4P38A

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with azd8329
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYNWDRFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Novel acidic 11 beta-hydroxysteroid dehydrogenase type 1 (11 beta-HSD1) inhibitor with reduced acyl glucuronide liability: the discovery of 4-[4-(2-adamantylcarbamoyl)-5-tert-butyl-pyrazol-1-yl]benzoic acid (AZD8329).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4p38A00
4J0EA 1BDBA 2H5LA 5JAMA 1GCUA 5L4LA 4WGGA 4P22A 3R0IA 1FDSA 3PIDA 1CIVA 3ABIA 3I4CA 3HUDA 1GEEA 3HZZA 4XGNA 2H9IA 5JLAA 1VJTA 4UAGA 1PGNA 4C7KA 4GGPA 1WWKA 4IDBA 2GN9A 3K9QO 4CPDA 1E7MA 1H94A 1WDLA 1WDMA 5MDHA 3HN7A 4BO9A 3EC7A 3VH1A 1E92A 3A4VA 1OAAA 2V6FA 2OO5A 4YJHB 3AI2A 1F14A 2HCTA 4CMJA 2OORA 3JQFC 4AJOA 1ADFA 1GPDG 1BXGB 3A1NA 3JQ7B 4M8SA 1FDWA 1N1GA 3PWZA 1EE9A 2B35A 3DXFA 4I5GA 1YQGA 1GDHA 5IZ4A 1HXHA 1HWYA 5HTOA 3Q3CA 4DUPA 1OBFO 4Z3KA 2NM0A 4GQAA 4MOWA 1HDOA 4GLLA 3PQEA 3JQBC 1UAYA 1LDYA 1GR0A 1N9GB 2IE0A 1BVRA 3OSUA 4OOFA 4BO6A 4WLFA 5C7LO 4BNYA 2Y1GA 1PX0A 5C5IA 4ZQBA 4HKTA 2O7QA 3WTBA 5A5EA 5G0TA 2DPHA 2JFFA 1YGYA 5L7YA 4CMEC 4F6CA 2Y1DA 5DCUA 1BVUA 1QR6A 3TZHA 1FDVA 4E5NA 4FFPA 5JPIA 1TB4A 4IZHA 3FSRA 4NK5A 4CV1A 1P9LA 1T2CA 5HS6A 4W9NA 4YJFB 1H2HA 1H9BA 1KETA 3C85A 3HSKA 1UXJA 3PYXA 5JYEA 3DTTA 1K5HA 3ETDA 1E1KA 1SO8A 2H6EA 2ZCUA 3Q9UA 1PWZA 4MVJE 4GVLA 1M67A 5JBIA 1DIHA 4BNWA 2E4AA 3LK7A 3NKLA 1UAGA 2Y1CA 4EEZA 2GGSA 1B3RA 1VKOA 1Q7CA 3FNGA 4TRJA 3JD4A 1QSGA 3NTRA 1YDEA 4U5QA 4HX5A 1Q0LA 1KBZA 2WJPA 2FSVA 1NPYA 1AHHA 3I9NA 4Z3DA 5CPFA 3JQEA 2OL4A 3E82A 4B4OA 4GMFA 1GPJA 4M55A 1XQ1A 4Y8VA 2NTVA 4CV2A 3RQSA 4JNKA 4PIVA 1G6KA 3F5SA 4N5MA 1DIGA 1D1SA 4QX6A 5CDTA 5IN4A 5KJ1A 5JFOA 4WKGA 4WLNA 3QIVA 4WCDA 2PD4A 1UP7A 2C2YA 4YEDA 3U4HA 1EVJA 1Q0HA 1MXHA 3ZWWA 1KEWA 4XRGA 3JQGA 4DMLA 1IPFA 2Q99A 1JLLA 1W73A 4W7HA 5G0UA 5TT1A 3UH1A 4CMIA 1LC0A 1ENYA 4CQMB 3OECA 4ZHSA 2QIOA 1M2WA 3PLRA 4R9RA 3E18A 3OIGA 3WWZA 1E6EA 4G5HA 1YJ8A 5K6AC 3WGTA 2FN7A 4L9RA 4MINA 2GASA 4CV3A 1IE3A 4HFMA 1HYHA 3OM9A 1DFHA 4L73A 2P9CA 4D0SA 2VZ0A 4UUOA 1HTBA 1PZGA 1T2DA 3PQFA 5DBFA 5KJFA 3Q11A 2YV2A 1I0ZA 2IEDA 4NBUA 2D2IA 1VRWA 3F47A 3V8BA 1QLJA 2VWQA 1V3VA 3GT0A 3EYWA 5I8WA 5A3JA 1CYDA 1GD1O 3AFMA 5J23A 5FF9A 3WIDA 4A5OA 4ALIA 3M6IA 4EITA 1GZ4A 1LDBA 3C24A 4QT0A 3S2FA 5IDQA 3E9NA 3OIFA 5DZSA 3UHAA 2PGDA 2AE2A 4MIEA 1E5QA 4E6PA 1I33A 3DDNA 2OBYA 1WZEA 5DCWA 3WGIA 2X1HA 5A06A 3SXPA 4HNHA 4FW8A 3W8DA 4Z0PA 3I5MA 3HB4X 2OZPA 3PIIA 4R41A 1A7AA 3U4DA 2CVQA 2O4CA 3NAQA 4XD2A 4ZJUA 1H6AA 1CJCA 4HADA 5JE8A 1EVYA 5ITVA 4KWIA 2HAEA 4Z9FA 4CM4A 2OP0A 3CIFA 1EBUA 1WXDA 3P2YA 2OMEA 4IDAA 4KMSA 3GMSA 1A4UA 2EJVA 2R00A 3JTMA 4UREA 4BO8A 1G0OA 4CM9D 4TKLA 4WNCA 1GV1A 2A35A 5CPBA 4XYLA 1X1EA 1Y8QA 2X22A 2GRAA 1YBAA 1B3BA 3BMNA 5IDWA 2J6IA 5I9NA 4LW8A 2PGLA 3QSGA 3UW3A 5FFFA 3VPHA 2NUAA 3DBLB 4ALKA 3AFNA 4D46A 1NASA 1PQWA 1ZFNA 1LRLA 1SC6A 2AHRA 4W9NC 4IDFA 5ADHA 5KTKA 1MG5A 4OO3A 4IJKA 3GY0A 4JXKA 2F00A 4BGIA 3LT4A 2PKQO 4RZIA 3VKVA 1NYTA 1UXIA 2CMDA 2Q4BA 3P5SA 4B7UA 4BS9A 3D5TA 2VNSA 2I9PA 3LT1A 3LDHA 3NGXA 1O8CA 4IINA 3GEMA 4DIFA 5DN9A 3KYCA 3NT4A 3JYQA 1UXHA 1I3LA 2CDAA 3WSVA 4R3WA 5L4NA 3E1KA 1HETA 4U6QA 2WYWA 4TQGA 5JMPA 4AICA 4GL4A 2B69A 3FNFA 2CF6A 4I5EA 2BHLA 1DLJA 4H16A 4ND4A 3GDGA 2HJRA 1Y7TA 2FY8A 1P45A 2FPGA 4YXFA 3WQSB 1EK6A 1R4NA 4BNKA 5F1OA 3VTZA 3WR5A 4MVJD 1B14A 4ESOA 2CDCA 3KV3O 3EVTA 1PJ3A 4PLYA 3OFSA 4YAGA 2DFDA 1RJWA 4BNIA 1U3WA 1JKFA 1U5CA 1MC4A 3VVBA 4CM9A 2VQ3A 3BTUA 5H82A 4IIUA 1M6HA 4E33A 4NIMA 3S2IA 3TZ6A 3DHEA 5F5NA 5A9RA 1PQPA 4YJGB 1E3WB 3AK4A 2OBNA 1HSOA 2LDBA 3HFSA 3RC7A 1VL0A 1NTOA 3EMKA 5IXYA 1HDXA 3BTVA 4FOSA 3OQ6A 4EGFA 2NVWA 3QW2A 2EJWA 3MJCA 2GZ1A 3KUXA 1P31A 3ZDFA 1SZJG 1L7EA 3WFIA 1QV7A 1TA4A 1V35A 2W2KA 3F1LA 1FXSA 2PKRA 2QZ9A 4NK4A 4IQ8A 4CLOA 1V8BA 1U1IA 4O63O 4OQZA 4BNJA 4QSMA 4CR7A 2CZCA 3MCVA 4U0KA 5IF3A 4NNJA 2IDZA 3GEGA 3OJOA 3QE3A 4WEQA 3PFFA 4FIZA 4DTIA 9LDTA 3EY4A 3JV7A 4J9VA 4YBZA 4LCEA 2DKNA 2VCYA 4F46A 4MO2A 4PN3A 2P5YA 1GFSA 1PWXA 4XKJA 1Y6JA 1PJ4A 1U4OA 3L6OO 4EJ0A 4NR0A 1B26A 1E0DA 2ILTA 2JHFA 3FI9A 5A5FA 1Z6ZA 4ROSA 4LISA 3E9MA 2D59A 5TC4A 3ZV6A 5ER6A 4BNHA 4IUYA 5BNTA 4RJTA 1Y9EA 3ICPA 3WLFA 3GVPA 2R00C 3WX0A 4MVJA 3DWFA 2ZTMA 5A02A 3LLVA 1GTMA 3EAGA 3E8XA 3PZRA 1RYEA 4ZD6A 3AUTA 3AU9A 4G65A 5ILOA 1TT5A 1HSZA 4RV9A 4B7XA 3K31A 4YT8A 3PRJA 5BNIA 4KOAA 4YA6A 5LC1A 1MX3A 4OMUA 4MVJP 1XR3A 3BIOA 2GUGA 1P0CA 2NVUB 3RC1A 5DULA 4HNGA 3MTGA 1YOVA 3ONEA 4URFA 3V1UA 4PLTA 4GH5A 4Z0TA 1HYEA 3RKUA 1BW9A 3GZNA 3TFOA 1ONPA 2EKQA 3JCZA 3PVZA 3ZI0A 2PKQP 4Y98A 3SBOA 3GRPA 5BSFA 2BFOA 1EE2A 3FWNA 1PL7A 3AM5A 4J49A 1WVGA 2XOXA 3M2PA 5F1PA 3WBFA 4A7PA 4YT4A 3BYZA 1GADO 4DQVA 5L45A 2YYYA 4Q3EA 4DPMA 5AXDA 3C7DB 4MP8A 1C0IA 4D42A 2VHXA 2Q2VA 1ISFA 4II2A 2Y68A 3N7UA 4Q3NA 4CMCA 4MP6A 4IQ0A 4H7PA 1ADCA 3GPIA 5AXBA 3QVTA 3VZSA 5EIOA 3GGPA 1GYRA 2X0RA 3VH3A 3KBOA 2C20A 4C4OA 3B1JA 5T5QA 4JBHA 1MGOA 5CDYA 4UVEA 3ZV5A 4RORA 2V65A 4H3VA 5EINA 1T1SA 1K6XA 2JCXA 1BSVA 3FBGA 1M6WA 1EMDA 3JQAD 4DPLA 3HDQA 2V6GA 3KSUA 3MOIA 4MVJH 2NWQA 3CZRA 3VH4A 3QJ5A 4J7UA 1HYGA 4MKZA 4XB2A 1L1FA 4HFRA 4AG3A 1I24A 3OICA 3RUAA 1DJNA 4RPHA 4CMHA 1ADBA 4LVUA 4NJOA 4NG5A 2DBVO 2WD7A 3HFGA 2O4UX 3ASVA 2X0IA 4NJMA 1JTVA 2BFPA 3HN2A 3MJSA 3MWEB 4YJDA 3S2GA 1AUPA 3T4XA 2NU6A 4LVCA 4WECA 1DHTA 3OA2A 3PHLA 4BMSA 4XA8A 5BT9A 3U9LA 3GGOA 1PEDA 2HLPA 5JS6A 4OL9A 1SOWA 4KQWA 4BO0A 1PTJA 3OH8A 5A3VA 4GKVA 1OFGA 2R6JA 1U4SA 3QHAA 4GKBA 5DP1A 2EKPA 3KYDA 3WYEA 1C1XA 5A05A 3GF4A 5ENDA 3DZHA 5A04A 1YDWA 4J6FA 1H6CA 5AXAA 3JQCA 4GX1A 1VPDA 3DOJA 3D64A 2H1SA 3UCXA 2ZCVA 4GWKA 2I99A 3OF2A 1QYWA 4CQLA 1HDGO 4IXTA 3SX2A 1SCUA 3ITKA 3KVOA 4Z0HO 1GUZA 4RF2A 3ZHYA 5I7VA 1WW8A 4BGVA 3EZYA 4FQ8A 3HG7A 3PGJA 4L4RA 2GR9A 3S2EA 1H6BA 3ZV3A 4I1IA 3ZNNA 1P74A 1R4MA 4YAKA 2Y67A 4L0QA 2Y1FA 3EZLA 3JQAA 3UFXA 5DDIP 1CQJA 4CLRB 2G1UA 1LRJA 3GK3A 3BTSA 3O03A 4WK6A 1NXQA 3SVTA 3PK0A 4PFJA 3OP4A 2DUUA 1SB8A 5B1YA 1PJTA 1T2FA 5JAZA 2AMFA 5GY7A 4AJ2A 2ZTUA 4A73A 5TIIA 3WGYA 3TF5A 3HE3A 2I76A 3GG2A 1O95A 2A9FA 1LU9A 3FHLA 4J2HA 5T64A 4CM7A 1JW9B 3PHJA 4RF4A 3LSYA 2C07A 3LT2A 5U4QA 4DC0A 3VPGA 1MC5A 2FPPA 3EHEA 1U9JA 2PH5A 1X14A 4XQ9A 5JDCA 2X0NA 1Z73A 1ZJYA 1BG6A 1W6UA 4W6ZA 4I8XA 2ZTLA 4D44A 4EEXA 5KNLA 3KZVA 4XGKA 1QYXA 5ENVA 2VTDA 4IZIA 3ZHZA 1E7QA 4CODB 5JAQA 1Y81A 2PV7A 4BV8A 5EERA 5AQ1A 3W6UA 2VZ8A 2WEKA 2PWZA 3CUKA 3H6KA 1HZZA 4KDEA 3KLPX 3RU7A 4LSWA 1T24A 1I10A 1MXFA 4JP2A 4LN1A 1SEPA 3KEQA 2WM3A 3OEWA 3AWDA 1XWFA 1DJQA 3HDJA 4WCFA 4ZGWA 4ZU3A 1QG6A 3MJEA 5TSDA 3D3WA 3O8QA 4FGWA 1Y5RA 3EVNA 4NU6A 2OP1A 4WNIA 1YWGO 4BNFA 4BO3A 4Y6SA 1WZIA 2NU8A 3H5AA 1TEHA 3GNSA 3GFBA 4AJ1A 3W6ZA 2O3TA 4MP3A 3ANNA 2EV9A 2GERA 3ENKA 1EEHA 4XRRA 4J4TA 2G82A 3HHPA 2EWMA 1DO8A 2YQ5A 1I3KA 2CD9A 3V2UA 4B7CA 4D3SA 3U49A 2D8AA 1XEAA 4IJVA 3EW7A 4NPCA 4M86A 2RCYA 5A9SB 2GZ2A 2O3SA 1YL5A 3BZUA 3DZIA 1AGNA 1LX6A 1BMDA 1PIWA 2VNAA 3A14A 5JAIA 1HDYA 1ZXBA 3U5TA 5B12A 4NDNE 4ALNA 3ZWNA 3MJ4A 2JCYA 1KVSA 1X0XA 2RAFA 3NX4A 2J5KA 4LMPA 4EUEA 2BI7A 4QUKA 1VL8A 2E37A 4E2ZA 4M1QA 3G1TA 1PS9A 1IZ0A 1MB4A 4HBGA 4NI5A 5K9ZA 1QLHA 4L8VA 1ENOA 2YHIB 3LC2O 1C0KA 2O3JA 4YT2A 2AEMA 1X7GA 2OHXA 2WMDA 3IC5A 4K9DA 1NX6A 5JY6A 3DBHA 3KRTA 1F0YA 3I4FA 3LLSA 4MIOA 1I2CA 1ISIA 4XZ3A 1VKNA 2CNBA 3QWHA 3X2EA 5EESA 5K6AA 3GGGA 3OJLA 3WICA 4FFRA 7ADHA 3I9LA 3AJRA 1MG0A 3D5QA 2DUWA 4RLSA 3RROA 4AJLA 4R54A 5I7EA 1ISMA 1PJBA 2E82A 2NTJA 2ZYDA 2O3RA 3JSAA 3D3EA 3IQDB 3GRKA 4HP8A 2GCGA 4FJ0A 4R01A 3B1FA 4FPXA 3W4IA 3GLQA 4F3YA 1P1HA 2VWPA 1LI4A 4FGSA 4TMFA 4PLWA 1NPDA 4UULA 4CMGA 3NTOA 3DAFA 1FDUA 1C1DA 2YW9A 4GMGA 2J5RA 3CZMA 3WMXA 3JQGB 1XGKA 2GF2A 2Y99A 5T67A 4R51A 4YAJA 3A06A 1F8GA 4GX5A 1EK5A 4KTTE 3WSWA 1NBOA 1EVIA 6ADHA 2PA3A 1YQXA 1PQUA 2UVDA 1AHIA 1ZK0A 1S6YA 4FFOA 1YQDA 3MJVA 5G0VA 4XIJA 3DZBA 5DNAA 5JDCC 3RBZA 2IXAA 3O38A 3DFUA 2IZ1A 2ZATA 3F4BA 3BHJA 1F12A 2ZYGA 1T4DA 2NTNA 5HBRA 3GVIA 1RWBA 4IQGA 4J2OA 4FFMA 4PLGA 1A9ZA 1DHRA 1DIAA 3ROQA 4DA9A 4LMRA 3V2HA 1W4ZA 5LDGA 1EQ2A 3JD1A 4CM8B 2WWRA 4P8RA 4WCFC 4O0LA 3JQ8B 4TVBA 3WJ7A 4ZQHA 1KY4A 2PZKA 2Y05A 2O23A 2W98A 2CVOA 3H9EO 3HDYA 3QVOA 4IXWA 4BMNA 1C14A 4OKNA 5FWNA 1ISGA 3ENNA 4KDFA 3TZQA 3CE6A 2Q46A 3K2BA 4GLOA 3GDOA 3GPDG 4E5PA 4HUJA 4PLPA 2FR0A 4I9UA 2BI8A 3F6YA 1GUFA 2EKLA 3GFGA 2J5QA 2PZLA 3IOYA 5CHEA 4DMMA 5CG1A 3BTOA 5A9TA 3BA1A 3NYWA 1V3TA 2NACA 2X7HA 4MVJM 1IZ9A 3DOCA 4MVJG 3KM0A 3E5MA 1XELA 1DEHA 4CR8A 1NVTA 5JDIA 3DAGA 4E21A 2Q2WA 4OM8A 5G0SA 3PDJA 4E2WA 4DYVA 2FHSA 3I83A 2I5PO 2CY0A 4GI2A 2NQTA 5DBGA 3QA9A 4HFNA 1Y8RA 1A27A 4IM7A 4P38A 1WPQA 2QZZA 1UUFA 3BMOB 4LSMA 5HA5A 2X5KO 1P1IA 3BMQA 3F5QA 4L4SA 1ZO8A 3FPCA 5GZ1A 3WIEA 3ZWPA 2AEFA 3INRA 3P2OA 5KJCA 1I2BA 2X23A 3ANMA 3Q2KA 4Y6RA 3NTQA 3DQPA 1U2DA 4K28A 1GQ2A 4KUHA 2PFGA 4RDIA 4XYMA 1N1EA 1P1RA 3FF4A 3RIHA 4BV9A 1DC3A 3PJDA 3UCEA 1XIVA 3PGXA 1ZCJA 2WE8A 2FMUA 1NQOA 1LQUA 1ZK3A 1F8FA 2YJZA 2D0IA 3I9MA 3I9JA 4J3FA 1VSUA 4ID9A 1LLCA 2JAPA 4WLOA 3KYCB 5AYVA 3TL2A 4BO7A 2Q2QA 3DEYX 4DLLA 4PCVA 3QVWA 2IYOA 4R1UA 1QP8A 3PLNA 1N8KA 2NLOA 1GY8A 1OC4A 1HEUA 3G79A 4I5DA 3MTJA 3V1YA 3ZCXA 5AXCA 3UAGA 1JN0A 2B0JA 1N2SA 1A9YA 4ND2A 3T4EA 3WGGA 3RUEA 2YV3A 1YKFA 3P7MA 1PU2A 1GL3A 1JA9A 4FDAA 2NVBA 2EP5A 4J43A 2EHDA 5C7OO 3V2GA 4ALMA 4Y67A 1JWBB 1R4NB 4M54A 3WTCA 1R37A 5FEUA 1LSUA 1X0VA 4GSLA 4WLVA 2FOIA 2QW8A 3M2TA 4OXNA 3GQVA 3Q9NA 4ZQGA 2X5JO 1LDGA 3PPIA 1I30A 3ADPA 4CM1A 5COQA 3JQ7A 1CDOA 4W82A 1ZZEA 1NM5A 4TZKA 3COSA 2QHXA 3ZNOA 2OXIA 1DXYA 3DHNA 3RUHA 3VZRA 1HDRA 4LCJA 2WSBA 3VOSA 1W0CA 3NV9A 5BSGA 2I67A 4OSPA 4P4GA 2W2KB 3FTPA 3KOUA 1N9GA 2P68A 4X54A 3ONDA 4RVFA 5EQDA 1D4FA 3HDHA 4CQMD 1JDJA 4DLBA 1E3IA 3NDJA 2IODA 3SLKA 4EZBA 1E6UA 5DF1A 3H65A 4AJJA 1KC1A 3E03A 4JBIA 4NU5A 4D43A 4YWJA 3DAPA 1LEHA 2ZB8A 1CF2O 3I9OA 1I3MA 3INGA 2BFAA 4ND5A 5CP8A 8LDHA 3G0OA 1PZEA 3ORFA 2PD6A 1IB6A 5IFLA 3AY6A 1EZ4A 4I9HA 2P4QA 4WASA 4XX0A 4FBGA 3DZGA 3DMTA 4RDHA 5A1TA 1IL0A 5JC8A 3JD2A 4I08A 1DRVA 4EBFA 4EUFA 2VOJA 4BNUA 3GC6A 3KYBA 1KEPA 5JDIC 4D3FA 2AA3A 3TL3A 4W4TA 3RUDA 2Q1TA 1TT5B 4NFSA 1U3TA 3AY7A 3L77A 4L76A 2HRBA 4XYGA 3ZHBA 3PQDA 1RM3A 4D0RA 2AXQA 3DO5A 4FB5A 1YOVB 3WS7A 2EP7A 3ZWXA 3JQDA 5TJ9A 2FR8A 1JAYA 4JJIA 2Q1WA 2ZB3A 2Y0EA 2C29D 4NBWA 1BW9B 3GZNB 4UEKA 2JD1A 3TZCA 2YY7A 1IHXA 4XDZA 3PDUA 4D41A 5CFZA 1FF9A 1FMCA 3RUFA 5L7WA 1KEUA 3E48A 3LQFA 4CQMA 1H9AA 2O7SA 3GAFA 2DBZA 4BOYA 2ZQZA 1V9LA 1E3EA 2HMTA 2ZTVA 4J4HA 4OYRA 5CEEA 4FFLA 5DP2A 4EJMA 4R1NA 2BRUA 4AL4A 1ENZA 3D7LA 4J1NA 3C1OA 3Q6IA 2G0TA 2LDXA 5TQVA 4I5FA 4RGBA 4HV4A 4XR9A 5C3MA 1LJ8A 5JO0A 3HB5X 1H0KA 1UXGA 5T6BA 3CEAA 1BDMA 1K6IA 3S55A 3WB9A 1NR7A 1ZW1A 2JFGA 3FN4A 1BWSA 1DB3A 2OFPA 1LBEA 4INAA 3GUCA 1C3VA 3I6IA 3IUSA 4K6FA 3STHA 4FC6A 5HS4A 1YE3A 2AQHA 2AEJA 1IYZA 4DPKA 3AOGA 4BO2A 2EW8A 3ULKA 2O3QA 3TSCA 3T7EA 3AUUA 4GSKA 3PJGA 3QWFA 1QXSA 4QTZA 1F17A 4BGEA 3N74A 2VHWA 2DLDA 2VUSA 3SJ7A 2WD7B 4E0BA 2YQ4A 2JHGA 4ILKA 4NJMB 2BFMA 3WXBA 5I9MA 3OJEA 4TKMA 2C0CA 4NFYA 3VPFA 4XQEA 4Q39A 2EGGA 5F5LA 5G4KB 3NT5A 3L9WA 4K6CA 1YS4A 3NJ8A 1XYGA 4OGWA 3TRIA 4B8ZA 1BXZA 4CLHA 1R15A 4R5HA 4IDCA 3RFTA 1O9BA 4O5OA 2R2GA 5BR7A 1HE3A 1D8AA 1W8DA 1TVEA 4PG4A 1LUAA 3KYDB 4ZRNA 4WUVA 2GLXA 1C1XB 1GV0A 3DBLA 4JIGA 4HWKA 1KS9A 1MLDA 3BMCA 3R3JA 5FYDA 1NAHA 1KC3A 1Z7BA 1ZK1A 4B79A 4XJTA 4TSKA 4XB1A 3EGOA 3GHHA 4Q9NA 1PJCA 4WLEA 4A03A 3GNTA 1A5ZA 5B4TA 1CEQA 2UDPA 3DZKA 4IDEA 1DFGA 2I65A 3SJUA 4BGUA 5JCXA 2EERA 4XJSA 3FNEA 2HKIA 3GHYA 4K26A 1HE4A 3DMTC 2HJSA 2HMVA 5ICSA 3KSDO 1K89A 3GR6A 3H9QA 1PR9A 3ICCA 3VTFA 4DQUA 1AN9A 1P44A 2A92A 3PP8A 2A4KA 1MA0A 4BUCA 2HUNA 3WWYA 5T8KA 1ID1A 2DVMA 3S1LA 1IY8A 1ZMOA 2D1YA 3GA0A 4QFCA 4ZQEA 1HDZA 4CLEA 1PJLA 2JL1A 4DL9A 5I8ZA 3PYLA 4E3ZA 2PGJA 1GYPA 1X13A 3SLGA 1O0SA 4FFNA 4KP7A 4BQRA 5L51A 1WP4A 3RCBA 4PZCA 3WGOA 4BNTA 1O5IA 5TRTA 3D4NA 1EBFA 1GAEO 1QORA 4ALJA 2POQX 1ZSNA 2WE7A 5EQFA 3D1LA 4CUKA 4JX8A 5KVVA 1B0AA 1R0KA 4RQTA 2WD8A 4Q3BA 4PZDA 3EUWA 4DYDA 1HE2A 2RIRA 5I7FA 2VZ9A 1XCBA 4YJGA 7MDHA 2VT2A 3MOGA 3GVXA 4BKPA 3OIDA 4YRDA 3QWAA 4GPD1 4IY1A 1PGJA 4CUZA 3ZU3A 5B4VA 3DC2A 1X7DA 4G81A 3O26A 2GNAA 3WGHA 3NT2A 4KZPA 4AJ4A 4RPLA 5FI3A 3NEPX 4PLZA 2E49A 4U0JA 5IN5A 4S1VA 3PJFA 5ES3A 4PRLA 4RCVA 4WCFB 3WFJA 4JP3A 1PGQA 3OETA 2CVZA 1YL6A 5IXSA 1ADGA 1D1TA 1K6JA 3VDRA 3QY9A 1QKIA 1H93A 4PVDA 3H9GA 2Q45A 2JD0A 4NZ9A 2Y93A 3K2EA 2YV1A 4YQYA 5G2OA 5JW6A 2C59A 1IOLA 4ALLA 1WMAA 3QV1A 3PXXA 2GZ3A 3AW9A 1QYCA 1PJSA 1E1MA 3M1AA 4MIYA 2B5WA 4PLHA 1NAIA 4A27A 4E5MA 3F4LA 2ZB4A 2UUPA 2B4QA 3KEOA 3WYBA 4XGIA 4RO0A 1DRUA 1PR3A 3DBVO 3H9JA 9LDBA 3W4JA 3TQHA 4RVGA 1EUCA 1P3DA 3GEDA 1H2BA 2AQIA 2OUIA 2X9VA 3OQBA 2DT5A 3ZU5A 1EFLA 2G76A 1Z82A 1TT7A 2NU7A 2D5AA 2VRBA 2HQ1A 2J3HA 1R0SA 4OHUA 4PLFA 5JMWA 3C8MA 2QX7A 4UEOA 4IGEA 4CV0A 5MGBA 1T25A 1XKQA 4N54A 1LSSA 4J7CA 3IJPA 4W99A 4AJKA 4PVCA 2V6BA 2JKVA 3UOGA 4J16A 1ZKMA 3JQ9A 1KY5A 4R1SA 3WQQA 1Z7EA 3DL2A 1K2WA 4AJIA 1GZ3A 5THKA 1Q1NA 3WNQA 4OAQA 3GUYA 2BLLA 4ITUA 2ZKLA 2Z1NA 4IIVA 1DC4A 2NVUA 3WQRA 1LSOA 1PJQA 1ZEMA 3W8FA 4XQGA 4YAIA 3K6JA 4U8GA 1KVQA 1Q2XA 1ZSYA 4U6SA 5C37A 3HADA 2DC1A 2NV6A 2VWGA 2Q1UA 4GGOA 1H5QA 2IZ0A 2DTEA 3GMDA 3L9XA 1VJ1A 4LRTB 1A71A 2G17A 4IS3A 3GDFA 3TPCA 4I9NA 4R1TA 3BHMA 2DM6A 1LLQA 4QO7A 2D5CA 4L75A 3GN1A 3S8MA 4E4YA 5KIAA 3PTZA 2B83A 2DFVA 5T8KC 3RFVA 4UVHA 1T1RA 2E6UX 3KLMX 3RJ9A 3FBTA 1WAMA 1AXEA 2QQ5A 2BELA 1KVRA 2RHCA 3MJTA 3PYMA 3H2ZA 1E1NA 2YDXA 4CM5A 3DZJA 3CSDA 3W4KA 5KVCA 4RVHA 1XG5A 2ZQYA 5L40A 1LSJA 3ASUA 1ENPA 1I8TA 3WGZA 1ULSA 2DPGA 1VLLA 4LK3A 3AU8A 2C7GA 2QYTA 1B8PA 3PHHA 5K0ZA 4WOJA 2B37A 4B3HA 1N92A 2C5EA 4GAEA 3RAJA 3DTYA 3QP9A 1NVGA 1E3SA 3LT0A 1GCOA 5H83A 3R6DA 4E5YA 3VZQA 1ZH8A 2P9GA 3B1KA 3ZW8A 4LGVA 1BXKA 4N5NA 3WYCA 1LTHR 5B37A 2J3KA 4J90A 2IEBA 1HRDA 3N58A 3PJEA 3U3XA 1JVSA 1ZIDA 2Y1EA 4BNNA 1CRWG 4RQUA 3O4RA 4OSOA 4RF3A 3WMWA 3BXXA 3PHIA 3VC7A 4UVDA 4DVJA 4YACA 1LRKA 2Z95A 4YVFA 4G2NA 4NMHA 1GU7A 3K96A 3ZH2A 2B4TO 5IJZA 1KIFA 1M76A 1UXKA 5L9AA 1P1KA 1SBYA 2Y0DA 3UICA 1WLYA 4A26A 4A2CA 1XU7A 4YDRA 4BKOA 2JFHA 4FN4A 1TXGA 2P4HX 1G1AA 3H9UA 1NHWA 1SOVA 4KUEA 1MUUA 3LF2A 1VL6A 4BMVA 4IDDA 5JCJD 5F3RA 4L74A 3CPSA 3TWOA 3W1VA 4EI2A 5JSFA 2GD1O 4IGFA 3RJ5A 4BO5A 1Y8RB 1UP6A 2TMGA 4Y9DA 4CMKA 4UVGA 3ZWVA 2FWMX 3BMQB 1I36A 1Z45A 2W2LD 2X58A 4CLRA 3UCFA 1JU9A 3U09A 1JAXA 4AJNA 4DIOA 1YBMA 4CLDA 5EJ2A 4E30A 1DDOA 1NQAO 3JQ9C 1P1FA 4BKUA 2E48A 3KO8A 3ZWBA 3WJAA 3OJFA 3MWDB 5TT0A 1HDCA 1I32A 1O89A 1QRRA 4O6VA 2ZYAA 4PRKA 3VZPA 1KOLA 1NWCA 3OJ0A 3VHRA 4R9SA 2PR2A 1NFFA 4ZRMA 5U1PA 3K5PA 1Q7BA 3ROKA 4TRMA 1QV6A 3K8ZA 5I7SA 3F3SA 4CMIB 3Q2IA 1P77A 1ZK2A 1NQTA 2JAHA 4CL8A 1R66A 3LC7O 4PGFA 5LDHA 5EMHA 1RM4A 2PY6A 3ZU4A 2VRCD 1UZMA 1LDMA 1ZJZA 2VHVA 4YR9A 3DHYA 1L7DA 3AY3A 4IMRA 4B8WA 2GN8A 3JYPA 1ONNA 4M89A 4PG7A 3CKYA 1E6WA 4XIYA 5DOVA 1T26A 3B20A 3K30A 4EYEA 3NDRA 1P33A 1DPGA 4B4VA 4J91A 2DBQA 1U5AA 4S3MA 5KCZA 3C1TA 3LZ6A 5BSHA 3K92A 3DB2A 2NSDA 3C3XA 1SPXA 1PGOA 1V3UA 2W8ZA 1PZFA 2HDHA 2O48X 2VYVD 4DC1A 2BF7A 3ROPA 5BNFA 2X86A 4M49A 4N18A 4HY3A 4UUMA 5AOVA 3T7CA 1JVBA 2ZK7A 5IDYA 4R3NA 5JCJA 4W7IA 1V0JA 1VJ0A 1P1JA 4YT5A 4JCOA 1XA0A 5KVQA 1GYQA 3JQ6A 4JN6B 3NDIA 2PNFA 2W2LA 5CG2A 3C7CB 3DBRA 1B8UA 1E7SA 4OJNA 4RF5A 4D79A 4YPOA 4NHEA 2EEZA 4CM4B 1I5RA 4B3IA 4RPKA 5CDUA 3TOZA 3JYNA 4QO8A 3H5RA 1A72A 4BNGA 1SNYA 5A9SA 2XF8A 5G4LA 4E13A 2Z5LA 4D7AA 1SMKA 1YXMA 1EDOA 4YAEA 2GPTA 5EPOA 2O2YA 2XXJA 1JKIA 1WNTA 4PZEA 1Y8QB 4TRRA 2X0JA 1DSSG 1HT0A 3JD3A 3BMNB 3I1JA 3D0OA 3GH3A 3MEQA 5IG2A 3FCOA 2Q3EA 1GQQA 2BGKA 2BMAA 3I6QA 4A0SA 5DBIA 3H8VA 3ZWCA 2ZIZA 1B16A 4MKXA 3UVEA 1E7WA 4ONEA 5KKAA 2BD0A 2W90A 3IL2A 2Z1MA 1BGVA 4MVJI 2YHIA 1HLDA 2VRCA 1MFZA 2ZJ0A 4B3JA 1U8XX 6LDHA 1VSVA 3G49A 1U2GA 3B70A 3O9ZA 1ZVMA 5T57A 3ZN2A 1D7OA 3ON5A 3RC9A 3ROMA 3VAZA 1U28A 1DRWA 3V1TC 4Y6PA 4DRYA 4QEDA 1A7KA 4EW6A 4XYEA 3RD5A 2Q50A 2RH4A 4WLUA 3NRCA 2VYVA 4BB5A 3PI7A 2VYND 3D4OA 4YTEA 3PHGA 3RC2A 5A4DA 2I3GA 3C7AA 2EG9A 3IS3A 1RYDA 4J0FA 2DTDA 4R69A 4TVOA 5KJ6A 3ZGYA 1VI2A 2HK9A 2GN4A 1EQUA 1QMGA 2PZMA 3GG9A 4MDHA 1LQTA 4UUNA 3QLJA 2UAGA 3KB6A 5L95A 5JC1A 3G17A 2I66A 2YUTA 2BH9A 1PS0A 5KJEA 1Z75A 4JK3A 1HE5A 4YJHA 1EFKA 1LDEA 3GN2A 2X4GA 3KETA 1B8VA 4DBZA 4TRNA 4KUGA 3EDMA 3WGQA 3AUAA 4J4BA 1BXGA 1FK8A 2QG4A 3PFWO 4PG5A 5U9CA 5ER9A 2Y0CA 1YB1A 4KWHA 4WE3A 1U7TA 2QYSA 1FDTA 2I3AA 5BSEA 2NNLD 3KXDA 3ITDA 4EUHA 1ISJA 3NGLA 2RH8A 4J7XA 1N7GA 1IUKA 3LVFO 3M1LA 3R3SA 3IJRA 1F06A 3GVHA 1YB4A 2FP4A 3B6ZA 3OBBA 3IP3A 3PWKA 1SAYA 4PLCA 4O59O 4CLOB 3L4BA 4WPGA 4CUJA 4CM8A 4OQYA 2VUUA 1NFRA 3TNLA 1V6AA 1CWUA 3AI3A 1YO6A 4BNVA 3D4PA 3JQ8A 3UF0A 2CUKA 4QECA 4A10A 1DC6A 3BAZA 1HF3A 1JKJA 1FJHA 1A4IA 2RHRA 4YJFA 5IZCA 1C0PA 3DONA 2VYNA 3TN7A 2FR1A 4Q3AA 2D3TA 1XQ6A 3ZWMA 4FOOA 3CTMA 5DOZA 2O50A 3RWBA 2J3IA 4FC7A 3RI3A 2WDZA 1ORRA 1N7HA 5KWEA 1KVUA 1ZUD1 4GWGA 4JLWA 1IULA 2DAPA 3FR8A 3I23A 4RZHA 8ADHA 4TZTA 5L4SA 2FRDA 2X9NA 4KTVE 2HU2A 1XLTA 2CFCA 4F45A 3L6EA 5CEJA 5JO9A 2CF5A 4QFDA 4M87A 2QRKA 4XR4A 2Q4EA 4BNXA 3BMOA 3CXRA 1PSDA 4OIMA 1SB9A 5GZ6A 1Q7GA 1RKXA 3IAHA 2YDYA 4DIBA 1M66A 5JNLA 5DCYA 3BMCB 3VH2A 5CDSA 2EGHA 4OXYA 3RFXA 4WEOA 4DREA 3NJ4A 1ZNQO 1RPNA 2C82A 3CINA 1ZMTA 5TLSA 3AI1A 4ZA2A 2V7PA 4FCCA 3F9IA 2C2XA 3AOEA 1DBVO 3FRJA 3FTNA 4DBVO 1PGPA 2Y1OA 4P4LA 4Q3DA 3H3JA 4BB6A 1U3UA 3RSHA 1KVTA 3R1IA 1UP4A 2C5AA 3VPSA 4FJ2A 5B4UA 5JXWA 5A03A 1KERA 3QVSA 4HXYA 4MJLA 4XQCA 3VPXA 4NQZA 1U7HA 3TJRA 4XEHA 4ZICA 4RLHA 1UH5A 3RUCA 3LU1A 2I6TA 2BKAA 5KVSA 2P91A 5LCXA 1AE1A 5TS3A 4AFNA 1ZK4A 2D4AA 5L53A 4NBRA 4E12A 1R12A 3UKOA 5TX7A 4GVXA 3PWSA 1SEVA 5F1KA 1DIBA 4N5LA 3U62A 4CM3A 1H6DA 4CLXA 1UZLA 5C7IO 4YB8A 1EUDA 1T4BA 4BNZA 1UZNA 4J1SA 4XWYA 2EIHA 3K73O 1E3JA 2VOEA 2YHUA 3ZWAA 1R6DA 1ULUA 2CDBA 1LLUA 4C7JA 5HM8A 3PZBA 3G3EA 1U3VA 1NWHA 1NVMB 4FSHA 2PZJA 1QYDA 1EDZA 1LDNA 1WMBA 2Q1SA 3OEYA 2FZEA 4Z6KA 4CMAA 1T2AA 4IJUA 4OOEA 1PS8A 1I01A 3VKUA 4R16A 1YONA 1HL3A 3LF1A 5CAEA 2XAAA 4R4JA 3HWRA 3L0DA 4JJFA 1ONOA 1XDWA 2NADA 3Q1LA 4O1MA 1OMOA 1U8FO 4J9UE 1J6UA 3IKVA 5EL0A 5CDGA 2HMSA 4N7RA 3L4BC 4AJHA 1M75A 3G1UA 3Q0EA 1ZXLA 1YB5A 2WTBA 2SCUA 2XPCA 3L4SO 1VC2A 2GYYA 3HQ4O 1TI7A 5IDXA 2PK3A 5IZCC 2AG5A 3X2FA 3F1KA 4LRSB 4QQRA 1J49A 2OOSA 3GZ4A 4JJGA 1CETA 4CQLB 2XXBA 5EN4A 2GN6A 4MPDA 4YRAA 1DIRA 4UUPA 3U4CA 1X15A 2QRJA 2H63A 4IPTA 3WNVA 1VE9A 2HRZA 4PLVA 3VVCA 1B2LA 1G0NA 2G5CA 3H3FA 1UJMA 4E31A 4ZN6A 4RPJA 1R4MB 1MV8A 3OQ1A 2RBEA 3E9QA 1XHLA 1K0UA 3DOOA 3NUGA 4IS2A 4IBOA 2HO5A 1E3LA 3JQAB 2QRLA 1B15A 4CJXA 4FS3A 4IMPA 4BL5A 5H81A 1HKUA 2AE1A 1DC5A 1O6ZA 4ND1A 1LC3A 4RVUA 1TLTA 5TF4A 3ZWOA 2VHYA 3FNHA 3UGKA 1GQYA 3DFZA 3WDSA 3ZNPA 2PLAA 4E5KA 4JBGA 4WOKA 2W4QA 4IDGA 4BHTA 5IAAA 3L07A 3AOEC 1GEGA 5F21A 3TDKA 4RL6A 3OA0A 4TWRA 2WYVA 4XDYA 2VN8A 4BVAA 4B4WA 1E7YA 2FSSA 3UN1A 1KEVA 4OKIA 1DAOA 1E1LA 1E3WA 1UR5A 2VHZA 3E6AA 2Q49A 4EJ6A 2V6MA 1BRMA 4GBJA 3HNPA 1YBVA 4CM6A 3UUWA 1UDBA 3KSZO 4CR6A 2Y66A 3QQPA 2VTEA 3DZFA 4D45A 3RBVA 3RBXA 3GVCA 3IMFA 4QXMA 1J4AA 1PL6A 3QWIA 1AXGA 2EF1A 2HMUA 1IHYA 4UEJA 3GAZA 4K1LA 2VT3A 4E2YA 2JJYA 3WOHA 3A9WA 4J1QA 1EVZA 3D3WB 3GNQA 3O8QB 2AG8A 5L3ZA 3TZKA 3U4IA 1OC2A 3ZV4A 2B4RO 5FI5A 3L6DA 1J5PA 3FWZA 4R68A 3V5NA 1ISHA 4WJZA 3F46A 4BNLA 2JCVA 1JQBA 2IRWA 4ND3A 4YCAA 1NP3A 2C54A 3RU9A 3LC1O 1XU9A 2IZZA 2TMDA 3I52A 3ANLA 5DT9A 3RKRA 1B7GO 4NFHA 1N5DA 4Q3CA 1GUYA 5COAA 4DXHA 1I3NA 2BGLA 3AUSA 3OMLA 4GX2A 1CERA 3QRWA 2GSDA 4PG6A 5G4KA 4E32A 2IXBA 1ARZA 4OXKA 3FR7A 5ITWA 4AVYA 4BO1A 3C1AA 4II3A 1Y1PA 1P0FA 2EW2A 4FJ1A 4NBTA 2B36A 1WDKA 1ZEJA 3ADOA 1NHGA 4HFJA 1Q0QA 1R0LA 3AM3A 5HWSA 2AW5A 4NH4A 3E5RA 1J0XO 4DGSA 1X1TA 1XSEA 1I2ZA 1ZSVA 4BIIA 1CQIA 3PEFA 4BO4A 5L7TA 4JGBA 1T2EA 3A28A 4NBVA 1R16A 3FD8A 1PZHA 3OHSX 4YQZA 3ZWYA 2A94A 4BNMA 4OH1A 3ZU2A 4R5MA 2P5UA 3H2SA 4BKQA 3RVDA 4Z9XA 5GZ3A 5KKCA 2O2SA 3H4VA 3H5NA 4JQCA 3ETEA 3DBHB 3RASA 5TJHA 3TOXA 4FD3A 2GDZA 4YRBA 4JROA 4BQPA 4RVSA 5ICMA 5JYDA 2DU8A 1C0LA 4RVDA 1LXCA 2X6TA 4AJPA 1NPTO 4BKRA 5AVOA 2GO1A 5I9LA 3WLEA 2J3JA 1UDCA 1RM5A 1D3AA 2YZ7A 4MKRA 1ML3A 1YVEI 3INTA 2PD3A 5KOIA 3CMMA 1LA2A 3WG9A 2X9GA 3ZZNA 2DQ4A 4PG8A 1DLIA 4EDFA 3IP1A 4ZVVA 2J8ZA 2YFQA 3JQFA 1E5LA 2DTXA 1OOEA 4B4UA 2HK7A 2P9EA 1K3TA 3I3OA 1C1DB 3KHUA 3H7AA 5TNXA 3SC4A 3ZW9A 4FR5A 4UVIA 2X5OA 3WBBA 4DLAA 1E77A 2PH3A 4IJWA 1NQ5A 4CMBA 4L4XA 1LLDA 1O94A 4J1TA 1EUZA 3DMYA 2DBRA 2NQ8A 1KYQA 4XCVA 5ILGA 1HLPA 3P19A 4AJEA 4MVJF 3I9KA 2IYPA 3W8EA 2UYYA 3FPLA 1QYVA 3CMCO 3JQBA 5HRUA 3JYOA 2B5VA 3SC6A 4F6LA 2HMWA 3IUPA 4E2XA 5THQA 3DR3A 1VM6A 1YH3A 3QVXA 4CMEA 5BQFA 3IDSA 5CEFA 1BHSA 4U7WA 3U0BA 1X7HA 3TFQA 1E7RA 3KTDA 3ONFA 1MP0A 5G0WA 4Z9YA 5COBA 1HZJA 3AM4A 3BHIA 1S7CA 2CSUA 1NNUA 2UV8A 3MZ0A 3QWBA 3HJAA 4H15A 1LNQA 3IIEA 2FZWA 3ETGA 2AQ8A 4DQXA 2ET6A 2UUOA 1IPEA 1RM0A 1OI7A 3DBRB 1NR1A 2FPIA 2HSDA 2VUTA 1YL7A 2X8LA 3GOHA 3LYLA 3ZHXA 3CH6A 4DWVA 1PJ2A 2VWHA 4XYBA 3SEFA 2OGUA 1NFQA 2BGMA 2F1KA 2ZB7A 1MFPA 3JD0A 3UXYA 1YRLA 2P2SA 5TGDA 1ZBQA 1DFIA 5JY1A 4GX0A 1Y5MA 3RUIA 4D3DA 1PL8A 2O3UA 2WYUA 3JYLA 4ZQFA 5GMOA 3ST7A 1JWAB 1Y9AA 2ZJ1A 3ZNQA 4CL3A 3IKTA 2NU9A 3EK2A 1DAPA 4KQXA 2C7VA 1BTOA 1DOHA 3VDQA 4RPGA 4YYZA 2YFHA 1OZAA 1Z74A 4TROA 2PTGA 1GZ6A 1YJQA 2HK8A 2EXXA 4P4NA 2JD2A 1UDAA 2AQKA
chains in the Genus database with same CATH superfamily
5FB3A 4GOLD 5L4LA 4P22A 4CXMA 1YQTA 2WPDA 3EARA 1USUA 5AVYA 3P26A 1CIVA 1WV0A 1JX6A 3HCFA 1N25A 5E95A 3CZCA 5TEWA 4B5LA 3HUDA 3QLTA 4GLBA 1TLLA 1C4KA 1FX0B 2IY9A 4S04A 3GJXC 1R6XA 2H9IA 4L51A 1OLSA 4DN6A 5MN4A 4BU0A 2PS1A 1Z63A 2ZBVA 4C7KA 2P9BA 4CEIA 2Q4DA 3K9QO 1YA6A 1CY0A 1E7MA 2PX6A 2IHTA 4EB0A 5LP6B 1KU0A 3SM9A 1ZH4A 3OLCX 4LJ7A 5AI8A 3HPQA 4BO9A 4YX9A 1V16A 2WM2A 3AR4A 3CLTD 3FUWA 5A2QA 1LW6E 3BJEA 2QAGC 1SGWA 4B3FX 3PICA 4HO1X 4RJ2A 1H2EA 1OAAA 5IAKA 4YJHB 2F59A 2IYYA 4E6EA 2UZ0A 2HCTA 3ZJ4A 3VJLA 4TTRA 3ZX4A 4CMJA 1CK4A 4CQNA 4AKTA 4GEGA 3ZS9A 4E5VA 1BXGB 3Q1KA 5GWXA 3WKEA 3A1NA 3JQ7B 5FTKA 1GRQA 2FSPA 4DC9A 4ZDIA 1BS9A 1QNFA 2XUZA 1DDIA 1P7ZA 3PWZA 3K0CC 1FFSA 1FRZA 4TV8B 5I7WA 2R6CA 1YQGA 4I5GA 1OZFA 1AZTA 1GDHA 2FZCA 2VAPA 3PLAE 3BB1A 4DJTA 1RKVA 3Q3CA 4DUPA 5K9ZA 3SKYA 1ZM2A 3BPSA 3W05A 3K9NA 3HVKA 4Q6BA 5CDFA 1WEHA 1G6Q1 4GQAA 1ZD1A 1B6GA 1WKVA 3Q41A 5H3HA 4WH0A 2PU7A 3GLFA 2W8BA 4YRNA 2WJAA 2JFXA 3JQBC 3LUKA 4CNBA 1T1GA 4ZI2A 3NBMA 2CDNA 4YFYA 4DAOA 3DP9A 1UBLS 1LDYA 2IE0A 1N9GB 1RHJA 2HCRA 4CHGA 5BQ3A 2VKTA 2Z9BA 2BR3A 5C7LO 3E0QA 2Y1XA 5IT4A 4MRRA 2UZ4A 1HNWB 2PQ0A 4ZQBA 3ZIAA 4HHEA 4HKTA 5G0TA 3R3HA 2DPHA 4CMEC 2VA9A 3P0RA 2OO7A 2Y1DA 4KE9A 5CK5A 3ZCPA 4E5NA 5IT5A 3CW9A 3G1WA 4R2IA 1YI8A 4NK5A 3FSRA 3PT9A 4CV1A 2J3LA 5KTRA 2FLWA 3NH9A 3B6KA 4YUAA 1MBZA 3ETHA 4P54A 5HS6A 4YJFB 5A6SB 5FCDA 1ZL0A 1H9BA 5TQ0B 3C85A 4ROTA 1KY2A 5CU7A 5BV8A 2O05A 1D2NA 1R18A 1OXBB 3HSKA 5ALJA 4AMVA 3VR4A 3G0DA 4ZC1A 5BN5A 1E1KA 5CJPA 3KB2A 1PWZA 3DL0A 3WLKX 4RYLA 2BR4A 2WD9A 1KP2A 4P6VF 5I4BA 5KWIA 5EKSA 3VMMA 1J2UA 4J94A 2IYUA 3LK7A 4FFDA 2E3JA 4PQGA 2V74B 5KU7A 2DCUA 4G8DA 2RIPA 5DW0A 1VKOA 4JLMA 4V2UA 3ICOA 3FKQA 3BDAA 4EP1A 5LUAA 3NNDA 1HO3A 2X2FA 3FNGA 3N6RA 1BYUA 3SC2A 4IZOA 5JT1A 4KPUB 5DW3A 3V9AA 1G3UA 2COEA 3C5EA 1JIQA 1KBZA 4EB8A 2FSVA 2C4KA 2W6NA 1G8YA 5AM0A 1U90A 4ZAFA 2OTCA 4Z3DA 1DOZA 2VJOA 1VSBA 5HOEA 4EGAA 5K7SA 2EBFX 1T0BA 1GA4A 3M7IA 1GARA 1JH8A 2B5OA 3BJMA 1GPJA 4B4OA 3MWJA 1XQ1A 3CSUA 2NTVA 4M55A 4CV2A 4EIWA 2ETXA 4M83A 4JNKA 1ZA2A 2E5WA 4JEHA 4X7PA 1U80A 4DLZA 1USWA 3MLBA 5IN4A 4B84A 2JLZA 2V5AA 1YS1X 2HSJA 2NO1A 5JFOA 2GPJA 4WKGA 3OO0A 4HAIA 3QIVA 4DLNA 4WCDA 5HFAA 2E7ZA 1JFRA 1UP7A 4YEDA 1EVLA 2BYTA 1JH9A 1MXHA 3EH1A 4AQDA 3IA7A 2AYXA 2WUEA 3M83A 5J63A 4C89A 2O9JA 4NZYA 5DKFA 1PHPA 3CWCA 3EYAA 3JQGA 4D4KA 1IPFA 1NBIA 2E1RA 1KKLA 2PS0A 1U2SA 2Q99A 3HR7A 4WA7A 4W7HA 4ECAA 5TT1A 4TV9A 4AY5A 1CUFA 2HSGA 3JZDA 3S70A 5K0EA 1WNFA 2WU3A 1AK1A 1X9HA 2OHVA 3O94A 2R751 2FN7A 4PNPA 3SPXA 2ZM6B 2BM0A 5F12A 1ECGA 4HFMA 2AVDA 1II8A 3OM9A 3T7AA 1N5OX 1RC0A 3UEOA 3DDCA 4MPRA 4FNAA 2BMVA 1HTBA 2Y6VA 1PZGA 1PUJA 5C9ZA 1LVGA 1WE2A 5KJFA 2A14A 2IWHA 1EXNA 3B2QA 2I4LA 3OKAA 4FE3A 3M5CA 4HNSA 1QU3A 2WFZA 4IOMA 3F47A 1J2TA 3V8BA 4YP0A 1QLJA 1JLHA 5BYKA 4GW3A 1V3VA 2NTEA 2ZBFA 1BX0A 3DMPA 3AFMA 4HDNA 4G89A 4XJXA 5FF9A 3UHJA 1RWWA 1Z5NA 4EOGA 4RWZA 4DLTA 1GLVA 1Y1RA 1I1NA 1ZUWA 4J0QA 4ALIA 4BFYA 2B30A 4F11A 3EG9B 4EITA 1XTVA 2AYZA 1G17A 2IE8A 4QT0A 5IDQA 3LDUA 1MX5A 1VA4A 1AVTA 4I7EA 4ZVRA 1EB9A 1J5EB 2P2LA 3OIFA 5DZSA 2XVYA 3MINA 4MIEA 1H2XA 3CLSD 1I33A 1BQEA 1MA3A 1UKVY 1DUSA 4ETNA 3MQ2A 3WMWA 3SKVA 2G7MC 3LO5A 3W8DA 2D2VA 4FW8A 5EOVA 3UO8B 4ITRC 3W3AD 3WVNA 3HB4X 1XPJA 3PIIA 4Y1GA 1A7AA 3NO4A 5K4HA 2O4CA 4XD2A 3ZPXA 3ML1A 1GAQA 3CLRD 2AHOA 4JJEA 4CM4A 2HAEA 3ET5A 2GBLA 2YJNA 4UM9B 1EBUA 5GJVC 2HXSA 2I3BA 5IJ9B 4KMSA 4R98A 3WLTA 2R8ZA 3FDXA 3T06B 5LWHA 2FHPA 2AFHE 4UREA 4MQLA 1V95A 4ZVUA 5LZ9A 4TKLA 5A71A 1ZG3A 1GV1A 1WRBA 2A35A 2P75A 1HOXA 2XH8A 1I4OA 4FGJA 4GLFA 5D2CA 3V46A 1YZVA 4DA6A 3M4XA 1ZH0A 2H1OA 5IDWA 3OQPA 5D6OA 3SHTA 1Y9ZA 4PM4A 3C8ZA 5LOVB 5I9NA 4I55A 2PGLA 3GPLA 3OWHA 3WL6A 1GL7A 1FNSA 4ENVA 2M6SA 1G8PA 1NIPA 1D2HA 4ALKA 3TTXA 3SYKA 4XFDA 3SJBA 1TMKA 2AL7A 2UZ1A 1E32A 2PDAA 3NIWA 3F97A 3GD5A 4M37A 1SC6A 4KXXA 2DR3A 2GXUA 2XWQA 1G20A 2R62A 5ADHA 3WP0A 3AEKB 1VCHA 2N42A 1RYBA 3GY0A 2OLEA 3KZCA 2F00A 3FCUB 4JXKA 3R7WB 4DDKA 5HM6A 2RFLA 4LJKA 2PKQO 1P9NA 3VKVA 1XVVA 3VPDA 5CVCA 4B7UA 1LB1B 2H0AA 3ZHQA 3PPXA 3NGXA 3T12A 1GUDA 4PZ0A 1UBNA 4F2HA 1RXVA 1UBHS 2OENG 1BNCA 3EZGA 7AT1A 5DN9A 3NT4A 3JYQA 1XRQA 3EHDA 4B9EA 4CIWA 3IDQA 5A0TA 1R5NA 4KFTA 3E1KA 3WLNA 1Q7EA 2WYWA 2ZPUA 4IIBA 1UIMA 3TSWA 3T1HB 2R7LA 5SY4A 4G0YA 1YVRA 2BTQB 4RJKA 3N2KB 1T9GR 3WKBA 1RLJA 2RJ3A 4ZC8A 1P7WA 5IEBA 1GXSB 3OFKA 1QGAA 1OZ0A 4I5EA 4W5HA 1GSOA 2BHLA 1DLJA 3NBQA 1Y34E 1RKBA 2BEWA 1Y7TA 2WIFA 2C92A 2FPGA 4YXFA 4MWDA 3BD6A 3WQSB 1Y3HA 1BU5A 1EK6A 3E23A 4UD6A 1N4DA 1XJ0A 3WR5A 5B5SA 1B14A 3K5HA 4AK9A 1YSCA 2PYZA 3EVTA 1EX1A 3ZOKA 3OFSA 3NYRA 1L5NA 1RJWA 4BNIA 1IZZA 1MC4A 5CT6A 4GHWA 2DGDA 3VVBA 3B3JA 3BTUA 1M6HA 1LW7A 3S2IA 5K6TA 2WFAA 3ZDRA 1PQPA 1E3WB 3AK4A 4P82A 2TMYA 5E7MA 3WA7A 2XI4A 4F0JA 1XHEA 2WJZB 3E53A 3VJRA 1WF6A 3GP8A 2A5GA 4HDKA 4IQFA 3RC7A 5IXYA 3E3AA 4M6WA 3HXTA 4YHBA 5AQEA 3DLIA 4EGFA 2P8JA 2ZETA 5BRJA 2BZSA 2Q2OA 2GZ1A 3TIGA 5KC8A 1AKUA 3V48A 3O91A 5E7QA 1P19A 1BEEA 4EA7A 4E3WA 3P45A 1QV7A 1FXSA 2C7RA 3B9PA 4G6ZA 4ZYUA 4IO1A 5FADA 1Z37A 4OY3A 2A6PA 4GRDA 1T1IA 3KUDA 3HYCA 4QSMA 2ZI4A 5B30A 1P3Y1 4I2VA 4K0RA 2DFPA 4B6SA 2FQQA 4NNJA 3USES 1G2OA 2GXQA 3BH7A 3OEHA 5HQ3B 3P8ZA 3BXFA 2VJBA 1K68A 1SZDA 3QFCA 4N3GA 1BX3A 2QRUA 4RK1A 4DTIA 4MYTA 1T8SA 2Y1WA 3C6QA 1J8YF 1CZNA 4YBZA 2QJOA 5KQGA 5FOSA 1AXRA 3AZOA 3V7WA 2XNSA 4EL0A 1W36C 4HVCA 4Q1CA 4NR0A 1B26A 3RIYA 1E0DA 4CTKA 1Z6ZA 3M6LA 1JNXX 3E9MA 4K81B 4ARZA 3ZY4A 1R0CA 1XD8A 4MUKA 5TC4A 3TMAA 4IFTA 1QDEA 1QE5A 5AKHA 3CV3A 1W9MA 2ST1A 3EEYA 4RJTA 3WY9A 4BVGA 4WJLA 5JJKA 2R00C 2NN3C 2JIZD 2AYYA 3U3KA 1B1CA 1ECFA 3A7DA 4K7JA 4PQRA 4YHHB 1YOBA 2FRXA 9MHTA 5IYZB 3K0KA 2CLDX 1FU7A 3UQZA 4ZD6A 1G9XA 3AUTA 2WUDA 2BN4A 4TUYB 1YZKA 3P9ZA 5BMVF 1PT8A 1T8YA 1HSZA 4RV9A 1L9KA 4YT8A 1A9TA 3PRJA 4KOAA 2M1XA 5BNIA 2ZANA 3IHTA 3AUFA 3WGVA 2G9VA 5HCIA 1FFEA 5E7IA 4XDHA 1FFGA 2NVUB 3RC1A 1JHAA 1XF9A 2BV3A 4HNGA 1NVBA 1REQA 5DULA 3AUYA 3Q8LA 3MSXA 4MHTA 3AERA 2GK4A 2EZ9A 1SVMA 3FW1A 2AOWA 3PCRB 3ZUPA 4PLTA 1P3JA 1Z5OA 2FYTA 2NZWA 4ZOLF 2QTHA 1S96A 5TPWB 2A1TS 3LM8A 1HYEA 1U0RA 4G0PA 3RKUA 4DT1B 1ODFA 1GCAA 4HDSB 3V33A 2K2QB 1QUFA 3ZI0A 1MEEA 2PKQP 4Y98A 1T36B 4AW9A 1EE2A 2O0JA 4LE0A 1WVGA 4AYXA 2GTPA 1XDDA 3BYZA 3PUIA 2Q9AA 2NTYC 4NPAA 3WE7A 1YIOA 5REQB 4PHGA 1C9MA 3NGMA 1OZGA 1UMDB 2Q2VA 3HKCB 3NW9A 5EPEA 3TUJC 1B8NA 3DNPA 3N7UA 3VSEA 4FYPA 2GZHA 3FCSB 2PKYX 2VSOA 5AXBA 1D0SA 3QVTA 2BGWA 1XVLA 1ZH2A 1LPAB 1GG8A 3LPLA 3H11B 4HRXA 4Y6OA 3RPEA 1K1EA 1QE0A 3T7KA 2C20A 2GVZC 4CN8A 4MLDA 5HRAA 3O2NA 3FPAA 3GRCA 1GQRA 4JBHA 1S9DA 4JI4B 4N3AA 3ZDCA 2V65A 3K4HA 4JT9A 1U1FA 2V45A 1Y3BE 1F2DA 3T9BA 3UPUA 4F91B 1JFFA 3PEVA 2EFJA 5FOUA 3KWMA 1M6WA 1EMDA 4IZ6A 1ZN2A 4ER7A 2O2CA 4YXWA 5ALIA 2ZWVA 3EBLA 1GPWB 3GLUA 3SS9X 2UZIR 4J7UA 3IXQA 4HGQA 4OCZA 1X2BA 1I2AA 1ZR2A 2ETVA 4HFRA 1GA6A 4EG7A 1W30A 3BCRA 2IH5A 3HGTA 2GPSA 4P33A 4GMXA 2E18A 4I50F 4QYIB 3CRRA 1JDPA 2B61A 3EEIA 4Z3OA 1Q1GA 3T3MB 4RPHA 3LL7A 1JZQA 1OGJA 1AQLA 3CYFA 1YB7A 2X15A 4JLKA 2YJ5A 3WLHA 3GJSA 2OM2A 2F48A 3ASVA 4GBGA 1RHRA 3UV3A 2O7VA 3MWEB 5CLLA 3VHXA 3C3WA 2IYRA 4LVCA 4YUVA 1TD9A 5EJEA 3UGTA 2QN1A 5LYJF 2F3UA 2XZLA 1CZUA 2OBXA 1NOKA 1YC5A 3LCCA 3O8OA 3U9LA 4EHFA 4BO0A 1COZA 3B6EA 5JS6A 4NMLA 4CW7A 2QJFA 1Z38A 4IKEA 2P3QA 1M3SA 2QEQA 1CLEA 1S89A 3OMWA 2ZDGA 3P9RA 2BDUA 4GKVA 1CRQA 2D2XA 1E1YA 2AFHA 2WJJA 4F04A 4FDMA 1KZYC 1JE1A 3ZHTA 3Q8KA 1ECBA 4YS6A 1CULC 1D2AA 2EKPA 2GAJA 5EZ6B 2XJ4A 3W5IA 4RY0A 3EXEB 2O5EA 2BBTA 2D4HA 5A05A 3KT6A 4BVLA 4OXQA 5A04A 5T7BA 5LQCA 4RD6A 2F4NA 4MPJA 3AZQA 3QBTA 2C4WA 3T9DA 1SHTX 3TPFA 2AG1A 5H7XA 2JFUA 3Q8MA 4RMHA 1W88A 4Z1MA 2R4UA 3THWA 1BRTA 2F1JA 4BMDA 1O96B 1IM5A 1G7TA 2RGDA 3N3BC 2XUQA 4Q4AA 2I99A 3RHZA 2IU6A 4WVLA 4P5EA 1PE0A 3R0VA 5AKLA 1XRSB 2HC9A 2V7BA 1PR6A 3BWCA 4IXTA 3ITKA 1O5TA 4R8MA 1OWMA 4KWEA 3ZHYA 4QYMA 5JH7F 3B7PA 1WW8A 4UMVA 4F4IA 4FQ8A 4ZEXA 4B3SB 2GR9A 4KAJA 2ZJFA 3DFMA 3DE4X 2W2NA 5LBIA 3ZV3A 4B40A 4CCYA 5HJ7A 3GZJA 2XKBA 4AM8A 1RI4A 1TC2A 4XPIB 4M9QA 3H16A 2O06A 2Y1FA 3D59A 2VNIA 3UFXA 4DLKA 4LWPA 1GTZA 2XIJA 4E5DA 3KQHA 3U7GA 1CQJA 1N2HA 3GK3A 3N2GA 4C7VA 5CVDA 5LQJA 3O03A 3RFCA 4BLRA 4WK6A 1OXKB 4D6PA 3GP3A 3PK0A 4GGMX 4MS4B 4E51A 2PZAA 4QHTA 4F84A 2DUUA 3B2NA 4FEYA 4ZO7A 3ZE2B 3GRAA 5KOYA 2F17A 3OC6A 4PIMA 3WGYA 3AJ9A 3LXMA 5TIIA 3GLHB 3PUZA 2GCPA 3Q0TA 3OPYI 3U7EB 3HE3A 4E15A 2HNAA 4KXMA 1O95A 3FHLA 3I64A 4Q9DA 1PR4A 1PKXA 4RF4A 3LSYA 1TD1A 3RH0A 3I2FA 5U4QA 3WRXA 3VPGA 4AT1A 5IS2A 1MC5A 3FJYA 4ZVOA 1BIFA 2C4UA 5JAHA 1O5OA 2PH5A 1QH1B 5KYUA 3ZLVA 2X0NA 1ZJYA 4D44A 4EEXA 1MTOA 1OX5A 1W6UA 2AXEA 1U3CA 3AR7A 3KEMA 1B2RA 4F4UA 4OHMA 4IJMA 2JNWA 2QR3A 2DH5A 2JAQA 2XTMA 1QYXA 4Q7LA 4IZIA 1P2VA 3IQZA 4Q1BA 4U63A 1CCWA 5FHQA 3ZHZA 1YQ9A 3FTDA 5JAQA 2Z5VA 3H7IA 2C1XA 3QEMB 4RK4A 5HF9A 1GPNA 3I30X 4BV8A 2CYBA 3W6UA 5AQ1A 2ANCA 4XCQA 3C1UA 2PEZA 3F8SA 3R3YA 4KDEA 4KIFA 2R85A 1DNPA 3AUXA 3T61A 4DIEA 3FMPB 1UBKS 2VRNA 3W1EA 4MR7A 2ZIAA 2AXPA 4AP5A 3AWDA 3DNMA 4WCFA 4EUSA 2HFKA 2P5TB 2P9YA 5AD1A 3MGCA 3MJEA 4ZYTA 3GU3A 2H1VA 3CPHA 4JZKA 1JV2B 1ZU4A 4MK4A 4TX1A 1GG2A 3ZV7A 1Q7RA 3EVNA 1C30B 1OWNA 3FYSA 4FGWA 2OP1A 4O5AA 3L1HA 3TRKA 4BO3A 4C0AC 2CGEA 1O3YA 3R3XA 1WZIA 2X2OA 4HEJA 4Y6SA 5JYCA 3G0BA 3IEKA 1R00A 5A0VA 4AJ1A 3TJZA 1E2PA 1J2EA 1P5FA 1VCOA 2ZKIA 2EFGA 1G8KA 3LOQA 4KACA 4U9IS 5AVJA 3R7BA 4DCVA 4B3GA 4J4TA 3NXSA 4TYQA 2B7LA 4U00A 4QDUA 4BV2A 4TMWA 3HHPA 1ZJ6A 2EWMA 1DO8A 3W7AA 4JIMA 1Z17A 1PWHA 2Z2ZA 2Z2XA 4D3SA 3V2UA 2D8AA 1EA5A 2C3UA 3EW7A 4NPCA 2WYIA 1RP7A 3K0FB 4ZT5A 4DWWA 5BOSB 2GZ2A 3AF2A 3CJTA 4JEMA 5DYYA 4IF4A 3BZUA 4C20A 4J0IA 2VNAA 3WL5A 4OMCA 3A14A 3EIFA 3NBZC 6LDHA 3QBVA 1THMA 1CR0A 5KQLA 4ALNA 1D9ZA 3ZWNA 3MJ4A 3TLBA 1QP4A 1YR1A 1Q1EA 1KVSA 1RWOA 2JCYA 2V7UA 2IH4A 2J5KA 3E3MA 2BI7A 2AKEA 1PTJC 2NOAA 2DLNA 1IZ0A 3SDZA 2Z04A 5C8VA 4RV5A 1IZ8A 3P96A 4HBGA 1ZI9A 2I1QA 4MAFA 3DEKA 4G26A 1DQPA 1VTKA 3G9QA 5C4GB 2YHIB 4L6CA 1CRLA 1XQWA 1VJDA 1C0KA 2H3HA 3GRFA 2O3JA 1C81A 3H6HA 3ONVA 1QM5A 2Q6VA 5ALKA 3SCZA 3TZBA 4BYMA 4JQSA 1ECPA 1Z2DA 2WMDA 3IC5A 2CV1A 3ZDBA 1SKYB 2HWXA 1ULAA 421PA 3KRTA 4EHIA 4LS3A 2H08A 3ZVKA 3CVYA 1F0YA 3ZHRA 1R0XA 3LLSA 4MIOA 2ZQ5A 3MPUA 4AY3A 5IU6A 5LQNA 3DOUA 2CJWA 2JGLA 1UJ4A 2QENA 4TWIA 1GTG1 3PGVA 9GPBA 2BTOA 1CG6A 2V6IA 1FMLA 4DCJA 5EESA 3WADA 2WKQA 4EGJA 3Q12A 4OP2A 3VKFA 5K6AA 1LZLA 1R9MA 2HMAA 3WICA 4BNDA 1W2GA 4R6XA 2CV0A 5CXSA 5FYQA 1A1SA 1GDDA 1XZFA 2JGKA 2QTNA 3FDIA 4GC9A 3T9EA 5J2UA 1YS6A 4DKJA 1N78A 1BGWA 1S7GA 3EVGA 1DTSA 1NN5A 2NTJA 1STOA 4Y7DA 2Q0HA 2PZGA 3ES9A 2H0QA 3JSAA 3KEGA 3QJGA 5FQOA 3GRKA 4HP8A 3TNYA 1OGIA 3B1FA 3GLQA 1HFJA 5ALYA 3QNMA 1A50B 4UULA 4CTNA 4CMGA 4Q3KA 3NTOA 2CEKA 2CCKA 1KJWA 1RRMA 1NNLA 4MLCA 1R0WA 4D8UA 5JJIA 2Y9PB 3I39X 3DVSX 3OI7A 4OX9Y 2PMDA 1OTYA 2ACVA 3NQ41 3WSWA 1EK5A 3A3YA 5KAPA 3GLSA 1T9DA 1NBOA 2Z30A 6ADHA 2CBGA 1XN1A 3I5AA 1VLVA 5I8PA 4DNQA 5KTSA 1M0SA 2CJFA 1YQDA 3PXUA 3T3OA 2XUJA 1P2TA 4N01A 3DZBA 5BN3A 1KYWA 3UGJA 1PWEA 1BDHA 1GGEA 1ZR4A 3ER6A 3DFUA 4AZTA 2Q9UA 4YBRA 2IZ1A 5ICGA 4RADA 3OE7A 4J0CA 1F12A 5B36A 3V8EA 5CLGA 2B98A 1T4DA 2G25A 3MA0A 3G0CA 2VPXA 1XWIA 3GVIA 4IQGA 4JB3A 4PLGA 4DA9A 3DOIA 1DIAA 2EJUA 1XA3A 1Z18A 3ZLTA 3RJMA 2AKAB 3KJFA 3M8KA 3F3MA 1TCVA 4ISCA 2R44A 3LP8A 3CCCA 4FNGA 4LY9A 1EK1A 5CVJA 4CM8B 2R60A 3DT6A 2ZRCA 4MQEB 4P8RA 4O0LA 3EVBA 3GROA 1P0QA 2JGEA 1T6NA 2Y05A 4G65A 4TM7A 1QBGA 1FP4B 4IXWA 3PNQA 1WQ1R 4BMNA 2KHZA 3L79A 3ECSA 2I4RA 1JKJB 1VYUA 3CE6A 5GTDA 1XTTA 2PX5A 4GLOA 3GDOA 2Z98A 3HEMA 4HUJA 4PLPA 2NP7A 3FYCA 4B0PA 3GFGA 2EKLA 3BL5A 4HAVA 3TNDA 2QVLA 2CFRA 2PU5A 2C57A 2FSIA 3DBIA 4B47A 3NYWA 5KSWB 3RVKA 2X7HA 2XF2A 3EF1A 1ZGBA 2W00A 3HC7A 3LP6A 3PGKA 3DS8A 4MVJM 4MVJG 4NVRA 3KM0A 2WU1A 1XEWY 3E5MA 3HWSA 1DEHA 3FYUC 5DWVA 4CEJB 1GPKA 3KQQA 4PTLA 1WU8A 4E21A 2F43A 1AKMA 1ML4A 1E60A 4PAQA 2Y2VA 5EEGA 4DLSA 2EARA 1E2LA 1RVDA 2SHKA 2W0MA 2I5PO 3I83A 3NYQA 2HI0A 4GI2A 4N3BA 3RREA 3VYWA 4BBAA 5TMDA 5DBGA 2YNMA 3QA9A 1O97C 1Y8RA 3GCDA 3JARB 4N8EA 4LSMA 3T5PA 2AW3A 1L8LA 4JXZA 2NAFA 1P1IA 3K70B 3BMQA 2H65A 2OCLA 3HK2A 1Q17A 3F5QA 5GZ1A 1GGHA 3INRA 3G13A 4X91A 4UUBA 3MPOA 3FPFA 1G41A 3OZFA 1U2DA 1Y42X 2ZYHA 2OCDA 1BWQA 3CLHA 2PFGA 3AZPA 3P2JA 4HR7A 4KUHA 5L3VA 1K92A 1SBCA 3FF4A 3ZGNA 1C3OB 4J0JA 3VRHA 2ZPAA 3G2JA 1RJDA 4JAVC 4PPNA 3HGQA 4B6EA 5LVAA 1J09A 3WMRA 1SXJC 1K3FA 3CEHA 1QRSA 4LF6B 1KK2A 3I9JA 4MV0A 3IUEA 4ID9A 1GG9A 5LFAA 1GFZA 1VCNA 2VXCA 4FNMA 3TL2A 4BO7A 4RS3A 3W04A 2IX3A 1HPLA 3DEYX 5ALSA 1IK4A 1FX0A 2IYOA 2MYTA 2VH2A 3QVWA 4OLJA 4R1UA 4DABA 3TB4A 5JASA 3I42A 5DTRA 4H7IA 1OXXK 2GYUA 3SX4A 2NLOA 1OC4A 1HEUA 3DAOA 2OVBA 1H69A 4IKPA 2I29A 3AW8A 3HZHA 3AVVA 3V1YA 1QMPA 3J80A 1ESNA 1H3EA 2E89A 1N2SA 1ODSA 1XTUA 3BK1A 3JPWA 5LP6A 1YKFA 3FSEA 3EFBA 4HGNA 721PA 1RWQA 2OCIA 3T0FA 4R7ZA 3RJTA 3R3UA 5HUQA 2AN9A 1WZUA 2P65A 3C8HA 3SGLA 1U0HC 4M54A 1EFRA 1BXRB 1R4NB 3ACBA 3UUFA 5FEUA 1N34B 3I2KA 1LSUA 1MQ8B 3COZA 1XZLA 4KJZA 1D0IA 4JI3B 3UNXA 1X0VA 1HDEA 1WOMA 4LJ9A 1EWVA 1KZ6A 3VI3B 5KYXA 3F78A 2BGUA 2AJLI 1N0VC 4M2LA 4XUEA 3GT7A 1KZ1A 1VL5A 3QFTA 1E89A 2X5JO 5CA0B 3SJAA 3PPIA 1I30A 3ITEA 4CM1A 3FNIA 3JQ7A 5ALEA 5LBUA 3RQIA 5JOQA 4DCPA 2YJGA 1TO1E 1ODKA 1ZZGA 1ZUNA 4LDZA 1PZMA 2XODA 5D84A 2CNLA 3F74A 3KOWA 3OUZA 4BJHB 1JHXA 2QLTA 2ZRMA 4ZHQA 1LF5A 1ZZEA 4AF6A 1NM5A 4G41A 4LZAA 2ERCA 3COSA 1OVGA 3KD2A 1NJSA 1THZA 3K6KA 4ND7A 1DXYA 2C03A 5IC5A 1PG2A 1N2CB 4LCJA 1R5BA 1HURA 1W0CA 2J3QA 5CFMA 2I67A 2JJ8A 1RLIA 5K20A 1IBKB 1N9GA 3NNNA 5LL6P 1YRYE 5BRNA 3AI7A 3ONDA 5CAEB 5HVNA 4TYNA 5EQDA 3B48A 5E38A 4CDGA 5AKGA 1M8KA 1FNDA 4HL6A 4WY8A 4DLVA 2F4VB 3IB6A 4EYGA 1P0PA 3H65A 2XBMA 3II6X 4D81A 4AJJA 4TXJA 3WWEA 1KC1A 4OBEA 5FI1B 3FIJA 1WPGA 5K4GA 3CG0A 3VR2A 4AUKA 2HU8A 4EUKA 3X1KA 4OL0A 4R7GA 5TQ0A 4D43A 4PYJA 3QMVA 1LS1A 2J1LA 4L0DA 1I3MA 2MMCA 4ZO9A 3WNZA 1JAIA 1JHDA 4DJFC 4K3VA 4F72A 8LDHA 1JEDA 3G0OA 4MARA 5B7QA 2P2GA 4R8KA 3TL6A 3ZDQA 3CF4A 2G70A 4O2LA 2PD6A 5DJ5A 5IP5A 3KELA 3IV9A 1OILA 2P4QA 2B99A 2ZAOA 4IWYA 3HU5A 5KYYB 3JZIA 4RD4A 1RMQA 1I7LA 1UT5A 2QRQA 3DMTA 4P84A 4RDHA 4CBVA 3EDCA 5CB8A 1DMSA 2J0QA 3BWYA 3KVNA 3HEAA 3QE2A 1K7YA 2OCPA 2CBXA 3UGQA 2G09A 5JC8A 3HN6A 1DRVA 1KEZA 3IUMA 4HTAA 4XSHA 3L7DA 4O4JB 1S2IA 2VOJA 3NIFB 2VA8A 5F7JA 4WW0A 1QFJA 3D8SA 3T5GA 1XEFA 3V8PA 4XOUA 1U6JA 3LLMA 2NO4A 3NVDA 2QTAA 2AA3A 1DDGA 2WAXA 3KKKA 2C2GA 4KPUA 4F6RB 4EHNA 4ZV9A 5BWLA 2PKWA 4EY3A 4F7DA 3RUDA 2I4IA 2IH2A 3PITA 3EPHA 2HB6A 2JCSA 4EPWA 1FVFA 1U3TA 1P7PA 4BBPA 1U8YA 5CLIA 1JJVA 2GEDA 3EA4A 3FRIA 4MROA 4C0LA 5KZMB 3TOCA 3AONB 3EEBA 3PQDA 1RM3A 4D0RA 2WFMA 1E9BA 1P7VA 4FEEA 1AHNA 4KFCA 4D9NA 1YOVB 5AOBA 3WS7A 4Q4CA 4I1UA 3RSZA 1VIMA 3DPIA 2YZGA 1PDWA 3HCCA 5ALMA 1QFXA 2Q1WA 4D26A 2A9KA 3FPGA 3BE5A 3GFPA 5JQGB 2JD1A 1XDBA 2ZRFA 4ZAYA 5GVRA 4KLRA 5P8WA 1T5LA 4XDZA 1LF0A 3PDUA 3L0SA 3WDLA 5M5BA 2GILA 1H9AA 2IZOA 2O7SA 3A25A 3EGXB 5CXXA 4BOYA 2ZQZA 1Z6TA 1V9LA 4H7FA 4OYRA 5CEEA 1T5OA 4QOEA 3MHPA 5EA2A 4LBVA 1M7BA 2AD1A 1ZM3A 3SDSA 4ZFNA 2WI8A 2BRUA 4AL4A 3G8CA 3H42B 4H7HA 5HKAA 4KN9S 3QYFA 4B45A 3LOUA 2F3TA 2XOEA 3I34X 5KNDH 3D3JA 4L28A 1G98A 4IVPA 2H3EA 1OFUA 1YI0A 2LDXA 2REOA 3LP5A 4LGYA 1IVNA 3ZCTA 1CV2A 2P78A 4D0NA 4NCNA 3U4QB 2XIQA 3SF0A 5TQVA 1ECJA 1I7NA 3B6MA 4I5FA 4IL5A 4O4IB 2FZKA 1I1HA 1M8JA 3A4MA 4DS3A 5CB4F 2R0QC 3GBPA 1OX4A 4QA9A 1AOXA 1UXGA 2G0NA 2H06A 3OLZA 4ZAVA 3EXG2 5T6BA 5BR4A 4LG1A 2BEVB 1YULA 1BDMA 2LD4A 2R8YA 2XE4A 3M4ZA 3S55A 9ATCA 1ZW1A 3W5SA 1KAQA 1KP3A 1YRAA 1U2ZA 3FN4A 1BWSA 1MC8A 3OZEA 3Q85A 1YFJA 3M3DA 4MUIA 5AW0A 4DIUA 3ZXSA 2DFLA 1YCHA 4Q9JA 2CYAA 2AQHA 2FPOA 1IYZA 2WT9A 2I6SA 3AOGA 4LDAA 3ULKA 2O3QA 2DULA 3M6VA 4JHLA 4CETA 3AUUA 2J6BA 4GSKA 5K09A 4EBBA 3E61A 3QWFA 4ND8B 1QXSA 4BCCA 1VZ3A 3PUJA 4S1PA 1H4VB 2DLDA 2QM0A 4D9MA 3AKCA 1CUSA 3FIUA 1SOAA 4NJMB 5IJ9A 2B4YA 5AUNB 3KALA 4DV0B 3VYSB 2O0LA 4NFYA 3VYTB 2LR0A 2XECA 4XQEA 1YA4A 3B3FA 3BIJA 2C5HA 3FFAA 3NT5A 4MB0A 5G4KB 2Q7OE 3U3OA 5IT9A 1E1QD 2JHAA 3M3PA 4ZMBA 3L9WA 1SIWA 1Z8NA 4KR3A 1E0SA 1UMCA 2GVDC 1R15A 2WVGA 4IDCA 1JG4A 4PFSA 4POAA 3G88A 3H87A 3SU8A 5EHQA 4P4TA 5BNZA 5BR7A 1D8AA 1W8DA 3KBBA 3M6FA 3PQ3A 2VTBB 3MRTA 4PCAA 1NC1A 1X7XA 1GV0A 4JIGA 3I72A 1CW2B 3ETNA 3JR3A 4LHEA 1KS9A 3CHYA 2C5FA 3KOYA 4O29A 3Q7SA 5BSMA 2G8LA 4XB6B 3V4ZA 5BPFA 1NAHA 1KC3A 1BVYF 2OD7A 4TV8F 2IEIA 2WTUA 3OESA 4TSKA 4P7GA 3EGOA 4HJRA 2LVBA 4WLEA 3UOWA 1XPOA 4KMOA 2QL5A 1B43A 4JGGA 4K5QA 3SJUA 4BGUA 1ZAYA 5JCXA 1CJMA 1PK8A 1PW7A 4XJSA 1MJGM 3GHYA 1QH9A 1AGRA 1HE4A 2HJSA 3S0JA 1F20A 1QWSA 2HMVA 3FHJA 3DFKA 2NT3A 1XVIA 2W2XA 3H9QA 1UK7A 1PR9A 2X77A 1RD4A 2P41A 4PC6A 4XM1A 3FPSA 1ACMA 2YWCA 3IAFA 4MMXB 2A92A 1W0JD 2A57A 2Y27A 1EWKA 3HL0A 3F98A 3HJNA 1WCXA 3P4YA 4J0KA 2C8JA 1ID1A 1MB0A 1KJZA 1TYAE 1ZMOA 1ZMXA 2BTQA 1HDZA 3GA0A 4M53A 3DDSA 3LHFA 1PJLA 2JL1A 2H4FA 3IHWA 3N2KA 1J9EA 2G77B 4RBNA 3PYLA 1GTL1 2HDWA 1UAAA 1VFNA 3AVUA 2XXAB 3CNHA 3LX5A 1SURA 4YRCA 4EF4A 4BQRA 3I0ZA 1Z4PX 1J06A 1MO2A 3QEAZ 4NOLA 3GV0A 3ZHSA 5JSFA 1KMIY 4HN4B 3UH0A 1HI9A 2JH3A 3BJZA 2AI3A 1B0AA 4TOIA 4IG9A 5HZMA 2FPPB 1D0VA 1Q83A 2ZT8A 3A1VA 4UM5A 5EXDA 5K45A 1PI3A 4IIXA 3VC1A 4NJEB 1SHJA 2RIRA 3Q7EA 4GI7A 4TL6A 5EJ8A 2WWWA 5I7FA 2C7PA 3TBFA 4YDQA 1R0BA 4DJAA 4TMVA 1ABEA 1PL0A 4X1YB 1NG9A 3BGWA 1ACJA 1QHHB 4Q03A 4IY1A 1WA5A 2B8NA 3SR3A 1NXWA 3LRPA 4G81A 3O26A 4N12A 4NV0A 2KBEA 3NT2A 3QITA 4TYPA 2GPWA 1QP0A 3QTLA 4A0RA 4GI1A 3NEPX 3ENZA 4U0JA 5YASA 3V00A 3A3PA 2DETA 4PGMA 3AKEA 4JP3A 3OETA 2AF4C 1E2FA 1GUAA 3DSRA 4DNOA 1SD2A 4Q48A 4X64B 1H8HA 3STVA 5IXSA 5JTUA 4AZ0A 2ANBA 1QYRA 4ZJYA 1FTGA 3E7WA 2Z9DA 5C34B 1B4DA 3B38A 2IHKA 1D2GA 2Y93A 4HAYA 2IU3A 4X62B 5KOJB 5HQ3A 1PD0A 2C59A 2PX0A 4RSGA 1WMAA 1YZ3A 1E58A 3OFVA 1IXSB 5IVKA 2R96A 3PXXA 4GP7A 2DPMA 3K94A 2FE4A 2XNKA 3O1JC 1VMKA 3U5ZB 4NLLA 4PLHA 3G8AA 4XWGA 4DMFA 3WRYA 3D8TA 5HKKA 3BHNA 3IRUA 5LB2A 4RO0A 1CR6A 1T6ZA 4D99A 3HJHA 2GS9A 3MD9A 3ZBQA 3TQHA 1FFWA 3EC2A 2DG2A 4DMRA 2E5LB 4UXIA 3PFCA 4R84A 1H2BA 1G5QA 1RWPA 2DT5A 1EFLA 4NYMR 4KOEC 3ZD9A 1B8OA 2NU7A 1XX6A 4KAFA 4YASA 3RVNA 2VRBA 1J2RA 1CHDA 1R0SA 4X85A 4H6WA 1BHO1 2QX7A 4IGEA 3ELUA 4OYYA 1XKQA 4UEOA 2IU0A 1UOPA 3OM8A 4NULA 3R8FA 3TW4A 4DV2B 4TUYA 3IAXA 4C0JA 1FFXB 4PS0A 4RZ2A 3ADBA 2VK2A 4PVCA 4RMGA 2NVOA 5ALHA 1ZKMA 3TVYA 4ZEVA 1YRQA 1KY5A 3P32A 1M2EA 3UXMA 1I7SB 4E2FA 5IBRA 3QF7A 3DL2A 1K2WA 1JVNA 3L7LA 3LFUA 5THKA 4WTOA 3BRCA 1EI9A 5FL7A 1OH7A 3HTXA 4KYTA 1XAJA 3JAWB 2AFVA 2Z1NA 4FTWA 4IIVA 4A0HA 2NVUA 5AVXA 2RHLA 2GK3A 3MMZA 5CNMA 5DI3B 3PR2B 2PKCA 4CE6A 4D3YA 3HBMA 2P2ZA 3I92A 4Q82A 2P0AA 5C1OA 4FBLA 2NYVA 1KVQA 1ZSYA 4U6SA 4UU0A 3ZBTA 5C37A 3HADA 5TPWA 2FWPA 2V4ZA 2NV6A 4UDOA 4DT1A 5A7GA 3B9BA 4HDSA 2Q1UA 2FH5B 4GGOA 5TB5A 2XV1A 2AVNA 2Z5GA 3U1TA 3ZBUA 2QY6A 5C5CA 5P21A 1CEEA 2QE7D 1T36A 1HM5A 2IBMA 4LHVA 2G17A 3OG9A 1PF7E 3NTXA 2CDRA 2P5SA 5REQA 1EXMA 3H04A 4Z4HA 1UMDA 4LX8A 4QULA 2VAXA 5AM5A 1O9HA 4IH9A 3GN1A 3S8MA 4IIJF 4OJMX 2IV2X 2DFVA 4HLCA 4R1OA 5T8KC 4YO8A 1VHDA 3LAWA 2E6UX 3SNHA 4REMA 3UMJA 4F2PA 3H11A 3NOVA 3FBTA 4NCKA 3BH0A 3QEKA 4NYIR 1KVRA 3PYMA 2X13A 4I3HA 3KZKA 2PL3A 5DBOA 1OFUX 4MEBA 5JWRA 5AH0A 2JI7A 2VZLA 3Q2OA 3OPXA 2VQEB 2YWJA 1SH7A 2OY0A 3IIJA 1ODLA 4NAUA 1FPMA 1IIBA 5F5XA 5L40A 3ZDDA 1QJ4A 1SU