2YOFA

Plasmodium falciparum thymidylate kinase in complex with a (thio)urea- beta-deoxythymidine inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
200
Chain Sequence
DDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Synthesis and Evaluation of Alpha-Thymidine Analogues as Novel Antimalarials.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 80
structure length 200
sequence length 208
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yofA00
1LS6A 2J59A 3HJNA 2QRNA 4Q7KA 1KI4A 1XCPA 1QHGA 4OJQA 3PUXA 3ZQ6A 2O5VA 3EA0A 3LXXA 3W90A 2ZU0C 1E1QA 1YVDA 3B1ZA 1E2KA 1ZM9A 2GXSA 4JL5A 4KFRA 2DWQA 1EFRA 1P9NA 3P26A 4MDFA 2OUKA 3ZDQA 2HJVA 4PAQA 2OXCA 2NIPA 1IM2A 3U6KA 4MRPA 1T0HB 3K0FA 1YE8A 3M6AA 3TNFA 3B1WA 1ZD1A 2ZI4A 4C0AC 3QEJA 1CS4C 2C9OA 4JZKA 1W36C 2A30A 4ESHA 5J4VA 1DAEA 1G4UR 4PC7A 3KZ1E 4NPHA 2ZI3A 3NVAA 5EE5B 3REGA 3GLIA 1EFHA 1G41A 2QORA 1G4AE 1G7SA 1UEJA 2AKYA 4EPXA 5K8LA 1UF9A 4PPGA 2MSCB 4FWTA 3K9HA 1RVDA 2WSSA 2H16A 2Q9AA 4WA7A 4C3ZA 1Z2AA 5CLQA 4K81B 2RGCA 3TW8B 5G41A 3VX3A 4YQFA 3UK6A 1L4YA 4K8OA 2PJZA 2DYKA 3HU1A 1GP2A 5CYOA 4PO1A 3CKLA 3NHBA 1NVWQ 4DSNA 1J90A 2W6ID 3X2SA 3AKEA 1CULC 3K0CC 1R8QA 4PPFA 3TQFA 5KU1A 4DSOA 3AP1A 4ERNA 2O0JA 4TMVA 3REFA 1DOAA 1IOZA 5GVRA 3AVPA 1XTSA 3QXCA 1JXMA 4UJ3A 3RVBA 4B33A 4DCNA 4CEIA 1OH8A 3BIFA 3Q72A 2XNSA 3AB3A 1NKSA 3NKVA 2ODWA 2MMCA 2VHCA 3VQTA 4EKDA 5CM8B 4OYHA 3RWMB 1US8A 1Z6GA 1IJEA 2PBRA 2RHDA 1RFLA 2BM1A 1QZXA 4MKIA 2P65A 4NBSA 2NGRA 2FJUA 4BRWA 1JI0A 4L5BA 5EJEA 1G18A 3ZZUA 3ZVLA 1C9KA 2QPAA 5LPNA 4LK2A 3AKDA 4DLTA 1KO8A 4MKGA 1T8UA 2A3RA 3ZVNA 1ZUIA 2YNMA 1KKLA 1KAOA 2CVFA 4KAXA 5AWFC 1QG2A 2HF9A 2JIZA 2CMKA 2NTYC 2O8BA 4DLXA 4PFSA 4JBWA 1R0YA 3U44B 2FWRA 1R5NA 4TLCA 5HE9A 2RGGA 3VKWA 1M1YE 2XGJA 1D2EA 5K8IA 1UKVY 2YC2C 5L3QA 2P5TB 2ZYVX 5EP3A 5EXTA 3BH6A 3PIRA 1MKYA 2FZ4A 4UQOA 1VG9B 4P33A 2IYXA 1E6CA 1X8KA 4DLUA 4JYBA 2IUTA 3A36A 3SFVA 1S2MA 1OV4A 221PA 5FOUA 1SULA 1S96A 1N6IA 2VTKA 3C41J 2RGNA 3K0FB 2W2VA 4QKQA 1F48A 3TH5A 4C0HA 3F5FA 5CB8A 4ASUA 2ERYA 1N5LA 3G82C 4JMPA 4ITRC 1JQJC 2OFOA 3DO6A 2HYDA 1V43A 2FV8A 3K0AA 2V4ZA 1LNZA 3UMRA 2HLDA 4OI2A 4G1UC 1JJVA 2XB2A 3KFVA 1NVUQ 1UADA 3DM9B 1ANKA 1OYYA 2RGAA 3ADDA 2VHTA 1T91A 1A2KC 1ZUNB 5FL3A 2IYZA 2DCUA 1Q1BA 4WXPA 2BV3A 1HE1C 2JCSA 4B3FX 1OH7A 4LY6A 2ZRPA 3SZRA 4BUJA 5DN6A 3LQQA 1H8ED 3Q5EA 1T6NA 4DVGA 2CHQA 2GJKA 3MJRA 4NTZA 1E4VA 1G3QA 1HT2E 1CIPA 5FTJA 1E1RD 5C46F 4F92B 3K70B 5FR2A 3LFUA 1OIWA 1OIVA 1VHTA 3CR7A 4CEIB 1P6XA 4KFTA 2ZS9A 1R0WA 1XJ0A 2ZSEA 2O8DA 4A36A 4MGIR 3SOPA 3FMOB 3A1TA 1HQCA 3F3YA 4MRNA 4BLRA 3KKPA 1US8B 3BFKA 5FUYA 5DE3A 3RWOA 2ZRNA 1M6NA 1I4LD 2C99A 2YHSA 3GJ4A 3TR0A 1Z6YA 4KHZA 4PR0A 3N70A 3W6NA 3EPLA 4WZAE 1JALA 721PA 4B3BA 1F2UA 4Q1AA 1X3SA 2OFWA 1W0JA 2UVQA 2O8BB 2WAYA 2E9SA 4BGDA 2C03A 2PCJA 1QHXA 5HPYB 1YR9A 2F1RA 3IBYA 5CLLA 3GFOA 3TSWA 2DHRA 4DLRA 5L3QB 2GAOA 3AF0A 4DDUA 1NBMD 3FHTA 3LY5A 1RRCA 1SVOA 3F8TA 3RRYA 4ACBA 2W2XA 3SC3A 1UPTA 3K70C 2O8CA 2G1JA 1NLYA 3MMPA 2I1QA 2X8AA 2N1BA 1ZYUA 2NOAA 521PA 3THOA 4AYTA 2XSZA 3KDSE 3W6PA 4DWJA 3BAFA 4NH0A 4KLNA 2AK3A 3Q9LA 1N6RA 3FKSA 2EFCB 1XDBA 2XZOA 3WYAA 1EESA 4KJZA 3GMTA 3UIEA 2XNDD 3K0AB 1O87A 2IXGA 1WRBA 1COWD 5DI3B 1G16A 1W4RA 1QHSA 4JLOA 1LW7A 2J5XA 3RLFA 5G3YA 1U90A 1KSGA 3TMKA 1JR3A 2WTUA 1KNQA 4NCIA 1HUQA 1KI7A 1Z0DA 4DCVA 2H92A 4B34A 2BMFA 3UKDA 3CZPA 3I3SR 4GSYA 3VR1A 1T3LA 2XJ4A 4CT4B 1E9SA 1GSIA 1TU4A 3I1FA 4MGYR 2BJWA 3NH9A 3W3AA 4I1UA 1S3SA 3THYA 4B71A 1Z07A 1ZNWA 4BFTA 3QVVA 4LYFA 2OHFA 4JL8A 2PMKA 1PLJA 1HY3A 1E0JA 4GBMA 4BZPA 1RPZA 1J7KA 2GRJA 2REBA 4NCKA 3TAHA 1PUJA 2GK6A 2O8DB 2PT5A 1T3SA 1Q21A 4ZCLA 5L3SA 1H8HD 3VKGA 3LA6A 4MYHA 5DGXA 4LJ8A 4NYIQ 3H86A 1BYIA 2A5JA 1ZM7A 3SN6A 3FKQA 3LDAA 2V1XA 5JFGA 4QFMA 2PT7A 2Q9CA 3NBZC 1MRNA 1QDEA 821PA 4QM7A 2NQ2C 4PC6A 1TNDA 2QM8A 3RANA 3TIFA 1F2UB 1Z28A 2OXRA 3LXRA 2EQBA 4WW0A 4BZQA 4LHXA 2CL0X 3OFNA 3GEHA 3H84A 1ZCAA 2ZRLA 2NO9A 2MSEB 2F9MA 2JJ1D 3UANA 1AQYA 3CBQA 3LBIA 5FUXA 2IYYA 1CP2A 3NC1C 4BLOA 1GNRA 2JA1A 4OI1A 4JLPA 3VX4A 2YWFA 1AIPA 2NPFA 4JT4A 1Z6XA 4RCYA 1VG0B 1VIAA 2VF7A 4II7A 4LHVA 2O8CB 4AKGA 4ZCMA 1S1CA 4ZI2A 4URWR 4JKIA 1AZTA 2GNOA 3B13B 1S4QA 2VP4A 1ZC3A 4E07A 5EUMA 3W8NA 3I62A 4RD6A 2W6JA 4RD1A 3GLIE 4RD2A 2ZYWX 1R0XA 4V0LA 1NN1A 3RS4A 2ZRFA 5FBWB 2CE7A 3O8BA 3U4QB 4EJSA 2ZSBA 2YJTD 1P62B 5HCIA 4IDOA 5DYGA 4KBGA 4B3GA 4EUNA 1JEDA 4NYJR 3Q5DA 4NONA 4QHTA 1J99A 2OE2A 5CIQA 2IL1A 5EZ6B 4Q1CA 4X8HA 4C0JA 4HUTA 3R8FA 2O52A 4TLAA 2HYIC 4OQLA 3CO5A 5JJKA 1CR1A 1P2UA 1TTTA 3MFYA 4D26A 1W5TA 1R8SA 5B58C 1OB5A 5DO9A 2ONKA 5EZ5A 1E96A 3AUYA 5FOSA 1EFUA 1BKDR 4LZZA 5LD2B 1CR2A 5HKKD 2P6RA 3THYB 2FFHA 3PUZA 3KTAA 3BJIC 3PG5A 3OEED 1KDRA 3R20A 3VU9A 5DHAA 2QP3A 2YC4C 4S2EA 2XAUA 3CPJB 5L3SB 4XIGS 4ACAA 3C7KA 3MUFA 4GZMA 1VCIA 3HR7A 1Q0UA 3PUYA 1GNPA 1XMJA 2C2HA 3BERA 4IEIA 5DNYB 3W9YA 4Q9KA 1P2VA 1KJZA 2C78A 1DAMA 1IY1A 1KZGB 1W4CA 4Q18A 2JJ2A 4DDWA 3PJRA 1Z3IX 1N2CE 4UXJA 3QJYA 4OL0A 5J4LA 4Z8XA 1N3BA 1R0ZA 5GJVC 2GCOA 4O25A 3AP2A 4V02A 3QNUA 2IYSA 1E9AA 4QBFA 4YXWA 4P4SA 3D7MA 3LD9A 4U5XA 3B6EA 5FBQB 1ZW6A 3DOEA 3TAUA 3SHFA 2J7PD 4Q66C 3RS7A 4DSUA 5KPJA 1FMJA 1AA9A 2G0TA 3WNBA 4CGZA 1AGRA 3PVSA 2D62A 4OK6A 5UKDA 4XWOA 2BCGY 4XTRA 3SHWA 3UPUA 2OV2A 3SNHA 1B23P 2F3RA 3H0KA 2J0QA 4PO9A 1KTVA 4Q7MB 1XTJA 4XWAA 3T1QA 3FHCB 4ZKDA 2BCJQ 2XTZA 3ZJYA 5JI2E 2O8FA 3PITA 4TMKA 3SI7A 1T9HA 4YDHB 1XD9A 1KMHA 4IJMA 3TUIC 1NG9A 4EPRA 3FVQA 2WBLC 3K8YA 3WBJA 2NZJA 3QSYA 1IN4A 4EJSB 5K8TA 2R6FA 2CK3A 4A9AA 2QE7A 2JLSA 1OF1A 4AK9A 3I5YA 3OHMA 3H2YA 4O2RA 2A5YB 1JQLB 2ATXA 1WBDA 1A1VA 1FX0A 2ZUDA 2VHUA 1VYUA 4PPQA 1YZKA 4JLVA 2ZS7A 3MG9A 1F6BA 4BLTA 3LV8A 4R2HA 1XTRA 4IDNA 2V7QA 4JLBA 5FTLA 1DVRA 3MJHA 3E70C 2BIFA 3G5UA 3MGCA 1Z0JA 2AWOA 4GPTA 5IT5A 1E2GA 2ZRAA 3ZZTA 2E87A 1ZRHA 5AUQA 3KXLA 2ZE7A 2ZYTX 3KTAB 4JVMA 4LPKA 3U7FB 1WCV1 2ZJAA 2IHYA 5E4FA 3VU9B 4KSBA 4XVUA 2F9LA 4CYMA 4JVLA 5H68A 4H1VA 5D3QA 2P6UA 1LVGA 1SKYB 2VP2A 3QENA 1AS0A 4LV6A 3TKLA 4D80A 1Q57A 3C4JA 4IVRA 3U6BA 3I4LA 1F5NA 4L8GA 4KYUA 2YVUA 4OQMA 5TB5A 4EPYA 4V03A 1II9A 1TQDA 2QP9X 4JSTA 4H1UA 1BIFA 4TL8A 3T35A 1KDPA 4JT2A 1XZPA 2B92A 2QEQA 5CITA 4LYAA 3GJXC 1FL9A 421PA 3NIBA 4P4UA 1TQ2A 2GCOB 2QENA 3ZZ0A 4N0EA 4C0LA 2QAGC 2NO7A 2JEOA 2W00A 2ERXA 1MO3A 1WF3A 3THWA 3PEYA 1UKYA 2WWWA 2VIIA 4P4SB 5KO2A 2EWWA 1GILA 1DPFA 5KPDA 4DLZA 2GA8A 5L3VA 3KB2A 4BEBA 1M2OB 1E2LA 1Z5ZA 3LQRA 3U3OA 1NSFA 2CNWD 1OYWA 1VKJA 4Q9LA 4GZLA 4PQRA 1KIMA 2WJIA 4Q47A 4ZIRA 2DPXA 3K9LA 2PZFA 4YMUA 2EWVA 2O8FB 1R6BX 1ESMA 4Q7LA 4TTPA 1RYHA 4PQFA 1KMHB 2PEZA 4LDJA 4LHYA 2ZJYA 3TJZA 1AS3A 2IX3A 1Z8FA 1E32A 3IEVA 4B2IA 2FA9A 2JLZA 1VHLA 1N0VC 4UXIA 3IBGA 3UMSA 3L82B 4ZDWA 2G77B 2YWEA 1UJ2A 1XD2B 2ZJZA 4Q9JA 5EUQB 3KJEA 5SZJA 4KBFA 2W0SA 4CT5A 4G0NA 1CR0A 4Q19A 3WMEA 1KOFA 4B2PA 1TU3A 1OXXK 4BFSA 3RS5A 1KI6A 3K0CA 1QF9A 4RD0A 1JECA 2BHRA 1CKEA 3CB4A 4LGMA 4GMDA 4DDTA 2PJRA 2WJJA 4QGHA 4A2WA 4LYHA 3IDQA 1MR3F 3C16C 5JRZA 4MGKR 1RYFA 1X86B 1FP6A 4I1VA 2J9RA 3LX5A 3QPUA 2ZPTX 2OCBA 3IPXA 4E22A 4XSHA 1G6OA 3FB4A 3U3MA 2G9NA 2ORVA 1NMXA 1TMKA 3EZ9A 3AF1A 4G5OA 1P2SA 5HTKA 3QG5A 1FZQA 3SFZA 3SBDA 1E2DA 2PX0A 4US2R 4PSKA 3WY9A 2OCYC 2A5FA 2A9KA 2ZU6A 2OZEA 5TXGA 4U7DA 1SZPA 5KDOA 3CRW1 1YU9A 4Q01A 2GESA 4DCSA 2BKEA 4HB2A 3AGPA 2D06A 1KO5A 3BD9A 4XD7D 4B3CA 4DCUA 3THWB 2BBSA 3TSOA 1U2RA 3PENA 4UNQA 3D6TB 4KLZA 4HATA 3RYTC 2QI9C 5FOTA 3HYRA 4C9BA 1S0UA 4NCNA 5GJCA 5CIWA 3C14C 3I32A 2FFBA 4BRUA 1F60A 3FDIA 2XITA 5AUOB 2WJHA 4KODA 4C0SA 2VHJA 2QN6A 5KSPA 5HR5A 4FMCB 4DEXA 2Q3HA 4NE2A 4I99A 1MT0A 3GEEA 4ZIRB 4QBIA 3T61A 2X19A 1OH6A 3CONA 1SXJC 3QBVA 1JAIA 3FHOA 3SJZA 4D2IA 3VR4A 5TMPA 1CJKC 1E2PA 1WQ1R 3WNDA 4KFSA 1T5LA 1UEIA 2DB3A 3B9PA 3AVUA 2RHMA 3ONWA 3U44A 2P3SA 3RAPR 1L4UA 2WWXA 1SVSA 3D8BA 3RS2A 3QKRA 4BFUA 1II8A 1T8TA 3NG1A 3EPJA 1AGPA 5KSOA 2OCAA 5TDHA 1XXHA 3DEFA 3KB1A 1XEWY 2BOVA 3MWJA 1KI6B 1QG4A 3CF2A 3CUEF 1J8YF 1IY2A 1G20E 1PJRA 2P5SA 2G1KA 2RCNA 2ZVQX 3FTQA 1G7CA 2AXNA 3I72A 2QUZA 3KJHA 4TQUS 4Q9IA 1II0A 1U99A 4LYJA 1EWRA 2QM7A 1SHZA 4M1TA 1EG7A 2WWIA 3AVVA 2GBLA 3FOZA 4HYYA 3MCAA 3VHXA 1SKYE 2F1HA 1SGWA 2GKSA 1IAQA 2GVDC 4DSTA 1IONA 2AL7A 3BRWD 4FCTA 1CRPA 3EW9A 3LRPA 2BC9A 2NO0A 2V55B 3KQKA 121PA 2BWJA 1XTQA 1F3OA 1BOFA 5FL7D 1M7GA 3FFAA 4IFBA 4Z1MA 2WMNB 1MO5A 3UWKA 4XJXA 3M1IA 4NCJA 4P31A 2LWIA 4ABYA 4AIIA 3ADCA 2BMEA 4HDQB 5AJXA 5LB4A 2QG6A 4NZYA 2VRWA 2DFNA 1DAKA 3HP1A 2E1RA 2B7BA 1IN8A 2ZI5A 3ETLA 4NL4H 2KBEA 3E5HA 4B48A 5FPHA 2H8KA 2L0XA 1FFHA 2A78A 1N6KA 2REXB 3X1XA 3WRYC 5C1BA 2HF8A 1VDZA 3GJ8A 2ORWA 4X8LA 2JAQA 2J45A 5JHHB 3AP3A 4RD4A 1OKKD 3FPAA 3DVLA 4TWZA 3M4YA 3X1ZA 1SQ5A 3HR8A 4TMXA 2D7DA 3EC1A 4TLEA 1QRAA 4GFDA 2V54A 1Q3TA 1T3HA 4B76A 5B2ZA 2D74A 3P4XA 4LJ4A 3EZ7A 1CRQA 2ODNA 1N5KA 2X2FA 3LW8A 2MMGA 2QP4A 2GHIA 1QHYA 3R9IA 4F93B 2Q21A 1CEEA 3V00A 3CNOA 4IDQA 4M1KA 1ZU5A 5FOWA 1E9RA 3AVTA 3QKRB 1II8B 4QC2A 5J5CA 3VR6A 3ASZA 3AVWA 4DUGD 4A0FA 3DOFA 3TR5A 1XXHB 2IEYA 1GUAA 2WKQA 2FU5C 4DDVA 4FMDB 3SJAA 2G0NA 3SYNA 1HTWA 5JLJA 1NL3A 4C0BA 3KL4A 1P75A 3A37A 3AVXA 1VCMA 1UBGA 2ZR7A 4D0GA 1XTKA 2FNAA 4FIDA 3EPKA 4BFZA 4POAA 1G8PA 1M74A 3ADKA 3ZVMA 2RGDA 2ZJ8A 4E03A 4TT3A 1P3JA 1AJEA 2IHBA 4N1AA 2XZLA 1NNEA 1GOTA 3HDTA 4HDOB 5DI3A 5A0FA 4CF7A 1DARA 3IIKA 4DHEA 3GFPA 1GVNB 2OEPA 3TK1A 1JBKA 1ONBA 1ZJ6A 1E2FA 3D31A 2F43A 2V6JA 2JLUA 1E9BA 1G3IA 1E2HA 1H8HA 3DL0A 4YLGA 1GKUB 5EE1A 4N3NA 1KI2A 3BS4A 4M9SA 4BFWA 1G17A 1GL7A 2DBYA 4WBSA 4DZZA 4XVRA 4MA4A 4PC3A 3OZXA 4NYMR 1N6OA 1KSFX 2WPDD 4M4SA 2CEAA 3KXIA 1E1QD 1QBKC 1XMSA 2HXYA 3WP0A 4A92A 1ZM3A 1EFRD 3NEYA 4PXAA 1YZUA 3LW7A 2WOJA 4ZKEA 4YMWA 3B78A 1N6NA 3PFIA 2GK7A 1Q1QA 5E7IA 2OSBA 4LJAA 5C18A 2GBLC 5SZKB 2ZI9A 3R9WA 2IC5A 4L15A 4BFVA 2J3EA 3ZS9A 1DAGA 2B21A 1G6HA 5TARA 2FX3A 2XTNA 1K6MA 4HAUA 3K09A 4PC1A 3RC3A 1O3YA 1PUIA 4A2QA 1XCMA 3VTKA 1W0KD 2GDJA 3I8XA 4C30A 2RGXA 2ZR9A 3EC2A 3GLFA 1IN6A 2WSSD 1DAHA 4F7WA 1U0HC 2QZ4A 4AD8A 1W44A 1E2IA 1DELA 4NCHA 5LDDC 1G19A 1MO6A 2AKAB 4GP7A 3KQNA 1OFIA 2AX4A 2JGNA 4OI4A 4AC9A 2QSZA 4Q03A 3K53A 4KYIB 3DZ8A 2FH5B 3HU2A 1W4BA 3PEVA 2ZR0A 2IYVA 5FFMA 1E94E 2WVJA 2AD1A 3OAAA 2PL3A 1R4AA 3V4FA 1Z0FA 1ZM4A 5F3WB 4LUCA 2CBZA 4LCBA 3P27A 1MV5A 1D5CA 3PR1A 1A5TA 1OT3A 2XZPA 3GJ5A 3C15C 2G83A 3LAWA 4PQYA 1UDXA 1FPMA 3QKUA 3JVUA 3ZLJA 3OIWA 4BFXA 2AFIE 1HYQA 2WICA 2D2FA 3SJBA 4EPVA 3U4QA 4EFNA 1G8FA 2J87A 4Q48A 5B64A 5D3MA 3LLUA 1BYUA 1VIYA 4ZV4A 3NBXX 3TGPA 2GJ8A 3AF3A 4W5JA 4I81A 3TQCA 1KJWA 1GKIA 1NLFA 2ZSAA 4QBGB 3SE0A 2AXPA 2R2AA 2J7KA 5H70A 5J4HA 1IXRC 2F43B 4IDHA 1CBUA 2GCPA 3IPYA 4HAXA 2ECKA 2GF9A 3GJ3A 3L0OA 1UBFA 2R6GA 5H8WA 4A2PA 4ARZA 5KUTA 1WBBA 1U9IC 4NYJQ 4FMBB 2CCKA 1WE2A 2FGKA 1OPXA 2C04A 3BH0A 4FCWA 2TMKA 1S1MA 4P3YA 4QGFA 3SYLA 4A15A 4PPNA 5AK0A 2ZITA 1I4TD 2JLYA 5FBLB 2F55A 4D4MA 4HLDA 5K8UA 3JZAA 5LB2A 1HQYE 2CVHA 4US1R 3VR5A 5B57C 1E2JA 1N0UA 4M1YA 4FWIB 4JKYA 2WHXA 3D3QA 3GCGA 2RKOA 5AJZA 4PHHA 2CLDX 2J7PA 3B5JA 2P6NA 3B1XA 2CL7X 1E79A 4LC0A 5KNBA 3E2IA 4QHYA 1GKYA 2V9PA 4UXHA 4LV5B 1ZAKA 2FSGA 1A2BA 3UXMA 5G53C 4GDFA 4ASUD 3A58B 4RKEA 2CDNA 1RRFA 2YINC 5BYKA 2FOLA 5TVKA 4F91B 2HUPA 4QGAA 1F2TA 1KK2A 2OLKA 2W0MA 4DLSA 4OJKA 3GLFB 4TYNA 3CM0A 1ZIOA 5CK5A 3OEHA 2CXXA 5E7JA 1WMSA 3KUCA 4GOXA 1G9XA 1PLKA 3W5IA 1XPOA 1XXHE 4B75A 3GLGA 4CVNA 1D9XA 1KHTA 3EAQA 2D2EA 3HPRA 2JDID 2JJ8A 5DN6D 4MRSA 3FFBA 4MGZR 1J2JA 2IF2A 3LO5A 5KTYA 4IOKA 3IUYA 5BN3A 1QVRA 2BBOA 2OG2A 3EASA 5AJYA 5CYPA 2FZLA 4JVSB 4M53A 2PX3A 4OBEA 2IYWA 4PSVA 2XX3A 1Z63A 1NN0A 1D6JA 4PSAA 4QHSA 3RRNA 4EPWA 3DPUA 1I2DA 3EG5A 3A6PC 1N5IA 4HAZA 1Z0IA 3EZFA 4MQBA 5EE9A 2JLRA 3AGQA 4A6PA 1YZGA 1XPUA 1G5PA 2C98A 4I1OA 2EU8A 2H1LA 5F98A 3X1WA 1IN7A 3K09C 4K46A 1N6LA 5DH9A 4JLDA 2FSHA 3IHLA 4LBZA 5D3MB 5J47A 2QNRA 4MYCA 3BC1A 4DJTA 4IVPA 1XP8A 2CHGA 1HH4A 1M7HA 1PLLA 2H7VA 1M34E 4A1FA 3QE0A 1HV8A 2QAGA 4GOKA 4YMSA 1JEEA 2N46A 2IWRA 3AV0B 4TSFA 3DMNA 3LWNA 4ARZB 2Q6TA 3NEJA 1QHIA 1OHHA 2XOKA 1YZNA 2WIAA 4QJ3A 1UKZA 2ZS8A 3OESA 2ORIA 1HT1E 1GTVA 2R65A 4YONB 4CEJA 2VHQA 3CRQA 1Q3HA 1IBRA 3AVQA 4TMTA 4JBYA 1KI3A 2X77A 1G3RA 4M1MA 4D81A 1I4DD 2R62A 3K0SA 1EWQA 2P67A 3WXMA 4B6EA 3IILA 3P20A 2ZSDA 2VH5R 2OLJA 1ZMXA 1NSTA 1W1WA 1Q22A 1YZQA 2EYUA 4HI0E 4UNPA 2Z4RA 3C8UA 5EXXA 3ADBA 3VNVA 2GVZC 4OHZA 5FOVA 3EXAA 4PHGA 4JLJA 3FMIA 1KY3A 1P7CA 4B74A 4O3MA 3FKSD 4OHYA 5FPYA 2IF0A 2C9CA 1ZCBA 3KQLA 1ZBDA 3CH4B 1F2TB 1KDTA 3KUDA 2RGEA 3HYTA 1N6HA 1G7TA 4N0DA 2EFGA 4FD2A 4A0RA 3QQ5A 4AG6A 1RZ3A 2EW1A 4YC7A 2JASA 3RC8A 4C7OB 1FUUA 1UM8A 5G3ZA 3ZYCA 3ZGXA 3N5CA 5EE3A 2ZXUA 4LX0A 2HEIA 1AKYA 3QXJA 4GL2A 3GLGB 1FQJA 1B0UA 3QEOA 3TE6A 2OAP1 4QOSA 3TRFA 5IF9A 4LWZA 4TL7A 3A1UA 4Y0AA 1T4GA 5F2EA 2Z0MA 3QF4A 1WP9A 3GJ0A 2H17A 4RCZA 4PZLA 4BWYA 5CM9C 1TQ6A 4AKHA 4G5SA 2ZRIA 5JECA 5KNDA 3TVTA 1Q20A 1K5DA 1GRNA 5FOXA 3T06B 4AKIA 2V8OA 3NXSA 3QIAA 1KKMA 1UFQA 3CWZA 1TX4B 2GWHA 3J81k 3QY0A 1LB1B 3KKOA 1JNYA 2FMXA 4G5RA 1XMVA 3TSZA 2CLSA 3DM5A 3LVRE 4IXMA 4M8NE 2D4HA 2AN9A 1LF5A 3KQHA 2ANCA 2P2LA 1G3UA 2RH5A 1XD2A 2VBCA 4WXRA 4JVNA 1P60A 3L0PA 1VMAA 5IRCD 2WAXA 4Y0VA 4EFLA 3VR3A 2QAGB 4C4PA 4KXFB 1VG8A 1JAHA 3KXKA 1VG1A 1NVXQ 1OXUA 4A0GA 3U7HB 1E0SA 2ONJA 1EFTA 3KX2A 3Q8XB 4V0KA 1TEXA 2ZQ5A 2ZIAA 4BE7B 4PAMA 1MABA 1X1SA 2FSFA 4X8MA 2YOFA 1Z06A 1KYIA 4IVQA 5HCNA 2V1UA 1KO4A 4CEJB 4D0NA 1AZSC 1R5OA 4GNKA 5EXPA 3B82A 3GQBA 3BK7A 3T12A 4XD7A 5LBIA 5KSZA 1BMFA 2Z6VA 1JR6A 4URZR 5EP4A 2YOHA 4BLSA 2G88A 2GXQA 2NO1A 4CW7A 2SHKA 4FCVA 5TV2A 1SXJA 1SVIA 3BORA 4TL9A 1T5IA 5J4KA 1XFAA 5JWHA 2W6JD 1BS1A 1P5ZB 3IQXA 4TL6A 3AF4A 3RS0A 4S35A 1W4AA 2WJGA 1OXSC 2QBYA 3GLFE 2RMKA 1Z0AA 2BEKA 2OILA 3QF7A 3SDZA 4B47A 1ESNA 3FWYA 2DFKB 1WXQA 1Y63A 3BE4A 1GFIA 3FMFA 2Z5FA 2Q3MA 3LLMA 3X1YA 2RAPA 2EFEB 1K5GA 1FTSA 3VR2A 2FEMA 5JS8A 2OO7A 5FI1B 1G21E 2KSQA 4JBXA 4UNNA 4KO8A 3C5HA 2ZJBA 2QQEA 3QF4B 2GEDA 4AYXA 3UWOA 1Z29A 5C4GB 4ZDKA 3AEZA 3T1OA 4O2LA 5H1YA 3R8CA 2PMDA 4M0LA 2GCNA 2FGJA 5SZIA 4LV8B 4QJ4A 3NBYC 5JEEA 2O0KA 5FPSA 2OT3B 5DIFA 2IS6A 4HDCA 1CU1A 1JB1A 4OHWA 2BBWA 2R6AA 3OIUA 5KOYA 2WWGA 3BFVA 4Q00A 2VP5A 3CX6A 4HAYA 1RKBA 3U2QA 4KVAA 2J41A 3HWSA 4HSEA 3X1DA 2JJ2D 2QTVB 4PO8A 1JR3E 4TLDA 4EQ6A 3VAAA 3KQUA 3ZD7A 3JVVA 3L0SA 4MRRA 3I5XA 2ZE5A 2QU8A 3OIYA 3ZIAD 1N6PA 3W5JA 4IOJA 2BM0A 5FL7A 1CXZA 1IQPA 2RGBA 1MABB 2QTFA 3EX7C 5IK2D 1RRGA 5HE8A 1LY1A 1VTKA 1ZP6A 2IYQA 3G0HA 3SU8A 5J4YA 2W6IA 5A5GA 1VYTA 2ZAOA 1SVKA 3A4LA 4QJ5A 2OESA 1E2EA 1UBCA 1CF4A 2ZSFA 1OXVA 2EYQA 3UG7A 5CJPA 2WOOA 1NN3A 4P0TA 2GILA 4R71A 4D4JA 4QNRA 3T5GA 2VF8A 1SXJB 4MITA 4JJZA 2DWPA 3KFXA 4NMMA 3U61B 3U7GA 3N2EA 1NY6A 3GEIA 1XEWX 1OKKA 5AJWA 1HE8B 3FE2A 2BVNA 3PV0A 1KK1A 3PUWA 2QMEA 3O8DA 4PX9A 2GXUA 1VYVA 1NY5A 4TYQA 2QBYB 1DO2A 2CK3D 2XEXA 4BFYA 4O0MA 3UMFA 1LTQA 1EX6A 4IDPA 1E2QA 4HEJA 2ZRHA 4HZUB 4MUBA 3HPQA 1OH5A 2WIBA 1ZNYA 1XWIA 3GLGE 2QAJA 4R2IA 2IYUA 2FE4A 1DO0A 2F7SA 5BN5A 3AH8A 4HLQB 4RSGA 1R10A 2D3WA 2ZRMA 2V7QD 4GI7A 2VA8A 3AVOA 2V6IA 2ZAMA 4DUGA 3KKQA 2DFLA 1YRBA 4XTCS 1NN5A 3CX8A 3QXHA 3LH5A 4TTQA 2ZEJA 3AKYA 3AQ4A 4H9GA 2OCPA 4NU0A 4BZXA 2I4IA 3WP1B 5E95A 2ZRCA 4M22A 1YR8A 4FXPA 5EE0A 2C5LA 2YWHA 4IXNA 4Q4LA 4IOMA 1E9FA 3TUZC 1G3MA 1YKSA 5AUNB 4M1OA 1OFTA 3BB4A 3CH5A 3CIOA 2GZDA 3Q7PA 5JMTA 2J0SA 1EX7A 4EQ6B 2GAAA 1W2GA 2YZ2A 1Q12A 2QY9A 4ZDJA 1ETUA 1OFHA 1KZ7B 3FYHA 4OQNA 2KBFA 1VCNA 4PHTA 1GZSA 3RSLA 3ZH9B 2ZREA 3OE7D 2FPLA 5KHOC 3ICEA 3IHWA 1FMLA 4CEHA 3QI2A 1N0WA 1DBSA 3U3RA 2PZEA 2XB4A 2ZI6A 3GJ7A 3PQCA 2ZRGA 4UJ5A 3QOFA 1YR7A 4B6FA 4BLQA 1PZNA 2HJGA 2YWGA 2FPMA 4AI6A 1NMYA 1XBTA 1XCGB 1X8JA 1H8EA 3THXA 3T1TA 2WPDA 3B9QA 4XOIA 3ZVRA 1X6VA 3QBTA 2F3TA 5DSZA 1W36D 3VKHA 1E1RA 1KO7A 3DZDA 1JJ7A 1IXZA 1ZIPA 5CK4A 2QTHA 1KK3A 2ZRKA 3ZS8A 4DLYA 1TAGA 1E2NA 4FI3C 2JLVA 4TZ6A 4LHZA 4Q21A 1RIFA 2IK8A 1U8YA 2QROA 2ZTSA 2FEOA 1U98A 4XSGA 1E9CA 2Z83A 2HCJB 2ZANA 1KSJA 2WKRA 2I3BA 5FTMA 4HLCA 1TUEA 3EZ2A 4A82A 1WDTA 4AURA 2A2ZA 3NWJA 4G3XA 4MYTA 1S9HA 4UNSA 3H1TA 4BEJA 1ZC4A 3MSXA 2F1IA 1LF0A 1ZU4A 1W0KA 4KVGA 2QSYA 4KI0A 1KDOA 4Q4HA 5HZHA 3H4MA 2WWFA 3LNCA 2IS1A 4BQSA 2B8TA 3LBHA 1W49A 2A7QA 2CJWA 5AJVB 5F9FA 4NYMQ 1RW4A 4I1SA 3GPLA 4A4DA 4L4UA 4Q1EA 1XZQA 4LPSA 2ZRBA 1DADA 1AKEA 1NBMA 4AWXA 3W34A 4MRVA 1TADA 4YMVA 1FQKA 2JATA 2X2EA 1YZLA 1OB2A 3TVDA 4JYCA 4ZDIA 3SYKA 4URVR 1NVVQ 4M9QA 1GNQA 1CJVC 5CB6A 2IXEA 1FTNA 2ZVPX 3C5CA 2I1VB 3RRZA 1G8GA 2AD5A 4RJLA 4WOPA 4C2UA 3SQXA 1SHKA 5FPTA 3U3KA 4JS0A 1VECA 4AKEA 1YQTA 5BXQC 4G5QA 5C4MA 1Y3AA 2H18A 2VSFA 3U5ZB 2O8EA 3CRMA 1U8AA 5BWMA 1LV7A 1U9IA 3IIMA 1YHNA 2XNDA 4FMCF 3U60B 2AFHE 4KFUA 1COWA 3IGFA 5SZHB 4L16A 4DCTA 2G3YA 2PLRA 2G6BA 3A1VA 4B35A 3NHAA 4R9UC 2IUSA 2R6DA 4Q9HA 1FUKA 3AF2A 3PXGA 1IY0A 1KAGA 4CEHB 5KYKA 3RS3A 4M1SA 5J40A 4QNMA 1GIAA 1M8PA 4QM6A 4RZ2A 4Q4JA 5L8VA 5C2JB 1XRJA 1P9WA 2QL6A 5GADl 1KK0A 2ANBA 3S1AA 3LX8A 4BPBA 3THXB 1AQUA 2QMHA 3QKSA 1TEVA 2WZQA 4Q1BA 1SXJE 2HT1A 1DTSA 2WKPA 2WSMA 1PVOA 1NIJA 2QPOA 4URXR 3T1VA 4DC9A 1OSNA 4V0MA 1UBEA 1GG2A 1HURA 2ZROA 4Z54A 5JI3E 3GLIB 4QL3A 1TF5A 3EA5A 4PC2A 3T15A 4B3XA 4DLWA 1DS6A 3IIJA 2FFAA 3GJ6A 2IS2A 1ZVQA 3Q3JB 4KU4A 3U7EB 4BASA 5ANRB 4Q4HB 3GD7A 4A8JA 2BEJA 1GWNA 2HV8A 3BOSA 4URUR 1R2QA 1IJFA 4TTRA 4D4KA 2OFXA 1NKTA 2CJWB 1MO4A 2VQSA 1NVVR 3B8HA 2JJ1A 2ATVA 5JSZA 5KNCA 3P32A 1TUIA 3PEWA 2Y8EA 4PHFA 1KSHA 1H65A 2VPPA 2NG1A 1QHHA 3O47A 4ZCIA 3IKJA 2JDIA 2BMDA 4HAWA 1YRAA 4W5HA 5P21A 3WYFA 1I2MA 5JWRA 1OXTA 3WRXC 4DKXA 4Z8YA 2VSOA 3U3JA 1VCOA 2HDNB 2IEZA 2GEUA 4LRWA 5IDVA 3B85A 1EFCA 4RFSA 3A4NA 3QXXA 1UAAA 2O8EB 4I4LA 3F0TA 1ELOA 3ND8A 4RD3A 1ZUHA 5E7MA 4Z1MD 1Z08A 5A4JA 2GZAA 4MKFA 1U0LA 1W2HA 4DLVA 2CCGA 3BH7A 4HB3A 5JWOA 4L9SA 1UKEA 4C2TA 3V4RA 5JCZA 3L8YA 1Z0KA 5BW8A 1XPRA 3CRVA 4LJYA 4ESVA 2GJAA 2QRZA 3I92A 4EFMA 5DLQC 4EIWA 3P4YA 4F4JA 3K70D 3CWQA 4KITB 2ZRJA 4Q4JB 1E9EA 3PUVA 2VP6A 3CX7A 1DG1G 4F4CA 3QG1A 3B1VA 3VFDA 3R9XA 2FG5A 4IW3B 2BJVA 3S1AB 2W58A 2UKDA 5HKKA 2IYTA 1Q1ZA 3QKSB 4IFEA 4OQFA 1MOZA 2WM9B 2VEDA 4M1WA 3OEEA 1ODFA 2J0UA 1M7BA 2QA5A 2EFHB 1ZINA 4FMDF 3N2IA 2W83A 4XWKA 1L7VC 2BDTA 3SQWA 2BBTA 2CE2X 3HU3A 4C0KA 1LFDB 2AK2A 1DG3A 1P9RA 1XJCA 2P0EA 3EZ6A 1S9DA 2J0VA 3WHLA 1MH1A 2JIZD 2PH1A 4TQ9A 4KV9A 1C4OA 1ZM2A 2J1LA 4NDZA 5KSYA 4NKRA 2GEVA 2NO6A 1AM4D 2RB4A 1AN0A 3IO5A 2LCFA 5GJWC 2H5EA 1SKQA 4D25A 1ZNZA 4NHOA 5FI0B 3WBKA 3KJGA 4L9WA 3BGWA 4IRUB 4KSCA 4A8JB 4A6XA 5KDDA 3ND9A 5EXSA 4YDSA 2C96A 1J8MF 4WVFA 3A1SA 4UNRA 1E3MA 3A8TA 4M9ZA 2ZRDA 3QXSA 5JSZB 3TBKA 3CNLA 4X8OA 5TY0A 4OK5A 1JPJA 2J46A 2ODEA 5CDFA 2PCLA 2YV5A 3BFXA 4GP6A 1QHHB 2YYZA 3KKMA 1NI3A 3QVUA 5L3RA 2Z4SA 1SVMA 2BMJA 4TT3D 2Q9BA 2CLCX 4OI0A 3NDBB 4LHWA 3RSOA 3QPWA 4ZPXA 2ZETA 4HB4A 5F9HA 2HLDD 2OM2A 3MLEA 4LOAA 4Z51A 1TQ4A 2RGNC 1G7RA 4XVQA 1YZTA 4GMXA 1IHUA 4B43A 2PEYA 1HA3A 1G64A 1IN5A 4RFSB 4C7OA 4RZ3A 4U00A 3SEAA 4TZ0A 3GLHA 4CZ2A 4D0LB 3BBPA 3B60A 4LJ7A 1D9ZA 4D82A 1E4YA 1E98A 5AUPB 2DWOA 1W48A 2MSDB 4U02A 1P61B 3CNNA 4A8JC 1FP7A 2NMVA 3VHLB 1D2NA 1C1YA 1ZNXA 3MWLA 2A5GA 3ASYA 2K5UA 3OF5A 1Q44A 1Z6TA 2KE5A 4IEEA 3WMGA 1XF9A 3T5DA 4DT1A 4Q02A 3DKPA 3RABA 4TYWA 5ELXA 1BH2A 2F6RA 1A7JA 1R7RA 4EPTA 1X8LA 4RFVA 1Q1EA 2J0UB 2XJ9A 3KJIA 2HCBA 1GM5A 3CPEA 3RNLA 3VMFA 2ZI7A 3UG6A 4GRAA 1JXOA 1G8YA 2GJ9A 3JZMA 4BECA 4ZI3A 1XU4A 1W0JD 2WV9A 4RZXA 2QT0A 4V0OA 3I8SA 4FW9A 4PANA 4LSGA 2VSXA 3WYGA 1OLOA 5IHPA 2FF7A 1KI9A 1JPNA 4J0QA 3PEUA 1QHNA 1CLUA 4Q5IA 5GVSA 1P72A 1GDDA 4LC1A 3R7WA 4XH9B 3LBNA 3SBEA 4JLAA 4Q7JB 2VP0A 1Z22A 3L0IB 5BQ5A 1NJFA 3LVQE 5FBVB 3EWSA 1R5BA 3OAAD 2X1VA 4RY2A 1G5RA 1TF2A 4LJ9A 4V0NA 2GXAA 3CF6R 3MD0A 1GAJA 3CLVA 1NBME 2XSZD 2IXFA 3RHFA 1A82A 3B1YA 2UZ3A 1X1RA 4URYR 5EP2A 2JLQA 4LBYA 1WA5A 3EIHA 5FPKA 3DKVA 1IXSB 4DXAA 2CNWA 1SVWA 4US0R 1W5SA 5JEDA 3K9GA 2ZJOA 4W7SA 1AK2A 4NYIR 3WMFA 4C0QC 2REOA 5AR1A 1Z6AA 1G1MA 3BB3A 4DRZA 2JLXA 2GJSA 2FFQA 2JLWA 5DI9A 1Z47A 1DEKA 2ZYUX 3P1JA 1JR3D 2F1JA 1G5TA 4HUQA 3CRRA 3GLHB 4OQXA 1TPZA 5FUVA 5FBRB 2ASEA 3W3ZB 4QRHA 4ZO4A 4W5WA 2B7CA 2KI5A 2W2TA 4HB0A 1RC8A 3NBFA 4IKEA 4Q4AA 3BWDD 4ILEA 3ZIAA 4TMWA 3MWKA 4B3DA 4B44A 4CIDA 5M04A 1S3GA 4QBHA 1U94A 1NG1A 1RJ9A 4OHVA 4JL6A 3EARA 4TYPA 1W7AA 4KCGA 1QVAA 3CW2A 4DT1B 1T0JB 5G40A 2YKGA 1RE0A 5IK2A 4DB4A 4HLUA 4AYWA 1KO1A 2ZJ5A 5DISB 2GF0A 3VNUA 1OJLA 5LD2C 1E79D 2C9YA 3EIQA 1U81A 3CF0A 2R6CA 3NH6A 1L2TA 4DB2A 1OIXA 5EP1A 3SS8A 1Z83A 4V0ME 1DE0A 3FMPB 4QXAA 4TYYA 2ZJ2A 3GP8A 3QUSA 2QMUA 2ZE8A 3Q7QA 1FOEB 4R98A 8OHMA 2O0HA 2DFTA 4NP6A 3BXZA 3OFND 3TW4A 1W46A 3O8CA 1HEIA 2AR7A 3OEHD 3NC0C 4LJ5A 3IEUA 3B7GA 4RZUA 5E3HA 2IW3A 3FGNA 4LBVA 2PLFA 1EK0A 1GL6A 4M21A 3R7WB 1KNXA 2XXAA 4PAOA 3SR0A 2V3CC 1U8ZA 1KJYA 2UZIR 4RVCA 1NIPA 3WNCA 1XEXA 2OBLA 2H57A 1ZD9A 2B8WA 2BKUA 5FR1A 2GTPA 4TLBA 6Q21A 2ODBA 4Q1DA 1XTIA 3CPHA 4YMTA 3O8RA 1EGAA 1NLZA 4PTLA 1GITA 1NMZA 2FPKA 3PCRB 5GJBA 1V5WA 2LKDA 4HZIA 1W47A 4IHQA 2Q0HA 5EQTA 3A4MA 1A4RA 2IUUA 3ZQJA 4BLPA 1NRJB 2QMOA 2HXSA 4HZUA 5JHGB 5JCPA 2IA5A 1MRSA 2OBMA 4HUQB 1E0AA 4TSFD 4EJSC 4JLKA 2IBMA 1OHHD 2VLIA 4IOLA 4WIAA 1NP6A 2XOKD 2Z43A 4JLNA 1XD8A 2AHOA 3WHKA 3BB1A 2VO1A 3AUXA 4PZZA 2C95A 2ZE6A 2ZUBA 5BYJA 3K1JA 2IYRA 4JJKA 2FDCA 3L8ZA 1FNMA 4M9XA 4Q4AB 2KWIA 5BN4A 3OE7A 3RDPA 3UATA 2WWYA 2N42A 4WZBE 1RJ9B 3CZQA 4FN5A 1D8TA 1XJQA 2LKCA 4B32A 4OHXA 2FN4A 1ZD8A 3Q85A 1KY2A 1OFUX 4MUAA 3KKNA 4G01B 5B30A 4JLMA 1BO6A 1TL7C 2NZ8A 2IS4A 4A0HA 2VP9A 3DDCA 1K8RA 4HAVA 1N25A 4CDGA 3ICQB 4DIEA 3QKTA 4OK3A 4PZYA 2XTMA 1EXMA 2A5DA 1KGDA 1KI8A 1P2TA 4TN1A 5JRJA 1XX6A 5JZVA 4LJ6A 3AVYA 3IQWA 2WWHA 1D2MA 2PZGA 4YXWD 2OBNA 5FH9A 2AWNA 5HZKA 5JS7A 2KB0A 2GETA 4LBWA 4AY2A 2WMOB 1WB9A 2QPTA 1CJUC 1LS1A 3AKCA 4EDHA 5CJ2A 1GL9B 2IYLD 1FNNA 1J70A 2XXAB 2IT1A 4QG7A 2OAQ1 4F4IA 1OE0A 2CL6X 2C77A 1FW6A 5JJLA 2DR3A 4R7ZA 1XMIA 2VL7A 1FX0B 2YOGA 4FINA 1XEXB 5CDFE 3AM1A 1AS2A 3CR8A 1CJMA 1XNJA 2WJVA 4Q1FA 3EWAA 4HLUC 3TLXA 3V9PA 3GFTA 3SJCA 621PA 4LI0A 1YJ5A 2DY1A 1E99A 5DYIA 4TQAA 1E9DA 1S8FA 2NPIA 2HT6A 4B2LA 4WZ6A 4JIMA 4QGGA 1P4SA 1UDWA 1N5JA 1Z2CA 2CHVA 3M0EA 3DHWC 5JJIA 1NF3A 2QE7D 3W6OA 4ON9A 5JBQA 4P4TA 1PV4A 4WAUA 3MAAC 4MKHA 4MDEA 4M2LA 3IO3A 3GLHE 1XEFA 1DAIA 4E09A 3W8RA 1KI1A 2ZM5A 4P32A 3EPHA 1P73A 1GRRA 3NDPA 4MYUA 4UKDA 2QT1A 3L43A 2EFDB 1U0JA 3NTUA 4EAQA 4D6PA 4DEYA 1E69A 2Q3FA 2ZUCA 1OW3B 3QPVA 2B6HA 3ZD6A 1NJGA 3L2OB 1G8HA 3TUJC 3E1SA 2C8VA 4GOJA 4TMZA 4W9MC 3RRMA 4D4LA 3MWYW 4GT1A 2KJQA 1L8QA 1TF7A 4MH0R 4DIDA 1GRQA 2FSIA 1BMFD 3MRSA 1E2MA 2QGZA 3I73A 1SVLA 3K9NA 2EVWX 2WJYA 1VPLA 4OKSA 1G291 1CTQA 1E0KA 3I61A 3EIEA 1SXJD 3OIVA 1YR6A 4G5GA 2VYFA 3DMDA 3B2EA 2D7CA 4DBLC 2QGNA 4E5UA 5DHFA 3A1WA 3ECCA 2QQ0A 2R44A 4RKFA 2IWHA 1RRPA 1W36B 4B73A 5FTNA 1CJTC 4JSYA 5KDLA 1CR4A 1XB2A 5FUWA 2GZHA 2R8RA 5FTKA 4F38A 2CCJA 4CRWB 1DAFA 4AG5A 2R9VA 1KMQA 3T34A 3K0EA
chains in the Genus database with same CATH superfamily
2X8JB 3D02A 1RAHA 3NOQA 2YJ5A 5CXXA 5CFOA 3I34X 4AS3A 1ZXBA 1U0RA 2QRNA 2QV0A 3WDLA 5B37A 2AXQA 3FNRA 4AJNA 2QM0A 5HJ7A 1QHGA 4XYEA 4TVOA 2QZJA 4M8IA 1RHUA 1K68A 1KA9H 1MMFB 2AYYA 2HC9A 2PU5A 5J58A 2NTJA 1YVDA 1HI9A 1BD3A 1ZM9A 4KFRA 3NR2A 4WBNB 1P9NA 3AHIA 1QYXA 3M83A 1AUVA 3IXMA 3RSGA 4BGUA 3GGPA 3PQ8A 5IFKA 2NIPA 3D8TA 2VP3A 5H7XA 4DAOA 2Q50A 3U6KA 1UWKA 1SIWA 3WOHA 5EGNA 1T0HB 2QD5A 3NGXA 1RYYA 4LQCA 3EGEA 3GELA 5KYUA 1N78A 3UBTA 2NSLA 3Q3GE 3UV3A 2ZI4A 4BLWA 4GUAA 3RM3A 4C0AC 2Y6UA 3GN2A 1VQ1A 1M2VA 1QPBA 4TRNA 1GPKA 5J4VA 1YQEA 5K6TA 4RE6A 3KZ1E 3GLIA 5EE5B 4I5FA 4ZANA 1G7SA 2BFCA 2CD7A 4BGIA 5LMUB 3JWHA 1IXKA 3FYTA 4M7PA 1SPXA 2HH9A 4OFZA 2B4RO 2PPVA 1BC5A 4B85A 2Q9AA 3L6BA 3V55A 4C3ZA 1ZXXA 1KVTA 2VYVA 1C7FA 3NWEA 3N0WA 4K81B 3U62A 3WKEA 5TPZA 1Z0ZA 3RYHA 4ZU3A 1NUSA 3VX3A 3FKJA 1L4YA 2N47A 1V1MA 5AM0A 3VDRA 3SLRA 3LM8A 5CYOA 1KP2A 4BY9E 2AOVA 4WFJA 3LNTA 3U40A 2B5OA 3GRKA 5LWQA 3NHBA 4GM1A 1VBNA 4IH9A 4MPDA 5E1OA 1J90A 2W6ID 2HWXA 1OWOA 1WS6A 4JUIA 1QKJA 4QPJC 1JIIA 4RPHA 3P94A 1X38A 5CT8A 1CERA 2W98A 2YN4A 4PYNA 3SYTA 3AP1A 4L50A 3TQFA 4ERNA 5KU1A 1ACJA 3KJXA 4PLWA 4XCXA 4TMVA 4RORA 3EDYA 5FAKA 3COSA 4CV3A 3AUKA 1U0SY 1VPWA 2EFYA 2D2VA 4G8DA 4QVKA 3N28A 4YT5A 1V3VA 4UM9D 4CEIA 4DCNA 2FEWB 3DR5A 2M1XA 3Q72A 4RK0A 5ILGA 4PEVA 2XNSA 2ZG6A 1NKSA 3Q9NA 5DHTA 3SC4A 5FCDA 5IBPA 2MMCA 3TYXA 4EKDA 1EFPA 1N9GA 3HA3A 3TTSA 3EDCA 1X70A 3UQYS 5I8PA 2JFHA 4JEHA 2PBRA 2RHDA 3PNKA 1ZD4A 5LQRA 3ABRB 1S8OA 2P65A 3A6KA 3U9LA 1PR3A 3V6LA 2H4ZA 4P4GA 4JZYA 4CTOA 3K4PA 4D4KA 2JW5A 1ZCFA 1PT8A 1KQFA 1W2WB 2LXNA 4KXLA 3QYAA 4MKGA 4OBBA 3ZVNA 1GO2A 4R2MA 3DVQX 4KAXA 5AWFC 2I80A 2HF9A 2JIZA 5DM1A 3I2JA 2L18A 3KPJA 4WFQA 4PFSA 3OZWA 3TZHA 3U9TA 4BO7A 4WWHA 1EP9A 3B2NA 3ESYA 4RKWA 1R5NA 3AJRA 4HD8A 4JP8A 4TLCA 3C3KA 1SELA 4DR7B 1D2EA 4MK4A 1EE1A 2XT6A 1IYZA 4JJEA 1LPSA 1A95A 2ILTA 2YC2C 5E1MA 5EP3A 5L3QA 5EXTA 1MKYA 1SBQA 2FZ4A 2EBHX 1PJAA 4P33A 1IZYA 1UMDA 4DLUA 1OROA 5SICE 2EJVA 2OOSA 1S2MA 2CB0A 1OV4A 4FJ1A 5ESWA 1PT7A 3UHOA 1I1QB 2KLHA 4QFDA 1GGKA 1Q16A 3NASA 3TH5A 4F12A 4QD3A 1HDOA 4ZRDA 3OJCA 1KEKA 3FROA 1ADYA 3CW8X 1VL8A 1L4KA 3E7WA 1E5DA 4GX1A 2Q5QA 1N5LA 2MYTA 2P2CA 4JMPA 4PYJA 4J0FA 2OFOA 5B7GA 1AMNA 4KXVA 1V43A 3K0AA 2REQA 1KFBB 4E4TA 4OI2A 4G1UC 4GVPA 1QS0B 3QVGA 2XB2A 3KFVA 4MLDA 4ZT3A 2GEFA 2XCUA 2I33A 1RLIA 3DM9B 3AHJA 4ZO7A 4RVSA 4ZI5A 4BCBA 2RH4A 2YQ5A 3EEBA 1BWPA 3OCYA 4RTKA 2VHTA 1ECBA 4BMPB 1EFVA 4P9NA 5J23A 1M34B 4KAJA 5AVYA 3R3YA 2DCUA 2ET6A 3K31A 1WMAA 3DBHB 3HO1A 3QV2A 5AW5A 3NP7A 3ROKA 3EZXA 1OH7A 4LF6B 3H83A 1FLNA 1JHDA 1V95A 3EOAI 4MUKA 1AKQA 4Y9RA 3A6HA 5DN6A 2FJPA 1H8ED 4HX9A 1YOVA 1T6NA 3PQ3A 2GJKA 4L07A 4CTJA 4NTZA 3I23A 2BFMA 5KX5B 1LD3A 5FTJA 1CIPA 1EQAA 4NNOA 3OE1A 2E4WA 1V8DA 3IAS6 3H8WA 3D0KA 1HOTA 1RNLA 3I09A 2G4VA 2J6CA 1HQDA 3RYIB 4AP9A 3FAKA 3TLGB 2NZVG 4ZV9A 3AC0A 1R0WA 3JQQA 3MN1A 3O90A 1PR6A 2PRKA 2H8GA 3FCUB 1YNOA 3A1TA 3EXFB 1R0SA 3DDUA 3FMOB 2VH1A 1KDZA 4BLRA 2GCEA 3KKPA 5T5QA 1ZK4A 1US8B 4Y6QA 1XLTC 1UWLA 4G63A 3TOVA 2ZRNA 1M6NA 5LP6C 2C99A 1ULBA 2IPLA 1UJ4A 1XP5A 3TR0A 5K3DA 1GZ7A 1O4VA 1Z6YA 3DFZA 3L4BA 4DM3A 3P0EA 4CTKA 4PR0A 3W6NA 2PWYA 3QFRA 3TD9A 3EPLA 1JALA 4YQEA 1U63A 3UK0A 4H16A 4IIGA 4B3BA 2W2NA 1RABA 1X3SA 2OFWA 2Z2IA 3O7WA 1W0JA 4J94A 4CKWA 1JEJA 4EB3A 3RJZA 1YL6A 3I4FA 4TROA 4EH1A 3O1IC 4Y2UA 4RMHA 3OM1A 1S3FA 1JHAA 3RBZA 4AUNA 2F1RA 3UTDA 3TQSA 5CLLA 3X2FA 3ZV6A 2GGSA 4F8JA 4RTSA 2J3HA 1N5OX 4FR5A 1NBMD 4AULA 4EW6A 1BVYF 1SVOA 2ID9A 3STTA 4ACBA 3RR2A 2W2XA 5FNVB 1QH9A 2EOAA 1KEPA 4C5AA 3K70C 1W75A 1Z6PA 2IUYA 2AEEA 3MXTA 2G1JA 1NLYA 3N2GB 2I1QA 3FLBA 1ATZA 1B26A 2FMHA 2NOAA 3ROFA 3THOA 2X3YA 5IWCA 4DWJA 3I2GA 3W79A 4K6OA 1NDUA 3G8CA 1WUYA 3FSGD 2AK3A 1J2UA 3Q9LA 5FLYA 2WJZB 3A2NA 3V7NA 4F9EA 4W5NA 3WKBA 3MOGA 1XHEA 2QX8A 3H5VA 1UIRA 1L4NA 1DCKA 2IRWA 3ZEAA 3CH7A 3IQGX 1M0TA 4ZMSA 2CYBA 1A71A 1O87A 1OX6A 2F17A 3RGGA 2IXGA 2J0EA 2QD1A 1COWD 2W42A 1G16A 2X8LA 4GGOA 1GJRA 2VJNA 2XT9A 1F0PA 4YP7A 3DV0A 1TTQB 2HMTA 3GG2A 3LUAA 2RHHA 2WG2A 4X63A 3CSSA 3TCNA 2ADMA 1S3IA 2BFBA 3RI3A 1QGOA 3L7YA 4KYVA 3UNXA 5B6IA 2O2EA 2Z56A 4DCVA 3UXHA 5JCOC 3UENA 2BMFA 1FSGA 1DWOA 1WG8A 3CZPA 3H9CA 3I3SR 1T3LA 2QT9A 1GRVA 2XJ4A 3V8VA 3VR1A 3H1BA 1FJXA 5IJXA 1GSIA 2GHQA 3L1HA 3NH9A 3W3AA 1PJ3A 3NW9A 4NHEA 3THYA 1Y1PA 3S8MA 1Z5GA 1ZNWA 4PYOA 4YAEA 1YJCA 2OHFA 3GVPA 1ZICA 4MW2A 2ID8A 1PLJA 1YCDA 4JROA 5CHEA 4EKNB 1VLLA 1LQUA 2Q1WA 3D3EA 1X7GA 1VI6A 4GBMA 1T0PA 3VAYA 1T2UA 1MA0A 4ZHSA 3FYSA 3MRTA 2QRLA 1TQHA 2REBA 3I1IA 3K0KA 3CR3C 1GGMA 4NCKA 4R8MA 4Y2RA 3C3EA 5H16A 3P9YA 3WLEA 2ZQYA 3PWTA 1T3SA 2HSGA 4NULA 1IZZA 1P2FA 4DJ5X 1H8HD 1JIQA 3QMWA 2HT1A 4LW8A 4X20B 4NYIQ 4MZDA 1BYIA 2VH2A 1MEJA 4LA4A 3LDAA 3PHLA 1C7ZA 5LZ8A 5LJLA 3I8OA 5HQJA 4F06A 1FFSA 4GHWA 3S3TA 1XVTA 2GYUA 2VHWA 2Y93A 2QM8A 1MEOA 3BZWA 4GUDA 3UGTA 1LDBA 1BGVA 3LXRA 3M6LA 2QNIA 4Q9AA 4LHXA 1HZZC 2P1DA 4ETNA 2IEAA 1IH8A 2V0GA 1KRHA 1FYEA 3OFNA 5EPOA 1NONA 4AN0A 3MUNA 3OUUA 3UUEA 3N0RA 4ZVRA 5F1OA 2COEA 4FE3A 2F9MA 3OZSA 2IYYA 3NC1C 4OXXA 2W2MA 4LE1A 1GNRA 3DL7A 1G21B 1JIJA 1U9ZA 1I8TA 1AIPA 4KWEA 1SH7A 3SR3A 4JT4A 1JDUA 2FEXA 3G2MA 3V46A 1JBQA 3RBAA 4II7A 2VF7A 3AOEA 2IYOA 3EB9A 4LHVA 4BHTA 2O8CB 1IUOA 1O6ZA 1TKAA 2IX9A 1E9VA 4QSHA 1S4QA 2VP4A 1FFEA 2O1SA 4HDSB 3W8NA 4WEOA 3M1LA 4EWLA 1GRCA 2W6JA 4GWGA 5DMXA 3ZDBA 4GP9A 1L7BA 2VQDA 2ZYWX 1IJBA 1R0XA 2NUPA 4P5PA 1QVVA 2BONA 4V0LA 3CW9A 4ZJZA 1K7EB 4P3NA 3SSNA 2ZRFA 2IPNA 2ZPUA 4A3SA 1XYGA 2ZSBA 4RW0A 1P62B 1K5PA 1Z4LA 2VXCA 2YWJA 3RNOA 1NXVA 4KBGA 4B3GA 4KPUB 4OL9A 3G68A 3Q5DA 4QDJA 4NONA 3ZV4A 1JIKA 1J99A 1VC2A 2O14A 1I6MA 2IL1A 3CB2A 5L6MB 1W5BA 2G9QA 2O52A 1TU0A 1DTEA 3CO5A 2RSLA 3LXMA 1CR1A 1GV1A 2G8NA 2Y1DA 3GXBA 1TTTA 1UJMA 5BV7A 1CUXA 2HRRA 1V48A 4Z9YA 1U4OA 5ECGC 3UAWA 4OB8A 3IDAA 5DBIA 3V6MA 3T5TA 3WA6A 1N5RA 2ONKA 1E96A 3AJ8A 1EFUA 3ABIA 3AK4A 1V5GA 1BCRA 1O95D 4DCCA 2P6RA 1YB2A 3EXIA 1G2OA 4R0VA 5BNWA 2C54A 4KH0A 4URHA 1GGFA 1KDRA 1WUIS 4X6UA 2HWKA 3PLAE 3R20A 1I3NA 3EIUA 1QV9A 3PJFA 3QVJA 3D9QX 3MGKA 4EF6A 2QP3A 2AZTA 2YC4C 4QX6A 4S2EA 2PUAA 1EM8B 1ICEA 2IP4A 2QJTA 5L3SB 3BWXA 3UOAB 4PW0A 4YYEA 3FZNA 1M1ZA 3HR7A 3EUFA 2AJCA 1ZH2A 1O94A 4H1HA 2IXAA 1KJZA 4AJ4A 5TLSA 3I58A 1IY1A 1KZGB 5T8KA 4DDWA 2JJ2A 1POWA 5AW2A 1T0IA 4JXXA 1CY8A 5LLSA 2YV4A 5J4LA 4MW1A 2VHXA 4Z8XA 1E7RA 2GCOA 1A4XA 3AHGA 5JQGA 1ZH6A 4ND5A 3PPIA 4NARA 1E3LA 2IYSA 4NBLA 1QB8A 1CT9A 1KPHA 2W48A 4P2GA 1P2DA 4N6OA 2J4CA 1NUTA 3FWPA 3O3CA 3ROQA 3WSVA 1KPIA 4N18A 4IR7A 4U5XA 2PS1A 2HO4A 2YYSA 3B6EA 4OXIA 1JDBB 5ALEA 3TAUA 3SHFA 2GZ3A 4E2WA 3ND5A 1NASA 1EESA 1DWUA 4Q66C 2NU7A 4J1TC 3M6UA 3UJAA 1H05A 5KPJA 2IIVA 1BAPA 1BWQA 1FMJA 2F67A 3F6BX 3SJUA 1NQAO 1PJTA 4OK6A 4GX5A 2UVPA 2HRCA 3LUKA 4HWGA 3CT4A 3X1MA 1B23P 3H0KA 1YCFA 3OF2A 4PO9A 1KTVA 2J0QA 1AF4A 2GNPA 2R1TB 4ZO6A 5KJEA 1BGWA 2D7JA 4LQ4A 2XB9A 5AI6A 3YASA 2XTZA 1CY4A 3RT1A 5CYGA 2BM9A 1H9CA 3DTVA 3VC3A 5G0VA 2RI6A 1ESZA 3IESA 2CFIA 1TCBA 2MT9A 5DBFA 3TUIC 1DFGA 4EITA 4HQ0A 5JBIA 4FPXA 4IINA 1UJ5A 1MT3A 2NZJA 3RO7A 3QSYA 1HLGA 3FJYA 2JBAB 2CK3A 2JAOA 3RASA 4IIDA 1IJKA 4D9HA 4IZ6A 1M33A 1OF1A 1DRUA 3T5CA 3TFOA 3I5YA 1YRQA 4GKVA 1XZJA 4J4TA 2A5YB 1NC3A 4ARCA 4TKUA 2V6GA 2JFNA 1WBDA 5CLIA 5KREA 3Q88A 2VHUA 4D0SA 5LXTF 4XYMA 2Q41A 2BEWB 3HBMA 8LDHA 3H99A 5BXYA 1U0GA 2LVBA 2R8XA 4ZT6A 2DHCA 4EO7A 5KYXB 2COUA 1PGPA 3V97A 3LV8A 4JI5B 4IDNA 4JSRA 5FTLA 1JTVA 1GHTA 3ER9A 1J23A 3MGCA 1V7QA 1Z0JA 2JHFA 3DJFA 3HKDB 3M5WA 1JG2A 1E2GA 3OVMA 1T13A 4MX8A 4WOCA 5E3JA 5IZCC 2RC6A 1L4FA 2E55A 4EP1A 3BWEA 3EVTA 3KXLA 2ZE7A 4JGBA 4JVMA 4R5HA 3TFWA 1QGED 1FMFA 3ZJUA 3OM0A 1KH1A 5E9JA 4DA6A 1WCV1 3N2KA 5K45A 4YJKA 5D3QA 4B3TB 1LVGA 1SKYB 4LV6A 3UYKA 4PLVA 1GUZA 1HEYA 1SBHA 3G2HA 1Q57A 4BV8A 2EDAA 1AE1A 2YJ6A 3I4LA 4IVRA 5TB5A 5AK5A 1SG9A 3UMJA 2N0SA 3VVBA 5I45A 5JPDA 4LAFA 2AEMA 1I33A 3G85A 4BXOA 1XZPA 2Y0DA 3GJXC 1XQVA 1FL9A 3QNMA 3EZYA 4F4UA 3NIBA 4NLLA 3PTAA 2O7SA 3V3TA 3C8ZA 3KM0A 1F1BA 5LP1A 1C9JA 1YRWA 2JEOA 1OLUA 2NO7A 1FC0A 3PGJA 3R5KA 2ERXA 4BFCA 3TNDA 1X2BA 1RJGA 3KAJA 4OUDA 4ZD6A 5LZ5A 3U1BA 3THWA 1PS0A 4D97A 2XQKA 4P4SB 3P9QA 3PT5A 3Q15C 1GILA 4JB2A 4QXMA 1J97A 1DPFA 2OQVA 3ZU2A 1RXSA 4OTZA 1BEUB 3T95A 3T9CA 4LGCA 4WRRA 3TMAA 3VKVA 3NOOA 1OZ0A 3U3OA 1NSFA 3EYAA 4QPZA 2ZUUA 3O4IA 1CVIA 2ZWAA 4GZLA 4GRDA 2Z30A 1KIMA 1P2BA 1DEXA 4KP7A 2ZRQA 4C04A 1M10A 3K9LA 1E5VA 5L4NA 1Y9AA 2FQXA 4Q7LA 4LZNA 3DAFA 1KS2A 1XYVA 4PQFA 2PEZA 4LDJA 1CY1A 5JD4A 2XADA 1E32A 1PZEA 4B2IA 4X00A 3ZNNA 1VHLA 2EEZA 4UXIA 3NKFA 3KKZA 1CDDA 3MF4A 4ZDWA 3FJ1A 5BV0A 1UJ2A 2VCYA 1FRFS 5BMVF 2W0SA 4C20A 1UOEA 4DAEA 4G0NA 3FOWA 4PVCA 1KOFA 1MB9A 1AVTA 1TU3A 3CSUA 2OWEA 4PLGA 1FJ2A 2AOWA 3PXBA 4R2JA 3UMGA 4DYVA 4S04A 3K0CA 4B8ZA 2PMWB 2RIRA 2XV1A 1ZAYA 3NHJA 4M0FA 1RQGA 3PJGA 4CKYA 1U7UA 2YX1A 4DDTA 1ZH0A 4OGLA 1IBCA 2H5IA 4PTZA 4OXKA 3CPSA 4H4DA 5FYDA 5JRZA 3I04M 4WACA 2X0RA 2XCOA 4RLFA 2YW9A 2WJ4A 3JRXA 1Q0HA 1JWLA 1E1CA 2AA3A 3Q4GA 3AONB 1R8YA 1G5IA 2P6OA 2H31A 2ZKLA 3KAKA 4WDQA 3PVCA 1ECPA 1XZKA 4MI3A 1KERA 2FXIA 1SA0A 1EJ2A 4DY4A 3AF1A 4XPIA 2AFIA 1F4PA 2V74B 3E1GA 4QDZA 1FZQA 1E2DA 2PX0A 2RAVA 1U8FO 2X4LA 4J1SA 5CR9A 1QX4A 4J9VA 3RW9A 1BHO1 1CE8B 2A5FA 1CZKA 2DLNA 2HV9A 2OCYC 1V3QE 2YY5A 2ZU6A 2OZEA 3U4HA 2P62A 3L7JA 1RM5A 1D2CA 5ITVA 1V5IA 3CLUC 2WAAA 4RVGA 4NE9A 1TGVA 2JFPA 3RAEC 4EDFA 3HJCA 1KYXA 4JBHA 1NXXA 2YZNA 3LDFA 3VC7A 4LJSA 2ZYHA 5AVUA 1KO5A 3BD9A 1QGYA 3LC7O 1J5XA 4B3CA 4DCUA 1QNLA 2ZTHA 3DVRX 1NPDA 2X6QA 3AEUB 3WC4A 1FIUA 4UU1A 6REQB 3ENWA 2OUIA 5AH0A 1YIAA 3I6MA 2RJOA 2I8CA 2OCIA 4KGXA 4F2WA 5FWAA 5FOTA 3BE8A 2IELA 1D7OA 4X65B 2PVPA 2Q3BA 1KZ1A 2ISCA 4CPDA 1LNSA 3O95A 3IAXA 5CDGA 3WK8A 2FFBA 4BRUA 3AUSA 2CV1A 2JCYA 1ZK3A 5AUOB 3V8PA 2X58A 2QN6A 3DUWA 3FVVA 4FMCB 4YRFA 2GPWA 4BMYA 4C6TB 4R2LA 1G42A 2EC5A 3ESQA 4I99A 1CZHA 4C4AA 4ZIRB 5FWYA 3KYDA 1SK9A 4BBZA 3H5LA 4L0QA 3VHQA 1V35A 2PK3A 3AEXA 4LDRA 3VR4A 3GZNA 2ZIWB 2OHJA 2QVZX 2R5FA 4KFSA 4XLTA 4YRPA 3WNDA 4AZTA 3F6PA 3KYJB 5BSFA 3AVUA 1R0LA 3KALA 2VF4X 2O8FA 4GECA 1RWPA 3CZAA 3U44A 1HK7A 3RAPR 1YI8A 2WWXA 2O2ZA 1GTG1 2VNHA 1II8A 4UHDA 4MWTA 1PL0A 2VA9A 3HCDA 3TBFA 4A73A 4UQLA 5K8JB 2BW0A 4UUBA 1XXHA 3KB1A 1XEWY 4X1IA 3ZHBA 3S4YA 3I72A 4Y2HA 1J0EA 2G1KA 2RCNA 4L95C 2AXNA 2JFOA 1P3DA 2P91A 4G09A 4Y1RB 4JWTA 3VI4B 1XUOA 3THSA 3EIOA 4UAGA 1V1RA 2B8EA 2HK6A 2YXDA 1EG7A 2WWIA 3CRNA 4M55A 1TIKA 1MCZA 3WGNA 2CF5A 2AMFA 4X41A 2B2CA 3VHXA 1SKYE 1TLFA 3OX2A 4IKOA 1M1NA 3GPBA 3NBAA 1WR8A 3GPIA 1T5SA 1IONA 1YUBA 1Z88A 2AL7A 1ZHFA 2EIXA 2Y1CA 2YIJA 3B7PA 3QYPA 3T3PB 2V55B 1WBJB 2V7TA 2Y2VA 5D5PA 4CLEA 4D43A 1CHDA 4FFRA 1TMOA 3NETA 2IPXA 3BL6A 4F96A 3U0VA 1XTQA 1C0KA 3KQKA 4JLUA 4ER6A 4U63A 1M7GA 1WV1A 3TIXB 2FFJA 4Z1MA 2I9KA 1MO5A 1SOMA 3M1IA 2RI1A 2LWIA 2R96A 4AIIA 2QSUA 3V8NA 2TECE 2QG6A 1CYDA 1H2WA 2RGYA 2QQFA 1GD1O 2VRWA 4NZYA 3BF7A 4OH7A 1WXIA 2E1RA 2IVFA 3REQA 2CUNA 2H1WA 4NCXA 1AK1A 4KWCA 5DEIA 3TF5A 2YZGA 2R8BA 1IY9A 2C5GA 4FDAA 4YV7A 4BQOA 5C1BA 5E8JA 4DA9A 4XIIA 3GJ8A 2WILA 4UBIA 2YXEA 4PG7A 4LIPD 4N3BA 2J45A 4X8LA 4B3HA 4BO6A 4TRRA 4IZIA 3SDBA 2NXEA 2FEKA 1JKIA 2XCIA 5I4IA 3X1ZA 4CCYB 3WLOA 2BGKA 2P3LA 2IU4A 4LXGA 3IQHX 3DFUA 4GFDA 4BDSA 2OZLA 2YUIA 5U1PA 4V39A 5INTA 2C2YA 4XGQA 5DBGA 2D74A 2IXTA 4B76A 2FPSA 4HX2A 5JW6A 1HRKA 3GDHA 3EZ7A 1CRQA 2VDVE 1C50A 2X2FA 3BE5A 2MMGA 3HHPA 3LW8A 1DC3A 1QHYA 4O2BA 1X7XA 3RFXA 4BU1A 4UFNA 3FBGA 1CUBA 1EHIA 1C7IA 4UUPA 3N2ZB 4F93B 2WSBA 3V00A 2W7TA 1SC6A 2C8LA 3HY6A 2XNJA 3ULKA 4QC2A 1EGQA 3TR5A 1XPJA 4FHGA 4RH1A 1ZONA 4DPMA 4AP5A 1OV6A 2QW1A 5IW8A 2BEUA 3EXHA 1JUDA 2IITA 2XUGA 4FMDB 4PWZA 4YJDA 2G0NA 4H59A 1A9TA 1HTWA 1NL3A 5FFFA 3GFQA 3KL4A 1YOBA 3SYNA 3VO9A 4C0BA 3DR3A 5BWOA 4B83A 3AVXA 1VCMA 3LOPA 4F0JA 2C5HA 1SG0A 1UBHS 3BM5A 4RIHA 3OTWA 3ZIUA 1N8KA 2ZR7A 4D0GA 2FNAA 4DBLE 1T2DA 2OY0A 4MCAA 4D4IA 3QEBZ 5ALUA 4Z2YA 3UCFA 3WNVA 3ADKA 2BLLA 4L0CA 2ZJ8A 3C87A 1AJEA 4R4JA 2IHBA 1H1DA 1GTJ1 4DKJA 2XZLA 1GOTA 5FPPA 3EAGA 3HDTA 4OSOA 4HDOB 5A03A 3B36A 1PWYE 2D5AA 2DSNA 2W9XA 3L8DA 5DI3A 3WQRA 4KMSA 4EMBA 2QV7A 4EMSA 3IIKA 4U3JB 1PEKE 1H0SA 3GFPA 4DHEA 3ZDCA 1Y89A 1GVNB 2OEPA 2XRZA 1JBKA 3QVOA 4BQIA 4C4YA 1E2FA 2GEJA 1PFVA 3D31A 4UUAA 4DA8A 1BVRA 1BE8A 1E9BA 5AKHA 3DL0A 4YV0A 4YECA 4HN9A 5EE1A 4PICA 1M2FA 3VUEA 3BS4A 2F3SA 3AR6A 1G17A 4L5CA 4Y3UA 2F59A 1QO0D 4GZ5A 2WF6A 3BKXA 2IOFK 2XHEA 4PC3A 3OZXA 4XDYA 1N6OA 1KSFX 2VT6A 3RJMA 3CLRD 3HUEA 1SBIA 1T6XA 4AY6A 4WINA 3MJDA 1IVSA 2I7DA 4UMEA 1EFRD 3QW2A 1F8FA 1YZUA 3L7MA 2XVXA 4O4LA 1LXCA 4Y6PA 3FOFC 2ACVA 1A4UA 1JN0A 3HYCA 2QJRA 3TTVA 1D04A 4G8BA 2GK7A 3AILA 5JZBA 3EGOA 5E7IA 2OSBA 5ICGA 4IP0A 2GBLC 2JJQA 4ZT4A 2W11A 4TWRA 3BMCB 1N1MA 4D8VA 4YY3B 4EGSA 3KKEA 4TSKA 1RS0A 2IQ5A 3NP9A 1MZPA 3FFXA 4YAJA 4WA8A 1W88B 3KZKA 4K6MA 3FCEA 3VDMA 3RVSA 1V4BA 3K09A 3E1KA 1PUIA 4A2QA 2CKMA 2ZWMA 2YV1A 2FMIA 2E6KA 3FTDA 2BF4A 4DLNA 3EC2A 5E3IA 1IN6A 4F7WA 2Q4BA 3VOTA 3RUFA 4V1CA 4AZ3B 1QGAA 3KOOA 2YIVX 3VZBA 3H5RA 3KQNA 3KWMA 4HQRA 4CLHA 4U8GA 2L17A 3OO0A 5FLKA 5IANA 4XWTA 1V3TA 1YS6A 2EX1A 4RKYA 1PVDA 1AQJA 3H2ZA 2ZR0A 4G0PA 4OP1A 2I91A 5FFMA 1E94E 1P1FA 1RBZA 2ACEA 3C7DB 2I2FA 2QGFA 3USCS 4CIWA 2QAIA 4AO7A 4OLFA 3OAAA 2PL1A 4UHFA 1KYVA 3V4FA 3RRFA 1Z0FA 3TR6A 2LE0A 3V1YA 2I03A 2W8BA 1J09A 3F73A 1ML4A 2CBZA 3HHEA 4WUTA 3TDNA 1QIEA 1TT7A 1YB6A 4A8PA 4G1CA 2YJ3A 3C15C 4LDPA 4EVRA 3LAWA 3W06A 2R8ZA 2YWRA 1FPMA 3AXSA 3OIWA 4J3NA 3S70A 3T7KA 4EPVA 5C8DA 2J9FB 2WICA 2O07A 3SJBA 5BMOA 5AM3A 4Q48A 3VV3A 1F4LA 4ZU6X 1YHZA 5D3MA 4Y9DA 3TGPA 2GJ8A 3AF3A 5C3UA 5EHXA 3TQCA 2QX7A 4JNKA 1AGXA 1UWCA 4QOHA 4ZREA 3ZGOA 4F11A 2OQIA 4IDHA 4MB2A 3ZXYA 3VNVA 4PM4A 4HAXA 5D6NA 2ECKA 2GF9A 4N82A 5CX4A 4TV9F 4NYJQ 1A96A 1WEKA 2LPMA 1L9XA 2CCKA 2M6SA 3PPXA 5HX7A 4WV3A 4W1RA 5AKZA 4BNKA 1S1MA 4I9UA 4QGFA 3VR4H 2C31A 5I9IA 4PPNA 4WT7A 3IS3A 2I7VA 1I4TD 2H54A 2QJOA 4PYKA 3JZAA 1JSCA 4I8DA 4WI1A 3M3PA 4H4CA 2EKBA 4WKPA 3VR5A 2H6EA 3CMMA 1N0UA 4P7JA 4FEGA 4M1YA 3SOZA 4C03A 2XEDA 1E89A 1TMGE 3K30A 5DSXA 3WNZA 3ZGLA 4F04A 3UJHA 4DXDA 1QORA 2AUTA 2J7PA 2QTNA 3LSTA 3B1XA 2CXHA 4LC0A 3KTDA 1BRMA 1BXKA 1C41A 2PIDA 1EQ2A 3TRKA 1M0EA 3OEWA 2ZT6A 3UXMA 4BZWA 3OTQA 1TGYA 1XF1A 3A58B 3EC7A 1NPTO 3TQQA 2DH5A 3TX6A 3U37A 5BYKA 4LXIA 3A10A 1U9JA 1F2TA 1KK2A 1TOAA 3SIWA 3UN1A 2F00A 4ZO9A 4OB6A 1EFDN 1EK5A 3LT0A 1ZGJA 3MCWA 4MV3A 3GLFB 4P0PB 1WKCA 3HUTA 2VUSA 3PHJA 3QIVA 4FHFA 3CM0A 3K5HA 4X9XA 3KD3A 2PS0A 4YCMA 3ONDA 4P53A 1I7QB 2CXXA 3G1UA 1A7KA 4K9SA 4XPZA 3HM9A 3ANYB 4CL2A 3MQFA 3WHPA 4WLNA 2EARA 3OQ6A 1PLKA 1THZA 1UK6A 2X76A 4Q9NA 5HZGA 3EAQA 2A4MA 3DWIA 4B1FA 3DS8A 4FCCA 4ZI7F 4ODIA 4XJVA 4BV2A 2QTMA 3NHYA 1GUBA 2B4AA 1EVYA 4MRSA 4RO0A 4CHTA 2XB8A 3JQRA 2WNHA 5KTYA 1GGHA 1OYVA 1HG0A 5C7YA 4IOKA 4RDIA 3RBXA 1UFOA 3ZOKA 2R00A 4JVSB 4M53A 3WKAA 3R75A 3MGGA 3GT7A 3WGMA 1HYBA 5HGJA 5AW0A 1Z63A 4ZOEA 2I71A 1VIDA 2JZNA 4LTMA 4D3DA 3R9XB 4YJFA 1KY5A 2XOEA 4C29A 1YR3A 3ICWA 4DANA 3A6PC 4DR6B 1N5IA 5JS1A 3N2YA 3EZFA 1D09A 1DBWA 3BHJA 4A6PA 1YZGA 3JALB 1D7AA 1JHXA 1G5PA 1L9KA 5DCWA 5F98A 2GM4A 1C3OB 1U3DA 5FQOA 4K46A 5C8YF 1X14A 2ZR8A 4BO1A 3CVJA 2QNRA 1P7VA 1NW6A 4KNVA 3S5JA 1XQ6A 1JSXA 2XBUA 4ICIA 2ZWIA 4IVPA 3V2HA 2P3OA 1XDWA 2WYUA 5F1PA 5AVXA 4RXUA 1OGJA 2PT6A 4C5BA 3L1KA 2CHEA 4YMSA 1CYEA 1YK1A 1QP8A 1XRNA 1XXLA 3C2QA 2WV7A 4TLLB 1YJAA 1H2XA 3O0DA 2IWRA 4Z4FA 4CMHA 1MAWA 1W6RA 3NEJA 1U2DA 4IAOA 4NZZA 2OQ2A 4HDRB 4QXOA 2XOKA 1RM0A 1PR5A 4MVJD 2ZS8A 5EMHA 3UGKA 3BCUA 3OESA 4QJ3A 2DFPA 2J3DA 1JG1A 3E61A 3CVXA 3O6VA 5JH7B 1TVMA 1Q3HA 4D99A 3AVQA 3D6VA 4BS9A 1KI3A 2X77A 1G3RA 4YJ2A 1I4DD 4K9LA 1LQ2A 3WXMA 3E9EA 3IILA 5GM2A 2ZUSA 2ZSDA 5C5IA 4FX2A 1KZHA 1ILWA 1Q6YA 1TM2A 3SY8A 5K01A 2KYRA 4UNPA 1QIKA 3ML1A 2EYUA 4HI0E 5DT9A 3C8UA 5EXXA 3TKYA 3ZIDA 2O23A 5B1SA 5EWLB 1O95C 5FOVA 3EXAA 5HRCA 4JLJA 1KY3A 4XGRA 4N40A 1ISHA 1GNSA 3EXG1 3F3MA 4ALLA 3DLPX 5HJ5A 3M9LA 1WCIA 1WETA 1TAQA 3UCXA 1ZCBA 4W9RA 3KZVA 3KQLA 1WHSA 1JEOA 1KDTA 4IMJB 4ND1A 2V59A 4N0DA 1P44A 1DEAA 4A0RA 3QQ5A 4KQ1A 3C3MA 4L72A 4AG6A 3ADOA 1YL5A 1RZ3A 4HFRA 2VTEA 4Q3KA 5B3JC 1P7YA 3RC8A 2VNAA 4OX9Y 4AUKA 3MB8A 3D43A 1KR2A 4JJGA 5EE3A 1U0BB 4LX0A 2DHQA 3HEAA 3KVNA 2Y1FA 3CUKA 2HM7A 3FCAA 2AI2A 1KORA 5CPBA 1YJ8A 4ZYTA 4RYDA 5IF9A 2IZ6A 4WVLA 2WDPA 3KQYA 5E2AA 1KYTA 1Z13A 3GJ0A 2W6NA 3RKUA 4PZLA 1VE7A 1X2EA 1JTFA 4BWYA 2A1UA 1EHCA 1TO2E 2JC3A 3N8DA 4HR7A 4TWBA 2IIQA 3E9DA 3VYTB 4BB6A 4HWRA 2VZEA 4O29A 3V1MA 4YUXA 4G5SA 4B6GA 5AW7A 4AKHA 4WFIA 1OTHA 4LDZA 3HA2A 1JA0A 3DZCA 2PUGA 1SBTA 5FOXA 3T06B 2BFEB 1A5ZA 3FUTA 4LYEA 4EMUA 4RU1A 1WW3A 1NQOA 4KDCA 3ZWKA 2GWHA 3F98A 4ZU1X 1J20A 3CUUA 1OGYA 1XMVA 2CLSA 4IXMA 3LVRE 1GPJA 2JLAA 3ISVA 4J07A 4M8NE 4RJ2A 4DJFC 2ANCA 1QZTA 4EG5A 1G3UA 2RH5A 1XD2A 3KQHA 5HHTA 3HTXA 4CQLA 1QC5A 1P5JA 4H7JA 5IRCD 3D81A 1C7QA 1NJSA 3JQ8A 3IAS1 2WAXA 4UD6A 4Y0VA 2YFYA 4ARIA 4O33A 4EFLA 4C4PA 1RKQA 3HCEA 3RVMA 3X0DA 2AFHA 5K4GA 2K2WA 1O96B 3KXKA 4NCAA 3N8GA 3U7HB 3ESXA 4A0GA 4FDMA 1NVMB 2OC4A 2PFGA 2XIJA 1QYVA 3KX2A 1I2AA 5DB4A 2ONJA 3ZZNA 4D74A 5CA1B 4R1QA 2ZIAA 2OVFA 2A1TR 3GP3A 3H9UA 3NTLA 1MABA 4PIVA 5AVJA 3RB8A 5LQUA 1DCTA 3Q9UA 4K9RA 1XI2A 4Q4CA 2YOFA 4QXRA 4ZAZA 3A0UA 4CEJB 4JEUA 4XWYA 4D0NA 4KO4S 4U9UA 5LOVF 2F8LA 7REQB 3AIIA 1AZSC 3AY0A 3EEFA 1DSSG 1YZFA 3HWWA 5TE9A 3MWEB 5EXPA 1DMSA 3B82A 4H1WA 4XD7A 5KSZA 3U26A 2NYUA 2B37A 1XHFA 1ZDMA 4BLSA 3TZKA 2LW7A 2GXQA 2I34A 4IIEA 2NO1A 3VYUB 3DAHA 2SHKA 3R4VA 1R88A 5TV2A 5BUSA 1Z68A 1SXJA 1VL5A 1Y1QA 3BORA 2O0MA 2ZULA 1NXTA 3D3WA 2CLFB 4ZOLF 3EVZA 1JR2A 4K3UA 1FNSA 3UJ6A 2Q4RA 1SURA 3IE0A 3NJ8A 4RQAA 3C6QA 3OIFA 5J2UF 1XA4A 3UYLA 2QBYA 1BMDA 3GLFE 4A23A 2RMKA 3PGMA 2OILA 5A4IS 4IPTA 4UUMA 5ELMA 3K2IA 1FTGA 1WXQA 1GFIA 3OWOA 3C3BA 1BX3A 2Z5FA 4MHSA 3LFHA 4RUKA 1SUCA 2B99A 4GAEA 1KYQA 2QTRA