4P38A

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with azd8329
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYNWDRFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel acidic 11 beta-hydroxysteroid dehydrogenase type 1 (11 beta-HSD1) inhibitor with reduced acyl glucuronide liability: the discovery of 4-[4-(2-adamantylcarbamoyl)-5-tert-butyl-pyrazol-1-yl]benzoic acid (AZD8329).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 99
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4p38A00
3M1LA 5HS4A 4GX0A 2C7VA 1JKJA 4NR0A 4TKMA 3FF4A 4C7KA 3SVTA 5LDGA 5A9SB 1NVMB 4IIUA 3F46A 4N18A 1P45A 3W6ZA 1X14A 3JD2A 4DTIA 3GVPA 3QP9A 4L74A 4BQPA 2PR2A 1KC1A 2UUOA 4XEHA 3C7AA 2GYYA 3GAZA 2ZB8A 3AY3A 1C1DB 1E1NA 1ENZA 1YO6A 2NLOA 3C8MA 3OP4A 1BMDA 1J0XO 2VRBA 4FIZA 4D41A 1X1TA 5A5EA 5B4TA 1FF9A 2QW8A 3WB9A 2GZ3A 3BXXA 3UN1A 5B1YA 5A05A 3NTQA 4LVCA 4NNJA 1N9GB 3BHMA 4K28A 2VYND 1ZBQA 2X5JO 1I3MA 3QWIA 5B4VA 3UW3A 4JROA 4PLCA 3WGGA 5JW6A 4QO7A 3NTOA 1ZK0A 3JYPA 1HYHA 3TQHA 3VH4A 1U2DA 3IJPA 1YB1A 4BNWA 1UAYA 3E5RA 3LDHA 3PJDA 3BMQA 3DB2A 2EKPA 3DBRB 4CL3A 3U62A 3V2UA 4IGEA 1ISJA 3OECA 4Q3EA 4CMCA 1N7GA 4KUGA 1PWXA 1Q7BA 2O3JA 3HB4X 5KOIA 1CJCA 1AXGA 1G0OA 4KTVE 1YQGA 4QQRA 1EVJA 3RUAA 5JBIA 3I9NA 5IXSA 5HTOA 5F5LA 2NACA 2YV3A 4R3NA 3D4PA 1E7QA 3GPDG 1J49A 1DEHA 3PVZA 5JSFA 2OXIA 2PD4A 4X54A 4W4TA 4NBTA 1H2HA 1PL8A 5JO0A 5DBFA 4I9NA 3HFSA 5JO9A 1E3WA 3JYNA 7ADHA 1HE4A 2UUPA 1RWBA 2GO1A 1XGKA 3KVOA 1ZK2A 3DHNA 1D3AA 4M87A 2X9VA 3PK0A 4UVEA 1YJQA 3AJRA 3INGA 4MPDA 4AJ1A 1P1HA 4NBVA 1JW9B 1V9LA 2I9PA 5IDWA 2G1UA 2ZB3A 5JYEA 2JAHA 1HDRA 2PH5A 1DC5A 3AUSA 3P5SA 4F6LA 4ZRMA 4PRKA 4RDIA 1X0XA 2IYOA 2EWMA 3HB5X 3RUIA 5CEFA 4J49A 4ND1A 4H15A 3GF4A 1XEAA 4W82A 1TB4A 4J4BA 2FR1A 1B15A 3DOCA 5KTKA 5DF1A 4OQYA 2O3RA 2PKRA 2J5QA 4MP3A 1B7GO 4N5LA 3G1UA 3WDSA 1W6UA 3WYCA 5ITWA 4CQMD 1VC2A 2EF1A 3AFNA 4CLOB 3GNTA 4NJOA 3GG9A 4D0RA 8ADHA 2WD7A 1SBYA 1Z73A 2BFAA 2R00A 1VI2A 1H9AA 3ZWPA 1DC4A 3BHIA 3PWZA 1VL0A 1U7TA 2CF6A 4O0LA 3G17A 3I5MA 2Y93A 2IYPA 1R0SA 1B8PA 1Q7GA 5JDIA 3ZWWA 3GQVA 2GN8A 4OJNA 1Z74A 4YDRA 4GH5A 3CKYA 3TDKA 4E6PA 2EKQA 1NPYA 2D4AA 2Y1DA 3QVXA 4HV4A 4WEQA 2IZ1A 2NTNA 2C2YA 3JD3A 2CD9A 2VWGA 4MVJP 4BNTA 3G1TA 1ENOA 1PZGA 2NVWA 4AJPA 3PI7A 1KS9A 4IUYA 3NT2A 3WBFA 4RVDA 2OP1A 4P4GA 5LCXA 2E6UX 4WCFC 3LF1A 1R4MA 4B8ZA 2NTJA 5LDHA 4TROA 3K30A 2GCGA 4UUPA 3VAZA 2AA3A 1ORRA 3GY0A 3F5QA 2DFVA 1KY5A 4TWRA 4HFMA 3TFQA 1K2WA 3S55A 4XQ9A 5BNIA 1YOVA 1LA2A 3AOEA 2A4KA 4XB1A 4GMGA 1N7HA 1D8AA 3G3EA 3KYDB 4OKIA 5H81A 2H1SA 2QRJA 1QV7A 3KSUA 3WTCA 3SC6A 3MJEA 1UXGA 3OF2A 3O26A 5AXCA 2NTVA 5AXAA 1DIGA 2EG9A 1AHIA 1F0YA 1GCOA 1Y1PA 1YXMA 1JVBA 1K6XA 2EXXA 4PLVA 4I5GA 1GQ2A 3RROA 1NAHA 4A10A 4MVJA 4J1SA 4MVJH 3DMYA 4HFNA 5JNLA 4RO0A 2I99A 3RAJA 1G0NA 1H2BA 4UULA 3GR6A 1E92A 4HP8A 1P31A 4R51A 1Y8RA 3PYLA 4ITUA 1GPJA 2C7GA 5KJ1A 2GGSA 2O4UX 1PEDA 1JA9A 4Q9NA 3ZHYA 2GRAA 4K6FA 2VNSA 3JQ7A 3MOGA 3OA0A 4CM8A 4CM9A 4CJXA 1EUCA 1HDXA 3ZWBA 1XG5A 3D3WB 3DR3A 1E77A 4UVGA 5JMWA 1J5PA 1C1XA 1A27A 3WSVA 4B4OA 1B8UA 3MWDB 3PGJA 3F4LA 4K1LA 1PGOA 1R15A 4RZHA 2O4CA 3P2OA 1ZUD1 1YONA 4ALMA 1X7GA 1HE2A 1LC3A 4IDAA 2PZMA 4AJHA 4HKTA 1I36A 5KKAA 1XKQA 4W9NA 5DBIA 1AUPA 4CQMA 5TJ9A 1SNYA 4GLLA 1O6ZA 1Y6JA 4QXMA 4E21A 3HADA 3MCVA 3JQBA 3SLKA 1NVTA 3M6IA 2XOXA 2CF5A 4BOYA 2JD2A 3GNSA 3PXXA 4NFSA 1GUZA 4BO0A 5BSEA 1LX6A 3GN2A 3HE3A 1NR1A 4NZ9A 1NHGA 2PZJA 4PG6A 1F14A 4GVLA 4TZKA 3IL2A 3DZKA 5IAAA 4WK6A 5G4KB 2HSDA 4Q3CA 5DP2A 3BTSA 8LDHA 2HJRA 3EMKA 1HT0A 2F1KA 2YHUA 4NFYA 2Q49A 3HDQA 3TPCA 1EBFA 1PR3A 4GLOA 5ICSA 1KY4A 3GG2A 3O8QA 1I3NA 2X5KO 3IUSA 4IDBA 1YBAA 3O4RA 4CR7A 3CMMA 4ZQEA 3X2EA 1DPGA 3EDMA 4LN1A 4Y6RA 4B4WA 4OQZA 3WTBA 2H63A 1ONPA 2W2KA 1PU2A 1PJ2A 3U0BA 4DQXA 1NQAO 3DEYX 5JAZA 1IL0A 1W73A 3H9UA 4FB5A 2IODA 4MVJG 1U7HA 4OHUA 2UVDA 4K6CA 4YJHB 5G0UA 5GMOA 4JXKA 5JLAA 2Q1SA 2QRKA 2YFQA 3QY9A 2HMUA 4J9VA 2VTEA 1GR0A 3TZKA 1CRWG 3BMNA 1C1XB 3UUWA 1R37A 2C59A 3BMQB 4D46A 2CVOA 2LDXA 4P4NA 4OL9A 4ZQBA 4CM8B 4RLSA 4PG7A 5F5NA 4M54A 3MWEB 2ZYDA 2V6MA 4ZQHA 4R3WA 1XYGA 4DQUA 1M66A 1MC4A 2WJPA 2Z95A 3R6DA 4XRGA 1HDZA 3TN7A 2P9EA 4IJWA 1Z82A 5TSDA 1JQBA 1SO8A 2O3SA 1YDWA 1I5RA 1EQUA 3F6YA 3WQSB 4RF2A 3ZV3A 2FWMX 3NEPX 4NG5A 4TKLA 1K0UA 1O5IA 3RUEA 4EUEA 5CPFA 3ANLA 4AJOA 1UR5A 5DN9A 3L6OO 3AU8A 1ZZEA 2UYYA 4W7HA 4XYGA 3HHPA 1YBVA 2I65A 2ZKLA 1CETA 1CYDA 4CV1A 4TZTA 3E6AA 3GDOA 1IULA 3ENKA 3GGPA 2IXBA 3LLVA 3F1LA 2D3TA 3JQAA 4IGFA 2ZB7A 1KEWA 2EGHA 4KZPA 1BVRA 2ZIZA 4FC6A 1V6AA 1UDAA 3OQ1A 3KBOA 1P0FA 2O7SA 3FRJA 1E0DA 4Q3AA 1KETA 3TSCA 3LT4A 2YDYA 4RF3A 3QWAA 3JD0A 4PFJA 4B4VA 3W8FA 1LDMA 3DAPA 3DC2A 4NMHA 4B7UA 4LRTB 2C0CA 4KP7A 2QZZA 2FR0A 2OORA 4MDHA 1KVRA 1JWBB 4J4TA 4J43A 5DT9A 2DTEA 3FNEA 4U6SA 4BO3A 3JYOA 2ZQYA 1R12A 1NFRA 3I83A 3RUHA 3JSAA 3IQDB 5DCWA 3DZHA 1L7EA 1NNUA 4NBUA 3OIGA 3NDIA 1GPDG 1ZK4A 1U3UA 4TRNA 4YT2A 1CQIA 1M6HA 1QKIA 2CY0A 2JHFA 3NKLA 1HE3A 1PSDA 4GGOA 4YJDA 1V3VA 4FFOA 2J3JA 3CSDA 4EBFA 4O5OA 1PQPA 3OJ0A 4LW8A 2DTXA 4LMRA 5MDHA 1N1EA 3IUPA 4Z0PA 4E30A 3W8EA 2IEBA 3FPCA 3ZNPA 4XGKA 3ICPA 4FC7A 2Q4BA 4F45A 1OI7A 4LRSB 3WBBA 2HK7A 4O6VA 2ZQZA 3ONEA 1DLJA 3MEQA 2X6TA 3QHAA 1TT5A 4FJ2A 3ZWYA 1BDMA 2Q1UA 3S2GA 2BF7A 2O3TA 1GU7A 4GMFA 3QVWA 3OH8A 1T2FA 2TMGA 2Y0CA 4NDNE 2NU9A 3ON5A 3SXPA 1V35A 3WFIA 2O3UA 3C1OA 3VC7A 1O9BA 5G0VA 1LTHR 3GPIA 3AI3A 5T64A 1PJLA 4JP2A 2E37A 3GVXA 4N5MA 3ASUA 4Z9XA 2BKAA 1LLCA 3WNQA 2DAPA 2WM3A 1GAEO 1TEHA 3DHYA 4XYEA 5TIIA 3FBGA 5TRTA 4BGVA 1VSVA 5CP8A 5DCUA 1ISIA 4E5MA 2DLDA 4ZHSA 5U9CA 3VKUA 3KB6A 5U1PA 2BH9A 1M76A 4P8RA 4IIVA 1GQYA 4FOSA 3B70A 4H16A 4QTZA 4Y6SA 3FPLA 1N8KA 1NTOA 2YZ7A 5IZCA 3B1FA 1DSSG 4BKQA 3GA0A 3HSKA 4FQ8A 4BGEA 3DFZA 2AE2A 1VRWA 2G76A 9LDBA 2VYVD 3EVNA 4CMHA 1PJ3A 2CDAA 1LRKA 1Z45A 2X23A 5F1PA 2FRDA 5I9LA 1X13A 3UGKA 2EJVA 4GSKA 4PLPA 4KOAA 2AQIA 3EVTA 4MVJE 1A5ZA 1PS9A 3RFXA 2WE8A 2ZCVA 4WPGA 1SEVA 2R6JA 5ICMA 3WQRA 4BHTA 3GVHA 1P0CA 5CDSA 5A3VA 4XGNA 5G0WA 3QIVA 4D3SA 3GH3A 4ALIA 1QORA 4RVGA 4BMNA 1XELA 4YB8A 1OC4A 1ZSVA 2EP5A 3PTZA 4PCVA 1MUUA 2I3GA 4CLEA 1DIAA 4YCAA 4DPMA 2CUKA 4YAIA 1GYRA 4Z3DA 2YV1A 4FR5A 3W8DA 2D2IA 1Y8QA 3KXDA 1PJBA 2D59A 4C4OA 3RFTA 3IKVA 3JTMA 5AYVA 2A94A 3JQ7B 1HLPA 1LU9A 1Q7CA 5EQDA 1I01A 2C07A 1ZJZA 4UVDA 3VPXA 1MB4A 1T1RA 3AY6A 5DBGA 1ZKMA 1NPDA 1OAAA 3VZPA 4II2A 5GZ3A 2WYVA 3K2BA 4PN3A 1E5QA 1MG0A 3B20A 3GAFA 1DHRA 3K9QO 3ETEA 4FN4A 2UV8A 4BNMA 4D44A 3DZJA 3PJEA 3ETDA 2HLPA 2CMDA 2AXQA 2O23A 3L07A 5CDGA 2Y0EA 3BIOA 3Q11A 4PG5A 4YQZA 5B4UA 3TZHA 2IEDA 4YVFA 3ZHXA 1O8CA 1M6WA 3WNVA 3FHLA 3WGQA 1MXHA 2VHWA 3OEWA 2C82A 1RPNA 4P22A 4LMPA 4RF5A 3Q1LA 4EI2A 4EDFA 1Y9EA 1ISMA 1RKXA 2JCYA 2JFGA 5C7LO 4WCDA 1M2WA 4YRBA 1WXDA 5IDXA 4LSWA 3WLFA 4FS3A 4BO4A 1NPTO 5FF9A 3RUFA 4Q3BA 1L7DA 3RKRA 1DO8A 3GFBA 3CE6A 3BTUA 1VPDA 1PL6A 4XX0A 4CLHA 2OZPA 4U0JA 4A73A 3JQFC 2FMUA 3LT2A 2CVZA 2RH8A 4CLRA 4QO8A 2QRLA 4Z9FA 5TJHA 4CMGA 4E5NA 2Q2WA 4YJFB 4WECA 1IPEA 4J1NA 5FEUA 2YV2A 4R5HA 1H6BA 1GZ4A 2VHYA 3TOZA 2B36A 2OO5A 5L45A 1JN0A 4E32A 1TA4A 3KZVA 4B3HA 4BNYA 3GUYA 2G5CA 4YR9A 1DBVO 1FK8A 4PVDA 5BR7A 5L9AA 5MGBA 1SB9A 1N2SA 1ZEMA 4PLYA 3WX0A 4KUEA 2GDZA 5TT1A 3SBOA 1PGPA 4WLNA 2J5KA 5HM8A 2NU8A 1OZAA 1T4BA 3INRA 4FFLA 1UXIA 2H9IA 3D1LA 4NHEA 2BFMA 4R4JA 5CPBA 2VYNA 4GKVA 4RZIA 2P5UA 3IIEA 2GR9A 3NV9A 1UDCA 4QECA 1NYTA 4FCCA 1P1RA 1Y8QB 1DC6A 1E7WA 2EV9A 1XIVA 4I8XA 4UUNA 4PZDA 4CM6A 3TL2A 1R4NA 3B1KA 2JAPA 4ZQGA 4CR6A 4E2ZA 2LDBA 3H9GA 5IFLA 1YS4A 2Y1GA 3D5TA 4ZA2A 5IDQA 3I3OA 5EESA 4KQWA 1DXYA 5ENVA 4BKRA 1PJQA 2QZ9A 5KIAA 4AJLA 3VDRA 1ADGA 3RKUA 3HN7A 2ZATA 1U4SA 2BGKA 1NASA 2NWQA 4HXYA 2RCYA 5B37A 4CMKA 3R3JA 2BD0A 4BS9A 2YFHA 2JHGA 1XHLA 1X7DA 3EK2A 4BNJA 3GRPA 2Y0DA 1NFQA 2AQ8A 2VTDA 3QJ5A 1EFKA 4NU5A 5I9NA 3E9QA 5G0TA 5K0ZA 2EERA 4BNNA 4CMEA 3V8BA 2AE1A 5I7SA 2AHRA 3UKOA 4QX6A 1GYQA 1ADCA 3WWZA 1Y7TA 1O95A 1QMGA 4L4RA 1GZ6A 5I8WA 4IDFA 1SPXA 1I2BA 1LQTA 2NU6A 2I67A 3JQDA 1NX6A 5IZ4A 1EK5A 2DBQA 3JCZA 4JBHA 4BO1A 3GRKA 3S1LA 4GSLA 1IOLA 1VE9A 2YYYA 4WCFB 1BRMA 3TWOA 1EUDA 5EJ2A 3SJ7A 2HJSA 2YW9A 2AEJA 1HETA 2FZEA 1WP4A 2PKQP 2C29D 3KRTA 3PLNA 2OOSA 3F4BA 5BQFA 1WMBA 3S2IA 3RC1A 4CODB 4J7UA 3I9JA 4F6CA 2ZJ0A 3O8QB 1TVEA 2Y67A 3ZU2A 4PVCA 5A04A 1WZIA 1VJ1A 4QSMA 1JKIA 1EBUA 3TFOA 5G2OA 2E49A 2I5PO 3P7MA 1QYXA 2JD0A 2FHSA 4XJTA 3PLRA 2GN6A 3H5NA 2NVBA 2GPTA 3ZWOA 4MO2A 4AJ2A 3E5MA 3WXBA 1UAGA 2CVQA 4W7IA 3PQFA 5JYDA 4J16A 2NVUA 2NQ8A 4MVJD 1MGOA 3H9QA 2NSDA 2P68A 1GZ3A 4JGBA 4BNZA 1DIRA 1FDTA 1A4IA 3BMCB 4H7PA 4NK4A 3V2HA 5F1OA 3RBVA 2C5EA 5C37A 3T4XA 4OKNA 2PFGA 1EDOA 3ZGYA 1Z6ZA 2C20A 1E1MA 3OEYA 1KVSA 3NX4A 3QV1A 4R1NA 1VLLA 5L7WA 3FNFA 2ILTA 5CAEA 3HG7A 5L4NA 4BO7A 4G65A 2P5YA 1TXGA 5AOVA 4R16A 3N7UA 4NU6A 5CDUA 1JTVA 2OBNA 2RIRA 3DAGA 4YRAA 3VKVA 2EKLA 1DRUA 3W6UA 1X1EA 1NM5A 2I66A 3ZI0A 5A03A 5HWSA 5KJFA 1B2LA 3MZ0A 1GYPA 2XPCA 1F12A 3O9ZA 4II3A 3CZMA 3CINA 3RD5A 1R6DA 3ADPA 3JQAB 4CR8A 2CDBA 2X22A 4GX1A 4JQCA 3ZN2A 1H6AA 4MKXA 3RJ9A 3ROKA 3F9IA 2AG8A 4IQ0A 4IJUA 1VKNA 3AUTA 3MJTA 4BNLA 2B83A 1MFZA 4MKZA 4ONEA 1K89A 3NGXA 3PYXA 3M1AA 1R4NB 3OSUA 4A26A 2QHXA 1E7RA 2YHIA 3OJLA 4G5HA 3L6EA 3WQQA 4DLBA 1YQXA 4ZICA 3WMWA 2V6GA 4RF4A 3JQEA 3L0DA 3RFVA 5U4QA 3GN1A 4FGSA 5I9MA 5C7OO 4YJGB 1GFSA 2NV6A 4XA8A 3FBTA 4DGSA 3SLGA 1QP8A 4E33A 4GVXA 1CDOA 1C0LA 2B69A 3FSRA 4DIOA 1K6IA 4RVFA 3VPSA 1ZO8A 3U5TA 1ONOA 4BO2A 4IMPA 4DREA 3K31A 5TLSA 1NXQA 4BKPA 3PHGA 4WGGA 4DWVA 3JV7A 1ARZA 5A9TA 1YKFA 1S7CA 3W4JA 1CWUA 5TC4A 1PJSA 1IPFA 3DQPA 1P3DA 1ML3A 2XF8A 2E48A 4FFNA 5A3JA 1FJHA 2QYTA 3RC9A 1H6CA 3I6IA 2Q45A 4EEZA 4N7RA 3JQ8A 5ER6A 1T26A 3PEFA 3SC4A 1EK6A 1EEHA 1S6YA 3CH6A 1H6DA 4BO8A 2WE7A 2ZB4A 4GQAA 4W6ZA 5T57A 1AE1A 1IZ9A 1ULUA 3NDRA 1I32A 3PIDA 4IDCA 4INAA 3TJRA 3HDJA 4BB6A 5T5QA 1DFHA 1MX3A 2FPGA 1LSOA 4E5PA 5CHEA 3AUUA 5JC8A 7MDHA 3AM3A 1YGYA 3I4CA 1A9ZA 4IY1A 2DUWA 1GEGA 3HFGA 1SC6A 4YAEA 2V65A 2WD8A 3AI1A 3RUDA 1XU9A 3IC5A 5BSGA 1U28A 2XXBA 4E4YA 1DC3A 2G17A 2UAGA 1BHSA 2A35A 4ZU3A 1ZSYA 3DTYA 1YOVB 3LVFO 5THKA 1E3SA 4RPHA 3OM9A 1X15A 2ZTMA 1AGNA 1MP0A 1PZEA 3SX2A 3UF0A 4A2CA 3KHUA 4J1QA 4EJMA 4WUVA 3U09A 1D7OA 2AG5A 1HEUA 3RBXA 4I1IA 3NAQA 1YDEA 4S1VA 4GWKA 2Q2VA 3LT0A 2VZ8A 3JQ8B 1UDBA 1DFIA 4NI5A 5L7YA 2IZZA 5K6AA 1PQWA 1LQUA 5H83A 1WMAA 2VNAA 3EAGA 3KUXA 4DYDA 3WJ7A 5CEEA 4J2OA 3FTPA 4P4LA 5C7IO 1CQJA 1HDGO 1LBEA 4TRJA 2HRZA 3E8XA 3JD4A 4Z0HO 3FNGA 2VT2A 4BNHA 4CMIA 2PWZA 3PFWO 4IQ8A 3AM5A 3DMTA 5DP1A 3VH3A 2X0IA 3D3WA 2HMTA 1U5AA 2X0NA 3RVDA 3GFGA 2B4QA 3IP1A 4L8VA 4PZEA 5COQA 4B3JA 1T2EA 3BMOA 1B0AA 2AEFA 4AL4A 3ANNA 1I2CA 1YWGO 4FSHA 3X2FA 5L51A 2C54A 4W9NC 4XWYA 2DPGA 1UH5A 5L40A 2XAAA 3BA1A 1I30A 1HRDA 2V7PA 2Q1WA 3U4HA 3I4FA 1LSUA 3WJAA 2OBYA 2VHVA 3MJVA 5FWNA 3GK3A 3ZDFA 5KJ6A 1NBOA 3PYMA 3R0IA 4F46A 4RQTA 4CPDA 3DZIA 3JQ6A 4Z9YA 4CM4B 3OICA 4B79A 3WGYA 1TI7A 3KOUA 2ZJ1A 5FI5A 4UUMA 4E13A 3M2TA 5KCZA 2P4QA 3ZU3A 4B7XA 4E2WA 2X58A 1PGJA 3L9XA 1TLTA 3L9WA 5C3MA 3DBHB 3VOSA 3CZRA 3W1VA 3D3EA 3KYDA 4HWKA 3AFMA 2OL4A 3PQEA 3A14A 2OUIA 3R1IA 3W4IA 4I5EA 5KWEA 4IXWA 2EW2A 3C1AA 3H5RA 4CQLB 4R69A 2VRCA 3PJFA 3GT0A 1K5HA 4DVJA 3CTMA 3B1JA 3GOHA 4KQXA 5LC1A 1EZ4A 1RM4A 3HQ4O 5AVOA 3PZRA 4RORA 4FDAA 3DOOA 3TOXA 3IOYA 1SAYA 3PHJA 3ZWMA 1IY8A 5T6BA 2BFPA 1QR6A 4DIBA 6ADHA 1GTMA 3GEGA 4G81A 4OIMA 2X4GA 1XR3A 3GZNA 2ZTVA 4IS2A 4BNFA 4MP8A 3RU7A 3QSGA 3RBZA 1J4AA 5KVSA 4OSPA 4BNXA 5TNXA 2BELA 4ESOA 3OHSX 1PS8A 4WE3A 4G2NA 3ZWVA 1HTBA 3TF5A 4DLAA 3TZCA 3EY4A 2HMVA 4D3DA 1DAOA 1BTOA 3OA2A 4D42A 4WCFA 2YQ4A 3ZWXA 4JCOA 2C5AA 3FWZA 3BMCA 1C3VA 3K2EA 5F21A 2QX7A 1M67A 3KYCB 1EFLA 3H4VA 4QFCA 4RGBA 4MVJM 2JJYA 3TRIA 1QRRA 3KETA 1T2CA 2F00A 3OFSA 4N5NA 4J4HA 3WGHA 4PIVA 5HRUA 1CIVA 1JVSA 3G79A 4IPTA 3VTZA 1VJTA 1ISFA 2HRBA 3FI9A 3QWFA 3VTFA 5JDIC 4RPKA 2W4QA 2BI8A 3UXYA 3UCXA 1P1KA 3QVTA 5EERA 3AM4A 3LU1A 4AJEA 1UXHA 4Y6PA 3UFXA 4YYZA 3U4IA 3QA9A 2R00C 4U5QA 1DB3A 4R1UA 2J3HA 2Y68A 1PS0A 1OMOA 3QW2A 2X9NA 4XIJA 3BTOA 5L3ZA 4LK3A 4UUOA 5FYDA 5CG1A 1WLYA 4YTEA 2PZKA 4J90A 2Y1EA 3DOJA 4BIIA 2I6TA 2J3KA 2VT3A 1P9LA 1ADBA 3DBVO 1LDBA 5A9SA 1LDYA 5HBRA 1E1LA 1HLDA 1WDKA 2FPIA 1RYEA 4QFDA 2P91A 3I6QA 1SOWA 1DJNA 1UJMA 1PR9A 3GGOA 3OJEA 4MKRA 1E5LA 4BMSA 4FD3A 3WR5A 4FFPA 3ZU5A 2DC1A 4BO6A 5GY7A 4N54A 3RCBA 2YUTA 4O59O 3V5NA 1GDHA 5AQ1A 3OETA 3PHLA 4BL5A 3CIFA 1VL6A 4CQMB 1MA0A 2YQ5A 2VZ9A 2VRCD 4BB5A 2A92A 2DBZA 3B6ZA 1U3WA 1QXSA 3GZNB 3ZH2A 3K6JA 3I9KA 3IP3A 3E48A 1LJ8A 1UP6A 3FR7A 4E31A 3PZBA 5JCXA 3ANMA 1NQOA 4GKBA 2PV7A 1O94A 3I52A 3GVIA 5JC1A 4HFRA 1IHYA 1H9BA 1ZIDA 2JKVA 3D4OA 3KEQA 5L7TA 2VWQA 4AJJA 4EZBA 3PWSA 1N1GA 3E9MA 3D4NA 4YT8A 1IUKA 1W4ZA 3JYQA 4MIEA 3AOEC 3WOHA 1H93A 1HXHA 3ADOA 4EGFA 1BXKA 3LT1A 1YBMA 1ISHA 1I33A 4I9HA 3Q2IA 1E6WA 1GEEA 4R01A 4KWHA 4RPJA 5DULA 2B37A 5JE8A 4E5KA 2X86A 1G6KA 4F3YA 4LISA 1WZEA 1I24A 4XKJA 5JY6A 3H7AA 3AWDA 3UHAA 1JKFA 3EYWA 1YB5A 3V1UA 2WYUA 1Q2XA 2W2LD 3MTJA 3QWHA 2I3AA 4AJ4A 3ITDA 4NFHA 1FDSA 4GL4A 1VJ0A 3JQGA 2P9CA 2RHCA 5KKCA 2DBVO 3PPIA 5I8ZA 5B12A 1A9YA 4L75A 4BV8A 1PGNA 3M2PA 1WAMA 4DC0A 1E3LA 3E03A 3DFUA 3A28A 2P9GA 4HX5A 4PLTA 4R5MA 2Y05A 4ALLA 1Y5MA 4OH1A 4YAGA 1DOHA 2FP4A 2BRUA 3KEOA 1T4DA 1B16A 3RSHA 1EQ2A 2CZCA 4LSMA 3ABIA 1T2AA 2RH4A 2CDCA 1KEVA 3DZGA 2VZ0A 1UXKA 4JBIA 1I10A 4DXHA 5CG2A 1C0KA 4L9RA 2OFPA 4AG3A 1EVZA 3U4CA 1HE5A 3HZZA 5ENDA 2DPHA 3WIDA 5A9RA 3PDUA 5A06A 3QWBA 1N5DA 1E3EA 4D43A 2W98A 2NADA 1PJTA 1PZFA 3LF2A 2ZTUA 3V2GA 1NR7A 1EVYA 4PLGA 5G0SA 4RV9A 3GLQA 3GHHA 4LCJA 3HN2A 3FR8A 2X9GA 2GZ2A 4IXTA 3UICA 3WWYA 4R1TA 3L6DA 5TT0A 2HQ1A 1KOLA 1ZMOA 4GGPA 1ZVMA 2E82A 2JFFA 3EC7A 4TQGA 2Q2QA 9LDTA 2G82A 2Q50A 1QYCA 4FJ1A 1FDWA 3MTGA 1ZSNA 4FFMA 2NVUB 3T7CA 3P2YA 2JCVA 5CFZA 1V3UA 3GDGA 3ZV6A 5H82A 3O38A 4WLFA 2HCTA 4CQLA 3VPGA 1CF2O 2FN7A 4OXKA 2CFCA 1E7MA 1PZHA 2D8AA 4PRLA 1J6UA 3NDJA 3I9MA 1IZ0A 4LGVA 1ULSA 2OMEA 1LSJA 5DZSA 1PWZA 4PG8A 3H2ZA 5EIOA 3ST7A 1IB6A 3A4VA 4Y9DA 1LRJA 1N92A 1R16A 4GI2A 1K3TA 2NM0A 2OGUA 3HNPA 4UVIA 1R0KA 4XB2A 4GBJA 4CM4A 4GAEA 1HYGA 1UUFA 2YHIB 3I1JA 4BUCA 3V1YA 1EDZA 1UP7A 4CM7A 1Y5RA 2OHXA 1XA0A 5T8KA 4ND4A 3H9JA 5I7FA 4XGIA 4MJLA 3DTTA 3UAGA 4XIYA 4PLZA 1WVGA 1FDVA 4TRRA 3ZCXA 4XQEA 3HDYA 3WLEA 1LRLA 3GEMA 5GZ1A 1F06A 3WGOA 5JPIA 1RM5A 2EGGA 3DDNA 4L76A 3STHA 1U5CA 3JYLA 1B26A 1E3WB 1NWCA 4RVUA 3DONA 1A7KA 1ZW1A 1DLIA 4RVSA 2ZYAA 1E3IA 1VM6A 3ZV4A 5ILGA 2NU7A 4Y98A 4YJFA 4BNIA 3S8MA 5EN4A 4UEJA 4BNUA 1ISGA 4DUPA 3I9LA 3JQ9C 3K8ZA 5THQA 3SJUA 1XQ1A 3ULKA 2BMAA 2BFOA 1ZEJA 3ZNNA 1U8FO 3LZ6A 2AEMA 1OC2A 5CDTA 1R4MB 3DBHA 4WASA 4MVJF 3DWFA 3DL2A 5JY1A 1Q0LA 3FNHA 4A27A 1W8DA 3WGIA 2BHLA 4XR9A 3EZLA 4A7PA 3EW7A 3ROPA 1L1FA 1ZCJA 2FSVA 2ZK7A 3AY7A 3GMSA 4GPD1 2PK3A 1JLLA 1KVUA 1JAYA 1ZNQO 1C0IA 4MP6A 4EJ6A 2X8LA 4DRYA 2B5WA 5TX7A 3C7CB 1O89A 3ETGA 4CLRB 1C0PA 2J5RA 3C24A 3LC1O 4WKGA 1OOEA 2EIHA 4XQCA 4RDHA 3V1TC 5TF4A 3BTVA 3MJSA 3BMNB 3VH1A 4B7CA 3GC6A 4BVAA 3E9NA 4R1SA 3AW9A 4IS3A 1VL8A 3ASVA 5DNAA 1ENYA 4DC1A 4DLLA 3RI3A 2DU8A 3OQ6A 4IINA 5KJCA 2J6IA 5A02A 2WTBA 3VVBA 2D5AA 3OBBA 4YACA 4ZRNA 1E7SA 2HO5A 5F1KA 5JDCC 1SOVA 1ZJYA 2RAFA 3N58A 4YT5A 4ZN6A 1T1SA 1Z7EA 1LLQA 4XD2A 4BKUA 4S3MA 4WJZA 4L4XA 5IDYA 4M55A 3GGGA 3OJOA 4CUJA 2JFHA 2EJWA 3KYCA 4PLWA 4ALKA 4M8SA 4CMAA 5IF3A 3G49A 4NPCA 1ZK1A 2DKNA 2Q99A 4PLHA 3COSA 4RJTA 1U3VA 1MG5A 4FFRA 2ET6A 4Z6KA 3ZWNA 4I9UA 4NBRA 2X1HA 4CV2A 3PGXA 2O7QA 4YRDA 4O63O 4OSOA 1H0KA 1R66A 4YJHA 1LEHA 1XDWA 4HY3A 3RJ5A 3MJ4A 4W99A 1YE3A 2VOEA 4XCVA 2V6BA 3NRCA 3GVCA 1D1SA 4BGIA 4I08A 4O1MA 1JWAB 1BXGA 1A71A 1ZMTA 3RQSA 4A5OA 5JCJA 1W0CA 3VPHA 1KC3A 1QYWA 3KLPX 3KSZO 4H3VA 3A9WA 3DXFA 4IDDA 1LLDA 2G0TA 3BAZA 4DIFA 5K9ZA 2DM6A 1PJ4A 2DTDA 5BSFA 1ZK3A 1KIFA 1LI4A 4AICA 4B4UA 1HWYA 4D3FA 1MC5A 3PHIA 3H5AA 1P77A 1E7YA 1SEPA 4R9RA 3RWBA 4CLDA 6LDHA 5HS6A 3DZFA 3ZHZA 1GV0A 1FMCA 1RYDA 3KM0A 2PTGA 5ADHA 1ZFNA 3WS7A 5JAMA 3K96A 4NH4A 1CERA 1PIWA 1NQ5A 1NQTA 4J0EA 1TT7A 4OMUA 1YL7A 3AI2A 4PG4A 3TZ6A 4Z0TA 1NAIA 1K6JA 1SCUA 2I76A 5DOVA 3PFFA 1R0LA 4XDZA 1Q0QA 4CM3A 4EITA 5JAQA 4YPOA 4ILKA 4OXNA 3VHRA 3WG9A 4YEDA 1HL3A 3OIFA 2PGJA 4OAQA 3WGZA 2Q1TA 1QLJA 1OBFO 4XDYA 1C14A 3LK7A 3ZU4A 5C5IA 2Z1MA 1U2GA 4WNCA 3QE3A 4DBVO 2O50A 2NNLD 1EE9A 2X5OA 3ZW8A 2PZLA 3GDFA 4RL6A 1HDYA 1I2ZA 1P1IA 1P1JA 2HUNA 3NJ4A 4P38A 2IZ0A 2IRWA 1Y8RB 4K9DA 2VWHA 3BYZA 1DRWA 3C85A 5ER9A 1UXJA 1UZNA 3NGLA 1KBZA 4BGUA 4NJMB 5DOZA 2SCUA 2Q4EA 4CM9D 3E1KA 2EHDA 3C3XA 2VWPA 3DZBA 5ES3A 4J91A 4HNGA 4AJIA 1BGVA 2GLXA 5BSHA 3AU9A 3ICCA 2DUUA 3DBLB 3R3SA 1DDOA 4M89A 3K5PA 3WMXA 1B3RA 2ZTLA 3A1NA 4CM5A 1BXGB 5JXWA 1I8TA 3WIEA 4RQUA 2P4HX 4CMEC 2GD1O 3A06A 2PGDA 2AMFA 3TL3A 4BO5A 1O0SA 5AXDA 3S2FA 1YL6A 4E2YA 3RIHA 1DAPA 1N9GA 3JQGB 4PZCA 3OQBA 4ALNA 5EQFA 2X0RA 3NJ8A 1LDGA 3NYWA 4KDEA 4WNIA 4IMRA 3Q0EA 1GD1O 3ROMA 3ROQA 1A72A 5TGDA 3OMLA 1MV8A 4GX5A 4ZVVA 5A4DA 3GUCA 2WDZA 3LSYA 5KVQA 5I7VA 1U8XX 2VUUA 2X0JA 4ZQFA 3RC7A 1F8GA 2GZ1A 2W8ZA 1U9JA 2O3QA 3D5QA 4YAKA 2O2YA 4XJSA 1X0VA 4JNKA 4M49A 4HNHA 4YWJA 4IDEA 5BT9A 3K73O 1NWHA 4JIGA 1M75A 2HU2A 2D1YA 4J0FA 4CMJA 2GN9A 1EE2A 3F47A 1DHTA 2J3IA 4LVUA 4BV9A 2Y66A 4MIYA 1YL5A 3KV3O 5FFFA 1HZZA 3LC2O 3HUDA 3IJRA 5G4KA 3BHJA 4WOKA 1T2DA 4E0BA 2GSDA 1U3TA 1HYEA 4UREA 3UVEA 5EMHA 4YT4A 3EZYA 3RU9A 5EPOA 2NUAA 3MJCA 1DJQA 4Y8VA 4J7CA 4E5YA 2JCXA 4D79A 5G4LA 4TVBA 4JK3A 4WOJA 4L73A 5J23A 3GZ4A 1YJ8A 3KTDA 1ADFA 2AW5A 4E12A 1JU9A 3L4BA 1HDCA 4Q3DA 1VKOA 4UAGA 1YQDA 3Q6IA 4IZHA 3VPFA 5IXYA 3U49A 2YY7A 2X7HA 2HAEA 3HDHA 3NT4A 1Q0HA 1LDNA 3Q9NA 2RHRA 4NBWA 1YH3A 4Y67A 1XU7A 1GV1A 2WD7B 2GERA 4XYBA 2AQKA 1QV6A 3RUCA 2FPPA 3FWNA 1WDLA 4Z3KA 4ND3A 5JFOA 2GN4A 4I5FA 4FPXA 4JJFA 1GL3A 3CPSA 1QYVA 1Z7BA 1AXEA 4B3IA 4URFA 4FOOA 2D5CA 1RM3A 2HKIA 4AJKA 4Q3NA 4CUKA 1QG6A 3GMDA 3ORFA 1LSSA 1QYDA 4CV0A 3DMTC 5CDYA 3DAFA 2BI7A 4NIMA 3ZZNA 4CL8A 3Q2KA 5L4LA 2PY6A 3U3XA 4JJIA 4JLWA 4DA9A 3PDJA 3D0OA 1AN9A 2VN8A 1Z75A 1FDUA 2ZYGA 2Y99A 3JQ9A 5KJEA 1P1FA 2IXAA 3QRWA 4PGFA 1PX0A 2V6FA 4IBOA 4U7WA 1EMDA 3WSWA 3ZNOA 2BGLA 2FZWA 1BW9A 3DHEA 1WPQA 2W2LA 1NP3A 3FN4A 5K6AC 3H3FA 3F1KA 2JD1A 4BQRA 1LDEA 2POQX 4YA6A 2WSBA 1F17A 4RVHA 4WLEA 1RM0A 3U9LA 4YQYA 1BSVA 2TMDA 1D4FA 2DT5A 2VYVA 4JBGA 2FOIA 1ZH8A 1HKUA 3KSDO 1GUYA 1EUZA 3BZUA 1ZXBA 3G0OA 3T7EA 5AXBA 1XSEA 5T8KC 3W4KA 2R2GA 4MIOA 2A9FA 4RLHA 4WLUA 3WFJA 1HSZA 2DQ4A 3L77A 3H8VA 4IQGA 2W90A 4J1TA 2GUGA 2FY8A 4TRMA 3N74A 1VSUA 3WYBA 4ALJA 2PH3A 5F3RA 2QYSA 4XYMA 2PKQO 1X7HA 1I0ZA 2VHXA 2CSUA 1QSGA 3GEDA 3SEFA 2D0IA 1XLTA 3QLJA 4EUHA 4K26A 4I5DA 5IN4A 3PRJA 2QQ5A 1MLDA 4R68A 4R9SA 3S2EA 4D0SA 2BLLA 2O48X 2EP7A 2PA3A 2ZCUA 1IYZA 3LC7O 1E6EA 3AUAA 4KWIA 2PD3A 4A0SA 3ITKA 1WW8A 3GNQA 3CEAA 1JDJA 1SMKA 1D1TA 3OJFA 3VH2A 4DPKA 1B8VA 1BW9B 4BNVA 3ONFA 5EL0A 1DIBA 1Y9AA 2WYWA 4JP3A 4FW8A 5JCJD 3VZSA 4CM1A 2B4TO 3H2SA 1Y81A 3EGOA 2PLAA 3JQFA 4OOEA 3ONDA 2GF2A 1P33A 5IJZA 3H9EO 2W2KB 4EEXA 5IG2A 2DVMA 3CUKA 4CV3A 4MOWA 4FJ0A 4YJGA 4GX2A 1P74A 4XRRA 3O03A 5COBA 2CNBA 4BKOA 1DRVA 3H3JA 2DBRA 4U0KA 4XR4A 4YAJA 4DPLA 4KDFA 3L4BC 5I7EA 2VOJA 4QT0A 3PHHA 3WGTA 2GASA 1B14A 1AHHA 3PIIA 2HMSA 3LQFA 4D45A 4NK5A 4OGWA 3NT5A 3VZQA 1LXCA 3ZV5A 3JQCA 5L4SA 3QVSA 3DBLA 4OM8A 1KVTA 2B4RO 1E1KA 1XQ6A 2Y1CA 4HADA 1UZMA 2WWRA 4L4SA 1HF3A 3E82A 3PJGA 2FR8A 2VUTA 4JN6B 3I9OA 1F8FA 2NQTA 1PJCA 1RJWA 2BGMA 3RC2A 3UH1A 1WNTA 3ZWCA 5L95A 2PGLA 2WEKA 4DYVA 1WWKA 1E6UA 4IM7A 3HJAA 3Q9UA 3UOGA 2VHZA 4CMIB 2Y1OA 3D7LA 2B0JA 2YDXA 4NJMA 4U8GA 5COAA 4B8WA 3IDSA 4MVJI 3IAHA 1JAXA 2OP0A 2WMDA 1BDBA 3AK4A 4ND5A 2EEZA 3RASA 4CLXA 1IE3A 2VCYA 1G1AA 5JMPA 5BNTA 2Q46A 1KYQA 3VZRA 2O2SA 2HK8A 3L4SO 4BMVA 1XCBA 2XXJA 2HDHA 3GHYA 3CXRA 4L0QA 4QUKA 2Y1FA 3H65A 3PP8A 4ID9A 4TSKA 2YJZA 3ZHBA 1UZLA 3C1TA 1GY8A 4TVOA 3DO5A 1ONNA 1BXZA 4PLFA 2RBEA 5DDIP 1A7AA 3F5SA 3NTRA 4EJ0A 3C7DB 1YVEI 3KLMX 3LYLA 4HUJA 4M86A 4GWGA 2QG4A 1C1DA 1T24A 1E3JA 3HWRA 4OXYA 4OO3A 4FGWA 4EYEA 3TNLA 5IN5A 5A5FA 4IDGA 4CLOA 3P19A 1H5QA 4R41A 3WYEA 1FXSA 1ZXLA 5JDCA 4J2HA 4DMMA 4LCEA 1H94A 5TS3A 1HSOA 1Q1NA 5ITVA 4OYRA 3MOIA 4MINA 1QLHA 4RPGA 4U6QA 1MXFA 1WDMA 2DFDA 1KEPA 3I23A 3E18A 1GQQA 4BNGA 4C7JA 3CMCO 4ZD6A 4AVYA 1BG6A 4XZ3A 4BO9A 3JQAD 1MFPA 3KO8A 2B35A 3DBRA 4OOFA 1EVIA 5IZCC 4BNKA 1B3BA 1NVGA 4WLOA 4HBGA 4D7AA 4J6FA 1PQUA 3H6KA 3K92A 1A4UA 1XWFA 1YB4A 4KMSA 5L53A 3IS3A 2JL1A 2VQ3A 1PTJA 4ROSA 1GADO 4CMBA 1NFFA 1BWSA 1SB8A 2E4AA 2EW8A 2HMWA 3UCEA 4YBZA 1V3TA 5JS6A 3T4EA 2PD6A 5CEJA 4WLVA 2B5VA 4EUFA 1DIHA 3QQPA 1NHWA 4DQVA 5T67A 2IE0A 1T25A 4NQZA 3TZQA 1IHXA 1I3KA 2HK9A 3FD8A 3EHEA 3IMFA 2GNAA 4ND2A 2J8ZA 1KERA 5KNLA 1GCUA 3FCOA 3IKTA 1V0JA 3VVCA 1I3LA 3PWKA 2C2XA 3FTNA 3BMOB 1LC0A 4HFJA 5KVVA 4YXFA 4UEOA 4FBGA 4RCVA 2FSSA 4IZIA 3ZWAA 4UEKA 4J9UE 3AOGA 1GUFA 5BNFA 2QIOA 4EW6A 3KYBA 1LNQA 3QVOA 4AJNA 3OIDA 5EINA 4E3ZA 1U4OA 4JJGA 3U4DA 2PNFA 3UCFA 4CUZA 4ZGWA 2Z5LA 1DFGA 1SZJG 1KVQA 4JX8A 4TMFA 2VUSA 4AFNA 1LLUA 1LUAA 1P44A 1HZJA 4QEDA 1HDOA 4ZJUA 5KVCA 3ENNA 2UDPA 3JD1A 4DMLA 1TT5B 4Q39A 3EUWA 1PL7A 3D64A 3LLSA 4J7XA 3ZW9A 1CEQA 1ENPA 3INTA 4XYLA 1ID1A 1KEUA 5ILOA 5DCYA 3ZNQA 4J3FA 4A03A 4E2XA 3VDQA 5JAIA 1OFGA 2IDZA 3Q3CA 4XQGA 3F3SA 4WEOA 2Q3EA 4KTTE 5GZ6A 4IJKA 4RPLA 3NUGA 1PGQA 2AQHA 4M1QA 5FI3A 1YRLA 1BVUA 2P2SA 4IJVA 1U1IA 2Z1NA 1UP4A 2H6EA 4UVHA 4DL9A 5TQVA 3PQDA 2H5LA 3JQBC 5A1TA 4R54A 3WICA 4DBZA 4KUHA 5HA5A 1V8BA
chains in the Genus database with same CATH superfamily
3T3GA 4GX0A 4M1TA 3RE1A 1OLXB 2YJ4A 3ZLUA 4C7KA 1BU8A 1ECBA 3T3PB 5H4GA 1NVMB 1VJGA 5JQWA 4IIUA 3FF1A 1W36D 2A0FA 3D59A 3EXIA 3JD2A 3W6ZA 4OI0A 4DTIA 3GVPA 3AF1A 4HAWA 5FYQA 1F3LA 3RB8A 5AKIA 3C3MA 4WJKB 2PR2A 3LH5A 3NHWA 3WDLA 4DSTA 3M5CA 5KYTA 5CX1B 3TQTA 5F12A 2H1IA 3B1VA 1OB2A 2YYZA 4Z4CA 5JT1A 5AVYA 2A58A 5CJ2A 4X1OA 3AY3A 1YULA 2IF2A 3PQ7A 2WJ4A 2FW9A 4BJ5A 1ENZA 1FU4A 2NLOA 1SBNE 1JZTA 1AGPA 3QJGA 5JFTA 3OP4A 2QNIA 5BSUA 4FIZA 3OG9A 4BYGA 1X1TA 5A5EA 2FFQA 2QW8A 3KYIB 3CRRA 4TLAA 3L5KA 4EPXA 2BN4A 2PWBA 2FSUA 3C8ZA 3H13A 1SIUA 4KLCA 1IG0A 3J80A 1N9GB 5AVXA 2HSGA 2UVPA 4TLEA 3WGMA 3AHDA 4MDYA 3L2OB 3OE7A 1P72A 1ZS9A 3CONA 4JROA 4PLCA 5HE8A 3WGGA 3L01A 4JH0A 4MYCA 1JEQA 4FQ7A 5D87A 4DV1B 5K3DA 1LTKA 3SEZA 3QITA 3B5EA 3PIRA 4V39A 3O0DA 1DC7A 2VRNA 4HSEA 1UPFA 2HIAA 4MVYA 3TKLA 4JCCA 4BNWA 3PXEA 1UAYA 3E5RA 3PJDA 5F2KA 4J8PA 1V4VA 2D74A 3DBRB 5ECYA 1KSGA 2AWNA 1O97C 2HSZA 1N6NA 3V2UA 4UTZA 4AI6A 4QHTA 4F91B 2AB0A 3DD5A 2OGZA 1PWXA 4M0EA 4RXUA 2ZUFA 1CJCA 1G0OA 5FLXA 4CCAA 1PDWA 3FYUA 1G2PA 5LP6A 1T6YA 2O8CA 3ROXA 3SYLA 3W9YA 3UY4A 1L8AA 3I9NA 5IXSA 3BCSA 3BB1A 3MELA 3I34X 3HB0A 1T0IA 2F43B 4MGYR 2HGZA 2VJNA 1RPJA 3G13A 4MICA 4XX1A 1R74A 1DEHA 3TEMA 4FMDF 4O2LA 1W5EA 1J99A 4MARA 2PD4A 3AL2A 5K3FA 4NBTA 1H2HA 3EXFB 5JV5A 4I9NA 4N3NA 4YQEA 5JO9A 2BI4A 1SC4A 1Z5NA 4HDAA 1H85A 3JYNA 1HE4A 2CLLB 1M8KA 3X1DA 2HMYB 2YVLA 1U2ZA 3RTCA 3DHNA 4HNRA 3X43A 1SFRA 4M87A 3JVIA 2C9BA 2YWGA 3PK0A 3IBFA 3S3TA 3AJRA 4IJ5A 3GT4A 1XCMA 3L84A 5IK2A 4IL5A 3CJRA 4GMDA 4C22A 5JYEA 5LKAA 4BWGA 1EWVA 2QVCA 1HDRA 4Y2PA 2ID8A 4D74A 2YIDA 2J85A 1C7FA 5D7BA 2EQAA 1EFDN 3EQ2A 3LA8A 1NI4B 3QOFA 4ENRA 2IYOA 3QXCA 5A5DA 1QNLA 1BFUA 2FPXA 1ODLA 2F3UA 2VT6A 5LUBA 3SSNA 3KKMA 4ZC8A 3V6MA 3MJRA 2HF8A 1XZEA 3JR7A 3O4JA 3QX8A 5A1JA 3ZK7A 3WWDA 3BILA 2PKRA 2V7WA 3NHPA 1G41A 1B7GO 4OQYA 5AJXA 5EJ4A 5BYKA 1W6UA 2X0DA 3S2YA 1EX1A 4DNFA 3PPVA 1PFUA 1DELA 1CE8B 2FN4A 1AKMA 1VC2A 3OJCA 3QGMA 4AZWA 1OX6A 4CLOB 4YHBA 5B58C 1HT3A 4DRXB 1IAVA 1UMKA 3KVNA 4OMCA 4FOLA 3GLGB 2PUDA 3R7BA 2DE0X 4HDNA 3CX3A 5HTKA 4YUYA 2OKCA 2PVPA 3V7NA 4TGLA 1U90A 5ALUA 2BFAA 3SQWA 2R00A 1VI2A 3AP1A 3THXA 1DC4A 2W83A 4HDQB 4EHKA 3BC1A 2G0AA 3I5XA 2XB6A 1OCEA 3ORRA 5TQ0B 2XEDA 4OU4A 5K3SA 2Y93A 1Q0RA 5C35A 2VYQA 3GLHA 1ESMA 1Z36A 3ZHVA 4KQ2A 5CFMA 1P5HA 3EGXB 4P33A 3EUFA 2YWJA 4GH5A 3CKYA 4BLWA 1YCGA 2Y1DA 3QVXA 1E1QA 1QCDA 4LYHA 4W5WA 4YP9A 5UKDA 3ZJ5A 3FPGA 1LF0A 4RLQA 4WEQA 2FMTA 5H5JA 3GEEA 2Q62A 3JD3A 4JB8A 4JYBA 1QE5A 2W2MA 1NJ6A 4Y2HA 4Q9LA 1OLXA 3QPBA 1XD2A 2OZLA 4C1BA 1E4VA 1BCSA 1XAIA 1Y3HA 4Y9UA 1XDGA 4EHAA 1KS9A 1SZDA 1FTGA 2ZIVB 3OT4A 2WFZA 2OP1A 4KXYA 5JLJA 4WCFC 3NXSA 3TB6A 1EUCB 1SQSA 2FWIA 2NTJA 4TWBA 5LDHA 1RQ7A 2AH5A 2VP3A 3T15A 5BORA 2AA3A 5KNDD 3ROEA 4RL4A 2DFVA 3E7DA 3DDZX 3HCAA 4HFMA 5JBNA 1Y6FA 3OKFA 1LCIA 4EW1A 1IEXA 5K7SA 2OB1A 5TEWA 3NNNA 4U2CA 4QFMA 4IO0A 3FTQA 3E7XA 3G3EA 3L0SA 4OKIA 1DUSA 1T9GS 3PFNA 121PA 2QRJA 3RF7A 4Z54A 5LM3A 1SXQA 1CRLA 1E4EA 1T9HA 1KO1A 3CZQA 4MWZA 5CA0F 4JI4B 3OF2A 2WUDA 2ARKA 3O26A 1DIGA 1KWKA 3BF8A 2IVZA 2OECA 4OA8A 2P9YA 1YUMA 1GPNA 2LR0A 2OQ2A 1X7YB 1AQIA 1Y1PA 2P9HA 3NIDB 5TPZD 5FV4A 3Q7QA 5EMNA 5BNWA 1QJ4A 1ZN7A 2SECE 1TRHA 2PL1A 4QU9A 1NAHA 2ZBGA 3UJ9A 5E4TA 1VDMA 3FDXA 4W5QA 2HRRA 1IAQA 1OILA 3GPBA 2QTRA 4RMNA 2Z2XA 4WQMA 2HHHB 5JNLA 4RO0A 5CYPA 1H2BA 2YWFA 3QK7A 5B58T 4UPDA 1F2UA 1R0WA 1YZ3A 3B3FA 1P31A 4Q7JB 4LF7B 4L08A 3CRVA 4ITUA 4BX8A 1GPJA 4RMJA 1E3MA 2C7GA 1HLFA 3KSMA 3OLYA 4M7RA 3IUYA 2CJWA 2GGSA 3B2QA 4RFSB 5IAKA 1VZ2A 2AXNA 2Y6UA 2GRAA 1QFXA 1IHDA 4KXWA 1DV1A 2H8GA 3I6BA 3MOGA 5C34B 5BYAA 3C6XA 3TUJC 4RVCA 1OHHD 1EUCA 1HDXA 1W30A 3BGVA 4MLCA 3ZWBA 1XG5A 5AD1A 1E77A 1JG6A 4UVGA 4XD7A 5JMWA 1N2JA 4B4OA 1B8UA 1HUQA 4G5OA 1Z0JA 3MWDB 3PGJA 3F4LA 1ZI9A 4K1LA 4MV4A 1XRSB 4V0LA 5JD6A 4RIEA 4JJEA 1UBOS 3LAWA 1D2RA 3BJEA 4G0XA 3FZYA 5AI6A 4ZU1X 1R0YA 2JANA 3RSOA 5CD1A 4KR7A 1EZZA 1X7GA 3H2HA 1HE2A 1BWQA 1EFCA 3A4MA 6NULA 4REMA 1XZNA 2SKDA 1I36A 4NENB 4ZAVA 2H52A 4AXXA 5DBIA 1IFXA 3EQ7A 2W6ZA 2LVBA 2PJZA 2J87A 2ZRLA 1V95A 1DJPA 2BDEA 3AR7A 4L95C 4URZR 4ZOCA 3OOWA 1I51A 5E95A 3HZRA 3JQBA 1SHLA 1U31A 3WK9A 3F4KA 4YRSA 6REQA 2QE7D 3ZEIA 1NVTA 1GCIA 1P5JA 1SQ6A 2QGFA 3HEMA 4MWSA 2PU7A 2H2HA 5GADl 5HZKA 1RAEA 2BV3A 2XOXA 3C3BA 3DTVB 2PFSA 4BOYA 3QEAZ 2JD2A 1NUAA 1TAQA 2XMQA 3E3AA 4BO0A 5CVTA 2PSHA 5BSEA 1OASA 1IY9A 4PC1A 4UTOA 2ZVPX 3GUVA 3TTYA 1UBRS 1NR1A 1WBJB 4HB3A 2PZJA 3TQFA 4NAVA 3NHYA 5GV7A 1Y9DA 3HVJA 4DA8A 1Z62A 3NHLA 5G4KB 3ET4A 1GXSB 3JALB 3KE9A 5DP2A 5SZKB 2VTBB 4MB0A 4N01A 4FNAA 2IYFA 4NPAA 4FCTA 3H19A 4DS3A 1U8UA 2A7XA 1CB0A 1EBFA 1T9GR 1PLLA 1HQDA 2C88A 4IDBA 5EHIA 1I3NA 2YFKA 3EFOA 5K51A 3O4RA 4CR7A 2ZUBA 4K05A 1Z63A 3ILYA 4ZQEA 3EDMA 4QDZA 4UM9D 4M0DA 4B4WA 3EIWA 3NCHA 1CUCA 4QGHA 4X8LA 3WTBA 2FK8A 1XN4A 2Q0HA 3LUAA 1PU2A 3LY7A 4K88A 5HFNA 4F9TA 3UV7A 1RQ2A 5J2UA 3JQPA 1D8TA 5CLFA 2IFTA 3WB0A 4B35A 1IL0A 3NC4A 3TCKA 2ZIXA 1GRRA 3FSJX 2CNWD 4KN9S 4NOKA 2QJFA 3PC8A 2JAXA 1U7HA 4I50A 3BPSA 4NE7A 3S1SA 3TLYA 4JKOA 3AEUB 4K6CA 5GMOA 5KB3A 5JLAA 2Q1SA 3MCAA 2QRKA 4I1SA 1OKKD 5J2UF 4K7JA 4J9VA 2XMSA 4N9WA 3KE8A 5E7JA 4NEHB 1VHWA 1QE3A 1V39A 3GRZA 5FPYA 2C59A 1HT2E 3BMQB 4RY9A 3EMBA 3D1VA 1WUIS 3JVDA 1YRWA 1OFVA 2P77A 4ZQBA 4CM8B 4P08A 5A7HA 1ZUNA 4TS4A 2G9RA 2JAWA 3AFIA 5F5NA 2FVXA 1Z35A 1CR4A 3UFBA 5ITSA 2B4KA 1KK0A 1K08A 5FPTA 3T5MA 3N0VA 2DHRA 2EQ5A 1M66A 3PEEA 4EO9A 3LBHA 1G7TA 2WJPA 3P0IA 4FNOA 2DHQA 4FYWA 4IDNA 3BBPA 3L0ZA 4L78A 3HDVA 4AECA 3L6BA 5JWHA 4QOGA 4NE2A 1ZVJA 5TSDA 1JQBA 1OZFA 1SO8A 1NBIA 1EQUA 1P9RA 1Q15A 3U3JA 1R0CA 3OE4A 1I1OA 2J32A 3LTEA 3IYLW 4M9SA 1F5NA 5G02A 4MCIA 4EP1A 1XEXA 5B6PA 4TTAA 4GGMX 4LGYA 4EUEA 3FDIA 2QRHA 4JUFA 2C5BA 4DSNA 3AXSA 4RAQA 2W2QA 4DANA 3V33A 1J20A 1UR5A 2E4UA 5DN9A 2DWOA 5SYMA 1C50A 1XZMA 3HU2A 4TKVB 3UV6A 3VR5A 5D00A 5I7UA 3QF7A 3NI2A 4XYGA 2R97A 3HHPA 1YBVA 2ZKLA 1CYDA 1XWWA 2QOEA 4ZCPA 3ENKA 4US2R 3MCZA 4L3OA 3KOXA 1JJFA 1C2TA 1JI0A 4IGFA 3WHLA 2J67A 3ND8A 4LJRA 3VOTA 4C0WA 2D2EA 5JISA 2Z6UA 4BVKA 1UDAA 3IDFA 4Z4QA 4XVCA 1P0FA 3FRJA 3TUZC 2AC4A 2IF0A 3TSCA 5HIJA 4BUZA 1GDTA 2GB4A 4V2IA 4FYJA 5G53C 3WKCA 3V4ZA 3IUEA 4EZIA 1LW7A 4HUQA 4ZO8A 4ZK2A 1LDMA 1PDOA 1Q6ZA 3DAPA 4UE2A 2V0GA 4NMHA 4R6XA 1QQ7A 1UPCA 3CY6A 3QVMA 2QSUA 4KP7A 1WA5A 2QUHA 2DKFA 3D8RA 2FR0A 4M36A 3VPCA 3ZBTA 3ZJYA 1KVRA 4TX1A 2RB5A 4RCYA 4YPVA 4J4TA 4MV9A 1C4WA 5DGCA 3U44A 3UHPA 2REQB 1GRQA 1NW3A 2H11A 2OGTA 1QVZA 3OE1A 4HYQA 1R12A 4PX9A 4B17A 3I83A 3RUHA 4PHGA 1KQPA 2YS6A 3JZIA 3HCWA 3TLAA 5MN6A 2P4UA 2PLWA 3CH5A 1NNUA 1SCIA 3V4LA 1YQEA 1KK2A 1PFVA 1M2FA 1Q6YA 4KX5A 5AVKA 4C30A 5FOQA 1UMCA 1U3UA 4TRNA 1AUVA 3KBBA 3WRWA 1CQIA 2NPOA 1QKIA 1YZKA 2CY0A 2GJKA 1HE3A 1XC7A 2UZ3A 3IP7A 2QN7A 3LWZA 1ACMA 3ZD8A 4AMVA 3U6KA 3R7DA 3QUCA 2H06A 3OPYA 4G0MA 4EBFA 4GYKA 3V7UA 5JYBA 2JLWA 5EJGA 1SELA 2VUHB 2PT7A 2FMKA 4LW8A 2OESA 4U39A 3H5LA 2PHZA 4F04A 3R75A 4HH3C 2VF7A 4CIYA 1SG0A 4E30A 1N2CA 1CQJB 3SPXA 3L8DA 4M38A 1BMFD 1V25A 3RS8A 2HFKA 3GCDA 2A1UB 4FSXA 5ARDA 2WKRA 4JUBA 3LZCA 1LPBB 2GM9A 2ZE6A 1KZ6A 1AU9A 3EBOA 2RJ3A 3IUJA 4LRSB 2YUIA 5H8WA 4L07A 1FLAA 2EFGA 1S1CA 3GRAA 4Q6BA 3TKYA 1U2SA 1KR5A 2LXNA 5ANRB 4FJ2A 1DDIA 1UBSB 2JATA 2NUTB 3S6JA 5H3HA 1RZUA 5EHZA 1DQYA 2HHAA 3D4LA 3OH8A 2IXFA 2VK4A 5FHRA 4B75A 3UBMA 1G42A 3U7JA 5KTPA 2OXTA 2R6GA 3G9XA 2A4MA 5BPHA 1KSFX 2XODA 4PZLA 2V1XA 3TRFA 1O9BA 5FTJA 1PN3A 1FYXA 1ECFA 2VYCA 5IULC 2WHPA 1PJLA 2Q28A 2E37A 3KKZA 4N5MA 1DT3A 3MWYW 4V1CB 3HPQA 1Y1SA 1LLCA 3UAYA 4RDCA 4UEQA 4NAHA 4XYEA 4JZKA 2BR4A 4BGVA 1D2NA 1VSVA 1T3LA 2JGIA 4J0CA 5CP8A 4E5MA 1ISIA 1E79A 4ZHQB 2X42A 4I50B 3I28A 4WXMA 5BV7A 3W2EA 5JJIA 3I2GA 3QBJA 2PMBA 1GCGA 3FHOA 3KB6A 3NO4A 1VCIA 1Y1TA 2BH9A 4OCZA 1M76A 5GAJA 5K0NA 2QGZA 4IIVA 1GQYA 1R00A 1KE1A 2BFNA 3B70A 3N2GB 4H16A 1O2DA 5C31A 1YR8A 4IOKA 3KTOA 1LS6A 4QUHA 1CLUA 1M6NA 1TZCA 5DM0A 2XH8A 4B4KA 3ISTA 3NDPA 2QLFA 4ZT4A 1P17A 3T1QA 5TVGA 2ERYA 1VIDA 2AZTA 3E0XA 4GVPA 4B73A 1PJ3A 1POWA 1Q7TA 1Z45A 2PWYA 4WKOA 4WUTA 2Y6VA 3DULA 4Y0AA 5F1PA 5CB4A 2ZUSA 5BVHB 2VJBA 2R25B 1OWPA 4KOAA 3WIOA 1FIUA 2C8JA 1A5ZA 2XCOA 2KLHA 3FSGD 2ZCVA 1PG2A 3PI6A 4WPGA 5IM5A 1KZHA 1VPWA 4H7KA 2VPTA 3VU3A 1XRPA 2O2JA 3ZH9B 4EGQA 5JD4A 1GPH1 1XQXA 5A3VA 4XGNA 4I19A 3QIVA 1BX0A 3GH3A 4PSCA 5G0WA 2WUFA 4WK0B 4HEA1 1QE0A 4RVGA 4UTXA 1EWKA 1KXZA 2R8BA 1SURA 1ZSVA 1QIHA 4H9GA 2EP5A 3TQCA 1CUJA 3X44A 4CL2A 3HXLA 1E60A 4MCJA 1A5SB 4DPMA 521PA 3GRCA 1CDEA 4FR5A 4H4EA 4YCDA 1ZY2A 2I55A 3LX4A 4C4OA 1A5BB 4PANA 3RFTA 2OCAA 3IKVA 1HC7A 5AYVA 1U94A 1LU9A 2I8AA 3D7KA 1I01A 3JZAA 1CVIA 1DEXA 1FFGA 3PXCX 1T1RA 5EE3A 1Y1RA 4LJ5A 1R5NA 3L40A 4CNQA 4NCXA 2GAOA 1OAAA 2QTLA 3KKNA 4X9XA 4PO9A 5AHRA 2ZS9A 5B5SA 2WYVA 4PN3A 1E5XA 1OFTA 3O1JC 1ZC4A 3GAFA 1L8OA 3K9QO 1Q83A 4JUAA 4F5WA 2X1MA 3K9HA 4EG1A 1Q12A 4CT4B 3U7FB 3C6KA 3TLKA 4DCNA 4Q66C 4AYTA 4B48A 2UXCB 3VV2A 1XEWY 2JEYA 3NORA 5FL7D 4XW2A 1TUGA 2HSJA 2AXQA 3UMSA 1FUIA 3TZBA 5CDGA 1CY1A 3OFNA 5JEEA 3UJHA 3A8TA 4XQ0A 1C7IA 3ZXXA 1CEXA 4RAOA 4RSRA 2VL7A 1OU0A 3ZHXA 3IO5A 5AW5A 1WQ1R 3U3RA 3WNVA 1MXHA 1L5HB 1PJRA 2VHWA 4WZAB 3A9TA 4P22A 5T41A 1G6HA 1TYZA 4WAUA 3TE6A 5AM2A 3O90A 2P5SA 2G9UA 4K8OA 4EDFA 2XYRA 4JZYA 1RKXA 1C8LA 1GL9B 2JCYA 2JFGA 2WSYB 3E4CA 2PBRA 1N1DA 3V3TA 2IOYA 4C4YA 3UJCA 3PDIA 3VR3D 1XTPA 1WXDA 2GLTA 1XB2A 3CX7A 3HI4A 5EIBC 4J75A 3WLFA 4FS3A 4UU8A 3IQIX 3LP8A 3NM5A 3BWEA 3FJYA 2WV9A 4XVQA 3IODA 3TD9A 3GO4A 4GSYA 4L3VA 4PS0A 3RYFB 2PYZA 1HE1C 2WM2A 2ZRAA 3GFBA 4HXEB 1OR8A 3VR6H 1M8PA 1WUHS 1VPDA 4MHTA 4HS4A 2ZIWB 4W1PA 1N7IA 4XX0A 3P9SA 4RCZA 4A73A 4OLHA 2HA5A 4BLPA 2FMUA 5K1ZA 5KQSA 4P3XA 1GVNB 2ZT6A 4CLRA 2E4WA 3PPXA 2NU7B 4HWOA 1D04A 1IPEA 2YJ5A 1ATIA 4RGQA 1MT3A 4J1NA 1F8YA 3GRVA 4S0XA 2PSFA 1S02A 1E59A 4R5HA 1NE7A 5EWLB 2XQKA 1JJIA 5I8PA 3R7NA 3PHBE 5ESRA 1YB7A 3V1LA 4YV2A 5KQGA 1NT2A 2B36A 5HQ3B 2D7JA 3KQOA 4UUBA 5L45A 1AO0A 3KKEA 4F1JA 5CK4A 4XD7D 5LOVF 4DR2B 1TA4A 2HJVA 2JJ8A 2O6HA 4P80A 1I4OA 2JGRA 2ENUA 3QBDA 4YAFA 5EXSA 1CUDA 5MF6A 2WF8A 1SB9A 5REQA 5I5EA 3WX0A 4KUEA 3ZXSA 3AQIA 1CQZA 4X8OA 4P3KA 5BR1A 5K5EA 2ODBA 2CXOA 4ETIA 1PGPA 3IUNA 1I6MA 1Y6ZA 1WXWA 2J5KA 2FVYA 4WLNA 1IVNA 4DR3B 1T4BA 1QGZA 2WP8J 3INRA 1UWKA 4FFLA 1AURA 4M37A 2V7BA 3D1LA 3I4LA 4NHEA 3P2KA 3HN6A 2BFMA 4JVNA 1UJ2A 5FR1A 3ZZUA 4ESHA 4GKVA 5DM4A 5LPNA 1U0RA 3KR9A 1EVLA 3QUQA 1ZL0A 2B8NA 2OMKA 3IIEA 1HTTA 1RI5A 2GR9A 4QECA 2ZR9A 2RJNA 4MWOA 5NULA 3ZLBA 4OMFG 4D4GA 2RAUA 4F1WA 7AT1A 2ZJFA 4PZDA 3TL2A 1R4NA 5LKRA 2GEUA 1AKQA 5DWDA 1SRRA 2CJWB 2JAPA 2AKEA 1J1UA 4CR6A 4QVIA 5AKGA 2BCGY 2AOUA 2G25A 4HDSB 3K0AB 5ALFA 3VSCA 5IWAB 1YZHA 1RLTA 4K03A 5BN1A 2QAGA 3VJMA 3ZIAD 5A3RA 4ZA2A 5KQPA 1JNYA 1KMIY 4H6WA 4QASA 5ICFA 5KC9A 1ID8A 1ZJ4A 2AT1A 4OAOA 5EESA 5D5QA 5AOCA 3NBAA 3G9UA 5ENVA 5KIAA 2WWYA 4IIJA 3WL3A 1ADGA 2ZATA 1PV1A 4M1KA 1IWBB 5FX2A 3OSZA 4LHZA 4QNMA 3WSTA 2BTQA 2H5IA 1QP4A 2QTHA 4F4CA 4BS9A 4EMSA 4MCHA 5LQKA 2HXYA 1XHLA 3GJSA 4WWHA 3QEOA 3EK2A 3GRPA 2PZ8A 2HRCA 2Y0DA 4QUIA 2BCJQ 1NFQA 2HNBA 4NU5A 3R7WB 4CIVA 4UHDA 2RSLA 2EERA 4OL0A 4Y2XA 5CGZA 1RNLA 3TOSA 3W5JA 1SKBA 1WMSA 2A9RA 1P4HA 1KQNA 3T4PA 4AKEA 3WL6A 3COPA 4XUEA 4V0NA 1QFYA 2HZBA 2W37A 3OCVA 4KACA 5EZQA 4LXTA 1CY8A 3HXOA 1SU7A 3ROGA 2I4IA 2ZBUA 5J5VA 3B6JA 1Y7TA 1O95A 1KORA 3OOYA 1F6WA 3IUQA 4N0MA 1L9XA 3H2GA 1F60A 2DQSA 5K4HA 2QI9F 3M34A 1KU6A 1L3BA 3HFRA 2RGCA 3HLTA 1KI4A 3IQHX 3JCZA 3OD5A 4LV5B 4WY2A 3PLAE 3GRKA 3UJ6A 3MPUA 1VE9A 1IOLA 1O96A 1VB5A 2WU4A 1BRMA 2YYYA 4GPTA 1IMJA 1EUDA 2FU5C 2XADA 5EJ2A 3KQNA 4BY9E 3CX8A 3S81A 4WZ6A 4Q1AA 4ZAFA 2YW9A 1RZ3A 2AEJA 2ZIUB 1HETA 1L5OA 3UK0A 4D5GA 2Z3VA 1GZ7A 1WP4A 1XVVA 2PKQP 1MIOA 2NTEA 3KRTA 3L8GA 5FOWA 1XQVA 3KQSA 5BQFA 3CGGA 1EDEA 1Z4KA 3BULA 3KUUA 3RJZA 3TRDA 4M7OA 1GAXA 2ZJ0A 3O8QB 4LX0A 4QU0A 1OT3A 1TVEA 4YMIA 3I5UA 3ZU2A 4PVCA 5GOTA 1JHYA 1CQWA 3QZUA 4IHJF 2HF2A 1A5AB 3GGSA 4UD6A 1BROA 3DFMA 5BW6B 5E8JA 4ANFA 3TFOA 4HQ6A 3MRVA 2XRFA 1PNOA 1TCUA 1ATZA 2E49A 2I5PO 2ZRQA 4PC2A 2PANA 5JIBA 2HMAA 5AKEA 1I4WA 4JVMA 5BUCA 2QW0X 2FHSA 4C6RA 3H2BA 1ZM4A 3EPJA 1VMKA 3H5NA 3ZWOA 4HPJB 3ABOB 4AJ2A 1E9CA 2H4ZA 1MVNA 3AVWA 4DLYA 3DLBA 2BKUA 3E5MA 3IDQA 3CF4G 3ORQA 3PITA 2VK1A 4KXVA 2OB2A 3PFKA 3PQFA 3NRBA 4LCBA 2NZXA 3WB2A 5JYDA 2NVUA 1RSZA 2NQ8A 1MGOA 1PHPA 2Q5EA 5FT9A 2NSDA 3CRQA 1TMKA 2IX9A 2P68A 3UJ7A 2ZBFA 2Q3MA 2HF7A 3MGCA 4KRGA 4FQ5A 2D7CA 1VYUA 4GECA 4QPNA 2FZLA 3BHNA 2FUNB 4ID3A 1TJPB 4PPQA 4L5JA 5AJYA 3V2HA 2H85A 2JFZA 1J0DA 1UFKA 5E1BA 2PUEA 3WDKA 5FD8A 3U3MA 1XNHA 2IUTA 1JUDA 2I2FA 1EWTA 4E46A 4TT3A 1GHTA 1C3OB 5B1IA 3V4FA 4PO8A 4ER3A 2D1TA 3FUVA 1YDGA 1VA4A 4W1QA 4YDSA 1ECCA 1HMYA 1YVUA 3FYTA 4H7DA 1Y7PA 4PBSA 3WMFA 5JZSA 5DWVA 4NZMA 1W1WA 1N5RA 3CCBA 4MUFA 3ICQB 4EA7A 2LCIA 3F3YA 2OBNA 4ZAYA 3BIXA 4MTLA 2WJAA 4LVNA 1R8SA 2RIRA 5JSYA 3UG6A 3ZX5A 1WKVA 2EKLA 2R7MA 3W6UA 5A03A 1NM5A 2I66A 4NTZA 4S1TA 4DOMA 2EX4A 5HWSA 1RQXA 1YOBA 1O94C 3A0RB 2XPCA 4E4RA 3O9ZA 3CZMA 5EUQB 3RD5A 4TYQA 3AI7A 3T54A 3OQNA 3A1WA 2QP3A 4CR8A 2CDBA 1N6LA 2X22A 1H6AA 4MKXA 1T2UA 3NIGB 3F9IA 4PCLA 1LJLA 5IBQA 3SFTA 2YXNA 5G40A 5AVVA 5HKAA 3RSLA 4AS1A 5DX1A 3PYXA 1AKEA 1KZGB 3OSUA 1K27A 1R4NB 4P31A 2QHXA 1U7DA 4D9KA 5KYYB 3E3NA 1YQUA 1A2QA 3WXMA 4N6NA 2XB8A 4TVSA 1YQXA 1ZC3A 4KWTA 3WMWA 2BONA 2BZ1A 4BV8A 4JKIA 4RF4A 2G09A 3MS4A 1FUEA 1GZ5A 3BEOA 4RE6A 4FGSA 2IUUA 5L3QA 2Q7OE 1GFSA 2YRXA 3JS5A 4EYKA 2XUKA 1TF2A 4I81A 3FBTA 4N3GA 5BOSB 1N6PA 3PTLA 3AR8A 4IIJB 2AJ8A 1LD3A 1C0LA 3B9PA 4G9EA 3L4KA 1XDDA 4IF6A 4BQSA 4DXDA 4XH9B 4RVFA 1JIJA 1C0EA 2Q3DA 4IMPA 5HMLA 4DREA 2XZTA 2JBAA 2CMGA 1H2XA 3ZTYA 4DWVA 3IUMA 5C1OA 1WD7A 1JKXA 2ZRGA 4RMHA 1XTJA 3KQQA 3MB5A 2QJRA 4AKHA 1GPUA 4YREA 1IPFA 2WIKA 5TC4A 4DWWA 4Q1CA 2D0PB 3FLAA 2XF8A 4C3OB 2E48A 5ARBA 4B80A 3LPLA 5IMBA 5C1DA 1Q20A 3TTUA 4QM7A 9ABPA 3FPEA 4BLVA 2Q45A 2EARA 3KSRA 3KKOA 3LPNA 6AT1A 2GT1A 2J3EA 4N7RA 3I1IA 4IDOA 2G80A 1SKMA 2W43A 1T26A 5JXIA 1P7YA 2OXCA 4DV7B 1YKSA 3HFJA 3MT8A 2WE7A 4BO8A 2MYPA 3UJPA 3IXMA 1Q0SA 3AW8A 3D6HA 3MQ4A 3PIDA 1LVGA 5LLSA 3TJRA 5B3LA 5CLIA 4LJAA 7YASA 2BYTA 5T5QA 1DFHA 4XSGA 3BUSA 1ZAKA 3ICOA 3K9WA 2XBMA 1LSOA 4KVFA 3CUWA 5H1YA 2ZFUA 4CN9A 3EVFA 3DNPA 2COUA 5JC8A 1Z5PA 3FWPA 2YZKA 4QYIB 1ABBA 4ZYWA 1L4BA 4EHLA 3V8NA 2H9AA 4Q12A 4DFDA 2R1VB 2DUWA 1OB5A 5IS2A 4P86A 2OV1A 2F48A 3HUEA 3EBLA 1XU9A 2WQ7A 2OXEA 1ZICA 5IRCD 2GCEA 2GOYA 2XXBA 5KKNB 1L5FA 4KE8A 1AK1A 2XRZA 2DY0A 1BHSA 3L92A 4OI4A 3LVFO 3UWSA 3NHKA 3OZEA 5CIYA 1X15A 1MP0A 1PZEA 2ECQA 4NMWA 3VYVA 4EMTA 4J1QA 3ZIAA 3LQ2A 4MWGA 4ZCTA 1EUYA 3TXXA 4YS6A 4FDTA 3BK7A 1HEUA 2CLDX 5KX5F 4PV7A 3RGWS 2F1RA 1DT5A 3REQA 2V5VA 3RYFA 2XMGA 1GFZA 1WXXA 2B92A 2OM2A 4M1WA 3N8DA 3T38A 3LT0A 1H65A 4LPKA 2X4IA 1UDBA 1DFIA 3EXEB 1HG0A 1BQ3A 3PR1A 4RELA 3ESYA 4Q1FA 5LMUB 5BSWA 3T9AA 1WMAA 1XZAA 2ZSIA 2D54A 4H3HB 3WJ7A 2KMLA 4J2OA 1PVOA 4P4LA 1YR7A 1JPJA 1R0ZA 1ZONA 3SMQA 4F6RA 5C7IO 1HDGO 4JBNA 1Q14A 2CJXA 4M88A 4OHRA 2G08A 2V74B 3TE7A 1WSWA 2QM3A 3PUHA 4YJ2B 4DRZA 1I0LA 2Z5VA 4MS1A 3I61A 2NW6A 2WIDA 3T5BA 3E8XA 4L5CA 2GYWA 2W6JA 3JD4A 2WJHA 3GRRA 4D9CA 2VT2A 4TTPA 5ALPA 4BNHA 5B7GA 2PWZA 5KTSA 1Q2UA 5G1NA 3ZGZA 2RGNC 2ORVA 3H86A 4DLRA 4EJ2A 1HFEL 1OWNA 1CDZA 1XN1A 2ZSEA 3GLTA 1VJCA 1Z2PX 2XYHA 4E88A 1ZI6A 2CVHA 5L3RA 2DWQA 3FPFA 4C4PA 3RVDA 3GFGA 4NNPA 2OPBA 1NXSA 2B4QA 3WRYC 3KQVA 4PZEA 4I0WB 1NNSA 1X74A 3AH8A 1B0AA 3K8OE 5DK6A 4AL4A 3CZ9A 1WHSA 2M6SA 3VI3B 4Y7CA 2PT5A 3MBKA 5FFMA 4W9NC 4XWYA 2AJTA 4LF9B 2I7CA 3SZOA 1UH5A 5LWQA 2XAAA 1I30A 1CG6A 2V7PA 2QRZA 4IV8A 4P7FA 3QNWA 5FWNA 5KJFA 3CEMA 5KJ6A 1O08A 3GK3A 3IDAA 3EIOA 3B6KA 1JEDA 3HR8A 3DZIA 4EUSA 4Q9DA 4MH0R 4Z9YA 4CM4B 4B79A 4CXMA 1B6GA 1PZXA 1TI7A 3KOUA 5EP2A 4ZT6A 1GTSA 2XMDA 4B3MB 2XXAB 1J2YA 2P4QA 2F1HA 5ALQA 2IOFK 3O4GA 4H7IA 2VH2A 3L9XA 3L9WA 4MK4A 5HCUA 3TD6A 5H7XA 5IU6A 3W1VA 4A7PA 3PFGA 3AFMA 3B12A 3A14A 3PQEA 3W2IA 1RKUA 3WV4A 4ZFNA 1RAAA 4AUEA 2EW2A 2XYQA 4S0ZA 3H5RA 1MX5A 4HGQA 2C95A 4C0KA 3COVA 3BWDD 2VRCA 4MQUA 1L3IA 5BMVB 5CA1F 4B3FX 5HKBA 4DLNA 1NKSA 3B1JA 2G28A 1EZ4A 1RM4A 3HQ4O 5I45A 1CY0A 1KDVA 3R8XA 1RAFA 3RAPR 4AROA 1NUUA 4HMPA 4AKTA 2WG1A 3U9TA 1E3TA 1TZKA 1YVPA 4UOEA 1K6MA 3JY6A 1PSWA 3QX7A 5CVEA 3ABSB 4RKFA 3CC8A 2BFPA 3ZBPA 4KX3A 1W0KA 1LKZA 4DIBA 1SULA 4FINA 4NZOA 1GTMA 3K15A 2UYOA 1XR3A 3FNQA 2BDUA 2ZTVA 3GZNA 1U3FA 3PF9A 4MP8A 1EWRA 5HF8A 3PUVA 3RBZA 2JB9A 4Z9AA 2OWEA 3MAJA 2ZDHA 3BRQA 3C43A 3R6LA 4QARA 4LGMA 4X41A 5BN4B 1MT0A 5ALXA 4HNTA 1RPTA 1X2BA 3TF5A 1XAHA 1QGDA 4G0UA 1HTBA 4RD4A 1E9FA 1QVAA 2HIHA 4MW2A 5MN5A 3Q9LA 1TLLA 3TZCA 1SVNA 5BW5A 3W5SA 3OUTA 1NMSA 2ZXFA 4D3DA 5AUOB 2ENWA 1BTOA 4QBFA 1L6IA 1QIIA 3DZDA 2V96A 4FONA 2YQ4A 3REOA 2PO7A 5JZ9A 3FFWA 1B42A 4JCOA 5FNVF 3BMCA 1ABFA 4KN5A 1I6LA 1XALA 4MYUA 3AIOA 4DCMA 4R2IA 3DLHA 1N2HA 3KFLA 4LYYA 4PX3A 5F21A 4OQEA 3THXB 4RABA 5B1SA 3DVRX 2WZDA 1HV8A 4D92A 2VP9A 3RK0A 3ZI7A 4BAUA 2ZCJA 1O3YA 4RGBA 5DFAA 2UU9B 3TRIA 4UD2A 2KPOA 4NZPA 3KETA 1PUIA 1RWWA 3OFSA 1Z88A 4OJKA 5IHPA 3TIVA 4J4HA 2JVIA 4AURA 2AL7A 4ACAA 1WX1A 3KZ1E 3HBAA 3PC7A 4MV3A 4RADA 5HRUA 4JENA 4IPTA 1IB0A 1M0TA 3FI9A 3UXHA 2BJWA 3GWZA 4JI6B 5GVSA 3T1HB 4P0PB 4DLVA 4UTPA 5IKMA 4OLAA 3A7DA 4CU2A 4NOJA 1E0KA 3DGEC 3H75A 1P1KA 5EERA 3I1FA 3FYUB 3TMAA 2FPRA 2WLSA 3KYJB 3LU1A 2VKQA 3R0VA 1WBDA 4AZ0B 3QPDA 2VT7A 1S1MA 3KB1A 4DNQA 2AVNA 1L5VA 1D4OA 1DB3A 1P9NA 2C4VA 4KW7A 1BDJA 3UYLA 3K70B 3BKWA 1VKZA 2G67A 1ZGBA 1IIRA 4MYSA 4QDTA 2BEKA 5FYDA 1Z68A 1IXSB 3W0LB 3WA6A 3WYGA 1V8OA 3IEKA 4YTEA 1SBTA 1WO8A 4PCAA 4RULA 1P9LA 2HQOA 3DBVO 1ZCFA 4I4TB 4DJJA 5A9SA 3A2NA 1LDYA 3K4PA 3IVCA 2OFWA 5HBRA 1E1LA 1WDKA 5C8YF 4K3UA 1QFZA 1SOWA 2V7UA 1DJNA 4YK7A 1PR9A 4AY4A 3GGOA 1Z4PX 2WQZA 1PAUA 1XXHE 2XSZA 1L7NA 10MHA 2Q8NA 4KSYA 5ELXA 2DC1A 4L8FA 2J08A 3Q85A 2VSFA 3V1MA 1US8B 5EE1A 2YUTA 1NF9A 2FEMA 4GMXA 4RV5A 4YCSA 3REGA 3UHFA 3DE3X 2QN9A 4EECA 2GZHA 3OETA 5F1YA 1HMPA 3G7NA 4H7EA 4ZOLF 3A27A 1KKUA 1E8DA 1CZLA 3E9DA 2Y1XA 2A92A 2DBZA 3B6ZA 4BQFA 3GLFA 5HHTA 4AN4A 1G9TA 4XWWA 1W2GA 4XCXA 2HU5A 1KK3A 1S4QA 3T5DA 3AETB 5KTMA 5KCMA 2R7AA 3PZBA 4UDNA 1ICEA 5CNMA 3ANMA 3IFSA 2WUVA 5AI0A 2VRWA 1SCBA 3IO3A 2RK3A 1ZA1A 5JC1A 1Q95A 4LXYA 3PC4A 1H9BA 1KZ1A 4YDQA 2JKVA 3KEQA 4JVOA 1WZNA 1B76A 4A91A 3BA6A 3MMSA 2VWQA 4UJ3A 1TM2A 4MHSA 2HA0A 4MAAA 2V9ZA 5GONB 3MLEA 1VIYA 4YT8A 1ZM7A 1JXAA 2CKMA 3ROZA 2Q9CA 3NVMB 3AOEC 1IG3A 2I6QA 2K2WA 2PKXA 3PXAA 4NE9A 4O4HF 1BHJA 1G19A 3LDUA 3RV3A 1L7MA 1N2IA 3DHWC 4L1KA 4CI0B 1M1YE 4NBKA 2XLCA 3H1BA 3H8JA 3V8PA 1ISHA 5IC6A 3TLJA 4RPJA 5DULA 1R5OA 3AVOA 1TAUA 1ORWA 1U0OC 1ZX1A 1UM9B 1Z5UA 3PXUA 3UPDA 3EWNA 4F3YA 4AQ7A 4D25A 1AUOA 2ZAOA 4GBED 4B6OA 1FP2A 3QPUA 1ORHA 1I24A 1NUSA 3H7AA 4NG4A 1Z6PA 2GESA 3AWDA 3DAHA 2YR0A 3P45A 1UPBA 2ZPUA 3KKQA 3K2QA 4P0TA 4NF2A 4NV0A 4YRZA 5CA1B 5BRAA 4DMCA 4YR7A 3SKYA 1ONBA 5HKKA 4NFHA 1FDSA 5FV7A 4Y18A 4EF4A 2P9CA 5KKCA 1OBVA 4BX3A 1N6OA 1A9YA 2A9JA 2AJDA 2WSMA 3PB3A 3UKJA 5BQ5A 3MHTA 1ODJA 4DC0A 3E03A 4G1FA 3QU5A 1WVIA 3GV0A 5JZOA 3AJAA 1VSBA 1DOHA 4XGKA 3EPKA 4K6HA 4UUAA 4ZI7A 1FRQA 2GQ0A 2R8PA 2GBCA 3RSHA 5FLKA 1R64A 4DC9A 1ZM2A 2CZCA 2O0JA 2J09A 3B3JA 4R2XA 4B1FA 1RRCA 3I39X 3ESCA 1I10A 4CT5A 4A3SA 1U1GA 2G3YA 4WA8A 3LY5A 4MJ7A 1X6VA 2XCUA 4AG3A 1HE5A 1JSLA 4RQBA 3QWBA 1DXHA 3G2JA