4NDNE

Structural insights of mat enzymes: mata2b complexed with sam and ppnp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
b'IPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase isoform type-2
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 309
sequence length 309
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ndnE00
1BVUA 3BMOB 3RUAA 2CMDA 1DFIA 4Y6RA 1NVTA 4RORA 3H7AA 4GLOA 2NSDA 4ALMA 3OQ1A 1H6CA 3KYBA 1Y8RB 1VJ0A 4CUZA 4ND2A 4WCFA 4RJTA 3WLEA 5F21A 2FR0A 3DAFA 4KTTE 2VHYA 3SLGA 3PLRA 4KUEA 3JV7A 3GAZA 3JQGB 3JD2A 5DN9A 3I6QA 4XCVA 3VTFA 5JXWA 3WNQA 2GDZA 4J4TA 1WDKA 4A27A 2I66A 1Y6JA 1PZEA 3UKOA 1WVGA 4I8XA 1YVEI 3QWFA 2VZ0A 2B69A 1M6WA 1T4BA 3U09A 3D5QA 3PYLA 2VHZA 2PV7A 2CDBA 5IAAA 2JD1A 3E1KA 5FYDA 5CG1A 1HETA 4O6VA 1YBMA 3ZDFA 1ENPA 4FFOA 2ZTLA 2D5AA 3LQFA 4PLGA 3NEPX 4PRLA 1VL0A 3FWNA 1E77A 4RPKA 4RPJA 1M67A 3RC7A 5I9MA 4MKXA 1ISJA 4KDFA 4CR8A 5C7LO 1C1DA 1L7EA 2J3IA 1C0KA 1E3IA 2AG5A 2IEDA 2AEMA 4GX2A 4JIGA 3WQQA 3DQPA 3F4LA 1UDBA 4YAEA 2NTVA 2XXBA 1W8DA 3Q1LA 3ZW9A 3AWDA 1X13A 3U4CA 1QORA 3GVHA 2AMFA 2JFGA 2ZYDA 4O1MA 2VUUA 1PS8A 4B79A 1YKFA 2G17A 3DONA 1FXSA 1DAPA 4J3FA 3AM3A 2VZ8A 3WQSB 3BAZA 5K6AC 3DZKA 3QA9A 4DQUA 2AEJA 2H5LA 2X58A 3ZCXA 5G2OA 1NNUA 2YHUA 4NQZA 4AJ4A 4EJ0A 3PHJA 3M6IA 3BA1A 4NR0A 1H6DA 2Z95A 2ZYAA 4NU6A 1NR1A 4YYZA 5I7VA 1T2DA 1GQ2A 1PR9A 4XRGA 3ENKA 1B16A 1MG5A 1K0UA 3OJLA 2BGKA 3DBHB 2PGLA 1VSVA 4P4LA 4FJ2A 1E6WA 4P4GA 1N9GA 4DXHA 3ITDA 3ITKA 4D44A 4CODB 5ENDA 1V3TA 2R6JA 3JD3A 5BSFA 1Y5RA 2BD0A 2ZCUA 2PK3A 1E3WB 4WLFA 4DUPA 1QG6A 2X1HA 4BV8A 1AHHA 2I99A 5TRTA 1KIFA 3UUWA 3GZNB 4BKRA 2ZB8A 4IDDA 3WYBA 2W2KB 5A3JA 1E7YA 1ZMTA 4J1TA 4CM9D 4Q3DA 4ZD6A 1YB5A 1H94A 2P9GA 4DPLA 1VL8A 3K8ZA 5T57A 3WB9A 3ZWXA 4YRBA 1U28A 4CMAA 2DTDA 2I76A 4PLFA 1LDMA 3SJ7A 1ZFNA 3Q9UA 3VH3A 3WG9A 5TC4A 5G0SA 5DP2A 3ROMA 1UXJA 3HN2A 1O5IA 3VOSA 3UCEA 2VOJA 4LW8A 1UAYA 3NX4A 2Z1NA 3PP8A 3GVCA 1GYRA 5A02A 5BT9A 3ANLA 4XYMA 3ZU4A 2PZKA 2AXQA 1WDLA 5DZSA 5FWNA 4R68A 2BLLA 3GDGA 3GPIA 3KRTA 4WLVA 4R1UA 5EJ2A 2PWZA 3KVOA 4LMRA 3PQEA 1R6DA 2QHXA 3B1KA 2H6EA 1UR5A 3OICA 3QP9A 1P74A 3LVFO 3PQFA 4WLNA 1TVEA 1ZNQO 4EZBA 1SCUA 4Q3EA 1LSUA 2UYYA 3W6UA 5JYEA 2NACA 1ZVMA 3GRKA 3KYCA 1SOVA 1U9JA 1JW9B 5L4LA 4II2A 1DJNA 3NUGA 3VVBA 2DAPA 4I9UA 3KXDA 2D4AA 1D7OA 4XB1A 5TJ9A 3D4PA 4AJ1A 2ZTUA 3G3EA 4TVBA 2Y67A 2NVUA 4NG5A 1I24A 2NVWA 3INTA 4NJOA 3PJGA 4M54A 3TWOA 4GGOA 4ZQGA 2WWRA 3IC5A 5HWSA 1ONOA 3LYLA 3GZ4A 1BSVA 4OL9A 4BHTA 1BVRA 5TT1A 4M1QA 4JNKA 1ORRA 1RM5A 1U7HA 4W7IA 2EW2A 3IKTA 2DBRA 4QO7A 5H83A 1I01A 2X7HA 4IDEA 1EBFA 1UDAA 3H6KA 4BNZA 3H3JA 2YV2A 3CMMA 4OAQA 3ETEA 1ZCJA 3D5TA 2LDXA 4IM7A 3KV3O 2O3UA 5KCZA 1PGPA 4PZCA 3WGIA 3KTDA 1U3UA 1KC1A 5JYDA 3JQDA 3AU8A 3GN2A 2Q3EA 3DWFA 3NDIA 3GEGA 3OH8A 3IMFA 3TFOA 4RVUA 4Y98A 3HDYA 5KWEA 2O7QA 2GASA 3PIIA 8ADHA 4BS9A 1T2FA 4BNUA 3X2EA 3L0DA 1E5QA 2JFFA 4QFCA 4GH5A 3AM4A 1EVYA 3OMLA 4HUJA 1E6UA 1VE9A 2YFHA 3DBVO 4I08A 1KOLA 2VTDA 4XYLA 1VPDA 1ZJYA 4LRTB 2VCYA 4JN6B 3S2EA 2EJWA 4BNXA 3PPIA 1SOWA 3MEQA 4RPHA 4TQGA 1AE1A 2XF8A 3T7EA 3WR5A 1EMDA 3GLQA 3LLSA 5KJEA 4DPKA 3PZRA 3VKVA 3ZN2A 3SVTA 4JJGA 3OIDA 4A10A 1Q0LA 5THKA 3L6DA 3AFNA 3GT0A 4FQ8A 4IJUA 2X23A 4YJHB 5I9NA 4TROA 1ENOA 1IPEA 1J0XO 1ZKMA 3ROQA 2X22A 3HFGA 3MOIA 2NQTA 4UUOA 4F6CA 2HAEA 4JROA 3VPFA 2I67A 3ON5A 4JCOA 1A5ZA 4E21A 1A9YA 1HSZA 1N92A 3K5PA 5KIAA 4FBGA 1LTHR 4BO3A 1K6XA 4BO9A 1NP3A 3LK7A 1F8GA 1PQUA 3K31A 3DR3A 3RUIA 1QRRA 1V3UA 4CLEA 1E3JA 3FBTA 1XSEA 5IDWA 4TSKA 2HMSA 4INAA 2FOIA 2C2YA 4CM6A 1IZ9A 3M1LA 1HDXA 2PH3A 3OECA 1SEPA 1V35A 4OGWA 4Q39A 5AXCA 3V2UA 1GADO 2RHRA 1PS0A 4IDAA 2VHVA 1GUZA 1DEHA 4II3A 3KM0A 4IJVA 4ZHSA 1FDTA 1YL5A 3JQAB 2QZ9A 3DBRA 3VH1A 3E5MA 4B3IA 4YQZA 4ONEA 2B4RO 4WASA 4WOKA 3UW3A 4WUVA 1NHWA 1RWBA 3L6EA 4RVDA 1Z82A 1QYVA 3GGGA 4WCFB 1HZJA 3RROA 5F1OA 4OQZA 5CDYA 4PZDA 1E1MA 3AUSA 3JSAA 2I65A 4B4UA 3NGLA 4J6FA 4OXKA 3EVTA 5CPFA 5A05A 5EESA 3I9JA 1ZK0A 3QVWA 5JMPA 5JNLA 2AW5A 1NQTA 2HK9A 3G17A 3NT5A 4GVXA 5DF1A 3VPXA 1YS4A 2DTXA 1N1EA 2NTNA 1DOHA 1YDEA 1K3TA 1Z75A 2WYWA 2Y0CA 1VSUA 1Y8RA 2PZJA 4BUCA 4L74A 2OP0A 3JYQA 3TZHA 5CHEA 4I9HA 1PGJA 1AXGA 4KDEA 4J1NA 5AVOA 3ZWOA 3TF5A 2GF2A 1BDBA 4YT2A 1K2WA 1LRKA 5U4QA 3RSHA 3GVPA 1R0KA 2YV3A 4FPXA 4WE3A 5TS3A 3L4SO 1YDWA 1NBOA 3BMCA 3PWSA 2DFVA 2ZTMA 2CVQA 3RFTA 4EEXA 2GD1O 2WYUA 3RC9A 1E1NA 2P4QA 3HG7A 1MV8A 3PI7A 3P2OA 4AJIA 5GZ3A 5EL0A 9LDBA 4J0FA 1P1HA 1OOEA 2FZEA 3DZIA 4EUFA 2R2GA 4N7RA 4JBIA 2ZK7A 3AUAA 5U9CA 2BHLA 4UVGA 3SLKA 4YA6A 4YAGA 2O7SA 3NTOA 2Q50A 3PHIA 3P19A 3D3WA 2QQ5A 3IUSA 4I9NA 5DOZA 5TNXA 4W9NA 1EFLA 4NH4A 3SBOA 1HL3A 3I83A 1IL0A 2B83A 3P2YA 3WFIA 4N5NA 2DTEA 2NU6A 4G65A 4HNGA 1QR6A 1LI4A 4CMCA 1I2BA 1N9GB 3W8FA 3F3SA 4U8GA 1HZZA 2JL1A 4E12A 2DBZA 2PR2A 3G1UA 1F8FA 3D0OA 5BNFA 4E5KA 1N8KA 3CZRA 1TB4A 2GERA 4YTEA 1H2HA 3W6ZA 4IGFA 3WWYA 4HXYA 3S55A 2HMWA 1IULA 3DZGA 1UDCA 3OQ6A 1ADFA 4OKNA 5JCXA 1I33A 2OUIA 1LEHA 1EE9A 4ITUA 5A06A 4YWJA 5GY7A 1I3MA 1OZAA 2C82A 2HK7A 4ALNA 4J7CA 4ZQBA 2Y0EA 2PH5A 3OJOA 4EEZA 4ALKA 3TZ6A 4F3YA 1YBVA 4MP3A 2QIOA 3JD0A 2JAHA 2EEZA 2VRBA 2CDCA 3LLVA 4GVLA 1E3SA 3HUDA 5GZ1A 1DFHA 5U1PA 2HSDA 3UOGA 3FCOA 3JQBA 4KMSA 4R3WA 4IXTA 1BXGB 1I30A 4A73A 2UAGA 2NNLD 4TZTA 5AXBA 4CM7A 4NBUA 1LBEA 4JXKA 5T67A 5DT9A 3GNTA 3WLFA 1E1KA 2D8AA 3TZCA 2P9EA 3H4VA 3RCBA 1PGQA 2VQ3A 1CRWG 3AOEC 1NPYA 3EYWA 2C7VA 3KSZO 4JP3A 3VTZA 3RBVA 4BNLA 1U2GA 2Q99A 4WJZA 3IUPA 1T26A 3D4NA 3EAGA 2J8ZA 3KYCB 1SZJG 2DUWA 2P91A 2O4CA 3ANMA 3JQEA 2IDZA 1ZO8A 3NGXA 1MXFA 2O2YA 2X5JO 1DRUA 1PQWA 1R4NA 3E82A 1IYZA 2D3TA 4X54A 2OL4A 4AJOA 1Q7BA 3ETGA 4BNWA 5MDHA 1RJWA 2ZATA 1EBUA 3OIGA 3PQDA 1LSOA 2DM6A 1DC6A 2VN8A 5CEJA 3CKYA 4PVCA 4J2HA 5JLAA 5I8ZA 4HFNA 5CFZA 3DHNA 3TL3A 1VC2A 3QWBA 5TQVA 1ADBA 1GU7A 1MUUA 4KWHA 5JSFA 3NJ4A 4OHUA 2V7PA 1DO8A 5HM8A 1RYEA 3WGTA 4MVJD 3ROPA 5IDXA 3PJDA 2HO5A 3WYCA 1XR3A 4CLOA 1P45A 1R0LA 1KVQA 2OBNA 4K9DA 5FI3A 2IYOA 4BO0A 3LT0A 3NYWA 3A9WA 4J91A 3HHPA 1NVGA 4R51A 1IY8A 1HE4A 5F5LA 4BGEA 4IS3A 3INGA 3F1KA 3SX2A 4UVEA 4BQPA 4XJSA 4ZN6A 2FR1A 3FR7A 2HRZA 3C24A 1E7MA 1NM5A 3BYZA 4CR7A 1T24A 4RLHA 1GCUA 1MX3A 2X0JA 3GEDA 3U4IA 3ZV4A 4EGFA 4XGNA 4DRYA 3KYDA 2JHGA 1LDYA 2NTJA 3H9QA 1K6IA 1YJQA 1BG6A 1MA0A 2VT2A 2XAAA 4DQXA 1S6YA 3OJFA 4W82A 2JD0A 3AY3A 2BFPA 4LK3A 1T2CA 4PIVA 4ZQFA 4RF3A 3DOOA 1P1JA 2OOSA 2X9VA 4NDNE 4RL6A 1HLPA 1I0ZA 1P1IA 2X6TA 3E6AA 1WZIA 3RUEA 3O9ZA 4GMGA 4WOJA 1SEVA 2C7GA 1XCBA 1XLTA 2ZB7A 4WKGA 3HJAA 3IQDB 2HUNA 1A4IA 3IIEA 1ZSNA 5L7WA 2JKVA 3MJTA 4OOFA 1O9BA 4XEHA 4AJKA 4YEDA 3AW9A 2DBVO 3GDOA 3DHYA 1IHXA 4YBZA 1IB6A 2O3JA 3FN4A 3V1YA 4WK6A 3M2TA 3WGZA 4AVYA 1LSJA 4PLPA 4CM4A 1JKJA 3U0BA 3ZV5A 3QWAA 1S7CA 4ND5A 1JVSA 4BVAA 3QVXA 1ULUA 2HCTA 1V0JA 1O0SA 4IJWA 4JJIA 2FN7A 2GSDA 1PZFA 1UXIA 4BO1A 4Z9XA 2CUKA 1V3VA 5C37A 1Y1PA 3F47A 3DBRB 3L9XA 2TMGA 3I52A 4QXMA 4BGVA 3KO8A 4LSMA 5BQFA 3HFSA 3JQCA 1FDWA 2QRLA 1Q0QA 2XPCA 2HKIA 1YBAA 1EZ4A 1Y5MA 3PDJA 3RBXA 3I9LA 3GH3A 3AOGA 4OSOA 2AE2A 3PHHA 4IQGA 3LDHA 4NBTA 4YVFA 1I8TA 3PYMA 4HKTA 2OORA 2TMDA 4HP8A 3RC2A 3JYPA 4DL9A 1O8CA 5ER6A 1E5LA 5L40A 4MIEA 3UICA 2OBYA 5KJ1A 1G0OA 1GV0A 1VI2A 3ABIA 5L7TA 5COAA 3A4VA 2VUSA 4PLYA 4RDIA 5DBIA 3INRA 2B5VA 4B4VA 4BO6A 3I9KA 3N74A 4M8SA 1I10A 4ROSA 4CMBA 3JQ9C 4D0RA 5JDCA 1T1SA 1UXHA 1GDHA 2GN4A 4UREA 1LQTA 3UAGA 3I9OA 1G1AA 2ZYGA 1P77A 2DFDA 4DPMA 4Z3KA 1SO8A 2HRBA 1QXSA 2VTEA 3VZPA 5B4TA 4WECA 2GN6A 2EW8A 3PJFA 1M75A 4H7PA 3D3EA 4R9SA 1VLLA 4IBOA 4XIYA 2EG9A 5JPIA 1DHRA 3RJ5A 4LVUA 1XG5A 3BMCB 1X14A 3QVOA 1KEVA 1U4SA 1R16A 1ZXLA 1ML3A 3F9IA 3BHIA 4BNJA 3DEYX 4TRNA 5G4KA 4FFRA 4DA9A 3ADOA 5DOVA 3AJRA 3BHMA 3FD8A 4YT4A 3EDMA 1OBFO 2EKLA 4MO2A 3H9EO 4TKLA 3E5RA 4Q9NA 1E7SA 1EVJA 2YY7A 4JBGA 1YL6A 1HLDA 4XGIA 3CPSA 4M55A 4XYGA 4Y8VA 2J3HA 1SBYA 2VYNA 2RHCA 2R00A 1EDOA 4QO8A 4BB5A 1EK5A 4MVJP 4NBWA 3RC1A 3D3WB 4J90A 3W4KA 2Y93A 3ICCA 2F00A 3RU7A 1JN0A 5JAZA 4A26A 2A9FA 2Y66A 1Q7GA 4MVJH 2E6UX 4OKIA 5L3ZA 1EQ2A 2NVBA 2DKNA 2Y1OA 2VYND 4FOOA 4UAGA 4BKQA 5BR7A 3IAHA 3KEQA 3T4XA 5DDIP 1B8VA 1GAEO 4RQTA 5TLSA 1F12A 2EP7A 4IPTA 3WWZA 4IZIA 3WDSA 5ES3A 2BMAA 4RVFA 3QVSA 5B12A 2GR9A 3IS3A 3D7LA 4GL4A 3ZHZA 2J3KA 3VDRA 2P68A 4BGIA 1OFGA 2O2SA 2YQ5A 5ADHA 4KTVE 4S3MA 2X0NA 3UGKA 1X7GA 2X5OA 1HF3A 1CERA 4BO5A 5A03A 4DGSA 3MJEA 1Z6ZA 4NPCA 4B4OA 5T8KC 3HDQA 3GGOA 1KEUA 1AXEA 1WNTA 1ISFA 3ZZNA 4UEKA 4CM9A 1KC3A 1PWXA 2RIRA 1NPDA 1OMOA 3A28A 4AFNA 4U6QA 4PCVA 4L0QA 3BZUA 5JAQA 2VYVA 2Y1CA 4OQYA 3WMWA 2NUAA 4D42A 2FPIA 3MWDB 1AGNA 4PVDA 4DIBA 1H9BA 1UXKA 3K96A 4WCFC 1GUFA 3EW7A 2VWQA 2B37A 2LDBA 3IOYA 1BRMA 2EKQA 5JDIA 5HRUA 2VYVD 4E2XA 2HMVA 2AQHA 3EY4A 4R01A 4J16A 2QYSA 4JQCA 3N58A 3WGOA 3PFWO 1BXGA 2IRWA 4K26A 1RYDA 3T7CA 1ADGA 2YV1A 4F46A 2BF7A 1NVMB 1IUKA 1PEDA 2J5KA 4CR6A 1R4NB 2H9IA 2EXXA 1A4UA 4R41A 4PG8A 4YJGA 5I8WA 4MPDA 4MIOA 3VVCA 1NFQA 2PGDA 4E13A 4I5GA 4RVHA 3ST7A 1X1TA 2HMTA 1X7DA 4E2YA 2C2XA 2E37A 3SXPA 1PJBA 3R6DA 4CQLA 2WDZA 3OEYA 1Q1NA 2WTBA 5B4UA 4ZU3A 4L9RA 1B3BA 4GAEA 3D1LA 4E2ZA 3RI3A 4F6LA 5JCJA 3BTUA 2ZJ0A 3K9QO 3KHUA 3EZLA 4QTZA 5EMHA 2JJYA 4MP8A 1LUAA 3F1LA 4OOEA 2C5EA 3IJPA 5COQA 1GV1A 2GYYA 4A5OA 3RD5A 3KB6A 4CLOB 5KKCA 3CEAA 4MVJI 1OAAA 3V1TC 5L51A 1C0PA 1XYGA 4NIMA 3ZU2A 2EF1A 2J5RA 5I7EA 1PL8A 1YB4A 4KQWA 5JCJD 1ULSA 5EN4A 1KYQA 2PZLA 4J2OA 3WYEA 3QW2A 2DPHA 4ZA2A 3DOJA 4U6SA 3RUFA 2C0CA 2E48A 2YQ4A 1QKIA 1C0IA 4RVSA 2WJPA 2Y1EA 1ZK3A 2CY0A 2HK8A 1VKOA 3H5AA 3KYDB 1JQBA 1DIRA 4CV2A 1I5RA 2PTGA 2BELA 5KVVA 3DB2A 2VZ9A 4HBGA 2PD6A 4YXFA 1FF9A 3BMQA 1N2SA 3DMTA 4UEJA 4YT5A 1IE3A 2DUUA 1E3LA 2X8LA 5ENVA 4Z9FA 4ZRNA 2VOEA 2Q4BA 1GPDG 4B4WA 3L6OO 1HRDA 4BNYA 1EQUA 3QE3A 5CG2A 2NU8A 1GUYA 1Z45A 1Y81A 4W7HA 3L4BA 3ADPA 4QSMA 3WOHA 3R1IA 1F17A 4FIZA 1WWKA 1CF2O 3KLPX 4FGSA 3VH2A 1YRLA 3ASUA 3U5TA 1XIVA 3F5SA 5L53A 4FOSA 4WEOA 3LF2A 3LC7O 3MTJA 4CMKA 1B2LA 2DC1A 3DL2A 4JJFA 5HS4A 3COSA 2O3TA 3H2SA 1PZHA 5IDYA 1SNYA 3GUCA 1P1RA 4CM5A 3W8DA 1LDBA 3G79A 3FNFA 4P38A 3RWBA 1ZH8A 4Z9YA 3VZSA 3X2FA 1GYQA 1T25A 4CM4B 3HZZA 1XEAA 4CL8A 5CEFA 1DRVA 2CF6A 5THQA 4L8VA 2FWMX 1T2AA 4Z6KA 1LX6A 1X0VA 3OBBA 4IQ8A 1KVUA 3WGHA 4RZHA 3QY9A 5DP1A 3R3SA 1BXZA 1RM0A 4ILKA 1A71A 5KJFA 3UCFA 1F06A 3JYNA 1T1RA 4M87A 3AUTA 3PK0A 4MJLA 3GFGA 1GL3A 1HT0A 3MOGA 4MDHA 1YL7A 2ZCVA 4Y9DA 1HE3A 3JTMA 1JWAB 1C3VA 5TIIA 5GMOA 3DMYA 3JCZA 1E7WA 2Q2VA 4BO2A 4HY3A 1D8AA 4AJ2A 1YJ8A 1N7HA 3F46A 3ZWVA 4ESOA 3OFSA 4ZJUA 5BSGA 1A72A 1GCOA 4UVHA 4UVIA 1WXDA 2XOXA 2YJZA 1K89A 1GEGA 1U3VA 3GUYA 1H5QA 1LLDA 5IFLA 1KEPA 1QYXA 4YQYA 2VWPA 3D4OA 1GY8A 3U62A 2BH9A 5ITVA 4XJTA 1R12A 1EUDA 3JQ7A 4FFPA 1NASA 3JYOA 4JK3A 3PFFA 3WGYA 1PJ4A 1GQYA 4NFSA 3K73O 3ZU5A 3HWRA 4IUYA 4YCAA 3TJRA 2EERA 1ID1A 1SMKA 2ZB3A 4TKMA 3EUWA 3VKUA 2JFHA 1XGKA 4CM3A 1YOVA 2PA3A 3DZBA 4CMIA 5B37A 5AOVA 1HKUA 1XKQA 3GRPA 4IY1A 1P31A 2RBEA 1HTBA 3IP1A 4B3HA 3OIFA 1H2BA 2IYPA 3LT1A 3Q2IA 1C1XA 1WP4A 4D45A 3A1NA 4KP7A 4YAKA 4BNFA 4CUKA 1YE3A 1P0CA 1ISHA 3HB4X 1ZK2A 2A4KA 3MJ4A 4OSPA 4Z0HO 1B14A 2OO5A 5G4KB 3TZKA 1LQUA 2Y05A 3U4DA 5A5FA 4MIYA 3DHEA 4HX5A 4L4XA 1CIVA 4RF2A 4ALIA 4NBVA 1NWCA 4BKPA 2SCUA 3IDSA 5JW6A 3UCXA 3BXXA 1D1SA 2W98A 2QRJA 1R66A 1KY5A 1B0AA 1IHYA 3OSUA 3WFJA 2FPGA 3KZVA 4IDCA 1ADCA 4E33A 5K0ZA 2ZIZA 1EE2A 3AU9A 3CE6A 6LDHA 1DBVO 4BNHA 3ASVA 3GG9A 1WMBA 3VPSA 4ID9A 3L9WA 2FY8A 4HFMA 2YHIA 5TGDA 4CM1A 4BNGA 5DCWA 4XR9A 4IQ0A 1PQPA 1FJHA 3GQVA 4WLEA 1HYGA 5T5QA 2YDXA 3JQ6A 3BMNA 4BKOA 3IL2A 1LDNA 1UP7A 2FPPA 1CEQA 2ZJ1A 2IODA 3V5NA 2E4AA 2JHFA 2VWHA 1LNQA 1ENZA 4BKUA 4GWGA 2NADA 4KUGA 1X7HA 2BFMA 2CD9A 3DTYA 4RO0A 5A04A 1E6EA 1XDWA 3C7DB 4BNNA 4YB8A 3TRIA 4EUHA 2Y0DA 4BV9A 4IJKA 3H2ZA 4XX0A 4YJFA 2J5QA 2BI8A 1XQ6A 4J4BA 4MVJG 1Z7EA 3FF4A 1Y8QA 4DYDA 1EVZA 2X4GA 3FTNA 1HXHA 3ZW8A 5ICSA 4FJ0A 5JS6A 4D41A 4LCEA 2V6MA 3I23A 3JQ8A 1ISMA 4KQXA 3KBOA 5IXSA 1Y7TA 2ZKLA 1U3TA 4DQVA 5CDTA 1NPTO 3P7MA 1PJTA 3OP4A 4XDYA 1WZEA 1LSSA 4L4RA 4XWYA 3RJ9A 2DVMA 4XQEA 4DMMA 4E5PA 2EJVA 1MLDA 1NQAO 3IJRA 3QVTA 5H82A 1W6UA 2FR8A 4F45A 4Z3DA 2RCYA 3TN7A 4YR9A 4YAIA 3T4EA 5JY1A 1DLJA 3PGXA 3WIDA 1BXKA 3V1UA 3LC2O 2HMUA 3ETDA 4U0JA 3DZFA 1W73A 3BIOA 3Q0EA 2RH4A 1DHTA 2FMUA 5G0WA 2Q1UA 4D3DA 1UAGA 5KJCA 3WGGA 1CJCA 5CDGA 3CMCO 2GZ2A 4OO3A 4IGEA 4YJGB 4BIIA 4DLLA 3TNLA 5ITWA 5LDHA 5ILOA 2UUPA 1MXHA 3V2HA 2EV9A 4OXNA 2CVOA 5JO0A 3MWEB 1YO6A 4CQLB 2D59A 3LSYA 4NHEA 2UUOA 5TX7A 1GTMA 1E7RA 2IZ0A 4R54A 2JCVA 5BSHA 1UJMA 5L95A 2QX7A 3C3XA 5G4LA 1P0FA 1HDRA 1ZBQA 2PD4A 4TWRA 3NAQA 3SEFA 2H1SA 1MFZA 5T6BA 4HFRA 4EW6A 2DBQA 1BTOA 2P9CA 1WAMA 3GGPA 4IS2A 1J4AA 1ZW1A 3QLJA 4K6FA 2DPGA 3O38A 2HJSA 4MVJA 4Z0TA 1LC3A 3WBFA 3ANNA 4PLVA 2G5CA 1J5PA 1W4ZA 3B6ZA 1OI7A 2A35A 2VWGA 1M6HA 2YYYA 3EMKA 1H93A 1CDOA 5LCXA 4ZQEA 4XZ3A 1ONNA 1SPXA 5KVSA 5IN5A 1SB8A 1Q0HA 4JBHA 2B35A 2UVDA 4W9NC 1HYEA 2Q2WA 3EVNA 4Y6SA 1JU9A 3OA2A 3WS7A 5IXYA 3RKRA 4G5HA 2VHXA 1R4MB 4YJDA 2UV8A 4DC0A 1RM4A 4YDRA 1ZMOA 4FFNA 4XQGA 4CMEA 4CLRA 3E18A 5L45A 4FFLA 2POQX 1PR3A 4Q3CA 5A3VA 2PKQP 2EWMA 5B4VA 1PWZA 3BMQB 2AA3A 2EGHA 2X86A 3BTOA 3PRJA 4WPGA 1XA0A 4PLHA 3ONDA 1P9LA 1RPNA 2V6FA 4LSWA 5KVCA 2NU9A 2ZB4A 1NYTA 2C5AA 2O48X 3U3XA 1E3EA 4EITA 4R9RA 2HJRA 3AFMA 3RUHA 3O03A 1ARZA 3GG2A 1DPGA 1MC4A 2G0TA 3W1VA 3K2EA 1YGYA 1MGOA 1DXYA 4BNKA 3RFXA 1H0KA 2IEBA 5COBA 1ZK4A 1WPQA 3NV9A 1JAXA 4QECA 4NBRA 3ZNNA 1WMAA 3GPDG 3TZQA 4PGFA 1G6KA 1QV7A 4EJMA 1V8BA 2VNSA 4R1TA 1P1KA 3TL2A 1N5DA 3EK2A 4NK4A 1B8PA 1Y9EA 2I3AA 3E9MA 2C07A 2PLAA 5BSEA 2GN8A 2O4UX 1DIAA 4W4TA 5TSDA 1TLTA 4D43A 4IZHA 2FSSA 4OMUA 3JQBC 3LF1A 3MZ0A 1JLLA 4B7XA 4E2WA 3H9UA 3S2IA 4ZICA 1NHGA 2X0IA 5G0UA 3K6JA 3WX0A 2UDPA 4H16A 3PIDA 1E92A 1GPJA 1UZLA 1I2CA 2HLPA 4AG3A 4ND1A 1ZZEA 2ZQZA 5IZCC 2YW9A 3ONEA 1NWHA 4P8RA 3K92A 5AYVA 5CAEA 1GZ3A 1Y9AA 1YQGA 5KTKA 3ZHBA 3WQRA 4FFMA 1G0NA 2AQKA 3HB5X 1TEHA 1X1EA 2B5WA 3OHSX 4DC1A 3C7CB 1BDMA 1DSSG 2EKPA 2YDYA 1QSGA 4XDZA 1HSOA 2P4HX 3ZHYA 4A7PA 1LU9A 3ZWPA 5CEEA 2QZZA 4BL5A 1MC5A 4MVJE 4NJMA 2ZTVA 3JQ7B 1B7GO 3OQBA 1RM3A 3PEFA 3QRWA 1GFSA 1CQJA 4RGBA 4EUEA 1UXGA 5TT0A 5K6AA 2OP1A 2C59A 2CF5A 2V6BA 3GEMA 3ZWCA 4NFHA 3FNEA 1A9ZA 4AJNA 1ZUD1 4MINA 4DIFA 7ADHA 3GVIA 4N54A 3WNVA 4CMIB 1YOVB 1X0XA 2QRKA 4QUKA 3O8QA 3UFXA 4ALLA 5JO9A 1DC4A 4OM8A 4OYRA 5J23A 1VJTA 3GOHA 4CQMA 4I5EA 4BQRA 1UZNA 1C1XB 4URFA 5IZ4A 3DFUA 1WDMA 4WEQA 1L1FA 3VZRA 3V2GA 1UZMA 4ZRMA 3NT4A 4E5NA 3OEWA 1JAYA 4GMFA 3GMSA 4B7UA 4HV4A 2B4QA 3S2GA 4RVGA 5DCYA 4CQMD 3GK3A 2AQIA 1D4FA 1I2ZA 4KZPA 4RF4A 3PLNA 3NJ8A 4L4SA 4R1SA 5HA5A 5KNLA 3QSGA 3ZHXA 3E8XA 5DNAA 2I9PA 3JQAD 3JD1A 4J9VA 3EC7A 2D0IA 4OXYA 4BB6A 4CL3A 2Q45A 1KEWA 5CPBA 3PHLA 4IIUA 1BW9A 1MB4A 4YRDA 5A4DA 2GO1A 1R37A 1NQ5A 2C54A 3ZGYA 2Q4EA 4GSLA 4R5HA 2OHXA 5LC1A 2VUTA 2YHIB 4PG4A 1NTOA 2YUTA 1E7QA 2Y68A 1EUCA 5CDUA 1T2EA 1H9AA 3AY7A 2OGUA 3C7AA 3GAFA 3BMNB 5A5EA 4JP2A 3GA0A 3ZWMA 1Z73A 5JFOA 2HQ1A 4CMHA 3UF0A 5EQDA 5AXDA 1GYPA 4CM8A 2PZMA 2HU2A 4O5OA 5ILGA 4I5FA 2B0JA 4N18A 2B4TO 2Q2QA 4DIOA 1I3LA 4XIJA 3NDRA 1E1LA 4E3ZA 1KVRA 2WYVA 5L7YA 1FDUA 4NK5A 3U4HA 4CJXA 4KOAA 4D0SA 3WSWA 4YRAA 3AM5A 3GMDA 2AHRA 2X0RA 1JA9A 1KVTA 4JLWA 4YJFB 3VZQA 3JQFC 2EIHA 1Y8QB 2PNFA 2V65A 5AXAA 2DLDA 2PFGA 4J4HA 3RAJA 3ZI0A 4AJJA 4ZQHA 3KSUA 2EGGA 2FSVA 1LJ8A 3C1AA 4IXWA 2AG8A 3JQ8B 2X9NA 2PKQO 4HFJA 2BGLA 1P33A 4EDFA 1YWGO 1BMDA 3MTGA 3ZWAA 2DU8A 1IOLA 2Y99A 3RFVA 4NZ9A 4MVJF 3CSDA 2D1YA 2CVZA 3VPHA 3AK4A 4Z0PA 2RH8A 2CNBA 1HWYA 4FD3A 4A03A 1L7DA 3I3OA 4TZKA 4BO8A 2Q46A 4L76A 1GR0A 4RQUA 2Q1SA 1PJLA 1LLQA 3GNQA 4MP6A 1HDZA 4MOWA 1QMGA 2OZPA 4B3JA 4FN4A 3FRJA 4R5MA 4U5QA 4XYEA 5JDCC 2BGMA 2BKAA 1DJQA 1BHSA 1PJCA 5F1PA 1TT5A 3PYXA 5JE8A 5B1YA 2IXAA 5L4NA 4MKZA 1O89A 4C7JA 5F1KA 4PG5A 1YONA 4B8WA 3ZH2A 1M2WA 5MGBA 1U5CA 1Z74A 3CZMA 4A0SA 4BO4A 3LZ6A 2WE7A 1UH5A 1ISIA 2BRUA 3WSVA 5JAIA 2PD3A 1Q2XA 2GZ3A 3KEOA 4WGGA 4C4OA 3FTPA 1P44A 3B1JA 4FSHA 2G82A 4RV9A 3ULKA 1F14A 2V6GA 3TSCA 3HNPA 3NTRA 1AHIA 5C3MA 4CV0A 1HDOA 1I32A 4GKVA 4DLBA 4E5YA 4AJPA 2O23A 3CTMA 3G1TA 2BFOA 3FWZA 4H3VA 3S1LA 5JBIA 1DIBA 1U5AA 3DTTA 3F6YA 3FSRA 4D79A 2YZ7A 5I7FA 4ZGWA 3GN1A 3I1JA 2R00C 5ICMA 1NAHA 4LMPA 3V8BA 4R69A 5HS6A 5EERA 1I3KA 1PZGA 3I6IA 4I1IA 3VPGA 4DTIA 5A1TA 4MKRA 2Y1DA 2Q1WA 1TI7A 4J49A 9LDTA 3HSKA 3HDJA 2J3JA 4K1LA 4CLRB 4NNJA 3DFZA 1CQIA 1CYDA 4XGKA 5JC8A 1BGVA 2E82A 2G76A 1MFPA 2IE0A 2WSBA 4IDFA 3LT2A 1XQ1A 1B15A 2J6IA 3VHRA 1K6JA 4E32A 4J7UA 1DAOA 3PGJA 3KETA 2H63A 5C7OO 3WTCA 4LGVA 1D1TA 2ET6A 5FI5A 3DZJA 3O26A 1R4MA 4PG7A 2OXIA 1EK6A 4GBJA 1ENYA 3WMXA 1NAIA 3ROKA 3VAZA 1ONPA 4PLWA 1GQQA 4J7XA 4CMJA 3QWIA 1VL6A 4ZVVA 3MCVA 4TVOA 1B3RA 4HADA 3PDUA 1U3WA 1ZEMA 3RASA 3UHAA 2W8ZA 4YAJA 1K5HA 2IZZA 1P3DA 1EUZA 3I9NA 4HNHA 5EPOA 1GD1O 2VRCA 4DBZA 5DCUA 4Y6PA 3NRCA 5EIOA 4PN3A 4XKJA 3UN1A 1ISGA 4PFJA 3HN7A 1QLHA 2X9GA 1UUFA 3FPLA 3MJCA 3PJEA 1AUPA 1KS9A 3NT2A 3UXYA 5KKAA 1PJSA 2VRCD 4RDHA 4BO7A 4YACA 7MDHA 3FNGA 1DFGA 1V9LA 1XU9A 1CWUA 5JDIC 4P4NA 1HE2A 2CZCA 2GZ1A 4E0BA 4OIMA 3FBGA 4R1NA 2GUGA 4A2CA 5AQ1A 1TXGA 1U7TA 4EBFA 4U0KA 4N5LA 4CUJA 1PS9A 2JCYA 1Q7CA 2ZQYA 4D3FA 3DBLA 5JMWA 4LN1A 2NV6A 2P5YA 3G49A 3TPCA 3HDHA 3ONFA 1DB3A 3RVDA 3RQSA 3GFBA 1U2DA 2O50A 4WNCA 2GRAA 1PGNA 4NJMB 6ADHA 2GCGA 3E9QA 3M2PA 5I7SA 3H3FA 3S8MA 1IPFA 4ALJA 1N7GA 1HDGO 2FHSA 4FC7A 4R3NA 4BOYA 4BMSA 1EEHA 4EJ6A 4GPD1 5GZ6A 4YT8A 1AN9A 3EZYA 3E48A 3HE3A 3NTQA 3U9LA 1GZ6A 3WJ7A 4BNIA 3DC2A 1EVIA 4QEDA 5K9ZA 2DQ4A 4CV3A 1I36A 4H15A 4DBVO 1ZK1A 3O8QB 1KERA 1VJ1A 3H9GA 1FDSA 3DAPA 3TQHA 3C1TA 3ZWYA 2Q49A 1QLJA 4CQMB 1Z7BA 3PVZA 5IJZA 3ZU3A 5HTOA 2PGJA 1HYHA 3HADA 3Q3CA 5CDSA 1X15A 4JX8A 1C14A 2WD7A 3W4IA 1PIWA 4GSKA 2DT5A 3O4RA 2F1KA 4GWKA 4XB2A 4IINA 4LISA 5FF9A 5L4SA 4BNTA 5A9SA 1C0LA 2O3RA 1NX6A 1H6BA 5G0VA 3SJUA 1O94A 1NFRA 1J49A 4O63O 3DZHA 4DMLA 4DWVA 4AL4A 4CV1A 3TFQA 5DULA 1LDEA 2OMEA 2QYTA 1W0CA 4IDBA 3DMTC 4E5MA 2VT3A 3ENNA 5KJ6A 1HDYA 3GDFA 1BW9B 3R0IA 4IIVA 3QQPA 4PRKA 1O6ZA 5FFFA 3FI9A 2AQ8A 4C7KA 4XQCA 3BMOA 5DBFA 4GGPA 2BI7A 3L4BC 3E9NA 4DREA 1J6UA 1PJQA 3CUKA 4MVJM 3WJAA 1VM6A 2CSUA 2W90A 3CINA 4HWKA 4E30A 2EHDA 4GKBA 4DLAA 1QV6A 3C85A 4WCDA 1M66A 1ZEJA 3K2BA 4LVCA 3RBZA 4AICA 1FMCA 2Z1MA 3NDJA 1PTJA 3PZBA 2WD8A 3OJ0A 1YH3A 3JQGA 4LCJA 4S1VA 3WGQA 3AOEA 4J0EA 4CM8B 4FB5A 4YPOA 3PWKA 1XWFA 3ORFA 3TOXA 1A7KA 3M1AA 5IF3A 4J1QA 1SAYA 3C1OA 2Z5LA 1DC5A 4D46A 3F5QA 1MP0A 5H81A 1C1DB 1DDOA 4J1SA 3WIEA 2BFAA 5IG2A 1TT7A 1U8FO 4TRJA 5KVQA 1OC2A 5G0TA 1CETA 1DRWA 4KWIA 4NFYA 4BMVA 1NQOA 1R15A 4L73A 2VNAA 1JTVA 1YB1A 1U8XX 2JD2A 3QJ5A 3DO5A 3KUXA 4Q3AA 3VH4A 3GC6A 3GVXA 2W4QA 2X5KO 4OJNA 2NLOA 4K6CA 5IN4A 2P2SA 2CDAA 2YFQA 3FPCA 4FCCA 1DIHA 3BHJA 4JGBA 1HEUA 4GLLA 3CH6A 1PU2A 4GX5A 4XRRA 3QHAA 4QX6A 3AI2A 5EQFA 4EYEA 3R3JA 2NU7A 1D3AA 3OF2A 1PL7A 1ZIDA 2HDHA 4IMRA 4B8ZA 2VHWA 2WMDA 4RPGA 3ZNOA 1OC4A 4NI5A 4J43A 3CIFA 5JC1A 1XHLA 1KBZA 3AI3A 5T64A 4E6PA 3ZV6A 3FR8A 3KLMX 4G81A 4QQRA 1U4OA 1TT5B 5FEUA 3TDKA 4ND4A 2NWQA 1N1GA 1JDJA 1A27A 2JCXA 4E4YA 2QW8A 3E03A 3VC7A 3PXXA 5EINA 2OFPA 1LLUA 3MJVA 1LC0A 4RZIA 4CLDA 2E49A 4I5DA 3DBHA 4Y67A 4OH1A 4EI2A 3JYLA 4AJEA 1SC6A 2XXJA 3LU1A 4Q3NA 4FDAA 2GN9A 1KETA 4ND3A 2GPTA 1MG0A 2GLXA 1LXCA 1E3WA 1DLIA 2GGSA 3DDNA 2A92A 1F0YA 4XA8A 2G1UA 1FDVA 5F3RA 3QIVA 3NKLA 3WICA 2B36A 3H5NA 4PG6A 4BNVA 3GZNA 1T4DA 2W2KA 3ICPA 2PY6A 3WXBA 3I4CA 4G2NA 1QYWA 4UULA 1LA2A 2C29D 3Q2KA 2I6TA 5ER9A 1NFFA 3OETA 4DYVA 1B26A 5BNIA 4CPDA 1PJ2A 3OA0A 2FP4A 3PWZA 4LRSB 2CFCA 3ZNQA 4CMGA 2PKRA 5A9TA 3ZV3A 4BMNA 5IZCA 4TRRA 3F4BA 4O0LA 3WTBA 1YXMA 1PGOA 1WLYA 3JD4A 1KY4A 4FGWA 4UUNA 3RIHA 5L9AA 1GEEA 2W2LA 3BTSA 1QP8A 4RF5A 3A06A 1YQXA 1PJ3A 3DXFA 3W8EA 3OM9A 3B1FA 4TRMA 2QG4A 4M86A 4XYBA 3GHHA 2IXBA 2NQ8A 3RU9A 3S2FA 1ZXBA 2I5PO 3FNHA 1E0DA 4UVDA 1PL6A 4UUMA 1DC3A 3H8VA 2NVUB 2GNAA 4R4JA 2W2LD 4QT0A 4L75A 3AI1A 4AJLA 4BGUA 1VKNA 4XD2A 4D7AA 3B20A 2FZWA 3UH1A 2EP5A 1U1IA 5DBGA 3DAGA 4RCVA 4UUPA 3RKUA 4PZEA 3SC4A 4XR4A 1LLCA 4N5MA 5HBRA 3ZWNA 1HDCA 3FHLA 5C7IO 3ZNPA 4FR5A 3L77A 3IKVA 3SC6A 3RUCA 4QFDA 3I5MA 4PLCA 4J9UE 3OJEA 5KOIA 4GX0A 5TJHA 3JQ9A 4RPLA 1PSDA 1VRWA 5JY6A 4FC6A 3U49A 1DIGA 3EGOA 5JAMA 4XQ9A 1R0SA 3H65A 3A14A 3MJSA 1LDGA 3KOUA 8LDHA 2D2IA 3B70A 1V6AA 1GZ4A 4PLTA 1RKXA 3GF4A 4PLZA 1ZSYA 5I9LA 4CLHA 3PHGA 1ZSVA 3LC1O 1EDZA 4GI2A 3P5SA 4K28A 1LRLA 3DOCA 2AEFA 2WE8A 3Q6IA 4IMPA 3Q9NA 4M89A 3DBLB 3BTVA 2RAFA 2Y1GA 3KSDO 3AUUA 2Y1FA 2AE1A 4FW8A 1JWBB 2WM3A 1KVSA 2I3GA 5LDGA 3L07A 1ZJZA 4B7CA 4TMFA 1NR7A 3STHA 1UP4A 3WBBA 2IZ1A 4Q3BA 2Q1TA 1QYCA 1TA4A 1A7AA 2FRDA 5TF4A 1PX0A 3GR6A 3I9MA 3IP3A 4AJHA 1BWSA 4FJ1A 1FK8A 5CP8A 3GY0A 3D64A 4DVJA 3PTZA 1SB9A 3N7UA 4RLSA 4WLUA 2C20A 3Q11A 3QWHA 3LT4A 4O59O 3UVEA 1I3NA 1LRJA 5IDQA 3QV1A 4M49A 4WLOA 3VDQA 4W99A 3RUDA 3H5RA 2ILTA 4YJHA 1O95A 3GNSA 3H9JA 3TOZA 1EFKA 3ZWWA 2JAPA 1JKFA 4BNMA 4R16A 2O3QA 4WNIA 4UEOA 3GHYA 4KUHA 1QYDA 2WD7B 1NXQA 4GQAA 1JVBA 4CLXA 3G0OA 3HQ4O 3C8MA 2P5UA 1WW8A 4NU5A 3JQFA 5C5IA 2O3SA 4P22A 4GX1A 5A9SB 3K30A 1B8UA 4IDGA 4U7WA 5BNTA 5F5NA 3ZWBA 1YQDA 4W6ZA 3CXRA 3EHEA 4CMEC 1IZ0A 3W4JA 1H6AA 4E31A 5A9RA 2WEKA 1HE5A 2NM0A 1P1FA 1UP6A 5T8KA 2D5CA 4FS3A 2A94A 4D3SA 3AY6A 1XU7A 3I4FA 1XELA 1M76A 1JKIA 3JQAA 4NMHA
chains in the Genus database with same CATH superfamily
1RWXA 4P3YA 2XZLA 4CEHA 3BMOB 1W44A 3RYHA 2H17A 2UZIR 4EO7A 4CTNA 3BD9A 3LECA 3RT7A 2F8MA 3HUEA 4RORA 2R65A 4KX3A 6YASA 1AKNA 1H6CA 3KYBA 4L2IB 2NO6A 1ZITA 1VJ0A 5ERXA 4CUZA 4EM6A 2HNKA 1PV4A 4RJTA 5ECDA 4REQA 1C7ZA 3F8TA 1XZGA 3KT6A 4YUAA 3ECCA 3E3OA 2PGNA 4KTTE 4XGQA 2VATA 3SLGA 2RI6A 1M2GA 3N2KA 3M1YA 3ADKA 5FTLA 1U7ZA 1G7RA 4ZYUA 5K0FA 3CXUA 3FPJA 5LVAA 3IQEA 3R3WA 3LIIA 2G83A 1JPVA 3HGMA 4CU5A 3H1BA 4FBLA 3EWAA 3RK0A 3BS4A 2RFLA 1H2YA 4NAUA 4A27A 2E5LB 4HLQB 5D7BA 2UYQA 3ZBQA 3IIJA 3SSMA 1CQWA 3UKOA 3MQ2A 2V6IA 3EJ6A 5EWJB 4TYMA 2VZ0A 3HJUA 1M6WA 1WEHA 1T4BA 3G0CA 2VHZA 1GGHA 5FJJA 2XYVA 3CONA 2PV7A 4MYHA 2C8LA 3FDFA 4RMGA 1ZOLA 1WL8A 5AH0A 5JSQA 3DFIA 1C8BA 3BGVA 4FFOA 1YZHA 2VC2B 4LOKA 3E3NA 2D5AA 2BW0A 3NHSA 1OW3B 3LQFA 4JFAA 3A6GA 4PLGA 3BERA 3NEPX 3V4ZA 1E77A 4RPKA 3DPSA 5HCNA 2ZI6A 2CVHA 2FW6A 2CBZA 4N0QA 1R0ZA 4P93A 3RC7A 2ZUWA 1SGWA 5I9MA 5K2MA 2B78A 2C4HA 1XMSA 3WIUA 1A95A 4KDFA 4MQLA 4IF6A 2CLHB 1WETA 2AEMA 4JIGA 2XB8A 2EZ8A 2GN1A 1CYEA 3D59A 4YAEA 4XWWA 1NXTA 5J4VA 3OMXA 5ICCA 2FQXA 1W8DA 2D1SA 2XXBA 3AWDA 1X13A 2GTPA 4KPGA 3ITEA 3GVHA 1FL9A 2D0PB 2QX6A 1LS1A 4KFSA 3DF7A 5LQUA 3RYFA 2O20A 3L4KA 1H2EA 3WGLA 3CN7A 1Z6TA 5IVKA 4HEQA 2VZ8A 5ALYA 1M34A 3VDNB 4AMVA 2H65A 4OHFA 3V8RA 3K9LA 1Q12A 1G2QA 2AEJA 2I34A 3OZRA 1P19A 1FX0A 2H5LA 5AW9A 1Z39A 4LXTA 1NNUA 3ZCXA 5HGXA 3BJZA 5IF9A 2HBZA 1H3EA 1IG0A 5CB4A 4AJ4A 4EJ0A 1XZNA 2W2XA 1Y4DE 2TECE 3PHJA 4FNAA 4M8IA 1GT91 1NOJA 5JAPA 3L0CA 4I19A 1DC8A 1H05A 4YYZA 3VKHA 2GESA 1LK0A 1FFEA 1PR9A 2JIOA 1DWOA 5EIWA 1B16A 1U0LA 1A1VA 2VTBB 3DBHB 4RTLA 1VSVA 2WWHA 3HV0A 4IKPA 1NVKA 1SCQA 1EXNA 1RWOA 1YD7A 4QGSA 3WIVA 3K15A 3NWPA 3MFYA 5ENDA 4URHA 5BN1A 2VCEA 1BO6A 4X1KB 1DEKA 1OTYA 4EVSA 2AZXA 3NDBB 3I2IA 1PV1A 3PC2A 4LRYA 4XEUA 2BD0A 2VHEA 3SZMA 3EARA 2C2HA 4O4LA 4DWWA 3LUAA 2E3JA 4Z9BA 2XA1A 3A4IA 1LWNA 2X1HA 5SZIA 4JI7B 1I4DD 4RIFA 5FORA 2HR1A 1KIFA 1RJEA 2BTOA 3B9RA 3UUWA 8ATCA 3GZNB 5K0EA 4IDDA 3N0TA 2W2KB 4ZOLB 2DFKB 3FHOA 3FGZA 4ZD6A 3R7FA 2GCOB 1H94A 4MW2A 4PHTA 4KXLA 3SSNA 5T57A 3WB9A 1VCOA 4I9FA 2FN4A 3AR6A 1QH9A 3ET5A 1C3OA 2CLIB 4TWZA 4E09A 5KWIA 1JFFB 3VC1A 1ZFNA 4OB7A 3VH3A 3GLFA 3WG9A 1C50A 1Q19A 5TC4A 1RBZA 1JDSA 4KSBA 3D4LA 3ROMA 1IHOA 3ZK7A 3EXG1 2OKCA 3VOSA 2KLHA 1DV1A 2ZAGA 1UAYA 1XZJA 2A58A 3JWPA 3L7BA 1XLUA 3H4MA 3NG1A 4LQLA 1RKQA 2G28A 3C87A 3PTLA 2IHNA 1U0JA 4YRKA 3DEZA 4NCNA 3M5PA 4PO1A 2HDOA 3L01A 4NCHA 2ECFA 3U3MA 4L5BA 4WLVA 1DTEA 3WLRA 1QPBA 2JAUA 1JJIA 2OXEA 4EUNA 3M6WA 4MUBA 3P52A 4K9RA 4R1UA 2BZ0A 1WCIA 3CLRC 3WHIA 4AUMA 3M83A 3V8QA 4BZWA 1RXWA 1YZ3A 1H9CA 3S7TA 3ZLJA 1Q11A 4MB2A 1GO2A 5KC9A 2O8EB 2PJUA 1IUPA 4M36A 1WV0A 4URWR 4EMUA 4FYVA 4AZVA 2DZDA 1RVDA 2UYYA 4HRYA 2YBEA 1PT9A 3NPMA 3UB2A 1ZVMA 3PGVA 1IXKA 2C9YA 3KYCA 4D3ZA 3P4UA 1FVFA 2CNKA 3D7RA 3RVKA 1Q7EA 2LTAA 1RWKA 2VF7A 4M0UA 1PK9A 1SUBA 2KBEA 4NZNA 3MRTA 1QPZA 2AZDA 3NUGA 3OX4A 2H8GA 1G21A 1V8PA 1XALA 2DAPA 2IYQA 2R1ZA 3K7EA 5FPTA 4OI0A 1U8UA 4MHTA 4CEIA 1VKZA 1IM2A 2H4JA 4KX5A 2ZTSA 4HF7A 5I6DA 3CNBA 2ZTUA 3N7TA 3I5AA 1HEIA 3KQPA 5JD3A 3UGJA 1O54A 5A0TA 1OJLA 1SR8A 1GPKA 3DPIA 1X2EA 3AR4A 1NF3A 4IIJF 3F8WA 4OBEA 1I24A 3D7NA 2B6HA 1MPXA 3D0QA 4FZVA 4UNPA 3T94A 2WWRA 4UXIA 5BV2P 2V55B 1X2BA 4C0KA 3QV2A 3UAZA 3GZ4A 4DM3A 3W5VA 5JIBA 2PRKA 5TT1A 5HJ5A 4JNKA 4K9KA 4G8BA 1ORRA 1RM5A 3Q7SA 2EW2A 5K7SA 2QN3A 3A36A 5H83A 4BZZA 5HQ3B 1I01A 2X7HA 3HJCA 4FI3C 5LXTB 3KALA 2XR1A 3QOFA 2QI9C 1EBFA 5TVGA 3LLMA 5CCEA 4BNZA 2OQVA 4F11A 3H3JA 3H5TA 5LIRA 2YV2A 3IJ5A 3V32A 3AF4A 1RYHA 4AS3A 4IDNA 2O1WA 3RYCB 1Z2EA 1M1UA 2FFJA 2Y27A 2ZQ5A 2LDXA 1O4VA 3DE4X 3Q1KA 3QVGB 2YMPA 5D3KA 1N6HA 1PGPA 1W2WB 3EJWA 4N8SA 4WXYB 3T52A 4AN1A 4F5DA 4YMGA 4M6WB 3AU8A 1X77A 3BWMA 3M6VA 4D9NA 5KPDA 3TFOA 3BWYA 3AUXA 1GIAA 1VG8A 3KR2A 3PUJA 4NOJA 5EXDA 4XFDA 2GASA 2BFFB 1Q1QA 3HP4A 2OLKA 2G77B 3PIIA 1T2FA 4H7HA 2PUEA 1MRNA 2P9TA 2BUCA 3IB6A 3L0DA 1RXIA 1ZKDA 3TTUA 3P0HA 2AD5A 5DW0A 3K6SB 3LW7A 2WTAA 4UCWA 1E4OA 4HUJA 1E6UA 4EKDA 1VE9A 3DBVO 4R0MA 3KHTA 4WGFA 3IAXA 1T3GA 1COZA 2GXUA 2R3SA 5DEOA 5BN4B 3S2EA 2EJWA 1NW8A 4P4SA 4BNXA 5BMVF 2BRUC 1W5BA 4IGAA 4RPHA 1AE1A 5GGXA 1EMDA 1L8OA 2OSVA 5AK0A 3L8EA 3VKVA 2I8LA 3ZN2A 3PDIB 2IS6A 3A2LA 1DEAA 4K40A 5THKA 2VAVA 2Q3FA 3AFNA 4FQ8A 4GHWA 3UMMA 1B0PA 2X23A 4UXJA 3SJCA 3NM5A 3Q5GA 4TROA 2JBAB 1J0XO 1XCOA 3ROQA 1TFUA 3TNYA 3HFGA 2YOFA 4JROA 3PVSA 4HI0E 3ON5A 1A5ZA 1MB0A 5LD2C 4A8JC 5AD1A 4MW7A 4Z99A 1LPBB 4HMQA 3TLGB 1L4KA 3NLLA 2G80A 1XTUA 2ZBRA 3LK7A 4L6AA 13PKA 2BPOA 4C22A 1V3UA 2AN5A 1E3JA 3BE8A 5EHIA 3CVYA 3MLBA 1XSEA 2I54A 3KLOA 1QP4A 1VA4A 3EQ2A 1NN1A 4TSKA 5LQJA 2IHJA 2FOIA 2H31A 2C2YA 2JBHA 4CM6A 1IZ9A 1XDUA 3QUCA 4AF7A 5KWSA 2ST1A 3B2QA 2BMDA 3D6TB 1G5TA 3QF4B 2Q27A 5AXCA 4K6GA 2RHJA 3RNOA 2VHVA 2R84A 1DEHA 4KXQA 4II3A 3THYA 3UMJA 2XEDA 2F59A 1MZPA 3QU5A 2QTRA 4IJVA 1AKRA 3T7SA 4ZHSA 1FDTA 2P79A 5CGZA 2OB1A 2NSHA 2FE1A 2XUKA 3WKBA 3VH1A 4PX3A 3E5MA 5JHGB 3SWWA 4B3IA 2YNMC 1NOIA 4CVNA 1VYHA 2IEGA 4UTVA 1UJBA 2FUKA 3KL4A 4GQIA 3W9UA 5LKAA 3TTWA 4BPBA 1F8YA 1RYNA 1WW3A 4RVDA 1MEJA 3GA7A 2FKNA 3T5DA 4YCSA 1G8JA 1SHUX 3N59A 4RHYA 3GGGA 3N8HA 3QELA 1FFHA 5FBVB 3BZBA 4OQZA 1K97A 1Y1RA 4UM9D 3RK4A 4D6XA 2IP1A 1AU9A 5CLLA 4EPTA 3NGLA 2WJGA 3H83A 1ZRHA 5A05A 1PLLA 2H29A 5EXTA 4RTOA 3PDHA 1IH8A 3THSA 2ZJZA 1NQTA 1Q17A 3BL6A 3NT5A 4GVXA 3VPXA 5I9IA 1QU2A 2DTXA 2XIJA 3ZXYA 4EPWA 4IDPA 2GHTA 1G3UA 1N1EA 3W79A 1SD1A 1DOHA 1YDEA 3ICVA 4F8JA 3D3KA 5CB4F 4P7GA 1FUKA 3AUKA 4ZO9A 2GBLC 2P35A 1UBHS 2QTZA 3HKEB 3JR7A 3U4GA 3BRWA 2WIDA 4B87A 4BUCA 4Y2SA 1YQ9A 3TZHA 1CVIA 4KODA 3UAXA 4CZ2A 5FWYA 2Q8NA 5HK9A 5AVOA 1QHHB 4JUAA 2ZRNA 3TEFA 3PNLA 4L0CA 3AF1A 2AJ8A 2KYRA 3AEQA 5ETJA 3RSHA 2JGAA 3GVPA 3E8SA 2YV3A 1DX4A 4YONB 3WP1B 1EJBA 5IANA 3AUJB 4JLJA 4E4TA 5CDYA 2ZTMA 4Q5IA 2DECA 4U7TB 5G0TA 3RFTA 3P9YA 4IH9A 4YK7A 1R50A 2B2CA 2ODAA 1A9XB 2WYUA 4RM2A 1OXKB 1YMUA 4QSHA 4O3MA 3PI7A 1BX3A 2PRYA 4LXQA 3P2OA 5F35A 1X7XA 1BD3A 1N6RA 3JQQA 4BX9A 1FUIA 5KSYA 1JLHA 1JR3D 4KE8A 5GZ3A 3VDMA 4Z54A 1WMEA 4V03A 1SXJE 2C9BA 1V7QA 3S99A 1JSLA 4GE3A 4GPTA 1OOEA 3DZIA 5KYGA 4EUFA 3EVFA 1NJFA 1TU0A 3A6HA 5FO0A 3WL5A 2WHEA 3AUAA 5J58A 4DT1B 5HR5A 2XLCA 2B6NA 1OYVA 4UVGA 5ALDA 5EKXA 2CL7X 3E1SA 3TRJA 4D4HA 5AM0A 2O7SA 2YMQA 2GXAA 1X74A 1MB2A 4YCDA 5C1OA 4RZ3A 5H80A 4UQPA 3X1JA 1UBFA 4IV0A 1T15A 3UMYA 5DOZA 5EKSA 6GPBA 1EFLA 4U7GA 2PWBA 1CUDA 1H85A 1ILWA 3UBTA 3FOCA 3S1AA 1MJ5A 1VMEA 2QVYX 4QBHA 3WZLA 3P2EA 4DV3B 5B6IA 1B73A 1V7CA 4MHOA 3FZYA 1Z15A 1QONA 4G65A 1RC8A 1QR6A 2DGDA 3MK31 4OHWA 5FUWA 2QAGC 3W8FA 4E12A 1HZZA 2INGX 4MNTA 1KI1A 3W5SA 2YVUA 4MEBA 5EXXA 1M1YE 4BB9A 1AGRA 1YS7A 3D0OA 4TTAA 1L5MA 4X8OA 4E5KA 5JD5A 1E59A 2FX2A 4I9GA 2R4UA 2O0KA 3O9MA 3WWYA 3WDLA 3I61A 3GRUA 2GD2A 1RWQA 2BGGA 2P7HA 2C3YA 5B58C 1O94C 3OQ6A 4N49A 4OKNA 1K08A 1I33A 1HOTA 1QE5A 2OUIA 1JDPA 2VO1A 4MRSA 1P29A 2WWIA 3IV9A 4JP5A 1VLQA 2FJPA 4TL9A 4XOUA 4E4RA 5C53B 3KZ1E 4U2CA 1YMQA 4JUCA 1ISPA 2PH5A 2PSSA 4EEZA 4URUR 2IVFA 1PUJA 3FY4A 4RIGA 5LA6F 1TGVA 4ARVA 2C97A 2DRIA 1A82A 3H5IA 3U17A 5KYWB 1WUYA 2P2NA 3ODGA 2TYSB 4LWPA 4N5DA 4QULA 4BMOB 4JEUA 3ZHUA 3IP6A 4RHCA 4RJJA 4KRGA 2HN9A 1G55A 3S29A 3ER6A 2OHVA 1TTTA 2KI5A 3OTGA 5U1PA 3P96A 3BULA 3NOQA 3UKJA 3DLIA 3UOGA 2Z98A 4MITA 4TLMB 4R3WA 3MWDA 3M70A 4TV8B 3VOAA 3M6FA 4IXTA 4HNRA 5KHAA 1I30A 4A73A 5K8CA 2A88A 3F96A 4MVYA 2GCOA 2NXNA 5IC6A 1BAPA 1TKBA 4TZTA 1QIJA 3LS2A 3QUBA 1H2FA 2ETXA 5JU6A 4JENA 4NBUA 1FU7A 2IDMA 4DE5A 3A26A 4Q7MB 1XHFA 4JBLA 3UV3A 2JG3A 3JZFA 3FZEA 1RPJA 3IO5A 3RCBA 1PVOA 4TV9B 2VQ3A 1W88B 3ZGNA 4H7IA 1GGMA 3KSZO 3OC6A 1N9ZA 3D7MA 1SCUB 5F3DA 1GUDA 2Q99A 1W59A 2ZKIA 3A04A 4WJZA 5DNDA 4BTEA 2PN1A 3P0IA 5FBHA 4OU5A 3SFVA 4OXXA 1JYSA 2WVGA 3Q3EA 3ANMA 1KDPA 2D7CA 3CU5A 3OPYA 2HLDA 4G5FA 1MXFA 3MM4A 4L72A 5JCOA 4HGPA 5B7PA 5F4BA 4FFBA 2V58A 4PFQA 3C8HA 2I7XA 3EQ8A 1A7UA 4X95A 2VXYA 2OL4A 1S3FA 1CR2A 1L7BA 3AP1A 1JB1A 4BNWA 2XKJE 3CQ9A 5MDHA 3EXFB 1WO8A 1FDOA 4ZYTA 4A5SA 3OZWA 2O8EA 3AETB 4EFDA 1TAUA 2HLDD 5BQOA 2DM6A 2VN8A 5CEJA 3CKYA 4Q9JA 2CYBA 2ZS7A 4QNMA 3D6NB 4OHOA 5JLAA 1COWD 1EPUA 2IIBA 1FE8A 4KEAA 3ORHA 4B6GA 2W2QA 4BMXA 3QWBA 5HILA 3OQIA 2CLEB 5JSFA 1T0JB 2AMYA 2R9VA 3NJ4A 4OHUA 2H51A 3SR0A 2V7PA 2XYHA 2ZI3A 2HTFA 2L69A 3R3UA 3VMMA 3ZEAA 4JUFA 3KLNA 3NALA 4MVJD 4KAFA 3WGTA 2MYUA 5HM8A 5IDXA 1SBZA 1WZUA 1Q1AA 3DEHA 4QDUA 1IATA 3WYCA 2FEXA 1DIOB 1P45A 1R0LA 2OBNA 3A9UA 3CISA 3L43A 1RXYA 4K8RB 2HWYA 2IYOA 3QNMA 2ZBPA 4BO0A 4DY6A 3DV9A 3Q10A 4EMBA 3LYHA 1ST3A 4J91A 3BGOS 2A9PA 1WM1A 3HHPA 1PG5A 3SYMA 1HE4A 3HWWA 4RD1A 2A1TS 4BGEA 2FJUA 1MX5A 1KI4A 3NANA 1JX6A 3F1KA 5F51A 4X20A 2ZCJA 3K0CA 5AM5A 3L6CA 4E5SA 5KNCA 5IUKC 3EB9A 2JFYA 4L8FA 4UVEA 1N2BA 2P0AA 2FR1A 4NL4H 3WYAA 4H4EA 4V0QA 1NONA 2HHHB 3RV3A 4OBXA 1AHPA 1KO8A 3GAMA 2W2TA 5A4JA 1T24A 2ZAOA 5DYGA 3NBZC 3U4IA 3HFJA 1BWQA 3UMGA 4EGFA 1XTBA 4DRYA 3KYDA 1KPGA 1LDYA 4AKSA 3ZXXA 5GP1A 2FF7A 3PWTA 4HYQA 3CRQA 5EP2A 5A4MS 4UHJA 4R8RA 1N8SA 1YJQA 5KNCD 3EVCA 3LDGA 5IT4A 2CNNA 3I05A 1BG6A 2OD7A 4AG5A 2CK3A 1ZP6A 1N6LA 1XXLA 2XAAA 3CBGA 2XTJA 2VSYA 4Q1VA 3OJFA 3HN6A 2PLWA 2JIZD 3AY3A 4FGJA 4W82A 4B3MB 2QT0A 4KAAA 4ZQFA 2O1SA 1DXHA 4RF3A 4ENSA 1KR2A 2IBSA 4DAEA 2PT9A 1EFRD 4C7MA 1P4SA 4GPZA 4NDNE 4ZVTA 2XYPA 3LBHA 4OQLA 1J9ZA 1P1IA 2X6TA 1A8SA 4R7TA 4ZPJA 3TPFA 3LQ1A 3GJ6A 4OMFG 4HDNA 5EKUA 3WOVA 4EFKA 2VPPA 1CUZA 5LZ8A 3BN3A 1XQWA 4RJIA 5ALLA 5C1IA 4HYYA 2D54A 5BORA 2P8JA 3MB5A 1JWLA 3HJAA 2L2QA 1A4IA 2Y9MB 2Q0HA 2CHGA 3MF4A 3RSFA 2PZ8A 3UJCA 5L7WA 3C5EA 5LNK6 3WLKX 3AJEA 2QV7A 3PDIA 1IPHA 3MJTA 5IC5A 1O9BA 4F5YA 4TTRA 4AJKA 2IYFA 3DDCA 4DBLC 1G4UR 1MAUA 5BVGA 4WA8A 2I29A 1ZLXA 4Q66C 4UPDA 3W34A 1AA9A 3VSEA 3DHVA 1I6LA 3FN4A 1U02A 4ZZ3A 5IM5A 1RP1A 3WGZA 5HJ7A 3Q15C 2AOUB 2HIHA 3KAJA 3GQBA 1JKJA 2NO4A 1GTG1 4GF5A 5MF6A 1JQ3A 2B98A 5K03A 1AGYA 4XE5A 4B1FA 3PNYA 3Q40A 1JVSA 4BVAA 4D6PA 2IQIA 3QVXA 4WBNB 1ULUA 1VMAA 1G8HA 4JJIA 2A2ZA 2FFQA 2A1IA 4NNOA 4QLOA 2GSDA 4RANA 1CUHA 2BFCA 4Y6QA 1J09A 5C37A 1YS2X 2WV9A 2TMGA 1AKVA 4HNAA 4FVTA 4RK6A 3BG5A 4LSMA 1UFOA 4PYLA 1OUMA 3CNNA 4NECA 5H02A 2A0KA 3P9IA 4R7GA 5IJXA 1FPMA 1CHNA 4RFVA 5BQFA 2IHKA 2HKIA 1EZ4A 1Y5MA 3RTBA 1B00A 1UOEA 1N32B 3AOGA 4OSOA 2WMOB 1CR6A 1VPTA 3MMZA 4YVFA 1LVUA 4I4CA 4K6MA 2C2GA 4FOPA 3HBFA 1KZYC 1PUXA 1RHMA 4FX2A 3RC2A 4DL9A 1KXJA 1O8CA 2YY6A 3MCZA 4EKGA 1E5LA 2WJJA 2W37A 2Y2VA 4R31A 2JEYA 4MIEA 5T7BA 3L04A 2WI8A 2PBLA 1XI2A 3RHFA 4JXXA 1USKA 3MG9A 1D9ZA 4ZVRA 1O5OA 1OLSA 1OZ0A 2E9SA 3FFAA 3CVXA 4EP1A 5L7TA 2PSFA 3WY9A 3QVMA 3INRA 1S2GA 4R05A 3SJBA 3WLJA 3OE4A 4B4VA 2EKZA 3I9KA 4ZJYA 4DUGA 1I10A 1KDRA 2R7KA 4UCFA 3JQ9C 3RF6A 4L0DA 1T1SA 4HJXA 4KVZA 4CKWA 4UREA 4M76B 4NICA 1P77A 2XKAA 4G26A 4DPMA 4EATA 1SO8A 2HRBA 3AJ9A 1KP3A 1V5FA 2B92A 2Z4SA 3K1JA 4LVNA 2B2NA 4CGYA 2GN6A 4H3HB 3DKRA 3R77A 5DX1A 1N2JA 2F8TA 1GILA 3AI7A 4IBOA 2ZP1A 3JAWB 2EG9A 4XIYA 3IUMA 5C0OE 4F2GA 4O8ZA 4ZZ0A 1URPA 4LBYA 2GUWA 4LVUA 5GGYA 2K7FA 1OGYA 3QVOA 2QXUA 4NZYA 5EJFA 3BH7A 5JBNA 1MEEA 2FZ5A 2JCGA 5LFAA 1ZXLA 1ML3A 2EU8A 4M0EA 5A6VA 2H1FA 2JH3A 3FH0A 4F72A 1UDRA 2QTTA 2C88A 4GOMD 2VPXA 3NGMA 2HRCA 4DA9A 4H7DA 3EGCA 3HL0A 3QA3E 3BHMA 5DOVA 4CF5A 2F3QA 2Q4OA 2A0WA 4ME6A 1AIPA 1I2MA 1SVMA 3GFFA 5ITSA 3ADDA 4GYYA 4QELA 2ILVA 4TKLA 4Q9NA 5FOXA 3ZDCA 2HQOA 4KZKA 4N3NA 1YL6A 2Z56A 2UZ1B 4M55A 4EJSB 1L7NA 1R0CA 2FPWA 2J3HA 5M7EA 4FM9A 3SS8A 3QY0A 2R00A 1EDOA 4QO8A 1E60A 4NBWA 3RVQA 4Q24A 3WMEA 4BB5A 4G01B 2FJ0A 3D3WB 3JZDA 4DQLA 3W4KA 1TF5A 5AJUA 4ZRDA 4S1PA 4ZKDA 2DH5A 3FUVA 1JJVA 1ML4A 3ICCA 4G89A 1XZKA 4NENB 4RAOA 4IX9A 1VYVA 4ZOLF 3R9IA 5JAZA 3ZZ0A 1U9YA 1JKMA 2LIPA 4GOJA 1G5PA 1STOA 1EQ2A 3ZDRA 4C6HA 2NVBA 4UAGA 1R5NA 4BKQA 2NU6B 3GW8A 3IEXA 1IRIA 4GIBA 5DDIP 3T4XA 5TLSA 4AKHA 5AO9A 4IZIA 3IVRA 4QAJA 5F7ZA 5BURA 5B2FA 3V8MA 2GRJA 5BRAA 4RVFA 1P2GA 1SJ9A 3USES 3OPQA 4Q4AA 4JBXA 1M83A 2B25A 2IDKA 3TLBA 2ZUFA 1PK7A 4F3RA 2EFGA 4BRSA 3QG5A 4D8YA 2ORIA 4OX9B 3ZUGA 3TW8A 1H4TA 2Q6IA 1R8QA 3UGKA 1A9PA 1X7GA 2X5OA 1HF3A 4BO5A 3GJ3A 2QTVB 3DDUA 3HYNA 4DGSA 3KVRA 2QTLA 3HDQA 3AIKA 3GGOA 4OQPA 2WHXA 4ITRC 4G0XA 3ZZNA 1ITZA 1TJ5A 3DJYA 4UEKA 4C2BA 1NL3A 2IYYA 1R6UA 2P2GA 2RIRA 3A3OA 3AKDA 3OKAA 4KPUA 1OMOA 1T5LA 3NUZA 5EJ5A 1AQNA 4YASA 1QHYA 1FU8A 1J0AA 4U6QA 2AFIB 4L0QA 1NYRA 4KC0A 4YRRA 4YI5A 2PGAA 2EWVA 4N12A 2VT7A 5I4BA 1EX7A 1JZTA 3FPSA 4B7AA 5ICGA 3C98A 5ALJA 4D42A 2FPIA 3A8TA 3C1UA 5HCIA 1LPMA 1PBNA 2GA8A 4EG0A 1DQPA 16PKA 1JHZA 1WTAA 1UXKA 4INJA 1FRQA 1M2NA 1QFZA 1F6DA 2HCFA 3FCSB 3NRJA 3A1WA 4RV5A 3N1UA 3VAYA 3PR1A 2VWQA 4FDTA 2B37A 3RVMA 1BRMA 2EKQA 3TIFA 4UDXX 3LT5A 4RY2A 4E2XA 2WHRA 3WIOA 1MPTA 3SJZA 2AQHA 2VK2A 3HZHA 7ABPA 5LXTF 1RE0A 3U3RA 3QKSA 3B48A 3K09A 1XMVA 4RAQA 4X8HA 1JFLA 3L79A 4AY5A 3PQ2A 3BORA 3JX9A 1Z2AA 4QVIA 1MHPA 4K26A 3WGKA 3GARA 4QHYA 4JJKA 3E9RA 3T7CA 1ADGA 4JWKA 1IUKA 4F85A 4CR6A 4OMCA 1A4UA 4R41A 5I8WA 2FQYA 1QQ5A 3BK7A 3NAZA 4ITVA 4MIOA 4E13A 1R6VA 4ZJZA 5GONB 1X1TA 1SVKA 1S9HA 2JASA 3EWSA 2LE0A 3R8XA 2ZWMA 2W6MA 1EWTA 4N1AA 4V0KA 3UJBA 3WLOA 4CQLA 5IJZA 2A8YA 2WDZA 2F1IA 1HOXA 5B4UA 4G0OA 2AYZA 2CW5A 2HU5A 2Q62A 2WAOA 4XB6B 3RFFA 3SZRA 4AULA 4EIWA 3D1LA 3D6AA 3REGA 1M0TA 4IOLA 4V1CA 1JHDA 3R9XA 4BFXA 3HCFA 1RTTA 3K9QO 1O7JA 5DE3A 6AT1A 2XYRA 3TLZA 3ZXIA 5EJ7A 2DT8A 3F1LA 5COQA 1KMHA 2C5EA 3U1BA 1RC0A 5ULLA 4YX9A 6REQB 4XFJA 2OV3A 5K3BA 3JWGA 3OTQA 4B74A 4RK7A 1OAAA 4BMZA 2FG6C 4M1EA 3ZU2A 3PNOA 2YWXA 1PL8A 5C3UA 1YB4A 1ZY2A 1ULSA 2I7CA 4I0WB 1QO0D 4MCIA 4DCMA 2QZ4A 4J2OA 3VJRA 2ATCA 3JU3A 4GECA 2IV3A 4ZA2A 4GR4A 4EX7A 4WMLA 2GX6A 4IVNA 4QTUB 3RUFA 1IXYA 4L9AA 2EJCA 3FKJA 4D4KA 4WJLA 4X7BA 4CEJA 1QKIA 3PICA 4TYYA 3ONVA 3PEEA 4FCTA 4RVSA 4QPJC 5CB0A 5KX5B 2CY0A 3GFTA 2GEKA 4DR3B 3IV6A 4JDUA 1UPFA 3O73A 4AC9A 3HYTA 3UJ6A 2AZMA 5CFOA 2PTGA 5KVVA 3TK1A 2QJWA 3KHKA 2RHHA 4IQFA 4EKYA 2VZ9A 3TTYA 4O4IA 2PD6A 4ARZA 1XMXA 1C7IA 2YXEA 2QG6A 1FF9A 2PZBA 3D6HA 4RSHA 4W9RA 1N2SA 4YXFA 3RYIA 3FNQA 1IE3A 2DUUA 2X8LA 2X9LA 1I1OA 2X9QA 2ANBA 1WE2A 4KMOA 1JIKA 3AEXA 1NSFA 1XWIA 1T1GA 1UXOA 2A59A 2NO5A 3L6OO 4Z86A 3HU1A 1EQUA 4BNYA 3WL3A 1ODTC 3HVRA 3MXOA 5CG2A 4CFYA 4MDFA 1SC1A 3WGUA 3ADPA 1ZL2A 4QNRA 2XMCA 3A1EA 3KSMA 3R1IA 4FIZA 4JYCA 1QQ6A 2P0YA 4M9UA 5CD9A 4RULA 1C80A 4W5TA 3FWKA 5FOQA 2WFAA 5B30A 4N9WA 3U5TA 1RABA 3F6RA 4D8WA 1YCHA 3IQZA 1IONA 4FOSA 4WEOA 1QRAA 4EY7A 5DYWA 4X7PA 3KZMA 5FYQA 2GEUA 3FVVA 2CJFA 1XTKA 3H8WA 5CT9A 4YREA 2O6LA 2RHWA 1Z56C 2A0FA 3ISTA 3FNFA 3LO8A 1K8YB 4BNDB 5AVYA 1ZH8A 3VZSA 4CLDA 2VPTA 4PV7A 4DIUA 2LNDA 1QZXA 4XXHA 3R7LA 1KAHA 3QOYA 1XZQA 3ZLVA 4B35A 1M8PA 4CM4B 1XEAA 1LZLA 4YMIA 4DJAA 3D6UA 4MUXA 1F51E 2CF6A 5CVJA 1SPBS 1T6XA 1FFYA 4PBSA 4L0MA 4J03A 5ALMA 1LX6A 1X0VA 3FW1A 2XW6A 2J41A 3QY9A 2P1ZA 1RM0A 2CEAA 3R3SA 4ILKA 1U6KA 5FUQA 3JYNA 1T1RA 3U6KA 1Q3TA 1M7GA 3T3EA 1GL3A 4C01A 3CR3C 1EGVB 3PE3A 5AHRA 4Y2YA 5IVIA 2R7LA 2AN4A 3AFOA 4RHTA 3PE4A 2C83A 4WZZA 1A50B 3JTMA 1JWAB 4GBGA 5TIIA 2P0EA 1S0UA 1E7WA 1OA0A 4B5LA 1IN5A 1J8VA 1YJ8A 3ND7A 3CX4A 4JS0A 2OFOA 2C98A 4ZJUA 3OUTA 2IY9A 3L1JA 1YE8A 3DV2A 4MYSA 5D6OA 1WXDA 2XOXA 4CKBA 3W5BA 1U3VA 3R4VA 3X1YA 2ZSAA 1U0RA 4BCBA 1IXZA 5IFLA 2ZDQA 1KEPA 1NE7A 4LQCA 4YQYA 4FYIA 1U5BB 2FMFA 2NXCA 5J2UA 1E5XA 3WV4A 1XNJA 2BH9A 2VSQA 4OU4A 1H5UA 1KJYA 3RVRA 5LN1A 3WHLA 1GARA 3ZZ1A 2Q2NA 2XNJA 3ZQ4A 2H0AA 3MAAC 1N2CE 2JI8A 3OCCA 3JYOA 5REQB 3KT8A 4JK3A 3GT4A 1F2TA 1Q21A 2RJOA 2ZSBA 3YASA 1FYFA 1DT5A 1GQYA 1M8FA 1USVA 2GB4A 2PLNA 2YW2A 3AFHA 1KI3A 2EQAA 1YUBA 4IUYA 5FDFA 3DLBA 4PPGA 3SGLA 4H6XA 4LYAA 3V1NA 2ZB3A 4K03A 1TRKA 1AHNA 4TKMA 1J42A 1XEWY 1KU6A 4X92A 2ZULA 4AQ7A 4HGNA 4N9QA 3EUWA 3VKUA 3CWCA 1P5RA 3GFQA 4Y2GA 1WSDA 1HKUA 5AOVA 3GRPA 1WULS 1P31A 2ZRMA 4B47A 5JATA 2DKOA 2QP3A 1HTBA 3HACA 2GPAA 3OIFA 4S1OA 3S7ZA 4LF8B 5KU1A 4AD8A 1C1XA 4FYMA 3PJRA 4YAKA 5DTMA 4BNFA 3LOUA 1H2XA 3CF0A 1O2DA 2GK6A 3EA4A 3MJ4A 4JLVA 2OO5A 4J0JA 4BFTA 1LQUA 2Y05A 3B53X 3U4DA 3WP0A 1AV7A 1N6KA 5AUQA 3CCFA 2BUAA 4MIYA 3DHEA 4L4XA 3U4MA 2NUPB 3EOAI 1I13A 1ZQ1A 3IODA 2AL7A 1TX4B 3U7RA 1QG2A 2IU3A 3A3KA 3IDFA 1E2JA 2VAXA 4H17A 1AQIA 2SCUA 4HUQB 2I91A 2CD7A 1ZGGA 4QPDA 2I71A 2GEFA 4FW9A 1QK3A 5JFTA 2VT6A 4DXDA 1R66A 4C5BA 4UCXA 1RCTE 3OSUA 5BYBA 3C39A 1KBQA 4PHHA 4E88A 4QVGA 3KKOA 1E2BA 1V1RB 2OMKA 4IDCA 4KVFA 2VBCA 4E33A 4RMNA 5K0ZA 2WB4A 1RBQA 1RE1A 3TUJC 4K5QA 1E6KA 2G1AA 2PQ0A 1QTRA 5EUMA 3ZBTA 2QNBA 5IUNC 3QZUA 2QKYA 1R27A 4EPXA 1FYWA 3NIGB 4ID9A 3DEKA 3L9WA 2V7GA 5FPKA 4HFMA 2LRHA 3TAHA 4DEYA 3WVNA 3RWOA 4EJFA 4A0FA 4YMSA 3KU4A 4R1PA 5DCWA 3FVQA 4XR9A 4IQ0A 1K92A 1FJHA 4YP7A 3ZD7A 2YDXA 4QU8A 2IX9A 4D99A 4R2HA 4BKOA 3EIOA 3OFVA 2VTVA 3AQ4A 2FPPA 2PNJA 3I5XA 1IN8A 4Z4CA 1UC8A 4F2PA 1DV2A 2E4AA 2UYGA 3V5NA 4C3OB 3ZCQA 2D74A 3EN0A 5KMGB 1FFXA 2P6MA 4HDOB 1ENZA 3IBYA 1UFRA 1WV1A 4NOLA 4WBXC 3HWSA 3VR2D 1J0CA 4RPIA 4KUGA 1XO1A 2BFMA 4QDKA 2XX3A 4ER3A 2CD9A 3DTYA 3WYNA 2JJMA 2B20A 5U4XA 1RQLA 1E6EA 2FMKA 5I5GA 1MB9A 3JWHA 4AU1A 4KYTA 4TV9F 2JW5A 4Z4EA 4NFLA 2XE8A 3IDAA 4PR3A 1QDEA 2Q3HA 3L1VA 4U9IS 4BNNA 4EUHA 3O1HB 3A6EA 4IJKA 4BQQA 3RS5A 2HM7A 1JEJA 2XA2A 1Y8QA 2QN7A 3BDVA 1YK1A 3FTNA 1HXHA 5JS6A 1J8YF 1FXUA 1Z5OA 4B0OA 3SBEA 1P9OA 4KQXA 1SCNE 1Y7TA 1NATA 1G9TA 3P7MA 1XZAA 1VXRA 3HCBA 4R2WA 4E5PA 1M33A 3IQFA 4O4HB 4ZEXA 3E35A 1W25A 2EJVA 3STYA 2P6UA 3IJRA 3L0BA 5H82A 4CG0A 3QBDA 5B1IA 2ZRKA 1DXOA 1W6UA 4MKIA 2N46A 4L02A 4Q9KA 5LIPA 5DXAA 2ISQA 3G0IA 3O74A 5BYAA 3LXMA 3KQMA 4P4TA 3OURA 3UK2A 4F3CA 2EYQA 1YA8A 1SFRA 2EDAA 3QOWA 5DM1A 4B6OA 4C08A 4EW1A 1DCTA 4YAIA 4IFIA 1SOMA 3O7MA 3T3IA 3PGXA 1Q22A 5CYGA 1BXKA 2COKA 1XTTA 4QRDA 3LC2O 2GXQA 1VLZA 3DKKA 3M81A 4U0JA 3U44A 1J1UA 3IEKA 1TO6A 3PC8A 1KRWA 2B3TA 2FMUA 1V96A 4M9ZA 3Q7IA 3WGGA 1CJCA 2YINC 3FMPB 4YJGB 2MIIA 3GZTB 3T1VA 3MLAA 2P65A 2WTNA 3TNLA 3TCKA 3V48A 3W2EA 3GLIB 4KJXA 1Z6GA 4ENTA 1WB9A 1ZOIA 1J97A 3TUIC 3C5VA 2FVYA 2A57A 2FXIA 5EJ4A 4TXNA 1KAMA 2G9VA 4PSUA 3GPLA 4YY3B 3DZ8A 5ALFA 2UUOA 5TX7A 3VYWA 1GTMA 2OQ2A 4ZP1A 4BLQA 2IUTA 5DNUA 1PJAA 1B43A 4WK0B 2VEDA 4UFPA 2PT7A 1RXSA 1N5JA 1OX6A 2MHCA 2QX7A 3LRXA 1RHQA 1NN3A 4HAZA 4RFSB 1JJFA 3B5EA 821PA 1P0FA 2ZBFA 2ATIA 4UM8B 4AX8A 3QTBA 2IPXA 2XDQA 3LXRA 4TWRA 2QVCA 3SHQA 5H8WA 4AS2A 2WFLA 2A9QA 3AKEA 4HFRA 1BTOA 1GVNB 4DDHA 4MGIR 4UASA 1J4AA 4DDUA 3BPSA 3O38A 3Q8KA 3HXQA 3EMVA 1P2UA 4I2NA 2H7CA 3M6UA 3U81A 1XL1A 3ANNA 3IP5A 4PLVA 2C7RA 3SYNA 1NBIA 1J5PA 3B6ZA 3LQYA 5BW6B 1WW2A 3VR5H 4LE1A 3EMKA 4TLBA 1H93A 1OGIA 1TYBE 4YPFA 3ORRA 4Q7EA 4ZQEA 5EMNA 5LCXA 5JNTA 1QGYA 2RG7A 1VJCA 1Z5NA 2UXBB 4HB2A 4UTXA 1SB8A 2HSZA 2B35A 2QJTA 2QVGA 2Y9PB 3EVNA 3KQTA 3OUZA 4B75A 5I3CA 1JU9A 4FFVA 4D9EA 3K9FC 1QVAA 3HPQA 3QBEA 1VKRA 2OAP1 2VJYA 1V4NA 1W34A 2IYVA 3AEZA 1ZU4A 3N8NA 4NMMA 1RM4A 5FR2A 1L4FA 1ZMOA 3N8GA 4FFNA 4YV7A 2IXGA 5LQAA 2POQX 1WJGA 2R79A 4LI3X 3TW6A 4U3JA 4Q3CA 3T9DA 1PT8A 2OZLB 5D85A 1HZZC 1R0XA 3S2SA 5DNEA 4DS3A 3KE9A 2ZJ8A 4H3VA 2FMTA 4C89A 4PQRA 3DOUA 4LGYA 4WPGA 3QITA 3MELA 3OFKA 2V6FA 2AI1A 1NYTA 2O48X 1N25A 4WBNF 3QKIA 3LFTA 4B81A 4ZCMA 3AFMA 3RUHA 2I7VA 2VDUE 1W87A 3FGNA 4HRAA 4U8HA 4YJKA 4B71A 5K8JB 1VPWA 1QYRA 3EX7C 3ZHTA 5GV8A 5CK4A 3W1VA 4BQIA 3W5UA 4GMKA 1IQRA 5ERGB 1YGYA 3ZTWA 1QGAA 4BNKA 5KUTA 1GKUB 5I7UA 3DYIA 3VKWA 2OFWA 3H7IA 5FUBA 4F06A 4YIHA 1JAXA 1MEOA 1L4YA 1LWOA 1PNQA 1A2BA