1E0KA

Gp4d helicase from phage t7
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
288
structure length
288
Chain Sequence
PDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA HELICASE
publication title Crystal Structure of T7 Gene 4 Ring Helicase Indicates a Mechanism for Sequential Hydrolysis of Nucleotides
pubmed doi rcsb
source organism Phage t7
molecule tags Helicase
total genus 80
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2000-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e0kA00
4XSHA 4M0LA 1E9FA 2O8BB 1D2NA 4G5GA 4HLUC 1CJKC 1Z47A 3BORA 4R71A 1Q21A 2NO1A 1GVNB 3PUWA 4TL7A 4LJ9A 2QMUA 4NE2A 1XTSA 1P3JA 1QZXA 1JAHA 1NSTA 4B35A 1N0WA 4ZI3A 5JWHA 2ZI9A 1KY3A 2XOKD 1ZJ6A 3B1XA 2JLUA 1OKKA 1NLYA 2ORWA 2J59A 4C0LA 2R2AA 3RSOA 1US8A 3I1FA 2AFIE 1UF9A 3PR1A 5KPDA 3UMRA 2ZRKA 4EJSA 4NCKA 4UXIA 1Q12A 2Q3HA 2PBRA 3U6KA 4BFXA 4ILEA 2PJZA 3WP0A 2WWGA 2ZREA 3RS5A 3LBNA 2UZ3A 1SVSA 3W8NA 4LSGA 3QSYA 1HV8A 3QI2A 1JECA 4EFLA 5AJYA 4Y0AA 3CX6A 3AQ4A 4TYYA 3TH5A 4HB2A 4BGDA 2O0JA 1NLZA 3IHLA 1EFRD 4NYIQ 1CKEA 4M22A 1SXJC 4MRSA 2VPPA 4KYUA 4RD0A 5EQTA 1OH8A 4LBVA 3CNLA 1FOEB 4IVRA 2DB3A 2FPKA 4LYHA 2EYUA 1GNQA 2W2TA 1QHNA 3C5HA 2XAUA 3GCGA 3PEVA 3A4LA 4ZDIA 2NO9A 5BWMA 5FTKA 4MRPA 5JJKA 4M8NE 2ZI7A 1XTRA 1RC8A 2XJ9A 5AWFC 3CR7A 4KI0A 2JLWA 2ZPTX 1Z3IX 3UWOA 1U0JA 4P32A 4B74A 1GILA 3CW2A 1T3HA 2LKDA 2ZVPX 1OH6A 2RGXA 3N2EA 4WXRA 2C98A 3AH8A 3K9HA 1KSGA 1GM5A 1OXXK 3K0EA 4QL3A 1JXOA 4BLRA 2VHUA 4HLDA 2RB4A 1XD9A 2HV8A 4PAMA 2YKGA 4V0NA 4JSYA 1JAIA 3HDTA 4JBWA 5JBQA 2C99A 2N46A 3SYLA 3EWAA 3UPUA 3LAWA 1XBTA 1U9IA 1OB5A 5FTNA 4TZ0A 1EWQA 2P65A 4XD7D 3MCAA 1YVDA 1ZW6A 2GBLC 2UKDA 2FJUA 1OXVA 2GK6A 3R9IA 4R2IA 1ZYUA 4OQLA 2WIAA 3B1VA 3KUDA 4F4CA 2Z4SA 1BYUA 4IKEA 4HYYA 3T35A 1QF9A 2X2EA 2EVWX 4HLQB 2WWYA 1UKVY 5DYGA 4MKIA 1EWRA 1FP6A 1Z5ZA 2XZPA 5TVKA 3PEWA 1MO5A 2DR3A 4DDVA 4TSFD 3K70C 2HYDA 4DVGA 1K5GA 2CE2X 2HT6A 3LQRA 3TK1A 1OE0A 5B2ZA 3Q8XB 3B85A 3A6PC 3FTQA 1E1QD 1R5BA 1E4YA 5ANRB 4A2PA 4B43A 2AX4A 3K0CC 2VHJA 2VF8A 4Q4AA 1SVKA 2IEYA 1XJCA 1OF1A 4ABYA 2CVHA 1F5NA 1NVVR 5H8WA 3ND8A 3R8CA 4DKXA 4KXFB 1FZQA 2HF9A 2AWOA 5IRCD 3SBEA 4TZ6A 2JASA 1Z6GA 1Q57A 2WICA 3WMFA 3C16C 1TAGA 2JA1A 1H65A 5D3QA 2QBYA 4GZLA 1FP7A 1JBKA 1XD2A 4MITA 1SHKA 3EW9A 4M53A 2QPAA 3HP1A 4Q00A 2R6GA 1AA9A 1SQ5A 2JJ2D 3QKRB 4B3GA 3MFYA 5H68A 1KMHB 1KDPA 1A1VA 1Z07A 4AG6A 1G3RA 4Q47A 4DUGA 2DY1A 5J4LA 1EGAA 4CVNA 2XSZA 5E95A 1QHIA 1UM8A 1KI6B 1PLJA 1S1MA 4NCJA 2AFHE 4NYJR 3SZRA 4C0SA 2DWOA 4US0R 2X77A 3AF1A 5EE5B 2KJQA 1ZUNB 1ZINA 2C77A 3EZFA 4ZKDA 4KLZA 3TMKA 3QG5A 2IYUA 4ZDJA 1GP2A 4TMZA 2WPDA 5FL7A 4FMDF 4UNRA 5LB2A 3TKLA 4D6PA 5L3VA 2WJYA 1P6XA 2VO1A 1G3UA 3NBZC 4M9QA 3GLFE 3A1UA 4B2PA 1UKYA 1WCV1 2OV2A 3TVTA 2D7DA 1SXJE 3Q72A 4O3MA 1G20E 2C5LA 2W6JD 3KTAA 4PX9A 4TMVA 3VFDA 1JXMA 4CYMA 2O52A 4NBSA 4MKFA 3K9LA 3RNLA 5AR1A 2IS1A 2QGZA 1OKKD 1M8PA 3SQWA 4UKDA 1MO4A 1U8YA 1G9XA 3EXAA 3LXXA 5TY0A 2IS6A 721PA 2IEZA 3VMFA 4G5SA 1YKSA 3HR7A 1VPLA 2QAJA 1GWNA 1YHNA 3KFVA 1IBRA 5M04A 4E07A 3UATA 1ZUIA 4KYIB 2GAOA 3ZZTA 4QNRA 1JI0A 2FA9A 4ZCIA 1LW7A 3ADCA 1E2MA 1E2JA 3ZQ6A 4QBFA 2ZS9A 2GCPA 4BWYA 1GSIA 5EP2A 1P61B 3I4LA 4I1OA 3QEOA 5JEDA 3RWMB 4C9BA 1NN5A 3VR3A 3T1OA 4U00A 3BD9A 1M34E 1VG8A 2W0SA 2QEQA 5JS8A 1JEEA 1NY5A 1IQPA 4FI3C 5JSZA 3ZD7A 2R9VA 1QHXA 1GRNA 1TL7C 4RFVA 1G8PA 2REOA 4MRNA 4GOXA 4CF7A 4TMXA 2J5XA 3K8YA 2VLIA 3V4RA 1M7BA 1W0JD 3U6BA 4D26A 2R6DA 2VP9A 2H17A 2HLDA 5C2JB 1IN6A 3G5UA 3AVXA 1NN1A 3AVYA 4LV8B 5L3SB 2PZGA 1N6KA 5JJIA 4B3XA 4OK5A 2QPOA 4M9ZA 2VA8A 4H1UA 3A4MA 3VR2A 2R65A 4MKHA 3AVWA 1R0XA 5FUVA 1KSHA 3LNCA 1MT0A 2WOJA 1U90A 1R2QA 2KBFA 4O2LA 3T12A 5FPKA 3EPJA 2X2FA 3AGPA 4OKSA 1D9XA 1DTSA 4Q5IA 2IYXA 4OI1A 1MOZA 4CT5A 3AVQA 4HUTA 3IEUA 3TUJC 1ZIPA 1TF7A 5LPNA 1NL3A 1OB2A 2PL3A 1UBFA 1Z22A 1P62B 3PFIA 3U61B 1JR3A 3THYB 1U81A 3I8XA 1NMZA 4L15A 2WWHA 1YZNA 4ZIRB 4OK6A 1S8FA 2QQ0A 5FR1A 4A82A 2NQ2C 1X8LA 1WQ1R 3G0HA 5GJBA 4YONB 2VSXA 4KAXA 5KNBA 4F93B 2QTVB 4EJSB 2QSYA 3C14C 1JPJA 2P5SA 5GJCA 2YC4C 4DLRA 1FX0A 1P9NA 1XPOA 4DDUA 4NZYA 3THWA 1YRAA 3VKGA 5CIQA 1S4QA 2REXB 1RRGA 5J4VA 3GLGE 1VIAA 2JJ1D 3OEHD 1UDWA 2I4IA 3LH5A 2RHMA 5K8IA 3ADBA 4FWIB 1B23P 3ICQB 2OAP1 3P27A 3WBJA 4JLAA 3TIFA 2P67A 1IM2A 1PUIA 4C0JA 4AYWA 2GETA 2F7SA 3LY5A 4JL6A 1VHTA 2QRNA 2WSMA 3IBGA 3TQCA 5DE3A 1G21E 3CO5A 3RANA 1RKBA 3DL0A 3W8RA 5CB8A 3CUEF 2YC2C 4LOAA 2EW1A 2WMOB 1JEDA 2W6IA 2IYRA 4LWZA 1Z29A 5FOUA 3R9WA 4XVRA 3LQQA 3R20A 5DISB 3E5HA 2QT1A 4XWOA 1VG9B 3GJ8A 5HZHA 3AP2A 4PHFA 1XXHA 3X1DA 1J8MF 4XH9B 4JBXA 4KJZA 2FEMA 4Q21A 2XZLA 5L3RA 1OT3A 4BLTA 1FQKA 2UZIR 3RLFA 3W9YA 2XNDA 3GLHA 2P6RA 4HZUA 1W49A 5E7JA 4YMSA 3SJCA 5DSZA 1LV7A 4AKEA 2C9OA 2O8DA 1RJ9B 1EG7A 2ZS8A 1NBMA 1SXJD 1T6NA 1YZLA 2BWJA 5CK5A 1BO6A 2FX3A 4DEYA 5CDFE 1II8A 4YMTA 3BFXA 1X1RA 1VECA 2OBMA 4XSGA 1ZD1A 2J7PA 4NDZA 4ASUA 4PXAA 5FBQB 2V8OA 4TQAA 2ZAMA 2OXRA 3B78A 4FMCB 3QKUA 4LHVA 4LY6A 4Q7JB 3BIFA 4MRVA 4Y0VA 3VX3A 2RGDA 1U8AA 4MGZR 4DLSA 3L0PA 2WMNB 5FL7D 3C15C 4JLBA 1T8TA 1U99A 4N0DA 5JFGA 1E99A 1O3YA 2AR7A 4Q48A 1M6NA 4CW7A 3GLIA 4A4DA 4EFMA 2K5UA 3SDZA 2NO7A 1BS1A 1Z6TA 1UDXA 2VF7A 1YE8A 3W5JA 3GEIA 1SVLA 3BS4A 3FFBA 1P72A 2N42A 2QAGA 3DPUA 5FPYA 4A2QA 2OLKA 2PMDA 1HYQA 4Q4AB 4B44A 5BW8A 2PT7A 3W5IA 2H1LA 4B33A 4BPBA 2IL1A 4CRWB 1ZU5A 5ELXA 5KTYA 3KUCA 3PG5A 3UKDA 1RE0A 2A5YB 1QHGA 1QHSA 4M9XA 4RZ3A 2QZ4A 3CRMA 1XPRA 2V4ZA 4XWAA 4DIDA 2YYZA 4M1KA 4KITB 1GAJA 3VHXA 1LS6A 3RS2A 2OCPA 4D0LB 5F9HA 4URZR 2ZJAA 1DPFA 1OXTA 1S9HA 1E9BA 1BYIA 4NCNA 2QMHA 1JQJC 2J3EA 4EAQA 5J4KA 2XTNA 4DRZA 3D31A 1E0KA 2CJWB 5BQ5A 4MQBA 3A1TA 5L3QA 4TLAA 2DBYA 4Q01A 2ZR9A 3L0SA 2JLXA 1ZNYA 2ZJ2A 1P5ZB 3U7FB 2Q0HA 4DXAA 2AD1A 3GJ6A 1T5LA 1LTQA 3MMPA 4POAA 3REGA 3B82A 4EPWA 2P6NA 1CXZA 1G4UR 1FNMA 3TAUA 1U8ZA 2VTKA 3A8TA 2BMEA 3CH4B 4PSAA 3WYFA 4B32A 4AKGA 2PX3A 4LJ6A 1LFDB 4W9MC 2ZUCA 1CR2A 3B9QA 1YJ5A 2OHFA 4NCIA 2WKQA 4ZPXA 5CITA 3H0KA 4DLVA 4N3NA 3PXGA 1KI9A 3TLXA 4WAUA 4QRHA 3VR1A 4Q66C 3U44B 4CEHA 4TLEA 4IFBA 2A30A 1R10A 2ZRPA 3EWSA 3KKMA 3KJIA 2ZR7A 3MWYW 2VQSA 5SZIA 5FUWA 3LW8A 1JR3D 3NDPA 3L0OA 2Z6VA 1UFQA 2PH1A 2R8RA 4M1TA 3BBPA 2Z0MA 4DWJA 2CHVA 3QPUA 3SE0A 3K9NA 4FD2A 1KSJA 2GAAA 3QXCA 1CRQA 2ZRFA 3QKSA 3GPLA 3PITA 2GVZC 1GKUB 3X1WA 4S35A 1SKYE 4D80A 4IDNA 2IF2A 5KNCA 2DFLA 2QA5A 1GUAA 1QG4A 3QIAA 1Q0UA 4NYIR 4R7ZA 3OEED 1ZIOA 1FW6A 4JJZA 2F9MA 3DKVA 3ND9A 4ZDWA 4BRWA 5FUYA 2YOGA 1G6OA 3F0TA 2BMDA 1W0KA 3ADKA 4ERNA 2ZI6A 1OV4A 1CR0A 5FBVB 3U7GA 3TR0A 1LS1A 2JDIA 3AUYA 3FE2A 1L4UA 4RZUA 4XD7A 4NYMQ 2B7BA 2W6ID 1MH1A 3VAAA 5JEEA 1TUIA 4C2UA 3NH6A 2VSOA 2IX3A 3LVQE 1YZGA 2ATVA 2VEDA 1WBBA 3KZ1E 221PA 2FSHA 1YZUA 4IJMA 2JATA 3FGNA 1W4RA 4L9WA 4YLGA 1XZQA 3KXLA 5EJEA 4YC7A 2CDNA 3DM5A 3QBVA 4IEEA 1KI2A 4LYJA 5HE9A 1HTWA 2HJVA 3B7GA 2EWVA 2IA5A 5GVRA 1ZD9A 3KDSE 5HPYB 1PLLA 2GF9A 1X6VA 2QUZA 3ZH9B 1XCGB 1NBMD 4R98A 4OHZA 4HUQA 1G8FA 1D2EA 2FFAA 4MYUA 1IN7A 3P20A 4GL2A 3BK7A 4JLOA 2WV9A 3QOFA 3A36A 3U4QA 2WM9B 1W36C 1KDRA 4AURA 3LW7A 4DLZA 3K0AB 1W46A 4YMVA 3Q5DA 2J7PD 4LGMA 4TWZA 2IXGA 4URYR 1EX6A 1L7VC 4QJ4A 3BJIC 4Q1CA 1GL9B 1GL7A 3AF2A 1F2UA 2BIFA 1QG2A 1QRAA 4PPGA 5FOSA 1C4OA 2R6CA 3LLMA 4LK2A 1J7KA 5KYKA 1NJGA 2OAQ1 4Q7MB 5BN5A 821PA 2VP0A 2QORA 4BEJA 4OQNA 1EFUA 4A6PA 3OFNA 3CZQA 2HCBA 3EA5A 2ORVA 4EQ6B 4LUCA 3TUIC 4XTCS 2YHSA 2A3RA 1YZKA 3Q3JB 3CH5A 1E79D 1JQLB 5KPJA 1UKZA 1G64A 3CM0A 2A5DA 3C4JA 1QDEA 2C9YA 4QHTA 3BFKA 1DO0A 1KAOA 4IDHA 2ZUBA 1XFAA 2ZI5A 4W5WA 2PZEA 1Z2AA 3KJHA 4TL6A 3AB3A 3EZ2A 1GOTA 4AC9A 2IS4A 4Q03A 1RZ3A 1XTIA 4RJLA 5JI2E 4PSKA 3JZAA 4UNSA 1CJVC 4A8JA 4RD6A 3KQUA 4ARZB 4DB4A 5KSYA 1HA3A 4JS0A 4A6XA 1NKSA 1T91A 4OQXA 4MDEA 3AVOA 1HY3A 1XXHB 2BMFA 4GP6A 4KFSA 4MGYR 5SZJA 3X2SA 3ZS8A 1JALA 1JJ7A 3E1SA 1CIPA 1SVIA 3PUVA 3L82B 2IYSA 2O5VA 3WMEA 2IK8A 3THXA 3H86A 2W6JA 1XF9A 2AL7A 4RFSA 5EP1A 3CPEA 2BKUA 1IY1A 5J5CA 2Q9BA 2ODWA 4NONA 1II8B 2H92A 3CKLA 2ZJYA 4DT1A 4KSCA 1LVGA 1E2LA 2ERXA 1G19A 3DMNA 1KI4A 2I1VB 3HYRA 1Z63A 3WHKA 1ZNZA 4K8OA 3K1JA 3MWKA 4L16A 2V6IA 3A1WA 3G82C 5AUOB 1Z6YA 1P2SA 4LV6A 4M21A 4RCYA 3CF6R 1U0HC 4D25A 3W34A 4BFZA 1DEKA 3FPAA 5F9FA 4JBYA 3GLIB 3IUYA 4B2IA 2CNWD 4QNMA 3R9XA 2XITA 2XJ4A 4KSBA 1E96A 4G01B 1A2BA 3EIEA 5BXQC 2GEUA 4Q7KA 3CR8A 1RRPA 4EUNA 2HDNB 2X1VA 3EX7C 3C8UA 3SS8A 2YINC 3VR6A 3IKJA 2Q9AA 4Q1BA 4HSEA 5FFMA 5CYOA 3AKCA 4F4JA 5KHOC 4DCNA 3A58B 1E1RA 1UEJA 2I1QA 1TQDA 2ZRIA 5BYKA 1W0JA 5SZHB 3TSWA 4V0ME 3C7KA 2YWEA 3H84A 1X8KA 3BERA 1VDZA 4H9GA 4NP6A 2RH5A 3E70C 4KLNA 2P2LA 4QGAA 3CRW1 1P60A 1VG1A 1Y63A 4V02A 4PQFA 4ZI2A 1FQJA 1RRCA 4FXPA 2RGAA 4Q9JA 5KOYA 2D3WA 1E2NA 2CVFA 2ZROA 3O47A 3WNCA 3MJRA 1KIMA 3NWJA 2F3TA 3EA0A 4UXHA 3BXZA 2FWRA 4A2WA 5JLJA 1W0KD 3LBIA 1VG0B 4D4MA 2BBOA 2AWNA 2KWIA 5GJWC 2QL6A 3AGQA 2V1UA 5KU1A 2JDID 4YMUA 1S9DA 2BV3A 2OCYC 2F3RA 3IO3A 4HAUA 5L3QB 3QG1A 4XVUA 2F9LA 2ZYVX 1KJYA 1O87A 4GDFA 5FL3A 4P4SA 3K0FA 1XTJA 4JVMA 1GZSA 4Z51A 5FPSA 3DEFA 3QVVA 2QMEA 1FL9A 1N6OA 4EDHA 4TLBA 5GVSA 5KNDA 1ZUHA 1KK0A 1HT2E 2CEAA 2NIPA 2H5EA 1OFUX 1HE8B 4UNQA 2GCOA 2ONKA 2GHIA 2GVDC 3P32A 1EXMA 4JLKA 4OK3A 5DGXA 5DI3B 3ZIAD 1P73A 4KHZA 4QHSA 1KNQA 5EXPA 2JJ1A 4HLUA 3OEHA 1YR9A 1BIFA 2J0UA 4GP7A 1YU9A 3MJHA 3RRMA 3ZGXA 2DWPA 3REFA 4D2IA 3QNUA 5EUMA 1U2RA 2FGKA 4JYBA 4E5UA 3IO5A 4Z8XA 1ZRHA 3TR5A 4DLTA 1P75A 4WIAA 3VR5A 3RVBA 3DHWC 1DS6A 4KV9A 4IHQA 1KKLA 4LYFA 3PEYA 2WIBA 3AVTA 2VHQA 2JLRA 2RCNA 3GJXC 3QKSB 3HWSA 5CJPA 1IJFA 1GTVA 4US1R 2PZFA 4JZKA 1ZP6A 1CR4A 4A15A 1A82A 4B3BA 2OFXA 4RZ2A 4JT4A 1KJZA 4RD1A 4BE7B 1UBEA 5EZ5A 5G3ZA 2IUSA 4G3XA 1CF4A 3OFND 3BOSA 3QENA 4I81A 1CRPA 1OSNA 2IF0A 4DEXA 3LA6A 3AUXA 1RPZA 3WBKA 3M1IA 4LHXA 2WTUA 1MABA 2A2ZA 4BZQA 1G16A 3BE4A 1AQUA 4GMXA 5JHGB 2ZJ5A 2WWWA 3RS0A 2F1HA 4JIMA 4OHVA 3TAHA 3GLFA 4DJTA 1YZQA 5H70A 1JNYA 1SXJA 3W6OA 4BLPA 1OFIA 3VTKA 4O25A 4XWKA 2DYKA 2OESA 1V43A 2ZSAA 3LDAA 1E4VA 1XEXB 2ZRCA 4G0NA 3KB1A 3QKTA 3K09C 5B30A 2EFHB 4QHYA 3QY0A 4I99A 2FMXA 1N6HA 4BECA 2FSIA 4MYHA 1AGPA 4YQFA 5JI3E 3V9PA 1DAFA 1RW4A 4YDHB 5EE9A 3AKYA 4LC0A 4WZBE 1PV4A 3I61A 2GJAA 1COWD 4C7OA 1AKYA 2OLJA 1UBCA 3A37A 2BBSA 4U5XA 3KKQA 3GJ7A 1YQTA 4FMCF 4Q4JA 3MRSA 1R5OA 2D62A 5AJXA 2MMGA 3A4NA 3FVQA 1U0LA 2XZOA 1VIYA 2ZRJA 4HUQB 2IUUA 4EFNA 5KDDA 5TARA 2XB2A 1IXZA 3U7EB 1JR6A 3KL4A 4XVQA 1E0AA 3U4QB 1GNPA 1FUUA 3I8SA 2HT1A 1CULC 1A4RA 1KZGB 3FYHA 5LB4A 4LC1A 4EPVA 1JB1A 1G5RA 3NTUA 3WYGA 2ZEJA 1KO8A 3H1TA 3PUZA 3RS7A 3HU3A 4YXWD 3U2QA 3TSZA 1IJEA 2A7QA 2ZJ8A 5BN3A 3Q85A 3DMDA 3UG7A 3GEHA 1KKMA 3GQBA 5EUQB 2JIZA 2I3BA 2HXSA 2BM0A 3ZYCA 4HEJA 1E9DA 1ZM2A 4RY2A 5A5GA 1G3QA 4DZZA 1XPUA 1IHUA 5IK2D 3ASYA 4Q1FA 1AS2A 2GXUA 2FF7A 2OO7A 2YZ2A 3OHMA 3I3SR 4X8MA 2ZYWX 4NL4H 1E32A 3U7HB 2QTFA 4EKDA 2G6BA 2QI9C 3BFVA 1IOZA 3IPYA 1MO3A 4NMMA 2A5JA 3QF7A 1XCPA 3K0CA 4HLCA 1NKTA 1E1RD 1N3BA 1CLUA 2Q9CA 4D4KA 1W36D 4QC2A 2PCLA 4Q18A 3LWNA 1E2QA 3VNUA 3K53A 2RKOA 4DB2A 1G7RA 1TNDA 3TQFA 4A8JB 5JWOA 2JJ8A 3SN6A 3VR4A 4ESVA 1P7CA 2D4HA 1XU4A 5HCIA 2J0SA 3CPJB 4KFRA 4OBEA 3TRFA 3KB2A 1N6LA 2QENA 2WBLC 1WBDA 3IDQA 2FOLA 1QVAA 4M1SA 1R8SA 4A36A 3TW8B 1OFHA 2WJIA 5BYJA 3I62A 5HE8A 2WVJA 4RFSB 5KSZA 1HEIA 1S3SA 2PCJA 3FKQA 3GLGA 2BOVA 1SVMA 4AK9A 2ZS7A 4QM7A 4ZO4A 2ZRNA 4M4SA 4CIDA 2ZSEA 1S96A 2B8TA 4DT1B 4HDQB 1US8B 2P5TB 2X8AA 3SFZA 3KQNA 1V5WA 1D9ZA 2GZDA 2VIIA 4JVNA 4BFYA 2ZUDA 3AP1A 4BLQA 1SVOA 2QM7A 4HAZA 2NZJA 1E9SA 3AF4A 1GKYA 1GIAA 1KGDA 1UADA 4KBFA 4ZV4A 2JCSA 4FCVA 1FUKA 3BAFA 3W6NA 3IIKA 2FFHA 1FFHA 1W5TA 4UXJA 3V00A 4AIIA 2V3CC 3FDIA 4Q1EA 4AG5A 3LD9A 4WZAE 2O8EA 3OEEA 3QXSA 2WJJA 4HI0E 5FBWB 1XEWY 3MLEA 1NMYA 1T3LA 4DSTA 5K8LA 1Z0KA 5B58C 2AN9A 2ODEA 2QTHA 3BC1A 1DAIA 2G0TA 2V7QD 2B7CA 3RS3A 1Q1QA 4B47A 4DCVA 4DIEA 4FCTA 1WB9A 2H57A 1KI1A 1NF3A 2FFBA 4V0LA 4EPTA 5C46F 4HB3A 4KU4A 3UMSA 2GF0A 5FBRB 4B6FA 3U3OA 1IY0A 4LPKA 2W58A 1HQYE 2FDCA 1E3MA 4JL8A 4BUJA 3KXKA 3GEEA 2YJTD 5HKKA 3T1QA 1ZCAA 3NHBA 5CDFA 2FGJA 1U94A 1OIWA 2IT1A 2RGEA 3FMIA 1VMAA 3DOFA 1HQCA 2D7CA 5FI1B 2HF8A 3NEYA 2CXXA 4QM6A 1E6CA 1G8GA 2ZU0C 4GRAA 2L0XA 2DFTA 5FI0B 1KI7A 1KZ7B 3HPQA 4KVAA 1AN0A 3T15A 4NYJQ 1I4DD 3OAAD 2O8FA 2GA8A 1E2DA 3EPLA 2ZQ5A 1E69A 3CWQA 2REBA 1Z8FA 1D6JA 2RGNC 4I1VA 3GJ3A 5A4JA 4FIDA 5LBIA 4D4JA 4EPXA 4LBWA 4URXR 1II9A 3EPKA 3L8ZA 2WAXA 2YVUA 1I4LD 2O8BA 4V0OA 5G3YA 2XEXA 1TX4B 2GTPA 3NKVA 4LJ4A 4E22A 3VNVA 4JYCA 4CZ2A 1KO7A 4P4SB 5J47A 2C9CA 4A92A 3T5DA 4JT2A 2CL7X 4IOJA 1WMSA 4M2LA 2GCOB 1AZTA 2ZI3A 5KDOA 2XX3A 1KK1A 1Q44A 2EFCB 2IHBA 2CE7A 3HPRA 1G41A 3MWJA 1E79A 1HUQA 3QQ5A 1DOAA 1G1MA 3IPXA 1TPZA 3BRWD 4OHXA 4C4PA 1E0JA 1NNEA 2TMKA 5LDDC 1PJRA 3IIJA 1TEXA 1X86B 3FWYA 4DLXA 2ZRBA 2QBYB 3WY9A 1XD2B 4QBIA 2OFOA 4GPTA 2JIZD 4TT3D 1CJUC 2NPFA 1E2EA 2MSCB 2V6JA 4IVPA 3FB4A 2GK7A 3CRVA 2BCJQ 3CIOA 3U3KA 3AEZA 5EXXA 3LV8A 4FINA 3SFVA 3FHTA 4JVLA 3OF5A 4GOKA 2GEVA 3R7WA 3K70D 3NG1A 2G1JA 2JLYA 3GLFB 5SZKB 2ASEA 2GXQA 3GMTA 2KE5A 1XCMA 3AV0B 4BLSA 1SXJB 2QE7D 1K8RA 2IBMA 4TLCA 1FPMA 2IWRA 2IYQA 2BJVA 2SHKA 4NU0A 4Z1MD 1FTNA 1FMJA 1CBUA 3SJAA 1S1CA 3S1AA 3HU1A 4Q9KA 3LX5A 1SGWA 1EFCA 3VQTA 4FWTA 3RRZA 3HR8A 3DKPA 4IOMA 3GFTA 4EIWA 1RYHA 5TB5A 5CIWA 1W4CA 1XEWX 3EZ6A 3C5CA 1AM4D 2QM8A 1T0HB 1CU1A 1ZNWA 1ZM4A 4IXMA 2CNWA 2OT3B 4M1MA 5FPTA 5GJVC 4DDWA 3WHLA 3ZDQA 4C7OB 2R6FA 2W2VA 1QBKC 3KTAB 2RGGA 3PUYA 5C18A 4C0QC 4Q4JB 3AF3A 1LF0A 1TQ4A 5AUNB 5J4HA 4RD2A 2BDTA 5CM8B 1ZMXA 2DWQA 3ZJYA 1N6PA 1ETUA 3V4FA 4LI0A 2CHGA 3CPHA 2PJRA 2HCJB 1WRBA 1R0YA 3TBKA 5B64A 2ZM5A 4B6EA 421PA 2OE2A 2V1XA 4TQUS 4DSNA 5LD2B 5E4FA 1XEFA 4AI6A 2H16A 2JEOA 3PV0A 2A5FA 5D3MA 1S3GA 1W4AA 1DAKA 1Z0AA 2HXYA 3Q9LA 3PIRA 4KBGA 3ETLA 5E3HA 5EXTA 2NO0A 4ITRC 1ZD8A 1XP8A 2C95A 4I1UA 5CK4A 1Q1EA 1WP9A 1PUJA 2OBNA 5JRZA 4GOJA 4LV5B 4PPQA 4A8JC 3HYTA 1OYWA 4ZCLA 1L2TA 5JJLA 1MO6A 3EZ9A 3VKWA 1GFIA 4TLDA 2GNOA 3ONWA 1GRRA 1TADA 4XJXA 4BFSA 3SC3A 5JSZB 1MRSA 3D7MA 2IYVA 4TTPA 4N0EA 1AK2A 1QHYA 3GFOA 2CMKA 1Z0DA 1TQ2A 3T61A 4LX0A 1NN0A 4ACBA 4OHYA 2IXEA 2BBTA 1NVUQ 3HU2A 1KY2A 5HKKD 3NIBA 4KFTA 3QPWA 4QJ3A 1KMHA 3OIUA 3NHAA 3N5CA 5AJVB 1NVXQ 1CJMA 3MD0A 4BFVA 2GZAA 4TQ9A 1KO5A 1DARA 3LLUA 1BH2A 1XMJA 1UEIA 1N6IA 2ZJZA 4X8OA 5CB6A 3ZIAA 3ZVNA 1KOFA 4UNPA 1W47A 5E7IA 4EJSC 2ZYUX 4U7DA 4PO1A 2EWWA 1KO1A 2QGNA 3NBFA 2YV5A 4KODA 3SHWA 1GG2A 3M0EA 1Q1BA 2BBWA 3M6AA 4AYTA 3GLGB 1EFTA 2IXFA 4QBHA 3OIVA 3F3YA 3T1VA 1VYVA 4P0TA 2IYTA 3GJ4A 4G5QA 2BCGY 4MDFA 1FMLA 1P4SA 5DO9A 2GRJA 2GJ8A 3SYKA 2C96A 4HB4A 1OW3B 4LYAA 1W1WA 4CEIA 2CCKA 1G8HA 1TQ6A 3D3QA 4MRRA 1KMQA 2HUPA 3D8BA 5BN4A 1S2MA 3U3RA 4II7A 2ZU6A 3NEJA 1FX0B 3THWB 2ZJOA 2FG5A 4QJ5A 1B0UA 1ODFA 2ZRDA 4PC7A 1NVWQ 5KUTA 4LJ7A 1BMFA 3CONA 1W2HA 1XTKA 2GXAA 2RAPA 4JL5A 1RRFA 1G3MA 2UVQA 2OILA 2ECKA 2ZE6A 4QKQA 4MGKR 4B3FX 5FTMA 1UAAA 1GNRA 3LBHA 4PQYA 4RCZA 2JGNA 2VP2A 3VKHA 4CT4B 2GDJA 2IC5A 1ZAKA 3NBXX 4H1VA 4I4LA 2CBZA 4PZYA 1SVWA 2CCJA 2N1BA 2OCBA 5EP3A 2R62A 2E9SA 4DCSA 1MRNA 3EG5A 1ZM3A 1GRQA 2A5GA 4OQMA 1NN3A 4DCTA 5FTLA 1XJ0A 4Q4HA 4PPFA 2YWFA 4AY2A 1YR7A 4Z8YA 3N2IA 1YRBA 3H2YA 1U9IC 1Z83A 2XTMA 3QF4A 1K5DA 3P1JA 4OI4A 2AHOA 2ZYTX 4NTZA 3U5ZB 3GLHB 1XMSA 1COWA 2FPLA 3NC1C 4HZUB 2ZSDA 3KXIA 1ZM7A 2NG1A 2FSGA 1DAHA 2O8FB 2WKRA 1EFHA 2O8DB 4IW3B 4PZLA 4XOIA 3X1ZA 2LCFA 4QFMA 2FH5B 3CWZA 4PZZA 1Q3TA 2RHDA 2YOHA 4LBYA 1N6RA 4NCHA 3MUFA 1WXQA 4DHEA 4M1YA 4B34A 2QG6A 2ZANA 2QSZA 2WJHA 3AF0A 2GJKA 5EE1A 2NMVA 3VX4A 1MV5A 3WXMA 3CX7A 5DIFA 4YXWA 521PA 2VP6A 2CK3D 1GKIA 3EIHA 2CCGA 1NIJA 4GNKA 3SJZA 4V0MA 3MSXA 3MG9A 4ZIRA 1AQYA 1C9KA 1Z0JA 4IDPA 5JECA 5IK2A 2LWIA 2WHXA 1J90A 8OHMA 2JAQA 4G5OA 3LFUA 2AKAB 2QAGB 2BKEA 2ZSBA 4WBSA 4BZPA 1OXUA 3SU8A 3MAAC 3B5JA 1UJ2A 1OHHD 4HAVA 5HCNA 1OH5A 3NC0C 5KSPA 2C03A 3NDBB 4BZXA 2GJ9A 1X3SA 2VRWA 4OJKA 2G83A 4L5BA 5C4MA 4ZDKA 4UJ3A 1G7TA 1KDOA 4C30A 3RRNA 4TYQA 1YR6A 1TU4A 4N1AA 1XMIA 1Z2CA 1AS0A 1VTKA 3MWLA 1VCNA 2NPIA 3PCRB 1F60A 2EYQA 3RC3A 4E09A 5KO2A 3SQXA 3O8CA 1TMKA 3K0SA 3IEVA 1E9AA 4C0HA 5F98A 1GL6A 3IIMA 2PLFA 3SJBA 2J0VA 5EE0A 2IYYA 2VBCA 4V03A 2AKYA 4RD4A 2ONJA 3RRYA 3KQLA 5AUQA 1UKEA 1X8JA 2GZHA 3NH9A 3QEJA 3BB3A 1R4AA 3R7WB 2AK3A 3KJEA 5CM9C 5K8UA 5KSOA 4DC9A 2GESA 4TMWA 3FHOA 2AXNA 2GILA 1D5CA 1TEVA 4RKEA 1VHLA 5HTKA 3SYNA 2B92A 4AD8A 1LY1A 4LHZA 5DN6D 2HYIC 2OM2A 1CS4C 1TF5A 2IYWA 4HDCA 4A1FA 1XMVA 1XJQA 1XX6A 2PLRA 1G18A 3S1AB 2CL0X 4HAWA 5TV2A 4E03A 1G7SA 3CX8A 1F2TA 3KQHA 3WP1B 3WNBA 2WWIA 4PO8A 4X8LA 4XIGS 2W2XA 1RJ9A 1CEEA 3B1YA 2R44A 3SEAA 4OI2A 3BH0A 4X8HA 1R8QA 3RSLA 3PJRA 3RDPA 2R6AA 1XRJA 3LX8A 1IN8A 4UJ5A 2J46A 3ZQJA 4TMKA 5LD2C 4TYPA 1DE0A 1SKYB 2XTZA 1F3OA 3GFPA 3QXJA 4WXPA 4CEHB 4L8GA 1E2IA 4OL0A 1WE2A 3BB1A 1CTQA 3QJYA 2V7QA 4HAXA 2ZSFA 4O0MA 2XXAA 2NTYC 2OSBA 2Y8EA 1Q20A 4Q9LA 3GJ0A 4HB0A 4IOKA 1QHHA 4Q7LA 3L8YA 1KDTA 4PC6A 1X1SA 1VYUA 3BB4A 1P9RA 4MYCA 4GI7A 5CJ2A 3TW4A 5A0FA 4F92B 3I73A 2F6RA 4TL8A 1AS3A 3PVSA 4PPNA 1T8UA 3R8FA 3EPHA 3B9PA 2KBEA 1ZC4A 3BWDD 1Y3AA 5L8VA 1VYTA 1Q1ZA 5D3MB 1NG9A 2CLCX 2FV8A 4PHGA 2FN4A 1N0UA 4RSGA 4TYWA 1J2JA 3B8HA 2IYLD 1BMFD 1S0UA 5JMTA 3TGPA 4MUBA 4GSYA 4GZMA 5EE3A 3ZLJA 2OUKA 2B21A 4RD3A 3ASZA 2OCAA 3OAAA 1DO2A 2OBLA 3I5YA 5JCPA 2J87A 1P2UA 4JLMA 3IGFA 2ZITA 1NRJB 2O0KA 3QBTA 4IXNA 4YDSA 1L4YA 3UIEA 3LVRE 4ACAA 4US2R 4BFTA 2FPMA 2QROA 4QG7A 3VU9A 1E98A 1KO4A 3IBYA 1N5LA 4IFEA 4TL9A 5G53C 3B2EA 2WJVA 2QP3A 4K46A 4P33A 1Q3HA 5EP4A 4Q02A 1IXRC 4B2LA 1IONA 4L4UA 1HT1E 1XD8A 2CJWA 3JVVA 4JKIA 2IWHA 3THOA 1N6NA 2ZRMA 3B6EA 1I2MA 3OE7A 4QGHA 3TVDA 1LB1B 4EPRA 1I4TD 4C0KA 3L2OB 3QVUA 2BEJA 4S2EA 1DG1G 4QXAA 2V55B 1W44A 2VHCA 3ECCA 3F8TA 3QPVA 5FOWA 4DSOA 4LCBA 3THYA 3TSOA 2AD5A 5AUPB 3P4YA 2FE4A 4LHYA 4JLVA 2GJSA 2P3SA 3DOEA 1NY6A 1GDDA 4WW0A 5DHAA 4IVQA 3EAQA 4D0GA 3QE0A 5GADl 6Q21A 3UG6A 1EX7A 4A0RA 4PANA 1G3IA 2XNSA 2WJGA 4KFUA 3T1TA 4CEIB 3IQWA 1Z0FA 2VP4A 2F1IA 3Q5EA 4OQFA 5UKDA 4V0KA 1ESNA 1F2UB 2GBLA 3NXSA 1H8EA 5JWRA 3QXHA 3U44A 4L9SA 4Q9HA 2QP4A 5J40A 1NIPA 1Z6AA 1OIVA 4TT3A 5C4GB 4PAOA 1VCMA 1CJTC 2BC9A 2D2FA 2IHYA 2ZETA 1IN5A 4IOLA 1Z6XA 1NI3A 5C1BA 4FCWA 3SNHA 3PENA 4BRUA 2VP5A 1KK3A 3CLVA 5AJZA 2DFNA 1SHZA 5JZVA 2J41A 1WA5A 1C1YA 3X1XA 4HATA 4R2HA 4ON9A 1II0A 2B6HA 2V9PA 2XGJA 1N5JA 2RGCA 1PZNA 1SZPA 3FFAA 3RABA 2QE7A 1DAEA 2ANCA 1HURA 2ZIAA 4RKFA 5IF9A 2E1RA 2W83A 4BQSA 4MH0R 4FW9A 4U02A 2ZRAA 1D2MA 4Z1MA 1ONBA 4DBLC 4HAYA 2G1KA 3B13B 3ZZ0A 2OXCA 2JLVA 4Q4HB 4B3CA 2W00A 4P4UA 4AKIA 4RZXA 2C8VA 3FHCB 1KTVA 2KI5A 2Q21A 5FH9A 4K81B 3QF4B 2Q3FA 3CBQA 1NMXA 3JZMA 4PC1A 4TMTA 3U3JA 1E2KA 3THXB 1G6HA 4QBGB 2FEOA 3CNOA 3OIYA 3X1YA 4KVGA 1UPTA 1G291 3EASA 3HJNA 1R6BX 1D8TA 4OHWA 3FOZA 3T06B 2GXSA 3EARA 1I2DA 3IQXA 5FOXA 1DELA 3RHFA 3LRPA 1CP2A 2G9NA 3CF2A 4MYTA 4OJQA 5H1YA 1OH7A 2F43A 1VCIA 2NGRA 3KKPA 3BGWA 3SBDA 2O8CA 1J8YF 2QRZA 2H18A 2QAGC 5IHPA 621PA 3K09A 2A78A 2BM1A 2F1JA 1N2CE 1DVRA 3O8RA 3T34A 1T3SA 1F48A 3OZXA 3B1ZA 1ZNXA 2QU8A 3A1VA 3LXRA 5DLQC 5IT5A 1E9EA 1WDTA 1W48A 3SHFA 1R7RA 3W90A 3CB4A 3K0AA 2PX0A 4Q19A 4F91B 3IHWA 4AKHA 3KX2A 3D6TB 4W5JA 1NVVQ 2WZQA 2CLSA 3DDCA 1KYIA 1P2VA 2Z4RA 4WA7A 4FN5A 1ZBDA 5AK0A 4BFUA 1DG3A 3IILA 4Q1AA 3AM1A 4IDOA 3AKEA 2DFKB 4IDQA 4TTRA 4B71A 4DSUA 1W4BA 4PSVA 1NG1A 3RWOA 3W6PA 1AZSC 2ZRLA 3PUXA 1EK0A 1W36B 2O0HA 5TXGA 4URVR 1OYYA 4JLNA 2PEYA 4EQ6A 3Q7QA 3SOPA 5JCZA 3WMGA 1JR3E 4J0QA 2FU5C 4LJ8A 2ZI4A 4F7WA 1TUEA 4URUR 3CF0A 3EC2A 2ATXA 2ZRGA 1BOFA 3GD7A 4CEJA 2G77B 2KSQA 3WRYC 1VKJA 4MGIR 4LZZA 2EU8A 1ZVQA 2HEIA 2J45A 4LJ5A 2QN6A 3ZZUA 3O8BA 3W3ZB 1A7JA 2NO6A 1E2FA 4HZIA 4QGFA 4CDGA 3LO5A 3UK6A 2ZE8A 1E0SA 1KSFX 2VL7A 4C0AC 3TE6A 2WOOA 2D06A 4ARZA 1N25A 1Z08A 2Q6TA 3KFXA 4NYMR 4B48A 3U60B 2Z43A 3FKSA 1W5SA 4B3DA 2QPTA 1H8HA 4W7SA 4XTRA 2EFGA 3DO6A 1CR1A 1TTTA 2YWGA 4JJKA 1FTSA 3J81k 3K0FB 4F4IA 1R5NA 2QP9X 1IY2A 2VSFA 3TNFA 2IYZA 1F2TB 4DUGD 2W0MA 4P31A 4PO9A 2XSZD 1QVRA 2QT0A 4BASA 1U98A 5EXSA 1OJLA 3OE7D 1XDBA 4I1SA 2G0NA 3N70A 4JMPA 4NH0A 4R9UC 5B57C 4FMDB 2YNMA 1FNNA 2J0UB 1XXHE 4GT1A 5F2EA 2Z5FA 4B75A 2WAYA 1E94E 1G17A 1W2GA 2EQBA 3AVPA 4B73A 1E2HA 5HZKA 3SI7A 2NZ8A 3B60A 3GLHE 4IEIA 4NPHA 2WPDD 1XZPA 2CL6X 2P6UA 2ZTSA 5DI9A 2XXAB 2DHRA 3AVVA 2PMKA 1DBSA 1AIPA 1QHHB 4MUAA 5JHHB 4FMBB 2WSSA 3U3MA 2F55A 3W3AA 1NBME 2V54A 3VHLB 1T0JB 4NHOA 1IAQA 2GCNA 3ICEA 1H8ED 5FTJA 4C3ZA 3M4YA 1ZCBA 1KJWA 1KI3A 4PHHA 3A1SA 5FPHA 2IS2A 2NOAA 3KKOA 4OI0A 3I92A 3EC1A 3JVUA 1K6MA 4D4LA 1A5TA 1OPXA 2BMJA 5DNYB 3E2IA 1LF5A 3UMFA 1W7AA 4OYHA 2JLSA 4NKRA 1MABB 1YR8A 4Q1DA 1N5KA 3GLIE 3WNDA 4F38A 1J99A 3BH7A 1Z0IA 1XB2A 1G5PA 4G5RA 2C04A 2CLDX 4DDTA 2JLZA 1AGRA 2KB0A 2DPXA 3UWKA 1TU3A 1UBGA 3PQCA 3GP8A 1EESA 2G88A 3VU9B 4JLDA 1E2PA 4LHWA 4Z54A 2WKPA 1DAMA 4Q4LA 2X19A 4LDJA 2AXPA 3NVAA 4JKYA 1J70A 1N5IA 2J1LA 5FBLB 5FOVA 2CK3A 3PEUA 2ZXUA 4PHTA 2OG2A 1A2KC 5DHFA 2H8KA 1M7HA 2XOKA 3CNNA 1RIFA 4MKGA 4EPYA 3I5XA 1ZC3A 3P4XA 4ESHA 3DZDA 2MSEB 3FMFA 1P2TA 1E2GA 1DAGA 1XTQA 1E9CA 4PC2A 2HLDD 5FR2A 1TF2A 3EIQA 4LJYA 2ODBA 1KI8A 1ZM9A 4C0BA 2BVNA 5P21A 2RGBA 1T5IA 2GWHA 3QUSA 4P4TA 2G3YA 2RGNA 4PQRA 2QMOA 1OHHA 4G1UC 1L8QA 2HJGA 3DVLA 121PA 4UNNA 3ZS9A 3Q7PA 5DI3A 5DYIA 3AVUA 2AK2A 1G5TA 1M2OB 5G40A 4M1OA 1ANKA 2ZJBA 4LPSA 1F6BA 3RAPR 1MR3F 4M9SA 4A0GA 4IRUB 1NSFA 1KNXA 1ELOA 3CRRA 3WRXC 1EFRA 2D74A 5CLLA 2ORIA 3EZ7A 3CRQA 4ZCMA 2ZVQX 4YMWA 1KHTA 1Q22A 2P0EA 4TN1A 5FOTA 4PC3A 4DLYA 1N0VC 2E87A 1NJFA 2YOFA 4AYXA 1RFLA 2GEDA 2FNAA 2FFQA 2ZAOA 2B8WA 4TTQA 2QY9A 4GBMA 4BLOA 4BFWA 3SR0A 3FMOB 5E7MA 3K70B 4D0NA 2BEKA 3H4MA 4JSTA 3GJ5A 5TDHA 5F3WB 4AWXA 4O2RA 3O8DA 3TJZA 3QKRA 1ESMA 5DN6A 5G41A 1BKDR 1G7CA 3CZPA 4RVCA 3ZD6A 1R0ZA 1Z06A 4A9AA 4WZ6A 2IW3A 1GITA 2H7VA 4URWR 1G4AE 2J7KA 1SKQA 2C78A 1JJVA 3K9GA 1KI6A 4QOSA 4WOPA 2YWHA 5EZ6B 1IXSB 2ZE7A 1WF3A 3AP3A 3ADDA 3NBYC 3DM9B 5JS7A 2MSDB 5DH9A 1NLFA 3ZVMA 4HDOB 1XEXA 4DCUA 3B1WA 4MA4A 2CHQA 4DLUA 4W5HA 2QNRA 4C2TA 1KK2A 3RS4A 1OLOA 3I72A 2EFEB 2GKSA 2WWFA 4PAQA 2XB4A 2Z83A 3FKSD 4GMDA 4DLWA 1G8YA 4KO8A 1H8HD 2VHTA 5CLQA 4LRWA 2LKCA 2OZEA 3I32A 5JRJA 2BJWA 5HR5A 2F43B 2FSFA 3L43A 3UXMA 2WWXA 2XNDD 1T9HA 2EFDB 1XNJA 1R0WA 4PFSA 2O8CB 1HE1C 3AKDA 4TSFA 2D2EA 3KKNA 1M7GA 1T4GA 2RMKA 1M74A 1OFTA 3WYAA 2A9KA 1DADA 1P9WA 1E1QA 4JLPA 1ZU4A 1YZTA 1HH4A 1KAGA 1OXSC 4D82A 3BH6A 3L0IB 2ZRHA 2C2HA 4PTLA 4QGGA 2OFWA 5FUXA 2OEPA 4KCGA 4ASUD 2O8EB 5TMPA 1RYFA 5CYPA 5J4YA 4B76A 4P3YA 3ZVRA 1SULA 2BHRA 3KQKA 2ZE5A 4UQOA 4CGZA 2J9RA 4PR0A 2IUTA 1AKEA 3P26A 4GFDA 5K8TA 5AJWA 3OIWA 3UANA 4Q9IA 4A0FA 4BEBA 3T5GA 1MKYA 2WSSD 1JPNA 4JLJA 3DZ8A 1Z28A 3RC8A 2JJ2A 1XWIA 2Q3MA 3FMPB 1PLKA 2J0QA 1AJEA 2FZLA 2PT5A 3TUZC 2ODNA 1OIXA 2FZ4A 2VH5R 2ZR0A 4LBZA 5IDVA 1VCOA 2JLQA 1PVOA 1LNZA 4M1WA 1M1YE 3MGCA 1IN4A 2ERYA 3ZVLA 4CEJB 4WVFA 3F5FA 3KJGA 3OESA 2F1RA 4JVSB 4ZKEA 2ANBA 1RVDA 3QXXA 1NP6A 3C41J 4TYNA 4D81A 4LJAA 2PEZA 2VYFA 5KDLA 3RYTC 5L3SA 2QQEA 4A0HA 2MMCA 1E9RA 2DCUA
chains in the Genus database with same CATH superfamily
1ZL0A 2CMFA 2R8ZA 4Y18A 2O8BB 3ONDA 5KX5B 4EK9A 1D7AA 3ANNA 1CUJA 3E3NA 4DY6A 1PFYA 3FF1A 3TW8A 4FYMA 1ADYA 3OC6A 1ISJA 1K8YB 1FRFS 5G1OA 3A9VA 1KF0A 1DKPA 3D2BA 1W5AA 2VFAA 3QWFA 4NE2A 4AJJA 2VPYA 1NSTA 4RTPA 1N0WA 4ETWA 1LQUA 4IIXA 5JWHA 5ADVA 1CRWG 4H15A 4HRVA 4UTRA 2JLUA 1JEYB 1PJCA 4MINA 2CDBA 3CG4A 5L95A 5LQNA 1B6GA 3GNLA 4FCCA 3N0TA 4C0LA 2I3ZA 3T3DA 3PGLA 2JCBA 3I1FA 5CXXA 2M1ZA 3FPEA 5EWLA 2J6HA 1KORA 1PN3A 1X9IA 3TFQA 2ZYHA 3SLGA 3UMRA 4B2YA 1Z2NX 1PR4A 3H42B 4WNAA 2JIPA 3ICOA 5IBPA 1FRQA 4IV0A 4BFXA 3JD4A 2EOAA 2PJZA 3P8ZA 4ILEA 4U6SA 5U4XA 2WWGA 1RYMA 2ZREA 4RNDB 4DSAA 4LRUA 3LBNA 2UZ3A 5EHZA 1QB7A 3KOWA 4G2NA 1GARA 4CLXA 2BZGA 4HDSA 1PL0A 1RXYA 5TT1A 2C82A 1WUIS 4TTAA 1KMMA 1DI0A 3N07A 3RC1A 3F3SA 1KR5A 2NLOA 5JD3A 2EV9A 4F71A 1TW3A 1TJYA 1ODSA 4PICA 4ZAGA 2C2YA 3GFSA 5IT4A 2V7BA 2OBBA 4RD0A 2F8MA 3LGSA 3I01A 4BCDA 1KJNA 1U2SA 4AJ1A 1XK6A 2FPKA 2RI1A 3JZIA 4P08A 5BV7A 3T8YA 2GPSA 5C7IO 2IZ5A 2JAUA 3GCGA 4MUIA 4QDKA 2OCKA 3HBJA 2A7XA 5FULA 2ZI7A 3HFJA 4GQBA 3WGVA 5JCOA 1XTRA 1O03A 1RHMA 2CLLB 2L82A 3UOGA 3SIWA 2XJ9A 3V46A 2JLWA 4KI0A 4BBAA 3Q12A 4PWZA 1EA7A 1IBCA 1Z3IX 5CBPB 2P9YA 4D0RA 4JP8A 3AEKA 1R27A 5KBYA 2FETA 4GXQA 4DSZA 3K2BA 1GT6A 4DMGA 2B69A 2RGXA 3C7CB 5AH0A 2PKWA 4D1YA 3K0EA 4QGBA 1BE0A 4YRFA 1XWWA 3BCHA 5KS2A 3L4SO 4WN3A 1XD9A 3L06A 1Z8HA 4V0NA 3L77A 2H85A 1TZJA 2SKCA 5FF9A 1YDGA 2IRWA 2OV3A 2JAXA 3WB2A 3VC1A 3OE4A 2N46A 2QW0X 3UPUA 1U9IA 2DKOA 3ZEIA 5B2FA 4EARA 5I7AA 4D9EA 3FGOA 4K9OA 2UKDA 1PFKA 3H2JA 2ODPA 1XMOB 5KC8A 3OETA 3N58A 4FDUA 5C5DA 1TM1E 3GLFE 3GRCA 3O6VA 1SA0A 3SQOA 1Y9DA 2EIXA 1VJDA 5BW6B 4OXXA 1XTVA 5DYGA 1D4AA 3T0IA 3FH0A 1SPBS 1Z5ZA 2QN7A 4M88A 3U0BA 4FYHA 2JI7A 4WXYB 3JQAB 1JTVA 4DDVA 4F3KA 2BGLA 1PZGA 3K70C 1U0TA 3GRVA 4HL6A 2HK6A 2CE2X 4RIHA 5TIIA 2EAUA 4Z3DA 3GOQA 5K0FA 3A6PC 4CUJA 1E1QD 1E4YA 4U2GA 1UK7A 4B43A 2Q6OA 2VHJA 3L6UA 4OHCA 3KBBA 1XJCA 1LBHA 1OF1A 2EBUA 4TM7A 4C1NA 1F5NA 1NVVR 3MPUA 3LECA 4FDTA 4RJ2A 5FXMA 1PF7E 4KN8A 5H8WA 2YY5A 3HB1A 5I9LA 4UQPA 5INTA 3SBEA 4TZ6A 2R00C 3HCDA 4H6WA 2WICA 1F4PA 3TRHA 5DHQA 4DA0A 2JA1A 4PIVA 4GZLA 1EWTA 1FP7A 5IKEA 4JJFA 5AKJA 3WK6A 1XQXA 3SLRA 2W4IA 2JFXA 2P2DA 4S12A 1X9HA 1GEEA 3IT2A 5CXSA 3HP1A 3NHWA 2Q8QA 3BEOA 5HOQA 4DV3B 3ONVA 4ER7A 4B3GA 3I1IA 3PHHA 1BQ4A 5H68A 4EFDA 4DF3A 2R1TB 1J9ZA 3O91A 1PNRA 2YIDA 1RSZA 5ALOA 4UVEA 4D44A 3LCMA 4CWAA 1G3RA 3PDUA 4DZTA 4DUGA 5BY2A 4KNVA 3T1HB 1SKMA 5K0JA 3LDHA 3INTA 1E64A 4FFNA 2VA9A 5E95A 5HJ7A 4MB6A 1KI6B 4FK8A 1XA0A 3WR5A 1KVTA 5BNTA 2PGAA 3C3YA 3DBHB 3BAZA 3HVJA 1GPDG 4PSCA 3OZFA 4PRKA 1SUCA 2D59A 2DWOA 2NP6A 3AF1A 1I10A 3HCCA 1MC4A 2OHOA 3GFRA 3KQPA 3E4CA 3EZFA 3F7MA 4G0YA 4IJKA 4ZKDA 1N2BA 4KLZA 2I6SA 1H5NA 4J75A 4YYEA 4ER3A 1PNQA 2IODA 2I1LA 2FPGB 3M6IA 2FAXA 1GP2A 2YYSA 2WPDA 2XWQA 2DPGA 3BMXA 4OCZA 3E2PA 4TMZA 5DEOA 4UNRA 3DFIA 3HC7A 4M9QA 5FPQA 3HKBB 1M73E 1VE6A 1U2DA 3F5QA 4ME6A 3Q9NA 5I7HA 5JJ5A 3ZCQA 4HH3C 1MFPA 2CXTA 3HJUA 4CLOA 2C5LA 4DQ0A 1KAQA 4PX9A 2X7JA 5CHEA 5B1IA 2WJAA 4CYMA 1P6QA 4FFBB 4MA0A 1L5KA 1KRWA 1G55A 5EFOA 3Q6MA 3H04A 3T9AA 3PPYA 2IS1A 1OKKD 1ORTA 1M8PA 5EG5A 3SQWA 4N8SA 1MO4A 1KQPA 1U8YA 2J08A 1PS9A 2Q0XA 2V03A 3CFYA 3EXAA 4FGLA 4NBLA 1SC4A 5TY0A 3VHRA 2IEZA 3VMFA 721PA 1AA6A 3T7TA 2J6IA 2IS6A 2NSHA 1YKSA 4J03A 4F9EA 1XDUA 3IP1A 3X3HA 4P86A 1TT5B 2QAJA 1EFVA 3RYCA 4JB0A 3RTCA 1IBRA 1X80A 4ZO6A 1A69A 1P4JA 1QKIA 2AC2A 3BWXA 4WDRA 2PUFA 2CEKA 4QNRA 1JHOA 1SC9A 5AFSA 3DT6A 3ZD9A 4MARA 3RD5A 1E2JA 1YS4A 1I3KA 2BJHA 2W4MA 4YLEA 3ORQA 2A1TS 1GSIA 5NLLA 4YO7A 1SXHA 3I4LA 3U0VA 4YAIA 4XX0A 1FMTA 4Y9SA 2G82A 1E1MA 4PU0A 4JGIA 4OHRA 1SB8A 1EHIA 2C5FA 4C9BA 2O7RA 2QLJA 1VRWA 5IAAA 2VF5X 5J2UB 1LLDA 4YJGB 1M8FA 4DA9A 4LGVA 5HEKA 3I76A 5FADA 3UJAA 1B74A 3B12A 2H08A 4FI3C 4PF1A 1IQPA 4DR5B 4PYQA 5JU6A 3NWPA 4B4OA 4IV5A 1XN1A 4B7AA 5F3DA 2XUDA 4J4BA 1QHXA 3RRBA 4EJMA 4LFAB 5EHXA 1GLGA 4ETMA 3EQ6A 1FLDA 5FA5A 1GLNA 3PC3A 4MRNA 3ZUPA 1FLVA 4TMXA 4KPGA 1H6BA 2GSWA 1W0JD 5ERXA 4D3ZA 1E1YA 5J3JA 1C0PA 4IWXA 1OWOA 4ODIA 3G5UA 5BSTA 1DL5A 1OUMA 3BKXA 1HDOA 3AVYA 4XLZA 1XYVA 1N6KA 2P2GA 2O8NA 1CQJA 2Z3VA 5JJIA 1RWPA 1BXRA 4OK5A 3AI1A 4UQLA 4M9ZA 2FQ1A 4XCXA 4LMPA 2NTEA 1IB0A 1JIKA 3N3AC 2R65A 1HDGO 1JKIA 1PGJA 1GGMA 3N7TA 4Y2XA 1Z4KA 4J0GA 3UQZA 3RAEC 5DXJA 1JE1A 4OFZA 2CLFB 4UCXA 1R2QA 2KBFA 1FRVA 5DRTA 1Y8ZA 2VAWA 1PQPA 3BWYA 1SBYA 5BT9A 1I24A 2G08A 4MWTA 4OI1A 1HNWB 3ZE1B 3NHFA 3IEUA 1Q0TA 3LM8A 4FFVA 4ISBA 1PJ8A 1OLUA 4ND2A 3RIEA 4B3SB 2X8LA 1NL3A 2PL3A 4ZTUB 1UBFA 2CZCA 4Q82A 3WZLA 3JQ9C 1P62B 2V59A 4I55B 3U61B 4PLFA 2C7VA 4ZIRB 4YAGA 3CYFA 3TLGA 2QQ0A 3O9ZA 1X8LA 4P2BA 4EYEA 1ZLXA 5KNBA 2VSXA 4F93B 1MGOA 2QSYA 1KJJA 3S40A 4RA6A 2YC4C 3AEXA 4DJJA 2NQ8A 3RTGA 1P9NA 1QDUA 5EIFA 4NZYA 3VYUB 3WAKA 1RMTA 1YE5A 1N5MA 1CP3A 4IKOA 5E4TA 1QIEA 3BFJA 3HN2A 1F14A 2EFYA 2N47A 3W4KA 4WXEA 4ZVSA 1XA3A 1UDWA 4KIWA 3ADBA 5MN4A 1B23P 3V8MA 2OAP1 2J0EA 3ESQA 2MINA 1NTRA 1OU0A 4MX8A 3TIFA 3UC5A 5IJWA 4C0JA 1ZGZA 3QKIA 1E7YA 1NVBA 2F7SA 2DHCA 4LAFA 4EGFA 3CO5A 3KUKA 4UHCA 3TLJA 4XCQA 1RKBA 1QU3A 3DL0A 3EXG1 1LQTA 1XNGA 2Q4DA 4NU5A 3W8RA 5CB8A 4K03A 1PJLA 1W25A 1FFYA 1JJFA 1ULAA 7ABPA 1M6VB 2W6IA 3KALA 1XAIA 3QLUA 1VL0A 1A9RA 2CBGA 2BAGA 2FTKE 3LQQA 3ZH2A 2NSJA 2PSFA 3VBCA 3UFXA 3E5HA 2QT1A 2DPYA 5HZHA 3AP2A 3G9XA 3X1DA 4D98A 3VPAA 4CL0A 1XRLA 4Y2HA 4DCCA 3UTDA 2XF8A 4KJZA 4JAVC 5C1IA 2NU6B 4YFYA 5L3RA 4MW5A 3T3GA 3G0IA 1P7YA 3LJKA 1SCBA 1FQKA 1MJ5A 5KQPA 1JFTA 3U1BA 1XKLA 1PFUA 2XNDA 3GLHA 1XMQB 2JD2A 1H4QA 2QNBA 2EW2A 2OORA 2P5YA 4Q16A 1WW8A 1DO8A 3IUSA 5A62A 1PT6A 1C4XA 1W49A 4DIFA 5DSZA 5FORA 2DR2A 3EZXA 1YS7A 3LPMA 2O8DA 2ACKA 3TTTA 1CY8A 1QH8A 5ITWA 1PVVA 2ZS8A 5KTOA 1T6NA 1YZLA 2FX3A 3X2EA 4X3CA 3RC2A 1JXQA 1V1MA 1II8A 2NV2B 3IEPA 2OYCA 4YMTA 3J7TA 4W99A 3GLTA 1VE1A 1X1RA 1IRXA 3MILA 2O0LA 2OBMA 3IKTA 1M6WA 2D1TA 2J7PA 3BL6A 2V8OA 3E4DA 4ZP1A 4BTLA 1WABA 3N6RA 4TOIA 3OY2A 4N03A 5K45A 1U0GA 4YROA 5B55A 3LFTA 1WOMA 2H54A 3JYOA 5EVJA 3PVZA 4N0DA 2GDZA 4LE1A 4DBLE 3SE7A 3TXAA 4Q48A 3PGJA 1M6NA 1G8SA 1RQPA 3OQPA 3D7LA 5FB3A 4L4YA 4A4DA 2LXNA 2OGZA 4XJSA 3EIOA 4EFMA 3HM9A 2EBFX 1DJPA 3D3NA 4FIZA 2NO7A 1KZYC 4MQ6A 2OZKA 3W5CA 1D2RA 1YE8A 2VR1A 3TKYA 4QELA 4M0MA 4C07A 2FPWA 2PFGA 3R5SA 5G0VA 5ER9A 1IHPA 4CLHA 1GGHA 2DQZA 1Y6ZA 1H9AA 3ORSA 4CM4B 4UBJA 4AVYA 1X1AA 3MK31 4E13A 1Q7RA 2YYYA 4N5LA 3R0JA 4B44A 1V2HE 3HKCA 2I6UA 3BZWA 5FPPA 2H1LA 3O1LA 3PQ4A 2UUPA 4EJ6A 3FOBA 3GDOA 4LC9A 2GR9A 3KC2A 5LYYA 1WMAA 2P2CA 4J76A 1Y5RA 5T3UA 4L9RA 1GAWA 3KUCA 3KQOA 4YAOA 3CUVA 4ZYZA 1WXIA 1RE0A 2A5YB 2PXHA 3FDXA 4Q9DA 1QHSA 4U39A 1ZHHA 4UEJA 4Q3BA 5KQRA 2FK7A 4RMHA 2Q3LA 2QUJA 3MS2A 4DIDA 3QFSA 1P2FA 3TPCA 1QX4A 1SCDA 2BUAA 1LS6A 3K5WA 4NS4A 1OX6A 3KCQA 1Y0BA 1C8VB 2W6OA 3B3AA 4MI9A 4URZR 3H75A 4ZYYA 5JY6A 3VOTA 3O8QA 2VQEB 1LVHA 4R16A 5E2IA 4UPEA 5J4KA 4FI3F 1YHZA 3B3QA 4DRZA 2BI7A 1FMFA 3HLKA 5JNUA 4LHEA 2XTAA 5ES3A 8MHTA 5CA0B 3PR3A 4AJEA 5DWDA 1UOEA 3K8OE 1FFDA 4TLAA 3RFXA 4WOJA 3TEFA 1YJAA 3UJBA 4BQQA 5CCBA 1B3BA 4U1RA 5CU7A 1RBZA 3L0SA 1OAOA 1ZXXA 1LSSA 3ZPXA 4HNAB 2GZ2A 4ZCSA 3BXEA 2AD1A 2H1RA 1X38A 4UM5A 1Q7BA 4DRXB 2I1WA 3EDQA 2JFPA 1SPXA 2PPVA 3VR2D 2P6NA 1CXZA 4JMLA 5T8KC 3JATB 5BWOA 4G0UA 4PSAA 4WK4B 4YS6A 3WYFA 2P77A 5KTTA 2AQKA 1YBFA 3DC7A 1JHUA 3B9QA 4YJ3B 2QMYA 5CITA 4HFJA 1LD3A 4YWJA 1G59A 2OHIA 4DLVA 3PXGA 2GPYA 4WKOA 3U44B 4CEHA 4DNOA 4TLEA 3E7DA 1GQOA 1W87A 2A30A 3HWRA 4IFBA 4Y1FA 1R10A 2ZRPA 4LXYA 4MEBA 1SXGA 4CDMA 1D0VA 3MWYW 4ZMRA 4NWIA 1V6SA 3LW8A 4U0KA 2OGWA 2VWGA 1J0CA 4M1TA 2P75A 3BBPA 3DP9A 4RE6A 5BQXA 4K1LA 3K9NA 3V4SA 4MV4A 2I66A 2O0MA 4MIEA 3QXCA 4GGPA 3ELUA 3O03A 4P7BA 1UXIA 1V35A 1DQRA 1GPMA 2AMLA 2F1KA 1AXGA 2EZ4A 1GZ3A 4FEGA 4JBLA 2GVZC 3SY8A 3UK2A 1GKUB 4RABA 3LPDA 1O94A 1I5EA 1XZGA 2QYHA 5A6SB 4O1HA 3B2NA 1P7VA 2CZQA 2X6RA 5TF4A 2XMRA 4JI4B 1H4TA 2DFLA 2CVOA 1ZW1A 1YI0A 1BD4A 1E8MA 1QG4A 3LKBA 1TO2E 1EDDA 2WTEA 1Y42X 3KZVA 5AM4A 4BKRA 4E08A 3OTGA 2XMBA 2F9MA 3DKVA 1JDPA 4RTQA 2AMYA 1X8XA 1V6CA 4MVJA 1I51A 2I87A 1G6OA 1X14A 3NTXA 4QJBA 3F0TA 3FJYA 2GAJA 4FR2A 1UMCB 3ADKA 4BN4A 2I4RA 1OV4A 2VTDA 4FE4A 4FD3A 2CUTA 2D7JA 2IEGA 5EMKA 2P1RA 5FJIA 4LZPA 4K9RA 5FBVB 1MC8A 1LS1A 1Y8CA 1UBRS 2JDIA 2YXBA 5IASA 3CF4G 4G84A 2Y99A 4P0PB 1H05A 1P18A 3J7AC 3VAAA 5JEEA 4BOYA 2GQ0A 2PUGA 4HFRA 1BMDA 2GPWA 2UUOA 3OPYA 5JZSA 2DTDA 1YZUA 2IUEA 4FGSA 4U7WA 2OYRA 3TLAA 3UB3A 2JATA 1KH2A 4P1ZA 2WABA 1H2YA 4L9WA 4YLGA 4PTZA 3KXLA 3ZE8A 4EX6A 1H6DA 2E1PA 3QBVA 4ZCPA 3UAZA 3KZNA 4TQGA 4ZI7F 3RVNA 3CNHA 4JASB 2H07A 2PZAA 4AKTA 4LYJA 1UJBA 1HTWA 5BMVA 2BY4A 4C22A 4FSHA 3B7GA 2EWVA 3QX8A 3WMRA 4AUNA 3H5VA 3D3WB 1PLLA 3PSAA 4OUDB 4X00A 1NBMD 4F3NA 2F4NA 4OHZA 1D2EA 3NTVA 4MYUA 1CEXA 1FBNA 2IOQA 2VLBA 2VPXA 3P20A 2YVKA 5CM2Z 3UAGA 2R2GA 4BP3A 2H1WA 1Y48E 1MAAA 3A36A 4MWGA 1KDRA 1NXWA 4ZO7A 4NX2A 1H9BA 3HR4A 4DLZA 2W2KB 3FPSA 4F6CA 3MGKA 4TWZA 5EJAA 3TMAA 2BE9A 4URYR 4OATA 5KWVA 1EX6A 2P7HA 3BJIC 2Q5EA 4PRZA 3WRWA 1RCTE 3IVRA 5IC6A 1RKXA 1GUYA 2BGTA 3AF2A 3LG2A 4I4TB 1QRAA 5FBKA 2GI4A 5FOSA 4D6PA 5HIMA 2H7XA 1C4OA 2EGUA 2ZBFA 1XTZA 4N39A 3TNDA 3TOZA 3ZDEA 4RDXA 1SMKA 3ROZA 3SJUA 2UUAB 1TVCA 1VQ1A 2GZ3A 4EYKA 3ZWPA 1DCTA 1IQ0A 5CPBA 4KFCA 2QORA 3H3JA 4ZEXA 3DPSA 4G0OA 4OQNA 2C84A 1ZVJA 4A6PA 1QYRA 1E6EA 1IMOA 2XY4A 2HCBA 2ORVA 1HO3A 4QTTB 5EUBA 3TUIC 4ZCQA 4XTCS 4EY6A 2BGRA 5DASA 3IT1A 3Q3JB 4GYKA 4MJ3A 1RTTA 2R86A 3TLKA 1E79D 4JI2B 3DPIA 3GVPA 2BR4A 4AU1A 3EG9B 1ZOOA 1U0NA 4QHTA 3WRXA 4CMAA 2JVJA 2G1PA 3PC8A 1XFAA 5I9MA 2PZEA 3D8SA 3GZJA 3OX1A 4ND8A 9MHTA 1NBEA 3WA6A 2PUHA 3DR3A 5D5HA 2ISQA 4O5AA 4AC9A 3HZHA 1Q74A 4Q03A 4QQNA 5IXYA 2PKQO 4MVCA 4PSKA 3KQUA 4BTEA 4RD6A 5M7EA 2OO3A 4ZALA 4DB4A 2BSXA 3JWHA 4LOJA 3TRJA 4CUZA 1HA3A 2JFOA 4JS0A 4OREX 2QY6A 2CHFA 3V8VA 2AFIA 4G36A 2P30A 2Y4NA 3AF5A 1P6UA 4G89A 2VZLA 3O95A 2IZOA 1ISSA 3H9BA 3LHKA 4C6TA 3KUXA 2CVZA 2V5UA 3NCHA 5TNXA 4JXZA 4GEGA 2IK8A 3THXA 5EYPA 2JKZA 3D8NA 1GADO 4KRYA 1XF9A 3WGZA 1FFBA 4XYLA 1FYWA 4TV9B 1Q0RA 3GF4A 3N0RA 4M7WA 4PYNA 4TWAA 5FWAA 1W8IA 4HEA1 3ZLVA 1EWYA 1WO8A 2ZJ1A 5J5CA 4KVZA 1MA3A 4QUKA 4RQTA 4ZO8A 5LBUA 1K6IA 1CERA 1E7SA 4GR4A 1GAEO 6LDHA 2FMFA 4LJKA 1QP7A 4DC0A 1X0XA 3DMNA 4GI5A 1VMKA 1CUDA 2I1VB 4DIMA 1E2BA 1U7WA 3HYRA 1L5QA 1ZNZA 4K8OA 4D02A 1NM5A 2Z2JA 5K3FA 1SXIA 2V6IA 3KP1A 4ZT5A 5GM1A 3FYUC 4EHFA 1P2SA 2H0QA 1UM9B 2AG5A 3ICPA 2AE1A 1U0HC 3CF6R 4LV6A 4U9IS 3W34A 2JK1A 1ZOPA 5F9FA 3EFOB 4JBYA 3GLIB 3IUYA 4RPHA 3AEUA 4GE3A 2IZ7A 5CHYA 4TTJA 1WY7A 4KSBA 3C6KA 5JNTA 2Z2XA 2WD9A 1CUHA 4GO1A 3W78A 4BYMA 1JSCA 1QRUA 2X1VA 5HK8A 3SXJA 3LX4A 3PNBA 3SS8A 4N7JA 2WVAA 1MJGA 4YCAA 1TVEA 3G2LA 4OHPA 3SIRA 3JAMA 2RI0A 3PKIA 3IKJA 1WD7A 4B8WA 1IG3A 4DUZB 3MCWA 4D4IA 3ZI7A 3KOOA 5H4GA 5EKXA 1XZIA 2R48A 4K28A 3IP6A 5CYOA 2IBTA 3JQBC 1JLLB 2H1CA 4FC7A 3S5JA 5BYKA 3GG2A 2WIDA 4UBIA 4ARVA 2O14A 3TSWA 3WFZA 1N9ZA 4O2BB 4BN0A 2YWEA 1UPFA 2NVUB 3BERA 4O3FA 2HMTA 1Z36A 3AFHA 2XH8A 1UUFA 3OF2A 2A0XA 4DBVO 4KWIA 1BS2A 2C07A 2C8JA 4C4YA 4J3NA 4PQFA 1RRCA 3UCXA 3R3WA 4BJ5A 3JD0A 4DCOA 5KOYA 1LDNA 3GA5A 3K2IA 1I4WA 2B35A 2CVFA 2X1LA 3GLUA 3K8QA 3GFGA 3GL9A 3S0JA 3T5CA 3WNCA 1KIMA 3FNBA 1LK7A 3D59A 2C0QA 4UU0A 3BXZA 1FTQA 5F1PA 3ROGA 3JQQA 5JLJA 2AEFA 1XPJA 1W0KD 1N8NA 2WF6A 3A04A 1QGED 2AWNA 4EFNA 3LZDA 2QL6A 3EVFA 3D5EA 4BNFA 5JS1A 1V4BA 3ESZA 4Q9NA 5L3QB 1MZPA 2YUTA 2EZ8A 2ZYVX 1DDOA 3UM9A 4CLDA 2XCQA 4ZMSA 2P4QA 1AKNA 4GDFA 4WBNB 2OAGA 1D1SA 4FOSA 5F7ZA 1NBIA 2H2IA 4Z9XA 4JVMA 1GZSA 2YVAA 4E2ZA 4XAQA 1VLLA 3ZBPA 4EDHA 3BMNA 5GVSA 1TDJA 1ZUHA 4ND7A 1EQUA 2F59A 3DMPA 1E8DA 1H2AS 2EQAA 2QRHA 1E77A 3EXHC 3D8RA 1OFUX 1VFNA 2UV8A 3FLEA 2I2CA 1XVAA 1S5PA 2GCOA 2I0FA 2ONKA 2Z5VA 2GVDC 4OK3A 5DGXA 3TN7A 3T3HA 1P73A 5J59A 1KNQA 4FGKA 3I9NA 1CIJA 1YR9A 4YJKA 3ZGXA 1A72A 3MJHA 3W5DA 3QM1A 5D7BA 2DWPA 3IAM6 3REFA 2GCGA 1IZ9A 5EUMA 4H0FA 4D2IA 2FGKA 3T3MB 4CMIB 3FVVA 1EUDB 2IBSA 4Z8XA 3JWPA 3RG2A 4DLTA 2D4AA 5CFZA 2GBFA 4ZCRA 3FRHA 1BRMA 3DD5A 4BB0A 4S05A 1KS2A 2QTZA 3GBPA 3DHWC 1KFCB 5BURA 3DNPA 4GIBA 4FHDA 4GYWA 3VYSB 1O95A 3PEYA 1F8FA 1MD9A 1MAWA 4HX2A 2WIBA 3EC7A 3RS8A 3DS8A 4TXHA 4C4ZA 2VHQA 2JLRA 3AVTA 1C5KA 2E48A 5CJPA 1IJFA 5LYJB 1QMGA 2VTVA 3VVMA 3DVQX 3ZGLA 1A82A 4GVXA 4HX9A 4RZ2A 4BB6A 1D04A 2WILA 4MUFA 4BE7B 1UBEA 5J5AA 4EYSA 4MTLA 2A0YA 3OFND 5L4LA 1CRPA 4Z4HA 2OL4A 2NZUG 4A10A 4DEXA 3LA6A 3WBKA 1NUHA 3M1IA 3HHPA 3OA0A 1GYQA 2NNWB 4FPXA 1F2DA 2A2ZA 3BE4A 3G0BA 2FEWB 1I30A 2CMHA 3NVMB 2WWWA 3RS0A 2F1HA 3TAHA 4CM7A 1TJNA 4DLNA 5H70A 4NXMB 3UENA 4MYRA 1FFCA 4RJKA 4K6GA 1AHPA 3QWHA 1EUCB 3W6OA 1IBLB 1G20A 1IU9A 1OFIA 2JFZA 1JA1A 4K9PA 2J9FA 3VTKA 2B83A 3P2JA 4O25A 3QVGB 4P58A 4TRMA 2OESA 3O94A 4TWRA 5EWJB 4AECA 4AZVA 4DARA 5LP6B 3LDAA 5KKCA 1ZSNA 1WMBA 4G0NA 1GZUA 3KB1A 3K09C 3LC7O 5DIZA 3OU2A 4C4AA 1N78A 3QY0A 2DQYA 3EGOA 3PS9A 4RVHA 1JDBC 1HL3A 4IHJA 1NLMA 1IIBA 3SZ3A 5C8XA 1N6HA 5DNUA 4RA9A 4MYHA 5D3ZA 1JMVA 2H6EA 4CU2A 4BO0A 4YQFA 2Y9PB 3A9SA 4PNZA 3K2EA 1DAFA 3V9PA 3PUHA 2WIGA 1JJBA 1YQDA 3A1EA 4G1EB 1QH1A 2E0IA 3PFGA 2H4WA 5AXCA 3D3EA 1KMCA 2Q62A 3W0LB 3EF0A 5K0TA 1K63A 3CNBA 5LA6B 3I0NA 1AHIA 3C3DA 5D51S 3KKQA 3QLVA 1YQTA 4FMCF 5FCDA 1N7IA 4D9HA 1LDMA 2JEZA 2HIGA 4F12A 1CETA 1UODA 2E37A 3ROPA 5B5SA 2YFHA 1U0LA 4ZRNA 3WLOA 2XZOA 1MBZA 2QVCA 1FNBA 1IHXA 3OJLA 3PJEA 2IUUA 5J2TB 1Y4UA 3U7EB 3FY4A 2AYXA 3KYCA 2OV4A 3I5AA 5DRYA 2BTEA 1IL0A 1T5SA 1YQGA 3EQZA 1GNPA 4NFLA 4R1PA 1ZNQO 1CULC 5FFFA 3LT4A 1C41A 1ENOA 1PNOA 2FCAA 2HFKA 2OSVA 1UAYA 3MJSA 4RF2A 4BCCA 1CE8A 3C7DB 5CLJA 4D0SA 1P0FA 3NTUA 2XUOA 4OGWA 5CNKA 1KO8A 1HF3A 3H1PA 3NPMA 1HT3A 4YXWD 3NHJA 1RR6A 5H9VA 3TSZA 4BO3A 1GCUA 1HK7A 5K6RA 1WM1A 3Q85A 3DMDA 2PGLA 4E30A 1KKMA 3BHNA 3GQBA 4KXQA 4NULA 2HXSA 2Y68A 2BM0A 4BL5A 1ZGGA 2H9AA 1URPA 3NJ8A 4XX1A 5IJXA 2H9IA 2WY2D 3T94A 4HDRB 3EEFA 4ZEVA 2HJHA 4O2AF 5A4DA 1XRSB 2PV7A 1XPUA 4RHXA 2DZDA 4TUYF 5BV2P 5IK2D 1QG6A 5LLTA 3ASYA 4Q1FA 5ADWA 2WHPA 5JVDA 1YVUA 3E61A 3VAYA 5HQ3A 2NXEA 3FDFA 4XB2A 4OBXA 5FEUA 3WSWA 3FAKA 3VR6D 4X8MA 2ZYWX 1EJ0A 2J4DA 4CGYA 3FYCA 5ALYA 1U5BB 3KJFA 5C3MA 3BF8A 3ZQKA 3DV0A 3B48A 3K0CA 1NKTA 4RY0A 4TT8A 1CLUA 2AG6A 3QW4B 4N9WA 4D4KA 3A6DA 2PCLA 5HIIA 4ZAFA 3LWNA 2B94A 1DWUA 1OZGA 2LUOA 2ODQA 4WOCA 5AOBA 1A3CA 4CMEA 2RKOA 3QFRA 3WICA 2HW8A 3TD2A 4A8JB 3TQFA 3V6LA 4IH4A 2E6UX 2JJ8A 5EJIA 3SN6A 1XU4A 3H8SA 3B6MA 4CN9A 4O4LA 2CWWA 3H9JA 2QENA 4PZEA 4JI1B 5AOAA 3I12A 5ITZA 2FEAA 3H05A 4LKOA 4B4KA 1MIOA 2J32A 2NADA 4D9IA 4YP1A 2HQBA 2OBXA 2PZBA 3BXHA 4KQIA 4C3VA 3I62A 1OBFO 3FSRA 4KREA 1N2HA 1H2WA 5F2KA 2WUDA 1SQFA 2WVJA 1CPYA 4XQ0A 3WB9A 5K8VA 3AOEA 2FVXA 1B73A 1E1DA 4GICA 4BMCA 4ENSA 2J5QA 1CUZA 1SVMA 2Y71A 3DTYA 1VDMA 3TW0A 3TYXA 1P33A 2WMDA 4QPZA 1NNUA 4DT1B 1B15A 1F38A 1DCKA 1TK2A 2W93A 2BFAA 2WM3A 3MQ4A 3FCEA 1V5WA 4B3TB 2IXBA 4G8DA 4KYVA 5LQMA 2BFFB 1CUUA 2F64A 2JHCA 3BMQB 3E35A 1G21A 3EXFB 3M82A 2FWBA 4JVNA 4R81A 3ESRA 2ZUDA 3FLAA 3H87A 4BFYA 1DQZA 2E21A 3NDRA 2PUTA 1U31A 4XIYA 4E32A 1KVQA 4HAZA 3SC6A 3ZWQA 2C3OA 2APJA 3OU6A 4ZV4A 5BQFA 2YYAA 1FUKA 4NPAA 3RHSA 3W6NA 2Y0DA 1VPWA 2ZM6B 4UXJA 3V00A 4H7JA 2TS1A 5KNCH 3FDIA 2H4ZA 2E6KA 1O57A 4Q1EA 1KE2A 5KWIA 1FU8A 3BM5A 3OEEA 4IDAA 1XEWY 2QTTA 4O1IA 5JOQA 3M4NA 3OKFA 5A3SA 5K8LA 4WK6A 1P2DA 2AN9A 3N76A 2BTQB 4PCVA 6ADHA 2V7QD 4NS1A 1Q1QA 3IQZA 1P44A 3A2LA 4V0LA 3UCEA 4ARBA 1QUFA 4HB3A 2EC5A 1OWPA 5GONA 3UMSA 2GASA 5BPFA 2GF0A 1I7PA 4FS3A 5FBRB 1VOTA 1ZI8A 2C00A 2ZBPA 2FN3A 4M9CA 5EKUA 1HQYE 1KXZA 3U7RA 3ZHYA 1JDZA 3QUTA 4BUZA 3HNRA 4YFVA 5EERA 1RKVA 5AKLA 1TJPB 4ZFNA 2NU9B 4BLUA 1RWKA 2DH6A 1ZCAA 1FTWA 1KYZA 1OWLA 1T4MA 1U94A 1GA1A 1X19A 3DH0A 1OIWA 3P9XA 1FSGA 3LHDA 3IPRA 5FI1B 2HF8A 3LQ2A 4QM6A 1DC3A 5E9AA 4JXJA 4UD6A 4IVNA 4BE9A 1NUUA 3CC8A 5FI0B 1ZH2A 1B41A 1KMIY 1N5DA 1KI7A 1NF2A 3HPQA 1NATA 4KVAA 5HF9A 3HABA 2DWUA 2RDMA 2Y1EA 2XRYA 3T15A 4MV1A 2A5LA 2QUIA 1E2DA 1PFVA 3GRUA 4AZ3A 1N1MA 4D9KA 5LN1A 1Z8FA 1XRRA 3HCOA 3P9YA 3PZRA 3FLBA 3MCUA 3WYCA 5COQA 3A9RA 3RSFA 4EAAA 2BHLA 3D43A 1WPQA 1II9A 3L8ZA 3WJAA 2FP4B 1QLWA 1ZIYA 3EVGA 2ZUWA 3K4QA 3IURA 2Q6LA 3FCXA 3MJCA 5EL0A 5G3YA 3CLRC 1E1LA 2GTPA 2XEXA 4LJ4A 4N65A 3PI7A 4G5XA 3E82A 4XYGA 4K9DA 1M76A 5TQJA 4RK1A 3AHFA 4E22A 4CZ2A 3BJEA 1WXXA 4KR9A 1DOZA 1E66A 1NF8A 2YL2A 3Q5GA 5EIOA 2JNWA 1A4IA 4GHWA 1JKFA 1DLJA 3T5DA 1WULS 2EEPA 2BZ1A 3EGCA 4J43A 1NXXA 1JE0A 4NIMA 4XGIA 1PSWA 1JYFA 3WK5A 4EA7A 4CMBA 3LWZA 3A0UA 4RQBA 1KK1A 2CUNA 4MV7A 4O4JF 2XMCA 3NOOA 5LJLA 1Y3IA 3OQIB 2CE7A 5JXHA 3HPRA 1G41A 2Y4OA 5H59A 2NAFA 4G0QA 1KJ8A 4YJ2F 4CQMD 2ZTHA 2QN1A 3GJTA 4N5HX 5ALHA 3VKVA 4AZ0B 5C9ZA 1C0LA 1DOAA 1NHGA 4R1TA 3FOAA 1VSQA 4PYLA 3TSYA 1TPZA 1DIOB 1M2VB 1UINA 4YCJA 2AOUB 4NESA 3FWHA 3V1KA 3E1KA 2D8MA 4EW2A 5JS2A 1A9OA 1XNHA 4X62B 3SS9X 2VTBA 4LIPD 3I6QA 1NNEA 1TZMA 2BI4A 2R8EA 4R8SA 4ZZ3A 1HNZB 5LDDC 1MX9A 1TEXA 2QBYB 4M8KA 2EHJA 5KEIA 2EZTA 1Z6ZA 4RVNA 1PYGA 1TYZA 1A98A 2JIZD 2QRJA 5H4HA 1NPDA 1TKBA 2AMFA 2JCYA 1N33B 4GPD1 1ARZA 2Z57A 4HH0A 4W1SA 1GY8A 4V0QA 3W1EA 4E21A 5EXXA 3GYBA 4MOWA 4FINA 3TIIA 3DLCA 3WHIA 3ZXSA 2YQ4A 4FW8A 1XNQB 3AL2A 3C3BA 3ZXUB 2E4UA 2DUUA 4X1YA 1DWOA 3R7WA 3L4KA 4RJIA 2XMDA 1EK2A 4L7QA 4OGFA 3K72B 2GXQA 2KE5A 4MAFA 1XCMA 4HGYA 3CGWA 1ZK4A 1SXJB 1H5UA 2AN1A 4HVTA 3FGZA 4PFQA 2AR0A 3ROTA 2IBMA 4TLCA 2QE6A 4FDLA 5JYCA 5LKAA 4G1FA 2CF5A 2UYGA 3UA3A 1KRXA 1EK1A 1QO7A 4JYAB 4INOA 1W9HA 2C5AA 1TEHA 1UBKS 3ET4A 3HWX1 4UTXA 3RQIA 3WWCA 4AS1A 4Q9KA 3ZHZA 1TYEB 3LX5A 3ETGA 3NTLA 1B2RA 3VR4D 4M0UA 4FWTA 2GD0A 2EARA 3PT9A 3RVJA 4HRXA 3VV3A 1G38A 1RYHA 2KX7A 2X58A 1PT9A 4IGKA 3A4VA 3F5SA 3LSTA 4YRLA 4I2NA 3BULA 2Z3ZA 2P9EA 3RIMA 2A1TR 3EVAA 3AB8A 1CU1A 1QZTA 4NF2A 4IXMA 4M1MA 1KRHA 2OT3B 5EOVA 5A9SA 2ZYIA 3WHLA 3CLTC 3ZDQA 1YUNA 1L5VA 3G8BA 5I7RA 4HP8A 4AJPA 2NU7B 4L78A 1Y3HA 4CPDA 3EDMA 3A9TA 5CM8B 3K6SB 1D1PA