1E0KA

Gp4d helicase from phage t7
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
288
structure length
288
Chain Sequence
PDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Helicase
molecule keywords DNA HELICASE
publication title Crystal Structure of T7 Gene 4 Ring Helicase Indicates a Mechanism for Sequential Hydrolysis of Nucleotides
pubmed doi rcsb
source organism Phage t7
total genus 80
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2000-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e0kA00
1S0UA 4KFSA 5FPKA 2ZSAA 2GK7A 4M1TA 3SJAA 1TAGA 4XSGA 2ZS7A 5IF9A 2R6AA 3REGA 1Z0IA 4PTLA 1UBCA 1N6RA 4TSFA 1XU4A 2Q3HA 2X19A 4TSFD 1G291 3X1ZA 5FTMA 4OI1A 3BAFA 2V9PA 4FIDA 1UADA 1W36D 3FHCB 2OCYC 3SBDA 2PCLA 3EWSA 2EFEB 3LXRA 4LX0A 4TLDA 2D7DA 4URWR 4EFMA 3NVAA 4NCNA 1UF9A 4HZIA 4MRPA 4LBYA 3U7FB 3QXSA 4NYJQ 4DCVA 4AURA 4KLZA 2F9LA 2H57A 1M2OB 4DT1A 1Q1BA 4WZ6A 1SGWA 3QY0A 4LJ6A 4HEJA 3OFNA 1Z0FA 2B7BA 4A6PA 4DDWA 4Q1AA 2ZPTX 3OFND 1Z22A 2HF8A 4NZYA 1L4YA 1MO4A 3FWYA 5CB6A 3K0AA 3I8XA 2IHBA 1ZD9A 2CHGA 2NGRA 4G5RA 5F98A 5AUQA 1ODFA 2A9KA 1VG9B 3VNUA 2Z4RA 2V1XA 5ANRB 2ECKA 1XMSA 2ZS8A 3GJ5A 1P9RA 4LYJA 4EPWA 4A8JC 2ZRPA 1KI4A 4TMWA 1IN7A 1W48A 4OI0A 1GNPA 2OXCA 3FMPB 2ZI6A 1C1YA 5C18A 1X6VA 5KOYA 1W46A 1ZVQA 2QROA 4NMMA 4POAA 3TLXA 4C0QC 1VYTA 1F60A 3ADBA 4GL2A 3KTAA 3N2IA 4EUNA 5E4FA 1NLZA 5EZ6B 5TV2A 3HDTA 3WYFA 3ZS8A 2AK3A 1NY6A 3BXZA 4AYWA 4LC1A 3Q8XB 2C77A 1W49A 2QPAA 4ZCLA 4C0BA 5J4HA 4M1MA 3X1XA 2WWIA 2CHQA 3CPEA 5IDVA 1ZM9A 3SYNA 3LBIA 1MO3A 3FVQA 3U4QB 3U6KA 3IGFA 1KY3A 1Z0KA 3EPLA 3GLIE 3NBYC 1JXOA 1RRPA 4XIGS 2IS1A 2Q21A 4LBWA 4BLSA 3X1DA 3LA6A 5BQ5A 5CYPA 1T3LA 4A0RA 4L16A 4TL6A 1M74A 5HE8A 4X8HA 4TYQA 4Y0AA 1NIPA 5K8UA 1J8YF 4Q03A 1KMHB 4NCKA 1P3JA 4LZZA 3TSZA 4ACAA 3QPUA 3TAUA 3R7WB 621PA 2P65A 3VTKA 1Z3IX 1K6MA 5AWFC 1S96A 2HCJB 4ZPXA 1L4UA 2Q6TA 2YOFA 4W7SA 2ZRKA 1UFQA 1E99A 1TEVA 2ZE6A 1E32A 2C78A 4Q21A 1U90A 4Q9IA 2YNMA 3H2YA 4CEHA 2GXQA 2WM9B 2GJAA 2IXEA 1BYUA 3UK6A 4E03A 3LLMA 3ZIAD 1XNJA 3VKGA 1R0WA 3GMTA 4PSKA 1XCMA 2C9OA 4TLEA 1FUUA 1DAKA 1RJ9B 5DI3B 4CEIB 5ELXA 1JR3E 2O8EA 2QNRA 3W6PA 4FI3C 1VG8A 2ORVA 1QHGA 3QKRB 4HB0A 2HCBA 1NLYA 1KZ7B 1E2MA 2HLDA 2DHRA 3FMFA 5CDFA 3SBEA 2GAAA 4DLXA 2HLDD 1QF9A 1XEFA 1T6NA 2NZJA 2P6UA 2REXB 2WVJA 2GJ9A 2RGCA 1X8JA 1FPMA 4UKDA 4IDOA 2RKOA 3K8YA 3MJRA 4NKRA 5AJYA 1NN0A 5JHHB 3EIEA 1R0ZA 3U3KA 2WOJA 2ZRCA 2QTVB 1N5JA 2VIIA 4D80A 2G1KA 2HDNB 1XMJA 1P2SA 3QPWA 1UBEA 2YC4C 3A1WA 3RNLA 2IX3A 4IJMA 2A2ZA 1DVRA 1LS6A 4TQ9A 4X8MA 2QORA 4Q4AA 3KKOA 2OV2A 4PC3A 3DM9B 3VU9B 4CT4B 4C9BA 3OEEA 4U7DA 4JVSB 2J3EA 4QHSA 1N6PA 3OEED 3QBTA 1E4YA 4TQAA 3EZ6A 5BN4A 3QG1A 1R7RA 1DADA 4OQLA 5C4GB 4XSHA 2V4ZA 2GF9A 3QKTA 3JZMA 1ESMA 3FDIA 1GL7A 2AN9A 2A78A 2VSOA 2DY1A 4JVLA 5FBLB 4A0GA 2JIZA 4DLVA 4B74A 3R9WA 1W36B 4Q48A 1N5KA 4HDCA 1MO6A 3KQKA 2P2LA 5FL7D 3VR2A 2QU8A 1VCNA 5KUTA 2ZR9A 4A36A 1NG1A 1KI7A 1VCMA 1G4AE 1HTWA 4ZDIA 3SFVA 2BWJA 3X1YA 1E2GA 1VPLA 4V03A 1M7GA 2ODBA 5DYGA 1G7SA 4XVRA 4LCBA 1M1YE 4A6XA 4EPTA 1G6HA 4HYYA 1XTSA 2PJZA 2RGGA 4LHXA 3CZPA 4DT1B 1K8RA 2LKCA 1YKSA 4KHZA 2I1VB 5SZJA 4TT3A 4EDHA 3RYTC 3MUFA 3OF5A 5JCZA 4TT3D 3K0AB 3WNDA 1KKLA 1T3SA 1FNMA 2RCNA 5JS8A 3UWOA 2FZLA 1S1MA 3PUZA 1XXHA 4M9SA 1SXJA 1GZSA 1TNDA 1CRPA 2J87A 1U2RA 1SXJD 3PEWA 4V0NA 5G41A 1IHUA 5KNCA 1B0UA 5CITA 1T5IA 3ZLJA 1Q1QA 1Z5ZA 3L82B 2G9NA 1HUQA 5K8IA 1G7TA 1US8A 1VDZA 2EFGA 4HB2A 4TTRA 1KZGB 4JT2A 2GCNA 3KTAB 4NYIQ 4Q9LA 1J2JA 5KYKA 1EFUA 2OUKA 4KI0A 4LV6A 4W5JA 4F4JA 4V0KA 1DAMA 2P6RA 3EXAA 4BE7B 1DOAA 2ERXA 3NKVA 3E5HA 3TNFA 1EX7A 5EE5B 5TY0A 1NVUQ 2GK6A 4OJKA 3DM5A 3IIJA 5DI9A 3F5FA 3V4RA 2BMEA 1E9DA 1G64A 4NYMR 5DIFA 3AVYA 2QI9C 3IQWA 1DG3A 1R0YA 1KO8A 4PPFA 1CBUA 2FN4A 2XEXA 1ZM2A 1CJKC 1KO4A 2MSDB 3NH9A 1GFIA 4DEXA 3DO6A 3T1QA 4TYNA 1KYIA 3ZJYA 4QM7A 2IYQA 3R8CA 3I61A 2FSIA 4K81B 1EK0A 4QJ5A 2CBZA 3LWNA 4FW9A 1GRNA 1G3IA 3BWDD 1BIFA 1FMJA 3IIKA 1G6OA 1XDBA 4D4KA 4Q18A 5F9HA 4B47A 2A3RA 1CR2A 1G17A 1UM8A 1NBMA 1Z2CA 2FG5A 2WIBA 4CT5A 1JALA 2GAOA 1S1CA 1NBMD 1O3YA 2FX3A 3GJ0A 1ZNYA 3X2SA 3DOFA 1WCV1 4G1UC 1DAIA 5EZ5A 5TDHA 1Z6GA 1LV7A 1XJ0A 2I4IA 4FMDF 2YWFA 5FTNA 1LS1A 3AVTA 1OH6A 2F3TA 1XJQA 1Q12A 2G0NA 2IYYA 3QEOA 2ANBA 5KSZA 2XB2A 3SOPA 4BFVA 1U8ZA 4CEHB 2H17A 4O3MA 2VP9A 4B75A 3B1VA 5L3VA 1TU4A 1AQUA 1FFHA 4JJZA 1TEXA 2VQSA 1NJFA 2QTFA 1Z06A 2H18A 2NO6A 1NN5A 1GP2A 1DE0A 3MLEA 2O8EB 4MDEA 3MD0A 4BLRA 2CDNA 1OFIA 1ZRHA 2W58A 5FL3A 2VHQA 1JPJA 1XFAA 1SVSA 1N5IA 4PANA 4ZV4A 4GOKA 1IJFA 1U94A 1F3OA 1LVGA 4NE2A 4IEIA 3BC1A 2X77A 4GNKA 3SZRA 2AWNA 2OAP1 4GT1A 2H8KA 4G01B 3H4MA 3PCRB 4JLDA 4PPQA 5LB2A 1E69A 1QDEA 2F3RA 1NVVR 3TAHA 2C99A 2O0HA 3VKWA 4BZQA 1U0HC 4HLUA 3WYGA 2XZOA 3KXLA 2GHIA 1Z0AA 4IOLA 4AY2A 4DCUA 4KVGA 3MRSA 3U3MA 2GVZC 3WMFA 2XTZA 1E6CA 2BBSA 1EWQA 4Q4LA 3W6NA 1GL9B 3ICQB 3NC1C 4Q4AB 4AKGA 4QM6A 3RRMA 1HT1E 1HT2E 4WZBE 4PZYA 1OXTA 1F5NA 1WE2A 4QBGB 4YDHB 4EPYA 4R71A 4JIMA 3EPHA 2KB0A 2ZS9A 1RC8A 1LFDB 1E9CA 3QF4A 1NF3A 2F1JA 4B3BA 4HI0E 4YMSA 1B23P 4E22A 2BEKA 1F48A 1FL9A 1Q1EA 3I3SR 2O8BA 4EJSA 3GJ6A 2CL6X 4JVNA 3LNCA 4MUAA 2JEOA 4LJ9A 4CYMA 2ONKA 1HV8A 2C8VA 1U99A 2YOHA 2ZXUA 1AK2A 3GEHA 2WOOA 5JI3E 2DPXA 3CW2A 2GXSA 3OEHA 4URYR 3BERA 3FPAA 3HYTA 2PZFA 1L8QA 3NBZC 3DOEA 3OEHD 5G3ZA 1AKEA 2OLKA 3B78A 4LJYA 2YWGA 3EPJA 5J47A 2GNOA 2ZJ5A 5GJWC 1CR0A 2D2FA 1ZCAA 421PA 1X1SA 5CDFE 2F43A 1KK1A 3LVRE 4C0SA 2G6BA 2JJ2A 2ODNA 2GZAA 4EFNA 1XTQA 4LC0A 4MRNA 3TBKA 4E07A 2LKDA 3A8TA 4DWJA 1WP9A 3U60B 3GLIA 3RRNA 2RGNC 2EW1A 2DFLA 2QPOA 2WJHA 5TARA 4X8OA 4HUTA 2O8DA 1S3SA 2GDJA 2J7PD 1VG0B 3JZAA 2AR7A 3AKEA 4G5GA 4Q9JA 3SYKA 3THYA 2OXRA 3A4MA 3WP0A 3K09C 3KKQA 4DSUA 2D62A 2ZJ8A 3KJEA 3RAPR 1XXHB 3KB2A 1SXJB 3BGWA 2BV3A 2AFHE 4TZ6A 1E2KA 2MMGA 2QGZA 3CNOA 3I72A 4URZR 1XZPA 3KQUA 3QENA 4TMZA 4WOPA 1TTTA 4Q9KA 1IAQA 2C98A 2W83A 4XVQA 2FFQA 2JLRA 1YZNA 1DAHA 3EASA 3QXXA 1US8B 1XCPA 1ANKA 2AX4A 3B85A 4GP6A 3IHWA 4JLOA 4L9WA 4WZAE 5CYOA 3AQ4A 1NRJB 3HPQA 2DYKA 2GCOA 5BW8A 1JAHA 3F0TA 2GJKA 4TTQA 3H0KA 4RVCA 2ORWA 2ONJA 2B8TA 2XZLA 3W5JA 1G9XA 3E70C 3FOZA 3KJIA 4EQ6A 2RMKA 4DLSA 3D31A 1SKQA 2PL3A 4TMXA 1GILA 1XP8A 3TVTA 2HF9A 3BK7A 4ZO4A 4QOSA 3AF1A 3A1UA 1E4VA 4B3GA 5JBQA 4DCSA 4UJ3A 2GXUA 1RKBA 3PEVA 821PA 2RGAA 1RZ3A 2AKAB 2PH1A 4DUGA 2ZAOA 1W5SA 1QG2A 2J41A 1ZUNB 4B76A 4DUGD 3UG7A 2OCAA 3LY5A 3IQXA 3SR0A 3AVOA 4RD3A 1CR1A 2RAPA 2QM7A 3OZXA 1JQJC 4M8NE 3MAAC 2V7QA 3SNHA 3LV8A 2LCFA 1Q21A 2QAGC 1ZAKA 3SE0A 3ADKA 5TXGA 2Q9CA 3DMDA 2P0EA 1EESA 4RKEA 4ZDJA 1UEJA 1N2CE 3DKPA 2AXPA 2HYDA 5JJLA 1R2QA 3EC1A 3PV0A 4O2RA 2FU5C 3CNNA 3K70D 2W2VA 3CX8A 3KQNA 2Z83A 5EP3A 4LY6A 1BMFA 4MUBA 4FMBB 3P20A 4NHOA 1GTVA 2CK3A 2ZSBA 3TK1A 1BMFD 2NO0A 2CK3D 1T91A 2ZJYA 4C2UA 4AKEA 1R5BA 4JBYA 2F9MA 2D74A 2B21A 3RS2A 1PLKA 3V9PA 3MWKA 1RVDA 2W00A 3KXIA 2FWRA 1VCIA 2CCGA 1AKYA 5FR2A 1D5CA 2H7VA 3SFZA 4YLGA 1UEIA 1M6NA 1VHLA 4GOXA 1Z6AA 2ZEJA 5KO2A 2QENA 1XBTA 5B57C 4NP6A 1CLUA 3VR6A 1RYFA 2Q0HA 1YJ5A 1SKYE 1SXJE 1IBRA 1KJWA 3C16C 5HKKA 2ZUBA 3ADCA 5TB5A 4WXRA 4JYCA 5KSOA 121PA 4G3XA 2R6GA 4Q19A 4XVUA 4OI2A 1N6LA 4P33A 4D2IA 3CF6R 1A82A 4RKFA 4GSYA 3THXA 3CIOA 3LW8A 4QJ4A 1D9ZA 4CVNA 5DO9A 5EP4A 3IO3A 3I8SA 3D7MA 5CK5A 1NVWQ 1OYYA 1E2EA 4FMDB 4PZZA 3BJIC 2J59A 3LH5A 3O8BA 3WNCA 1DEKA 2GWHA 1GUAA 2A5DA 2QL6A 2ZJZA 2DWQA 3M1IA 4QHYA 3WP1B 2P5TB 4AWXA 1QVAA 5A4JA 1KSJA 5DE3A 3U3OA 1W0JA 1GL6A 4MH0R 2CMKA 1W0JD 2CLCX 3KZ1E 3QF4B 4M1YA 1SQ5A 2C9CA 5DN6A 4BFXA 4CEIA 4KSCA 4R9UC 4UNQA 2ASEA 4MDFA 1KDPA 2KI5A 4IDHA 3B1WA 5DN6D 4M53A 4PSVA 2FEMA 1P2VA 2GJSA 2JATA 1EFRA 2W0SA 4XD7A 2P5SA 4EJSB 5C1BA 1YR9A 1EFRD 4XD7D 3VR5A 1CXZA 3NHAA 1XCGB 4RD6A 5CJPA 1QVRA 3GLGA 4JL6A 4JSTA 2IEYA 2ZRHA 3QJYA 2IYVA 4HAZA 4AD8A 2V1UA 4F4CA 1MRNA 2QN6A 2ZRIA 1W2HA 2N46A 4JZKA 1J99A 1NBME 2HT6A 1HYQA 3UG6A 1NL3A 1Z6XA 3Q5DA 2UVQA 4ITRC 5SZKB 2F43B 3DL0A 2WTUA 3MCAA 4GOJA 4C0KA 3EPKA 1E2FA 2Q3MA 4GDFA 4D6PA 2OFWA 1X86B 5JJKA 5DYIA 2JLSA 3VR1A 1ZBDA 4PPNA 2O8DB 4FCWA 4DLUA 4JYBA 2ZANA 1FQJA 4MRVA 2OEPA 2OILA 4B6EA 4C2TA 3AKYA 4NDZA 4DIDA 3THYB 1E96A 4RFVA 3T1VA 3BFKA 2R2AA 4KFUA 2ZETA 2ZROA 1KSHA 3RS3A 4BASA 4IHQA 1OW3B 2OO7A 2ZE8A 3PUYA 4C30A 5LDDC 4HAWA 3ZVLA 1P9NA 5DISB 4KYUA 1NJGA 1A2BA 1GKIA 1OE0A 2EWWA 2JLXA 2ANCA 5E7IA 2FOLA 4JLVA 5E7MA 1IXRC 1OPXA 1QHIA 3RDPA 3DHWC 3AVXA 1E9BA 1LNZA 3O8DA 4RD1A 5FH9A 1XTKA 2FPMA 5BYJA 1EFTA 2GCOB 3T15A 1R10A 1CULC 1VYUA 5B30A 1FOEB 1N25A 5FBQB 3R9IA 3TUZC 1E2PA 3IEVA 3WBJA 5FPYA 4EQ6B 1YR7A 1NNEA 1HQCA 2JA1A 2X2EA 4EKDA 5L3QA 2ERYA 4ZCIA 3VKHA 2WSMA 2I3BA 1RRCA 4LWZA 4IFEA 3ZGXA 5JECA 4KXFB 1CEEA 1FTNA 1TMKA 2PEYA 1TQ6A 2HT1A 2XAUA 1OYWA 1RW4A 1QZXA 5DH9A 4OL0A 2PX0A 1W0KA 4MYCA 2ODWA 1WF3A 3T12A 1U9IC 1CU1A 3QUSA 1GRQA 1W0KD 4LHVA 1KSGA 1GM5A 4M1WA 1DAGA 1OSNA 1Q22A 3OAAA 3RSLA 4LJ4A 1P6XA 2OCBA 1SULA 1ZUHA 3UANA 5HPYB 3OAAD 1DS6A 2FMXA 4GPTA 3LX5A 2GJ8A 3K0CC 1II9A 4NPHA 1V43A 4PO1A 2NQ2C 4RFSA 4PFSA 1XPRA 3TVDA 2ZU6A 2BCGY 3B5JA 1IJEA 1R8SA 3PR1A 1KKMA 2GESA 4KLNA 4GP7A 5CB8A 4P4SA 2BEJA 3ADDA 3EW9A 2GBLA 3C14C 4OHVA 3K70B 2V6JA 4IW3B 3AF3A 4LDJA 1TUEA 4C0JA 1BO6A 1XRJA 4UXHA 5FI1B 4RZ3A 4OBEA 1PUJA 3OIUA 4WXPA 2R9VA 4FXPA 4O2LA 3K0SA 2AL7A 3QKSA 1F2TA 4LRWA 2G77B 5G40A 3HU2A 4TMKA 2EYQA 4DC9A 2HXYA 5AJZA 1KDOA 2OHFA 1N6HA 1JBKA 2ZJOA 4N1AA 3SEAA 2IK8A 3C7KA 2NO7A 1I2DA 3A4NA 4U02A 3BB1A 4JKYA 3UKDA 3SQWA 1N5LA 4V0OA 3OHMA 2FNAA 3EZ2A 1ZCBA 5CLLA 5FBWB 3DEFA 2WMNB 2F1RA 4MYUA 2ZYTX 2JLYA 4CZ2A 1WBDA 1XEXA 4TMTA 3HP1A 5CIWA 3BH0A 5J4LA 3EZ9A 2ZVQX 1O87A 4Q02A 3ZZTA 4I4LA 3WBKA 2XOKA 2R62A 1T8TA 2XOKD 2GZDA 4BFSA 4B3FX 3RC8A 1IXSB 4U00A 1D2EA 2GCPA 1E2HA 3THXB 2BM0A 2F1HA 3CKLA 4UNNA 3L0SA 4LJAA 3WYAA 3RANA 1UKVY 2E1RA 2FSGA 4QBFA 4HDOB 1FZQA 1SVKA 3K9NA 1G5RA 3MWLA 1FP6A 1YR6A 3CB4A 3SDZA 4I81A 1K5DA 2GXAA 2BBOA 1T3HA 3IHLA 5FTJA 5GVRA 2EWVA 2CCJA 1YZUA 3CRVA 2OZEA 2B8WA 3NEJA 1FTSA 4PHFA 2QRZA 4Q7JB 3VX3A 2YHSA 4GFDA 2N1BA 1ZIOA 2WV9A 2EVWX 4A8JA 4PQFA 1KJZA 3FYHA 3GLGB 2IF0A 4R2HA 4W9MC 1N6NA 4Q7MB 1JECA 4YMWA 4Q1FA 2QY9A 4ZDWA 4QXAA 1YRAA 1OH7A 3VFDA 1J70A 1FMLA 1FP7A 2XTMA 3AEZA 1RPZA 4MRRA 5JCPA 2XJ4A 2GETA 2V3CC 5FOTA 1D2NA 2REOA 1U81A 2C04A 4D82A 5BWMA 3QEJA 4BUJA 4PO8A 1Z47A 2P6NA 4LJ7A 1TQ4A 4KITB 3ZD7A 3X1WA 2XX3A 3A58B 3L2OB 3V00A 5JZVA 4GZMA 3NIBA 1X1RA 4DDVA 3AVVA 3MWYW 2PZEA 4Q4JA 5FPSA 1XPUA 2B7CA 3A6PC 1Z07A 1AS2A 8OHMA 2QG6A 2JJ8A 5CK4A 1IY0A 1NKSA 1RRGA 2NO9A 5J5CA 1DTSA 2AK2A 4DIEA 3AVWA 3GJ7A 1A5TA 4GMDA 5EE0A 4XWAA 1YZLA 4IOMA 1UDWA 3EA5A 1SZPA 2JIZD 4A2WA 1KTVA 4JL8A 2PEZA 3I5YA 4N0EA 2HEIA 1JR6A 4NYMQ 3G82C 2V6IA 3SS8A 1OJLA 3MMPA 5EXSA 1E9RA 4V0MA 1R0XA 4A9AA 1T4GA 3AUXA 3B9PA 4KSBA 5L3QB 2BJVA 4GZLA 4B3XA 3A4LA 2IHYA 5E95A 3C4JA 4L5BA 4BLPA 1OXVA 2HJGA 4K46A 1IN6A 3PXGA 1Z8FA 3GEIA 5LD2B 4KFTA 1E0AA 4M4SA 4B2PA 4N3NA 3CONA 3KQHA 2I1QA 1FNNA 1JJVA 3HJNA 2IYTA 5CJ2A 4RFSB 1NN1A 4FWTA 3DZDA 1NLFA 2WWGA 1Q20A 1TUIA 4YMVA 5KSYA 5D3MA 5BN3A 2GILA 3WNBA 3ETLA 4P4SB 2IWHA 4D81A 5K8TA 5C4MA 2IXFA 3GLGE 4L8GA 2NPIA 1XWIA 3ZVMA 1EXMA 3NWJA 2HV8A 2ZM5A 4D0NA 1KHTA 2XNSA 3CPHA 1E0JA 1ZJ6A 4NCJA 2IUUA 1ELOA 3F8TA 4JLBA 3FTQA 4JLKA 221PA 2C96A 3PVSA 4LBVA 1YE8A 5FOSA 4A15A 1XMVA 2BHRA 3I73A 3IILA 1JXMA 2JDIA 1I2MA 3QKSB 1F2TB 3CPJB 1YQTA 2AFIE 3TIFA 4B71A 2JDID 3IPXA 2AD5A 3K9LA 1XZQA 2IYUA 2GA8A 4JJKA 4JSYA 5HR5A 1DARA 1QHHA 4P0TA 3AP3A 4XTCS 1M34E 1CP2A 3PUXA 4M22A 1EFCA 1MT0A 3ZQ6A 3KUDA 2R8RA 1NVVQ 5AJWA 3Q9LA 2R6CA 3AKCA 3AVUA 4KU4A 4LK2A 5AK0A 4HAYA 4DB2A 2B92A 3DKVA 1XEXB 2BVNA 2HUPA 1G18A 2A30A 2IYSA 1E9FA 1OIXA 2QBYA 1PJRA 1AZTA 4Q1DA 4URXR 4B32A 3H1TA 2KSQA 3A37A 2GVDC 1JB1A 4AG6A 3CX6A 2IT1A 4H1VA 4JS0A 4DSNA 4S35A 1KI6A 3IBYA 2CLDX 2ZRLA 1U0JA 2QMUA 3BB3A 3CH5A 4HAXA 3VR4A 1DELA 2WJYA 5UKDA 5J4KA 5H68A 1KO1A 2J9RA 4HB4A 2UZIR 4RY2A 2VYFA 1RRFA 4HUQA 3SI7A 1E1QA 4CDGA 2G0TA 1P61B 3FE2A 2WWXA 4YMUA 4PAOA 3UPUA 4O0MA 5H8WA 4KBFA 4ARZA 1WDTA 1VG1A 3AF2A 4ACBA 3I92A 3T5DA 1XTIA 3KX2A 2FV8A 1Z0JA 4A4DA 3PG5A 3KJHA 1MR3F 2V55B 2WJJA 2WWWA 2REBA 1R4AA 3D3QA 4FN5A 3RHFA 3SJZA 4X8LA 1JEDA 5FTKA 3LVQE 3NBFA 2ATVA 2VP4A 1WXQA 4A8JB 3W9YA 2G3YA 2Z4SA 2J1LA 3GPLA 2ZI9A 4V02A 3UATA 2J5XA 1KI1A 3CBQA 4OI4A 3CNLA 2BMJA 5B64A 1COWA 1W1WA 2ZJAA 5JSZA 3REFA 1COWD 4B35A 1GAJA 1EGAA 4PC2A 3IPYA 1E1RA 4JVMA 3L0PA 5IRCD 1MO5A 4AC9A 5K8LA 1E1RD 3BOSA 2MSEB 3RRZA 4B43A 4KAXA 4DSOA 1SVWA 2FJUA 1NMXA 2IYZA 2X2FA 5LPNA 3THOA 2PJRA 3AGPA 3SJCA 4C7OA 3GJ4A 2N42A 4FD2A 4LPSA 1IM2A 1GG2A 3EIHA 3NBXX 4C0LA 4DXAA 4D0GA 4Q4JB 4I1UA 4Q66C 1YR8A 1LTQA 1S4QA 4HATA 2CNWA 2W0MA 5GJBA 5JMTA 1XTJA 4ZI3A 2CNWD 1CRQA 3KXKA 2QP3A 3U5ZB 3QXJA 3I4LA 4M9XA 2NIPA 3EIQA 2CVHA 3PITA 1IN8A 5DGXA 3AP2A 4LHZA 2ZU0C 4QC2A 1N6IA 1DO0A 3TR5A 3EC2A 5EUMA 3H84A 1W4BA 3QG5A 1D9XA 2NG1A 4MYHA 2JAQA 1OT3A 2IC5A 5DHAA 3TW8B 1G7CA 3A36A 3UMFA 5L3SA 3B1YA 2ZRBA 4BGDA 3BIFA 4ABYA 1OIWA 1OFHA 3M6AA 4CGZA 3BH6A 3K53A 2VH5R 4Z51A 1AGPA 1MV5A 4A92A 2XB4A 4PZLA 2JJ2D 1JPNA 5AUNB 4MGZR 4H1UA 4ZI2A 1XX6A 4EIWA 5BXQC 1I4LD 1R5OA 2VRWA 2EU8A 3KKNA 3EZFA 3U3JA 3TW4A 3N2EA 3W34A 4AK9A 4XTRA 4UXJA 2ZSFA 3B13B 4R7ZA 4CF7A 1VHTA 1G3QA 1SKYB 1ZM3A 3G5UA 1ZD1A 2ZYUX 5JFGA 2BMDA 1E2DA 3B9QA 2FSFA 4F7WA 4QGFA 2RGEA 4II7A 3BRWD 3TMKA 4R98A 5D3MB 4IOKA 2Q9AA 3WRYC 1XD8A 4ERNA 4Q7KA 1IXZA 1ZNZA 2SHKA 3NH6A 3L0OA 5F3WB 4BFYA 3B6EA 1AZSC 1S9DA 2WZQA 2QMHA 2QPTA 1H65A 3EX7C 5KNDA 2QAJA 4BRUA 3P4YA 2ZR7A 2CL7X 3GJ8A 2ORIA 1LB1B 2FFBA 4AKHA 3U44A 2FPKA 3I1FA 1TU3A 1GRRA 4CRWB 4ZIRA 3NDPA 2GEUA 4UJ5A 5SZHB 1WA5A 3AUYA 1KO5A 4OHXA 5GJVC 2VHTA 3IKJA 4OKSA 1AA9A 3Q85A 1QHHB 1W2GA 3PFIA 5IK2A 2VP5A 3ZH9B 5IK2D 1G21E 1GKYA 4L15A 2E87A 1ONBA 3G0HA 2FF7A 2WHXA 4LYFA 2ZI5A 3LXXA 4DB4A 2QP4A 4E09A 2JCSA 3RWMB 2QBYB 2PX3A 2IS4A 5HZKA 1UJ2A 1DAEA 1J7KA 2VSFA 3FHOA 3HU3A 1LY1A 1SHZA 1JQLB 2V7QD 4J0QA 4MKFA 5EE3A 2O0KA 1KI6B 2W6JA 3PJRA 2YC2C 2VP6A 1M7HA 4TZ0A 2RGDA 4R2IA 2C2HA 3NEYA 2DFKB 2QEQA 3P4XA 4A0HA 2P67A 5JEDA 1OH5A 1YZTA 1GSIA 2EFHB 2UKDA 2VP0A 4QHTA 1V5WA 1KGDA 1XMIA 4QNMA 5KU1A 5FOWA 4HUQB 4BEJA 1CIPA 4D4LA 5FOXA 4UNPA 4CW7A 5JWOA 5EXTA 2QMEA 1RYHA 2RGNA 3ASZA 5KPJA 4HAVA 4V0ME 4ARZB 2IUTA 1AM4D 3CRQA 4LUCA 4B2LA 1Z08A 5EQTA 3WHLA 3TGPA 1MKYA 2PCJA 4G5QA 4ON9A 4W5HA 3SC3A 3K09A 4EPXA 4OQNA 1FW6A 2KWIA 1Z29A 1QHYA 2BBTA 2D4HA 4FINA 4I99A 1HH4A 1TPZA 3N5CA 4PC7A 2QE7A 5EXPA 2CXXA 2QE7D 4FWIB 4F38A 4ESHA 4M1SA 3W3ZB 5JSZB 4F91B 2B6HA 3CF0A 1NSFA 4D25A 1II8A 2A7QA 3GCGA 5HKKD 2BBWA 2V8OA 4QBHA 4QFMA 1G5PA 2O8FA 2NOAA 2HXSA 3NC0C 3L0IB 4NH0A 3UMRA 1WBBA 3B1ZA 2PLFA 4KCGA 1ZIPA 2ZYVX 5E7JA 3T35A 5C46F 4QL3A 3GJ3A 3B8HA 4IKEA 3TUIC 1T0HB 2EQBA 2QUZA 4OK5A 4DHEA 4C7OB 3W8RA 2YKGA 3P32A 4GBMA 4FCTA 2JLVA 5GVSA 1GNRA 2FE4A 2DWPA 2J0SA 1KK2A 3KFVA 1JEEA 3DPUA 3T34A 1A1VA 1KOFA 4TLCA 2QRNA 5J4YA 1YU9A 4LGMA 3GLHA 1W36C 1UPTA 2NMVA 3C15C 2WJVA 4B48A 5JLJA 1W47A 2YJTD 2QAGA 2ZTSA 2DCUA 4G5SA 1ZC4A 1OB5A 4QGGA 4PSAA 1TADA 2ZI4A 1PZNA 1OFUX 2DFTA 2ZRDA 2ZUDA 5BN5A 3K0EA 2ODEA 3IEUA 3QPVA 2WJGA 1WQ1R 3AGQA 3DDCA 2OFXA 1F2UA 1G5TA 2WKQA 5L3SB 1KNXA 1U98A 3TH5A 2ZVPX 1C9KA 2XJ9A 3ASYA 2GRJA 3W5IA 4GI7A 1G1MA 3U61B 1SVIA 2FSHA 4PQRA 1JI0A 1OKKA 2CE7A 1F6BA 3PEUA 3ZZ0A 3BE4A 4PC1A 3LBNA 1OKKD 4E5UA 1IONA 2UZ3A 1XPOA 4I1SA 5F9FA 4Q1BA 2WWFA 2O0JA 4A2QA 5KSPA 1IN4A 2R6DA 3N70A 3T06B 2VPPA 2R6FA 1NI3A 1TX4B 1WRBA 1L7VC 5F2EA 3D6TB 4Q1EA 4TL9A 2Q3FA 4IDPA 4ZKEA 1N0WA 4CEJA 5AJVB 3OE7A 4WW0A 1YZGA 1CF4A 3GFPA 2BDTA 1GNQA 4US1R 3OE7D 3F3YA 4MGKR 5EE9A 3I62A 1E2IA 1EFHA 2GZHA 5FUWA 6Q21A 2C03A 1HA3A 2CE2X 5AJXA 4HLQB 2VF7A 2RGXA 3FFAA 1R8QA 4LYHA 1G4UR 4DCTA 5FUXA 1H8HA 4JLAA 4A2PA 3QXCA 1CR4A 1XEWX 3RS7A 1FQKA 1YRBA 3SN6A 4B33A 1H8HD 2OAQ1 1WMSA 3U44B 2IEZA 1T0JB 1W7AA 1G20E 3THWA 4JMPA 4ZIRB 3KUCA 4LJ5A 3QBVA 3V4FA 2ZJBA 3L8ZA 4KYIB 4DKXA 2C9YA 3CUEF 1E98A 1VCOA 4BLTA 4N0DA 4OHZA 2CEAA 1A2KC 3U7HB 5KPDA 4Z54A 1VKJA 3WRXC 5CM9C 5DSZA 1TQDA 1G8HA 2BMFA 1G16A 1QG4A 3ECCA 3LFUA 2H92A 2TMKA 2Q9BA 2VTKA 2IA5A 4DLTA 5KDOA 1G8PA 4YXWA 4UXIA 4AG5A 3LRPA 4OQFA 5KHOC 3UMSA 2PMDA 4AKIA 4YXWD 1IY2A 4WBSA 4MKHA 5A0FA 3ZQJA 4CIDA 2Z43A 2J0VA 3GD7A 3P26A 5FUYA 2VBCA 5B58C 2XGJA 3IDQA 2VLIA 3SQXA 1OXXK 2W2XA 2VP2A 2RH5A 4TWZA 5JWRA 1LF5A 4KV9A 1P2UA 3MFYA 2QSZA 2QTHA 3TSWA 3SHWA 3NTUA 1E3MA 3KKMA 4KFRA 4OHYA 2PZGA 1NG9A 3ND9A 2ZRAA 1DO2A 4HZUA 4D4JA 4TLBA 3CWZA 2AWOA 5L3RA 5FBVB 2FGJA 4JLJA 3WY9A 3AB3A 4S2EA 3AF0A 1E2JA 2RHDA 1Q3TA 1ZW6A 2BIFA 1Q57A 4IVPA 4B6FA 3SU8A 1XF9A 3BB4A 4RD2A 3E2IA 1XB2A 4DCNA 4TN1A 2A5GA 4RZUA 1ZP6A 3AKDA 1U8AA 1Q44A 2IYRA 1G7RA 2BKUA 3CWQA 1W44A 3KL4A 2OCPA 5FOUA 4DLZA 5A5GA 4F4IA 3RVBA 1PUIA 3NHBA 3K9HA 5KNBA 4JLMA 3A1SA 2Z6VA 3CO5A 3MG9A 4DEYA 3FB4A 2O5VA 1AQYA 4GRAA 1P62B 1II8B 4Y0VA 4QGAA 1ZU4A 3RRYA 4B3DA 4NONA 2CCKA 2V54A 5LB4A 2CJWA 2H5EA 4HLCA 2VF8A 2O8FB 3LAWA 3GP8A 1GITA 4QBIA 1UDXA 2ZUCA 2FH5B 2QQ0A 2KJQA 4Q01A 4P4UA 5HTKA 1BOFA 4NYJR 3ZVNA 3ONWA 4TTPA 3EA0A 4GMXA 4LOAA 2BJWA 5EXXA 3ZD6A 2F6RA 4EAQA 2QMOA 2QQEA 3T1OA 1VMAA 1U9IA 2KE5A 2WPDA 2YYZA 1Q0UA 3GFOA 2YOGA 1NP6A 1AS3A 2WPDD 1A4RA 3HR7A 5HCIA 1E9AA 2WBLC 2ZSEA 3I5XA 5FI0B 2VHCA 2F1IA 2G83A 2MSCB 3GLHB 3NDBB 1MOZA 1XD9A 2Y8EA 2HYIC 5JHGB 3K0CA 2QAGB 4DDTA 4WA7A 3W6OA 2BOVA 2A5JA 2XSZA 5JRJA 2QP9X 4M9ZA 5EJEA 1HY3A 2XSZD 2DR3A 2IBMA 1ZMXA 2QA5A 1KK0A 4TYPA 2ZITA 2D06A 1CJUC 1U0LA 1CKEA 3WMGA 1KI8A 1F2UB 1R6BX 3ZIAA 1GKUB 2WKRA 1NY5A 1AN0A 1NMYA 2JJ1A 3AP1A 1VECA 4OK3A 2W6IA 2CVFA 3KFXA 2JJ1D 2W6ID 4MKIA 2XXAA 4IXMA 5EP1A 3QIAA 3OIVA 4JLPA 5J4VA 1Q1ZA 2VHJA 4LJ8A 4L9SA 3QQ5A 5HE9A 1P60A 1CJVC 3DMNA 1AS0A 1KMQA 5CLQA 4KODA 1SXJC 1S9HA 2VO1A 1HEIA 2YV5A 2JLQA 1SVLA 3P27A 4TL8A 1UBGA 1YZQA 4RJLA 1SHKA 3JVUA 2NTYC 5FR1A 2IS2A 4CEJB 2JLZA 3QVUA 3SJBA 4RCZA 2YVUA 4DJTA 3T61A 4XWKA 1ZNXA 2QM8A 4PO9A 1ESNA 1S2MA 3VHLB 4NBSA 1HQYE 2ZR0A 4TMVA 4JLNA 5IHPA 3IUYA 2IWRA 1KAGA 3CZQA 4TYYA 3A1TA 5FFMA 2FEOA 3RS0A 1EWRA 1XD2A 1NN3A 4PX9A 1E79A 4QGHA 2R65A 4RZ2A 3RSOA 3TUJC 2DFNA 1E79D 1YVDA 1M7BA 3DVLA 1PVOA 3O8RA 3THWB 4M0LA 1UKZA 4Q47A 3EARA 3LD9A 5FPHA 1ZU5A 4IVRA 1AGRA 1N3BA 3B2EA 1KO7A 3FHTA 5TMPA 2G88A 4UQOA 1II0A 4PAMA 1KI2A 2AXNA 4WIAA 3BH7A 1R5NA 4MKGA 4EPRA 1PLLA 1JNYA 2PBRA 2OG2A 3ZS9A 1CJTC 5FL7A 2NO1A 3FKQA 2GF0A 4NTZA 4Q4HA 2J0QA 1LF0A 3Q5EA 3RC3A 2ZIAA 1LW7A 2F55A 3RLFA 4YQFA 1ZM4A 2ATXA 2IXGA 3HR8A 4BFWA 1BYIA 3IO5A 4IVQA 4A82A 3W3AA 3GLHE 2YWEA 1SVMA 4RD4A 521PA 2WSSA 721PA 2AD1A 2IYLD 2WSSD 3U7EB 3S1AA 1HE1C 3W8NA 2Z5FA 1N0VC 3L43A 1TL7C 2ZI3A 3O47A 2HJVA 4W5WA 1JAIA 4BRWA 1ZM7A 2ZRJA 3Q72A 4HZUB 1G19A 1OF1A 2G1JA 1E94E 3GLFA 1OIVA 4FMCF 2MMCA 4IRUB 1G8GA 3U6BA 3UIEA 3Q3JB 2GEVA 2PMKA 5H70A 4B3CA 2A5FA 1GVNB 3PQCA 1TF2A 1T5LA 3TKLA 3KQLA 4PPGA 1DG1G 1X3SA 2OESA 4BPBA 4NU0A 3PENA 4DDUA 1P73A 4HLDA 3M4YA 3K1JA 1L2TA 2IS6A 3K0FA 1Z28A 4XOIA 2AHOA 2WJIA 1BKDR 4HLUC 4TLAA 2YWHA 2ZQ5A 2CHVA 2W2TA 5P21A 4BFTA 5HZHA 1YZKA 3TQCA 3EWAA 1OLOA 3QXHA 3T5GA 3OIYA 1E2LA 1E9SA 4P3YA 3TQFA 1EX6A 2OE2A 2CJWB 4MGYR 1N6OA 1KNQA 3OESA 4QKQA 1J8MF 1CJMA 2XTNA 1KAOA 3P1JA 3OIWA 4WVFA 1DPFA 3ND8A 4RSGA 4PR0A 3NG1A 4EFLA 4MA4A 1E1QD 4P32A 4BECA 3LQQA 1G41A 4C0HA 1UKEA 1OB2A 4IOJA 1KDTA 4DLWA 3AVQA 3U2QA 3RWOA 4Z1MA 4EJSC 3CRMA 4KJZA 4LHWA 4Z1MD 3AF4A 1NSTA 5IT5A 4LHYA 2JLUA 1MABA 1G8FA 1DAFA 3TR0A 1YHNA 3LO5A 4PHGA 4NL4H 3C41J 1PV4A 1UKYA 5CIQA 1VTKA 4PQYA 1T8UA 2ZRFA 4MGIR 3UWKA 3GJXC 5JEEA 2RHMA 3EZ7A 1W5TA 1J90A 3BBPA 4KBGA 3CR8A 2BKEA 5DHFA 1P5ZB 4D0LB 4JT4A 4M1KA 2NZ8A 3LQRA 4BZPA 2QGNA 2H1LA 2Z0MA 3VAAA 2ZRNA 3KDSE 5DNYB 4NYIR 4QJ3A 1W4AA 2XXAB 4ZKDA 4M21A 4TL7A 1ZC3A 5JS7A 3TRFA 1E9EA 2A5YB 1IY1A 4K8OA 2X1VA 1CS4C 1P9WA 3IBGA 2FDCA 4PC6A 4F93B 3VMFA 2FFAA 3GFTA 4C3ZA 2PT7A 5C2JB 5KDLA 4BLOA 3JVVA 4M9QA 3B82A 1ETUA 4QRHA 3HPRA 1OXSC 1T9HA 2AKYA 4LYAA 2PT5A 3A1VA 5AR1A 3B60A 4ASUA 4NCIA 1OXUA 2ZSDA 1E2QA 2WMOB 4ASUD 2ZRMA 4P31A 5B2ZA 4Q5IA 4DZZA 4LV5B 4BLQA 3M0EA 1HURA 2X8AA 2ZAMA 4PAQA 3UXMA 3W90A 1XD2B 3MJHA 4XWOA 3L8YA 1N0UA 3FKSA 1NIJA 3Q7PA 3KKPA 5FOVA 3FKSD 3Q7QA 4OQMA 5FUVA 4DBLC 4YONB 3QKUA 4BWYA 1BH2A 1KSFX 4L4UA 3O8CA 1NVXQ 2D2EA 4HSEA 4KVAA 3CH4B 1BS1A 3AVPA 4KO8A 5FPTA 5BYKA 5JWHA 2LWIA 1MH1A 3LBHA 2EFCB 5E3HA 1Z83A 2R44A 4MRSA 5G3YA 1U8YA 2J0UA 4H9GA 5DLQC 3TE6A 1VIYA 2O8BB 1KDRA 4Q4HB 5EUQB 2O8CA 1CTQA 4HDQB 2GEDA 1FX0A 5JJIA 2RB4A 2KBEA 3SYLA 4PXAA 4US0R 2BM1A 1IN5A 4EPVA 1UBFA 1VYVA 4M2LA 4Q1CA 1KJYA 1Z2AA 1ZYUA 3K70C 3T1TA 4DLRA 5D3QA 3PEYA 2IF2A 3PUVA 1Z63A 3U7GA 1D6JA 4LSGA 1A7JA 5AUPB 3S1AB 2J7PA 2CLSA 3LW7A 1S3GA 4P4TA 4B73A 3QOFA 2ZRGA 1AJEA 4JBWA 4LV8B 3CR7A 1GDDA 4PHTA 4A1FA 3HYRA 3GLFB 3CLVA 4ZCMA 4WAUA 4B44A 4AYTA 1TF5A 2J45A 2ZJ2A 4Q9HA 5HCNA 2JASA 4DVGA 4URVR 2C95A 1P72A 3AV0B 3D8BA 1GWNA 3BD9A 2C5LA 4HAUA 4UNSA 3RS4A 3QNUA 3B1XA 2P3SA 1ZNWA 3VQTA 4TYWA 1S8FA 1D2MA 1QHSA 2WWHA 2ZI7A 2EYUA 3I32A 3WMEA 4TQUS 1KIMA 2OSBA 3K0FB 5G53C 2QSYA 1MRSA 3EG5A 3AM1A 5JRZA 4LI0A 2O52A 3ZYCA 3MGCA 1I4DD 4G0NA 5LBIA 3R9XA 3EAQA 3KB1A 1OH8A 1KK3A 3C5HA 3LLUA 1HE8B 4IXNA 3VHXA 3BFXA 3FFBA 4LPKA 4NCHA 1IQPA 1XTRA 2XZPA 1SVOA 4Z8YA 4MITA 3DZ8A 4OK6A 2W6JD 4BQSA 1EG7A 1RFLA 3C5CA 1JR3A 5FTLA 2XITA 4C0AC 2OBLA 3ZDQA 1JR3D 5KTYA 2WICA 3J81k 3ZZUA 2WIAA 2VEDA 1Z0DA 2F7SA 1GOTA 3WXMA 2FZ4A 2VHUA 2VSXA 4ESVA 1E2NA 2DB3A 2RGBA 1Y3AA 3H86A 3FMIA 1G3UA 2DWOA 4FMCB 1W4RA 3WHKA 3PIRA 4YMTA 4JL5A 5H1YA 4US2R 2JGNA 3RABA 2OBNA 5TVKA 1KI9A 4G5OA 4JKIA 4A0FA 1MABB 4OQXA 3B7GA 4I1OA 4JBXA 4FCVA 4UNRA 1FUKA 4HB3A 2OT3B 4DLYA 5AUOB 1W4CA 3E1SA 4B2IA 1E0SA 2K5UA 1RE0A 4BEBA 1N6KA 2WAXA 1PLJA 1ZINA 1Y63A 4IDNA 2OBMA 1Q3HA 4Q7LA 3QSYA 1TF7A 3FMOB 3CRW1 4M1OA 4D26A 2QZ4A 3U4QA 2ZE5A 3QE0A 4I1VA 1G3MA 3K9GA 4ZDKA 1ZUIA 3LDAA 4DRZA 3FGNA 1I4TD 2J46A 2XNDA 3CF2A 2WWYA 2GKSA 2GTPA 2IW3A 2OFOA 2XNDD 1P7CA 1XJCA 3NXSA 1KI3A 2DBYA 2QT0A 4MYTA 1NMZA 2CL0X 2PLRA 5FBRB 3ZVRA 1RIFA 2JLWA 3BORA 3GLFE 1Z6YA 3CM0A 1XXHE 3QVVA 2BC9A 1KMHA 2ZE7A 5SZIA 3CX7A 4RD0A 2IYXA 4Q00A 5EE1A 3R7WA 1G8YA 4XH9B 3SHFA 4BFZA 1XEWY 5GJCA 3C8UA 5JI2E 1Z6TA 1X8LA 3ICEA 4Z8XA 5M04A 4QNRA 1TQ2A 2WAYA 2J7KA 4QG7A 3GQBA 5EP2A 2BCJQ 4AYXA 3BFVA 1JJ7A 4URUR 4DSTA 1AIPA 2D3WA 4F92B 2OLJA 1OFTA 4BZXA 5J40A 3U3RA 4ILEA 1X8KA 1IOZA 4IFBA 4LBZA 3PUWA 1DBSA 3IIMA 2NPFA 1GIAA 2EFDB 3MWJA 4AIIA 5L8VA 1OHHA 1H8EA 1C4OA 4C4PA 4YC7A 1RJ9A 4OHWA 5DI3A 2VA8A 1OHHD 1H8ED 2FFHA 3CRRA 5LD2C 1QBKC 2FGKA 5CM8B 4IEEA 4BFUA 1P4SA 3QKRA 4MQBA 5GADl 2J0UB 3MSXA 3R20A 1KY2A 4B34A 1OV4A 2IL1A 4RCYA 1K5GA 2KBFA 2D7CA 3AH8A 4U5XA 2O8CB 2L0XA 1P75A 1ZD8A 1FX0B 2E9SA 2OM2A 3RS5A 4RZXA 2QT1A 1E0KA 3HWSA 1UAAA 3LX8A 5KDDA 2GBLC 4OYHA 2VL7A 3QF7A 4YDSA 1QHXA 3TSOA 4O25A 3VX4A 4XJXA 4IDQA 1D8TA 4PHHA 3BS4A 2IUSA 2YZ2A 1VIAA 2IYWA 3HU1A 3GLIB 1M8PA 2WKPA 3QI2A 2FPLA 1NKTA 2ZREA 4V0LA 1WB9A 3VNVA 3TJZA 1P2TA 3VR3A 1QRAA 2FA9A 3GEEA 3KJGA 1G3RA 3VU9A 4OJQA 3R8FA 4AI6A 1QHNA 2ZYWX 2YINC 4D4MA 2H16A
chains in the Genus database with same CATH superfamily
5AM1A 5JFGA 2C7OA 5FPKA 4M1TA 2W8BA 4UHHA 4BBAA 1IVNA 3D4BA 4XSGA 3G88A 4JI5B 3RADC 3PQEA 2R6AA 2FDXA 2QD3A 1Z0IA 5EXPA 2JGMA 4YJGB 3MAJA 1KH2A 2JFOA 2QR3A 2WHEA 4TSFA 1O95D 3E5RA 3KUKA 4AW9A 3Q8LA 2CB9A 5B3AA 1N32B 4RF4A 2NTVA 3EXHC 4NIMA 5CFPA 2DQKA 3DGEC 1NSYA 4D3SA 1SUAA 3RT7A 3PYXA 3UJAA 3DVQX 3O84A 1MW8X 1NVFA 3FHCB 1VDMA 3WNZA 3UKJA 5D8DA 2PCLA 2QXTA 3EULA 3EWSA 2D7DA 4LX0A 3B52X 4URWR 2X22A 4FW8A 3RC2A 4JI1B 4FM9A 3IAUA 3BT7A 1DKPA 1UFVA 4HWKA 4HZIA 2V03A 4PFQA 3QXSA 5GGYA 1BHO1 4BMNA 3U7FB 1NP3A 3MOIA 3HUFA 3ILXA 4ZVNA 4AURA 3E8MA 3N3BC 3QPCA 5EIBD 5BWBA 4Z6KA 1Y3HA 3C6MA 1TO1E 1NJ2A 1M2OB 4QQRA 4S24A 2H54A 1Q1BA 4GZ6A 4I50B 2OUIA 4MMZB 4DDWA 1NQUA 1JEJA 1LPMA 4O4JF 4DQDA 5JZSA 1INLA 2D00A 1SZCA 4OIMA 1M2HA 5AM0A 4YWJA 2GPYA 4AG3A 1MO4A 4Q37A 4RJKA 3T0GA 2AYZA 3K6JA 4D92A 1O8CA 4OD0A 5HYVA 3BTVA 1GKKA 2VJPA 3L6UA 5F98A 2CYCA 4MP6A 5AW4A 1GVHA 3EXG1 3LCUA 5AUQA 3VNUA 1BA2A 4ZYTA 1NXXA 2CLFB 2Z4RA 2V1XA 1IHDA 2GM9A 5ANRB 2AH5A 4M8IA 3HKCB 3FXAA 1RABA 1OBCA 4L0MA 3ILSA 2X1LA 4OUDA 4G8DA 2O3RA 4BAGA 4J49A 2OXCA 3LQYA 3MUNA 4YALA 3K5HA 1JUDA 1ULUA 3DULA 1X6VA 4QGBA 3UUWA 1ZVQA 1L7DA 3BMXA 1WDKA 1Y5LA 3E6AA 3QVTA 3TLXA 2VBFA 4C0QC 1DKMA 1H0SA 2P9QA 4R2MA 1VYTA 4WY8A 1F60A 5EJ8A 1UC8A 5IPFA 3ADBA 3KTAA 3N2IA 3PJDA 5BUSA 1Z33A 5E4FA 2EX1A 4D9CA 4CCYA 3B3FA 3WYFA 3ZS8A 1WW8A 3BXZA 4LC1A 4RF5A 1YASA 1W49A 2RAVA 5J4HA 4I1RA 4M1MA 1RWXA 4CTOA 2WWIA 2X8BA 2CHQA 1WLSA 4YRKA 3C7CB 3SYNA 1X7XB 1AUVA 3LBIA 1GQ2A 4UDOA 1WXHA 1KY3A 3MTAA 2PM8A 3OUUA 3QTTA 4QRDA 1QLJA 4XX0A 3W1WA 5DLEA 5CB4A 3EUFA 4H6WA 1O0CA 4RGBA 1ICEA 4J0HA 3MHTA 3JD2A 4QUEA 3I2YX 1A7UA 1RRPA 1UJMA 5AJUA 3SHQA 1FSGA 4REQA 3U17A 1OX6A 3VKVA 4BLSA 1LEHA 2C0QA 3V4PB 3OPNA 2FQQA 2A4MA 4XM0A 4QBTA 1CUZA 4K05A 3T7IA 3T3NA 3AZQA 4U7TB 4MPJA 5M34A 4WNAA 3TZEA 1EUDB 4ZEWA 2FWMX 3DVSX 3FUXA 2I6XA 4G8BA 3TSZA 3ZHQA 4ACAA 3FGOA 4LMAA 1XAJA 3TAUA 4EB3A 3R7WB 1G98A 1YBVA 3JXEA 2Q3BA 5AICA 5FEMA 5CD9A 1VJRA 3UYKA 4F1WA 5FF9A 4M36A 4ZZ0A 2P65A 4BB5A 1POWA 2YV2A 1XQVA 1Z3IX 4EABA 5AWFC 3QGMA 4U9HS 1I5OA 1XVIA 4BFLA 3CH6A 5I9NA 4XKJA 4K9SA 2PDAA 4NE7A 1VE5A 1SVUA 1T25A 2Q6TA 3GC6A 3P0RA 2VKTA 4W7SA 3VSCA 2ZRKA 1WUKS 4L4SA 1E99A 1W93A 3RTGA 2WHPB 4IINA 1XRQA 4YJ3B 2VNIA 2NXCA 4YDRA 1SPBS 1U90A 2QM0A 3PGA1 5E6UB 3SHTA 3G9ZA 3H2YA 3KDAA 4DM7A 3QOWA 4D99A 4JQYA 2AOTB 2GJAA 1CRLA 2JRCA 5H5JA 3UK6A 3GP5A 3TIGA 4E03A 3I1JA 4DBLE 4BKUA 3KVVA 1P4AA 2QGFA 1TZMA 5P8WA 4YUAA 1IEQA 3GJQA 4UEOA 1ZJWA 3VKGA 2C9OA 2I8CA 5JASA 1DAKA 1RJ9B 4JOSA 5ELXA 1JR3E 1MV8A 1M2EA 2QNRA 3Q7SA 4FI3C 4NG4A 1VG8A 5H3HA 4MHTA 2ORVA 2EBHX 4HN2A 4IX1A 2JH9A 3D3WB 2FG6C 4RAOA 3W7VA 5B6PA 9LDBA 2X0JA 5JXIA 1V5GA 1AXEA 4DLXA 4NBWA 2O2EA 1EE2A 2NZJA 1GG8A 2REXB 1X8JA 3A7EA 3AFHA 3H8VA 4I9FA 3K8YA 4IHJF 1ZJYA 1XQ1A 3KEOA 4KXQA 3UJBA 5ALGA 4MDYA 4EW1A 2QTVB 4ZRNA 1N5JA 2GO7A 4D80A 4DAEA 4RJTA 3I9LA 1XMJA 3MGGA 3TXXA 2B4KA 2EX0A 2VHWA 4IJMA 1MTOA 1NI4B 1JYEA 2Q3JA 3TOCA 1X92A 3T3HA 3M3DA 1W0CA 3JQBA 2H2FA 4UD6A 1E2UA 1KP9A 5KMGB 1S3FA 4OHUA 3AUKA 3I9FA 1WBJB 2IZ5A 4FI3F 1CUBA 1KFKB 1Z73A 3KVYA 1QIHA 3VU9B 1NHWA 5G4KB 4J16A 3MINB 1QGDA 2JBAB 4OQZA 2VRCD 1P0QA 1XRMA 4CT4B 1ZI8A 3WFIA 2R68A 1TC1A 1N6PA 4IGAA 3QWAA 3QBTA 1E4YA 4C4XA 3B53X 2WIJA 2O5RA 2XGOA 3ICCA 1G6KA 1E6LA 4O4IF 3L84A 2W8BB 3RHZA 1N3IA 1AURA 4RQBA 2FKNA 1T9AA 2UZ4A 1T0UA 4PSCA 2A1UA 3FVVA 5C4GB 4XSHA 2V4ZA 1TM2A 1U2GC 1M6WA 2GF9A 3HVHA 4JELA 1RE1A 2WTBA 4M8SA 4OXXA 3S2EA 3DB2A 3BZUA 3SMVA 1YRYE 5LJLA 4JVLA 1PZFA 4NEQA 4DLVA 3R9WA 3OX2A 1KVSA 3VDXA 5DM70 2GRAA 1KYTA 3PWTA 3HA5A 3GBPA 1MO6A 1RAIA 1NPYA 2FCRA 4HDCA 2R2GA 1UPFA 5FL7D 2F9FA 3F98A 1VCNA 3TNLA 3HNRA 1BVHA 3RARA 5LYYA 4XSVA 1NUAA 2Q46A 1Z2NX 4RGVA 4ZDIA 5IXJA 2FN7A 1MHPA 4FFWA 5JH7A 2CHUA 3CN7A 3IVXA 3WYBA 5LWHA 1VPLA 1MB2A 2ZYRA 3PF8A 1OZ0A 4F3TA 1EHYA 1XWWA 2RG7A 2XGSA 3IPCA 2ODBA 1G7SA 3S99A 4A6XA 4EPTA 1E3DA 4YV1A 1QMGA 4FVTA 2CLEB 3KJQA 1KERA 1YB2A 2G5CA 3RV3A 3R1IA 4J2HA 3LF2A 1YKSA 1JR4A 1U0GA 5FAXA 1X7WA 4BBZA 3TOSA 3RYTC 4V1CI 3O73A 4UM7A 5LUBA 3OF5A 4ZAFA 1SOAA 3N86A 1WF6A 3MRXA 4CMEA 2JK0A 4BO4A 2BDEA 3N0RA 3IB3A 1FNMA 5T57A 1WEHA 2JHAA 4TPKA 1WZ2A 1S1MA 3G2OA 4KKXB 4CLHA 4N18A 5IZCC 3TG2A 2HSZA 4M9SA 1CRPA 1BFDA 4HDNA 3FIJA 1QHEA 3NUZA 4N7JA 4X5OA 3X3HA 4NENB 3E4DA 4AKSA 4OUDB 5G41A 4BNIA 1B0UA 1ZVJA 5CHYA 1T5IA 4AJOA 4XFDA 1Q1QA 2M6SA 3ZWVA 1HUQA 5D84A 1K0UA 1US8A 4DS3A 2HA3A 4HB2A 3DYBA 4JY7A 4KZPA 1KZGB 1YTUA 3KTAB 1WMDA 1Q77A 4NYIQ 5AW6A 2Y66A 3NTRA 4M83A 2OUKA 3LUCA 4J9VA 4W5JA 3VOAA 4CCYB 4MWZA 4NESA 3O82A 3R3ZA 4WY2A 1QRDA 2GT1A 3DGFC 1DOAA 2ERXA 2P2CA 4G09A 4RLFA 4LOIA 3JD4A 4LZOA 3TNFA 3DBVO 1JMKC 4M0UA 2DLDA 4GLLA 3WV4A 4DV0B 2HGZA 1BFUA 1NVUQ 2HQBA 4XYGA 5CB4B 1Z17A 1U7DA 3IIJA 3L93A 4XX0B 4J8PA 4ND7A 5DI9A 5DTEA 4B8WA 1ONOA 3HP7A 3I37X 4QFCA 3ZLUA 4MCJA 4PX2A 5FEUA 5J2TA 2IHNA 2B1GA 4D57A 4REQB 1L5OA 1PZHA 4XDGA 2QI9C 3K72B 4DV6B 1WETA 3NHKA 4PPFA 1CBUA 1ZM2A 3NBUA 3KAKA 2J3DA 3SVZA 1KO4A 3K16A 2AQIA 3B48A 4WNAB 2CBGA 4R3UC 2B99A 5AK6A 4DEXA 1WMEA 4TYNA 1UCFA 3O95A 3AONB 1GAQA 3NM6B 1KVUA 1ZKMA 4R5MA 2CNDA 3R8CA 1U31A 3VR0A 3ZU4A 4JWTA 4EATA 4QJ5A 3UJ3X 5AHXA 3DONA 2WLTA 3CN9A 3WYEA 2WJ6A 4AUNA 1FMJA 4RDIA 1G6OA 4D4KA 2XWSA 2BM8A 2QTRA 3C4QA 1QZTA 4Q18A 3MXOA 4MUXA 2A3RA 1G17A 4ZP1A 4B47A 1QB8A 3ONNA 3IUJA 2X0FA 3VU1A 2RHRA 2J5KA 2AOUA 3VPDA 4C7MA 2FX3A 3GJ0A 1ZNYA 2C4TA 4TKZA 5T6BA 1QUEA 3MOGA 2YHAA 4G1UC 3CT4A 1PD1A 1DAIA 2Z2ZA 4L51A 4H6XA 1XJ0A 3GP3A 4FMDF 1LS1A 2NSHA 4N03A 2I54A 4B7CA 1WM1A 1PJTA 3G2IA 3LI2A 3QEOA 5KSZA 3V3KA 4MEBA 3MLAA 4MKXA 2XZTA 1YRQA 2QI9F 4ZU6X 4ZYYA 3C4VA 1FBTA 3B1VA 1J2YA 1YC5A 1FFHA 4RENA 4DJDC 4EI2A 5HX7A 5L3VA 1POXA 2GNPA 3E7DA 5TQ0A 3RHTA 3G49A 4MP8A 1QV7A 1KA9H 4PU0A 1ONPA 1VA5A 1K9SA 5DMXA 1GP2A 1DE0A 1GA4A 2WE8A 4Y1FA 1W30A 1RJGA 1X42A 5SY4A 1OFIA 2VRBA 3N0XA 2YS7A 1IBMB 1ECPA 3DZBA 1XFAA 2PS0A 3IMGA 1SVSA 2WP0A 4ZAZA 5HDQA 1PK7A 4I08A 4RF2A 4JI0B 2IELA 3WISA 4NE2A 3II6X 5A05A 4BNJA 1SBZA 1FU8A 1PSWA 3C6XA 1K3FA 4G01B 1Z26A 3KELA 1LDNA 1NUQA 3PCRB 1E69A 5DYYA 4B3IA 4BZQA 5KNLA 1DMRA 4DM3A 4HLUA 3D0KA 3WYGA 1L4EA 2GHIA 1Z0AA 1L3IA 2NSLA 4IOLA 3N28A 5AVKA 5FO0A 4DCUA 1Q0HA 4FFOA 4KVGA 4LOLA 3MRSA 3UICA 4ZOLF 2X5KO 3A32A 4BN0A 5C8YF 4Q4LA 1NU8A 1YBFA 3U9TA 2ZUEA 3ICQB 4U6NA 1U0BB 2Y76A 5CTJA 1CW2B 1P2BA 1TM1E 1D03A 3P52A 2NZUG 4RVOA 1HT1E 1Y9JA 3G5AA 5DGTA 1OXTA 3Q3HA 1XVLA 4R8RA 4R2KA 4RLSA 3L1UA 4K87A 4YDHB 4EKNB 4R71A 2OBBA 4FDLA 4UHJA 2QZJA 4ZHSA 2P9GA 1NQVA 1B6GA 3HLKA 2ZFUA 2DY0A 1YE3A 2A1UB 5KIAA 1F48A 1Q1EA 5AOBA 3IQDB 3RVLA 3VPHA 1PEYA 5EAIA 3IT0A 1NXVA 2JEOA 4INPA 4Y6PA 2GVNA 4F6CA 1U1DA 1Y8CA 4OU5A 1XROA 5DM1A 5EGSA 1Y4UA 2OMKA 4LZNA 3H42B 1AX9A 2WOOA 3HJHA 4GWLA 3W5VA 1T0BA 1DQYA 4XCQA 1CIVA 2WFZA 2JGDA 3HYTA 3P0IA 4N5DA 2VDOB 4DV5B 2QTNA 1SBIA 3B78A 5JH7B 1FF9A 3EPJA 2HK6A 4JR2A 3RRXA 1GNLA 2E7ZA 3ESXA 4NEHB 1U7PA 4Y9UA 3ETDA 2G63A 1X1SA 4PXSA 3G0OA 3L07A 4R4JA 4RIEA 4C0SA 4DARA 4FEEA 5BSMA 5K0BA 1A9XA 2GZAA 5JS1A 2ZDQA 3A8TA 2Y93A 4AQYB 3U60B 3EDRA 1PR2A 3D8NA 1DEOA 5F5XA 1H2BA 4AP9A 2CDAA 1X7WB 3JAMA 2C5EA 2EG5A 4K1XA 4F3NA 1NLUA 1WNTA 3THYA 2G76A 1JL3A 5TLSA 4DBZA 2XGGA 2IIVA 4M1ZA 3KKQA 1BMDA 4UEQA 3WP0A 2ZJ8A 5GOZA 4DSUA 4IQFA 1L4GA 2ZYAA 2IEBA 3ZD9A 2JIBA 3KB2A 3NPAA 4MCAA 4W9NA 3FNRA 4HDNB 5ALWA 4YDQA 4TZ6A 1SIUA 5E9WA 4D44A 4A8PA 3OIGA 3HUUA 3QENA 4WOPA 1OX5A 1Y1KE 4YRGA 4O1IA 2W43A 2F8SA 1V95A 4YRLA 2WHYA 2WUVA 3HG7A 5DK6A 5J5CA 2NYAA 2E2WA 1US8B 1FXUA 1XCPA 4MKHA 5CYOA 4QBKA 1V5EA 2J5QA 2CMDA 3C3KA 3GUCA 4DSAA 3AQ4A 1CDEA 3P19A 3AINA 3HPQA 2FXIA 1GEEA 1SM4A 4AJLA 4NRDA 3H0KA 4HP8A 4CXMA 3W5JA 4YLYA 1KFCB 1G9XA 2XZLA 4IZIA 3KJIA 4HRYA 2RMKA 5EL0A 2QLMA 3ZGVA 3WJAA 3ZI7A 3GXBA 3RU7A 5HRCA 2RHJA 1LI7A 4CL8A 3JRXA 5DHSA 3FA2A 4FZ3A 4Y2SA 1E3IA 1QHFA 1S02A 4QOSA 3O31A 3A1UA 4GM1A 5DLYA 1XWFA 5J2TB 2GXUA 3PEVA 1VLQA 4EGAA 821PA 1JVSA 2WG2A 2YHBA 4XZ3A 3GCDA 3L1VA 2WABA 3JQGA 4BQNA 5KWSA 2J41A 1E20A 3EMBA 3IQXA 1N3YA 4I9HA 3SHVA 1CJBA 4LOJA 2QM7A 1JQJC 4CNQA 4A0HA 3LTNC 3GRUA 3B3GA 3BBLA 3MAAC 4IIDA 4AMVA 2R0QC 2LCFA 1RT9A 2PRYA 3SLKA 1ZAKA 3SE0A 1Q17A 3I6BA 2Q9CA 2GPBA 4OY3A 5AK3A 3LT0A 3RQIA 2EQAA 2E4UA 2E5LB 1BX0A 3RASA 3DKPA 3CG0A 2LW7A 2AOUB 2NV2B 2HYDA 4MVWA 4W4TA 2G5TA 5F21A 5KKCA 1TIBA 4YRRA 3WZMA 4RHEA 4O2RA 3E0QA 2GPJA 4CPDA 2W6ZA 1X1CA 2Z83A 3ZIUA 5EP3A 2ECOA 4ZC1A 4FMBB 2OSVA 2PS3A 2ZATA 4UVEA 1WJGA 3ISVA 1BMFD 1FXWA 1KYQA 1M75A 4GOMD 2QYHA 4D8WA 1I32A 4AKEA 1HGXA 4KXLA 3GO4A 2F9MA 5TQ0B 1N0HA 2D74A 2JGIA 4CL0A 3CUKA 3M33A 2ZB7A 1PEAA 1A97A 1RVDA 2W00A 1U6JA 1AKYA 8ABPA 1D5CA 4ND5A 1DIRA 4NMXB 2VK8A 3TNDA 4MVCA 4PZ9A 3SFZA 4YLGA 3IBCA 4CMGA 1VHLA 3BICA 1SIBE 4N5IX 3T5PA 2E5FA 3V6LA 1HEYA 2VFAA 2NO5A 4NFHA 4WXHA 1H2RS 4QARA 1X3LA 4CM4A 5BW5A 4FU0A 3ZCVA 1RYFA 2Q0HA 3V8VA 2QB5A 1T6YA 3DVAA 4B0PA 2SKDA 1QGAA 1KJWA 3V1KA 4LNHA 5EJIA 3T0FA 3W5UA 2YZMA 4I5IA 4I1IA 1SJ9A 3AI1A 4Q19A 4XVUA 4KQXA 4G8CA 3RSCA 1Z4JA 1N6LA 4Z9AA 3SQNA 4P3OA 3JQDA 1Q92A 2RH4A 2FZGA 5A9SA 3THXA 1BNCA 2D5LA 1M83A 1JSCA 2W6OA 4FQ7A 5EP4A 3ZCPA 3I8SA 5THQA 3K0KA 3N75A 5EZQA 2J59A 2JFQA 3O8BA 3R3UA 2XWQA 1XHLA 2QL6A 4C87A 3VYRB 4HYTA 4CR6A 4NXMB 5C8ZA 4D9FA 4IIHA 1C7RA 3H4VA 3PNPA 4IF4A 1KSJA 2OVBA 3NHLA 4IDEA 5F64A 1NM5A 4HMPA 4RJJA 5DRTA 4FSDA 2XUAA 2GD6A 3DD5A 4RA6A 3UXYA 4C4AA 3BFPA 3QQPA 2CLCX 4UBNA 3SS7X 2V8BA 3EOAI 1SQ5A 2PL5A 4JJGA 4KSCA 1SA0A 4MDFA 5BQ3A 2HJRA 2HWWA 4M53A 2WQ7A 2FEMA 2W0SA 1EFRA 3DE5X 4XIIA 2P5SA 5B2FA 2JIOA 1JGTA 1DUIA 1YR9A 1ZLXA 4MJXA 1BHQ1 1P1KA 1XCGB 3EIUA 1IQRA 3PR2B 4R8VA 5CJPA 4ITUA 4K3VA 4D8UA 2H0RA 2V1UA 4QXMA 2XCQA 4L7VA 4B45A 3LUAA 1GUBA 1Z12A 2JGDB 2P7HA 1DUVG 1YCGA 3U3DA 1NXWA 3VUEA 3S8MA 2OENG 3ZLTA 1W2HA 2ZJ3A 3OFKA 3ETJA 1IVYA 3ENQA 4NZOA 5EGNA 2OORA 2FUG6 3SM3A 2UVQA 5DM0A 4ZPJA 3ZTTA 1WZIA 3I4CA 3C43A 5AYVA 1Q0RA 4MO2A 1N92A 3GGJA 4TUYF 4KIUA 3I9V1 3ZEAA 4F96A 1H05A 2ETXA 2Q3MA 4GDFA 1S8AA 4D6PA 1AT1A 1RWMA 3IAHA 1FFYA 1PR0A 1JVBA 4N3CA 4PPNA 1QQ5A 3THRA 3UT5A 1TE2A 2FPPA 2I62A 2ZANA 4B6EA 2OEPA 4NMLA 4X60A 3OF3A 5CG2A 2JRLA 3DE0X 3THYB 4QWWA 3ZXYA 2ZETA 1N7JA 3GPBA 3JWJA 4BASA 5IF3A 4C30A 1A8QA 1GFZA 1ZH6A 5AKIA 1CQPA 3HZRA 4O63O 5AW2A 3PLRA 1F7VA 5B1DA 1T9BA 1I2BA 1J8FA 2FWIA 3QMMA 1RWPA 3LU1A 2JLXA 2ANCA 3KQQA 4AF7A 1VIVA 2C97A 3PD1A 1IBLB 2EKDA 3K9QO 1XG5A 1OPXA 1QHIA 2H9AA 3GEMA 2HREA 2AIRA 3WK9A 1OTYA 4LE1A 1B3BA 1E9BA 5BNIA 2Q27A 4X85A 4RD1A 3W1VA 1EM8A 8ADHA 1XTKA 1YDMA 1ZVMA 4RHYA 1UQUA 4NICA 5BYJA 3U4IA 1EFTA 1ISMA 3FNIA 3HCDA 2W2OA 2DBZA 2PLWA 1U3VA 1Z74A 2B4QA 5E9QA 1CULC 2IPNA 3LMKA 2H29A 4UCWA 3P2IA 5FULA 5C5DA 3Q2IA 3TUZC 3NNSA 3IEVA 2DLNA 3WBJA 3CINA 5DTIA 1X9IA 4X45A 2AA3A 5K3DA 1EK5A 1D2RA 2QTBA 4MAFA 2JA1A 3WE7A 3ZN2A 4B87A 1Z7WA 2PH3A 2ERYA 1D5WA 1AGYA 1I1NA 4KDCA 5L3QA 3VKHA 1WCIB 2C0PA 2FSVA 2DG2A 2IYFA 2R48A 1DOHA 2ORYA 4JBNA 2FUEA 1TMKA 4OPMA 4XFJA 5HKLA 3T38A 3TZCA 3VSBA 2HT1A 1OYWA 1QZXA 5DH9A 2AJTA 5KB3A 4YMIA 4MCHA 5DHUA 5EJ2A 1W0KA 3NRCA 2ODWA 1H93A 1HT3A 1X1EA 1CU1A 1ESCA 3JQGB 3QLUA 4N54A 4B80A 2VUIB 3CR3C 4HDSA 4MI9A 1TM3E 5C80A 1DAGA 2ATEA 3OURA 1VJ0A 1GT91 2OCBA 1ZUHA 3KQWA 1U8UA 4CI0B 1YS1X 1FCJA 1VHDA 3MAGA 2JVKA 1UZAA 1HDOA 4HS9A 3DE4X 3B5JA 2OYRA 1R8SA 3PR1A 3IEMA 1KKMA 5BNTA 3MMXA 3RUAA 1ISJA 4CNBA 5CB8A 2Q8PA 2VG8A 4EHLA 2QWXA 3J81A 2GBLA 3TOXA 1YVPA 4Y2XA 3KTOA 5CH8A 4G9GA 4OGKA 3AF3A 3RODA 5T8KC 1Z4NA 4UXHA 2FZEA 1TIPA 1G5FA 1YS7A 2IXAA 2QNBA 3GARA 4RZ3A 4WASA 1YS9A 4OBEA 3S2GA 4DJEC 4DIKA 3LUBA 4BO9A 3OIUA 3T8YA 1D2CA 1MQAA 4A2CA 1CP3A 1ZGHA 2AL7A 2OCIA 2P9YA 4OJNA 5D85A 1F2TA 1RYYA 1X1DA 1FSSA 7ABPA 3MERA 4RK4A 4IV5A 3AYZB 5J59A 2TMGA 4DC9A 3EGXA 3PP8A 3GBVA 1GGVA 1PX2A 1KDOA 5CT9A 4CKYA 5AHRA 3UBTA 5LXTA 4QD3A 5LKRA 1HRKA 1RQ2A 4MQEA 1E4OA 1I2DA 1EYZA 4U02A 5IW8A 3BB1A 1RLOA 3KZXA 3WLHA 2AUTA 3Q8MA 2C8KA 1OGJA 2FNAA 3TD2A 5CU7A 1FS4A 1K4MA 3D7SA 2CFSA 2ZYTX 3QFSA 3NWBA 3S81A 3DVAB 2JLYA 4L8YA 3SAJA 1EK6A 2GHTA 1RXWA 1PEDA 2ZVQX 1AU9A 4EX7A 5JD3A 2AJCA 3WBKA 4PFKA 2R62A 4QX6A 1T8TA 1S2GA 2XOKD 3P9ZA 1ZLYA 4B3FX 5DXJA 3QE9Y 4NARA 5A9SB 3THXB 4BAZA 4GLBA 1F8YA 1B16A 3CLTC 3L0SA 1WTAA 1GPNA 1X9HA 1U6KA 4OP2A 4GRIA 4LCJA 1EFKA 5I9TA 4BVJA 4YXFA 1ABBA 5HP4A 2FSGA 3NASA 4HDOB 1FZQA 1C8LA 2PBLA 4C21A 3MWLA 4QO7A 3CVYA 3M3HA 1FJHA 3EXIA 4AZSA 3MGBA 2PA3A 3DMYA 4IILA 3QHQA 2YVLA 3BJRA 2GXAA 4RA6B 5FTJA 5BSTA 1N8KA 2C4WA 3C85A 3ZW7A 1IZ9A 2EWVA 3OQVA 3TQHA 3V46A 3CRVA 2OZEA 1Q0PA 2PANA 2IBTA 3P96A 1SA0B 1A8IA 1FTSA 4YP9A 2QRZA 3L06A 2YHSA 3CRNA 4BO1A 1XPJA 3IRUA 2B37A 2BGMA 4IICA 4HBGA 4A8JA 1KJZA 2H85A 2HDWA 1F8XA 3FYHA 3RYFA 3STHA 3HXOA 5LMZA 2I9PA 2W4IA 3IOCA 2IF0A 4KUHA 4R2HA 5EMLA 4BE9A 1N6NA 4QM7A 1ZD4A 1JECA 2CD7A 2C9BA 4X1KA 1KRXA 3M1LA 5EINA 4G9BA 1HDRA 2B6NA 4A10A 2QY9A 5DNVA 2ID7A 4QXAA 2XQFA 5IN5A 3BIWA 3KJZA 1YRAA 3VH4A 1J70A 1UP6A 2XBLA 5JCPA 1JP7A 4Q16A 2V3CC 1O6ZA 5FOTA 4Y2HA 5JADA 1D2NA 5JNUA 1J2RA 2REOA 5HTOA 3AG6A 2C04A 3BXFA 5FNVF 1S2IA 5KTPA 4XB2A 4U5QA 4O1HA 1ZH2A 4EB0A 4CM3A 1ECCA 2GO1A 3ONDA 1L5GB 3GXOA 3IYLW 2K87A 3OCCA 3UT5B 2FPPB 4DV1B 1BDHA 2CV0A 4LJ7A 1ZKDA 3AY6A 1TQ4A 4KITB 1P17A 5ALIA 4GC9A 5ECYA 3KEFA 2EP8A 1K06A 3A58B 3L2OB 2CNLA 4GZMA 3V8QA 4DDVA 7ADHA 1J7JA 2RHBA 2HRZA 2HHLA 3D4PA 3I52A 1A2QA 3O3OB 4LDRA 5FPSA 3RROA 1XHFA 2Z4TA 4KN6A 4LDAA 2JIQA 4KQMA 1PQYA 3U40A 1ZW1A 4RYLA 1DQRA 1RRGA 4DANA 3RUDA 4BHTA 2NO9A 4W6QA 3F6YA 4E5DA 1T6XA 3FPHA 3IOEA 4Z7NB 1DTSA 2DMRA 3TQQA 3M6MD 4D8YA 1A5TA 2C9ZA 1L7MA 2BFAA 3AEQA 1N2CA 4UMDA 1KFJB 3KDPA 1EM8B 1A04A 3N6XA 2EZ9A 3R0JA 4JROA 4RYDA 1GQFA 5IAAA 3A6LA 3W78A 5DW0A 5JZBA 3MS7A 2BKLA 5BURA 3UWMA 3LPNA 5C31A 4TXLA 3UOAB 3PXCX 4M9UA 3GI1A 3C5WP 1O7JA 1TMYA 3COZA 3K8ZA 4PLPA 4A2WA 3CVUA 1Z6ZA 3WLPA 5C4IA 2C57A 1IE3A 3G82C 4NYMQ 4UUNA 3VYUB 4F56A 4HF7A 1TCAA 5EXSA 4EO7A 1RQPA 4V0MA 2JAXA 5L3QB 4RLQA 1S5PA 1ES9A 4KSBA 1XU9A 2J85A 5K20A 2IHYA 3HI6A 4L5BA 1J33A 4QQKA 2NUAB 3ZV3A 3GFFA 2QX4A 3NAGA 4K46A 2QW8A 3F3SA 4J90A 1RYZA 3GAZA 2ZUFA 4K6FA 1ZNQO 5EYPA 4DUZB 4HEQA 1LPAB 1WD5A 2PQ0A 4HDSB 1XL0A 4KFTA 1Z4PX 3G8BA 2GS9A 1E0AA 3EIWA 4MQUA 3IIEA 1DBPA 2M6LA 4DNOA 3PE6A 2HLPA 3VJRA 3KQHA 4E32A 1QVWA 4J29A 1FNNA 1G8SA 4U0KA 2Z3WA 5DYNA 4KR6A 1JJVA 2QD4A 3DOUA 1A27A 3HJNA 3ZHBA 4DJFC 3L4BA 2PGAA 4J0IA 3O8OA 4FR5A 4F1KA 3G9TA 4EL5A 3FNHA 4JP1A 1XVAA 4GRDA 1VKNA 1TUIA 4NS1A 2GILA 5K8TA 1TGVA 3ZC3A 4DR2B 3TSCA 4ZFNA 3S40A 5JZOA 3PQ3A 2OYCA 1NUPA 3BM5A 1EXMA 3K2QA 1QX3A 3TS1A 1KHTA 2H2GA 3MGAA 4RMJA 2WM3A 2WU0A 1ZJ6A 2IUUA 4GWKA 1ELOA 3F8TA 1LLQA 3MT8A 1EK2A 4MPDA 1VOTA 2C96A 4LBVA 5FOSA 3ABIA 5AXCA 3ZV4A 3T1HB 4BVLA 4FUTA 4A15A 1JXMA 5JC1A 1I2MA 1F2TB 3H5OA 4M99A 1YQTA 1C3VA 2JDID 4YLEA 3L4JA 2ETVA 1E5LA 2IJGX 3EGXB 3K9LA 3VAZA 4B7ZA 5EVJA 1E7MA 5LXTB 2IYUA 1CYDA 1UK8A 4MQEB 3ET4A 5HILA 5AIBA 5HR5A 1YB4A 1JZQA 3H5TA 3ZQ6A 4M22A 3KUDA 2UUAB 2R8RA 4WEOA 3A11A 1CUIA 3Q9LA 4R9RA 5AJWA 1JS1X 2AC2A 3WDMA 4UOZA 2O59A 2ZG6A 4AG6A 4DB2A 3FOWA 3KXPA 4AFNA 3WB2A 3FPEA 3KS9A 1DBQA 2TYSB 1PJRA 1AZTA 2QBYA 5KAPA 3TCNA 1PR9A 5ADHA 3EQ7A 3CX6A 4ZJUA 6CHYA 5FUQA 4R2XA 5A5FA 1GUFA 1CCWA 3FJOA 4REMA 3X1KA 1DXQA 1P77A 4O2BF 2HOQA 1PFVA 3LXMA 4DADA 5I7HA 3FSJX 1MJ5A 3VR4D 3ZXUB 3IVGA 2DWCA 2VYFA 4J0DA 4J1TA 1SUBA 1V4BA 5IJZA 4HUQA 3Q5GA 1JX6A 2QTMA 3CZAA 4KO1S 4BIMA 3DZFA 4XUGB 4CDGA 1J0BA 3KYJB 3HEMA 1CUFA 4ZODA 1JJFA 5H8WA 3FROA 4O0MA 4G2TA 3EXIB 2ECFA 2JCYA 1I7SB 3TRHA 1C0EA 3WIUA 1I7PA 4ARZA 2W2NA 3S4YA 4A8HA 1QGUA 1JXAA 3AF2A 4H6VA 3I92A 5A02A 1XTIA 3MHPA 4BO0A 2ZBRA 3LK7A 4FE7A 5T64A 3O9ZA 4U1RA 2V55B 1TU0A 3RYCA 3HWRA 4YCAA 3SG0A 3L5OA 1G9SA 5IVDA 1C3EA 1VJ1A 1FQOA 1RHJA 1JU3A 5HGJA 4I6EA 2HWKA 2ZZKA 2ATVA 3NBFA 5IKEA 2VP4A 5LMUB 4OQPA 4A8JB 2GJ4A 2G3YA 4OB8A 3RYFB 3TLEA 3UATA 3FPSA 3ZKAA 4UCFA 4BMDA 1I0ZA 4QT4A 3VPAA 2EATA 3CNLA 4JUDX 4X1KB 4Z1OA 4YGYA 1COWA 1R4MA 1W1WA 2C5GA 2LV8A 5TRTA 1L5KA 3W8DA 3CBGA 4B35A 3QOYA 1JDUA 3FOAA 5BYAA 1U4OA 1P2DA 4J9UE 5CLIA 3KZKA 1ZGGA 4RESA 3NOVA 3FTDA 2J9YB 1RLUA 1CZOA 3BOSA 3UJ7A 1UBNA 3OJCA 4D6YA 1NVKA 4Z4FA 2D1SA 5FBKA 4B43A 2WPNA 3ADOA 5A1TA 1A4UA 3DBRA 3AGPA 5D3ZA 4MLDA 4YNBA 3SJCA 4MHOA 4JI2B 3H9JA 3GJ4A 3ROGA 3ONVA 4JWKA 2DXIA 2EGHA 2OC4A 2TMYA 2XVXA 3EIHA 3C7AA 4BJ6A 4D0GA 2ID4A 3UEOA 4A91A 4Z9BA 5IJWA 4HATA 4Y6OA 3PI6A 3HSKA 5JI3E 5JMTA 3CLUC 2CNWD 5C3MA 1RQXA 1CUAA 3WB1A 1U7UA 1OREA 3D2LA 3QVWA 3QXJA 3I4LA 4LGVA 1I10A 4P82A 3WL4A 3T9DA 3CLKA 4EYQA 4FR2A 3AEQB 1N2CB 3PITA 3AP2A 5HKAA 1L5LA 3O1LA 3EC2A 3FR7A 4WSOA 1QONA 4HGRA 3QPBA 3H1PA 3L40A 1K5PA 4OXRA 2NG1A 1HG1A 4G26A 4PM4A 1FFWA 4YYZA 3OJWA 1FYDA 1OT3A 3TGWA 1HETA 3AHDA 1G7CA 1T3ZA 2RAUA 3A36A 5L3SA 1ETHA 2YQ4A 3B1YA 1ZEJA 3E9MA 2DUWA 3BIFA 2ENUA 3WLMA 3ZDRA 4ZU1X 1OIWA 3PT9A 4ALIA 4CGZA 4KSYA 3BH6A 4YPFA 3K53A 2EBFX 3KQTA 3SZ3A 3R24A 3K9CA 2REQA 1E61A 3RTBA 1VSUA 1MV5A 2VYVA 4PINA 4PZLA 5TGDA 2ENWA 1TECE 3HS3A 2A92A 4H1UA 5EYPB 4C88A 1YXMA 4EIWA 5BXQC 4FHGA 1XZBA 1R18A 4Q9DA 3K30A 4MWCA 2EU8A 1IG0A 2YZNA 3CGWA 3ZD8A 5IKXA 3KD2A 3KKNA 1IOVA 2RJOA 3U3JA 4EBBA 4K0KB 5EKSA 4X63A 3W34A 1Y8ZA 2ZSFA 2I8AA 1UIRA 2IITA 3C8DA 4U2FA 5A4AA 3WQRA 3O8OB 2GOYA 1SN7A 4XLLA 1UBLS 3BRWA 2CLLB 5FPPA 4BRZA 1XMOB 4LAFA 1RAGA 3AI3A 4QIHA 4II7A 1EBFA 3TMKA 4CL3A 3H8SA 4D45A 4I50F 5K0ZA 3NOOA 3NRJA 5BSRA 3CTPA 3LFTA 3WRYC 2C61A 1I7DA 4XYLA 4ZJPA 5D3KA 3NH6A 2WYUA 3GLQA 2VKQA 1PHRA 2FPGA 5EUCA 4BFYA 4C5BA 3WJ2A 4JA0A 2QPTA 3OZIA 2AR9A 5E8JA 3WGQA 2SNIE 5CVTA 4TMYA 1LLCA 2ORIA 2ZGVA 4PLWA 1EWKA 4DR1B 3U44A 1TU3A 3G85A 5GV8A 2YN0A 4CRWB 4ZIRA 3NDPA 1U3CA 4C03A 5EJFA 5JAOA 3G6KA 6ADHA 3U4DA 2UXBB 2ECPA 3V3TA 1WA5A 4OHXA 1JG4A 3EDYA 3HO8A 3IKMB 3PGMA 3G1UA 4LWPA 4WE3A 4OKSA 5AO9A 1GTRA 1BGWA 2P41A 1EGHA 3BGIA 2H48A 3FAKA 1XZEA 2UZ0A 3I9V6 3L4KA 1C9MA 2E3JA 2C82A 2HUNA 4KXWA 2CXSA 1JHPA 1LBEA 1NVBA 2E87A 2E89A 2QVXX 2IXBA 3KIPA 4WN3A 2FF7A