4NDNE

Structural insights of mat enzymes: mata2b complexed with sam and ppnp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
IPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase isoform type-2
total genus 112
structure length 309
sequence length 309
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ndnE00
3G79A 4YT2A 1BXGA 4UEKA 4PLGA 4GWKA 2R00C 4AJHA 2D8AA 2WSBA 4DIFA 4JGBA 1DJQA 4D3SA 2C7GA 4GGPA 4BIIA 2EJVA 3C3XA 3A28A 2O4UX 3OFSA 3ZWNA 3JTMA 3HDYA 4NU5A 1I3LA 3EYWA 2EW2A 2YY7A 4BO3A 4BNHA 4PG4A 1VE9A 1A27A 3VPFA 4EJMA 4WLUA 4CM3A 2HLPA 5DOVA 2NVBA 4XEHA 4NI5A 1PGPA 3MJSA 2VOEA 1HWYA 3G1UA 1KVQA 2YV3A 3GGOA 1U8FO 4JNKA 3M2PA 3NJ8A 3CE6A 3IMFA 4Q3CA 2AHRA 2ZTVA 3TQHA 3NDIA 4WNIA 1U9JA 1CWUA 4RLHA 3WBFA 4D42A 4U0JA 4M1QA 3BTSA 1ONOA 5BSGA 3R3SA 2Z1NA 3I83A 2YFHA 1MP0A 2I66A 1B15A 5K9ZA 2GR9A 3QQPA 3WICA 4HV4A 1DEHA 3INRA 4O1MA 3QLJA 4YR9A 3RI3A 1GCUA 3Q0EA 5AOVA 3ZWMA 4TKLA 1FJHA 3F6YA 3OIGA 4P22A 1I2CA 3TZHA 4AJNA 4BNNA 3AOGA 1PS0A 2YV1A 2EP5A 5CPFA 1OBFO 2FY8A 4IDAA 1RYDA 3M6IA 2X22A 4CMJA 4Z3KA 3WR5A 4IS3A 4GH5A 2O23A 3MJVA 4LCJA 3UGKA 1ENPA 4MVJA 3UN1A 5BSHA 5L4LA 3PYLA 3ZNPA 3RUDA 4PIVA 4IXWA 3D5TA 4OMUA 3JYOA 4H15A 3H8VA 4RJTA 4Q39A 4J7CA 2WE8A 2EHDA 2YW9A 5EQFA 4J1QA 3DOCA 1R6DA 4QTZA 3KHUA 1B26A 1DOHA 4YVFA 1ULUA 3JSAA 3O03A 3BHMA 2F1KA 2POQX 5CDGA 3LYLA 3QVTA 3M1AA 1H94A 1F06A 4L75A 3WQQA 2FHSA 4OSOA 2DFVA 4WCFA 3WLFA 2HU2A 4CM4B 5A4DA 1BSVA 3PRJA 3NKLA 1GZ3A 1EVZA 1HXHA 2ZATA 3GEMA 4IDBA 4YYZA 1H9BA 3GG2A 2G5CA 1IB6A 3WOHA 2P91A 4FR5A 5C3MA 3NAQA 4BKRA 4DQVA 5HS6A 3ST7A 4LMRA 3CXRA 5EIOA 2X1HA 4BQPA 4ALIA 3WBBA 4YPOA 4NJOA 1QV7A 1ULSA 1N1GA 4DVJA 2ZB7A 1HDGO 1FK8A 3WDSA 5DT9A 3BMOB 4CM9A 5TLSA 2AQ8A 2LDXA 1PJBA 4CMCA 2PK3A 1W0CA 3VVCA 4WLNA 4CMBA 2DBQA 3C1OA 4XRGA 4XCVA 4IDCA 4XQ9A 3GNTA 3JD3A 3OQ1A 4CMEA 3OF2A 1PL6A 4ALMA 1PZFA 2I76A 1R4NA 4Z0TA 5B12A 4UVHA 1IZ0A 3KLPX 4YTEA 2O3SA 4BNJA 3CIFA 3BMQA 4FB5A 3KSDO 5JLAA 1EK6A 4QFCA 3UW3A 4AFNA 3L0DA 4BNMA 2VTDA 3NEPX 4MINA 3RJ9A 4AJEA 4A27A 5IDQA 3VDQA 5CG2A 1IY8A 2RCYA 3EVTA 4BKQA 5CEEA 2ZJ1A 4QT0A 5I7SA 2EWMA 2NV6A 4II3A 3AI2A 1U3WA 2DTDA 3DXFA 3PHGA 4HNHA 4JCOA 5HTOA 3WGIA 3ABIA 4M49A 5GZ3A 2P5UA 4LISA 3DHEA 1YH3A 2O2YA 2C20A 1G6KA 3H9UA 1MFPA 4XYGA 4FC6A 4R9SA 3RASA 3TL3A 4CQMB 3N74A 1ADFA 1D1SA 3ZHYA 2A94A 4RV9A 3ZV3A 1U3VA 5AXDA 4IUYA 4RORA 5TRTA 5F3RA 4E21A 1BG6A 1I2ZA 2PH3A 4EITA 1P74A 2AXQA 4W7IA 3C1AA 1VC2A 3F5QA 4DA9A 4XQGA 3VPXA 1RM0A 3E82A 1GADO 1ZXBA 3ZWVA 5G0VA 1Y9EA 2VUUA 1U8XX 1C0PA 2V6GA 2O3TA 1DB3A 4ZHSA 3PPIA 1T2CA 4NR0A 4NK5A 1LXCA 1NM5A 4E31A 1UP6A 1Y8RA 4AJ2A 2OP0A 3STHA 4E2ZA 4TVOA 3HB5X 5G4KA 1I30A 4RDIA 1YBMA 2DBRA 3D5QA 3C85A 4OL9A 2NUAA 4B4WA 5IZCC 4GX5A 1NR7A 3ZHBA 3U5TA 5G0WA 4R5MA 3PYXA 3FN4A 5T5QA 2ZTUA 3MWDB 5GMOA 2JAPA 4B3JA 4PN3A 1GCOA 4NPCA 2FR8A 2FPGA 2OGUA 5FEUA 2DLDA 1HKUA 4XIYA 1PS9A 3DTYA 4B3IA 3DBRA 5BT9A 2W2KB 4FW8A 4N5MA 4DTIA 1EE2A 4R3WA 3JQAB 8ADHA 4HFMA 1QYVA 2Y1OA 3KYCB 1IL0A 2FRDA 3PWKA 4ZQFA 4GGOA 3H9GA 4XGNA 2AQKA 1BDMA 1PQPA 1PJTA 3WYCA 4CM7A 3VOSA 5F1PA 3FPLA 2Y99A 2ZYDA 3KSUA 3LLVA 4GX1A 3S2EA 2HMVA 4IDFA 4I9UA 1NFFA 1BVRA 1E3SA 1JU9A 3IJRA 9LDBA 4R16A 1SEPA 1KC1A 3PI7A 3WIEA 4RPGA 3OHSX 1ZNQO 4NBVA 4O63O 4B4VA 2X9VA 4RF5A 5A02A 3SC6A 3AFNA 2VYND 4CM1A 4FJ1A 1Q7CA 3WJ7A 2IEDA 2Q4EA 3GY0A 2B0JA 2G1UA 4Y6SA 2B4RO 1NPDA 3S1LA 5HRUA 1DIBA 2JD2A 1NWCA 5IN4A 5GY7A 2VQ3A 4OXYA 4JXKA 4C4OA 3QWAA 1U2DA 1SAYA 3KYDB 2AEMA 4JN6B 3MWEB 2Y66A 1UDAA 2GERA 3KLMX 3UVEA 4BNUA 4EJ0A 4KUHA 1Y1PA 1HZZA 3GVXA 3IP1A 1ADCA 3FNHA 4D0SA 3ZU5A 3JYLA 4U7WA 3P19A 3G1TA 2D59A 1N7GA 4Z9YA 5A9TA 1IUKA 1BWSA 3WTBA 1DO8A 3F5SA 5CHEA 1N1EA 4CV0A 1HYHA 5TNXA 3ZW8A 4YAGA 4PZEA 4EDFA 3BAZA 1XLTA 5A1TA 5HA5A 1ZMOA 2VYNA 1C1DA 1E7YA 2OBNA 3W1VA 5JS6A 1R12A 1V3TA 1I33A 1JW9B 4B4OA 5F5LA 1E5LA 4QSMA 1BHSA 4YJGA 1EDOA 5L4SA 2IYOA 1UXKA 1EVIA 2J3KA 4DYDA 2UVDA 4R3NA 5ES3A 3ZW9A 2C07A 4MP6A 4MPDA 3ASUA 5JDCA 1MX3A 2HSDA 5COBA 1XGKA 3H3JA 2VUSA 3K2BA 4YDRA 1K3TA 4N5NA 3BXXA 4MVJM 5TT0A 4NFHA 4AJ4A 1DHTA 4Q3BA 1JWAB 2HRBA 4WCFB 3GG9A 4NQZA 3JQFA 4GX0A 3PHHA 5FWNA 2BGLA 2Y93A 3HADA 2VHWA 3L4SO 4II2A 4YA6A 4J90A 2VT2A 3AI1A 1GYPA 1MC5A 4RZIA 5ENVA 3ROQA 4F3YA 1W73A 4E30A 3H3FA 2RBEA 2XAAA 2BLLA 3IIEA 3ETEA 4BNVA 4GSLA 4EI2A 2VRCD 3MJEA 3PLNA 1XSEA 2H6EA 2DTEA 2YHUA 1J0XO 3I6IA 1MB4A 3PJGA 4CL3A 3IUPA 2QZ9A 3WGTA 2Q1WA 2GUGA 5IF3A 1PQUA 4R54A 4XQEA 2DC1A 1EQUA 5DOZA 3NTQA 5G0TA 4X54A 3KUXA 3VC7A 1GUZA 3ANNA 3I4CA 1OZAA 4PG5A 1GPDG 3ROMA 4ZD6A 1FMCA 4F45A 2A4KA 4MP8A 4UAGA 4I5GA 1ZVMA 4DPLA 2OBYA 4BGEA 3OICA 3U4DA 1KETA 1UJMA 2Q2VA 4DBVO 2P9GA 3ZU3A 1R4NB 3H5NA 2BI8A 3HDQA 1VJ1A 1KVSA 1WXDA 4K28A 3LF1A 1JVBA 4RDHA 4E5MA 1O89A 4PRLA 2O7QA 4MOWA 6LDHA 4PVCA 3DOOA 4AJ1A 3GFBA 1KIFA 1LNQA 2AA3A 3BZUA 4OYRA 1WAMA 2WMDA 4GMFA 4RCVA 5FF9A 4NZ9A 4A73A 4R1SA 3CPSA 2UYYA 3GVCA 3FRJA 1MLDA 5G0UA 3LC1O 1X14A 3RU7A 1E92A 2I65A 1M66A 1NHWA 3I6QA 1Y81A 3BHIA 3RC1A 4ALJA 3O8QA 3U09A 3ROKA 5KVQA 4LMPA 1MXFA 4TZTA 4S3MA 2R6JA 4YQZA 4IQ8A 3I1JA 1DPGA 4H7PA 1DHRA 4OJNA 1NQAO 1T1RA 1DXYA 1Z45A 2C54A 2FZWA 5T57A 5T8KA 1ENOA 3HHPA 3GGPA 3OA2A 5IDWA 4CMHA 1PGJA 2GN9A 1LLDA 3D3WA 3SXPA 1YDWA 1G1AA 5DCYA 1GY8A 1RKXA 1TA4A 3V1TC 1S6YA 3TN7A 4TVBA 2B5WA 4K6FA 2CF6A 2HMSA 4BV8A 4I1IA 5K0ZA 1D8AA 1VL8A 3VVBA 4CV1A 1GEEA 2GLXA 3JD2A 1PJSA 1H6DA 3R6DA 4EBFA 3R3JA 1YQXA 4CM8A 3IL2A 4L73A 1QRRA 2GD1O 3NUGA 2ZTLA 5A05A 3UFXA 1NBOA 4BVAA 3GOHA 3GNQA 1K5HA 1B7GO 5T8KC 4BO5A 4CR8A 4MKXA 4UVGA 4EJ6A 2VWGA 3JQBA 3QIVA 1E6UA 3DAFA 3OQBA 4E2WA 2Q1SA 1HYEA 1LRJA 7MDHA 4YJHB 1SEVA 2OHXA 3VZQA 4RVSA 1X7GA 1GAEO 4HFNA 4OXNA 1V9LA 4ZJUA 3ZI0A 4MVJE 3GUYA 3ZWAA 2UAGA 2VYVA 3C7AA 3FR7A 1ZEMA 2X58A 3IS3A 2E37A 1DFIA 1ENYA 2NM0A 2VZ8A 4BMNA 4HNGA 4BNXA 1OC4A 4R1UA 3UXYA 4ZRMA 1UXGA 4LK3A 2PGDA 4F46A 3W8EA 1M6HA 3EK2A 4CMKA 2X0JA 3EVNA 3ZHZA 4XKJA 1RM5A 2AE2A 4YAIA 3KM0A 1K89A 3WTCA 4I5DA 5T64A 1NQOA 5A5EA 4M8SA 1RM4A 4I5EA 3I9JA 3JQ8A 4D7AA 1ML3A 1PQWA 1VL6A 2D5AA 3KYBA 3P7MA 3PZBA 2GF2A 4K6CA 1GL3A 2R2GA 3V2GA 3TFOA 3A1NA 5DP1A 1UUFA 4UUOA 4LVUA 2EJWA 1HETA 3DBHA 3T7EA 3OM9A 5G4KB 3VKUA 3ULKA 3QVXA 4BNFA 5C7IO 4GLLA 3WFJA 4R5HA 1W6UA 4M87A 4KMSA 1T2AA 4A03A 1A7AA 3JQ7B 1ZK2A 5B4UA 4Z9XA 2PNFA 2JD1A 5TS3A 2BFMA 2RAFA 4K26A 3DAGA 2GCGA 2B36A 2PZKA 3EW7A 1PJQA 5TT1A 4A7PA 4YRDA 4E5YA 3KYDA 4N18A 2P4HX 5DF1A 4XQCA 3JQAA 2O48X 2V7PA 4WEQA 3U4HA 4ILKA 4KDEA 4UUNA 4U0KA 1WP4A 5TJHA 1AGNA 1GD1O 4MKRA 1QV6A 4NBUA 3FTNA 1NFRA 3L6EA 3SLGA 3GN2A 2Q46A 1XU7A 5IDYA 3IQDB 2C0CA 3UOGA 5AXAA 5IXYA 3KEQA 3RU9A 3TNLA 1O9BA 1H2HA 4JP2A 3F1LA 3OMLA 5TQVA 1DC4A 4DIOA 3I5MA 4DC1A 4ND4A 4PLYA 1OC2A 4J9UE 4TQGA 3C1TA 2O50A 3JQ6A 4CM6A 3AW9A 3ZV5A 5B4TA 2JD0A 3HB4X 1DC3A 1Y9AA 5JYEA 4J4TA 1IHXA 4DYVA 1BRMA 4L4XA 1NHGA 4LW8A 2QYTA 1GQYA 2NADA 4EUEA 5KVVA 2OO5A 4IJUA 1YL6A 3KO8A 5ER9A 3NYWA 1IE3A 3DHNA 1NAIA 4CUKA 4E13A 3FR8A 5F21A 1LJ8A 1HLDA 5HWSA 2JHGA 5DULA 5DBIA 3SEFA 5H81A 2FPIA 5A03A 1WDMA 1NVMB 3JD1A 4DWVA 3CINA 1E1KA 5CDTA 1CEQA 2VNAA 2FOIA 1QMGA 2Y1DA 2VWHA 3FSRA 2ZQZA 4CV3A 3TOXA 3WNVA 3IJPA 4HUJA 3WGQA 3HNPA 4EW6A 3EZLA 4O6VA 3ZWXA 3RUEA 1JWBB 1T2EA 3RCBA 1U3TA 1PZGA 1T4DA 5T6BA 4IY1A 4J0EA 4BKOA 1FDSA 2BD0A 1PTJA 3DOJA 4LSWA 3RBVA 1KS9A 1EK5A 5A3JA 1P1RA 3WMWA 4RPLA 4CR7A 1HLPA 2J3JA 5L7TA 2IZ1A 4TRJA 2YYYA 2V6FA 3L4BA 4BL5A 1UDCA 4HXYA 4BO4A 1R0SA 1KBZA 4GSKA 4YJDA 2BH9A 5K6AC 1DJNA 2I67A 1EVYA 1FDUA 4D0RA 4U8GA 1DSSG 1YKFA 2W8ZA 4QUKA 3DZIA 5I7VA 2H5LA 4JX8A 5G0SA 3RC2A 4BO8A 1YL5A 3PQEA 1ISIA 2GZ3A 3DFUA 4UEOA 3A06A 3AU8A 5BNIA 3H9QA 3PVZA 4A10A 4CMAA 4J16A 4Q3NA 3VAZA 4CM4A 3FHLA 3I23A 1ENZA 1PZHA 1IOLA 2D5CA 3OA0A 3JYQA 4KUEA 1HSOA 3RJ5A 3UICA 3WS7A 4E33A 1GUYA 3TWOA 1H93A 3PZRA 2DKNA 3RD5A 1P3DA 4FFLA 2BI7A 1GTMA 1QSGA 4WEOA 5ILOA 3ZU2A 2PGLA 2OXIA 4BO7A 3WB9A 4HKTA 5KVCA 1TT5B 2BGKA 3E9NA 4RGBA 1R16A 1YOVA 4WKGA 3GDFA 4BUCA 3A9WA 2JFFA 2OOSA 2ZYAA 3VPSA 4J7UA 5DCUA 4D43A 2Y0DA 3JQ9C 4EEZA 4I5FA 1ZCJA 5ITWA 2QYSA 5BR7A 5KKCA 4Y6RA 4IDGA 4RVHA 2Q1TA 2CNBA 1WDLA 4BO0A 3BTUA 3GMDA 4XDYA 5CG1A 5IZCA 1OFGA 1SC6A 3UHAA 3VZSA 1VLLA 2Q45A 5DN9A 4ZQEA 5JMWA 4XR9A 1EE9A 1N5DA 1U7TA 2VYVD 3GR6A 3U4IA 4MP3A 4E5PA 3QHAA 2BGMA 1Y5RA 2DBVO 1UZNA 3JQEA 3PDJA 3RFXA 2A9FA 4PLFA 3UF0A 4NJMA 4MJLA 3ADPA 4GKBA 4XGKA 5A04A 5ADHA 1I32A 1H5QA 3GK3A 4BGVA 3VTZA 3K8ZA 5I7EA 1ONNA 2E82A 3FWNA 1JAXA 2PA3A 2IRWA 2FZEA 3D3WB 1VI2A 2NQTA 3D7LA 3K73O 1HDXA 3MOIA 3RKRA 4L8VA 3RUHA 3DB2A 3RC9A 4ID9A 4XJSA 1B8PA 1VL0A 5I9MA 3E6AA 2W90A 1I3KA 4FJ0A 3PP8A 3OQ6A 5BSFA 1YB5A 3SX2A 2HMUA 3AOEC 3WGOA 1XG5A 4IPTA 4OHUA 4UULA 4KTVE 1HRDA 1YBVA 4LGVA 3AM4A 4JLWA 2FSSA 3RKUA 2Q4BA 1DFGA 2O2SA 3ETDA 1BXZA 1HDRA 2RH8A 5IAAA 4FOOA 4CMIA 4ZGWA 4A0SA 5HM8A 5ITVA 3JYNA 3DMTA 4GAEA 4AICA 1WVGA 4Y67A 3BTOA 1UAGA 2HK7A 1B8VA 4RQUA 1QYXA 1A72A 3CKYA 3FI9A 4YJHA 4O0LA 5CEJA 1LDMA 2WE7A 3INTA 3T4EA 2ZQYA 4FCCA 4BGUA 2ET6A 3GEDA 2NVUB 1A71A 1DAPA 1VSUA 4NH4A 2Q49A 2QHXA 1V3VA 1NVTA 1V35A 5EJ2A 3GLQA 2IDZA 4EEXA 2O7SA 1M6WA 1TVEA 4W6ZA 2EKQA 5CP8A 2ILTA 1ZK0A 5JMPA 4Z0HO 1LC0A 2VUTA 5C7OO 1LTHR 2I5PO 3DZFA 1LDEA 1WZIA 2ZYGA 3QWFA 3RSHA 3WGZA 2HCTA 3DFZA 3WWYA 2FN7A 3NJ4A 5L51A 2UV8A 4YBZA 1NX6A 1B3BA 1H2BA 2Y1GA 5K6AA 4Y9DA 3BMNA 3I4FA 5A06A 1JKIA 1JN0A 1V0JA 3AUAA 4J1TA 1U3UA 2AG5A 1O94A 3D1LA 3MTJA 3NV9A 1UH5A 2B35A 5A9SB 3BTVA 1KY5A 2X0NA 2PH5A 1WLYA 5KVSA 1K6XA 2QRJA 1PJ2A 1G0OA 3GAZA 1R4MA 2UUPA 3JQ7A 3CEAA 3SBOA 1SZJG 5LDHA 4FS3A 2QRKA 3HN2A 3NT2A 2EW8A 3PFFA 4ALNA 4BO2A 1AE1A 3Q2IA 5DDIP 3TOZA 4YRBA 2BFOA 2YDYA 4WOKA 3U49A 4Q3AA 5BNFA 4CM5A 1PJ3A 1JDJA 5LC1A 5JSFA 4RF4A 2OFPA 3K2EA 2PD6A 2HDHA 4OIMA 4GPD1 3U0BA 3VPHA 1AN9A 1E6WA 2LDBA 5KOIA 4XIJA 1F14A 4J4BA 3OH8A 1YJQA 3SJ7A 3CTMA 3U62A 1EDZA 2C29D 2HJSA 3V2HA 3EDMA 1HF3A 5I7FA 5I8ZA 2OORA 1UXJA 4MVJI 4IJKA 2AE1A 3LSYA 4BOYA 4GWGA 1CF2O 1I3NA 3KTDA 3WXBA 1XCBA 2DAPA 4GVXA 4IQGA 3W4KA 1N8KA 3DONA 1HE4A 4AL4A 1A4UA 1X13A 1XU9A 1FDWA 3ZWYA 3P5SA 2Y0CA 1P0CA 3KZVA 1Q7GA 3F46A 1C1DB 1XR3A 2NLOA 2PY6A 1ADBA 1YXMA 3G3EA 3PWSA 5T67A 4ONEA 2J6IA 3Q9NA 1U4SA 1IYZA 2QQ5A 4CMEC 4WUVA 2NWQA 1LU9A 3L77A 3IKTA 2BF7A 5L7YA 4BMSA 4BNGA 3B1KA 1YE3A 2CY0A 1XELA 1AUPA 1Z7BA 4FD3A 4LSMA 1YO6A 3DZKA 4J1SA 5GZ1A 3GEGA 3HE3A 4W99A 5DBGA 4B3HA 3GHYA 4MVJH 1ZK1A 3TZQA 3JQGB 1YVEI 1GDHA 1UP7A 2VWQA 3WLEA 4CV2A 4HFRA 3DWFA 3GMSA 4XYEA 4DBZA 5TIIA 1LRLA 1X1EA 4PLPA 1ZJYA 4NBWA 1Q7BA 1YRLA 4UUPA 4WLOA 1KY4A 3RAJA 2AG8A 4BGIA 4YT4A 3DZJA 2PD4A 4MVJG 2GZ1A 1VKNA 3VHRA 1KVTA 3RBZA 5DBFA 1PU2A 3BMOA 4P8RA 3WYEA 3VKVA 1IPFA 1TT5A 4YB8A 4ZVVA 4BO1A 1GR0A 3FF4A 1N9GA 4FPXA 2R00A 4J1NA 4HFJA 3FNGA 1IHYA 4GL4A 4D46A 4PZCA 5KWEA 2DPGA 3KXDA 2DPHA 1ADGA 4E6PA 3GVHA 3PDUA 3ZN2A 2OZPA 1A9YA 1E1MA 1Z73A 3RWBA 1DRUA 1R0LA 3L6DA 4D44A 3DTTA 3HQ4O 4J7XA 3DMYA 2W2LD 4UEJA 3SC4A 3O9ZA 1U7HA 1LDNA 5IDXA 2X5KO 1KVUA 4CMGA 2B37A 1NPTO 3RVDA 4XYLA 4ZQBA 3KETA 1DDOA 3LLSA 4DLLA 5THQA 4M89A 3E5MA 4Z9FA 4PZDA 3NDJA 4NJMB 3WFIA 2VHYA 4Y98A 1HZJA 2IEBA 5I9LA 2QG4A 2JJYA 3ICPA 3JQ9A 2X5JO 2Z95A 3N58A 2E48A 2WTBA 2VT3A 1Z74A 3U9LA 4PG6A 1KEWA 2PWZA 3GZ4A 2FPPA 3GVPA 2B5VA 9LDTA 1GZ4A 2FR0A 4A5OA 1E3EA 4PLCA 2BHLA 4R1TA 4DQXA 1PGOA 4LVCA 3UH1A 4RF2A 3PTZA 5EINA 2X9GA 4RVFA 1MGOA 1VJ0A 3MOGA 3DR3A 3QJ5A 1UZMA 1YL7A 4WK6A 4DPMA 1W4ZA 4EYEA 5JY6A 2Q2WA 2E4AA 2WYWA 1J4AA 3ETGA 2EGGA 1YDEA 3D0OA 3NT4A 2HAEA 1E77A 1PS8A 1R37A 1S7CA 3L9WA 4I9NA 2YFQA 3QVSA 1P44A 1NPYA 4ZA2A 1PR9A 2X23A 4E12A 1LDYA 3L9XA 1P33A 3TZCA 1I5RA 5L4NA 4CLRA 2GZ2A 4M86A 3NGXA 4IMRA 4M55A 4J4HA 4WECA 2WDZA 1F8FA 3QWBA 4FIZA 4N5LA 1NNUA 5HBRA 4WCFC 3B70A 4W7HA 4ZQGA 1PJCA 2GN6A 2W2LA 5KJEA 3PIIA 5TX7A 2YDXA 2NTNA 2W2KA 1ZKMA 1TB4A 4PCVA 2AQIA 4MKZA 4B4UA 4WLEA 1JQBA 1ZSYA 1FXSA 3E8XA 1K2WA 2XF8A 3ZWPA 1DBVO 1LEHA 2D4AA 2HK9A 4WLVA 1D4FA 2PZMA 3VPGA 4YEDA 1CIVA 4QX6A 3UAGA 1IZ9A 1LQUA 4GX2A 1SB8A 4I08A 2B4TO 3N7UA 1GFSA 1NQTA 1V6AA 2NU8A 4YJFA 5JCXA 2QRLA 4XJTA 1YWGO 2IODA 5F1KA 1GV1A 1IPEA 1UZLA 2E49A 4ZN6A 2OL4A 4DPKA 1QLHA 2NNLD 5LCXA 3T7CA 2D0IA 5H82A 5ER6A 3R1IA 1LDGA 3C7DB 3EY4A 4IJVA 3WSVA 3S2FA 5A9SA 3FD8A 4NK4A 2YHIB 5EQDA 3WJAA 2NU7A 3W4JA 1CDOA 4JJIA 3ITDA 3U4CA 1P0FA 3BMCA 4CR6A 4J49A 2X0RA 2FR1A 4P38A 4QO8A 3ZZNA 1U2GA 1X7DA 2P9EA 3ICCA 3FTPA 1E7WA 7ADHA 4KTTE 4R01A 2GSDA 3OJOA 5EPOA 4OOEA 3HN7A 1I0ZA 3O26A 1QXSA 4HBGA 1N7HA 5I8WA 1BTOA 2WD7A 3BIOA 1EVJA 1Z75A 3IKVA 3H5AA 4RZHA 4XZ3A 8LDHA 1DFHA 1ZK4A 1LLCA 1T25A 1X15A 1GEGA 3D4OA 4FFRA 4GMGA 4UVEA 3KVOA 3V5NA 3VH3A 3RUIA 3SVTA 5ICMA 1LQTA 2WD8A 1CYDA 3C7CB 2Y68A 4ZQHA 2QIOA 4WE3A 3VH4A 1Q0QA 5F5NA 1NYTA 1HT0A 2Y1EA 1KOLA 5B4VA 4WGGA 3JQCA 3QA9A 2BKAA 3BMNB 1HE2A 1OAAA 1DIHA 3PIDA 2Y0EA 3O38A 1YQGA 1LX6A 1CQIA 3TFQA 1HSZA 5JAZA 1HDOA 2O3QA 2CZCA 2ZIZA 3M1LA 4AJJA 2CVQA 3OETA 1M76A 2ZCVA 4NMHA 1XEAA 2DFDA 2X0IA 5KTKA 4XB1A 3V2UA 1WNTA 2Y67A 1GU7A 1GYRA 2O4CA 3WMXA 2G76A 3IDSA 1R4MB 4PRKA 2GNAA 1GV0A 3LC2O 4B7CA 1TXGA 1YB4A 5JE8A 2DQ4A 1KERA 1T2DA 3F4BA 2AQHA 4WCDA 4HWKA 1JKJA 4CQMD 1I2BA 5EL0A 4MDHA 4FFOA 5A9RA 4BNKA 4FJ2A 4OAQA 3TPCA 3LVFO 3PK0A 3UCFA 5MDHA 4OH1A 1QYDA 2VHXA 3NTOA 3W8FA 4HX5A 4L4RA 3H7AA 3FCOA 3PWZA 4L0QA 3TZKA 1SOVA 5I9NA 5BSEA 2EIHA 5GZ6A 1M75A 3ONDA 3AU9A 1YB1A 4DLAA 3ITKA 1JKFA 4RVGA 4F6LA 4OOFA 2IYPA 2GPTA 3BA1A 3DAPA 2I6TA 2HQ1A 5J23A 4JJFA 1QP8A 5LDGA 4Z6KA 4GKVA 3MEQA 5JPIA 3PJDA 2ZCUA 1N9GB 3I9MA 4KDFA 2QZZA 1K6JA 2Y1FA 1XQ1A 2PLAA 2FMUA 3HDJA 2Z5LA 3PYMA 2VWPA 3UKOA 1U5AA 2B4QA 1AHIA 2YUTA 2O3UA 1ZIDA 1ZO8A 2BELA 5H83A 5CDYA 3PJEA 3EC7A 3HFGA 1E7RA 2XXBA 2ZK7A 3LT4A 4L74A 4ZU3A 3HG7A 5AYVA 1V8BA 3ZWBA 3EZYA 3WGYA 1SBYA 2CDCA 5HS4A 1PZEA 3JQBC 1AXEA 1DIAA 3PQDA 2NSDA 4IGFA 1GQQA 5JDIC 2P5YA 4N7RA 2JHFA 3QV1A 4IINA 1KEPA 2WWRA 4GLOA 2Q3EA 4KZPA 1H9AA 5L3ZA 4CPDA 2BRUA 4NFYA 5FI5A 1EUZA 3P2YA 2YV2A 3AK4A 2WYVA 1PX0A 4E0BA 3GZNB 3AM5A 3MJTA 4J2HA 4BO6A 3VH2A 5KJ6A 4IIVA 3IAHA 2CUKA 1C1XB 4PLVA 1OI7A 3OJ0A 1LSJA 2H63A 1PR3A 1Y5MA 1Y6JA 4I9HA 1Z82A 4K1LA 3ZGYA 5IG2A 4NHEA 2YQ5A 1E3LA 5JC1A 3H65A 1ISGA 1FDVA 1LRKA 4DREA 5JAQA 1Q2XA 1QLJA 4ZICA 1DRVA 2C7VA 2YJZA 3DZHA 5JDCC 2Y1CA 3K9QO 3I9LA 1DLJA 3JD0A 4CM8B 4CLOA 4BNTA 3U3XA 4J2OA 4RO0A 1P45A 1NP3A 4N54A 2PKQO 5TGDA 4MO2A 3OP4A 1EFLA 5L45A 2Q50A 4JQCA 5CDSA 1LC3A 3QW2A 4CLHA 4AVYA 3ADOA 2FSVA 3HWRA 4HY3A 4CQLA 4IIUA 4PGFA 5JDIA 1BDBA 2HMTA 2RIRA 3DC2A 1U28A 3CZMA 4XWYA 1E7MA 2CSUA 1BGVA 4ALLA 1LDBA 4W82A 1U1IA 1N2SA 3GUCA 2A92A 3EAGA 4XB2A 3FWZA 3GPDG 4DGSA 1OMOA 1C0IA 3LK7A 3PGJA 3KBOA 3ZV4A 2XPCA 4CQMA 1W8DA 3C8MA 1LBEA 1EBUA 1K6IA 2FWMX 4XYBA 1CJCA 1OOEA 1Q1NA 4BHTA 4DMMA 1MUUA 3NT5A 4FSHA 3ZWOA 3G17A 4J6FA 4L76A 4PLZA 3MJ4A 2RHCA 1LLUA 3GDOA 4NBTA 4ITUA 3MTGA 2VN8A 4PLWA 1JA9A 4EUFA 5COAA 5DP2A 2HRZA 3VTFA 1YS4A 3EUWA 4PFJA 4YWJA 3E5RA 4BNZA 4O5OA 2EEZA 4XYMA 1EZ4A 2JFGA 1SNYA 3D4NA 2BFAA 4RPHA 1R15A 2GN8A 4CMIB 2WEKA 3QRWA 4DUPA 3S2GA 2PTGA 3WQRA 2V65A 3GRKA 1YGYA 5THKA 2H9IA 3LU1A 4TSKA 1ZK3A 3ZNNA 2EGHA 2JAHA 3ANLA 4AJLA 4LRSB 3G49A 3TDKA 5IZ4A 2WD7B 1C14A 4K9DA 1CERA 4YAJA 1BXGB 2DUWA 3TJRA 2VNSA 2P9CA 3LT0A 1ZUD1 2EF1A 1EUCA 3ENKA 1MG5A 1T24A 1LUAA 1T1SA 2H1SA 4KUGA 4NIMA 3H2SA 5CFZA 3KYCA 3E03A 3ZNQA 2CMDA 3E9MA 3P2OA 4YT8A 4C7JA 1ZXLA 3UUWA 4OSPA 1E1NA 3FBTA 3G0OA 2ZB3A 4MIEA 4BNYA 4D3FA 5AQ1A 3M2TA 3GNSA 1I10A 1ORRA 5U1PA 5U4QA 3KV3O 4C7KA 4E3ZA 1H6AA 3PJFA 2PZJA 3I9KA 1UR5A 3GRPA 4NU6A 3K6JA 1G0NA 3QSGA 3PHJA 1QG6A 3B20A 3BMCB 2BMAA 1I24A 4IBOA 1ZJZA 1MFZA 3CH6A 4KOAA 1CETA 4YACA 1LLQA 2PKRA 2P2SA 3ON5A 3W4IA 4CLEA 3RUFA 1J5PA 4BB5A 1ISJA 5JC8A 1GPJA 3OIDA 1ZMTA 3Q2KA 4OXKA 4M54A 4OKNA 3W8DA 3KEOA 3DBLB 5IN5A 3WGHA 3GQVA 4Q9NA 3Q6IA 4JK3A 2O3RA 4FFNA 3MJCA 2VTEA 4U6SA 1UAYA 1BW9A 3GA0A 4IGEA 2GYYA 2HK8A 2C59A 1YBAA 3SJUA 5A5FA 2EXXA 3IP3A 3QVWA 3B6ZA 1VJTA 1H6CA 5KJFA 3GDGA 3K5PA 1QR6A 3F47A 2JCXA 3GH3A 1B14A 3OJLA 4URFA 5AVOA 3X2EA 2HO5A 1YJ8A 1HE3A 4FOSA 3WGGA 4RF3A 4RVDA 4XRRA 1WW8A 3E48A 3NTRA 4RPKA 4R4JA 3WQSB 4J43A 3ZDFA 1ZEJA 3PHIA 1D7OA 4TWRA 3QVOA 4WASA 4YJGB 5KKAA 1JTVA 3W6UA 3FBGA 5JAIA 2J3HA 4CLDA 3AUTA 3T4XA 2I3AA 1O6ZA 2EP7A 1FDTA 3Q3CA 2BFPA 2DM6A 4KWIA 3ZCXA 4LRTB 2NTJA 1QYCA 1TLTA 5ENDA 3W6ZA 4AG3A 5DCWA 5KJ1A 1R0KA 2P68A 4JBGA 1LSSA 4XR4A 1J49A 1XIVA 1PL8A 1CQJA 5CPBA 4IZHA 4TZKA 2JFHA 1X0VA 2J5QA 3PHLA 1XKQA 5L95A 1F12A 1GZ6A 4ZRNA 3JQGA 4BS9A 4HP8A 1T2FA 2B83A 2JCVA 3NX4A 2VCYA 2DTXA 3RUAA 4DMLA 1ISHA 4R9RA 1HTBA 1B0AA 3GVIA 4JJGA 3WX0A 3H2ZA 5DZSA 4MVJF 5JFOA 1PGQA 3F1KA 2PR2A 3WIDA 3VH1A 4BMVA 3LT1A 5JO9A 1YOVB 2IXAA 1BVUA 2I3GA 4IDEA 1IULA 1WWKA 1MXHA 1M2WA 3DDNA 3GGGA 3F4LA 3OEWA 3PEFA 2VHVA 3NDRA 1PWXA 1YQDA 2NU9A 1RM3A 5TJ9A 1EBFA 5JYDA 1A9ZA 1VRWA 3GPIA 1K0UA 3BMQB 2EERA 4YT5A 2VRCA 2DVMA 3A4VA 3H9EO 4BKUA 1PJLA 1RWBA 1GYQA 4OM8A 4E2YA 2E6UX 3CZRA 4RL6A 2G82A 2FP4A 1KVRA 3ZHXA 4P4LA 2Y05A 2IE0A 4EZBA 4G2NA 2C82A 4ND1A 3JYPA 3DMTC 3I9NA 4YXFA 3RFTA 3WYBA 1P1IA 4Z0PA 1WZEA 4OGWA 3Q1LA 4XA8A 1Q0LA 2SCUA 1L1FA 2C2XA 2JCYA 1WMBA 4IJWA 1Y8QA 3GAFA 4BNIA 3OIFA 3O8QB 4TKMA 4CLXA 1KYQA 1C1XA 4BB6A 3FPCA 4DRYA 4NBRA 1PSDA 1ZZEA 1GUFA 3RFVA 4IZIA 3JCZA 3PXXA 4AJPA 3CMCO 1N92A 1C3VA 4J91A 4G5HA 3PQFA 4A26A 5COQA 1JAYA 2OUIA 3FNFA 1E3IA 3WNQA 4WJZA 1O8CA 4FC7A 2DUUA 4RPJA 4RVUA 4E5NA 2HKIA 1NAHA 1O95A 4YQYA 4E2XA 3GF4A 4D79A 4B8ZA 1ID1A 5TC4A 5C5IA 5JY1A 4DQUA 1X0XA 3WWZA 4FN4A 1ONPA 2D2IA 4LN1A 4MIYA 3SLKA 3V1UA 1HE5A 3BYZA 3IC5A 4WOJA 5DNAA 3RROA 3B1JA 1E6EA 3X2FA 1EEHA 2IZZA 3LF2A 4S1VA 2P4QA 5KCZA 4R69A 3AJRA 2F00A 2X86A 4NFSA 4BV9A 4KP7A 4FDAA 1TI7A 3HDHA 5JW6A 3H6KA 4CLRB 3EMKA 4PLHA 1P31A 2NVUA 3HFSA 2NTVA 6ADHA 3H5RA 4ND3A 5L40A 3HJAA 2PGJA 1QYWA 4BKPA 3S2IA 4GVLA 4DIBA 1VM6A 1U5CA 5JAMA 4B7XA 4H16A 4B79A 4IS2A 3LC7O 4ND2A 1E3WA 3AWDA 4J3FA 3LDHA 1A7KA 2AEJA 2Q99A 2C5EA 4IDDA 3B1FA 4UUMA 5L7WA 3BHJA 5C37A 1AHHA 1Z6ZA 1KC3A 1SOWA 1UXIA 2JL1A 2YQ4A 4MVJP 4YCAA 5B1YA 3ZNOA 3TF5A 2NQ8A 4RLSA 3L6OO 3IUSA 3QWHA 4ESOA 2AMFA 1A4IA 3LQFA 1QORA 3JV7A 4WPGA 1X1TA 5A3VA 5JNLA 3JQAD 1C0LA 2V6BA 4NG5A 3TSCA 1SMKA 1T26A 3E9QA 4R1NA 1Q0HA 3ASVA 5BNTA 3ZWWA 5ICSA 1L7DA 1E3JA 4B8WA 4DL9A 1P77A 2YZ7A 2VOJA 2QW8A 3RC7A 1SB9A 2CFCA 4UVIA 5KJCA 4IXTA 3AY6A 2X7HA 1M67A 2YHIA 1B16A 3IOYA 3OEYA 4QEDA 1H0KA 1R66A 4TMFA 4CODB 5EESA 4D3DA 3AM3A 3QE3A 3CMMA 3KOUA 2OMEA 3WG9A 3ONEA 3ORFA 3L07A 3V8BA 1PGNA 4G65A 1WDKA 4XX0A 3ROPA 4OKIA 5JXWA 1VPDA 2TMDA 4W9NA 1YONA 2PD3A 4JP3A 4P4GA 2DT5A 1HL3A 3E1KA 4FBGA 4TRNA 1TEHA 1FF9A 4A2CA 5FFFA 1XQ6A 2WJPA 4YAEA 3TL2A 3QP9A 4IQ0A 3A14A 5L9AA 2O3JA 4D41A 4FGSA 3KB6A 1NTOA 1RPNA 1RYEA 1TT7A 4FGWA 4OO3A 4BNWA 1ZFNA 2CDAA 4GBJA 3S8MA 5IXSA 4QXMA 4TRMA 5IFLA 1UXHA 3D4PA 2HJRA 3DQPA 3S55A 3F3SA 1KEVA 4IM7A 3ZU4A 1P9LA 4PVDA 3VZPA 2VZ0A 4F6CA 2AW5A 5ILGA 2G17A 5TSDA 5CEFA 4PLTA 1JVSA 2Q2QA 2VHZA 2C5AA 3C24A 4Q3EA 3EHEA 3DZBA 4O59O 3AUUA 2RH4A 3JQFC 2W4QA 1V3UA 3Q11A 3QWIA 1P1HA 4U6QA 5KIAA 2QX7A 5FYDA 5CAEA 3RQSA 3GHHA 3KRTA 4EUHA 1ZSVA 1PJ4A 2CVOA 4W4TA 2GN4A 1DAOA 1Y7TA 1NFQA 2EKPA 4ALKA 1GQ2A 2IZ0A 2I9PA 3R0IA 3H9JA 4ROSA 4CUJA 4PG7A 4L4SA 2VZ9A 3ZWCA 1O5IA 4BNLA 2JKVA 3GN1A 4CM9D 2UDPA 1EFKA 2CD9A 1SPXA 3DBLA 4BQRA 1SO8A 1X7HA 1B8UA 1I8TA 3K92A 4Z3DA 4L9RA 4MVJD 5JO0A 3CSDA 1P1FA 4Y8VA 2EKLA 4Q3DA 1BW9B 5KNLA 1J6UA 1T4BA 2GASA 4IMPA 1RJWA 2XXJA 1LSOA 4QO7A 3AY3A 3HZZA 1A5ZA 2X4GA 1CRWG 4R41A 2IXBA 4WLFA 3HUDA 2ZKLA 4OQZA 5AXCA 1E7QA 3OJFA 2NVWA 1WMAA 2TMGA 1UP4A 1LSUA 5EMHA 5JCJD 3AOEA 1ISFA 1E5QA 4CUZA 3ANMA 4W9NC 1ISMA 1NXQA 3F9IA 4JIGA 5BQFA 1ZBQA 3ZH2A 2W98A 3CUKA 2NACA 3O4RA 3GFGA 5EN4A 1E7SA 1NVGA 1WPQA 2D1YA 3V1YA 4G81A 5EERA 2DU8A 2PKQP 1KEUA 1U4OA 4NDNE 4FQ8A 2PV7A 5B37A 4EGFA 1DRWA 3KSZO 4DXHA 1QKIA 2VRBA 1PL7A 2GRAA 3I52A 3UCXA 3FNEA 4PG8A 4TROA 3OBBA 3I9OA 1DC6A 2B69A 3NGLA 4HADA 3AUSA 3GC6A 4KQWA 1VKOA 1LI4A 1XA0A 2UUOA 4JBIA 5JCJA 2ZJ0A 3Q9UA 3UCEA 5JBIA 1XDWA 1L7EA 5F1OA 4INAA 4KQXA 3WSWA 5AXBA 4NNJA 5L53A 2HUNA 3RIHA 4E4YA 3EGOA 4JBHA 3GZNA 3OECA 1UDBA 1VSVA 5IJZA 3INGA 1ZW1A 1B2LA 3QY9A 1XYGA 2ZTMA 4OQYA 4CL8A 1DC5A 3GT0A 4QFDA 2G0TA 2A35A 2PZLA 2XOXA 1MV8A 3K30A 1EUDA 1I01A 2X6TA 4D45A 3TZ6A 2ZB4A 5CDUA 5G2OA 4YRAA 4R51A 2OP1A 4AJKA 2X5OA 1D3AA 1I3MA 4KWHA 1C0KA 1MG0A 1P1JA 2EV9A 4UREA 2AEFA 1Z7EA 2CVZA 3AY7A 3ONFA 1HDZA 1B3RA 3ENNA 1BMDA 3JD4A 4CLOB 2NU6A 3DEYX 1P1KA 4MIOA 3LZ6A 5C7LO 2GO1A 1E1LA 4P4NA 3PGXA 3VZRA 1NR1A 2PFGA 3LT2A 4Y6PA 2ZB8A 2WYUA 1Y8QB 2I99A 4YAKA 4CQLB 4BO9A 1HEUA 3H4VA 1I36A 1NASA 1AXGA 1NQ5A 3PLRA 5TF4A 2CDBA 3K31A 3DBRB 1D1TA 4E5KA 2J5KA 1E3WB 2GDZA 1DIRA 2D3TA 3MCVA 4I8XA 3K96A 1F8GA 1SCUA 4QQRA 3NRCA 4R68A 1DIGA 3D64A 1E0DA 3OJEA 5FI3A 1EMDA 3ZV6A 3JQ8B 4DC0A 4YJFB 3DZGA 3VDRA 1PIWA 3E18A 2CF5A 3L4BC 4JROA 1MC4A 4GQAA 3COSA 4LCEA 2C2YA 3OSUA 4UVDA 1DLIA 1NWHA 2EG9A 2GGSA 3AI3A 1O0SA 3DBHB 4J9VA 4QECA 2HMWA 4XDZA 3MZ0A 3RUCA 2Z1MA 1XHLA 1HDYA 4FFPA 1BXKA 1HDCA 4XD2A 2J8ZA 3JQDA 4WNCA 1Y8RB 2WM3A 1PWZA 1ZSNA 3D3EA 1H6BA 4FFMA 4XGIA 2J3IA 3DHYA 3TRIA 1F17A 1MA0A 3DO5A 3AFMA 4ND5A 3RBXA 4H3VA 2Q1UA 5MGBA 4AJIA 1F0YA 4CJXA 4U5QA 2J5RA 4J0FA 3DBVO 1ZH8A 4E32A 5G4LA 3PFWO 2RHRA 3I3OA 4B7UA 4RQTA 3HSKA 2V6MA 5U9CA 1HYGA 2X8LA 2X9NA 1PEDA 2DBZA 1LA2A 1JLLA 1ARZA 4AJOA 1EQ2A 3DL2A 1XWFA 4TRRA 4DLBA 4GI2A
chains in the Genus database with same CATH superfamily
3D9QX 5EZYA 4YT2A 1BXGA 5CFQA 1ZUNB 4PLGA 5JAPA 1N2JA 3E81A 4LVOA 2R25B 2RHHA 1WCYA 5E9QA 3AQIA 1Q1BA 4C7MA 3UJNA 1QPBA 1H4VB 2J9YB 2WWGA 4FR2A 4YASA 1Y37A 4D9NA 1HO3A 4RFSA 4LRYA 4GGPA 3PT5A 5TQ0B 4C08A 1AS3A 1MX9A 2RKBA 4XVRA 3A28A 1CD5A 4HLDA 2Q5IA 3TQIA 1KRHA 1POWA 1GG2A 3BJZA 3ZWNA 1DWPA 2R84A 3JTMA 3X1YA 2OO7A 5FOTA 1UBMS 4DMRA 3NANA 2YH2A 3RS2A 3W77A 1RI2A 2I6UA 4BVFA 3RO7A 1A27A 3H8JA 1YAJA 3TSZA 4B0PA 4DNXA 4KPUA 1ZI8A 2HLPA 1W4LA 3SBDA 5J2TA 3BWXA 2PANA 3EOZA 2VP5A 3QENA 2I0FA 2YV3A 1UT8A 4W9NC 3GGOA 4B6QA 3TRFA 2WHYA 4JNKA 2FOXA 3M2PA 3Q8WA 3THXA 3CE6A 5B1HA 1BFUA 1B4DA 3ZIAD 2AHRA 2P6OA 3BM5A 2CDRA 2VJDA 3NDIA 1XYVA 4F5EA 1R50A 4OPMA 4LY6A 2LGJA 1CVLA 4G67A 4N5IX 4MJ3A 5IDVA 4YUYA 3BTSA 3T3IA 1XHFA 3EXAA 3R3SA 4C4YA 1ZMBA 3X1KA 2NT3A 2FUKA 1NUSA 3ACDA 2ECOA 3EEIA 2GR9A 3F3MA 3KPVA 3PRHA 5DPMA 3VU1A 3QLJA 1W47A 3ZGNA 5BN4A 3T5DA 5LZ7A 3RI3A 1W4RA 1GCUA 2GUWA 5LQRA 3ZWMA 3H1GA 2PNJA 2RHOA 4P22A 1RZVA 2W58A 3TZHA 5K8IA 4RXMA 2EP5A 1KYWA 5KEIA 4RELA 1GA1A 4X7MA 3MCTA 4FT2A 4DCSA 1R0BA 4Q82A 1RYDA 2YZMA 2YXEA 1OHHA 1ILWA 3CUWA 3Q7EA 4CMJA 3ZY4A 1SUAA 2D00A 3DH0A 1QBGA 4RA9A 3REOA 5CVTA 4GH5A 2I4IA 3MJVA 4F97A 3FTCA 1QO0D 1M5RA 4F3RA 3PFNA 2GMWA 3A1WA 3MILA 3ZNPA 1EP9A 5HYVA 3DMGA 3PEUA 4UTNA 2ZYHA 4AC9A 4OMUA 5HNKA 3H8VA 3RABA 2WE8A 4GYYA 4FHDA 4NAUA 5FUYA 4BWVA 4KYUA 4WOCA 3DOCA 1UPTA 3G9QA 3HJBA 1W96A 1EXDA 1ECCA 4QTZA 3KHUA 3SSNA 2QKYA 1C1HA 3D1JA 3JSAA 5D5PA 4AMGA 4M1TA 1Q3KA 1G64A 2PH1A 3LYLA 3LPNA 2NO7A 2FSGA 2OHVA 2FPOA 2ZWIA 9ATCA 2OKGA 2KBFA 1PLJA 5D3MB 1PR5A 5FV4A 1Y4ZA 5A62A 2PWAA 1WSBA 2VQFB 3WLFA 4B5KA 3AINA 4GECA 1OBOA 4QBTA 3O0DA 3UEOA 3CU5A 3PRJA 1WABA 3TMAA 1CVRA 1Z0UA 2GVNA 1EVZA 1HXHA 4CL0A 1OH6A 1JIUA 1IB0A 5B3AA 2GZDA 2JHAA 3EXHC 4YYZA 3GG2A 2G5CA 3TH5A 1EPUA 4GVPA 4HDKA 3BA6A 2C57A 5EMLA 3SIPA 1CBUA 4DQVA 1FYDA 3MT8A 4DM4A 1TIPA 1NE7A 4CN9A 3VU9B 5GJWC 3T0GA 2ODPA 3BCSA 3WBBA 2W6IA 4ALIA 3LK6A 1W88B 2M32A 2WA2A 1XKXA 1N1GA 3MTBA 4OP1A 1J8QA 1EFPB 3OM1A 4GOOD 1QKJA 4P31A 4PQEA 5TF0A 4DVJA 4EF4A 3CCBA 4GYKA 2WTNA 3N8IA 3SE7A 1TW3A 1ZONA 4A0RA 2IUFA 3S5UA 5DT9A 3F4KA 3K1JA 3B8EA 4CM9A 2XVYA 1PJBA 1UDXA 3VA7A 2RJNA 2N42A 5CFMA 1WDTA 2X41A 2EP8A 3K71B 2XIJA 4YJ2B 2E4VA 4XQ9A 3GNTA 1TOAA 1ZH0A 5LMNB 2Z4SA 1PL6A 1RR6A 1H69A 1B00A 3W79A 2DY0A 1Z2DA 4JV5B 1FW8A 3F71A 4LJYA 4U1RA 3CIFA 2MSKA 1GUAA 1TJNA 2XCLA 2FB9A 3PF8A 4FB5A 4AFNA 3OURA 1PW7A 4NABA 4MINA 1KZGB 3BB3A 1TIKA 3GD5A 2WAAA 4AJEA 5EZ6B 1AKUA 1TKBA 4WXMA 5FORA 1IY8A 4YRRA 3EVTA 2BL4A 4BKQA 5KWIA 1W5TA 2C92A 2OAEA 3PPYA 3EOAI 4ZEOA 4II3A 4CIXA 3EGXB 1E3QA 3IAM6 1QGAA 3DKIA 2DTDA 3DXFA 4HNHA 3WGIA 3TXYA 3QNWA 1SXJE 2BRUC 4KYTA 2B2CA 3DGEC 3WGMA 2PX5A 4KWEA 4BEJA 4PAMA 3DHEA 3L7YA 5DI9A 5KUTA 2O2YA 2SCUB 4MW4A 4S0ZA 4XYGA 4AQ7A 4MZXA 2XMRA 4MEBA 3O1IC 1RAFA 1VIVA 2O06A 1IY9A 1TJ5A 1D1SA 4G63A 5ALJA 1KZHA 1SCUB 1PLLA 1V47A 4QUGA 4RV9A 4W7SA 2OMKA 4DCVA 2GD0A 3FE2A 5TRTA 2R7AA 1BG6A 4C78A 5B7NA 1P74A 5AOBA 4W7IA 5G1PA 1LPBB 4FDTA 2BFBB 2YVAA 3ISJA 1OVGA 1NOIA 4ZOLB 5DMXA 3E82A 1N0UA 4JKOA 5E3HA 3V32A 3WLOA 1XVIA 5KYXA 1RI1A 5DLPA 2VUUA 1WW3A 2PX4A 2BR3A 5ECWA 4EY5A 1U8XX 1WUIS 2V6GA 4TVKA 3B3QA 1DB3A 3TIFA 2F4NA 2F8SA 2V1UA 1B2RA 2VP4A 3HVUA 3TEMA 3M9LA 4ZZ2A 4AJ2A 4TVOA 4RMIA 2D5LA 4F5WA 1AKRA 4EJFA 4RDIA 2ABWA 1N1DA 2RC6A 2Q7XA 2IX3A 4MWSA 5AKHA 5C3UA 2GEUA 2V96A 2YJNA 1RWOA 3TINA 1TFUA 3IKLA 4ZYZA 1XQWA 3PYXA 4OV6B 3ZXIA 2ZTUA 2EJBA 4JIMA 4BV3A 4QT4A 2JAPA 2VFAA 5CFNA 5LLDA 2BP7B 2C8VA 4ND6A 4TSFD 2WIAA 1E9DA 3Q9SA 5EHIA 5FTNA 4LBWA 5B1IA 1TF2A 2FPGA 2XDQA 4AXXA 2DLDA 1FB5A 4XIYA 2F3RA 1TU0A 1PS9A 2E4XA 4LF9B 1L7VC 2V55B 1XU4A 2DG2A 3JQAB 4X60A 8ADHA 2WZQA 1QYVA 4OHZA 1XUOA 4PSAA 3KYCB 3QF4A 2WLTA 4L22A 2YNMC 4QICA 4BLQA 3EUFA 4GGOA 1OXTA 4LHEA 5HKKA 3UXHA 2VQ6A 2BFNA 5JAOA 4PV7A 3EXFA 5AVTA 1JHXA 1PQPA 1PJTA 1RYHA 4EKGA 5PGMA 1C81A 4AMBA 3ICVA 3K15A 2XCSB 3UBTA 1NUQA 4L57A 4OLHA 1NIJA 4QUJA 4BQOA 4RD4A 4YV1A 2ZYDA 2QUJA 2KM1A 4XVQA 5H5JA 2HMVA 2WAYA 1JLRA 1VYTA 1ZINA 1KEEA 1GT91 1BVRA 2ZT8A 1P7PA 1XZCA 1IBRA 1DQSA 1GHTA 1QH9A 2WJZB 1QFYA 2QQ0A 3H5WA 3JAKA 4IIJA 4M46A 1XOIA 3OHSX 3OQIB 3PE4A 2FPLA 4X63A 4O63O 4B4VA 4RF5A 1CUGA 1XMIA 3SC6A 2ZRGA 2C94A 2VYND 4Q03A 5HZHA 3UA4A 3O73A 2BEWB 5JSHA 1Q7CA 1H1LA 2IEDA 3Q8MA 3GY0A 2B0JA 2YWEA 4BC0A 1OT5A 2B3DA 4ZTBA 1FP4A 2PM8A 2QS9A 2FUG6 3FWYA 1M5UA 2QVLA 3NXSA 4ZFNA 4JEHA 1HZZC 1S01A 3H1PA 5GY7A 3SX0A 2VQ3A 3TLMA 3VZBA 4C4OA 2WHPB 3TE7A 4X00A 1ZIPA 3PTLA 3KYDB 2JGJA 3IILA 4NZOA 4JN6B 1KP2A 3HR7A 2HIGA 3MWEB 1FFAA 3DLAA 3RH0A 1JX6A 1NJFA 1W85B 1IN4A 3WKDA 4BNUA 4U3JB 1GKLA 3C98A 3OG9A 3SHQA 3H8SA 3KTOA 1HZZA 4P0QB 1HUQA 5JV5A 3IP1A 2H2IA 4NEGA 1UFKA 1U28C 3KUCA 5IKPA 4TN5A 2XYQA 4U7WA 3G1TA 5DNCA 1B73A 1N7GA 3P9YA 1IUKA 1ZQ9A 2XTZA 2XXAB 3WTBA 4JKIA 1DO8A 3F5SA 3IKJA 2HJGA 4L3WA 3RJTA 1GWNA 3AW8A 1XKLA 3N28A 4A36A 1IBCA 5K8UA 1L5VA 3NH9A 4DWJA 2CN1A 2VYNA 1C1DA 1AF4A 5HIMA 3GUVA 4W5RA 2OBNA 1M2OA 3N5CA 3RHSA 3CIOA 4RANA 4YAUA 2QL9A 3LKBA 1M33A 5AW7A 2XUOA 1E5LA 3IBYA 3LUJA 4YJGA 1JAZA 1M10A 3K4PA 3B6JA 4FEYA 4UUQA 5SZKB 4DEVA 2ZSHA 2GHRA 2O8FA 2UVDA 2C3UA 4F2DA 3SGLA 2NUTB 1LQ2A 5FUBA 5CB6A 1G41A 1PFUA 3LA6A 3DKVA 1MX3A 2VP3A 3E05A 2Q8QA 4E88A 3QOXA 5GV8A 1XGKA 4O33A 5FQOA 1Q1QA 1JKXA 4RHXA 3PNOA 2J0UA 3TI7A 3ZQUA 2IYQA 3NPAA 4RIIA 4PYLA 4Y2RA 4GKJB 5LZ5A 4REQB 4H4CA 4AJ4A 2CXHA 4JJAA 2HRBA 1G55A 4M6WA 4NLLA 3B9QA 4NE7A 1IN7A 4GX0A 3HXQA 3AUFA 3NHYA 5FWNA 5BWOA 2VHWA 4DJAA 4L3VA 4YA6A 2CLKB 2JLZA 1GYPA 1LBSA 1Q1ZA 4BX2A 1C9KA 2XWQA 2DQYA 4RZIA 2EFJA 5ENVA 2R5NA 3ROQA 2CCKA 1SG6A 5ESWA 5T7BA 1OH8A 1LLFA 4ZIRB 3RTCA 5BP7A 1IN1A 3GIDA 2BLLA 3TOCA 3R0ZA 4OFZA 3ETEA 4BNVA 5K01A 3BCRA 3EDCA 1NE2A 4GSLA 4Q4HB 5HEKA 1XJWA 2VRCD 3MJEA 3PLNA 3AO0B 1XSEA 1W9HA 1G8SA 3CRNA 3ILYA 3VZCA 3PNLA 4F72A 3QZUA 5I47A 5G41A 3PJGA 3RRMA 5DNWA 1VE5A 1U0EA 1J2UA 1Z22A 3IDOA 5DOZA 5F51A 1T0BA 2HLDD 2I2DA 1OH5A 3ECAA 3I4CA 4LDJA 1OZAA 1GPDG 3BK7A 4RV4A 4M53A 4MP8A 4EMTA 1ZRHA 2YJGA 1ZVMA 1YIAA 1U0HC 3DMNA 4Y30A 3G88A 5EQTA 4U02A 2JATA 4L8GA 3U4DA 3QMMA 1JB1A 1Z2CA 3QBVA 1JHZA 5JANA 1VPLA 4NCKA 4C0LA 4DBVO 4A4DA 4Q4AB 3T9AA 3I5XA 2VSFA 3D4BA 5ALGA 5FLKA 1XZMA 3CWZA 1JVBA 4RDHA 5JFGA 1QTQA 4MOWA 1G7SA 1GG8A 4PVCA 1L8AA 2XCIA 4HAWA 1EX9A 5HQTA 3GFBA 4OYRA 1LNQA 4MMZB 2GXAA 1WAMA 1XNGA 3HY3A 4N3CA 3C15C 5JXJA 1SY7A 1HTTA 4LGMA 2R8YA 3PXEA 3CPSA 1P4AA 2LKDA 3G13A 3K5IA 2WINI 3N2GB 5CW1A 3FRJA 1RCFA 1M6VB 1ULTA 4MQEB 2P7IA 5G0UA 3WBKA 2H2HA 4M98A 1E92A 4ALJA 1M66A 4LZAA 4O2AF 4EYSA 3BHIA 1W4AA 3O8QA 3SHVA 4WKPA 3HR4A 3ROKA 2G28A 3O1HB 1FE8A 4LBVA 1J70A 1A1SA 1HEYA 4LMPA 1F20A 2QXTA 2IV2X 1P62B 1ZGZA 3QUBA 3I1JA 5I7HA 1DPGA 1C0EA 3DAOA 4P5DA 3WRXA 2V3WA 1Z45A 1C7QA 1DXYA 2C54A 2FZWA 2CXTA 3UMFA 1ZGJA 1NW3A 3AWIA 1OSNA 1VP3A 3OA2A 3NHPA 5IDWA 2QI9F 2GN9A 2P9YA 1LLDA 2ZWPA 2VF2A 3SXPA 2J32A 3GJTA 4RETA 4P4SB 5EWMA 1RKXA 1OH7A 2IU6A 3UAYA 4QDKA 1S6YA 4OQPA 1Z0JA 4K46A 2QI9C 1VRVA 1ZD5A 2DCUA 5MN4A 1DBRA 1FA9A 4IICA 4GP9A 4K6HA 2PSSA 4ZALA 2QVBA 2ZS7A 4TZ0A 3WWEA 4BV8A 5J1SB 4I1IA 4PX3A 5K0ZA 5EP4A 4FEAA 4MLPA 4CV1A 4GKAA 1WU7A 2E5FA 3ENWA 1JHVA 1GEEA 4PYMA 2RC5A 3G2KA 4DCNA 4ERXA 3T5PA 4ML3A 4M83A 3G5UA 4EBFA 3IL2A 1YQXA 2VXOA 1SVMA 3BF8A 3FFXA 2NXCA 3QMPA 4L73A 4OB6A 3RHFA 1QRRA 3UJ9A 2ZTLA 2I78A 5A05A 1EA5A 1NBOA 4R2JA 3SEQA 1K5HA 3PDIB 5EJIA 1RABA 1FQKA 2WF7A 1Z2PX 4BO5A 2BKEA 1M8GA 1L8XA 3UWDA 1EXNA 4HNAB 2VWGA 1KMHB 4DCPA 2Q1SA 2WF6A 2PGNA 1KK1A 3PV0A 4LZPA 2AC2A 1VSQA 4EUSA 2EX0A 3U4GA 3EIWA 4RVSA 1OFIA 3ODGA 4BJ1A 2HM7A 4FFDA 3GJQA 3DKPA 1ZM7A 3FRHA 4D9EA 3VHXA 1NJ5A 3OPVA 4IH4A 3ZI0A 2VXBA 4MVJE 2AJ8A 5TY0A 4C0JA 1G8GA 3W6NA 3NORA 2PL5A 2MWMA 2UYGA 3CSSA 3WK8A 4IIHA 1UEXC 1YB6A 2JAXA 2XD9A 4HNGA 5KYTA 4ZRMA 1A97A 2IOQA 3I9V6 3HM2A 3AVQA 4CMKA 2GT1A 2XTMA 1E9CA 2ERYA 1H3NA 1NBMD 4PQYA 3ZGZA 1K89A 3WTCA 4I5DA 5T64A 1NQOA 2R8OA 4ZREA 1GARA 1GZVA 3GD7A 1RM4A 2BCGY 1F38A 2A9QA 4AW9A 2JA1A 3G2NA 1QUFA 1UOPA 4DJDC 1ML3A 5FJIA 1VL6A 3U13A 3EZNA 2QZ4A 2C1ZA 1GRNA 2ZRIA 4G5GA 4DA8A 3TPZA 1A76A 1CC1S 2VPIA 4BBZA 1APBA 2XYGA 1UUFA 4RTNA 1FVHA 4KLCA 2KX7A 3M83A 3O93A 1XVLA 5HF8A 2WU4A 2KPOA 2IOHA 1MAVA 2RI6A 3JVDA 3OM9A 2WMNB 5G4KB 1QB8A 2FN8A 1KAEA 3R24A 4GLLA 1C3LA 3ZHCA 5CFLA 1FY2A 2C7BA 3WFJA 4RZXA 5KYVA 3F6BX 2O2ZA 1T2AA 3G8AA 1WB9A 4ZVNA 1FNCA 3BXZA 3JQ7B 1ZK2A 2HPHA 5ELLA 4EB8A 2XHZA 4MQUA 3DAGA 2QSJA 3IMCA 1E59A 2PZKA 2B36A 2P2DA 4X61A 3FFBA 1MR3F 3IH5A 3TLCA 3COYA 4FE7A 5KBYA 4NXNB 2X0KA 4E5YA 3KYDA 1CB0A 4G4SO 3ZR4B 3ZHVA 5KDDA 2I91A 1ZQ1A 2Z58A 4N18A 2P4HX 4TLEA 2VNKA 2DWUA 3R5XA 4LRQA 3TLKA 1N2OA 4DY6A 5AT1A 1CF4A 4LHYA 3ETCA 2F67A 1OGYA 2O48X 2ZU6A 1FL9A 5JI2E 3RIXA 4Q7EA 4Q6BA 4I1UA 5EJ6A 1WP4A 4JBXA 4BCCA 4MKRA 4NBUA 1NQVA 2I22A 3L6EA 3LS2A 3E58A 4U7TB 3OM8A 3KJIA 5B55A 2NN3C 2D54A 3EDQA 5BWMA 5KVAA 1KWGA 5IDYA 4XPZA 1MVNA 3V4PB 3SHTA 2VI5A 2C0CA 5BR1A 3GUUA 3ICWA 3LBIA 4PSCA 3RU9A 5IXYA 5KPDA 3FFAA 1W5AA 3PE3A 5TQ0A 1GG9A 3HCWA 2ZVDA 1ZIXA 4DIOA 1W7AA 4QVGA 1SVKA 4ND4A 1ZI9A 3O92A 1OC2A 1TU4A 3F9CA 3C1TA 3JQ6A 3KD3A 4UZFA 5ITZA 4RAOA 4CM6A 2ZS9A 3AW9A 1Q16A 3LT5A 4JI3B 5J2TF 3UYLA 4EB6A 3TQRA 4IIJB 5B4TA 3AEUA 3IAFA 3MPUA 1G63A 1NQUA 1U8TA 2I8CA 3ABZA 1Y9AA 2GPBA 3MRVA 4TTTS 4V0SA 5ERXA 3X1XA 5KTRA 5LL6P 4L4XA 2FUG1 1FJGB 5GIPE 4EZIA 5KTNA 5AICA 5K3EA 4QULA 2CLSA 3HU2A 3SKVA 2JI8A 2QGZA 4IJUA 1YS6A 2FMTA 4AWAA 4ED9A 1IE3A 1SHZA 1U11A 5BSMA 1H5UA 2X4LA 4P54A 5D3ZA 3U7QB 3GQBB 3DP9A 3QG1A 5F2NA 1I1OA 4EI8A 5H59A 4C2UA 1P39A 3KLOA 1WUJS 4EF6A 2ZIAA 3QF7A 4P1ZA 1G3QA 1N9ZA 1ZH6A 1QTNA 1CEQA 4DWVA 1QMGA 4UPDA 4LJ6A 1NVVR 2VWHA 2O57A 4EGJA 2EYQA 2H4XA 3CLTC 4W5QA 1SXIA 4CV3A 3F6PA 1KI9A 1G7TA 3SQMA 3M1YA 2I7CA 4B6GA 4ZT3A 1W25A 3KLNA 3PNSA 1J8FA 1G66A 3EZLA 2MCFA 3TFWA 1AUXA 2WIFA 1P75A 3RUEA 3NALA 1SKYE 2C5FA 2ROQA 1PZGA 2OZLA 2RG1A 3KOZA 4P7FA 4IY1A 7REQB 1NONA 1P2TA 1MB0A 3PUHA 3EOBI 3I28A 1KS9A 4HVAA 4M0MA 4XIFA 4KO3S 5EUMA 3RBVA 4DLZA 5K0LA 1HLPA 3HC7A 2J3JA 4NYIR 1WW2A 2QVCA 4KVFA 2IXFA 2C97A 2FW9A 3KKQA 3PC8C 4HZGA 4C2AA 3KQWA 2W42A 1GDTA 5DGCA 1TADA 4BVKA 1GFWA 4E14A 3E22A 2BH9A 1DJNA 1K08A 3K0KA 3RODA 2Z6QA 1ODTC 4Q4AA 3DW3X 1S4MA 2H5LA 4W9MC 1X7ZA 4UCFA 4B2LA 1Q1AA 3KZ1E 2ONCA 4D8YA 2XYRA 1T5OA 3DFUA 5AVSA 2B1GA 3A06A 3V7UA 4AMVA 3A1FA 4CKWA 2BE9A 4BDTA 4P7GA 2YXPX 3VAZA 1GZSA 1Z5NA 3IMEA 1PNOA 3CYFA 3I23A 3WNQA 4IJMA 3QPUA 1X92A 3T06B 4MI6A 2D5CA 5LD2B 3ZE7A 3OA0A 4KUEA 2FNAA 4I50B 5H3HA 2GAIA 2NO5A 1JSCA 4ZU1X 4E33A 1C4WA 4CHTA 4QIHA 3TWOA 2B30A 4HS9A 4C7OA 4CDMA 1H93A 3ZY3A 1UM8A 4FFSA 1NI3A 5HDQA 4L0DA 1MO5A 3P4YA 2V8BA 4MUJA 4Q66C 1E64A 4QLOA 2AZMA 4U39A 2X77A 4UASA 5FJJA 2WB2A 1O6BA 4WEOA 1QX3A 2JVKA 2JK1A 3K6KA 5ICCA 2V4MA 3GO4A 3TI9A 1K8RA 3ZXSA 3OOJA 1KU6A 5AM0A 4HKTA 2YYAA 1SZDA 1Z56C 2BGKA 1K27A 2R8PA 1PVDA 3VR5A 4B44A 3E2IA 1YOVA 1R2QA 3EPKA 2HCRA 3Q5DA 1YFZA 1QWSA 3A6ZA 3PVCA 2YJ4A 3QPWA 2KBEA 3O91A 4TT8A 4ZV9A 3DKKA 4GHWA 2X1VA 4MQ6A 4J75A 3UO8B 1IBKB 1AKWA 2R7KA 2ZYAA 4J7UA 2XMPA 5LXTB 4K0KB 2Y0DA 3JQ9C 4OU4A 4OYYA 3EVZA 4EEZA 4I5FA 1ZCJA 5ITWA 4YJ2A 1S96A 1ODLA 4LYDA 1RQGA 3F7NA 1E79A 2ZE6A 4DJEC 3UAXA 1MH9A 3ET5A 4ECEA 4Y6RA 4IDGA 2NU6B 2Q1TA 1WDLA 3LX5A 3BTUA 3P27A 1CDZA 4L95C 4R1QA 5LBIA 2KI5A 3GMDA 4XDYA 3WLIA 3KZNA 1JMVA 4AUNA 1OFGA 1SC6A 2AMVA 2HFJA 2XUPA 3UHAA 3VZSA 5IABA 1VLLA 2Q45A 5EXSA 2XB2A 5IDQA 1JSXA 1Q1GA 1N5DA 1U7TA 2VYVD 4E5PA 3RVPA 1Y5RA 3PDJA 3CW2A 3NWJA 3RFXA 3WRVA 2CJPA 3ICEA 1FDRA 4JLNA 4HRYA 4H0NA 1R0CA 2CLFB 1S8NA 1AQNA 2HJVA 4E5DA 1YS1X 3UXMA 1GKKA 1N6NA 3AF6A 5LKRA 3AFHA 5I7EA 3NKVA 3FWNA 1OX4B 4POAA 5D2CA 4YP9A 3AVUA 1Z7GA 1BMTA 1N5OX 2PA3A 4TUYF 2X0EA 3O4GA 4IJ6A 3K73O 4O02B 2NQTA 3RKRA 3DM5A 1G6HA 4BWGA 4L8VA 4QOIA 1KGDA 1DADA 4HB4A 1B8PA 4MWEA 4NKRA 1CR0A 1PK8A 2PTHA 2W90A 4R3UC 1XTTA 1SVSA 2K2QB 4FJ0A 3SZOA 4B6SA 4O4HB 3LCUA 4PAGA 4YECA 3FW1A 3CF2A 3DOEA 3SX2A 1KJ8A 1OW3B 4IPTA 2P35A 2G6BA 1Y1RA 4QBGB 4Y2HA 1P7VA 1COWA 2B8NA 5ULLA 5TPZA 3KCQA 1DFGA 2O2SA 1DX4A 3F2VA 5B36A 4L72A 2IPLA 4X20B 2MSNA 2RB5A 3LPMA 4A0SA 4CMIA 4ZGWA 1M7HA 3DEIA 3NVAA 4HNQA 4WZAA 1PAUA 4IH9A 1N5LA 5FTKA 3DMTA 4MGZR 3F6RA 3SIXA 2HADA 4PNZA 4KDCA 4JU8A 4YONB 4AICA 1WVGA 3K5WA 4QM7A 2BEVA 4Y67A 1VQ1A 1JG7A 5IAEA 1QYXA 2A58A 4NH0A 4YJHA 3F5DA 1LBQA 1KZ6A 4FCCA 3FDFA 2PAAA 3LD9A 4XLLA 1JDZA 1RRPA 3QLTA 5GJBA 3S2ZA 1LNSA 3QVJA 3S1AB 2W6OA 3G9TA 3OOSA 4NH4A 2F1JA 1V3VA 2BBOA 1U1DA 2ZIXA 1QIEA 2JHCA 4K03A 4FYHA 4P3NA 3TLEA 2CLDX 2O7SA 2FOLA 5AHRA 3UM9A 5DXAA 3R2JA 2ILTA 1O03A 3BRCA 4CFYA 2A5JA 2IHVA 5JMPA 1O87A 5KSZA 1MO2A 1FFBA 1U2DC 1WVIA 2I5PO 1LDEA 2NZ8A 2ZYGA 3DZFA 2YXLA 3EF1A 3BXFA 3FMGA 4KAJA 3R75A 2XCRB 1FRFS 2WJJA 3OPMA 3NJ4A 5IC5A 3LKZA 3I3SR 2Y1GA 2FAXA 4RZ2A 3PD0A 3STYA 1W5BA 1RIFA 1XJ5A 2C5LA 3HA3A 5K03A 1SULA 4CEJB 1TYAE 3BAFA 4Z99A 1T43A 3DV0A 3SSAA 1MAAA 3QFRA 4K40A 5ITZB 4HB0A 4L1KA 1U3UA 2RHLA 1E8DA 4IV8A 3C5WP 1O94A 4M1WA 2VCHA 3MTJA 3DWGA 4A2QA 5K6AA 3PGVA 4REOA 5A3RA 4UU0A 3RS8A 3BTVA 4V03A 1WLYA 5AKLA 2QRJA 1SKQA 1GPAA 2AD1A 3X3HA 3VO9A 3UC5A 5JVDF 1O4VA 1M8FA 4H4EA 1C30B 4FFBA 2ZP1A 3GAAA 2VF7A 1I5EA 4TX1A 1N6PA 1SXGA 1T5BA 2OYRA 3NOOA 1PJZA 3Q2IA 2XQIA 5AIAA 1IJBA 5LR6A 5DDIP 2BFOA 2YDYA 5HF6A 3U49A 3U7GA 5ED4A 3C7TA 1JDJA 1NW9B 4YRIA 3TBKA 1SXQA 3N87A 1Q3TA 4RF4A 4LSGA 3K2EA 3X1JA 2HDHA 4DUGA 3VPHA 3EIUA 1E6WA 4BLSA 2LDBA 4XIJA 4HSEA 3RYHB 3WJ1A 1F14A 4J4BA 3T15A 3K70C 4BQIA 4LMBA 3RVQA 3HCNA 5AUOB 4BB9A 2R11A 4QG7A 2C2OA 3A3NA 2P2NA 1M54A 4N9QA 1V5FA 2XQGA 5AJXA 4FUTA 3U7JA 3V2HA 3EDMA 1HF3A 1RU3A 3BICA 5I8ZA 4DNPA 4Q4JA 3BDVA 4Q7MB 2AE1A 5HQJA 2HF2A 4GWGA 3RYFA 3C8DA 4TYNA 1SUSA 5EYPB 1MQ9A 2XXAA 3KTDA 1YQEA 1FDOA 2DAPA 2XITA 4YQYA 2EGUA 4GVXA 5AR1A 1N8KA 2XV1A 2UU9B 4M1SA 1PJAA 4X64B 3ZWYA 1GPH1 3C5HA 3OX3A 3P5SA 4KGXA 1MRSA 4W5WA 4RTQA 3JR3A 1Y3BE 2ZAMA 3LA8A 1YXMA 3HDTA 3MSXA 3RVSA 3ILHA 3NW9A 1NVBA 3T1QA 2FRXA 1F0NA 1V4BA 2YWHA 3C5VA 4MRMA 4AY4A 1RC1A 1H22A 1GUDA 3Q9NA 4JP5A 3THRA 1ZICA 4ZCIA 3K35A 1OYYA 2QQ5A 4RS4A 4FGLA 3RRXA 2FW1A 2NWQA 1M73E 3IKTA 2BF7A 5L7YA 4BNGA 4CKCA 4FS8A 2EATA 1XL0A 1FSFA 4IEFB 4UU8A 1NX9A 3FYTA 1ABEA 1KI3A 3COZA 1C7JA 4WVFA 5DYYA 3R7WB 3UAVA 2BBTA 4X45A 2XT6A 6AT1A 3LI2A 1FNSA 1GA4A 1YVEI 3I64A 4PTYA 4B84A 5K20A 1JIJA 4DBZA 3A4TA 3LWDA 4S35A 1PD0A 1SC4A 5DTRA 2BI4A 4JELA 2J59A 1UADA 2F3PA 2Q8NA 4O2AA 1XLWA 3JZIA 2FPKA 4QPCA 4AP9A 1ZJYA 2JB9A 5JZVA 3UWKA 1XQYA 4NBWA 1AG9A 4UPVA 3TNYA 1KY4A 4WERA 1VP9A 1Z6GA 4BGIA 3P4UA 5GAJA 4DJTA 2PD4A 4MVJG 4U2BA 4A6DA 1WD5A 2GZ1A 3TW8A 4LV8B 4FOPA 1CNFA 3R3HA 5CU7A 2J6CA 2AN1A 3RBZA 1E4EB 5DBFA 2IYUA 4WQMA 1NNEA 4G4SP 1ACLA 3PXDA 4P8RA 4F60A 3MWFA 1PKXA 3WKEA 4BFYA 4YB8A 2O8VA 3OOHA 1RI3A 4Q02A 4UHEA 5ALDA 1M2GA 3FNGA 2CZQA 4GL4A 4ZANA 3UK0A 4UHDA 3UMMA 4B6OA 2VTBB 3LCVB 1A9OA 1GN9A 4MYDA 1CUAA 3TTVA 5AMXA 2O8CA 2Q3HA 5FHRA 4E6PA 3SJBA 4GUDA 3CPEA 3SYRA 3PDUA 3ZN2A 5LNK1 1Q19A 1A9YA 1XMVA 4N12A 1VYVA 2OB1A 3RWBA 4LYEA 1KJJA 2C7OA 1TA0A 1Z5OA 2R751 3DTTA 1NLFA 3MMPA 4UEJA 3TLYA 1PKEA 2XNDD 1U7HA 3H4TA 1MJNA 2CYCA 2I34A 1V6CA 1RRKA 3Q1KA 1F2UB 4M7WA 4TUYB 4D8WA 2PLRA 4PWYA 1N6LA 4DLLA 1Z0IA 2DT8A 2XODA 4PPNA 1IPHA 2H3HA 2PBLA 3MCUA 4RZSA 4QJ4A 3ZWVA 4Z2AA 2XKBA 2CVFA 3NDJA 4NJMB 2VHYA 3PEEA 4YPFA 5DNYB 2A8YA 1HZJA 2AV6A 3EC2A 4GOMD 1R88A 4L50A 2QG4A 4RMHA 3R76A 4RDXA 2Z95A 4LVNA 5A7HA 3DE6X 2VRWA 4L5BA 3W7AA 4L9AA 3OEHD 1G3MA 2QMOA 1RFGE 1Z6PA 1E1RA 3HB7A 1E3EA 4DQXA 2BHLA 4R1TA 1PGOA 3TTXA 4LVCA 3LPAA 4DYHA 1W9MA 4KQ9A 4ENSA 1XZAA 4W8HA 3PTZA 2AYYA 2ZJ4A 1GRQA 4RVFA 3BT7A 1VJ0A 2DFNA 3C4QA 4WK6A 4B7AA 3A3YA 5BSKA 1F2DA 5AW4A 5M7EA 3DHVA 3OZCA 2EZ8A 2Q2WA 3ETGA 2BKLA 5F35A 4RJIA 2EQBA 3L0PA 2OCXA 3KOXA 3CZ9A 1R37A 5IVIA 2D74A 2ZG6A 1S7CA 2YFQA 3RSOA 4QU9A 3ZHRA 3CV3A 2J9RA 2G1KA 4DT1A 5LYYA 3I0MA 2XB9A 3L9XA 1NVEA 3FTFA 1E9AA 4BLPA 1K7SN 4Z86A 1VPWA 3DQZA 3LW8A 3JWIA 3TZCA 3WDMA 3NBKA 1PEAA 1TEXA 4ZEVA 5A4AA 1JG3A 2ID8A 3NGXA 2VDOB 4IMRA 2QGNA 4EG6A 3EXEA 1SBTA 3BCUA 3V42A 2A9VA 3A37A 1YASA 3QWBA 3EG5A 1ZS9A 2G40A 2ECPA 1NKSA 2WC1A 3I2YX 4Q05A 5KNCD 4E94A 1SCNE 5FUWA 4W7HA 1PJCA 2ZR0A 4DG5A 3PIIA 1Z6AA 3ZEAA 2A9KA 1EGHA 2NSJA 2NO0A 3AIMA 3EXHB 3GJZA 2AQIA 2YHBA 3G1WA 3AB3A 3IP5A 4M9UA 1M8JA 3P52A 4ENRA 1SC9A 2BWJA 4WLEA 3L7OA 1MOSA 2MINB 5DX8A 3UK1A 3CLSC 2XF8A 4TWBA 3ZWPA 5A2GA 4FYXA 4JLSA 2H51A 2MDTA 1D4FA 1CIVA 3KIPA 3PXBA 2W22A 5DNEA 2ORED 1U1CA 1O7JA 2D2EA 3UAGA 4GX2A 4I08A 1XV5A 3EZ7A 2H5EA 3OE7A 4B2YA 5L6LB 5C5EA 1XLUA 3R7AA 2E87A 5HKKD 1X80B 1EQAA 4JR2A 4EHFA 1GV1A 1YA6A 1E2MA 4LQDA 5LCXA 2W2MA 1OXUA 3A1TA 1CUYA 3GI1A 5ESXA 5H82A 5IMSA 4TGLA 2GPNA 4MGHA 1QAMA 4IJVA 4YJ3A 5D1NA 4NCXA 4KR2A 5A9SA 4QARA 2YHIB 2XDAA 5EQDA 2C61A 3W4JA 2J3DA 3KJGA 3AETB 1V96A 3ITDA 1XLTC 1QVZA 4K05A 1SQ5A 3I5YA 1IZYA 1OPXA 5I9TA 1FXUA 1KJNA 4YUZA 5AM2A 5C8YF 2CWDA 5M29A 4CR6A 2MIIA 4J49A 5CA0A 2X0RA 2HA5A 3AUYA 4IZOA 3ZZNA 3IR5A 2PRSA 1U2GA 4E4RA 2P9EA 3ICCA 4O4IB 5I6DA 3MNFA 5LUBA 1RPTA 4A0HA 3E1SA 2XH8A 2W6CX 3O26A 1I0ZA 1I2MA 3KNZA 1ZNWA 1W85A 1LPSA 1N7HA 3PENA 1BTOA 2WD7A 3BIOA 3C3KA 4HBGA 2M1XA 1HNZB 2XZLA 4XZ3A 1Z4KA 1XMJA 4B17A 3KR1A 1QHSA 5HOQA 1DFHA 4UM9D 1E96A 3LBFA 4G8JA 3M0EA 1T25A 1X15A 1GEGA 4GUAA 4GMGA 4KQ6A 4M9QA 5EE5B 1CQZA 1H1DA 2H00A 2HW8A 2OO3A 1WXEA 4WL0A 5ICMA 1G5PA 1SUPA 2YYSA 2J9GA 4LE2A 4C01A 3GLHE 3V8QA 1EJ0A 1ECGA 2O05A 4R2MA 4JVLA 3ZZ0A 1DG3A 1NYTA 2JI7A 3A1VA 1JDPA 2AG0A 3EHDA 4EYQA 5JXGA 1M2NA 1UC9A 3QA9A 2HWWA 1WLSA 2BGRA 4WW0A 3LUPA 1I80A 3T4PA 4E07A 4YR7A 1E0KA 4CEJA 1LI5A 5LP6B 1EWTA 2Y0EA 1D9XA 3O38A 1CUIA 3AB8A 3TFQA 3R0QA 3LM8A 5JOQA 5JAZA 2CZCA 3L4EA 1EVKA 1YJ5A 3PHCA 5AW8A 1Z4IA 1P80A 3UMBA 5HE8A 1PF7E 2Z8YM 5JCOA 5FKJA 4MPJA 1GYRA 5GJCA 3O31A 4DNFA 2EVWX 4KMOA 3LC2O 4PRKA 3FETA 2CUZA 2VIIA 5KNCA 1Z6QA 1ZJWA 3GFPA 3NJRA 3ABSB 3G2MA 1UCFA 3KR0A 4MQMA 1Y4DE 2O2GA 1T2DA 1FUKA 2PIAA 3F4BA 1D5WA 3IJ5A 2QP4A 4JFRA 4WCDA 1JKJA 1SCAA 4MIKA 4PYKA 1I4EB 4KXFB 5K4GA 1KJYA 5A9RA 4BNKA 4FJ2A 3V80A 4YMVA 3E8MA 3PK0A 3UCFA 1KE2A 2B1JA 3SS9X 4EQ6A 2ZJBA 2VHXA 4L15A 3A1UA 4HX5A 3EPRA 3H7AA 4JR0A 3U3DA 4M22A 3W8FA 3PWZA 5CH3A 2QN6A 2FH5B 1T10A 4FX2A 5GADl 3LLCA 2A1UB 3EDYA 4ZAVA 3CCFA 2HU5A 3HH8A 2HEIA 3DT6A 1CU1A 1REQA 1D6JA 4Z1OA 4B31A 1EXVA 4X24A 2FPMA 4LX0A 2Q0QA 1HQKA 3FZEA 3OWOA 1PZNA 1M8KA 3L2OB 5DSZA 1JKFA 2M6LA 3TX6A 4OOFA 4K6OA 1ZD3A 2YQZA 5C8YB 2GPTA 5LWQA 7ABPA 1LV7A 3ZVLA 1IQ0A 4Y3UA 2NOAA 3HVRA 1I3CA 1QP8A 4GKVA 3MEQA 5E0KB 4RU1A 1I1QB 1YR8A 3LUDA 3V1NA 4C0AC 3IEPA 5I7AA 2ICAA 5KU1A 4KDFA 3VKFA 2Y8EA 2F3QA 3TXAA 1BHJA 2Z5LA 2ZUDA 3AH8A 1AKVA 2V58A 3IP6A 2IELA 1XRQA 4JD5A 3W2GA 4E2FA 8OHMA 1KTIA 3FUXA 2SHKA 4H1TA 5H83A 3SYMA 3PJEA 4NVRA 1T0IA 1SKBA 2XXBA 4RD1A 5CLLA 2F3TA 2RI1A 4QUBA 1SU4A 5BPHA 3KDSE 3LQKA 4Q4DA 4ZU3A 1Q44A 5UKDA 3HG7A 3E22B 4EY3A 5CMLA 5FBLB 4UZEA 3LLUA 3WZMA 1JSLA 1MRNA 4WADA 5D3MA 1G21A 1QONA 2NSDA 3UGJA 4FI3C 4IGFA 2G83A 4NZYA 3USES 2P5YA 4A6XA 1KP3A 2XWJI 4IDQA 4IINA 2QW0X 4IRUB 4XLZA 3MTIA 4ZPXA 5M3BA 3WV4A 4JLDA 1H9AA 3R9XB 8GPBA 1E4YA 2BRUA 2RCNA 2HLNA 4O2LA 3GZJA 5FHQA 5IH7A 4AYTA 3W06A 1WUTA 1F2TA 3LY9A 2AVDA 1WXHA 5LMCA 1SZCA 4O29A 2WSLA 2Y6VA 2XB8A 2C9ZA 3BJMA 4Y9UA 3W7VA 4ZCTA 1AX9A 1S4QA 3SFVA 5BN5A 1KJZA 3BK1A 4WXHA 2CUKA 2ECFA 4CE6A 1HFKA 4R8MA 5IT0A 3TOSA 3O90A 4HAIA 3K0AB 1LSJA 1LVUA 2HX1A 2GILA 4Q5IA 1AV6A 4Q9IA 1YCDA 3KVRA 1P4S