4NDNE

Structural insights of mat enzymes: mata2b complexed with sam and ppnp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
IPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase isoform type-2
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 309
sequence length 309
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ndnE00
3C7AA 2O2SA 5B4UA 1L7DA 4PLHA 5IF3A 5HM8A 1T2DA 2AEMA 4CM4B 3VOSA 2DQ4A 2E49A 1N7HA 1Y7TA 3QLJA 5U4QA 3N7UA 3PJEA 4I9HA 3GRKA 3U4CA 2V7PA 1A71A 4OMUA 2CZCA 1XYGA 2JJYA 3KVOA 4CV3A 3ZWOA 4E3ZA 3DBLA 2JFGA 3CMMA 3HDJA 4CM9A 3AUSA 4MVJG 3PZRA 4CM6A 3W6UA 1LRKA 1IY8A 1CERA 2ZQYA 4LRSB 3ZI0A 4NQZA 5TT1A 1F06A 1E5QA 1ISMA 1EFKA 2PY6A 4UUPA 4DBVO 1KC1A 1J6UA 4NDNE 3GFBA 1P0CA 1P1IA 3D4PA 3GVPA 2GASA 1Y8RB 1LQTA 4LSMA 1BG6A 3MZ0A 3ZV5A 3UKOA 3I4FA 1TB4A 3AOEC 5ITWA 3G79A 3MJTA 3ST7A 4NBUA 4J91A 3WFIA 4PG5A 1E6UA 1O89A 4AJKA 1T2EA 4KTTE 4RO0A 2NTNA 4OAQA 2Z95A 4XR4A 4Y6SA 1M2WA 1XU9A 1PQWA 2HJRA 3JYOA 1FDTA 2AQ8A 2X8LA 4RLSA 5HS6A 5G0WA 2NVUB 4CLOA 2X5OA 2XOXA 1HDXA 1D1TA 3NGLA 5AOVA 1N1EA 3GLQA 5LDGA 3LT4A 4OGWA 2VRCD 5CPBA 5AYVA 4LMRA 3BMCB 3KRTA 2OHXA 3VH2A 4DTIA 3K2BA 1R0LA 4J3FA 1E1NA 4CJXA 1DJQA 1QXSA 3KBOA 1BXGB 2B83A 3UW3A 4YTEA 4ZQBA 4RZIA 1UP7A 1NNUA 1O9BA 3ENNA 4TMFA 3CZMA 3JQ7A 4DA9A 4J1SA 3N74A 5A5EA 3GZ4A 5HWSA 2Y1DA 1PQPA 2GO1A 4XIJA 4PFJA 1YBAA 3NDRA 5HTOA 3FCOA 5JAIA 4R5HA 4YT4A 4OJNA 1IPFA 1IUKA 3TSCA 2Y68A 1AE1A 1XIVA 1GADO 3LF1A 4CV0A 4FBGA 3GVCA 3GY0A 5CG2A 3ZNPA 4UEKA 2D5AA 4BL5A 2P5UA 3ETDA 1NQOA 1B14A 1BHSA 1HETA 4I5DA 1PWZA 3M2PA 4TVBA 3PYLA 4EJMA 1I10A 3KSUA 4IUYA 2FN7A 3KSDO 3O4RA 3SJUA 3A14A 4BB5A 3FNEA 4WEOA 3VH3A 1JKIA 5CEFA 1SOVA 1QV6A 1U5CA 3WQQA 2FR1A 3MEQA 4BKRA 1LI4A 1Q7GA 4J0EA 4F6LA 5BNTA 4OQYA 2Q4EA 4BNUA 4ALNA 3H9QA 4GKBA 4F3YA 3FBGA 1VL8A 1YOVB 3HDYA 5JXWA 4UUMA 3W4IA 3ZWNA 5A06A 3QW2A 4BO6A 4Q3BA 2WM3A 3RU7A 3QVXA 2C82A 3EYWA 3QVWA 2HMSA 1C14A 3H9EO 4FFMA 5ENDA 4ZRNA 4UVEA 3F6YA 4IDCA 4JX8A 2Y0DA 1C3VA 2RHRA 1DAPA 4RF2A 4L75A 4RF5A 2Q99A 3W8FA 1WPQA 1PJ3A 4GX0A 4WCFA 3LF2A 1AHIA 4O6VA 1D3AA 3WOHA 2VNAA 3D3EA 3VDRA 2B4TO 1O6ZA 9LDBA 2O3SA 3RD5A 5GY7A 3B20A 2B4RO 1VRWA 1IULA 3EUWA 4PLCA 3I5MA 4UULA 3WICA 3FHLA 3ZWPA 5CEEA 1VSUA 4DQXA 3I9MA 1WZIA 2J3JA 5I8WA 1T1SA 1NVGA 4Z0PA 4CQMA 2J6IA 4J4BA 3KYDB 2X0IA 1KOLA 1EMDA 2VWPA 1SMKA 2VRBA 2A9FA 1V0JA 5I7VA 1ZK2A 2VYVA 2QYSA 3RUEA 3VTZA 4E21A 3DMYA 2ILTA 2WYUA 4GGPA 1DBVO 4RPHA 4Q3NA 1PGQA 1K2WA 1K6IA 1I32A 1B8UA 1N9GB 4Y6PA 1JWAB 8LDHA 3K9QO 4XDZA 1YO6A 1E3WA 4R3WA 4DC0A 4HADA 3H9UA 4FB5A 5A9RA 5IJZA 4Z3DA 3PTZA 1NYTA 3CEAA 3NRCA 1SC6A 4BNXA 3KZVA 2P4QA 4CQLB 1CF2O 5L7WA 3ANMA 3R3SA 4I1IA 1WDLA 4LN1A 3ASUA 2VTEA 1C1DA 2FZWA 2HUNA 3OEYA 4I5FA 3SC6A 5BR7A 3S8MA 4E5NA 4IBOA 2ET6A 3D3WB 3IUSA 1JU9A 1GYPA 2B5WA 3Q1LA 5BSHA 1TVEA 2ZTUA 4RCVA 5GZ3A 2PV7A 3WXBA 4CM5A 1ULUA 1GUFA 4MVJA 3H3JA 3RU9A 2NM0A 2PH3A 2PH5A 5JO9A 3A28A 2VYND 4NJMB 3UXYA 4NFHA 3NJ4A 3CKYA 3CPSA 2Q1SA 4J2OA 2E48A 1FDVA 3T4XA 3EY4A 1RM3A 2X0RA 3KSZO 3R3JA 2YZ7A 1GL3A 1YONA 1OBFO 3L0DA 3PEFA 4GX5A 4N54A 1HDZA 2O4CA 3S2IA 5A9SB 3VZRA 2VOEA 1HXHA 2GERA 3G0OA 1A72A 4A27A 4C7KA 1DIAA 3E9MA 1VKOA 3PP8A 2ZTVA 3VPGA 1Y1PA 1ZSVA 1UAGA 3DBRA 1OI7A 2UUPA 1DC3A 4P4GA 5DN9A 1RPNA 1E1LA 1YJ8A 2WD8A 3PYXA 2ZB3A 1UZMA 2HMVA 1QYVA 1I8TA 3RCBA 4ZGWA 3AK4A 5KJ1A 2X5KO 2RAFA 4XD2A 1I3LA 3UHAA 1SOWA 4WNCA 2AE2A 1XEAA 1NXQA 1Q0QA 2VWHA 1T4BA 4RQTA 1E92A 5KJEA 3TPCA 4A03A 1DEHA 1QYXA 3HDHA 3PFFA 2FP4A 3DMTA 4E5KA 5JDIA 4AJ4A 3GK3A 3HN2A 3EVNA 1S6YA 4EEZA 2P4HX 1M67A 3AUAA 1CETA 4IS2A 2DUWA 2Q2QA 3WMXA 1Y8QA 3P5SA 4DQUA 4GLLA 4MOWA 3JQFC 4LVCA 4NBVA 1EBUA 4KDFA 3VKUA 4JQCA 3WSVA 5EQFA 2AEJA 1BWSA 2PZLA 1VL0A 3HFSA 4P4NA 4R01A 4PLPA 1X7GA 1DJNA 5ILGA 1TT5B 5BNIA 5AXBA 1UJMA 1E7YA 1Q1NA 2JD0A 1CIVA 3JTMA 4DGSA 3VZQA 4ESOA 4KMSA 3HG7A 3HJAA 4J4TA 4XR9A 2GN4A 3JD0A 3Q3CA 5A04A 2JFHA 3OBBA 4RVHA 3KEOA 1JA9A 2JCXA 1XR3A 3GPIA 2QRKA 5JE8A 2YFQA 3MJCA 4CM3A 1JLLA 2DBQA 3IMFA 1KIFA 2WD7A 2F00A 1MLDA 4OQZA 1P1RA 2QHXA 1SEPA 4JP3A 5A5FA 3GVIA 4O5OA 4BNMA 3U62A 4QT0A 1ISGA 3MOGA 3OFSA 3QWAA 3RKRA 5H82A 1T1RA 4IDAA 4RPLA 2G5CA 2EP7A 1YQGA 1PX0A 1X15A 1BXZA 4CL3A 1LSSA 2CMDA 1NWHA 4JROA 2UVDA 2FPPA 3LC1O 5L7YA 4B4UA 4PG7A 4IY1A 4JCOA 5H81A 3GVXA 3KYCA 2PZMA 1JTVA 4PLYA 3TZHA 4ZA2A 5L4LA 3WJ7A 1DRVA 4BIIA 1N5DA 4QTZA 5BT9A 5KKAA 3SEFA 1CQIA 2EERA 3L77A 1T2AA 1RYEA 2JAPA 1MC4A 3EVTA 1E7RA 2C5EA 2RBEA 1DRUA 2H5LA 3ADPA 2IZ1A 1LQUA 3NTRA 5CAEA 5BSEA 3RASA 5JMWA 4PRLA 4RDIA 3VVBA 2YHUA 1PTJA 4IJUA 1WAMA 4IDEA 4J4HA 2GSDA 3W8DA 3B1KA 3S2EA 4YT5A 3FBTA 3LVFO 3T7EA 2RCYA 2FRDA 4PZDA 4PG6A 3NJ8A 4GVXA 2PD6A 3ITDA 1SEVA 2EV9A 4UUOA 3TZQA 2P2SA 1R0SA 4NFSA 4CLRB 3G1TA 4IQGA 1WWKA 3HUDA 5IXSA 2NVWA 1PL6A 3AOEA 2H1SA 4BS9A 1YE3A 2IZZA 3EAGA 1KVRA 3C1OA 4JJFA 1CRWG 2A92A 3JD1A 4QX6A 4YWJA 5JCXA 4GAEA 3DHEA 2W2KB 3Q9NA 3HDQA 4TRMA 2VHWA 4QO7A 4D43A 3I3OA 3D7LA 2WSBA 4TRRA 5JNLA 3Q11A 3IUPA 4UAGA 4WK6A 3WDSA 1D1SA 4NZ9A 1N7GA 3QVSA 1KS9A 3GHHA 4IMRA 2DBRA 2Y66A 3RBVA 5FWNA 1H9AA 5TX7A 4E5MA 4CUZA 4W4TA 2CF6A 3BMNB 3NYWA 1ARZA 3LC2O 1DFHA 4IGFA 4ZQHA 5DP2A 4I9NA 1PS9A 3F47A 2Y05A 1F14A 2O50A 5CDGA 2YDYA 4E0BA 1PGJA 2PKQP 5FEUA 7ADHA 4WJZA 1Y9AA 4M87A 3V2HA 1E3IA 3DOJA 4K28A 2OOSA 3WMWA 4ZQGA 1IZ9A 3RUFA 4M49A 5HRUA 3QV1A 3VAZA 1HSZA 1LDEA 1H6AA 4W99A 1NAHA 2NSDA 5K9ZA 3FWZA 4J49A 2UV8A 2BGKA 1PJ2A 1XHLA 1PIWA 3ZWCA 5CDYA 4J0FA 4GPD1 1PJLA 1PS8A 2UDPA 2OBYA 3MJEA 1KEUA 2PA3A 5L51A 1ADBA 1I2ZA 4E6PA 3E9QA 1SCUA 3O38A 1UH5A 1NQAO 3C85A 4RDHA 5C5IA 1LJ8A 4IMPA 1D4FA 4LCEA 4QUKA 4FJ2A 4H15A 3UCEA 3TOZA 2G82A 4YA6A 3AUUA 5TJ9A 4E2XA 4WE3A 3JYPA 4ZQEA 1ULSA 3VPSA 5GMOA 1C0IA 1HWYA 3IP1A 3DZHA 2VZ9A 3PHLA 4JP2A 5ES3A 3V2UA 4MIYA 4L4RA 1ID1A 4UEOA 4F45A 1ZNQO 4D3FA 3FR8A 3C7CB 4O1MA 4BO8A 1BTOA 2V6FA 4CLOB 4J16A 2BFAA 3I9LA 4IGEA 1GV1A 2GGSA 1C0KA 4YXFA 3U4IA 4PLVA 3AU8A 1W6UA 3Q9UA 3RJ5A 2IZ0A 4BO9A 1U1IA 2ZQZA 5C37A 2IYPA 3F5SA 1DFIA 5JC8A 4B79A 4PRKA 4XWYA 1C0LA 2EP5A 1LEHA 1DC4A 1HDGO 1P1FA 3I9JA 4PLFA 3MJSA 1SB8A 5B4VA 1KVTA 3AI3A 3ETGA 5EESA 4EUFA 1ZEMA 1M75A 4UREA 3EHEA 1VSVA 2X9VA 3VH4A 4EITA 4XYGA 1IPEA 1YBMA 4BNNA 4J1QA 5DBGA 4XIYA 1A7AA 3ZV6A 4GWKA 1W4ZA 2D5CA 4Q3CA 4YQYA 4DYDA 3R1IA 3OJEA 2DUUA 4QFCA 4MVJP 4I8XA 5B12A 3QA9A 5C7LO 2R6JA 1VKNA 3PHJA 1O95A 2VRCA 1EUCA 4NU6A 4CUJA 3GAZA 9LDTA 4JGBA 4YAGA 1QLHA 4XGKA 2ZTLA 1ZH8A 4Y67A 4IXWA 4RVSA 5G2OA 3LQFA 2VHYA 1I36A 1I3NA 2C5AA 3DB2A 5KTKA 4Y98A 5ICMA 3P7MA 4WNIA 1AXGA 4P38A 5L45A 1WP4A 1BVUA 2D4AA 4DLAA 4IXTA 1DAOA 1XKQA 5IAAA 3GEMA 1IB6A 4WLOA 1C1XA 4A10A 1YDEA 4YACA 3PYMA 4IJVA 4DIFA 1UZLA 1P33A 1ZJZA 2CSUA 4RPGA 4YRDA 4O0LA 2UYYA 5B37A 2O3RA 5JO0A 2VT2A 1GY8A 3OJ0A 2BFPA 2GZ1A 5EN4A 1YB4A 3WGZA 5I9MA 4R69A 4ALIA 4YEDA 1U3VA 5B1YA 2DLDA 5DBFA 4WCFB 3WFJA 4BO1A 5I9NA 5ENVA 5TT0A 4AJ2A 3FD8A 3H7AA 5T67A 1L1FA 3EDMA 5KVSA 1D7OA 3JYQA 4YRBA 4U0JA 4BOYA 1DPGA 4DLBA 3DBHB 3L6EA 3SXPA 4J90A 2WYWA 2VUUA 2WEKA 3OJOA 1HF3A 3NT2A 4L74A 1DC5A 4TQGA 4CM8A 5BSFA 1SO8A 4ROSA 3WNVA 1MXFA 5EPOA 4MKXA 1WXDA 4CQMB 3AY6A 4I9UA 3T7CA 1J4AA 5TJHA 3MJ4A 3PRJA 3IKVA 4L0QA 3TQHA 3G1UA 3TN7A 2B69A 3BIOA 5T5QA 1U3TA 3QVOA 3BTUA 1ORRA 1LRJA 3C8MA 2AE1A 5TNXA 5DOVA 3E6AA 3VZPA 1K6JA 4FD3A 4CV2A 1YWGO 2OO5A 4D3SA 5KVVA 6ADHA 4OXNA 4IDDA 3KLMX 1E3WB 2DVMA 3QHAA 1HDYA 1W73A 1NFRA 2JKVA 3JQFA 4HKTA 4JIGA 1JAYA 1JW9B 3GNQA 3KXDA 1V3UA 5FI5A 2OMEA 5AXDA 4BGUA 3TRIA 4Q3AA 4CLDA 2I3AA 1XCBA 2NUAA 2OP0A 2ZCVA 3L4BC 1T2FA 3H5NA 5A02A 3VDQA 1G0OA 1PL7A 1GCOA 1QYDA 4MIEA 1B7GO 2IYOA 3UUWA 1YQXA 3EC7A 3G49A 1YDWA 5A4DA 3EK2A 4A73A 4PG4A 1XELA 3UF0A 4E5YA 1EVIA 2LDBA 4GGOA 1HEUA 5LCXA 4FOOA 1PZGA 1I0ZA 4Z9YA 2CD9A 3C7DB 4J9VA 1ONPA 3PLRA 2CDBA 1YJQA 3ZN2A 3AW9A 4IIVA 4EW6A 3HFGA 3DR3A 2B0JA 3E03A 1MP0A 3OIGA 4II3A 5EMHA 1Z82A 1MXHA 1A7KA 1MC5A 5ICSA 4A2CA 4BB6A 3JQCA 4RJTA 1Y9EA 4XJTA 2FR0A 3DBRB 3MTGA 1SB9A 2HSDA 2HRBA 1ADCA 3RC2A 1F0YA 4I5EA 3I9KA 2OUIA 3FPLA 4DIOA 2EKQA 2EW8A 2JD2A 3ULKA 1EK6A 5L3ZA 3UFXA 2X0JA 1QSGA 4CMEC 2DAPA 4EGFA 4ZICA 1HSOA 3C24A 4MKZA 3JQDA 5A05A 2J8ZA 1GAEO 4MP6A 3JQEA 4G81A 4ID9A 4CMIB 1ZCJA 3HSKA 1V6AA 1EVJA 1HE2A 2HO5A 3GDOA 2ZIZA 3S55A 3HQ4O 3D4OA 4M1QA 1Y8QB 3TNLA 1E77A 4N5LA 5B4TA 1Y5RA 4PLTA 2YY7A 5DOZA 2D0IA 1YRLA 1PU2A 5JAQA 4YYZA 1R4MA 4QFDA 5K0ZA 4IJWA 5F21A 2B4QA 3DZKA 1LU9A 1YKFA 2X86A 1H2BA 3K5PA 4YJFA 1BMDA 4AJ1A 1X1TA 1EEHA 3RFVA 3K96A 1BDBA 2DTEA 4EDFA 2C59A 5CPFA 3PZBA 2PD4A 4Q39A 3KOUA 1YL5A 1VI2A 4BNLA 4DPKA 2EWMA 4BUCA 3DHYA 3AJRA 1ZBQA 4F6CA 4RGBA 1EQ2A 1LC3A 2HK9A 5J23A 1LX6A 1GQQA 1Z75A 3AFMA 4BO3A 4XCVA 3PHIA 4MPDA 3OICA 3D1LA 5JCJA 1MFZA 1VE9A 2CY0A 3H5RA 2Q2WA 4E31A 4KTVE 1G6KA 2AG5A 4NBRA 1PS0A 1BW9A 2O7SA 4GX1A 5JPIA 3QWIA 4OKIA 2DFDA 2C7VA 2EG9A 1JDJA 4F46A 3AWDA 3NTOA 3KO8A 4PVCA 5THQA 5L40A 4P8RA 1NASA 4FPXA 2QG4A 3LK7A 4BV9A 5CFZA 1ZO8A 5KKCA 1X7HA 3GF4A 1E0DA 3E18A 3GDGA 3AY7A 3PK0A 2HU2A 3EZLA 4GI2A 5IZCC 5G4LA 1ADFA 1VC2A 1CQJA 1X0VA 1DLJA 3O9ZA 1GR0A 1WVGA 3BMQA 2IRWA 5COQA 4BMSA 1FJHA 1PJTA 2JL1A 2FSVA 3PVZA 2G17A 2LDXA 2X58A 2XXBA 4WKGA 5T64A 1GPDG 3E8XA 3NDJA 4JXKA 1GZ3A 4AJNA 1EDZA 2QIOA 3WGTA 4K1LA 3FR7A 4CM9D 2RH8A 3JQ6A 1A9YA 2X23A 3WBBA 4YCAA 4ITUA 3PQEA 3BTVA 4Z0TA 1GEGA 3NDIA 4HNGA 4MP3A 2CNBA 4Z6KA 2X4GA 1I2BA 1M6WA 1XGKA 1XDWA 2I66A 2Z1NA 1YVEI 4ZQFA 5F5LA 3JQ9C 4XYEA 4B8ZA 3JD3A 1NM5A 3PPIA 2V6MA 3LLSA 3IKTA 1DIHA 1T4DA 3FNFA 4BNKA 4CLXA 1FDWA 4LK3A 1TT7A 3ZHXA 4TKLA 3E9NA 1WMBA 2P5YA 2QRJA 3GG2A 4M55A 2ZYDA 2C29D 3ONEA 4J9UE 2Y1GA 3QWFA 3PLNA 1D8AA 5L7TA 3RBZA 4FR5A 1JKFA 3W6ZA 1U4SA 3GGGA 1E3EA 1MX3A 3UN1A 5F1KA 3STHA 4LMPA 1SPXA 1U8FO 2JAHA 3BYZA 3VPFA 4YAKA 3QP9A 1GFSA 2AXQA 4W9NC 2Y67A 4DPMA 3JYLA 1NR7A 3ZWYA 1L7EA 3D5TA 1WLYA 1T2CA 2BRUA 1JWBB 1H5QA 3ENKA 4CR6A 5KJFA 5U1PA 3L9WA 3WSWA 1A4UA 4Z3KA 3FWNA 3U0BA 1I33A 1J5PA 3BXXA 1PGOA 4CL8A 2YUTA 4MVJI 1HKUA 4XKJA 4YRAA 5JSFA 1PJSA 4E12A 3IL2A 5G0UA 1Y8RA 3GT0A 3BMOA 1LLUA 4NU5A 3MJVA 4A26A 3I52A 3OF2A 1UUFA 5AVOA 1YQDA 3GMDA 3MOIA 5EL0A 3OA0A 1HTBA 4ALJA 2C2YA 3FI9A 1NHGA 3OA2A 3RUHA 3U4DA 3INTA 3GR6A 1XA0A 5ER9A 2BI7A 5DDIP 5G0TA 3QQPA 4Y9DA 4BKQA 5K6AC 3VH1A 3GN2A 2YHIA 4PLWA 1QMGA 2NTVA 4XQGA 2DKNA 2FMUA 3RFTA 2AQKA 2P9GA 4IZHA 2NVUA 4K6FA 5BQFA 4FQ8A 2YQ5A 4ND2A 3D64A 3LT2A 4WCDA 3RC7A 3ZU3A 2Q45A 2GN6A 1IYZA 2GUGA 4MJLA 4AJEA 1V8BA 3H2ZA 2GRAA 2PK3A 4HBGA 3K73O 2GYYA 3DZIA 1T26A 3JQ8B 1BXGA 3GAFA 1O5IA 1YH3A 2GNAA 2ZJ1A 4DWVA 3KUXA 5IDQA 1UXJA 2JD1A 3RVDA 4R9RA 5KNLA 4BV8A 1EVZA 4DC1A 1U3UA 3QJ5A 1RM0A 4D7AA 3CUKA 3G3EA 3ORFA 1KY4A 3NUGA 4JBHA 4R54A 4ZRMA 1UDCA 2AG8A 2VT3A 1KBZA 4DMLA 1GV0A 3GG9A 3MCVA 3RSHA 3JYNA 5MGBA 2HAEA 3OETA 3RUIA 3WS7A 4OKNA 4P22A 2WMDA 1GYQA 1H93A 4A7PA 3ZU2A 1OAAA 4LGVA 5DZSA 3E5MA 1K5HA 3FSRA 1ZK0A 4S1VA 3L4SO 4E5PA 2Y1OA 3WWYA 4WPGA 2AMFA 3UGKA 4W6ZA 4ND4A 4LVUA 3PJFA 3ZNQA 3FNHA 3WTBA 1HYEA 2VTDA 4FN4A 5DCYA 4Y6RA 4PZCA 2W8ZA 4AJJA 3FPCA 4WOKA 3WLFA 4IM7A 1U7TA 2IXBA 2I9PA 4PIVA 1YOVA 1PEDA 1ZKMA 1DC6A 2QQ5A 4B4WA 1PJQA 2Q50A 4FC7A 4BMVA 4N5NA 2EEZA 3BAZA 1P1KA 3WGIA 3H5AA 3F9IA 2NQ8A 3LT1A 3CIFA 1HT0A 4R1NA 2VYVD 5KVQA 3KYBA 4AJPA 2UUOA 4DMMA 3I6IA 4CLHA 4A0SA 2EGHA 1H6CA 4C7JA 3PGXA 5DT9A 1M66A 4BNZA 2BHLA 2EKLA 2J5KA 5CP8A 4TZKA 3SLGA 4NR0A 3VVCA 5DP1A 3WGHA 3GOHA 2OFPA 4IS3A 3VC7A 2UAGA 4XYBA 2DM6A 3ONDA 3F1KA 5FYDA 3NTQA 2HQ1A 1Z45A 1R66A 4U6QA 4J1TA 4D44A 1PZHA 4R3NA 4G5HA 1Y81A 1B26A 4U6SA 1U9JA 3IIEA 3JQAB 2J3KA 3BTOA 3L4BA 4PG8A 4BNJA 1WNTA 1B3RA 3KB6A 1HE5A 4BGEA 3DQPA 4WLFA 5DBIA 3IQDB 4U7WA 1UP4A 2PGJA 3DBVO 3HB5X 2G76A 3HN7A 3W1VA 4FGSA 3K6JA 3KYDA 1LNQA 3CMCO 4E33A 4XZ3A 2PKRA 3WQSB 3L07A 5JY1A 1G0NA 1B2LA 2XF8A 3F4BA 1QYCA 1C1XB 2DFVA 2I3GA 4Q3DA 1UR5A 5TQVA 3GZNA 4CM1A 2GCGA 2C07A 4XJSA 5THKA 3OJFA 1IE3A 5T57A 1SZJG 4FIZA 2PNFA 2P9EA 3HWRA 4J1NA 1ZK3A 4ALLA 3F1LA 4D41A 3PXXA 1HE4A 3BA1A 4BNYA 3K2EA 1TI7A 3HNPA 5G0SA 5EINA 4CMJA 1GU7A 4ZU3A 4FC6A 4JJGA 5COAA 5I9LA 1BXKA 3BZUA 2Q46A 4S3MA 2PWZA 3A1NA 3H4VA 4XQ9A 3M1AA 4YJDA 4X54A 5TRTA 3W4JA 2W2LA 1MFPA 5ER6A 5FI3A 4NNJA 3AM5A 3OMLA 2EF1A 2Q1TA 2Y1EA 4AG3A 4BO5A 3WQRA 4CM8B 1LUAA 1UXKA 2ZB7A 3ETEA 5DULA 3O8QA 1LLCA 1NQ5A 3ZGYA 1OZAA 2O3QA 4H3VA 4CMEA 5JS6A 5T6BA 4YJGA 2WTBA 4TRJA 1Z74A 2P91A 2YDXA 3GNTA 1ZEJA 3DAPA 4XQCA 5L4NA 3V5NA 1R15A 3LU1A 4AL4A 1R0KA 3GDFA 5DF1A 3B6ZA 1GTMA 1IL0A 1B16A 5AXCA 2G1UA 1KVUA 3DBLB 1H6DA 1I5RA 2YV3A 1ONOA 3AFNA 4XRGA 1EE9A 3SX2A 3UAGA 1E6EA 5C3MA 4INAA 2VHZA 2Q1UA 4TROA 5ILOA 1NPTO 1WDMA 4ZVVA 3DEYX 1HRDA 4RF4A 3JQBC 3VPHA 1YBVA 1X0XA 4B4VA 1NFQA 1E5LA 4KWHA 1P45A 1VM6A 1LSOA 4MVJF 2YV2A 3HE3A 3I6QA 1ZSNA 2C2XA 2X5JO 4J2HA 5EERA 1QLJA 3ITKA 3PWKA 2ZATA 3KTDA 1MGOA 4E30A 2WJPA 3F3SA 4NIMA 3EGOA 5JYDA 2OXIA 4B3HA 2GZ3A 4CM7A 4L9RA 3BHIA 4CR8A 4EZBA 1G1AA 2C0CA 3ZU4A 4D45A 4ND1A 1GDHA 4YT2A 4OOEA 2OORA 1NPYA 1ZZEA 2AQHA 3IDSA 3PQDA 5COBA 3WYCA 1VJ0A 3OH8A 2AA3A 5A1TA 4Q9NA 4YDRA 4RVUA 2R00C 1ZSYA 2C7GA 4FW8A 4DUPA 1E1KA 3NX4A 3HHPA 3WIDA 4PN3A 3AUTA 1BGVA 3WBFA 2DBVO 1HLDA 1HDOA 1WDKA 4AFNA 3DZFA 2VHVA 5AQ1A 1R6DA 2Q3EA 3LDHA 3P2OA 4IZIA 2DBZA 5IZCA 3E5RA 4BNHA 4GMGA 4U5QA 4TZTA 1T25A 4UVIA 5KOIA 3GUCA 3RUCA 1KEPA 1E3SA 4RPKA 4XYMA 2GDZA 3LT0A 2JHGA 4BNFA 4JLWA 1ML3A 1KEWA 1KYQA 2PZKA 3JQ7B 4MP8A 4L8VA 3LLVA 2BFMA 3I9NA 2YQ4A 1B8PA 5JY6A 2IODA 3SLKA 2RH4A 3HB4X 3QRWA 5DNAA 3GA0A 2O3TA 3P2YA 1B3BA 3GMSA 3ROPA 3H8VA 5C7OO 3L6DA 1WMAA 4W82A 3JQ9A 5F1OA 4HWKA 4OL9A 1P0FA 1R4NA 3ICPA 1JN0A 1ISIA 2QX7A 4WASA 5H83A 3S1LA 3WGYA 3LZ6A 3CH6A 3WGOA 3HZZA 2VZ8A 4HFJA 1R4MB 4M86A 2JFFA 1EUZA 4DIBA 2AW5A 1VPDA 4DL9A 4EJ0A 1TA4A 4YJFB 2GR9A 3NAQA 1SAYA 3WJAA 4YAJA 1NHWA 3U5TA 4WOJA 3WGGA 5JYEA 1CWUA 3LC7O 3MWEB 3ROKA 4BMNA 4W9NA 5LC1A 2GF2A 2PKQO 3GHYA 2I76A 1MG0A 2CVOA 2ZKLA 3GC6A 2ZYGA 4YJHA 4DPLA 4UVGA 1PQUA 3SC4A 3INGA 3ROMA 4BO4A 1DIGA 1DIRA 1LTHR 2NTJA 4JN6B 4RQUA 1YXMA 2Y0EA 4MDHA 4R41A 3P19A 2VOJA 3DZJA 3RFXA 4I5GA 4NI5A 2EIHA 1Q7BA 1BW9B 1Z73A 2F1KA 3RI3A 4BKOA 5KCZA 2ZK7A 1W8DA 3NGXA 4OIMA 1XWFA 1EBFA 3RC1A 1X7DA 3IJPA 4XB1A 3GEGA 4U0KA 2HJSA 4DQVA 1UXIA 4E32A 4WUVA 3X2FA 5L53A 1U8XX 4R51A 3IOYA 3KV3O 3R6DA 4PVDA 1NQTA 3H65A 4LRTB 1B0AA 1O94A 1J49A 4D79A 5K6AA 3WG9A 2W2KA 2X0NA 3L6OO 1F12A 5T8KC 1TEHA 3GVHA 4XGNA 3DOCA 1VLLA 3X2EA 2O23A 4ND5A 3H9GA 1F17A 3JD4A 1YS4A 4GWGA 5ADHA 4NBTA 1UAYA 2PFGA 3DZGA 3TZKA 5CDSA 1UDAA 2CDAA 3DFUA 3IAHA 4RLHA 1DFGA 4QECA 2J5QA 2O7QA 4L73A 3UICA 2E4AA 2VUTA 1KVQA 2ZCUA 3QY9A 1PR9A 4YPOA 5CG1A 5IZ4A 2I6TA 4FOSA 3ON5A 1XQ6A 3LYLA 2ZB8A 3EW7A 1E3LA 4BGIA 2DTXA 1FMCA 1U28A 3E1KA 1U2DA 4FJ0A 4L4XA 2X9NA 3EMKA 1VL6A 4PLGA 4L76A 4EUEA 5HS4A 1P44A 4R5MA 3VKVA 2B36A 1NR1A 4WLUA 1M6HA 1N8KA 1RM4A 4OH1A 3V1UA 4Z9FA 1C1DB 1NP3A 5F3RA 4O59O 1BRMA 1KETA 4RF3A 4GKVA 3OIDA 1PJBA 2D8AA 2PGLA 5TGDA 1A27A 4FGWA 3LSYA 3WWZA 4DRYA 2NU8A 4KQWA 2AHRA 5MDHA 4M54A 5ITVA 4NHEA 3WTCA 4XX0A 3TZ6A 2O3UA 3QWBA 4NMHA 3ROQA 2OP1A 2IE0A 2Q49A 3ZZNA 2BD0A 1U3WA 1Q7CA 3U49A 2J3HA 2H6EA 2A94A 2WWRA 4RV9A 4D0SA 3BMOB 4MVJM 4RPJA 5L9AA 3NKLA 3DWFA 3QWHA 1R37A 1KERA 5HA5A 5I8ZA 4QQRA 1GUZA 3KEQA 2OL4A 3U3XA 2H9IA 4W7HA 4W7IA 3RUAA 1XG5A 4KP7A 1N2SA 2YHIB 4CLEA 1I3KA 4URFA 5I7EA 4GH5A 3TFOA 5BNFA 2DT5A 2XXJA 4EBFA 5C7IO 4EI2A 1E6WA 3ZU5A 3Q0EA 5TLSA 2IDZA 4BNWA 3WYEA 1AGNA 4BO0A 3C3XA 2FHSA 5CHEA 3V1YA 1SBYA 2BMAA 2VYNA 1P31A 3GPDG 3CXRA 3JQGA 4HXYA 4PLZA 1LBEA 2BGMA 4DXHA 3JQAD 2W4QA 1ZMOA 2WE7A 4OM8A 2HK8A 2VQ3A 4YAIA 2GD1O 2JHFA 4JK3A 2CDCA 5G4KA 3ZV3A 4AJOA 4R1SA 3DZBA 4CMHA 4CMKA 3A06A 1NVTA 5A3VA 4FFPA 1EFLA 1NTOA 4MVJE 4ZN6A 4MO2A 5IDXA 1SNYA 1QRRA 2PLAA 3DFZA 3GFGA 2IEBA 3DDNA 1NBOA 1UXGA 3I23A 2VN8A 4OXYA 2V6GA 3TL2A 3ZNNA 3PDJA 4RVFA 1MUUA 2PTGA 1P9LA 1A4IA 1FK8A 1H94A 3OP4A 4PGFA 2A35A 3DO5A 1ENYA 2X6TA 1VJTA 3AOGA 3K92A 2FOIA 4XQEA 4JBIA 2O3JA 3F4LA 2WD7B 3RJ9A 1DIBA 1KC3A 3OJLA 1PGPA 5TC4A 4AICA 2X1HA 1IOLA 4MVJH 5A3JA 2NACA 1HYGA 2FZEA 3OQ6A 4R1TA 4K9DA 3RC9A 4TVOA 3ZWWA 3RWBA 1DXYA 4UVHA 5JDCC 3DXFA 3M2TA 4YB8A 4FFRA 4AJIA 4NJOA 2ZB4A 2PR2A 2AEFA 1GPJA 4EJ6A 4RORA 4G2NA 3ZNOA 3KYCB 4EUHA 2GLXA 3GRPA 4H7PA 4WGGA 1AXEA 2O4UX 1Z7EA 4QO8A 1Z6ZA 1PGNA 1M76A 5EIOA 4IDFA 2EKPA 4I08A 3DTYA 5A9TA 3ZHYA 1ONNA 1EDOA 1LDYA 2HK7A 2Q4BA 4NK4A 4CODB 4R4JA 4HFRA 1GQ2A 1F8GA 4TWRA 4WECA 4R68A 1HDCA 1JQBA 3DBHA 3NT5A 3JQBA 3WIEA 2Y93A 2EJVA 3IC5A 1RKXA 4CR7A 4U8GA 1DRWA 4LISA 4TSKA 3PHHA 2FY8A 1QR6A 2I65A 3MWDB 4IJKA 5IFLA 1EQUA 3T4EA 5G0VA 1I2CA 4CM4A 3FTPA 2V65A 2NVBA 4BNIA 3DC2A 1R16A 4QSMA 4HV4A 3GZNB 4WLVA 2EXXA 2BGLA 1MV8A 1ZXBA 2P68A 1DOHA 5IN4A 4Z9XA 1RM5A 4PZEA 7MDHA 3JSAA 5JW6A 3RAJA 3B1JA 1Z7BA 2R00A 4XDYA 1CDOA 4HY3A 4E2ZA 5L95A 3TF5A 2NLOA 5I7FA 3ICCA 4FFLA 5JLAA 5IG2A 1MA0A 2PZJA 3KLPX 3I83A 1X14A 3V8BA 3ZWAA 4NFYA 4BQRA 1YL6A 3I9OA 3B1FA 4IIUA 4HX5A 1U4OA 1HE3A 4HNHA 4IQ0A 1LSJA 4HP8A 5EQDA 3TDKA 1LLDA 3CTMA 3PFWO 4DBZA 3ZV4A 2YYYA 3DHNA 3O8QB 4AJLA 1I3MA 1JVBA 3PJGA 6LDHA 1E1MA 3ZWVA 2R2GA 1XU7A 4YJGB 3A4VA 1PJCA 4YR9A 2WE8A 3W4KA 3H3FA 3OHSX 1P74A 1DHTA 1OMOA 4XRRA 1NWCA 2A4KA 5JC1A 1K3TA 2O48X 1PZFA 1NPDA 4KDEA 4KUGA 2E82A 5L4SA 4ZJUA 1H0KA 5BSGA 4R1UA 1X13A 1UZNA 3K31A 3K8ZA 3S2FA 2D1YA 3G17A 1V35A 3ANNA 1KEVA 4NK5A 1EK5A 4OO3A 3FTNA 1OOEA 3BMCA 3WGQA 1E7SA 1EE2A 3SBOA 5DCWA 4DLLA 1Q0LA 2H63A 2TMGA 2P9CA 4IINA 3SJ7A 5LDHA 1I24A 3AI2A 1NX6A 4WLEA 3Q6IA 1HL3A 2WDZA 1ZVMA 2IXAA 4N7RA 1ZJYA 4CMAA 2CVQA 4N18A 3CE6A 4KWIA 1YB5A 3RBXA 1IZ0A 2GPTA 4JNKA 2G0TA 3O26A 2BELA 5TF4A 4DVJA 1ADGA 1YL7A 2I99A 5JCJD 3IJRA 4CMIA 4C4OA 2VWGA 1H9BA 1T24A 2WYVA 3R0IA 1GYRA 1VJ1A 3TL3A 1E3JA 3WX0A 1LC0A 4IDBA 5HBRA 5I7SA 3PIDA 2J3IA 1WW8A 4OXKA 4J7XA 1FDSA 1BDMA 1HDRA 1LLQA 1S7CA 3UCFA 5A03A 4OOFA 3WNQA 3ZH2A 1GCUA 4DREA 2NU7A 5KJ6A 4MKRA 1WZEA 4R16A 1OC4A 2NWQA 3OQBA 3I4CA 5T8KA 3DAGA 4L4SA 3K30A 2BLLA 3VPXA 1JVSA 3E48A 4MINA 1C0PA 4CQMD 1O8CA 1PWXA 4FCCA 4YVFA 1OFGA 3F5QA 4ZD6A 2TMDA 3B70A 4RVGA 1ZK4A 2D2IA 2SCUA 3ASVA 4CMCA 2CF5A 2FR8A 4N5MA 3MTJA 3TZCA 3UH1A 3GEDA 3TWOA 2VUSA 1RJWA 2NNLD 4Q3EA 4D42A 3OEWA 4M89A 3U4HA 4EYEA 3ZWMA 1XSEA 1K6XA 4ILKA 5KIAA 1MG5A 2DPGA 4R9SA 1XLTA 3DL2A 3L9XA 1UP6A 3PJDA 4HUJA 1ENZA 4BKPA 3ZW9A 3COSA 1R4NB 3V1TC 1CEQA 3JCZA 4H16A 4YBZA 5AXAA 1I01A 2GN9A 3PHGA 5JBIA 3CINA 3FF4A 2NQTA 3DTTA 3FRJA 4TKMA 3M6IA 4NH4A 3W8EA 3NV9A 2BI8A 2EW2A 4BHTA 3ONFA 5FFFA 5F1PA 1XQ1A 4ALKA 2HKIA 8ADHA 2PGDA 2HMWA 1HZJA 5JAMA 1U7HA 1H6BA 4ALMA 1GD1O 2X7HA 3M1LA 4B7UA 1V9LA 1ENPA 4G65A 4BO2A 3KETA 4YJHB 3KM0A 5CDUA 4EEXA 2YV1A 2I67A 4MVJD 3WLEA 4LSWA 3GGPA 4J7CA 2QRLA 1N9GA 3VTFA 2HCTA 5TSDA 3H6KA 2HRZA 1HYHA 4ND3A 1B15A 3SVTA 4FFNA 4E2YA 1ISJA 2NV6A 1Y6JA 4J6FA 4M8SA 4B7CA 4E13A 4XGIA 2B35A 3AU9A 5IDYA 1UDBA 5CDTA 3ZHBA 1HZZA 5IXYA 4J43A 1ZFNA 3AM3A 5GZ1A 4O63O 1PR3A 2ZYAA 4BGVA 2GN8A 3A9WA 3OIFA 4CQLA 4YT8A 3FN4A 2VNSA 2Z1MA 2EGGA 4HFMA 3ZWXA 2V6BA 2DTDA 3WR5A 3TFQA 5TS3A 3BHJA 1A5ZA 3RROA 1QP8A 1I30A 3TOXA 1UXHA 1LRLA 1DLIA 4II2A 1DO8A 1JAXA 3QIVA 4NBWA 3UVEA 2CFCA 4GX2A 2DU8A 3ANLA 1N1GA 3D3WA 3FNGA 2E6UX 4KZPA 2BH9A 2DPHA 2E37A 2OBNA 1FDUA 3IP3A 2C20A 4FDAA 4XEHA 4B8WA 1BSVA 1IHXA 1KVSA 3NEPX 2DC1A 2Y1FA 4PCVA 5DCUA 4GQAA 4NJMA 1ZIDA 4OSOA 2Y99A 1LA2A 3ADOA 1YB1A 1YGYA 3UCXA 4B3JA 1PZEA 2HLPA 1MB4A 1W0CA 2FPIA 1U5AA 1H2HA 4JBGA 4XA8A 3BTSA 2QYTA 4WCFC 4YQZA 1B8VA 1P1JA 2YFHA 1TLTA 2XAAA 4Y8VA 1EZ4A 5A9SA 3GH3A 1QV7A 1LXCA 2J5RA 3QSGA 4RZHA 3Q2KA 3OQ1A 5EJ2A 3PGJA 3RIHA 4RVDA 2CUKA 4D0RA 4KOAA 1HLPA 4GMFA 3D0OA 1KY5A 4Z0HO 4BNTA 2NU6A 3CZRA 4NG5A 1F8FA 3BHMA 2QZZA 4B3IA 4OSPA 1E7WA 3IS3A 3N58A 5JMPA 3ZW8A 2X22A 1QG6A 4K6CA 2VHXA 3PDUA 2I5PO 4D46A 1DDOA 1DSSG 1CYDA 3JQ8A 3DONA 4FJ1A 1Y5MA 4IDGA 2EJWA 3AI1A 4A5OA 4J7UA 1V3TA 1QORA 2ZJ0A 1GZ4A 5GZ6A 3D4NA 3U09A 1K89A 3H9JA 5U9CA 3C1TA 5JDCA 1LDBA 3ZCXA 2VCYA 1P77A 1FXSA 1GQYA 1PJ4A 4E2WA 5FF9A 3ZWBA 3ABIA 2CVZA 4CUKA 1AN9A 1TT5A 4XYLA 3PI7A 3VZSA 3JV7A 3RQSA 3HADA 3VHRA 2HDHA 4ONEA 4MIOA 1Q0HA 1EVYA 4KQXA 2POQX 2HMTA 2QW8A 4BNGA 1K0UA 4GSKA 1ZK1A 3I1JA 4RL6A 2B5VA 3JD2A 5JAZA 2B37A 2VZ0A 2D3TA 3PQFA 3D5QA 4HFNA 2YW9A 5KVCA 5JFOA 4NPCA 3AM4A 4CV1A 2PD3A 3INRA 2FPGA 3JQGB 2AQIA 2Z5LA 5TIIA 3WYBA 1O0SA 2BF7A 4GSLA 2W98A 5KWEA 3OECA 5G4KB 4AJHA 4QXMA 4UUNA 4LCJA 2BKAA 3C1AA 3ZDFA 1QKIA 1AHHA 2ZTMA 1DHRA 2C54A 4QEDA 1JKJA 4GLOA 1GEEA 3EZYA 1GUYA 3E82A 4JJIA 2QZ9A 1N92A 3TJRA 1BVRA 2OGUA 1ZW1A 3F46A 3OSUA 1EUDA 2NADA 3DOOA 1R12A 3GUYA 2Q2VA 1OC2A 4IQ8A 4K26A 1ZXLA 3CSDA 2W90A 3S2GA 4D3DA 1RYDA 3O03A 2Q1WA 4GL4A 4LW8A 2FWMX 4WEQA 4B7XA 3GGOA 1ENOA 2IEDA 4DYVA 3V2GA 3PIIA 3DAFA 4OHUA 4BVAA 1RWBA 2EHDA 3NT4A 5F5NA 3JQAA 2X9GA 4BKUA 3PWSA 1P1HA 5JDIC 3DMTC 4KUHA 2W2LD 1P3DA 2OZPA 4GVLA 4CPDA 2NU9A 3RKUA 1CJCA 1NFFA 3GQVA 1ISFA 4BNVA 2Y1CA 1LDNA 1Q2XA 1PL8A 1PSDA 4FFOA 3ZHZA 4CMGA 4CMBA 5KJCA 2HMUA 1NVMB 4CLRA 4OYRA 4KUEA 1IHYA 1ZMTA 1LDMA 4AVYA 3QVTA 1LSUA 5CEJA 1U2GA 2O2YA 4YAEA 3WB9A 2FSSA 4WLNA 1AUPA 3GNSA 1NAIA 5IN5A 1DB3A 2GZ2A 2D59A 3BMQB 4P4LA 3RUDA 1ZUD1 1A9ZA 3QE3A 4E4YA 2JCVA 4ZHSA 3U9LA 4BQPA 4IPTA 3H2SA 2BFOA 3AY3A 3UOGA 4FSHA 5IDWA 1LDGA 1X1EA 3GN1A 1TXGA 3PWZA 4B4OA 3BMNA 1E7QA 4GBJA 1J0XO 2XPCA 2Y0CA 3OM9A 4UVDA 1ISHA 1E7MA 2VWQA 4UEJA 2JCYA 1V3VA 4TRNA 1GZ6A 2YJZA 3Q2IA 1QYWA 2RHCA 4FS3A 1FF9A 4XB2A 4BO7A 3KHUA 2RIRA
chains in the Genus database with same CATH superfamily
2QT1A 4W8HA 3EIWA 3HFJA 1VB3A 3C6XA 3PVCA 4M36A 3FTCA 4Z99A 3T9CA 4UUAA 4QODA 4D57A 5HIMA 3PE6A 1T2DA 3T1TA 4D56A 4CM4B 1SUBA 4GLFA 3QNWA 2FSHA 2WG0A 3N2KA 4AG6A 2EFDB 3E7XA 2BW0A 3HBLA 1N7HA 3A26A 4ISCA 4D6YA 4N47A 2HU5A 3N7UA 2BEUB 4FS8A 4KSBA 4WRRA 5TGZA 1L4GA 1VMDA 3TLYA 4QGSA 1PUIA 3O4HA 3N8IA 2N1MA 4N3AA 2V7PA 2XV1A 4EG3A 2DFPA 2GJ9A 3KVOA 4G8JA 1LPMA 1H2WA 3HDJA 1ZM4A 1YRQA 5HNKA 3W6UA 2AN5A 5FPSA 3WLMA 3N6VA 1T9GS 1XAJA 4GMHA 4JZYA 4LRSB 3HJRA 3ZI0A 9ATCA 2XXAB 2BBWA 2QMZA 4B45A 4DR7B 3AG6A 3QUAA 1PL0A 2PUDA 1KC1A 3N39C 1J6UA 1O6FA 2M6KA 1PFQA 4X90A 1CJVC 2Z56A 2O20A 1P0CA 1P1IA 2CK3A 3EA5A 3HXPA 4P93A 5FUYA 1F8UA 1VG8A 1Y8RB 3R44A 4JQSA 2HQRA 3EQ9A 5EAIA 3RBAA 5FPTA 13PKA 2IYEA 2C2WA 3I4FA 1ELOA 5SYMA 2YHAA 5KNCH 1F3LA 1JQDA 1TCBA 1XRLA 3G79A 1KBQA 2AK3A 2WM8A 3FZGA 5ERYA 5E7IA 4JUFA 5DPMA 4NBUA 2C2MA 5C4GB 1E8MA 3O4JA 3WFIA 1E6UA 3HXTA 2TYSB 4IVNA 1JFLA 1T2EA 4AJKA 2GHRA 2H4YA 3QFTA 4Z0NA 4Y6SA 1L7PA 3IHTA 4FYMA 5JXGA 1PQWA 3JYOA 4CLOA 3EF0A 2AQ8A 3RYIA 4EKYA 4IW3B 3JWGA 4N41A 3ZE0B 3TXAA 1HDXA 3RVJA 1N6RA 3S1AB 4A0RA 4CNBA 2HA6A 4OHBA 2WKQA 3LT4A 1AMNA 2V7QA 1ZDMA 2NZUG 1EFAA 5CH3A 3IR5A 3K9BA 4DTIA 3FKQA 3DDWA 4CJXA 1DJQA 1QXSA 3PGMA 1USIA 1OQAA 3CKMA 1HI9A 4YCDA 1S2GA 3EXFA 2XKJE 2F64A 2J7PA 3NCTA 4FYKA 1OWOA 3QM1A 4QRDA 4IG9A 4RZIA 1UP7A 2YXEA 5EZYA 1Z39A 2UKDA 2FI1A 1NZJA 4G86A 4C7BA 1Y89A 4U5XA 5KI6A 2WIGA 2ECFA 2VBGA 1KZYC 4TMFA 4FMCB 3CZMA 4DA9A 1D5CA 2J30A 4YMHA 1PT9A 2OV8A 3NNSA 5FR2A 3GZ4A 2EL9A 5DM4A 5A5EA 2XEDA 4F2GA 5HTOA 1JLKA 2PGOA 4FN5A 2VJMA 1XUOA 2VQ6A 1FUKA 5I4BA 1J2YA 4I4IA 4OHXA 1TYCA 1IPFA 1IUKA 1FY2A 2ENWA 4KFRA 2BH2A 2G08A 1AE1A 5ES4B 2O2EA 4C7VA 3U37A 1RZ3A 3LF1A 1QJ4A 4PU0A 1ZGBA 3GY0A 4KC0A 1QGUA 5CG2A 1IJBA 3IBSA 4GXQA 2I80A 3OE7A 1JPJA 2CNLA 2WSYB 4UEKA 1ICEA 1GXSB 3AR6A 3AERB 2WY2D 1HETA 3NHYA 4XSGA 1PWZA 2CUNA 3PS9A 3KB8A 2GOYA 3UQZA 2QMEA 2EAUA 2OO7A 4UARA 5ELXA 1QP4A 5ELLA 1SUDA 2FN7A 5BSMA 2QZSA 3JAMA 5JT1A 5B2ZA 2VPQA 4RULA 1CVRA 1PR5A 1PSWA 2NO7A 1S8FA 4DR4B 1XP8A 5E3IA 1YUMA 1QV6A 1QCZA 1S2NA 3OZDA 4RK5A 3MEQA 4PE5B 1H66A 1FFCA 3E5NA 1CJKC 3GWZA 2X40A 4JA2A 2G1KA 2NSHA 3DJFA 4GKBA 1N8NA 1JHMA 4N8SA 1GGEA 2PJDA 4URWR 1SQ5A 4D8UA 4UM5A 1DJOA 4WBNA 4A5SA 5JXWA 3W4IA 3BMXA 2O06A 1B0UA 3QW2A 4Q3BA 4RWEA 2IHVA 4P0TA 2SCUB 3A9RA 2FYTA 4BO6A 3QKRB 3QVWA 3VR6D 2OVBA 3UIEA 5JANA 2AKYA 1IZ7A 1J09A 1JA1A 4ZRNA 1O4VA 4KDRA 3ZV7A 2VJYA 4JX8A 2Q9UA 2WA2A 2Y0DA 3RODA 1C3VA 2ZWVA 2GKSA 2ODBA 4RF5A 3KZNA 3W8FA 2WPDD 3DULA 3HLKA 5B2EA 1C4XA 1WPQA 2FXVA 4R9NA 4YP1A 3SIPA 4B84A 4WCFA 4Q02A 5JMOA 2QV0A 4KQCA 2WKRA 3WK6A 4YRGA 2EX4A 2IHUA 2YIJA 4NL4H 5G41A 3ZTYA 2PR7A 4TYPA 2VHJA 2B4TO 3HVKA 1RD4A 2Z8YM 1MB3A 1U1FA 1PDVA 2O3SA 3RD5A 4EVSA 2HPAA 3BWEA 2B4RO 1VRWA 1IULA 3BB4A 3UWDA 1BMFA 1XTPA 4GI5A 4Y18A 4YP9A 5TQ2A 4UULA 4PONA 3VR3A 5JNUA 3ZWPA 2DP4E 5DTRA 5CEEA 3BEDA 2CV1A 1BQ4A 1T3SA 1DKRA 1OUMA 2I2BA 3GP8A 5LMCA 1E2LA 4MUAA 1QCCA 2ZJ8A 2QD4A 5I8WA 3LWBA 4HRVA 1T1SA 2G5GX 4Z0PA 1JFFB 3G6KA 3I04A 5U4XA 1KOLA 1NP7A 1AUOA 4FYIA 3EMDA 4X7BA 2FA9A 1DX9A 1BQEA 1N4DA 1Q7TA 2D1SA 2VRBA 2DKFA 5E2AA 1Q19A 2A9FA 4WXHA 3DMHA 3QXSA 1E2QA 3AB8A 2WP8J 3GFQA 1H1LB 1D1PA 3SYRA 2O54A 1PFGA 4RPHA 3FJOA 2C2OA 1K6IA 4OHOA 2FE1A 1B8UA 1IN1A 5CFPA 3D0RA 1XZPA 3I2HA 3A04A 1H0RA 4BMPB 3H9UA 5AVKA 4EUNA 2IPAB 2P4SA 3M70A 1ZJJA 1H23A 4O2AF 2V9ZA 3IMCA 4M1EA 1QWSA 1ZG3A 5HCIA 4QTUB 2NV2B 3GJ5A 2WFLB 3IPYA 1XZAA 2AWNA 2CB9A 4YCSA 2VJQA 1KP9A 1YZVA 3HHEA 5KX5B 1CF2O 3BB1A 3SHFA 2X2OA 3ANMA 4LN1A 3ZGZA 1A50B 3ASUA 2GCOA 1C1DA 1TKBA 4UXJA 1J2JA 3ED5A 2GUWA 1KHTA 1V8OA 1R8XA 1I1QB 5DHQA 3DBOB 4IL5A 2GN1A 2ADOA 1P8AA 3EOBI 3IA7A 4Y2PA 5ALEA 4D99A 4EKNB 3D3WB 5AM3A 4L5IA 1JU9A 3AVWA 1JEQB 3Q1LA 5LOVA 1RC8A 4RENA 4WD3A 1W0JA 4JB3A 4CKWB 4LPKA 2P9FA 3SJBA 1KI2A 3WXBA 1UDXA 2QRGA 1VOTA 1RI4A 3MJRA 3VC1A 4MVJA 3MRTA 1M7BA 1TVKA 1J2UA 2NM0A 1P7YA 2H2AA 1CDEA 1NC3A 2VYND 4OXXA 2NUTA 3B13B 2I1LA 4GPIB 3UXYA 1JBEA 2B6HA 1YDHA 1SIWA 5BN3B 2E48A 1FDVA 4Q19A 1I5EA 3D6UA 3Q10A 2X0RA 5DLYA 5EJAA 5AWFC 1R8JA 5LA6B 1M1ZA 4F11A 1WXQA 5FBKA 3Q7EA 4EX6A 4JJ7A 4TV9A 5DM2A 3U13A 1N0UA 3QU2A 2H7YA 2P6UA 4EQZA 2CNOA 4LA4A 1HDZA 4PC7A 3VKHA 4RELA 2D5BA 1ORWA 1T6BY 4RKWA 3VZRA 2WZCA 3PDIA 3T7KA 3DV2A 1C1YA 4A27A 2D5IA 2X9QA 5FPHA 4DRZA 4E7OA 1VKOA 3PP8A 2WWWA 2JGKA 5IAEA 1OI7A 2UUPA 4KWEA 1E1CB 2FMHA 4G1BA 3ZKWB 5HOEA 2BR5A 4V03A 1RPNA 4QTXA 2EBUA 3QEOA 1Q0SA 1NULA 2HD4A 2O1WA 1S02A 3B78A 3KD3A 2Z4SA 1RBZA 2A0WA 3UT5B 4EFMA 3C5HA 1I8TA 1UBSB 3T1HB 2HJHA 2X5KO 2RE8A 2RAFA 4XD2A 1I3LA 4L5CA 3UHAA 1G291 2I54A 1Y1LA 1XEAA 2AMJA 3G8DA 4ZT6A 3G13A 3BH6A 3IIJA 1CIJA 5B1EA 1RCFA 4EJSC 2VWHA 1NQXA 1V7QA 3R7WA 1M1NA 5BV0A 4EFLA 2C2BA 3IAUA 2C96A 5JDIA 4E5KA 1RQ2A 4AJ4A 3UH0A 1Y42X 1J00A 4FP9A 1S6YA 1R1DA 5K0JA 2P4HX 3MBKA 4XQ9A 3TW6A 1RS0A 3R4CA 4NMLA 5ICEA 2E7ZA 4NBVA 4IRXA 2XYRA 4TVKA 5E4FA 3GD7A 3TGLA 3CGWA 3WKDA 2AEJA 1BWSA 3HFSA 3OWHA 2O1XA 2QR3A 3QLEA 1AKUA 2FCAA 1X7GA 1X80B 2BP7B 4PLPA 5JBQA 2MU1A 1GGFA 1DKPA 1EWYA 3EZ9A 2JVIA 4RCZA 2HHJA 1Y4UA 4MYDA 5E1OA 2Q5QA 4MUNA 1GNPA 3LY5A 3NP9A 2I7CA 3UJHA 1JBQA 2HDOA 3OX4A 1K98A 3JTMA 4DGSA 2HA7A 5JCXA 4KMSA 2O2HA 4LBVA 2BGTA 2GN4A 3RS3A 2JFHA 3OBBA 2OHJA 3KEOA 2GAOA 3ZE7A 4P3PA 1R18A 4KPFC 4G4SO 5JE8A 3WI7A 4DA4A 1JB1A 2QRKA 1SGWA 5DK4A 4LE2A 1DC8A 3ZLBA 1SWVA 4JODA 2C1ZA 5JVDB 1L4HA 2JGMA 2CDRA 2WD7A 1YRYE 2F00A 2JAQA 3PKZA 2I78A 2QSJA 2JFUA 3SOPA 2R60A 2HA2A 3G2NA 1EB8A 2IYZA 5JCOA 4BNDA 2PKCA 5ALHA 3PUJA 5ALLA 3EPKA 2GRUA 3MVEA 2IY7A 5F2KA 2AC4A 2OXTA 1ISGA 2W2VA 2EZ9A 2XKAA 1SC1A 4RH1A 5C46F 1GA4A 4RPLA 3FB4A 3TINA 3V42A 2V59A 1PX0A 1ZRNA 2PBRA 3P8ZA 4Q47A 5CYFA 4B87A 4Q4CA 1CE8B 2O2CA 1U0LA 5K3SA 4YCNA 1FNCA 2FPPA 4MGIR 4OJKA 3L8HA 3BWYA 4YMWA 4IY1A 1P0QA 2PLWA 3QZUA 4OB7A 5ALKA 3ZHUA 2PZMA 4OQPA 1VBMA 5FFMA 3TZHA 2AKEA 1FYWA 1D2GA 1MGPA 3O92A 4HHEA 5JXHA 4IHJA 1WHSA 4LYEA 3GGSA 1HV8A 3KVYA 3SEFA 3MLBA 1FYEA 1DAGA 2J9YB 2G7MC 3IO5A 1PZMA 2JAPA 4MH0R 1MC4A 3U4QB 1YZUA 3EVTA 5JALA 2C5EA 5KDDA 3I5UA 2H5LA 4QDZA 4Q4DA 5E6UA 3O8RA 1SBHA 4UMVA 1LQUA 3GLIA 1A96A 1G20B 5BSEA 2LD4A 1ZOIA 4ZI5A 5L3QA 1DBIA 2QJOA 5JNSA 2AJBA 4TMXA 1D6NA 1LCIA 4RTQA 4K6GA 1QG4A 1WAMA 2IZ6A 2NUPB 4OQ4A 4IDEA 5GGYA 2IWHA 2P0AA 1XFDA 2II6A 4L6CA 4U7TB 4I3HA 3S2EA 1ABFA 2NU9B 3D2BA 3ASZA 1TM2A 2X42A 1YE8A 3QU4A 2C9BA 3NJ8A 4GVXA 4QELA 4F7DA 3ITDA 3ANYB 5E3JA 4Q3OA 1Z5OA 2MWMA 1R0SA 4Q1BA 1Z35A 3F8WA 4IQGA 2PIDA 2PUBA 1CY7A 1Z28A 4GZMA 1PL6A 1JSZA 3AOEA 4RABA 2H1SA 1RQ7A 3G02A 2FDCA 2FAXA 3IPLA 4GC5A 1KVRA 3C1OA 1I51A 2DUJA 2A92A 3EAFA 4GRAA 4QX6A 1QS0A 4HS4A 3CVXA 3BQ9A 3DHEA 2A0YA 2W2KB 4L0CA 4TRMA 2Q2OA 2IK8A 1G3MA 2VHWA 1KA9H 4QO7A 4TRRA 4YMGA 5DGTA 2G36A 1J8MF 2BMJA 3WDSA 1D1SA 4C1NA 2ZIUB 3B1ZA 4L4YA 4DAOA 1PR2A 1JIVA 1NRJB 3GHHA 4HRXA 3EH2A 2DBRA 3RYFA 4HVAA 3HA7A 2FK7A 3QHPA 4KE7A 5FB3A 3EJ6A 4E5MA 1ZIXA 3K16A 3R7LA 4W4TA 1Z56C 3LK6A 2XDAA 2CF6A 4O29A 2D7DA 2NMVA 2I2AA 4RHUA 1ODFA 2BE9A 1JXMA 1IBCA 5JMTA 1ZM9A 3W3AA 4WW0A 3LC2O 3R7SA 3WL8A 2A30A 1NUQA 2W2OA 3L1IA 4KFSA 4R8RA 1W2GA 4I9NA 4ZQHA 1PS9A 5IARA 1DAEA 2VK2A 4MAAA 4ZMBA 4CKCA 1ZI9A 3TR6A 1WETA 2AL7A 4IP0A 4WZZA 4E0BA 3QEAZ 5ALWA 3UWSA 4R1QA 4AZ0A 4B35A 4CFYA 5E8JA 3WB1A 5FEUA 1G20E 1KI9A 1Y9AA 2J7KA 2PWBA 4MYUA 5HILA 5FH9A 1XZIA 4YJKA 1ZZGA 2OOSA 1GNSA 1IZ9A 2AGVA 2R6GA 3BBLA 1T36B 4ATNA 4UHDA 5JI3E 1Y9DA 2PXHA 5HF5A 3RUFA 3OKPA 4KMMA 3VDNB 2XSZA 4AIRA 4EPXA 5HRUA 1GTRA 1G21B 3CPJB 1EZZA 3BJMA 1LDEA 1V5FA 1AN0A 2XTJA 1XA4A 1G6OA 3IUYA 3PFBA 3J80A 1O1YA 4UBKA 3MWYW 3ZVLA 1N6NA 3ADKA 4IWNA 3U61B 4TQAA 1JG2A 4M0FA 2FSVC 1BE6A 2UV8A 2BGKA 1OYWA 4GM1A 2E6KA 1TVMA 4EWLA 1OTXA 3PHCA 3LJKA 3MUOA 5CDYA 1M6VB 2I3DA 1WU8A 2F59A 3IKMB 4MYCA 4JI1B 4DSNA 2Z5GA 1D07A 1PS8A 6GPBA 2XA2A 5KNBH 1SHLA 3EGCA 3UC5A 4BAGA 4XX0B 4E6PA 2RD2A 4N82A 5LQSA 2C8JA 3DM5A 1P7ZA 2CBXA 5DIZA 4F8EA 1SCUA 2RGNC 2VZEA 3O38A 3SYTA 1UKAA 1SXJC 2CUZA 2OQIA 1I3CA 1VKJA 2QAGB 3JVEA 4IOMA 1RT9A 1Z8NA 3C85A 5B4UA 2Y2UA 4IMPA 1CNEA 1CP2A 2YJ6A 4FJ2A 5EZQA 3FZYA 1OILA 2G82A 4R1MA 3UCEA 4FB4A 3BM5A 1QFYA 3AUUA 4NU0A 3PQ4A 1IN4A 4OK3A 4WE3A 3JYPA 1HL7A 5KDLA 3ZZ1A 2FFQA 3ABQB 3UHJA 4ARVA 1ZUNA 5D5HA 1C0IA 1HWYA 1ECGA 1TE2A 3DZHA 1G5FA 3EB9A 2VZ9A 1A0OA 4JP2A 5D3KA 3FMIA 2WOJA 5ES3A 4JITA 2YCLA 5FLEX 1ID1A 3IQZA 4I5IA 2C7PA 4DAEA 1XRJA 1UMBB 2NIPA 5ENZA 4EA9A 3DL0A 3KLNA 4E5UA 2EOAA 2G6BA 2QTCA 1Y5LA 4WSOA 1E9AA 4B3BA 4X7RA 4J16A 5DSZA 3WYFA 4Q37A 1BIFA 1P6XA 2ZUUA 1YR3A 3N2GA 4NF2A 2Y0BA 1QNFA 2GCIA 4HNAA 1G21E 3AU8A 3GGJA 4GBMA 4L6AA 5I51A 3Q9UA 2Z57A 4HDMA 2WQ6A 1TZKA 3OZCA 4ZXPA 3TAHA 1PHRA 4BFZA 1TUEA 2VK1A 3O47A 4DLSA 1S8AA 5FV7A 1WQ4A 1WSBA 1SC3A 1Y63A 4N8EA 5FBHA 1FYVA 4B79A 1C0LA 2REQB 1TM4E 1TYBE 2N42A 4AKEA 1KP3A 2F9MA 1KWKA 5F7OA 5B4VA 3ZE6A 4D9MA 3VKFA 1PR4A 5EESA 4EUFA 3V3KA 1V8FA 2EBFX 2PYZA 3EVEA 4HLDA 1VSVA 1GO2A 3D59A 3VH4A 3AR9A 5GIOE 3WA7A 3GRFA 5JS1A 1YBMA 3HCRA 3QMMA 4FI3C 4EHDA 3R3XA 5KYNA 2P6RA 3ZE1B 4J1QA 4FHCA 3REGA 1UK9A 1RFGE 1E1RD 2OSVA 2WF9A 4XSHA 5EQTA 3TQOA 4GWKA 4RUKA 3ZHCA 2D5CA 3ZV6A 4II7A 1C7FA 3HCDA 4ER3A 1R74A 3G8BA 2IF0A 1XVUA 4HDAA 1WL8A 2D1FA 4X94A 1RAAA 4R8VA 4FBMA 1N2CE 4BN0A 2V45A 4CZ2A 3K6SA 3QEBZ 2CVPA 3DTVB 1RXEA 3HJUA 1W4RA 4R2IA 3KQWA 4GBED 1VKNA 3A4NA 2PLNA 1EJBA 5K45A 3L46A 1EUCA 3RQIA 1COZA 4N03A 3ZVRA 1SBNE 4JGBA 9LDTA 1QLHA 3IXQA 3DFKA 1TZJA 4XGKA 4JT4A 4Y67A 3GGDA 3RO7A 4RVSA 2NPIA 1P4SA 2VHYA 2WU3A 4KXXA 2W6OA 2W93A 2XTZA 1I3NA 2FLKA 3PNBA 1G8AA 4MRAA 3LBYA 4YMUA 5ICMA 3CZ4A 2XWPA 5AOCA 1A8IA 4AS1A 3E1SA 3RANA 1FFGA 1BVUA 2D4AA 5JD3A 1BDIA 4Z4GA 4AKHA 1CLEA 3B9BA 1UL1X 5AKLA 1IOVA 3CLHA 4I50F 4UU1A 2LGJA 5IAAA 2ZVQX 3O9VA 3M4JA 3SU8A 4Z4EA 1EESA 4YACA 5AKKA 3S2SA 3PYMA 4YP0A 3U1BA 2VG8A 4KXFB 2CJWB 4QXOA 3GPLA 4PC2A 2BKUA 1HFWA 2WHXA 2LBPA 3FYUA 2VT2A 1LK0A 1WIWA 4JEMA 4KVZA 4LYYA 1W88A 1DADA 1U7ZA 4EYGA 5IT4A 1YB4A 2ZRBA 3F6PA 4K8OA 1Y1TA 3BF8A 1MQSA 4Q66C 3F71A 5AI0A 1U3VA 4C2AA 4DRXB 2DLDA 3JXEA 4K9NA 1DZ3A 1VSTA 2QXTA 1TPYA 1QHFA 2GEVA 3EVBA 3FPFA 3FD8A 3U3ZA 2JEZA 3H7AA 1L1FA 2ZVPX 1SKQA 3JPYA 4ABTA 5AW7A 3EDMA 1SUAA 1TOAA 5KVSA 4ERNA 1PEAA 1KPIA 1OX4A 3KFVA 5KREA 2R1VB 3OZTA 4U0JA 2E5WA 3BREA 3W6PA 1DPGA 2HIMA 1TZ2A 3TYXA 3MJDA 1G2OA 4UJ5A 1TGYA 2Z8XA 4BE9A 3SXPA 4J90A 2WYWA 4ZEOA 4F4CA 2D2EA 2DOKA 5DYGA 1GPMA 1P7WA 4ROSA 9ABPA 3GXOA 1LBQA 3FW1A 1MXFA 5EPOA 4CETA 4MW6A 4CQMB 1R0BA 1UBMS 4G1MB 5TJHA 4JSRA 3EZ7A 3IKVA 5C32A 3ONWA 4UBLA 2H11A 1KL7A 1I2AA 5T5QA 5JADA 1T13A 1JHPA 1XQXA 2O2ZA 3BTUA 3L1VA 4U2EA 3C8MA 1FMFA 1QC5B 1NUPA 2AE1A 3CPHA 2JLAA 4H60A 1XDBA 5CVCA 2VH5R 3T7DA 1M2VB 3WBJA 5AK5A 3LXUX 3VZPA 6ADHA 1V7CA 5KVVA 3AF4A 1EWVA 4AD8A 5JZSA 5E6RA 4LXQA 3KLMX 4MV5A 1TW3A 1YCGA 5KYYA 1W73A 5A3RA 3DF7A 4PSUA 4MQLA 2GZDA 1JAYA 5LWQA 4Y0VA 3KTOA 1TFUA 2QT9A 4BGUA 4DJ5X 1UM9A 5FNVA 4MNTA 1OI3A 1JG4A 4F84A 1P9RA 1X87A 4CLDA 2PL9A 3T7RA 3FAKA 2Y8EA 3LP6A 4MLCA 2OP0A 3L4BC 1LW6E 4NBSA 1JDSA 3I58A 4EBBA 2PIAA 4G0YA 2V54A 4ZYXA 1PL7A 4INPA 2EQ5A 3HC7A 1K8RA 4ZOCA 1B7GO 1X8KA 2FSGA 2PO7A 3MD9A 2YVAA 3D9QX 4BXOB 1SXGA 3Q5DA 2H4JA 3ZCUA 2GDJA 4JVSB 2IF2A 3B9PA 4XASA 4POOA 5LP6A 1QR2A 1BCRA 1NMEA 4FVTA 3WGNA 5A4DA 1ZJWA 5C53B 1SVSA 3V4OA 3EK2A 5M04A 1M5RA 4RFLA 3T9EA 4NYJR 3DWEX 2E55A 4E5YA 1EVIA 1HT3A 4PBRA 2X1VA 3DLPX 5DLDA 2A0KA 2PWYA 3ISVA 3P9KA 1X7ZA 4QYTA 5ALDA 4E07A 2HCRA 1MAVA 5LCXA 3QMVA 1KZGB 3RYCB 3CN9A 2UU9B 4JEUA 1LTKA 2JB9A 4Z9YA 1TUGA 2XB9A 4UM9B 5B7QA 3EA0A 2CDBA 2FFJA 1KKLA 1SD5A 3ZN2A 4LPSA 4C4PA 4CEIA 5TMPA 3WGVA 2B0JA 2QX4A 4II3A 5EMHA 1DVRA 1Z82A 4OP2A 5C81A 1OREA 3RLFA 3RTCA 4ZCMA 3ENVA 5ICSA 1O87A 2LIVA 3VO8A 1J8FA 4WESA 1UFQA 4BAUA 5JSHA 5LDDC 4QLAA 1Y9EA 4PW0A 1OD6A 2WMOB 4BJHB 3CCCA 3ORYA 4XJTA 4IUBS 5BUSA 2HOQA 1NC1A 1SB9A 2V97A 3KJZA 2ZR8A 2HRBA 4CNQA 2H31A 2FEKA 1I0LA 2QSUA 2VDOB 4UASA 4XXHA 3R7DA 4HWGA 5F78A 2IBSA 5CIWA 3WWOA 3IAFA 4OHPA 4R2HA 4F5WA 2BR3A 4WXRA 1I80A 4KR2A 2AD5A 2RGEA 1NBIA 1NMYA 3NWOA 4ZICA 3DHVA 1HSOA 3OX2A 4HQRA 2HHCA 3DSRA 4BN4A 1OBOA 4K0KB 4W5NA 1IQ0A 1YHYA 4MP6A 1O2DA 1UXOA 1XVAA 2XQJA 4MW1A 4O4LF 2B61A 3H5LA 1ZCJA 4HPWA 4CMIB 1PFYA 2I4RA 4MS4B 1LZKA 2FWBA 1V6AA 4LHXA 1RU3A 2ZIXA 1HE2A 1AKRA 3S55A 4A8HA 1XZJA 2ZIZA 3NIBA 4JC0A 3BDVA 5FQNA 4ANFA 3TNLA 5B4TA 3GP3A 1O6CA 3IUEA 1YRLA 5MN6A 5FL3A 1AQ6A 3UPDA 3KQMA 1U7DA 2B2XA 3BAFA 3DZKA 1LU9A 5FAKA 1Y8AA 4L5YA 2X86A 4C89A 3KXLA 4HWPA 1Y33E 5IWAB 1I7DA 3N70A 1O94D 1EEHA 3RFVA 1BDBA 2PHZA 4WFKA 3ZY6A 4XM2A 4MI9A 3DMDA 2XZDA 2XCOA 3PE4A 1Z07A 3R77A 4IOLA 4BNLA 2CLOB 5BWNA 1T4CA 2KBFA 4B85A 2D06A 3AJRA 3IO3A 2EWWA 4XWGA 4RGBA 4ZVPA 1TJ5A 4XVHA 1RTKA 3AFMA 4BO3A 2ZUWA 4XCVA 4AAYA 4D3DA 4C22A 4YREA 1WCIB 4P81A 1E1YA 2NYRA 2EZ4A 1LS1A 3PITA 3HGTA 5KC9A 3O4IA 1VE9A 3VR4D 2IIVA 4ARZB 2QVGA 5A62A 4I99A 3AEYA 1FFAA 4DSOA 3H75A 4LYFA 4NBRA 4GX1A 1BW9A 4EHJA 3VKGA 1R6XA 5BRJA 2I2WA 1NUAA 2OORC 4KZKA 2DFDA 4OKIA 2C7VA 4XJXA 1JDJA 1CZNA 3VSCA 3QE9Y 5FLXA 1EGAA 3W2EA 1ODKA 4EJFA 1FFDA 3FZEA 3B2QA 4P8RA 1NASA 3KWLA 4E1VA 5AKHA 1X7HA 3GF4A 1E0DA 3ORHA 5AICA 1H22A 1PF7E 3AY7A 1CR6A 4GL2A 3UC9A 5IZCC 1MQAA 2RJOA 5G4LA 1YUNA 2BCGY 3EDCA 5JARA 3OT4A 4G89A 1I4WA 1X0VA 3HCBA 4QOGA 1IC6A 3FI0A 4IMJB 1GR0A 1E3DA 2IRWA 3O3MB 4BC0A 1FJHA 3MK31 4NPHA 2JL1A 2ONYA 4PFKA 5EXSA 3C5CA 3RTBA 1IQRA 1CQIB 4WKGA 1K8YB 3LKVA 5T64A 1GPDG 3NDJA 4JXKA 4WFJA 2OCYC 2DX7A 2XVAA 2DH5A 4MLDA 1KP2A 3LS2A 5KWIA 3WBBA 1CUSA 4JI2B 4X93A 2Q3CA 2PX4A 2ZWOA 1N3LA 2FWIA 3MUNA 3PCRB 4BB0A 5G3YA 3J7AC 4GYKA 4KYIB 3PQEA 5DHRA 5GQSA 4Z0TA 2WKWA 3IDOA 1MTOA 2RK3A 3M5DA 4C29A 5G1NA 1POXA 2ZI5A 4HNGA 4M9CA 3CF6R 1KJIA 2ILVA 4YUWA 4G1EB 1KI6B 1Z29A 4DDUA 5KU7A 1VLZA 1L8OA 1YVEI 2I66A 2BFDA 5BMVB 1M2KA 1R88A 3U3MA 2J31A 3PL5A 1ORVA 1W7AA 2XNSA 1YC2A 4BNKA 4Y3UA 2P9TA 4S2UA 1FDWA 2HQBA 1SZPA 2ZSEA 4L16A 1TT7A 3ZHXA 3ABOB 4DA6A 4E11A 3E9NA 4HH1A 1P72A 3V4FA 3GG2A 4WMLA 4EJ2A 1G5TA 3EVZA 4M55A 2C29D 1SD2A 4Q7LA 1D2NA 2Y1GA 3ESZA 3RBZA 4FR5A 3TRKA 1AO3A 1OBVA 2XVMA 4D3XA 3STHA 5MN4A 3CNBA 4WUTA 1OR8A 3OD5A 2CXSA 2VH1A 4NX2A 4RVNA 1RMQA 3OI7A 3U19A 3W8NA 4TMYA 4NKRA 1G66A 3JAWA 2X4DA 4FGJA 3TTYA 2Z2JA 3LVBA 1PRYA 2XADA 1VCOA 1JWBB 1H5QA 3HKBB 2C7QA 1UINA 5LB4A 2G9RA 1A4UA 3WSWA 4Z3KA 2A33A 5FADA 2H9AA 1KYXA 2DHDA 1FFWA 1RYHA 1U1DA 4H4EA 1I33A 2HSZA 3O7WA 1BGWA 1J5PA 4QPZA 5BQ5A 3ZJVA 1FRVA 4WDQA 5DNCA 2AI2A 1QHIA 2I33A 4YJ3B 4CL8A 3AHFA 4MVJI 3GA5A 3E2IA 1HKUA 1AS3A 4GR4A 4XKJA 2P3SA 3IL2A 4QXQA 1CY8A 3L7NA 3OWXA 3L04A 1FFBA 1ZA2A 4IWXA 3VPFA 2I6SA 3BMOA 1LLUA 2I6FA 2AFHB 4LY6A 5KTSA 1TD9A 3B52X 1RWWA 3EFBA 1XF9A 2JFWA 3I52A 2R9VA 5AVOA 1SCNE 3MOIA 2QGZA 3UOWA 2IIBA 3VR1A 3VR5H 3HSSA 4ALJA 1FQJA 2C2YA 3VHXA 1U31A 3FI9A 3OA2A 5HGXA 4HWSA 5G0TA 1MF7A 4RW0A 1M83A 1YU9A 5AOBA 3AIKA 2IPMA 1DELA 3GN2A 1NURA 1V95A 1QMGA 1Q16A 2E4WA 2NTVA 2YHIA 2DFLA 3D02A 4PLWA 4W7SA 4KFCA 2FMUA 2X7JA 1KYIA 4MCIA 1VE5A 3D3JA 4IZHA 2NVUA 1PJAA 1B41A 4OBEA 1YR7A 1ECCA 2M2IA 2HCJB 1OT5A 2QDKA 2YQ5A 3DTVD 3PL1A 2LV8A 2FEAA 4ND2A 3EQ8A 4XFJA 5T6MA 1IEQA 1NKVA 2OEPA 4WCDA 3NORA 4DCPA 1RXUA 4QPCA 3ZUPA 1UFRA 2GN6A 3RGWS 5JCPA 2GUGA 2QRVA 4IOKA 3NM5A 1Q21A 2C95A 2GB4A 4KQHA 2GRAA 2AJCA 4BC1A 1BS1A 4O2BF 5H9WA 1Z18A 2O52A 4B46A 1SR8A 1Q7EA 1YH3A 2X4LA 2ZJ1A 1YRBA 1U28C 4RS4A 1UXJA 1PEKE 2JD1A 3LCVB 5FUWA 3E7WA 3RVDA 3KWMA 1HO3A 4YO7A 1N3IA 4YMLA 4Z9AA 4TVSA 1EVZA 3GAAA 2IXTA 5BR4A 4J76A 3GJTA 4DW8A 3E3NA 1JR4A 1USWA 3FWPA 4DC1A 5EJ8A 1D2RA 5IT0A 1L5SA 1RM0A 5JOQA 5BSUA 1KQPA 2BGIA 2GPJA 3EULA 1WUKS 1SA0A 3G3EA 1KY4A 4H59A 4JWTA 4KU4A 3LM8A 4O0MA 1K63A 2CHUA 4YASA 5ALIA 4ZRMA 1UDCA 2VT3A 4DMLA 3NMUF 3MCVA 2HQSA 3T4UA 3WDKA 1YZQA 2X6QA 3Q87B 2KX7A 2Q07A 3GFOA 1Z4QA 2Q6KA 2AFHE 3EZ6A 4A7PA 1A95A 2WMDA 1XZGA 4PHTA 3ZU2A 5EHZA 3QGMA 4WHMA 4YO8A 1OV4A 1K5HA 2UZ0A 3FH0A 3FIJA 2C97A 3IVMA 4B4KA 4B74A 4Q1EA 1OLUA 4RFSB 4E5PA 4C2TA 3RK1A 3PICA 4IVPA 4H4CA 2XWBF 3FFAA 3D3QA 4GR5A 1OPXA 3Q6NA 4R0VA 4QG3A 2AMFA 5DYIA 5MFZA 3OCXA 4Z51A 3TSAA 1G6HA 1L4KA 4LVUA 2VRNA 3IAM6 1OH8A 4BWFB 3FNHA 3OPNA 3DLIA 5CVUA 3RE1A 2FN8A 4EB6A 4AQ7A 4GM4A 4C6SA 3K9FC 3MJFA 4RMNA 5H1YA 3V8EA 4WOKA 4AJJA 1TYZA 5BYAA 3PFGA 1A69A 2PQMA 1LK7A 1OBHA 2R25B 4TUYB 2GPYA 5AIAA 2Q4RA 4CIWA 3PGLA 1WCYA 5I9SA 3QNMA 2O2XA 4PFSA 2B5OA 1DTWA 3BAZA 2V4MA 1P1KA 3EHDA 3F9IA 4LJ9A 3CIFA 4DADA 5BOSB 2H16A 2Z8YA 4R1NA 5KVQA 3D2LA 3IP8A 3L7LA 3I6IA 4PXSA 3TQFA 3S8YA 2DR3A 2EGHA 4TTQA 1LJUA 1VKHA 2ZGVA 3OMXA 2GK7A 2BHLA 4BNZA 2J5KA 4CXMA 1OVMA 3FSGD 4TSRA 3VVCA 2V96A 3GOHA 2HJGA 4HDKA 4IS3A 2UAGA 3R0XA 1UOOA 5BNZA 1T8WA 3EH1A 3F1KA 4RS3A 5FYDA 4TKUB 2ZRJA 3G9ZA 3NHKA 4U6QA 1R66A 4LQDA 3DNMA 4ZVLA 5G53C 4AWAA 1YHZA 5D6NA 1B26A 5LXTA 1JQKA 2W6IA 3BTOA 3HMKA 2HRQA 1XN4A 3BC1A 1F0NA 4PG8A 5IJ9A 3KPVA 1OAOC 1Z26A 1HE5A 2WYIA 3SGLA 3DQPA 1DXQA 1AIPA 4Q5IA 3DBVO 1QIGA 1OIXA 1S89A 3HB5X 4ZK6A 1YQUA 3DE5X 3JW8A 4FGSA 4X1YA 5AI9A 5ADVA 3KYDA 1FJGB 1GLGA 4JT9A 1U8TA 4G8BA 4WFQA 2C77A 3N1UA 4XZ3A 2PKRA 3NBFA 5SY4A 3PFCA 2ZVJA 1R5OA 3SR0A 3H2YA 1G0NA 1XOIA 4ND8A 3F4BA 5DW0A 9GPBA 2GD0A 4CM1A 1X1AA 3KHSA 4KR3A 1EFPB 2UUAB 4QC2A 3RYTC 1RRVA 4U7JA 3MMPA 1I5OA 1K3UB 1MKYA 2VF8A 4UM9D 4ALLA 1CFZA 1NZDA 3GJZA 1HE4A 1EHIA 3BA1A 3CRRA 5KAMA 3K2EA 4DC9A 2DETA 1ZD3A 1UWKA 2I2CA 2IXEA 5ED0A 5CXUA 1WSAA 4U2DA 5H4HA 3KYJB 4X6YA 1YU6A 5G0SA 3LHFA 1UC5B 3BWCA 3O74A 5EIBD 5EINA 3LDFA 4ZU3A 1XKTA 3AR4A 4FC6A 4PX9A 4RGVA 2AMLA 3TSYA 4CG0A 4X85A 4A0HA 5I9LA 2H9YA 4FFBA 2Q46A 2IYFA 2PWZA 2EF0A 3A1NA 3OCWA 4KIGA 2EFJA 4ND6A 4NEQA 5TRTA 4LKRA 4AP9A 4CTJA 4M1YA 2EF1A 4Q03A 4QAJA 3QITA 2FJPA 3M3HA 3A2MA 4CU5A 4RHYA 2G06A 3D54D 3OPYA 4QPJC 5T3UA 4KQJA 3LKDA 3WKEA 1N5RA 2DFNA 2LW7A 2ZRQA 1LLCA 3PENA 4LDNA 4Z4IA 2ZBEA 3ZGYA 2K87A 3C8DA 2O3QA 4H3VA 4H9GA 5HEKA 1OT3A 1GSOA 1NSFA 1Z74A 1U5BB 5C7YA 3RABA 5CIQA 2J6HA 3DAPA 5L4NA 3V5NA 1OA1A 1R15A 2HBQA 4MQEA 5DCLA 5DGCA 1KRHA 1GCGA 1ZWKA 3LU1A 2WWFA 1DAMA 1GR1A 3EUEA 4ZANA 1ZR4A 4TMTA 4AWBA 1GTMA 1IL0A 3N2YA 3FPHA 4I55B 3KQKA 1J8DA 3ZK8A 1FPQA 1W46A 3K8YA 1ONOA 1X39A 3AFNA 4XRGA 2H0RA 1ADJA 5LZ8A 2EJCA 4AUNA 4CL0A 4N0EA 4TROA 2QN3A 3RAFC 4RD6A 4UBJA 3U60B 1NPTO 1Q0UA 4TTRA 4ZVVA 1LBTA 2ZR9A 3DEYX 1JTEA 1HRDA 3JALA 3HU5A 5AVJA 4BE4A 3BGDA 1X0XA 4D26A 2A7XA 1NFQA 4WJKB 3QYPA 1VM6A 3W78A 1WCXA 2PGXA 3GLKA 3GCZA 4OQFA 3D2CA 1ZGGA 3OKAA 3OLVA 4PEVA 1P5HA 5AVUA 3OHPA 4J2HA 1A9PA 2Y27A 1TM1E 3IAEA 4C4ZA 1JG3A 4U39A 4MHOA 3KTDA 4KV9A 4MRPA 3VAAA 4YAUA 3EGOA 1AF4A 1SC4A 3SHWA 3RIXA 2CHGA 2BFBA 1AGXA 4CM7A 2F3TA 4WY8A 1KWGA 4EZBA 1G1AA 5HIIA 2CDNA 1SK9A 2XUZA 4ZDIA 4Q9DA 4D45A 2V9CA 1NPYA 1QHHA 2AQHA 3IDSA 2I29A 1ZRMA 4B6EA 4G56A 3QKIA 1VJ0A 4IFBA 3QPWA 4C7OA 4U63A 1SCAA 4NHOA 3IEVA 2R00C 3OFNA 5BV2P 5CFRA 1SIOA 2RK4A 5KQPA 3AUTA 1BGVA 2AJ8A 2DBVO 4HQOA 1WDKA 1HDOA 1TQ2A 4CIXA 1XXHB 1EFVB 5HFAA 3IUJA 1PQYA 2Q3EA 3L18A 2YKGA 3L7YA 1KKMA 3NANA 4IZIA 2QTFA 3E5RA 2ORYA 1YQ9A 2P1DA 2W6CX 4MK4A 5CTJA 4K9SA 3WYDA 5JQWA 4DR3B 3GUCA 4U9UA 3HXQA 3HH8A 5ALFA 4RPKA 3T0IA 2NZVG 1ML3A 3U80A 1D03A 2IW1A 4XVRA 2W2TA 4PR0A 5DLQC 1KHHA 2WQZA 4PXAA 4KXUA 5BNWA 4DA0A 2Y0PA 1DKQA 3I53A 4KFTA 4EARA 1KEEB 4L8VA 2AJTA 4HWOA 2CL7X 1NF2A 2F8MA 2YZGA 2YQ4A 1P5ZB 1B8PA 2CZGA 1FRZA 3G23A 5BV1A 2IODA 3SLKA 3B53X 4XUEA 1AY0A 4AX4A 3QRWA 3KJQA 5DNAA 1QGDA 4R05A 3LQQA 2VYFA 1XZNA 2JIMA 3QVGA 3O4GA 4IZ6A 5IK2A 4TYNA 3H8VA 1PWYE