2YOFA

Plasmodium falciparum thymidylate kinase in complex with a (thio)urea- beta-deoxythymidine inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
200
Chain Sequence
DDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Synthesis and Evaluation of Alpha-Thymidine Analogues as Novel Antimalarials.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 80
structure length 200
sequence length 208
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yofA00
1W4RA 1NN0A 2QROA 5BYKA 4NBSA 1FTNA 2AR7A 2F7SA 2ZRDA 5FFMA 1U98A 2PEYA 3E70C 5FOVA 2VP6A 4JLPA 1L2TA 2GZDA 2IW3A 1KHTA 1QHHA 1Z0KA 3MWLA 2IL1A 3ND9A 4Q4AB 3W6OA 5GJVC 5IHPA 2ZPTX 4DLRA 3KFVA 3ASZA 2H8KA 3MAAC 4EPXA 2JLXA 1OXSC 4GL2A 2QRNA 4A15A 1AZTA 4Q00A 5JJIA 4LJ4A 4PO9A 2Y8EA 5FPYA 1GNQA 3CRMA 3B1VA 4MITA 1E9RA 2DFTA 4NDZA 3K0EA 5FPHA 3SYLA 1SQ5A 4LHWA 1HA3A 2JIZA 3FHOA 2PMKA 2PCJA 3K0AA 4DEYA 3K70C 1OIXA 4JLMA 1MV5A 4JIMA 4HZUA 3K0FB 2XZOA 2R6DA 2V1XA 3WHKA 1KDPA 3NIBA 3A1VA 4M1WA 4BEJA 4DWJA 3A1WA 4AIIA 3M1IA 1YKSA 1LFDB 5HZHA 4YXWD 1E1RA 1EG7A 1YZKA 3CNLA 3NBFA 2HYIC 2I1VB 4LYJA 1X8LA 1PUJA 4CW7A 1P61B 4M9QA 1TQDA 1XTKA 3ZIAD 2LKCA 1XCPA 4YONB 3BFXA 2FSHA 2ZS9A 4RKEA 4S35A 5JHHB 1Z2CA 2F43B 3GEHA 2QN6A 3NH6A 2FH5B 1YHNA 4LSGA 4BLTA 2VHJA 3VQTA 1WE2A 5KNBA 1XFAA 2F1IA 3VKGA 3LRPA 2ZROA 3F3YA 2Q6TA 4OI4A 2YJTD 1ZUIA 4B71A 5JEDA 1QHIA 3MUFA 2NTYC 5K8TA 4P32A 1UEJA 4QXAA 3BWDD 2DCUA 2W83A 2V1UA 2OV2A 1KK1A 2PEZA 4TL7A 1TAGA 1W1WA 3TE6A 3KB1A 1X6VA 4TQAA 3FKSA 1U0HC 5JRZA 5E95A 3TLXA 4KCGA 3VNVA 2CDNA 3RAPR 4CVNA 1G20E 5K8IA 1M6NA 4URYR 1J8MF 5CDFA 1UFQA 2ZE8A 5UKDA 4RD2A 3SN6A 3AVQA 4EPTA 3EIHA 2AKYA 2IUSA 3P4YA 4I4LA 4URWR 4GI7A 3T1QA 4OHZA 1E94E 3TVDA 1PV4A 3K9LA 2H18A 5E4FA 3TQFA 3OEHA 2JJ1A 3QPVA 5CYOA 5DISB 2YOGA 2D7DA 3BD9A 3MD0A 4UNNA 1N6IA 4IKEA 1IHUA 5A5GA 2DB3A 3R8CA 4A2PA 4RD0A 1BMFD 1TQ4A 3RWOA 2VTKA 3FHTA 2GILA 4POAA 3UXMA 1XJ0A 2H5EA 4A1FA 2XXAB 3IBYA 3KTAB 4XVQA 3THYB 2XNSA 5CIWA 4LHYA 1E1QD 2PX3A 3MWYW 2V7QA 1HT1E 4PC2A 2QAGB 2BMJA 1KKLA 4BLQA 1P62B 3HJNA 3IDQA 1NY6A 4AG5A 1UKEA 1RW4A 4FN5A 2FJUA 3FMFA 1KKMA 3H2YA 5EP1A 1XD9A 1RYFA 3N2EA 2YINC 4US1R 1U81A 2E87A 2B6HA 1RRFA 2Q9BA 4ZKDA 4Q4HA 1IN7A 2D3WA 3ZYCA 2A2ZA 2GEVA 4AYWA 2ZSFA 4TLCA 3EPHA 4D25A 1N5IA 2NO1A 4X8OA 1IN8A 4QBHA 3U4QB 3CIOA 4DZZA 1LVGA 4FWIB 3QY0A 5G3ZA 4C0SA 4OK6A 1XD8A 1RVDA 1CJMA 1KJWA 4PPQA 2P6UA 2HJVA 4QC2A 5FBWB 4F92B 3JVUA 3PITA 4E09A 1E2JA 2DYKA 2W0SA 5AWFC 4MDFA 4CT4B 3HR8A 3TR0A 4DCTA 3SR0A 1IXRC 1ZC3A 4W5JA 3ZD6A 2D74A 3ZGXA 4EPWA 4Q4AA 3QE0A 4BE7B 1SGWA 1KO5A 4AKGA 2X2EA 4URZR 2PX0A 3GLIA 2GWHA 1D8TA 3WMGA 2WM9B 2WZQA 4HB2A 4B3GA 1SVKA 3EWSA 4IVRA 2REBA 4D4MA 4EFLA 2YWHA 4IJMA 4RZUA 3PFIA 1OPXA 1ZCAA 2IS4A 3N70A 4HB0A 2EFDB 4A8JB 3L8ZA 2XJ9A 4ASUA 3VR5A 4JVLA 5EP2A 2J87A 2OCPA 2OFXA 5JFGA 5HE9A 1ESMA 5KNDA 1F2TB 1KZGB 2ODBA 2W6JD 1EFRA 2FFAA 2HCBA 3FE2A 3KB2A 3DHWC 3LAWA 2QI9C 3AEZA 2OG2A 1E32A 3I73A 3EIEA 4EFMA 3CH5A 1GIAA 1KDOA 1SVSA 3OHMA 2VQSA 4HLDA 5E7MA 2ZANA 1SKQA 5FOTA 4A0RA 2NIPA 3OIUA 4EAQA 2B21A 4TLBA 1R2QA 1ZM9A 3C14C 4C30A 4JBXA 3QUSA 4Q7KA 1NRJB 2QE7D 1VHTA 2R44A 4NCIA 2F43A 2ZRCA 3D3QA 1R8SA 5H1YA 5EE0A 3AM1A 1NBME 1AQUA 1FP7A 2IHYA 3AP1A 1HQYE 4WXPA 2OT3B 4UJ5A 2VHUA 1E4YA 1KI4A 2Q3HA 4O0MA 4OYHA 4E5UA 2WJHA 4RCYA 4RZ3A 4UNRA 1P2TA 5IRCD 2MSEB 1VG9B 4JLJA 1KYIA 1OYWA 1MR3F 3T1TA 2WTUA 2WWFA 1ZBDA 1P9RA 4M1TA 1QHNA 1XCMA 4I1VA 2RCNA 4X8LA 2IYUA 2XZPA 3ICEA 4V02A 2QSYA 4LC1A 1E2EA 1ZUNB 1N6LA 1WRBA 2HLDA 4N3NA 4JSTA 3WYAA 1R5OA 1FUKA 4TMZA 1CR4A 2EVWX 2HCJB 4O2LA 4DUGD 4PQYA 4DSUA 4DB2A 3TKLA 2GAAA 1KSHA 4DT1B 2A7QA 3GPLA 2NO9A 4TQ9A 1V43A 2ZRBA 2PT7A 4ZV4A 1T4GA 1H8ED 1MO4A 4LYAA 3JZMA 4A9AA 2FFHA 2BM0A 1CP2A 1RRCA 5J4LA 5FBQB 3ZS9A 3THYA 2X77A 3CX8A 3Q72A 2XNDA 2QAGA 2O5VA 3PR1A 4A36A 3LNCA 1G5TA 4KFUA 5EQTA 1VYTA 1W0KD 3SYKA 1N6KA 1J99A 1W5SA 4LOAA 3W3AA 5LB4A 3U3KA 2ZM5A 2IUUA 4M1KA 1E9FA 5TVKA 2QBYB 4PSVA 4Q9JA 3FTQA 1JJVA 2WPDD 1ODFA 2CL6X 1Z3IX 3BJIC 3F5FA 3FGNA 1X8JA 4GBMA 2IYTA 4RKFA 5AR1A 4MGYR 1Q0UA 3V4FA 2RHMA 4QOSA 4JLBA 3SJCA 3U4QA 4PAQA 1KIMA 1NG1A 3DMNA 4II7A 2NMVA 3GJ3A 1F6BA 4Q66C 4J0QA 2QMHA 4RFVA 1JI0A 3ASYA 2PLRA 1GL9B 4O3MA 1BYIA 1OFHA 5DI3B 4D2IA 2KBEA 2WSSA 4JVSB 3JVVA 1OXXK 3TBKA 3T61A 2ZRMA 4QHYA 4O2RA 1W44A 3FFBA 2N42A 5C4GB 3FWYA 1NY5A 3L82B 1T3LA 4FMDB 3X1YA 3RVBA 1UEIA 2RGXA 4AC9A 3VKHA 3SJZA 4F4CA 2J7PD 1IOZA 1KI6B 3QSYA 1Z07A 1N5KA 1DVRA 3O8DA 2WIAA 1CJTC 3OFNA 3DVLA 2AKAB 3EA5A 5E7IA 4A8JA 2IYQA 1ZM2A 3CRVA 1U90A 1AQYA 1WCV1 2NO7A 5JJLA 1D2MA 2OBLA 1OFTA 1GFIA 2R62A 1TPZA 3ADBA 3AP2A 4DKXA 5C2JB 4DLUA 2FEOA 2FN4A 2FSGA 5KSYA 1Q1BA 4L16A 3CX6A 3Q8XB 3BH7A 5TV2A 3CRQA 1P6XA 3O8CA 1KO8A 2ZXUA 1AJEA 2OCBA 1DEKA 1P9NA 2QMOA 1VCOA 4B3DA 3HPQA 4MYUA 1I4TD 1Z47A 2XTMA 3F8TA 1TL7C 3SOPA 4LC0A 3ZZUA 5FOWA 3W5IA 2QAGC 3ZZ0A 1OSNA 1OH5A 1LF0A 5EUMA 3QXCA 1A2KC 2IXFA 2ZUBA 3RNLA 3LBIA 2BV3A 4MGIR 1E0JA 2HEIA 4RJLA 5FR2A 3W90A 5FPKA 2PJRA 3AVTA 4AI6A 2ZJZA 4U00A 4Q1FA 1SHZA 3GD7A 2KSQA 1ANKA 3CH4B 2H92A 4K46A 1U9IA 3MMPA 3U44B 3OESA 3FOZA 2XAUA 5KU1A 4TYNA 1N0VC 2FPKA 1IONA 4EUNA 5B58C 4A82A 2R6GA 1E0KA 1UAAA 2RGCA 1GVNB 3GEEA 3FB4A 3K0SA 4ZCMA 1W2GA 1G17A 5KTYA 1F60A 2ZSDA 1Z83A 4A2WA 1EXMA 4EQ6B 5FL7A 1E3MA 2PH1A 4DT1A 1M7GA 4BPBA 1Z06A 1KJYA 1YZLA 2LKDA 2CLDX 1U8ZA 3A4MA 1HY3A 1VYUA 1F5NA 4XVRA 2DPXA 4YMVA 3EAQA 3WNCA 1N3BA 1N5JA 2ONKA 1QRAA 2XSZA 4ZI2A 3B7GA 2IF0A 1KOFA 1C4OA 1AIPA 2R9VA 4IDHA 1KK2A 3G82C 3GJXC 4YMSA 3QKSB 3IEUA 1WP9A 4A8JC 5C18A 2NG1A 4BFWA 5CJ2A 1NI3A 3ECCA 4OHYA 4WAUA 2MSCB 3NVAA 3T35A 2HV8A 3VX3A 2J0SA 2DBYA 4TZ6A 4HAZA 4PZYA 1UF9A 1QDEA 3U7GA 2J0QA 3I1FA 2HT6A 4JS0A 4RD6A 2VA8A 5KNCA 3KXKA 1CF4A 5C1BA 4B2IA 4GNKA 1E6CA 1W46A 2BMDA 3U5ZB 4WIAA 4CYMA 3UMFA 1VECA 4PC3A 4XD7A 2CCJA 1LNZA 1X3SA 4HSEA 1DOAA 5FBVB 3K70D 1VCIA 1K6MA 4RZ2A 2B7CA 1GDDA 5EXSA 3B8HA 4PPFA 2ZJAA 3GFTA 5EZ5A 5SZIA 3P4XA 4LV5B 3KZ1E 3PIRA 5DN6D 4YDHB 5L3VA 1BIFA 3CF2A 4KBGA 4LYHA 2FEMA 4KLNA 2JLSA 3PUZA 2RB4A 3NC1C 1U9IC 2ZR7A 1Z6XA 2ZI4A 1KI6A 1RRPA 3AKEA 4AKIA 4PHFA 5KPJA 1OH6A 1MT0A 3U2QA 2G0TA 1EESA 3NDBB 4UXIA 5EXTA 1A4RA 3WRXC 2WKQA 2YOFA 2ZJ5A 3LQQA 3RHFA 1IJEA 4I1OA 1VIYA 4JKIA 3WMEA 4B6EA 4PO8A 4ZDJA 4MRSA 2QZ4A 2HF9A 3HR7A 2XITA 2QENA 4EIWA 4M1MA 4PZZA 5AJWA 3D31A 4TL6A 5EE5B 5FI1B 3T1OA 4BFUA 3TQCA 3IKJA 3NHAA 5HCIA 3AP3A 3HPRA 4LHXA 4UNQA 3B60A 4KITB 4XSGA 2GXUA 3BH6A 1YR8A 2FFQA 2G1KA 1M8PA 2KWIA 3QQ5A 4TSFA 4B6FA 1DPFA 3I5YA 2QY9A 4BLOA 4GT1A 4HEJA 1NLYA 4B44A 3RSOA 1KNQA 2Z43A 1S9HA 2V55B 3AGPA 4TMXA 5AUQA 3QPWA 1OFUX 2ZTSA 1S8FA 4QNMA 4V03A 2WJJA 3FFAA 2JAQA 2GRJA 1XZPA 2CNWA 2P6NA 4XVUA 3CR7A 1ZINA 2JJ2A 2AHOA 2B92A 2H57A 2IS6A 1L4YA 3U44A 3K0AB 1W4BA 1AKEA 4HZUB 3C16C 4HLCA 1E2FA 2P3SA 2ZYTX 2A5DA 4FIDA 4QBFA 1E0AA 1GITA 3MGCA 5GJCA 1BYUA 3DMDA 3KKQA 3LX8A 3CX7A 1QHXA 4KFRA 4Q1BA 6Q21A 1E98A 1ZCBA 5KDLA 4ZIRB 4C2TA 4Q9HA 2JASA 3AF0A 4M53A 2W00A 2WWGA 2NQ2C 3AV0B 2PZFA 3Q7QA 4RCZA 1YRAA 3QXSA 4NTZA 4BUJA 3B1YA 2YVUA 4HUQB 3ICQB 1CIPA 1KDTA 1G9XA 1E1RD 2W58A 1IY0A 1VDZA 4D6PA 3A1UA 4OKSA 2KB0A 4V0LA 1C1YA 4TLEA 4Q1DA 1U8AA 3E2IA 1SULA 1JPNA 2W0MA 3QKSA 2CCGA 2QL6A 4GSYA 1JXMA 1KY2A 2C8VA 3SU8A 1OB5A 3G0HA 2IC5A 2X19A 3THWB 2O8EB 3NTUA 4A4DA 4QKQA 1P3JA 1FX0A 5DLQC 5JS7A 3U61B 4GRAA 3KJEA 1Q3HA 3FPAA 4HAXA 3IGFA 3HYTA 4DLTA 1OXUA 1LS1A 1OJLA 2QQ0A 4F4JA 1EGAA 2ZSBA 3LLUA 3M0EA 2ZJ8A 1VIAA 1KK0A 2BOVA 3DKPA 3FKSD 5CIQA 3T12A 4ARZB 4ZDKA 8OHMA 3IHLA 2DFKB 4AYTA 1Z22A 1G7RA 3CZPA 5GVSA 1F3OA 4Q5IA 4RSGA 3E5HA 5CLLA 2UZ3A 2WMOB 5AJYA 3VNUA 1J90A 4M1SA 4XH9B 2XJ4A 4WOPA 2IXGA 2BBWA 2HXYA 2CCKA 1HURA 2N1BA 4B75A 1WF3A 4HDQB 4MUAA 4E22A 3OEHD 2JJ1D 1DG1G 1MO3A 1KSJA 4PZLA 3TJZA 2R2AA 3SE0A 3B85A 4R7ZA 1Z0IA 5BYJA 2CLCX 3OF5A 2ORWA 4Q7LA 3A58B 4B33A 2Q9CA 4ESHA 3P32A 4X8HA 1I2DA 3LLMA 1NVVR 2W6IA 4HLUA 4XTRA 3T5GA 1WA5A 3EZ9A 4B76A 1EFCA 4L15A 1IN5A 2V7QD 3QG1A 4MKFA 5FPSA 4Q21A 5EP4A 3B82A 5H8WA 4RD3A 2MMCA 1Z0JA 5LD2B 2V6JA 2F6RA 1KO7A 1PLJA 1QHGA 3I62A 3ZH9B 3WYFA 1NN5A 1YR7A 1T6NA 4Q9LA 1XF9A 1CR1A 1EWRA 3QKTA 3KXIA 3NXSA 4C9BA 2VP4A 2E1RA 3N5CA 1W36B 1JALA 1P2VA 5EP3A 3TW4A 1M2OB 2QORA 4NMMA 4OHVA 1S96A 1G5PA 4U5XA 3R9IA 1KTVA 1U94A 3FMOB 2A5YB 5ANRB 1FZQA 3X2SA 3GLIB 3F0TA 4A6PA 5BN4A 4KFTA 1DE0A 2F1JA 4DVGA 4C0JA 1JPJA 3QXJA 2P6RA 1L8QA 4C0LA 2L0XA 3GLIE 1QHYA 2JLWA 1MRNA 2O52A 2C77A 2WIBA 2WOOA 4LUCA 1KGDA 3SQXA 1XMSA 3TVTA 4PPGA 2NO6A 1NJGA 1DBSA 1D6JA 4L9SA 2F3TA 1SZPA 4LV8B 2VL7A 5LBIA 4BQSA 1IQPA 5CM8B 4PHGA 3DM9B 1NLFA 2ZRKA 4B35A 1ZP6A 1UDWA 2VBCA 1X86B 1NIPA 1G8GA 2WJVA 1AKYA 3LY5A 4BWYA 3B6EA 1GWNA 4ZIRA 3EZ6A 2BCGY 2QMUA 5GVRA 1JB1A 2O0KA 4R2HA 1EFRD 3RC3A 3RC8A 1E0SA 4DXAA 5JWOA 4HZIA 2RGAA 5FTMA 3BFKA 1FPMA 4XSHA 1ZUHA 2IYZA 4OQLA 4A0HA 4HUQA 4DDUA 3KQNA 4BZPA 1BH2A 4G5GA 4JLNA 1W4AA 2ZUDA 3KQUA 2ZS7A 3C7KA 3T15A 5FOXA 2QGNA 2FGKA 4C0QC 4JKYA 3VX4A 4BRWA 1COWA 4HLUC 2VSFA 2OFOA 1KAOA 4Q7JB 1FTSA 3R8FA 1X1RA 5ELXA 2Z4SA 3HU2A 4B73A 3L43A 3B1XA 3WYGA 3THWA 3GJ5A 2O8EA 5LPNA 3BK7A 4DLYA 1E69A 3QXHA 1NLZA 2ZR0A 2RKOA 3U6BA 4JLDA 2NO0A 5B57C 4K81B 2J9RA 5BQ5A 3AF4A 3THXA 5HKKA 5IT5A 3WY9A 2ZRGA 4WZAE 2GKSA 2RH5A 1G6OA 4ARZA 2E9SA 4CIDA 1CRPA 1J8YF 3EARA 4TWZA 1CLUA 2CXXA 2V6IA 4R2IA 4TN1A 3R9WA 1Z5ZA 2HLDD 1JXOA 2GCOB 4P0TA 2YHSA 2GCNA 2CJWB 4V0KA 4HAUA 2OCAA 4NHOA 1GNRA 1P2SA 2VSXA 4G5QA 5FR1A 4D4KA 1GKYA 4BRUA 3IO5A 4P31A 3TUZC 2EFGA 4F7WA 2YV5A 2WJYA 4YQFA 3PV0A 3U7HB 1KI9A 2FE4A 2D2EA 2FNAA 5IDVA 1OF1A 2RGGA 1ESNA 1J70A 4DDVA 5L3QA 2XNDD 2ZI3A 5BWMA 2Z0MA 5HCNA 2C9CA 1HH4A 4PANA 5B64A 2WAXA 4JLOA 5BW8A 2NGRA 3EPKA 1P60A 1LW7A 2BKUA 5KPDA 4JLKA 4ABYA 4KO8A 1ZMXA 2IF2A 3W6PA 4A0GA 2OCYC 3L0IB 4QM7A 2J3EA 2ZR9A 2K5UA 4IRUB 2WKRA 4FI3C 2Q3MA 2FWRA 2VHTA 3A8TA 3B1ZA 5H68A 1R0ZA 3KDSE 3UG7A 4BLPA 4KYUA 1UKYA 4IW3B 2KI5A 2WWYA 2AFHE 2YOHA 2LWIA 1XBTA 3GMTA 3MG9A 5DE3A 2ORIA 3N2IA 2OAQ1 4WZBE 2FMXA 4V0MA 1W0JA 3FVQA 3AVUA 1T3SA 4ZDIA 4D82A 4TLAA 3MSXA 4I1UA 3AVOA 1R6BX 2AX4A 4GOXA 4LWZA 3L8YA 4GZLA 1WDTA 4U02A 5EXXA 2IX3A 3ZDQA 1SVIA 3C41J 2CMKA 4EFNA 3V4RA 2I1QA 3WP1B 2GVDC 1TUEA 3CONA 2OZEA 4QHSA 1N6NA 1XMIA 4M21A 1NMYA 1OKKD 4DDWA 3QNUA 2VP5A 3KQHA 1PVOA 2CBZA 2J45A 2BBTA 3OEED 1T8UA 1Z0DA 1NJFA 2G9NA 4IEIA 1NIJA 1GG2A 1MH1A 1Y63A 4A2QA 4OBEA 4HI0E 3UK6A 1GRQA 1WXQA 2CL0X 3AF3A 5TDHA 2W2XA 2G77B 2ODEA 3AF1A 4ZDWA 1E9BA 2IYLD 2ZE7A 4CEHB 4N1AA 3TR5A 2GESA 3IPYA 5FUXA 5P21A 3DO6A 3ZIAA 1NBMD 2FV8A 2QP4A 4MGKR 3NBYC 5TB5A 3AKCA 2XB2A 2I4IA 2ZSEA 3BGWA 2BC9A 5SZHB 2ZJBA 4UQOA 1RZ3A 2PT5A 1XWIA 4E07A 5LD2C 1VG0B 2G88A 2JLUA 5H70A 1P7CA 3C5HA 4LPKA 4NYJQ 3R9XA 2Q0HA 3W9YA 1GNPA 5JI3E 1G8PA 4D4LA 4WVFA 2VHCA 4NYMR 3SJAA 3H86A 5CK5A 1W36C 3GLFB 4IHQA 4LRWA 4WBSA 1YR6A 2OLJA 3CF0A 1P75A 2CVHA 4H1UA 4DRZA 3LVRE 2ZVPX 4JL5A 4X8MA 4TYPA 1UKVY 2GCOA 2W2TA 3RRZA 3A1TA 4I99A 1Y3AA 2CJWA 2QTFA 3GLFE 4TTQA 4KFSA 5JWHA 2BBSA 2FFBA 4L9WA 1RFLA 4AURA 1Q57A 1R0XA 1B23P 4MKHA 4AD8A 3CWZA 2KE5A 2FPLA 4PQFA 5DYGA 3HU3A 2Z6VA 2A5FA 1E2NA 1NN1A 1LB1B 3UMRA 3AF2A 2DHRA 2QSZA 1I4LD 4IOMA 3I8SA 4US0R 1H65A 1AM4D 4BFTA 2AXPA 3CM0A 2XSZD 1E4VA 3THOA 1XZQA 2ZRFA 1XCGB 3UIEA 5KUTA 1T5IA 1SHKA 2GBLA 3I5XA 1SVMA 5JHGB 1QVAA 3ZS8A 2PL3A 4PC7A 4HB4A 4KODA 1OIVA 1CULC 1G291 2QMEA 4CRWB 4P33A 3DKVA 4M0LA 1G3QA 1Z28A 2NPIA 2QM8A 3D8BA 5FI0B 3QF4B 1NKTA 3RS0A 2CHVA 3RWMB 5L3SB 4AY2A 4ACAA 4B3FX 2ECKA 2RGDA 4OL0A 2GF9A 1TU4A 4G5OA 4JBYA 5BN3A 1Z0FA 4KBFA 4EJSB 1AS0A 2RMKA 4LGMA 1QBKC 3QEOA 2P2LA 4DC9A 4LV6A 3D7MA 1S3GA 3WBKA 1Q3TA 2QM7A 3LXRA 3QKRB 3B78A 2G83A 3KJHA 4JYBA 1YE8A 2C9OA 1KMHB 1OYYA 1RKBA 3Q5EA 4DSNA 1T91A 4I1SA 2IWHA 1XPUA 1DG3A 2B8TA 3S1AB 1SXJB 2IYYA 1ZM7A 3AVPA 2EYQA 4IFBA 2IBMA 4IDOA 4TT3A 3U60B 4PPNA 2P65A 4LBVA 1FNMA 3WXMA 2FSIA 5TY0A 2VP2A 4DJTA 4HATA 2RGBA 2OAP1 4HAYA 3LX5A 4BECA 2TMKA 4MUBA 3KUCA 4BFVA 1OH8A 4NYIR 4TZ0A 5AUNB 4XWKA 1Q20A 2BMFA 2C99A 1E2GA 5FOUA 4JJZA 4LDJA 2Q21A 1MO6A 4ZO4A 4A6XA 3SI7A 1ZNZA 4HAWA 4N0EA 4GOJA 1OB2A 3VAAA 4D0GA 1FOEB 2AN9A 3T06B 3OIWA 2GNOA 1DAIA 1XTQA 3PUYA 1ZYUA 1OFIA 2HF8A 4PC1A 1N6RA 1ZVQA 4GP6A 2DWOA 3EG5A 4BEBA 4CEHA 1BS1A 2P5SA 1XEWX 2OUKA 1UJ2A 3OAAA 2IS2A 3KKNA 3H1TA 3TSOA 4QJ4A 5FH9A 1C9KA 1G3MA 2Q9AA 1EFHA 2IEZA 3PUWA 1NSTA 1UPTA 3PEUA 3X1DA 2JCSA 4JBWA 4BLRA 4C7OB 1YVDA 821PA 2GHIA 1HUQA 3SFVA 2QPAA 4MRRA 3IQWA 3CKLA 3TUIC 1KSFX 4KVGA 2GJ8A 2WHXA 1W4CA 2BMEA 4QGAA 2CK3A 2CNWD 2EWWA 2JJ2D 2A5GA 5AJVB 1Z0AA 2AL7A 1RYHA 5DSZA 1GM5A 4OQMA 1E9EA 1R5NA 2G6BA 3SZRA 5CITA 5DNYB 4EKDA 1GZSA 1AS3A 2ZQ5A 3GLFA 2FDCA 4LZZA 4TMWA 1OV4A 1NP6A 3DOEA 2J0UB 4MRNA 4OK5A 4PAOA 5FTNA 4Q7MB 1YJ5A 5EJEA 3PEYA 5JWRA 4MA4A 1NVXQ 2O8FB 4YC7A 1O3YA 2J59A 4ERNA 1Z6GA 3O8RA 4NE2A 3ETLA 4JT2A 3SBEA 2EFEB 2HJGA 1G1MA 1EX6A 1AN0A 2PMDA 5C4MA 1TF7A 2X8AA 1EK0A 2Z4RA 1H8EA 4GFDA 4LBZA 1VCNA 4D0NA 2XEXA 5FOSA 2GEDA 4LK2A 5J4VA 5FPTA 221PA 5G3YA 4Z51A 3IO3A 1FX0B 3C15C 1H8HA 2VHQA 4K8OA 4HUTA 2OSBA 1G8YA 4HLQB 1L7VC 421PA 1SKYB 2ATXA 2ZI6A 4DLVA 4DB4A 4QGHA 4P4TA 1E9DA 3PUVA 1DAEA 2ZRPA 3L0SA 4M1OA 2RHDA 2CVFA 2QAJA 3P20A 5G41A 2GCPA 2X2FA 2IUTA 4CZ2A 4LJ8A 4NU0A 1IY1A 1SKYE 3LW7A 3T34A 5L3SA 3QF4A 2WPDA 4LJ9A 4NCKA 1G3UA 1FQJA 1G19A 1T9HA 3W8NA 5JECA 3GJ6A 4M8NE 1TU3A 3B2EA 4ZCLA 4TL9A 4CDGA 1NVUQ 1YZQA 4EJSA 3BERA 3LV8A 4Q03A 4ZKEA 4A0FA 5GADl 5JZVA 1QZXA 2EFHB 4AYXA 1GL7A 2ZI9A 4ACBA 4DLZA 4TTRA 1XNJA 3U3MA 3QKRA 3SNHA 3C8UA 4MRPA 1A2BA 4DCUA 5JCPA 2ZEJA 1V5WA 5FTJA 3UG6A 1A82A 3LA6A 1KMHA 4NKRA 4Z8YA 4WXRA 2IXEA 3CRW1 3GLHB 4W7SA 2EQBA 3A4LA 4PR0A 4Z1MA 3S1AA 4JYCA 3AVXA 4LYFA 1SXJA 1NMZA 3KL4A 4F38A 2O0HA 5J4YA 1G41A 1TEVA 1DO0A 5C46F 2J7PA 3GLHE 5HR5A 1Q1ZA 3UPUA 1VPLA 4XWOA 1ZD8A 1CR2A 5DI9A 3KKMA 2ZRLA 3IIJA 2GA8A 3AVYA 2ZREA 1FMLA 1U8YA 4LJ6A 2ZJ2A 1YRBA 3EZFA 1TMKA 3FYHA 3GJ4A 4OHWA 3QVUA 4CEIB 3ZVRA 2JLZA 1NVWQ 2KJQA 3LFUA 3T5DA 5KSZA 3EZ7A 2GK6A 2CEAA 2GJSA 2IYXA 2YWEA 3CPHA 3CRRA 2IYSA 4QL3A 1F2UB 4BFXA 3MWJA 3AUXA 3ZVMA 3K9NA 3AKYA 3SS8A 4C7OA 4DCNA 3LBHA 4XWAA 2GVZC 1HEIA 3DOFA 4QM6A 2J46A 1W5TA 3Q9LA 3P27A 5KDDA 3PENA 1D9ZA 2FGJA 1IXSB 4JL8A 3B1WA 1KMQA 4M9XA 3CNNA 4BFYA 3MWKA 3VR6A 2WWXA 4FMCF 1CU1A 3V00A 2O8BA 3GFOA 4EPVA 1G7SA 2JIZD 5JBQA 3EX7C 3NG1A 3IBGA 4H1VA 4EJSC 3NKVA 1G18A 1BKDR 2ZUCA 4IOKA 4UKDA 2J0UA 4HYYA 1MRSA 2WBLC 1AGPA 4M22A 5L3RA 3W5JA 5DO9A 2BVNA 3J81k 2VF8A 2F9MA 4FINA 2O8FA 2GK7A 1M34E 5JJKA 1S0UA 1UBFA 3LXXA 3REFA 1VG1A 1K5DA 2OHFA 4MKGA 1CTQA 1M74A 2P67A 2HYDA 3K0CA 1J7KA 1JNYA 1KI2A 1SXJC 3RS3A 2IEYA 2R65A 3IIMA 3BS4A 2XOKA 3QG5A 2DR3A 3CLVA 3X1ZA 3CF6R 1UADA 2RGNA 4RFSB 3UMSA 1TF5A 3BORA 3VR3A 4XTCS 4AKEA 3Q5DA 1UBEA 1COWD 2RAPA 3UANA 5JCZA 2HT1A 1JAHA 1RIFA 4G1UC 2W2VA 1VCMA 4ILEA 5K8UA 4MGZR 5JRJA 1ZNXA 3THXB 4YLGA 2G0NA 3BH0A 2V3CC 2EFCB 1JEEA 2A3RA 2JDIA 1SVOA 1W48A 3U6KA 2G1JA 3NC0C 1E9AA 1JR3E 1XU4A 4OK3A 3RLFA 2ZIAA 2C95A 3MCAA 1RPZA 3SQWA 5HKKD 4UNPA 4PAMA 3U3OA 3WMFA 1DO2A 1M1YE 1KJZA 1LS6A 3QF7A 1II9A 2C03A 2PJZA 5IK2A 4LHZA 2DFNA 4YMTA 2IT1A 5CM9C 2HDNB 4NYMQ 3A4NA 3MLEA 1KZ7B 2WJGA 1OHHA 5FL3A 1XJCA 3KXLA 1XB2A 3HYRA 1IAQA 4Q9KA 2ZE5A 3IPXA 2MSDB 4TQUS 4OJKA 3ZVNA 2CHQA 1ZIPA 3MJRA 4QFMA 2C2HA 3U7EB 2ZE6A 3GLHA 3AVVA 1R7RA 1QG4A 5B2ZA 1XMJA 5DN6A 4LJ5A 3I4LA 1D5CA 2PCLA 2DY1A 4C3ZA 1OXTA 1TF2A 2O0JA 3TRFA 2ODNA 1Q12A 5L3QB 2QT0A 2DWQA 4DIEA 3ND8A 3P26A 3RDPA 3FMIA 1XD2B 3KJGA 1RRGA 2F1HA 2C96A 3LD9A 4URVR 2IS1A 2VP0A 1HE1C 2H17A 3KKPA 2BM1A 3VTKA 2ZVQX 3R7WB 3U3RA 2YC4C 4FCWA 5CB8A 4URXR 1JAIA 1E79A 3NBXX 3SHWA 3HP1A 4LX0A 1LF5A 4Q47A 3A6PC 2CE7A 1GL6A 3I92A 2FX3A 4CEIA 4PHTA 2QP3A 4IEEA 1KDRA 5F98A 3KX2A 1EFTA 2EU8A 2NPFA 3K0CC 2REXB 1K8RA 4NP6A 2NZ8A 3W34A 2X1VA 3DDCA 3EW9A 4Q4JB 1W36D 1F2UA 1TQ6A 3QBTA 4FCTA 5HZKA 4XIGS 3ZQJA 3OE7A 2WVJA 3NH9A 3K09A 1NKSA 3BIFA 1XXHA 5F9HA 2IHBA 4RD1A 1P2UA 4A92A 4V0ME 3PCRB 1XTJA 2J7KA 4JMPA 5GJWC 2BBOA 1GUAA 1W0JD 3O8BA 1U99A 3PVSA 2GJAA 3M6AA 1IJFA 1JQLB 5BN5A 2VF7A 4BFZA 2O8CB 4BFSA 1IM2A 3HU1A 2JLYA 3VFDA 2GJKA 1DAHA 4IXMA 4S2EA 4IDQA 2J0VA 2XX3A 4ASUD 1DAMA 2WWWA 1VYVA 1N0WA 1GAJA 3H0KA 3MJHA 1PLLA 1XX6A 4L5BA 2BJWA 1OE0A 4BZXA 3NEYA 2OBNA 3RS7A 3CO5A 4C0HA 4E03A 3NHBA 2FOLA 5CJPA 1IBRA 5JLJA 4NL4H 3PQCA 1I2MA 5AJZA 3TAHA 1CBUA 4NYIQ 2WV9A 4D26A 3OIYA 4MDEA 2R6FA 3AUYA 5J4HA 3Q7PA 2A5JA 4CF7A 1CEEA 2C98A 1G16A 2ZRIA 4AWXA 1BO6A 1TX4B 4LI0A 4TL8A 4TLDA 3IUYA 4M1YA 4C4PA 4FMBB 3SFZA 3TIFA 1OT3A 1Z2AA 2J41A 2IYRA 3KKOA 3QKUA 4LY6A 4D81A 3DZ8A 4D4JA 5FUVA 2ANBA 1TNDA 4P4SA 1Z63A 4RFSA 3GJ7A 4ZPXA 2YWFA 5JMTA 4GPTA 1DAKA 1G3RA 1OIWA 3I32A 4OQNA 1CRQA 4JLAA 1JR3A 2A78A 2WMNB 3DEFA 4IDPA 1A7JA 4QBIA 5FBRB 2QNRA 2FU5C 2AD1A 2C5LA 2R6CA 4DLWA 1HQCA 2KBFA 1TADA 4HDOB 4UXJA 3BAFA 5JI2E 2UKDA 2NZJA 4M4SA 2YNMA 3BRWD 5TXGA 4KSCA 2A30A 3VR4A 1JR6A 2H16A 3AB3A 3CNOA 1B0UA 4LBYA 4FCVA 1G4AE 1HTWA 1NMXA 2GZAA 1AZSC 3RSLA 4PQRA 4O25A 1JQJC 5DHAA 5BXQC 2PZEA 4BZQA 1T8TA 1VHLA 2J5XA 2H7VA 4RY2A 4DCSA 4DLXA 3UWKA 4GMXA 3KFXA 3LVQE 3LBNA 5IF9A 2WSMA 3GLGA 3TAUA 2GEUA 3K09C 1QF9A 3VU9B 3GCGA 2SHKA 4Q9IA 4TYQA 3UATA 1GKIA 4US2R 3WNDA 3P1JA 4Q01A 2QGZA 4IDNA 3HWSA 1VKJA 3GJ0A 1FUUA 1OLOA 2Z5FA 1G3IA 1N0UA 4ZI3A 2ZI7A 2JGNA 1E2LA 1JEDA 3NWJA 4Q1CA 1XD2A 2BEJA 2FZ4A 4CGZA 1MKYA 4W9MC 3I8XA 4TMKA 4LPSA 5AK0A 3VMFA 1OW3B 3SC3A 1E2IA 4YDSA 4QGFA 4FW9A 3QVVA 4OJQA 1E9CA 3LWNA 1XPRA 3VHXA 3R7WA 3VKWA 3TK1A 1Q22A 3IIKA 5D3QA 3CPJB 4DIDA 1NG9A 2YZ2A 1YZUA 4LJAA 2FG5A 1R10A 1R0WA 3CZQA 4QGGA 4TYYA 4EPRA 2OO7A 3UKDA 5F9FA 2F1RA 1N25A 4Q4JA 4B34A 2WSSD 1W2HA 2MMGA 2WJIA 4BGDA 1KSGA 2UVQA 2WWHA 2CHGA 2GTPA 1OH7A 3ZQ6A 2OEPA 4KSBA 2D62A 1R5BA 4PO1A 2FPMA 3EWAA 2Z83A 4RZXA 4MQBA 1K5GA 4OI2A 4PHHA 1Q21A 1S2MA 1W7AA 4PX9A 4ESVA 2O8CA 1P9WA 4Z8XA 5HE8A 2BHRA 3L2OB 3AVWA 4TT3D 3BBPA 3OFND 2ORVA 1ZAKA 4V0OA 2EW1A 3TH5A 1TTTA 2VH5R 4C0AC 1N5LA 2BIFA 4KU4A 5DGXA 1P72A 1WMSA 2P5TB 4OHXA 3RS4A 3RRNA 2JEOA 3QJYA 3QI2A 1LV7A 1UM8A 1NSFA 3FDIA 1G7CA 3MRSA 1FW6A 2ZYVX 5TARA 4CT5A 2ZRAA 2B8WA 4YXWA 5D3MB 1EX7A 4CEJB 1I4DD 1U0JA 3NBZC 4IVPA 3WP0A 5CB6A 2CE2X 2PZGA 3VHLB 2VPPA 4PC6A 3K0FA 2XTZA 2QTVB 1E9SA 1W49A 1T5LA 2XTNA 4DHEA 1CJUC 3B9PA 2P0EA 3NEJA 2QG6A 4LCBA 4NCHA 5JS8A 2HXSA 1E96A 4PSAA 2ODWA 3OAAD 2QTHA 1S1MA 1MO5A 4D80A 4G5SA 4MYCA 1UBCA 4M9SA 2JLVA 2ZU6A 4Q02A 3T1VA 1DELA 2FF7A 3V9PA 3VR2A 2AK3A 3K1JA 4B48A 1CJVC 3EA0A 5AJXA 2PLFA 4NH0A 4V0NA 4M9ZA 4Y0AA 2QT1A 2CK3D 2VSOA 5SZKB 3BE4A 3TSZA 3VR1A 1VTKA 2OBMA 1NL3A 2GXQA 1ZU5A 5M04A 1ZD9A 2ERYA 4B3CA 3LQRA 4GMDA 3WHLA 4NZYA 5FL7D 4C0BA 2VLIA 4DBLC 4Z54A 1G6HA 3I3SR 3O47A 2F9LA 3G5UA 2HUPA 1XDBA 4KHZA 4EDHA 3PEWA 5E7JA 5DHFA 2AK2A 3RRYA 2GETA 1LY1A 2H1LA 3LO5A 3VU9A 2WKPA 1XMVA 1ZW6A 1BMFA 2OE2A 4MRVA 1T0JB 2C04A 2QQEA 1U2RA 1S4QA 5DIFA 2ZS8A 3MFYA 1XRJA 1E1QA 2WAYA 3QEJA 5EXPA 1D2NA 1ZJ6A 1KI8A 5J4KA 1XTSA 4F4IA 1GOTA 2WWIA 2VP9A 3A1SA 2ONJA 2IWRA 2XXAA 4NONA 3KTAA 2YYZA 4M2LA 4XOIA 4OI0A 1H8HD 1D2EA 3KQLA 5KSOA 3EASA 1X1SA 3R20A 1YZNA 4LJYA 1SVLA 1RC8A 1YQTA 4JSYA 2XGJA 5KO2A 1W47A 3KUDA 2R8RA 3A36A 3CWQA 4IXNA 3A37A 1GSIA 4XD7D 2ZJOA 3LH5A 1PLKA 2PBRA 4R98A 3ADDA 5B30A 1AK2A 3DL0A 3BB3A 2ANCA 3CBQA 5TMPA 1E2HA 4UJ3A 4KAXA 4JVMA 2VYFA 2OXCA 3X1WA 2BKEA 5CYPA 5J5CA 1WBDA 2C9YA 4KV9A 2GXAA 3CW2A 4KVAA 1HYQA 4F91B 4QHTA 1SXJE 2ZAMA 4Z1MD 1SXJD 2QEQA 4WW0A 1NVVQ 2GZHA 1UBGA 3RS5A 2F55A 1KI3A 3SDZA 1II8B 4R9UC 4TMTA 2RGEA 2FZLA 1A5TA 2FSFA 2V8OA 2W6JA 3FMPB 5JEEA 4HDCA 3K9GA 2B7BA 4AKHA 1OKKA 4IFEA 1ZM4A 1AGRA 4NCNA 4Y0VA 2ZRNA 3OEEA 5D3MA 2JATA 5FBLB 2XB4A 1P5ZB 4KLZA 1NNEA 4CEJA 4GDFA 1RE0A 1TUIA 1F2TA 1Z29A 4OQFA 1PZNA 4WZ6A 5JSZB 1T0HB 2VRWA 1YU9A 4R71A 1HV8A 1JECA 4TSFD 5EE9A 5G53C 2QE7A 1E2PA 1ONBA 1XEFA 1N6PA 2GBLC 3TNFA 3X1XA 4JVNA 3L0OA 1VG8A 3BOSA 4ITRC 3WRYC 3HDTA 1NBMA 1OXVA 1O87A 4FXPA 2ZI5A 3REGA 1N6HA 3PEVA 4MYTA 4AG6A 2O8BB 4NCJA 3EC2A 3OZXA 3QXXA 1ZRHA 1KO4A 1PJRA 5AUPB 3UWOA 1GTVA 4B43A 1TEXA 1BOFA 1N6OA 3GQBA 5SZJA 2GF0A 1ZC4A 1N2CE 5EE3A 4Q48A 1XEXB 2CL7X 1U0LA 2QPTA 5DH9A 2QA5A 4FWTA 2JA1A 1E99A 3QPUA 1M7HA 4I81A 3I72A 3W8RA 1ZD1A 1RJ9B 5FUYA 1KI1A 3ONWA 1KI7A 2V9PA 4DLSA 4DUGA 4XJXA 4G5RA 3BXZA 4Q18A 1WB9A 5CK4A 4ON9A 4Q1EA 3RANA 2VIIA 1D9XA 3TSWA 2ZETA 4PFSA 2REOA 3GP8A 4B2LA 4EPYA 1CS4C 2G3YA 4IOJA 4DSTA 3AQ4A 3RYTC 4B3XA 1E2QA 5KSPA 3PG5A 521PA 1E2DA 3BFVA 1CXZA 5KYKA 1CR0A 4FMCB 2AD5A 4QBGB 5K8LA 4G0NA 2YC2C 5HTKA 1XTIA 4MKIA 1ZU4A 2XOKD 1W0KA 4N0DA 2WICA 3FHCB 5AUOB 2JLQA 2QRZA 3H4MA 4IOLA 3GEIA 1T3HA 1R8QA 4B47A 4W5WA 1US8B 4FMDF 2R6AA 4YMWA 1XP8A 2JDID 4IVQA 4G01B 2YKGA 1FP6A 3QOFA 1AS2A 2QBYA 1IXZA 4C0KA 5GJBA 1M7BA 4LHVA 4PSKA 5E3HA 1XPOA 3K53A 1J2JA 3K70B 4KI0A 1MABB 3BB1A 1Z08A 1ZNWA 5DYIA 5G40A 3SYNA 1WBBA 1ELOA 2C78A 3AH8A 3OIVA 3TMKA 5IK2D 3U7FB 1HT2E 4LJ7A 4OI1A 1X8KA 1FNNA 1ZIOA 1CJKC 1CKEA 1XEWY 4KXFB 5DI3A 1OHHD 5J47A 2FA9A 4UXHA 5HPYB 2IYWA 5EUQB 4Q1AA 3TGPA 4Q19A 2AXNA 1Z6AA 2OESA 3AGQA 4U7DA 2W6ID 1KNXA 3I61A 3EZ2A 4DEXA 4MYHA 2ZJYA 121PA 3WNBA 2UZIR 2IA5A 4FD2A 5LDDC 1KY3A 2AWOA 2GDJA 3IILA 1II0A 1II8A 4RVCA 4DSOA 1Q1EA 1UDXA 1KAGA 3TUJC 2O8DB 2OM2A 1NN3A 5FTKA 2ZU0C 2BCJQ 3JZAA 2OXRA 1S1CA 1E79D 2VEDA 5FTLA 1AA9A 2ASEA 3C4JA 2ZSAA 1E2KA 1XJQA 3GFPA 3KJIA 5JSZA 2DWPA 5F2EA 3CPEA 2WOJA 3SBDA 4MH0R 3B13B 3KQKA 5FUWA 3ADCA 1DARA 3Q85A 2F3RA 1E2MA 3ZZTA 3EPJA 1XXHB 1FMJA 1DADA 2D4HA 1GP2A 2LCFA 4G3XA 3ZLJA 1R0YA 1Z6YA 3RABA 4JLVA 4BASA 1QHHB 2ATVA 3OE7D 3IEVA 3B9QA 1XXHE 1FL9A 3CUEF 2YWGA 1GRNA 3BB4A 4B2PA 3W6NA 3K9HA 2JJ8A 4QJ5A 2EYUA 4URUR 3L0PA 1G8FA 1Z6TA 4NYJR 4W5HA 5CLQA 3LW8A 4B74A 2A9KA 1FQKA 1XEXA 2BWJA 2V4ZA 1EWQA 3QBVA 3ZVLA 4L8GA 1VMAA 3E1SA 4GP7A 4WA7A 3DPUA 3W3ZB 1RJ9A 5KHOC 4PXAA 3NDPA 1S9DA 2QU8A 1G8HA 4JJKA 721PA 2AWNA 2V54A 3RRMA 4L4UA 4C2UA 1KK3A 3C5CA 1WQ1R 3ZD7A 1IN6A 3D6TB 4JZKA 4EQ6A 1IN4A 3SHFA 4P4SB 1QG2A 2BDTA 1MOZA 1GILA 3EXAA 1Z8FA 4LBWA 1ETUA 3K8YA 3H84A 3WBJA 3PJRA 2OILA 1LTQA 3QIAA 3ADKA 1KO1A 4HB3A 4BLSA 4DDTA 1FFHA 4AK9A 1ZNYA 5EZ6B 1DAFA 3SJBA 4OQXA 3EIQA 1GRRA 1Q1QA 4JT4A 1GKUB 4QJ3A 1ZM3A 1YZTA 2OFWA 3PXGA 2ZRJA 4P3YA 4QG7A 1JR3D 1A1VA 1US8A 1YZGA 4YMUA 3EC1A 2ZYWX 3TW8B 4TMVA 1DS6A 1TQ2A 2ERXA 1P4SA 1QHSA 1YR9A 1Q44A 3ZJYA 1F48A 2J1LA 4QNRA 3BC1A 4F93B 2IYVA 2OLKA 2JLRA 1JJ7A 4QRHA 3GLGB 3FKQA 3Q3JB 3LDAA 3DZDA 5J40A 1G5RA 1NF3A 1DAGA 1P73A 1MABA 2GXSA 3IQXA 3PUXA 3RS2A 1XTRA 3CR8A 2XZLA 4TTPA 4Q4LA 1UKZA 2N46A 3GLGE 5CDFE 2QP9X 3B5JA 4HAVA 4DCVA 4B32A 2IK8A 1DTSA 2Q3FA 2D7CA 4GOKA 2ZITA 5A4JA 1EFUA 2EWVA 1G64A 3GJ8A 3EPLA 2ZAOA 2ZYUX 4JL6A 2VO1A 2DFLA 3M4YA 1L4UA 2BJVA 2I3BA 4UNSA 5EE1A 1G21E 4H9GA 4PTLA 3CB4A 3IHWA 1R4AA 4B3BA 2ZRHA 1QVRA 2AFIE 2D06A 3QENA 4GZMA 5L8VA 5F3WB 2NOAA 4D0LB 4TYWA 2O8DA 5A0FA 1IY2A 5KOYA 1G4UR 2CLSA 2D2FA 2BEKA 1SVWA 4Q4HB 1PUIA 4KJZA 4KYIB 5LB2A 4RD4A 2QPOA 3DM5A 1G7TA 5KDOA 1JBKA 3AKDA 621PA 2GAOA 3SEAA 2RGNC 1S3SA 3U3JA 2GJ9A 4P4UA 1HE8B 4NPHA 4ZCIA 2QUZA
chains in the Genus database with same CATH superfamily
1GUFA 1XZIA 2AEJA 3ANSA 3DAPA 3CNEA 3HGMA 3WNVA 1DFHA 1Z7WA 3LOQA 3PTZA 4ZVLA 3W06A 3WLIA 1KC1A 4PY2A 4TL9A 4JJ4A 1VRCA 1FY2A 1HDXA 1O58A 1U98A 4L5IA 2VP6A 8GPBA 4H1WA 1OBHA 1P9LA 3DSRA 1TT7A 3MOSA 3B38A 3IDOA 2CLMB 3NHYA 3KYDB 1QHHA 2YUTA 1QG6A 2IL1A 3ND9A 3OLWA 4Q4AB 4YEDA 4IZ6A 1VC2A 5GJVC 3W6OA 4RLFA 1ZW1A 3HADA 2D1QA 3LT5A 3H4TA 3ASZA 4QJIA 3AR5A 5E2BA 2ORED 4DXHA 5IAOA 4XGKA 1UAGA 3HWRA 1EZ4A 4Y7DA 2R0QC 1AZTA 3QZUA 1FB5A 2PWYA 4LJ4A 4M89A 4PO9A 2E5FA 2G9ZA 1ZRSA 1JX6A 1Z5GA 1WZEA 1YMUA 4KK3A 3NT2A 3SYLA 1SQ5A 2W7TA 4DUYB 4TMFA 2JIZA 2PMKA 5LQRA 3KZCA 4DEYA 4EO9A 1KGSA 2ZJ3A 4JLMA 2QM3A 2PS9A 4JSRA 1U7DA 4IJVA 5FF9A 2V1XA 2A8YA 1CDDA 1RC0A 2UVPA 5ARBA 1KDPA 2ZIEA 4M1WA 4D9MA 1SC4A 2BFAA 5IDWA 1VHQA 4JGBA 4YJFB 5KVVA 5MN5A 2QW0X 3A1NA 2YBEA 2DHDA 1VJ0A 4DDKA 4WK6A 1E1RA 2HTFA 3O3NB 4UUPA 2V5VA 4OXNA 1PUJA 1CJSA 3FNQA 4DJDC 4L4YA 2Y67A 1S02A 1W0CA 2PN1A 5HIJA 4M9QA 4MUMA 5MN6A 1XCPA 2WIFA 1E4EA 2ZS9A 4X7BA 1G5QA 4UDXX 2FH5B 4LSGA 5HFNA 2QU7A 2VHJA 4EW1A 1XFAA 2BTOA 2NTJA 4WK0B 2RKWA 4DUPA 3LRPA 3S2UA 3HB0A 4PG5A 3SDSA 5EI5A 3S70A 2OOKA 4AXXA 3UJ9A 3ZGNA 5K8TA 3QU5A 3VO8A 1MH9A 2OV1A 1TB4A 1TD9A 2XODA 3BWDD 2H2FA 2W83A 3A26A 3A11A 4TWBA 3MWDA 4DCCA 5BV8A 4E11A 7REQB 8ADHA 1PZGA 4JEHA 2QR5A 3KB1A 1X6VA 5BVGB 3FKSA 3R3UA 4FSDA 4B3IA 3K8OE 5CU7A 3TQQA 4X1YA 3T4PA 1R00A 3E3AA 3L5KA 3TLJA 1W4ZA 3F7TA 4CVNA 4CKBB 3ZE6A 5K8IA 1L5OA 5U9CA 3D3WB 3NT5A 1H6BA 4RD2A 2FMIA 1YI1A 1TYDE 3GJQA 3OMXA 2AKYA 4XW2A 3GN1A 2GPWA 2I1LA 2ZIFA 4GI7A 1Z26A 2R8ZA 3KBOA 3ZHCA 1ORIA 1CP3A 1E94E 1MAWA 1RQPA 1TO1E 2FUCA 2O0LA 2VYND 1MG5A 3HBFA 3K9LA 4HY3A 4LC9A 4ONEA 3TQFA 3ZNQA 3TZBA 1DFGA 5DISB 5CFPA 5IDYA 1N3IA 4HNGA 1N6IA 4KE8A 5G0WA 3OZTA 4IKEA 4H7DA 3EXG2 2QVCA 1JA1A 5A5GA 3IUNA 4CN9A 4RD0A 1QIIA 5A62A 3WIOA 2L19A 2IEIA 1W5BA 2VTKA 2O7RA 3L8CA 3RWOA 3G85A 2AQKA 2H5EA 3RV4A 2O05A 1YFJA 3IBYA 1M2VB 4MULA 4XVQA 4ZK2A 5CIWA 3THYB 4LHYA 3SEFA 3PDCA 2OHVA 4L3VA 3MWYW 5JDCC 4PC2A 3HRKA 3I37X 2BMJA 1KKLA 1EUDB 1G2QA 1B8PA 1P1CA 1UC5B 1CE8B 4EL5A 1OOEA 2PD3A 1UKEA 1LSJA 1T6BY 3FMFA 1KKMA 4OP3A 3H2YA 1XDSA 3AU8A 4BO2A 4CKZA 5G0VA 3S2EA 2YINC 2HCTA 3AR9A 2PUBA 3KWJA 1Z7BA 4DC1A 1I3LA 4ZKDA 4GBGA 1IN7A 4JGGA 4JJEA 4LNUB 3UMBA 2YN2A 4F4DA 4N6NA 2G8NA 1C30B 1OLSB 3I2KA 3B8EA 2ZJ6A 3QV2A 4XGNA 3HN7A 1L5NA 1N5IA 4X8OA 4I2NA 3T52A 1P45A 5BQPA 5JAMA 4KRFA 3CIOA 1TKCA 2IZZA 3I6QA 8AT1A 4B81A 1RVDA 3L18A 3ME5A 4PPQA 4GC5A 1MLDA 2AG6A 4F92B 1MT3A 2QHXA 3JVUA 1NQUA 2XQJA 4QUBA 2O3QA 3CN7A 5LYJB 5EEHA 4TKVA 1E2JA 4CT4B 3HR8A 1R4ZA 3WLHA 3B6MA 4TWRA 3SR0A 1USIA 3WISA 1RAGA 1IXRC 1ZC3A 4YBRA 4RF3A 3ZD6A 2C1EA 1VZ3A 4ITUA 4ZN6A 4G36A 3Q10A 3TLKA 1P2GA 3U7JA 5KJ6A 4E51A 2XYQA 3S2FA 3TZLA 2C4KA 2FI1A 4MPRA 1IUNA 4G4GA 4URZR 3KOOA 3GLIA 3QH4A 3O2JA 3E7DA 3HA5A 1SVKA 1WXEA 2Q3JA 3DC2A 5CVUA 5DM0A 3HXTA 5LXTA 5KS2A 1HFEL 5BSFA 2PX6A 4IJMA 4MHTA 2IS4A 1U31A 1FVFA 1AKNA 3PXAA 2BEVA 4HB0A 4Q93A 4A8JB 2H0RA 3N39C 1U3CA 3CZCA 3D7LA 4JVLA 5EP2A 5JFGA 2OFXA 3ROQA 2XY4A 1KQFA 4NQRA 1ESMA 1JMKC 2YXLA 3AERA 3BJRA 3LGAA 3QVOA 1N8NA 2ODBA 1P7VA 3FE2A 3CY6A 4A0HA 1EVKA 4MVJD 1W87A 3W5VA 1N9GA 3CH5A 4OF4A 2WJWA 1CVRA 4IQFA 1UMDB 4CKWA 3KD2A 3T3EA 1GA6A 1OLXB 4HLDA 2ZANA 3BJZA 3VJMA 3TDKA 4EVQA 4NCAA 3HNPA 4EAQA 1M6VA 2QRUA 4RK7A 3R75A 4KGDA 3HCWA 4UCWA 4QPPA 4TLBA 4LZAA 4WNAB 2NO4A 3HCOA 3C14C 3RU3A 2RHHA 2JVKA 3B6KA 1MPTA 3DDZX 3QYJA 4YR7A 1CEXA 3WLTA 5B55A 2PGDA 2C2WA 2WWRA 2F43A 1NGSA 2C4MA 2ZRCA 2P27A 1PEKE 2ACVA 2Q6IA 1M5UA 2QTCA 3HRHA 3OZGA 4U7GA 4W8OA 5HIMA 1D2HA 4PTZA 5EE0A 5HM6A 3EGIA 4MARA 3FZGA 2PSFA 1AQUA 2CXQA 4EGFA 3P7MA 4A8TA 4MI6A 3CLUC 1L5SA 1HQYE 1MX9A 1XLUA 2OT3B 2WB4A 2VHUA 3AP1A 2Q3HA 3B1JA 4G1EB 4PU0A 4Y9TA 3S81A 1PDOA 5E9WA 2RH4A 1Y1SA 1G20A 1TJYA 3DR5A 5B1HA 4YO7A 1Z0SA 3WLQA 5EERA 2F8SA 1OYWA 1R9GA 3OOHA 5CB4F 5LLTA 4M1TA 3P2MA 4BLVA 1ZXLA 3AHDA 2FWPA 4Z99A 4Q3EA 4RNDB 2RCNA 1FRZA 2JHAA 2IYUA 2AMFA 2XQIA 3IBSA 4V02A 2QSYA 4C89A 1AA6A 1EUCA 3Q6MA 1BFUA 1SKBA 5DRTA 1GGKA 1TJ3A 4R41A 4RVHA 4HC4A 2PKQP 1R5OA 1FUKA 3JWJA 1K08A 4RHCA 5BNIA 3WDMA 1D6MA 1DKMA 1JPVA 1NLUA 3VKUA 1CR4A 5JNSA 2HCJB 3S1SA 4BXOB 3M83A 4O2LA 3IXLA 2GUGA 4RPGA 4DSUA 1Z34A 3TKLA 1KSHA 4DT1B 1QNLA 3KD3A 5FPPA 3RT7A 2FSVC 2ZRBA 2J6CA 1NUSA 4NX2A 1DKPA 4GR9A 1H8ED 1PG5A 1PWHA 1V41E 2H7CA 5D5PA 2Q4DA 3URMA 2FFHA 4A9AA 5FAKA 1EQ2A 1CP2A 3JTMA 4ER3A 1IBMB 4BUCA 1IVSA 5EIWA 2CVZA 1R8XA 3C3MA 4J2TA 3T99A 1SQ6A 2FEPA 4S0ZA 3Q72A 2C7GA 3IP7A 4X3PA 3RGGA 5KTMA 2F3QA 3UMYA 3OUZA 3DFFA 4I55A 5EQTA 3SYKA 1H4TA 2A9PA 1N6KA 1N2ZA 2NV2B 1NVMB 4CMEA 4M38A 5LB4A 3CJRA 3I6BA 3STTA 2OGUA 4A73A 3NTVA 4V3CA 1T24A 2E4VA 1E9FA 2J4FA 3OI7A 4ND1A 3FBGA 3M34A 5TVKA 2QBYB 4Q9JA 2WG2A 5F9MA 4C43A 2B94A 3TTXA 1Z3IX 2M1XA 2YVKA 2C4TA 2JS7A 2C2BA 2IPXA 4ZTZB 1GPH1 2XYRA 4MGYR 1Q0UA 4MW2A 2RHMA 3SJCA 1Y6QA 3U4QA 4PAQA 3DMNA 3ESDA 5T67A 1F4VA 3JS5A 2NACA 4F3YA 4MVJM 1RI5A 1MJGM 4RFVA 5BVHA 1DV1A 2PLRA 3MTBA 3QYAA 1BYIA 2AFHA 5DI3B 1WP4A 5IBRA 3A9TA 3FNGA 3KXDA 1SB9A 1Z38A 1M2JA 4HWOA 3O3CA 1C29B 5K05A 1Y7HA 1BXGB 4U2EA 2I2FA 3I64A 5FFFA 4F4HA 3F6BX 3TBKA 2VTBA 2PM8A 3BIJA 3LIPA 3LQ2A 4YUZA 4P9NA 1NDUA 2GN2A 2ZRMA 3DXYA 3OTIA 1RP1A 1G66A 1PFQA 1XYVA 2W2LA 3SXPA 5CFQA 3V1NA 3FCSB 2DOKA 2LTAA 3FI9A 5FWDA 1T3LA 4LY0A 1QIEA 3DNFA 1WW2A 1NULA 2RGXA 4AC9A 3AL0C 5KWVA 3VKHA 3QSYA 1KI6B 1NHGA 1CB0A 5CLFA 1JJAA 3RIYA 3O8DA 4FTWA 2NUAB 2J3QA 3IE0A 1U1CA 3OFNA 1I4OA 2AKAB 3WV5A 1WCV1 2XWQA 3LM8A 2XF2A 1KFKB 4UMVA 2OBLA 1OFTA 5L9AA 3LYAA 1TPZA 3ADBA 2I7VA 6YASA 3BICA 3GA7A 4GE0A 4QU0A 4C88A 1FYXA 3D81A 3H2BA 3WRVA 4DLUA 1U63A 3NS7A 3CZMA 2EHDA 5KSYA 4EZIA 5KMGB 1CWUA 2J3KA 2V9ZA 3QOXA 1Q1BA 5A9RA 3L05A 3T7CA 3Q8XB 2A3NA 1XLTC 3WNQA 4YH1A 1FEZA 1KP2A 4EBFA 4PQGA 5AVWA 3O8CA 1AJEA 1Q0QA 2ZGVA 4CG0A 2C9MA 1P9NA 4R3NA 3JQ8B 4F2WA 4WADA 3FOEC 1K3UB 2B0JA 3S28A 4PBTA 1LLFA 3PHIA 3SF8A 3HKBA 3A6HA 2I91A 4P2GA 3A4IA 2FQWA 3V7YA 4LC0A 1JU9A 1PQPA 2IYNA 3I9V1 5FOWA 1HYEA 4WJLA 3MB8A 5EUMA 4BVHA 4R31A 3QXCA 1A2KC 1AUOA 3OSUA 4MCAA 1ZLXA 2HJRA 1UL1X 4W4TA 3W90A 4B6RA 4MGIR 2HEIA 3D0KA 3AVTA 2FJ0A 4MRMA 4P86A 3LRXA 4DYDA 2Z9DA 2FX5A 3EGDB 3RG8A 2JI7A 5JADA 2X5KO 2ETXA 1DJPA 1HORA 2UZ1A 1U9IA 1WB6A 3AHJA 3E61A 3IAXA 3MMPA 3P2IA 4GYYA 4KDCA 4EY4A 3DTVA 3FTEA 1TM5E 4IS2A 3BGOS 4EUNA 3D0RA 1IUOA 1DOZA 4A82A 4EX7A 1GCIA 1ZUNA 1R0CA 2NV0A 5ALVA 2B2CA 4B46A 4CR6A 4IY1A 2BKAA 2X0JA 5KKNB 1N8TA 2AXQA 2V6FA 1O5OA 2ZSDA 5E9QA 3SGLA 4ENPA 3DT8A 4IDDA 3DEYX 1TAHA 5AVOA 1GPMA 5FL7A 4BV9A 2WU4A 5CG2A 1J56A 1M7GA 2EJUA 5ECWA 4BPBA 1KETA 1KJYA 3OWHA 3OM9A 2QLFA 4GQBA 1RKVA 2FQXA 4KGVA 3A4MA 4W5QA 2PMEA 4XVRA 2DPXA 2Q45A 3EAQA 1QH0A 1N5JA 2IF0A 1ST2A 2R9VA 3FNRA 5BXYA 1V71A 4BVFA 5HJ5A 4KO2S 3WGMA 5DOZA 4EW2A 3CLTC 2JIRA 4QICA 5BURA 4COOA 5J9FA 3KKZA 3C3CA 3NDIA 5C18A 2CV1A 2Z6UA 2YZ7A 4RANA 4BFWA 2YH2A 4CF5A 3KALA 3ECCA 1DDIA 4WAUA 4OHYA 2BPOA 4WUVA 2MSCB 4CL2A 2HV8A 1X7YB 2J0SA 5AQEA 4TZ6A 1OROA 4YRSA 1E3JA 3B6ZA 1QDEA 3JPYA 2ID8A 1YCGA 2GSDA 4LRTB 3TQTA 3V2GA 5A4DA 3W79A 1N7JA 4EZEA 1M76A 3FX2A 2HT6A 4JS0A 1PDWA 4XX1A 4YRQA 3HR4A 4B2IA 4WT7A 1WB5A 2RB5A 2HWKA 4GNKA 3SD7A 1UIMA 2ZLBA 3DJFA 4Y2HA 3JYPA 4CYMA 4Q3LA 2Y05A 2RHCA 4PC3A 1UZAA 2ZB3A 4X9XA 4XD7A 1LNZA 4UZFA 1DOAA 2GN8A 3N2LA 1PJBA 4HPJB 1TK9A 4QLAA 2CHUA 3OVMA 1K6MA 4PGHA 5IARA 4BNDB 5DX0A 3B8HA 3DMPA 5TJ9A 2Q9UA 4O8ZA 1UMBA 1SXIA 3KZ1E 1Q7BA 1M9NA 2YFQA 3KSRA 4R2MA 1JF8A 5TMBA 4E4RA 1VMIA 2QX9A 2H08A 2HV9A 3CF2A 5DLEA 1PE0A 1BQEA 5F51A 5KKCA 2FEMA 2JLSA 3PUZA 1MDFA 2P4SA 2RB4A 3O4HA 1F0KA 1YUBA 4HR7A 5LZ9A 1RRPA 2IZ5A 3PWZA 5I7HA 3DW3X 3COYA 3C74A 3ZU6A 2NZUG 2FFJA 3KM0A 1A4RA 5EXTA 5KIAA 2YOFA 3CNHA 4H15A 3RHFA 5ED4A 4ZDJA 2P9FA 4GGPA 1YNSA 2QZ4A 3Q3HA 4NENA 4TVOA 3UTDA 2QENA 2VR1A 2M98A 3VPCA 4EIWA 5BOSA 4HUJA 3OQOA 5GZ3A 1GPAA 1AHHA 5G1NA 1PG2A 5AJWA 5GMOA 2X4LA 2QWXA 5CLHA 3AKZA 2PZJA 5EFZA 2NZ2A 1EFAA 4UDOA 2HO5A 2X13A 3IKJA 2XHZA 4M87A 5I8PA 5HCIA 3VZDA 3ZYZA 2MR5A 1K66A 4R40A 5AI6A 3IVGA 2GXUA 3G5AA 2G1KA 3FNFA 3V34A 4B6FA 3PTAA 3I5YA 4N6OA 1NLYA 4CDRA 1U7OA 2N1MA 1FSSA 3FUVA 3RSOA 5A5EA 2Z43A 4TMXA 1GQ2A 2BFBB 2D1RA 3QPWA 5AW8A 1V1RB 3Q8KA 4R68A 4MQEB 1YCHA 2PYZA 3OOJA 1Q2XA 4XD2A 4UPDA 2GRJA 1CQIA 3ML1A 1VB5A 3AEYA 4WLOA 4ZOCA 1ZINA 3MWEB 4XVUA 5EJFA 2JJ2A 4HYTA 2EX0A 4A1OA 1SVNA 1CDZA 1XWWA 3ZZ1A 1QP0A 1FP4A 2ZBPA 3L41A 4BMXA 4FGLA 5CBPA 1V8BA 1ORWA 1VFNA 4KREA 3ERCA 3C16C 3ILVA 5KAPA 3R4VA 4PLHA 4RM2A 4NCXA 5G4LA 4IO0A 3OJEA 1NT2A 1GITA 2E4UA 4BP9A 3TLYA 4GI3A 1Y6ZA 3CX7A 1QHXA 4Q1BA 1QGUA 1K7SN 3RW9A 2B5WA 3DE0X 3A6ZA 3AF0A 2II6A 2W00A 3O4JA 3RVLA 1BDIA 3CCFA 1EJ0A 3P97A 1ISPA 1LGYA 1TM2A 4RCZA 3LKZA 5BY2A 3MHTA 1NUUA 4HUQB 3ICQB 4R05A 1G9XA 3LKBA 2K2WA 1O8CA 2Z9BA 3HP7A 2X5OA 4HX5A 2BKVA 2CZQA 1OZAA 3G59A 4FP9A 3RYCA 3PF9A 3KXPA 4PLPA 4ZEOA 1PWZA 1E5QA 2DJ5A 4WK2B 1JLRA 2PQMA 1JPNA 1YGYA 2Y9PB 3MQFA 3SU8A 3COJA 1JR6A 2J30A 3PKJA 3THWB 4OAQA 1KY4A 1THZA 5E1BA 3DZGA 1RTKA 5KYUB 1FX0A 1OD6A 1M73E 2OGWA 2GUWA 4GRAA 3MJVA 2ONZA 3JQFA 4HAXA 3OTQA 4YRPA 1Q1GA 3C3KA 4DLTA 2OHJA 4L3OA 3R5SA 5ADUS 3H1BA 1CIVA 3LLUA 2K7FA 3PHHA 3DLHA 3UXEA 1KK0A 2PR7A 4CF4A 8OHMA 3T12A 3N86A 4ZDKA 4KWTA 3ZTYA 3OLCX 3HDVA 5GVSA 3VDMA 2HCFA 3HKCA 4RSGA 4BB6A 3I6YA 5A3RA 4F5ZA 4OKNA 3JX9A 2B5OA 4JEIA 2PWBA 1LLQA 1J90A 4XH9B 4BKPA 2XJ4A 1GGEA 1MJFA 3OJCA 1GVHA 1L5HB 2BBWA 1JYFA 5A5VA 2CCKA 4FGZA 1HURA 3NTQA 5LLSA 3AJRA 4X3CA 2QKYA 4OATA 3A9UA 4B7CA 2GBCA 1VP9A 1I2CA 4HDQB 4Y2PA 1JNXX 2P9ZA 2HJWA 1DLIA 2JJ1D 1MO3A 3OEHD 4PZLA 3H2JA 4RKRA 3TJZA 4YJHA 3LT0A 3O1IC 5BYJA 2Q3BA 4QO7A 2JZCA 5M7EA 2AW5A 2J31A 2WE7A 3A58B 1NR1A 1MZPA 3P32A 1Y89A 1OI2A 4RC9A 3LLMA 3K71B 5J1SB 4XTRA 3T5GA 4EGCB 1WA5A 4TWIA 4E14A 4B87A 3EZ9A 3EF1A 4Z4FA 1IN5A 3LZDA 3PK0A 3QG1A 4GKJB 3IE2A 1F17A 1D03A 4FFNA 1I6LA 2C9ZA 4FFBB 2GBIA 2G7MC 2P9HA 3H9GA 3QLJA 2NUBA 1NJ5A 1Z2PX 4C4OA 3D6NB 1MOPA 5EXDA 1GADO 4XQEA 3WYFA 5B3JC 3PF8A 2YN4A 4Q9LA 1PR9A 1R8YA 3D3NA 2O1SA 4Z7QB 2DBZA 1EWRA 2OBXA 4UHDA 4E5SA 1XZJA 4FW8A 5B7QA 2VP4A 2ACEA 2VPTA 4HK4A 1WL8A 3ZW9A 1P2VA 2DH6A 3EWNA 5KWSA 3D8UA 4N0MA 1JHVA 1QV9A 1DU4A 3BXFA 4UUAA 2XYVA 4RJIA 4EY6A 2Y1XA 1BEUB 1G5PA 3TIVA 1RIIA 2ROQA 4FHCA 4U5XA 5LP6F 1A4UA 1U94A 1UM9B 2A5YB 2C97A 1KWGA 4ZYUA 1FZQA 1YS6A 3F0TA 2ZBQA 5BN4A 4KFTA 1DE0A 2B0CA 3AUKA 3CZ5A 5EJMA 3VYUB 2BT4A 2VQDA 1W4LA 3FGPA 1JPJA 2C42A 5BRJA 3QXJA 3QX3A 5TSDA 2P6RA 2RAFA 4HDRA 4C0LA 1PO7A 1QHYA 3O8QA 1GRVA 2WIBA 3RVMA 2DVMA 3A6JA 1KGDA 1T34A 4FS8A 1K7FB 1XMSA 3NALA 4U9UA 1S8OA 5IBPA 1V5GA 3JWHA 3TVTA 3RJ9A 4Z5XA 2B3DA 1D6JA 4W7HA 5EQFA 5LBIA 3H2KA 5F12A 3TEMA 1GPBA 3CW9A 1D2RA 1DCFA 2ZRKA 3BF8A 1K89A 4CFZA 1PSWA 4IHJF 4E94A 4EOGA 5C34B 1UDWA 4CDNA 4D9NA 2EF0A 5TPWA 3GT4A 2GASA 3LY5A 1U2ZA 4ZHSA 5GIOE 2C5BA 3PCTA 1OA1A 2QMUA 3NUQA 4PLVA 2R3SA 1EFRD 3JAMA 1E0SA 4ARBA 3L0YA 4C6TA 5EJ6A 1LPNA 1FPMA 2OCIA 1JVBA 4E2XA 5LR6A 2IXBA 2YJ3A 4FFMA 4DDUA 2WFMA 2O54A 4N5NA 3DZBA 4MVJG 1ILEA 4HBZA 4BC0A 5F35A 3C7KA 4M6WB 3ZY4A 1VSVA 3O73A 2OK8A 5FOXA 3VHQA 2XNHA 2FGKA 3L84A 4BJ6A 1Y33E 3VX4A 1X80B 2WUWE 3AW9A 5DF1A 2VSFA 5JD5A 1NNLA 1P18A 1TZCA 2VK8A 1U3TA 3LX6A 4LE1A 1Q92A 2VF4X 3FRIA 4BCDA 3GJ5A 3ICVA 4UTNA 1LDNA 3UC9A 2ZBFA 1JG4A 2XMBA 3C3PA 1E69A 1K6JA 1YS1X 3AZQA 3D6VA 3EG9A 3GFVA 3CZ4A 3FPFA 3KZKA 1SCKA 3NVMB 3F1KA 3QELA 4LF6B 5TEVA 3FCAA 5JZ9A 1D3AA 2NO0A 3MMNA 4MQMA 1XKXA 4FGKA 3GDFA 4HRAA 2POCA 5B58T 1NXVA 1Q6ZA 2E7ZA 2OUIA 1ZLYA 3E3LA 2AYYA 1ISSA 1P9OA 3ELWA 3QITA 1X1CA 1NVKA 2F9FA 3D4OA 4WZAE 4A5SA 2AMLA 1Y5IA 1W85A 2E9SA 5EKXA 2Q7OE 4X97A 9GPBA 1CRPA 1J8YF 3W8DA 5A6VA 4GE3A 3OWXA 1CLUA 2EBFX 2GYUA 2CXXA 1UAYA 3RJTA 1Z5ZA 1GEGA 1JXOA 1C9YA 2HHLA 1BQ4A 2GCGA 5DWQA 3RS8A 2Y1GA 2CJWB 4IWYA 4U7FA 4PXYA 3PQ5A 3RTDA 2DUUA 3NDJA 3ZV7A 1WMBA 1GNRA 3A04A 1L5LA 2FB9A 1B4DA 1GKYA 4BRUA 1Z18A 1AXGA 3TMKA 4BE9A 2PFGA 2VJCA 2BFEB 3HFSA 1G0NA 4I9NA 2AI1A 5AK6A 5LKAA 3ED5A 3KVRA 1XHLA 3IUMA 4B4WA 1F7UA 1QLJA 2P41A 3MIZA 5A3SA 2HFKA 1KI9A 4CTKA 4AF8A 1LRLA 1QF7A 1N1EA 2HREA 2D2EA 3K4PA 3R0QA 3ZWPA 5L6MB 1R3UA 2RGGA 1EDBA 3N2GA 4BJ3A 5FWNA 3RADC 2OXFA 2XNCA 4CWAA 2BDUA 2QDKA 2A9VA 2XNDD 1C0IA 4DWVA 5J58A 4YVFA 1DEAA 3PGVA 1WZUA 2PRSA 2ZQZA 5HCNA 3H5LA 3PDJA 1JQKA 3QVGA 3AHIA 4HDMB 3W3AD 2PKWA 3PPIA 2I4RA 3RTCA 1HH4A 5KHLB 4YLEA 1P4GA 5FI3A 3RJZA 1CQXA 5BW8A 3CVVA 1YFLA 1VPWA 3EPKA 1P60A 1P4RA 3QMVA 4FFLA 3FUTA 1M6WA 2J9FB 3BWCA 4MSUA 4JLKA 1LWNA 2WM2A 4KO8A 4MR7A 1ZMXA 1NNSA 2IF2A 4YJGB 3TTYA 1D0IA 4M3NA 1E9VA 1ZVMA 1J09A 4FI3C 5H68A 3T7JA 2IH2A 1JS1X 3KDSE 4BLPA 1UKYA 4IW3B 2WWYA 1ULBA 3OO0A 1NVFA 2BFWA 2O9JA 2ISQA 3MYYA 2CKDA 2P9GA 3VR6H 4WZBE 5CH8A 1TU0A 2GCEA 3PD1A 4I4TF 5IKOA 3TOVA 4AW9A 4KPUB 5I4BA 3AVOA 3R77A 1HPLA 3AOGA 3FFXA 4I8XA 1WDTA 1TRHA 3AZOA 2WA1A 1TK2A 5DIZA 2O6HA 3IPRA 4R1MA 4BNLA 2DBRA 1OBFO 3EUWA 2NVOA 2DCMA 3HY6A 4RF4A 4EFNA 4G5FA 3FPJA 2HQRA 1S4MA 1BXRA 1Z5WA 2GVDC 2VK2A 3D6UA 4PG4A 3CONA 4UCXA 4LVUA 5K1ZA 3ZKAA 5KCZA 3HK2A 3KCNA 1WSBA 5COBA 3O4GA 3L6DA 3R4CA 3L7DA 5SY4A 5JAUA 3LZ6A 2GF2A 3TRDA 3K9FC 1GUBA 4N3GA 2CBZA 4E7PA 2J45A 2ZKLA 3OEED 3FZYA 3I23A 1UMKA 3EK2A 1KORA 2MR6A 5FNVB 2I3AA 3LP6A 3DWEX 1JHZA 3DFIA 4E12A 3RREA 1WXQA 2C20A 3CINA 3GQVA 1I3KA 3SZMA 3WHPA 2WF7A 2CF5A 2W2XA 3KYBA 4JC0A 4C7BA 5T64A 3HLKA 4MWOA 3RS9A 3VH2A 4QG3A 3HXQA 1SC3A 4S12A 4RESA 5DEOA 3ZX4A 4H3VA 5FOQA 3AI7A 3INRA 3JU3A 3RSHA 2VUUA 4M0CA 5TB5A 2J9YB 4NBNA 3GPBA 4QQRA 4HH0A 3HJCA 2Y77A 3H17A 1Z33A 2AOUB 1ADJA 1U6KA 5C1OA 2DFDA 4MB6A 1YRHA 1PTJA 1FRVA 1L5GB 5CCXA 4HGPA 1U3UA 4FDLA 1CYEA 1HQDA 4DN6A 1JUDA 3JQ7B 4HFNA 3JQGB 1HC7A 5P8WA 3BRWA 3AR8A 1SUFA 1ZVKA 1MQ9A 2C4HA 2CLIB 2HU7A 2Q4BA 4H4EA 4PCLA 1FSZA 2FMHA 4YAFA 3S7TA 3GPCA 2Q0HA 2WUEA 4HGNA 2A14A 5AK5A 5JI3E 3M6IA 3LUGA 3MUNA 3UGQA 4Z9YA 2VHCA 4OG2A 1RE1A 4AN4A 5CDHA 2PKXA 3WK8A 1RHMA 1HWYA 1G38A 1BFDA 2ZB4A 4LCEA 3P2EA 3Q2OA 4CL0A 4QDJA 3Q3IA 4R2WA 3WKDA 4EB0A 1YR6A 2OLJA 5ERXA 1WR8A 5FA5A 1R6UA 4G84A 4JL5A 2NP7A 3EQ8A 5A06A 3AIKA 2JBAB 4BN4A 1EWVA 3SLRA 2X9GA 2BGKA 4JOBA 4J94A 1SUDA 3LDUA 3LPCA 4AX8A 2DKOA 3Q1KA 4KFSA 2BBSA 2XIQA 3QU9A 4J07A 3O90A 4L9WA 1NNI1 1Q57A 1R0XA 3HLYA 4NAHA 4ND5A 4FLFA 4G81A 3TS1A 4AURA 1EGQA 1HZZA 1JE1A 2YJNA 2BGWA 3ZDBA 1A27A 2KE5A 4Z0PA 5DYGA 1EP3B 1YC2A 5TC4A 3R7BA 2BHNA 4EG8A 3G2IA 1E2NA 3D3JA 4ZCQA 3UMRA 3HO6A 5A7FA 4DG8A 1GPKA 4US0R 1U3GA 3HBLA 2IODA 1L9XA 4BFTA 2XSZD 3P0JA 4ZT6A 4XE5A 1AUQA 2B8JA 4YA6A 4Z7JA 3UIEA 2FHSA 3R3HA 1D1PA 1MRZA 2C1ZA 3WFJA 5HFAA 1Z75A 3CLKA 2I6SA 4ENUA 1STOA 3D5TA 5IBCA 1UDCA 5ALPA 2QPLA 4LVCA 1RJGA 2V0CA 4Z0TA 4HB4A 4BKQA 1J2YA 2C94A 2PBZA 4KLCA 2XQGA 3ZKWB 5IT0A 1H2WA 3D0OA 1LPPA 2FDXA 3FYDA 5F21A 3GRAA 3TZEA 3HGQA 2CHVA 3K1TA 3MCVA 5D5QA 1P4HA 4KLRA 5B1SA 3RS0A 4HTFB 1QANA 1V4VA 1YDFA 2HK8A 1NBWB 3VDRA 4E2YA 1E3EA 4BP1A 1YF3A 3W5DA 3NQ41 3PRKE 4KBFA 4LGMA 1WMAA 2QRPA 3ORYA 1P0QA 4MV0A 3D7MA 4MQFB 1ZD5A 1B3RA 3WBKA 5E1MA 1EXDA 3CG0A 4N65A 5T5QA 4BFCA 1WUTA 3C39A 1WVGA 3X1MA 4CM4A 2IQIA 1NXOA 1RKBA 5HCUA 3Q5EA 4UC0A 4DSNA 5JTUA 5AI0A 3SM3A 3LHSA 1RM4A 4EHHA 2XDQA 2B8TA 1S5PA 5E38A 1JG3A 2VKTA 1PFUA 1ITZA 1SXJB 3AVPA 3HB4X 2EYQA 2IE0A 1T2NA 4IFBA 5EMMA 3PXDA 4IM7A 2J5BA 4LG1A 3U60B 1DGQA 1R0SA 3VO9A 5CNJA 1Z9BA 1P7WA 2VP2A 4R2KA 4HATA 5AOBA 4XB6B 1XYGA 4MV7A 1PD0A 5A05A 4GDMA 1BDHA 3ISVA 4NZMA 5IF3A 3KAJA 3LIIA 4KAJA 5FAXA 5AUNB 4XWKA 1DZ3A 3M8KA 3IESA 4E13A 5JS1A 3EMDA 1H6AA 4H6XA 5DHTA 5A6SA 3VO2A 1F9EA 1X87A 1O94D 2Q21A 3OFSA 4INPA 1LQ2A 2Q0QA 1IQRA 4ZO4A 2UYOA 4A6XA 3GFQA 3MMSA 4WUTA 1OB2A 2Y2UA 5F2OA 4GBED 1FOEB 2BGTA 3GT7A 4YCBA 3UF0A 5KNDA 3PPWA 5IU6A 2PKEA 3W5HA 3CN9A 3A9SA 3MJ4A 4AL4A 4GLFA 4RTOA 3PUYA 3PQ4A 1ZYUA 1OFIA 1L5FA 4KUHA 4UAVA 3RYFA 3W5BA 2B30A 1U5AA 2XZTA 3EG5A 3EXFA 2P5SA 5DXJA 5H83A 2ZSUA 2E21A 4EA7A 3LGXA 1Q0RA 3KKNA 3H1TA 3ZU5A 2PJDA 2P2DA 5KTKA 1C9KA 3PXBA 3EXEA 1OJ7A 5CW2A 3WNZA 5CEJA 1CNFA 2A1TR 3PEUA 2BSQA 5DK6A 2L2QA 4C7OB 1RBZA 2GHIA 1Z4LA 1HUQA 1P77A 3D43A 3SZOA 2G06A 3SFVA 4HWKA 4MRRA 4O2AA 2TSYB 5IM4A 3VR4H 2PUFA 3BXGA 2WHXA 1O95A 2BMEA 4QGAA 4M98A 2IV3A 4UHFA 4BATA 1LK7A 2CNWD 3TSYA 3KKKA 1IHXA 2EWWA 1Z25A 5FWYA 1XALA 1RYHA 4NXMB 5T4BA 3G2QA 1RLOA 1HM5A 3H97A 1R9MA 1DMSA 5EGSA 5K8VA 3FVWA 1E2UA 4NEHB 2OHIA 1AS3A 2NU9A 3CGWA 4LZZA 4TMWA 2GKOA 1TTHA 3PWTA 3FRHA 4MRNA 4NWIA 3TQSA 2DM6A 4O08A 4PAOA 3TX2A 1DXHA 5FTNA 1JWLA 4Q7MB 3VJLA 3HN6A 1E77A 1IB0A 3S2YA 3UAWA 5K6AC 4YC7A 2J59A 4I3GA 1P4JA 4ALMA 2O8FB 1Z6GA 4RWEA 4X1IB 1N33B 3PXXA 2EFEB 3KLBA 4ZA2A 1EX6A 3ITKA 1VA4A 2DQSA 1N2BA 1RU3A 5C4MA 5I6DA 4UEQA 5JAZA 3HM9A 2AUMA 2YY7A 4J0DA 1EK0A 2Z4RA 1H8EA 4L1KA 2Y1FA 4AS2A 4D0NA 4EGSA 1PNOA 1IMJA 4G0OA 4OB6A 1KE1A 2XOEA 3ACBA 1F14A 5FOSA 2GEDA 5ECGC 4PYRA 3W7BA 4CM8A 4N0PA 1DTEA 5G3YA 3WL6A 3PR3A 1RT9A 3QX7A 3T3DA 1WLYA 5HJEA 4ZAXA 3WRWA 1RQ2A 3WQRA 3Q8MA 3DVQX 1ZXBA 1G8YA 1C3OB 1EFPA 3JQAB 1D2AA 421PA 4DLVA 4QGHA 1JA0A 3VVBA 4FEYA 1VLZA 3V2UA 1RWVA 2GA9A 2NX2A 2ZSKA 5GIPE 1H6DA 4D9HA 3B5IA 3H3XA 2BKXA 4OXKA 4WE3A 4CFSA 5EWLB 4EY3A 5L7WA 2X1HA 2KS6A 3LT2A 3H9UA 3EAFA 3KTDA 4NU0A 1IY1A 1FX1A 4G24A 3STXA 5L3SA 5IT9A 4BXOA 3T3OA 2I9PA 3FDJA 3TPFA 1CY7A 4XVHA 5EQJB 3DXZA 1G3UA 2G1PA 9ATCA 1T9HA 1BVHA 4XKJA 5ALEA 5ENVA 2QL7A 4CDGA 3BERA 4ZKEA 2Y27A 5GADl 1XTZA 2DG2A 2G36A 4QDXA 1XDZA 1K3TA 3PD0A 3UCXA 2RARA 1ZGZA 1G5HA 1T25A 2ZI9A 4AO6A 3M4XA 3MERA 4Y9DA 4DLZA 3SXUB 4WXMA 1U7UA 3CPSA 3SNHA 3L07A 1VSBA 1A2BA 3QTLA 1NFQA 4U5QA 4BP3A 2ZEJA 5FTJA 3FMVA 3S8MA 3ZC3A 5HIKA 3LXMA 2P3LA 3R3YA 4JXKA 3CRW1 4WXRA 1BC5A 1B8VA 3IR5A 3GLHB 1MNQA 4W7SA 3A4LA 3S1AA 3QQPA 2E55A 4MDYA 1SCNE 5A4MS 1NMZA 5HILA 2LV8A 3KL4A 3L40A 4ZAZA 2XZDA 2O0HA 2DLCX 1ZICA 4EMUA 1YV9A 4ZEWA 4TV8A 3UV6A 1I8TA 5C46F 1XTBA 3ZEAA 3U7QA 3DB1A 4H31A 3GLHE 1WZ2A 2I54A 5HR5A 1ZO8A 1PQ4A 1MJ5A 1VL1A 2PS0A 2X7XA 4XWOA 5DI9A 1JT9A 4FFWA 1FFDA 2R2GA 3FSEA 3OQBA 2HA2A 5KYXB 2R00A