1E0KA

Gp4d helicase from phage t7
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
288
structure length
288
Chain Sequence
b'PDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA HELICASE
publication title Crystal Structure of T7 Gene 4 Ring Helicase Indicates a Mechanism for Sequential Hydrolysis of Nucleotides
pubmed doi rcsb
source organism Phage t7
molecule tags Helicase
total genus 80
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2000-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e0kA00
4E09A 5DH9A 1T5LA 1KTVA 1NVWQ 3AP2A 2IF2A 1Z0IA 2GJKA 4MDFA 5DHAA 2WWGA 1G3MA 2ATXA 4UJ5A 4D4KA 3LBHA 4URXR 4TSFA 3M0EA 4AYTA 4D0NA 3QKRB 4HLQB 5JSZB 5B64A 121PA 1Q3HA 2EFEB 3KKPA 2IBMA 1A7JA 4QM6A 1R0WA 1UDWA 2W6ID 3CNOA 4OQXA 5E7JA 2G77B 5K8UA 2G1JA 3THXA 3A4LA 4TLCA 3SU8A 4BEBA 2A5GA 2QAJA 3VU9B 3NWJA 3PVSA 1Z08A 4B44A 2RGGA 4ZDIA 3SOPA 2IYYA 3KFXA 5L3SB 4L15A 3SJAA 3IBYA 2GXQA 1KMQA 1CRQA 2N46A 1G8FA 2QMHA 3VR3A 3KXIA 2W6JD 2ZSAA 5HE8A 1DADA 3EG5A 1NP6A 1A1VA 3ZQ6A 3D3QA 4MRSA 4XOIA 2DB3A 1NIPA 3BC1A 1CXZA 1G8PA 1N6KA 2K5UA 3GMTA 3KTAA 3MAAC 4D6PA 4UNRA 2F1HA 4PHFA 1OB2A 1LVGA 3EARA 4XTRA 1OHHD 5IK2A 1Q57A 3IHLA 4DLZA 1E9SA 2CHGA 1KKLA 3QUSA 1XEWY 2C9CA 3CKLA 4P4SB 4QC2A 1IY1A 1HQYE 3R8FA 3UMRA 5F9FA 4HZUA 4JJKA 2O5VA 4DSTA 1QHIA 2PZEA 4RCYA 2QQ0A 5J40A 2DWOA 4P31A 2R6AA 3VKHA 2WMOB 1XD8A 4JVNA 2RGAA 2IL1A 1CJTC 3SJCA 2X8AA 1Z8FA 4BRWA 1H8HA 1VHTA 1S1MA 5J4YA 2XTZA 1Z6GA 3T1VA 1EX7A 3TSOA 3UWKA 3OFNA 4BRUA 1XTRA 3I4LA 1E2DA 3VQTA 4KAXA 1G7TA 2FPKA 1HTWA 1TADA 1XTSA 1KNXA 1BIFA 3CRW1 1NN1A 2YWFA 3Q5EA 2OAQ1 3LW8A 2BKEA 1KKMA 2PJRA 2DWQA 2Z5FA 1KI3A 4C0JA 3K70D 4CEJB 5LB4A 3T12A 2FNAA 4HUQA 4DLYA 4FIDA 2F6RA 4IFBA 1IN5A 1Q1BA 3BRWD 4NHOA 1BS1A 5DHFA 5KUTA 1QRAA 3U4QA 1DAGA 2ZTSA 2FEMA 1FMLA 4FMDF 1OW3B 4MYCA 2W83A 4QHSA 4Q00A 5DI9A 5FUYA 3EPJA 1FNNA 4TMTA 2WJIA 1J90A 3THWB 1JJVA 1HURA 3FMIA 1VTKA 4D81A 1ZC4A 1X86B 2CDNA 3FKSA 4R71A 4LWZA 3OESA 3BOSA 2QQEA 2W2TA 2GWHA 3GLHE 4B2PA 1AA9A 4YONB 1SVIA 1DO2A 1AKEA 2F7SA 4IVRA 3TQCA 4DEYA 2QU8A 3AKDA 221PA 1J2JA 4DSUA 4AIIA 1OXVA 4BLTA 1AQYA 4D4LA 3L8YA 4G01B 1RPZA 3QQ5A 2ZREA 3WYAA 4A1FA 3BIFA 1J8MF 4C2UA 1P72A 3FMFA 2H8KA 1U9IC 2QGZA 3T1QA 3NEJA 4EAQA 2R6GA 1JXOA 4BLPA 3RHFA 1QZXA 4OK6A 2GDJA 2ORVA 5FH9A 1OH7A 1WDTA 3EZ7A 4DWJA 2BDTA 1VYTA 1IM2A 4NONA 1VYVA 2WWXA 2ZRDA 2V6JA 1G64A 1Q12A 4IDPA 4M8NE 1U0HC 4DZZA 1JEEA 2HEIA 3AVXA 3LBNA 1WA5A 3WY9A 4DB2A 3V4RA 1R8QA 2GJ8A 2QE7A 3NKVA 4URZR 1MABA 4PO8A 4D25A 2WZQA 3CO5A 1CR4A 3IILA 3RNLA 3SYKA 3RWOA 5KNCA 3KL4A 3TIFA 4LYHA 2P3SA 3CRMA 3VFDA 2JATA 3PEUA 1VG8A 3R20A 2IYWA 3RRYA 4NL4H 4OI4A 3TKLA 1K6MA 2ZR0A 5EP4A 1FUKA 1Z0JA 3IGFA 1W4RA 1G5TA 4HZUB 2BBOA 2ZRCA 4KCGA 2KSQA 1SVLA 1EFRD 3I73A 4QG7A 3LH5A 4OK5A 4RFSB 4LJ6A 4RVCA 2IYVA 1GM5A 3QBTA 3HU1A 4P32A 1A2BA 1XTKA 4IOLA 3THYB 2V4ZA 3EZ9A 1JBKA 1A5TA 3MLEA 1YZNA 1TQ4A 4V03A 5LB2A 1XMIA 1KOFA 4B75A 3W8NA 2NQ2C 3BB1A 3TH5A 1SKYB 1KNQA 2ZVQX 5DISB 3WHLA 4UNPA 2P6RA 3QSYA 1JAIA 3DL0A 3O8DA 2WPDD 1CLUA 4F38A 4A6XA 5JBQA 5JWRA 1RIFA 1N2CE 5TY0A 2ZS9A 4ZO4A 1N5LA 2GXSA 2WSSA 1YVDA 3DOFA 1KSGA 1E2PA 3GLHA 5CM9C 1EFHA 2FPLA 3EWAA 1DE0A 1DAIA 1E99A 1IXSB 2XSZA 2RKOA 1G6OA 5KSPA 4GDFA 3AM1A 3MGCA 5JHGB 1ZIOA 2NMVA 2DFTA 4KXFB 4V0LA 3U4QB 4EPRA 2FA9A 3K53A 4QBIA 1DELA 3TVTA 3EPLA 4PC6A 4A8JA 1VCOA 3GJXC 5HKKA 1KAOA 3L43A 4KYIB 4KBFA 4DKXA 1ZCBA 2JLUA 2ZXUA 3ZZTA 3UG6A 4D80A 1AS0A 4HB4A 2PMDA 521PA 1SVWA 2EFGA 2RGEA 1UPTA 1X1RA 1NIJA 4A0HA 4A15A 4LJ4A 1MO4A 1CP2A 1WBDA 3MRSA 3AVTA 4EJSC 4PAQA 4FMDB 2XXAB 3AF3A 1JI0A 2WOJA 1NN5A 1US8B 4AD8A 4XJXA 4LYAA 3B1VA 4CEHA 1GNQA 4TMXA 5GJVC 4OJQA 1V43A 4RD6A 1DAKA 1W2HA 4H9GA 4ACAA 3ZZ0A 1XNJA 3TQFA 1LV7A 2X77A 3PEWA 3K0CC 3PFIA 2A5JA 1CF4A 2GEUA 5F2EA 2J0QA 1N5IA 4OQMA 4B33A 4DSNA 4HDOB 1MKYA 2XEXA 4TLBA 3U6KA 2AKYA 4OYHA 5JEEA 1N0UA 3VTKA 4X8HA 4C3ZA 2B92A 2CVHA 2QMEA 5CYOA 3U44B 1JR6A 1PLLA 2AK3A 3ECCA 2ODWA 2V54A 3KQKA 1XCPA 2KBEA 3ZH9B 1QF9A 1NNEA 1W46A 4JLJA 4Q9HA 1RC8A 5E95A 5FPTA 2PT5A 2D2EA 2FE4A 1L2TA 1OXSC 1YZTA 3FFAA 4JIMA 2ZRNA 4PC3A 4RKEA 3KDSE 5DIFA 1SVOA 1XWIA 2VSXA 4O3MA 1K5DA 3K0EA 4PANA 1GUAA 1E4YA 4DT1A 1JR3E 1M7HA 3SFZA 1T3LA 2QAGB 3A4NA 4A0RA 4EFMA 1EWRA 3C5CA 3LLUA 1BYIA 1OXTA 3LX5A 1XPUA 2XNDA 1HUQA 4Q9IA 5KDDA 2WKRA 2IXGA 1P2VA 4TT3D 1N3BA 1N6NA 1Q1EA 5FL7D 2ZU6A 3KJGA 3GEIA 5DE3A 1E96A 4NYMR 4URWR 5GJCA 2A78A 2ZU0C 4US0R 3FDIA 5BXQC 3QF4B 4M1KA 4C4PA 5JFGA 3R7WA 1PV4A 4WAUA 4TWZA 5E3HA 4JT2A 2YHSA 2HJGA 1R5BA 1G4UR 2OFWA 4RD3A 4XD7D 2EWVA 2OXRA 3H4MA 3C8UA 4POAA 3ZLJA 2ZROA 1E9AA 2PEYA 3JVVA 5H1YA 3AGPA 3DEFA 4DLVA 2Z4SA 2NIPA 1UEIA 2YOHA 1WMSA 2B7BA 4GI7A 3B1XA 2EU8A 4BWYA 3WMGA 1RRPA 3LX8A 4XWKA 3CX6A 4CYMA 4KFTA 1DTSA 2YWEA 4TQAA 2OBLA 4B3DA 2O8DB 2Q9BA 3K09A 4KJZA 4KHZA 3GFPA 1AGPA 5G41A 1N6LA 2ZR7A 5GVSA 1YU9A 2PX3A 2ZE6A 5FTMA 4JVSB 1HA3A 2H1LA 4TMZA 1M34E 3CM0A 3GJ4A 1E6CA 1KDRA 5UKDA 4QL3A 3RC8A 5L3VA 2F3TA 2DHRA 4MYUA 2R44A 4QBFA 3O47A 5FL3A 2Z43A 2X19A 4I1UA 4UJ3A 4IDHA 1CJVC 3NC0C 2Y8EA 1ZIPA 4UKDA 2ZRIA 3X1ZA 2F9LA 1I2MA 2ZSEA 4PO9A 4I1OA 4P3YA 1YR7A 2ZS8A 4WXPA 4FN5A 1W5TA 2ZAMA 3P26A 2WOOA 3RS3A 1XPRA 3UKDA 3VAAA 2DYKA 3CX8A 5B2ZA 5EE0A 1UEJA 4WVFA 3Q5DA 4R2IA 2O8FB 2P5SA 4RY2A 4CEIA 1P61B 1TNDA 1G6HA 1KO4A 1ZJ6A 3EC1A 3QXJA 4GMDA 3U3JA 3ZVRA 4DJTA 3FOZA 2HLDA 2JIZD 1UBEA 4BFYA 5JI3E 3E1SA 1MV5A 5KSYA 2QGNA 2SHKA 3BE4A 5FR1A 3RDPA 5FBRB 3K9NA 3ZD7A 4TZ6A 3NDBB 1YRBA 2QPTA 4K46A 2D7DA 2CE7A 1C4OA 1S3GA 3C14C 4PR0A 5SZHB 4IDNA 3U6BA 2CNWA 4LZZA 4A2QA 4BLSA 1XMJA 1DG3A 4KU4A 1AK2A 2WWHA 4F4JA 1UAAA 5FBVB 1CTQA 1WP9A 4PSKA 2DPXA 1II8B 3LXRA 1S3SA 3NHAA 4IOJA 1NSFA 5D3MA 3U3OA 4LC1A 1J99A 3CR7A 2IEZA 1Z28A 4KFSA 3VX3A 1XFAA 3PIRA 2PLRA 3GLFA 4Q1AA 1Z6TA 1TL7C 1NVXQ 2UVQA 3DVLA 3DZ8A 5CJ2A 1UBFA 4NBSA 1SULA 3CW2A 4K8OA 4C0SA 5G3YA 1XD2A 5L3QA 1QHHB 2H92A 1CU1A 1BMFA 2OO7A 3L0OA 1MO5A 3ETLA 4FINA 4I1VA 2EFDB 2ECKA 2VP6A 3PCRB 4LCBA 4QGFA 2W6IA 1OJLA 4RJLA 2O8BB 3R7WB 4PO1A 3AVVA 1YZUA 3IO3A 3OAAA 1GAJA 1DAFA 1N6PA 1BOFA 1L4UA 3BFXA 3ZS8A 3WHKA 4YMSA 3ADBA 1NLFA 1ZNZA 3ASZA 4B71A 1P75A 1E32A 4NYMQ 5C4MA 3GQBA 3RSLA 4ARZB 5CDFE 1FNMA 1FOEB 1YE8A 4BLQA 1BKDR 1JPJA 1U8YA 1QVRA 2ZUCA 3MFYA 1WCV1 2VHCA 1QBKC 4F4IA 3IBGA 1MT0A 3SDZA 2J41A 3A6PC 1ELOA 4LBVA 1MRNA 2Q0HA 2ZJOA 2QY9A 4M21A 3FHTA 4IVPA 1KMHA 5IT5A 2GZHA 4ZV4A 2XNSA 2RAPA 4JLNA 1OHHA 4DIDA 3GLGE 2HXSA 2CMKA 5SZJA 3HYTA 4M1TA 5G40A 2FFAA 2XB2A 1JAHA 4OHYA 2D7CA 1LFDB 3WYGA 1SXJB 3K8YA 4Q19A 2LKDA 2HF9A 2IYXA 4W7SA 4DSOA 1IN7A 4XSHA 4MDEA 1NVVR 4PC7A 3D7MA 1ZNWA 1NLYA 3SYNA 3U7EB 3QXSA 4U02A 4JMPA 4W5JA 2ZI6A 1E79D 3FGNA 4B47A 4PAOA 4O0MA 1T91A 2JLSA 3WRXC 2O8EA 1EFTA 4AG6A 621PA 3QENA 1T3SA 4TLAA 3TE6A 1XTIA 3KKMA 5CLQA 3S1AA 5FUWA 3SS8A 2ZRPA 1IOZA 4PPFA 3EC2A 3TAUA 1N25A 2OM2A 4LPSA 1KZGB 3BWDD 3TJZA 4Q66C 1KK3A 2IHBA 4DB4A 3OF5A 2I1QA 2EFCB 3AF2A 3BGWA 3QI2A 4JLAA 3SC3A 2D2FA 5BWMA 1NBMA 1OYWA 4ESVA 2J3EA 4A9AA 2J7KA 4CT5A 4M9SA 3PJRA 2Z83A 1UKYA 4DDTA 4BECA 2XTMA 3A1VA 4B74A 4BFZA 4O2RA 2QEQA 1IXRC 3U61B 3F8TA 4FMBB 3BBPA 4NP6A 1WBBA 4Y0AA 2C04A 2VF8A 2WVJA 4XWAA 4C2TA 1Q20A 2BM0A 1R2QA 2FFQA 1L7VC 3L0IB 4ASUD 4L9WA 3ZD6A 1KY3A 2QT1A 3KKQA 1DG1G 3LDAA 5EZ5A 4XTCS 2QA5A 2G3YA 3MUFA 3GJ6A 1CR0A 2RGDA 3U7FB 4TMVA 3CH4B 2FOLA 4CF7A 5ELXA 4TL6A 4NKRA 4WA7A 2YKGA 2MSCB 2XB4A 3MWYW 4HYYA 1GTVA 2GF0A 3IIKA 3VMFA 3W5JA 3WBJA 1PUJA 2JJ2D 1NVUQ 1EX6A 5B30A 1G5RA 1TX4B 4DC9A 2J0UB 1EK0A 3GLGA 1X8JA 4LX0A 4B32A 1FX0A 4RD0A 4B3XA 1E9EA 4KVGA 4TL7A 4GP7A 5H68A 3V4FA 1HE8B 4O2LA 2XOKD 4OJKA 1P3JA 3RWMB 5BN3A 1T8UA 2G0TA 4M9XA 4LV5B 3THOA 2CL7X 2VHJA 4JL6A 2BIFA 1DOAA 1S96A 1YQTA 4CT4B 4LBYA 1AIPA 2PCJA 3W90A 4B3BA 5JRZA 5GADl 3KB1A 3B60A 1AZSC 2ZI5A 4QFMA 2FMXA 4C30A 3W3ZB 3IPXA 2FV8A 1U8ZA 2Z6VA 4AWXA 1D9ZA 1ZMXA 4JL8A 3NH9A 4Q4LA 3WNCA 2ZE5A 1RJ9B 1TUIA 5JLJA 2WJGA 2BJWA 3EZFA 1CRPA 4OQNA 3CPJB 1X8KA 4QJ3A 4P0TA 4V0KA 1M74A 4KFRA 1ZU4A 4C9BA 1H8ED 2O8CA 3P32A 5IDVA 2NPIA 3SI7A 4NYJR 4JJZA 3FMPB 4JKIA 5M04A 3NTUA 1EFRA 3T34A 3BFKA 2RCNA 1E1RD 3QEOA 1S9HA 1LS6A 1ONBA 1G16A 2NO1A 4EIWA 1NG1A 3ZQJA 3FMOB 2G0NA 1G7CA 3TMKA 4HUTA 2ASEA 2G1KA 3P4YA 4OHVA 3K0SA 1E9DA 4A82A 2VP4A 2FWRA 1AQUA 4XH9B 4IHQA 2GVZC 2GHIA 4G5GA 4TYPA 4IDOA 4A2WA 3E2IA 4JBXA 2GXUA 2EFHB 3QE0A 3X1WA 2ZPTX 2I3BA 2EYQA 2WPDA 5CYPA 3A1UA 3CRRA 3RS2A 5LD2C 4B3FX 2NPFA 2IYUA 2V55B 1JNYA 1EWQA 4PQRA 5JWHA 4D82A 4MA4A 4M2LA 4G0NA 4UQOA 2DY1A 4B43A 1TPZA 3LA6A 3P4XA 4PHGA 1E0SA 2F55A 2DR3A 1LTQA 3AVPA 1HV8A 1DAHA 1W5SA 4EPWA 4DDWA 5H8WA 1VG9B 2CHQA 2KJQA 2QBYB 5CB8A 1LS1A 2AL7A 2OFOA 3ZVMA 1R8SA 2FFHA 2JCSA 4YXWD 1G7SA 1OB5A 5FPKA 2VYFA 4OI2A 3I5YA 3T61A 4KITB 2JLWA 1W0KD 3I5XA 1IXZA 4G5QA 1XXHB 2CJWB 1YZGA 3QKSA 1BH2A 2IS1A 4BLOA 1M2OB 3D6TB 1E2JA 3VHLB 4Q03A 2WIBA 3GFOA 3PR1A 2OLJA 4C7OB 2ZUBA 1I2DA 3UXMA 3RLFA 5TMPA 2BEKA 2ZI4A 4PHTA 3EXAA 1T6NA 3EASA 5F3WB 2JDID 2P2LA 4GMXA 2BMJA 4FCTA 2QNRA 2GCNA 2V6IA 2VHQA 4Q5IA 1F3OA 5G3ZA 1F5NA 2N1BA 2O0HA 5SZKB 3R9IA 2XZLA 4RFVA 3AKEA 3K0AA 2REOA 3SJZA 2H18A 4G3XA 5JS8A 1P60A 1UKVY 4N0DA 3QIAA 2ZE7A 5CB6A 4NYIR 1XEXA 3SJBA 1P9NA 1LB1B 1GKIA 2DBYA 5LD2B 4Q4JB 3CWQA 3F5FA 4JVLA 2FZ4A 4LRWA 3IIMA 3GJ0A 1GKYA 1OH6A 4CRWB 2AKAB 5C18A 1Z2CA 1F2TA 3CRVA 4Q1FA 4HAVA 4US1R 1YRAA 1ZD8A 1S8FA 2GJAA 1J8YF 5LDDC 3RANA 4WZ6A 2Q3FA 3OIYA 3MWJA 1YKSA 4AI6A 2ZYUX 3THXB 2OILA 4DLRA 2KB0A 3EA5A 1SVSA 3IKJA 3B1ZA 3OEED 4DCNA 1LF5A 1Q0UA 1VYUA 1P73A 2B6HA 4BZXA 1KI2A 1GL7A 1MO6A 3KKOA 1TAGA 4L5BA 4RKFA 5BYJA 3WYFA 3AVQA 1AM4D 1T4GA 2EYUA 4EUNA 4TYNA 2H16A 2RGCA 4PAMA 1AS2A 3FKQA 3LAWA 1NY5A 2C77A 4TYYA 2RMKA 2CLDX 5JEDA 1TF7A 1XMVA 821PA 4QRHA 1Q1QA 4S35A 1WQ1R 1G5PA 4EQ6A 1ODFA 4TT3A 1B0UA 4PPNA 5FL7A 1E98A 2ZVPX 3W5IA 2HXYA 3B2EA 3KTAB 2ZRJA 4M22A 4Q4HA 5F98A 3AGQA 5EE3A 1C9KA 4FI3C 2YZ2A 1JB1A 3K1JA 4LPKA 3QPVA 2OCYC 2ZJAA 5FOWA 3EX7C 2ZJ8A 2ORIA 2J45A 1OF1A 1XJ0A 2BMEA 3N70A 4C0LA 1ZC3A 5IF9A 4XD7A 3WMFA 2ZEJA 1XEWX 1RRGA 3H86A 2IS2A 4NE2A 3KJIA 2GK6A 1ESNA 1W4AA 4GT1A 2OHFA 4KI0A 2DCUA 3VR5A 2YC2C 3DO6A 5JCZA 4AKHA 2PMKA 2GF9A 2NZJA 2P5TB 5J4HA 4U00A 4DRZA 1F2UA 2CCKA 3A36A 1RRFA 1IJEA 3NIBA 3CZQA 3ZVNA 1GIAA 2GBLC 3EIQA 3VKGA 2F43A 4QBHA 2HYDA 4BPBA 2W0SA 1PJRA 4FW9A 4LGMA 2C03A 5JJKA 5JJLA 1G19A 1ZM2A 4AKEA 3V9PA 2OSBA 4MRRA 2FJUA 5FBLB 3UWOA 3EZ2A 2OG2A 1FTNA 1NMZA 4JL5A 1V5WA 2XJ4A 721PA 3MWLA 3TR0A 1OYYA 1S1CA 4EJSA 4QOSA 1PUIA 4HUQB 1D6JA 5AJVB 1R0XA 2VSOA 2W58A 1OXXK 1YZQA 2VTKA 4G5RA 3RS4A 3TUJC 3EPKA 2WHXA 2NO7A 4JSYA 3AKCA 4Z1MD 2XGJA 4AY2A 2ZRMA 4R9UC 1KZ7B 3I61A 4PC2A 2W2VA 2IYRA 1LF0A 1U94A 3K0CA 3QF7A 4IXMA 1KDOA 1ZD9A 1E0KA 1G3RA 2WWIA 2QAGC 2ZS7A 4AG5A 5FUXA 2QRNA 3AF4A 2QSZA 3UATA 4QKQA 1VHLA 2HCBA 4ZCMA 3SNHA 5KHOC 3A58B 2JIZA 1MRSA 2NO6A 2CL6X 5IHPA 2IXFA 2OV2A 3D8BA 1FFHA 5FOVA 3SBDA 3TK1A 1ANKA 1D2MA 2IWRA 2ODBA 2FU5C 1E2IA 1YHNA 2AD5A 2ZI9A 3SR0A 1ZUIA 2JGNA 2QN6A 1CS4C 2CBZA 2FEOA 1E2EA 1KDTA 4XSGA 3QVVA 2NGRA 4PFSA 3J81k 1IJFA 2BM1A 2DFLA 2YINC 4OHXA 3HU3A 3W6PA 4BUJA 5C4GB 4WIAA 4GSYA 4YC7A 1VCMA 3C4JA 5FBWB 4Y0VA 3IQXA 2C9YA 2YOGA 1R7RA 4LK2A 1SVMA 1GL6A 2BOVA 2B21A 4IOKA 2NZ8A 4US2R 2PBRA 5BN4A 3H2YA 1CEEA 2WJVA 3C5HA 5KDLA 1MABB 3QJYA 3IPYA 4LJAA 4V0OA 1KSJA 3GLIE 2YC4C 3Q3JB 3PENA 1UADA 1NKTA 2WWFA 4HAZA 4HB3A 1Z6AA 2WKQA 3RYTC 4BFXA 1G291 2J7PA 2ZRKA 3PXGA 2CLSA 5AUNB 3O8RA 1XCGB 1HEIA 1JXMA 3LVRE 4EFLA 5EJEA 1KHTA 5CM8B 5J5CA 1DVRA 1T3HA 2OFXA 3B8HA 1XTQA 5HE9A 3BH6A 1IN8A 1U8AA 3EWSA 5BQ5A 2QM8A 2EQBA 1E4VA 2GESA 3L0SA 2GK7A 2PEZA 2FDCA 4LYJA 2XAUA 4MH0R 4LC0A 2AWNA 5KNDA 2H5EA 4Q02A 4GL2A 2KI5A 3G0HA 1EG7A 2WM9B 4HATA 4P4TA 5KO2A 2ZSDA 2ZM5A 1GWNA 2JLVA 1NN3A 3AUXA 4QJ5A 3LBIA 5J47A 1KYIA 1JQLB 2QTHA 4ON9A 3Q7QA 3W3AA 3QY0A 2PL3A 1W1WA 4PSAA 3KQNA 1HY3A 2ZJ5A 3UIEA 3GLHB 2V3CC 2QE7D 4URYR 1IBRA 2CHVA 3F0TA 4QGHA 2Q21A 4YLGA 2GCOA 2BCJQ 4G1UC 3ZJYA 3TRFA 4DLSA 4MRVA 3A37A 1ZBDA 2O0JA 1KI9A 1HQCA 3BB4A 2NO9A 4PX9A 1XZQA 3QBVA 2ANCA 1XTJA 2MSEB 3PUWA 2QENA 1E2HA 3LLMA 2VL7A 2BV3A 2A5DA 2CEAA 2ZR9A 1OH5A 5AJWA 5TARA 4A8JB 1ZP6A 2VHUA 4F4CA 3BORA 2WV9A 4IJMA 1HYQA 1KAGA 2ZUDA 2HT1A 5HTKA 4I1SA 1XBTA 1EXMA 2GRJA 5L3RA 4Q9KA 5P21A 1MH1A 3B9QA 4JYBA 1KO5A 4OK3A 3BAFA 2D06A 3FE2A 4PPQA 1ZINA 1NG9A 5EXSA 4NCNA 3QG5A 4A36A 3B13B 3VX4A 1AKYA 1GRQA 4E22A 4Q1EA 4UNSA 3CUEF 2W00A 2C5LA 3JZMA 4LHVA 2CCJA 1UDXA 4MGZR 4CEHB 3T35A 1GILA 1OIXA 4F7WA 2BBSA 1RFLA 2IC5A 1W4BA 4JLVA 4II7A 3T5GA 3FFBA 3KXKA 4B3CA 1CKEA 3BFVA 4F91B 1W36C 4KFUA 1CULC 1S9DA 1ZM9A 2AN9A 4KVAA 5H70A 4ASUA 1U90A 1JR3A 3W9YA 1ZM7A 1ZYUA 1W7AA 1GNPA 1QG4A 1PLKA 2E1RA 1Z29A 3G82C 3M6AA 4Q9JA 2IHYA 1LW7A 3P27A 1Q1ZA 4PZZA 1OIVA 1OSNA 3DM9B 1OKKD 4PQFA 1XZPA 2RH5A 4V0ME 2RGNC 2J1LA 4WBSA 3ADCA 2C8VA 1SKQA 3AB3A 3FTQA 4Q4JA 3RSOA 1ETUA 2MSDB 2ZI7A 5FI0B 1G17A 2JJ2A 3MJRA 3IHWA 1P7CA 4URUR 3K09C 5EXXA 2HUPA 3I32A 1G8YA 4LI0A 4CDGA 3GJ7A 4G5OA 4WW0A 2RGXA 4MYHA 1NI3A 3HYRA 3FYHA 4AYXA 4KBGA 2FGJA 3SZRA 1E2KA 2UZ3A 3SQWA 1CIPA 2XOKA 4B35A 4DT1B 1W0JA 1SXJC 4Q4AA 1Q22A 2IYZA 2BHRA 4UXIA 1ZM3A 2E9SA 3X1XA 3ICQB 4OL0A 2AXPA 1OPXA 2F3RA 5TVKA 4M1YA 1UF9A 5K8LA 3KZ1E 5AUOB 2ZETA 5AUPB 2HJVA 5JZVA 1X6VA 4I4LA 2W2XA 5AR1A 4ZIRA 3K0FA 3ICEA 4IDQA 5EUQB 4TZ0A 4BFSA 3F3YA 4NTZA 3RC3A 3B1YA 1G1MA 1NMXA 1U2RA 2J9RA 3HJNA 3R9WA 4BASA 2XX3A 3E5HA 2RB4A 1NN0A 2GKSA 3KB2A 1W44A 4A6PA 4TMKA 4RD4A 3TW4A 4N0EA 1H8EA 4DLXA 1W36B 4L9SA 3AUYA 5DI3A 2OCBA 1Z6XA 2QI9C 3ZGXA 5FTNA 3HPQA 5DN6D 2WAYA 3ONWA 4LJ7A 4BEJA 1E1RA 1IHUA 3HR7A 4ITRC 5FI1B 4L16A 1G41A 1KI6A 4BZQA 5HZHA 2W6JA 3EIEA 4CIDA 1JALA 1OFUX 2A9KA 1NMYA 2A3RA 3L0PA 4ZI2A 1U99A 3B82A 5CK5A 1Z5ZA 4Z51A 4H1VA 4TTRA 3U5ZB 2JAQA 1PVOA 1XXHE 4F92B 4NH0A 1HT2E 1Q21A 5FFMA 2PCLA 1CR1A 1GNRA 2YOFA 1P2SA 2ONJA 3X1YA 4OQLA 2E87A 3AP3A 2XZOA 3RABA 5GJBA 1FP6A 4BFUA 4M4SA 4YMUA 1KI8A 4KLZA 1G3IA 1W47A 4HLUA 4TYQA 3CF6R 1AGRA 2A5YB 1FP7A 2XNDD 3LFUA 3IUYA 5FOSA 3OIUA 3N2EA 2IYTA 3WNBA 4X8LA 2QP4A 3QKRA 4KODA 5JSZA 4URVR 4V0MA 3O8BA 1ZRHA 4N3NA 1KDPA 2A5FA 4RSGA 4LOAA 1U0LA 1N6RA 1YJ5A 1IY2A 4LV6A 4LUCA 4YXWA 1ZAKA 2ZANA 4YQFA 4GPTA 5KSOA 4LJ8A 3AF0A 2Z0MA 1W36D 3VU9A 4V02A 1W4CA 3QXCA 2YVUA 2VPPA 3I72A 4M1MA 1Z3IX 2ORWA 5L3SA 5CITA 3OIWA 4QGAA 2GETA 3VR6A 1GG2A 4CEIB 1CJMA 2WJYA 2ZYVX 2JASA 2GVDC 4HLCA 4TMWA 4MKFA 1E9CA 1VCNA 4MYTA 1T0HB 4Q1DA 2OUKA 4HAXA 3T1OA 2BKUA 2HDNB 4D0LB 2C96A 1WB9A 2JDIA 1JECA 1L4YA 3TSZA 2ODEA 4MRNA 2N42A 1S0UA 3FWYA 4JZKA 2QROA 3TNFA 4KLNA 4NZYA 4DHEA 5C2JB 2IUUA 1FW6A 2OE2A 4M1OA 1R10A 1FUUA 4P4SA 2QP3A 3GPLA 3UPUA 2CE2X 2UKDA 3TGPA 3OEHD 1EFUA 1Z2AA 2ZITA 4LJ5A 5B57C 5FPYA 3VR2A 1SXJD 5D3MB 5BYKA 2NO0A 4LV8B 2ZJBA 3CR8A 4G5SA 4MRPA 2H57A 3BS4A 3X2SA 5HPYB 3K9GA 3SHWA 4U5XA 3GLFB 1Q3TA 5FTKA 5CDFA 4DCVA 4B3GA 3QOFA 1QHSA 4GRAA 1GOTA 2O0KA 3WNDA 4UNQA 1X3SA 4B34A 1KJWA 1Z06A 2ZRHA 3VKWA 4BFTA 2IWHA 3KQUA 3QXXA 4AKGA 2WSMA 3RRMA 1XD2B 1ZVQA 3CZPA 1KGDA 5L3QB 3CF2A 4S2EA 1DS6A 2B8TA 3HDTA 2J87A 3KKNA 4IXNA 4Q9LA 1R0ZA 2ERYA 2BMFA 2TMKA 3H1TA 5CIWA 2OCAA 3QPUA 4FWTA 3ZIAD 4GFDA 1SQ5A 3OEEA 2ZAOA 3LO5A 5JMTA 5L8VA 1NSTA 4XWOA 2QUZA 4Q1BA 3DKVA 1G8HA 3ZZUA 2AHOA 4D26A 4C0QC 2L0XA 4X8MA 4OKSA 1T5IA 4CEJA 3A1TA 1G18A 3GJ8A 5KPDA 1Y63A 4C0BA 1CJKC 2XZPA 4CGZA 5EXTA 1SKYE 2CNWD 1XU4A 3KJHA 2CCGA 4V0NA 4YDHB 4PZYA 3IEVA 1IONA 1II0A 1KMHB 3THWA 3PUYA 4LJ9A 2BMDA 2OZEA 2OEPA 4B6FA 3C7KA 1NLZA 3I8SA 1TEXA 1COWD 3PEVA 4D4JA 1TU3A 5AJZA 1F60A 1G21E 3U3RA 1Z63A 2AR7A 2GAOA 4KV9A 2R65A 2QM7A 1G3UA 4BQSA 4FCWA 4N1AA 2O52A 1CBUA 3X1DA 1BMFD 3I62A 3W8RA 2CK3D 2ZQ5A 4GOKA 3C15C 5JS7A 1O87A 1E1QD 2Q3MA 2V7QD 1OLOA 2P6NA 3LV8A 4JLDA 3OAAD 3RVBA 3EAQA 2O8EB 2R9VA 4Q21A 3UG7A 4BZPA 1VIAA 4AYWA 1FZQA 4IEEA 2HT6A 3NBYC 3GEEA 1GP2A 1K8RA 4DUGD 3A8TA 3MMPA 1NVVQ 2QPOA 4R98A 4FMCB 3S1AB 3TVDA 1AS3A 4JS0A 1OXUA 1T0JB 3PV0A 1P9WA 1UKEA 1TF5A 4RZ2A 2C99A 3BH7A 2J59A 3FB4A 2GILA 1IAQA 2R62A 2IS6A 2VP2A 2BBWA 3LW7A 4WOPA 2KBFA 4YDSA 4QXAA 2OAP1 4BGDA 3K70B 1UBGA 4D0GA 2OBMA 3DPUA 1O3YA 1EFCA 3BERA 1KI4A 4LYFA 4Q47A 3UMFA 3SHFA 4Q01A 3U7GA 4ZKEA 3AH8A 4HDCA 4DLUA 4Z1MA 1M7GA 3AV0B 1TEVA 2FSIA 1NJFA 2ZYTX 2FG5A 1W48A 3DZDA 4OI1A 1N0WA 2UZIR 3TBKA 3IIJA 4EPVA 4YMVA 1Q44A 3PUZA 1IY0A 2CL0X 2VO1A 5KTYA 2XITA 4RFSA 4LY6A 4HB2A 3OHMA 4NCKA 3W6OA 3THYA 2GTPA 4W5WA 3B78A 4UXHA 4FXPA 3CF0A 4QJ4A 4M9QA 5HCIA 4EKDA 4FWIB 5SZIA 2IS4A 1G4AE 3HP1A 1RW4A 5KPJA 4A0GA 2J46A 3Q72A 4DBLC 3I8XA 3ZYCA 3NG1A 4DVGA 1ZNYA 5TDHA 4XVQA 1VKJA 2OCPA 3GLGB 2D62A 1XDBA 3T06B 1FX0B 2VQSA 1U9IA 5KNBA 2IX3A 1M8PA 1NRJB 2NOAA 4ESHA 2FSHA 3WXMA 3T1TA 5HZKA 3HR8A 2WAXA 3KUDA 2A30A 1QDEA 2GZDA 4NCIA 2P67A 3KQLA 4IW3B 2AXNA 3OE7D 4IFEA 4IOMA 2BVNA 1E9FA 1NBMD 2QG6A 4QM7A 1R5NA 2JJ1D 5E7MA 5EUMA 5J4KA 1ZUNB 4DCSA 3CNLA 5EP1A 1XMSA 5C1BA 3A1WA 2GJSA 4TQUS 1IN6A 4W9MC 1E0AA 3BK7A 3QNUA 4WXRA 1E2LA 2JJ8A 1VIYA 4LBWA 4I99A 2VIIA 1U81A 3P20A 3PITA 3TSWA 3B5JA 2RHDA 3N2IA 5AJXA 1QHYA 1GL9B 2O8CB 3QG1A 1DBSA 5CLLA 4JLBA 4AURA 4RZ3A 1E2NA 3U2QA 5JECA 4CW7A 3V00A 2VHTA 3K9HA 3GEHA 2XXAA 2FSGA 3B7GA 5EP3A 4ZCIA 1US8A 2ZRLA 3AP1A 4OHZA 2ZIAA 3REGA 1A2KC 2G83A 4JBWA 2AD1A 2YWHA 5EE5B 2GBLA 3PG5A 2Q6TA 2MMCA 3JZAA 5AK0A 4DXAA 1R5OA 2V9PA 4A2PA 3C16C 4NYJQ 2P6UA 3TR5A 2A2ZA 3QPWA 3HWSA 3M1IA 3RRZA 3RS7A 1VPLA 2ONKA 3U7HB 1TF2A 1GDDA 4TYWA 4A4DA 3BB3A 1E2MA 2IF0A 2D3WA 2VH5R 2WKPA 4LHXA 1KK2A 1M1YE 1N6IA 2ZRBA 3LY5A 1G8GA 1XF9A 3U44A 1P2TA 4KYUA 1D5CA 3TAHA 5FTJA 3W6NA 4WZBE 4BFVA 4TSFD 3ASYA 1U0JA 3U60B 4GOXA 2OT3B 2Q9CA 2PZFA 3LD9A 2EW1A 4MGIR 3VR4A 1GZSA 1OT3A 2IYQA 2JLRA 1E2QA 3SE0A 2VP0A 3KX2A 2FZLA 4J0QA 1UJ2A 2YJTD 2QL6A 5FUVA 4E07A 4Q7KA 4TLEA 2D74A 3EZ6A 4LHZA 1WF3A 4JKYA 5DYGA 3U3KA 4RCZA 2PJZA 5KU1A 4Q7JB 5EE9A 4OBEA 1EESA 2VSFA 3GJ5A 2WBLC 3QKSB 4JT4A 2QAGA 3B9PA 4R2HA 3DKPA 4UXJA 4MITA 1Z6YA 4Z8YA 2FPMA 5EXPA 1OIWA 2WIAA 2P65A 4M9ZA 2ZI3A 2QMUA 2R2AA 2FFBA 5JCPA 4HDQB 3DHWC 1OFHA 1MO3A 3O8CA 2WMNB 4NMMA 3U3MA 4WZAE 4Q7LA 1UKZA 3QF4A 5A4JA 2LCFA 5IK2D 5GVRA 1P6XA 4QNMA 2GNOA 1FQJA 1LY1A 2R6FA 2VP5A 4PSVA 3REFA 1ZD1A 3Q8XB 4TLDA 1ESMA 3K0AB 2WJJA 5B58C 3EPHA 2YWGA 4DLWA 3DMDA 4AC9A 4L4UA 1KSHA 2REXB 2ZJ2A 1XEXB 3EA0A 2I1VB 4HEJA 3AEZA 4MKGA 4PZLA 5FTLA 1XPOA 5BN5A 1Z07A 1TQ6A 1Z0DA 5E7IA 1OE0A 5AUQA 2J5XA 4IVQA 3NH6A 5FR2A 2HF8A 4QNRA 1D9XA 2LWIA 1F2TB 1Z22A 5LBIA 1H8HD 1OKKA 1W2GA 2EWWA 2VP9A 4P4UA 4DDVA 1GFIA 2IYSA 2PZGA 4JLMA 5EQTA 4D2IA 3HPRA 2JEOA 2ZSFA 1ZW6A 4TL8A 3OFND 2V1XA 2C2HA 4NPHA 4NYIQ 4OHWA 3W34A 2O8DA 4QGGA 3CX7A 1FQKA 4GP6A 1GITA 4AK9A 3B1WA 1IQPA 4JLPA 3AVUA 1KJZA 2I4IA 1M7BA 4I81A 4C0AC 4JLKA 4JYCA 2YV5A 4ZDJA 4GZMA 5DYIA 2JA1A 5A0FA 1R6BX 1QHGA 3WMEA 1UFQA 4B2IA 4DDUA 3GD7A 1AN0A 1KO8A 2YNMA 4ZI3A 3GFTA 1XP8A 2CLCX 4LSGA 2GXAA 1C1YA 3FHCB 4GOJA 1ZM4A 3MJHA 1S2MA 1G3QA 4EQ6B 1E9RA 2GZAA 5KOYA 1E3MA 4Z8XA 4DCTA 3PQCA 2ZJZA 3CWZA 2IA5A 4LHYA 3SEAA 2IYLD 1WE2A 4Q4HB 3VNVA 4A8JC 4HSEA 2BBTA 1PZNA 4UNNA 4IRUB 3KQHA 2WJHA 2Q3HA 3D31A 4RD2A 3FPAA 4MKIA 5CIQA 5JRJA 1ZU5A 5DSZA 2O8FA 3FKSD 2BCGY 3G5UA 4A92A 2C98A 4HAWA 1FL9A 2DFKB 3AQ4A 421PA 1JQJC 5K8TA 1SXJE 4C0KA 3I3SR 4DIEA 4PC1A 4H1UA 3NVAA 4IEIA 5DN6A 1DO0A 8OHMA 1XCMA 2IXEA 1F2UB 3QVUA 4HAUA 2PLFA 3SQXA 2G6BA 4TTPA 5GJWC 4TQ9A 3LNCA 1KJYA 1NKSA 2ATVA 4QHTA 2H17A 4TN1A 4BLRA 2F43B 3GJ3A 1P9RA 1XX6A 2MMGA 2DFNA 3NC1C 4DCUA 4MKHA 2ZRAA 3QXHA 2J0SA 1II8A 4HAYA 3ZDQA 2R6DA 2WWYA 1QHNA 2WWWA 4NU0A 4MGYR 4QBGB 1JPNA 1TU4A 1ZUHA 2AX4A 3BJIC 5FBQB 2P0EA 4BFWA 1J7KA 2D4HA 5FOTA 2HYIC 1QHHA 1KK0A 4GZLA 1HE1C 2V8OA 3NDPA 4EJSB 4Z54A 5A5GA 4CZ2A 3NHBA 1X8LA 2O8BA 2C78A 1OV4A 3QKTA 4CVNA 1E79A 1RZ3A 2QRZA 1B23P 2QT0A 4DEXA 5HR5A 3DMNA 4Q7MB 4RZUA 3A1SA 4KO8A 3PUXA 1DARA 4FD2A 2GEDA 4K81B 1VMAA 3MSXA 2KE5A 2PX0A 4IKEA 4M0LA 2JLXA 3TUIC 1I4TD 3EW9A 4PXAA 3GLFE 1BYUA 4ARZA 1D2NA 1E69A 1OFTA 1CJUC 1T8TA 4HI0E 1GVNB 1Z47A 1Z83A 1GRNA 3IEUA 3K9LA 1LNZA 1TQDA 2Q9AA 3AVYA 5TV2A 4ACBA 2IUSA 4JSTA 4B76A 1DEKA 3QEJA 4ILEA 5DLQC 5FPHA 2F1JA 2RGNA 4B2LA 1FTSA 4QHYA 3ADKA 1SVKA 5BW8A 2JLQA 5KDOA 5E4FA 2WTUA 3IDQA 3GLIA 3H84A 4Q18A 5JI2E 1H65A 2QPAA 4Q48A 2RHMA 4PPGA 5TXGA 3SFVA 2IW3A 3P1JA 2OBNA 1YR9A 2WSSD 5FOUA 3OEHA 4L8GA 1VDZA 2ZE8A 3KFVA 1N5KA 1YR6A 3RAPR 3TUZC 1SXJA 3CNNA 3OZXA 1G7RA 1Z0KA 1JEDA 4KSBA 1NJGA 1GRRA 4XVRA 4LHWA 4YMWA 2XSZD 4P33A 4EPXA 1F48A 1RYHA 2CVFA 3EIHA 3FVQA 4MUAA 1HH4A 1R4AA 2R8RA 4ZDWA 1TMKA 1M6NA 4ZCLA 5D3QA 1DAEA 3PEYA 1KO7A 1WRBA 1RVDA 3L82B 2R6CA 1VG1A 4ABYA 5HKKD 3BXZA 1I4LD 1U98A 2JLZA 2PH1A 3MD0A 2X1VA 2QORA 4NDZA 2ZYWX 1RYFA 3N5CA 1NY6A 1PLJA 2J0VA 4HZIA 3GCGA 3ZIAA 3RRNA 4F93B 4XVUA 4EDHA 3NEYA 2AK2A 1IN4A 2KWIA 4HB0A 3TLXA 6Q21A 1KI7A 2AFHE 2IUTA 1NF3A 2BEJA 2WICA 2VLIA 3KJEA 4MQBA 4XIGS 2F1RA 4JVMA 5JWOA 1E0JA 3IQWA 3MG9A 3ND8A 4R7ZA 1WXQA 2IK8A 2IT1A 5LPNA 3SN6A 2ODNA 1II9A 5CJPA 1N5JA 2EVWX 1VECA 3LXXA 2ZRGA 2BJVA 1YZLA 2C95A 3DDCA 3R8CA 3ADDA 3KUCA 2GAAA 1P4SA 3T15A 1YZKA 2LKCA 5J4LA 4OI0A 4RZXA 1EGAA 4C0HA 4BE7B 1P5ZB 2A7QA 2GJ9A 2HV8A 3CLVA 3VHXA 4M1SA 1G20E 1QVAA 5EP2A 5JJIA 1RKBA 4E5UA 3AVOA 3UK6A 5K8IA 4B48A 2VRWA 3BD9A 4TL9A 1A82A 4ERNA 3FHOA 1KY2A 1COWA 2OXCA 1UBCA 4M1WA 1F6BA 2FX3A 5F9HA 3NXSA 1RRCA 3CBQA 2VEDA 1A4RA 2GCOB 4KSCA 3WP0A 1XD9A 3WP1B 3DOEA 1SZPA 1NBME 1Z0AA 3NBFA 2CK3A 1VG0B 4MUBA 1E1QA 1P62B 3E70C 5G53C 2B8WA 2J0UA 2V7QA 1D8TA 1J70A 2NTYC 3NBXX 4LBZA 1XJCA 2J7PD 3H0KA 3B85A 3MWKA 4MGKR 1DPFA 1GKUB 3CONA 3CIOA 2BC9A 2FSFA 3Q7PA 4U7DA 5DO9A 2ZRFA 1FPMA 1TQ2A 2XTNA 4DUGA 3AKYA 3RS5A 1R0YA 2FGKA 1VCIA 1ZNXA 3WBKA 3DM5A 1W49A 3CPEA 4E03A 3L8ZA 4OQFA 1I4DD 5CK4A 4FMCF 4PTLA 4YMTA 3QKUA 2VA8A 5DGXA 5FPSA 2QTVB 1RJ9A 4ZKDA 3UANA 4PQYA 4X8OA 3GLIB 1SHZA 1MOZA 2PT7A 4D4MA 4HLDA 2W0MA 1KI1A 1P2UA 1XJQA 2DWPA 2REBA 4FCVA 4Q1CA 4RD1A 2ANBA 1OH8A 1N6HA 5FOXA 1W0KA 3CRQA 2HCJB 2OESA 3LQRA 4B6EA 5J4VA 4TTQA 1CR2A 4M53A 2X2FA 2QZ4A 3L2OB 5EE1A 3R9XA 1HT1E 1N6OA 4W5HA 2CXXA 2GA8A 2FF7A 3SYLA 2BWJA 2G9NA 2OLKA 2FN4A 2B7CA 4JLOA 5ANRB 3LVQE 3GP8A 2V1UA 3AVWA 4ZDKA 1QG2A 1E94E 1GSIA 3RS0A 1MR3F 3MCAA 3JVUA 3TW8B 2QP9X 4O25A 3UMSA 1D2EA 4NCJA 1AJEA 4GNKA 2Z4RA 3LWNA 2XJ9A 4GBMA 2G88A 3LQQA 4HLUC 5DNYB 3ND9A 1FMJA 4LDJA 2RGBA 4LJYA 1KSFX 5EZ6B 4B73A 4EPYA 2ZSBA 1X1SA 2GEVA 1KK1A 1S4QA 4Q4AB 3B6EA 2NG1A 1E2GA 1OFIA 1G9XA 4EFNA 5IRCD 2X2EA 2AFIE 2F1IA 3OE7A 1AZTA 2QTFA 1SGWA 1T9HA 3M4YA 3VNUA 2JJ1A 2QBYA 2GCPA 1Y3AA 5KYKA 4ZIRB 3K0FB 1E2FA 1K5GA 1Z0FA 3IO5A 3AF1A 3CH5A 5KSZA 1SHKA 1XEFA 2IEYA 1XXHA 3CB4A 2CJWA 1ZCAA 5TB5A 1JR3D 1DAMA 4JBYA 3OIVA 3CPHA 2F9MA 5AJYA 4C7OA 3C41J 1JJ7A 2HLDD 3ZS9A 5AWFC 1YR8A 1E9BA 1L8QA 2H7VA 5DI3B 3SBEA 2C9OA 2ZJYA 5HCNA 2QSYA 3Q85A 3BH0A 3K70C 2VF7A 3HU2A 2JLYA 4AKIA 4EPTA 4A0FA 1KO1A 1KI6B 1N0VC 5JHHB 2AWOA 3LRPA 1XB2A 2ERXA 2QMOA 3KXLA 4NCHA 1QHXA 3WRYC 4ZPXA 3A4MA 3Q9LA 1BO6A 3I1FA 3PUVA 2YYZA 1UM8A 3VR1A 1RE0A 3I92A 5C46F 2VBCA 4PHHA 3T5DA 1W0JD 3NBZC 3ZVLA 1TUEA 1NL3A 1TTTA 2FH5B 1KIMA 1XRJA 4DLTA
chains in the Genus database with same CATH superfamily
1RHMA 4BV8A 1KTVA 1NBEA 4UUBA 3TLKA 3SMVA 4YCDA 5DHAA 3OE4A 2ATXA 4C4YA 2JAOA 4UJ5A 2C7PA 3LBHA 4LVNA 1I5RA 1WQ4A 4TSFA 4AYTA 4D0NA 4URXR 5IJ0A 4E2WA 4NG4A 1KRHA 4LJKA 4P92A 4C1BA 2GM4A 3I05A 3EQ8A 2IBMA 4DG8A 3MWEB 1UDWA 3RQIA 3E9MA 4OQXA 5DHQA 2VT3A 1Y98A 4N9WA 3OLQA 1J0EA 2GPBA 1UAGA 3QWAA 3D0OA 4LDAA 5C7OO 5IDWA 3VU9B 3NWJA 5JNVA 1L9KA 1K08A 1WKVA 4OSPA 2B3DA 5IPFA 4FCCA 1T13A 1TJ5A 1NLUA 1FBTA 4K9OA 3RSGA 1KMQA 1YJ8A 2VK1A 3DLTA 2X5JO 3G2MA 2JGMA 3NGXA 4D9KA 1SXGA 1FXUA 1O8BA 3GH3A 3EY4A 2W6JD 5HE8A 1NTOA 3C3BA 1VI5A 3EG5A 3RI3A 4CLOB 4CR7A 2GZ3A 2RFLA 2IEBA 3OETA 3RC1A 4DR2B 3SCZA 1MQ9A 3KV1A 5BVHA 2KYRA 2C7QA 1BC5A 1NIPA 1KQPA 2A5LA 3BC1A 1N6KA 3GMTA 4LTMA 4ONEA 2ZTHA 1VPTA 2FQ1A 3HM9A 3EARA 2UZ1B 2I67A 1FP4B 5DEOA 3TLCA 2VPZA 1Q57A 2JFPA 2CHGA 5CTJA 3TDKA 4Y7DA 2RAFA 2RAUA 1XEWY 2C9CA 4MLPA 4NBRA 4QC2A 1HQYE 3VPXA 3AV3A 4I50F 3FOBA 4HSGA 4JJKA 5AOBA 1V1JA 3USZA 1QHIA 1LKZA 1XYGA 1Z75A 2PZEA 4TRNA 3R0ZA 4XB6B 4BB6A 1SCUB 5J40A 4NHEA 1GJRA 3BE8A 3W2IA 1LTHR 5FCDA 5IXJA 2I2BA 3D0QA 5ALUA 2ID4A 1F8XA 1TEHA 4OUDA 3ZDAA 5D5PA 5EWMA 5A02A 1E6LA 1PEYA 1WCIB 1MO2A 2UUOA 3OQPA 4RJ2A 1N3LA 1BCSA 4IMRA 3U80A 4UUMA 3W2FA 5J4YA 1GA4A 4YB8A 3TSOA 2UUAB 4HFMA 1A9XA 3L1VA 1WW8A 3I2GA 3I4LA 3M9LA 2DQSA 4PV7A 4KAXA 2FPKA 1ZLYA 3MEQA 1TO2E 3GK3A 1RWPA 3PKIA 4V1CA 3UUWA 4EUEA 2XIQA 2XMSA 1U2GC 1XT6A 1KKMA 2BKEA 3C6ZA 5CVCA 4JEUA 1DUVG 3VNQA 2Z5FA 1Q84A 3TEMA 3HB0A 1C2TA 2OZLB 4IKPA 2C4NA 5LB4A 4IHJF 1QIIA 2ZYAA 1JQ5A 5CNMA 2H29A 4EYGA 1Q1BA 1TLFA 5COBA 2JLVA 3RJ9A 3O2QB 3QK7A 1XROA 3JQQA 3U4QA 2ADOA 3VR0A 3D3KA 2O2DA 2FEMA 3U0BA 2R4UA 1GPUA 4HPWA 1P3Y1 4F2GA 4MYCA 2W83A 3WQBA 4UNRA 2FJ0A 3C3MA 3EPJA 1J90A 1TCVA 3HUEA 1Y37A 1SOUA 1HORA 5IUKC 3KOWA 1VTKA 1XU7A 4D81A 2AFRA 4R8SA 2HNBA 2JS7A 2QQEA 2FPSA 2W2TA 2GWHA 2HK7A 3OP1A 4OVKA 1WBJB 1Q1GA 5JAQA 2GRUA 5JZBA 2XCOA 3CN7A 3PT5A 5EIFA 3RSHA 1EVKA 3GUCA 3R24A 2PIDA 5A3RA 2ID7A 3AKDA 4RHCA 1GGJA 3G9QA 4C0WA 2PSEA 2YIMA 4KQWA 2YH2A 4D4LA 4GBJA 1D0SA 1ZJ4A 4M7WA 4A0SA 4G01B 4BNGA 1XA4A 5EZYB 1PEDA 1W1UA 2H4XA 1BX1A 4FFNA 2OV4A 2W48A 5EWLB 5I9TA 4DQ0A 2VOJA 5MN4A 4P1ZA 5KWSA 4EW3A 2FMIA 4DMFA 3FMFA 2H8KA 1U9IC 4PYKA 5AW3A 1E3DA 3RH0A 2J6IA 1WUYA 1JXOA 2IODA 2ZBUA 1QZXA 3N8HA 2H2IA 1B42A 3QHQA 2ORVA 1KQGA 1CUEA 3BZWA 1T43A 4FFLA 4DWJA 2BDTA 3A9UA 4I4CA 1VYVA 3E3LA 3O6VA 3FWPA 2V6JA 1G64A 4IDPA 4RQBA 4MQEB 1QYWA 4P7FA 4Z0NA 3PQ6A 1JEEA 4OMDA 4JI3B 3GEPA 4JP5A 3WY9A 4DCMA 2ZG6A 2HA4A 4D0SA 1NNI1 3B7WA 1P0CA 1RWQA 3BQ9A 3GJTA 3LTEA 3CO5A 2PG3A 1CJCA 1YCHA 2HIHA 3IILA 3WISA 3ESDA 3RWOA 3P8ZA 1IB0A 1YB2A 3U62A 5KNCA 1MD9A 2PGDA 2D6FA 3REOA 1I6MA 2NYRA 3AKZA 3GRAA 4IICA 1YR2A 5TEWA 2WG1A 3R20A 5F2KA 3RRYA 4KW7A 3T4UA 4CM9A 3OU7A 1E59A 3IPAA 3O4RA 3VTZA 1CUBA 2OCDA 2CKMA 1Z0JA 3R5XA 3G23A 1W4RA 1M8FA 2KSQA 5DWDA 4Z3DA 1N2EA 1JEYA 1HZZC 4IH9A 5JQGF 4RFSB 4NJMA 4RVCA 1AU9A 2O3RA 4LCJA 1XO1A 2E4YA 3HU1A 3THYB 3HVKA 1XFDA 2JH3A 3CV3A 3L7BA 2Q5JA 2V4ZA 3Q3EA 2P9QA 5HS4A 3L6CA 2RG7A 4OIFA 1YZNA 5LB2A 1DIAA 2YWBA 5HQ3A 4X71A 2NQ2C 2ZDGA 1KP3A 1SKYB 3LP6A 2IOFA 1HMPA 3UJCA 5KX5F 1ABBA 4G0VA 3IA2A 2BPOA 1JAIA 4I50B 2A57A 3DL0A 4LXXA 5KNCH 3UUGA 3N75A 3O8DA 1JDJA 4YACA 5T64A 3Q3HA 1CLUA 3CMCO 4YX9A 4RKQA 4F38A 3OD5A 3EF1A 5JWRA 3CX4A 1EQ2A 1N2CE 2NTNA 2ZS9A 4KQ1A 5IHXA 1QAMA 2BEVA 5B7GA 2I76A 2WSSA 1YVDA 4NCXA 1YBMA 3PIDA 2O06A 1FS4A 2R1VB 5CM9C 3RVPA 3EVFA 3T94A 3H11B 2QVCA 1Y5LA 2D5LA 2PD4A 3Q12A 5U1PA 1E99A 3TXXA 3VU0A 4F4FA 4BC1A 1KJIA 2G40A 2J9YB 4MP8A 4E32A 4DCCA 3CEPB 4MS4A 1PV1A 4EL5A 3AM1A 3ZWAA 3QP9A 5BT8A 2NMVA 3HFJA 4KXFB 3U4QB 1WLSA 3JD1A 4QBIA 1VB5A 1T1EA 4Y2QA 4JI7B 1MX9A 1VCOA 2R1TB 3GJXC 5C35A 2NNLD 3ETCA 4CQMB 3NAZA 5E9AA 3W06A 2QW1A 2ZRQA 5HKKA 2JLUA 3GOHA 2I87A 3PXCX 1YIDA 3GEDA 3UG6A 4HB4A 3V4ZA 4D80A 4R05A 1LLQA 3S2UA 4B7CA 1ACMA 5AFSA 2EFGA 2RGEA 1UPTA 1M0SA 1M1YA 1PEAA 1BVHA 1Z2DA 2Q29A 2GD2A 3ST7A 3E03A 1NIJA 3AFIA 3DEJA 4R4JA 4YQYA 3VSEA 4ZU6X 3A9VA 4TTAA 3MQ4A 1VSQA 3PWKA 2WK1A 1B2LA 4IJ6A 3PNBA 4LYAA 2W8BA 3YASA 4DR1B 5ESDA 2C2XA 1DOZA 1HR0B 1W9MA 1Y3CE 2G9UA 3I1IA 3AHJA 3LC7O 5A5EA 3W9BA 1EM6A 2G0AA 3GC6A 1UKCA 1XNJA 1ODSA 4KSYA 1VL6A 4ZVPA 3FVTA 3O84A 5DGHA 2A5JA 4XYBA 3OJFA 1RTTA 1CF4A 4PN3A 1ISFA 2GPNA 4GW3A 1N5IA 2ZTVA 1N75A 1XLUA 2PXXA 4HDOB 4KP7A 4QG3A 3IMEA 4FZ3A 3CCCA 4JFRA 4OYHA 2IV7A 1RQNA 3TZKA 2V97A 3S4YA 2QMEA 4X0EA 2JFHA 2Z08A 4ZPJA 3ZBQA 3DAPA 3GVPA 2V54A 4WINA 4EPXA 4BAGA 2JGRA 1QF9A 1XZJA 3JQFA 2P91A 3U4HA 1X7DA 2XNKA 1NNEA 1RC8A 3BJEA 3ODGA 1NPYA 1P91A 1RWBA 2FUKA 2B6NA 3V8QA 1XKXA 1L2TA 5DIFA 1DAPA 3H18A 5G1OA 5ICSA 1KMCA 1OGYA 1J56A 2GAFA 3K1ZA 4BU1A 2ZWIA 4N40A 1C2YA 3OTIA 4EG3A 3EEBA 4O3MA 4MUGA 1N2CA 3ROTA 2CLIB 5ES3A 5F4ZA 5TLSA 2A59A 1EXNA 5FWDA 1X9HA 5CYFA 3RODA 2F3SA 4DT1A 4KPEC 1NYLA 1Y3BE 5K0SA 3JQPA 5KYNA 1EWRA 1XZIA 4IIBA 5DULA 3NVKI 1JILA 1FSZA 1EDZA 2ZGVA 4EJFA 3KYCB 2B5VA 3PKZA 3D8SA 3I8OA 1FQWA 1P4HA 1SQ6A 1HUQA 3PE3A 4YMLA 1P2VA 2QQ5A 4TT3D 1G4HA 1RMTA 4S0XA 3EUWA 1N3BA 1Q1EA 1XHLA 2QL7A 3L4SO 2VUHB 3O82A 4UMFA 5DE3A 2VXBA 4NYMR 3IQFA 2H2HA 2PL1A 1X38A 3DZBA 5HUJA 1H2YA 1JA9A 4BQFA 1H2ZA 1AK9A 3CEHA 1NW9B 3F97A 4L27A 1GLVA 2XDWA 3FNRA 4JT2A 1GDTA 1H93A 5JQGB 2FQWA 4RV5A 1N57A 3EVAA 3N07A 2Y0EA 5IANA 1C7RA 2OXRA 1TD9A 1MORA 3M4NA 4IXWA 1RI4A 3AUTA 3G0CA 2H0RA 3JQ8A 4ICIA 5TMBA 4BNYA 2PEYA 2FRVA 5T5QA 4DLVA 2Z4SA 2DBZA 5DWVA 1JQBA 1V5IA 3L7JA 2NIPA 4KO2S 3M49A 5AOCA 4DSAA 5KX5B 3VYVA 1ULHA 2YOHA 5AM0A 1KETA 2MR6A 2QDKA 4B4OA 1AO0A 2PMCA 3ET4A 3GFFA 1N33B 4JZYA 5FTWA 5KCMA 5FD8A 3HCPA 3BDVA 4BWYA 1RRPA 1FX1A 1RBYA 4CMHA 3CX6A 3NGMA 4KFTA 3IJRA 3M3PA 1CRZA 4UQPA 2VAVA 2GN0A 4B4DA 3F7TA 5DYWA 1FYVA 1D04A 4KIFA 3GQVA 3H5OA 5EIWA 4AWAA 4DL9A 3OQOA 4UAVA 3RUDA 4E51A 4PGGA 2ZE6A 4JVSB 1HA3A 3AY6A 4Q05A 1M34E 2FN7A 2WF7A 3CM0A 2HXGA 1E6CA 5JMOA 1RM4A 2IEDA 4C14A 1JU4A 3T0GA 4MXDA 2F3TA 4CTMA 2ZSHA 2DHRA 5ALTA 3SPXA 3AEUA 3BSYA 4P82A 1JFVA 1NUAA 3R3XA 3O47A 5FL3A 4UJ3A 5K8CA 4IUDS 3NC0C 4G0PA 4LRXA 1AO3A 3JQGA 4I8IA 5BNZA 2ES4A 1DBRA 1KC1A 1TAHA 1Z4QA 2ZSEA 4KE8A 5C8YA 3P26A 3B8EA 1LPAB 4FFWA 2QTAA 3HXOA 4ND1A 1J8VA 1J21A 2QS9A 5EVJA 4B6QA 2DYKA 5C4IA 2PY6A 4WY5A 2PFKA 4U7GA 3WA7A 3Q5DA 4R2IA 1OREA 2YVAA 3S1LA 2Z2IA 1P61B 1V3TA 1G6HA 2NU7B 2XE8A 3EC1A 3K32A 4GMDA 3A3OA 5DW0A 3SEZA 3ZVRA 3RU7A 4J7CA 3TDMA 4BEVA 3FOZA 4AJJA 3F6YA 5KNLA 3HBLA 1L8AA 3MFQA 2QGNA 3DDWA 3FPKA 3RDPA 4JCCA 3MF4A 1J2UA 4O4JA 4EA9A 2D7DA 3D3WA 4I4TA 1HG1A 2CE7A 1C4OA 4RUKA 4DZTA 2NADA 1J0BA 4KNVA 1CZNA 3C14C 1EVJA 2DQ4A 1TC2A 1TZKA 3DMGA 4ERXA 1IATA 4BLSA 1ECLA 3P52A 3VHQA 5A9TA 5HM8A 4EJ6A 5JUWA 4X66B 2ETVA 3ENVA 1ZGHA 4F4JA 2NZYA 5FBVB 1U3TA 3WLIA 2DPXA 1II8B 1NW3A 1S3SA 4IOJA 3S1SA 1NSFA 3EEYA 3H16A 3MGAA 3IV6A 2CXPA 1P0QA 2AQ8A 3VX3A 3PIRA 4YCLA 1RWNA 4RK4A 1G9SA 2K2WA 5F23A 1TL7C 3DVLA 2PRJA 3DZ8A 2FUEA 4FHCA 1T36B 4QODA 3HBJA 3LL4A 4YP9A 1FSPA 1R0KA 2NQTA 3GO4A 4ISBA 5MFZA 2Z5VA 3T1HB 4D9BA 4KQMA 3BICA 2H92A 1CU1A 1BMFA 1MB0A 2DBRA 2GEBA 2OO7A 3L0OA 4DQUA 2YQZA 2CMFA 4FINA 3BPSA 4V1CI 4E1VA 1RTKA 3F7OA 2EFDB 2W6IA 2GPTA 4YLEA 4KQXA 2VUUA 4PO1A 5AYVA 4MW4A 4E15A 4MX8A 1JG2A 3FBWA 3VDMA 1DAFA 5AXDA 1QH1A 4Z0PA 1BOFA 5LQNA 1K6XA 4YMSA 1N9KA 3PVCA 1NLFA 2IDZA 5IFKA 2ADFA 1BMTA 2HF7A 2PJDA 3T7EA 4B71A 5LQRA 3HCBA 2PM8A 1LPBB 3GQBA 2BGKA 2H3EA 1EFPA 5TGZA 3QE2A 2OXFA 3I04A 3TQTA 5CDFE 1YE8A 3ZIUA 4EKIA 1VPWA 2G17A 2YFKA 4BLQA 1DT3A 5EESA 1JPJA 2QTBA 2B1JA 4Y6LA 3P2JA 1WUIS 4BNNA 3U17A 3CVOA 2ZUFA 2ATCA 3KQMA 1ADFA 3P5BA 1XAHA 4RVSA 1FSSA 2YN2A 4YP1A 2QY9A 3GCZA 3AW8A 3NRBA 1Q11A 3R3UA 1GG5A 5T6MA 5IT5A 3KK0A 4D3XA 2G9RA 3U4IA 4DABA 3EGXA 4Y9RA 4C5CA 4KXMA 3QBJA 1DEHA 2XUZA 4MVCA 2JI7A 3ECAA 4XQ9A 5LOVA 1UJMA 4LRUA 2A35A 5JW6A 3VMMA 3RNOA 4AS1A 1T6XA 1V4NA 2NVOA 4ZQFA 5J1SB 2Y1DA 4G4JA 4JITA 4QWWA 3TZ6A 3F4LA 3WYGA 5ECDA 4BCCA 1TJ3A 1KWKA 5C7IO 3U4GA 1Z45A 3SR3A 3UAWA 1NVVR 1RCFA 3IAM6 4Y1GA 4PC7A 5K6AC 1RHJA 3DOIA 1NLYA 3U7EB 1ILEA 3ZGNA 5ALSA 1TTPB 4MEAA 4XWTA 2NU6B 4X44A 3AYZB 3UEOA 1E79D 2Q1UA 1AXEA 4B47A 3RU9A 1JAZA 3HDHA 1THZA 2JLSA 4C1NA 2O8EA 2WYUA 1QPGA 3QMWA 4LXTA 1B43A 1R5JA 2V03A 3K15A 3ZX4A 1GN9A 1GQRA 3C5VA 3VPBA 1G20A 4RPCA 1QIDA 4EVIA 1EP9A 1R00A 5EJ4A 3TOCA 1XNQB 2PKQP 3MILA 3LT4A 4N03A 1IOZA 4I6JA 3L1KA 4PPFA 3EC2A 4NFSA 4PE5B 4RACA 5IT0A 3TJZA 3MERA 4AJ9A 1H66A 1KK3A 3PGA1 4O2BA 1L1QA 2FHSA 4WLOA 1YIAA 2I1QA 3KU1A 3LCUA 3AF2A 4R7GA 1MV8A 2VJPA 5D5HA 3SAJA 2D2FA 3QELB 3R4VA 1XVAA 3IFSA 5BQXA 2Y9MB 1X1AA 3F5DA 1NBMA 4O4JB 3U5TA 2J3EA 2IDKA 2J7KA 2OHGA 2XYRA 1E5XA 1YL5A 3PHIA 2C5GA 4DDTA 1XMQB 1DC7A 3OWOA 1M1XB 4O2RA 2WQ6A 3U61B 1CYDA 1B6GA 3F8TA 3BBPA 4QVKA 3VHXB 3ZCRA 3EVCA 2C07A 5AT1A 5JC8A 2WVJA 1WBBA 3IE2A 1I2CA 1Q20A 2QHXA 3D2BA 4XWAA 1P5JA 2FFQA 2Y0BA 1GNVA 2O2ZA 3P2EA 5CP8A 4F3CA 1JPVA 1I30A 2V7TA 4L9WA 3L05A 1NX9A 5KYUB 1KY3A 2QT1A 2JBAB 2V6FA 1SH7A 3CZ5A 1DG1G 1JG3A 1G8JA 1IC6A 4NCBA 4YHHB 5EZ5A 4G0ZA 4QA9A 4TUYA 4J76A 3GJ6A 1CR0A 2KM1A 4RXUA 3WGQA 4UULA 3CH4B 4KQJA 1E62A 2FOLA 4UU8A 1NJ5A 5ELXA 4TL6A 4NKRA 1SZCA 4WA7A 3EZYA 2XB4A 3MWYW 4KBYA 5AM1A 5TMDA 3W5JA 5CBPA 1X74A 1XZCA 2G25A 2HRZA 1IZ8A 2OFPA 2Y1XA 3FB1A 1NVUQ 1EX6A 2G1AA 3QLUA 4MV4A 5D00A 2VJKA 1RZUA 1IQ0A 2P9BA 1SUAA 1ICEA 1S7GA 2FEXA 4QXMA 1DEXA 4NOMA 5AW5A 4DDUA 1BD3A 2DFDA 4YRSA 4B3XA 4RULA 1J5EB 1GQSA 1HE8B 2UYOA 4PICA 3SXUB 1MFPA 3M3HA 4PG8A 2OZVA 1AV7A 3LUJA 3FOAA 4UDXX 4M9XA 4D97A 3THOA 4ZOCA 2VPXA 4HG2A 1DOAA 3HO6A 4LBYA 1AIPA 3ZWKA 3O3NB 4D9JA 4I9HA 5JRZA 5ALWA 3B5IA 3A2LA 1J25A 1Y8RB 3FHLA 3OSZA 1AZSC 4QFMA 5MN6A 4AWXA 4NZPA 4ZXPA 3IBSA 1RPNA 4G4SP 5JISA 5HJ2A 2QUIA 1NMQA 4LZPA 4Y2PA 3K8OE 1FFGA 3BGIA 2FEPA 1GTG1 1FXWA 1WHSA 4V2UA 2HFJA 2PKRA 2R86A 2WB4A 3GZTB 3O73A 3P0IA 4IJ5A 5CVTA 3T95A 4KFRA 1YA6A 2LGJA 3RIGA 4C9BA 3PQ5A 4XVHA 1YQXA 1Y48E 3SLKA 5HUHA 2AI2A 1ECCA 2RSLA 3FMPB 3P0FA 2I6FA 3N0RA 2AFHB 4I55F 3ABZA 2GSWA 4M3NA 3RFFA 5HGXA 5IZCA 5JSKA 2BT4A 3BFKA 1CNFA 3WIOA 3QEOA 5D85A 3I23A 1H42A 4I4IA 4EIWA 1V6CA 2PMWB 3EG9B 1NG1A 3F71A 4TKMA 5JD5A 3ZQJA 4CPDA 4JN6B 2Q5LA 1LWOA 2ASEA 3O7WA 4URFA 3FRHA 3K0SA 1E9DA 2G82A 4GG1A 2FEKA 2VP4A 4LXGA 1FJ2A 2BRUA 2FWRA 3IAXA 2Q7XA 1G8AA 3GN2A 4PRLA 5EMNA 4EQZA 3CG4A 4ZOBA 1JLSA 2Z5GA 3SKYA 4JBXA 4A2WA 1WD7A 5E6SB 4BC0A 1J0DA 2C3PA 3WLNA 2EFHB 2IZ6A 3GUZA 1QLHA 3QE0A 4YT5A 3Q0EA 3K4QA 1ZMBA 5CYPA 2H9IA 1F3LA 3A1UA 5LMUB 1I3OA 1JRLA 1YQUA 4ECEA 1N0HA 3BAZA 1QX3A 4WXYB 4JKOA 1YJXA 4BB0A 1WP4A 4EP1A 4JEMA 4G0NA 1VJ0A 3C7DB 3ILVA 4RK5A 1OWLA 4MTLA 3L7CA 4Z4EA 2BHLA 3FPLA 3IB6A 3Q0IA 1LVUA 4UBJA 3K4PA 4POOA 2AN1A 4GOMD 2EV9A 3KCQA 2HPVA 4IPTA 4LRQA 3KQYA 1DAHA 1I5EA 4Y30A 5GONF 4DDWA 3GDHA 2A58A 4MIYA 4R81A 2RBGA 2QBYB 3HXTA 5CB8A 4BNWA 4M49A 1R8SA 1FDIA 1U2QA 2JCSA 4YNBA 1Q7TA 1OB5A 4RHTA 3I5YA 4IX9A 1WX1A 1ZX1A 3T61A 4F6RB 1IVNA 1ZRNA 5DEIA 5DNDA 3SYTA 3I5XA 1IXZA 2JLWA 3QFRA 2I2XB 1CX9B 2RK3A 2YXNA 2CJWB 1YZGA 1BH2A 3HG7A 3ZXUB 2LPMA 3N86A 4Q03A 2GZSA 3PR1A 1NFFA 4UEWA 4MW6A 1EWKA 2R4QA 4G41A 3UMVA 3WKBA 1LLUA 3T9EA 3UXMA 5KYXB 1P29A 3L02A 2ZI4A 3PTLA 3OIGA 1E92A 1K7SN 2CXOA 2I6QA 1L5QA 3OH8A 1IK4A 2YBDA 4KQGA 2FPIA 4X1OA 4Z9AA 4D6XA 1ACJA 5FUBA 2VHQA 2FPXA 4Q5IA 3H2JA 5BPFA 1O6ZA 2C2OA 1QH8B 2N1BA 1WLYA 1YQGA 3RSZA 3VNSA 5REQB 4YUXA 5K9ZA 4JB3A 4N8EA 5T8KC 4AMVA 4JJ8A 1IHDA 2REOA 4KAAA 4BO8A 5KYYB 1FUYB 1YB4A 3NCTA 5ALJA 4HN2A 5G0SA 1EGMB 5JS8A 1NWHA 8ATCA 4N0DA 4X54A 3QIAA 1YRHA 2RBKA 4E2FA 4RSMA 1GPBA 1JWBB 1P9NA 1SAYA 2XPCA 2IY7A 3FCSB 4B3RB 1Q1AA 4RLHA 4Q4JB 5JAIA 1SCJA 3CWQA 1NXVA 1WW2A 1BDHA 4WERA 1NTRA 3KD3A 4S2UA 3GJ0A 1K4YA 2VJMA 3I83A 4C08A 2HJHA 3KLOA 3NBQA 4CRWB 5I6DA 1VPEA 3GVIA 5FHRA 3VXKA 5C18A 1E7QA 2HLPA 4ND5A 3WAGA 4M9CA 3DXYA 3KEOA 3O7MA 4RTLA 1P2FA 6LDHA 2UYYA 3RANA 2HQSA 4WZ6A 2Q3FA 1OASA 3J7TA 3OIYA 5FXMA 3TMYA 3IVCA 4AI6A 3CEMA 4IHAA 4BV9A 4RW0A 2BEUA 1PFGA 1RXEA 4DLRA 5BR1A 3PJEA 5MF6A 1B6TA 1Q0UA 4HTFA 4UBIA 5EJ8A 4EGAA 1E7MA 2P7IA 5CLGA 4CDRA 5T67A 3B52X 1AA6A 3KKOA 4WK6A 3OZFA 1EK2A 2UVDA 1ISHA 1X87A 5H83A 1GA1A 2BAGA 2H16A 1V5GA 5D1NA 2O5EA 3CT4A 4LDZA 1FDWA 2OBBA 3I39X 1XMVA 4QRHA 5F5XA 2JGLA 5H80A 3EGEA 1V3VA 1UP4A 3HB5X 1I7LA 1KS2A 1ODFA 5LMCA 3TG8A 4S04A 1B0UA 5FL7A 2ZVPX 4UU0A 3B2EA 4CM7A 3KTAB 2ZRJA 3GHHA 3PC8A 3PZRA 3SX2A 5H02A 2F2TA 3Q40A 2JCVA 2JC3A 3ZHZA 5FOWA 1MPTA 5KJ6A 1M0TA 3AB7A 5KJCA 1FFSA 3DDNA 4I55B 1RKXA 3P9ZA 2J45A 2C94A 2BMEA 5IABA 3N70A 3NWPA 1ZC3A 5IF9A 1I2BA 5M3BA 3WGUA 1XEWX 1Y1TA 1UQRA 3ESYA 3H86A 3I9MA 3KPYA 4CUZA 4GT1A 1W4AA 2QUHA 2EX1A 1QIFA 1CUXA 1DFGA 4BUCA 2NZJA 3PUKA 4DRZA 2GKOA 4I4NA 4LTDA 4NPCA 3FD8A 3A36A 4U7PB 4DDHA 4YYZA 1RRFA 4BNZA 2CHUA 3NIBA 4BKRA 2HSEA 3ENKA 1I8TA 4RQTA 4QBHA 2OQRA 3EHDA 5ALYA 3OQBA 1RD4A 2HYDA 2W0SA 2DPLA 1EJBA 4H59A 4CODB 1H4QA 4FW9A 1K3UB 4LGMA 4YAWA 3OQIB 2BW0A 5HIAA 1R6TA 1QLJA 2M6RA 3COPA 1GA6A 3F74A 5F73A 4D42A 5JJKA 2R11A 3RYHA 3MT0A 4LY0A 4CIVA 1FUIA 1GZ6A 4MRRA 1USUA 3O74A 2FJUA 2H4ZA 4FSXA 1A5ZA 1Z6QA 2CLEB 2D54A 4I5IA 1O6GA 3TD6A 2ZPUA 4CHGA 1IFXA 2FKNA 2JZNA 2PWBA 3PI6A 4JL5A 4CLXA 3K1AA 3M81A 4REMA 1CUSA 2XJ4A 1S1CA 4EJSA 2OFFA 2EEZA 4QOSA 3C3YA 4FNGA 4HUQB 3HVIA 5JY6A 3R7SA 2CV2A 4CGYA 2VSOA 1TU0A 1Q0ZA 3EFOB 3QOXA 1XVTA 3VBEA 2NO7A 3P19A 4JSYA 4BVLA 2QX4A 4D6YA 4QX6A 1CY0A 2O1EA 4XX1A 2V3WA 1N2GA 4TLLB 1CCWA 4F7DA 3F67A 3QUQA 1AZLA 4IXMA 3QF7A 4MUMA 1K7XB 1Q3KA 1ZD9A 2ZUVA 5BRAA 2QAGC 2W9XA 1F0YA 2HF2A 3DV2A 2CDCA 4KQIA 4RF4A 3RFUA 2O1XA 3SD7A 1GGNA 1IZ7A 3SNHA 1MAUA 1NBIA 2GPSA 2IH2A 2HOQA 2JIZA 2NO6A 2ZJ3A 5IHPA 2IXFA 4E33A 5J2TA 4UM5A 1ZN8A 3AEKB 3OHSX 1ANKA 1XLWA 4AZ3A 1W52X 1GLNA 2F4NA 1WXXA 2ODBA 1TCBA 3VZPA 1A7UA 3DTVA 4H7JA 3SR0A 1W5BA 1NU6A 3BMCB 2F90A 2JGNA 3DEHA 4DQLA 1UMDA 4X7RA 1Z12A 2CBZA 2FEOA 1KDTA 3NO4A 1H4SA 2VDKB 1YV9A 2NZXA 2FY8A 4HJXA 4HTFB 1IOWA 1ODKA 3SQNA 5U4XA 4Q3LA 5C3MA 1FB5A 3VKFA 5TX7A 3HU3A 4V38A 3OQHA 3CT6A 1U9ZA 1Y81A 5I7FA 2ENUA 3IQXA 5EZQA 3ZLUA 4C7OB 2C9YA 2J5KA 3EVTA 3MJSA 2DMRA 4RTOA 2YV4A 1R7RA 2GHTA 4LK2A 3SSMA 3QITA 3VH3A 1GL6A 4W5TA 3IXQA 2P5YA 5T7BA 3HKCA 5HZGA 3MMNA 1XAGA 4HX9A 1P77A 4US2R 1C3OA 5TPWA 2PBRA 1E58A 2V7XA 3VDXA 3AJDA 3NDRA 2KLBA 1X1TA 3P2KA 1HDRA 1L5RA 1P7VA 1PDWA 3PC2A 3QJYA 3IPYA 2HKIA 3KB6A 4KYTA 4X1IB 4XJSA 4LX8A 4CQMD 1E8NA 1HYGA 4JBGA 2IU6A 2AMJA 2B3TA 1Z6AA 3SVLA 1KFJB 3WK6A 1O6CA 5DBGA 4MV7A 2CLKB 3JALB 2GH1A 4JGGA 4PXSA 5KQRA 1W85A 4B40A 1XCGB 1HEIA 5J5CA 1DVRA 2W2OA 1ZEJA 3SG0A 2WJ3A 1K63A 2E48A 1RJWA 1HI9A 1EH5A 2QIOA 4F97A 2VYCA 3S8EA 1U8AA 2H2GA 2MYPA 3EWSA 1NHWA 3HV0A 2QM8A 3QVTA 1E4VA 3N2KA 3D3EA 1H5UA 5I5EA 2H1CA 2YQ4A 2PEZA 1DRWA 5ICCA 3BIXA 3INYA 2W37A 3HV2A 4MH0R 4LC0A 2W6OA 4G81A 4UFPA 2DAPA 4ZT4A 4JUCA 5IWCA 4K3VA 1EEXB 2P1RA 1EG7A 1ODIA 2FPPB 4FR2A 5FF9A 3ABQB 4AJHA 4MR9B 4BTEA 2NTJA 3C39A 4V0RA 2XT0A 3Q15C 4WTOA 2XOXA 4WASA 1AUXA 1JLLB 2JHGA 2OUIA 4BL5A 1GWNA 3AESA 1NF9A 2WHRA 3LBIA 5J47A 2G28A 1LGYA 3SP1A 3Q7QA 4ND3A 1B6RA 1NNUA 1LRKA 4YI5A 2WJAA 1HT3A 1H4VB 3E8XA 2NXJA 1R66A 4PSAA 5JPIA 3UIEA 3HNPA 3GLHB 4D92A 3KQNA 2V3CC 1DT5A 4N65A 2RGRA 3LPCA 2A1TS 2C61A 1LCIA 2BCJQ 4FNOA 3LM8A 4G1UC 4DJAA 4B3HA 2YZKA 3OCZA 3FPBA 1ZBDA 5KNCD 3JAKB 1HQCA 1SC4A 2JJQA 4NS4A 4PX9A 5JNWA 2ANCA 1XTJA 4CM9D 2E4WA 3SIXA 5EIXA 1Z2OX 1DZIA 3GT7A 4KXLA 3UAVA 1Q19A 2BV3A 2PUJA 2ZR9A 2X0EA 1T2AA 4F4CA 3QTTA 3RIHA 4DA0A 4B17A 3PFCA 2HBRA 3F6SA 1TA9A 1K3FA 2XLCA 3EK2A 5FAKA 3OVMA 5HTKA 1E6WA 4I1SA 5BSUA 3DQPA 3LI2A 4AUNA 4RDCA 4ALJA 4KREA 3ICOA 1V96A 2WWRA 4DNQA 4IV0A 1SQGA 2B5WA 3B9QA 4DC0A 1NFRA 1VLHA 4LNHA 4DM3A 1KO5A 5LFAA 2PKQO 3BGDA 4MI9A 1DINA 1OU0A 1T8PA 1XGKA 2FETA 3BAFA 4J1TC 4TTVA 3T9DA 3ZCPA 3F2IA 4YLYA 1QV6A 1EE2A 2NUTB 3G0IA 4EB8A 5BMOA 1P1FA 4A36A 1P19A 3JYLA 3NTRA 4N39A 3A14A 1U8TA 4PCVA 4Q1EA 1ULBA 2J5QA 4PFJA 1BE8A 1A72A 1GG9A 2GK4A 3MGGA 4WFIA 1GGVA 4MYSA 3E0XA 4CEHB 2IP2A 4F7WA 1CLEA 5C7LO 5JNSA 3RVSA 1J9GA 1NUTA 1RFLA 3GDOA 2H1VA 3LT1A 4II7A 3T5GA 1SUPA 1JHUA 1EXWA 5DV9A 3I2JA 3VYUB 1T26A 2YW9A 4ZRDA 4F91B 2CUZA 3TR6A 3CZMA 3EXHA 4BLUA 1ZM9A 2ODQA 4KKXB 3JYPA 4R1UA 5H70A 4BDTA 4Y2SA 1KPHA 4M88A 4W1SA 1REQA 4PAWA 5GMOA 4DY4A 2P1DA 1HFWA 3FZYA 1CRWG 1GNPA 3IKVA 3DZKA 2PS1A 3LP5A 4RXTA 1XRNA 3HB9A 1IUKA 2IHYA 4I1YA 4OAPA 4HK4A 3X44A 2MU1A 4CMIA 4MROA 3BT7A 1OIVA 4UDOA 4V0ME 4O1IA 5KMGB 3FTQA 1SKQA 4BLVA 2VDWB 1NVTA 2ZJ7A 2YDYA 2ZI7A 3FH0A 4S24A 4BJ6A 5IJWA 1F9AA 3KZMA 3MMSA 3D8TA 4FFDA 3IH5A 5C5CA 5J23A 1IULA 5JZ9A 3QX9A 4WW0A 1W76A 1DC6A 3VH4A 4AG3A 4MYHA 5KSWB 1B0AA 1N8SA 3PF8A 2AXQA 4P4NA 2WVHA 3HYRA 3L7MA 1JHAA 2ZP1A 2E49A 4YMIA 3KPVA 2FGJA 2UZ3A 4ETMA 4LFCB 1WS6A 1U7HA 3SEFA 3WGNA 4I1PA 1W0JA 4J0DA 5JD6A 1QMGA 1Q22A 4Q4AA 1H1LA 4UU7A 4YAKA 1GARA 2R8ZA 5HIMA 3ZKAA 4KQ6A 3X1XA 4RX1A 4ENQA 1X92A 4OL0A 4DE5A 2LD4A 3AIIA 4M1YA 1YS2X 1UF9A 4R1PA 3WFJA 4BGEA 4W7IA 5K8LA 5B3JA 4GLJA 5LKAA 2H06A 5AUPB 2Y4NA 1GZ3A 2BTQB 1GCUA 2W2XA 4JUFA 4KQKA 5AR1A 3K0FA 5A06A 5EUQB 2VXYA 2RHGB 4LXHA 4NTZA 1TO6A 3CBGA 4W9RA 4L7VA 1U2RA 5JANA 3EUEA 1TCAA 2X22A 4L5YA 4N01A 1CIVA 2VPTA 1V25A 5JCJA 5FJJA 2M32A 3E5HA 4G4SO 1NN0A 1K0FA 2GKSA 3W7AA 2B9VA 4G97A 3PDIB 4L9RA 4NIMA 5KTNA 1W44A 1KQOA 1WEKA 4PBTA 1FSGA 4DJDC 4FFMA 1H8EA 4MINA 5TGDA 1RM0A 5NLLA 1GQQA 1GPKA 3EVZA 2Q3DA 3BTUA 3S6JA 4BZWA 2SNIE 3MA0A 5A4MS 3BK2A 1DRKA 5IZ4A 4GQBA 2YDXA 3RKUA 2C7GA 3ONWA 1GUDA 4LJ7A 4QSHA 1IHUA 1PHPA 4PLYA 4ITRC 1R4MA 2UU9B 4L16A 1G41A 3BX1A 2YFQA 3M7IA 3RW9A 1KOLA 1TLLA 4CIDA 2NUPA 1ML4A 1GCOA 3I42A 4ZI2A 1T10A 4FYXA 3LCCA 3T5BA 2G8LA 3B82A 1U1DA 2IEIA 5CK5A 2VHWA 3ACCA 3LY9A 3PGLA 4KNYA 4OU4A 4LDNA 3WICA 1XXHE 1ADJA 4FHEA 3OZBA 5FFMA 2PCLA 1GNRA 1PRYA 2C2GA 2FPGB 3CLRD 1XZDA 2BSXA 2QLTA 3AP3A 1ZOSA 2VJCA 3NC4A 4M4SA 4EA8A 2B30A 1KI8A 3T4EA 4ZFNA 3WLOA 2QSJA 4UQLA 1UT8A 1OAOC 1WCWA 4JOQA 1FP7A 4RORA 5HJ5A 4LEIA 3IUYA 2Z1DA 3JQ9A 4YGXB 1STOA 2BHNA 5I7AA 6Q21A 1YACA 3OIUA 3N2EA 2IYTA 4DLNA 4NLLA 5A9SA