2YOFA

Plasmodium falciparum thymidylate kinase in complex with a (thio)urea- beta-deoxythymidine inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
200
Chain Sequence
DDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Synthesis and Evaluation of Alpha-Thymidine Analogues as Novel Antimalarials.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 80
structure length 200
sequence length 208
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yofA00
3LVRE 3CF0A 3ZVLA 4Z54A 2V54A 3CWQA 1O87A 2PX3A 5HTKA 3ZDQA 1TF7A 3LW8A 3K09A 3AUXA 2WWHA 3CPJB 4GP7A 2VSFA 4U5XA 3DPUA 4AI6A 5EXXA 1F48A 1XJQA 4RZ3A 4G01B 4NYIQ 4MRPA 6Q21A 1QHIA 3U4QB 1JR3D 2H18A 2ZE6A 3P32A 4LYHA 2ORIA 1ZBDA 3N5CA 1LFDB 3WP1B 2EWVA 4B3FX 3TAUA 4V03A 1E2IA 3JVVA 1KY3A 3GLHB 3V9PA 5L3SB 2QGNA 1P7CA 1GTVA 3KKPA 1FFHA 1Z47A 4PQRA 4D4LA 4EUNA 1SVIA 2IL1A 3HR7A 3GLFE 2BBSA 2HT1A 1IN4A 4DUGD 4URVR 2JATA 4Q4HA 4OI0A 4GZMA 4HB4A 2SHKA 2YV5A 3NBFA 2JLWA 1C1YA 1F2TB 1HY3A 1UDWA 1XB2A 3DDCA 3NIBA 3VKHA 1R6BX 5C18A 4A8JC 1MV5A 3LX5A 5GJWC 2ZRHA 3MD0A 3OAAD 1G7RA 3T5DA 2QY9A 4XWAA 5DSZA 5CDFA 5JCZA 2ZEJA 3QPUA 2F1JA 3TVDA 2GCNA 4DRZA 5K8TA 5M04A 2CLSA 3RWOA 2OFXA 2BCJQ 3QXHA 2JLSA 2GCPA 3LAWA 4DCSA 2F9LA 3OHMA 4F4CA 2WPDD 1KJWA 2BJVA 3A1SA 3EC2A 5KSOA 1G6OA 3RS2A 1XPRA 5JLJA 2FV8A 3OEED 2Q0HA 1KI9A 4B3BA 3GLGB 2CCJA 3PQCA 3W3ZB 1A5TA 1KMHA 1G19A 3TSOA 3AVTA 2XB2A 4QM7A 2IEYA 2WTUA 1ZVQA 4FCTA 3UATA 1QHXA 5AJVB 1RJ9B 1Z0JA 3QF4A 1I4LD 4HAVA 1W36D 2ZYUX 3KTAB 1PUJA 1Z0FA 2ORVA 1DPFA 1N6NA 2IUUA 2V3CC 2RCNA 2XZLA 1IM2A 1P9RA 4KXFB 2CJWA 2IW3A 3HP1A 4MDFA 1X1RA 2IK8A 1HURA 3ZJYA 4CT5A 2IEZA 2N1BA 4LV5B 1TF2A 1CJVC 3BS4A 4HDQB 1NSFA 4YMVA 3P26A 2QTVB 1GWNA 1VYVA 4RD4A 2I1QA 1GNQA 1UFQA 2WMNB 4URWR 1S3GA 1ZU4A 5CM9C 1SVOA 2GAOA 4MKIA 3CB4A 4LYJA 1UEIA 1T9HA 3SHFA 3U3OA 2ZRPA 3EIQA 4TL8A 4FMBB 4UKDA 5DH9A 1IY1A 4UXHA 1T8UA 4H1UA 4HUQA 3W34A 3U4QA 4UNPA 1OH8A 5TY0A 4BZQA 2Q3MA 2D06A 2WSSD 2ZE8A 3NHAA 4UXJA 4LJAA 4Q4JA 2OSBA 1G7TA 4Q9KA 4PHHA 4TSFA 4S35A 4ZCMA 4FIDA 5DO9A 1ZD1A 3GLHA 1DAMA 2W2XA 1YR7A 4MRSA 2LWIA 2FE4A 3KL4A 5IK2D 3AP2A 1JQLB 2ZYTX 2JLXA 4YXWA 3OFND 3GLFB 4NYMQ 3TMKA 2FJUA 3X1YA 2YNMA 1TX4B 1LS1A 1E2GA 4HAXA 2OFOA 521PA 2NO0A 1D9XA 4QXAA 1RIFA 2Z4RA 1B0UA 2GJAA 5E95A 4ILEA 2HLDD 4Q1AA 5FFMA 2IYRA 2YC2C 4TLAA 1U9IA 2QUZA 2X2EA 2A2ZA 4DLYA 1OHHD 2EFHB 4EPTA 3REFA 3SQWA 2XXAA 4PANA 4EFLA 4OI2A 3K0CC 4X8OA 5FBWB 3WMEA 1CP2A 3A1TA 5DI3A 3R8CA 5GADl 1KOFA 2W58A 1MABB 3HJNA 3PUYA 3ZS8A 3JZAA 4PPGA 4WXPA 1K6MA 3CRMA 4I4LA 2FFAA 3QBVA 4RZUA 4BPBA 3ICEA 2O0JA 1K5DA 2H7VA 3T35A 2CNWD 4CT4B 4JT4A 1SHZA 1HQYE 2OESA 2GXUA 3BXZA 3CW2A 4CEIB 3PR1A 2IYXA 5FOSA 3KTAA 3IUYA 2ZRFA 3RRNA 2KI5A 1VIYA 3HPRA 4JLOA 2YKGA 1FW6A 1ZJ6A 1YR9A 2QAJA 2VH5R 1FL9A 2A5YB 4A4DA 2WSMA 3ND8A 4W7SA 1NVVQ 1G8YA 1JQJC 2ZANA 4Z8XA 4FWTA 3EARA 3KDSE 5DLQC 1M34E 3IIJA 2ODWA 3SS8A 2JLUA 1KDOA 2DBYA 3C15C 1JPNA 3LNCA 3IHWA 1Q3TA 1U8AA 2EU8A 2GTPA 3FYHA 3ZIAA 4IDNA 3PEWA 3SI7A 1V5WA 4X8HA 1BKDR 1E2PA 3QY0A 2B7CA 4FWIB 4PAMA 4MKFA 2QP9X 2WWYA 4CIDA 3TQCA 2IWHA 3SR0A 2VYFA 1RRCA 3K0FB 1TADA 4ON9A 4YQFA 2FF7A 1Q57A 5CIWA 3TUZC 3TRFA 1VPLA 3AF0A 1R5NA 2BBTA 2HXSA 1E32A 2PJZA 3B1VA 2IT1A 4Q1BA 5A0FA 3JZMA 3F3YA 4JSYA 4RD3A 3I32A 3ZD7A 1KSGA 2I1VB 3E1SA 5JJLA 2WVJA 2N42A 3U61B 4QL3A 3LRPA 2GF9A 2QRNA 3EIEA 2ZAMA 3SQXA 1OKKA 1CU1A 1OPXA 3WYAA 3GLFA 2O8CA 2AFHE 2VF8A 1XD2B 2NPIA 1RW4A 1KI2A 3X2SA 1E94E 1IN6A 2CL6X 3CH4B 4HAYA 2REBA 5CB8A 1YR6A 3H4MA 4R71A 4R9UC 3RYTC 1KSFX 2QM8A 4A6PA 1WDTA 2BCGY 2ZSDA 2ERYA 4X8LA 2C96A 5FTNA 4DLWA 3THYB 1TL7C 4JVSB 5LB4A 4JMPA 4EJSA 3FKQA 5EE0A 1OYWA 3IPXA 2GEUA 1SVKA 2PLFA 1VYUA 2REXB 1G3IA 2BM1A 2ODEA 1NBME 2YYZA 3AH8A 2FFHA 4ZCLA 2GCOB 1CKEA 4DWJA 3GFTA 2ZI4A 4IVPA 4BFXA 1XZQA 4F38A 1G4UR 3E5HA 2W6ID 2F43B 3TR0A 1XTQA 4B3GA 4Q21A 8OHMA 3LFUA 1KAOA 3CNNA 5EE5B 4C7OB 1T0JB 2XTNA 1F60A 1OXVA 1AKEA 3ASYA 4C0AC 3ZVMA 2C8VA 4LZZA 721PA 1CXZA 2QBYB 1U8ZA 4P3YA 4Q48A 2G6BA 3IIKA 1AJEA 2VPPA 2VSOA 5J4KA 1WBBA 3O8BA 1SQ5A 4ZDKA 3WYGA 2QQ0A 5FUVA 2QTHA 2ZM5A 1I4TD 3I8XA 2JCSA 4FCWA 4BFWA 4NE2A 1HV8A 1E9DA 4YXWD 4CEHA 1WE2A 5AK0A 1J8MF 1R0YA 2HV8A 3ECCA 1G4AE 4TMXA 1ZD9A 5E3HA 4QJ5A 2GK7A 1DTSA 2GAAA 2BMEA 2WJIA 3ZVRA 4M0LA 4F4JA 2OBLA 1E2KA 1BYUA 1NG1A 2AKYA 2FEMA 2OUKA 2ZI5A 4DLTA 1XZPA 4FXPA 2GJ8A 2QAGB 3AEZA 4ZPXA 1OXUA 2HT6A 2PCJA 3KQKA 1ZD8A 4AY2A 1ZP6A 2GEDA 4MRRA 3FKSA 4M9ZA 4MQBA 4B47A 3AVPA 2X77A 3RNLA 3MGCA 4EQ6A 2O8FB 1W47A 1E9AA 2C9OA 4G5RA 4DSTA 2Z5FA 3R9XA 1X8JA 3CR7A 1AQYA 3DOEA 3FMOB 3QJYA 1JEDA 3B1ZA 4LV8B 5TV2A 4F7WA 2O8BA 3PITA 1XD2A 4CYMA 1RYHA 2PEZA 3GLIB 1OIWA 5BN3A 1E9SA 3QOFA 4HZIA 1Z2AA 4WW0A 3HU1A 2ZUCA 5EUQB 1R4AA 4Y0AA 1ANKA 1E2FA 1YR8A 4LX0A 2X2FA 3UIEA 4B32A 3THWA 3VTKA 3QKTA 5KPJA 1E4VA 1WRBA 2AWOA 2DY1A 4Q7KA 1E0SA 4TQAA 4JL8A 4K46A 4EPYA 4LGMA 1NIPA 4NYJR 4BLOA 3C7KA 2IYVA 3AGPA 4PX9A 2VSXA 3THXA 3L2OB 1G20E 2GCOA 5EZ5A 2IWRA 1GVNB 4A8JB 2BMFA 2HXYA 3QPWA 3WNCA 1ZNZA 2FSHA 2AXPA 2C9CA 1E2JA 2QPOA 3GEIA 1N5JA 2IHBA 2XTZA 2DWPA 4GOJA 1RRPA 2DB3A 3DKPA 4C7OA 1ELOA 2Q6TA 4Q9IA 4B48A 3AVXA 2IS6A 1SVWA 1T3HA 2QM7A 2X8AA 3BERA 5E4FA 4PPFA 3BFVA 5E7IA 2IX3A 5EP4A 4BEJA 1KSJA 2PBRA 4TMVA 1GILA 1DEKA 1JPJA 1VHLA 3AVVA 3OF5A 3A8TA 4LJ5A 4PTLA 1DG1G 2E1RA 2BWJA 3AVUA 1G291 2IBMA 3WY9A 1G5PA 1IXSB 1AK2A 1H8HA 4KBFA 4I1SA 4Q4LA 1G8PA 3Q8XB 1BIFA 3MJHA 3F0TA 1ESNA 4AKGA 2QT1A 4KU4A 2JJ2A 4LOAA 4PZYA 2ECKA 3QI2A 3HYRA 4MITA 1N6LA 1KJZA 4LBYA 3TUJC 4DCNA 1XU4A 1P2VA 4IVQA 4Q1FA 3LXXA 2FSFA 2Q9CA 2WWXA 1GITA 1KKLA 4AKIA 3B1YA 1YZUA 3AM1A 1R5OA 1XD9A 2OLKA 1U81A 3NH6A 5HE8A 1VCIA 4OK6A 1NN3A 3TIFA 4EKDA 4GOKA 3FFBA 3WXMA 2FDCA 3SEAA 2W83A 2QSZA 1FNNA 1VKJA 5CJ2A 1M1YE 3CF6R 3SBDA 5D3MA 1RE0A 1XMJA 3B5JA 4POAA 4ZIRA 1E3MA 3OE7A 1U90A 1JAHA 4JLAA 4PQYA 5BQ5A 4DT1B 1Z8FA 1XBTA 1II8A 2XOKD 3IILA 4KYIB 4C2UA 4BFVA 4B71A 5TXGA 3OEHA 5DN6A 3ZH9B 4X8MA 5SZHB 4MGIR 1VCOA 1SKYB 2GESA 1KIMA 4M9XA 4Q00A 2MSDB 1NRJB 1EFRA 3CIOA 1D5CA 1EWQA 2AWNA 1Z2CA 3EPJA 1GL6A 1RPZA 1N5KA 4B33A 1Q44A 1ZINA 5BXQC 3P20A 2OCYC 2W6JA 4TLCA 1VCNA 3IO3A 2AK3A 1YZLA 4QGHA 5G41A 4FMCB 1NBMA 4F92B 1G64A 3RRMA 1DE0A 1D9ZA 3K0AB 3U5ZB 4JL5A 4IJMA 4XOIA 3SFZA 2ANBA 4LJ9A 2BJWA 1XRJA 2B92A 3LWNA 3T15A 4GNKA 1P5ZB 3W8NA 5C1BA 1FNMA 2FSIA 1US8B 1S2MA 2AR7A 2ZIAA 3FMPB 3PG5A 2G3YA 3WYFA 3L8YA 3RS0A 5GVRA 1G21E 1KHTA 4MYHA 4OQMA 3ZS9A 4P0TA 1NMYA 1U0JA 4C0LA 2C2HA 2J87A 1FMJA 1JR6A 3UXMA 4TYNA 3GD7A 1NVUQ 2ZQ5A 4RZ2A 4KCGA 5JSZA 4D0NA 4DUGA 1IJFA 1GL9B 2JLRA 4TL9A 5EXPA 1IY2A 4LYFA 1ZM3A 1BYIA 5HZKA 2ZYVX 3BD9A 2B7BA 3QKRA 4P4SA 4IXMA 2G9NA 1LNZA 5FBLB 3X1XA 3HU2A 4BZXA 2ZI9A 3VR3A 2WWGA 1DAEA 1P2TA 2VEDA 3OAAA 4D4MA 3K0EA 1YE8A 2BOVA 5KDOA 2QMOA 3L0SA 4XD7D 1W46A 2PT7A 2ZVQX 2OCAA 3REGA 4YDSA 1GSIA 1XCPA 2Q9BA 2RAPA 2UKDA 3GQBA 4UXIA 5FR2A 5L3VA 1VG9B 3SBEA 3U44A 5JBQA 2VQSA 4XTCS 3VHLB 3MWYW 3PUZA 2EFEB 1Z0IA 2FA9A 1JI0A 3LD9A 3OEEA 4V0LA 3LO5A 1OB5A 1Z6XA 4GL2A 4Q66C 4MUAA 4C2TA 3AKEA 4EPWA 2A5DA 4AG6A 2J7PA 2XSZA 1A1VA 4KSCA 4KLZA 2GWHA 2V55B 2HCJB 1OFTA 2WOOA 3AVQA 3X1ZA 1H8HD 1T5LA 4JVMA 3DVLA 1ZRHA 2CHGA 2R44A 4OJKA 2QT0A 3TLXA 4ERNA 4QG7A 2R62A 4AIIA 3I73A 1IJEA 1NLYA 1ZNYA 3H1TA 4MGYR 3DMNA 3QG1A 4QRHA 1DVRA 3B85A 2GA8A 4FMDF 1CS4C 1R0WA 1CIPA 4LV6A 1QG2A 4EAQA 1SXJC 2DFLA 4M8NE 1HT1E 2XITA 4NCKA 3B9QA 3W6PA 5JECA 2RGDA 4MDEA 5FL3A 4IOJA 2QN6A 1UADA 2IA5A 3PEVA 2Q9AA 2RGCA 3GEEA 1M6NA 4NL4H 2RGAA 1Z0AA 1US8A 2R2AA 1S1MA 3BWDD 4D26A 4URYR 3VHXA 3VR1A 1HUQA 3KUDA 2WSSA 1KY2A 2V9PA 2W0MA 4L15A 5JS8A 4NONA 3GLGE 4BZPA 4QC2A 4C3ZA 1E0AA 4IOMA 1E9FA 3RANA 3HPQA 4IW3B 2KJQA 2RGNC 4DLUA 4OQLA 1G17A 1NI3A 1R5BA 2NOAA 1ONBA 1ZW6A 2GXQA 2B21A 2X19A 4UNSA 1E2QA 4D0LB 1CRPA 1DO2A 1KI6B 4BLTA 4B73A 4HLUA 3SHWA 2VHUA 1ZUHA 5EE3A 3PEYA 3P1JA 1AGPA 2J59A 3LW7A 4PZLA 1Q1BA 2ZROA 1L4UA 2HUPA 2VP0A 1S0UA 3J81k 5J4HA 4QM6A 3B1XA 1AS3A 4B34A 2FWRA 3I72A 1OHHA 2WHXA 5L3QB 4F4IA 4MGKR 1KO7A 1HE1C 1LY1A 4ARZA 2G1KA 4WVFA 2UZIR 4IOLA 1NBMD 1WCV1 3LY5A 5BW8A 1XTIA 4BQSA 4JLVA 3WMGA 4LC1A 4B74A 4KHZA 4IFBA 4QJ3A 3FHOA 4U02A 1GRQA 1KDRA 4KODA 3ZLJA 4QGAA 4D82A 4JLJA 4Q9HA 1P3JA 4LC0A 2CNWA 4Q18A 2Z4SA 1NJFA 4O2RA 4CGZA 1E4YA 5EZ6B 3PVSA 5KYKA 4BFTA 2OM2A 4M9SA 1SULA 4D4JA 5HE9A 3EZ2A 2JDID 2A30A 2YWEA 4TYWA 2NO6A 2H8KA 1R10A 4P31A 2ZJ2A 4R2HA 1N0UA 2F1RA 2G88A 1UM8A 1W0JD 4IEEA 2DHRA 5JRZA 1SGWA 4CDGA 2QL6A 1KZ7B 3PCRB 3WRXC 1T91A 2QEQA 1XJCA 4IHQA 3K70C 5FOUA 1M2OB 2XJ4A 5DISB 3BK7A 1E96A 2ZR0A 4JT2A 4UJ5A 1TEXA 1IN8A 3AF2A 4Q5IA 3G0HA 1E9BA 3IO5A 3KQNA 2GZHA 2BVNA 3EIHA 2G0TA 4F93B 4TMWA 2QTFA 5KSZA 2ZETA 4PC2A 2CLDX 3NC1C 5FI0B 3MWJA 4MRNA 3T34A 3K53A 4WIAA 4B35A 5JEEA 1GNPA 2FZ4A 1EFCA 1NJGA 3VU9B 4DLXA 1HQCA 2EWWA 2QRZA 3BC1A 2IUSA 3PUXA 3NTUA 4PSVA 2ZU0C 1LF0A 4FN5A 2X1VA 2EVWX 2A5FA 3Q5DA 4MYCA 2ZE5A 4BFUA 4US0R 2J7PD 2XSZD 1NY5A 1IXRC 4GT1A 1ODFA 4TQUS 1W4CA 2WM9B 5BWMA 4TTPA 2VBCA 3C5HA 3KXLA 5J47A 4BLPA 1X8KA 4MRVA 4W9MC 3GP8A 2IS2A 1XTRA 2O8DA 1TNDA 2W2TA 4RJLA 4Q7JB 3BB4A 3RS4A 5JJKA 2Y8EA 3RRZA 2O52A 3I61A 3AVWA 3AKCA 3PIRA 3U7EB 1EWRA 4DEYA 4LHVA 4US2R 1T8TA 3DKVA 4MUBA 3I5YA 1KTVA 1U98A 3X1WA 5HCIA 2C98A 2DPXA 2W6IA 1A7JA 3VKWA 4A92A 3IDQA 4QBGB 4DCTA 3DZ8A 2OAP1 2ZE7A 1JNYA 3CWZA 3ADCA 1Z0KA 2A5JA 4JYBA 2VP2A 2DR3A 3U7HB 4JLNA 1LS6A 4DC9A 5TDHA 1Z6GA 4QOSA 2VP6A 5J4VA 1RKBA 1XX6A 4NYJQ 4M1MA 4O3MA 4CVNA 1OXTA 3FDIA 2DFTA 4A0RA 2QPTA 3BBPA 5L3SA 1N5IA 4RD1A 3ZQ6A 5LB2A 4G1UC 1G3MA 3QKUA 2D7CA 4GDFA 4AURA 1EG7A 1L4YA 1SKQA 3QXJA 1WQ1R 5TB5A 1FUKA 1Z29A 2OV2A 4Q1CA 1F2TA 2V1UA 3D31A 4CZ2A 3IQWA 4P32A 2XZPA 5K8IA 4LWZA 3U2QA 1W4AA 1OB2A 1P9NA 2ZREA 3QEJA 4WZBE 1W36C 4HAZA 3KKNA 5FPTA 3HYTA 3QQ5A 4I81A 2AX4A 4J0QA 4DSOA 4BECA 1U8YA 1SHKA 2FPKA 3EWAA 4V0OA 2FN4A 2GBLA 2IYUA 3RS3A 3TJZA 5HKKD 3EPLA 2FMXA 2V6IA 3VR4A 2P3SA 1TPZA 3GLGA 2F1HA 4A2QA 2RGBA 1VCMA 2HDNB 3C4JA 4LBWA 2BEKA 3W6NA 4XTRA 4XSGA 2H92A 1SVLA 4UNQA 1DS6A 1RJ9A 2CHVA 2AL7A 2VP5A 1X86B 2ZJ5A 1JXOA 1E2NA 3BFXA 4Y0VA 3BE4A 1RZ3A 2ZITA 5KPDA 1TUEA 1ZC4A 2W00A 5KNDA 1IBRA 2OO7A 1E2MA 2P5TB 2C77A 3H0KA 4RKEA 4PHFA 4TL6A 4W5JA 4IOKA 1F2UB 3NVAA 3KQLA 5EP2A 1N6OA 1N0WA 3TH5A 2DFKB 3PUVA 4B75A 3KX2A 1VG8A 1UKYA 1MOZA 2VL7A 1W44A 2A3RA 4IKEA 1IAQA 3IKJA 1TUIA 1AM4D 1OFUX 3QVVA 4JIMA 4NCIA 4RD6A 2B6HA 3CRW1 2ZSBA 4RSGA 4V0KA 5JWRA 3IIMA 4OI4A 1UBFA 5H68A 5JI3E 4L5BA 3B9PA 4LJYA 2ZI3A 4CEJB 1N6KA 2YZ2A 1TF5A 3ADDA 2YHSA 1GM5A 3GCGA 4B2IA 3D6TB 3KXIA 4OHXA 3GJ8A 1KNQA 3IGFA 4PFSA 1BMFA 1LF5A 3ZZTA 3UG6A 2LKDA 3T1OA 3RC3A 1J8YF 2W2VA 2J41A 2WV9A 1Q1QA 4YMSA 1E1QD 1RRGA 3MUFA 2ZJYA 4HB0A 3R7WB 2NQ2C 2J0QA 1Z6TA 4IVRA 2JA1A 3QEOA 3S1AB 3GLIE 1KO8A 2V1XA 3LQRA 3K09C 4NKRA 2Z83A 4N0DA 3RSOA 2VIIA 1Y3AA 3RWMB 1EESA 2HJVA 4U7DA 2BDTA 1CR0A 4KFRA 2MSEB 1NN0A 1HEIA 3E70C 1R8QA 1VECA 3B60A 5TVKA 5IRCD 2YWHA 2AD1A 1XMSA 3RS5A 2BEJA 2YC4C 3I5XA 1AQUA 3I4LA 1VIAA 1HE8B 1RVDA 1KSHA 3QIAA 3MAAC 3RC8A 5JWHA 3LVQE 4M21A 2EW1A 5LDDC 1SXJB 2PMKA 1HA3A 3Q3JB 3PV0A 1J7KA 2QMHA 1KO1A 1MABA 1T6NA 4GRAA 1A4RA 4UNRA 1TU4A 4XWKA 2WZQA 2FGKA 2QMEA 1J90A 1H8ED 1NLZA 4MKHA 4Q9LA 5AJZA 4CW7A 4JVNA 4A0HA 2Q21A 3K0SA 2N46A 4QBHA 621PA 2VRWA 4ZDIA 3L0PA 1QVAA 1XTKA 2XOKA 1T0HB 2FFQA 3U7GA 5FBVB 4CEIA 4D2IA 5IDVA 4W5HA 1HYQA 4JS0A 2WAYA 1LVGA 3FB4A 2DWOA 3K9NA 2WIBA 4Q19A 3SYLA 5GVSA 3NEYA 1IHUA 3ZQJA 5CB6A 5AJYA 1I2DA 1P6XA 4YONB 4OJQA 3ZVNA 1AKYA 4AWXA 1XPOA 4A9AA 1KK2A 4DCVA 3HU3A 1KO5A 4FINA 4ZI2A 2ZAOA 2KB0A 5G40A 3A37A 4LBVA 4DDTA 1XMIA 4N3NA 2F3TA 1UPTA 1X1SA 221PA 4DLZA 3M4YA 4LUCA 3NWJA 5A4JA 4H9GA 1ZIOA 3L43A 3WBJA 1ZM7A 2C95A 2QE7D 2ZI7A 3CUEF 2BBOA 1XEWY 1Q12A 1D8TA 1GNRA 2PH1A 2IYWA 1H65A 4Q1DA 4KYUA 1R0XA 2IF0A 4CEJA 1S4QA 3GJXC 3R20A 3K0FA 4LJ4A 4II7A 3EZ9A 3Q7PA 1XWIA 1YRAA 3LBHA 2RHDA 4PO1A 5AUOB 1WF3A 2ZR9A 3K9HA 2DYKA 2I3BA 5F3WB 2R6GA 4GBMA 5AR1A 4KI0A 2EFCB 1G8HA 2KSQA 1Q1ZA 4JBXA 4NHOA 3VAAA 2RGEA 4WZAE 5G3YA 3S1AA 1XNJA 3U6BA 3A4LA 1KGDA 1AA9A 1OH5A 4BUJA 3AQ4A 4LI0A 1SKYE 1P72A 5D3QA 5F9HA 1LV7A 1X6VA 1C9KA 1P62B 3KQHA 1QRAA 2FX3A 2O8EB 2ERXA 5AJWA 2J45A 4HZUB 1CR4A 4OKSA 3CR8A 5P21A 1OIVA 3DL0A 2IYYA 1N25A 1GFIA 1X3SA 4DDUA 3THYA 1Q3HA 5JI2E 3GJ3A 1DBSA 1NP6A 3T1QA 4M1OA 5DHAA 4YLGA 1W5TA 4URUR 3FE2A 4B76A 4QGFA 1XDBA 2NO7A 4XD7A 3K70B 2IS1A 2LKCA 2F43A 2WKPA 2XNDD 1Y63A 4LHZA 3ZD6A 2Q3HA 2O0KA 4N0EA 1KO4A 2ZRJA 2RH5A 2VP4A 2JLVA 2ZVPX 3H86A 3KKQA 2J0UB 2PZEA 3C16C 3PEUA 4PHTA 4PSAA 4XVQA 5GJCA 3SFVA 3V00A 2QBYA 4C0SA 3UPUA 1BMFD 2JIZD 2F3RA 1II9A 1U9IC 4Q7MB 2GNOA 5TARA 1TQDA 4CRWB 3QXCA 4HEJA 3AF1A 1FTSA 4C0QC 4GOXA 3SNHA 3DZDA 3GFOA 5FOTA 2Z6VA 1W2GA 3A1VA 4KFTA 2GBLC 4M22A 1FZQA 2JJ1D 1G3UA 2ODNA 3ND9A 1GL7A 4GPTA 1ZUIA 5CLQA 1YQTA 4C0JA 4I1UA 2E87A 4EFMA 1CJUC 2BHRA 2CXXA 3NBZC 1Q20A 3QKSB 4IDOA 4F91B 3QUSA 4EPRA 5AUQA 3F8TA 1RYFA 2CCGA 3K8YA 2F7SA 1NG9A 1VMAA 3FPAA 1G5RA 1KZGB 4PC3A 4JLPA 4TMZA 2WWIA 1KAGA 2QAGA 2PX0A 1HTWA 3AVYA 1PVOA 4PZZA 2XAUA 4C30A 4Q4AB 2ZJZA 3EPHA 3KJIA 1JBKA 1E6CA 4KVGA 1N6PA 4HATA 5BN5A 1FP7A 3CONA 2ZJBA 2ZS9A 1DAKA 2ZSEA 4LK2A 3UMFA 4A6XA 4DB2A 4L4UA 2O8FA 4IDQA 5KSYA 4TT3D 2IYLD 2QROA 1WMSA 1TTTA 3GLIA 2GJSA 1KNXA 3DM9B 3NHBA 4ASUD 3VNUA 2FPMA 4K8OA 1YZTA 1E9RA 1G18A 2G1JA 1W49A 4OQNA 3ICQB 2AXNA 1EK0A 1NLFA 1G7CA 3U6KA 2OT3B 1EGAA 2BIFA 4OHVA 3VKGA 3OIYA 5EJEA 3LBIA 3V4FA 5JJIA 2XB4A 3G82C 1SVSA 4BGDA 2ZS8A 1CJMA 4A8JA 4TYYA 1CBUA 4BRWA 4ABYA 3AV0B 1G9XA 3O8CA 4RCYA 1VG1A 1Z5ZA 5JMTA 2G83A 3AVOA 4LPKA 2FU5C 2CK3D 3R9WA 1VTKA 2IHYA 2IXGA 2ZR7A 2QP3A 4NP6A 4DIDA 1S96A 2HYDA 4YMTA 3CX7A 4D0GA 2ZRGA 2FPLA 2IYZA 1ZM4A 3WMFA 2UZ3A 1TEVA 2DFNA 3QPVA 4Q9JA 3TSWA 1G16A 3I92A 3MG9A 1UKEA 4JLBA 2JJ8A 1FQJA 4RKFA 2ZUDA 4O2LA 1COWD 4TTRA 1W4BA 1UKZA 1A82A 1NKTA 1FTNA 4V0ME 4E22A 4EJSC 1P73A 5FTKA 4NCNA 2JDIA 2QORA 2QP4A 1Z28A 1DARA 2H16A 2XGJA 1U99A 3TBKA 5IF9A 2D74A 3PUWA 4FI3C 2ZXUA 3FTQA 5SZKB 3NG1A 1W0JA 1GZSA 5EP3A 1E99A 1KK0A 2RGXA 3ADKA 4AD8A 3B7GA 2CVFA 1CJKC 1JXMA 1WB9A 3W5IA 1MO3A 2P6NA 1Q21A 2RKOA 4AKEA 3KB1A 2D4HA 3KJHA 4MA4A 3H84A 2EYUA 4AC9A 3D3QA 4RCZA 1SXJD 4BLSA 2H1LA 2ZTSA 4OBEA 1AZSC 1QHHB 1XXHB 4WA7A 4TMKA 2P67A 2PZFA 3GJ0A 2FG5A 3R9IA 5ANRB 4DT1A 1Z22A 2KWIA 2WJHA 5KNCA 1P9WA 1FX0B 4EIWA 1GRNA 1L7VC 4DJTA 4PPNA 1HT2E 3TW4A 5E7MA 2V7QA 1NMXA 1G1MA 1AZTA 3UMRA 3OIWA 2JLZA 1MR3F 3UKDA 1GKYA 1PLKA 1RRFA 2A78A 2P65A 2GRJA 4WXRA 4XSHA 1Z83A 4HLQB 2QZ4A 4BE7B 5F9FA 3FVQA 1R7RA 3M6AA 4M4SA 1FPMA 1XTJA 4BLRA 1MO6A 3BB1A 4PQFA 3LA6A 2IC5A 1UAAA 3QXXA 4QJ4A 2WKRA 1VYTA 2XNSA 3OIUA 3QENA 3EA5A 5DI9A 4B6FA 5C46F 2C99A 2YWGA 4ZKEA 3NC0C 1I4DD 1XCMA 3BAFA 3K0AA 1LW7A 4DVGA 2C78A 3BH6A 1Q1EA 1JB1A 2CHQA 3C41J 5DYGA 4PXAA 1P4SA 4NCJA 2ZSFA 4P4TA 3CPEA 3MSXA 5AUNB 1OE0A 5J4LA 1F3OA 4M1SA 1M7HA 4KBGA 2FEOA 1TU3A 3QVUA 2GVZC 3P4YA 2ZJOA 5FTJA 2H57A 1BH2A 4RZXA 2ZRLA 4OK5A 1IOZA 3NDPA 4Q4HB 4B3DA 3GJ6A 3UWKA 1YZQA 2RHMA 1ZNWA 1UDXA 2O0HA 4AKHA 4KO8A 3QBTA 5CM8B 3CH5A 4HI0E 3CBQA 1DAGA 3LBNA 5HZHA 2L0XA 3GFPA 5FBRB 2R6CA 2PCLA 4TLBA 4JJZA 4E07A 3RVBA 1G7SA 3VQTA 2GKSA 5ELXA 3EZ6A 1Z0DA 1KI7A 1ZIPA 4DB4A 1GKIA 5B57C 4O0MA 3C8UA 1CEEA 1KI8A 3K70D 2QENA 4Z1MD 4L9SA 2WBLC 2WKQA 3D8BA 2GDJA 2RGGA 2JASA 2H5EA 2NZJA 3Q9LA 1D2NA 3TSZA 1PJRA 1KMHB 2C04A 4M1YA 2OCPA 3ZZ0A 4DBLC 3EPKA 1W0KD 1UJ2A 2R6DA 2FFBA 2ZRIA 5HKKA 3CRRA 1CJTC 4JJKA 3QF4B 3H2YA 2BV3A 4D25A 3E2IA 5BN4A 2G77B 1FX0A 2GK6A 2P5SA 3CPHA 4JKIA 4LBZA 1XEXB 4TMTA 1FP6A 1ZUNB 5E7JA 3A36A 3RRYA 1ZC3A 3MCAA 3CNOA 1M8PA 2AHOA 3GMTA 4DHEA 2EFDB 5K8LA 2F55A 1GUAA 2QQEA 3CLVA 5KNBA 2P2LA 1T4GA 1YRBA 2EYQA 2QAGC 3NBYC 3Q72A 4G3XA 4R2IA 2CDNA 1E69A 1KK1A 3OZXA 4L16A 3MWLA 3KJGA 3T5GA 3AP3A 1R0ZA 4AYWA 1IN7A 4TWZA 2CCKA 4C0HA 3O47A 3A58B 4ESHA 1CF4A 5GJVC 3VFDA 1MRSA 4JLMA 2DWQA 4M9QA 1TQ6A 3M0EA 4HUQB 1N6RA 1AN0A 4A2WA 1JALA 3CNLA 3U3RA 3B13B 1UEJA 1EFTA 4LCBA 1GAJA 4E5UA 1Q22A 4Q4JB 4TZ6A 4AK9A 1JEEA 2R65A 1FOEB 4NBSA 3TK1A 1E2HA 4MGZR 2OG2A 5B30A 1CR2A 4A0FA 2F6RA 5JRJA 3N70A 5EUMA 5B2ZA 2J0VA 1T3SA 4M2LA 5C4GB 3DOFA 4V0MA 3GPLA 2VHJA 1E1QA 3CZPA 3T1TA 2V7QD 3PENA 421PA 5KSPA 5FOWA 4EFNA 4Q1EA 1Z06A 1KI4A 3TR5A 5DGXA 1KI6A 2GVDC 4ZDWA 4ZKDA 4U00A 2XXAB 2CE7A 4GMDA 2JGNA 3AGQA 1ZM2A 2I4IA 3BRWD 4EPXA 2D2FA 3U7FB 3I1FA 1KI3A 5DHFA 2CVHA 4Q03A 1VHTA 5FPYA 5DI3B 3U3MA 2UVQA 3W5JA 1Z08A 4GMXA 2V8OA 5H1YA 4RFVA 4ZCIA 2ZI6A 5L3QA 4G5OA 3RLFA 4I1VA 1U0HC 1E0KA 3O8RA 3FWYA 2BKUA 3DM5A 2IYTA 2IUTA 2JEOA 4HB2A 1G3RA 2ZYWX 4WOPA 1OYYA 2A7QA 2XX3A 3DHWC 1P75A 3ONWA 1M7BA 3WNBA 3MJRA 3SC3A 1QHSA 3DEFA 1H8EA 1JJ7A 3NKVA 5DYIA 2P6RA 1XEXA 5AWFC 1KKMA 4DSUA 1E9CA 2FH5B 3L0IB 1Z6YA 1G3QA 2IYSA 1P2SA 3QE0A 1JJVA 3UG7A 2BKEA 4PHGA 4UNNA 5B58C 1A2BA 2MMCA 4M1WA 3SDZA 4NU0A 4EDHA 5JS7A 3CKLA 4PR0A 4US1R 1ETUA 1FQKA 2J7KA 1ESMA 5KDLA 2P6UA 4N1AA 4D6PA 1WBDA 1S8FA 1IN5A 3KKOA 1ZM9A 2ZRNA 3B78A 1M7GA 2GEVA 3N2EA 3N2IA 4YC7A 4DZZA 5G3ZA 1V43A 1ZYUA 2ZRCA 3RHFA 2QE7A 3GJ4A 4OHWA 1SZPA 3CM0A 3UMSA 3G5UA 2D2EA 5F2EA 4P4UA 3QXSA 5JZVA 1K8RA 4M1KA 2ZRKA 4S2EA 1O3YA 2PT5A 3M1IA 2K5UA 1DADA 2OHFA 1SXJE 3K9LA 4Q02A 1WXQA 5FUYA 1ZU5A 1W1WA 1T3LA 2GXAA 1W48A 1QBKC 1OW3B 121PA 3EA0A 2O8CB 3SE0A 3SOPA 5FPHA 1LB1B 3VU9A 5K8UA 1JECA 3FMIA 3GJ5A 4HDOB 5CIQA 4URZR 1OSNA 1RC8A 4QBFA 2HJGA 3SJAA 3KB2A 1E79D 4LSGA 1XEFA 3Q5EA 3AUYA 2R9VA 1XMVA 4LPSA 2YOGA 3T61A 1J99A 4TYQA 4EJSB 5FR1A 2QG6A 4B3CA 2PEYA 4A82A 3RDPA 4DCUA 2VHCA 4OHZA 1NF3A 821PA 4XVUA 2QSYA 2WJVA 1UBEA 3LLUA 4HSEA 4R7ZA 4IEIA 2YOFA 4OL0A 2VHQA 4HLDA 2A9KA 1R2QA 4M53A 4K81B 2PLRA 4FMCF 4HYYA 3I62A 2ONKA 3DMDA 4NTZA 2GJKA 2P0EA 3SZRA 2ZS7A 5FUWA 1DAFA 3LDAA 2R6AA 3Q85A 3WBKA 2AD5A 1OF1A 4ZV4A 5LD2C 1CULC 1DG3A 1Z3IX 2F9MA 2NIPA 4JYCA 2XNDA 2WWWA 3F5FA 5HR5A 1W5SA 1BOFA 1U2RA 4PC1A 2NMVA 4HLUC 1MO5A 2W0SA 3OIVA 2IYQA 4L9WA 1XPUA 4JBYA 4ACBA 4LY6A 4B43A 1OV4A 1IY0A 3FFAA 3P4XA 4NMMA 2JIZA 3MRSA 1YVDA 2CMKA 5LBIA 2GZDA 1GOTA 4CEHB 4QNRA 1NVWQ 5F98A 1DELA 4LJ6A 2J0SA 4KJZA 1AIPA 4MYTA 4FMDB 3DO6A 4PAOA 2XEXA 1CTQA 1XTSA 4XIGS 2WAXA 5C2JB 1J70A 3W3AA 3IQXA 4RY2A 5EQTA 3NXSA 2JJ1A 3P27A 3EWSA 2HEIA 1KYIA 2VP9A 1KJYA 1QF9A 3UK6A 3KKMA 2R6FA 5FBQB 3U3JA 3BIFA 3A6PC 2AFIE 2BMJA 5FTLA 3FMFA 2KBFA 4KFSA 2BMDA 4RFSB 3FOZA 4TQ9A 4WZ6A 4JL6A 4AG5A 4B3XA 4ESVA 3BH0A 1K5GA 3WNDA 3BORA 4EQ6B 1G6HA 4JBWA 2J46A 1G41A 1YZKA 3TGPA 1EX6A 1GIAA 3CF2A 2A5GA 2O8BB 3VX4A 4BFSA 2KBEA 2YJTD 3EAQA 4BLQA 4BRUA 1Z63A 1OH6A 1MKYA 4LHYA 3A1UA 2NPFA 4MYUA 3SU8A 3I8SA 4M1TA 4QKQA 2OAQ1 3L8ZA 1W7AA 4OHYA 4NYIR 4PPQA 3THWB 4TT3A 3FGNA 3PXGA 3SYKA 1NIJA 1BS1A 3B1WA 4KSBA 2NZ8A 3FHTA 4ASUA 1XFAA 2NGRA 1NNEA 4R98A 2HYIC 4C0KA 4A15A 3K1JA 3KJEA 4DSNA 3THXB 1PZNA 4L8GA 3WRYC 2ODBA 4DLSA 5SZJA 1QHGA 4GSYA 5KTYA 2F1IA 5AJXA 1F2UA 4PC7A 3A4MA 4URXR 5DNYB 5FPKA 3LXRA 2GILA 4QGGA 1OFHA 3RSLA 1CR1A 1Z6AA 1OT3A 2NTYC 3HR8A 2Z0MA 3B6EA 4ACAA 4QHSA 2ZUBA 5J5CA 5BYJA 4TSFD 1JR3E 2J5XA 4GP6A 4NDZA 4FW9A 2PJRA 3R8FA 3UWOA 1E98A 4DDWA 4P33A 2CK3A 4I1OA 2ZJ8A 4C0BA 5JEDA 4A0GA 2TMKA 5JCPA 3ASZA 2OZEA 3SJBA 2C9YA 4A36A 4GZLA 1OJLA 2QNRA 1UF9A 4DEXA 3HDTA 1YJ5A 3ZGXA 5GJBA 2ZU6A 3EC1A 4DXAA 3BJIC 4AYTA 4Q47A 5KDDA 1N6HA 1COWA 1GP2A 4LRWA 4TN1A 1E2DA 1II0A 1PLJA 3R7WA 2DCUA 3D7MA 2ATXA 2XJ9A 5KU1A 2QA5A 2RB4A 4QHTA 3VX3A 1YZGA 3MMPA 4E03A 2WICA 4YMUA 1NVXQ 4G5GA 2VHTA 3U60B 3VR2A 3IBGA 2OBNA 2IF2A 2IXFA 3CO5A 1ZMXA 1GDDA 1P61B 3BB3A 3L0OA 2MMGA 2JAQA 3C14C 3EXAA 4RFSA 4Q01A 5JWOA 2XZOA 3U3KA 5D3MB 5L3RA 2OEPA 4ZIRB 5FL7A 4TTQA 3SYNA 1FUUA 2PMDA 3EASA 4DDVA 3T1VA 3BFKA 1IONA 1QDEA 2VA8A 1U0LA 5EP1A 2C03A 1SXJA 1U94A 1II8B 2OFWA 5FI1B 2GHIA 4IDPA 2D7DA 3THOA 4Q7LA 3GJ7A 4OYHA 2CE2X 4NPHA 1TQ4A 2ZRBA 2CL0X 4NZYA 3PJRA 1Q0UA 1QHYA 4G5QA 5JHGB 2AKAB 4TLDA 5H70A 1ZAKA 3EZ7A 4PAQA 2BM0A 4OI1A 3KZ1E 2QMUA 1W4RA 5CK5A 4GI7A 1LTQA 2QI9C 2EFGA 3AF4A 3QNUA 1D6JA 1XCGB 2BC9A 3MWKA 1AS0A 5DIFA 3CX8A 1GKUB 3ZIAD 5A5GA 5H8WA 2RGNA 2JLYA 1B23P 4HLCA 2V6JA 1UBCA 2OXRA 1E1RA 4FCVA 1NN1A 2HF9A 4IFEA 3SJCA 3VR6A 4HB3A 3FHCB 1KK3A 2JLQA 1KMQA 4D80A 1MT0A 1JAIA 4NYMR 1YKSA 4O25A 4MKGA 4UQOA 1YU9A 3T06B 4ZDJA 2GZAA 4TZ0A 1MH1A 3LX8A 1XEWX 1EFHA 2AK2A 2NG1A 1S3SA 3ETLA 3IEUA 1CRQA 1C4OA 1IXZA 5SZIA 4YMWA 4Z8YA 4IDHA 3AP1A 2ZPTX 1N0VC 5DE3A 1R8SA 3UANA 1L2TA 2G0NA 1XXHE 2YVUA 1OKKD 4JLDA 2FNAA 1PV4A 2HCBA 3AB3A 4XVRA 2ZRMA 5IT5A 2B8TA 1G5TA 2R8RA 4HAWA 5JSZB 1P2UA 3CRVA 3ZZUA 2B8WA 1T5IA 2PZGA 3PFIA 1XJ0A 2VLIA 3QKRB 4P4SB 3CX6A 3IHLA 3ADBA 4BFYA 2IS4A 4OK3A 2O8EA 4HZUA 5CYOA 3C5CA 2CL7X 4UJ3A 3TVTA 1WA5A 1KDPA 2GETA 1OFIA 4QHYA 4C9BA 5FTMA 2XTMA 1XD8A 1BO6A 2WJYA 1G8FA 3U44B 1QVRA 1NVVR 2ASEA 3GEHA 4E09A 4XWOA 1EXMA 1L8QA 3EZFA 4DIEA 3TUIC 4W5WA 4FD2A 3IPYA 5EXSA 1D2MA 4Z1MA 4EPVA 3K9GA 4BASA 1OLOA 1MO4A 5FUXA 1UBGA 3W8RA 2ATVA 4MH0R 1W0KA 4TYPA 2ZRAA 3TKLA 2CEAA 5FOVA 2FZLA 4QNMA 4KLNA 2QGZA 3SJZA 1KI1A 2ONJA 2PL3A 1W36B 2J0UA 4BFZA 5L8VA 5B64A 5CITA 1N3BA 3B2EA 1VDZA 5FOXA 1NMZA 2O8DB 1N5LA 3L82B 2QU8A 3AF3A 3NEJA 3LV8A 3T12A 5BYKA 3EX7C 1ZCAA 3EG5A 4DLVA 3KQUA 3Q7QA 1EX7A 4Z51A 5KO2A 5KOYA 3TAHA 2NO1A 2KE5A 1DAHA 2J1LA 3TNFA 1KDTA 5IHPA 4JLKA 2CLCX 1QG4A 5CDFE 1EFUA 4GFDA 3W90A 3CZQA 1S1CA 2WJGA 4B2PA 3AKDA 4BWYA 3QKSA 4AYXA 4QBIA 2OCBA 4NCHA 1TMKA 4ZI3A 3FKSD 1PUIA 4H1VA 1QHNA 4KVAA 5FL7D 3RABA 3VR5A 1JR3A 1DO0A 2EQBA 4LYAA 1F5NA 1P60A 4KFUA 1NL3A 5C4MA 3HWSA 1MRNA 3X1DA 2H17A 3O8DA 4Q4AA 3WHLA 5UKDA 3JVUA 5KUTA 1TAGA 4V02A 1N6IA 4RD0A 5LD2B 4ZO4A 2WMOB 1YZNA 2GXSA 3A4NA 1J2JA 5CK4A 3MLEA 3W9YA 3MFYA 4I99A 3BOSA 3B82A 2J3EA 2E9SA 5J4YA 4G5SA 2YOHA 5KHOC 2LCFA 5HPYB 1AGRA 1DOAA 1GRRA 3LLMA 4XH9B 2D62A 4BEBA 4TL7A 3LQQA 5FH9A 2Z43A 1W2HA 3KXKA 3I3SR 2WIAA 1NSTA 4C4PA 4ARZB 2GF0A 5AUPB 5J40A 3VMFA 1TQ2A 5CLLA 1E1RD 4V0NA 1FMLA 4IRUB 2HF8A 4PC6A 1XP8A 2WPDA 4RVCA 1E2LA 1S9DA 2YWFA 4OQXA 2FOLA 2ZRDA 3KFXA 4LHXA 4WBSA 4LHWA 1AS2A 3IEVA 1WP9A 1YHNA 1X8LA 5EE9A 3WHKA 1F6BA 4HAUA 1ZNXA 2O5VA 4LJ7A 3AKYA 1IQPA 4NH0A 1NN5A 2ANCA 2FGJA 2WOJA 3K0CA 4B6EA 3GLHE 1S9HA 1VG0B 4KV9A 2AN9A 5G53C 1I2MA 2FSGA 2VO1A 2VF7A 3NH9A 2D3WA 3CRQA 3KUCA 4YDHB 3KFVA 2JJ2D 4PSKA 4TLEA 4XJXA 4HUTA 3BH7A 3TQFA 3QF7A 1M74A 4JZKA 1ZCBA 3RAPR 1HH4A 1NY6A 4B44A 2WWFA 1CLUA 3B8HA 2RMKA 3WP0A 3NDBB 2ORWA 2VTKA 4HDCA 3BGWA 3QSYA 2GJ9A 1D2EA 2WJJA 3A1WA 5CYPA 1E2EA 3RS7A 4CF7A 3VNVA 5FPSA 4ITRC 4A1FA 5JFGA 2V4ZA 3IBYA 1DAIA 4RD2A 3OESA 3SN6A 1OXSC 3W6OA 4WAUA 3V4RA 1QZXA 4D81A 5JHHB 1A2KC 1OXXK 1E0JA 4LDJA 1OH7A 3OE7D 1GG2A 1SVMA 2REOA 2QPAA 4DLRA 1UKVY 2IXEA 4OQFA 1E9EA 3TW8B 2Q3FA 4QFMA 1PLLA 4B2LA 4IXNA 4JVLA 3OEHD 1QHHA 2CBZA 5DN6D 1XXHA 2ZSAA 3NBXX 2OE2A 3EW9A 3TE6A 5IK2A 2ZJAA 4PO9A 1G8GA 5CJPA 5HCNA 4JSTA 2YINC 4DKXA 1XF9A 4G0NA 3OFNA 1EFRD 3LH5A 1Z07A 3QG5A 4KITB 2BBWA 2OBMA 5EXTA 1RFLA 4PO8A 1N2CE 2OLJA 2CJWB 2HLDA 2OXCA 2MSCB 4JKYA 2W6JD 4LJ8A 1E79A 3ZYCA 5TMPA 1NKSA 5EE1A 2J9RA 4A2PA 5LPNA 2NO9A 2OILA 1OIXA 4KAXA 4D4KA 2C5LA
chains in the Genus database with same CATH superfamily
3LVRE 2SKEA 1WABA 2JH9A 3ZDQA 2YN4A 3EEBA 4AJEA 4Z53A 3ZHYA 1MC1A 1PFGA 2O2GA 4GP7A 2VSFA 4AI6A 1XGKA 1B00A 1EX9A 2Z4TA 3FCOA 5EXXA 5TPZD 3D6MA 4BNUA 3LC0A 3U49A 2O7VA 1ESCA 3DXZA 4ER7A 4JQOA 3LBAA 5G0VA 1Z2EA 1R8XA 2FUKA 4PRKA 2H18A 2ODAA 3PC8A 4LYHA 1NZJA 2PKWA 2DR2A 4F85A 3ZDAA 1T5DX 1PT6A 2PGJA 4E46A 2AN1A 1C80A 2YRFA 5K99A 1DV1A 4V03A 5DFAA 4KIJA 2JCXA 4U2KA 3ROTA 3TG8A 3V9PA 3BMOB 1OLSB 3TQHA 2HGSA 1VKNA 3T7JA 2D59A 4RA6B 1WDWB 2ZATA 1Z47A 1YT5A 3LOPA 4UFNA 2WJZB 5AOBA 2D1YA 2JJMA 2NSJA 1TQHA 2BBSA 3K96A 3CU5A 3OCWA 4LVUA 1H2BA 2OR3A 3OOEA 3GHHA 5BNTA 4MQFB 4QYMA 1CCWA 1VPVA 1YACA 2HIMA 2HF7A 2WMDA 3EEIA 4GZMA 4OQQA 4URVR 4J6FA 3Q4GA 1HE5A 4WKGA 4AZSA 3NBFA 3B5EA 5SY4A 1C1YA 2R5WA 2G4LA 3DOCA 4W5TA 2EDCA 2X58A 4R05A 1MV5A 3KQWA 1DUVG 4HNUA 1KPHA 3K1YA 2V96A 2VBIA 3BE6A 1U9YA 1BX3A 3LT1A 1G7RA 2IEGA 2YV1A 2JB9A 3T5DA 1YMQA 3KHUA 2JCVA 2QY9A 1C7EA 4LFBB 5DLYA 1ZX1A 2ZEJA 2F1JA 2ZBPA 2GCNA 4R8RA 4YAEA 2CY0A 2XD9A 2CLSA 4ZAGA 1XVVA 2OFXA 5EJAA 5F5XA 3RWOA 1L8XA 2ZIGA 2IZ1A 1JYEA 3A05A 3FZNA 4K87A 2IHJA 1MW9X 3LAWA 4YJHB 2F9LA 4Z9YA 2LXNA 3ZU6A 4D9BA 4DCSA 4EATA 4EG3A 1DIOB 3I37X 2NO4A 2BJVA 3RYFA 3ZI0A 5KSOA 3TW8A 3L0CA 4QDKA 4FWBA 4UMDA 4A6DA 3G79A 2FV8A 4B3BA 1KI9A 3N2KA 1P9OA 4IWNA 4XGQA 2JHCA 3MGAA 5A71A 3W3ZB 1W36C 1PJTA 6CHYA 1ZUD1 3VSCA 4RHEA 1KMHA 1G19A 5CG2A 1GTRA 4R5HA 1U5BA 3AVTA 1KEPA 4R8LA 3OM8A 4KH0A 3SXUA 1BWPA 1XO1A 4FCTA 3UATA 1Z0JA 2Z3WA 2ZYUX 4RGYA 4RPLA 3ILSA 2V3CC 2O2XA 3NAMA 3R5JA 2RCNA 2JFGA 4G85A 3RI3A 2HUNA 2P4HX 3H9QA 2IW3A 3MFQA 2Y9MB 3CZRA 3PXUA 4Q7EA 2I87A 3BGSA 2FUEA 4AN1A 4PZ9A 2N1BA 5IUKC 1YZYA 5HM8A 1C3OB 4HDQB 4PZAA 3QOXA 1W75A 4YMVA 1IY8A 2QTVB 4XQEA 1PJLA 1XA0A 2QLBA 5TGDA 4RD4A 3AKZA 1GNQA 2GRAA 2WMNB 2ZIWB 5JAUA 4M0MA 3V8VA 1ZU4A 3EXFA 1VI5A 3QUBA 3KT3A 3DE1X 4MKIA 1VE3A 1UEIA 3OQ1A 3U3OA 1G42A 3DAOA 4EYKA 1Y98A 2V9CA 4PLVA 4EBBA 4L4ZA 2PUWA 5DCWA 4BNKA 4DYDA 5ER9A 4HUQA 4BWFB 1OH8A 1E6LA 2OC4A 3GX1A 2IFTA 2FAXA 1CUXA 2IU3A 2CXQA 4KQ2A 4ZGGA 2P30A 2FQXA 3NHAA 4L1KA 3GIWA 1J39A 4UXJA 1UDBA 4LJAA 1FYDA 1L4LA 4BMZA 1G7TA 4Q9KA 4WLOA 4TSFA 2YX1A 4OUDB 5CLFA 1I32A 4F4HA 4S35A 2RAFA 1V6AA 1P31A 2B69A 3MUEA 4P5DA 4UCXA 4EG8A 3AX6A 3WSVA 2LWIA 2HKIA 3DZJA 4I6JA 2JZOA 2FMTA 5LZ5A 3KL4A 4PF1A 5IK2D 1N92A 2QRJA 3FYUA 1UK7A 4YALA 1O54A 2B5OA 2ACKA 3GCWA 4AU1A 4F46A 3OFND 3RQIA 1JR2A 5JYBA 4FTWA 2FJUA 4YASA 1DRJA 1TX4B 3U39A 2JIOA 1LS1A 1QIHA 2LDBA 4IXDA 3ERCA 4KH1A 3E5RA 2ZB7A 4QXAA 4U8HA 4NARA 4EW3A 2OGZA 2GJAA 4UM9D 2HLDD 1XTTA 3BEOA 1T9DA 3C24A 3E23A 3V1MA 3WKAA 1U9IA 1ORTA 1WUKS 4Q3KA 1ZKDA 2A2ZA 2QJWA 3PK0A 4UBKA 2XXAA 2AOUB 4OQPA 1Q2UA 2C2KA 3ZU4A 4XDHA 2GD1O 3UPDA 4YY3B 2VQ3A 4BMYA 2ZUUA 3DPSA 3K6RA 3H8WA 5HMLA 2XB8A 1R4MA 3WMEA 3ESCA 2JZNA 1NBAA 2PR7A 5GADl 4G8CA 3OY7A 4CU2A 4E51A 5D3KA 2W58A 3ZE2B 3PUYA 1LLDA 2C31A 2EGUA 4WXPA 4KK4A 3CRMA 3QBVA 3MPUA 3NYWA 4CIVA 3MIZA 4LGCA 3ICEA 4OV6B 2WP8J 3A32A 1NRXA 3GDGA 1RJEA 3C48A 4BLWA 4YREA 4OOEA 4YACA 4UBJA 4WV3A 3WWDA 4HNQA 2GXUA 2QR5A 4QYXA 2NV6A 2BR3A 4FE3A 2YYAA 3IUYA 4H3SA 5IJWA 1WHTB 2YW2A 4PG8A 2KI5A 1OLXB 3L84A 3D02A 3DMTA 2IY9A 3NUZA 1YR9A 3S5JA 2GTHA 1K88A 2GYVA 2ZWMA 3PHGA 2A5YB 1NZFA 2WSMA 1JQJC 4LRSB 2C84A 1I5RA 3EZYA 3KDSE 5AIAA 3SS8A 2ODWA 1K89A 3BWXA 4QEKA 2B4QA 3ZCUA 4WXHA 4NESA 3B9BA 2P9YA 2GTPA 1TK9A 3MC1A 1FLAA 3ZIAA 3SI7A 4CM1A 4M54A 1GZ6A 2VXYA 1NR5A 1ZD4A 3DL4A 3S3TA 4EW2A 3R3XA 5KOJB 4I6EA 3DW1X 3PX7A 2QW8A 4TQGA 4DXDA 3TQCA 4KV7A 4Z6KA 3FOCA 4YK7A 4CIWA 2VYFA 5LOVB 5C32A 3R74A 1TADA 3L4KA 4OREX 2D3TA 1MJNA 1HBJA 1Q57A 5CIWA 3U7QB 3RROA 1PQWA 2HIHA 4A8HA 1VPLA 3F6PA 1NTOA 2EP5A 1BD3A 1U0SY 4ND2A 1V45E 3BHIA 2HXSA 4OUDA 5FYQA 1XDUA 1OX6A 3LO8A 3JZMA 3F3YA 4N18A 1UOQA 1AF7A 4NK5A 1E3JA 2FUCA 5I6DA 2GGSA 2IPLA 3ZD7A 4CHTA 3DP9A 3PFNA 3ABQB 3I12A 5C7OO 4NF2A 1WW3A 2A84A 1NBEA 2GF9A 1MMFB 2QPLA 5K6TA 2P4SA 3SQXA 4GECA 3L8FA 3O1HB 3WYAA 1CU1A 1OPXA 5BNIA 1LSJA 1VMIA 5IDYA 5E9WA 1ADJA 1KI2A 1QX4A 1MDBA 1IPHA 1RW4A 2JVIA 3BDVA 4U2GA 2FW1A 3UV7A 1X15A 4JVOA 3ZXIA 5F64A 5I48A 2CZGA 4DLAA 2GAFA 2R751 3VYWA 4R1SA 3IT1A 2RHCA 1TCAA 1JKJA 1NE2A 2C88A 1WDTA 3PD1A 4K8RB 2ERYA 4JWKA 4DLWA 3FYDA 1UPCA 5MFPA 1TL7C 1ULHA 5LB4A 3VOBA 1GSHA 5I8WA 4LTDA 1CEYA 4UEQA 4AMYA 1RJGA 1VC2A 1ZY2A 4AO7A 4FBLA 1VYUA 2R1ZA 5BT9A 3S5UA 3ZGZA 5TT1A 1G3IA 3MYRA 2ODEA 3KQMA 5CCDA 4AMVA 1HQDA 4L8VA 5D7NA 3HBMA 3R24A 3W9UA 4YT4A 1GAEO 1ZVJA 2W6ID 1O03A 2C57A 1XTQA 2V74B 2BTEA 5IMBA 4B3GA 1KAOA 1QV6A 2ZKIA 3TJMA 5C5EA 1F60A 1H1TA 1LBQA 1RC0A 1TYEB 3ASYA 4C0AC 5CB4F 2WEKA 5IX8A 1E66A 5JCPA 3CS3A 721PA 2JVJA 4NEQA 4WQMA 3AI2A 2PTHA 5BY2A 2FHSA 5GWXA 2NACA 4FOLA 3W1WA 2VPPA 3O92A 1G9TA 3JQFC 5FIUA 2WVAA 1SQ5A 3MTBA 3NHSA 1XVUA 1Q0RA 1U1EA 1Y5LA 2FXIA 3ZU3A 1W85B 4QELA 1RWBA 4FYWA 3EVTA 4FC7A 4FCWA 3ANNA 3Q6MA 4JU8A 2VBGA 2ZRQA 2NXEA 4QULA 1LDYA 4LE1A 1JQ3A 2X0IA 3CWCA 1NUSA 4CEHA 4D6YA 4GGMX 2W43A 3R0XA 1VZ3A 4S1TA 1UK9A 5CT4A 4K9DA 4FX5A 3RFFA 2OO3A 4TMXA 2AYYA 3WGOA 4MKXA 2GK7A 1DTSA 4BATA 2XRFA 5IM5A 5T67A 1GQQA 1EJ0A 4H0CA 2OBLA 2VSQA 4OH7A 3TGWA 3JQ8A 3CVWA 1JHXA 1NG1A 2FEMA 2OUKA 4JBGA 1OWOA 6YASA 1EQUA 3AEZA 1AZWA 2AOWA 3PDIB 4XPZA 3ZQUA 4IF6A 3DWEX 4K86A 2Z5LA 3IMFA 1FSZA 4P35A 3D7SA 3DJFA 4I7EA 1JQDA 4DY6A 2VPXA 4EP1A 3BTUA 1QK3A 2PBFA 4JODA 5BN5B 3O38A 1K3UB 3VYTB 3ZGNA 4TWJA 1XZEA 1V1MA 3B3GA 3CF4A 3QI7A 5TQ2B 2FQ1A 2O8FB 4G67A 1Z5PA 3CINA 1PV1A 2Z5FA 3C5WP 1X8JA 1PZHA 4ZQCB 3HN2A 4F7WA 2NXCA 2UYOA 3IXLA 1K97A 1R18A 3PITA 1LLUA 2AC4A 4Y2YA 1QLHA 4I9GA 1GV1A 2COEA 5LA6B 4EHHA 5DYYA 5CHEA 2IJGX 2JIMA 1VQ1A 2VWPA 3QOFA 3WIDA 3IDZA 1Z2AA 1A9OA 4YCCA 1EI9A 2EF1A 2Q4TA 2QV7A 1YR8A 3EVEA 1TCVA 2HHCA 1QKKA 1M2NA 4I50A 4HXEB 4J6EA 5AW3A 4RQBA 4JB8A 3NANA 2BGWA 4G23A 3OFSA 1E4VA 1WRBA 3C6YA 2DY1A 2I4NA 4EAAA 4G09A 5C52B 3O7WA 1ID8A 3FOAA 2BT4A 2GWRA 2VJNA 5E8JA 2IDZA 2YN2A 3H5IA 4LMRA 5C5CA 3C7KA 5JE8A 5HGXA 2MYPA 1G20E 1T2EA 2LR0A 4A26A 4A8JB 5IXYA 1GRVA 1X7ZB 2HXYA 2FQWA 3WNCA 5HIJA 3ZJUA 2Q5QA 1ZNZA 2FSHA 2OB1A 3FYUC 2AXPA 2QPOA 3GMIA 3TB6A 4P86A 3ZNQA 4NBNA 5DX8A 3ZNPA 4IIGA 5A1TA 2P9ZA 4GOJA 3PYMA 3DKPA 3I6ZA 2VVTA 3D3EA 4PRYA 4Q9IA 5GM1A 3SQDA 1IEWA 4RQAA 4E1VA 5B55A 4O1HA 1BDHA 1TW3A 5BNFA 3UHFA 5A9SB 1YR1A 3BERA 2IX3A 4PPFA 4V38A 1P7VA 1P17A 1X8XA 2IU4A 5EP4A 4BEJA 1RHQA 5DB4A 1VHLA 4KMOA 2Q4EA 4IMPA 3WLNA 4PTLA 1GLVA 4LJ5A 4WA8A 2AOXA 3UUFA 2XI4A 4FDTA 1EVIA 1PE0A 3QPBA 2NV2B 3WWOA 3WY9A 2QT9A 1IXSB 2NU7A 4KBFA 3VSAA 4Q4LA 1G2IA 1CRWG 1ZQ9A 3OJFA 4FSHA 1ESNA 5JY6A 4AKGA 1XLTA 2QT1A 4PZYA 1YVUA 4AJOA 2ECKA 1L7DA 3SC6A 3HYRA 1KJZA 3K2QA 4D3YA 3EY9A 4ZODA 4KKVA 5D6OA 5L9AA 1P2VA 4PSUA 3OC6A 2FSFA 2FZCA 2J9XB 4K9NA 1B16A 3O4JA 1KFKB 1GITA 2PUTA 2NYRA 3TOZA 3UKOA 1KKLA 4RGQA 1YZUA 5TEVA 3E4DA 3HKEA 3HSYA 1XD9A 2PGOA 3I53A 3U4IA 4FJ0A 1U81A 4IIVA 3K72B 3AONB 3NH6A 1VCIA 3L0DA 1EVYA 3DMFA 1GGHA 1TJYA 4RS4A 2AH5A 2CFSA 3G0OA 4FHFA 2RHRA 3I1IA 2VDLB 4J0GA 4PZPA 4AJPA 3DMTC 4F5YA 3MA0A 3K15A 1M1YE 1QE5A 4RTSA 2B30A 5D3MA 3GQBB 4GIBA 4ZIRA 1EEXB 1N5RA 1YRWA 3N5KA 3OTHA 3SX2A 4DREA 1E3MA 5HOQA 1E6KA 1VRCA 1H85A 4XLTA 4EEZA 1NA5A 1ZWLA 1SOMA 4CG3A 1II8A 4KYIB 1DB3A 4C2UA 2I4MA 2Y4NA 4WZAB 4FEYA 5COQA 2IKSA 2YTZA 4R3WA 1ZGBA 4K6HA 4TRNA 4X8MA 4DGSA 3UFBA 2GEKA 5LKAA 1OAAA 2W93A 1SKYB 4YCLA 5EHZA 2UUAB 3Q3IA 4D74A 5EAIA 4FQ7A 9GPBA 4TKZA 1NXQA 2O2CA 1NRJB 4N6GA 4KN8A 2FW0A 3OM1A 5E2AA 1YL5A 2RI6A 1EWQA 1BS9A 5C37A 1GL6A 2AZTA 4ZFNA 1AQLA 1Q44A 2CKMA 2Y2UA 1GXSB 4Z9FA 2Z5VA 1IM8A 5ITZA 2Q2WA 1VCNA 1MDFA 1WV1A 2V59A 4Z3DA 1THZA 3B3AA 4YRRA 3ZTYA 5G41A 5CLGA 1BGWA 3SM9A 1OGIA 1PSDA 4AMZA 4D43A 4F92B 3RRMA 5LZ8A 3A7DA 4DV5B 3FYTA 5JS6A 2Z5GA 4JJEA 5EINA 3M2PA 4JL5A 2WZCA 3QX7A 1ECLA 3C7CB 1FCJA 2QTGA 3RK4A 3SFZA 3U1VA 2ANBA 4EMBA 5BP7A 5C8DA 4V3BA 2I2AA 4LJ9A 1XRJA 2ECQA 3OP1A 4GNKA 3RT7A 2GCGA 4MHOA 3PRHA 1CUVA 3T4PA 3W8NA 3UGJA 1FNMA 3A26A 3SNKA 4E08A 1MUUA 2H52A 1WQ4A 4YAJA 5BWLA 5LQNA 2UV8A 5GVRA 13PKA 1NVFA 2F48A 1ZN9A 1KHTA 4OQMA 2JGEA 2VDRB 4EF5A 4DA0A 1ZAYA 1DMSA 4ZREA 4CF5A 3NM4A 4EVRA 3IA2A 1K98A 4YLEA 1NC1A 2FI1A 5ARBA 5IKPA 1I7LA 1ZJYA 3N2LA 2QTNA 1SH7A 1FMJA 4MDHA 1JR6A 3HR4A 3C5EA 3DULA 3P2OA 1G63A 2QLMA 4JJ8A 2GBIA 2BZ1A 2EKLA 2V7WA 4KCGA 4AQDA 4CMIB 1Z15A 4GLBA 4D0NA 3LY9A 2XT6A 3FTNA 1EDBA 1C7ZA 2DBRA 4H3VA 1VIVA 4XIIA 2DULA 2HLHA 1FRZA 1H9AA 3FTDA 1ZD2P 3ICPA 3NGLA 4G65A 4LYFA 5B3JA 3SSMA 5IM4A 4P4SA 5DBOA 4IXMA 3U3ZA 3PS9A 1LNZA 3IAAA 3NHLA 3NV9A 2QRUA 1M2VB 2ZI9A 2VJOA 1Y7PA 3NM6B 2WWGA 3QGMA 2PE5A 3GJZA 1OI2A 3GFQA 4LXUA 1ZOSA 3KLMX 4BFLA 3H13A 5CH8A 4E7PA 1QIJA 2DGDA 5KYUA 4NZNA 3QVGA 4AP6A 5CEEA 2UXBB 3GQBA 2WE7A 5FR2A 4KNYA 1G2QA 3NTQA 2XWSA 1D6NA 3ZUPA 3TLYA 1YGPA 2E21A 1OU4A 2H2DA 2QUAA 4K9SA 4N0MA 2EFEB 3H9JA 4GGPA 3S1LA 3STVA 3OIFA 4OB7A 1OU0A 1P5FA 2R4QA 5ALYA 4ZZ0A 3RUAA 3OEEA 3IDOA 2HQ1A 3LO5A 1TC2A 3TNJA 1HRKA 1K6EA 1P5HA 4MUAA 4OTZA 3AM3A 3TSYA 3AKEA 1LLFA 3I6QA 1XU7A 2A5DA 4AG6A 3IKVA 1T6BY 2I7DA 3WR5A 4KLZA 2V55B 3ZX5A 3TPZA 1ZVVA 1KXZA 1YDFA 2EJCA 3JAKA 4F4DA 3OLXA 5C1DA 1LQUA 2RHHA 3I01A 1M1NA 3V3TA 3VU3A 2BSAA 1IJEA 1NLYA 2Q45A 3H1TA 3CN7A 4MGYR 4Q12A 3CVOA 3SSAA 4KW7A 4G5XA 3UJHA 1QYDA 1V95A 3F9IA 4ZU1X 1JNXX 1CIPA 2IIPA 1BXGA 3KZNA 2OPHA 3V4ZA 1OROA 1HKUA 1HT1E 1JG7A 1NMSA 1FMCA 2DF8A 4YECA 4E6EA 1Z5NA 4B6PA 4DM7A 1J0XO 2UVPA 5KHOC 1SMKA 3BZWA 3W6PA 4BNMA 4IOJA 3AHEA 2OHHA 3L77A 2BKLA 3FCCA 3JQBC 2IA5A 3SYMA 5I4IA 2AXEA 3ZJTA 3OZUA 3L04A 1F2DA 2RGCA 1USIA 5KWSA 2RGAA 1T9ZA 3LUPA 4LZOA 1S1MA 1JAYA 4FNMA 5JSQA 2Q5LA 2AMFA 1QB7A 5EXEA 4UC0A 3GT3A 1V39A 4MVJM 5BW6B 3P52A 4L15A 1AQIA 3CZCA 3MJEA 3O4RA 3UAVA 4PGAA 5EXDA 5H5JA 4IOMA 5DASA 1E9FA 1XHLA 4ITVA 4ARSA 4IW3B 3WMXA 5DNAA 4AZ3B 4DLUA 4OQLA 4RJIA 3WK5A 4F3CA 2ZJ3A 1R5BA 4CTOA 1ONBA 2BGLA 2BP7A 2EJUA 3WYEA 1KI6B 3LQFA 3SHWA 2VHUA 1ZUHA 4CI9A 3EDRA 3R9KA 3SIWA 3ZNNA 2E3JA 4OXRA 2J59A 3GFFA 4R54A 4BNLA 3BF8A 4YDQA 3SX0A 4RBNA 3AUTA 4LMPA 1YBMA 3RVQA 2CV1A 1KJ9A 1N3YA 4YRGA 1L4UA 1JKIA 5K8JB 4OX9Y 2VP0A 3PQDA 1AS3A 2BGMA 3KK0A 1I1OA 2XF2A 4URHA 2FWRA 3AR8A 3I72A 5CVEA 1QMPA 4EX6A 3V8EA 4MGKR 1NQVA 4G1CA 3W5SA 4BNZA 1ZK3A 3FMVA 1XZJA 3G9ZA 4WJKB 3IRVA 2XVYA 5IDWA 1WCV1 3JQ7B 2DQYA 2LV8A 3D8SA 3LY5A 4AW9A 2I3ZA 2H1IA 4IV0A 1XTIA 4W8GA 5DBFA 3PQ6A 5ALDA 2I99A 3PHBE 4UEWA 3E8XA 1JEQB 2ZAGA 3LX6A 1BCSB 2PWYA 4OHFA 4U02A 1MNAA 1KDRA 5F52A 3ZLJA 3DCIA 3EQ6A 4W8OA 4JX9A 4J1QA 4JLJA 1W5EA 4Q9HA 1F1BA 3ML1A 4A16A 5KQRA 3U09A 3L8HA 2WUGA 5KYKA 3FYSA 2OM2A 1YQXA 3UXEA 3P2JA 1VA5A 2YWEA 4TYWA 1D2HA 5F2NA 2H8KA 3EXIB 1PEDA 1MQ8B 1R10A 2HRCA 3IIIA 4I5EA 4CE6A 5EIAA 1IVYA 5G0WA 3TZ6A 16PKA 3WA7A 2ZJ2A 1RWNA 3G0CA 3KYCB 3RNOA 4IEEA 4OQYA 1G9SA 1CUIA 1UC9A 1SGWA 2C54A 3KWMA 4PHCA 3PCRB 1JEOA 4E1AA 1QHEA 3SSNA 4WBNA 1IM5A 4IHQA 1E1DA 4FYIA 3M3PA 5DIZA 3VTZA 4MSUA 1IIRA 1Z74A 2P9TA 1R00A 5M34A 3RUHA 3TFOA 4JT2A 1CZRA 4B4DA 4RTMA 2Z2XA 3OSUA 5FHQA 1FSPA 1IN8A 2ZYIA 4RF4A 4AKSA 5HS4A 2FR8C 3AF2A 1MB2A 2OWDA 2R8YA 4Q5IA 3WICA 1F0YA 3KQNA 3AV3A 3RYIA 1RM4A 4P7FA 2ID9A 3BSFA 1IVSA 1R88A 4XX1A 2QTFA 5KSZA 3SLKA 1ZK1A 1ZK4A 4GQBA 3G3EA 3NC1C 2A86A 2YHIB 3S2IA 4YT2A 2PVCA 3MWJA 4MRNA 2JI4A 3K53A 4BCDA 1QPGA 4B5LA 1GNPA 4QTYA 1EFCA 3F8WA 2OCLA 4TLLB 4TX1A 3JWHA 1KAHA 2EWWA 4JP3A 4PSVA 1N78A 4QOJA 1LF0A 3LFTA 2X1VA 2P35A 5IAAA 2EVWX 4MYCA 1JFTA 1U04A 5I9TA 5T7BA 3Q15C 4US0R 2O3QA 4GQAA 2WW8A 2J08A 4G4SP 4NK4A 4ZCQA 4C1BA 1M10A 2DTXA 1Y1SA 3VJLA 1WDKA 5BWNA 2XUAA 1LDBA 3M5WA 1GGJA 3JZFA 4F45A 4Z0NA 1Y6RA 4BO3A 5F76A 2HAEA 2WLSA 4KIWA 3UOAB 3W4IA 1IOWA 3QKWA 2H1RA 2HJ9A 4KUEA 5TVGA 2W2TA 3LC7O 4Q7JB 1TUBA 5JNVA 1YJBA 4MS4B 3L7OA 1KE1A 2Y8EA 3GDFA 1EXWA 2C3YA 2WZDA 3I61A 4KB5A 2PKQP 3B2QA 3NAQA 3PIRA 4DEYA 4LSZA 2HDWA 2GSDA 3DKVA 3P0IA 4O4LB 4O4JF 4DLLA 2VYND 3MCTA 3PVZA 1U98A 2RAUA 1BCSA 1U7OA 2EQAA 2C98A 2ZUSA 3PA8A 1A7JA 2IOYA 3ZCVA 4DCTA 5LMNB 2G7MC 2AOVA 2REQA 1N2XA 1XJWA 2ASVA 1G8MA 5B3JC 2N1MA 1V3VA 2C42A 3N0WA 1HE4A 1WW2A 3U7HB 5B3LA 3QU4A 2DPHA 2QZ9A 3GPIA 4JLNA 2FMIA 2C5EA 4CJXA 5CT6A 1R8JA 4F1JA 5ECYA 2VP6A 2BN4A 5LQRA 3K32A 4R6XA 4M1MA 1KGSA 3R6DA 4ZYLA 3EXHC 1CY2A 3EXIA 5M2QA 4A6EA 4A0RA 2DFTA 5HKBA 3BBPA 3ZBPA 4LWOA 2ADFA 5E7QA 4I4TF 4IHAA 1Q84A 1A8HA 2G76A 1YI8A 2Y71A 3NNSA 3KYCA 3A9RA 4HZGA 4RD1A 4UDNA 5AI8A 3ZQ6A 3V8PA 3QKUA 1S89A 2D7CA 3UCXA 1X1DA 1SKQA 3P2MA 1PJ2A 3PA6A 4I55A 4DKJA 2R6ZA 1FUKA 4QRIA 2XLCA 4MV4A 5A6VA 1HI9A 3ORYA 1JSLA 3KCNA 4CZ2A 5E4TA 5K8IA 2ZVJA 4RVGA 4O33A 1TFUA 1SOWA 2PV7A 4ARUA 3U2QA 1HT3A 1W4AA 2QM0A 1MFPA 1OB2A 1ORHA 1UKAA 3UB2A 3WZ2A 2VDJA 5B6PA 2EBHX 4QUHA 3CUVA 4J0QA 4MUNA 2JC3A 4DSOA 1U8YA 2FPKA 5DEOA 3CNBA 4ZZIA 1WOYA 5HKKD 3VR6H 2P9BA 4G56A 1JT2A 1LPAB 5JQWA 1YTUA 3VR4A 2P3SA 5TSDA 1JA1A 1JFVA 4KRYA 3FUVA 4EHDA 2F1HA 4PX3A 1B43A 3U48A 4UDXX 3AM4A 3WYBA 5KX5A 4J0JA 4MWCA 4KZKA 4TMYA 4LBWA 4LOLA 4XDZA 4FZ3A 1BKYA 3TXYA 1C0PA 1PJ8A 2O1WA 5LKRA 1A97A 4UUNA 3ETHA 1SVLA 3D3WA 1RJ9A 4IIFA 1ZS9A 5AOAA 2AL7A 4EVIA 1JXOA 3FPCA 4Y0VA 1ZA2A 1J0DA 4HNSA 3BE4A 3FGOA 5TLSA 1H2AS 5JMOA 2R66A 3R0VA 1BU8A 1NURA 1SB9A 1TUEA 1UFVA 1ZC4A 4R8MA 1Z16A 5DX1A 1SZJG 5MGNA 3DGFC 1IBRA 3L7LA 3KLOA 1KJIA 4DNXA 3H0KA 5KQPA 2PQ6A 4ZJUA 2AQHA 3OE5A 3R3VA 1J4AA 4MS4A 1QXSA 1N0WA 3TH5A 5K2OA 3FJYA 4H15A 6NULA 3HO8A 2VL7A 4H6XA 4IX1A 2I7VA 4P4LA 4RHCA 1L7PA 2A3RA 3OE1A 4IKEA 1YE3A 8AT1A 5FFMA 4JIMA 4RD6A 4RSGA 1OFUX 4TKUA 5EIWA 2DSNA 3TTVA 1QZTA 3UC9A 4KLAA 4O2AA 5JWRA 2E1PA 2P6PA 3IP9A 1JSRA 3DDWA 2B1IA 4L5BA 5IBCA 1OZHA 4CEJB 1Z45A 2VJDA 3EVZA 5I5EA 3P94A 4MIKA 5K5EA 2YICA 1UOPA 3GCGA 3D6TB 3KXIA 4MPPA 5DF1A 4S3MA 3DZIA 5BQXA 1ADCA 5AKEA 3ZYZA 1Q0PA 1BMFA 3AUAA 1OI4A 3ZZTA 2LZ0A 3QU5A 3UG6A 2ATIA 4Z86A 1E0DA 1J8YF 2CMGA 1N9KA 2W2VA 1OFGA 1QP8A 2J41A 2K2QB 4R1MA 5B1SA 4F4UA 5ICGA 4YMSA 4XX0B 1L5OA 3MUFA 2OM6A 1A5AB 2ZJYA 4HB0A 1BVRA 2GCIA 4XB6B 1M5UA 3TI7A 4CM8A 3WL8A 2JGJA 5JXHA 4U6SA 2JA1A 1E18A 1QIDA 2Y4OA 3S1AB 4HVAA 1Z35A 4X71A 4N0DA 5THQA 3RSOA 1AY0A 5AD1A 3R8XA 3PIIA 2ZBFA 3G2JA 3P45A 4S1WA 3I0NA 3ZWVA 1EESA 1HKHA 3RVRA 1SUIA 2WU0A 4LY9A 1YR3A 5LLDA 4XCXA 1NN0A 4XFKA 3ROQA 4Z7NB 1R8QA 3DFZA 5IRCD 2QHXA 3UMVA 2LIPA 4LE2A 5ALMA 4EZEA 3UMGA 3A9WA 5AQ1A 1VLZA 3KSDO 5D3ZA 4V1CB 4MVCA 1ZSNA 2GK4A 3AR3A 4ILKA 3NW9A 1I7PA 3FBWA 2X5KO 3QZUA 3AUFA 3LVQE 1ITZA 4BVKA 1NQWA 1PFQA 2EW1A 1ID1A 2PMKA 5IEBA 3E3OA 1RYEA 3BHJA 3D4NA 2PKRA 1T6NA 3GW8A 1ZSYA 4MIYA 1AMUA 4W6QA 4XWKA 1O0CA 2WZQA 1HORA 1M6HA 1H8ED 1WMBA 5LZ9A 2BFNA 2MSKA 1XTZA 3L7AA 3HA5A 5AJZA 4CW7A 2W6OA 3K71B 1VP9A 3WLEA 2O06A 2Q21A 2Q1SA 2VUHB 2Q8PA 1IQUA 3BCUA 2VA9A 4QBHA 4F4FA 3FPGA 1MFZA 4C22A 4F5DA 4BMVA 4RKWA 1EWTA 1IHPA 2XOKA 3U7GA 4CEIA 3K1ZA 3VR5H 1LX6A 4D2IA 4W5HA 2WAYA 1LVGA 2Q0QA 4M0FA 4MIOA 3SYRA 2WIBA 2ZTMA 1PNQA 3R3WA 1CQJB 1D4OA 1H5NA 2PTGA 4Y1RB 3WV5A 5GVSA 1J00A 3MWGA 3ZQJA 4OJQA 4ZAYA 1SO8A 2HF2A 1AKYA 2J32A 3IVXA 4DQDA 3G9XA 4MJLA 1XVLA 3I05A 4Z5XA 1KK2A 4DCVA 5JY1A 4GLOA 3AETA 4N03A 1OBCA 1TVKB 4FLMA 2JEYA 4N3NA 4RELA 1E5DA 1E8NA 1UPTA 4H31A 4AS1A 2AC2A 4RPKA 1ZJZA 4LUCA 1THGA 4NOKA 3D7LA 2IPOA 4ZXFA 3O5AA 1F17A 4D79A 2JHPA 1H4QA 2WC1A 2XQIA 2OL4A 1KPIA 1YQGA 3DVRX 4OP3A 1W19A 1XEWY 1Q12A 2DH6A 2ZT7A 1GNRA 2PH1A 4QPPA 1BW9B 4ZT6A 1DZIA 2WTXA 5LC1A 2IYWA 4Q1DA 1CUUA 3FSRA 3FGPA 4GWLA 4KYUA 1DU4A 2IUYA 4ZZ1A 4LN1A 1J8VA 4CEJA 1S4QA 3K0FA 4LJ4A 1ACJA 2DG2A 3CEAA 3W78A 1XZKA 1WHSA 3EZ9A 2Q41A 9LDBA 3O4IA 3GFGA 4U6NA 2BEVA 1QIEA 3O1LA 3K9HA 5CDGA 2C4HA 2DYKA 4O1IA 4B82A 1WWKA 4H2DA 3UHAA 4NECA 4NHOA 3A06A 3RK0A 3UWPA 3UWSA 2PKXA 3E7XA 621PA 4WZAE 4PM4A 3S1AA 3HBLA 1E1CA 4IDGA 2W2NA 2B7LA 3U6BA 3DAGA 4I4NA 4KMRA 1E4EA 3THSA 2VJMB 1C1DB 3AQ4A 5EJ4A 1FFCA 1SKYE 1XL0A 5G02A 2E4ZA 4BX8A 1GO2A 4N39A 1LV7A 4PN7A 1FEZA 1P62B 2FX3A 2FLKA 4PLHA 2JH3A 4NDNE 5IW8A 2ERXA 3QW2A 4PYOA 4HZUB 1SPBS 3HU5A 3GB9A 1RCTE 3MERA 5P21A 2JLCA 3RM3A 3DL0A 4D9KA 1J8QA 1RQPA 1DOZA 1WQ3A 4UVDA 5F3RA 3THYA 4GPEA 4IVNA 3PNVA 4V1CA 3T1QA 1XZGA 4LJSA 1AA6A 2OORA 2QRGA 1W5TA 4QVGA 2JFHA 2XEDA 2EZTA 4MUHA 1REQB 3V5NA 4XD7A 4COKA 2AFRA 1PN3A 2FP4B 3V8NA 3LECA 3LK7A 4K26A 3DAHA 1P4HA 3IKMB 4J03A 2Z2IA 5AVTA 1K8ZB 3ECSA 4G5FA 4EB3A 2YL2A 1J1UA 1Y63A 1P1KA 5CPFA 1KO4A 4OD0A 1XZHA 3CEPB 2JLVA 4FT2A 3BXFA 3V4SA 4Z4IA 2TRSB 3OECA 3KKQA 4GF5A 4PSAA 3PEUA 3SFVA 4R1LA 3TBFA 1T2CA 5I7HA 3WHPA 4NU8X 2IU6A 1JDNA 1IUPA 3IPLA 2H65A 1BMFD 3GP5A 5KKAA 5AW5A 2F3RA 4G0MA 3F6SA 2QNBA 5JUWA 1R6UA 3FOWA 3AI3A 4CRWB 4K9RA 3NTOA 3SVLA 3AF1A 4NDAA 1AB5A 2IUEA 2XQGA 3SNHA 1JVNA 1T35A 1JIQA 2Z58A 3DZDA 3GFOA 3MJVA 5DK4A 1NASA 2MINB 5FOTA 3L4JA 2HHHB 1JQKA 3G8AA 3W3AD 5CVTA 1M0EA 1WXXA 4A0SA 1G3UA 2HNAA 2ODNA 3ICOA 3MB8A 3F97A 5AYVA 1YQTA 5AJHA 3G17A 3AUUA 3HB5X 2BKXA 1ZOPA 5CFNA 3DBIA 4TVKA 2ONCA 3NLLA 3NP9A 1L5SA 2AKEA 2P40A 2WYUA 4IV8A 1IY9A 1IG0A 2CCGA 2OD7A 2F7SA 4JFRA 1PJ4A 2J4FA 1LBEA 1QE3A 2WWIA 3FWHA 1KAGA 3SMVA 2PX0A 4MJ7A 1UWKA 3LSYA 1PD1A 5JSHA 3ZDCA 2XAUA 4Q6WA 2ERCA 3AT1A 4FB5A 5CDYA 3NRBA 4TXLA 2OUIA 2X8WA 1T5OA 1VL5A 4B84A 3AFGA 1QC5B 2R8PA 4ROSA 3OFKA 2ZSEA 3JTMA 1QOQB 4G1MB 4OPMA 1W0CA 4L4UA 4WBXC 4IDQA 1WSAA 3KWFA 2D5BA 1E7SA 1J22A 3AILA 3VZBA 2I67A 3FTPA 2IYLD 4WPGA 3LPLA 1QWOA 1PR3A 3HCFA 1TTTA 1WBJB 3GLIA 3ORSA 1QFXA 1AKVA 1KA9H 3DM9B 4AJKA 4BVGA 3GZNA 4F3NA 4ZOLB 3NHBA 4CQMA 1RWQA 4N3CA 4RZQA 3LQ1A 4DS3A 3WLHA 1G18A 1W49A 2VXOA 3I09A 3LT0A 5KWIA 2PNFA 3ICQB 1FMFA 1OA1A 3LUDA 1NLFA 4RLFA 4XM1A 1W1UA 2G5PA 1U8CB 3NTVA 3KOUA 4OH1A 2JFUA 1KQNA 2EGGA 4OHVA 3FPKA 4L8FA 5EJEA 1N7JA 1P1BA 2E89A 3EWIA 4KRFA 4JR0A 5I9NA 4ALLA 1Z0SA 4RV5A 1G8JA 3LUHA 1SVSA 1LJLA 2FP4A 2ZS8A 4ANFA 4DJAA 1K3TA 3LYLA 2NXNA 2HMUA 5EN4A 4TYYA 4JITA 4ABYA 4ARCA 1T2UA 2NQ8A 3Q3CA 5EWJB 1ZRSA 1VG1A 3UKJA 1N77A 3AVOA 1PRYA 3AIIA 3PCTA 1Z88A 1VE5A 5E6UB 1RI1A 4NP6A 1S96A 2B1JA 2HYDA 4TTAA 2ZRGA 2FPLA 1ZM4A 2UZ3A 2MU1A 1S7GA 2CDAA 4CCYB 1TEVA 2DFNA 3QPVA 3EGEA 4M37A 3TSWA 3H2KA 1NATA 3MG9A 4OLAA