4P38A

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with azd8329
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYNWDRFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Novel acidic 11 beta-hydroxysteroid dehydrogenase type 1 (11 beta-HSD1) inhibitor with reduced acyl glucuronide liability: the discovery of 4-[4-(2-adamantylcarbamoyl)-5-tert-butyl-pyrazol-1-yl]benzoic acid (AZD8329).
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4p38A00
3KLPX 4LK3A 5JSFA 1ZW1A 4U0JA 1ISIA 1SO8A 4KTVE 2JCYA 3F47A 1BG6A 3GAZA 2YY7A 3PP8A 4CLXA 3BAZA 2OORA 4GX0A 1T2DA 1HETA 3JD2A 1T2FA 1PJLA 3VZQA 1NP3A 3AM3A 3AW9A 4YJGA 4Q3CA 1DRUA 5GY7A 2VHVA 4OOFA 4RVFA 1G1AA 4A7PA 9LDBA 4AICA 4KOAA 3BMNA 5JO9A 3PQEA 4BO1A 1QLJA 1XIVA 5T67A 4FOSA 2JCVA 2Q1WA 4GWKA 3ZWNA 5A9RA 3GT0A 3C1OA 4TRNA 1I2ZA 2FPIA 4RPKA 3I1JA 2I9PA 3VAZA 3WMWA 3LF1A 4I08A 1U4SA 2V6BA 3EYWA 4YACA 4ZICA 2C5AA 2AG8A 3HB4X 2DTDA 4B7XA 4DLBA 1BDBA 1JDJA 4J7UA 3SXPA 2VN8A 4U6SA 5JPIA 2CZCA 2DC1A 2I3GA 2BFMA 3E5RA 1DPGA 5G0VA 5CEJA 2Y1GA 4J0EA 2UYYA 1PQPA 3CSDA 2H6EA 4BQPA 3BMCA 2HQ1A 4EBFA 4IXWA 1ZFNA 4IQ0A 3HDHA 4DXHA 1PJQA 4DIBA 2NV6A 3W6UA 3H2ZA 2JFHA 2O48X 5ILGA 3OJFA 1B3RA 1K6IA 2IXBA 2P5UA 4HADA 1SBYA 4Q3DA 3ZU2A 3D5QA 3B1FA 3H7AA 4GVLA 1PWZA 3ZWBA 1P33A 3LU1A 3ZDFA 3NEPX 3BTUA 3JQ8A 1T2AA 4DC0A 1XYGA 1X0XA 2JD2A 2DBZA 3HHPA 3IL2A 5LC1A 3QQPA 2QW8A 1U28A 5AVOA 1E6UA 3CPSA 1ZBQA 3U4DA 3V1YA 2DPHA 5I9LA 5I8WA 2QX7A 1B16A 2DBVO 3G79A 1HYEA 3QV1A 1JA9A 2R00A 4FGSA 4ND1A 5KIAA 3X2FA 1CQIA 5TNXA 4WUVA 3KOUA 4E0BA 4ZA2A 3LT0A 3IQDB 3D3EA 2Y67A 4M54A 3WNQA 2EIHA 1OI7A 3H3FA 3SLGA 4AJ4A 1P0FA 2X23A 2JFGA 2Y0DA 2G76A 4NHEA 4O6VA 4GKBA 5HBRA 1PQWA 2OO5A 3WLFA 3ZHBA 1UXGA 4L73A 1LA2A 3JD0A 3OA2A 3AFMA 1N9GA 3I6QA 4L75A 2W98A 3FN4A 3JTMA 4IXTA 5G0SA 3VH1A 4I5EA 2C2YA 2ZYAA 4E33A 4PG6A 3JQAD 3NV9A 4WCDA 2Y05A 5F1PA 2IYOA 4NU6A 4R41A 1WDKA 1S6YA 1J5PA 4XQEA 2WD7B 2OZPA 3HJAA 1LDYA 5L53A 5U4QA 2HMUA 4J1SA 3L77A 4MDHA 1HDXA 5CPBA 3WDSA 3ZV5A 4YT2A 2PD4A 5K6AA 2NU9A 4S1VA 5TLSA 4XYEA 5TSDA 3S2GA 1I30A 1LLQA 1KEUA 3MJSA 4PZCA 3ETGA 1F8FA 1JKJA 1I2BA 1EEHA 1OMOA 3FR8A 1V0JA 3C7DB 5ER6A 2ZATA 3QRWA 4MKXA 2PNFA 5JDIC 3U3XA 2ZB8A 1ZXLA 3K2BA 4E5PA 1D1TA 1E7WA 3WQQA 4J2OA 4U6QA 2ZB7A 1EVIA 4FFLA 3GG9A 4KUGA 4BNTA 5F5NA 2I67A 4NZ9A 4DVJA 3LYLA 3PHJA 1DC4A 1E3JA 2FR0A 3RU7A 3JQGA 1B14A 1NR1A 4Q3EA 1WDMA 1KC1A 1CIVA 1YH3A 1ZIDA 3F5QA 4XR9A 3NDIA 2NU6A 2ZYDA 4DPLA 4W82A 1KVQA 2BH9A 4WOKA 1B7GO 1K5HA 3JD1A 4XZ3A 3VDQA 3PHLA 2A35A 3PEFA 4MVJP 3GVCA 4GMGA 2W2KA 3SX2A 3H9QA 4ZQFA 3FSRA 1YS4A 2CDCA 1SNYA 1KVTA 2Q2WA 4UVGA 1YQGA 5MDHA 5DBFA 3FR7A 2O4UX 2EG9A 3ZV3A 3ROPA 2A9FA 1T1SA 4E30A 3GLQA 1CJCA 1HZZA 2EWMA 1NQAO 1O89A 1LDMA 2WEKA 2UUPA 4I9NA 1U7TA 2B5WA 3CZRA 4URFA 3DO5A 2A92A 3QA9A 4RF4A 3TOXA 2YHIA 1U8XX 4UUMA 2GRAA 3VZPA 5G2OA 1GQYA 1VJTA 4J6FA 3IP1A 3RQSA 3DBRA 2DTXA 3CZMA 3K92A 4YAEA 2IXAA 1E6EA 2FSSA 4AJ1A 2VZ8A 3OJOA 3Q6IA 1UXKA 3ONEA 2NSDA 3TNLA 3TFOA 1RM5A 1LC0A 2P2SA 3DMYA 2AMFA 4NK5A 3V1TC 1PZEA 3INGA 1H6CA 3RFTA 1MC4A 5C5IA 4I8XA 1QR6A 2D5AA 1DSSG 2EJVA 1F14A 4Q3AA 4JQCA 3OJEA 1BHSA 4CM9A 2ZQYA 2J3HA 3WGGA 2FPGA 3OECA 1PR9A 4IZIA 2CDAA 1JAXA 1JVSA 2WM3A 3OEWA 3ZWYA 4XA8A 1MA0A 3RUDA 1I24A 1JW9B 3BHJA 5IJZA 4ZN6A 2GSDA 4NI5A 4XDYA 1K3TA 2C29D 3GGGA 3DTTA 2HU2A 1U3UA 2VTDA 3GMSA 4XGNA 1ZK3A 1QXSA 1ZH8A 4MVJG 1TLTA 3M6IA 3F4LA 1BXKA 3QWAA 5F3RA 1KEPA 3B6ZA 1IYZA 2PKQP 2WE7A 4TKMA 3L9WA 2HK8A 4RCVA 4RVGA 3E9QA 4QXMA 1ULSA 1YO6A 1ZUD1 2HO5A 1W0CA 4ID9A 2YDYA 4RORA 1IUKA 4UVIA 5KJEA 1LRLA 2FSVA 4FB5A 1C0IA 4CQMA 1ENPA 3WS7A 1C0PA 4L8VA 4RV9A 4Y6PA 5TJ9A 3BMQA 1J4AA 5L45A 4LVUA 2CVOA 2IODA 4GX2A 3G0OA 5JDIA 1J6UA 3ULKA 4YJFB 1PL6A 1KETA 5CDYA 4RPHA 5F1OA 5LDHA 2B36A 5KNLA 4IDAA 3C1TA 2Y93A 5C7IO 4HFJA 4FN4A 4DC1A 4MKZA 1AXEA 3WICA 3PJFA 3PK0A 4B4VA 4CR6A 4YR9A 1O6ZA 4INAA 2QRLA 3UICA 1YDWA 4FGWA 1JKFA 4G65A 4EGFA 3RSHA 3U09A 3RBXA 3ROMA 2CY0A 3DR3A 5IDXA 3AI3A 2D3TA 3GPIA 3MJEA 4N5NA 3TZ6A 1GADO 4IPTA 4Y9DA 2GN9A 4XDZA 5AXAA 1KYQA 1LUAA 1PS8A 3GHYA 3Q9NA 4CM6A 4DL9A 5HWSA 1SEVA 1YE3A 3QHAA 5DZSA 3IIEA 3F6YA 1WMAA 1B2LA 3H5AA 4HFNA 4A0SA 4ZJUA 1IHYA 1DC6A 1QYDA 2JL1A 2VUUA 4R1SA 1JKIA 2OBNA 3H8VA 3ONFA 4D43A 3HDQA 3RKUA 5KVCA 2I66A 4CMEA 1E1MA 4HUJA 1CRWG 1LLDA 1AE1A 1ISMA 1JQBA 3U9LA 5A3JA 4ZQGA 4BGVA 3FTPA 3R3JA 1ISGA 2PK3A 3GG2A 2YDXA 5JC8A 3HSKA 4BNWA 4PG7A 1XR3A 4ALNA 1C1DA 4CUZA 4FFMA 1DXYA 3PTZA 4B8WA 3LZ6A 4EUEA 4YT5A 4RJTA 4FS3A 3RBZA 4E5NA 3NTRA 4RPGA 1DJNA 4J90A 4CMIA 3GMDA 4CR8A 3U4IA 1E5LA 1H6AA 3MCVA 4BVAA 4KUHA 5H81A 1YVEI 4JBIA 2FR8A 1R16A 1MXFA 1XWFA 2EGHA 5I9NA 3JYPA 2B4QA 3UAGA 1E7SA 1WZEA 4DREA 2X7HA 4RPLA 2B83A 1Y5RA 3L0DA 1IZ9A 1ADFA 1I3NA 1P1JA 3FNGA 1N1EA 1X1TA 4Z0PA 1YGYA 4MVJH 4DPKA 3RASA 3JYQA 2EW8A 3QSGA 3AUSA 4DIFA 4O1MA 1CETA 3G49A 4IDFA 5A1TA 2NLOA 1DFGA 2BGMA 5JO0A 1UH5A 4OL9A 5I7SA 3ENKA 1MB4A 3BIOA 5JLAA 5IDYA 4XCVA 3BHIA 2DT5A 3IUSA 2WYWA 1NPTO 4F3YA 2VYND 4DA9A 5B4VA 3DC2A 5CFZA 3IP3A 4PLVA 1HSZA 2PZJA 2J6IA 1F06A 1R4NA 1FDTA 3F1KA 3JQ9C 4CPDA 3IKTA 4DQVA 4ZVVA 3NJ4A 5DBGA 3RCBA 4R5MA 4RF3A 1TI7A 4IJUA 3GUYA 2PLAA 3TQHA 5EJ2A 1E1KA 2JKVA 2GNAA 4BKRA 3WJ7A 3JD3A 2VUTA 4OKNA 3AU8A 1EFLA 1NFRA 4KMSA 2GUGA 2ZK7A 3GR6A 1LDGA 4E5KA 3EC7A 4NBTA 1X7HA 5A9TA 3HDYA 3QVSA 4NPCA 2OP0A 3V8BA 1OC2A 1T2EA 3I52A 3DOOA 4CMGA 4MVJF 5THQA 4RF2A 1PX0A 1G0NA 2W8ZA 3S2FA 2W90A 2X5OA 3ZWXA 3BTSA 3JYOA 1UXIA 1E1NA 4E5YA 2X9GA 3JSAA 3FHLA 5GMOA 4NJMB 2EHDA 3ASUA 4KQXA 5G4KA 3DBLB 3KLMX 4UEOA 1BXZA 2BGKA 4MVJD 1YL5A 4W7HA 4UUPA 2XF8A 5BSHA 2IEDA 3K73O 3KYCB 5L7TA 2NQTA 4JJGA 4BB5A 4JJFA 1DO8A 4TZTA 1Z6ZA 4R5HA 4RDIA 4XGIA 2WJPA 1MC5A 3V5NA 3NTOA 3ADPA 3SC6A 4M1QA 3WGIA 4PLCA 3P2YA 2HMSA 4JP3A 4LSMA 4Z6KA 1R4MB 2BFAA 1K6XA 3I9KA 4LCEA 4Y98A 1OFGA 4WJZA 4IINA 2O3UA 1CWUA 4GLLA 2PD6A 4CLHA 3S55A 3ZU3A 3RC7A 1QYCA 3DAGA 4BMSA 2V7PA 1DLIA 2J3IA 1WAMA 3DFUA 4N5LA 1G0OA 3D4PA 3O9ZA 3F5SA 1JU9A 2X4GA 3CMCO 3UCFA 4IIVA 5A05A 2Z95A 1ZJYA 4PN3A 1LSOA 4LRTB 3PZRA 2F1KA 1PU2A 2ZCVA 5A04A 1DIAA 1U3VA 1YB4A 4PZEA 3EDMA 3S8MA 4YPOA 5JCXA 4RZIA 3Q2KA 4JLWA 2RH8A 3AY7A 4JXKA 4PLWA 4OJNA 2X0NA 4NFHA 4NMHA 5KVQA 3W8FA 1GZ4A 4NQZA 3H9EO 2C7GA 5KCZA 1N2SA 4NBUA 1E3IA 4AJEA 1Y81A 2O2YA 3EGOA 2Q1TA 3ZCXA 3WFIA 1YDEA 1YOVA 4GH5A 3WBBA 3I4CA 3Q11A 4DLLA 1P77A 3E18A 5JAQA 5BSEA 1NVGA 3DOJA 2O3JA 1WW8A 3VVCA 2Z5LA 1DIGA 4WCFB 4BL5A 3JQ9A 3TOZA 2XOXA 5IZCC 4CQLA 4BS9A 1HXHA 1H2BA 3ZH2A 1QYVA 1Z45A 5G0TA 1I33A 5KKCA 2AEJA 4GLOA 4ZGWA 2DTEA 1NHWA 1DAPA 4HY3A 1HF3A 1PJCA 1ZMTA 2J5RA 2HRBA 2NU7A 2O4CA 3PGXA 1LQUA 1ZK0A 2X0RA 4FOOA 4AJNA 1M66A 2O3RA 5F1KA 5HTOA 3DDNA 3JD4A 5JMWA 3WGQA 1ENYA 3ZI0A 3OM9A 1ARZA 3DZBA 3TZKA 4HWKA 2DU8A 3ETEA 2QZ9A 1NAHA 4M55A 3IC5A 1K0UA 2HJRA 2AXQA 2NTNA 1ULUA 2Y1FA 1Y8QB 3CXRA 3GN2A 4ALLA 5ILOA 4FDAA 4MVJI 2OGUA 5G0UA 3GGPA 2Q49A 4FFOA 2HKIA 5L7YA 4I5GA 4XB2A 3KSUA 3D64A 1NWCA 5IAAA 1YJQA 1B15A 4WLVA 1YXMA 1Z7BA 3UFXA 2BFPA 4RLSA 3Q9UA 1Z73A 1NWHA 2J3JA 1T1RA 3A9WA 3H65A 4Z9FA 1AHHA 1VRWA 4O63O 1A72A 1PIWA 5IN4A 3RC9A 2NTJA 3JQDA 2NUAA 3OP4A 1I5RA 5ICMA 1DAOA 2YV1A 4O0LA 4J7CA 4WPGA 2PWZA 3KSDO 1YONA 3JQ8B 4R51A 3S1LA 2RH4A 1RYEA 1X15A 4K26A 4YVFA 1EBUA 3JQAB 1EUCA 3P5SA 4KQWA 5EQDA 1DLJA 1YL7A 3X2EA 3DZJA 1A9ZA 1ZSVA 2WDZA 3GZNA 4PLYA 1NAIA 2R00C 4BNKA 1VM6A 3ENNA 3I23A 3NRCA 2POQX 3ZW9A 2SCUA 4LCJA 4AG3A 2UUOA 3JQBA 4N5MA 2C7VA 4MP6A 3FTNA 4CM7A 5L51A 4EITA 4JX8A 4DRYA 5JY6A 1DDOA 2TMGA 4N54A 2DBRA 3H9UA 4GWGA 3MOGA 4PFJA 1KVRA 2H9IA 3CE6A 5T64A 4BNNA 4E2ZA 3I9MA 4FD3A 3EVNA 3PYXA 3CKYA 2WSBA 1E7RA 5EPOA 2CUKA 1GV1A 3ZHYA 2NVUA 3DHNA 3UHAA 3VKUA 3GNTA 4MP8A 1QSGA 1UP6A 3RWBA 2OXIA 2RCYA 1EMDA 4ND4A 4GBJA 2BRUA 1EFKA 3RU9A 4E5MA 1XEAA 1GYQA 5IZCA 3M1AA 2C07A 5DCYA 1X7GA 3R3SA 1LRKA 1LBEA 1R66A 1VKOA 2HMTA 3BMOA 1ZNQO 4P8RA 1B8VA 5EERA 2X9NA 3TSCA 5K6AC 4B7CA 4IQGA 3W1VA 4XD2A 1U3TA 2W4QA 4CV3A 4XQGA 2EEZA 3I4FA 3NUGA 3OF2A 2EGGA 1EVZA 1U1IA 4CM8A 3D0OA 4QSMA 3JQ7B 2Y68A 1M6WA 4BUCA 4YJHA 2B0JA 5DN9A 2GLXA 1BW9A 2X22A 4YRDA 5IFLA 1DHTA 3UW3A 2O7SA 3V2GA 3PHHA 1B8PA 4OOEA 3AWDA 2EW2A 1W8DA 3T7EA 3DTYA 4IIUA 3JQFA 3JQGB 4PVCA 1RYDA 1YQDA 2C82A 3D4NA 3GVXA 1A7AA 4QFDA 1A27A 4AJOA 4PZDA 3D7LA 1B0AA 3PI7A 1E92A 5I9MA 2X0JA 5JCJA 1E3LA 1VC2A 3ZU5A 4A73A 2AW5A 3GVIA 3PVZA 2AQ8A 4GX1A 3INTA 2LDXA 3E9NA 5BT9A 2BD0A 3LC2O 1P45A 4BHTA 4ND3A 4HXYA 1PJ2A 4J9UE 4A27A 1M67A 2UV8A 3L6EA 3VH4A 3DBHA 1V8BA 3T7CA 1B26A 4CMEC 5IXSA 1U3WA 1UXHA 4WNCA 2HDHA 1BMDA 4E32A 3AY6A 1F17A 1XELA 3SJUA 4AL4A 3C3XA 4D3SA 2O7QA 2GASA 1Y5MA 4E21A 2C20A 2Z1MA 4WOJA 4MVJE 1HE5A 3DBRB 1DC5A 3AK4A 1HLDA 2JAPA 4EDFA 3NGLA 4R9SA 3VZSA 3V1UA 4EYEA 3FPCA 5IXYA 1HTBA 4JCOA 3FCOA 3OSUA 4JGBA 5CEFA 3D5TA 4D42A 1KEVA 2VYVD 4XIYA 4BV8A 1ID1A 4J4TA 3ROQA 3E8XA 3O26A 3ZWOA 2NWQA 1X1EA 2ZTUA 1SOWA 4IQ8A 4LW8A 4RVDA 3OQ1A 1BTOA 1H2HA 2WYVA 1QYWA 2V6FA 5KJCA 4U7WA 3FRJA 1IE3A 4HBGA 4IJKA 4UEKA 2R2GA 5T6BA 3UGKA 4H15A 4YTEA 5BSGA 1C1XB 2DBQA 3T4XA 3DZIA 5A5EA 4ALMA 4YA6A 3HE3A 5L4NA 3WMXA 5BNIA 4BNZA 4Z3DA 5DOVA 5C37A 4UREA 1GUZA 4IMRA 1EBFA 2QG4A 1YL6A 4YQYA 2RHCA 3W4JA 2IZ0A 2J8ZA 1R0LA 1KVUA 3K2EA 3PWZA 4Y8VA 2JAHA 2EV9A 2NU8A 4BNVA 2JHGA 5TRTA 1EK6A 5C3MA 3MEQA 1ENOA 2PH3A 5ICSA 4PRLA 3AU9A 4CQMB 4MVJM 4L0QA 5IDQA 5HA5A 3KETA 1EQUA 4NDNE 1AN9A 3BMQB 4P4LA 3RUHA 1JVBA 2B4TO 4IMPA 3JCZA 5AOVA 1DBVO 5DOZA 1O8CA 3H6KA 2E82A 4IDBA 4TRJA 2PD3A 1PTJA 4TZKA 4U0KA 5KTKA 1V3TA 2QHXA 4IBOA 3HADA 3KTDA 4UAGA 4BNGA 4KWIA 4WLOA 4IDCA 2B35A 5AXDA 2PGDA 2P4QA 2YV2A 5TX7A 2VRCD 2PGJA 2Q4EA 1LEHA 3P7MA 1Q2XA 1A7KA 1WDLA 2A94A 5DBIA 1NPDA 1KC3A 3OH8A 4FR5A 2Y1EA 3LSYA 3TZHA 4WLEA 1KY5A 3MWDB 4A10A 1SAYA 1H9BA 2AEMA 4W7IA 4MINA 3DQPA 5TT0A 1KEWA 4NR0A 1BVUA 3K5PA 4D41A 4A03A 1PGNA 4N7RA 2CD9A 4L9RA 4RVSA 2HK9A 2BELA 1I2CA 3ANMA 3QWBA 4IJWA 4WEOA 4EI2A 5L3ZA 3MOIA 1QMGA 5THKA 4MPDA 3IAHA 4FIZA 3DXFA 3UVEA 4BNHA 1N7GA 4AJHA 2JCXA 2PH5A 1ZJZA 4MKRA 5EQFA 2GN4A 3ZHZA 4PIVA 5CDUA 4CMBA 1DFHA 1GCOA 2DQ4A 3OJLA 4GX5A 5HRUA 2BKAA 4GL4A 4WLFA 5T5QA 1KBZA 4CMIB 3FNHA 4Y67A 4TWRA 5KOIA 3MJTA 1E1LA 4S3MA 4XKJA 3LC1O 4LMRA 3FD8A 5U9CA 1SZJG 2FOIA 2PR2A 3RC1A 3WQRA 3GDOA 4J43A 1P1IA 5FI5A 3IMFA 4CV1A 5A9SB 2X58A 4TQGA 4RGBA 2CF5A 1ADCA 3O8QA 3QJ5A 4OQYA 1TT5B 3AOEA 3JQCA 3PJGA 3SBOA 5JE8A 3PPIA 4MIYA 4CUKA 4XEHA 4ITUA 2GZ2A 3OIGA 4M89A 4BNYA 5B37A 4GQAA 1P1HA 2VT3A 3MZ0A 2VCYA 4IM7A 4RLHA 3KHUA 3G1UA 5KVVA 4N18A 3DAFA 3IS3A 5T8KA 4E13A 1PJTA 3QVWA 2BLLA 2FP4A 3AUUA 3E48A 3IKVA 1AUPA 3PFFA 2E4AA 3CINA 3BYZA 1WMBA 1I36A 1GQQA 4OYRA 4AJKA 1EDOA 2OL4A 1K6JA 4K9DA 5CG2A 2CFCA 2DPGA 4EEXA 2EXXA 2WD7A 3DB2A 4CM9D 3N74A 4BO4A 4FQ8A 3LLSA 4BV9A 3S2EA 1E0DA 2Q3EA 3F4BA 2Q2VA 3WGYA 5I7FA 3ITKA 1D4FA 4YAJA 2NACA 4KZPA 3L6DA 4DYDA 1NFQA 1DB3A 3EUWA 9LDTA 2CF6A 4YDRA 3JYNA 4DTIA 2J5KA 5JS6A 4PG4A 1DRVA 5EINA 1KS9A 4JK3A 2PY6A 3K96A 4C4OA 2Q99A 3GRPA 5G4KB 4NJOA 2BFOA 2NM0A 1EUZA 3UH1A 2GN6A 1KVSA 1DIHA 2VTEA 4CQMD 1W73A 1U7HA 2P4HX 4YAGA 2I3AA 2VNSA 2PKRA 4DUPA 3ZNOA 1E3WB 3BTVA 5L9AA 2ZTLA 3U5TA 4F45A 2AQHA 1K2WA 3I9NA 1IL0A 1QV6A 2LDBA 3F3SA 4FJ2A 2WE8A 4R1UA 3D3WB 3ZWMA 1KY4A 4YYZA 4WECA 1EZ4A 4QO7A 3TJRA 1NQ5A 3H5NA 4TRRA 4WKGA 1FJHA 4J7XA 2IZ1A 4TMFA 1HKUA 3HWRA 3M1LA 1CYDA 4FCCA 4W99A 1OC4A 3O4RA 4OO3A 4HFMA 1XU9A 1E7MA 1UR5A 3DMTC 2EP5A 4U5QA 5I7VA 4E2WA 2PV7A 3ONDA 3GVHA 4UVEA 4BKOA 4DLAA 2QYTA 1NX6A 3ZNQA 4ZRMA 5JAZA 3IJPA 3NYWA 3NX4A 3PGJA 4EJMA 3E82A 2FZEA 5F21A 3NJ8A 1H0KA 2DFVA 4YJDA 4HX5A 1Q0LA 4AJLA 5DCUA 4AFNA 3W8EA 1ZCJA 3I9JA 5HS4A 1A4IA 4Z3KA 5BR7A 5JYDA 3WWYA 1I8TA 4CM4B 1LNQA 1Y6JA 2YJZA 3ANLA 1IY8A 2ZB3A 3P19A 5HS6A 5ITWA 5JAMA 4D3FA 1TT7A 1MXHA 1L7EA 3RFXA 1JLLA 1QV7A 2Y1OA 4R3WA 1PS9A 1GPJA 4WEQA 4A5OA 3N7UA 2TMDA 1GUYA 4IDEA 3Q3CA 3VPSA 5F5LA 4Q39A 4AJPA 4XYMA 3RAJA 1PGQA 5H82A 2Q2QA 3OIFA 1LLCA 3ROKA 2Q1SA 2I6TA 1P3DA 4UVDA 1HEUA 3QLJA 5EL0A 1I3KA 2GPTA 3GFGA 4R3NA 4BO9A 1PWXA 2B4RO 1E6WA 4C7JA 4CMJA 1MGOA 2VUSA 1BVRA 1I3LA 2C2XA 3C85A 3NKLA 3PJDA 4PLFA 3RVDA 3K9QO 1U2DA 3WGTA 3KYDB 2DAPA 3GPDG 3GVPA 3LC7O 4XRRA 1BWSA 1KERA 2VWPA 3U4CA 3BXXA 3UF0A 3H5RA 3KBOA 4A26A 3WQSB 4BO2A 3WX0A 1TXGA 2O23A 1RWBA 4NH4A 3KB6A 2E48A 3DONA 3KSZO 2ZJ1A 1GYPA 1UJMA 4GGPA 1GZ3A 4P4GA 3T4EA 2OFPA 4YJFA 4EJ6A 3PRJA 1FDWA 1EE2A 1LSSA 2H1SA 2GYYA 1OBFO 2GN8A 1XCBA 4O59O 5FWNA 4J1QA 4ZQHA 3ZNNA 4PGFA 5JNLA 4IDDA 4IS2A 1O0SA 3RIHA 3NDJA 1IOLA 1FXSA 1B3BA 3C24A 4XR4A 4E3ZA 4XYGA 3L9XA 4ESOA 5KJ6A 1RM4A 4M86A 4B4OA 1WWKA 4NFYA 1PS0A 1JN0A 1T24A 2BGLA 4BKPA 3HFSA 4TRMA 3O38A 1RKXA 1C14A 1P74A 1YBAA 3DBVO 5A5FA 4BNXA 2XPCA 3GFBA 3DHEA 4RVHA 4E12A 2IEBA 2GCGA 1GL3A 5JDCA 1Z74A 2BI7A 3W4KA 3GK3A 3UKOA 3I9OA 4W9NC 1NFFA 5C7LO 3FNEA 3DMTA 1I0ZA 5K0ZA 1Q0QA 4JROA 3CEAA 2D8AA 3K8ZA 2FPPA 2IYPA 3ORFA 1M76A 4XIJA 3TN7A 2G1UA 3JQBC 4DMLA 1PZGA 1M6HA 1CERA 4BO8A 3DL2A 2CMDA 2DM6A 3WGOA 3WYEA 2C5EA 2HMWA 3WIDA 2RBEA 1UP4A 5ENDA 1DC3A 4XJTA 5A3VA 1LSJA 1ADBA 4BGEA 4DIOA 2G0TA 5KWEA 4OXYA 2HRZA 3K31A 4TVOA 1MFPA 6LDHA 4CL8A 2B69A 3UUWA 3EW7A 4EEZA 4LVCA 3EAGA 4W4TA 2PKQO 1MG5A 7ADHA 4EZBA 1XHLA 5I8ZA 1P9LA 2YYYA 2FN7A 3RKRA 3D4OA 1Y8RA 1UDBA 2C54A 1HSOA 1QP8A 4MJLA 2ZTMA 3ETDA 4GMFA 2GD1O 2W2LA 3EVTA 4XQ9A 1LSUA 1QLHA 1YBMA 3VH2A 4FFRA 4NFSA 2VZ0A 2X6TA 4CMCA 2CDBA 3BMOB 3TL2A 2P68A 4WK6A 4RDHA 4BGIA 3DEYX 4YJGB 4YRBA 1Q7CA 3WGZA 1DIBA 2DVMA 1ZKMA 2IZZA 1V9LA 4OXNA 4II3A 2OP1A 1CDOA 1ONOA 3BMNB 3KM0A 3QWFA 2QIOA 5B1YA 5MGBA 4WCFC 4R69A 1MP0A 4CM8B 2ZB4A 3LT1A 1X0VA 1TB4A 4FC6A 1UZNA 4BKQA 4J16A 4YT4A 4K6CA 1DEHA 1UAYA 1Z75A 2B5VA 4GAEA 5FFFA 5TS3A 3W6ZA 1P1KA 5A02A 5FEUA 4ALKA 3ZWCA 4J3FA 3VVBA 3GZ4A 4IGFA 4CL3A 3C7CB 3ASVA 1JWAB 5U1PA 3RUAA 1KOLA 4CLOA 3A4VA 4P4NA 3GEDA 1U5CA 3HB5X 4Q3NA 3GRKA 4TKLA 3PWSA 5CG1A 3JQFC 1Z82A 4WGGA 3BMCB 3ZHXA 1PSDA 1E7QA 3AI1A 4XX0A 2GGSA 4CLRA 5L4LA 1LTHR 1NM5A 4XGKA 1GZ6A 1R0KA 1ZMOA 2EJWA 4FJ0A 4LRSB 4NK4A 3PQFA 2VOEA 3GAFA 4NJMA 1L7DA 4II2A 5K9ZA 1DOHA 3DZGA 5JFOA 1PZFA 4NNJA 5DP2A 4L76A 1PJSA 2Q46A 4QFCA 1F0YA 3ADOA 3CH6A 3GDFA 2R6JA 3KYCA 4DPMA 1H6BA 3QIVA 4WLUA 4R01A 3WFJA 5DNAA 1LDNA 5FF9A 4Q9NA 4HNHA 1U9JA 5IDWA 1AHIA 4W9NA 3WSWA 5TT1A 1T25A 4P22A 4JJIA 1NPYA 3FWZA 4G5HA 4R54A 1UUFA 1GFSA 4HV4A 4HKTA 5AYVA 5AXCA 1D7OA 3DFZA 3ON5A 3LDHA 3DWFA 2P9EA 4GVXA 2Q4BA 2HAEA 4JBHA 4AVYA 3RROA 3VTZA 3TWOA 3RD5A 5ES3A 3C7AA 4BO5A 3WXBA 3DAPA 2I76A 1HDRA 2VOJA 1N9GB 3FBTA 1YBVA 4D44A 5CEEA 4ZU3A 3QP9A 5COBA 3WOHA 4EW6A 2E6UX 1H9AA 2NADA 1UZMA 1H5QA 2VWHA 3LK7A 1U8FO 5KVSA 3WJAA 5AQ1A 1GY8A 4FFNA 4OHUA 5BQFA 4X54A 3GDGA 1O9BA 3E03A 1A5ZA 1LDEA 1GEEA 4DMMA 3F46A 3ABIA 5DT9A 3AUAA 2P9CA 2Y66A 1X14A 1D3AA 2CSUA 4Z9XA 4K28A 4PCVA 3A1NA 1ISJA 4ZHSA 1I01A 1PJBA 2GO1A 1E77A 2G17A 4TROA 2PZMA 1LU9A 3WYCA 3LT4A 1NQOA 1XQ1A 3PLRA 4ND2A 4WCFA 4LN1A 1QRRA 3PLNA 5G4LA 3WNVA 2JD0A 2YHUA 1EQ2A 1EVJA 2YFQA 1RM3A 4P38A 4E2XA 3FBGA 3CTMA 2UAGA 1XQ6A 2P5YA 2VWQA 4D0RA 5B4UA 4BO3A 3KV3O 1QORA 1LQTA 2HJSA 2PFGA 5JXWA 2OOSA 3TDKA 2Q45A 2P9GA 1R15A 3H9GA 2QZZA 4NG5A 5DP1A 4J9VA 3HNPA 4CV2A 4J49A 5FYDA 1VJ1A 2X9VA 4RVUA 3TL3A 2GERA 1VJ0A 1E5QA 2G5CA 5GZ3A 4RL6A 2V65A 2W2KB 1IPFA 4GGOA 1T4BA 2D4AA 3OMLA 1Y8QA 2QYSA 4B3IA 5GZ6A 1GU7A 4Z0HO 1SB8A 1BXGA 3VPGA 3R0IA 2EKLA 1QG6A 3UCEA 3RUCA 4ALJA 1E3EA 4NU5A 2YHIB 2DFDA 5CP8A 3C8MA 4I1IA 1MFZA 3OFSA 1Q7GA 3OHSX 1V6AA 2YUTA 4BO6A 3A28A 3ITDA 1FDUA 4OGWA 5L7WA 2FY8A 3LLVA 3W4IA 3RJ9A 5IZ4A 1NYTA 4I5FA 1JTVA 2VYVA 4QTZA 4XQCA 4OKIA 4J0FA 4XB1A 5J23A 1HE4A 1NR7A 3V2HA 3DOCA 1Y9AA 3E9MA 5JCJD 1E3SA 1K89A 4YAKA 3VZRA 3GQVA 1R12A 3ZV4A 4RQTA 3L4SO 4PLGA 3JQAA 2JFFA 2V6MA 1VLLA 2X1HA 4DQUA 3E1KA 5LCXA 3B1KA 3RUFA 2J5QA 1G6KA 1UDAA 2BI8A 5ER9A 5DDIP 4L74A 1IPEA 1OAAA 1R6DA 1LRJA 4MO2A 1VSVA 3HZZA 3STHA 5CHEA 3O8QB 3AOEC 1GPDG 3HUDA 4GSKA 3M2PA 1OZAA 3EHEA 4L4SA 3VTFA 2VZ9A 4F6CA 4J1NA 1V3VA 4OQZA 3VC7A 3SJ7A 1HWYA 3AFNA 1QYXA 3LVFO 2D59A 3LF2A 5CDTA 1FF9A 4QX6A 1HT0A 1B8UA 1C0LA 1WXDA 3BA1A 3RUEA 3KVOA 4OIMA 5COAA 5T8KC 4EJ0A 4QT0A 3B1JA 2H5LA 1N5DA 3H3JA 4JNKA 4L4RA 1NNUA 4ZRNA 3WBFA 4QO8A 1OOEA 3PDUA 1Q0HA 4D0SA 2FRDA 4IY1A 1LJ8A 1SPXA 2ZYGA 3I5MA 3UCXA 1MUUA 2WTBA 2CVQA 2O50A 2AG5A 3S2IA 1HYHA 2ZQZA 3JQ6A 2I99A 3VPXA 1ZK1A 1PR3A 3MTGA 4UUOA 3BZUA 4PVDA 5KJ1A 1MV8A 2JHFA 2VRCA 3KYBA 1R0SA 3VH3A 1EVYA 2HSDA 1LDBA 3OEYA 3RJ5A 4R68A 3AM4A 3VOSA 1P31A 5L40A 5JAIA 4NBVA 1HDGO 2GZ3A 4YWJA 4JN6B 4E2YA 2V6GA 4ROSA 1GR0A 2X86A 1T26A 4MOWA 1N7HA 5JMPA 2FR1A 3VDRA 5JYEA 2X8LA 3JQ7A 1YQXA 3NTQA 3PHIA 1V35A 3C1AA 3EY4A 1PL8A 3VKVA 3B20A 4FW8A 1C0KA 2RAFA 2VHYA 2ILTA 3MJCA 3Q0EA 4ONEA 1VL0A 2X5JO 2AE2A 3PYLA 5JY1A 3TZQA 1UDCA 1GAEO 2DUWA 4XJSA 5G0WA 3L4BC 4BNJA 3H2SA 3EMKA 1DJQA 1LLUA 4I5DA 4DBZA 5H83A 4K6FA 5BNFA 3OQ6A 1XDWA 5C7OO 4BKUA 1GYRA 3SC4A 1YB1A 5L4SA 1O94A 3KEQA 3ZWWA 2GZ1A 1PL7A 1BGVA 1P0CA 1KIFA 1JAYA 1GD1O 3AY3A 1WNTA 3ZW8A 4G2NA 1GDHA 1AXGA 1C1DB 4DWVA 3ZWAA 3AM5A 4CODB 3RC2A 2AHRA 3TPCA 2NVWA 1WVGA 3HG7A 1GTMA 4J4HA 4PG8A 2O2SA 2FMUA 3WTCA 3TRIA 1XSEA 3G3EA 2FZWA 2AE1A 1ZK2A 3P2OA 4E4YA 2A4KA 3QY9A 3R1IA 1XG5A 2RIRA 3COSA 2PA3A 3EZYA 4B4WA 2GR9A 3B70A 3GEGA 3MJVA 4PRKA 1HDCA 4RO0A 4XYLA 4CR7A 5A4DA 1HYGA 4QUKA 5BSFA 3I6IA 4ZQBA 3ZV6A 3ICPA 4KTTE 1F8GA 2VHWA 2Z1NA 4BO0A 3GNSA 3MTJA 1P1RA 1O95A 3PFWO 5CDSA 4CM5A 1LI4A 1HRDA 3KEOA 1Q7BA 4JIGA 4YRAA 4ILKA 1NBOA 1GQ2A 3F1LA 1YKFA 1ORRA 2B37A 4D46A 1DHRA 3A14A 3D1LA 2O3SA 3K30A 3GH3A 2NQ8A 4R4JA 3ZU4A 1R4NB 1M2WA 2Y0CA 3ZGYA 3CIFA 1HLPA 2YW9A 1T2CA 4B7UA 2ZIZA 4F46A 1BSVA 3MWEB 7MDHA 1YRLA 1C1XA 5ITVA 2VT2A 1MX3A 3DZKA 2OHXA 2WYUA 1UZLA 3QWIA 1D8AA 2VNAA 4AJ2A 1FDVA 2NNLD 1CQJA 2FWMX 4O5OA 4BNIA 1J49A 2I65A 4CLDA 3INRA 3PYMA 3KO8A 1PJ4A 1NVMB 4IGEA 2GDZA 4PLHA 4DGSA 1HDOA 4LSWA 3QVTA 3BHMA 3KUXA 4BO7A 4YEDA 4D79A 1R37A 1Y7TA 2Q50A 3NGXA 3SVTA 3WB9A 1H93A 2YV3A 3WYBA 1VL8A 3GHHA 3QE3A 3G17A 3K6JA 3L4BA 4JBGA 4LMPA 2RHRA 3E5MA 1NTOA 1QKIA 1SB9A 1E7YA 4FFPA 2VWGA 4B3JA 1J0XO 1NHGA 2YQ4A 5LDGA 5TF4A 4W6ZA 4Y6SA 2ZCUA 3G1TA 5CAEA 2HUNA 3OA0A 3KXDA 2DUUA 3I9LA 4KWHA 2AEFA 1WPQA 3ZN2A 4RQUA 5IN5A 3FPLA 5JDCC 4UULA 2Y1DA 4YAIA 1ONPA 4NBRA 3L6OO 1ZO8A 2P91A 3AI2A 4LISA 3LQFA 4R9RA 5B12A 2C59A 1N92A 2ZJ0A 1NXQA 1HL3A 2D1YA 1AGNA 2CNBA 2VRBA 1FDSA 3UXYA 3EZLA 4TSKA 4AJJA 1BDMA 1Q1NA 5TGDA 2OUIA 1A4UA 5EN4A 3PIIA 4CMKA 4YXFA 3QWHA 1S7CA 1EDZA 1UP7A 3EK2A 1HDYA 4QECA 3TFQA 3GF4A 3R6DA 1L1FA 1JWBB 3DZFA 1GUFA 2VYNA 1P44A 3I83A 2D5CA 3HN2A 5HM8A 4Z0TA 4R16A 1VL6A 2IE0A 3WGHA 4ZQEA 4OMUA 5A9SA 1YOVB 4CM1A 2IRWA 1YJ8A 3GOHA 5DCWA 1TT5A 1Y8RB 3CMMA 2O3TA 4OAQA 1T4DA 1ZSYA 1NASA 1GV0A 3VPFA 2EP7A 4ALIA 1C3VA 5CPFA 4ND5A 4CQLB 2F00A 1HE2A 2QRJA 3Q1LA 5JBIA 4H16A 2AQIA 5GZ1A 4FBGA 3PQDA 4KDFA 3PWKA 4BB6A 3DHYA 4DYVA 2YZ7A 3ZZNA 3FI9A 3L07A 1ZK4A 4OM8A 1ISHA 3NDRA 4J91A 3WTBA 4BGUA 5EMHA 4U8GA 1GEGA 4I9UA 2HLPA 1VPDA 1RPNA 1U4OA 3HN7A 3NT4A 4B3HA 4BMVA 2DKNA 4UVHA 4MVJA 1U2GA 2Q1UA 3E6AA 2FHSA 3FF4A 3KZVA 1MLDA 1PJ3A 4A2CA 4CMAA 3OIDA 1A71A 4YT8A 4BOYA 3PXXA 4HNGA 2VHZA 4FSHA 4PLPA 1HDZA 4ZD6A 4KUEA 4M87A 4CLOB 4OSOA 2BMAA 2EERA 4XYBA 3V2UA 3AUTA 4OH1A 2NTVA 4G81A 6ADHA 3M2TA 4Q3BA 1SOVA 1PGJA 1PEDA 2X5KO 1ZZEA 3VHRA 1X13A 4IUYA 4CLRB 2D0IA 4L4XA 3U62A 1U5AA 4B8ZA 1ML3A 4XRGA 4R1NA 3AOGA 1X7DA 4JP2A 4DBVO 4UEJA 1UXJA 2XXJA 2HCTA 1CEQA 4FC7A 3PIDA 3QVXA 1TEHA 3FNFA 4BNLA 4XWYA 4J4BA 4GI2A 3ICCA 3H4VA 2CVZA 1IHXA 3A06A 1I3MA 1XA0A 4WNIA 2IDZA 4E6PA 1PGOA 4D45A 5IG2A 3GUCA 3QW2A 4R1TA 5ENVA 1E3WA 3RBVA 1N8KA 3RUIA 2JJYA 2EF1A 3QVOA 3HDJA 1XU7A 3IUPA 3GZNB 3D3WA 2DLDA 3ST7A 2X0IA 4OSPA 4WASA 4K1LA 3AJRA 4Y6RA 2PZKA 4QEDA 5JW6A 4DQXA 4H7PA 4YQZA 1IB6A 1DFIA 1TA4A 2YQ5A 1H94A 2XAAA 2D2IA 3GA0A 3JYLA 1IZ0A 2EKQA 1ZEMA 2EKPA 3N58A 4IS3A 3WLEA 4D7AA 2H63A 3OETA 4MIEA 1NQTA 2YFHA 4E31A 2OBYA 3UOGA 4C7KA 3OJ0A 2XXBA 1LXCA 4RZHA 3GN1A 4NBWA 2Y1CA 5KJFA 3MJ4A 4IJVA 3OBBA 3GEMA 2VQ3A 2NVUB 1EK5A 4TVBA 4D3DA 4BMNA 5TJHA 3W8DA 3ZNPA 4IZHA 3KRTA 4RPJA 1I32A 1ZXBA 3TF5A 4GPD1 2GF2A 3I3OA 3JV7A 4CM4A 2I5PO 4CJXA 3ZWVA 4J1TA 4MIOA 2HK7A 5L95A 1ENZA 4HFRA 3RFVA 1RM0A 1O5IA 2O3QA 4FPXA 3ANNA 3VPHA 3Q2IA 4BIIA 2VHXA 4WLNA 1EUDA 2JD1A 1ZSNA 1SEPA 2OMEA 3PHGA 4CMHA 3O03A 5BNTA 4YB8A 1HE3A 3WIEA 4YCAA 3SEFA 4BNMA 4YJHB 5IF3A 4CUJA 1BW9B 3IDSA 1UAGA 5ADHA 3OQBA 4H3VA 5A06A 3PDJA 1A9YA 4Z9YA 1PQUA 2W2LD 1GCUA 4PLTA 1FMCA 1VE9A 4KDEA 1PGPA 3KYDA 4EUFA 8ADHA 5A03A 3UN1A 1FK8A 4OXKA 1DIRA 4F6LA 2NVBA 1ADGA 4B4UA 5JC1A 1LC3A 3WG9A 2ET6A 2AA3A 4HP8A 2QQ5A 1CF2O 1YWGO 2PZLA 3GGOA 1VSUA 3GNQA 2Y0EA 2WD8A 3U49A 1IULA 1SMKA 1W4ZA 5KKAA 5COQA 3U0BA 4AJIA 3PZBA 1WP4A 3GC6A 3DBLA 3NT5A 5EIOA 1NVTA 3SLKA 3H9JA 4WE3A 1BXGB 2AQKA 2WMDA 5T57A 4CM3A 3DBHB 2ZTVA 4IDGA 2PTGA 3GY0A 2E49A 3F9IA 5DF1A 3IOYA 1ZVMA 2ZKLA 4RF5A 3WR5A 1VKNA 5I7EA 1MG0A 1H6DA 8LDHA 1R4MA 4FJ1A 3WWZA 1W6UA 3CUKA 1SC6A 2Y99A 2QRKA 5CDGA 1P1FA 1N1GA 2UDPA 1SCUA 2PGLA 2C0CA 3HQ4O 1DRWA 4M49A 4LGVA 1D1SA 2G82A 4BNUA 1Y1PA 4UUNA 2J3KA 5DULA 2E37A 3LT2A 3PJEA 4CLEA 4MP3A 4CV0A 1TVEA 3FWNA 4GSLA 1PZHA 4BQRA 4YBZA 2WWRA 1XGKA 1XKQA 5TC4A 4PLZA 4QQRA 1EE9A 1HZJA 1ZEJA 3RI3A 1F12A 4J2HA 1ONNA 1YB5A 5B4TA 1V3UA 2BHLA 3NT2A 4M8SA 4PG5A 4KP7A 1I10A 5TQVA 5EESA 4B79A 4GKVA 5AXBA 3DZHA 1VI2A 4NIMA 1Z7EA 3IJRA 1ISFA 3WSVA 1Y9EA 3ZWPA 1BRMA 4EUHA 3TZCA 3HFGA 1XLTA 1M75A 2UVDA 1WZIA 3BTOA 3OICA 3U4HA 2BF7A 3JQEA 1WLYA 2HMVA 4BNFA 1RJWA 3NAQA 5FI3A 4I9HA 1LX6A 5TIIA
chains in the Genus database with same CATH superfamily
1NXPA 4Z4QA 1T5IA 4OX9Y 1GARA 1SO8A 5FOTA 4X20A 4F72A 2E18A 2QLBA 2WTMA 4JFAA 4DLNA 3HJFA 3LLCA 1FNDA 2WJWA 3DO8A 2OORA 1HETA 1QPGA 4OBEA 1UQUA 4QXOA 3L02A 2GJKA 3V48A 3U3DA 2JAUA 4ZAXA 3BG5A 2ACWA 2ZSIA 3G2QA 1NP3A 2Q5OA 1W87A 2QP4A 3AM3A 3AW9A 4GPEA 4KN6A 4X84A 5J40A 4YJGA 1F9EA 2BP7A 4Q3CA 1L5KA 1DRUA 4F38A 3OZXA 4QBIA 5LZ9A 1DE0A 2B2CA 1U7ZA 1GNVA 2CXUA 4LV6A 4QGGA 1R6UA 3M0EA 1R0BA 4A7PA 1RI5A 1EP3B 4YQEA 9LDBA 4AICA 4KOAA 5JO9A 1EFAA 3PQEA 2Y9PB 3PE3A 4TYNA 1QLJA 1YHYA 3R9WA 1XIVA 5T67A 1Z35A 3KJZA 4TV8A 4PYLA 4EHHA 5A9RA 5HVNA 4TRNA 1NBWB 3EZ6A 4FP9A 5JHGB 2WJ6A 2OBXA 2FPIA 3MLAA 5LNK6 2E55A 3CVXA 3JSXA 1Q11A 1VXRA 3SS8A 1U4SA 2FUG6 2V6BA 4I6GA 4YACA 4ZICA 4EFLA 1FTGA 2DTDA 2Q07A 4B7XA 1BDBA 2DFLA 3KSMA 4C7MA 3ER6A 3GEBA 1K7CA 2OPHA 5JPIA 5TY0A 2CZCA 1KKUA 3TZBA 4ZAFA 1BMFA 5CEJA 3LTEA 2Y1GA 1EJ0A 4J0EA 3UJNA 1NVAA 2B8EA 2L82A 3M6UA 2HQ1A 4BQPA 4WL0A 5LP6B 3FKSD 1JVNA 2MYNA 1U7UA 3R75A 3A2LA 1R8XA 2GM4A 1NVWQ 1IN7A 2AI2A 3EXAA 4ZVOA 1YZ3A 1CS4C 3H2ZA 3KSAC 3ZE1B 4XCXA 4PPFA 3ZDYB 4F2GA 3F5DA 3G0CA 3MQ2A 4NBNA 1B3RA 4X63A 3EVDA 1M2VA 1OZGA 1TJYA 1ZRHA 4FK8A 1YIOA 2QQ0A 3OCCA 3ZU2A 1SOUA 3D5QA 4Q9JA 4BB0A 1PWZA 1ZD9A 3H4MA 1KSHA 1P0PA 1A97A 3JZAA 2C3OA 2K7ZA 3NEPX 4Q02A 1Y48E 2JI6A 3LG2A 4WW0A 1EKXA 2XE4A 3K70B 4C6HA 1E1YA 4D98A 1SHKA 1DELA 1UBRS 2IYTA 4P4UA 4N03A 3U4DA 5AW1A 4UJ5A 1WL8A 2QN1A 1TF2A 3FDFA 1UK6A 1MB0A 5K3EA 3U7GA 1INLA 1UEIA 1QUFA 1ZNYA 2PT7A 3KB1A 3Q7TA 4KCGA 2CUZA 4PAGA 5K51A 5TNXA 3FWKA 4E0BA 1Z2AA 1SCIA 2NNWB 3LT0A 1EGQA 2WWGA 4K6MA 2E4UA 1V5FA 2PJDA 2WHXA 3D3EA 3IQDB 4IZOA 4O4IB 4U6NA 2XZLA 1NUTA 4LC1A 1ATZA 1P0FA 2P0YA 2G76A 2Z3WA 1G3IA 2XNSA 3MGGA 4O6VA 3K6SA 1YTUA 1CCWA 2GBIA 1KH2A 2JH8A 2V7XA 3EY9A 1PQWA 5LD2C 3QFHA 3WLFA 3UUFA 2FDCA 5H3LA 4OBXA 2P3QA 3WKEA 1C1YA 3PHCA 2W98A 3JTMA 5ALUA 1QIJA 3R5JA 1OWMA 1KJWA 4PYKA 2ZYAA 3HO8A 4E33A 3E35A 1N6LA 4IXMA 4L2IB 1SA0A 3SSOA 2Y05A 3LX6A 4P92A 2B5OA 2IYOA 1K98A 1FP1D 2I8AA 1VPWA 5BR4A 3K5WA 2WD7B 1HO3A 4R7ZA 3L7BA 2FMXA 2JANA 2OZPA 4I1OA 3DVAB 3NVKI 3UFBA 2EFHB 1LFAA 5U4QA 3WOVA 5EIHA 4X6XA 1XQVA 4J1SA 4JB3A 2FUKA 2ZEJA 3IV7A 1L1RA 4G0QA 2VXCA 1WSDA 4C21A 3HA3A 3WDSA 1XVLA 3ZV5A 5K4GA 2CLCX 5TSDA 4FXPA 4Y9UA 2AWOA 4PTYA 2A58A 1CUCA 2GHTA 2AFHA 4HMPA 4PZCA 3SHVA 5K2OA 1F8FA 1CSEE 3H2BA 1OU4A 1O87A 4DR2B 2DFPA 3IELA 1OMOA 4IUDS 2R5WA 1S1MA 2OZLA 4MUEA 3MT8A 2GILA 5F3WB 5DHRA 2VLIA 4JENA 5ER6A 4LYJA 1QH8B 3OT4A 1Y4UA 2ZATA 4B0OA 2PNFA 2PPLA 4G0YA 4Y2YA 1OKKD 5JDIC 1CS0A 2VK8A 2Y1LA 3HB0A 5J63A 4WI1A 3GYGA 3WQQA 1EVIA 1HK7A 4KUGA 4BNTA 3AIOA 2I67A 1FCJA 4NZ9A 3QEAZ 1ORDA 1RJ9B 2VBIA 2Y4OA 3CUUA 1AUVA 1U9ZA 1YFKA 3II6X 4EELA 4US2R 3PHJA 1FRZA 4IG4A 5IVHA 1JR2A 3RU7A 2D06A 2WSLA 4LQ4A 4XR9A 1WDMA 1ZIDA 4TS3A 3WWCA 2NU6A 2YBEA 1G1MA 4G5SA 4GFDA 4DMUB 4F91B 1L7VC 4V0ME 1F4PA 2PQ2A 4KLCA 4LYEA 4GR5A 5F2NA 3WAJA 3VU9A 4G2TA 3RM3A 5CAEB 3PEFA 2SECE 1EFDN 4V0OA 2G5PA 4DKXA 1LF0A 4MRSA 3SX2A 4ZQFA 3B6MA 1YS4A 3EBOA 4MCHA 4CKCB 1YQGA 4DUZB 3FR7A 4FU0A 3VYWA 5HW0A 2EG9A 3ZV3A 3ROPA 3U6BA 3FOWA 3GLQA 1CY0A 2WEKA 4GE0A 5CDHA 1LDMA 4NP6A 4PRZA 4URFA 1U7TA 3CZRA 4UNSA 2P1DA 3RG2A 1YU9A 3EEIA 4ENQA 1U8XX 2NV2B 4QTTB 3E22A 3IA2A 4BJ3A 1G2OA 3BS4A 1CRQA 5KYVA 1VLZA 1SXJD 2I22A 1JPUA 1ZIPA 2E1PA 4J6FA 4L8WB 4OHBA 2ZS7A 4BYGA 1E96A 1FYVA 3EW9A 1RBQA 3DBRA 3RQSA 4AWXA 4I8IA 4YAEA 2NYRA 1V9CA 1RHQA 4L16A 1DEXA 5DYWA 4ETMA 5IAEA 1O94D 1QOZA 1VI6A 1ZOPA 1V3QE 2QTMA 2QTAA 2NSDA 4EENA 5BPFA 4BEJA 2XBMA 4YCJA 4L4ZA 4FQ7A 2FPLA 1GDDA 2P2SA 4PHCA 5KYTA 2AMFA 3TIFA 4NK5A 3V1TC 2R6CA 4EJ2A 2GXAA 4YRIA 1H6CA 3L7IA 5L6LB 4ZV4A 1RBMA 1IN4A 2OXEA 1XZKA 4PQYA 2IDJA 4YRLA 3UJ3X 5J4KA 5K3AA 5KAMA 5K0GA 2HCBA 3B7PA 4FGKA 2DSTA 2JVJA 4MJXA 2C5SA 4Q3AA 5TPZD 5LU9A 1FMJA 1E5DA 4M98A 3OJEA 5I8PA 3ZYZA 5HOEA 3MWJA 1XKTA 1EA7A 3AO0B 3RNLA 1AN0A 1M8JA 2FPGA 1PR9A 4IZIA 4PYJA 2HOQA 2N75A 3OEHD 2HSEA 1JVSA 2HCFA 2PEZA 5GONA 2MSWA 3EIUA 3ZWYA 3HA5A 1LBIA 1P29A 1Z25A 3RUDA 1I24A 1S4MA 3CLSD 3BHJA 3KPJA 4GF5A 4JL5A 3RPEA 3VFDA 4BQNA 1JHZA 2FMFA 4FFBB 4P7JA 5IJZA 5E9QA 4IX1A 2DXIA 2HU2A 2VTDA 3TSYA 5I47A 4RVNA 1ZK3A 3ZXIA 1N5RA 2KLHA 2CHFA 2WY2D 1L4NA 3HKEA 1TLTA 2G07A 1RXWA 1NJ8A 1OLSA 2PKQP 1EJ2A 3TZLA 4ZYZA 1O95D 4MDFA 1J7KA 1V6SA 2HK8A 1KEEB 4HDQB 4GLJA 4RCVA 1VB5A 3OCXA 1ULSA 2CB0A 1Q12A 2PWAA 4D56A 2PCLA 1M8GA 4ID9A 4RORA 5KJEA 3EGXB 2FSVA 3SS9X 1WU7A 3W2HA 4CQMA 4BMXA 5D8DA 4G1CA 3ZIAD 3VX4A 1CUSA 2X6QA 2PZFA 1ZUHA 3IOCA 1J4AA 2IODA 2ZR9A 3Q6MA 1EX1A 4GX2A 4JLAA 4KL8S 4L08A 3ULKA 4C88A 3F7MA 5KEIA 3DTNA 5F1OA 4IAOA 3QNWA 1OF1A 4ESHA 4IDAA 3W7VA 4DKJA 4AYWA 2Y93A 1TVKB 4RFSA 5DI9A 3SDBA 2EU8A 2M98A 4TZ0A 3T0FA 1V7QA 2CFSA 3IPYA 4CR6A 4INAA 4HDOB 5B64A 3AXTA 4EPRA 1OYYA 2GEDA 2W2OA 1KOFA 1T9DA 5BPHA 4TYYA 1FLDA 4RHFA 2TYSB 4EGFA 3U09A 3R0JA 2VL7A 4B43A 1N2IA 4G86A 2JLXA 2CV2A 3BVPA 3NBKA 4MVWA 5FPSA 4LJRA 2O1SA 3GLHE 4GZ3A 5ERXA 1LUAA 3LW7A 4CVNA 3PXBA 3Q9NA 2QN7A 4FI3C 1SEVA 4JQSA 1BDIA 1GRCA 1VHQA 1YE3A 1KO1A 3AIIA 1ZM9A 3COVA 2GCOA 3PXDA 3QHAA 2OCXA 3TUZC 4DJTA 1N32B 3SHTA 4KBFA 3FYUB 1EX9A 3FNBA 3H5AA 2RKWA 1V2HE 4MB6A 4TMXA 3T5TA 2IPOA 4A0SA 4ZJUA 3SQNA 2VUUA 1QPZA 4D99A 5DM60 3ONFA 5I4BA 1M3SA 2XR1A 5IKEA 5KVCA 5K8TA 1E1MA 4HUJA 2WYHA 1U0JA 1H2FA 2Z9BA 4P81A 2VZLA 4MS1A 3UWKA 2XD4A 2UKDA 4NONA 4KSBA 1KMIY 2FPPB 5AI0A 4BGVA 3Q3HA 5ALWA 3HSKA 3L8EA 4RAOA 3W9SA 1J2EA 4EX6A 4MW6A 4R2LA 3MUOA 1DVRA 5AQEA 5BRAA 1C1DA 3IVRA 4FFMA 3FMFA 1DXYA 4I1VA 2P3OA 4B8WA 2QTHA 5JNTA 3CVWA 1EB9A 2CBGA 5IT0A 2XOEA 5EWMB 4FS3A 4E5NA 1AB5A 5FWDA 4YCCA 1J9ZA 1W85B 5BN3B 1Q0TA 4DR4B 1DJNA 3I64A 4CR8A 4WAUA 4ANFA 1C9MA 4BVAA 1Q0UA 1ISRA 3A1CA 3I5UA 3L0SA 4W9RA 1Y7LA 5LPNA 5H81A 1I4DD 2C3UA 1DTWA 2B9VA 3UMBA 4ZMSA 3KJQA 3LVBA 5KTRA 1KF0A 1MXFA 5I9NA 5DB4A 2GXUA 1MB3A 3JYPA 1JQDA 2H4ZA 3RIGA 4DLPA 5LUAA 3B78A 4DREA 2VS1A 3B7GA 4HGNA 5I51A 2XCOA 2AJDA 4RPLA 5F23A 4JLSA 3HGMA 2E1RA 3WYGA 1MD9A 4K1XA 2REQB 5KDLA 3G7SA 1YGYA 4DDHA 1XJCA 5C8YA 4DPKA 3JYQA 1M0TA 5CD9A 5K8LA 1L5WA 4GXQA 6ABPA 4JVOA 5A1TA 4C04A 5GVRA 1DFGA 1WPXA 5F73A 4UDXX 4URZR 4WK4B 1JFFB 1UH5A 2FQYA 3CE9A 4OL9A 5JO0A 1K88A 3K3PA 4Q6WA 1N3IA 4NE2A 2BH2A 2JIBA 1AKTA 2OSBA 3BHIA 5DK6A 3LHKA 4BWYA 1D9ZA 2J67A 2FN8A 3KG2A 4NMWA 3J81k 3C4JA 1K9SA 4F3YA 2LZ0A 3O94A 4JASB 2ZYIA 3EGEA 4ASUA 2HHHB 4NNOA 3IEKA 3CNQS 3IP3A 4YDSA 4CKWB 4FNOA 3KVYA 1F06A 1R4NA 3E05A 3F1KA 4HLQB 4ZAVA 2BFFA 1EIZA 4HWGA 1KDZA 2J6HA 2BMFA 4MRVA 4XE5A 4BAGA 3Q8KA 4RF3A 1PW7A 4ZI7F 4MWTA 5KTMA 4MKGA 3GRAA 3TQHA 1M7HA 1E1KA 2JKVA 4P9NA 3W1WA 1TTTA 3HCEA 1JR3D 3EWIA 4OKNA 3TTTA 4KI7A 5KINB 1AHNA 3D8RA 5INTA 1GGEA 2KPOA 2H31A 2AKEA 2J0VA 4RKYA 5JS1A 3KPVA 1R0CA 4Q24A 2LIPA 2PUHA 4BVKA 2VDOB 16PKA 3R9XA 1L4LA 5FXMA 4C5CA 2OM2A 5HIIA 3V8BA 1OC2A 4F93B 1KPIA 4ZIRA 4XTCS 3PX2A 1QH0A 5THQA 1G16A 4EI9A 3HLTA 5FQNA 2NX2A 2ZI5A 3S2FA 4NICA 3BTSA 2JJ1D 4HX9A 3L3BA 3NBQA 4E5YA 3QPUA 3JSAA 1H22A 3AETA 5I4CA 4DUYB 1EFVB 2PUTA 4AW9A 3LQKA 1U9CA 3JWPA 3KLMX 4FBLA 4MMYB 2XQFA 4QUHA 1N36B 1JH9A 3ZJVA 2IE8A 4TYWA 1BXZA 2I62A 3ETLA 4MVJD 5EE9A 1RZUA 3ZG6A 1GTJ1 3IP9A 4W5NA 3VXKA 5L7TA 5C8ZA 5FOWA 3TTWA 4BB5A 2JIZA 3MYYA 4TZTA 1CJUC 1DO8A 4EFDA 1AB6A 3I5AA 3NJRA 1Z6ZA 1EFCA 1ZA1A 4RDIA 3KQWA 4Y3UA 1MC5A 4I4TF 3V5NA 4LFBB 2WKQA 2ZBFA 2BMVA 4M1QA 3E7PA 1AQ6A 2NYAA 2HMSA 1RWKA 4IOMA 4L8GA 4GL2A 1EJBA 4IH4A 2Q9AA 4D81A 3V33A 4YXWD 3I9FA 4N12A 2O3UA 1MOPA 2EBWA 4MA5A 3RRNA 1RKBA 4ZHQA 3SPXA 1QJ4A 3W7BA 4QTUB 5TPWA 3S55A 3ZU3A 4F12A 2XWPA 3S5JA 5K01A 1W5AA 3FHOA 4BMSA 3OX3A 5D6NA 4Q3KA 2HN9A 2O1XA 5CCDA 4FB4A 5KSZA 5LM3A 3TG2A 2XCTB 3HXOA 3E81A 2XMBA 3D4PA 1Z0AA 2JJ8A 3AHDA 3AVPA 4KIUA 3UCFA 4MS4B 1GN8A 5BV7A 3BULA 1YC5A 1ZH2A 4CU2A 3PFIA 3ZV7A 5HQJA 3ZZ0A 4R6WA 3UPDA 1NX9A 3I76A 1PU2A 1SBCA 2WKPA 3AGPA 3IT1A 1G3UA 4LV5B 4FZ3A 1U3VA 1YB4A 2AYXA 3AL2A 1A3CA 1TCAA 1XN4A 3EDMA 5CLGA 2ZUDA 5LB2A 2XEXA 4BN0A 4OQMA 5H7XA 2CLDX 1XAJA 2Z8XA 4GPBA 2PS9A 5AVWA 2YY5A 2JHPA 4PE5B 5TEWA 4PLWA 3PGA1 5IXJA 2WMNB 1DKOA 1A5SB 1L2TA 5KB3A 2J59A 2N46A 2X6RA 4H0FA 4V1CA 3JZIA 3W8FA 2B1JA 4V2UA 2I2BA 1GZ4A 4NQZA 3RG8A 4HX2A 5SY4A 4C4TA 4YRZA 5KCZA 4F4CA 1N2SA 5B7NA 1SU7A 5LNK1 3AJAA 1CHNA 1P9NA 3ZCXA 1KJZA 4UXHA 1NMEA 5IUNC 4HWSA 3L49A 4GH5A 5KC9A 4QQ8A 2YVAA 2FUG1 3I4CA 4I1RA 4X95A 1R00A 2C1ZA 5IX8A 1IN1A 1MENA 3E18A 4U7JA 1RQPA 1RRKA 2EIXA 5KYKA 1NVGA 3ZDRA 1IK6A 2O3JA 2YHBA 4MDYA 2J0UA 5MF6A 2IOHA 1JSRA 4ZVUA 3RRFA 2XOXA 2ZSEA 3NM5A 1FVXA 2VF2A 3A1FA 2CD7A 4LTDA 2FV8A 2GFQA 2QX9A 3ZH2A 1Z45A 4GMDA 2OHFA 4AZ3B 1OIVA 4GBED 4KPYA 1J1UA 3OZDA 1NQWA 3M4YA 2AEJA 1KTIA 4NYJQ 4ZGWA 2DTEA 2TECE 2HCJB 2JVKA 2XNJA 4DG9A 2CT8A 3RYFB 4QXQA 2JGJA 1HF3A 3DOEA 3DVSX 1PJCA 4X00A 5F7JA 3U37A 4C9BA 2J5RA 3A32A 3MTIA 2NU7A 1N6OA 1LWNA 2CZGA 2C9ZA 4B46A 4BVEA 1ZIOA 3TLGA 2O3RA 2O8FA 4ZGBA 2EW1A 5GM1A 2QNRA 4JKYA 3WGQA 2RI0A 1ENYA 4LDNA 2JNWA 4C05A 4RYLA 2JPDA 3VC3A 1W9MA 3OM9A 4ZOCA 3DZBA 2B61A 4HWKA 3ZOKA 3ITNA 1K0UA 1QFXA 2E85A 5D00A 2VH1A 2NTNA 2Y1FA 3GN2A 2C7BA 4UTXA 4D6XA 3SP1A 3TB4A 2OGUA 5G0UA 1T0BA 3PF9A 4FFOA 3LBYA 2O0HA 4OBBA 1KBOA 5FBHA 1YQUA 3RADC 1I4OA 4QOSA 3L7MA 4AI6A 2B1QA 4O4JF 3GLFE 4IMIB 4JGGA 3GLGE 1H1DA 3F8SA 1D0SA 1ZQ1A 3U7FB 1L5RA 2BFPA 3R3VA 3REFA 3SXUA 1NN5A 2IC5A 1NMQA 1JAZA 1S1CA 13PKA 1A8UA 1KH3A 3H65A 3MIZA 3P45A 1JEQA 4GM1A 1VRWA 1A72A 1E61A 1F2DA 4XPIB 3RC9A 2NUAA 1VBNA 2XMGA 1NC3A 4TYQA 1E69A 3SZLA 3TQRA 3IP7A 2HWUA 2W6IA 1SXGA 1QB7A 2PWZA 2IQIA 4ZK2A 1TADA 3P1JA 4MULA 3JQ8B 3FOZA 4CFSA 1OI4A 4UW9A 1QDEA 1HEIA 4K26A 5CBPB 3G23A 2O8BA 3JQAB 3ODPA 1EUCA 1P3JA 2P0AA 3P5SA 1I13A 4MICA 5IBPA 5TGZA 1S3IA 2R85A 5IK2D 1DLJA 1YL7A 3JAKA 3PWTA 1ND5A 2XKAA 4P33A 5EHXA 1ZSVA 3L7AA 3GZNA 2DLCX 1H0HA 3TW4A 3UEOA 4KR2A 1NC1A 1Q50A 1QGZA 2AKYA 1RYNA 2Q6VA 3ENNA 4ZTUB 1CQIB 4ZV7A 3MTQA 4HLUA 1Q83A 2B9EA 5H3HA 2Q28A 4LCJA 3LWZA 4AG3A 2UUOA 3IQXA 3JQBA 3L05A 4Y2HA 1F8XA 5LA6F 3HPRA 2AN3A 3GL9A 5A4IS 3GARA 2IHZA 2MYUA 4LRQA 3FWPA 2EAUA 4DRYA 5EJ6A 1BE8A 1TE2A 2OO5C 2YIDA 2FE4A 4PNZA 2X4LA 1EFRD 2ZWPA 4AYTA 4OHPA 2EQ5A 2MSCB 3G0DA 1U1EA 4GWGA 3MOGA 1Q6YA 4XX1A 3VDQA 1KVRA 3VJMA 3WLKX 3NXKA 2QV7A 3EVNA 3PYXA 4QUDA 3BCHA 2NZ2A 3AZQA 3ZHYA 5F9FA 5L6MB 5C35A 3UW1A 4GOJA 3TE6A 3UM9A 2PBFA 3W3AD 2OXIA 2I6GA 2EX4A 1T36A 3SJZA 5C51B 3ICQB 2C5GA 1JEYB 3U4MA 3QUSA 2OYSA 4A16A 8OHMA 3LYHA 4F9GA 1WD5A 1SUSA 1J39A 2BRUA 3BCRA 3FA2A 1XEAA 2IH4A 2PRSA 3UMGA 1IBLB 3A3PA 3HI4A 3UMCA 3CRVA 2C8VA 1DKUA 1X7GA 1U9IA 1ZD5A 3R3SA 4XLZA 1F0NA 1LBEA 5CJ2A 2HMTA 2PS0A 3T95A 1B8VA 1NLFA 3HBFA 3TSCA 4CKBB 1P72A 2WK1A 5CRIA 1GSOA 4Y2GA 4C4AA 1PG0A 1TUIA 1U3TA 5SZKB 3JAWA 4MR9B 1YR9A 4XQGA 1SVMA 2EEZA 3G2JA 1XOIA 4R84A 5LUBA 5AM4A 5I48A 3I4FA 3NUGA 4EHAA 3S2UA 1KU6A 1IM8A 1TZKA 3IUBA 3TTXA 4F84A 3TM4A 4UQOA 4CM8A 3ENWA 2WUGA 5FEMA 3THOA 1M6WA 1QFZA 1MR3F 3HYSA 3Q3JB 4JKOA 4PZ9A 1E60A 1G7TA 3T1OA 4LX0A 2JEYA 5DN9A 5K1ZA 1P7PA 4C89A 4EA6A 1AUQA 4Z3OA 5IFLA 1PTJC 5ALJA 2VQDA 1ISSA 1X7XA 5HIKA 1IOWA 4FT4A 2WDPA 3CRMA 3I2JA 1TPZA 3PHHA 4U00A 1OWLA 2HQOA 3AWDA 2EW2A 2QJWA 3T7EA 2AG1A 4IIUA 3UHOA 1MQSA 3VKGA 3KSRA 4LOIA 2RB4A 4RHXA 2P6NA 3JQFA 3JQGB 4FFVA 5ERYA 3FB4A 1YDGA 4J6EA 1ODJA 1L6IA 2F8LA 3A1VA 2WWVD 4C06A 4QLAA 4J8PA 1QVRA 4JGIA 4MUGA 1VKHA 3RT1A 3ZU5A 2AW5A 5D01A 3T4PA 3CLTC 4CEJA 4OHKA 2IUEA 2XB6A 4G4SP 2DUJA 2CMKA 5BT9A 5REQA 3KCNA 2FFRA 1GT6A 1MHPA 2BM0A 2YWJA 3KKKA 1UM9B 4Y0AA 4UTVA 4J9UE 4BQEA 4ENWA 1UEJA 3I0ZA 4LGCA 3AF1A 2N1BA 3Q5GA 3REGA 3OF3A 1RQ7A 2ACKA 5EMNA 3NTXA 4NCXA 3OI7A 1ZL2A 5IYZF 1U3WA 2ECOA 5F77A 4ER5A 4BWFB 3ETCA 3I37X 1F17A 1U9YA 1XELA 5CFRA 1N2CE 2XWJI 4Y1FA 2GASA 1UMCB 2HF7A 3ROFA 2VDWB 3LCCA 2MTBA 1BMFD 3UHFA 3EEBA 1JHQA 1XF9A 1KJYA 2FEKA 4PGAA 3PEYA 2Z98A 4DLRA 4M6WA 4TLMB 2ZR7A 2PJRA 2XOKA 3T9BA 5IXYA 1QRDA 1TUBB 4JCOA 4ZVSA 2IW1A 3QPCA 4GS5A 3MMXA 3L7DA 3OSUA 5CEFA 2BEKA 3D5TA 1LPBB 1ORIA 5B6PA 2VYVD 4XIYA 1MABB 2XCIA 2PWBA 2QAGC 3SFZA 1Z6PA 5EEGA 5AW0A 4PCLA 1UL1X 2NO1A 3IQZA 4FDMA 3AZPA 1AC5A 2NUPA 2XAUA 2ZTUA 2ISSD 3DTVB 1SBZA 3C3MA 3RVRA 4ICIA 3WA7A 3BFPA 1CZNA 4RVDA 3EMDA 5E6SB 4PHTA 1HC7A 1JXQA 2H0AA 2GETA 1A95A 3WY9A 2MDTA 5KJCA 1KQ3A 4U7WA 2HEIA 3FRJA 1IE3A 5CIQA 1E2LA 4IJKA 1EUQA 3PEUA 5TQ2B 1YA4A 4KR0A 1PL0A 4ARIA 1AQLA 2O0JA 4NEGA 4YA6A 1DJOA 3A7DA 2QP9X 1Q17A 2VRWA 3KR1A 4HH0A 3EARA 5HKLA 3WMXA 4I81A 5BNIA 1G8HA 4YRFA 3ZVKA 3WJ2A 1N0UA 2E89A 4Z3DA 3MMPA 3OIUA 1GUZA 3QFFA 3GRRA 4K03A 3DYBA 4OSEA 4DABA 1EBFA 1S2MA 1MQ9A 1N8SA 1S5PA 5D85A 3TW8B 1ZM3A 2FX5A 2REBA 3ZE6A 2IZ0A 3K2EA 3FPAA 3HR4A 3FM9A 3DNMA 2EV9A 2NU8A 1JGTA 2J4FA 1LPOA 2JHGA 5GAJA 5CTJA 3NHRA 4OP2A 5C3MA 5JRJA 2PH3A 2ZVJA 1A9XB 4TXHA 2PJZA 4PRLA 3AU9A 4E15A 4L0QA 4LECA 4NDNE 1AN9A 1XCGB 3BMQB 3KE9A 4Q4LA 1JVBA 1OBCA 3JCZA 2GBLA 4EOGA 2ZM5A 221PA 3DW1X 4O2RA 4PCUA 1PAUA 2JASA 4O4HF 1WO8A 1ZNZA 2R65A 4N8EA 4EW2A 1JG4A 5A2GA 5KTKA 1L8OA 2W6CX 1SIOA 3K35A 3DP9A 1PN3A 3HFJA 5FTMA 1ZVQA 3WLRA 3AHCA 4IDCA 1RPTA 4WLOA 5TEVA 3LTNC 4DSUA 3UJ6A 2YV2A 1XZGA 5I4IA 3VHLB 2PGJA 2Q4EA 4GDMA 3ETJA 1CUGA 5BURA 3P7MA 3BL8A 2RGUA 3M5DA 1J8YF 3OD1A 1A7KA 2JKYA 1YOBA 4QJ4A 2BBWA 1WF3A 2QN2A 4LBWA 4RKEA 3VNSA 1XT6A 1ACJA 1CVIA 1PG2A 3R0QA 2FMTA 3R7BA 3NHLA 4LXTA 5CA1F 2WA2A 1J99A 3FPEA 2Q27A 3KKNA 1SQFA 4QGSA 3B3QA 3IX7A 4A10A 2WUDA 1VCIA 2PX8A 1H9BA 5DV9A 2Q6OA 5KNCA 4MA0A 1E64A 4JDPA 1L7PA 1PUJA 4QU8A 5LP6A 1SQSA 4D41A 4E03A 3MWFA 1ZOOA 3KUCA 4BTEA 2DQZA 4OGKA 1QCYA 4RVSA 5DBHX 2BELA 1VHDA 5CVTA 1CK4A 4QRHA 2ZJAA 4UKDA 3D6FA 1RD4A 2HA0A 4Q7KA 2YXBA 4KXQA 3IAHA 4P4SB 2IHYA 4RJJA 3UVEA 4BNHA 5BV8A 5IUJC 2RJNA 4LBYA 2C83A 1WETA 4V0NA 4JMLA 1ID8A 5EQFA 5L7WA 3AJ8A 3F6RA 3HFRA 3ZE9A 3ZHZA 4BRWA 4KIGA 4KJZA 1R0RE 2HA2A 2OV3A 1DFHA 4CMBA 5CDUA 3GCZA 3I58A 4GX5A 5HRUA 4WLFA 3DVQX 5T5QA 5DTJA 1OT3A 5KPDA 3FNHA 1QNLA 1QVAA 3D8BA 1EINA 2C2KA 2D7JA 2FOIA 4DJEC 4MX8A 2FR8C 3EMBA 3KHSA 3GDOA 1Y1TA 1P1IA 4FMDF 4RDXA 5A9SB 2X58A 5CFMA 3ROXA 1DEKA 2VEOA 4D9EA 1G21E 2CF5A 1ADCA 3FHCB 1HYQA 3TFWA 3TLXA 3ZS9A 5KYYB 1U63A 3A58B 4JC0A 4HDRB 4BFSA 4MWDA 2IDMA 5CIYA 1SK8A 1X42A 4KVZA 4IHJF 3SBOA 3C14C 1UANA 4GMHA 1O96B 2E3JA 3PPIA 4MIYA 3BSFA 4RZUA 4ENUA 5C1DA 3AR6A 4ITUA 2KSQA 3N3AC 4A36A 4BNYA 4GR9A 4IXDA 1BCSB 2VT3A 2IXFA 1P61B 1H3NA 1G20B 3MZ0A 4X7RA 2IEAA 2OB1A 2OT3B 3D6VA 4L3OA 4L22A 4OHVA 4RLHA 1ZHOA 4UE2A 4D9BA 5A0VA 2QW0X 3DAFA 5CVVA 5T8KA 2VA8A 4UMVA 2FP4A 3CR7A 2RB5A 2A6PA 4IIJF 3UG6A 1IBKB 4ZV9A 2PSHA 3BYZA 3EXHC 1XRPA 3IOMA 2FN4A 4AJKA 2B7LA 2PBLA 1JE0A 3S2YA 3P2EA 4JLKA 4OLBA 4FONA 4DY6A 2NO9A 3LPMA 3O82A 3QOWA 2EX1A 4M76B 1IZ7A 2WD7A 4RS4A 4M8KA 4C20A 1B73A 5EUQB 3N74A 5KMGB 3JWGA 1JIQA 1TA0A 2HD4A 3DNFA 5EIFA 3NCTA 1PRYA 1HM5A 2J1LA 4S1OA 3ZPXA 1RWNA 1FDOA 2O2IA 2PVSA 3ANSA 3L79A 5I7FA 1KZGB 4CEHB 1E0SA 1NP7A 1K5GA 1NJ6A 5KHOC 2VR1A 3MYRA 4DYDA 5KWJA 1T5SA 2V98A 4L3WA 4DDKA 3QEBZ 1QHHB 2IZOA 3VNUA 1R2QA 2IS2A 1NFQA 3LHFA 3IRUA 9LDTA 4LAFA 1NW6A 3DM9B 3GLSA 4LWQA 5DN6A 2PYDA 3VOTA 5ALDA 3RBAA 1Z6AA 4KWEA 4NATA 1E2QA 4PG4A 1KDPA 1NVFA 1DRVA 1QH8A 2OG2A 2PY6A 3K96A 1J06A 2ZJ6A 4BV3A 4WZZA 3IP5A 3RC8A 5HYVA 1T34A 4HDCA 3CLVA 4ER0A 4N9WA 4DDMA 3T9CA 3COPA 1IXYA 4CEIB 3EZFA 1YHZA 5IM5A 3T9DA 3FCUB 1A76A 1E6KA 2BFOA 1C3EA 1CUFA 1RCTE 2NM0A 2QYHA 4UCQA 3UH1A 2GN6A 4F7DA 5TARA 1DIHA 3IILA 4CQMD 2IELA 3MQFA 1P7VA 3QIAA 4YAGA 4P0TA 3DD5A 5AHKA 4BLRA 2WJYA 1X1BA 5CUQA 5F12A 1ACMA 1YVUA 2ZTLA 4RHUA 3U5TA 4F45A 2C00A 1NBMA 1GGJA 3I45A 3V1MA 5TIIA 1YR1A 3F3SA 4FJ2A 4MB0A 3D3WB 4WECA 3HP7A 3L93A 2DFNA 4IF4A 2X1VA 1CRPA 3IRVA 3FDJA 4UBNA 3GDWA 1B0PA 3VZDA 1EDDA 4DQKA 1XJ0A 1X9GA 4TMFA 1DCMA 3MTAA 4DYHA 2AJBA 4HB0A 4CKCA 2GS9A 4WBNB 5LQCA 3QX8A 1UBGA 5EIBD 3NYIA 1VCOA 5DM4A 1C7QA 1JEAA 1W19A 1XU9A 3AIKA 3EWAA 2YJ3A 4UVEA 2O7NA 4BKOA 1D4ZA 2D54A 4NRDA 3ZNQA 3WGUA 2GYUA 3IJPA 4LDPA 4LJSA 1AF7A 4U8HA 3UQZA 2R8RA 4K0RA 3GJ6A 3PGJA 4EJMA 1AOXA 4QUBA 2FZEA 3NJ8A 4LXUA 1A2OA 3HXPA 1R8YA 2CXPA 4HX5A 4ZT5A 4BQQA 5ED4A 3WRWA 1JA0A 1OV4A 1YUNA 1G5FA 1ZCJA 3R3XA 3G85A 5JYDA 1MT3A 1TQ2A 4IILA 1ISPA 4O8ZA 1Z15A 2HA5A 4TS4A 2AMJA 4ZC8A 5JZVA 3HBAA 4RA9B 2ZB3A 2JZOA 1Y8ZA 3IUNA 5F64A 5FBKA 1Z5VA 1NSTA 1MXHA 2RSLA 1L7EA 3RFXA 2ST1A 2YTZA 3TQFA 3CBGA 1O57A 5BSVA 1GPJA 7AT1A 2TMDA 3VPSA 5F5LA 2JARA 4Q39A 1VHLA 4XYMA 3RAJA 5KWSA 3VKFA 4WADA 1PGQA 4EA9A 2ZUVA 4F5YA 1TZCA 2RAUA 1U0SY 4R05A 2A67A 1UC4B 1SRQA 1VBKA 5J58A 4XWGA 3QLUC 4NSNA 3ACCA 4S24A 2JIQA 5AI8A 1U3CA 1TC1A 4FFBA 3OKPA 4Y1RB 4UVDA 3RF7A 1BGWA 3KPUA 3AUJB 3SEZA 5EL0A 3GFGA 3WGJA 5KS2A 5BN5B 2B4RO 2G83A 5J1SB 3E4DA 4M9ZA 1X80B 2HJGA 1AO3A 3C85A 1I3LA 2C2XA 5K3BA 3RVDA 3ZJ4A 4B32A 3ELDA 2N42A 1U2DA 4LI3X 4HLDA 3WGTA 4Q7QA 2DAPA 3MWKA 3A4YA 1KERA 4HHEA 2XCUA 4B7ZA 4DZTA 5JOQA 1KEEA 4PAMA 1JB1A 1JDBC 4HTFB 1QWOA 1I7PA 4OP3A 5DHAA 1DQPA 1CDEA 2PS1A 4A26A 2J07A 1N5IA 3V9AA 5IAGA 5AW7A 5MFPA 4DCJA 5LXTB 4BJHB 3ASYA 3EGXA 3KLNA 4QT0A 1YJAA 2LPMA 3KSZO 3L06A 1B2RA 1Z5WA 2BHTA 3CW9A 4GGPA 4ASUD 1PFKA 4P4GA 3GNLA 1K5DA 1UWVA 1KK0A 1OV6A 2XZTA 3PRJA 4LNAA 1KH1A 1WCWA 3ND5A 4MQUA 4BJ5A 5JJIA 4O2AF 4GU5A 4U4AA 3ZH9B 1LSSA 1BJKA 1YT5A 3CNHA 5FWNA 4LOHA 1G2PA 1TVKA 2JLSA 4J1QA 3WRXA 3ZNNA 4FR0A 5JNLA 4IDDA 3VVMA 4DB4A 3UKJA 1O6FA 4E51A 3RIHA 3DPIA 4TGLA 1SKYB 4A8PA 3S7ZA 1Y6RA 5TMEA 4Y30A 4XYGA 1XQYA 1ZZGA 3BJEA 3ZQUA 2HLHA 4E3ZA 5KJ6A 3L43A 3L1IA 5JCPA 4RMJA 2IOFA 1TK9A 2PEYA 1CIJA 3CF4G 2JCBA 1T24A 3TIGA 4OLAA 3MF4A 2Z4TA 3HGTA 4PTZA 4TRMA 1ECBA 1ATIA 4DLZA 5C80A 1C14A 2G1KA 1Z0DA 1QK3A 1UEXC 2ORYA 2XB8A 3DHEA 3FYUA 1CZOA 3I04M 3GZJA 1RYMA 3OG9A 4MW5A 4RVHA 4C2TA 3U5ZB 4NBSA 2GCGA 2MSKA 5KTSA 1FW6A 4ZOEA 3S44A 3W4KA 2EZ8A 2I80A 4ED9A 1QGYA 3KR9A 3OOEA 3RRXA 3FNEA 3A37A 3IOBA 4HN2A 2D8AA 3K8ZA 2FPPA 2IYPA 3T52A 3DCNA 4JZYA 5K4HA 2JIZD 3P5BA 5KTTA 3JYHA 4F06A 3X43A 3G5AA 5LU8A 4Z53A 3WDLA 2Z6QA 1L5QA 1S2NA 2EHJA 4XIJA 4XUEA 4NMXB 3TN7A 3ZGXA 4DMLA 1PJZA 1SUAA 1M6HA 1PT5A 1CERA 3QBJA 1XKLA 3PDIB 4HAUA 3TVYA 3DEFA 3ET4A 1ZM2A 3LV8A 5EWMA 5JWHA 5DM70 3WYEA 3GLHB 5BN3A 2GA8A 3A1SA 1U1FA 2RBEA 2C7QA 1XPJA 2JHCA 2P35A 1DC3A 2QL5A 3ZJUA 1LSJA 3KXPA 4BGEA 3HCNA 4DIOA 2IGBA 5KWEA 2HRZA 5LLTA 1SKMA 4KGVA 3K31A 1CEXA 1QH9A 3GOQA 4KWCA 4Q18A 3C6YA 4UU7A 1OROA 6LDHA 4WVFA 2B69A 4XVRA 3EW7A 4WZ6A 1XEWX 2OAQ1 2HX1A 1MN6A 4JB2A 4EB8A 1MG5A 3R7WB 5HKAA 5I8ZA 2D1FA 4E46A 2ZIXB 1P9LA 2YYYA 3OX4A 2FOXA 2FN7A 2QOEA 1UC8A 1UDBA 2C54A 2IHKA 2GVDC 1HSOA 1NRIA 2REQA 2FG6C 3A36A 3HB9A 3NW9A 1UMBB 3Q9LA 3ETDA 4MJLA 4ZCSA 3KZNA 4GBGA 2J9GA 5AUOB 4DCGA 5LQKA 1NVKA 1ZM7A 3HVKA 1LSUA 1YBMA 1XMQB 4IDPA 5FCDA 2VZ0A 5EJ9A 1FFEA 1A82A 2WHPA 1ECFA 1R64A 3BMOB 5JJCA 4LTMA 3ZD9A 1JFFA 3M8KA 4PFQA 4WK6A 4YRBA 3OKAA 2AFRA 1Q14A 5LZ2A 1Q7CA 2OAEA 5CDFA 2DVMA 2PIAA 2A5GA 2WKRA 1HDEA 3VYVA 3I5XA 2QD5A 3MNFA 2D3WA 4C0QC 3K0FB 1TM2A 2CE2X 3KM0A 2HA3A 3L04A 4NOJA 4HC4A 4AY2A 1J1IA 4KSYA 5K0LA 4AF8A 5JAUA 2QIOA 3OQMA 4WCFC 1XTKA 4ZVQA 3MUEA 1OFIA 1Q7EA 2PUJA 4BKQA 4C01A 4CXMA 1K3UB 2FWNA 4K6CA 5JD3A 2QTRA 2XYQA 2IEGA 5TS3A 5M2QA 4DNXA 4RXUA 1JLSA 2ZYHA 1N8TA 3DBOB 3VVBA 2Z56A 2CYCA 2LWIA 3K15A 3UXHA 4DILA 4KR6A 1ZH4A 2CLHB 3A4VA 4P4NA 1L3IA 3GEDA 1UMKA 5FRDA 1WJGA 3ZJYA 1MRZA 2MIIA 4NU8X 1T5LA 3VKWA 2V54A 1Z82A 4WGGA 2F8MA 5AVQA 1VP9A 3A3KA 3W3AH 1L9XA 3A4TA 3D6MA 4Y1GA 5AW2A 5AKYA 2OGTA 1QFSA 3NHMA 5DX1A 3N59A 1M5UA 1DXOA 3BJIC 2E5LB 1XROA 1KY2A 1VQ1A 4LQDA 1E4EB 1EFVA 2WIFA 1JG6A </