4P38A

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with azd8329
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYNWDRFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Novel acidic 11 beta-hydroxysteroid dehydrogenase type 1 (11 beta-HSD1) inhibitor with reduced acyl glucuronide liability: the discovery of 4-[4-(2-adamantylcarbamoyl)-5-tert-butyl-pyrazol-1-yl]benzoic acid (AZD8329).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4p38A00
1ONOA 2NVUA 2WYUA 4DBZA 4DLLA 3GVCA 3DB2A 1KVRA 2W90A 3DWFA 4B4UA 2CMDA 4CQMA 2VTDA 1IHXA 2Y99A 4YT4A 3L9XA 1V9LA 4UVDA 4R5MA 1PR3A 3T4XA 1SEPA 4PG5A 1DAPA 3VC7A 4CLOB 5L7TA 1GQQA 4EUHA 3Q9UA 3KSUA 1DC6A 2IYPA 4KUEA 4WUVA 1D1TA 2D5CA 1P44A 4YJFB 4B3IA 3ETDA 3K5PA 2C7GA 3Q2KA 2JFGA 2P91A 2W8ZA 4NDNE 3TF5A 4CLRB 2C5EA 1M6WA 1K2WA 4CR8A 3MWDB 1GADO 1B16A 3L9WA 1UZLA 4UUPA 2ZQZA 4W6ZA 4B7XA 4K28A 2C07A 5B1YA 4YJFA 2A94A 3I6QA 1R12A 4E2WA 3RFTA 4A2CA 4PCVA 4GQAA 4CLRA 4M54A 4XYBA 1K89A 1XKQA 2G17A 2ZTUA 4Y9DA 1UR5A 5AYVA 3GEGA 4PZCA 2ZYAA 3PK0A 3OEYA 4CV1A 4U0JA 3GOHA 3I6IA 5L51A 2W2KA 2HMSA 5K0ZA 4FGSA 4IIUA 1XG5A 5EERA 4XJTA 1Q7CA 2XXBA 3LLVA 3E18A 3RQSA 1Q0HA 3B1KA 4IM7A 1PWXA 3OETA 4XEHA 3H4VA 5EMHA 4F3YA 1VL6A 3RC9A 4J49A 3FSRA 1ZSVA 4LVCA 2AEFA 2ILTA 1HL3A 5ENVA 4L4XA 3VDQA 1YXMA 4TRRA 2DPHA 4FN4A 4IDBA 5DT9A 3ZH2A 1DHRA 4DPKA 3WGIA 3QWFA 4N7RA 4AVYA 1PTJA 4BO0A 3GGOA 5LDHA 4QO7A 2C29D 3CXRA 4I9NA 5F5NA 1F12A 4NFHA 2DAPA 2EIHA 3DFZA 4GKVA 3ZWAA 4OAQA 3ST7A 1QP8A 3OFSA 2YFQA 2NM0A 3D3WB 4R16A 1K6XA 5EPOA 5KJEA 2NTVA 4NBUA 4ZQGA 4FBGA 2Y68A 4UUMA 3WMXA 2OZPA 1QYXA 2EG9A 3E5MA 4GSKA 1TXGA 4QQRA 4ZICA 2G5CA 3PIIA 1P1RA 2ZIZA 3IOYA 3FCOA 3M2TA 3RIHA 2B83A 4ALIA 3VHRA 1H2HA 3HFGA 3TFQA 4CR6A 4CQMD 4R1NA 4XZ3A 3LC7O 2X0RA 3PQEA 3WQQA 1AXGA 3ETGA 3C85A 1I2ZA 1LLQA 3A9WA 4RF5A 3VZQA 1ISHA 1M76A 1WLYA 3WJ7A 1TT5B 1JW9B 4YJHB 3BMOB 1CERA 4WNIA 5ILGA 3V2GA 4NHEA 4BKRA 4BNTA 3QVOA 3H2SA 4J0FA 2VNAA 1PWZA 4LMPA 4NBWA 3U5TA 1E1LA 3JD0A 1PS0A 2EGHA 4BB5A 3SJUA 2CD9A 1HDCA 1ZK2A 1GUFA 3I3OA 5T67A 3EMKA 4J43A 1OC4A 3ANLA 4GWKA 4NFYA 2J3JA 2J3HA 1GDHA 1PJQA 2IXAA 3H9UA 3LT1A 3QA9A 1HE3A 1HT0A 2VHXA 3JQAB 4WCDA 4A5OA 4RQUA 3ZWCA 3O8QB 4CL3A 1DJQA 9LDTA 4E31A 1BG6A 3GT0A 3DQPA 5I7SA 4M55A 1IZ0A 1GFSA 4LSWA 1BVUA 3CIFA 3FHLA 4L75A 1DRVA 2C54A 3WBBA 3DHEA 3T7CA 2DU8A 3MEQA 1C1DA 3OSUA 1ZIDA 2B37A 1HTBA 2EP5A 2GNAA 3W8FA 4JJIA 2Q2WA 1DB3A 1ZNQO 3EC7A 5EQDA 5I9LA 2ZATA 4NIMA 3S2IA 4D3FA 4KUHA 3HWRA 1AHIA 1FDWA 1NASA 2Z1MA 3QV1A 2UV8A 2BF7A 4Z0HO 2FOIA 1D8AA 4EBFA 4AJJA 1B14A 5K6AC 1HDYA 4HFJA 4W9NA 4CMAA 1SBYA 4PVCA 1PZGA 4E4YA 4YAGA 2VQ3A 1UXHA 2GN4A 4OXKA 5FF9A 1ZXLA 4IJWA 3OEWA 1IUKA 3IJRA 4ZHSA 3ZZNA 4FOOA 1ID1A 4WEQA 2EGGA 4OMUA 5A06A 2DTXA 3LU1A 2X0NA 4XYGA 3VVBA 4EZBA 1BMDA 3VH2A 4BGIA 1EVIA 2I9PA 2EJWA 2XXJA 3JQFA 3E9NA 5CEEA 2B5WA 1JKFA 1DPGA 1ZJYA 2Y67A 4WCFB 2WM3A 4AJPA 2DC1A 1HETA 1R6DA 1Z6ZA 1ZK4A 2WE7A 4MKXA 1PJBA 3RC7A 5B12A 3I1JA 3SVTA 4WK6A 1JTVA 4YQYA 3F5QA 3TL2A 3KOUA 4Q3DA 1E7QA 5L7WA 4IPTA 4WCFA 1YJ8A 1YL7A 5A05A 4Z6KA 1IB6A 4OSOA 4B3HA 4DA9A 1LDNA 3DAGA 2JAHA 4TRMA 1UZMA 1N7HA 2R00C 1UH5A 1UP4A 2JKVA 3OA2A 3Q0EA 4PLTA 3V5NA 4GVXA 3JQGA 2AEJA 3DBHB 2EJVA 3DZJA 4Q9NA 3VZRA 3NUGA 5BSEA 2HK7A 2GZ2A 4A0SA 1UDCA 2NNLD 3OJEA 3T4EA 1PJ3A 4YT5A 3I9LA 4BKOA 3D4OA 1EVZA 1BSVA 1PGNA 1X0VA 3BTSA 4Y8VA 4URFA 4D42A 4RLHA 4IDGA 4B4OA 3KYDB 1VI2A 4DIOA 1NHGA 1UDAA 3ZU5A 1FXSA 3V1TC 1TVEA 1YQGA 1GV0A 2YQ5A 4D43A 1ADCA 3WYBA 4YWJA 1YO6A 2YHUA 3NTRA 3R6DA 4WECA 4NPCA 4L76A 3UN1A 3GC6A 1IE3A 3KYDA 2HCTA 3DOJA 1P1HA 2BLLA 5DDIP 1WAMA 4I1IA 4E3ZA 1CRWG 3HQ4O 5JXWA 3OQBA 4WLVA 1R4NA 2VZ8A 3PYLA 1BXGB 4J7UA 1YBMA 3D64A 3WGHA 4IJVA 5JAZA 5KJFA 2QYTA 4WLNA 4UVHA 4ALJA 1BW9B 2DTEA 4J16A 3N74A 2VUUA 3MJEA 1A71A 1O94A 1RKXA 4QT0A 3HG7A 4GX5A 4DIFA 3ZNNA 1BXGA 3NEPX 3WGYA 3K9QO 1MFPA 1PJLA 2C82A 2DT5A 3A28A 5COBA 4ESOA 1XLTA 1PGJA 4UUOA 3GNTA 3VH4A 2BI8A 5CDUA 5KVSA 1EBFA 4QFDA 4BNMA 1U9JA 1OZAA 2BMAA 3INTA 3TZHA 3BMNB 4NG5A 4K6FA 3H5RA 4ZQFA 2IZ0A 4MIOA 5F21A 3JYLA 1XHLA 1JAXA 4E5KA 1PL7A 1R0KA 2PZJA 2HK9A 4AJLA 4L74A 1Y7TA 1CDOA 1MG0A 4J4HA 3WFIA 3AUAA 3BMNA 5GMOA 3SC4A 1EK6A 2VZ0A 4C4OA 4K6CA 5CDGA 5JS6A 2YUTA 1B26A 2A92A 3NT4A 5ENDA 4NU5A 3BTUA 3MTJA 3ZHYA 2HRBA 1E3WB 4FPXA 5FI5A 4RDHA 5KCZA 4KUGA 2VUSA 4B7UA 3RUDA 3DZBA 1M67A 2GN9A 3DMTC 1LRKA 5JPIA 1E7SA 4PLYA 4OXNA 3LT2A 3M2PA 4M1QA 4YAEA 5DCYA 4B8ZA 1A9YA 2DBQA 1W4ZA 4P38A 3TWOA 1GZ4A 5JDCC 2X4GA 4RLSA 2A35A 2CVOA 3G3EA 4KP7A 2JD2A 3TNLA 5A9RA 3JTMA 3ZDFA 3GA0A 1RJWA 1LDMA 1FF9A 3HDJA 2X22A 3HB4X 1ISJA 3IP1A 4NBVA 1E6WA 1FK8A 2V6MA 2G0TA 4JJGA 3JQCA 1X7DA 1GV1A 3FI9A 4Q3EA 2HRZA 3KZVA 2I76A 3AI3A 1B8UA 5A9SA 3FD8A 4NK5A 2NADA 3GR6A 4WOKA 3TZCA 3U4DA 2Y1EA 4YAKA 4LCEA 3UKOA 4BO5A 2Z95A 4UEOA 4P8RA 2SCUA 2GZ3A 2X1HA 1DIBA 3S8MA 4YJGB 1DJNA 4FFMA 1LI4A 1NVMB 2FY8A 4RL6A 2VZ9A 3WWZA 1UXGA 2BI7A 4CR7A 1G6KA 5TGDA 4RPHA 1E3LA 8ADHA 4NBRA 1B0AA 4PLGA 5TLSA 2V7PA 2DBVO 2Q2QA 2FR0A 2AE2A 4YJGA 3WYCA 4EUEA 3FPLA 4I9HA 2RHRA 1VJ0A 2OOSA 3GG9A 1YS4A 1EVYA 3LLSA 1PEDA 4PGFA 1P45A 4XCVA 5L53A 4MKRA 3PRJA 3QSGA 3CZRA 3FR7A 4ONEA 3UCXA 2E49A 3SJ7A 3E6AA 3E8XA 5H81A 3RUHA 3BYZA 3RJ5A 2HLPA 3VOSA 4PLWA 4C7KA 4CM5A 3SBOA 4DQXA 1I01A 2OL4A 2DKNA 1E5LA 3UF0A 1VL0A 4ZN6A 3WDSA 4CV2A 3GZNB 1X14A 2F1KA 2GCGA 3W4KA 3FBGA 1Q2XA 3JQBC 4X54A 3ZW8A 3ROQA 1NHWA 1LEHA 4OOFA 4OQYA 1NTOA 5T57A 1PSDA 1E7MA 2GASA 1A7AA 2I3GA 1GTMA 4N5NA 2EWMA 3NJ8A 4ND1A 1A4UA 1T2CA 1QSGA 1R16A 3CH6A 1NNUA 4IDAA 4OOEA 1LU9A 5CG1A 3WR5A 2J3IA 3VZSA 3UAGA 2DUUA 3KYBA 1CF2O 1PZHA 4UAGA 3WMWA 2WD7B 3ZWYA 2A4KA 2O7SA 3IMFA 3OF2A 3RFVA 3C1OA 5K9ZA 5ER9A 1SZJG 5JAMA 4B79A 3WQSB 3C1TA 3LVFO 1W73A 2GR9A 4A26A 2JFFA 4BQPA 3TQHA 4DBVO 3RFXA 4DRYA 4CUJA 1J4AA 3PHJA 4L4RA 4D0RA 2V6BA 3BIOA 4KQWA 4M87A 3WFJA 3I4CA 3LYLA 5C7LO 3K2EA 3SLKA 1AHHA 3WGTA 1HE2A 3HFSA 5F5LA 3WG9A 3JQEA 4FFNA 4Y6SA 1R0LA 2ZJ0A 3VPXA 5T8KC 2VT2A 1F8FA 2O3SA 1LC3A 1C1XB 4YQZA 1ZW1A 2VWPA 4NZ9A 1R37A 1P0FA 4OH1A 3DHYA 4PZDA 3WX0A 3WNQA 1B3RA 3IDSA 4G65A 5U4QA 3ZWMA 2DFVA 4B4WA 4BKUA 1V8BA 3PHLA 1XQ1A 2WYVA 4QUKA 1FDUA 3ULKA 5DBFA 4EEXA 3FTNA 5GY7A 5MDHA 4H7PA 1B15A 2XPCA 4YT2A 3DONA 1IHYA 4RPLA 4TQGA 5G4KA 5AXCA 2VT3A 3H5AA 2PK3A 4ZVVA 1EUZA 1JVBA 4HUJA 4KDEA 4CUZA 4QXMA 3DZFA 2D8AA 4CM9A 2HUNA 5U9CA 2X7HA 1VJTA 5GZ6A 1ADFA 5ES3A 2JFHA 3JQ8B 1GEGA 2X0IA 1F17A 2QQ5A 2YV1A 4FDAA 2IODA 2Z5LA 1V3VA 5CAEA 1H9BA 3IS3A 4BS9A 1C14A 1LA2A 4LSMA 1NVTA 5G0WA 2O23A 1T24A 3QHAA 4WJZA 4XRRA 2ZCVA 3UUWA 5TNXA 2Q4EA 3JQ8A 3OP4A 1GCOA 4TKLA 4YT8A 5TT0A 3DAFA 3WGGA 4GWGA 1NPDA 3AY7A 4GGPA 2Q45A 5I8ZA 4ALLA 2CVZA 1P31A 1NQ5A 1P3DA 1ENOA 1NFFA 3FNGA 4IINA 4LGVA 4CMIB 4E21A 4EI2A 3EK2A 2AG5A 5HWSA 1YB5A 3GF4A 1EFKA 2J5RA 3IAHA 3PGXA 4GKBA 4PZEA 4RJTA 5CHEA 4KOAA 4CPDA 3HJAA 5KVVA 2PKRA 4HX5A 1HXHA 5CFZA 3GG2A 3B6ZA 1E3IA 3AI1A 2O2YA 2ZB3A 3H6KA 2AA3A 4H15A 1QG6A 4GBJA 4ALNA 2GN6A 3IKTA 4TVOA 5GZ3A 2O3UA 5A3VA 3DBVO 3EAGA 3Q9NA 4DLBA 4EITA 2JAPA 1UJMA 3KLPX 4OKIA 1Q7GA 3FR8A 1U7TA 1PGQA 1XU7A 1FJHA 3O03A 4XJSA 5EL0A 2D0IA 4OM8A 4OHUA 1S6YA 3D5QA 3HDQA 1V3UA 3RWBA 2I67A 3I52A 3MJSA 4J3FA 4P4NA 3HNPA 3ZU3A 3OM9A 4I8XA 4E5PA 4II3A 2YFHA 3U0BA 3RBVA 5JO9A 2B35A 2TMDA 5EQFA 4BNIA 3D3EA 1KOLA 3VZPA 3E9MA 2E37A 4BNGA 2FN7A 3VPHA 2VN8A 3M1AA 4Y67A 4ZD6A 4R68A 3A1NA 1IULA 1XR3A 2BH9A 4PLZA 4XRGA 5K6AA 1NFRA 3DTTA 1LTHR 2F00A 4ZU3A 3VKVA 3EYWA 1DIRA 1JAYA 3E03A 2FR1A 4IMPA 4M49A 3ASVA 3Q11A 4YR9A 4O5OA 4CM9D 3ICPA 5I7FA 1UXKA 5LDGA 1U28A 5A9TA 1GEEA 1V3TA 5JLAA 3GNQA 4D7AA 2PD4A 4GAEA 3VTFA 5KVCA 1HKUA 1J0XO 4YCAA 2PGLA 4U0KA 2VUTA 3ICCA 3DZKA 3L6EA 3PYXA 1Z7BA 4ALMA 3RUEA 3MCVA 4O0LA 4CM7A 1GCUA 1KEUA 4QECA 1HDRA 1HZZA 4IGFA 2QRJA 1R66A 4ROSA 1WW8A 4CL8A 3L0DA 4YPOA 1E5QA 3SX2A 1TB4A 2W2KB 3AY6A 4O1MA 4RZHA 4IJUA 1DIAA 3ZWBA 5F1OA 3GHHA 3KSDO 4QO8A 2R00A 1OMOA 4XWYA 4JN6B 5IDXA 2PKQP 1A27A 3DZHA 4GL4A 3ZHXA 1RPNA 4BNZA 4NQZA 2QYSA 4OYRA 4C7JA 6ADHA 1H93A 2CFCA 4HY3A 4MDHA 3GVHA 3PHHA 4Z9XA 2ZTVA 3NT5A 4BV8A 3ZU4A 1MC5A 3W4JA 4FJ0A 1N1EA 3L6DA 3SXPA 4BNYA 4U7WA 1Z45A 1U3TA 3AUSA 5DP1A 1H94A 4BGUA 3IIEA 4L9RA 3L6OO 2P9CA 1O8CA 4RPJA 3GMSA 4CJXA 3RBXA 5ITVA 4A03A 5HRUA 2Q49A 3F3SA 5KIAA 1DLIA 4PG4A 1YDWA 3JD4A 1HDXA 1BVRA 3EUWA 1ZUD1 4A7PA 1WPQA 3FN4A 1YB1A 1ONPA 4FW8A 4AJ2A 5JBIA 1RYEA 3AFNA 3GQVA 4BO9A 1TEHA 1KC3A 1NVGA 5IFLA 4HNGA 2GUGA 3OICA 1CETA 5HA5A 4YEDA 4JBHA 3U49A 4G81A 4WGGA 4EJ6A 3I23A 3E5RA 3RROA 4J91A 1FMCA 3CPSA 4RVGA 1AXEA 5L3ZA 3DAPA 1DHTA 1ULSA 2NU9A 4BQRA 2Q2VA 5JYDA 3Q3CA 3OHSX 3PQDA 1W8DA 3S2FA 4J1NA 2VRBA 3QVXA 3GMDA 4J9VA 1PX0A 1UAYA 4BMSA 4EYEA 2OGUA 5L7YA 1ISIA 2PFGA 2PY6A 1Y8QA 4OGWA 4CLHA 3PTZA 3DFUA 2CF6A 2O50A 1XWFA 3GDFA 3Q1LA 4D44A 2W98A 4JJFA 4XYEA 4TVBA 4BB6A 1VL8A 5JDIC 1GPDG 2GZ1A 4IBOA 2UVDA 3AU9A 4LRSB 2EKQA 3V1YA 1A72A 1EE9A 1YONA 4BNLA 5L4SA 5LC1A 1PR9A 4FFOA 4XDZA 2ZK7A 2HMUA 1U1IA 3ONDA 4NJMB 1C1DB 1X7HA 4KWIA 3AFMA 1GYRA 2H63A 2GF2A 3RKUA 3OECA 3WLFA 1ENYA 1XCBA 4U6SA 2NU7A 1H6DA 3BHJA 1K3TA 4L73A 4A10A 3BZUA 3OJ0A 2Y0EA 3QWHA 2J5KA 5ER6A 2VHWA 2NUAA 1D1SA 4NJMA 2BFMA 2NTJA 4HBGA 1I30A 2NVBA 3DMTA 2FSVA 3LQFA 4N18A 1JU9A 1P1FA 1JKIA 3GNSA 4MVJE 1CIVA 2VTEA 3JQ9C 2GN8A 3TOZA 3WB9A 4R41A 4XYLA 3GY0A 2WEKA 4PRKA 3G0OA 2WTBA 3QIVA 1CWUA 1VLLA 1EMDA 1X15A 4BO1A 3ZWXA 4F6LA 5JDCA 3VH1A 3X2FA 1P1IA 3WS7A 4GX2A 5KKAA 4BO6A 5H82A 4YACA 3U4CA 3ZHBA 3Q2IA 3C7CB 8LDHA 3UICA 4B3JA 1MX3A 4U8GA 1KVSA 2Q1SA 2HKIA 1F14A 3NYWA 4RF2A 3WOHA 2BD0A 2OHXA 4MJLA 3TJRA 2Y05A 1XA0A 4RPKA 5AXBA 2PWZA 2X23A 3COSA 1PS8A 1UZNA 2Y1OA 2X9VA 3ZI0A 3CEAA 1E0DA 4ILKA 4MP3A 1XELA 2DBRA 3GLQA 4I5GA 2VWQA 1ZKMA 2EKLA 4IMRA 4MVJF 2PTGA 3OQ1A 3DBRB 3K73O 4WASA 1DC5A 2WD8A 1ADBA 3C24A 1C0LA 4YJDA 3ZGYA 3DOOA 4DMMA 2AHRA 1PL6A 3W6ZA 2PKQO 4IZIA 1WXDA 4KWHA 5AQ1A 4FOSA 3K8ZA 1G0NA 2FWMX 3KVOA 5HS4A 3PZRA 3JQGB 2X58A 1E7RA 1QR6A 4CMKA 5JFOA 2DTDA 3R3SA 3DBRA 1YOVB 2CDCA 1ZSNA 3NKLA 2LDXA 1U8XX 3ZN2A 5BNFA 3I9KA 3AU8A 3EGOA 1VRWA 4N5LA 1MC4A 2FMUA 4CMHA 1ISMA 3GUCA 5L4NA 3PPIA 5A1TA 3H65A 3D4NA 4CMBA 1YOVA 2W4QA 4WE3A 1Y9AA 3PP8A 1O0SA 5JAIA 1WMAA 3RD5A 3WSWA 4E13A 1UP7A 2HO5A 5EN4A 1EBUA 2NWQA 4GI2A 5TS3A 1ZJZA 4MKZA 1SB9A 1NAHA 2B69A 1LDBA 3O9ZA 4EJ0A 1E92A 4QSMA 4XA8A 1ZEMA 3G79A 1H5QA 1E3JA 1SEVA 1NFQA 4CM6A 2Q99A 3WYEA 4B7CA 3JQBA 3H3FA 1R4NB 2Q1WA 2JD0A 1CEQA 2G76A 5KJ6A 2IXBA 4M86A 1I33A 5COAA 2I65A 3ONFA 1LC0A 1ZMTA 1LX6A 2HSDA 4E5NA 5JO0A 2HAEA 1I10A 3UH1A 1PZFA 3PWZA 3E82A 5I9NA 3NGLA 4J0EA 1GYQA 3ZV5A 1DO8A 3AWDA 4R1TA 3ABIA 5G0SA 3RCBA 5F3RA 1B8PA 2BGMA 4IXWA 3GEMA 5CEJA 1L7DA 1LNQA 2OUIA 4GLLA 2VNSA 2BGKA 1F8GA 5G4LA 3RBZA 4Z0PA 4W7IA 2C2YA 1EFLA 1N8KA 3OMLA 4DPMA 4IS3A 2BGLA 1LXCA 3PEFA 3WWYA 3OQ6A 3H2ZA 2NV6A 3TRIA 1P1JA 1MG5A 1UXJA 5HM8A 4RO0A 3G17A 3I4FA 2JD1A 1IL0A 5T8KA 3UGKA 1FDSA 4DIBA 3KV3O 1VSUA 4MP6A 1R4MA 3RUFA 2EKPA 5IF3A 2HMWA 2DUWA 2DM6A 3UW3A 1LDEA 4PIVA 1NPTO 3ZNOA 2P2SA 4TZKA 1U3UA 2RH8A 3GDGA 3LF1A 5T6BA 1NR7A 1N5DA 1GL3A 4DMLA 5THQA 4FC7A 5BSFA 1IYZA 1V35A 4IDEA 1YQDA 3W8EA 4P4LA 4GX1A 4J90A 2EEZA 5TJ9A 5JC8A 1B2LA 3KUXA 4LCJA 4MVJI 4J4BA 4J7CA 4JCOA 4ZRMA 5IJZA 3HN7A 3FRJA 4E33A 4QX6A 5JC1A 1EUDA 3PDJA 3QWAA 3H9GA 4I5EA 3DOCA 5U1PA 2FRDA 3L4BC 1AUPA 2D3TA 3KYCA 3PZBA 3WJAA 4OQZA 3K92A 4IS2A 1U2DA 1KC1A 1E6EA 4FD3A 1DFGA 3HZZA 1YQXA 3B20A 1N92A 2Y1DA 2VHZA 5A9SB 1M6HA 5LCXA 4S3MA 2X5KO 3GN2A 2H5LA 3GN1A 1HRDA 2X0JA 1HYGA 1U4OA 1QLHA 2H1SA 3DO5A 3RSHA 2GSDA 4D45A 2AMFA 3SC6A 3WGQA 1RM3A 2VYVA 3QVWA 4CMEA 2WYWA 1KERA 1B7GO 1HWYA 1MV8A 4HP8A 4WOJA 2P4QA 3DEYX 3DC2A 2WWRA 4CV0A 2ZB7A 1T25A 2FPPA 2X86A 3WGOA 4AFNA 5FI3A 3TZKA 1MFZA 2POQX 2NQ8A 1K6JA 4YRBA 1I3KA 2HDHA 3ADOA 3C7AA 5G0VA 3CUKA 1WZEA 3ANMA 3BA1A 1VPDA 3NX4A 3PQFA 4O59O 2NU6A 3S2EA 4XIYA 4DPLA 1U5CA 3KM0A 3F1KA 3BXXA 4HFNA 2O48X 3GZ4A 5KTKA 2QG4A 4F46A 2BFOA 4FC6A 5L95A 1ZEJA 2GRAA 2LDBA 3MJVA 4J6FA 4UVIA 1OFGA 2BFAA 4RPGA 3PVZA 5IN4A 2VRCA 3ENKA 4IQ8A 3ROPA 3O4RA 4BNHA 2RCYA 1ISFA 1F0YA 2PZMA 3H9QA 5KJ1A 4AJNA 1JA9A 4FJ2A 3U4HA 1T2DA 3ZWVA 3FBTA 2WE8A 4Y6RA 1VC2A 2CUKA 4CV3A 1EQUA 1QYDA 4PLPA 1MLDA 2VWGA 3LC2O 1QORA 2IDZA 1HEUA 1YJQA 3BMCA 4BUCA 2FPIA 3D1LA 4RQTA 2ZTLA 4IIVA 2ZYDA 4H3VA 4R69A 4CLEA 2Z1NA 5T5QA 1L1FA 3DBLA 1SAYA 4ND3A 1EVJA 3WNVA 4XGKA 2QRKA 2C7VA 5L45A 3G49A 3A14A 1ONNA 2HMTA 3KB6A 1KVQA 4KMSA 5TIIA 2B4QA 2X5OA 4PG8A 2IZ1A 3I9OA 3KSZO 4Q3BA 4AG3A 3QWIA 1KEVA 4J4TA 3TL3A 3UHAA 1I32A 3NAQA 3HUDA 1G1AA 1BXKA 4ZGWA 2Y0CA 5CPBA 2FR8A 1W6UA 3G1TA 4EUFA 3TOXA 3MOGA 1AE1A 1EUCA 1QV6A 3BHMA 1B3BA 4DQVA 2DVMA 2NQTA 5DCWA 9LDBA 2CZCA 1C0IA 1TT7A 1VSVA 2GYYA 3WIDA 4EDFA 2R6JA 4UVEA 5DNAA 3P2YA 4BVAA 3GAZA 2VYVD 4NI5A 4I5DA 4LMRA 3U09A 1Y8RB 1ZK3A 4CQLA 4CM4A 5JE8A 1QYCA 3K6JA 1G0OA 1KVUA 5DBIA 1PQUA 3A06A 3GFGA 4ZQHA 5G4KB 2GGSA 2JL1A 3L77A 1Y8RA 3PJEA 1ISGA 1W0CA 3ON5A 2J5QA 3ROMA 4UUNA 1HF3A 1SCUA 3CTMA 3PJGA 3JYPA 3PIDA 2JCYA 3AM3A 2Y93A 1KBZA 2GD1O 1XSEA 3B1JA 3SEFA 4DL9A 2Q3EA 5TJHA 4IQGA 1GUYA 2E48A 4TWRA 5TT1A 7MDHA 3UXYA 3O38A 4DYVA 1DDOA 3C1AA 5HS6A 1H0KA 1ORRA 2PGJA 3I9JA 5JMWA 2JHFA 1ZCJA 2PD3A 4DUPA 5C37A 3BMQA 1GPJA 1GY8A 4FR5A 3WBFA 3NTQA 3R1IA 3GGPA 1ENPA 1R15A 1Z75A 1Y6JA 1VKOA 2CDBA 3DR3A 4LVUA 1HLDA 2Q46A 3ZU2A 4BGVA 2VHYA 3S2GA 3VPFA 4Y98A 5ILOA 1AN9A 2C59A 2H6EA 4FJ1A 1QKIA 3DZIA 1XDWA 1NXQA 3OBBA 5THKA 1I5RA 1DFIA 3TZ6A 3H7AA 3WXBA 1D4FA 4HXYA 1UAGA 3GAFA 1CJCA 3GPDG 1ZSYA 3ITKA 3PXXA 1GR0A 1VJ1A 3OJLA 1OOEA 1KYQA 3JD2A 4ND4A 4CMEC 4YXFA 5KNLA 1JVSA 1S7CA 2AG8A 3MOIA 3HADA 3QW2A 1GUZA 2D4AA 4ITUA 2PNFA 4ZQEA 5JDIA 4HADA 5A5FA 1IZ9A 1EDZA 3JCZA 5H83A 5IZ4A 2EP7A 3E9QA 5EESA 3AK4A 4FFRA 1LSUA 1E7WA 1WP4A 5IZCC 3IKVA 2D2IA 3NDJA 1HDZA 3BTOA 3QVSA 4PLVA 4YDRA 3RUCA 2VYNA 4HFMA 5TF4A 1A9ZA 4LRTB 5B4UA 3WTCA 2ET6A 2J6IA 1Y1PA 3HN2A 2PH5A 3ETEA 5A3JA 5F1PA 1O9BA 3ZWPA 4P22A 4MINA 1SO8A 2YHIA 3KLMX 5C7IO 5TSDA 5BSGA 3STHA 4J1QA 4TKMA 2O3JA 1LRJA 3QJ5A 4CM1A 4BO8A 4RVFA 4DREA 3GVPA 4BL5A 4JNKA 3K96A 4NH4A 2X9NA 4II2A 2W2LA 2FSSA 3QY9A 3GVIA 2FP4A 2JCXA 3JQ9A 2VWHA 2GO1A 2C2XA 2YY7A 3M6IA 3ORFA 4ZA2A 5C3MA 5CDSA 1O6ZA 1QRRA 5I8WA 2P9EA 3LSYA 1BTOA 2P9GA 1GZ6A 5AXAA 4OL9A 4CLXA 5FFFA 1N9GA 1NX6A 4XQGA 1WDMA 1A5ZA 2E6UX 3VH3A 1GD1O 1PJ2A 1B8VA 1DC3A 2QIOA 1I2CA 2X5JO 4E30A 2NLOA 2UUPA 3MTGA 4NNJA 3UFXA 5CDYA 1WVGA 1UP6A 2JCVA 2Q4BA 2HK8A 4HNHA 4IDCA 4CM8A 3KEOA 3CKYA 3IUSA 1P33A 2YZ7A 4JIGA 4ZQBA 5AOVA 4ZJUA 3WLEA 1TLTA 3KETA 4QTZA 2PD6A 1T2EA 4DC1A 5B4VA 4IGEA 4ND2A 3AY3A 5J23A 1YB4A 1T2AA 4XX0A 3ZNQA 2UAGA 1GYPA 3W4IA 3WGZA 2AXQA 4MVJM 1NQOA 1WWKA 4BNNA 4FFPA 4KZPA 4IZHA 4WNCA 4AJHA 1DIHA 3QE3A 1NR1A 3KO8A 4GX0A 1NQAO 4DC0A 1J49A 2B36A 1EDOA 4XYMA 3F46A 1I24A 3NT2A 4UREA 2E82A 4EGFA 1I0ZA 1H6AA 3ZNPA 4CUKA 4RVHA 2CNBA 2PV7A 4YRDA 4BKQA 4CLOA 2P68A 5BNTA 4MIYA 3TDKA 3CSDA 4M8SA 2ZB8A 3RASA 3NRCA 4AJ4A 1I3NA 4PLCA 4GH5A 1KETA 2B0JA 2PZKA 5CG2A 5A02A 5BR7A 1KS9A 1N7GA 3P19A 1JN0A 3KTDA 5JAQA 1EE2A 2ZB4A 3LC1O 3QWBA 4G2NA 2VYND 3TZQA 3K2BA 5JY1A 3DXFA 2AQ8A 1QXSA 4DTIA 1U7HA 4K1LA 3CMMA 1NP3A 5EJ2A 5A4DA 5EINA 5A5EA 1XEAA 4NFSA 3AOEC 3CZMA 4J1TA 5DZSA 3GUYA 4B4VA 1OC2A 5DP2A 3JYOA 3GEDA 5JCJA 5ICMA 1PL8A 3W1VA 1NWHA 2DFDA 5T64A 2W2LD 3NDRA 2GPTA 2QZZA 3INRA 4Z9YA 1PGPA 2P5UA 3OJFA 1UDBA 5B37A 4CM3A 4LN1A 4WLFA 3LK7A 2H9IA 4E2YA 3OA0A 3HDHA 1N2SA 1PU2A 3LZ6A 4NMHA 4BKPA 4CMGA 4JQCA 2EV9A 4BNKA 4YB8A 3K31A 3UCFA 1GZ3A 4W82A 3S55A 3A4VA 1P77A 3FWZA 4R9RA 1Q7BA 2E4AA 1Y8QB 5BT9A 1LSOA 1SOVA 1T4BA 1A7KA 1K6IA 3QQPA 3MJCA 4I9UA 3RU7A 3U3XA 4RVUA 1DXYA 2WDZA 2EERA 2OP1A 1ZK1A 3PWKA 1P0CA 2RAFA 2WJPA 4XR4A 1KEPA 1UXIA 1OI7A 4O63O 1P1KA 2EF1A 1X1TA 4J2HA 1U4SA 1PJSA 1YRLA 4HKTA 1XQ6A 2VOEA 4JGBA 2CDAA 2I6TA 3GH3A 4D41A 1ZK0A 5AVOA 2WMDA 2PGDA 4MIEA 4DQUA 1IPEA 2V6GA 3B70A 3D3WA 1X7GA 4BNJA 3I9MA 4L4SA 5ITWA 5G0TA 4NK4A 1D3AA 2Y1GA 2RIRA 2C5AA 2FPGA 1PIWA 4XIJA 3NV9A 2BRUA 3W6UA 1U3VA 5TQVA 3INGA 3DMYA 1WNTA 5BNIA 1DC4A 1N1GA 4GPD1 2OBYA 3P2OA 5DN9A 2AE1A 3U62A 2EXXA 4YVFA 5COQA 4TSKA 1PZEA 4JXKA 1E3EA 3CINA 1QMGA 4ZRNA 2GLXA 1TT5A 4AJEA 5I7VA 4YJHA 3OJOA 1Y9EA 3BMOA 2TMGA 3L4BA 1LBEA 2QHXA 1HSOA 5I7EA 3H5NA 2PH3A 1BHSA 1LQUA 1XIVA 2YDYA 2AQHA 3JYNA 1SOWA 2HMVA 1IPFA 1H6CA 2X8LA 4IY1A 5DOZA 4XGIA 1Z7EA 3GVXA 1NYTA 3IUPA 3MWEB 3IL2A 4D3SA 3PJFA 5GZ1A 4PG6A 3EY4A 1HZJA 1YVEI 3JQAA 3PGJA 1E7YA 3O8QA 1DFHA 5KKCA 5TRTA 4RORA 1U8FO 5JCJD 1KIFA 3JD1A 4MVJP 1EZ4A 3QRWA 2Y1FA 2GERA 4UEJA 1CQJA 1I2BA 3IJPA 4BNXA 1DIGA 1PQWA 2AQIA 3ZV3A 3PLRA 2DBZA 2NACA 2RH4A 4YAIA 4BNUA 3GDOA 2PLAA 3R3JA 1NM5A 1T2FA 2B5VA 2P5YA 1RM5A 4EJMA 2IE0A 2NSDA 1T1RA 4XGNA 4K9DA 4XD2A 1V0JA 2JHGA 4OKNA 2YW9A 4W7HA 1PJTA 1EQ2A 4OJNA 6LDHA 1QV7A 1GU7A 1BGVA 2BELA 5CP8A 2D59A 1SC6A 3V1UA 3D4PA 1BDMA 1ZMOA 3OIGA 1QYWA 4R9SA 4AJOA 4Q39A 2HJSA 1ZVMA 4R54A 2Q50A 4AJKA 4EW6A 2VHVA 4BMVA 1DAOA 2J3KA 1YGYA 4JROA 1LSSA 4BO3A 4CMCA 3RU9A 3VVCA 3VAZA 2J8ZA 4S1VA 5IAAA 3EZLA 1O89A 1LRLA 4U5QA 4BO4A 1BWSA 5JNLA 1VM6A 1SNYA 1DRWA 3ZW9A 2FHSA 4IJKA 4G5HA 3PHIA 3GRKA 1YE3A 2OORA 1YBAA 4XQ9A 1P9LA 1XU9A 5F1KA 1Z74A 2UUOA 2O3RA 1JQBA 1HE5A 4MVJA 2O7QA 1F06A 4BV9A 1X13A 1PS9A 4UVGA 4WKGA 2FZWA 1PJCA 4LW8A 3WSVA 4RVDA 2G1UA 1XYGA 3KXDA 4O6VA 4Y6PA 1A4IA 4TRNA 1MA0A 5L40A 3PLNA 3GFBA 3HE3A 3DDNA 1LDYA 3GGGA 5IDYA 2EW8A 1LDGA 3KEQA 4NJOA 3RUAA 4BGEA 1YL5A 2Y66A 4R51A 2IRWA 5IXYA 2IEBA 4OIMA 3UVEA 4KQXA 3DBHA 3U4IA 1HYHA 4RGBA 4R4JA 3JV7A 1J5PA 4HWKA 3EW7A 5DULA 2XF8A 4JX8A 1EK5A 1HYEA 4Z3KA 1U2GA 3V2HA 2VOJA 4BOYA 4PLHA 4DWVA 3F47A 3N7UA 4I08A 2DLDA 4RZIA 4WPGA 4JP2A 1IOLA 4HFRA 3EDMA 3JQAD 1J6UA 3FPCA 4D0SA 3C8MA 2YDXA 3LDHA 3PI7A 1ML3A 1WZIA 3D5TA 4INAA 5TC4A 2XAAA 4UULA 1RYDA 3RUIA 4GLOA 5DF1A 1R4MB 3D7LA 3O26A 3NDIA 4DYDA 1WDLA 1D7OA 5JMPA 1LUAA 1QLJA 3W8DA 1SMKA 4DLAA 1ZZEA 1LLDA 1K0UA 4PFJA 1PJ4A 4FQ8A 1KVTA 4R3NA 4XKJA 1C0PA 3OH8A 4DVJA 4U6QA 4JBIA 3JQDA 1Q0QA 4Z0TA 5JCXA 1ADGA 1E1KA 3QVTA 4KTVE 4F45A 3IQDB 3ZCXA 3CMCO 1BXZA 3G1UA 1MP0A 1BW9A 2OP0A 3RAJA 4NBTA 4RF4A 4AICA 2V65A 2YV2A 4LK3A 4JP3A 7ADHA 1KY5A 1LJ8A 2ZTMA 4NR0A 3FWNA 3KYCB 5KVQA 5AXDA 2B4TO 5ICSA 1JWBB 2C20A 2O3QA 4JLWA 4YRAA 3FNHA 1DBVO 4EEZA 1ENZA 1MUUA 2NTNA 2O2SA 3V2UA 1NBOA 5A03A 4HV4A 3IC5A 4WLOA 1CQIA 4JBGA 5EIOA 1DEHA 3DZGA 4KTTE 4RV9A 5IN5A 1R0SA 3TFOA 4P4GA 4MVJD 1E3SA 4OSPA 2I99A 2YYYA 1M66A 3AUTA 4W4TA 4CLDA 2ZKLA 3C7DB 3KBOA 3V8BA 5KJCA 2EW2A 1ZO8A 4BO2A 1E6UA 1U3WA 4XB1A 5FYDA 4ALKA 1TA4A 4M89A 4L8VA 3F4LA 4E32A 3AM4A 3I5MA 4A27A 3RVDA 2CF5A 3F1LA 4IDDA 5IXSA 1RM4A 5L9AA 1HLPA 3ENNA 1E3WA 1T1SA 4NU6A 2GDZA 4BIIA 5IG2A 2AQKA 5CPFA 3ANNA 2XOXA 5KWEA 2Y0DA 4MPDA 1U5AA 1ULUA 3P5SA 1AGNA 5CDTA 4W9NC 4GMGA 4E5YA 2C0CA 3FF4A 4FIZA 3FNEA 4IXTA 4MP8A 5C5IA 5IZCA 1MXHA 5CEFA 2I5PO 2NU8A 2UYYA 2Y1CA 3NJ4A 3OIDA 3T7EA 3GHYA 3QLJA 1O95A 1M2WA 3VKUA 2BHLA 2PA3A 3MJTA 3PJDA 4QEDA 4RDIA 1C3VA 3DTYA 3BHIA 4ID9A 4WEOA 4PLFA 3JQFC 4N5MA 4Q3CA 1JLLA 1H9AA 1HDOA 4JK3A 4DGSA 2A9FA 4D79A 1I36A 3VPGA 3SLGA 1ARZA 1MGOA 2X6TA 3BMCB 4GVLA 2VCYA 3KRTA 3AJRA 2YV3A 1I8TA 5JY6A 3AUUA 4TZTA 4GGOA 3VPSA 4WCFC 3DBLB 4XR9A 2I66A 2HJRA 3HHPA 2RHCA 3TSCA 1JWAB 3DHNA 4Q3NA 1H2BA 3EVNA 5ADHA 4BMNA 2PR2A 3H8VA 1YDEA 3MZ0A 3ZWWA 4W99A 3VTZA 5MGBA 1OAAA 3ASUA 3JQ7B 4MOWA 4YYZA 3TPCA 1BDBA 2NVWA 2WSBA 2CSUA 4RCVA 2QX7A 3N58A 4FB5A 2G82A 3QP9A 5JYEA 2ZYGA 3HDYA 4ND5A 4AJ1A 4E5MA 3I9NA 5HTOA 4N54A 1E1NA 3JQ7A 2Q1UA 2D5AA 1GQYA 1DLJA 1O5IA 2O3TA 2UDPA 3ROKA 1VKNA 1YL6A 4BNFA 3F6YA 1Z82A 4FCCA 3RJ9A 1KEWA 3LT4A 1EEHA 5DOVA 1SB8A 1P74A 2FZEA 5HBRA 4TRJA 1L7EA 4J2OA 1GAEO 1YWGO 4WLEA 1GQ2A 1LLCA 3C3XA 4PG7A 1ZBQA 3ITDA 4YAJA 1RWBA 1LSJA 4CQLB 4CM4B 3LF2A 2PZLA 2ZQYA 1MXFA 1NPYA 4TMFA 3GZNA 4XQEA 3LT0A 4CMJA 5B4TA 4R01A 3ZV4A 4J1SA 1T26A 4H16A 2B4RO 2EHDA 4IUYA 4BO7A 1XGKA 3H3JA 4WLUA 3RKRA 4AL4A 1DRUA 2BFPA 5IDQA 1IY8A 1ZH8A 2OO5A 5FEUA 3GPIA 3WQRA 2QW8A 4KDFA 4R5HA 2V6FA 4D3DA 3EZYA 4BHTA 3AW9A 2WD7A 4DXHA 4E0BA 3E1KA 3NTOA 1I3MA 5DCUA 4R1UA 3ADPA 3M1LA 3BMQB 2ZCUA 3AOEA 3S1LA 3I83A 1MB4A 4J7XA 2CY0A 1TI7A 3E48A 2D1YA 3F9IA 2OBNA 2VRCD 4J9UE 4Q3AA 3ZHZA 3F5SA 5L4LA 1RM0A 2CVQA 1YBVA 1CYDA 4OO3A 3F4BA 2O4CA 4R3WA 4PRLA 3VDRA 1YKFA 4FGWA 4MVJH 3KHUA 4E6PA 4PN3A 3GRPA 2O4UX 3PFFA 3P7MA 4FS3A 3NGXA 4BNWA 1WMBA 1C1XA 1Y5RA 1ZFNA 2HU2A 3B1FA 1VE9A 2OMEA 1HSZA 4K26A 1FDVA 3WIEA 4AJIA 3PHGA 3JYQA 1X1EA 5IDWA 2AW5A 1V6AA 1OBFO 3FNFA 1Q0LA 4BNVA 1H6BA 1M75A 2P4HX 3HSKA 1ZXBA 4E2ZA 3EVTA 4IQ0A 1WDKA 3MJ4A 1K5HA 1LQTA 1NWCA 4PVDA 1KY4A 3EHEA 3WICA 1DOHA 5KOIA 3JSAA 2BKAA 2Q1TA 2ZJ1A 4L0QA 2QRLA 4R1SA 3AOGA 1LLUA 4TROA 2X9GA 3UCEA 3U9LA 2JJYA 4QFCA 5C7OO 3RI3A 3WTBA 2I3AA 3ZV6A 5BSHA 1DSSG 1T4DA 3CE6A 3K30A 5JW6A 3ONEA 2IEDA 3Q6IA 1HDGO 4LISA 4CODB 1Z73A 3AI2A 3HB5X 1SPXA 2YHIB 1YH3A 2DPGA 3RC2A 4FSHA 4D46A 3H9EO 4XB2A 5G0UA 3ZWNA 3R0IA 4A73A 2OFPA 4GMFA 3RC1A 4UEKA 1JDJA 1Q1NA 4E2XA 4B8WA 2RBEA 1X0XA 1UUFA 2OXIA 4RVSA 4F6CA 3IP3A 4FFLA 4Z3DA 4E12A 5FWNA 5BQFA 2QZ9A 2R2GA 5DBGA 5G2OA 4Z9FA 3X2EA 3ZWOA 3H9JA 3UOGA 3PDUA 1NAIA 1NQTA 3L4SO 4MO2A 2AEMA 4RF3A 4CMIA 1HE4A 1QYVA 5TX7A 3DL2A 1PQPA 3PWSA 4XQCA 4IDFA 1PGOA 4YTEA 1N9GB 5I9MA 3PFWO 2YJZA 2IYOA 3PYMA 4YBZA 3BAZA 4GSLA 4CM8B 3AM5A 3FTPA 4I5FA 1C0KA 3JD3A 3OIFA 3D0OA 2IZZA 3L07A 3JQ6A 3GK3A 1E77A 1Y81A 2NVUB 4OXYA 4XDYA 5A04A 5JSFA 1E1MA 1FDTA 2HQ1A 4CQMB 1Y5MA 1I3LA 2YQ4A 4MVJG 1BRMA 1JKJA 3TN7A 4YA6A 2DQ4A 3BTVA
chains in the Genus database with same CATH superfamily
1ZJ5A 2WYUA 4DBZA 5IYZA 4FDLA 1S8NA 2IXEA 2C88A 3DB2A 4JEUA 1KVRA 3SSNA 4B4UA 5JI3E 1NJFA 3VFDA 4V0QA 1CUYA 2VTDA 3IBTA 3Q8XB 4DM7A 1S3SA 4M9QA 4CT5A 2QQEA 4LDJA 3HO1A 1GAJA 3T6KA 1A9OA 2ZRKA 3L8EA 1SEPA 4PG5A 1DAPA 3VC7A 4IRMA 2F1RA 5EP2A 1F2UB 2UZ3A 4HPXB 5B57C 4ZP1A 2CXSA 1UXOA 4EUHA 1WEKA 3FG9A 3W5SA 3KOXA 3GU3A 4MS3A 1E3MA 3KUCA 3CONA 1GNPA 1ZMXA 3Q9LA 2ERXA 2RONA 5EIHA 4BX9A 4D3YA 1VGQA 2O8EA 5LL6P 5KTRA 4BNDB 1CR2A 4B3IA 2C7GA 3OOEA 1CJSA 3E9YA 2X14A 5TGZA 3VSEA 3TF5A 4CLRB 1KE1A 1WB4A 3A1FA 5JNRA 5ALDA 3KOYA 3U19A 3Q98A 3MWDB 1SXGA 1GADO 4UCXA 5LUAA 1B16A 4ZCPA 3KQNA 1V9CA 5AI8A 1XAHA 4HOYA 2A7XA 4OV6B 2YCLA 3NFRA 1WBJB 3EEBA 2C07A 3N9IA 5B1YA 2CVHA 1U90A 4LGYA 1QFXA 3EF1A 4QDOA 1G38A 2QZJA 3KAKA 5MGNA 2AI2A 2G77B 4Q7JB 2NXCA 3RRZA 2Z6AA 4TT3A 1A1SA 1RAAA 5J58A 4S2UA 3GXOA 5KNCD 2BJHA 3QELB 4JJ8A 3A6GA 4OYYA 4XWWA 4WFJA 3E2IA 3ML1A 3C0KA 3OOJA 4CV1A 4U0JA 4BBPA 5L51A 2GHTA 2HV9A 1J8VA 4ZMSA 1UMCA 4BFUA 2BKLA 1AKNA 4CU2A 4TMXA 4X66B 4QXOA 4ZYXA 4FGSA 5IKMA 5AK4A 2KB0A 3LCJA 2F6RA 1DZ3A 5KYWA 3LLVA 1RI2A 4I2VA 2ODBA 2IDJA 5FF9A 4NYMQ 2C3MA 1Y42X 4XEHA 1NVXQ 1XZEA 1YKGA 4F3YA 1YTUA 1CP3A 3VU0A 3K72B 1ZSVA 2GUWA 2ILTA 2GZSA 4HXGA 3G7SA 4UTVA 1XTBA 3HCDA 4L4XA 3VDQA 2Z4RA 3U4GA 4TRRA 1G8HA 5IM4A 4FN4A 2SICE 3D1JA 2IYAA 1L5LA 2FE1A 1N6OA 4N7RA 5A5VA 1PTJA 3F96A 1WXGA 4BO0A 1WEHA 5KC9A 5LDHA 2C29D 2WIKA 2I1LA 4TS1A 2G9RA 1IBLB 1JEOA 3WDMA 4G0QA 4RIEA 2Z8ZA 2EIHA 4OHCA 1XZFA 1GKIA 4OAQA 4UMFA 1QP8A 1AA6A 5J63A 5CR9A 1WCIB 3IBFA 5FBQB 4DCSA 3D3WB 2CBZA 5EPOA 3BCHA 1YFLA 1CQXA 1PDWA 2VNIA 2BEWB 3K9WA 1NJ1A 4LJ5A 4QD3A 3CFYA 4FBGA 5G1OA 3M6VA 2VYFA 2OYRA 1EP2B 2Y68A 1YZHA 3OCYA 3RREA 3IV6A 5LA6F 2HEIA 3Q41A 2FPGB 1QC5B 2G5CA 4X1KA 3UYKA 8ABPA 1T4GA 3MSCA 4AMGA 1QK4A 3RIHA 4BEBA 3MLAA 1H2HA 4Y6QA 1NGSA 1NC3A 3OTIA 4X8OA 3DHWC 3TFQA 2JJMA 4R1NA 1CNFA 1JEDA 3NEYA 3RT9A 2Z2XA 2WSSA 3MELA 5I51A 4TXJA 2P9FA 4NLLA 1YAHA 2E5LB 2G71A 2Y27A 2IUFA 3LX6A 3N3AC 4ACBA 4QYIA 4LF9B 4L5YA 5CTAA 4BEVA 1VKZA 2W58A 4PIPA 1OLUA 2QRUA 2ZYIA 3CUUA 3KZOA 3A9WA 2V0NA 3LHIA 1ZM3A 1A2OA 1E61A 4NULA 3BRCA 4B7ZA 4BKRA 1E79D 2REOA 4JSTA 2I4OA 4NHEA 1KJYA 4BNTA 4HEQA 5D87A 3H2SA 1E3QA 5EMJA 3V1NA 5B58C 4HH3C 2HLNA 4ZAZA 4FNAA 1VP3A 1YHNA 4IL5A 4RFSB 1RYMA 3TLGA 2JLAA 1TVKB 1QO7A 4IGIA 3CT6A 1IM2A 1NUTA 3I3OA 2A5JA 2NSYA 1TAGA 3EH2A 4JJAA 1OC4A 4HDQB 3EZFA 2QRVA 1JR2A 2J3JA 2L18A 3A25A 4NV3A 3QA9A 2FLKA 3JQAB 4WCDA 4A5OA 4AZSA 4FU0A 9LDTA 4QBFA 3O8QB 2O14A 4NZNA 5JWRA 1BG6A 2H08A 1A8UA 2PRJA 3ROGA 4US2R 3K7EA 3ETLA 3U7JA 4C7BA 4F56A 4CEIB 4IFTA 3MCZA 4FS8A 4BRUA 1GFSA 1ZGAA 2FYTA 1W5FA 2BDTA 3JARB 1BVUA 4IIFA 4LSWA 1KQNA 3DQQA 4PHTA 1NUPA 2ADFA 2C54A 2WIGA 2ZXFA 5ALLA 1T3GA 2B8NA 5FR1A 5JJIA 2AN9A 1GCGA 2G1KA 3T7CA 3V1KA 3BGSA 3DOFA 4ZODA 1HTBA 2QRMA 3U3ZA 2WOOA 3QUAA 1RADA 2GNAA 2QNRA 2YJ5A 3F5FA 3I73A 4CNBA 4JJIA 2ICAA 4XOUA 1W4AA 5DGXA 2DFPA 5I9LA 4OBBA 2H2GA 2OXEA 3THWA 4R1OA 3DF9A 1FDWA 2DQKA 5HF9A 4NZOA 2ZSIA 2UV8A 1QJCA 1EXWA 2XB8A 4OHXA 2NO7A 3U39A 1MA3A 1XD9A 3UKDA 4AJJA 3TM4A 2Q3LA 4EBFA 4P84A 1RI1A 5K6AC 1E2HA 1F3OA 1S4QA 4HFJA 4J7AA 4C4YA 4PVCA 1PZGA 5D84A 1GPYA 2QTNA 1NULA 4HDAA 1Z5UA 1T13A 3A1CA 2BTQB 3WLMA 3ZZUA 3HCOA 4UD2A 4UEQA 3NW9A 3PEEA 3NUZA 4CZ2A 4P3YA 2HNAA 3KQWA 1T6XA 4TV9A 5DNEA 3KVRA 2K87A 4MDEA 3RYHA 5LM3A 1TW2A 2BI4A 3VPDA 5A06A 4OMUA 1FZTA 3LU1A 2X0NA 2WZQA 2PO5A 5ARDA 4X3PA 1LPAB 3VH2A 4Q3OA 1V1RA 2I9PA 3EG5A 4RHXA 2GBPA 4OL0A 3RRFA 4PF1A 1M2VB 1D1PA 3MFYA 3QU5A 4ADSG 4WCFB 3T7IA 4O4IA 4DEXA 4Q00A 3SY8A 4AIRA 4BZPA 1NBAA 1IBMB 3HYRA 1ZK4A 2F3PA 3B7GA 3LLCA 5ALUA 4UUAA 1QIJA 4JFRA 4NYJQ 3I1JA 1UCFA 3PLAE 4IVQA 4J3JA 3AWIA 3C87A 4YQYA 2HSWA 3TL2A 1Z33A 1KDVA 1X1BA 4KW7A 4DNQA 3SCZA 4IPTA 5IWCA 2XODA 2E89A 4Z6KA 1YNOA 1QV9A 1IB6A 4OSOA 1YQEA 4EMSA 4DA9A 5KINB 5B3AA 3DAGA 2JAHA 2P3LA 3HFRA 1N7HA 2YQZA 5ISMA 1G4AE 2EZUA 4M8NE 4GVXA 3JQGA 3V5NA 4AROA 2ZUTA 1L4HA 2G28A 4WJKB 3VZRA 4NOJA 4I3HA 3TLMA 2FSFA 2HK7A 4EG6A 4X20A 3ADCA 2BZGA 4XQ0A 4A0SA 3QLTA 4KR9A 4OFWA 1SXJA 2BMDA 3E5HA 1PJ3A 4AM8A 2DHQA 2O2CA 3FNQA 3T7DA 1G20A 1ULAA 2HIGA 5CIQA 2XNKA 4NQRA 2VP2A 3OD5A 4Y8VA 1Z4KA 4K5QA 4URFA 1YRAA 4HZGA 1TGYA 5LMCA 4IDGA 4RV4A 3L7JA 2ZE5A 3R8CA 1F9AA 4MB2A 3V34A 3OI7A 3GLVA 3BVPA 1NHGA 1UDAA 3PXBA 4W9MC 3L4JA 2RK4A 2QVZX 2OC9A 4QSHA 1DCFA 1GVHA 2AL7A 2C2GA 1R18A 4D43A 1Z36A 3QFRA 1YMVA 1IH8A 3DOHA 1NVWQ 1OBCA 5DK6A 4OIFA 3UAOA 1YFKA 4NPCA 2BZ1A 3KR0A 4RQBA 1MJ5A 1GR1A 2O5RA 3EZ7A 3GT3A 4L76A 2XCUA 1OROA 5JRZA 4OBXA 1KYIA 1ONSA 3VPBA 1IXSB 2BLLA 3AFIA 2HU5A 3HCAA 3BD8A 4WKCA 3DS8A 3ANYB 3HQ4O 4NARA 4UJ5A 2JDIA 3OQBA 1TJ4A 3PYLA 1EFRA 4J7UA 3IAM6 2C7QA 1K7EB 2W6JA 2IY8A 4G36A 3LT5A 4UVHA 4WLNA 4ALJA 4DCVA 3F90A 1E2KA 4NYMR 1AV6A 3G8BA 1L7PA 2JFWA 1SBNE 2VQEB 5ALRA 4JJZA 3CT4A 3MJEA 3TKLA 1A71A 1O94A 2P2GA 3QEBZ 1RKXA 3NASA 3HG7A 3AINA 4ZT2A 4UM9B 2PVCA 2GAFA 4V02A 3C4JA 4G1EB 3STWA 2VTBA 4RE6A 1BXGA 1EK0A 5DHTA 1NIJA 4KH0A 3K9QO 1MFPA 1PJLA 2NUPB 4QGGA 2DT5A 3CLRC 4RK1A 1XLTA 2AN3A 2V1XA 3TQFA 3W5HA 2YWEA 4UTOA 1CQIB 5CXXA 4BNMA 1TKRA 1ZOIA 2JC3A 2P77A 3INTA 4YGXB 3BMNB 3SHWA 2CV2A 2E87A 4NG5A 2D7CA 5E9AA 3SHVA 1QPGA 4OG2A 3HB1A 2VDWB 3NRJA 4UPEA 5F21A 3JYLA 4E4TA 1Y37A 4RKRA 3C6ZA 2KBFA 1YR2A 3EJWA 1H69A 4MPTA 2VAVA 1R0KA 2EX1A 2F8LA 4GMKA 2HK9A 4L74A 2UVQA 3JPWA 1CDOA 4NCJA 1FDIA 2WJYA 4J4HA 4F84A 1VHQA 5EZYF 1EK6A 2JI4A 2Y9PB 2K5UA 4G4IA 3FMGA 4K6CA 4MVCA 3JALA 5CVCA 2GBCA 5CDGA 1B26A 1PAUA 2A92A 3NT4A 5I4IA 4XSVA 2C3OA 4ETIA 4IEEA 3AF6A 3SXUA 3ZHYA 3FDZB 5BRAA 1PR1A 2DJIA 3VSAA 2WU1A 2V7WA 3HPRA 5FI5A 2IBMA 4RDHA 3DL7A 2XADA 3T3EA 1SIOA 5FORA 4DXAA 4JR2A 2I4RA 1YS9A 3ABQB 1WOMA 3VTAA 2PANA 1LRKA 3B5IA 5KTPA 3FOEC 5JSZB 5FH9A 4OXNA 4YAEA 4G07A 3OCVA 2EAUA 5KHOC 2QU8A 1I4DD 4JLOA 1MH1A 2F67A 4K40A 4QELA 2NU8B 1JPUA 721PA 5JDCC 2B8EA 4J07A 3SN6A 3E7DA 2A35A 3G3EA 5KS2A 4IO1A 1KMIY 2J7PA 5LQNA 2JD2A 3TNLA 3EFOA 2ACWA 5EFZA 5AK3A 1FP1D 3HSSA 1ZNWA 3ZDFA 5J59A 1XXHA 1EJ6A 4EPWA 3GA0A 2QRZA 4P2GA 2WVAA 1TM7E 2VHCA 4RFLA 4ZO8A 3RSQA 4LVNA 3GCGA 1ISJA 3IP1A 4NBVA 5TXGA 1E6WA 1JLLB 2ZU6A 2PH1A 2V6MA 3ANSA 1KAHA 4E7PA 3UUFA 4JJGA 1AGRA 5AI6A 1IXRC 1N4DA 4GO1A 4TKVB 4BEWA 1E2NA 4UUQA 3TQQA 1GV1A 3QVGA 1YZVA 3MSXA 1Y0BA 4ON9A 5H9WA 2I76A 1Y33E 4IH1A 1GGEA 2C95A 2H7YA 4KXNA 1YUNA 4EENA 5HVNA 4RETA 2WF7A 2PAFA 4XWGA 4LFBB 5B3LA 1NUUA 3X3HA 3T5MA 4EF5A 4ZIRB 2AC7A 3HDGA 2FDRA 5EJ5A 2G25A 3EF0A 6Q21A 3UGJA 1P39A 4DNFA 2OAGA 4U7FA 4Y2PA 4Q4LA 2Z95A 4BO5A 1UWCA 2EJUA 5CXQA 3Q7EA 4P8RA 3D7NA 1Q1QA 3GLGE 3FFWA 1RLUA 1N4AA 3FJOA 1J23A 1DIBA 2X1HA 2I3BA 4GHWA 4KE7A 1DJNA 1I4OA 2E1PA 2PT5A 4QUAA 3ROFA 5J3JA 4BZZA 4M60A 1LI4A 3FTCA 3UKJA 2AVNA 4B46A 2FH5B 3H1PA 3R5SA 4TQ9A 3UPDA 3CVWA 3UJHA 1CZNA 2JH9A 2QR2A 4PPNA 2A30A 2VP6A 3BJIC 3FPFA 4BQNA 4X93A 5TGDA 1ZM2A 4RPHA 4CR7A 4E46A 2G04A 1RWPA 3V8VA 1JR4A 4TTJA 8ADHA 4NBRA 4PLGA 3BXZA 1YQ9A 2HTEA 2DGDA 2ZW9A 1OGIA 3HRHA 2IS6A 2VSOA 4URHA 3A1UA 2FR0A 1Z7GA 4EUEA 3GIWA 4IJ6A 4PN7A 2HT1A 3KHKA 3LLSA 4KLRA 3ZLTA 3EPJA 1VPTA 1XZJA 4U2GA 4ER6A 1JB9A 1JJVA 5FTMA 2E49A 2G9ZA 3SJ7A 3EFEA 4FTWA 3WLJA 3PGLA 5CA0A 4LFAB 3BD9A 2VSNA 2AWNA 4KKXB 5EZQA 4CM5A 1XN1A 4UNPA 3SBOA 1H22A 2XT6A 3R8FA 5F78A 4DQXA 1I01A 3MWGA 4NE2A 4FEYA 4NYJR 4EB8A 1E5LA 3UF0A 2V5VA 1V2GA 3WDSA 4F5WA 3EY9A 4GZ3A 2YN2A 3FBGA 3JQBC 1FX0A 1G7TA 1E1RA 4X54A 3GIDA 3ROQA 4OOFA 3RTEA 4MR8A 3VSCA 4WNAB 5BMOA 1YZQA 5T57A 5FLYA 2IYFA 1F48A 1SY7A 5LQJA 3KHTA 4LY6A 2WJAA 5DX1A 4ND1A 1JFSA 3R9XA 1N2XA 1SU8A 4RZXA 1T2CA 1JHMA 1P9OA 2X8AA 4KQEA 4PXSA 1R16A 4WN3A 2AH5A 2BLNA 5CG1A 3OZAA 3VZSA 1BZYA 3FKSD 2J9FA 3SNKA 4AY6A 2EEPA 4J75A 4M0PA 3MINB 4RTJA 3TJMA 3FTDA 3GX1A 4UAGA 3WMWA 5KZMB 4ZTZB 3RFVA 2ECOA 3CQ9A 1BCSB 2HO4A 5ER9A 1O94C 1SZJG 1SU4A 1W73A 1JIQA 5DLQC 2JFFA 2V74B 4WZZA 3TQHA 4DRYA 2IBTA 4QVIA 2R85A 3HWSA 2Q0XA 1W0KD 3FOFC 3BK1A 4P86A 2B6HA 5AR1A 3BIOA 1TO6A 4H7IA 3DE2X 3N2ZB 5KTNA 4K0RA 1YUMA 3LYLA 3H0KA 3ZQ4A 5C7LO 3FROA 3SQWA 1NN1A 4RCYA 1AHHA 5E1MA 2WW8A 3HFSA 3WGTA 4BMVA 2R47A 1HPLA 3D6MA 2JANA 4LOJA 1R0CA 1OSNA 4MW1A 3JY6A 3LNCA 2CKMA 1F8FA 3WMFA 1C1XB 1M83A 1W93A 4YK7A 4AUNA 2VWPA 4PC6A 4NZ9A 3TE7A 1R37A 2IVFA 3DHYA 2I4IA 2EF0A 3NHLA 3OCJA 3IDSA 5U4QA 4BKUA 2AOUA 2CT8A 4ZEVA 1K8RA 1A9PA 2B1GA 3JQQA 4TMVA 1U7UA 5PGMA 2RB5A 4LV6A 4L5CA 5DBFA 1RP7A 1X3SA 4YRCA 4NONA 5GY7A 3ESQA 1GRRA 2ANCA 3UT0A 4A82A 5FOVA 3ACBA 4YP5A 3UJPA 5D3ZA 2AHOA 2BFWA 4H7PA 2ST1A 1B15A 4UZFA 3ZWQA 4YT2A 1P62B 4RPLA 5EJ7A 5SICE 4BBJA 5HFAA 4EZEA 1A9XA 2JCBA 1G21B 2V7QA 1PZNA 2C94A 4R2IA 2VXOA 4ZVVA 1LWNA 1YD7A 4CUZA 3GLIB 2B4KA 2ORVA 3KC2A 3O6VA 1L5OA 4TL8A 5U9CA 4BMOB 4N0PA 4N5HX 4OYHA 5CMLA 4EM6A 1VJTA 2PVSA 5GZ6A 5T3YA 3UPUA 1S8OA 2GAJA 4DA8A 2ADOA 2AX4A 4WH0A 2LPMA 4U02A 2YV1A 4B48A 2Z2ZA 1RYHA 5CAEA 1V3VA 4LXXA 1H9BA 2RFLA 1NOIA 3PPXA 1PWEA 1REQB 2WAOA 2WUVA 3DMGA 5EKUA 5BN5B 2NUTB 3TINA 1NBIA 4FHCA 6PFKA 4XRRA 3UUWA 1VPWA 3OTGA 1KQFA 4CTNA 3ZIUA 1PDOA 3VNBA 2Q4EA 1JR3A 3OP4A 3KTAA 2REQA 1EB9A 3BRWD 3O2NA 3N8DA 3QLUA 1FFSA 3WGGA 1NRXA 1NPDA 4GWGA 4I4LA 2A6PA 3IPXA 4RAQA 2GD6A 1P31A 1P3DA 3C3DA 3M4NA 4KQJA 2R6FA 4B6GA 5ITZA 1F2TA 2FZVA 3PTAA 1XDDA 4E21A 3EK2A 1YGPA 5AW7A 3LUGA 5HWSA 4JI5B 1EFDN 2Q5QA 3GF4A 4M1EA 5BPHA 3PGXA 2J5RA 1Q44A 1QP4A 2FSPA 4RJTA 1MJHA 3BGDA 4KOAA 4ZO7A 2JGMA 5AKGA 1C9KA 2PKRA 2XTNA 3OFKA 3AZQA 5LJLA 3SEZA 3GG2A 2WTEA 1Y5LA 1E3IA 1R27A 3AI1A 2ZB3A 2H7XA 1UJ5A 3NEJA 4FONA 1FQOA 5LWQA 4DLBA 1A9TA 2JAPA 1UJMA 3G0BA 3KLPX 4M0EA 4M9UA 4UKDA 4JJEA 1PGQA 1WO8A 2DULA 5K09A 1BHO1 2EFGA 2ZWAA 3O03A 4NOLA 1XD8A 1XRLA 2YV4A 5IMSA 1E0SA 1W6RA 2WFLA 1JHDA 5EL0A 3AYXB 5EVJA 4BE7B 4UDOA 2XRZA 1CK4A 2NPIA 2ZBGA 3EVCA 2DUNA 1F5SA 2PX6A 1KZ7B 1NSFA 3G89A 3Q7PA 3H75A 4R0MA 3KWMA 4LJLA 3CRVA 1V7QA 3NNDA 1AGPA 4I8XA 4OP2A 2QBYA 4G0VA 1NMSA 4UDXX 4II3A 4E5PA 4EMUA 3PB3A 1WV1A 3U0BA 3LRTA 3RBVA 1X7XA 4F8JA 2TMDA 3CRQA 4BNIA 3LUBA 3CCBA 5I7WA 4HH4A 2E37A 3GLTA 3G0DA 4DIKA 3VPHA 3GT4A 4R2XA 4Z4IA 3D02A 1CFJA 2VN8A 4PZZA 4UXJA 4V0RA 4DDUA 5I4CA 4UBLA 4MV9A 3T3DA 1NLFA 1IULA 3CSSA 3DC7A 1CULC 4A5SA 2XZOA 4FNOA 4MWCA 2C9CA 2QE7A 1P4AA 3G2NA 4A0RA 1CF9A 1E4VA 4QTUB 3KVYA 1U2QA 1MVOA 4CIVA 2MMGA 2HXSA 3VKVA 2OESA 1QRSA 5C8YA 1JYSA 5HZMA 3ZOZA 1N2HA 3E03A 1MC1A 4E5UA 1YJAA 4G8DA 1YVPA 4A2WA 3OZXA 3UJ6A 3ASVA 2HWWA 1KSFX 2J33A 4WGFA 1D04A 5LDGA 2IKQA 2CNNA 1U28A 5LLDA 2P35A 3BAFA 1GEEA 1M6NA 3DM5A 1YHZA 4D9KA 5B3JC 5FWYA 1LBQA 3GNQA 3TFWA 3TKYA 4F2DA 2OAEA 2QVYX 3IBYA 5KVCA 1BMFA 4AULA 2QL6A 3SZMA 3UAZA 1WQ1R 2FR8C 4F0JA 1IZ8A 3ROTA 4F4HA 1K8QA 5I47A 5EIWA 3RUEA 1CUEA 4AF6A 2B98A 1QIEA 1X7WA 3HP1A 1KEUA 1XTTA 4O8CA 4IGFA 1XUOA 5HF5A 3P2EA 4MWZA 4CGZA 1JJ7A 3SM9A 4YPOA 2AGVA 3L8FA 3TR0A 2NYAA 3A3PA 2WJJA 5KYWB 2V5UA 2UUBB 3AY6A 5EVCA 2C3PA 1ZGHA 3EXFA 3NHBA 4BX2A 1DIAA 4LRQA 2JGAA 3T9FA 5EWLB 4WXEA 5LP6F 3JZAA 4Z7QB 4KR7A 3KJXA 4CMEA 3V8NA 3ORYA 1A27A 3DZHA 3BFVA 4GL4A 2B34A 1P2GA 1RPNA 4NQZA 2GXQA 1XJWA 4PRZA 2DHDA 2W71A 1II8A 4ZI2A 3D1VA 1H93A 4WD3A 1VGRA 2Q0SA 3GVHA 4YLGA 3THYA 4DUYB 2C5FA 2ZTVA 4OHBA 3NT5A 2HYDA 4Q1FA 1QBGA 2DWCA 3P0EA 5FL3A 1M5TA 1AUQA 1VIMA 3D8BA 1H8EA 1QB8A 4QHTA 3R3XA 2XB4A 2Z2YA 4KK3A 4NYIQ 4Q21A 2FZKA 4U7WA 5TPWB 1JZTA 2FJUA 3AUSA 5D7NA 3B3JA 3REQA 4TTSA 3ZVKA 1Z07A 3G2JA 2MR5A 3PR3A 2X3FA 3TIIA 4I1UA 4PSUA 2P9CA 1E0AA 5AP9A 4CL0A 5LOVA 2R6DA 2X1VA 3GMSA 1PI3A 3ZG6A 4A03A 5IT0A 3Q10A 2ECFA 2FLWA 2G72A 3QXCA 5KIAA 1B76A 2L69A 4RY0A 4A36A 1YDWA 5AUPB 1KNQA 4X1KB 2ERCA 2AFIA 4AN4A 4OGGA 3TKAA 2D6FA 5KPDA 1V1MA 3LIPA 1AS0A 3IAS1 4MYCA 4YUAA 2AV6A 5EHQA 3CNHA 5H9VA 3R3WA 4J0GA 1YB1A 1K5PA 1U3CA 4E08A 1LPMA 3ABSB 3KQQA 1RYEA 3AFNA 2IITA 4BO9A 2CZGA 3IELA 2F3SA 2GUGA 4JKIA 3LW7A 1Y3HA 4QYIB 1CETA 5HA5A 1O8BA 3H2JA 1CUZA 4AMZA 1OLUB 3U49A 1H2FA 4G81A 4Q02A 5DNUA 3KKMA 4HAYA 1RC1A 4LCBA 5EIEA 4WWHA 4RVGA 5L3ZA 2FSIA 2COEA 3L0BA 4C88A 1I1QB 1PK9A 1DHTA 5J1TB 2X0FA 4MUEA 1FXWA 3HBMA 5JYDA 4ITRC 1OZ0A 2VXYA 1YV9A 5ALSA 1W8DA 1WW3A 2FN3A 3EDYA 3EMDA 2IIBA 3AUJB 3S2FA 1XCMA 5K2OA 4PGHA 1ZVQA 1UAYA 3TLGB 4EGAA 4TT8A 1XRPA 3TEFA 5JV5A 1QPBA 3H84A 1MJGM 5EIAA 1Y8QA 2C3UA 2ZJYA 4L50A 3TRKA 1Q6ZA 3D2LA 4F4FA 2H4YA 4YMLA 2QRVB 1LTKA 4U2CA 2O50A 2H8KA 1F5NA 1TEXA 1J1UA 4XYEA 3ZLJA 2H18A 2LUOA 3PD0A 4R6XA 1DGQA 1IY2A 1G2QA 2EKQA 3V1YA 3VNRA 2WABA 2XE7A 1VCIA 3BS4A 3INYA 4QDJA 4UE3S 2OR3A 3L4KA 7REQB 2ONJA 1NDQA 4K81B 2AWOA 2FK8A 1FNNA 1PR9A 3S0JA 1Q1ZA 4J76A 3KAJA 1EWKA 3GWZA 3GT7A 4NS1A 1U1IA 4H7JA 2FFQA 3CN7A 1OGYA 1WS6A 3JVVA 2WU3A 2HIHA 4KXQA 3ZGLA 2QMEA 3C5EA 3FGOA 2VDMB 2ZS7A 1W34A 1XYYA 2G36A 1X7HA 4B1FA 4LZLA 1RPTA 4QTXA 4JLMA 1ZOOA 4Y1RB 2NXNA 3OECA 3RKUA 4ENTA 5JSQA 1ENYA 1XCBA 2RHJA 2JG3A 2VPYA 2Q6IA 2HYIC 1NUHA 2Y0EA 3QWHA 1QQTA 1IG3A 2N1MA 3OE4A 2OSVA 4N3BA 1Z7YA 3RIEA 5K3DA 2FN8A 2W6NA 4OLBA 4QAQA 4LNUA 3SJAA 1EFTA 2NTJA 2RHBA 1A7UA 2F1HA 4RM2A 3NIWA 1ZD9A 1IN4A 3DMTA 4Y3UA 3LQFA 3H2BA 4HAVA 4EG7A 3LG2A 4CIYA 3MS7A 1P1FA 3GNSA 5ETJA 1M8GA 1L5MA 2P3SA 3JQ9C 3H8WA 4DSAA 3GY0A 4PRKA 3CX3A 3G0OA 3PL5A 4WKBA 2WIAA 4X1YA 2CJPA 2W70A 1VLLA 4TV9B 4F6LA 3FWHA 3MXTA 4FCWA 3C6BA 3RYHB 2J1LA 3FYCA 4GX2A 5KKAA 3ZWXA 3OZVA 1LF5A 4BO6A 2XE6A 1KBOA 2FUKA 1T6ZA 2VDQB 3AR9A 4DW8A 5H82A 3I6MA 5L6LB 1SD1A 3UJ8A 3A1WA 2ZRIA 1GG5A 3B3FA 4B3JA 2XZLA 3DFIA 4NRDA 1DUVG 3PXUA 3T1NA 3GJTA 3V8MA 3H0EA 4ZZ0A 1UEJA 3WOHA 2B6NA 4O4IB 4Y2SA 4LHYA 2Y05A 1PJAA 1XA0A 1JSXA 1AGYA 1GNTA 3I34X 1CLEA 1EHYA 1PS8A 4EG3A 5LMZA 2IXGA 2Z5GA 1JEEA 2HA0A 3S44A 1GPMA 1JG3A 1SQFA 5F98A 3ZDCA 1SHJA 2VWQA 2EKLA 4MVJF 4HWPA 4A6EA 1E0KA 2JFXA 2B2CA 4DUZB 3NTXA 4QBTA 4WASA 1QFJA 2WD8A 1ADBA 4TWZA 2CXOA 1H1TA 2AHRA 1QZXA 4NXNB 3RVOA 2DLCX 1TO1E 1W1IA 3PUXA 5DSZA 4AXBA 2BBWA 4FOSA 1TFRA 3K8ZA 2FWMX 3KVOA 2VI5A 2WMOB 3JQGB 3QPBA 2OKCA 2DTDA 4KNYA 2B8WA 4B3MB 2PR7A 2Q6TA 3NKLA 3PC8A 3AM1A 2VAPA 4X20B 2YIJA 3QOFA 2I4NA 3NO4A 5KSYA 1XFAA 1VMAA 2MSCB 1QH8B 3AU8A 3EGOA 4MTLA 3A04A 2GF9A 1BE8A 2V7UA 4LTMA 4N5LA 3EIXA 4CMHA 1G20B 1NTRA 4TWBA 1T6NA 2OYSA 3COYA 3D6JA 3NOVA 3S1AA 3OIVA 3H65A 4CMBA 2W4QA 5GGXA 1Y9AA 3PP8A 3C3YA 3PVCA 1O0SA 3M4JA 3N8HA 4NCXA 4EFMA 4G97A 2I6XA 3NALA 3RD5A 5JAIA 4M0MA 1MT0A 1XTJA 5EN4A 4L95C 2FQWA 2NWQA 4CCYA 3N0TA 4GI2A 4XGRA 5TS3A 2O2DA 3I39X 3A70A 3EGWA 4JIMA 1U65A 3MGCA 5ALZA 5BW8A 1ZI8A 1OLXA 3WHLA 2F8SA 3MWJA 2I1QA 4H77A 3KX2A 4QSMA 4EJ0A 1CCWA 2GJ8A 3G79A 1H5QA 3QF7A 4WAUA 4IRUB 1ST2A 3Q88A 4JUIA 1OXBB 3WYEA 1DO2A 1UJ4A 4J1TC 1FEZA 5KDOA 3L05A 2Z8YM 1BJTA 2GI4A 3C1UA 3H3FA 3NIDB 2H1OA 1JFFB 1PT9A 3A8TA 2PUFA 3S7TA 1A96A 1T2NA 4BQOA 4M86A 1NURA 4QATA 1GGHA 1JHQA 4YP9A 4F2GA 3FFAA 3B9RA 3LKDA 1IEWA 3OUUA 2I65A 3OQIA 1CUDA 2P0YA 1LC0A 3IUYA 5DM4A 1DS6A 1ZJWA 5IABA 1YCHA 4REOA 1QJ4A 2HAEA 3JZIA 1QH0A 5I9NA 4UBOA 3IIMA 3PSAA 4KQCA 4M1TA 1W48A 4ZOLA 3QEOA 1DO8A 5D85A 5EA2A 3ZV5A 4V1CI 5JWHA 2RAPA 2HCFA 5DX8A 4EQ6B 1B8PA 2BGMA 1IDN1 3L0SA 4IXWA 4LWZA 3IEXA 2WP8J 4DNXA 5CEJA 3DOEA 4V2UA 1C41A 3WIOA 1BVHA 2W42A 2WWTA 3RIMA 4S04A 2JVIA 1U98A 4RKQA 2CLHB 4H3SA 5G4LA 2WD9A 1EFLA 4D9HA 1FYWA 1F60A 2W6ZA 3GGSA 1YS6A 3OMLA 4G4SO 4YCJA 821PA 4YRLA 4D6PA 5DWVA 3NOQA 1UBMS 4HUQA 3KU1A 1K8YB 1GRCA 2O2HA 2DHCA 1RI5A 4MPRA 5EE0A 3K9GA 4MUAA 3WLPA 4LQCA 3WWYA 5C1OA 4MLZA 4KRYA 2OFOA 3GZJA 2Y1LA 3H8SA 4HATA 1MG5A 2R66A 4FNGA 4MZXA 1IL0A 3G6KA 3AG5A 3RWOA 2OCLA 3JALB 4YRSA 1FDSA 3OT4A 3ZHRA 1BEZA 4JUFA 4DKXA 1NVAA 4UNRA 2HMWA 2DUWA 1U0GA 1NPTO 2EBFX 2P2SA 1K5DA 2RH8A 4TZKA 5DM2A 4CKWA 3R2JA 1OH7A 4LF8B 4RTSA 4X0EA 1ZD8A 3DKVA 3Q3IA 4IH9A 4DMLA 4FC7A 4EF4A 4IDEA 1YQDA 4RS3A 4P4LA 4L6AA 3HY6A 1JIIA 2ZWPA 3PU6A 2I2DA 1JLHA 1XU4A 4JCOA 2HDOA 2G0AA 4RD0A 1EM8A 3FRJA 4JEIA 5DNWA 1CEYA 3N5KA 4QX6A 2YMMA 3SBDA 3SZOA 4D26A 4DB4A 1Z6XA 1AN0A 3EFOB 4KQGA 1LI7A 2A1TR 1J22A 4I5EA 2QX9A 1XXHB 4H0FA 4FI3C 3IESA 3ZUGA 3TBFA 1XZLA 3CR8A 3KPUA 1QIHA 1TKCA 3HO8A 4DLPA 3PZBA 3CH7A 4K9NA 1G18A 4KGDA 3A4IA 4OQZA 4BIMA 1R3DA 1SOMA 3KE8A 3RVKA 4EITA 2G1PA 3WGUA 3MYRA 1M2GA 3HZZA 1XJ0A 1NW9B 1N92A 2FGKA 3KSMA 1J70A 5EE5B 2VHZA 4CODB 1O0CA 1SIBE 5DEOA 4S3MA 1SC4A 1Y1RA 2W2NA 2X5KO 1YE8A 4P4SA 4PICA 1P4HA 2P40A 3S29A 4C3ZA 1L7NA 4FYMA 3RBXA 1M74A 3AEZA 4AQDA 2NIPA 3U48A 2H1SA 3KXKA 3RSHA 4D45A 3CF4A 1KP9A 2HPZA 3WGQA 3U7IA 4P98A 1N77A 5AW9A 1TYEB 2O8VA 1MV8A 1N2CB 4QLAA 3TM5A 5CTJA 4Z99A 4CV0A 2ZB7A 1AZLA 2B30A 4OXRA 1NATA 1YR9A 4OHFA 1Y8CA 3TZKA 3K0AB 1PT8A 1XMIA 4A23A 1JEYA 3SOZA 3FBWA 4RTNA 3G68A 3TEJA 1P60A 3M5CA 4B0OA 4PGMA 4U2EA 1WZEA 521PA 1VPDA 2HM7A 2NU6A 4XIYA 4RYDA 1PJ8A 3KM0A 1NNEA 3B6JA 1S4MA 2ZKIA 5KTKA 5AVVA 2EKDA 5F35A 4F46A 1XHFA 1MV5A 2ZSDA 1PG5A 2GRAA 3GCZA 4DV6B 3B78A 3LBFA 1GTJ1 4UVIA 1PR6A 3U3JA 5AVTA 4UBIA 4RPGA 5C1DA 2VRCA 2PS9A 1XZNA 2R6GA 1EHCA 2I2FA 4FKBA 3KWFA 3TE6A 4FM9A 4DR3B 4KAAA 3PRYA 5KUTA 2ZWIA 4D0LB 3A2LA 3AP3A 5IVKA 3F74A 1WF6A 2OORC 2EJCA 4M9XA 3BWBA 5KJ1A 1JA9A 3BULA 3FUCA 3G9ZA 4FJ2A 1Z4LA 1OY1A 1A8HA 1U1GA 4LYDA 1YR3A 4MR8B 2NGRA 1MDBA 1ZP6A 2H07A 2MDTA 3EXHC 3OZWA 2CUKA 5FIUA 4O2AF 2GYUA 1QYDA 2WKSA 5JDCA 3R9XB 1Y1TA 3FVVA 2UXCB 3IB3A 1MIOA 2IDZA 1HEUA 3SQLA 4J0DA 2FPIA 4RQTA 3ROEA 2PL5A 5DHQA 4IIVA 3OVMA 4YRIA 3VPAA 1N3YA 3NYIA 1O5OA 2NTYC 4H3VA 3A9UA 4R69A 3W2HA 1DKUA 2A1UA 4ND3A 1XMXA 1K92A 5HF6A 4HQRA 4XCXA 4YQFA 4WY5A 5E4JA 2G08A 4B45A 2IKSA 3AHIA 4X94A 3UHJA 1W0JD 3ESCA 4PSCA 1E58A 2XAUA 3G49A 1KI6A 1HUQA 3WB1A 2HMTA 4ZVTA 4ASUA 5KU1A 2OGSA 3N70A 3LUPA 4QUIA 2X5OA 3V2IA 3Q72A 4Q1BA 2JVKA 4HR7A 3LCUA 1JHYA 2WJHA 1G8KA 1U02A 1YTLA 2E5WA 1H2YA 1RRMA 2QPTA 2WDPA 3B5EA 3HVIA 3IVCA 3QWIA 3PG5A 4WESA 4XI9A 1U2GC 3HXOA 4LOHA 5LMNB 1QRAA 1SZCA 2CHUA 1BXKA 1T0IA 3DB1A 4N8EA 2Y0CA 5CPBA 4B32A 1W6UA 1UBKS 4DG9A 2OQIA 3IT3A 4Y6OA 3LW8A 1AE1A 1QV6A 3EXG1 1TK9A 1B3BA 4YAFA 3UMVA 2QMYA 1SQGA 5DCWA 5K4GA 3H1FA 4XDHA 4BZWA 2YOHA 3R0XA 4YGYA 3WIDA 1G21E 1QFYA 1VMEA 3AJ9A 4EDFA 2J9YB 2QW0X 4Q9JA 5IP5A 2H4WA 3GLIE 2J07A 3AHDA 3NZEA 3DL4A 5SYAA 3GAZA 3T5PA 5E3JA 3CVYA 2AOUB 1EYZA 1Z35A 1ZD1A 2C61A 2EGUA 4NI5A 4RKEA 3A58B 1EFAA 3IV7A 1QFMA 1ZK3A 5D5QA 5BV8A 2YC2C 3U5ZB 5EHZA 2AW3A 5GIOE 4JSRA 2X5NA 1GPKA 3N1UA 4G9BA 1A95A 1IB0A 1ZKDA 2QTAA 3V8QA 3LHFA 5DBIA 4DV2B 3T9EA 1EU1A 5JZ9A 3GFGA 1C3EA 3NAMA 4ZQHA 5ERYA 3KDSE 5JS8A 3I9V6 4JQOA 5L3QA 3MN1A 1Y8RA 1W0CA 4UNNA 4AJ9A 5JVDA 1XTKA 3CTMA 2WBLC 3HC7A 1F8UA 3FNRA 4R1QA 3PIDA 1K1EA 3AM3A 1QRDA 3GJ8A 1KBZA 2GD1O 2XA1A 3TUZC 4UTXA 1XSEA 1DMSA 3JQRA 1LNZA 1M8FA 2PYZA 2XUZA 4ILEA 1R4AA 4PGGA 3Q40A 4BFZA 2J0UB 3GFRA 4MQUA 1N0UA 1Q74A 2FWAA 2WT9A 1M8KA 1N75A 3OZDA 4IHJF 4QDZA 1DDOA 2GPSA 5CAEB 5L3RA 2ZUFA 2HHHB 3I9JA 2J45A 3JWGA 4HCJA 4N5DA 1ZCJA 1XEWX 4LZWA 5A7HA 4KHZA 3NWPA 2PWYA 5DGIA 1XCLA 3EPKA 4C0AC 3THSA 3NTQA 1T8PA 3V9AA 2PM8A 3SS8A 2WQ7A 4N7MA 4IJMA 2HHLA 1VSBA 2DRIA 3KTAB 1R15A 4N82A 4LVUA 3VU3A 3DR3A 1S8AA 3ZU2A 3P45A 4BGVA 1GUDA 2VHYA 1F2TB 3COVA 4ER0A 4Z49A 3FUXA 1KNXA 4WOBA 5ILOA 1AN9A 1SC3A 1PWHA 1RVV1 2GTIA 5ALYA 2IE8A 2GT1A 1I2MA 1T9HA 1DQPA 2IP2A 2QP3A 3B85A 3CYFA 3MTIA 3JRXA 1TUBA 4GDMA 3TLCA 5JD6A 1D4FA 1EFUA 2BHNA 1HNNA 1G5QA 3E61A 3GPDG 1NW6A 4ZHQA 3F5MA 4KB5A 5CCEA 1LVUA 5CJPA 3X0DA 4ND4A 1G63A 1V16A 3MOIA 3HADA 1G3UA 2VJPA 4RY9A 1L3CA 1RYYA 2XQJA 4ITUA 2Y1KA 3HABA 3RC3A 2WP0A 4I2NA 4EH1A 4F97A 1G64A 1S2MA 3F6EX 3QMMA 2C84A 1OAOC 4FSDA 2HA4A 1SZDA 5A5FA 2ZJ6A 1JE1A 3E15A 2WFLB 4YP6A 4JZYA 1UPXA 2D13A 3BT