUC 3ZVLA 1OT5A 2AMVA 2VA9A 4XCQA 5TDHA 4D80A 3WRYC 4C0KA 2VUHB 3VPXA 2KM1A 3BE5A 4EYQA 9LDBA 2QTWB 5LBUA 3WDMA 2NUTB 2OGWA 4J1QA 4LJLA 2R6GA 3WS7A 1MG5A 3GAAA 4LKOA 2P35A 1GUFA 1XTZA 1MV8A 2O0MA 2WJGA 3EDQA 3IEUA 3TW6A 2NADA 1CDZA 4KXFB 5LQMA 1BFUA 1Z4KA 3DBLB 4NDAA 3MD0A 1DC3A 1NDQA 1X1RA 4NEQA 5KB3A 4ZTBA 5JVDA 3E9NA 2V9CA 2NUTA 2KI5A 1LS6A 3L6CA 3PUWA 3OLYA 3HHEA 4YRTA 1GPYA 2DETA 3RFXA 4NH0A 1PJ3A 3LXXA 3DL0A 3D8UA 4Q37A 3DBLA 4RE5A 1NVVR 4YB8A 5AKLA 1VIYA 2AW5A 2XUOA 3EWSA 3I6BA 3MUOA 5FYDA 2J59A 3G0HA 1YZNA 1K8ZB 3R24A 1WP4A 3KL4A 4IWNA 2N47A 3PP8A 3FNFA 5ALNA 4YRSA 1I8TA 5AW4A 2EQAA 1K2WA 3I9V6 5BUSA 2P5YA 1POXA 1XMQB 2IHJA 3IEPA 3N0WA 5C4GB 4CUZA 3UJ3X 3QENA 4PZEA 1UBNA 2TRSB 4FEYA 3B6KA 4RU1A 2QRHA 4AJLA 4MJ7A 1FLVA 1NFRA 1OFGA 1E0DA 4LBVA 5L45A 1ENYA 4BRUA 3FVWA 5K01A 1P1BA 2B2NA 3HCAA 5B36A 2C2HA 4QOJA 1GL9B 3QVTA 4I99A 1PFVA 4J0JA 4UVEA 4ZGWA 4OHCA 4R54A 3TBFA 2OOSA 5FHRA 2GERA 2H65A 2QY9A 3VC1A 3EPLA 3Q2IA 3E05A 1JPVA 1S7GA 1JHRA 2AS0A 4M89A 1N8KA 5ALPA 2PMEA 1PJLA 2VRWA 4RTPA 5HNKA 1DRKA 3FKJA 4LFBB 3AUJB 4ZDWA 1I3NA 1H65A 3KETA 4ESEA 4LVCA 2BZ1A 4OM8A 3VUEA 3HCCA 4QO7A 1R8YA 4AXBA 1G8MA 3GZ4A 1W73A 2P4HX 2YFQA 3EVBA 4IJUA 5B57C 5A5VA 3CX6A 1GCUA 4AN4A 3E8SA 4D8WA 1O4VA 2H4HA 4NULA 1AK1A 3H2YA 6AT1A 1Y8ZA 1ADGA 2FGJA 5IK2A 1W36B 1M0TA 1AOXA 2EWWA 5C4MA 2O20A 3AG6A 3MGAA 2ZJ8A 3WYDA 3R7NA 2Z2JA 3CRVA 1HA3A 3PQ7A 1T8RA 4X85A 4DSTA 5D51S 1FLNA 2CBGA 3GWZA 5DISB 5TMPA 1N2ZA 1QNFA 1HM5A 2W6OA 2JG3A 2AFRA 2VAXA 3GR6A 4BO0A 1JLMA 1R0CA 1PK7A 1U7PA 4I14A 1VGRA 2IYQA 4E12A 2O7QA 2OGSA 2DFDA 2P67A 2YWEA 3C8UA 1VYHA 2G76A 3EEYA 1A2QA 5D3MB 3VO8A 3LPMA 4W9MC 1VJCA 1QGAA 1XK6A 2ZSEA 3CGWA 3V2HA 3UZUA 1U7HA 2J3HA 1U1GA 2OGTA 4FSXA 4KI0A 1QIGA 2Q1YA 3F7NA 3OUUA 4XSGA 1OJ7A 3TL3A 2AF4C 2ZTHA 1PV2A 1US8B 1DDOA 1SXHA 2X2OA 3D3QA 4PLPA 1FU8A 2ZI5A 3S68A 4BC1A 1EUCA 5EXXA 3TLMA 3UKOA 3QYFA 4RSMA 2Z9DA 2JS7A 4BVEA 5D3MA 2PH3A 2NX2A 4OKSA 4PICA 3RC3A 3VR2A 4BVHA 4CMIB 4ESVA 2B4QA 3AI7A 4EFMA 3MWGA 5EGNA 3FLEA 3WWZA 1US8A 1MJ5A 4JOSA 3O75A 4X94A 3UAWA 1EE1A 1HG1A 1JV2B 3ZTWA 5A3JA 4JEHA 3JY6A 4TWBA 4OLBA 4CMGA 4M8KA 4NE9A 1J4AA 1I3OA 4MVYA 2FP3A 2REOA 2QLBA 1SKYB 3QFTA 4GAEA 1HDIA 1X7DA 4C30A 2ZE5A 2H2GA 4EKNB 1DTSA 2WJJA 2XBMA 2B7CA 4CMIA 2ZSFA 3SQWA 3U7GA 2WYHA 2YJGA 3DBRB 3RSOA 2Q2WA 2QM7A 5FUQA 4JBWA 1IVNA 3ZK7A 2Q4RA 3EIEA 5JMPA 3I1YA 2RGGA 5KYUB 3TK1A 4OGFA 3FFWA 3IUPA 3OTOB 1LBHA 5ELLA 2Z30A 5JNTA 5I8WA 4KLRA 5CFPA 2PGAA 2E85A 2V65A 5B3LA 1XAIA 1YR7A 4XM2A 5TJHA 5F35A 1P9OA 3DBRA 4QZVA 3ISVA 4MB6A 4NPHA 3D7LA 3VR6A 1L4KA 2NQ2C 4R3WA 2ACKA 2CLMB 3FUXA 3I32A 5KYUA 2ES4A 2Q27A 2BMDA 3H5LA 3KKLA 2XMSA 2PX0A 4DCCA 3O1JC 1IN8A 2NZXA 1AG9A 2YHBA 4MI6A 4FDLA 1L7EA 1SCAA 2H00A 3DMYA 3L2OB 1NT2A 4V24A 4Q9HA 4YROA 2EDAA 4ARIA 4EARA 5CIQA 3L79A 1H42A 3DMGA 1FK8A 4KYVA 1ZK4A 1O3YA 2XJ4A 4Q05A 4B6QA 2HWKA 4ND6A 5LIPA 1NPTO 2PMKA 1PR1A 3PGKA 4ZZ0A 5BV0A 2QKYA 5MGNA 3UWKA 1Q7CA 3LUKA 4XARA 1QRDA 1NJ6A 5HTOA 2XZOA 2GN9A 5HEKA 1Y6FA 1S02A 3CC8A 5BYKA 4YBRA 4W5OA 2DUUA 2VHUA 3HBAA 3V1YA 4GOLD 4TWJA 3WQBA 2HWWA 3AH8A 1Y3BE 1NQTA 2V4UA 1B0PA 3GPBA 3M83A 3C5CA 2H9AA 4HB2A 3S2IA 3S2YA 3ZZ0A 4D4GA 4MPPA 2QN2A 3IJ5A 3DVSX 5DN9A 2Y9MB 2HMTA 2OBYA 3QPUA 4ROSA 2ECOA 3RD5A 5AVXA 4EW6A 4D4JA 1SKAA 4AY2A 2EQBA 3NPAA 1OVGA 3H3JA 3HKBB 4R05A 4TQGA 3S5JA 2NU6B 3BE6A 2CZCA 4NE7A 4CRWB 3GUCA 2H85A 5K4GA 1FFCA 1G18A 2QTBA 3ZWWA 1SXGA 1PVOA 1QG6A 4PO3X 3K1YA 2XDWA 2ZI6A 4MWDA 4RLQA 3QKUA 1T3TA 3E1GA 3KLOA 1OI2A 3HKBA 1QAOA 2B1IA 4CNBA 5DGCA 6CHYA 2P6UA 2NU6A 2O14A 1EJBA 3S55A 2O2CA 3HNOA 5KTNA 2Q6LA 3PYXA 4DZZA 1ZA1A 4PFSA 2PZKA 5EN4A 5EEGA 2PU5A 3ETJA 1SRRA 3EB9A 1YONA 3RSCA 3TD9A 2JLCA 2QGFA 3D8RA 2VHEA 3L1HA 1VIVA 4JLKA 4RNDB 2AJCA 4IDFA 2GR9A 1BQ3A 4L9AA 4WUTA 5F52A 5I7AA 2PSDA 1C9MA 3G8YA 2J07A 3IC5A 2E82A 1GCIA 4MTCA 2XTNA 4MWGA 3GN1A 4V0SA 5SYNA 3TG2A 2R87A 3E7WA 2IP2A 2PZFA 2OKGA 1M76A 2DLNA 4K6HA 2VHJA 3KJGA 2C2YA 2VH1A 3HZZA 1NJFA 3L0ZA 2RI6A 3R5XA 4LDQA 1BXGB 3UCXA 4IILA 3ZHSA 3A2MA 5E4TA 1T4BA 1UJNA 1WW2A 3E35A 5TSDA 2JLYA 1CIVA 1HR0B 1LPMA 3HXMA 3WHPA 1EP2B 2YHSA 4EMSA 2EHJA 3JQ9A 3KK0A 3WDLA 3URKA 5IXJA 2X0NA 3DGFC 4LGMA 5FWYB 3I0MA 5LZ9A 2IOQA 3DKVA 4XYEA 3I34X 2ZYUX 2WUDA 2JIBA 4HQOA 5DTRA 1BXGA 2RHRA 1NWHA 1W36C 5JE8A 3GJXC 4G5YA 2FOXA 1JJBA 4B6FA 4Y2QA 4Y18A 2BUBA 3T9AA 5I4BA 3QWAA 2G9RA 2CD9A 2I0FA 2OV6A 1JQEA 3T1VA 1MD9A 5BPHA 2HO4A 3MCWA 4FP9A 2QJRA 2VF8A 3EGEA 3OC0A 3S27A 5FWYA 2BTEA 2ZYVX 4DY4A 2O06A 4MA5A 1QFYA 3ORFA 3KP1A 4WXHA 1XTVA 5KEIA 2XQJA 5THQA 2ZB2A 3WGNA 2VRBA 4ZVUA 4YR7A 3DNFA 1RW4A 3I72A 1MJHA 3TTYA 5JXHA 4AQYB 4EB6B 3L1KA 4Q93A 4ZOEA 1PI3A 4HVTA 4YAFA 1QYCA 2B5VA 3VDXA 2B3TA 1X1QA 3I9MA 1FX0B 2KJQA 4KCGA 3RTDA 3OX2A 1CY8A 4Z8XA 1I2DA 1ZUHA 3KUKA 3W7AA 1AUQA 2ZYRA 4X8MA 5CFZA 4QG7A 3I53A 4LDNA 1NX6A 1NW8A 2Q9AA 3LL4A 1EGMB 4LTMA 4EB6A 4CV0A 3ZN2A 1T2DA 4PRLA 4EPWA 2DPYA 1FX0A 1YCFA 4XW2A 4ZEOA 2OM2A 3F6BX 1KZ6A 3V7FA 4EGJA 1QFZA 1FFHA 2RSLA 2XVZA 1M8GA 1RYZA 3SVZA 4IV8A 2IS2A 4DRYA 3FVQA 4BMPB 1CT9A 1JQJC 3CE6A 3ENWA 421PA 5BWBA 2RONA 5TEVA 5DNAA 4KSBA 3GLSA 3OIDA 1TPYA 2IIPA 2A0WA 4N6OA 2B1RA 1TQ4A 4BHTA 1RM5A 1QHFA 1LQTA 1V71A 1IBCA 3IP1A 3PQ4A 2Y0PA 3AVPA 4DM7A 4IH4A 4S2UA 2WM9B 3ZLBA 4BUZA 4G0NA 4P98A 2LVBA 2Z04A 1F38A 3EFEA 3G7NA 2IYWA 2OCAA 3M1YA 3QG5A 3T3DA 2CCGA 5CU7A 2PQ0A 1O6BA 4HZUB 2C94A 2FSSA 4PZYA 3OFSA 1YNOA 3DXFA 3KXDA 3PGXA 4MW7A 3NEYA 3TINA 5DWQA 1GAJA 4C2AA 1DEOA 3LLSA 4G67A 1YR1A 4I46A 4KXYA 4J1TA 1EQUA 2W4IA 3IR5A 3WL8A 2V5UA 2VK8A 4AS2A 4BRWA 5K05A 4MW9A 4QYMA 3TFWA 2UZ1B 3ZE8A 2YJ4A 4L28A 1DBQA 1TJYA 2ZYIA 1YBHA 4FDTA 4HZUA 4I8IA 2GPAA 4XVHA 1JR3A 4K5QA 4Y6OA 4H08A 1WLYA 3UA4A 4ALMA 1L5QA 4MI1A 2PD6A 3OM1A 4RELA 3MJEA 3TSZA 1C7QA 4ALJA 2E89A 4L3OA 1ZR4A 5C1DA 2OYSA 3WLRA 3AKZA 4EKYA 2QM0A 2AHOA 4PHHA 4BECA 4IDNA 4WT7A 3BD6A 2QQEA 3INTA 4B8WA 3VI3B 2UZ1A 1TM1E 4AJ4A 2EFDB 4DLRA 2O2DA 3LP5A 3E3MA 4FILA 1ABEA 4GECA 2IPXA 3A6EA 3RF7A 5D85A 2OXCA 1DXOA 2RI1A 4IIFA 1FQOA 4KPFC 3TOSA 5I45A 4QSHA 4U2DA 1UZNA 3GLVA 1PQPA 3W2IA 2Z09A 4IDQA 4GL4A 3EIWA 3BWCA 3OPVA 5K0FA 1R9MA 4PLFA 2CXXA 2W70A 1TCVA 4Q3CA 2KMLA 3HP7A 3NTUA 3Q0IA 2P9FA 4IEIA 5LWHA 4UHDA 1REQB 2OVBA 3CUVA 4TYPA 2EW2A 2I62A 2V7VA 1YKSA 1GSOA 1Y1KE 5CTAA 2C5LA 1ISPA 2BP7B 2MSWA 3GNLA 1C3JA 2DX7A 3EDCA 4DTIA 1R8SA 1TEHA 3NHUA 4KQ6A 1ECBA 4N82A 3H1AA 3Q0TA 5AM4A 1M2EA 1G6Q1 2HLDA 2YOFA 4FOPA 4M99A 2VHVA 3PNKA 1GGKA 3HACA 2JIOA 2PA3A 3DOJA 3EVAA 5C8XA 2ZAGA 3DGEC 5FFFA 4QT4A 5F23A 5L4NA 5LP6B 1REQA 3CH5A 3MMXA 4FFSA 3OQNA 1NJGA 1P4HA 3C7DB 1BX0A 1SUIA 4KMOA 4KQMA 2VZ8A 4N9QA 3FRIA 1K4MA 4MX8A 4RFLA 2D5IA 4EQ6B 1AMUA 2BP7A 1R3UA 3ADBA 4KVFA 1MP0A 1N3YA 4NZNA 4ANFA 4BV2A 1BMDA 2AN5A 2AWNA 1JIIA 1RS0A 3PGLA 4MKZA 4M1MA 5KOJB 3A4NA 1B6GA 3L43A 5GZ6A 4BTEA 2M2IA 4H59A 3V8VA 3A31A 2QIPA 2COKA 2W2LA 4IIVA 3LQYA 2NV2B 4FBGA 2P6PA 3PRJA 4KQGA 3K1JA 1XAJA 5LP6A 1W19A 4BNYA 3E61A 3JQ9C 4EQ6A 5DBHX 5HKKD 4QTZA 2WPNA 2BE9A 5AI5A 2ZU6A 1U99A 5JOQA 3QVOA 5KOJA 4WUVA 5E9JA 4EY4A 3LLCA 4GXRA 1Z06A 2QLTA 1S4QA 1SB9A 1MFZA 1RI2A 3FM9A 1LNSA 4JC0A 4DCMA 4DV3B 2CEAA 5HIIA 1A9XB 2MR6A 5COAA 1E2UA 2WU3A 3KOZA 4CCWA 4D46A 2QLMA 2GX6A 2XTMA 5LPNA 5C80A 3NB0A 2AR0A 4ZDIA 4FCCA 1E62A 3W3AH 5AW6A 5CXQA 4G24A 4ZT2A 1RTKA 4YR9A 1U1EA 3IXQA 4L6AA 1GSHA 1JQ3A 2SBTA 3MQ4A 1RI3A 3SXJA 4EB0A 1T8SA 1EVEA 1A9XA 2VVTA 2I22A 1ZNXA 1XXLA 3EAGA 4NZMA 3LUCA 4P35A 1KQGA 1O9GA 4JJZA 1U8UA 2E4VA 4WOCA 5DHFA 1QYRA 4Y2PA 5FBRB 5TV2A 1P29A 4F4HA 3DAPA 4BMYA 4O2AF 1EWTA 2MIIA 3GMDA 4WBNF 3U9SA 4QUDA 5JC1A 2WFAA 5JQWA 1L7XA 1DBPA 1LBIA 1NI3A 4RTRA 5ICFA 1USUA 4PQGA 1ZHHA 3LUDA 4M53A 4AF7A 4QE3A 5P21A 2IXFA 3HR4A 1AS3A 4COKA 4FJ0A 1QGUB 3LHDA 5I3ZA 4X90A 4YP9A 1VBFA 4HX2A 5JFGA 5FL7D 3OM8A 2FYTA 4J0GA 1ZLXA 5CR9A 1GNLA 1Y5LA 3C45A 4RPJA 1VMIA 2QN8A 2G07A 1PLJA 1R0LA 3GYGA 4HAIA 4TLDA 3ABIA 3QE9Y 3RS8A 1UJ2A 3IP5A 3KZKA 3WHLA 5NLLA 2A0YA 1ORWA 2BCGY 2Q8PA 5FQNA 4F9TA 1QGUA 4MEJA 5CURA 1NTRA 1GTJ1 7MDHA 2ZRNA 5CJJA 1LSUA 3R76A 3A04A 4B73A 3MS7A 1LB1B 2JI4A 3LK6A 1P1RA 2G71A 4YDSA 4FHFA 1W52X 4AECA 4HVLA 5JBIA 1RKVA 1KYTA 2OBBA 1EMDA 2B37A 3H4VA 3R0QA 3X1WA 3IQGX 1BCSB 2R1VB 3AGQA 3OFND 5E4FA 3DHEA 3EZ7A 3EY9A 3KSBC 4DR3B 2CLSA 3JWEA 4F46A 2FU5C 4ZQGA 3S2GA 5J2TF 4UBIA 4JSYA 2B8JA 4IOKA 4J1TC 4WXMA 3ZQUA 4DLVA 1QOQB 4X64B 4Q9DA 4QUHA 1OVMA 5C37A 4EX7A 4YUWA 4RZXA 1N8SA 1DRUA 4DG8A 4PC7A 1TQ2A 3ZTTA 4INJA 2FSVA 1B0AA 1BCSA 2R1VA 3CLSC 3JRWA 4V1CB 1KZHA 3BSYA 4J6FA 5BNTA 1FC0A 1U0TA 1DAEA 2R1TB 3VHRA 3AHIA 1C9DB 3W2FA 1A76A 4MHSA 4D5GA 4CL8A 4G4GA 3WGHA 2IEAA 5JWOA 1PS9A 3CISA 4G4SO 3QRWA 1WMBA 4K6CA 5EMJA 3VKFA 5KOYA 3QKRB 1IM8A 1PBTA 3K31A 5KYVA 3VR4H 1Q0HA 4CFSA 3TGLA 1H4TA 4V1CA 1VI6A 1IDOA 2ILVA 3HUTA 3U4MA 2ID4A 3DW3X 4AIIA 2R1TA 5KWEA 1RHRA 4DANA 1BA2A 1VIMA 2PT6A 4MINA 5GMOA 5FWNA 4J43A 1JG7A 1L7QA 3EQ9A 3PIIA 3QKRA 4JUAA 3ES9A 3FBGA 3N8DA 1U4SA 2GYUA 3WGQA 1YAHA 3G6KA 4ND7A 4DARA 2JZOA 4UM7A 1D4AA 1K5DA 4F9FA 3WGJA 1PEDA 1Q15A 1W88B 4KR7A 2X19A 2FZVA 3BILA 3AEYA 5L7WA 4LXYA 4QNMA 2IS1A 2SECE 1YJCA 2BYTA 3EC1A 5IKEA 4YMHA 1TK2A 4JEMA 5HZGA 3T1HB 3JAWB 1Z38A 1IN7A 2V7QD 4UVHA 1QFSA 4L27A 5TRTA 5KCMA 4Q01A 3KKNA 1SIUA 3ZHXA 1L4GA 4DJEC 4F04A 1KTIA 4GPBA 1W88A 2PGOA 2H1IA 1ZGCA 3DHVA 2GJ9A 4HWRA 2DKOA 2UZ0A 2P27A 2YFKA 4PHGA 4EYEA 4DJAA 3FPAA 2Z43A 3A4MA 3JAWA 2P0AA 1QAQA 3QPCA 5FBWB 3RTBA 3K9FC 2YVLA 3W9YA