4P38A

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with azd8329
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYNWDRFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Novel acidic 11 beta-hydroxysteroid dehydrogenase type 1 (11 beta-HSD1) inhibitor with reduced acyl glucuronide liability: the discovery of 4-[4-(2-adamantylcarbamoyl)-5-tert-butyl-pyrazol-1-yl]benzoic acid (AZD8329).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4p38A00
2DU8A 2JL1A 1JWBB 1XKQA 4FFOA 1IOLA 3L6DA 1UH5A 3R1IA 2VCYA 3E18A 1O94A 3CPSA 2FR0A 3H9GA 2X5OA 3DHEA 4O6VA 4PLCA 5TX7A 3U4IA 4TRMA 3T4EA 3EVTA 1DLJA 4J0FA 3ZWXA 1ZO8A 2HDHA 3ORFA 4ROSA 4WEQA 1V0JA 2HMTA 2GPTA 1KEWA 3OJLA 3DZBA 5A05A 4A73A 2BFAA 3T7CA 4CLOA 3WICA 2PZKA 2BI8A 4CM7A 2YV2A 1MFZA 2EJWA 4Q9NA 4GH5A 4ALNA 2I76A 1D7OA 1LX6A 4Y9DA 1GADO 2OOSA 3AOEC 3PZBA 4PLHA 3NTOA 3DR3A 4WKGA 3N58A 1EVIA 4P4NA 4FJ2A 5B4VA 1E6EA 5EPOA 3I6IA 3B1FA 4QX6A 4IJKA 4TVBA 3VAZA 4CV0A 4JQCA 4E6PA 1P0FA 3DDNA 4FFRA 4Q39A 1Q0LA 1C0LA 5B37A 3QWFA 4A10A 3WGYA 1ZW1A 3WQSB 1LDGA 4LMPA 3TZCA 1L7EA 2HAEA 4QEDA 1GFSA 1WDMA 1E0DA 4CMCA 3OA0A 4ALKA 3GGGA 2Q3EA 1KERA 4IQ8A 1Y8QA 3OJOA 3GG9A 1DJNA 3I23A 4R54A 2JJYA 4KDEA 3RJ9A 1UUFA 4R69A 3Q9NA 4BNJA 3DBLA 4CLXA 3ZNOA 4YCAA 1K89A 1LXCA 2QZZA 4YJHB 1KVSA 3WOHA 3MJEA 3FNGA 3Q0EA 4NH4A 4YAKA 1NYTA 1QRRA 3H5RA 1VPDA 4YRAA 1U7HA 2DPHA 2Y1FA 4B3IA 1PWXA 1QYDA 1F8GA 4I8XA 4X54A 1CF2O 1IHXA 1R4MA 1SBYA 5I8WA 1GL3A 3MTJA 1E77A 3PQFA 3H4VA 4J7CA 2A92A 2QIOA 2OZPA 2V6FA 2BI7A 2C5EA 3E5RA 1BTOA 4FC6A 4RV9A 1E3JA 4WUVA 3H8VA 3OJFA 1DFGA 1HDGO 2V6BA 1L1FA 4MIYA 5AXBA 2VZ8A 3JSAA 1D1SA 1P77A 1V35A 3AU9A 5TSDA 4DREA 5JW6A 3KXDA 3NJ8A 4IDEA 1UZNA 2CSUA 2UUPA 4OSPA 3WIDA 4BV8A 4TROA 3ZNPA 3W1VA 1UXHA 3BHMA 3QWBA 1I3LA 5KJCA 3GAFA 3JQGB 3KYBA 1UR5A 2H6EA 4XIJA 4YACA 3O4RA 3GNTA 4NBWA 4B4VA 2IZ1A 3NX4A 2GN8A 3GZNA 3T7EA 2GSDA 4MVJM 3PTZA 4RO0A 4F6CA 1P1FA 2ZTUA 1KC3A 2BGMA 3JQ9A 5JSFA 3V2GA 4BO8A 3E9MA 2BGLA 2VRCA 3Q3CA 1GR0A 3L77A 2BFPA 2BFOA 3DBHA 4RLSA 1I0ZA 3DBLB 4FFPA 2FMUA 1U2DA 3ETEA 2V6GA 4HNGA 2O4CA 4INAA 3ICCA 4ZICA 4L75A 2Y1CA 1E3SA 1B15A 1HRDA 3TRIA 4CMHA 3JQFC 1Y5MA 4Z9YA 3VZQA 1JWAB 1NVTA 1ZIDA 2HRZA 4TSKA 1HSZA 3LLSA 3LK7A 4P4GA 1ZK1A 2YYYA 4HFJA 4I5DA 3AU8A 3TZKA 5IZCC 3H65A 2FR8A 5DULA 1MLDA 1N1GA 3I9NA 3KOUA 3LT1A 4GWGA 1ONOA 4CLHA 5TGDA 1XQ6A 4J3FA 3DZFA 2GASA 3TN7A 3UCEA 4CODB 1SB8A 2IEBA 3OIFA 3SX2A 3A28A 3G0OA 4XZ3A 2DTEA 3BHJA 2OO5A 3TZHA 3DXFA 3PIIA 3DFUA 5L9AA 2PZMA 3NT5A 3S55A 4FFMA 1B3RA 1Y6JA 4U0JA 1HZJA 4A7PA 3VVCA 3EK2A 1RJWA 2UVDA 4G65A 4RJTA 3WNVA 4AJ2A 3WGGA 4TVOA 3JYNA 4CM8A 4FC7A 4NJMB 4XJTA 3KYDA 3H6KA 4BNLA 5F5NA 1M76A 5KTKA 4CUZA 1B3BA 4QT0A 1JKJA 1C14A 7MDHA 1KVUA 2JFGA 4FPXA 2HK7A 3ITKA 5H83A 2DPGA 4URFA 4HWKA 1I3NA 1NHGA 4BNXA 4XYMA 5LC1A 3MZ0A 2IXBA 5IDXA 2EHDA 4GX1A 4JROA 4B3JA 2C59A 3QVTA 1OZAA 4R51A 3BTSA 3U9LA 3LF2A 4TKLA 5HTOA 1BW9A 1MC5A 3L0DA 2WYUA 4WCFB 3ICPA 4YAJA 3UGKA 1P1JA 2J3HA 1BXGA 2XXJA 1F14A 3K92A 4I08A 4TKMA 4HADA 1ISHA 2Y66A 1IB6A 1YO6A 4DTIA 1WVGA 4IQGA 2ZTLA 1GYRA 2ZYGA 1V3UA 4RVHA 3JD1A 1R15A 4R1TA 3LT2A 3WGQA 3GK3A 1NX6A 1HDYA 4JBGA 3MWDB 3JYPA 5A5EA 2WD7B 3PHJA 1V3TA 3NDRA 3QQPA 5G0WA 3WMXA 3HQ4O 3TZ6A 4J7XA 4QO7A 5IDQA 8ADHA 3M2TA 3AM4A 1UP6A 2DFDA 3OIDA 4IBOA 5AXDA 2R6JA 1LLDA 3ETGA 1AE1A 1LC3A 1YWGO 2PH3A 3TJRA 1E1KA 4BGEA 4B4WA 1E6UA 1DO8A 3UF0A 1PSDA 3EMKA 3AOEA 1UAYA 4L4RA 2Y1GA 3AY7A 3E8XA 2EIHA 5TT1A 3WFJA 2PGDA 4JGBA 3WR5A 1X14A 4PIVA 2CVQA 1RYEA 2HMVA 3N7UA 4UVIA 4C7JA 2H5LA 4LK3A 2QG4A 1B0AA 2GR9A 3U09A 1S6YA 4OSOA 3PDJA 2DC1A 5T6BA 3OF2A 4GQAA 2EJVA 4RVUA 4AJEA 3QVOA 2P9EA 1PR3A 3ANMA 3GDOA 4CM8B 2RBEA 4BNZA 5GZ6A 3B1JA 4UREA 1ULSA 1NVMB 3DZHA 1ZCJA 2FP4A 3ZU2A 2B69A 4II2A 1RM0A 4PLGA 3DOJA 4JX8A 1B16A 4FJ0A 3GMDA 3D5QA 1A4UA 5T8KC 3VPHA 1LSJA 2FY8A 2EGGA 5L7TA 2AMFA 4YJFA 1DC6A 1ZMOA 2Y68A 1E92A 4DIBA 2Q4BA 5CEJA 3JQ7B 3ON5A 3IUPA 4XX0A 1DB3A 3G79A 3AJRA 2JAPA 3CTMA 5FWNA 3PJEA 2VHXA 1ZZEA 1JTVA 3GDFA 1WZIA 2GF2A 2BLLA 1JKIA 4OXYA 5J23A 1MA0A 3AUTA 2FPIA 1SC6A 5BNFA 3TOZA 3QP9A 5BNTA 3KSZO 1T4BA 3K73O 1GEEA 1U5AA 3AFNA 4XQEA 1P0CA 3PQDA 4JN6B 1NWHA 2CVOA 3IS3A 2R00C 3H5NA 5A4DA 1I2CA 2I6TA 1ENZA 3GG2A 3JQ8A 4BMSA 2IYPA 3WDSA 5GZ1A 1XELA 3KZVA 1N9GB 3RSHA 3SJ7A 1EBUA 1TLTA 1VL8A 4IGEA 2P9GA 3VZRA 1N5DA 1NASA 5DF1A 3L07A 4NK4A 4DBZA 2J3IA 3MCVA 4YDRA 2O50A 4QQRA 2HMWA 4ZHSA 1GPDG 1B14A 5JAIA 4DPMA 5CEEA 3C3XA 1HXHA 4NFHA 1ZJYA 3CH6A 4YWJA 4GX5A 5JFOA 5JYEA 4W6ZA 2XPCA 2BKAA 2YHIA 4CM1A 4J0EA 1GD1O 3P19A 3I4CA 3VC7A 3BIOA 1YS4A 4MIOA 2P4HX 2DBQA 2UYYA 3AUAA 5A04A 4XKJA 3EAGA 4WEOA 4Z3KA 4D42A 5JDCA 1U3VA 4WLFA 1DRVA 1SCUA 2IODA 5F5LA 3CEAA 4MVJD 2JD1A 1A27A 1HDRA 1TVEA 4AFNA 1X7HA 4MJLA 1XU7A 3MJCA 3JQFA 4FOOA 2NACA 4YJFB 2O3RA 3F6YA 4YR9A 3OJEA 3WSWA 1YBVA 3SBOA 1LLUA 1WAMA 3P5SA 3D7LA 1PS0A 4YTEA 2PD4A 3V1TC 1P44A 3OECA 4UUOA 1P74A 2GN9A 2AHRA 3TSCA 2VUTA 1H6AA 1WNTA 3C7CB 4Z0HO 1R37A 1T25A 4ALJA 3OA2A 1DXYA 1GYQA 4RF2A 2W98A 1BXZA 1G6KA 5DBGA 3VPGA 4JP2A 4YRBA 1J4AA 3OP4A 3A9WA 2NVUB 4M54A 4ALMA 4E5PA 3ZN2A 4IDFA 5ITVA 2FSVA 2QHXA 2AE1A 2W4QA 2QX7A 5EJ2A 5JO9A 5DN9A 1ZUD1 2Q46A 3RUIA 2X0NA 3IL2A 2CMDA 4W7IA 4YXFA 1BSVA 4MKZA 2E82A 5KNLA 1YE3A 3G1TA 4W82A 2H1SA 2YJZA 4DBVO 3NDJA 3PXXA 2EGHA 3SEFA 3FR8A 5CDUA 2E4AA 3DB2A 5A5FA 2F00A 2WJPA 1O9BA 4CMEC 5KVSA 5JY1A 1PJ4A 1YL7A 2VZ9A 2O3UA 4BO7A 5DOVA 4Q3CA 3E03A 4BO0A 3WJAA 5JAZA 1Y81A 3QVWA 2JCYA 4NG5A 4J1TA 3DOOA 5KVQA 2YV1A 1GV0A 2Y67A 3CINA 3AM5A 2Q1TA 3SLKA 4WLEA 5EESA 1DFHA 1YH3A 3NGXA 1Y5RA 1JA9A 3BMOA 5TLSA 1LDEA 3KYCA 3W4KA 4KZPA 4NJOA 4BO3A 3WQQA 1MG0A 4OMUA 4BVAA 4BNHA 1LJ8A 4NMHA 2O2YA 1ZEJA 3C24A 2DVMA 4OQZA 3UCXA 1LRKA 4XR9A 1XQ1A 4RPJA 3ROPA 2TMDA 3TL2A 2IZZA 3TZQA 1BVUA 2WE8A 3DC2A 1MX3A 3GNQA 1ZNQO 5G4KA 1R16A 1O95A 3ZHBA 4B7UA 1DRWA 3EYWA 1PR9A 2FWMX 1WMAA 2RH8A 4IDAA 2DBZA 4BO4A 1EUCA 1JU9A 2W8ZA 2Q1WA 2E6UX 3HG7A 2OBYA 3RBVA 1KEUA 1QV7A 2DT5A 1H2HA 4MINA 4DXHA 3S2EA 3WNQA 5TJHA 3ZV5A 3H7AA 4IMRA 1K2WA 1LC0A 3R3JA 5TT0A 2PNFA 4J1SA 1E7SA 1XGKA 4TWRA 3HN2A 4XWYA 1VJ1A 4BO6A 3G49A 4GLLA 1FDVA 4PLYA 1SNYA 3HFGA 4ONEA 1CWUA 4AJJA 5K6AC 2ZB4A 1ADBA 4YVFA 2CZCA 3DZGA 2O2SA 4BNTA 1UZMA 5I8ZA 3X2EA 4DYVA 1DIAA 3DZKA 4ND5A 3S2IA 3WTBA 4E0BA 5C7LO 1PL6A 3GFGA 3C1OA 1H0KA 5EN4A 4D45A 2C29D 2VRCD 4E2YA 4XGNA 2Q4EA 1IPEA 1ML3A 3S2GA 4RVDA 3DQPA 3VH3A 4H16A 4A0SA 2WMDA 4E33A 3U4HA 2X9GA 3DTTA 4RPGA 3QV1A 2Y93A 4R4JA 5C5IA 1Q1NA 2R00A 2VYNA 4BNNA 4AL4A 5HRUA 3PHHA 4L9RA 4ZQEA 1BMDA 2I67A 1R4NA 1KYQA 3QHAA 3D1LA 3S1LA 3ZNNA 3RC1A 3QLJA 1NXQA 5C3MA 2Z5LA 5G4KB 5H82A 4IQ0A 3MWEB 1IL0A 4I9UA 1AGNA 3DAPA 3DMTC 2VWGA 3WS7A 4E12A 3I1JA 2JHFA 4TRNA 3IP1A 3ZWWA 3QA9A 1U3UA 3ENNA 4A27A 1I32A 4D43A 1Z7BA 2ZB7A 4KQWA 1BWSA 2ZB3A 4XQGA 2WDZA 3U0BA 4MP8A 4OO3A 4YAGA 3A14A 3F4LA 1NR1A 2AE2A 3TNLA 4KMSA 3IJRA 3JTMA 2X23A 4D3SA 1NPTO 5G4LA 5BSEA 5HWSA 4XDZA 5COAA 4IDBA 3EZLA 2Q50A 3ULKA 2XOXA 1SOVA 4BKPA 3WQRA 2CUKA 1U8FO 3JD3A 4PG7A 4W99A 1ARZA 4HX5A 3U4CA 3X2FA 3PWKA 3RAJA 4JJGA 2NSDA 2QYSA 2Y1OA 3GF4A 1TI7A 5ENVA 2BFMA 5JC8A 3OIGA 1OBFO 1GV1A 3DAFA 4ZRNA 1FMCA 4R1SA 2A35A 4PZEA 4N5NA 3GMSA 3MJSA 4LSMA 3ROMA 2CF5A 9LDBA 1C0KA 4MP3A 5JDIC 3TFOA 4KP7A 3WGOA 1UXIA 4QXMA 4AJLA 3AFMA 1B26A 2GYYA 3GC6A 1ZJZA 5GY7A 4D44A 5L45A 4RGBA 3RASA 4DC0A 3DL2A 3F3SA 1GCUA 1R6DA 2B5WA 3JCZA 3PLRA 1ZK0A 4AJ1A 1C3VA 1D3AA 3AY3A 3LVFO 5F1KA 3JYOA 2WYWA 1GZ6A 2NWQA 2PGLA 2ZJ0A 2FRDA 1HEUA 4RVSA 1TA4A 4CLEA 5CFZA 4D0SA 1HDZA 1LLCA 1Y9AA 2J5RA 4QFCA 4EGFA 1IE3A 4IDCA 5DCYA 4CLDA 3DO5A 3RC2A 1TB4A 3QIVA 1D4FA 4CMEA 3IIEA 4R1NA 3TQHA 3GVXA 2FSSA 3W6ZA 4E31A 3D4PA 1I3MA 2Z1MA 3F9IA 4HXYA 4OQYA 4BNUA 1LDYA 2Q2VA 1C1DB 2Q2QA 4OXNA 4S3MA 5ICSA 3RBZA 3K8ZA 2VHYA 1EK6A 1GDHA 1PJQA 3HWRA 4WOKA 1F0YA 4OM8A 5BT9A 1JLLA 3KVOA 1HETA 3U3XA 1W6UA 5DOZA 5U4QA 1X13A 4L0QA 2DUUA 4CLRB 2V7PA 2I5PO 1DIHA 1I33A 3VHRA 1U2GA 2C7GA 2RCYA 5A9TA 1HTBA 3PJGA 5JO0A 1DOHA 3I4FA 3VTFA 2NLOA 5C7OO 5L7WA 4XCVA 5JAQA 6LDHA 3QSGA 3LF1A 4HV4A 3DFZA 3JYLA 4GL4A 3HE3A 4QO8A 3O8QA 5LDHA 3QY9A 1LEHA 3LC1O 1K6JA 1YDEA 4I5FA 3WBFA 3OMLA 3EUWA 3GH3A 3GT0A 3H9JA 1HE4A 3GN1A 4R9SA 4HUJA 3ZWCA 4MPDA 4EUHA 4GVXA 1J6UA 1GUYA 1X0VA 1ADGA 4HNHA 5JE8A 4CLOB 3ZWYA 2P5UA 1Q0QA 2Y1DA 1H9BA 4IIUA 4KWHA 4NQZA 5I7SA 1KY5A 4MVJG 1LBEA 1PU2A 1Z73A 1PQWA 2SCUA 2HMSA 2WTBA 4L4XA 4N5LA 1E7YA 2CDCA 5K6AA 4PVDA 3GEGA 2VUUA 3WTCA 1AHHA 4IDDA 3CZRA 1P1KA 1KETA 5G0TA 3OQBA 5F1PA 1GZ3A 4F45A 1X0XA 2G17A 4HP8A 4H7PA 1GQQA 1ISJA 3FTNA 2O3JA 4MVJF 3ZW8A 1GU7A 1K3TA 4ZQFA 3V1UA 2OXIA 2B4TO 1WDKA 5A3VA 4H15A 1DAOA 4Y8VA 1C1XA 1Y8QB 3UW3A 4BO5A 3E1KA 1YQDA 1YVEI 4O63O 4CUKA 3NT2A 2X22A 1QORA 4DIFA 1PJSA 2ZTVA 1EZ4A 2RAFA 4RDIA 2G82A 5EINA 4PG6A 5ILGA 2Z95A 5ITWA 3K2EA 3HDQA 3KM0A 1A4IA 1FXSA 3JQEA 1I2ZA 5G0VA 3LT4A 4TMFA 3B1KA 4GWKA 1C0IA 4J9UE 4KUEA 3AI1A 3K2BA 4UVGA 5AYVA 3ADPA 2A9FA 2RHRA 4GGOA 4ND1A 4A03A 4CM3A 2QW8A 3JQAA 4NZ9A 3ZHZA 2ZCUA 3A1NA 3BTUA 3RKUA 3LSYA 3VPFA 2YDXA 4CV3A 1UAGA 1XG5A 1R4MB 2CFCA 4IS2A 3O8QB 1LLQA 2R2GA 4R01A 1ZBQA 1LDMA 5DDIP 1A9YA 3DMTA 3TOXA 4Y6RA 1KBZA 3QW2A 1AXEA 5FF9A 1P1RA 4CMGA 4E5YA 3L9XA 2C2YA 2PLAA 5L4NA 4Z3DA 1HDOA 5I9LA 1PJBA 4NBTA 1ID1A 2JD2A 4WGGA 3NJ4A 1HLDA 4G5HA 2O7QA 2DTXA 4DQVA 5IAAA 2FHSA 2QYTA 3K9QO 3GZ4A 1KVTA 5B4UA 3KLPX 2IXAA 4NBRA 5CG2A 5KCZA 2ZYDA 4P8RA 1LSUA 3PQEA 3K6JA 4DQXA 3L6EA 3KV3O 5HBRA 2OUIA 3HZZA 4E30A 4Q3EA 2LDXA 3GZNB 4WNIA 4OOEA 4YA6A 4BNIA 2HO5A 1YB1A 3FTPA 4IM7A 4CV2A 1ADFA 1OFGA 4UAGA 4IJWA 4OJNA 4XGKA 1R12A 1V6AA 4J49A 4KDFA 4QSMA 3D4OA 2BD0A 4JNKA 1QKIA 4YQYA 4OAQA 1FDWA 1HL3A 1QMGA 1NP3A 3PGXA 3U62A 4CL8A 4D3DA 2ET6A 1ZSVA 3DBHB 4P4LA 1DIBA 2P5YA 4RL6A 4CUJA 1RM3A 3JQ6A 2G0TA 2VWQA 2DAPA 4AVYA 3NGLA 3MOIA 3KHUA 3RFTA 4BNVA 2ILTA 1WMBA 1H94A 1HDXA 4BGVA 1H2BA 2VZ0A 1ISFA 2TMGA 3JD0A 4WJZA 3JQAB 3RROA 1F06A 3MJTA 1WWKA 4YJDA 4FW8A 4B7CA 1WDLA 3INGA 4GAEA 9LDTA 8LDHA 3ONEA 4UVEA 5DZSA 5IDWA 3MEQA 5TS3A 3UVEA 4ND2A 1U3TA 4J9VA 4JLWA 4DLLA 1N92A 2G1UA 1Z6ZA 3ZWOA 4B8ZA 1ZSNA 4XR4A 4L73A 4RF4A 2P2SA 3TWOA 4CQMA 4DIOA 4B4UA 2PD3A 4AJHA 4E3ZA 3B6ZA 3UFXA 5L53A 5F21A 5L7YA 5IXYA 3TPCA 3KYDB 3OEWA 1QV6A 4J4HA 4CMKA 2PKQO 4BS9A 3PI7A 1XWFA 2JCVA 1VI2A 3LC2O 1N2SA 4U8GA 4P38A 1I24A 1QYWA 3JD4A 5TJ9A 4MVJP 2HJRA 3AOGA 4BNYA 3ENKA 4UVHA 1H6DA 4S1VA 4MVJH 1ZFNA 2BF7A 4NHEA 1XCBA 3HNPA 3ZWNA 1BDBA 3GHHA 1WP4A 2HQ1A 1OI7A 3TFQA 5JCJA 4BO2A 1PGNA 2HLPA 1BW9B 3CE6A 4E4YA 4DYDA 4KUHA 3F4BA 4PRKA 5IXSA 3ZV4A 4WCDA 1BXGB 1B7GO 4YT8A 4RCVA 1U7TA 3L6OO 5F1OA 2JKVA 3PK0A 3WYCA 4K6CA 4WK6A 1YL6A 3ZWAA 1QYXA 2HSDA 5AQ1A 3OSUA 2OP1A 4BQPA 1UP7A 3D5TA 5JYDA 1PIWA 5KOIA 3IKTA 4K9DA 3BMQA 3ONFA 4PG5A 5COQA 5EERA 2GO1A 3LT0A 1DSSG 3NKLA 4J90A 1FDTA 1I3KA 1Q2XA 1I8TA 3GR6A 5I9NA 3ZZNA 5EL0A 4PZCA 2HU2A 2W2KA 1ZEMA 2ZK7A 3UCFA 1NHWA 4IY1A 4RPHA 4WPGA 2D2IA 4Z0TA 1IPFA 2EXXA 1E5LA 5JLAA 2NU8A 4LISA 3I83A 1MG5A 2BH9A 3HFSA 1I10A 1WXDA 3EY4A 3PP8A 2D5CA 4IGFA 4Q3DA 4XRRA 4YEDA 5CEFA 1WPQA 1CYDA 5A9RA 3PDUA 5K9ZA 5A03A 1YGYA 1O8CA 2CDBA 2WEKA 5JS6A 1SAYA 3RWBA 3VKUA 1XA0A 4FBGA 4B7XA 4M55A 1E1NA 3IAHA 4BB5A 4JK3A 4BNFA 4FFNA 4FN4A 1DPGA 1M66A 2BRUA 2O4UX 2PV7A 1G0NA 4G2NA 4B8WA 2EEZA 2C54A 2OP0A 3D3WA 4ITUA 4NFYA 3OICA 3INTA 5EQFA 4GPD1 4PLFA 5T64A 5G2OA 4DLBA 4E32A 4MIEA 1PWZA 1VE9A 4O59O 2FZEA 1Y1PA 3U4DA 1FJHA 4HFMA 4GMGA 2C2XA 2EP5A 1EEHA 1DIRA 1M6HA 1O6ZA 3AY6A 3QJ5A 1X15A 3OHSX 2C20A 1BDMA 3VTZA 3GGOA 2YFQA 5IZCA 3ZNQA 1V8BA 2UUOA 5BSHA 3CZMA 4TQGA 1F8FA 2JCXA 3QVSA 3NUGA 2YV3A 3H2ZA 4EEZA 4TZTA 1WZEA 4FD3A 4Z6KA 5L40A 3QRWA 3PIDA 1IZ0A 4PLTA 1T26A 3RJ5A 2A4KA 3V1YA 2VWHA 2GERA 4NNJA 2LDBA 3ETDA 3OQ6A 3PEFA 4O1MA 1MXFA 3HDHA 4DMMA 4DVJA 4YBZA 5LCXA 2CDAA 4E2XA 1BG6A 3SXPA 1TXGA 1GUFA 3OEYA 1Z74A 3I9JA 3OJ0A 2EWMA 5EIOA 3HDJA 3SC4A 4ZRMA 4AJPA 1KEVA 1PL7A 3C1AA 4BGUA 2J5QA 1Z82A 1JKFA 3ZWPA 4BNKA 3ZV6A 1NR7A 2OFPA 4L8VA 3IP3A 1NVGA 3JQ8B 5KIAA 4ESOA 2VQ3A 1Q7BA 1Z75A 1I36A 3ZHXA 4DC1A 4MKXA 3ZV3A 2QRLA 3CXRA 3WYEA 3ZH2A 3RC9A 4GSKA 1S7CA 3RUHA 1LSOA 2VNAA 2GCGA 1B8VA 1NFRA 4XQ9A 4EDFA 4IMPA 3AK4A 5AXCA 3RUCA 4FR5A 2GUGA 3KEQA 4Q3BA 4FQ8A 1CQJA 2YHIB 1PGQA 1E3WA 4CMIA 5CAEA 2WSBA 2CNBA 1NFFA 1XR3A 4W7HA 5C37A 4PFJA 1QSGA 3STHA 3ZU5A 4YB8A 3O03A 1PTJA 2W2LA 1N7HA 4YAIA 2G76A 4IDGA 5DCUA 1QR6A 5COBA 1C0PA 4HBGA 3Q2KA 1DAPA 3E5MA 3O26A 4YAEA 2YZ7A 4OXKA 3RFVA 1SMKA 5IJZA 5KWEA 1DJQA 3AW9A 3RUFA 5IG2A 1PZGA 2EKPA 3FPLA 4WLOA 2I99A 3Q6IA 1D1TA 1GCOA 4FS3A 1GEGA 4QFDA 1HE5A 1OOEA 4XRGA 4JIGA 2C82A 4LRSB 4OHUA 4DQUA 1JW9B 5KVCA 2O3TA 2B4QA 1T1RA 2PGJA 4KTVE 1P1IA 5JY6A 3M1LA 1ZH8A 4ND4A 3OH8A 1F17A 4Q3AA 3GLQA 3BYZA 3DEYX 1EQUA 1VSVA 1DC4A 2PY6A 4IS3A 1CIVA 3VKVA 3E6AA 3BA1A 1YKFA 2P9CA 5TF4A 3I3OA 3GRKA 2GGSA 3KETA 3WJ7A 2Y0EA 3UUWA 3WFIA 1X1TA 4XJSA 4XGIA 2NTNA 4CMAA 1K0UA 3PWSA 3P7MA 5L4LA 3JQBC 5ER6A 1ULUA 4E5NA 2C5AA 3LC7O 1YB5A 2O48X 4YT4A 5GZ3A 4R68A 3F5SA 5I9MA 3KEOA 2G5CA 1RWBA 1N7GA 4J4TA 1B2LA 3WBBA 2BMAA 4AJ4A 3ADOA 5T8KA 1EUDA 4U6QA 3EC7A 3C8MA 1M75A 4XB2A 4BIIA 3ROKA 1H5QA 5A02A 5MGBA 5U9CA 1E7QA 1IYZA 2NVBA 1YOVA 3F1KA 2X58A 4LCJA 4XIYA 4OKNA 4EYEA 1BXKA 4AJIA 3B20A 4UUMA 3RUDA 3EGOA 4C7KA 2YQ4A 2ZQYA 4CR7A 4XYLA 4MVJI 2CY0A 1YONA 1ZVMA 3WGZA 4LGVA 1LDBA 3BMOB 2GD1O 3KYCB 5JNLA 5CDTA 1ZK3A 2B4RO 2X0JA 1YBMA 2EW8A 4WCFC 4W9NC 1SEVA 3M1AA 4OIMA 1GAEO 1HT0A 2I66A 3FBGA 1W4ZA 3JQAD 4GMFA 2VWPA 2H63A 1AUPA 2EKQA 2NVWA 2FPPA 4UUPA 1HYGA 3RI3A 1HE3A 3SJUA 4XYEA 2DFVA 3DBRA 5CDSA 1SPXA 4UULA 4JJIA 2C0CA 1RM5A 2AEJA 3EDMA 2RHCA 3OM9A 4LCEA 2EP7A 1QLJA 3ITDA 5FFFA 5GMOA 1W0CA 2E48A 1LQTA 3C7AA 3KSUA 1QYCA 1LA2A 2DUWA 2YFHA 3GAZA 4DA9A 3O9ZA 2I9PA 5F3RA 3GHYA 1A71A 1KS9A 4LMRA 3WG9A 5A9SA 2PZJA 2BHLA 2NADA 2VOEA 1A7AA 5DT9A 1JDJA 1XU9A 1K6IA 3H9UA 1PS8A 4XDYA 5JXWA 3ZU4A 1Y8RA 1NAIA 1FDSA 3LU1A 1PEDA 2AEFA 2WM3A 1UDCA 1A9ZA 1VM6A 4FIZA 5BNIA 2YHUA 3L9WA 2ZIZA 4M49A 4BL5A 3GVCA 2D5AA 2YDYA 1YOVB 4J1NA 4BUCA 1GUZA 3DMYA 4K26A 1NQTA 4L76A 4EEXA 4Y98A 1KC1A 2P4QA 1HF3A 2OBNA 2GN6A 2ZYAA 4RDHA 2UV8A 3DOCA 4KWIA 2VYVA 5L95A 3MTGA 1PQPA 3RIHA 4R3NA 1DC5A 2X9NA 3QWHA 1K5HA 4Y6PA 3CMCO 1FF9A 3CMMA 4CR8A 4E2WA 3AM3A 3HHPA 1GZ4A 4IZHA 4ZGWA 4BV9A 2ZATA 4PG4A 1SOWA 1PJLA 5TQVA 2IE0A 4H3VA 1KVRA 1A5ZA 1UDAA 4NFSA 1KEPA 2VRBA 1WLYA 5A3JA 5MDHA 2B35A 2P68A 4GLOA 1LU9A 4B3HA 1YJ8A 1T2FA 1N1EA 3QWIA 3HB4X 4RORA 1R4NB 3R6DA 4EJ6A 4AG3A 3W8EA 3K31A 5K0ZA 1UXGA 3DBRB 5I7FA 5ENDA 1G0OA 4Z9XA 1DC3A 1TEHA 4WE3A 3ZWBA 2Q99A 4RPLA 5G0SA 2FPGA 4HFRA 1YBAA 1E3EA 1TT7A 4L4SA 1NPDA 3RU7A 3OFSA 4LSWA 1M2WA 3GEMA 4FOSA 4C4OA 3E9NA 3PGJA 2P91A 4U0KA 1CETA 3GN2A 4CQMD 1E1LA 1MXHA 1O0SA 1T1SA 2X6TA 4IIVA 4ND3A 5A9SB 1LI4A 4XEHA 5U1PA 4L74A 3AWDA 3UXYA 3GQVA 4JXKA 1P31A 2NTVA 4GX2A 2EW2A 3JQGA 3IQDB 3ZI0A 1E1MA 3BMNA 4PLZA 1Y8RB 3HN7A 2C7VA 3F5QA 3BMCA 3RVDA 4J4BA 3FRJA 1LTHR 1H9AA 1AHIA 1X1EA 2PR2A 2VNSA 2B0JA 3GY0A 3LYLA 4DL9A 3WGIA 1UXKA 1EVJA 1YQGA 3BAZA 3IC5A 5DBIA 5JCJD 3G1UA 1BHSA 4GGPA 5IF3A 1ENYA 4D7AA 4QUKA 1UJMA 3GPIA 4FSHA 3DZIA 2PFGA 4ZQHA 1RPNA 3FNEA 2O3SA 4J16A 3S8MA 2GNAA 2Y0DA 3UICA 2GLXA 2VHVA 1V9LA 1ZSYA 2DKNA 3ASVA 5LDGA 2AQKA 6ADHA 3COSA 3NTQA 4GKVA 1CJCA 2PTGA 3GDGA 2GDZA 1IULA 4K28A 3DONA 3DAGA 1YDWA 2HUNA 2D3TA 3LDHA 1J0XO 2J8ZA 2JFFA 3VPXA 2B36A 4ZU3A 1HE2A 3MJ4A 1MV8A 2NU7A 4NK5A 1QYVA 2X7HA 5FI3A 2Q1SA 3JQBA 2VTDA 5KJEA 1VLLA 4XD2A 1DHTA 2DBVO 5DP1A 2AG5A 2D0IA 2O7SA 3SLGA 1K6XA 1G1AA 3KB6A 3O38A 1T24A 1GPJA 4UEKA 2DM6A 3EVNA 3A4VA 2EERA 3KBOA 5C7IO 1KOLA 4EUEA 2WWRA 3H9EO 2V65A 4LN1A 4BKRA 1KVQA 2I3GA 2YY7A 2ZTMA 2JAHA 1BRMA 4NJMA 2Y05A 5JAMA 1RKXA 3FD8A 2JFHA 4DGSA 1DFIA 3BXXA 2IYOA 1R66A 2NUAA 2ZKLA 3ZGYA 2FR1A 3BMNB 3HADA 2FOIA 1W8DA 4AICA 4PGFA 4BKQA 3C85A 3WWZA 3BMCB 4PN3A 5L51A 2DTDA 3W4IA 3PLNA 2O23A 4M86A 4EZBA 1XSEA 2IDZA 3UH1A 4MP6A 2E37A 2OORA 4A2CA 4D79A 4RVGA 4NU6A 4NBUA 3WXBA 1MGOA 4TRRA 4WCFA 4R5MA 4FFLA 3IDSA 4W9NA 3WGTA 1EE9A 4J6FA 1SO8A 4TRJA 3VZPA 1FDUA 2Z1NA 1IHYA 3WB9A 5I7EA 3PRJA 4K1LA 2B37A 5CDGA 3ZU3A 5CP8A 3V2HA 2DBRA 1XEAA 1P1HA 4WLUA 5JDCC 3WMWA 2XF8A 1EMDA 2QRJA 3OETA 4OKIA 1GYPA 2X0IA 1GQYA 2WD7A 2EV9A 3AI2A 1NBOA 3GVHA 4B4OA 1CRWG 1LQUA 1XYGA 1LDNA 3IJPA 5IZ4A 5HM8A 2HKIA 2O3QA 3KSDO 3ZWMA 5JCXA 3VH1A 3DTYA 2PK3A 4JBHA 4CQLA 3HB5X 3P2YA 1B8UA 4YPOA 2PWZA 3FI9A 3W8FA 4ALLA 3KO8A 3W6UA 4CM4A 1SZJG 4NIMA 4IXWA 3RFXA 2FN7A 2BGKA 2NNLD 3NYWA 3EZYA 4CM9A 1VJ0A 1P33A 1XLTA 3I9MA 4W4TA 3RD5A 4BKUA 4JCOA 1B8PA 5EMHA 5FEUA 3WLFA 3FN4A 4IUYA 2D1YA 4J2HA 4OYRA 2ZQZA 4ILKA 3GGPA 3Q9UA 4RQUA 3GUCA 3DZJA 1ZK2A 4WECA 1MUUA 1NM5A 1JVSA 5KKAA 2GRAA 3I9LA 4M8SA 4XB1A 1C1XB 4OL9A 2WYVA 3HUDA 4R1UA 3I6QA 4M1QA 2RH4A 2PKQP 4OGWA 5ER9A 3BTOA 2W2LD 4OOFA 3MJVA 3FWNA 1ZXLA 1RM4A 4WASA 3EHEA 1LNQA 4KOAA 5BSFA 5JDIA 1VJTA 3NAQA 1Q0HA 1M6WA 4ZA2A 1HYEA 4UVDA 4EI2A 1PZHA 4ZJUA 4I9NA 4BKOA 4PG8A 4PLWA 4HKTA 1YL5A 1VSUA 5TNXA 3JQ7A 4WNCA 3HJAA 1U5CA 2E49A 1UP4A 4FGSA 4LRTB 2IEDA 1CQIA 3EW7A 4I9HA 4YRDA 2DLDA 3CIFA 2NM0A 4JBIA 3D4NA 1YB4A 4XYBA 1R0KA 1E5QA 4EITA 3NRCA 2J3KA 4CPDA 3INRA 3FR7A 4FB5A 3GFBA 2JHGA 3PJFA 4RQTA 1R0SA 2Q2WA 3IMFA 1U3WA 4A5OA 4F3YA 1PGJA 4K6FA 3R3SA 4JJFA 1OAAA 1PGPA 1EDOA 3FF4A 1OMOA 3RU9A 1ENOA 4CQLB 3Q1LA 3N74A 5CDYA 1N9GA 4IXTA 4BHTA 3OBBA 3PFFA 3VVBA 3H2SA 2D4AA 1CEQA 1XDWA 2PD6A 4ZVVA 4CM4B 3DWFA 4HY3A 5FYDA 3PWZA 3QE3A 4BNMA 1J5PA 4NI5A 2OL4A 4E13A 2B5VA 2RIRA 1CERA 2NTJA 2JD0A 5T5QA 4F46A 3TL3A 1T2DA 3U5TA 1IUKA 2NU6A 1CDOA 2VHZA 2X0RA 4BNGA 4EJ0A 5DCWA 4AJOA 4E21A 5IN4A 3FNFA 5A06A 4ZD6A 1PQUA 3ABIA 4DWVA 4CJXA 1ADCA 1HKUA 3PJDA 3H9QA 3W8DA 2POQX 3JQDA 5B12A 1LRJA 1DRUA 4WLVA 1E7RA 5L3ZA 5BR7A 3GNSA 3JV7A 3VH4A 2C07A 3WYBA 2J6IA 4UEOA 1P3DA 4N7RA 1U8XX 3VDRA 4E5KA 4Z0PA 3PYLA 1T2AA 4O5OA 3L4BC 4BO9A 4U6SA 3D3EA 5AVOA 4CMJA 3M2PA 3PYMA 4B79A 4BO1A 1LRLA 2AXQA 2VYND 1DEHA 2VHWA 2IRWA 1I5RA 3LQFA 2HCTA 3LZ6A 4EJMA 1VKNA 1KIFA 1QLHA 5IN5A 1QP8A 3FNHA 1P45A 4O0LA 3PZRA 4N18A 1I01A 2HJSA 3ZW9A 5CHEA 1UZLA 1YXMA 4QTZA 1E3IA 4CM6A 1XHLA 1NWCA 1HLPA 5AXAA 2X5JO 3F47A 4F6LA 1UXJA 4Q3NA 3IUSA 1JN0A 2X5KO 4N5MA 2AEMA 2NVUA 4N54A 5AOVA 3NEPX 3WSVA 1LSSA 4BMVA 3TF5A 2Q1UA 4DRYA 3I52A 3KLMX 5TC4A 3UN1A 3DHNA 4CMBA 4BGIA 4CQMB 1PZFA 2HK8A 1NQAO 5ILOA 5B1YA 5I7VA 3E9QA 1T2EA 7ADHA 5KVVA 2X86A 3VDQA 2Y99A 4BNWA 1AN9A 1PL8A 1ZMTA 3ZCXA 3WWYA 5BSGA 4PLVA 1H6CA 3OQ1A 3KRTA 4U5QA 4BOYA 1NNUA 2W90A 5BQFA 1EK5A 4LVCA 1R0LA 1MB4A 2AQIA 4MOWA 4GVLA 3GPDG 2WE7A 3R0IA 3K30A 1DLIA 2VYVD 3GEDA 2OMEA 3FPCA 1WW8A 4NU5A 4CR6A 4I1IA 5CPFA 5L4SA 1A72A 1HDCA 1DDOA 5DP2A 1DIGA 5H81A 1DHRA 3RBXA 4DMLA 3AI3A 5CPBA 4IINA 1FK8A 3RCBA 2X4GA 2GZ3A 1NQ5A 3I9KA 3VOSA 1T2CA 4QECA 1GTMA 1PZEA 1GY8A 1PJCA 5IDYA 4NR0A 3BMQB 1EFKA 4RZIA 2AW5A 4R3WA 3NT4A 5THKA 5HA5A 1YJQA 4WOJA 1U4OA 3G3EA 5JMWA 1HWYA 4ZQBA 3V8BA 2W2KB 3WLEA 4LW8A 1A7KA 2X1HA 1ISGA 3NV9A 1P9LA 1QG6A 4J7UA 1IY8A 1YQXA 2CVZA 4D0RA 4DPLA 1MP0A 4YT5A 1PJTA 3ANLA 2PH5A 3QVXA 4G81A 2UDPA 5JMPA 1V3VA 1E6WA 1HSOA 4GSLA 2VOJA 5ICMA 1W73A 5KKCA 4XYGA 4IJVA 4NDNE 3PFWO 1NPYA 2IZ0A 4M87A 1ONPA 5ES3A 3PVZA 4EW6A 4EUFA 1M67A 2X8LA 5DBFA 4YT2A 2HMUA 4MVJE 1E3LA 3VZSA 5KJFA 1PJ2A 3F1LA 3U49A 4E5MA 4EBFA 2YQ5A 3SVTA 1TT5A 4J1QA 3D3WB 2UAGA 3UHAA 4LVUA 3CUKA 4GI2A 3FBTA 3PHIA 3I9OA 3PHLA 1UDBA 2PA3A 1ONNA 5ADHA 2QZ9A 2VUSA 1J49A 1VL0A 2XXBA 2YUTA 2HRBA 2Y0CA 1O5IA 1ISMA 1VC2A 4R41A 3PHGA 1MC4A 5JC1A 1VKOA 2AG8A 1EVZA 1YRLA 4RF3A 4CL3A 2WD8A 1Q7GA 1Q7CA 3Q2IA 4UUNA 1O89A 2HK9A 1NFQA 3BHIA 4P22A 5CG1A 3WGHA 3H5AA 2Q45A 3IKVA 1ZK4A 4I5EA 4II3A 3UKOA 5KJ6A 5DNAA 3L4SO 4GKBA 2J3JA 4J43A 1JVBA 4KQXA 1ZXBA 4AJKA 4PRLA 1JAYA 4OH1A 4E2ZA 1XIVA 4NBVA 4ZQGA 1MFPA 3ASUA 3RUAA 3VPSA 1NTOA 3HDYA 5T57A 3PYXA 4ID9A 4M89A 1H6BA 1F12A 1PS9A 3M6IA 1AXGA 2D8AA 3V2UA 3K5PA 2EG9A 4FGWA 1SB9A 1PGOA 4BB6A 1E7MA 1HZZA 2Q49A 4CV1A 3SC6A 5JPIA 3H3FA 4Y6SA 3DHYA 1EUZA 1SEPA 1D8AA 2B83A 3H3JA 2EF1A 3DBVO 2VN8A 1ENPA 2D59A 4MKRA 1X7DA 1U1IA 1QXSA 2V6MA 2FZWA 3A06A 3HSKA 3ROQA 4J2OA 5KJ1A 3RC7A 2I3AA 2VT3A 3P2OA 2BELA 2AQ8A 3GVPA 4YJGA 3C1TA 4FDAA 1I30A 2OGUA 3GUYA 4PZDA 2NV6A 2NU9A 1PX0A 3F46A 3KTDA 4XA8A 5TIIA 2QQ5A 1EBFA 1E3WB 1X7GA 2ZB8A 4CMIB 3Q11A 5HS6A 3W4JA 1H93A 1JQBA 1DBVO 2H9IA 5G0UA 1TT5B 4IZIA 4RVFA 1Y9EA 3D0OA 4KTTE 2A94A 4WLNA 3ZDFA 3NDIA 4HFNA 1OC2A 1U9JA 2CF6A 1JAXA 4PCVA 5T67A 5TRTA 1L7DA 3E48A 3IOYA 1ORRA 2I65A 1Z45A 3FSRA 3L4BA 4JP3A 3T4XA 3ONDA 3GVIA 3UOGA 3JQ9C 2EKLA 2CD9A 4NPCA 2OHXA 3TDKA 2DQ4A 2NQTA 4R9RA 3NTRA 5FI5A 4J91A 4R16A 5THQA 2NQ8A 3V5NA 5A1TA 2YW9A 3LLVA 2Y1EA 3FCOA 3MOGA 1U28A 3CSDA 3ZWVA 4IPTA 3GRPA 2AA3A 2GZ2A 2QRKA 4IJUA 4KUGA 4PVCA 2GN4A 2XAAA 1GQ2A 4Y67A 4U7WA 3AUUA 1OC4A 2X9VA 3D64A 4TZKA 3RUEA 3BTVA 2VTEA 4RPKA 4FJ1A 1EQ2A 1N8KA 4Z9FA 4D46A 3RQSA 3K96A 4MO2A 4YQZA 3GOHA 3JYQA 1EE2A 3JD2A 1BVRA 2PKRA 4ZN6A 4BQRA 1RYDA 4GX0A 4RLHA 4CM9D 1VL6A 1E7WA 4D3FA 3JQCA 3ANNA 4D41A 3GA0A 5B4TA 4AJNA 1IZ9A 4PLPA 3BZUA 1LUAA 1HYHA 2F1KA 3C7DB 1C1DA 2GZ1A 1ISIA 4XQCA 2VT2A 4YJGB 3PPIA 4A26A 3E82A 4I5GA 1BGVA 1VRWA 5EQDA 4UEJA 3UAGA 1PJ3A 1ZKMA 3WIEA 1T4DA 1Y7TA 1EVYA 3AUSA 1EDZA 2ZJ1A 3FHLA 3QWAA 4RZHA 3S2FA 1Z7EA 3WX0A 3RKRA 4MVJA 4CLRA 3KUXA 1U4SA 4DLAA 4R5HA 4YJHA 4RF5A 4DUPA 5HS4A 3FWZA 4ALIA 3G17A 1EFLA 1KY4A 3ST7A 2J5KA 2AQHA 3CKYA 4YYZA 4DPKA 4BMNA 1NAHA 2ZCVA 4CM5A 5IFLA 5JBIA 4MDHA 3I5MA 2PZLA 4FCCA 1I2BA 1NQOA 4GBJA 3VH2A 3ZHYA 3B70A
chains in the Genus database with same CATH superfamily
1O03A 1SQSA 3THWA 3EVBA 5C31A 3KLOA 1UH5A 1V8PA 3WQHA 2FPPB 4BE9A 4DF3A 1PZMA 1OAKA 1JEDA 2FFBA 4UBMA 4H3SA 2FR0A 4N3CA 3RVQA 1OCEA 4DLVA 2OD9A 1K5DA 4PBTA 2QE7A 3UJHA 2P9QA 2VP4A 4Q7JB 2HRQA 4TRMA 3EVTA 1BQ4A 4UHKA 4ITRC 1DLJA 1QB8A 4JP8A 1ZO8A 5CFPA 2W93A 4ROSA 4WEQA 3UW1A 1THGA 4BE7B 3BCSA 3V7FA 1WU7A 2EARA 4MI1A 4F5ZA 2BFAA 1EHIA 2RMKA 4CLOA 3C3KA 4JLKA 5C46F 2G25A 2EJWA 3ICEA 4M0KA 2PX5A 5HZKA 1QRUA 2PSEA 3DCNA 2RJOA 4JI1B 1FVHA 1SIOA 2OOSA 3I04M 4AX4A 4C6TA 5A5DA 1GTRA 4BVLA 3NCHA 5EJMA 4BP3A 4QATA 1RWVA 3FFTA 4GYYA 2BSXA 3KQPA 1D5CA 3HH8A 4M6WA 2QA5A 1Q3TA 4M1KA 4P4NA 5KYXA 3KWFA 4LI3X 3ZKWA 4JJAA 2HJHA 4IJKA 4TVBA 3GLIA 2ZM6B 3BWVA 2AOUB 2ZUSA 4OFWA 4FDMA 4L8FA 3IUEA 4Q39A 3QEMA 3QFTA 5WRFA 2G1AA 2YWFA 4QVKA 4COOA 4YI5A 1ZW1A 3RJTA 3QNWA 3G13A 4MS4B 2HAEA 3TRDA 4CMCA 3QW4B 1FTQA 1TCUA 3NUZA 5G1PA 1GGMA 4ON9A 5SY4A 1KERA 4DY6A 3OIYA 4R54A 5E1BA 2W4MA 1P2GA 4IVNA 1TCVA 3BREA 3KJHA 2I4NA 3STVA 2GPJA 3ZGNA 4BJ6A 3S1SA 3FOFC 4OVKA 3P9XA 3SQWA 4FKMA 1KDYA 1K89A 1G18A 5EQJB 3SEZA 1D6MA 4ZT3A 3ZHSA 5AVSA 1KVSA 2VK1A 5LB2A 3ISJA 4ZOEA 5IAGA 5FI1B 4DCUA 5EIBC 3RWMB 4G85A 3DUFB 1XXHA 5H68A 1VPDA 2C3UA 4HS4A 3A4MA 4GR4A 3ZIUA 2Y1FA 1NATA 3HCFA 1KSHA 1JSCA 1YCGA 4D9CA 1F8GA 3I62A 4YDSA 3ZLBA 4X54A 3V8MA 4YXWD 4YROA 4ZCIA 2YXNA 5I8WA 1OFTA 2XDAA 4E6EA 2QUKA 1C29B 1NW9B 2HO4A 1SVMA 3EQ6A 4MTCA 4LJ4A 4M9CA 4X9XA 2QMZA 2OZPA 1CJUC 5EHGA 3DL7A 3IVGA 3DWEX 1N2EA 3H8VA 3L7AA 1JDSA 1RHUA 2FPGB 2WHQA 2V6BA 3HLKA 3OJFA 4EBBA 5CFNA 1RC8A 3A3OA 1LH0A 2VZ8A 3VR3D 3WO0A 2ZJ4A 3KQMA 3D4BA 2I80A 1WB6A 2OESA 3AILA 4MW5A 4MYRA 3RYFB 3TVYA 3AU9A 4V0NA 4UU1A 4DREA 4TWAA 1BN7A 4JR1A 2HUPA 3WIDA 1KNXA 3PL5A 4OSPA 1J23A 4MUIA 5DHPA 3DDCA 5K3BA 1LPNA 4P9NA 3KOOA 2AXPA 4BVFA 1I3LA 1Z13A 3GAFA 3HACA 2GF9A 2YHBA 2QRUA 5GONA 4C0AC 3VNBA 3EA0A 1PEYA 4NBWA 1FNSA 5DSXA 1H69A 3S3TA 3UK7A 1C50A 3K9LA 3NX4A 2GN8A 1J22A 1Q1ZA 4R0NA 2J46A 4OSEA 2ISSD 1GGHA 1BEEA 2IZ7A 3EEBA 3H11B 5AI6A 5EIWA 3ZXIA 2IVFA 4G5XA 4F8EA 2Y71A 3QX8A 4UE3S 5KDDA 5JISA 3C6MA 5KYNA 1U04A 4O2AB 5JSFA 1KC3A 2QV0A 1QM5A 3V2GA 4G1UC 1I7LA 2C8KA 4B5LA 3VOBA 2BUAA 2VPYA 3Q3CA 3RTDA 2HWWA 2I2WA 4ZC1A 1TGYA 2G70A 2JAWA 3O1JC 4MR7A 5I7SA 1YRWA 3DBLB 1TD1A 3EIQA 3SM9A 1SVSA 2HDOA 2H7YA 3QU4A 1QDEA 2VDWB 2XMGA 4EVQA 1GZUA 2VG8A 2ZUDA 3ZJ4A 3HYRA 1E3SA 1ISPA 2GSWA 4FCVA 3TRIA 4CMHA 2Y77A 4N0QA 4OEHA 3KDSE 4Z9YA 4F6RA 1SK9A 1TO1E 4EH1A 3TG2A 3FSGD 4IKOA 4QREA 5B1SA 1NZFA 1C9JA 1ZK1A 1SUCA 1U0GA 3AKEA 4EB3A 2HFKA 2WKRA 3U16A 4CQJA 4WKBA 1W59A 4KIGA 1N5IA 1P9RA 1AKYA 2VSFA 2UKDA 2WD9A 3DZFA 1CUEA 2GNPA 1WY7A 3G68A 2OCLA 3IKJA 4U2EA 5I9SA 5K51A 5DFAA 1YZKA 1KQNA 1ZCFA 2I3BA 2ACKA 2OCIA 2VK8A 2I3DA 1G20B 4MLPA 2BDUA 4XLLA 5E95A 1M0TA 4MUBA 4K8OA 4INOA 1TIKA 4X7MA 1GNSA 4HDMA 2VBFA 1I5EA 2I54A 3AUFA 3HGTA 2CBZA 5HGXA 4C43A 2Y6UA 4EWLA 3VVCA 3EXHC 3EK2A 2QN6A 3OCZA 2H08A 2UVDA 3ECCA 1TMYA 4JENA 4RELA 4TVOA 5FA8A 1UJ6A 2WF7A 3B60A 4FC7A 4NJMB 4QQ8A 1YZHA 1ZD2P 1DCMA 3ZY2A 3KYDA 1U90A 1KGSA 3H6KA 3QBVA 4QEZA 5F5NA 1F4LA 2WHEA 4IOKA 4WZAE 4BNLA 5B3JA 4KRXA 4EI8A 3LQRA 1LTQA 3KE8A 4OK3A 1Y4AE 4O2AF 1ZIPA 3IO3A 4E4TA 3N6RA 2CJPA 1GCGA 2VAWA 3HGQA 4O4LA 1KU6A 2FRVA 1RWOA 5H83A 1TMGE 2JGDA 4QXPA 3NIBA 1WETA 2Z4TA 4HWKA 3EYAA 1N78A 1BS2A 4BNXA 4DIUA 3RFUA 2EHDA 3TFWA 1G5TA 3U39A 3L41A 4B3JA 3NEJA 2C4UA 3A9RA 1UOEA 4LZWA 1C8KA 2CBGA 3PUIA 4TQ9A 4V38A 4RTSA 3IUBA 2CL6X 5HTOA 5AI0A 2WBLC 3TQRA 1T43A 4UDOA 4WCFB 2Z83A 3FDZA 5FA6A 4GWLA 5EGNA 1F14A 2ZI3A 4OJKA 3CCFA 1IB6A 3FWKA 1J8DA 4K88A 2ZTLA 1GYRA 1V3UA 5A71A 3OQPA 1P60A 1JIUA 1P2SA 2ZPUA 3JD1A 4I1RA 1R15A 1ZCBA 4JH0A 4K87A 1YI8A 1P2UA 3IUQA 3A27A 1L5VA 4JLOA 4N6NA 4BCBA 2QRQA 3EH2A 3B3AA 4AZ0A 5AICA 2N1BA 4V3CA 3W9UA 4B3MB 3NDRA 1ORTA 2H0AA 4C9BA 1PEKE 4WY5A 3TZ6A 1O54A 3TTYA 5F33A 3M2TA 8ADHA 1GRNA 2DFDA 4MXDA 5B57C 4YUVA 4X65B 2BFEB 1AE1A 2ZETA 4MV3A 3SG0A 1MA3A 1RBQA 1GHTA 1QHYA 1E6UA 3WJ1A 1DO8A 3UF0A 3EMKA 3KOYA 3UTDA 3ILXA 5HQ3B 5HILA 3AY7A 4X7BA 5TT1A 1G4AE 3WFJA 2FMIA 2PGDA 3Q3GE 2PBLA 3AXTA 3HCWA 4IRXA 2YBEA 1N3YA 1ZOOA 5CFLA 4DVGA 4Z49A 4R2MA 3K9FC 1MO6A 1N5RA 2H5LA 4MRAA 4NAUA 2GR9A 3VNSA 3U09A 2A2ZA 5ERGB 2PL9A 1HO3A 3PDJA 2R1TA 5LZ2A 1XRLA 4EIWA 4B3RB 4F1JA 2C2MA 3IT3A 4IOLA 3RHZA 2NTYC 3KCNA 1EVQA 2RHTA 5D5PA 3ROZA 3ZCRA 1KQFA 2HT1A 1JNYA 1ODFA 1E2FA 2BEVA 1ZM2A 4PNPA 2P9EA 4QYWA 2R44A 1RJ9A 4NWIA 3LQ2A 2OKGA 4CM8B 3CVUA 1GQSA 1QX3A 3B1JA 3SNHA 3T7IA 2QP3A 3K0AA 3T7KA 3CEMA 3IPRA 3ZU2A 1QC5B 4ZVTA 5IASA 1CUSA 3QPAA 5THXA 5J3JA 2YY6A 2QZPA 1SCIA 3GMDA 3D5QA 2CEAA 4EG7A 3HCEA 3H05A 3CH7A 3A9CA 3OPYB 5L7TA 1E5TA 1VJGA 2BE7A 2ATIA 4OTZA 4EG1A 1NVBA 2CHGA 3KAJA 4B9AA 3CR3C 4DDUA 4ZMRA 7GPBA 2ZDHA 1E92A 4CN9A 3TR6A 1Q0UA 4B3TB 1EH5A 2B1QA 2Q4BA 4YQEA 5KSPA 1I6MA 4OHYA 3IUPA 2QE6A 4DFDA 3RRXA 3DOIA 3P0IA 2ONZA 1KI9A 1YRHA 3CTMA 1QJCA 3FFWA 5FWNA 3B2NA 2VHXA 5D1HA 3TS1A 3VR4A 4BC0A 1PI3A 1VPTA 3GJ0A 5H4HA 4ETIA 1ZUNA 1QF7A 1GN9A 4G09A 2OLKA 1WBJB 1MA0A 3P0HA 1Z2DA 4RGYA 5E7MA 2OOKA 3T3PB 2BHSA 2BM1A 5BNFA 3TOZA 1N9KA 3FY4A 3ZQ6A 1NJ5A 1U98A 2QENA 4AJ9A 1GEEA 3AFNA 3F6CA 3UJBA 4C4XA 1G8MA 2OGZA 2ZXEA 1JF8A 3AH8A 4DMUB 1CNMA 2R00C 2XUPA 3H5NA 1XAHA 2R4QA 1TQ8A 3LPDA 1T4MA 2AG1A 4YRTA 5A4DA 4IO1A 3L7YA 4WKOA 4BLPA 1M1XB 2BL4A 3B12A 4IXMA 4BMSA 4E22A 3IHKA 3NKFA 3WZMA 3M1YA 3G0HA 4PGMA 1CUZA 2FQYA 1RFGE 2GYVA 4MPJA 3RSHA 1EBUA 1M54A 4IGEA 1UFRA 1N4AA 1AMUA 1Z2CA 1UJBA 3CNHA 5DM4A 3RTGA 4QOJA 1X94A 3Q8LA 4IF4A 5TMEA 5EKDA 4MV7A 3D8RA 1Z2OX 5BXYA 2WINI 4CTMA 1SWWA 4L5JA 5JD5A 5HNKA 1AVTA 1OB2A 5F9FA 1OASA 2EW1A 4US1R 4WXEA 1CDDA 4W1RA 4DM3A 5ALPA 1P4GA 1ZJYA 3CH6A 4NFHA 5DW0A 5F7JA 5JYEA 2NU6B 1MAUA 1QG2A 3CBGA 3GXBA 4YRLA 4MW7A 2BI4A 2BKAA 2OBXA 4P58A 5TR9A 4DZZA 2CFRA 5E9WA 1FQOA 5HKKD 4IJQA 1L7BA 2XVAA 4IWYA 2IEZA 4D4JA 3AKCA 3NCTA 5LYJB 4D98A 2P4HX 1AKUA 4NJEB 2OLEA 3EAGA 2Z6AA 4FNGA 3O47A 5B64A 1S2LA 2QNIA 4MVJD 2FMHA 4JLJA 2CT8A 1HDRA 1YASA 1BD4A 3SR3A 4AFNA 2XE7A 1V4VA 1T91A 4UM7A 1GQFA 1UFKA 2I33A 2REQB 4TTQA 2JIRA 3Q0IA 4YJFB 5ALXA 2BTQA 3OURA 3OQHA 4YR9A 3WSWA 2WTEA 3SBOA 1HH4A 4RSRA 1G8HA 1WAMA 3P5SA 1PS0A 2PD4A 2R9VA 1N2CB 4MGIR 2NYRA 1DRJA 3JR3A 1UJ5A 8AT1A 3NP9A 1P74A 4C4PA 5KB3A 3OTIA 3H5VA 3EF3A 2PRKA 1G98A 3ZLTA 2AKEA 1EFPB 1WTCA 3HXPA 4R8RA 5EIAA 3S40A 4ACAA 2CYAA 1ZNYA 1OI2A 4I0WB 3WIUA 3D59A 1G2PA 2QE7D 5GJCA 4NCAA 4ZVPA 3BK7A 1R6UA 4YAWA 4ALJA 1KO4A 1I6WA 1GYQA 4FBLA 1RLUA 2I34A 1EJ0A 4Q47A 2VP9A 1BXZA 1G6KA 4B8YA 3QXSA 4JP2A 1G8AA 2AFHB 2W6ZA 3OP4A 3N87A 1DINA 3TX2A 3EXHA 5ITVA 2V7XA 1O4VA 3L1HA 1VJCA 2QHXA 2FPSA 2AE1A 2W4QA 4IDNA 2YN4A 1TVCA 2QX7A 4EA8A 2E5LB 2JHAA 3WHPA 3L6RA 1O1YA 4W6QA 1BSVA 3G5AA 3LW8A 4UW9A 4JVNA 4UM5A 2A5YB 2H1SA 3BWMA 2YJZA 4DBVO 3HA3A 2EGHA 3KB2A 1W47A 2QV7A 4M0MA 3ZW7A 4MDEA 4CKBB 3KALA 1Y1LA 5CDUA 1KQGA 3FHTA 1FRQA 5C4MA 3Q3JB 2KE5A 4S12A 4JI4B 5JY1A 1QIJA 4U2GA 5DXJA 5IVIA 1IUNA 4AAYA 4LF6B 4O8CA 1ZN2A 2FFRA 4RZ3A 4BO7A 3IE0A 3NHSA 2WG1A 1U02A 1ODKA 3NETA 3PUYA 4JOBA 2G80A 5DOVA 5HFAA 3WE7A 3WJAA 5B2EA 1XD2A 1Y81A 3KJQA 2BM8A 2JCYA 3NONA 4NG5A 4QNRA 1ZD8A 3QH4A 3DOOA 1V5WA 2ZT6A 4BZQA 2J0QA 4OQEA 3T4UA 4LDRA 2O0KA 5E1DA 4WJKB 3SLKA 1GPUA 4WLEA 5EESA 1DFHA 2NZYA 3LWNA 2PUBA 1H2RS 4P7FA 5DU2A 2WABA 4P0TA 3ZEIA 4J0HA 4TL7A 5TLSA 3W4KA 4KZPA 1RRFA 2GCEA 1X1QA 3HCDA 2H11A 1MO2A 3DMHA 1QQAA 1U2RA 4H59A 1UPBA 2O2YA 1ZEJA 3GJZA 4JUFA 5AKGA 5HPYB 2C5LA 2QN9A 2W6PA 4XR9A 1XQ1A 1V5GA 1YDGA 3ROPA 1QOPB 3A1FA 3JVIA 5DBOA 4REQA 2IZZA 5H0IA 1JGTA 1AS3A 5D51S 2ESRA 1KFKB 4C89A 1S3GA 1SH7A 1ORVA 5AK0A 1FIUA 2QLLA 3GJTA 4YV7A 1R16A 4B7UA 4IDPA 4JA0A 3EYWA 2AMJA 4DABA 1WMAA 4IGAA 4IH1A 2ZWAA 4UAVA 5HF8A 2JK1A 3H75A 2HU7A 1LVGA 2RGEA 4U2BA 1JU9A 2W8ZA 2Q1WA 5H4GA 2E6UX 3N8NA 4RS4A 5K3FB 3QMVA 2N1MA 3HJRA 3RAEC 1Z4JA 3SBDA 4Z4QA 4GUDA 1IHPA 2P27A 2P6UA 2D5LA 3RBVA 2W8BB 1E9EA 1QV7A 3MW8A 3RVSA 5AIBA 1QBGA 1JKMA 1T6NA 4RPCA 4RK5A 4QLBA 3SFZA 3B7GA 3FAZA 3NBKA 1ZUIA 3S2EA 3WNQA 3QXCA 3QEBZ 4L4UA 2XUJA 4B5KA 1K2WA 4QASA 1LC0A 3FCCA 5LQKA 1A4XA 1T5HX 1F20A 2V03A 5C5CA 3LFHA 2N42A 4J1SA 3ICWA 4R1QA 2EAUA 4TX1A 4Q24A 1VJ1A 1K5PA 3G49A 1Z0DA 4GLLA 4ZT4A 2P9BA 1I7PA 5C4IA 2FZKA 2CB9A 2FSHA 1CWUA 4AJJA 4N82A 5K6AC 3BXPA 3DZGA 4LJ7A 4N5IX 2O2SA 2IE8A 2XE6A 3QKSB 3RG8A 1UWLA 4BNTA 1BCRA 5I8ZA 3X2EA 1ZVKA 2YN0A 1DIAA 2GARA 2OQRA 3IBGA 4ND5A 5CB0A 2JLYA 1H0KA 3C70A 1THTA 2VDOB 5EN4A 2C29D 2IP1A 1E89A 2FZ4A 1OT3A 4E2YA 4AMBA 1IPEA 2VYQA 5LA6A 4OH7A 1VIMA 2YOFA 1LJLA 4UOEA 5HIAA 1PYOA 4MUGA 4H16A 1KGDA 1X74A 4A0SA 3U4HA 1OFHA 2X9GA 2XQFA 1OYWA 1EBBA 2CUTA 4TN1A 3IV6A 2OORC 4NCBA 3T5PA 1Z6YA 1XU4A 3AIKA 4MLZA 1Q1NA 2R00A 3VPAA 2VXCA 5L8VA 3VKGA 4QBFA 4BNNA 4ABTA 2GEKA 3DE5X 4AL4A 3PHHA 4B73A 5HRUA 4JYAB 3E4DA 1OX5A 2ZAYA 1BMDA 2QSJA 3SI7A 1UINA 1G21E 4R9UC 3D1LA 3S1LA 3ZNNA 4A8JB 4FP9A 3OZEA 1SCDA 2VLIA 1E8DA 1FP6A 4JUCA 5CX4A 3TTTA 2GPBA 3GU3A 3OTWA 5G4KB 1ZWLA 4I4LA 5H82A 4MKFA 2VWGA 5ICEA 2XAUA 3AKDA 1DTWB 4W1SA 3KUKA 3DUWA 3N3AC 5EKUA 3CRZA 4J3JA 5FHQA 4TRNA 3LUFA 3IP1A 4L95C 1CV2A 5LKRA 4Y1RA 4BMOB 3CUEF 1AMOA 1I1NA 2RHWA 3G89A 4TXMA 3ZWWA 1OIVA 1TJNA 4DZRA 3L8ZA 3E84A 1XZEA 3KJFA 3I2FA 5FPPA 5DWQA 2ZB7A 1E62A 4KQWA 4TPKA 4U7GA 4GRIA 1FTSA 1PW5A 2C77A 2H48A 3U0BA 1AQ6A 4KN6A 3MS4A 1M1ZA 8ABPA 4G8DA 1UDWA 4RE5A 1MVNA 1UBRS 2GHQA 3TNLA 4KMSA 3UMJA 1PT9A 4A6EA 2XRMA 4NESA 4UCQA 3LCUA 5JVDF 4XDZA 2Y4OA 2XZLA 2VZLA 4IDBA 1RWMA 1EXDA 2CLIB 1BWQA 3WA7A 2OXEA 3BSSA 1JQLB 3FZYA 7AT1A 3J81k 3M4XA 2QR2A 4EOGA 2PVPA 4ZREA 3M6VA 1OD6A 5IH3A 4WZBA 1S3SA 1G7CA 3IBSA 1BHJA 4XARA 4LK2A 4NYJQ 2J59A 5ALGA 1A69A 1UEJA 3U4CA 3KS9A 5B6PA 2HHJA 1NM5C 5FOQA 3RAJA 2NSDA 2Z0MA 1DWQA 2Y1OA 4G0VA 4K3UA 2BFMA 3TPZA 5CBPB 3DAFA 3K9CA 4GR9A 4MI9A 4QQFA 4TV9B 3KUUA 4LSMA 1KYWA 5FI0B 3TVTA 3AB8A 1D4AA 1VCOA 2VTVA 2FPRA 5DIFA 3CW9A 3CSSA 4YJ2A 1Y8CA 1S8NA 4DSUA 4KP7A 3WGOA 3EZ7A 4XSGA 2Q5IA 2EVWX 3A2LA 1O96B 4LMAA 5AHRA 4ZJPA 1Y3DE 3HWX1 4F2GA 1CJVC 5I4BA 2HXYA 4D44A 5L45A 1VI6A 4ZI7A 4DC0A 3DL2A 1MIOB 3DP9A 3F3SA 2Y1WA 3N0XA 1R6DA 5HE9A 1CY0A 3R20A 3ZIAA 4HVLA 1KTVA 5IAOA 5JZVA 5K01A 2BP7B 4TKVA 1ZR2A 2XHZA 3FTQA 3WV5A 1D3AA 1QV9A 3C48A 4N9QA 2CXQA 5KQLA 4H3KB 5CK4A 1A0OA 2H2HA 5DHQA 1I7SB 2PGLA 1KE1A 3EFEA 4M9RA 2ZJ0A 4LJ5A 1HEUA 4RVSA 3K1AA 4CG3A 2HR1A 3JVUA 2A0FA 4DV1B 3P4UA 2J5RA 1FNMA 4RY9A 1CUYA 4GYWA 1IE3A 1SC3A 2AG0A 3FFBA 1S1MA 4LXHA 3HXKA 1KQOA 2CLMB 1KWGA 3DO5A 3GAAA 1TB4A 4U9UA 3RC2A 2O8EA 4PPGA 4URXR 1AA9A 1M7GA 1MMFB 3D4PA 1I3MA 2FI1A 4JLVA 4QOGA 4HDKA 3EDRA 4WDQA 4YRSA 4YCMA 1ZD3A 1C1DB 1QO0A 1Z06A 1Z4PX 6REQB 2VHYA 2NT3A 3HWRA 4WOKA 1VPLA 4OM8A 3NFRA 2WJYA 4Z4IA 2EKDA 3UT0A 3UKJA 1XHFA 4X45A 2O7VA 3FE2A 4ZARA 2X4LA 3FCXA 3HM9A 1RTKA 3PXUA 4L28A 2H4YA 1JDNA 3NVMB 2P3LA 1W6UA 4MGYR 1HORA 5U4QA 5JASA 4JXXA 2UZ0A 3FPKA 3RAFC 1BCSB 4CLRB 1JA0A 4G1MB 4LZZA 4QUHA 3RAPR 2UVPB 4OK6A 1C7QA 4TV9F 1BQEA 2RCYA 1JPVA 3BL6A 1IVNA 5EIBD 2O20A 2H7XA 2W6IA 1NXXA 1E98A 2B61A 1DOHA 4QXQA 3R0JA 5JO0A 3A26A 3PC3A 3I4FA 2CLOB 1II9A 3TK1A 1DJLA 3F71A 5IJ9B 1QH9A 4MA5A 2X8JB 5CYPA 4F4DA 1ID8A 4EVRA 1NMQA 6LDHA 5FTNA 2H07A 2PGNA 3VR4D 3QVGB 3HE3A 3TIIA 1E9BA 2J48A 5LDHA 4G6ZA 4LZJA 4WWHA 1LEHA 3LC1O 4YP0A 1J07A 3L5KA 1YDEA 3DKRA 3OMLA 3GFFA 3EUWA 4B2YA 4BB9A 3GT0A 3H9JA 1JIVA 4FFDA 4YUXA 4EFNA 4HLCA 3FDFA 3TR0A 1J6UA 3CN9A 4OJYA 5CIQA 4RA9A 1ADGA 3B9RA 1E4EB 1RS0A 1CZLA 3CCCA 2P65A 1WRBA 5HDQA 5CM9C 2G1JA 3AIOA 3KEMA 3Q7EA 5AKKA 2A9KA 3IX7A 1NVDA 2GK6A 1H9BA 4X6LA 3X1KA 4D8VA 1RCUA 1FP2A 4MQ6A 3BCUA 1F8YA 4MQUA 1J9ZA 1XL0A 4O8ZA 2EATA 3ZDZB 1LBEA 1VHQA 2BF4A 4AK9A 1JR2A 1LPMA 4RMHA 2HMSA 2WTBA 4KNWA 2RI6A 2V74B 5AW2A 1E7YA 2OPBA 2JAOA 2OYCA 2DERA 1VLHA 1WP9A 1Q6ZA 5IJXA 5K6AA 3GARA 2YVAA 2I1VB 3VC3A 1G38A 2BUCA 4LVOA 3VHQA 3QF7A 3OQBA 3LCRA 4HP8A 3R09A 4R2HA 2V8BA 3H16A 4HDNB 4D1YA 3S70A 3ZW8A 1O9HA 3MT9A 1K3TA 1T34A 1QZUA 3V1UA 1QRDA 1SKUA 4ZEOA 3RARA 4Y6OA 1Y8QB 4EY3A 1WCIB 4D8YA 2GTPA 3WBKA 4ACBA 4LAFA 4UPEA 5ESDA 1YVEI 5AHKA 1ZQ9A 5BWNA 3NT2A 7REQB 1C8BA 2HEIA 3CLSC 5AK4A 1MD9A 1QIEA 1EUYA 4BZZA 1V96A 2NPIA 1IJKA 1XDGA 2G82A 1NVKA 4V0LA 5C1DA 4PG6A 3BL8A 5JARA 2HGSA 2BFWA 2OGSA 3EBLA 1Q0ZA 3K2EA 4OA8A 5H59A 2AHOA 2GEJA 2WP0A 2Y2UA 4NMLA 1SA0A 3RRZA 3TW4A 4O1HA 1I2ZA 4MCAA 2IGTA 2EJBA 4OX9B 1SXJB 2K87A 3IB6A 4PYKA 1YS6A 1MVLA 2XMPA 2FKNA 3FCSB 1IPHA 3AI1A 1COWA 2I7CA 4UVGA 2A9FA 2OCDA 4BFWA 4ND1A 4EHKA 5TMDA 4NZ9A 2HHLA 3WYGA 1QS0A 5BW8A 5FBZA 3RKUA 1ZX1A 3BK1A 1XF1A 1RXYA 2YDXA 2QROA 3EB9A 3LSYA 4YK7A 1YRBA 1R4MB 3U3KA 4EHDA 3RTBA 1EWTA 2V4UA 5AW0A 1LLQA 2M1ZA 2UYHA 1ZBQA 2QW1A 2UZ3A 4WFJA 3BE5A 5BUZA 1IN7A 4Y6RA 1RZRA 3DZCA 2CXPA 2WWIA 3L18A 5FPHA 1FOEB 4PNZA 4CMGA 3K3PA 4Q3LA 3VTKA 3TOCA 2C2YA 4TYNA 4CL2A 1ZA1A 4AY5A 2DSTA 4NU0A 1P8AA 4UUBA 4NBTA 1RLMA 5H1YA 1GG8A 3R41A 2JLQA 2XWJI 2OV8A 4NXNB 2PSDA 3IT2A 1TZ2A 1EWVA 4DQVA 2O7QA 2DTXA 3B78A 3K9BA 2RHHA 1T35A 5FWYA 3OJWA 1NUUA 2AKYA 1J1UA 1W1IA 3SX4A 2B2NA 4QPZA 1Y1KE 1NMXA 4NBRA 4G24A 1L4BA 4INAA 5EKSA 4ZI5A 3X44A 2ZYDA 5CG2A 1TTQB 3IEKA 4H6PA 3Q9SA 5AUQA 1Q83A 5AM4A 4X0EA 1R0BA 3ZCTA 1CUXA 4MQEB 4DQXA 3L6EA 4G4IA 4OBEA 4PPNA 4RETA 1T9CA 4UXIA 1LK7A 3HZZA 1KI2A 2FE1A 1PR4A 2LDXA 3E9YA 3GZNB 3RUPA 3DKKA 4RHYA 3VJRA 1J2RA 1AZSC 1IVYA 2O2GA 5CUQA 1WULS 3FTPA 4H31A 4IM7A 4QVGA 1WD7A 4URWR 4CV2A 3OKAA 4UAGA 1XTKA 3NAGA 1R12A 4H35A 4PC2A 4PONA 2VT7A 4JNKA 1QKIA 1T1IA 1FDWA 5EUQB 3VISA 3KPJA 2PGXA 3G9QA 3HDGA 4DCNA 4P0QB 1P5JA 1RE1A 4MO9A 1WXQA 1CPYA 4RS3A 3OTOB 3L40A 3T94A 3RRFA 3ILYA 3VJMA 2Z08A 5EPUA 1BEUB 1T36A 3MMXA 2ZI5A 4D5GA 1XD8A 1UM9B 2J85A 4F12A 5K45A 3CRW1 4XDGA 5EYPA 1CLEA 2ONKA 5KMGA 4L27A 1R9JA 4PAOA 3RFTA 1JHYA 1M7HA 4F6LA 1X19A 1ZN7A 4E70A 1WMBA 1UBCA 2PPLA 3IBYA 5AI5A 4U8HA 1H2BA 2Z6VA 1RKUA 4RMIA 3PIRA 1JQAA 1SUPA 2CNWA 3EPRA 3JQAB 4ZZ2A 1RWQA 2IU3A 4AZVA 3IQEA 5M3BA 2DB3A 2ZFUA 1II8B 3GLHA 2J5BA 1KE2A 2HU5A 2GAAA 4DV6B 5TMBA 1HL7A 2IHNA 4XVRA 4EPRA 4TQAA 5AKJA 4KDRA 5IC5A 3FPSA 3PKIA 2ZBVA 3BXZA 3MEQA 5TS3A 3KZNA 4X20B 1K6EA 2GHIA 5DVZA 1MJ5A 4J9VA 2F3RA 2IPLA 5DTEA 5JALA 1EVEA 3ZWOA 4QUDA 4P1ZA 5BORA 2QL6A 5BSKA 4L73A 1N2JA 2ZREA 3DVAA 4JLSA 4UMVA 3NG1A 1NXSA 5F21A 1KSGA 4ICIA 5L3VA 3K8OE 4B17A 1PG2A 3OEWA 1QV6A 1BYUA 3OMWA 4IDOA 4CMKA 5K4HA 3R3VA 5KU1A 2NPOA 3EGCA 1VI2A 4YP1A 1ZJ4A 1JIKA 3FZQA 2P2NA 1O6GA 4P38A 1L7MA 1I24A 3JD4A 2Z1DA 4U9HS 3IQIX 3P4XA 1KAGA 4MKGA 2BLNA 1YR3A 4UVHA 3CUVA 1KYVA 4RA6B 5EZYA 4MVJH 4GOKA 4G89A 4CGZA 5BWBA 4HB4A 2HZBA 2QSZA 4WOPA 1ZOPA 3ZWNA 3JRWA 4B6QA 3N2LA 4ZZ3A 3TFQA 4UU0A 2HLPA 1XTQA 4EQZA 1HEIA 2QR5A 3F4BA 4QDKA 4HG2A 2FFAA 3IIJA 3WA6A 1BXGB 1MB3A 3OFNA 3TSOA 1NI4B 2UZ1B 3PSHA 5CA1F 5E4YA 3EXIA 1C3LA 2JKVA 4WXHA 5F1OA 5JS7A 1YL6A 1CS0B 4TMYA 1QYXA 3IKLA 1Q6YA 1EM8B 3LOQA 3SDBA 4DUYB 2BGJA 2VP6A 2WSMA 3EXFB 4O2BB 1NI5A 4BQPA 3B6JA 1UP7A 3KVNA 3BXHA 3K32A 5JYDA 2X14A 3VBEA 2Q0QA 3CRVA 4XUDA 2QZJA 3TLJA 3VGJA 1JHMA 1DSSG 1YZYA 4J90A 3FSEA 3WMGA 1G64A 3ZU6A 4C08A 4ZIRA 1Q2XA 3GR6A 5I9NA 2FMTA 4B81A 4N49A 4R7TA 4LPKA 3QKWA 4M7OA 10MHA 1XEWX 2FMXA 4MUEA 2NYUA 2ZK7A 3UUEA 1F4PA 4EB8A 4IY1A 5IJWA 5J43A 4Z0TA 4I19A 5K99A 5AKXA 4A15A 5JLAA 4EECA 2FUKA 4DT1A 1V1RB 1MORA 4IKEA 1UPXA 3G8AA 3HFSA 3PP8A 4IGFA 1WXDA 1XMQB 3ZZTA 1WPQA 1YB7A 1TW2A 1FMLA 1TTHA 2ID4A 4H3HB 5DHTA 4KSCA 4HUTA 4QGSA 4HGNA 5BOSA 5FAKA 2O8CB 2CDBA 1WF3A 2I1LA 2IYUA 4RHEA 1SAYA 3NHLA 4WXRA 5JSKA 5JAHA 1X7XA 3ZHRA 4M53A 1HT3A 5HFJA 1H0SA 4GG1A 4MVXA 4B7XA 3F97A 4BB5A 2Q0XA 1DPGA 1XCJA 3BWXA 4FN4A 2AD1A 1Q14A 3K53A 4MV0A 2PV7A 4AN4A 3ESDA 3U7QA 3V00A 2VZEA 4B8WA 1KK2A 1E79A 3KTFA 1VKZA 4NFYA 4CE6A 3EISA 1AX9A 3DHVA 2BHNA 3JZDA 4QL3A 1PWZA 3U4DA 4BO1A 1Y1PA 4HFMA 4MB2A 3RSSA 5DTJA 4UBOA 4U7DA 1UKVY 2XUAA 3LYUA 3KKMA 5FPKA 1DWPA 3HKEA 4GMGA 2EP5A 2VJQA 5CM8B 4Q4DA 1EEHA 1DIRA 4ZYXA 3QJ5A 4G0MA 4WH0A 3DT6A 2ZTHA 1NBHA 1Y37A 4D4GA 1TQ6A 1DQPA 1GLVA 2EJUA 2KYRA 3OHSX 3DLAA 1X1DA 4PS1A 2Q5QA 4B6FA 4CI0B 5IZCA 4UASA 5KPDA 4U02A 5JZ9A 4O2BF 1CY8A 3ZNQA 9MHTA 3CZMA 1V11A 3LHIA 4TQGA 5B1EA 2J9GA 2JCXA 2AVDA 2J0SA 4EEZA 4KBFA 4TZTA 4MS3B 3DBIA 5DPMA 3TQIA 2MR5A 1Z5PA 2VR1A 1HT1E 1N2GA 4Z6KA 4M7WA 1T8TA 2JLUA 5HF9A 4H6XA 1Y7IA 2YXPX 3ISVA 3SEAA 2I6GA 1YHYA 1KYXA 2RONA 3HL4A 1Q1AA 2X5NA 3M4ZA 3Q3EA 1LVUA 3OQ6A 1N2BA 3HDHA 3I39X 4N5HX 3T3GA 4YBZA 4ZOQI 2CDAA 1N33B 2OC4A 3SXPA 4JWKA 4RJIA 1Q74A 3GBSA 1DOZA 3OJ0A 3HDJA 1WTAA 1KEVA 1PL7A 3C1AA 1YV9A 3UWMA 1HM5A 1JG4A 3ZIAD 4D99A 3W5CA 1RQLA 5I4IA 3QTTA 4B71A 1DTSA 2XB2A 2YZGA 2N46A 1NVGA 1YT5A 3A8TA 3JQ8B 4IAOA 4ESOA 5KIAA 4X6YA 2VS1A 2XXAB 1M2OB 4DR4B 5EJAA 1SOMA 5GTDA 1YZ3A 4TVKA 3THYB 1ONSA 2C7RA 3CO0S 4L07A 1BU8A 1ZH4A 1J0AA 1N6RA 1P6UA 4PANA 1Z9BA 4F7WA 1S7GA 5JHHB 1UJCA 4DLXA 4KYTA 4AIIA 4R0MA 1I3CA 4GSKA 4WZBE 3RUHA 2ZJ7A 2QD2A 4JEMA 2VNAA 4PHFA 5DNDA 5HHTA 2GCGA 4ZICA 1XRJA 5CYFA 1SXQA 5AVYA 1AA6A 4RK1A 1FRZA 1UBFA 2B34A 4C7XA 4EARA 1QO0D 2OV1A 5JJBA 5J63A 2AS0A 4ZCTA 3MMNA 4UTNA 2YHIB 1MJGM 2OSBA 5TY0A 5IRCD 2QMQA 1JFRA 4CMIA 2XCRB 1KYIA 2CNBA 2WSBA 5CTAA 4EY6A 4W7HA 3TSWA 3U37A 1TOAA 3UAXA 5AW4A 2OZEA 3JAKA 3SIXA 1LS1A 4CCYA 1NXVA 1O5OA 3ZU5A 4KHPB 4YB8A 3O03A 1EX7A 1YIDA 2O8BA 1QQTA 3RAGA 4QJBA 2GBLA 4LV5B 5DBHX 5HR5A 4LXGA 4JVLA 1ADJA 2G5PA 3S7TA 1I94B 3SU8A 4A4DA 4NK5A 1GPWB 1Z6QA 3K8YA 1R5OA 2QIPA 4AULA 3O26A 1Q7RA 4JP1A 3DEZA 1GSIA 4ARSA 1NF3A 3RFVA 4E11A 2W6ID 1DJQA 3BGSA 3AW9A 5CGQB 3OQJA 4A2QA 3FPLA 4MLDA 1RXSA 4LMBA 2I99A 4WLOA 4B44A 4C0HA 1KR2A 1XRRA 4EKDA 1G5HA 4QFDA 2CVPA 2XTJA 4I1UA 1OOEA 2JAUA 3G2JA 3N76A 4JIGA 5ETJA 1Y8AA 3V34A 4A6PA 4BY9E 1RNLA 1Y1TA 1JT9A 1NN3A 5AM3A 4S24A 4DQUA 3U4GA 1UWCA 3UZUA 5KVCA 1Q3KA 1ZH2A 2O3TA 1N6KA 2B4QA 2G1KA 2IXFA 3OQIB 5FUBA 2NUTB 1SUDA 4KTVE 3PPYA 1P1IA 3HA5A 1NQUA 4I14A 3M1LA 4E31A 5IU6A 1NYLA 1ZH8A 3OH8A 1F17A 3QM1A 3GLQA 3HZOA 4ND4A 4Q3AA 1VSVA 4Q3OA 1UFVA 3AHCA 4COKA 1DC4A 4C0QC 1ZOIA 2Q2NA 3GLVA 1CIVA 4L78A 1XTTA 3G7UA 5IX8A 3GCXA 1WXWA 4M9QA 3A4NA 2H1CA 3K9NA 3IHTA 4R7GA 3LDUA 4ETNA 4PAMA 3KETA 3WJ7A 1EA5A 3I9V6 4BAUA 1J2YA 1X9HA 1IEXA 1KZ9A 1ZA2A 4GI5A 3UUWA 2FK7A 4BZXA 4XWOA 2IS1A 3PWSA 3OOSA 1KO7A 2XDWA 4I4NA 3P7MA 4FQ7A 4MUAA 1C2YA 3FH0A 3M3DA 1B43A 2O5CA 5JNWA 1JQ3A 3DKVA 4R68A 2OTCA 3H0EA 2C92A 3C6QA 1RBMA 3WBBA 3GI1A 4RD3A 3BQ9A 2I6QA 1ISSA 3DAHA 4S1OA 1EUDA 2CXHA 4FFVA 3C8MA 1M75A 4BIIA 5MGBA 4FGZA 4W5HA 5EE9A 4DNQA 3HL0A 2NVBA 4DV4B 3IALA 3KOMA 5EHNA 3N2EA 4UHFA 3B7PA 3PUZA 1AKNA 3R0QA 1TF7A 2Y9PB 5DGCA 3UNXA 1UK9A 2HV9A 3RSFA 2FMKA 4EYEA 2PFSA 1ECPA 1YBFA 5CAEB 3SGLA 4DR2B 3HYSA 4D6PA 1Z56C 4AJIA 3RUDA 4N12A 4UUMA 4LY3A 1Q16A 1X86B 4HDRB 2YWCA 5BYKA 1L9XA 4O3FA 5HKOA 2GILA 1RT9A 1M1YA 4OBXA 2M98A 4S0ZA 1EWRA 2AZMA 2GO7A 2BKVA 4F93B 3BMOB 1FLVA 2XTZA 3I2YX 2R8PA 3KYCB 3PQ4A 2P9ZA 3EGEA 1LW6E 2RKBA 3HSYA 1ZK3A 2JFNA 4QXAA 3SIRA 4C2UA 2IS4A 4NV1A 2I4TA 4M1MA 2JFWA 4XQ0A 2PNJA 1MAWA 2EW8A 3OFKA 2C8JA 3I01M 3IP6A 4W9NC 5E7JA 5B55A 4OIMA 1MOZA 2K6GA 3I12A 3T0FA 3MD9A 1EFUA 3A6EA 3AFIA 3FGOA 3RLIA 1C0EA 3UJ3X 2VWPA 4Q82A 3IMKA 2H63A 3N2KB 2NVWA 3ETNA 2ERCA 4UUPA 5JQGA 1NTRA 1HE3A 4QUJA 2PZBA 4JFRA 4ZO4A 1V25A 5EMJA 4OMDA 3MLBA 2D0OB 1SPXA 2EC5A 4UULA 5BN5A 1NXOA 4JHLA 1ZINA 1P4RA 3PFHA 4JJIA 2C0CA 3GGJA 4X97A 1RZRD 5F9HA 4HVAA 2WAMA 4LYEA 3EQ2A 2ODWA 1PWEA 3G8DA 1XK6A 4LCEA 2EP7A 2PX4A 4M9ZA 5DTIA 3WB2A 1QGZA 3NU1A 4G3XA 5FFFA 5GMOA 3NOVA 4ECEA 2P8SA 2YJ6A 1GZVA 1LQTA 3C7AA</