4NDNE

Structural insights of mat enzymes: mata2b complexed with sam and ppnp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
IPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase isoform type-2
total genus 112
structure length 309
sequence length 309
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ndnE00
2BI8A 4BMVA 4CODB 1SOVA 4NK4A 4MVJH 5THKA 1U9JA 4CQMD 1PJTA 2OUIA 3JYLA 3ZWXA 3UN1A 1NFQA 5KTKA 1RYDA 4ND3A 1GEEA 2Y05A 3ICPA 3QVSA 4D3SA 1VRWA 1M66A 5TC4A 1HLDA 2DUWA 5I9LA 3ETDA 5T57A 4MKRA 2ZCUA 3I4FA 4GGPA 3VKUA 1KVSA 1EE2A 3WMWA 5JLAA 3MJEA 1G1AA 2PLAA 2QZZA 1Z7BA 2Y1FA 5DP2A 1LSUA 4TRJA 3VKVA 4BNZA 4AJKA 4MVJD 1PGOA 4YAKA 3AK4A 3KYDB 4N7RA 3ONFA 3AWDA 1MUUA 4HXYA 3TSCA 2VRCA 5ER9A 4ESOA 4IIUA 2GNAA 2BGLA 3HDHA 3QWIA 3F47A 5LDGA 3VTZA 2HK7A 3FR8A 1RM0A 3BZUA 1X0XA 4R1UA 1JQBA 1AUPA 1HZJA 1LLCA 4OXYA 1HDGO 3LT4A 3PJGA 4BO2A 4F3YA 2X58A 1P77A 1GQ2A 2EF1A 3PYMA 4WLUA 3ZGYA 3GEGA 3W8FA 3UCFA 2PTGA 3BIOA 1DDOA 1PJ2A 3I4CA 5JCJA 1PS9A 4LN1A 3EVNA 2NTJA 1BVUA 4BNNA 4NHEA 4B4VA 2HMSA 3D3WB 1P0CA 4P4LA 5FFFA 2B36A 5JCXA 1U3VA 1WXDA 4CM8A 1E1LA 2PY6A 4MP3A 5DZSA 3M6IA 5T5QA 1LDNA 3B1FA 4M86A 3ZDFA 1SOWA 1UDCA 1LLQA 1WW8A 4YB8A 1ZK3A 1N1GA 3OMLA 2HDHA 1IE3A 2C0CA 1OBFO 4EEZA 1ZBQA 1ONOA 4DPLA 1SEPA 3CPSA 4OQZA 1HEUA 4RQTA 2PZJA 2FP4A 2GYYA 1ZK0A 1ID1A 1VI2A 5K9ZA 3DOOA 4HFNA 4UVIA 5I9MA 1S6YA 1Y8QA 3FTPA 4MIYA 2Q50A 3E9NA 3S2EA 2YFQA 4J90A 4W7HA 5TJ9A 5COBA 2R6JA 4YACA 4E5NA 3TFQA 3LSYA 2CUKA 2X0IA 4N5NA 2WD8A 4I5DA 4ZJUA 2RIRA 1YS4A 4M55A 4CMBA 4YT2A 2YHIB 3EMKA 3C1TA 4UUNA 3IKTA 4NR0A 2VZ9A 4E4YA 3UICA 3KYBA 3OQ6A 3ADPA 4OXKA 3ST7A 4UAGA 3O38A 3HE3A 4IZIA 4BKOA 4H16A 2W2KA 2HK9A 5A05A 1KEUA 3GOHA 7ADHA 1N5DA 4R68A 5A04A 1QMGA 4II3A 2UV8A 4NDNE 4ND2A 2J3IA 3JD1A 4YEDA 5KJ6A 3ZCXA 3L6EA 3SC4A 2VHWA 3F4LA 3HN7A 2VHXA 1GZ3A 1E3SA 1UXHA 3L9XA 3DO5A 5KKAA 2W8ZA 2UAGA 2FN7A 1MXHA 2HLPA 3C7AA 3VH3A 1TEHA 4CM4B 3S1LA 3ZU3A 5JSFA 5AXAA 2I3GA 4R1TA 4R3WA 1R0SA 3HN2A 3WNQA 3PDUA 4BIIA 3AUTA 4A2CA 2O3TA 1LRJA 1JDJA 1NAHA 4R4JA 4UEJA 4EJ0A 5BNTA 2DPHA 3OEWA 3AM5A 4L4RA 1NTOA 3ONDA 2VWHA 2VRBA 1E1MA 3QIVA 4IGFA 1LRKA 3WIDA 4I5FA 4CM9D 5G0SA 1UXJA 3NTRA 3GVHA 4IS2A 1SB8A 3WQQA 5L95A 3GG2A 3KUXA 3DTTA 3I83A 1I01A 5C7OO 3OQ1A 1YJQA 2XF8A 2Q99A 1NX6A 2ZKLA 2X4GA 2P4HX 5A3JA 3JQ9C 1B8UA 3OEYA 5BNIA 2I66A 2UUPA 3C7CB 5B1YA 5FI5A 3R3JA 3W4KA 1WLYA 4BNKA 1H6DA 4TZTA 4YQYA 1I30A 3DEYX 3HSKA 2P5UA 5BSFA 1E1KA 3KTDA 3GVIA 2BHLA 3WFJA 5BT9A 5T8KC 4E5KA 1D7OA 1VJ0A 4OSPA 4KP7A 1O8CA 4DQUA 3HDYA 1GD1O 2YQ5A 4OH1A 2J3KA 4BB5A 2AEFA 3I52A 2RHCA 5L45A 2DLDA 2QIOA 4O1MA 4XRRA 1DB3A 4O6VA 1XSEA 3PIDA 1DAPA 3UVEA 1ZJYA 4IPTA 3W4JA 4OYRA 1E77A 1NQ5A 3HWRA 3PHJA 3RUHA 3E82A 1ENPA 3WMXA 4CR8A 5CDTA 3G1TA 4MINA 5L40A 1DRUA 1K0UA 3NJ4A 1VM6A 1A5ZA 3VPXA 1SB9A 1R0KA 5IZCA 3IOYA 1ZW1A 2VRCD 5JO0A 4UVGA 4OAQA 2WDZA 3INGA 3SEFA 2AG8A 4DPMA 1V3TA 3L77A 1ZXBA 2O4UX 1BVRA 1T2AA 3AOEA 2HK8A 2YHIA 3OIDA 5G0UA 4MVJM 4CMGA 1LLDA 4PG4A 2GPTA 2YV1A 4S1VA 3VZQA 2C5AA 2CMDA 1E3JA 2EV9A 2IRWA 3F46A 4L4XA 1H5QA 3AUUA 5KJEA 3E03A 1W0CA 1ZMTA 1ISFA 3PWSA 3JQBC 3JYPA 4CQLA 1A4IA 3DMTA 1GAEO 1GU7A 3JQ8A 3QWFA 5IJZA 1H0KA 3NRCA 3WGIA 5JNLA 4CQMA 1EQUA 1PJQA 3GAZA 5DBFA 3G1UA 2ZB8A 3GG9A 4WLNA 3FI9A 3RBZA 4DUPA 7MDHA 5ADHA 5KIAA 2PKRA 1I2ZA 4JQCA 4FJ0A 3WSVA 3KRTA 4NFHA 3I9NA 4BV9A 4E13A 4JGBA 1DBVO 1XEAA 2JAHA 3FN4A 2EKQA 2IXAA 4IQ0A 2X5JO 1NXQA 3WS7A 4XGNA 2BD0A 3F1LA 2W2LA 3FD8A 5MGBA 3CIFA 4RVUA 9LDTA 1SMKA 2D2IA 3E9MA 1T1SA 2Z1NA 2YV3A 5BQFA 1MGOA 3I9MA 5A5FA 2P9CA 4NH4A 1HYEA 9LDBA 4PLGA 4C4OA 1Q0HA 3U3XA 1ZXLA 4Q3BA 2WJPA 4OM8A 4XRGA 3E18A 4MIEA 1CF2O 1U3WA 2G5CA 2X5OA 4YCAA 1ZEMA 5JE8A 3WX0A 3MTGA 3TZ6A 5CG1A 1B16A 2BFOA 1GEGA 3ZNOA 2NM0A 4DBVO 4JK3A 1LTHR 4DQXA 4XWYA 4RO0A 1GZ4A 4XA8A 1XELA 3RC7A 5A3VA 1LNQA 3ZV4A 3MOGA 1DC5A 3CZMA 3TZQA 4UEOA 1K6XA 3CMCO 4U0KA 1VL0A 4L75A 2VN8A 1A9ZA 2BI7A 4IS3A 1MA0A 4JBIA 5TJHA 2YY7A 4GL4A 2X5KO 3W6UA 2EGGA 3QP9A 3U49A 2BFAA 1U2DA 3QV1A 4Z0PA 5C3MA 2GCGA 3BA1A 1E92A 3AFNA 4CV2A 1I2CA 2NTVA 3LQFA 3ANLA 3RAJA 3HQ4O 3ZWBA 4QUKA 2HJRA 2AHRA 4WCFB 4D0SA 4N5LA 1T26A 4J1NA 2QX7A 3D5TA 3PJEA 4OIMA 5HBRA 3ONEA 5IZCC 2VUTA 2E82A 1Z75A 2BLLA 3ZI0A 1BHSA 2OBNA 3PYXA 4OL9A 4FD3A 4RVFA 4KQWA 1LSOA 1UP6A 1SAYA 3QLJA 1NASA 5JDCC 4PG8A 4XJSA 1GYQA 4OXNA 4R9SA 3KO8A 4YJFB 3UFXA 3VDQA 5CAEA 4MVJI 2VYND 4NI5A 1L7EA 4J9UE 3D4NA 2WD7A 1PQPA 3WWZA 3H9QA 4B3HA 2B35A 1YOVA 1Y81A 5AXDA 2RH4A 3CMMA 4QSMA 1ZKMA 4BNUA 3PTZA 4MVJP 5IZ4A 4U6SA 2PV7A 1YB1A 4TKLA 5T6BA 2AE1A 1BGVA 2C20A 1HETA 1NQAO 1H9BA 3E5RA 3GR6A 1QXSA 4PLZA 1DRWA 4MKXA 3WR5A 1SCUA 2OO5A 3H4VA 1K89A 1DIBA 1EQ2A 1RKXA 2ZYGA 1D8AA 1E3WA 1QORA 4A7PA 4ZQBA 4R5MA 2CDAA 3I1JA 4Y9DA 1R12A 1QRRA 3ZNNA 1Q7GA 4PLPA 1GUZA 2EW8A 3QSGA 5JYDA 3ABIA 5FF9A 5LCXA 4XQGA 5TGDA 3JYQA 5GZ3A 4O5OA 4L73A 4IUYA 3ROMA 1E5QA 3H5AA 1M75A 3I9JA 1I3KA 1T2EA 2X22A 1O89A 4J91A 3DQPA 1PIWA 4QEDA 2X0RA 4PRKA 1NFRA 1DJNA 4YRDA 3VPSA 3NGLA 4PLFA 1VPDA 4BNWA 1OAAA 4WASA 3H6KA 3C1OA 3W8DA 3ZWWA 3PXXA 3K8ZA 4Y6PA 4XQ9A 4L9RA 3DZJA 2O4CA 2YV2A 3H2SA 4L76A 1X14A 4B3IA 1C1DB 3FNHA 1F8GA 3DR3A 1LRLA 4NBWA 4NFSA 1HSOA 4DVJA 1BDMA 1KIFA 2C59A 3MZ0A 3RC1A 3Q9NA 4CLXA 1HWYA 4L0QA 4H3VA 1QYWA 1NPYA 1O6ZA 5HS4A 2NVWA 1SBYA 4B7CA 1FDVA 4G5HA 3RC2A 1ADCA 3RUFA 4D7AA 1PL8A 1W8DA 3WGQA 2DQ4A 3K2BA 3CXRA 1V6AA 2Q1UA 4CMJA 1M76A 3H9EO 1WZEA 3EY4A 4WK6A 4ZRMA 3K31A 4BS9A 1OZAA 3OIGA 5A02A 4CLDA 2VNAA 3GZ4A 4RJTA 3ZNQA 1N9GB 1EEHA 3BAZA 1R37A 1E7MA 1GFSA 4FFLA 1WMBA 3IC5A 1IHYA 2V6BA 5DBIA 4CM8B 3JD3A 4XKJA 2CZCA 2O50A 3ANNA 4J49A 4IMRA 1CQIA 1IULA 4ZD6A 2C2XA 3L6OO 1UR5A 1EFKA 1EUDA 3P2OA 5ES3A 2WYUA 1JWAB 4L74A 2P4QA 3GMDA 1J6UA 2B69A 3GZNB 5G4KA 4ILKA 2F00A 3RKUA 3W8EA 1E1NA 3ASUA 3WGHA 1XYGA 1X0VA 1B26A 2NLOA 1GY8A 2VT2A 1L7DA 2OBYA 4JXKA 1JAXA 4F6CA 5BSGA 2X7HA 3UGKA 5I7SA 1KVTA 3DZGA 4D3DA 3S2IA 4FPXA 3GUCA 4YJDA 3LK7A 1GPDG 4G81A 4RCVA 1IY8A 3WBBA 1I5RA 4P4GA 4FGSA 2P91A 5C7LO 4FN4A 1DLJA 1XQ6A 3O4RA 3KYDA 5EESA 1KEVA 1GYPA 1SO8A 3QQPA 3VC7A 4E31A 3FSRA 2W98A 4I9NA 4YTEA 4NU5A 3E9QA 3STHA 1GV0A 2A9FA 2JFFA 2ZYAA 1VE9A 3PK0A 1AE1A 1NVTA 3W1VA 4CM3A 3DC2A 5JDIA 4CUZA 3X2FA 4NBTA 3CEAA 3K73O 4EW6A 4RZHA 5GY7A 3GPDG 3WB9A 5B12A 5FEUA 3NX4A 1XKQA 2BH9A 4J4HA 3X2EA 1PS0A 4ZICA 3IMFA 4CL8A 2QHXA 2HO5A 4JN6B 1XU7A 4DLAA 3F3SA 3LVFO 3TJRA 1J5PA 1DFGA 4ID9A 2J3HA 1EBFA 1RM3A 1I10A 3U0BA 4IJKA 3WXBA 2JCXA 3N58A 4TQGA 4DGSA 3RIHA 1PJSA 4WEQA 3VZSA 4EJ6A 3PQFA 5AXCA 1YQGA 2VYVD 1OFGA 4Z6KA 3GRKA 3JQ7B 4EBFA 4NZ9A 5JO9A 3RU9A 2IXBA 1P9LA 4Y8VA 3I3OA 2UUOA 4RL6A 4IY1A 3BMOB 3SLKA 5CFZA 5IFLA 3DZFA 1XDWA 1YQXA 2OMEA 3ZV5A 2E4AA 3P5SA 3VH2A 1LEHA 1YL7A 3AI1A 3KM0A 4XEHA 5TX7A 2ZTUA 4AJ1A 5U9CA 1J4AA 1R6DA 4KWIA 4YT4A 2ZYDA 3DFUA 2QG4A 1V9LA 3R0IA 2GF2A 4Q3CA 3VPGA 4BNXA 3INTA 2VNSA 5GZ6A 3PP8A 1HKUA 4F6LA 5JY6A 4DMMA 1FXSA 1HZZA 1YDEA 4AVYA 4B7XA 5CDYA 4U5QA 3RROA 1C1XA 1R4NA 1Y8QB 3NKLA 1DLIA 3F5QA 4UUOA 3SC6A 3PHHA 4N5MA 4ROSA 3MJ4A 4ZA2A 3OBBA 1B3BA 4JIGA 1M67A 3K2EA 1NQTA 1H2BA 2POQX 1D1TA 1NHGA 3C85A 3IS3A 4GI2A 1T4BA 1Z73A 2HJSA 1LX6A 4YDRA 1T4DA 5G0WA 1EZ4A 3HFGA 1SC6A 1PZGA 4WLVA 3DZKA 3SX2A 2J6IA 4FFOA 2G1UA 3H2ZA 3OQBA 4AJ4A 4YYZA 4XGKA 5IXSA 4X54A 3I6IA 3OF2A 2HMUA 3AUAA 2FSVA 5DF1A 1GQQA 2DKNA 4ZU3A 2ZB4A 3UUWA 4CPDA 1GDHA 3PZRA 4K26A 5K0ZA 2H6EA 1AXGA 1XCBA 4XB1A 1PZFA 4QT0A 1Y8RA 4HFMA 1VSVA 2WMDA 4AJHA 2OL4A 3NV9A 3H3FA 4AJNA 3GNQA 3NDRA 3DZBA 4YA6A 1IL0A 1RJWA 4LSWA 3KETA 5U4QA 1HE5A 3ULKA 5IDWA 1CRWG 2QZ9A 1U7TA 2EEZA 5CDUA 4AICA 2BELA 4JBGA 1TLTA 3DDNA 5JCJD 5F1PA 1KETA 4XYBA 2H5LA 4E32A 3GT0A 1YH3A 1PJBA 3TNLA 1XU9A 4E2ZA 2JL1A 3HDQA 3P19A 4YRBA 4W9NA 4PG7A 5DCYA 4JP2A 3W4IA 1U3TA 3FBTA 2PH3A 2DBQA 2EKLA 4IIVA 4A10A 2R2GA 1NR1A 3GH3A 5TS3A 5JAIA 4R54A 1O5IA 3NTQA 2OHXA 2H1SA 4DMLA 2NVUA 5DCUA 5COAA 4JJGA 1ADFA 4CUKA 1GV1A 1BW9A 2B37A 2WWRA 4PZEA 2A35A 5JYEA 4MVJA 1PL7A 2OXIA 3KEQA 4TSKA 3OJLA 1IZ0A 3BMQA 4Z9XA 1E7WA 1YDWA 2OORA 3TWOA 4E5MA 4U0JA 4D41A 5HWSA 5K6AA 1E3LA 3ETGA 3G49A 3H9GA 1BG6A 4BNFA 1TXGA 4J2OA 4LCJA 3LLVA 4XR4A 4R1SA 2D8AA 3I9KA 1PR3A 3G0OA 5CPBA 3RJ9A 1JAYA 1RM4A 3VZRA 1NWHA 2B4TO 1LQUA 3EUWA 2AXQA 5A4DA 1UAGA 2RH8A 4QECA 1B3RA 5IDQA 3IP3A 1E7YA 1YQDA 4XX0A 4PFJA 1U4OA 1QV6A 2Q2QA 5CDGA 2HAEA 2VHVA 3ZNPA 2P9GA 3JQ7A 1CEQA 2EW2A 4E2YA 3M2PA 2X1HA 4AG3A 2VWQA 1FDWA 2FPPA 4FOSA 2AQKA 1B8VA 3B20A 2FR8A 1QLHA 3F1KA 3GGGA 3MWEB 4YAIA 2FR0A 4Q3AA 3OJOA 4BKQA 2OOSA 3D4PA 6ADHA 2DPGA 1GL3A 3FCOA 4ND5A 4TMFA 2HMTA 1PQUA 3SBOA 5THQA 3H9UA 2AE2A 1MFPA 3QWBA 4IDAA 5LC1A 2IYOA 5L4LA 1EK5A 1UUFA 1EVJA 3DWFA 5EL0A 4E2WA 5CDSA 2BGKA 2X0JA 3DHYA 4KDFA 2OZPA 3OA2A 4IDCA 5IG2A 1R66A 1ZK4A 3GVPA 3JSAA 4M89A 4AJPA 2FOIA 4J7UA 1EUCA 4DPKA 4F46A 1LBEA 1PTJA 5TT1A 3OFSA 1RM5A 2D3TA 2GN9A 1U4SA 2CNBA 1R16A 4HY3A 2V6FA 1X7HA 3GPIA 5F1KA 3E8XA 4BO0A 3GFBA 4JX8A 1X7GA 1NR7A 4GSKA 1BTOA 2BKAA 3BTUA 5A1TA 5ICSA 1TT5B 3MEQA 1M6WA 2DFDA 3I9OA 1FDTA 1F0YA 3P2YA 3JQ9A 1H6BA 3PDJA 1RYEA 4IJWA 3NJ8A 2Q46A 2WYVA 4I8XA 1DJQA 2I6TA 3WFIA 1C0PA 1A4UA 3OM9A 3ZU4A 1PWXA 3PHLA 4JBHA 2E37A 2QRJA 3VVCA 2Y0CA 3E48A 3NT2A 3K92A 1YKFA 5KJCA 4MVJE 4FOOA 3BMQB 4QX6A 4D79A 3VDRA 2YFHA 4NMHA 3GQVA 4BNIA 4JROA 1VJTA 3JQGB 3ENKA 1U8XX 4HP8A 1X15A 1LQTA 1FDSA 4ALJA 3K30A 5JC8A 5KOIA 5L51A 2CF5A 1KVUA 1GR0A 4FJ1A 4F45A 3ZWYA 5TLSA 3S8MA 1T24A 3LC7O 2OP0A 1LC0A 1N7GA 3WGYA 1PGNA 3A1NA 2CF6A 4RPKA 2DBZA 3V2HA 3HG7A 1AXEA 1MG5A 1TA4A 4BHTA 4CMIB 4Y6RA 4IQ8A 4FB5A 4OO3A 3GDOA 3BMCA 3DXFA 4QO7A 2AEMA 4PIVA 2VHYA 3IP1A 4CM1A 4PLWA 1BXKA 5COQA 2NTNA 1EDZA 3MWDB 1A71A 2O3RA 2C5EA 3RUIA 5L4SA 4BO4A 2PKQP 4M49A 4R3NA 4FJ2A 4CMKA 3T7CA 3VHRA 1E6UA 5ITWA 4UUPA 1C0LA 3FNFA 3RBVA 4BO3A 2CSUA 2FZEA 4GMFA 4XDYA 2B0JA 1WDMA 3V2GA 4WCDA 3GHHA 2B4RO 3KSZO 4K9DA 3IUPA 2VZ0A 2VYVA 1PEDA 2HCTA 2C07A 3UCXA 1PGJA 5C37A 1BXGB 5FI3A 1ZCJA 5I7VA 4XYLA 4A73A 3KV3O 5CEFA 1BDBA 3KHUA 1EMDA 2XAAA 4GGOA 1Y1PA 3HZZA 2GGSA 4BL5A 2AQIA 5KVSA 4LMPA 1E3IA 5I9NA 1YL6A 4YBZA 3RWBA 3T7EA 5B4VA 5F21A 1DXYA 5KVQA 3CE6A 3TL2A 2H9IA 4CLRB 4ALKA 3CUKA 1UP4A 3LF2A 3B70A 3WGGA 1CYDA 3GN2A 3JQFC 1DFHA 4J16A 4CM9A 3BTOA 2I65A 2P2SA 3GGPA 2AMFA 4DC1A 5B4UA 3R6DA 3QVWA 3KYCA 1P74A 4IZHA 1PL6A 1IB6A 1K2WA 4R16A 2X9VA 4DLLA 3OJ0A 2VZ8A 2P68A 2IE0A 3QHAA 1O0SA 3HB4X 4DA9A 1AHIA 3WLEA 4AJJA 2Q3EA 3JD0A 3JYOA 4RV9A 1CJCA 1U8FO 2Q1SA 1LDYA 4Z0TA 1T2CA 3F5SA 2HQ1A 5JAZA 4BKPA 1C0KA 3AU8A 1LJ8A 1SPXA 2BFPA 4HNGA 2R00A 2CY0A 2VYNA 1UXIA 3EDMA 2FHSA 4KZPA 5JC1A 1P44A 4CMCA 3GNTA 3IQDB 2C2YA 1BXGA 3KSUA 2VTDA 3L4SO 1Y6JA 1PX0A 3NDJA 2PZMA 5C5IA 1TVEA 2O2YA 1DC3A 3RUCA 4BNMA 3RFVA 1X1EA 5GMOA 5BSHA 2ZJ1A 4UUMA 4DTIA 3MJVA 4C7KA 4O63O 3IAHA 2Y68A 1NWCA 3DHEA 3AY7A 2Q2WA 3CH6A 4GX2A 1YRLA 5C7IO 1H9AA 1F17A 1NBOA 1PR9A 4GVXA 4BGIA 1HL3A 4TROA 4WKGA 4CQMB 4EI2A 5IF3A 1E7RA 4RF4A 2WYWA 5TQVA 4A26A 2PNFA 1LU9A 1KS9A 1NQOA 2JCYA 3OH8A 4NQZA 3AM3A 3RQSA 3PGXA 4RLSA 5A03A 4QFCA 3NDIA 2A92A 4DQVA 3PPIA 1EBUA 4EITA 1P1KA 4NBRA 1CDOA 4Z3KA 2EXXA 4IINA 3G17A 3GVCA 2Y1DA 2Q1TA 4NFYA 4YAJA 1R4MB 3DBRB 2PD3A 1Q1NA 4U7WA 1WDKA 3BTVA 3H5NA 4Y67A 4EYEA 1XQ1A 3OECA 3WGTA 3CTMA 1N2SA 4IJVA 1ISGA 3MTJA 2O23A 4J7CA 5J23A 4D43A 4IGEA 4I1IA 4R51A 3ZHBA 1U28A 1VC2A 4QXMA 4D3FA 4XIYA 3LT0A 4OKIA 2J5RA 2Y0DA 4XIJA 1MG0A 4MKZA 1YGYA 1Y9AA 3C8MA 3AOGA 3L6DA 5G4KB 4CM7A 1I8TA 1JKIA 2Y1CA 4YJGA 4WLFA 1JW9B 1JN0A 2WSBA 3UCEA 5EQFA 3PFFA 2LDXA 1GADO 2NU7A 3OIFA 3OJEA 1WVGA 4NPCA 5HS6A 3GMSA 5JXWA 1P0FA 2ZIZA 4BO8A 3MJSA 4MVJG 1I24A 4FS3A 2HRZA 4BO6A 1B8PA 2DUUA 2CDBA 2FSSA 1OC2A 3WWYA 4PN3A 2Q45A 2DFVA 4HV4A 3ASVA 1IZ9A 2RBEA 1B14A 4P4NA 5A9RA 3V1YA 4DC0A 4UREA 1ISHA 1D3AA 1T25A 2ZCVA 4II2A 2BF7A 3JQFA 4PVDA 3JQ8B 2IEDA 4WLEA 1C1XB 2AW5A 2XPCA 1EUZA 3PJFA 3H3JA 3PLRA 2Z1MA 3RJ5A 4D46A 2PZKA 4BGVA 3EHEA 1PZHA 3WNVA 2EG9A 4R69A 4B4UA 5AOVA 3EZLA 1EVIA 2GD1O 2Q1WA 1PZEA 3KSDO 4MDHA 4ONEA 4R41A 4OJNA 2VWGA 4PCVA 3GEMA 2AQHA 1T1RA 5L7TA 3QA9A 4PLHA 4FFRA 5F1OA 5I8ZA 3JCZA 1N92A 3WYBA 5I8WA 2ILTA 3I23A 2NVBA 3AY6A 3FTNA 2YW9A 1V3VA 4RZIA 4AJ2A 2D5CA 4KQXA 4BQPA 2GZ3A 1HDRA 5EN4A 3B6ZA 5ENVA 2O7SA 4WNCA 5L7WA 1SEVA 3BHIA 4KWHA 1HDOA 2WE8A 1ZK1A 4CUJA 3D1LA 3A9WA 4WOKA 3Q6IA 5ILGA 4BKRA 3HJAA 4Q3NA 2GDZA 3DOJA 4O0LA 4HFRA 4BGEA 1JA9A 3PIIA 2ZK7A 2AG5A 2OGUA 1A72A 4DREA 2EWMA 1GZ6A 1OOEA 4OOFA 3AY3A 3MOIA 1N8KA 1WP4A 1NVMB 1I33A 3JQ6A 4E2XA 1QYCA 2JD0A 1SZJG 3JQBA 2FY8A 3QVXA 3LZ6A 3TPCA 4A03A 1P1RA 5DOZA 2X86A 4KUEA 5F5LA 5L53A 4J4BA 1U3UA 1KEPA 3FPCA 3M1AA 3ROQA 5IDXA 3GNSA 5JY1A 1UDBA 3FPLA 4U6QA 2Y1EA 4GLOA 4W4TA 3UF0A 4C7JA 3NT4A 1E7SA 3WIEA 4FR5A 1DC6A 1I3MA 3GAFA 2OP1A 4IJUA 3L9WA 1U7HA 3N7UA 3EW7A 1LDMA 3P7MA 3LC1O 3UHAA 4J0EA 1XWFA 4R01A 3ZN2A 4DL9A 2WE7A 3FBGA 1R15A 1MC4A 4J6FA 1GUYA 1IHXA 2EKPA 3WSWA 4H7PA 4NBVA 1QR6A 2X8LA 3S2FA 4YT5A 3TDKA 1NP3A 2EGHA 4OOEA 1VJ1A 2B4QA 2XXJA 3DFZA 1V3UA 4J3FA 5ER6A 1QYDA 4OQYA 1LLUA 3Q9UA 2GN6A 3D3WA 4R5HA 1LDEA 5JDIC 4RPHA 5JBIA 4WCFA 2W4QA 2XOXA 3A06A 4GPD1 2H63A 2EERA 3RCBA 4JP3A 1G0NA 4IDFA 3MJTA 2DC1A 4J7XA 2GN4A 3BXXA 4E5YA 1B2LA 4TVOA 3UAGA 3FHLA 4LGVA 4A27A 4QO8A 2GUGA 4D45A 3JQCA 4YQZA 4YVFA 4LRSB 1YJ8A 1YL5A 1R0LA 4Z9YA 3OICA 5I7FA 2IZZA 2I76A 2IDZA 3MJCA 4XDZA 3IDSA 3IL2A 5T67A 1LSSA 5DNAA 2NNLD 1HDZA 2E6UX 3AJRA 1MB4A 1YVEI 3ZW9A 1ZNQO 3D7LA 1X13A 4L4SA 4MVJF 4OKNA 3V2UA 3DBHB 3QVTA 3NTOA 3QE3A 2PGJA 4GSLA 4PLCA 4DWVA 4LISA 1I2BA 2X9GA 4E33A 1K3TA 3RI3A 4GH5A 4N18A 3IKVA 3GUYA 2JD2A 4PZDA 1UJMA 3HNPA 3GLQA 1MP0A 4JJIA 4XR9A 5JPIA 3E1KA 1ULUA 1AHHA 1MV8A 3WICA 3IJRA 3VAZA 2PA3A 2PGLA 3OSUA 2W2LD 3ZW8A 3KBOA 4RPLA 1ZK2A 3L4BA 4JCOA 4FIZA 4BO9A 4E30A 4NNJA 4HWKA 4XCVA 4YXFA 4UEKA 2EJWA 2Q4EA 3NYWA 3QWHA 4AJLA 3R1IA 2J5KA 4N54A 4XJTA 3KEOA 4MJLA 4NJMB 4WECA 4BQRA 5CG2A 1DRVA 3GK3A 2ZQZA 1EVYA 1D4FA 4IDEA 5JDCA 2UYYA 5HTOA 1BXZA 2ET6A 4EUEA 1HTBA 4BNHA 3KOUA 2WM3A 3FF4A 1PGPA 1F12A 2VQ3A 2X6TA 1UDAA 3GVXA 4ZQEA 4WJZA 4RPGA 2GRAA 5MDHA 1QKIA 1VKOA 5T8KA 2FPGA 4CLHA 4BNGA 4CMEC 5TT0A 3ZH2A 3PFWO 4YJGB 2YDXA 3WGOA 1ENZA 4R9RA 4W9NC 3U4DA 4MO2A 4ZRNA 4B8WA 3TZKA 3UKOA 3VPHA 3JQDA 4ITUA 1VSUA 2P9EA 2RCYA 1JVBA 4S3MA 1ZSYA 2PR2A 3ITDA 2GASA 2I67A 3O8QA 4JJFA 5FYDA 5ENDA 2DU8A 3KYCB 1GUFA 4OMUA 4HUJA 5F5NA 4BNYA 3PWZA 3L07A 3BHMA 1HDYA 2EIHA 2QRKA 2NU8A 3I6QA 2Q4BA 4RGBA 3RFTA 3DBRA 1R4MA 4IDGA 2FWMX 1Z7EA 3AM4A 3INRA 4DYDA 3RUDA 3GA0A 4GVLA 1KY5A 1ZMOA 2WD7B 5B37A 3WJ7A 3H8VA 2QQ5A 1WAMA 3AOEC 4DLBA 1ISJA 4FSHA 4CV1A 2EHDA 1UH5A 4K28A 1ONNA 4KUHA 1P1IA 3K6JA 1XG5A 4CV3A 4CLOA 3ZV3A 1NPDA 3T4EA 1A9YA 1U5AA 1M2WA 3WYCA 1XHLA 3RUAA 1JTVA 2VWPA 3PJDA 2GO1A 1LUAA 2ZTMA 4WCFC 5EINA 4E3ZA 2B83A 3AI2A 3EYWA 3QVOA 3KLPX 3DMTC 4P38A 2W90A 3UXYA 1PS8A 3ETEA 4CM5A 3TRIA 3D3EA 3EAGA 2WEKA 2CVQA 2YZ7A 2C54A 4BGUA 4JLWA 5CHEA 4CV0A 4EEXA 3LF1A 5CPFA 1MXFA 1Q0QA 3T4XA 3WDSA 3VVBA 2OFPA 3ROKA 4ALMA 4W6ZA 3H9JA 4HNHA 1S7CA 2GZ1A 2VTEA 3EVTA 2P5YA 4J0FA 2ZATA 4BVAA 3Q3CA 2JD1A 4AFNA 4K6CA 4LSMA 1DHRA 1JKJA 3BMCB 3NAQA 1XGKA 4KUGA 3C3XA 5A5EA 4CM6A 2QYSA 1GTMA 3VTFA 1UXKA 3SJ7A 1HYGA 5KKCA 4FC7A 3PI7A 3WG9A 4NBUA 4A0SA 3LDHA 2Y1GA 1IPFA 5JMWA 3WGZA 5L9AA 3JQEA 5DCWA 1KVQA 4BMSA 3JQGA 2V65A 5JAMA 2B5WA 3OHSX 4GLLA 3L4BC 4L8VA 1KYQA 2F1KA 1H2HA 3WQSB 1ZEJA 4G65A 1DFIA 1YE3A 1Z74A 1PJLA 2HU2A 1X7DA 2O3QA 2QRLA 1FF9A 1OMOA 3IJPA 1DC4A 2XXBA 5ITVA 1WNTA 3TOZA 4ZGWA 5IDYA 2G0TA 4ALLA 1DEHA 4EUFA 3CSDA 2CFCA 2DTXA 3TF5A 4YJHB 3BMNB 2GR9A 3OP4A 2QYTA 3B1KA 5DT9A 4KDEA 1PJ4A 1VKNA 3FNGA 4TWRA 2BGMA 3ZWNA 1E3EA 3OA0A 5IXYA 1QYVA 4E5PA 1LSJA 4AJOA 4Q3EA 2DVMA 4MP6A 1PSDA 5G0VA 4BUCA 1ISIA 2B5VA 2NACA 2Y99A 2TMGA 4FFPA 4LMRA 1ZSNA 2QW8A 1E6EA 5A9SA 2PGDA 4J1TA 5G4LA 5HA5A 2Q49A 5IAAA 1YXMA 2CVOA 3PRJA 1A27A 4XD2A 2BRUA 1W4ZA 4WNIA 2PKQO 1CWUA 3L0DA 4BMNA 3SJUA 3QJ5A 4K6FA 1UAYA 4RORA 3CKYA 2D1YA 1QP8A 1IYZA 4XQCA 3D0OA 1KVRA 3KXDA 1O95A 2NSDA 4CQLB 3RD5A 2D0IA 4B4OA 1E3WB 5DBGA 2IZ0A 3A14A 4FDAA 5ILOA 3SVTA 4LCEA 6LDHA 1TT7A 3V5NA 2IODA 1FJHA 4ZVVA 3TQHA 2CVZA 3AI3A 3Q2KA 3ANMA 1Z82A 3PQDA 5KVVA 2FRDA 4OSOA 3GF4A 1WWKA 1NVGA 4M87A 4B79A 3DBLB 3D5QA 4D0RA 1ZUD1 2PWZA 4FGWA 2Z5LA 1YOVB 4TRMA 1ZJZA 2J5QA 1YB5A 5AVOA 1DO8A 1TI7A 4JNKA 5L3ZA 3WBFA 5EIOA 2DM6A 3JQAD 5LDHA 5BNFA 3HFSA 1M6HA 1YO6A 4XYMA 2TMDA 4WLOA 1NPTO 1GPJA 2HUNA 4FBGA 4NJOA 1WMAA 1RWBA 2FMUA 3NEPX 3COSA 1QSGA 3JYNA 1Y9EA 2RAFA 4XGIA 5T64A 1K6IA 1Z6ZA 5KJ1A 2I9PA 4XYGA 3RVDA 5I7EA 1TT5A 4W82A 4LK3A 3U5TA 1Y8RB 2G82A 4E12A 1I32A 1FK8A 4GBJA 4UULA 1G0OA 4RDIA 4UVDA 1W73A 1GCOA 4XQEA 3RASA 3DZIA 3MCVA 3ICCA 3PQEA 4CLOB 4ZQHA 1WZIA 5AXBA 1PQWA 1SNYA 3H5RA 1BWSA 1BMDA 4AL4A 1BW9B 2NUAA 4I9UA 4GX5A 1J49A 1TB4A 4J1QA 4GKVA 1YBMA 3BHJA 2E49A 2VUUA 4XZ3A 4ND1A 4TVBA 1J0XO 3LLSA 4J43A 3ZWVA 4EJMA 3PWKA 3ORFA 4YAGA 2JFHA 2PD6A 5CP8A 2ZB3A 1K5HA 3TN7A 2R00C 2NU9A 3KLMX 5AQ1A 4QQRA 1ENYA 1UXGA 3O8QB 4FFNA 3K5PA 2CD9A 3I9LA 5TF4A 3H65A 3F4BA 1Q2XA 4YR9A 4GKBA 2HSDA 1P3DA 2NWQA 3HB5X 2FR1A 3ZU5A 1ONPA 4IM7A 1DSSG 1H6AA 1K6JA 1WPQA 4E21A 4B8ZA 5BR7A 1DHTA 3DOCA 3G79A 2J8ZA 3Q1LA 4LRTB 2I5PO 1JVSA 1XLTA 2W2KB 1I0ZA 1ZH8A 1YONA 4IXWA 1XR3A 3U4HA 4ALNA 2V6GA 1V0JA 1NNUA 4YWJA 3M1LA 2RHRA 1I3NA 3O03A 2YYYA 3I5MA 1IUKA 2JKVA 5JMPA 1ISMA 4M54A 3C24A 5G2OA 4NJMA 2Y1OA 3QRWA 1C3VA 2FPIA 1KBZA 4DBZA 2PK3A 4RVDA 5G0TA 3TL3A 1D1SA 1U2GA 4WUVA 1E7QA 3U4CA 3PHIA 3HDJA 1WDLA 1GQYA 1HYHA 4HX5A 3FR7A 4J2HA 1EE9A 2GSDA 2JAPA 2G76A 3TOXA 3B1JA 3DMYA 5CEEA 2YUTA 4WOJA 4INAA 4I08A 2DBRA 4OHUA 5TSDA 1NFFA 4EZBA 1JLLA 4WGGA 2HKIA 4KTTE 4BNLA 2VOJA 1DPGA 1MFZA 1PGQA 1UZNA 2PFGA 1EVZA 1GYRA 3NT5A 4I5EA 4LW8A 2I3AA 2ZTLA 4HFJA 3K96A 4DYVA 1ZIDA 4YT8A 2BMAA 3DBHA 4FFMA 1Y5RA 4PG6A 5AYVA 4BNTA 4TRRA 2NV6A 1P45A 1Z45A 4TZKA 1P1HA 3JTMA 1B15A 1I36A 2YHUA 4ND4A 3JD2A 3WTCA 4RVHA 3Q0EA 3ZZNA 4G2NA 3WTBA 4DXHA 4KTVE 2Y66A 2C7GA 1OI7A 3D4OA 1F14A 1HRDA 3JQAB 2G17A 2JHFA 4GX1A 1EFLA 4GWGA 5A9TA 4CMHA 4IDBA 1LDGA 1KC1A 3NGXA 5DP1A 4UVEA 4BKUA 1FMCA 5DULA 4PG5A 2X0NA 4RDHA 2ZJ0A 3DONA 4J4TA 4XB2A 2UDPA 1X1TA 2FZWA 4BO1A 1BSVA 4CJXA 5KCZA 1Q0LA 1A7KA 1QG6A 1QLJA 2Y67A 3GGOA 3GRPA 1KEWA 4PLYA 3DZHA 4WPGA 4Z9FA 1Q7BA 3SXPA 1P1FA 3RSHA 1E5LA 4FCCA 5ICMA 2O2SA 2Y93A 4GMGA 1ZVMA 5EPOA 8LDHA 4HBGA 2AEJA 1LI4A 1PJ3A 4PZCA 3O26A 1B0AA 4I5GA 4BO7A 1ADGA 2ZTVA 2HMWA 2JFGA 5CEJA 2HMVA 3HADA 2NVUB 3JV7A 4CMAA 3PHGA 4KOAA 1ZSVA 1HF3A 1U1IA 4W99A 1NM5A 1ZO8A 3JD4A 2A94A 3V8BA 4HKTA 1DIAA 3BTSA 4ZQGA 5TNXA 3W6ZA 3VZPA 4YPOA 2GN8A 2LDBA 4YRAA 5JW6A 3DBVO 1YB4A 1W6UA 4UVHA 3OETA 4P22A 5HM8A 5KWEA 1UZLA 1U5CA 2DBVO 1IOLA 3IUSA 1PJCA 3FRJA 4RQUA 1BRMA 1UP7A 3HUDA 1GCUA 4ZHSA 4GX0A 3ZWAA 2JJYA 4URFA 4ZQFA 1QV7A 2SCUA 4R1NA 4WEOA 1HSZA 4B3JA 4FW8A 4CR7A 1RPNA 1DIGA 4BOYA 3ZWCA 1ORRA 1HXHA 3FNEA 3JQAA 1E0DA 1ZFNA 1IPEA 2Y0EA 1L1FA 3WYEA 1P33A 4FQ8A 4MPDA 2WTBA 2VHZA 5EQDA 2D4AA 4OGWA 4RLHA 4Q3DA 1N7HA 3GN1A 3R3SA 5EMHA 4NIMA 3IIEA 1KC3A 3EZYA 3LU1A 3EGOA 3FWNA 2CDCA 4MIOA 5B4TA 2EP5A 3ITKA 4PRLA 5F3RA 3PEFA 4GWKA 1HE4A 4H15A 4BV8A 1ZZEA 3GHYA 3ZWMA 1CETA 1DAOA 4IXTA 3CZRA 1CQJA 3NUGA 1VLLA 2O3JA 2NADA 5DN9A 4I9HA 3RBXA 1A7AA 3EC7A 1DIRA 1R4NB 5BSEA 3AU9A 4KMSA 1CERA 3N74A 1LC3A 3UW3A 2V6MA 1NYTA 5L4NA 2IYPA 1B7GO 4EDFA 4A5OA 4P8RA 2AQ8A 1HDCA 1UZMA 1AGNA 1C1DA 2O3SA 3E6AA 3M2TA 1H93A 4WE3A 1JWBB 4DIFA 1T2DA 3Q2IA 5IN5A 4DIOA 5JFOA 3KB6A 5DDIP 3TZCA 3ZV6A 2VCYA 3DB2A 3GC6A 1E6WA 1HE2A 4YJFA 5EJ2A 3ZHXA 5A9SB 1EK6A 4NU6A 4K1LA 3RKRA 4EUHA 3SLGA 3Q11A 4QFDA 2JCVA 4GQAA 4GAEA 1ARZA 1KY4A 3U09A 4LVUA 4IMPA 2GERA 2DTEA 3C7DB 3ADOA 2PZLA 3C1AA 4TRNA 1KERA 3WJAA 2J3JA 5K6AC 2O48X 3GEDA 5KJFA 5GZ1A 3D64A 4HADA 3BMNA 1JU9A 3WQRA 4BNVA 4IQGA 4W7IA 2VUSA 1P1JA 3U62A 2DAPA 3U9LA 5H82A 3VPFA 3G3EA 5KNLA 1H94A 1PU2A 2O7QA 1ENOA 2O3UA 3GFGA 4PLVA 1XA0A 3DAGA 4QTZA 1PWZA 1FDUA 2ZQYA 1N9GA 2GLXA 3LC2O 2AA3A 3TFOA 1XIVA 2PH5A 4CMIA 1YBVA 3DHNA 1JKFA 3EK2A 3LT1A 4M8SA 3FWZA 1MLDA 4RF5A 2VOEA 4XYEA 4B7UA 4DIBA 3DBLA 3PZBA 4Q9NA 2YJZA 2EJVA 2VT3A 5HRUA 2C82A 3U4IA 4MP8A 4TKMA 4CR6A 4EGFA 2E48A 2YQ4A 1HE3A 4BNJA 4CL3A 4D42A 3AW9A 2ZB7A 1VL8A 1CIVA 3A4VA 1AN9A 3CINA 3GDFA 3QWAA 5EERA 4PLTA 3KZVA 1HDXA 1LA2A 1T2FA 3K9QO 4Y98A 4Z3DA 3GY0A 2V7PA 1MC5A 5JS6A 1C14A 2HRBA 3WOHA 3ZU2A 3HHPA 1MX3A 2C29D 2Q2VA 2DTDA 2UVDA 3PYLA 3F6YA 3AFMA 4FC6A 3DL2A 2JHGA 3UH1A 4LVCA 3LT2A 4RVSA 4CM4A 1LXCA 3GZNA 3WLFA 3DAFA 5JAQA 4D44A 4PGFA 4CLEA 1DIHA 4NK5A 5H83A 4Y6SA 1NAIA 4RVGA 3GDGA 1N1EA 4IDDA 3PVZA 4B4WA 2NQ8A 1HLPA 4RF3A 5IN4A 3A28A 5FWNA 4AJEA 8ADHA 4YJHA 2DT5A 4M1QA 5H81A 1G6KA 3ZHZA 1NHWA 4O59O 2D59A 2EP7A 3H7AA 4E6PA 4DRYA 1Y7TA 1F06A 5A06A 1F8FA 2NQTA 4U8GA 1V35A 3E5MA 3S2GA 1LDBA 1O94A 3ROPA 3VH4A 4J1SA 3PLNA 1YBAA 3QY9A 3RFXA 3UOGA 3ON5A 4ALIA 1Y5MA 2X23A 4Z0HO 4CMEA 2IZ1A 3DAPA 5U1PA 1Q7CA 5L7YA 5DOVA 2Z95A 1VL6A 3BYZA 3VOSA 3PGJA 1YWGO 2I99A 3QW2A 3RC9A 4BB6A 4ZN6A 3AUSA 1ULSA 3ENNA 4RF2A 4MOWA 4RPJA 1KOLA 3RUEA 2A4KA 1ADBA 1OC4A 3TZHA 3V1UA 2D5AA 4Q39A 1DOHA 4CLRA 1C0IA 5KVCA 4YAEA 1HT0A 2PD4A 3S55A 2IEBA 4NG5A 2GZ2A 3DTYA 3KVOA 3O9ZA 5TRTA 3RU7A 2C7VA 4PVCA 2YDYA 4IBOA 3V1TC 3ZHYA 4J9VA 1QYXA 3F9IA 1H6CA 2NU6A 4AJIA 3BMOA 2BFMA 3ZWOA 2X9NA 5TIIA 1P31A 1O9BA 3VH1A 1I3LA 1V8BA 4BO5A 1EDOA 3OJFA 3LYLA 3ZWPA 1ML3A 4E0BA
chains in the Genus database with same CATH superfamily
2ZRCA 4KYIB 4M7WA 1Y3HA 4YP7A 3ILHA 4CFZA 4JSTA 2WU1A 3V80A 1SOVA 2FUCA 4NK4A 1JG2A 1UBFA 2XNJA 4EKYA 2I1QA 4JQYA 4CQMD 1FDRA 3L1HA 3JYLA 3K6SB 3QPBA 1F0PA 1ZI9A 1F9AA 3DKVA 4CDRA 2ZJ3A 3AZOA 1RYDA 3A4TA 1GEEA 2RAPA 1JT2A 1FFBA 4AN1A 3QVSA 2ZR0A 4PAMA 4DJTA 3QMPA 2ZIUB 4G0ZA 1Y9ZA 3P0IA 2DUWA 4K9LA 4D5EA 3ETDA 1O08A 2FEXA 1FVFA 5FQOA 4AWAA 4P58A 2FF7A 4MRMB 3WMWA 5JLAA 1FUUA 1G1AA 1M7BA 2AI1A 2DKFA 2JLCA 3IR5A 5NULA 1VMEA 3VA7A 4DV2B 1IZ7A 1U7XA 2H8GA 2Q7XA 4AJKA 1U1GA 4NPAA 5EG5A 1PGOA 2ZR8A 4ZU6X 1PWYE 4E11A 3WQBA 4RPIA 4YAKA 4TT3D 3UJ8A 3KYDB 2HRQA 1QRUA 4I3GA 1H42A 1N9ZA 3P0EA 4ZVSA 3U7EB 1SKUA 5CAEB 3T5TA 2RK6A 4PTZA 1AY0A 1U65A 1VJ5A 3CURA 3QWIA 4FZ5A 1R8QA 5C1DA 3ZD7A 1TQ6A 3N6RA 5F7OA 1KMMA 1PEKE 5BN5B 3GUHA 4MV4A 1JQBA 1MQSA 4NZNA 2YL2A 1QCCA 1HDGO 1XMPA 3AHEA 3LT4A 3EIFA 1WXWA 2X58A 1KO8A 1Z18A 4PZLA 2EF1A 3PYMA 3ZGYA 3BWDD 4KNWA 1OZGA 2G5GX 3HKBB 4N0DA 4S24A 3V9AA 2C2MA 4LNAA 1DDOA 3I4CA 1NC1A 1MEJA 4WKBA 1UM8A 4BNNA 4ZVTA 2B7CA 3CLKA 2ZWAA 3D3WB 4P4LA 5ALSA 5H80A 2ZVPX 5JCXA 3I01M 3IR7A 3I39X 1U3VA 2CLKB 3QZUA 4HAYA 4R9NA 3HRHA 2KLBA 2XGJA 3M4ZA 1H69A 2DPYA 3M6IA 4M86A 3ZBUA 1UBTS 1D03A 1SOWA 1UDCA 1HNNA 1DKQA 1WW8A 1ZK3A 3D8RA 4WBNF 5FT9A 1QGYA 1IE3A 2NO7A 1XYYA 2OECA 1OSNA 2ZUEA 1ZBQA 1MJ5A 2ZU6A 3L8GA 4L50A 3MN1A 2FH5B 4RY9A 1AKWA 2QN7A 1JAHA 2VQEB 1SZPA 4KIUA 4TMXA 3T99A 3DBOB 2NG1A 1E0AA 2PZJA 3ZHQA 1K9VF 2B5OA 2YYAA 3HCCA 3PL5A 4HATA 1FYWA 1CRQA 4P86A 3FTPA 4MIYA 5JQGA 2QAJA 1WZNA 2FP3A 2XZPA 4YGXB 5LB4A 1F2UA 2DHQA 3VU1A 4NBNA 4EG5A 1X9IA 3GP5A 1H2EA 4I4CA 3V4FA 4W7HA 4O1IA 4MUKA 1MVLA 3G0HA 4GR9A 4KQGA 4TWBA 3KQTA 4NYMR 3KR1A 1RWNA 2CNWD 2IYQA 3KAPA 5FUBA 4PX2A 2QSJA 3OFNA 2IEGA 5GM2A 4ZJUA 1J1ZA 1U9ZA 2G72A 4AY6A 2GCOA 4US1R 3LW7A 3JWGA 4YT2A 3CNHA 4MW4A 3IVGA 1JIQA 1WB5A 4NR0A 4ARSA 4E4YA 3KYBA 5A4JA 3GLVA 4EPVA 4RTSA 4K8OA 1OW3B 4NYJR 3P2IA 2FPGB 4G0QA 4URVR 1BEZA 5K4HA 1SKMA 3MINB 3SR4A 1AK9A 2W2KA 3IQXA 2HK9A 4H16A 5H0IA 1XN4A 1KEUA 3ENQA 4D5GA 1W4BA 1N5DA 4R68A 1L6RA 5E1DA 3D8NA 1QMGA 4NDNE 2BUAA 1CJKC 5A3SA 5JAHA 1XI2A 3JD1A 3TIVA 5K0SA 4QM6A 3UT5A 2WT9A 3OO0A 1UFVA 1VG1A 2G6TA 4XUDA 1Z37A 1ZI8A 2Z2KA 4FKZA 4L9AA 1XJ5A 1YTLA 1G59A 3RVQA 1XRJA 4YCDA 3HKEB 1STOA 1VHTA 4ZAGA 3UUFA 4YYEA 2UAGA 3FMPB 3CA8A 2FN7A 2MT9A 1V48A 4RMNA 4CM4B 4X20A 3F98A 4TKVA 5JSFA 1H3EA 3QBDA 4BTLA 1R0SA 2GCOB 1MQ9A 3HN2A 1J7JA 1IH8A 2NUTB 4C7OA 5JR3A 1KEEB 2BW0A 3PX3A 2O3TA 2RKBA 5D00A 5DXJA 4EJ0A 1UKZA 4TXHA 3K1AB 3AR3A 3BDAA 5JNVA 3ZUPA 3BL8A 4K8RB 4P34A 4RKQA 3GJQA 4G8CA 1VJGA 4X6YA 3QSYA 1WBJB 2M1XA 1BVYF 1FNDA 1XX6A 3CKKA 4IGFA 4J0JA 1LRKA 1RDFA 1YC2A 1UXJA 3DLTA 2P8SA 2I2FA 4HMOA 1N78A 4G5XA 3DTTA 4PYKA 4EGJA 1I01A 3H2HA 5AK3A 4CGZA 2Q7DA 2PYZA 2IOFK 3OQ1A 4U7FA 1FP6A 2Q99A 1NX6A 2O6HA 1UM9B 2J9ZB 2WUGA 3BGSA 5D5PA 4YUYA 2DLCX 3C7CB 3IH5A 2ZAYA 4MRSA 3IQZA 3SWWA 1U7DA 4MRMA 3SYKA 5FI5A 5F7XA 1XF1A 1SBHA 2CHVA 2G83A 4BNKA 4HAZA 1M1XB 2P11A 5I5EA 1FP1D 2PL3A 3HSKA 4KN6A 4F04A 5BSFA 3P97A 4MUBA 2PX2A 1C50A 3GVIA 2PKYX 2PX8A 3W5SA 3IEVA 2QD2A 2VCHA 5J4KA 5IKXA 5CA0F 4MMYB 4JLOA 3VR2A 4OLHA 1VJ0A 4E5KA 3UZUA 3ND6A 2XYGA 1K27A 1YDHA 5CYFA 2FSPA 2PTHA 3L8FA 2YQ5A 2EWWA 1XFAA 3D8SA 4IO0A 1WSAA 1GNRA 2J3KA 2VJLA 4OH1A 3BQ9A 3T06B 1PTJC 4BB5A 3ZDEA 4AWXA 1CX9B 1Q1QA 5L45A 5C53B 2DLDA 2QIOA 2HT6A 2ISSD 1C80A 2B8EA 3LQYA 3N2YA 4RWEA 4S35A 3UVEA 2CW5A 1DQZA 2YZKA 3AERB 1T9BA 4HDAA 4JMPA 4WINA 3W4JA 5F7JA 4C29A 5CDTA 2XZTA 3RHZA 3G1TA 4MINA 3A6GA 1DRUA 5L40A 2XUQA 3HYCA 2KSQA 1G6Q1 3NJ4A 3OLYA 1VM6A 2DH6A 5FA5A 1B6SA 1R0KA 1XAJA 5B3KA 4ZCIA 2NYVA 2ST1A 3L0IB 1NN1A 3U39A 4H1WA 3ZVNA 4UVGA 4L78A 1F2DA 1U94A 3CLSD 4PC1A 5E4JA 3AINA 5AHKA 1AHNA 2AG8A 1XPUA 3BIJA 3L77A 1GIAA 1ZXBA 2O4UX 1REQB 3DVRX 2W6IA 2Z2JA 3G13A 3LDFA 4MI3A 5HE9A 2CLFB 2JCSA 4CDMA 3S1AB 4B3MB 4MVJM 1T6ZA 2X2OA 2X5XA 4M8LA 4PG4A 1RPZA 3VMFA 3D6FA 1DEAA 3TSOA 3VU9A 3QOYA 1XTZA 1HKHA 2FMFA 4UM5A 3AUUA 3RYFB 3SYTA 2PUBA 4UHFA 1ODFA 4UNPA 3SIXA 1M7HA 1QOPB 2WPDA 3LX4A 2V9ZA 4GYYA 4INZA 2ZJ4A 3JYPA 3KHTA 1Z2DA 5DBHX 1Z39A 2HA0A 3VSBA 4HLUA 1OV4A 2Q6OA 4N01A 4OGLA 5E7JA 3Q3GE 5CITA 3P0JA 3ND5A 3DNFA 1NC3A 2Y1WA 1OX4A 2QLNA 3MCWA 3QWFA 4HRAA 1QAMA 3TLKA 1DCTA 1EQUA 5DBFA 1U0JA 3CGWA 4A5SA 1KQ3A 421PA 3FPSA 4WLNA 2WTUA 3RBZA 4BQFA 5FB3A 7MDHA 2VNHA 1JJFA 1Y6FA 5J43A 4TV8A 5KIAA 3NH9A 1I2ZA 2I1VB 1V8DA 3CHYA 4YAUA 3KRTA 1IQPA 4NFHA 5JUWA 4F3TA 4E13A 3SQOA 2JAHA 2EKQA 2RARA 1LZLA 3HKDA 1NLZA 2X5JO 2BD0A 4CDGA 2W2LA 2BFEB 1VDMA 4XWAA 1AKEA 5MGBA 4J0KA 4RVUA 4FTWA 3RYHB 3U4HA 4YMVA 2YV3A 3L4KA 5KQPA 1ZU5A 3I9MA 5SY4A 3T7DA 1Q1BA 3F5FA 4NH4A 1N2OA 3A0RB 4J07A 4IKPA 3H4TA 5JASA 3DOHA 4PLGA 4C4OA 3IKJA 4JLBA 5FD8A 4BRUA 2I7CA 2O8NA 1K75A 3E18A 2D2FA 2XUAA 3C74A 4HO1X 2KS6A 4MIEA 1CF2O 4MK4A 2XHEA 5ERYA 2ECOA 2WWTA 3FMFA 4P4SB 2WFLA 3NBAA 1AF7A 1TIPA 2CUNA 5JE8A 1GNQA 1ZDMA 2R84A 1D6JA 3MTGA 4HF7A 1IEQA 2CWDA 3H3XA 4DCUA 2BFOA 1ABBA 1GEGA 3G02A 1RKBA 1OFHA 1V2HE 2NM0A 3UK7A 3E9DA 3NHBA 2TYSB 4XWYA 1Y4UA 3DAYA 3GXBA 1TCBA 3LLMA 3DVQX 4JXJA 1FDOA 3MYYA 1PO7A 2GPJA 2CJWA 3RC7A 3TLJA 1LNQA 1IJKA 2Q6TA 3WL8A 2E1RA 4EKDA 1MZPA 3KHSA 5FYQA 1DC5A 1T8SA 3CZMA 2OE2A 3DMNA 2V1UA 4UEOA 2G5TA 1IY2A 3DB1A 1WXQA 4TT3A 4O4HB 4U0KA 3UWMA 4NCHA 4Z7OB 1VL0A 2VS1A 2ZUWA 3P45A 1Q7RA 1R9JA 3CW8X 4K6HA 4IS3A 1OFUA 4UE2A 3DUFB 3QTLA 3TXXA 1MA0A 4JBIA 3U7IA 4F5YA 4M60A 3EPKA 1ESDA 2YY7A 4BZZA 1GUAA 4GOMD 1QE3A 2X5KO 2A1IA 5LUBA 2JFWA 3NB0A 1NATA 3ZDZB 2ZM6B 2VNIA 3ISTA 3D0QA 1ZVQA 2IUFA 2BFAA 1JYSA 4XVRA 4NABA 3UXMA 1FQKA 3BZBA 4OFXA 2I4MA 4IH9A 1KJQA 3HCOA 4MWSA 2EJTA 3CKMA 4CFYA 3NETA 2VJCA 3N70A 2NTVA 5JNTA 4GF5A 3Q3IA 1NN0A 4J2TA 4BWYA 3RAJA 5BRAA 5DGXA 1PR5A 1T0HB 2LR0A 4BBPA 4CDNA 5C46F 1NM5C 5JEEA 4H7JA 2HJRA 4HQ0A 4C4PA 4G97A 3FSJX 3PUJA 4N5LA 3ZJUA 1DZIA 1T26A 1NW9B 2QX7A 3D5TA 3PJEA 4NV0A 1X9HA 4YX9A 5A4FS 3R0ZA 4OIMA 2E4XA 2IHZA 2Q3FA 4GM4A 5HBRA 2C61A 1I4WA 2W0SA 3T4UA 2H1HA 3FPGA 2RJNA 4OJQA 1XEFA 4XWWA 2XCQA 3TXAA 1TZJA 3MFQA 4OHFA 4QDTA 3EDCA 1UP6A 1XWWA 1OI2A 5IHPA 1M2FA 1H1DA 2R9VA 1NASA 4KL8S 3L1IA 5JDCC 3TRHA 3K0CA 4G67A 4OXNA 4R9SA 1IAVA 4YJFB 3UFXA 3VDQA 2X2PA 3A26A 4NI5A 5D3KA 1ST2A 4J9UE 2PO7A 3WL7A 2ZSFA 3W9SA 2B35A 1R9NA 4G1VA 4L51A 3AFHA 4AUKA 3PTAA 1JPNA 4GYJA 2RH4A 2QN8A 2WWFA 4KQFA 3SYRA 1XNRB 3IT0A 1CY7A 1UZAA 3G0IA 2JJ2D 1Q16A 1YB1A 3ZDCA 1B6RA 2QUIA 1ZOOA 2X1LA 3GJSA 2AE1A 2C20A 3OZAA 4EX6A 1JIKA 1HETA 5F5XA 4MGYR 1CUBA 4UXJA 2MYNA 1QXSA 4S1OA 4JLSA 4TXLA 3NIBA 4V0LA 1FFWA 1SCUA 4V0SA 4Q1EA 5CA1B 3IBGA 2J7KA 2R8RA 1FFXA 1GPKA 1NZJA 4X84A 2ZYGA 3A6PC 1JE1A 2YJ4A 3EZ2A 4HH3C 1LQ2A 3EUFA 5AT1A 3SNHA 4ZVKA 5GP1A 4FOPA 4UTOA 5F2NA 3NEAA 1FPMA 1TF5A 2AT1A 2A1UA 3DF7A 1GUZA 2EW8A 2ISQA 1MEOA 1E64A 5JYDA 5JD6A 3TE6A 5HYVA 4L2IB 4NENB 4J3NA 3VR6D 5FBVB 5LCXA 4X65B 5FPHA 1BGWA 4Z49A 4EPYA 2ZANA 5TGDA 3L8ZA 4XPIB 5GZ3A 4L73A 2H1WA 3C6YA 1M1YB 3H5AA 1M75A 3N6XA 5FL7A 2PG3A 2AB0A 5HIIA 2PRYA 1NSYA 2WKQA 1U0GA 1QR2A 4BDSA 1I0IA 1HO3A 4PM4A 1G1MA 1OV6A 5F3DA 5ULLA 3TQOA 2X3UA 5KB3A 5MN5A 1VE3A 3E3LA 1L4YA 2IW1A 3PGVA 4EPXA 4BNWA 4WY8A 3C1OA 3ZWWA 3K8ZA 2Z5VA 5CM2Z 3DKPA 2COKA 4G07A 4EH1A 4LF6B 1ESZA 3D6MA 4XQ9A 1UC5B 3CR3C 2DHEA 4LTMA 4YFVA 3VR0A 2I7DA 2B25A 2P41A 3H2SA 5EJAA 5IVDA 3VHQA 4FHDA 3UMBA 4NV3A 3LCVB 4C04A 4DCMA 3ID6C 3ZIAD 3FNHA 1F8GA 1LRLA 1II0A 3HXPA 3C15C 4HZIA 4NMXB 4CE6A 2ODEA 3K9LA 2QTRA 3QMVA 5LA6B 3CH7A 4YRSA 4DVJA 2O2JA 3G9ZA 3WVNA 5FUMA 5LMUB 4F2HA 2C59A 4KJZA 2JIBA 2R5NA 3PUIA 1A7UA 2OG2A 3Q9NA 2P2LA 5CLLA 4PRZA 1IBKB 1C2TA 2GN2A 4UNNA 4EHDA 4W5QA 2VSQA 3ICVA 1QYWA 3MMSA 1NPYA 3MPUA 3JZIA 4PBRA 4B32A 1SBYA 2R66A 5T4HA 3R7AA 3WLPA 2WTMA 5TDHA 4G5HA 1A4XA 3QX7A 1PL8A 1J20A 2PT5A 2DQ4A 2N42A 3QXCA 3IT2A 3WGQA 6REQA 4CMJA 2VTBB 4YK7A 1ZJ4A 3EY4A 5B1DA 1M73E 5JG7A 1G7CA 1W36D 1TK9A 4CLDA 2R1VB 3EIEA 1GN8A 3EULA 5GOZA 4RJTA 1N9GB 3QNUA 1EEHA 5L3SB 1QQAA 1E7MA 4YRMA 1XZQA 1QIDA 3CU5A 1WMBA 4FFLA 1IHYA 2V6BA 5DBIA 4AIIA 4URXR 4K9RA 3UTDA 1YZHA 1CY0A 1PEYA 3H1AA 3WZLA 4RQBA 1CQIA 3THYA 4IIYA 2WWVD 1YTUA 1NKTA 1QX3A 1RI1A 4KHZA 4WFQA 3S5JA 1YJ5A 3P52A 1J99A 2F9FA 2P4QA 3FCXA 3QLEA 2CKMA 4KJXA 4MI1A 2H85A 5G4KA 4U9UA 1NGSA 3IEPA 1IU9A 1MW9X 4KVGA 3ELYA 4OP1A 4QU5A 4XOIA 5LWHA 4G1BA 2NLOA 1QKJA 1GY8A 4K6KA 2OBYA 3THSA 4F6CA 5BSGA 1E98A 3EEFA 1SVKA 3DM5A 5LBTA 4D3DA 2OPBA 5K0LA 3Q4GA 3VKGA 2PAAA 4YJDA 1VCMA 1M72A 4RCVA 5JVDB 2ZWOA 5AVSA 4I1YA 2J7PD 2RBGA 1M2OA 2XE8A 1G9TA 2XMDA 4WNYA 5KNBA 3G7NA 5JNWA 3F6PA 4XD7A 2BSQA 1EUCB 4RKWA 3HLYA 2ZYTX 2ID8A 1AKVA 4WOPA 3FSRA 1Q1GA 2W98A 3JZFA 2JFVA 3E9QA 4YRJA 2A9QA 3R74A 4QBKA 4DLYA 5T4BA 5FNVF 3GQBA 3PK0A 1RQGA 1EVEA 4YAOA 1VSQA 5CT9A 4CUZA 4DIEA 5A5VA 3CEAA 3K73O 4UQPA 5EI5A 5C5CA 1WO8A 3KZCA 2JANA 3GPDG 2I78A 4C30A 3A31A 4JYCA 2ZWMA 1Z6AA 2F9MA 2GAOA 3D8UA 4F0JA 3LECA 4ENTA 5HJ5A 3U3DA 3M6FA 1RPTA 1FYXA 1LBIA 3IMFA 4J0HA 2NUTA 4CL8A 4JN6B 3GLFB 4WKNA 3BSWA 3KP1A 2NPOA 2QMHA 2B0CA 4QDZA 5LQDA 2J3HA 3N2EA 1HA3A 4IJKA 2JCXA 4GPAA 4DGSA 4WEQA 2PSSA 1MO2A 3MUOA 4WXHA 4EK9A 3VZSA 3ZY5A 3DTNA 2JFPA 3QU4A 2WNSA 3PQFA 4FNAA 4M83A 2RGNA 3JQ7B 1EFVB 4COKA 4WZAA 1PG5A 4Y8VA 1RXVA 1UWKA 2QJRA 1MJNA 2JFBA 2ZJFA 4MUEA 5BW4A 4RL6A 4F4CA 2PMFA 1LK7A 1YQWA 4IDOA 4MO9A 5FOQA 2J67A 1Y4AE 2X6RA 1T3ZA 2FPWA 4NX2A 3JVUA 4HNRA 4RTRA 5KYVA 1YR3A 4UQOA 5IFLA 2VBIA 5FP0A 3DZFA 3K3PA 1VKRA 3GP8A 1RAIA 4DB4A 2VT6A 4NOMA 4BZWA 1PR6A 3AI1A 1BYIA 1CUVA 4XEHA 1SHLA 2ALJA 2WTNA 1YUNA 3ITNA 5ALNA 5GIPE 3HKCB 2WG2A 4KWIA 1R6DA 2NXJA 4M8NE 2P2ZA 2FR8C 4MQ6A 2QG4A 4TV8B 4YT4A 2ZI3A 3INTA 2XLCA 2IHJA 3PP8A 3WGUA 1J9ZA 3ZDDA 2H5JA 2IUSA 1WBBA 5A0TA 1FXSA 1OKKA 1JKXA 3U1TA 1TGYA 2ZVQX 5DI9A 1YU6A 4AVYA 4GE3A 3M7IA 4G5RA 1C1XA 1NT2A 1R4NA 2DYKA 5JW6A 3F5QA 1R2QA 3N0VA 4IRUB 4ZRDA 4ZA2A 2FPLA 4JIGA 4UTNA 1M67A 2PJUA 3K2EA 1H0RA 5CNIA 1NW6A 3CBGA 2AN9A 5A6SB 1D1TA 2POQX 3C85A 1E9AA 3TGWA 1OZFA 2HJSA 3HVUA 5KDLA 4NBSA 1T4DA 5TF0A 5F77A 3TLXA 1EZ4A 3ORRA 3VPCA 4C7MA 3GFVA 2GTIA 2RDMA 1KJJA 2VTKA 3RR2A 1RE0A 4KGDA 5I5GA 5C5EA 2IU0A 5KMGA 4RVOA 4J8PA 3D7NA 3DEJA 4AJ4A 4YYZA 4IIJA 4NCIA 1EHIA 3OF2A 4LS3A 3ZU6A 2FSVA 3UUWA 2GESA 4BN0A 3O91A 5D3MB 1I4EB 4L4YA 4K26A 4OJMX 2BP7A 5TARA 4RPCA 2F4NA 2Q9AA 2HDOA 4FK8A 1RTKA 3OQJA 1EYZA 1Z8HA 4V0KA 4KX3A 2A78A 4HFMA 2VQ6A 4G09A 3AR5A 3RT7A 2AIRA 4G0UA 3PPYA 5K5EA 4L3VA 2WMDA 5KHOC 1UBJS 3OCVA 4QRDA 5C1IA 1PNVA 2Q5OA 4YI3A 2GN1A 2REBA 3NKFA 1A50B 4RSGA 4DM4A 2QPOA 1DWQA 1DGQA 3LWDA 4RE5A 5BSMA 3VAAA 3RO7A 4V0OA 2QPAA 3KAQA 1URPA 1U7TA 4KXMA 2JA1A 4DMFA 2VEDA 1NBWB 3QKSB 2EEZA 1KP2A 1VMKA 5KSWB 2Y27A 2WP8J 4RGVA 2PR7A 3LCUA 4KPUA 4AICA 4JBGA 5HFAA 4CN9A 5TMPA 1KETA 1NI4A 4FGUA 2I8CA 1Q83A 5ICGA 2H5LA 2X40A 3TNLA 1YH3A 2G4LA 3Q2OA 1SBCA 3ZHOA 2WAXA 3AF1A 4E2ZA 1DX9A 1FFDA 4W9NA 5CRIA 1D6MA 4AG6A 4PG7A 4LJ5A 3VR5D 1RQ2A 4YRBA 2DB3A 5I9IA 1NP7A 3MXOA 2W37A 2OXEA 2GZRA 4ZEOA 1E6MA 4LGYA 2R5WA 4P33A 5TS3A 2W2PA 4JL8A 5ETJA 1MENA 2NT4A 1ZCBA 4LC1A 3RVNA 3U37A 5ESDA 3ETCA 3ZZUA 1HT3A 2PUTA 2PZBA 3KL4A 1XTUA 4PXSA 5COAA 5DCUA 4BMXA 1UEJA 1ADFA 1B1AA 1ND6A 2G9RA 3I9V1 1FZTA 3UA3A 2MMCA 1KGDA 1WXIA 1G41A 2B37A 2V7XA 4RNDB 4RYDA 5LMNB 1TZBA 4NEQA 3B1YA 1PKXA 3B53X 1OLOA 1IZ0A 3VAYA 4FWIB 1E7WA 1EGAA 1YDWA 3KQYA 4OHOA 4P3PA 4XSVA 1XCOA 4JLKA 4D41A 2W4MA 5AHXA 4TXJA 3ETGA 5IAEA 3G49A 3D6TB 3LDGA 3T3DA 3K9GA 4WVFA 4AROA 2YOGA 1NJGA 4BFVA 5EJ8A 1XDBA 2BLNA 2G8NA 1EWRA 2PMDA 4J2OA 3LLVA 4Y2SA 3UJDA 4C7OB 1R0CA 5IT0A 3JVVA 4D9MA 3FPKA 2C03A 4AO7A 3V4RA 2D8AA 1KDPA 1BWPA 3Q3HA 2C1XA 2YV4A 3G0OA 3BFKA 4DSUA 4MYCA 1SBNE 4NAHA 1LD3A 2CEKA 5CYOA 4QBIA 1LQUA 2B92A 3RH0A 2Z2YA 5A7HA 4YLEA 1YRHA 1UAGA 1BH6A 1V7CA 1A9RA 4B2PA 1B3RA 1PSZA 3Q3JB 3KOZA 4RTLA 4YJ2A 1PJRA 1E1RA 2MYPA 2Y1XA 4HAOA 1YQDA 3A70A 4XX0A 5A3RA 3GLKA 1CRZA 2E2WA 2QUHA 2VL7A 3ZNPA 4E2YA 1NJ8A 3JQ7A 2EW2A 1S01A 3EGXA 2X1HA 5DGIA 4AG3A 1FDWA 1W93A 2H54A 2R65A 2HWKA 1IOZA 4IX1A 1JPUA 4MB6A 2AF4C 4UTPA 1TU4A 2GPBA 4RSMA 1U1EA 1TLLA 3HYLA 3N8NA 5GAJA 2XZLA 1GPBA 3ISVA 4J7AA 3SU8A 3S7ZA 3OC6A 4E15A 4YAIA 4Q3AA 4LECA 5E6RB 2WABA 4TTPA 4P5DA 1XNJA 2NO4A 3D4PA 2DPGA 3CG0A 3NPMA 3KU1A 3F5MA 2GNPA 1CUCA 2W6MA 3FYUC 2XOKD 1YA8A 3UB2A 1VHWA 4MV7A 4ZYVA 3H9UA 1QHSA 3QWBA 4M9XA 5IPFA 2EAUA 2IYOA 2VEOA 4EZBA 3E5NA 2W7TA 4FR0A 4C08A 5WRFA 5CDSA 1JDNA 2WIGA 1KI2A 3UENA 2CV2A 3DHYA 1V6CA 2CLCX 4MEAA 2R96A 1OWOA 1L8XA 4IDCA 1JRLA 2GF9A 3FTEA 1MHPA 5IG2A 1G5QA 2P77A 2ETXA 3HWX1 1NI5A 2CL6X 3GVPA 4RKEA 5HM6A 4M89A 3CUVA 2Y6VA 2FOIA 1R00A 5HR5A 4HWPA 4WKCA 1LBEA 1S3FA 1EXDA 4EENA 3UG7A 1UCFA 2WVGA 4JUDX 3OZRA 1Q92A 1RM5A 1SUAA 2BRUC 2GN9A 3I45A 4LGCA 3DR5A 4ENUA 2V6FA 1G291 1X7HA 3D7MA 1BXRA 3L7OA 4H18A 5JH7F 2L42A 1EGMB 4EO4A 4XX0B 4PANA 4DDWA 3W1EA 1C5KA 1KR2A 2ATIA 2PA0A 1AM4D 1NR7A 1BTOA 4LXHA 4QDOA 2FVYA 1TT5B 3G9TA 2WINI 3UATA 4AX8A 2AOWA 4C3ZA 4F1KA 1N36B 1OZHA 4X3PA 4EKEA 5DM70 3UMGA 2D00A 2DT8A 2HF2A 4YREA 4TYYA 4NE2A 4D9CA 1J06A 4RZ2A 1U0TA 3SKVA 1SQ0A 1DJQA 2I6TA 5ALHA 4BMOB 4H7EA 1NJ6A 1MIHA 2HU8A 2HBQA 3UV3A 4JBHA 2J3DA 5CT5A 3VVCA 4MDYA 4JY7A 3CF4G 3K92A 3AYZB 1PW7A 4RZUA 1UINA 1BE0A 2VRNA 2WJVA 5L3SA 2WF9A 5KYTA 4KAXA 3QFFA 2YFHA 2C7BA 4C0BA 1FU7A 1MDFA 3I64A 2AZMA 4P7BA 1IY9A 5AJVB 1WDWB 1BFKA 3M9WA 3PIRA 2WV9A 3MTEA 2B1IA 1GPLA 2PBLA 3JQGB 2J3EA 3BSYA 4HP8A 5KOIA 5JC8A 1JHPA 1NBMA 2QWXA 1ODIA 3FB1A 5U9CA 2CF5A 1TCUA 2BR4A 2R1TB 3H86A 4Q00A 2JCGA 2DH5A 3VJKA 4D02A 4F2WA 4IF4A 1NJ2A 3LC7O 4C06A 2BCGY 5KSPA 1FXWF 3WGYA 4RIHA 2HA3A 4OUDB 3IT3A 4ERNA 5LUAA 2DBZA 3E9ZA 4WXRA 3BQMB 1MG5A 1TA4A 2PWBA 4MS1B 4OFBA 3SMQA 3FGPA 3HCPA 1HNXB 2O2CA 4C3UA 1Q3KA 2ANCA 3BMCA 2AEMA 3RRYA 3T3EA 3V6LA 3BJMA 4S2UA 2WSSA 2LP4Y 2L19A 2INGX 1XZNA 4INJA 5COQA 5GONA 1Q15A 1QZ3A 2O3RA 3RWMB 4CYMA 4EI8A 2V7UA 4BO4A 4M49A 1ZH4A 4BNDB 5FOTA 3T7CA 2BI4A 2Z6VA 3O95A 4Q47A 3TUJC 4LTNA 2JA2A 5FOWA 3CT4A 5ITWA 1A8PA 2V7BA 4UUPA 2Y0BA 4U2KA 4UDOA 4YRTA 2QYHA 4XWTA 4XDYA 2FZEA 2C2GA 2VI5A 2EFHB 1GAJA 3BOSA 1KPIA 3DYVA 3KSZO 3IUPA 1YRAA 4DR2B 1DPFA 1E2KA 3DO6A 3E4DA 2HWUA 5AM4A 3Q5GA 3CE9A 1MT0A 1WXHA 2GHRA 2HCTA 5EIHA 3PB3A 1KSFX 1WIWA 4OREX 3RRBA 4IAOA 3RTGA 2Q0QA 2CVPA 1ABFA 1Y6ZA 1A69A 5CTAA 4PCUA 5JSQA 1BDBA 1O8BA 5D3QA 4ITVA 4Z99A 1ZICA 2R86A 3KHUA 1EMDA 2XAAA 4AWBA 3IUEA 4HWSA 1CHNA 3CF2A 3HZZA 5KVSA 1Z0DA 3KFVA 4LMPA 2IIBA 1YL6A 2DECA 3RWBA 4PN7A 4XFJA 2HWYA 1DXYA 1KMHA 5KVQA 1X80B 4ETWA 4LCBA 4G0OA 3TL2A 4CLRB 4CFSA 1CZRA 1F20A 3LJKA 1WMSA 1ECCA 2O8DB 1QVVA 4D6PA 2QPLA 3GN2A 2IEAA 3JQFC 1DFHA 1M5UA 2JHAA 3D0KA 4J16A 2G7ZA 4KWEA 4Y2QA 2AMFA 3V7YA 5B4UA 3GJYA 1RYMA 3KYCA 3KQHA 4RY8A 1PL6A 1K2WA 1QGAA 3GNLA 3T5GA 4UBKA 1XLTC 1LGYA 3S2SA 4JLUA 4EM6A 1NW4A 4CU5A 4HN2A 3QHAA 3L1UA 1O0SA 5AVYA 3HB4X 2B7LA 1IIBA 4AJJA 1U8FO 3EAFA 3ZK9A 2HQ1A 5JAZA 3A9RA 4YRCA 1NYRA 5GJWC 1MQAA 3IDOA 2AEEA 5AJXA 3R5SA 4KI0A 1T0UA 2GOYA 9ATCA 2B8WA 3I5UA 4EG1A 3G88A 3EODA 5IKEA 2C2YA 2GWRA 5AP9A 4ZFNA 5ALYA 1RZVA 2OHOA 4EELA 1IMOA 1CUJA 2PZMA 1BEEA 5AKJA 2RJOA 1WHSB 1TVEA 1V5WA 4DDVA 3OLWA 1DC3A 5FH9A 5J1SB 1OLXB 1Y6QA 2I4RA 3SF8B 3RFVA 4WHMA 4P08A 1BEUB 4CCYB 5BSHA 3JWHA 5CLGA 4MQFB 4DTIA 1G8GA 3CB4A 4DMKA 4HZUB 1GGVA 1G8FA 2Y68A 3KQWA 1PLLA 3AY7A 2Q2WA 1OA0A 4O4LF 1O6BA 4IMIB 1H9AA 1NBOA 1DG1G 1P0QA 1PR9A 1XKLA 2ZTSA 4GVXA 4L4ZA 4BGIA 4ER3A 1UBEA 4TROA 2QSUA 4EI2A 2CCGA 1C30A 1E7RA 1WD7A 3HLTA 3IOBA 4WK0B 1E3QA 2PS3A 2WYWA 3VFDA 5CCBA 2PNFA 2BEVA 2FQQA 2NP6A 4JJ7A 1GZHB 1NQOA 5ARBA 3KKLA 2JCYA 5ANRB 3RQSA 4RKYA 2JDIA 4HLQB 3BWBA 1LZKA 3PGXA 4QG7A 4EABA 2D7JA 3A58B 3NDIA 3OP1A 4MVWA 4OHKA 1A7JA 5EJ4A 3CISA 2A92A 3CNBA 5FPPA 5B7GA 3S1SA 2BBSA 2BJWA 2OFFA 3BF8A 3KVVA 4Z3KA 5EZ6B 3G17A 1FJ2A 4E3WA 1GQOA 5B3AA 4DE5A 4RFVA 2OWEA 4I50B 4OB7A 4C2BA 2R7MA 4C6TA 3HGMA 4DV6B 1U8TA 1WDKA 4H7HA 3BTVA 2DHDA 1KPHA 1XQ1A 4QNNA 4Y67A 3OECA 3WGTA 2QJOA 3CTMA 3D81A 4IJVA 5D1HA 1TQ8A 1XDGA 3ACDA 3EXEB 3ZD6A 2O23A 2R1TA 4QYIB 1DAFA 4HOYA 5J2TF 2EFDB 4DWJA 2GO7A 4HH1A 3VU0A 2WQ6A 3JWPA 4AMGA 5C9ZA 1BD3A 3KZXA 4B3XA 1E6CA 1RT9A 2YJNA 4QXMA 1F1BA 3WAJA 4G1CA 1NVDA 2ZULA 2LD4A 3WGMA 5DHSA 1GOTA 5J2TA 4RNCA 1MG0A 3V8QA 5KNDH 2IYWA 4H35A 4J0GA 1C7ZA 4WXMA 1TAHA 2IEZA 3C8MA 5AM5A 4D3XA 5G4KB 1XVIA 4CM7A 3CEMA 2GJ8A 4ZJPA 4H4DA 2VDOB 4KXQA 4OYLA 3IP9A 3VJRA 2GK7A 3A6DA 4DGQA 521PA 1MAAA 3N1UA 5LJLA 1Z07A 1ZW6A 2B2CA 2OZLA 3RVPA 1V1MB 1W25A 3OJEA 3FJ1A 3PUKA 4AX4A 4NPCA 5EFZA 5HS6A 3AT1A 2ZIZA 3TMYA 3DOIA 3KEGA 3MJSA 4LXYA 3GFRA 1QP7A 1I24A 4AZVA 3K70C 4KBFA 4UHDA 3EQ9A 3SC3A 4YUAA 1VKHA 4MRPA 2DUUA 4HQFA 2CDBA 4FU0A 2FSSA 4IIDA 3WWYA 4TTQA 2JLYA 4KMOA 2VAPA 4HC4A 5C80A 3CUEF 2UYQA 3MJFA 1B14A 5A9RA 3LYHA 3OCXA 5TGTA 1DO0A 2WWIA 2EJUA 3OOYA 3LKZA 4JP8A 4ZVRA 4II2A 5I9BA 2YX1A 4PVDA 3DV0A 4JP1A 4EYKA 5A62A 2QI9C 4ER7A 5CNJA 4CWAA 3I73A 1ZESA 2MHCA 4EBBA 5DYTA 1ODTC 3KJZA 5LKAA 2AW5A 2XPCA 1T2UA 1KYZA 3E81A 3LHIA 1PR2A 3U44A 1U7UA 1Q7EA 5LA6A 2YIMA 3L1JA 4TPKA 4D46A 4KYVA 2RG1A 2C8KA 1KHHA 1GHTA 1PZHA 1UFRA 3CONA 3T3PB 1SXIA 4YO7A 4QFMA 4B4UA 2CGEA 2NN3C 2ZXEA 1EVIA 2Q1WA 3BIWA 1PZEA 2MMGA 3FKSA 2JAWA 4UTXA 3FMVA 2WYOA 4PCVA 3GEMA 3KWJA 3R6TA 2AQHA 4L8FA 4ND6A 3GCDA 3WKDA 2MSEB 2JI8A 1D6NA 2XLBA 3AL3A 3ASYA 3MGGA 3QA9A 4PLHA 3RWOA 3T52A 4KO1S 2JLVA 1RRPA 5ICEA 1Y5NA 4B6OA 1R0XA 3COWA 2NVBA 4KV7A 3FTNA 5GGXA 4WVLA 2Z9BA 5FWYB 4M2LA 5CB6A 3ROFA 2UU9B 2D5CA 4BQPA 1B0UA 2GZ3A 4LOKA 1HPLA 2FEMA 2B3DA 2NYAA 3B6ZA 3GJRA 2FX5A 1EDBA 4M88A 4WNCA 5C4MA 1Z7YA 1SEVA 4PGMA 2WE8A 2DY1A 3GRFA 3KR0A 1D2CA 4O3MA 4QFBA 1XZDA 3D1LA 2A9RA 3BE5A 4A0RA 5ILGA 1VZ2A 4BKRA 5BV1A 4XFDA 5H16A 4GPBA 4BMCA 2GDZA 1C7EA 3PCXA 4MQUA 1JA9A 3PIIA 3VYTB 1N4DA 1A5SB 1R7RA 2AG5A 4FZJA 1U8UA 3D31A 4UJ3A 2EWMA 2CLIB 2X2EA 4QGHA 3N59A 2H1LA 5F51A 3SDSA 5DNUA 1GKYA 3H04A 1M0SA 4E2XA 2AYYA 1Z2CA 3HDTA 1QYCA 3I37X 3IV9A 3RFCA 2AK3A 3JQBA 4RFSA 2JFXA 3LZ6A 3QVGB 2AKEA 4X91A 1TM5E 1OX4B 4C01A 4ENSA 2FDCA 2PUDA 5K3FB 1P0PA 2CV1A 4NARA 1PT8A 5IF9A 1U3UA 3ROQA 3TLGA 5F64A 1XTTA 1XAHA 3KWFA 1VG9B 3FPLA 1XTVA 2NQ2C 2O07A 1DEKA 3M6XA 4GLOA 4XIFA 4AS3A 4RS4A 1E63A 1CUGA 3ABZA 3DEAA 4PCAA 1WTCA 4PGHA 4K9SA 1UM9A 1ECLA 4P1ZA 5AW4A 2BGWA 1SOAA 1AD2A 1KDTA 3ORHA 3GAFA 3GLHA 4DR4B 2CBXA 4IJUA 3L9WA 1WY7A 3QUAA 2XVAA 1U7HA 3T5AA 3EW7A 1PP4A 1QHYA 2R2AA 2B99A 1I1HA 2MCFA 2BBTA 1XWFA 4R01A 3HB9A 4LSGA 1W4CA 1VXRA 1SPBS 1CQWA 4ED9A 4QASA 4ER6A 3M6VA 2C1EA 3DHVA 3O4JA 4HLDA 3DXZA 3EXIA 1NT4A 4YJKA 1L4BA 3WSWA 1XNGA 3BSFA 2X8LA 3JQPA 3REGA 3S2FA 2AYZA 3FYHA 4L08A 3W06A 3THRA 4UOEA 1A98A 4OOEA 3DFZA 3CFYA 2QD3A 2XYPA 4J3FA 2GEBA 2FMKA 1TA9A 1XEXB 3A4IA 3LP6A 3T9FA 2NPIA 4ENWA 5DIZA 1ZGBA 1RAHA 2IF2A 1VQ1A 4ZDKA 4ZT7A 3UH0A 3W5JA 4RPHA 4OI1A 5JDIC 2GEJA 2W4QA 4KXYA 4LYAA 3A06A 4OIFA 2EERA 1JJ7A 2K2WA 2P65A 3P8ZA 3U4MA 1IN7A 3QA3E 3EHDA 3WMGA 3LPDA 1ZKDA 5F9MA 3HKBA 1ZBDA 3JASB 2BZ1A 2JC3A 3NBXX 2GJSA 3BXXA 4KRYA 3O4VA 4E5YA 4CTKA 4I36A 1WQ1R 4ZARA 1OX6A 4QO8A 5CNKA 2C7RA 3NJRA 4XSHA 5T3UA 1SD2A 4ZV7A 1YUBA 3NNSA 3OICA 1TYAE 1HZZC 3B85A 1OE0A 3MJCA 3R5TA 3G9QA 4EG4A 3OMWA 3IL2A 1RXUA 4RD4A 3DUFA 3MLBA 5DNAA 1RLMA 3AHDA 3NUQA 4QDJA 3THYB 2PMKA 3GYGA 1T3TA 4IOKA 4RK7A 3ZD9A 4M1YA 4LF9B 2JGAA 5T41A 1X13A 1MMFB 3AO0B 2VZLA 3V2UA 4HH0A 4OKNA 3DBHB 3DH0A 1YZGA 1T0BA 1XJWA 4DF3A 5LU8A 2PGJA 3QEBZ 1SCAA 2QLFA 5J9FA 3CWQA 3OUZA 4DWVA 3A11A 2Z6UA 1N2BA 3B2EA 1U2DC 1DELA 3NAZA 1FW8A 1XPJA 1L4NA 4E33A 4QT4A 4HH4A 3RI3A 3A1WA 1HC7