2YOFA

Plasmodium falciparum thymidylate kinase in complex with a (thio)urea- beta-deoxythymidine inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
200
Chain Sequence
b'DDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Synthesis and Evaluation of Alpha-Thymidine Analogues as Novel Antimalarials.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 80
structure length 200
sequence length 208
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yofA00
3PIRA 2D4HA 2A9KA 4QJ3A 2O0HA 5FOUA 4D2IA 5F2EA 1R4AA 4E5UA 1CJUC 2A5JA 3GEHA 4A2PA 1P73A 4GMDA 1GOTA 1LTQA 2ZUCA 4U7DA 4D4MA 1R0ZA 1SQ5A 2D06A 1EESA 5B2ZA 5TB5A 3U61B 1R8SA 3IEVA 3AF1A 5JMTA 5FR1A 3TUIC 2CBZA 3B85A 4UNPA 1Z63A 4PAOA 3KQUA 4TTRA 1N6HA 5G3ZA 4QG7A 5BN5A 4NU0A 1IY0A 1N5KA 1AJEA 4IRUB 3CRMA 4NH0A 5JBQA 1JB1A 1W0KD 2VTKA 4WBSA 3SE0A 2RGNA 4PANA 1KO7A 1TQ6A 4IEEA 4OHXA 5E95A 1T0JB 2WWGA 4IDQA 1VPLA 3EG5A 4BFXA 1XD9A 3R7WA 4DCSA 4DDVA 3J81k 3U7HB 4JLBA 3BERA 1R8QA 4AKGA 3FFBA 1NLFA 4TLDA 2C5LA 3C7KA 3ONWA 2KBFA 4HSEA 4JLMA 5P21A 1WA5A 2NPFA 4B2IA 1RYFA 5JEDA 1Z0KA 3QF4B 4LHXA 3W8NA 3A36A 3ZZTA 2FX3A 1QZXA 4RFSA 4MITA 4A2WA 2REXB 2IW3A 2Q9CA 4KBGA 2AFIE 4LC1A 4BZXA 4F93B 1T0HB 4EJSC 4N0DA 1XJCA 4Q03A 4QNMA 3GLFB 2ONKA 4V0LA 4FW9A 2XXAA 3RSLA 4HDOB 2IYXA 1EFRD 2PEZA 5JI2E 1LS1A 3QG5A 1OLOA 3D7MA 2H18A 2UZIR 3E1SA 3JZMA 1XXHE 4W7SA 3LVRE 3MUFA 3D6TB 2RGEA 5E4FA 2FSFA 1S9HA 2ZE7A 4D0LB 5CB8A 3UMFA 3I61A 1D2MA 3QKSB 2JLWA 2EU8A 2F1JA 2QQEA 2CVHA 2FA9A 1E1RD 2IS2A 3KL4A 5GJVC 1Z08A 1HQYE 2IYSA 1J7KA 3OE7D 2V6JA 5FH9A 2ZM5A 1FFHA 3TR5A 2Z0MA 1VYVA 5G53C 3GPLA 1FP6A 4DHEA 3LY5A 2JA1A 3LO5A 5AWFC 5DHAA 4MYTA 1GKIA 1Z5ZA 1F60A 2VP2A 3L0SA 4R7ZA 5K8UA 1GL6A 4MKFA 1JQLB 1Z29A 4BECA 1G3UA 4URYR 2X2FA 4QBFA 4TT3D 3RRYA 1S4QA 3VKHA 1IN7A 1M74A 1D2EA 3B9PA 3LA6A 2IHBA 2FEOA 4CEHB 2CLCX 1DARA 2ZS7A 4Q7LA 4Q1FA 4UJ3A 1P2UA 4QJ4A 3SI7A 5K8LA 5KNDA 3BFVA 3EPJA 2EFDB 3ND8A 3AKDA 3VMFA 5JSZA 2W58A 1IXZA 2R62A 3QENA 4B75A 1TEXA 3GLIE 4FWTA 4YDSA 3ZLJA 1G3IA 2YV5A 3Q85A 5A0FA 4G5QA 2QY9A 4MGIR 1Z22A 5EP2A 2VSOA 4XVRA 1JEEA 4JSYA 2IYYA 5DSZA 1ZM7A 3K0EA 1G5TA 1Z07A 2O52A 4Y0AA 1E1RA 3BH0A 2GF0A 4F91B 4B2LA 1TPZA 3P26A 5KSPA 3OE7A 1A82A 3LBIA 3BB1A 3L0IB 2PX3A 1RPZA 4R2IA 5CB6A 1EK0A 1KO4A 3FOZA 3KTAA 1ZINA 4WIAA 3U6KA 1IJFA 2EFGA 2FU5C 2G1JA 1ELOA 4LHYA 2Q3HA 2CCKA 4MGZR 1ESMA 4Q4JA 1UKZA 5F3WB 2ZETA 2J41A 4DC9A 4DIEA 5ELXA 2JLZA 1YQTA 2KE5A 1MH1A 2JLRA 4TT3A 1Q1EA 3OESA 3B6EA 5DISB 3SZRA 4PZYA 3CM0A 3HU2A 3QKUA 4I81A 1KTVA 2CK3D 5FTMA 4CGZA 1F5NA 3MG9A 1NNEA 2N1BA 4TL9A 5EXPA 1TU4A 2D62A 2HT6A 5D3MB 3THXA 3RANA 3SS8A 3BFKA 2GTPA 3BH7A 1R2QA 2DFTA 1RE0A 3DZ8A 1W0JD 1LV7A 4AG6A 5CK5A 2Q9BA 2QRZA 2J87A 4GSYA 1LW7A 2UVQA 3HYRA 1SHZA 1FQJA 1HE8B 3I8XA 2HF8A 2OLKA 1IN8A 2GILA 2BBOA 1NN1A 1XEFA 1U81A 5IK2D 2OCPA 2GXSA 2ZS9A 2SHKA 1GRQA 3OIWA 2J1LA 3T1OA 1F2TB 1T6NA 1COWD 4B43A 1M7BA 1GFIA 5DE3A 2AL7A 2W6ID 3C5HA 2GAOA 1XMVA 4MQBA 3AQ4A 3HJNA 4MUBA 3H84A 2ZJBA 2YINC 4ESVA 4Q01A 2XB2A 2CEAA 3WYAA 1WBBA 4M9XA 1NMZA 4BLSA 1E98A 4IFBA 4JLVA 1LB1B 4JJKA 3O8RA 4NHOA 2KWIA 5TV2A 1TF5A 2GEDA 2VPPA 1GRRA 3U3RA 1EFHA 3UXMA 1OH5A 1KZGB 2CDNA 5AUPB 2ECKA 2Q3MA 3A1SA 3C14C 2QMUA 3F0TA 4TYWA 1YZLA 3QPUA 3NC0C 1XP8A 2QGNA 2ZRAA 4WVFA 2WAYA 1Z0FA 2XEXA 5J4LA 2CK3A 4HZUB 4B48A 1UADA 3RHFA 5JI3E 2PJZA 4P31A 4BLOA 2MMCA 4QNRA 2BMDA 2F43A 2VEDA 3GJ5A 3N5CA 3WHKA 3U6BA 2O0JA 3GJ4A 3VAAA 1IHUA 1U0JA 1D9XA 1W0JA 3CH5A 1W5SA 4TMXA 2ZPTX 5DLQC 3N2EA 1DAHA 5FOVA 5LDDC 1KDOA 1MABA 1PZNA 1QHGA 5FL7D 1I4DD 3L0PA 121PA 1E9DA 5IK2A 4UKDA 1ZM3A 4URWR 1R0YA 3TH5A 1COWA 1R5OA 2UZ3A 4LZZA 2O8BB 3DPUA 3I1FA 2X2EA 2W6IA 2BBTA 4WW0A 3VU9A 4IOLA 3L0OA 2O8CB 2F7SA 1UKYA 1CTQA 2JATA 4ZO4A 2YNMA 4B34A 2P5TB 1J2JA 4BQSA 4CT4B 5EXTA 3BE4A 1YZQA 4II7A 5HCIA 1QHSA 1WF3A 4CIDA 5BQ5A 4ACBA 221PA 1ZCBA 4PHTA 2AXPA 1CULC 2VP6A 4URZR 5HPYB 2J5XA 4V02A 4L15A 2ORIA 1AN0A 4K8OA 4AI6A 1KK3A 2FPMA 2IEZA 1KI9A 4Q18A 2KSQA 2OT3B 2PEYA 3BD9A 3ZQJA 2X1VA 4KYUA 5JFGA 2O8EA 2JLVA 1UPTA 5AJYA 2OEPA 4XVUA 1G6OA 2JLYA 3U44B 4M9QA 3CPEA 4RD3A 1DAFA 4B6FA 2EYQA 4CZ2A 2WJIA 4LJ4A 5JCZA 3EIHA 4DLZA 3AVYA 4BRUA 4PAQA 3U4QB 4M0LA 4A15A 4K81B 2JGNA 2ZSEA 2R6CA 1DTSA 2HYDA 2W83A 3AEZA 2YWHA 4PTLA 2XJ4A 3A1WA 4BFVA 1NIPA 3PEWA 1NG1A 1ZNZA 4G5GA 2BM0A 3AVOA 3LVQE 2ERXA 1FNMA 2D74A 1XZPA 3W34A 2CLSA 4KBFA 4JVSB 1VECA 3UANA 2PJRA 2VHUA 2BV3A 1EX6A 3AKYA 4Q7MB 4AKHA 4TMVA 5B57C 2MSCB 4A8JA 1E0AA 4G0NA 2FSIA 2JEOA 4XOIA 2YVUA 3IGFA 4DXAA 3JZAA 4LV6A 3LRPA 1E9CA 2ZI4A 4Q9HA 1KO8A 4V03A 1G21E 2XTZA 3O47A 4JVLA 4YC7A 4HZIA 1W2HA 5DI3B 4JMPA 5FFMA 4PPNA 1N2CE 3ZQ6A 4AD8A 1Z6YA 1XPUA 2I3BA 3BXZA 2ZE5A 4GBMA 1TADA 5G40A 4E09A 4M1TA 3RLFA 2VSXA 3FGNA 2Z5FA 3L2OB 4TSFA 1A5TA 3RS7A 4Z8XA 3KJHA 2WWYA 1R0WA 1KAOA 2H7VA 5EE3A 3AP3A 1F6BA 1MO6A 5ANRB 3DMNA 3NBFA 1GUAA 2WSSD 2PCJA 1XXHA 4ZV4A 2XZLA 1ZYUA 3FYHA 2KB0A 2AWNA 1E9FA 4ZIRA 3PENA 2J0UB 3I92A 3LWNA 1AS2A 2GVDC 1Z0JA 2LKDA 3QXJA 3CX7A 2IWRA 4BFYA 2KJQA 2IWHA 4DLXA 4KVAA 5L3QA 1TU3A 1SVMA 2J0SA 1RVDA 1AS3A 4LX0A 1Z8FA 1PVOA 4O25A 1QHYA 4NZYA 1HA3A 1Q1QA 1RJ9B 3KKPA 5IRCD 3ZS9A 1VIAA 2F3TA 1QHNA 2A30A 4O0MA 2CL6X 1RFLA 1IY1A 1KNXA 2BMEA 3E5HA 4LSGA 3RDPA 1MO3A 1P7CA 4KI0A 2XZPA 3T15A 1IN6A 3MGCA 2H17A 4BFSA 5KUTA 2VLIA 1E9EA 3FKSD 1A4RA 3NDPA 3THYB 2VYFA 3AP1A 1PJRA 4P4UA 4CF7A 1XEXB 1P72A 3MMPA 3B1YA 4NONA 3ZVRA 1M7GA 4IDOA 2PT7A 2BC9A 2P2LA 4LUCA 5BYJA 4J0QA 3CRW1 2L0XA 3O8BA 4US0R 4DUGD 5TMPA 2QN6A 4OK3A 1VTKA 3WRYC 2V1UA 1BO6A 2GJ8A 3HR7A 1UKVY 2WBLC 3IQWA 1UBCA 2BHRA 2F1IA 4HYYA 2ZUBA 4OQMA 1GVNB 4DCUA 2R6DA 2GJKA 2WSSA 4M1OA 4UQOA 1U99A 2XTNA 4JYBA 4Q9LA 3NEYA 2OFWA 4BLTA 1DOAA 2YHSA 4KFUA 4NKRA 4TLCA 4XD7D 4XWAA 2CVFA 1QBKC 3IPYA 3ADKA 4JIMA 1CKEA 1U0HC 4M1YA 1KZ7B 4WZAE 3WY9A 4YMUA 1XWIA 4JLDA 1FMLA 2PH1A 4DEXA 2GVZC 4ZDJA 3AVXA 4XH9B 1WP9A 3BB3A 1G17A 1X1SA 3NHBA 4QM7A 1LFDB 2EFHB 5FL3A 5JRZA 1A2KC 4NCNA 2IYQA 4IOMA 4M4SA 4Q4HA 3Q9LA 2V4ZA 1SHKA 3HPQA 4Q1BA 3U2QA 5KDDA 5L8VA 1P60A 3FKSA 3RS4A 4AYXA 2NQ2C 3AKCA 3LBHA 4GOXA 1JPNA 2C98A 3PV0A 1MR3F 1KI1A 4KCGA 5FOXA 1QG2A 1Q0UA 2B21A 4Q1CA 3U3JA 1OFHA 1FOEB 1I4TD 1XMJA 5KNBA 2NMVA 1R5BA 1I4LD 1YR7A 3LAWA 2XOKD 3NVAA 4DUGA 1B0UA 4KSBA 3VQTA 1N3BA 1W49A 2B6HA 2EFCB 3ZS8A 2RH5A 2WIBA 1GKUB 3LLUA 4JBXA 4OK6A 3K0SA 1NF3A 3GJ7A 5BYKA 3RC8A 3T1TA 2NIPA 3TLXA 3H0KA 1WE2A 1NSFA 2OESA 2HXYA 1XCMA 1DO0A 4IDPA 4BFUA 4C3ZA 3GLFE 1XPOA 3K8YA 1E9BA 4FMBB 2AKAB 4QBHA 4QBIA 2B92A 1NJFA 4GP7A 5SZHB 3W3ZB 4TN1A 3K9LA 3P1JA 4XD7A 3UKDA 2HJVA 4RZXA 3BK7A 1E9RA 4RKFA 4AYWA 2FFBA 2ODBA 2X77A 1E0KA 4N0EA 2GCPA 2W2VA 3TQFA 1G64A 1DE0A 2NO1A 3DOFA 3MAAC 3TMKA 2FFHA 3DVLA 3KXIA 3KJIA 3SBEA 2DB3A 3W5IA 4B6EA 3NH6A 2D7DA 4DT1B 1W47A 2HUPA 4ARZA 1GZSA 1CRPA 3DZDA 4UNQA 1IXSB 2ZYVX 3QXSA 1Q20A 1CR0A 4M8NE 3SR0A 2FF7A 1ZP6A 3ASYA 2IUSA 3BBPA 1G4AE 2Z83A 4WZ6A 3KB1A 3LV8A 2ZJ5A 4DVGA 4C2UA 5FTKA 3I32A 2CJWA 4EPYA 2QP4A 2AHOA 2ZUDA 1QHXA 4OI2A 4IDNA 2ATXA 2AR7A 2RGGA 4B3GA 1OXUA 2IL1A 2XOKA 3B1VA 4Q02A 1E94E 1SXJD 3NBYC 4D82A 4X8HA 5LPNA 4P0TA 1H65A 2IBMA 2JAQA 3GFPA 4DLVA 4M9ZA 1D2NA 2ZE6A 1XPRA 1U9IC 2FFAA 4PPGA 3RAPR 3TBKA 3DKVA 5JHHB 2VA8A 1GWNA 5SZIA 4EFMA 1FP7A 5M04A 4Q19A 3DHWC 4WOPA 3QVUA 3C41J 1ZM9A 2HYIC 3UWKA 2FJUA 3TAHA 1AQUA 2QAJA 2ZSDA 1SKYB 2CNWD 4TMKA 2QP3A 1G3RA 3AGQA 1CRQA 1SXJC 2P3SA 5B58C 1NN0A 2NPIA 1M7HA 1Z2CA 5L3VA 1CXZA 2HLDD 4B2PA 4D6PA 4KJZA 5FPKA 2FV8A 3A8TA 3K9HA 4LYHA 2QTFA 3QBTA 2QQ0A 2QRNA 1CJTC 4L9SA 4O2RA 2FSGA 4PR0A 2CL0X 1S2MA 4B3BA 2ZJAA 2WWFA 1NVWQ 2FGJA 1DELA 3WYFA 1YU9A 4Q47A 4M9SA 3U3OA 5IF9A 1BYIA 1DO2A 1XD8A 2V6IA 3Q7PA 4RCYA 2VH5R 4EPVA 2RGXA 4HB0A 4MH0R 4W5WA 5F9HA 4TL6A 3KX2A 2FPLA 1X86B 2HV8A 4RZ3A 2WWXA 5BXQC 1IY2A 1E2IA 4AKIA 4MGYR 3WXMA 4NCIA 1II0A 1EFTA 5DNYB 3CONA 3B5JA 1KI6A 3CW2A 1JR6A 3AF2A 1EWRA 4EQ6B 2QT1A 3IO3A 3KJEA 3DL0A 3Q5EA 4EJSB 4X8OA 4HLCA 1KI4A 4KSCA 5J4HA 5G41A 1LF0A 1J8MF 2RGNC 3IIKA 1OH6A 4LJ8A 2OBMA 4A82A 3RRZA 1UFQA 1XCGB 1VYUA 2CNWA 5F9FA 4EPXA 3CF0A 2FGKA 3CRVA 4M1WA 2DWPA 2DPXA 3VHLB 5SZJA 5KTYA 3C5CA 4GZMA 4RD6A 2F9MA 3IHLA 3B82A 4Q21A 5EUQB 2ZRIA 3AVUA 2HLDA 4A0GA 1XD2A 2GESA 1KAGA 4JKYA 5CM8B 4Q00A 3C8UA 2ZI7A 1OF1A 3WNCA 1B23P 5EE0A 1E0SA 3QE0A 1HEIA 5LB4A 3K9GA 1ZU4A 4DCNA 3D8BA 3SFVA 4G5RA 2C2HA 2GJAA 2ZREA 3RC3A 1P2VA 2H57A 1GL7A 2KI5A 3W9YA 1W36D 4KO8A 1FQKA 4DLRA 1OH7A 4GOKA 4NYMR 2ANBA 2P6NA 2RMKA 2XNSA 2R6FA 2ASEA 4UNNA 2CCJA 2QNRA 2DWQA 3BORA 2WIAA 3OF5A 3T06B 4A6PA 4KV9A 3K0AB 4URVR 1NG9A 3ADDA 4Z51A 4NCHA 2WM9B 1OH8A 3HYTA 4BLRA 1YZNA 4JLPA 721PA 2BIFA 1Y3AA 2QPTA 2ZANA 4L4UA 4QKQA 3AUXA 1J70A 2OBLA 1LY1A 3TE6A 3K09A 2QA5A 5DIFA 1R10A 4UXJA 1G3MA 2TMKA 3GLGB 3S1AB 1DBSA 3WMFA 3B1WA 2AWOA 1C9KA 3Q3JB 2CHVA 4NDZA 4POAA 2ZAOA 4KXFB 4XTCS 4Q4JB 2ZSAA 2J45A 5JWHA 1Q22A 3B2EA 2JASA 3TR0A 3B13B 3SEAA 2QMEA 1OW3B 3IBGA 3OIYA 4BFTA 1Z28A 4PC7A 1G19A 1T3HA 2QGZA 2V1XA 3PUYA 3W5JA 4MRRA 1E9AA 1N6PA 1P6XA 2ZSFA 3EWSA 4PC6A 4R2HA 5TVKA 3FDIA 2O8DB 4EFLA 1YHNA 4IHQA 1U98A 3SJAA 1UEIA 1F2UB 1NI3A 1VCNA 3CWZA 3NKVA 4MYCA 3ZGXA 1CF4A 4LCBA 3KQLA 3THWB 4V0MA 1NLZA 3BS4A 5H68A 1L4UA 2H1LA 2WV9A 1OKKD 1QHHA 1E4VA 2Q21A 2WZQA 3WP0A 1NVUQ 5AJVB 4RZ2A 1KJYA 5DI9A 1RRGA 1JPJA 3Q7QA 1GNRA 1XZQA 3WRXC 4DLTA 1ZNYA 2CE2X 1G1MA 1TF7A 1MRSA 4PC3A 4FMDB 3HU3A 4RZUA 1R6BX 2WJJA 5TXGA 1J8YF 4JLNA 3EX7C 3U7FB 2IS6A 1EWQA 4P4SA 1AM4D 1UF9A 2OBNA 2XTMA 3AH8A 4DSOA 4DCTA 1G8HA 1OFUX 4B3FX 1F3OA 1KSJA 2JIZA 3WMGA 1NKTA 2R65A 3X1XA 1KK2A 1CP2A 1KMQA 3N70A 3WNBA 2R6GA 2QM8A 2QE7A 1N6NA 1WQ1R 2DHRA 1G41A 5J4VA 1K5DA 4DLUA 1DAEA 1ZIPA 2G1KA 2QSZA 4CEJB 4GI7A 4FMDF 2P6RA 1GP2A 3SYKA 1GRNA 4AKEA 4LK2A 1A7JA 4LBYA 1ZU5A 1YKSA 2BBSA 2GF9A 3VR5A 3I73A 1XEWY 1IJEA 1DPFA 3CNLA 1D8TA 3GEIA 5BWMA 1PLLA 4PAMA 4X8LA 4M1KA 1KMHB 2HF9A 1D5CA 1ZJ6A 2GDJA 3HPRA 1J90A 4BASA 1FZQA 1G5RA 1GSIA 2VO1A 2XX3A 3OIVA 5DYIA 3U60B 1S1CA 3QF4A 4CRWB 3NC1C 2HEIA 3MRSA 1OKKA 2CMKA 3QNUA 4KVGA 3LBNA 3RWMB 3CR7A 3EZ6A 3GLFA 2D3WA 1E3MA 5AJWA 4TYQA 4PX9A 2NO6A 3AVPA 4FXPA 4GRAA 5CYPA 2OFOA 5KPDA 3HP1A 4M2LA 2RB4A 2GEUA 3ZIAD 3QJYA 1IOZA 3QKSA 1HH4A 2QPOA 4LJ9A 1BKDR 3B9QA 1KIMA 4ESHA 4FI3C 3KUDA 4UNRA 2EWWA 4DB2A 4HB2A 4TYYA 4QGAA 1VCIA 1NKSA 4PSKA 4HUTA 2GZHA 1RW4A 2ZJYA 3LX8A 2B7CA 5AJXA 1E2JA 3GQBA 1E99A 2CHQA 2ZRNA 1XNJA 5FBWB 5FBQB 4W9MC 3TK1A 4PPQA 3ADBA 4C0SA 3LW7A 4Q4AB 5GVRA 4RD4A 3SJBA 1SVIA 4P33A 2YOHA 1G8YA 4I99A 4MRNA 2FZLA 2O8EB 4Q1EA 2FEMA 2F1HA 3GJ8A 1EX7A 3AP2A 3CZPA 4MRSA 4LJYA 1T5LA 3MWJA 3RS2A 2ZI5A 4MKIA 3ICQB 1Q21A 3DEFA 1JI0A 1Q3TA 2G77B 2QEQA 3VTKA 3F5FA 1YR8A 4CEHA 4BZPA 2E87A 3M0EA 1KNQA 1NVVR 4TTPA 1U2RA 3OFND 5DGXA 3IPXA 4OL0A 1W4AA 5HZHA 1BYUA 4ZI3A 1RRPA 1S3GA 3RRNA 3R9IA 5FUWA 5IHPA 1YRBA 2GKSA 3NBXX 3QKRB 3LQRA 3DOEA 4B74A 1Z6GA 2DYKA 4M22A 4ZDWA 3ZIAA 1WB9A 5J40A 4PSAA 1UDWA 1SULA 4A8JB 1Z83A 2VP9A 2GK7A 3TJZA 3ZD7A 1NBME 5JRJA 4CVNA 4DZZA 3SOPA 1XJ0A 1FUUA 1AKEA 4C30A 4ZI2A 5DO9A 3K70D 1C4OA 3QVVA 4IKEA 1S1MA 1ZMXA 2O0KA 2C77A 3PVSA 4F7WA 2IXFA 3SQXA 2OZEA 1KI7A 2X19A 5JJKA 1CS4C 2FSHA 2P67A 1JNYA 2ANCA 4PQYA 4FN5A 2BOVA 5JLJA 2C9CA 4QC2A 5JEEA 4LGMA 2DFLA 4LDJA 2AK3A 4QGGA 4EAQA 3CF2A 4TMTA 2YC2C 1FPMA 1BIFA 1YVDA 3SHWA 4C0BA 4OHYA 1MV5A 2IEYA 4TLEA 2NTYC 3VNUA 4OJKA 4PO1A 1SGWA 1CBUA 5FI0B 5KDOA 1PLKA 2GCNA 1QHIA 3UG7A 2BMJA 1W44A 4RKEA 3FHOA 3OFNA 1KO1A 4A0FA 4D4KA 2ZJOA 1MOZA 3EA0A 5D3MA 3ZZUA 4EIWA 2REBA 2VF7A 4TSFD 5JCPA 2ZRDA 5DHFA 4GT1A 1JR3E 1KYIA 1RC8A 2RCNA 4C0KA 1JXOA 2FH5B 3QXXA 4A8JC 2V54A 4A0HA 5K8IA 1CJMA 2I1QA 4ZDKA 2E1RA 5KSZA 3QSYA 2PT5A 2Z6VA 3AF3A 1ZIOA 4U02A 1G291 1KJZA 3L43A 3PITA 4IFEA 1G8FA 1NY6A 3FTQA 1XTIA 1OT3A 3GLHE 4OHWA 1HT1E 4PZZA 1LF5A 2ZR9A 3RS0A 1W4CA 1J99A 1JAIA 2PMDA 1ANKA 3FMIA 3A4MA 3FMOB 3OZXA 4P3YA 2MSEB 4R9UC 4B47A 5A4JA 1H8EA 1O87A 2OUKA 1EXMA 4TMWA 3H4MA 3AVTA 2W2TA 2EW1A 3K9NA 2EVWX 1S8FA 2QROA 2QTHA 1QG4A 1T3SA 4AIIA 3ZYCA 2VRWA 1E2HA 5J47A 2Z4RA 3MSXA 3EASA 4TL8A 2C03A 2PZFA 3T35A 1YJ5A 1W4BA 4R98A 3MWKA 3GMTA 1SVSA 1G7CA 3BC1A 4HAZA 2ZI9A 3ECCA 3SQWA 4B3CA 5CDFE 4QJ5A 4WZBE 1TQDA 1ZD1A 4H1UA 1F48A 4BRWA 4L9WA 2AD5A 3SYNA 2ORWA 2A5FA 1ZC4A 1G7RA 4GOJA 4DBLC 2NO0A 3LXRA 2JLSA 4EPWA 1U0LA 4TQ9A 2Q6TA 3L82B 5EZ5A 1P2SA 2EQBA 5AUNB 2B7BA 3V4FA 3IKJA 1NVXQ 1US8A 2D2EA 3SFZA 3RSOA 4NCJA 4DWJA 1BS1A 5FBVB 3ZVMA 3KQKA 3GLIA 1ODFA 4H1VA 4LRWA 3CPHA 3SJZA 4HLDA 1XF9A 3BGWA 4MDEA 3TQCA 3UMSA 1JECA 2IXEA 2OXRA 1TX4B 1T5IA 2O8BA 1KY3A 4EKDA 4ZDIA 2OAP1 1SKYE 3KXLA 3L8ZA 1E69A 5JECA 4V0ME 1OXXK 2P6UA 1VHLA 4OQXA 1OYWA 4U5XA 5LB2A 4AURA 4E07A 5CK4A 3R8FA 3C16C 4HAXA 2ZQ5A 4OJQA 1GM5A 3I3SR 4KYIB 3ZVLA 4PHFA 2LWIA 4Q66C 3F8TA 3PEYA 3I5YA 2GBLA 1E2QA 1N6RA 5FOSA 2J0VA 4IDHA 4MYUA 1HQCA 3QXHA 5J5CA 2E9SA 2B8WA 1ZBDA 3CF6R 5KYKA 1DS6A 1T8UA 3A6PC 1Z6AA 1M8PA 5J4KA 4W5HA 2CE7A 4DDWA 2FDCA 2BKEA 3BWDD 3AUYA 2ZAMA 4FMCB 1XBTA 2QSYA 2HDNB 2ODWA 4Y0VA 3V4RA 3U4QA 3THOA 3TNFA 2DFNA 4HUQB 3NIBA 1FX0B 5FPHA 4ARZB 4O3MA 3PR1A 3TAUA 4RCZA 2OXCA 1QDEA 4UXIA 3MD0A 2BCJQ 3E70C 4LYJA 2C78A 2WPDD 1AZTA 1D9ZA 4CEIB 2IF2A 1T91A 2O5VA 2VIIA 1FMJA 1GNPA 1OV4A 1SVWA 2PLRA 3QIAA 4YONB 5G3YA 1N0VC 2GCOB 2GHIA 2DY1A 2QP9X 1W1WA 2VHCA 5C4GB 2DWOA 2CCGA 2FE4A 2GXUA 2RKOA 3FMPB 3CNOA 1G3QA 3IIJA 2QUZA 1N6OA 4FMCF 3KFXA 3TIFA 5DN6D 3EPLA 4JS0A 4LHWA 4QHSA 1HURA 5FPSA 3TVTA 4D0GA 3IILA 1FW6A 4N3NA 4D80A 4GDFA 1NSTA 3NH9A 3O8DA 4Q1DA 1DAIA 2IA5A 1XX6A 4NYJQ 1E2PA 5DI3A 3M6AA 3QG1A 4A36A 4Q9KA 2JLQA 1VIYA 2IYTA 2GWHA 1AIPA 4KLZA 2OILA 3GD7A 2HT1A 1RZ3A 1JJ7A 2AXNA 3CKLA 1ETUA 1P5ZB 2DBYA 4GPTA 4BFZA 4TLAA 2WJVA 5C4MA 2EFEB 1AGPA 1HE1C 1N25A 3G5UA 3LH5A 3VR6A 3A4NA 3C4JA 3CUEF 1E2FA 1QRAA 4I1VA 2ZITA 1NBMD 4JVMA 3K0FB 4A4DA 3ZVNA 2J0UA 3RNLA 3FHTA 1GNQA 1II8A 4FWIB 5F98A 1T3LA 3NHAA 1EGAA 4KLNA 3U3KA 1II9A 2ZEJA 2WPDA 2ZSBA 3UWOA 1VMAA 2W0SA 4C7OA 4C0QC 1JBKA 3SHFA 1IM2A 1UKEA 4FCVA 5B30A 5HR5A 2C8VA 2OLJA 4LHZA 3I72A 3T5DA 1ZNXA 2NO7A 5EJEA 1V5WA 4I1OA 3GLGE 2C96A 2OO7A 4S35A 5TY0A 4L5BA 5DN6A 3NWJA 2W0MA 2W6JD 4DCVA 2F1RA 4NCKA 5L3SB 4DB4A 1SXJB 1KI2A 3H1TA 4IXNA 2GRJA 2PZEA 1UBGA 2XAUA 3EZ7A 1KSFX 4GL2A 1XEXA 1IQPA 5KPJA 4V0OA 1DAKA 1ZAKA 4NP6A 2FWRA 3HWSA 2O8FB 1KI6B 4RSGA 2OAQ1 4RD1A 5TARA 4DSUA 2JJ1D 2C9OA 3BJIC 5IT5A 2YJTD 1YZKA 1WDTA 1N5IA 2VBCA 3QBVA 1OIXA 2GZAA 4NYIR 2IYRA 3T34A 1KKMA 1JR3D 3C15C 2OSBA 3RYTC 3AVVA 4ZPXA 1RRCA 1UJ2A 2ZJ2A 3OIUA 3TSZA 2OG2A 3U7EB 2VHTA 4I1SA 5AUOB 1DAGA 1E2GA 2Q0HA 1S3SA 3SC3A 1WCV1 1NBMA 2J46A 4YMWA 1ZNWA 2JCSA 3KB2A 3PUXA 3L8YA 4XVQA 4BPBA 1N5LA 1P61B 4A1FA 3LLMA 2QENA 3I5XA 1XD2B 4MYHA 2P5SA 2ZE8A 4DLSA 1HUQA 3ZH9B 3CR8A 4LI0A 1SZPA 4D0NA 3AM1A 1E32A 4NYMQ 3A1TA 2WWIA 3BFXA 4ZCIA 4A9AA 4DRZA 1A1VA 2G0NA 2RGDA 2HXSA 4L8GA 4PHHA 3TUJC 2V55B 3F3YA 4NYJR 4TYNA 2BCGY 3R7WB 2W6JA 2YWGA 4LYFA 3ZDQA 5H70A 3W6OA 4M21A 2C95A 5GJBA 2ZU0C 3A1VA 4A0RA 4ERNA 3VR1A 3ZZ0A 4HEJA 5JJLA 5FOWA 1X1RA 3LW8A 1Q3HA 5FBRB 3VFDA 3FWYA 4RFSB 3FKQA 1UBEA 2AX4A 4MGKR 4LJ5A 2BEKA 3DM5A 1KDRA 1UAAA 1TNDA 4US1R 5A5GA 2JJ1A 3VNVA 4OKSA 2XXAB 3OHMA 2ZRMA 3HDTA 2C04A 1JR3A 3A58B 1VCOA 3BRWD 3VR4A 4E22A 3LD9A 3QF7A 3FHCB 5GJCA 2YYZA 4XWOA 3U5ZB 3O8CA 1KK1A 2BJWA 4MRPA 2WOJA 1ZUIA 4EDHA 2FN4A 2BVNA 4BE7B 4Q1AA 1SVOA 4AWXA 1G20E 2Q3FA 1XTSA 1M34E 1YZTA 2R44A 5KSYA 2QPAA 1ZC3A 3U3MA 4EPTA 3LFUA 4S2EA 1DAMA 3MWYW 3GLHA 4UXHA 1GG2A 4YQFA 2IYVA 3K0CA 3AVQA 3PQCA 2F9LA 5CJPA 2JJ2D 3GFOA 2IXGA 4OBEA 5EP3A 1XMSA 3WBKA 3R8CA 4KITB 1KGDA 2ZJZA 5SZKB 1Q44A 4TTQA 3LX5A 4DT1A 2XNDD 2GNOA 5HTKA 1ZM2A 2QAGA 1N5JA 1CJKC 1YZUA 2V8OA 4ZKDA 4OI4A 4YDHB 1GKYA 2XZOA 3DM9B 3FMFA 2GXAA 1WMSA 1E2NA 4V0NA 2QBYA 4BGDA 1Y63A 4LC0A 1W36B 2QG6A 1S0UA 1QHHB 1UM8A 4C9BA 3QPWA 4B44A 1CIPA 2GA8A 5KU1A 3QI2A 2WJGA 3IBYA 1DEKA 5CDFA 2EYUA 2WHXA 3TW4A 2IS1A 4D26A 1AZSC 3NG1A 1NJGA 1P9NA 2AN9A 5CLLA 1Z6TA 2BKUA 4YXWA 4P32A 5KOYA 5LD2B 4BEJA 2RGCA 1NN3A 4MUAA 4LHVA 4P4SB 2R8RA 2A2ZA 3QEOA 3CZQA 3JVUA 3K09C 2NG1A 2XB4A 2ZR7A 3EARA 4HAVA 5JSZB 1P9WA 3V00A 2PL3A 4FCWA 3VX4A 2RHDA 4XSHA 1Z06A 4HLUA 3AVWA 4OHVA 5CIQA 2VL7A 1EFCA 2F6RA 4Z8YA 4B3XA 3GP8A 2ZRCA 5H1YA 2IT1A 4JLJA 1MO5A 1VG8A 1U8ZA 3P20A 2IF0A 3UK6A 2RHMA 3UPUA 2JJ2A 2BEJA 2LCFA 3EC2A 1Z47A 2ZVPX 2J59A 2V9PA 1FTSA 2XNDA 1G9XA 2JIZD 3KTAB 2QMHA 4DDTA 2GEVA 3VHXA 1R5NA 4QRHA 3DMDA 4C0AC 4XJXA 2QE7D 3GJ3A 3MLEA 2G9NA 2GAAA 3KKOA 3CIOA 3OEHD 4IEIA 3EC1A 5CJ2A 2F55A 1W36C 1KJWA 2GK6A 1Q12A 3FVQA 5D3QA 5EP1A 4TMZA 3W90A 1KDPA 5AK0A 3PUVA 3R20A 1JXMA 4MRVA 4TQUS 1OJLA 2BDTA 4M1MA 2A5DA 2HCJB 3W6PA 4Q5IA 5LD2C 4RD0A 1K6MA 1KHTA 1IXRC 3PJRA 4D4LA 2ZI3A 2Y8EA 3THXB 2CL7X 1G5PA 3TSWA 4QM6A 1E4YA 4LV5B 1OHHD 1Z6XA 2OV2A 4OI1A 2WAXA 1G6HA 3NTUA 3GEEA 4EQ6A 4JLKA 2IK8A 4K46A 3EIEA 1ZD8A 3W8RA 3EZ9A 4EJSA 3SN6A 2ZYWX 5GVSA 3TVDA 4MKGA 1LVGA 4O2LA 5EXXA 4DSNA 5JWOA 4TZ0A 1W0KA 5CIWA 2ONJA 4RFVA 4WXPA 421PA 2ZXUA 4CT5A 1V43A 4ON9A 3NBZC 4Z54A 1NVVQ 4TLBA 3CRRA 5FPYA 3IHWA 4LV8B 3EXAA 4TWZA 1SKQA 1QF9A 2ZYUX 5GADl 1L8QA 3ETLA 2QT0A 4CW7A 2NGRA 1PUJA 3OEHA 2OE2A 2YKGA 2K5UA 2WMNB 4TL7A 4Q7JB 3G0HA 3X1ZA 5KSOA 2XITA 4Q9IA 2YWFA 4B76A 1UEJA 3IDQA 1N6IA 2ZRKA 2R2AA 1VDZA 4PFSA 1HY3A 4LWZA 1TUEA 3VKWA 4QL3A 2BJVA 4ITRC 4OQFA 4BUJA 3RRMA 5AUQA 1EFRA 3T1VA 1BMFD 1I2MA 3V9PA 5GJWC 2B8TA 1YR9A 2F43B 4G5OA 1AA9A 2FZ4A 1Z0IA 1VHTA 2IYUA 1XTKA 2J3EA 3NEJA 4IOJA 1KI8A 1NN5A 4QHTA 3CH4B 1FL9A 1OHHA 3IUYA 5HE8A 2ZRPA 2ORVA 3EPHA 5KO2A 1MABB 3K0AA 4AC9A 1XEWX 3LDAA 4EFNA 2ZRFA 1XJQA 3P27A 5JS8A 1MO4A 1ZW6A 5FTNA 4OQNA 1NLYA 1EFUA 2QU8A 1MRNA 1ZCAA 3I4LA 2OFXA 1A2BA 4JVNA 3GLGA 1CEEA 3S1AA 3VU9B 3B78A 4F4JA 4KU4A 3AF4A 3EA5A 4FD2A 3AB3A 3IIMA 1RKBA 4B35A 3WNDA 1OE0A 4BLPA 4LBVA 2DR3A 4W5JA 4LBZA 4QOSA 4A6XA 1OXSC 1XU4A 3HU1A 4NTZA 3JVVA 1DVRA 4C0JA 3SDZA 1VG0B 3M1IA 2ZJ8A 4HB4A 1W7AA 4QGFA 5HKKD 3RABA 2PCLA 4HDQB 1XTRA 2O8DA 5FR2A 1E96A 1TAGA 3W6NA 2CLDX 4JLAA 4KFSA 2VP4A 4Q9JA 2DFKB 1F2UA 3K53A 4MDFA 1BMFA 4QGHA 4F4CA 3IO5A 3THWA 3RWOA 2GXQA 3GJXC 5FTJA 4PQFA 4BFWA 3TUZC 1O3YA 4M53A 2IYLD 2XSZD 3IQXA 1QVAA 4AG5A 2QTVB 1Z0AA 2GJSA 4JT2A 3K70B 1XDBA 4US2R 1U8AA 1GDDA 1E9SA 4XIGS 5EE1A 2ERYA 3WBJA 3X1WA 2QL6A 3WYGA 4JYCA 2QMOA 4OHZA 3MJRA 4IXMA 1GAJA 1FTNA 2IUUA 1L7VC 3BIFA 1G8PA 1W48A 1TL7C 2OCAA 3LQQA 3QY0A 1X3SA 4GNKA 4CEJA 5E7IA 3GJ6A 2CXXA 1ESNA 2BMFA 1XCPA 2WJYA 4LOAA 4URXR 4LBWA 2WTUA 4KODA 2BBWA 3QUSA 4KHZA 1KDTA 1P75A 5LBIA 5HKKA 5KDLA 3T12A 4B71A 3EPKA 1H8ED 4DSTA 1W5TA 4LJAA 1KMHA 1XTJA 3QQ5A 5BN3A 5E7MA 1ONBA 4DLWA 1X8LA 2ZI6A 2WWHA 3ASZA 3LXXA 4L16A 3SJCA 4Q4LA 2JLUA 1OFTA 1E2EA 1K8RA 1KOFA 3ADCA 4B3DA 1IAQA 1TUIA 3D3QA 4C2TA 1US8B 1W4RA 5HZKA 1N6KA 2G6BA 1XXHB 2XSZA 3DKPA 2Z4SA 3GLIB 2C9YA 1LS6A 2J7KA 4ZKEA 3K70C 2WMOB 4ZIRB 3WMEA 4CDGA 1L2TA 1UDXA 2R9VA 1NRJB 2NZJA 3PG5A 3KUCA 3B1ZA 4Q48A 1JQJC 4F38A 1TTTA 3SU8A 2NO9A 2FG5A 3IEUA 4PSVA 5EXSA 4I4LA 5L3QB 3KKNA 5DYGA 2RAPA 1KK0A 2D2FA 1KO5A 1IN4A 1ZVQA 4TYPA 2CHGA 4DIDA 1C1YA 5EE5B 2VQSA 2OM2A 3MFYA 3UATA 2KBEA 1ZRHA 5FPTA 2J7PD 1XFAA 3QPVA 3H2YA 2ZROA 4ZCLA 3T1QA 4RVCA 3TRFA 1GL9B 2A5YB 3MCAA 521PA 1F2TA 2WVJA 3A1UA 4HAWA 2HCBA 2R6AA 1CJVC 2ODNA 4JLOA 4UJ5A 2PLFA 5L3RA 3DDCA 1CR1A 1HV8A 1WXQA 4Q4AA 2AFHE 3ICEA 4WXRA 1CR4A 5FI1B 1RYHA 2EWVA 1G8GA 1SXJE 3UMRA 4OI0A 1GIAA 4MA4A 1TMKA 3RS5A 3U7GA 3P4XA 1KY2A 3BB4A 3KKMA 3T61A 3R9WA 1N6LA 3BH6A 2QORA 1WRBA 5C2JB 4AY2A 1XB2A 5FL7A 5FBLB 2G3YA 5E7JA 5B64A 4DLYA 3REFA 1YZGA 3EZFA 1NMXA 4M1SA 2IC5A 4BZQA 3KJGA 4GP6A 2JDID 4P4TA 1OPXA 2DCUA 4HZUA 4XWKA 1CR2A 2REOA 2N46A 1AQYA 4IVRA 4JZKA 5JHGB 3QKRA 5CITA 2WICA 2C99A 2JLXA 2ATVA 1BH2A 3AV0B 3B8HA 3R9XA 4ASUD 1JALA 4AK9A 4YLGA 4KFRA 2J7PA 3BOSA 3WP1B 1U8YA 4I1UA 4YMTA 5FUXA 2ZRHA 3GCGA 4RY2A 2ZIAA 3LNCA 3PFIA 4PQRA 1L4YA 4Q4HB 4KAXA 2H8KA 4GFDA 1E0JA 3G82C 3X1YA 2J0QA 821PA 1NY5A 4G1UC 4U00A 2WKRA 2WOOA 3PCRB 1AS0A 1M1YE 4A92A 1I2DA 2GBLC 3KXKA 4IOKA 4PHGA 4WAUA 1U94A 4BWYA 1RIFA 4A2QA 2O8CA 5AJZA 3UIEA 1BOFA 1E2KA 3B7GA 5C46F 4Z1MD 2ZYTX 3ZJYA 3KFVA 4MKHA 2ZU6A 2H5EA 5FUVA 1E2MA 1DG1G 1R7RA 1S96A 3EWAA 1GITA 1NIJA 3AGPA 2NOAA 4HAYA 4V0KA 2GZDA 2ZVQX 2AD1A 3OAAD 3SBDA 3I8SA 4G3XA 4HAUA 2OHFA 4DKXA 3PUZA 1W46A 1S9DA 1G18A 1II8B 4YMVA 2I1VB 1VCMA 5FTLA 2JDIA 2H92A 3TGPA 4C7OB 2GETA 4JT4A 4D81A 2A7QA 1PUIA 4XSGA 1FNNA 5CM9C 1M6NA 1YRAA 4AYTA 3K1JA 3BAFA 3A37A 1T4GA 4ASUA 3Q72A 4QBGB 5BN4A 4JL6A 5BW8A 2I4IA 4WA7A 2YOGA 3CPJB 3WHLA 4NBSA 5EQTA 4NYIQ 3T5GA 3P4YA 2JJ8A 2HJGA 4JBYA 3UG6A 5KHOC 2ZRLA 4RD2A 2QM7A 4B32A 2ZRGA 1E6CA 1K5GA 1DADA 3TKLA 3X1DA 1VKJA 3KQNA 1MKYA 3OEED 3EW9A 3QEJA 3NDBB 2D7CA 2CJWB 1E2LA 4DEYA 4HB3A 4LJ6A 3VR3A 1MT0A 4Z1MA 5AR1A 3CNNA 1OIVA 1KI3A 5UKDA 2Q9AA 4ILEA 3SYLA 1W2GA 1SVKA 1X8JA 3OAAA 2MSDB 1OSNA 2WKQA 1E1QD 4FIDA 3REGA 3RVBA 3EIQA 1P2TA 3Q8XB 1N0WA 2PBRA 3B1XA 5JJIA 2RGBA 4C0LA 1JEDA 2V7QD 1QVRA 4LYAA 2ZRBA 1E79D 3TW8B 1Z3IX 3CX6A 3MJHA 1VG9B 2PZGA 4D4JA 1Q1ZA 2ZTSA 3KZ1E 3NXSA 3CX8A 1NMYA 4R71A 4LY6A 2VP0A 4ZCMA 4BEBA 5IDVA 5EP4A 4LJ7A 2Z43A 4JSTA 3CO5A 3P32A 4PC1A 4IW3B 2ZRJA 3CWQA 621PA 1T8TA 1M2OB 2FPKA 3D31A 4FINA 4IVQA 1SVLA 3GJ0A 5JWRA 3I62A 2A5GA 5HCNA 4FCTA 2G88A 4G5SA 4NE2A 4OK5A 4PZLA 4TQAA 2WWWA 3RS3A 2YC4C 4HATA 1RJ9A 2W2XA 1OYYA 3OEEA 2VHQA 2ZR0A 3QOFA 5CLQA 2G0TA 5EE9A 2GJ9A 1RRFA 3A4LA 8OHMA 4JJZA 1PLJA 3PEVA 2ZS8A 5HE9A 2LKCA 1P4SA 5EUMA 2N42A 3CRQA 1KSHA 3EZ2A 3THYA 2VHJA 1ZUHA 1R0XA 2WSMA 1E1QA 4ABYA 1P9RA 4JL5A 5C18A 4F92B 4LPKA 4EUNA 1TQ2A 1G4UR 2AK2A 4PO9A 1HYQA 2WJHA 5J4YA 2V7QA 4NPHA 1OB5A 3GLHB 2AKYA 3KQHA 1E79A 1ZUNB 4DDUA 2IX3A 2YZ2A 4PXAA 2G83A 4C4PA 3VX3A 1CLUA 4HLQB 5H8WA 1WBDA 2A78A 4HUQA 3ZD6A 1FX0A 1G7SA 2QAGB 3EAQA 4JBWA 4LPSA 2IUTA 1NP6A 3PUWA 1VYTA 2FNAA 3AF0A 2OCBA 1JAHA 4B73A 2WKPA 1X6VA 5JS7A 2QBYB 3FB4A 4CEIA 2YOFA 4D25A 2GCOA 1H8HD 3FFAA 5FOTA 3VKGA 5FUYA 4X8MA 1Q1BA 4N1AA 3FPAA 4E03A 4PO8A 3QXCA 3CBQA 2FFQA 2YWEA 3DO6A 3KKQA 2FMXA 2PX0A 3ND9A 4G01B 4BLQA 2MMGA 1ZM4A 3PEUA 1OXVA 5TDHA 1ZD9A 2PMKA 1IN5A 1AK2A 1UBFA 1NL3A 2IYZA 2P65A 6Q21A 4URUR 4B33A 1LNZA 1DG3A 2VF8A 4NL4H 3Q5DA 4HDCA 5EZ6B 4IJMA 2NZ8A 4OYHA 4EPRA 1XTQA 4JKIA 3SNHA 3QKTA 2XJ9A 1AKYA 1Q57A 2BM1A 4HI0E 4TZ6A 1XMIA 5JZVA 5C1BA 1OB2A 4XTRA 3FE2A 4OQLA 3KDSE 1U90A 2VP5A 2BWJA 2W00A 3E2IA 3H86A 3PXGA 4YXWD 4F4IA 3K0CC 4JL8A 4GZLA 1YE8A 3CB4A 1IBRA 1P62B 2V3CC 3N2IA 3U44A 2IHYA 1KKLA 1Z2AA 3K0FA 1E2DA 1G7TA 2QAGC 1Z0DA 5K8TA 1U9IA 4RJLA 2FOLA 2X8AA 1D6JA 1X8KA 4DJTA 2XGJA 4NMMA 1TF2A 4IVPA 4PC2A 1EG7A 2OCYC 2A3RA 3HR8A 4QHYA 1OIWA 2IYWA 4ACAA 1P3JA 1PV4A 4KFTA 1OFIA 4QXAA 1CU1A 1YR6A 4QFMA 1H8HA 5KNCA 1IONA 3VR2A 1GILA 1KSGA 2IS4A 4C0HA 1FUKA 1JJVA 2QZ4A 2H16A 5CYOA 3AKEA 2RGAA 3GFTA 1AGRA 1TQ4A 4CYMA 1OXTA 2P0EA 5L3SA 5E3HA 4PPFA 1GTVA 4UNSA 1N0UA 1SXJA 2VSFA 1G16A 3W3AA 3X2SA 4H9GA 2UKDA 1TEVA 3B60A 2ODEA 4YMSA 1HT2E 2O8FA 1T9HA 5DH9A 3TSOA 2J9RA 3MWLA 4Q7KA 1HTWA 4GMXA 4HLUC 2QI9C 3M4YA 1VG1A 1XRJA 2F3RA 3CLVA
chains in the Genus database with same CATH superfamily
2IH4A 4QJ3A 3FVVA 2GQ0A 3RWBA 1EK2A 5FOUA 4IEFB 3VDRA 1NHGA 4F3RA 1R4AA 2OZPA 2A5JA 3GEHA 4D9BA 4BJ3A 2PXXA 4YJFA 2JHFA 3VZQA 1ZHOA 3ACCA 1RPAA 3VI4B 3QE2A 4ETWA 2C57A 1PIWA 4GYKA 5B2ZA 1CVIA 3IEVA 3AF1A 3HA5A 1Z63A 3B85A 3KQUA 2ZYDA 3D8HA 3IKTA 1WP4A 3S2IA 6LDHA 3F98A 4G9EA 4WERA 1W88B 1IY0A 2VT2A 4YPVA 3NDIA 4F71A 3UZUA 1U9CA 4IIFA 4KN8A 3SZ3A 4FHZA 3OQBA 5DGTA 3MBOA 1JB1A 3CJQA 2VTKA 1M1YA 3I52A 3JASA 4W8GA 5E9QA 3WK6A 4R6WA 4CF4A 1DZ3A 3BQNB 4JT8A 1JG1A 4DMMA 4DTCA 2WWGA 1N78A 1TTPB 4DCSA 1PFVA 2IKSA 3I09A 3RTAA 4MIKA 3ZV5A 5IDWA 5FBZA 3DTTA 1FRFS 2XOXA 4JOCA 1NLFA 2CMDA 4I8XA 1NBAA 3KALA 3V3TA 2C5BA 1JEYB 3ROEA 3COYA 4EOGA 1E5LA 1H6CA 1QP8A 4G1CA 2PYZA 3QF4B 3RK4A 3W8NA 3A36A 3CLUD 2A1TR 3W5UA 4A2WA 3DHYA 4E33A 2BEVB 1GT6A 4BZXA 3T1YB 2H00A 3DAYA 3IOBA 3S99A 4ER3A 4UFNA 4DRXA 1XAJA 4HDOB 2BHLA 2WLSA 1YBFA 3MEQA 3OE1A 3ZE2B 4RTOA 1JSZA 1T10A 1DWPA 1TCAA 5J2TA 1RS0A 2HW8A 1WY5A 2H18A 2UZIR 1BW9B 1IBSA 2B36A 1IE3A 4W7SA 1GZ7A 3VNQA 3LVRE 3MUFA 2M6LA 2FWPA 3D4IA 1PW5A 1KAQA 2FSFA 2VNHA 4FS8A 1NJSA 1XRQA 2QTRA 3RYIB 3BMNB 3UJBA 3JYLA 3EQ9A 3KZKA 3Q3VA 4KQ6A 3STYA 1PR5A 3AHDA 1ZBQA 2F1JA 1M0SA 3TZ6A 4B17A 4R83A 2CVHA 3JD2A 5EJ9A 1N2XA 3LWZA 7REQA 1OZGA 3KOWA 4GGMX 3CBGA 3VDXA 5JAQA 5G4KA 3GGCA 1ADYA 4FBMA 2AT1A 3FCEA 3QJGA 5TMDA 2LVBA 3VPDA 1HSOA 4WCDA 1PQUA 1ZWLA 2PHZA 2Q1YA 3DEIA 4HNRA 4UTVA 3MMSA 5ALRA 1FP6A 3C1UA 3GQBB 3LY5A 3P9NA 5KX5B 5TPZD 2BPOA 4HVAA 5I7FA 2W2LA 1F60A 1J0BA 4M8KA 3L0SA 3Q2KA 2OGZA 4CIAA 1B0AA 1SKAA 2PXCA 5KWVA 4GYYA 1AF4A 1TO6A 1XR3A 3H5WA 3M6UA 2X23A 5IKOA 3PNYA 1MCZA 2PAAA 4FMPA 1KC1A 3GC6A 4YRPA 4DXDA 4ROTA 3TCKA 2WHQA 2X2FA 5SICE 3ZEAA 4NENA 5LQJA 1S4QA 1Y3BE 1KZ6A 1U0TA 1Y34E 1KVTA 2D1SA 2I7CA 3HP4A 1IN7A 2VXYA 3LP8A 4RXMA 5G2OA 1NMSA 4C88A 1L7BA 2IHBA 5A4DA 3PXBA 4QOIA 3PPWA 3E27A 4D9KA 2AA3A 3VNBA 4EHNA 1U1GA 3ZWAA 1HKHA 2ZUTA 4QJ4A 3SZLA 4AY5A 2QZ9A 3BXGA 2CSUA 5KNDA 3QX7A 1QH0A 3CCBA 5KX5F 1L4BA 1DWUA 3ND8A 1IBKB 5GPBA 3UJDA 5EJMA 3WKEA 5K2MA 5DWDA 5JSZA 2W58A 4FWTA 1TEXA 5LDDC 3R3JA 1EVJA 2C7BA 2YV5A 3O4FA 5TNXA 2G70A 3RU7A 1USWA 4DJDC 5ALXA 1LPNA 2B5VA 2J9FA 2GZ1A 3M4XA 1I14A 2X9QA 4FW8A 3U7JA 3DDSA 1ZPDA 4DY4A 1TAHA 4EW1A 2IZZA 1VFPA 1JZQA 4X1IA 2AN4A 2YJZA 2CDCA 3HFJA 3Q4GA 3JD1A 1ZM7A 2FQ1A 2JA2A 3HEMA 3K16A 1O0BA 1PG0A 2IHKA 2DFDA 3WRXA 1E1RA 1BXRA 3PIIA 3SBOA 4CTJA 4IDDA 2VEOA 4CV0A 5H59A 2HIMA 5FLKA 2R96A 3D4PA 5KSPA 4CLHA 4ZO7A 4INAA 1LQTA 1XNHA 3TW6A 4B3IA 3L0IB 1TJNA 2WFZA 3E8XA 1NQTA 4MUEA 5CB6A 1L3BA 3FOZA 2EFGA 4PS0A 2IIBA 3LT0A 1NXOA 4LHSA 5HIJA 1ELOA 4BBAA 1LVUA 2OWDA 1VE6A 4LHYA 3M4NA 5FIUA 3W1VA 4MGZR 1DHRA 1TYZA 3WJ2A 2QLMA 5E0OA 1UKZA 4KE8A 5CXUA 2HIAA 2RGRA 2XRYA 4DC9A 3A10A 3PBKA 1O95C 1PJCA 2JLZA 4E1VA 1QLJA 1GARA 3V1NA 5ALVA 4YPOA 1XELA 2ZDGA 1Q1EA 1KJIA 2C3MA 5DISB 1G20B 1X1EA 2VDMB 3QKUA 4I81A 2VZ0A 3LUAA 3OZTA 3OTOB 1AG9A 4CGZA 4ALMA 2PUTA 3CVOA 1DIAA 5BW4A 4N0MA 2IU4A 1YA6A 2B4QA 4L4YA 3ZI4A 4TLLB 3SS8A 2QD5A 3OX3A 5KTRA 1LV7A 2JFUA 4AG6A 1MF7A 2Q9BA 3SNKA 5FI3A 5C37A 5JJCA 4DV2B 1X7YA 1GQ2A 1ZONA 1F17A 1WJGA 2SNIE 5FWXA 5KYWA 1SHZA 5I45A 1FQJA 2HF8A 4P2GA 1N36B 3QLVC 1IN8A 2ATEA 2GILA 1T0UA 1UMBB 2BBOA 4X7RA 1NN1A 5FBWB 3AKZA 2IU3A 2C7PA 1DCMA 5HBRA 1ORDA 5LP6A 2J1LA 2OXTA 5LIPA 1I4WA 5EKUA 1SCBA 2SECE 1T6NA 1COWD 2JKYA 1NVBA 3VNRA 1GFIA 5DE3A 2GAOA 1Y6ZA 3IEPA 1U6IA 3QA9A 4I9FA 4MQBA 1JRLA 4MUBA 2VQDA 3GEPA 2YINC 2JVJA 3V97A 2HQ1A 1FLDA 4Q3OA 1WBBA 1PR3A 3DXXA 1CQWA 2G9UA 3T7SA 2HF2A 3C6BA 2NV0A 1V4BA 4JJKA 4DLNA 4G0QA 1XG5A 5C1IA 3GMIA 4Y9RA 3ZK8A 3ORRA 1EFHA 3RADC 2BTQB 2GHQA 5CYGA 3SD7A 2JVKA 3R5HA 4HNHA 4XDHA 3ER8A 4H7HA 5AUPB 1BDMA 4KIJA 1YD7A 2Q3MA 4DJEC 2QMUA 3PT5A 4H0FA 1AQIA 1VJGA 4PN3A 3AOEA 3QPUA 1J2UA 4YT8A 3WRVA 4PX3A 3O3OB 2G40A 2LNDA 5J4LA 5IWCA 4HZUB 2FRDA 1PWEA 4Q39A 4PG7A 5CFZA 4IMJB 4BLOA 2EBUA 1MIHA 4QNRA 1B15A 3K1AB 3UJCA 2BMDA 4OY3A 4BU1A 5E1MA 1IATA 3AONB 1RZRD 3M4JA 1CUJA 3EDOA 5KQGA 4AIIA 1PK9A 1ZN2A 3VAAA 1W0JA 3CH5A 1KAEA 5KEIA 1QMGA 1QBGA 2ZUVA 4FEEA 1MW8X 5DBGA 3NV7A 1PYDA 2C9ZA 3JD4A 4NEGA 3ZCRA 4B7XA 3T3EA 4HFRA 3MTJA 1KERA 2E1PA 1E9DA 3G1WA 4EVSA 3OMWA 5GP1A 1FVFA 5EI5A 4ZK2A 4UKDA 1RJGA 5JT1A 4LZZA 4IG9A 5AVJA 2O8BB 3DPUA 3I1FA 4PRLA 3IX7A 1H2EA 2FETA 3EVNA 5FHRA 2WYVA 4LCEA 1EPUA 1DHTA 1TMYA 3INTA 3KUXA 3L0OA 1QXSA 1YCFA 2F7SA 4RK1A 4ISCA 1Z82A 5TF4A 1GV1A 1RMQA 1WHTA 4KQWA 1FDIA 2WF7A 4V3CA 5IX8A 4S3MA 3PWKA 1HEUA 1J2JA 4CT4B 1Y8RA 1YZQA 3BE4A 1SWVA 5I7OA 3QVGA 4AJOA 5LIRA 1WF3A 3R6TA 4MUIA 5ITVA 1J20A 4OX9Y 2VP6A 4URZR 1MB0A 2OKCA 3AIOA 3LVFO 4WV3A 5HPYB 4DPKA 1EE9A 2ORIA 4L6AA 9MHTA 3PVCA 1KK3A 3DVAB 4UDOA 1ZIXA 2DZDA 4PIVA 3X1MA 5JSFA 1EFAA 2IEZA 1YE3A 3PR2B 3Q7IA 3L1IA 3MWGA 3E9MA 3NWBA 3ZQJA 2WPNA 5EZSA 3I1YA 3N2LA 5DZSA 1C8KA 2AZ4A 5B58T 2I6UA 1G6OA 3KBBA 2H1RA 3MMZA 3CPEA 1ZL2A 1SB9A 2FN7A 4QTZA 3M6FA 4YIHA 3HN7A 4O4JA 5DBOA 4AJ1A 1K4KA 2RAFA 2WJIA 3CUTA 3MA0A 4LJ4A 5CT5A 2CDRA 2I7TA 3AVYA 1TLFA 2D2VA 4PAQA 5E2BA 4K81B 2Q4EA 3H7IA 3UHAA 1Y1SA 1D4OA 2P3LA 4P7JA 3RVSA 2R6CA 3AEZA 2HYDA 3PXXA 4BFVA 3CG0A 3PEWA 3D7LA 5KB3A 4H08A 1ZNZA 5FUMA 1XJ5A 3LVQE 1Y1RA 2Q99A 4D02A 2D74A 3UAXA 2W2PA 4JVSB 1LRLA 1VECA 3Q15C 3UANA 1EX6A 4MUNA 4XYMA 2YV3A 4V1CA 1CZLA 2A86A 5B57C 5U4QA 3I5UA 2GPYA 3I83A 2E4ZA 3EMBA 5D87A 5I5EA 3B1JA 4OXNA 5B1HA 3PHLA 3RS9A 1GDHA 4AMGA 4AL4A 4XOIA 1SCUB 4YRTA 5COAA 5SY4A 4D0SA 4IH9A 4JQOA 1BS9A 2I2XB 2WTUA 1BX0A 4LV6A 5H4GA 4ISBA 3WL4A 3OD5A 3ZTYA 3HKDA 5M3BA 4HNTA 5DI3B 2OCGA 1YULA 4JMPA 5F76A 1P44A 1MOSA 3O83A 1Z7BA 2BUAA 2FG7C 1ZK1A 3U49A 1DZIA 2XWSA 2BLNA 3LL4A 4R41A 3L6RA 4ZVKA 4NQRA 3D7SA 1IUKA 3ZK7A 2IOYA 3S8MA 3RLFA 4MRAA 3FGNA 3TQQA 1V41E 4Z8XA 1HDXA 1H85A 1ZXBA 1Z4NA 2GB4A 1DQRA 2I2CA 4U9IS 1JFFB 1F6BA 2AS0A 3U31A 5ANRB 2FLKA 3NBFA 4J90A 5IN5A 3ZBTA 4E4YA 1XXHA 3OLVA 4LVOA 4ZV4A 1EDOA 2EP5A 4AM8A 1DIGA 5AOBA 2GZSA 2ECFA 2XZLA 4OQYA 3ZK9A 1S4MA 3MT8A 4MVJA 1TLTA 3KT8A 2VKTA 5CVJA 1A50B 1WLYA 3FLBA 3UAGA 3BMCB 3H3JA 1PNRA 3LWNA 1Y9DA 5EMJA 4EYEA 1REQB 3QXJA 1E62A 2KJQA 2IWHA 4KVAA 3FTDA 2J0SA 1H6DA 1Z8FA 2LRHA 1KP2A 3REQA 4HRYA 3R5SA 4PZ9A 4XX1A 3NT5A 3T5TA 2HQOA 2VF5X 2DPGA 3KKPA 1SXQA 4IDBA 3ZS9A 3WQHA 3EDYA 1QHNA 4YXFA 4U8GA 1QGUA 3N0WA 2PPVA 1OWNA 3FTEA 3RDPA 1RFLA 1IY1A 3MIZA 4LSGA 1MO3A 3KR1A 5IVIA 5TC4A 5FLYA 1IN6A 5J1TB 3MGCA 3I58A 3SQOA 1QU3A 2UUPA 1GUZA 2ID4A 3L4BC 4L57A 4UVDA 4EA7A 3R7DA 4ZODA 3FNHA 2VYFA 1R4MB 3CR3C 4BNHA 2XF2A 2WNIA 4P4UA 1UQUA 4JB2A 4RJKA 1QH8B 1BKYA 3MMPA 3B1YA 3JQ8B 4NONA 3D5QA 3ZCTA 2P9QA 2FW1A 2O59A 3T5PA 2MR5A 2P2LA 3SY8A 4OGGA 4OYRA 1FMCA 1M10A 4AFNA 1U8XX 2E85A 2O0LA 3ZY5A 5FUQA 2RBKA 3BWXA 4JCOA 3MB8A 1RI2A 3WRYC 4LY9A 2V1UA 1NJ8A 1WVIA 3B2QA 4RKWA 2GJ8A 3HXQA 3CUVA 2F1IA 5JAOA 4EW3A 2YZKA 1GVNB 1Y6FA 2WSSA 3D2BA 3N7TA 4M1OA 5IMBA 3CS3A 4W1QA 1MMFB 1U99A 2FJPA 2XTNA 3U0VA 4JYBA 2O2XA 3IP6A 1GFWA 1AGYA 4TWRA 1I33A 2E4VA 2COEA 1Z75A 3X1KA 5JISA 4GSKA 5JCJA 1YQQA 1NZDA 2R79A 3MHPA 1Z8NA 4EY7A 2DEUA 2YVAA 1UM9A 3LRTA 2CVFA 4ZT3A 5JSUA 4M1QA 2YH2A 4K2AA 1SIUA 5M2QA 3K9FC 2AVDA 1QF7A 2C5GA 3IUPA 3CVWA 4WZAE 4DGQA 2A0FA 1LBHA 1XWIA 3INYA 2FMTA 2JFXA 2MINA 3IP3A 1U2QA 4N5HX 2GVZC 5DNEA 4DRYA 1DXYA 2J31A 2VKQA 2Y67A 4LCJA 1WP9A 3LDHA 4XH9B 4EATA 3NHBA 3QZUA 2C94A 3IXLA 1LFDB 3LCCA 3CF4A 3L8FA 5CYFA 5D5HA 1SWWA 1U0BB 2XVAA 4K1LA 2PFKA 4BZWA 4ENTA 1QRRA 5JTTA 1NAIA 3ETEA 3G6WA 5AKEA 2JPDA 3BHJA 4MV0A 4Q1BA 3U2QA 4BP1A 5KDDA 4MZDA 1P60A 3HYNA 2RJOA 4MPPA 4FN4A 1X2BA 2Y0DA 4GMHA 5LDHA 2X7JA 4EG7A 2BKAA 3LBHA 3JTEA 4BE9A 1V8OA 2BM8A 3ZHVA 1XNGA 2OYSA 4YAJA 1MR3F 1OU4A 1W1UA 2DJ5A 2FR8C 5T8KC 1L7EA 1IWBB 1ZVMA 3G59A 1FOEB 4UU7A 5KNBA 3VYVA 2QJWA 4HN2A 1ECPA 3IEXA 1Y89A 4BTEA 3NVAA 1DKQA 3OQVA 2O8VA 5A4FS 5LXTA 2IYOA 2I78A 4KSBA 3KP1A 2OA0A 3ZS8A 4AS3A 2EFCB 2GM3A 3U44B 2RH5A 4JBXA 2I2AA 3K0SA 3ND7A 1NF3A 3T1TA 3TLXA 2PKWA 4DIFA 1GPNA 2AUMA 2AMVA 2QSUA 4YRDA 2HXYA 3F73A 5F1KA 3QE9Y 3GG9A 3NX4A 3GLFE 1XPOA 4FR0A 1S02A 1E9BA 1ML3A 2H1HA 4QBIA 1H3EA 4GP7A 3ZJVA 4TN1A 1WIWA 2DUWA 3M70A 1DJNA 3P1JA 1ISRA 4HWKA 4XD7A 3NANA 2GN1A 4NQZA 1ISFA 1YI8A 2FFBA 2QRGA 3ESDA 4BEVA 5HQTA 4DARA 4ARAA 3HXMA 3IP7A 4X3CA 3UEOA 3DOFA 3MAAC 2P8SA 4LXQA 3AQIA 1A9QA 2BM9A 5EJFA 1Y5IA 2DB3A 1V1RA 3NH6A 5CP8A 4EKNB 2QVBA 1HI9A 4DT1B 1G6KA 2HUPA 4E2YA 4EJ0A 3SVLA 2HLPA 1SMKA 3IXMA 2EW2A 5BO5A 1JTEA 4ESEA 3IDFA 5AXAA 1FPQA 2RONA 5TMEA 3SR0A 1K6JA 1AUQA 1QRDA 2I99A 1C3OB 2XGGA 1DTWA 1AKMA 1L3CA 3BBPA 3AG6A 4BMZA 3LV8A 4P38A 1XZMA 3NRJA 3IURA 3I32A 1HBJA 3FUVA 5TQ2A 5AW3A 2Q3JA 2B4KA 1UBLS 4DG8A 4LJSA 5IVPA 1LJ8A 2AN3A 2ZUDA 3ZXSA 3IL2A 3OWXA 5IJXA 3WLLA 2XLCA 1H94A 2OAGA 1Z35A 4XIJA 2D1YA 1FSSA 2AR7A 5GY7A 2G8NA 3E2PA 4TKZA 3NBYC 3W3AD 3TM4A 1KH3A 1KEWA 1WMAA 1OXKB 2JAQA 1J2TA 1AKWA 4F8EA 1PR2A 3W8FA 2ZE6A 3FAZA 5EJ8A 3H42B 3RAPR 2IPNA 2GUGA 1HFJA 2XNKA 3C6YA 1QF6A 4J0IA 5HXAA 1GWNA 3BWCA 5SZIA 4EFMA 4YWJA 5M04A 1I51A 5AW4A 4Q19A 4WOPA 2DT8A 4PYOA 2VWQA 4E21A 4AQYB 4CJXA 4MV5A 4I7EA 4NXNB 1KOGA 4YECA 4DKJA 4WX2B 1ZM9A 3FPLA 1QONA 1KAHA 3UWKA 3WWCA 3ZOKA 1VFNA 1W85B 1S3FA 3G8CA 1G2QA 1VCHA 5A9SB 3TAHA 3GK3A 2PBLA 3OMLA 1J21A 3EZGA 4L8WB 4CCSA 3QVOA 3K31A 4KMRA 3L5OA 1NW5A 4OLFA 1SKYB 3WLNA 3WLKX 3DLTA 1XAGA 3IMFA 2NTJA 1UIRA 4MCAA 1CRQA 4OFXA 4MP8A 2ZIXA 2UYGA 1JLLA 4DFDA 2NQTA 2JW5A 3A9WA 3F8WA 5HOQA 5IM4A 1N33B 2JBWA 2HLDD 5I4CA 3IKLA 1KYYA 3KQVA 3WL7A 1FFXB 1GNTA 3A8TA 4RKRA 3GELA 3DD1A 1OWLA 3SHOA 5BSKA 1DQZA 4PR0A 1THZA 2ZIEA 1S2MA 5IW8A 3Q88A 1TRKA 3GLUA 1U8EA 1WSWA 4HDKA 2X5KO 4IDFA 3R0IA 3GHYA 3U3OA 2R66A 3Q6IA 4ZOEA 2R7NA 4G4SP 4RCYA 5GQSA 2VH5R 2RGXA 4N5MA 4G36A 4HB0A 4W5WA 4AMBA 5F9HA 1YZVA 2DQ4A 2AJ8A 4WLEA 1L4KA 2BTOA 4ZYLA 5KQPA 3GPIA 3KR2A 3W8DA 5I3ZA 1FRQA 2EX0A 2HV8A 2O23A 1TAQA 3LPMA 3U3ZA 5AD1A 1E1CB 2QTZA 4MGYR 4NCIA 1XSEA 3JAMA 2H0RA 5KAMA 2I66A 1JKXA 4HMOA 1HF3A 1FDRA 2J0EA 1WXXA 3RIEA 3WQBA 1JN0A 2FSVA 4DCMA 2BFEA 5EUCA 1GZ3A 1VYHA 1PWHA 3KJEA 1KDZA 3SICE 1UPCA 1VE1A 1B0ZA 1NW6A 4HLCA 3KB8A 4OQ4A 4KSCA 4RE6A 4CN9A 5J4HA 3N2ZB 3QX9A 4EG5A 5IKPA 2VXBA 5ER6A 5G41A 1MORA 4GEKA 1V47A 2CXTA 5EN4A 3FGOA 1A8SA 1OH6A 4UQLA 4L8YA 4LJ8A 3USZA 4KVFA 1Z2NX 4RNDB 1IXKA 4QFDA 3EZXA 5CU7A 2PRJA 2O3JA 4A82A 1FYDA 4RMGA 3CRVA 1VLQA 2IE8A 1H4VB 3AXTA 3D1JA 4I3FA 2GERA 4J2OA 4M1WA 5AW2A 2IHZA 3UOWA 4N54A 2OHGA 1T36A 1WCYA 2QYOA 4RD6A 1AQ6A 3IHLA 3ROXA 2OCXA 1EEXB 3AVUA 4A0GA 1UMCB 1KAGA 4XPIA 3GJRA 4UTRA 2HADA 1GGNA 5J63A 1UOPA 4Q00A 2PTHA 5DV9A 5BXYA 4BNIA 4HDMB 1OF1A 1E8MA 4PRYA 1TFUA 3WNCA 1B23P 4Q3NA 4B3MB 1N2CA 3OQMA 1T6BY 1HEIA 3E3OA 5LQAA 3K9GA 4BVHA 1ZU4A 4DCNA 1YS1X 3VDMA 3NTOA 1WNTA 2C2HA 3I28A 2AYZA 2RB5A 3JWEA 1RHUA 2ECQA 1JMVA 2GJAA 2H7CA 2VAMA 4WNAB 2H1FA 5AVYA 3GD5A 2ZREA 1AUVA 1RWNA 1OR8A 4EMSA 2KI5A 2NUTB 5FAKA 1P7VA 1YL5A 2FSSA 5IDXA 1KEEA 3L7LA 2VJNA 2DY0A 3PKIA 3VI3B 2P6NA 4EF4A 5BORA 2XNSA 4AN4A 2HREA 1RCUA 4F5WA 2R6FA 4YRZA 3B3JA 4OMCA 3SJUA 3U4CA 2RG1A 2QNRA 4N8EA 5CFRA 4KLAA 1FBNA 4PO3X 3IEKA 2JFBA 1I0IA 1ZCJA 4NCHA 1K1EA 1OH8A 4F3YA 2FTKE 1YB7A 3IAAA 2VDLB 3UV3A 721PA 2LDXA 1VIVA 2ZFUA 4WJKB 3DBHA 3NHMA 3AUXA 3N87A 2OBLA 2RI0A 2IYAA 4ZMBA 5F73A 2R2GA 3K09A 2QA5A 3KOXA 2H51A 4UXJA 4WLVA 3S27A 3TZLA 2TMKA 4X95A 1ISMA 1ZHFA 2I8CA 1JWAB 1UBNA 4IS3A 1W0CA 4PN7A 3KB6A 2O5CA 2AZXA 4KXFB 4FYIA 4Q4JB 2J45A 5JWHA 3VYUB 4EHJA 4NU6A 3AHIA 2OZVA 3OPYI 4EW6A 3OCZA 1V8DA 1YL6A 3TR0A 2QMEA 5EIEA 3O91A 5EJAA 3JWIA 4JJAA 5FLXA 1Z28A 3ENWA 1T3HA 3I6ZA 1ONPA 1AKTA 3PUYA 1O03A 1P6XA 1J9ZA 4LW8A 2A1TS 4EQZA 2PKQP 2QL7A 1CSEE 4N5NA 4EHLA 5COBA 1UDAA 5DTJA 1VZ3A 2WA2A 2ECPA 1DP4A 4BNGA 4OFWA 1U98A 2P9JA 3SJAA 1UEIA 1NI3A 1TO2E 2H2WA 3ZGXA 1Y1PA 1Z16A 1CE8B 1YUMA 3DHNA 4ZQGA 4QTUB 1UWCA 1ZN7A 2PLWA 5CM2Z 5CLGA 3VKUA 4NCXA 3BS4A 4YRFA 5FULA 1DC3A 1CUYA 2H1LA 1C41A 5JDIA 1BVHA 2X5JO 1OKKD 2WEKA 4QAJA 3FPKA 4RWEA 3DZHA 5K6AA 3WP0A 9LDTA 2Z3VA 1GPYA 2R25B 1RAGA 1LA2A 2HSEA 4O5OA 2ROQA 5DCYA 2B2CA 3K6SB 3ESZA 3R77A 1Q14A 1ZNYA 1MRSA 4FMDB 3I5MA 3VRHA 4X00A 3TO5A 4BVJA 3HU3A 1XRSB 2FZGA 1C3EA 3EX7C 2VWHA 1ESCA 1PJBA 2ZWVA 2OORA 1UF9A 4JP2A 2O3RA 2XTMA 3O4GA 1MEEA 2YBEA 4WDRA 2NU9B 1CT9A 4DCTA 4B3FX 1FC0A 2JIZA 3WMGA 2IH2A 4FGWA 4DAOA 1ES9A 1FNCA 3OIFA 1PZXA 1CP2A 2FXIA 2VI5A 1XROA 3OCXA 3N70A 4KK4A 3ZQ4A 4EVRA 2QM8A 4KRFA 1M66A 5CCDA 3ZGVA 4W5TA 1WQ1R 2DHRA 1G41A 3H3XA 1K5DA 2E5FA 3SX4A 1DIHA 2EKZA 2VP3A 3VBEA 1NM5C 3DSRA 4CEJB 3NTRA 4GI7A 4FMDF 2P6RA 4U2EA 1GP2A 3QKIA 4RMJA 2ZKLA 3ICVA 5HQ3B 2YXBA 1TVCA 4K3VA 4Y1RA 1YKSA 4MUGA 4BATA 1RQGA 1X7WB 4O1MA 4AF7A 3OA0A 1L8OA 5ES3A 1QIIA 3IQZA 1D1SA 1IJEA 1D8TA 2AI3A 4AX8A 1PLLA 3WJ7A 2MYPA 5KKCA 2YXDA 3C2QA 5KS2A 4PSDA 1D5CA 5T67A 5BN3B 4JFAA 5EWJB 5DT2A 2XX3A 1GSIA 2H0AA 3OIVA 3IUMA 5DM2A 5ER9A 1S1CA 4C76A 1TK9A 3DOOA 4CRWB 2PGLA 2V8BA 4CKZA 4HPJB 1PGJA 5B4UA 1GPH1 3S1SA 4YAGA 3ZCPA 2Q3LA 4EVQA 4XSVA 4WLUA 2D3WA 1X13A 3G79A 3W9BA 2PBZA 1M34B 5KMGA 1C3LA 1NVKA 3OPYB 1EUQA 4FXPA 1SXHA 2G76A 1WVGA 2WQZA 4LC9A 1BXGB 2EKBA 4NNPA 2J9YB 4HZGA 2GEUA 4M1ZA 1VMEA 3A9RA 4CG0A 1RAFA 1FFBA 3HDHA 3QKSA 1AH2A 4LJ9A 1TMGE 4Q3BA 2WWRA 1GGVA 2NYRA 3KOMA 3R3ZA 3ZHZA 3U3RA 4BMNA 2JC3A 1LW6E 1MC8A 4EO9A 1JWLA 1QRUA 4J75A 2NSLA 1KMNA 1FVXA 1P1FA 3WE7A 1GA6A 2YHAA 1K7XB 2YICA 4PSKA 4HUTA 2XGSA 3L0ZA 1PYOA 3DAOA 4GICA 3LX8A 5AJXA 4A8HA 3ZY3A 3WA7A 4BKQA 1SXPA 2XBLA 2G5TA 3FOBA 4BV2A 4R0VA 2ZRNA 1FYWA 2VQFB 4RIGA 4CE6A 1MW9X 4AJ2A 4C0SA 2RHCA 1SVIA 4P33A 3BF8A 4YJ2A 2MTBA 2PGXA 1U1CA 4DLKA 3H2KA 1V37A 1QO7A 1RZVA 3DZJA 1O2DA 4MRSA 1SHJA 1XT6A 3OZSA 3CO0S 5LLSA 4MI1A 2W4QA 5IXYA 3UWMA 3DEFA 1JG3A 4Z3KA 3Q3CA 4BBPA 5GIOE 1KDYA 3D6JA 2AC4A 2G77B 4M1EA 3VTKA 3F5FA 2ZIGA 3WIVA 1A0OA 4CEHA 2QTMA 2FW7A 2E87A 4KOEC 3DE3X 5DGXA 3OZDA 3ZN2A 3UWDA 1W4AA 2C83A 5HZHA 4QA9A 3RRNA 3AFHA 2QW1A 5JS2A 3R9IA 2R5NA 4HX2A 5IHPA 1M54A 5K45A 5AI8A 3HB4X 2QUKA 3D81A 4LF9B 5CCEA 2D54A 5K3BA 4ZOBA 3TJZA 4CQMD 2YNMC 4IJUA 5JRJA 2HRZA 4BLUA 3B9BA 3V46A 2VPWA 3VU0A 3FTNA 2BFAA 4C30A 3GEGA 2IY8A 4IKEA 3QVVA 3AUKA 2Z6UA 4U2KA 4MI9A 5CXQA 3ANTA 2AI1A 4F7WA 4WNIA 2I76A 3PVSA 2X41A 2G9VA 1P3DA 2TSYB 3TIXB 4IJWA 4OHOA 4UATA 3RC2A 2P67A 4ENSA 1O89A 4QXOA 4PQYA 1RTKA 2C9CA 3OFSA 3BVPA 4NEHB 4NS4A 2GO7A 2R8YA 1X7GA 3D7NA 1Q0RA 2NADA 4QQRA 3I34X 1HYEA 1QQ7A 1QYWA 2BE9A 2R8PA 2ZSUA 3OC6A 4TMTA 1FPMA 4GGOA 3D43A 4RVSA 5CD9A 4RA9A 1AHPA 3TD9A 1MV5A 4TLEA 2NTYC 5HVNA 1ULBA 4L4ZA 4OJKA 4F4HA 4OG2A 4ZTUB 3NHZA 3QUBA 1EGMB 1B43A 1VPVA 4FBLA 2VDQB 3Q8MA 1L5HA 5KDOA 1SCIA 4UARA 1T3GA 1H2ZA 4HH1A 3WLQA 1AZLA 5AVZA 1CZRA 2D0DA 1CUSA 2XB9A 4ER5A 3F97A 4R1QA 5LL6P 2BMJA 1Z5GA 4NU8X 3WDKA 1A8QA 2HWUA 3E8SA 4QXRA 3E9NA 1KO1A 2WAMA 4MVYA 5I8ZA 4A0FA 5D3MA 3ZHQA 3UF0A 4XFDA 2UXDB 4QE3A 5JCPA 4WKNA 1VA5A 5DBIA 3V55A 3H8JA 2IFTA 1RWVA 4FJ2A 4J7CA 5F35A 2RCNA 3UM9A 1E1NA 5TVGA 4ZEVA 3CT4A 3ZE7A 2F8TA 1ILEA 5ISMA 3QXXA 4A8JC 3MTGA 5FF9A 1DIRA 1YFKA 4AS2A 2J32A 3TRJA 1GPDG 3WI7A 4EW2A 5KSZA 2Z6VA 2N9UA 1QCZA 1E1MA 4HMPA 4RZQA 4DYVA 4EEXA 2DH5A 1NY6A 1XTIA 2XVZA 4H1HA 4F96A 2HZ7A 4OHWA 3I9V1 3C6QA 3GBVA 3QYPA 3AYZB 4MKRA 4PZZA 3T7DA 4BCCA 3LUGA 3FMIA 4R9UC 3FMOB 2YJ3A 5AHOA 1Z8DA 5IBCA 3T7KA 4HXYA 1KBOA 4IV5A 5T57A 3K9NA 2EVWX 1HDGO 1R15A 1QG4A 1T3SA 5CGZA 3ZYCA 2VRWA 1RI5A 1FCJA 1WDWB 2PZFA 3EASA 4YCNA 4FOTA 1QQAA 3R7SA 4CLEA 2BAGA 2FX2A 1ZK4A 3RIYA 5CFOA 1IBCA 2VZEA 2YN0A 1E6WA 2GDZA 4H7DA 4UM7A 4HAZA 5EEHA 3ECCA 1JIKA 4XD2A 4B3CA 2NYVA 1L5LA 4WZBE 1Y6JA 4Y67A 4H1UA 4E6PA 4L9WA 3K9BA 4K9KA 4KREA 2A5FA 2XUFA 3HKEB 4ZQIA 3N7AA 1BWQA 2Y9PB 1ZC4A 2OECA 3IUNA 4YJ3A 4LF6B 2R7LA 3S2YA 2DQKA 3JR3A 3IOEA 2NO0A 1HORA 2JLSA 3I2FA 4DBLC 4EPWA 3AWIA 3CKYA 2Q6TA 2BY4A 1ZJYA 4J49A 3IE0A 1IK4A 1JFTA 4J7AA 2C00A 1JDNA 1RXCA 3AZPA 3IKJA 3PUKA 1NVXQ 1BHQ1 4JKOA 1US8A 3IAXA 1ZFNA 2VJOA 4YCLA 1MB4A 1RWOA 1QYXA 2FN8A 5K05A 3EMKA 2GF2A 3QFRA 2DE0X 2HTEA 2AW5A 2C8KA 3DVSX 4P83A 3BGWA 4MDEA 1JU3A 1QV6A 3ON5A 1JECA 2GI4A 5JCJD 4TTSA 1T5IA 2HCFA 3IT1A 4NJMB 1PR1A 2Q7XA 3U4DA 3ZE8A 2YVQA 5K3OA 5JECA 2CZCA 3AEKB 2DFPA 1NVGA 1EUCA 1OXXK 2AJLI 1R3UA 3DZIA 1V45E 4AURA 8MHTA 4G0PA 4KHPB 4LSZA 1WDLA 1ZWKA 3QI7A 2IU0A 2ISCA 1ZD3A 1NZJA 2FW9A 3G0IA 4W5OA 3DV0A 3KQMA 3I6QA 4K6HA 1WCIB 4ZARA 4KYIB 5BVGB 4XR9A 2X4IA 1T5OA 3HH8A 4MTLA 3DAPA 1MC1A 2IPLA 2PBFA 2JLAA 2LWIA 4Q66C 5JVDB 2IE0A 3W9SA 3W4KA 4GRDA 1E2QA 5FOSA 4K7JA 1TKAA 1TFRA 3MF4A 3PYXA 3PRJA 1TZCA 5B3LA 1G2PA 4KYTA 1PI3A 3CF6R 3T3MB 1JLHA 2Y99A 3L8MA 1M8PA 2DECA 3OOHA 2CE7A 5FTWA 2CFIA 1M5UA 1TUBB 2OHHA 2FDCA 1CR6A 3AUYA 2VDUE 1WF6A 3E3MA 1WCXA 2JBHA 2HDNB 4ICIA 3ZHTA 4BZZA 4RANA 2FZEA 3V4RA 3U4QA 2QTTA 1YKGA 3NIBA 4FFBB 2P11A 2DP4E 4GQIA 1JTFA 4MCIA 3VPSA 1T8WA 4ARZB 5JVDF 4RLQA 3HJUA 4UXIA 2BUCA 1I1OA 1GLVA 4LYJA 2WPDD 1AZTA 1PNVA 5HF6A 4DMLA 2O5VA 2IJGX 4OXQA 1FMJA 4XCQA 3QIAA 3JVEA 4YONB 1N0VC 2FVXA 2GCOB 4YP1A 5HJ5A 1W1WA 1J4AA 1A96A 2DWOA 2FE4A 2GXUA 3P5BA 4BMXA 1G3QA 4L5YA 3S5UA 3IIJA 2HMWA 3UJ9A 3ZC3A 2CD7A 3H05A 1FDVA 3OQ1A 4WCFB 2QR5A 3TTTA 3UV6A 3M5DA 5DYWA 2BD0A 4Y30A 2D00A 1HURA 5FPSA 2GTHA 2SCUA 2XKKA 1JLSA 1ODLA 4D0GA 3IILA 3OP4A 4GDFA 1NSTA 4LRSB 4IRMA 5AKGA 4BNFA 2BE7A 4PBTA 1I3OA 1E2PA 2JHAA 2ZIZA 4D9GA 5L7TA 1OWPA 4A36A 3E9EA 4Q9KA 1OLSA 1N4DA 4HN4B 2BFCA 4YQZA 3AUTA 2VS1A 2M9MA 4L0MA 5E6SA 4DA4A 3MINB 5JZBA 1AIPA 1Q0TA 3EQ7A 5BRJA 4KLZA 3GD7A 1U1DA 4R1PA 1DBVO 4XVHA 3OM0A 4WFKA 2ODPA 1RP7A 2DBYA 5K7SA 3JQGB 5FPQA 3PDIA 1JT9A 2XA9A 2AOTB 4YRJA 1C7JA 2EFEB 2ABWA 3PQ2A 3LH5A 1KJNA 4PRZA 3CLSC 1E66A 1LGYA 3MMNA 2P40A 3CUEF 1GKLA 1JEQA 2GYVA 4TKUB 4JVMA 4A4DA 3DMTA 3HCEA 1NTRA 4L4RA 3ZVNA 2HN9A 4XQEA 1II8A 3WSVA 4UBLA 3HSSA 5EPUA 4IJKA 3U3KA 5CW1A 3VR6H 3GJTA 1II9A 1B8PA 1C1XB 2G4CA 4HDSA 1JSRA 2ZAIA 3VO2A 5HS4A 4ENRA 4UUQA 4C7OA 2CXOA 4AJ9A 5E7QA 4FCVA 4EG1A 5BMVA 2R751 2W4MA 1Q19A 4LHZA 4F45A 5SV2A 3KV1A 3GLGE 1T26A 1V5WA 5JQGA 5KWJA 4RPGA 3N2KB 2FZVA 3FGPA 3N6RA 2A1UB 4S35A 3A9CA 5TY0A 4JOSA