3R40A

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
291
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 112
structure length 291
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r40A00
5JD6A 2BJHA 2WIFA 3D4LA 2OLEA 2G63A 2PM8A 3V1MA 2FUKA 3D59A 5DYTA 2ZVDA 4H7EA 1P0MA 1S8OA 5JIBA 1EA5A 1MX5A 5ALEA 3DEAA 2XMRA 2DSNA 1F6WA 6YASA 3QITA 4W1PA 3R40A 1LZLA 5K3DA 1ZOIA 2WIDA 5LIPA 5JZ9A 3N0TA 4WCVA 2HA2A 4NS4A 5FXMA 1LPPA 1MX9A 2XMCA 4MEAA 2XUKA 4CCWA 2NW6A 4H7DA 4ZV7A 4GBGA 4HRYA 4AZ0A 1ODCA 1ZIXA 2ECFA 2WUDA 3B12A 4UBLA 5T4BA 4QDUA 5CTAA 4OB8A 4G9EA 4J0CA 3HABA 1YAHA 1DTEA 3NUZA 4C6HA 4F0JA 4Z49A 1JJFA 4H7KA 4MYDA 1JI3A 3BIXA 5AK3A 4BCBA 1XRRA 5DWDA 1XZDA 1XKTA 4GWLA 4HAIA 2EDCA 1IVYA 1XRNA 1XFDA 4QE3A 1JMYA 4DNQA 5A71A 4AX4A 1THTA 2QXUA 4J3JA 1B6GA 1EB9A 3KSRA 2X5XA 5CT9A 5JATA 2WHPB 5FOQA 1UK6A 4P93A 2QMQA 1ZJ4A 5JD5A 2QVBA 3T4UA 3I6YA 4C01A 1T4MA 3ICWA 3ESAA 2WHRA 1CVLA 3LIIA 1ODTC 4BZWA 4DMFA 5HF5A 1EINA 1W52X 1H2YA 5CRIA 4UHFA 4BBZA 1IUNA 2XQKA 4KYVA 4M0MA 4AMZA 2XMDA 1LGYA 3BJMA 3KDAA 1THGA 2QXTA 3FYUB 2HA4A 4BTLA 5LZ8A 4W9RA 4OU4A 4IQ4A 5K3CA 2W6CX 5YASA 4OU5A 5HFAA 2XT0A 4AZ3A 4N5HX 3W9BA 1CUZA 1L7QA 2OG1A 3BL8A 2O7RA 4H7JA 4QLAA 5ALZA 4U2FA 3ILSA 1H2ZA 2JIDA 1BN6A 4ZXFA 4Q3KA 2FX5A 2WJ6A 1GT6A 1CQZA 5CMLA 2GYVA 3IBTA 4J0GA 4X00A 2Y2VA 3FBWA 4GI1A 2O2GA 1QONA 4BDSA 4QDXA 3C6ZA 3WL5A 5H3HA 3UMJA 2IIVA 2WIGA 4PSCA 2VTVA 4E46A 5AKHA 1JKMA 1XLWA 4BCDA 4FHZA 3RM3A 1QZ3A 1CUSA 4E15A 3E1GA 2HU5A 4B7ZA 2PSDA 5K3AA 4F60A 2C0QA 2I3ZA 1ACLA 4TVKA 4BCCA 4Y2QA 1JJIA 4UBNA 4FLFA 2WU3A 4KJXA 3WJ1A 4BTVA 4DSAA 1CUFA 3KD2A 4KRXA 1F8UA 1TCAA 4FOLA 5CT4A 1WCYA 4RE6A 3QM1A 3V48A 4C4ZA 3FCYA 2H7XA 5AKKA 3AIOA 4A16A 1BE0A 1MPXA 4OD0A 5FP0A 2XLCA 1QTRA 3AILA 3NWOA 3C8HA 1GKKA 5CW2A 3S2ZA 5CH8A 3R41A 1N8SA 1DU4A 2XUGA 4WY8A 3I2IA 3E3AA 2WIJA 3L1IA 4BATA 5ISMA 5JAPA 3W04A 4C87A 3D2CA 4FLEA 1XZEA 5BWCA 3H18A 2QZPA 1CLEA 4XWGA 1CQWA 5AI5A 4GEGA 1FSSA 5IVDA 3WYNA 2O2HA 3FSGA 2ZYSA 4LKOA 1SCQA 4BDTA 3DDUA 1R3DA 3X3HA 1CUCA 4NMWA 4OPMA 3QPAA 3C5VA 3O4GA 4Y2TA 4ARBA 4Q3OA 1QIMA 2IX9A 3VVMA 4DTCA 4GXNA 5EFZA 3ZLUA 2AJDA 3TJMA 5HCUA 1QJ4A 4RE5A 3CN7A 3FYUC 4HVTA 2WG0A 1WB4A 3P2MA 1ORWA 1UT6A 5CXXA 4PW0A 3G7NA 2DHCA 2PU7A 1Y7IA 1Q0ZA 4MXDA 5EGNA 4EY6A 2I03A 3STYA 1DINA 2YYSA 4KAFA 4ZGBA 4Y2XA 2GBFA 3R3YA 5AKGA 5FLKA 3N2ZB 4G5XA 1QIKA 5FV4A 1ORVA 2J3QA 2XMZA 2WUGA 3WKBA 3OTQA 4W63A 1BCSA 3WA7A 3JWEA 2PSFA 1QIJA 1HPLA 2AJ8A 3ZWQA 4YX9A 1CUAA 1UFOA 1H2XA 3F97A 5EHXA 1EX9A 5DTJA 4MWSA 1A88A 1CUWA 2XMSA 2PBLA 1YASA 2PSJA 1Z68A 1AQLA 5AK4A 3M83A 3BF7A 4K6HA 4PNZA 5A7FA 1NU6A 3I2JA 5JANA 4OUKX 5A7GA 1XZJA 5LKRA 3FLBA 1TAHA 4V2IA 5FPQA 4BAGA 2JEZA 4UHCA 3QBJA 4KAJA 2ZJ6A 4B9AA 4X92A 3WK6A 3F96A 4J0DA 4QDTA 4FTWA 5ALIA 1TCCA 1TK3A 1QO9A 1YR2A 2WTNA 1ISPA 2HFJA 4N8EA 3WKCA 3WLAA 4EUSA 4CCYA 5AOAA 4HS9A 2VJDA 3WWDA 1XZBA 2WFZA 1D07A 2XQGA 5CXUA 1HKHA 3BXPA 4G4GA 3DLTA 4K2AA 1FFAA 2I78A 1KU6A 5JAHA 4Y2PA 1VA5A 4J0KA 2HA3A 1VLQA 4MWTA 2HDWA 1LZKA 2WJ3A 1BU8A 2PKYX 3I2GA 3M81A 2BGRA 3AJAA 3AZOA 1QIFA 3UUEA 4EB0A 5LYYA 3I6ZA 3H17A 1ZGCA 3H19A 2XE4A 3A6ZA 1VXOA 1Y37A 4MQLA 4Q3LA 5EIAA 1UKAA 1B41A 2BGNA 1H23A 3I2KA 4H35A 4UBJA 3R0VA 3U1TA 2XUIA 4BVKA 3PUHA 2WHQA 3FCXA 3G0DA 1QGED 2RONA 4AB1A 4H7IA 4GECA 1QFSA 4DIUA 1KU0A 1MNAA 3L1JA 5A7HA 3HSSA 2GZRA 4Q05A 4EHBA 3BIWA 5JZBA 1XQXA 5IH7A 3M82A 5IVIA 2GYWA 2GBGA 1XZKA 3VKFA 1XZCA 5FKJA 4UBOA 1QTIA 4WFJA 2OQIA 2W22A 2VA9A 5HZGA 1U4NA 3VDXA 3GBSA 2PUHA 2PPLA 1RP1A 1RWQA 4ZWNA 5IVKA 1AKNA 5BOVA 5AK6A 1ZI6A 1E5TA 2ZSHA 4BVLA 4A5SA 4CIBA 3C8DA 3PICA 4KRYA 5C8ZA 3A2MA 4P08A 2WILA 1FFEA 2J4CA 5LZ5A 5CT6A 2ZYRA 1LLFA 3DOIA 2D0DA 3I2FA 5DJ5A 3K2IA 1Q83A 4X94A 3FSGD 2VJAA 1NX9A 2HRRA 2O2IA 2C7BA 4Q1VA 2RGUA 3GELA 2JGMA 2DHDA 3W05A 2OAEA 4B83A 4JEIA 2XQFA 3H04A 5BWBA 1A8QA 1ZD2P 5JASA 3WK9A 1TKRA 1HDEA 4LYDA 4DYHA 2XB6A 1L7AA 5EIHA 2VQ6A 1N5MA 3HYSA 2VATA 2PSHA 3D3NA 3ANSA 2JGKA 3WWCA 1JFRA 1DX4A 4P92A 1IUPA 3VJKA 3H2JA 1UWCA 2QRUA 1HBJA 5AKZA 4RPCA 3FAKA 5ALJA 5AJHA 3E4DA 5AI8A 3QPDA 3CCBA 4ROTA 4L0CA 5AOCA 4BC0A 5C81A 3LLCA 4U2GA 3ZLVA 4U2BA 4G1FA 5D3KA 1PJAA 5IKXA 2VJBA 1X70A 4LXIA 5JZSA 1MT3A 1FFBA 4EA6A 2OCIA 1L7RA 2AJCA 3WQHA 2HHAA 1UOQA 5T4EA 4BAUA 5AM5A 1LPNA 4DNOA 5ALXA 1CPYA 4EY4A 3BDIA 3VXKA 2CJPA 2PVSA 3H2IA 2ZYHA 1EI9A 5JALA 1QIEA 4W1SA 1E89A 4I19A 4B82A 3DKKA 1XROA 2XMBA 3MUNA 4LIPD 1VJ5A 3IUMA 4UPDA 1MAHA 1AZWA 5HKAA 2CBGA 1C7IA 1GQRA 1JU4A 1ZD5A 3HLKA 4LXGA 4UFNA 2WJ4A 4KACA 1I6WA 1ETHA 4Y2SA 4ZRDA 1EB8A 2QS9A 3TGLA 4FBLA 1WOMA 3QH4A 5LLSA 5HF9A 2HRQA 1QE3A 4Y2UA 2XUAA 3DNMA 4BC1A 1MJ5A 2Z5GA 3H1AA 4KR0A 1MX1A 2H7CA 4J0IA 4F21A 1MNQA 2WFLA 4Y2YA 3H2GA 5E4JA 3O0DA 1FFDA 5EHQA 5CH5A 2IITA 5AOBA 2PX6A 1XZIA 2HL6A 4LHEA 1QOZA 4Y2RA 1UXOA 3G0CA 1EVEA 3C87A 5F4ZA 1UKBA 2Y1KA 4PQEA 2B20A 5ALLA 3DCNA 4WY5A 1N1MA 2WHPA 3TEJA 3WL8A 2JBWA 2Z3ZA 4NVRA 4XIIA 1XQVA 1K6EA 5ALUA 5KBYA 5LKAA 1EK1A 2Y6UA 3AIKA 4OYLA 4Y9SA 3ANTA 1K5PA 2BCEA 1XKLA 4GDMA 3G9TA 2K2QB 2PL5A 2X8BA 1TCBA 3KOOA 3AFIA 1R50A 3RK4A 3U0VA 4LYEA 1BEZA 3O4IA 4WDRA 4W1RA 3STXA 2WG1A 2JGFA 3G0IA 3GZJA 2H7YA 1UK9A 2JGIA 3R3XA 5DLPA 1DWOA 3Q8WA 4OYYA 1DQZA 3JYHA 3R3VA 3C43A 5ALPA 4CG2A 4HZGA 4BVJA 2CB9A 3ZV7A 2WSLA 1G42A 3CN9A 2RI6A 2YXPX 4B0PA 4EY8A 3A2NA 2XUQA 3MVEA 3WL6A 5JAUA 2R8BA 4G4JA 5E4YA 5KWJA 1VZ3A 3O4HA 1T2NA 5ALSA 5FDFA 3C6YA 1ZGBA 1TIBA 3I6MA 4KE8A 4KE9A 3CXUA 4FDMA 2RHWA 4G4IA 2CUTA 1IZ7A 3DQZA 1VOTA 4UUQA 3C5WP 5A2GA 2XQJA 2QUBA 4X95A 5AKEA 4OCZA 1P0IA 2JGJA 1VZ2A 2JF0A 4E11A 1OXMA 5K3FB 2JEYA 4AO7A 1MTZA 3B3QA 1LBSA 2AJBA 1CUHA 4B85A 5ALKA 1R9MA 2GBCA 3WZLA 2DQYA 3BDVA 3DL4A 3D2BA 3FLAA 5J3JA 2D5LA 3IDAA 2O7VA 4UHBA 5AO9A 4I4CA 3H2HA 1CIJA 3IULA 3DS8A 4QZVA 2G5PA 4X6XA 3WI7A 5T4FA 4DNPA 1CUEA 4UBKA 4HXGA 5ESRA 4EY5A 3HZOA 3OPMA 1ZIYA 3L1HA 1HQDA 3IUQA 4G8DA 2QTBA 3W2TA 2QJWA 3PE6A 3AINA 3CCCA 1MO2A 1KEZA 1ODSA 3G8YA 1IZ8A 4WJLA 5K5EA 3RLIA 4B84A 1W1IA 2HA5A 1TRHA 4GW3A 1BROA 3W06A 1QIIA 1U65A 1DT5A 5LP1A 4X6YA 4BZZA 1ZI8A 3G02A 1WPRA 3D7RA 3IIIA 5AH0A 4B0OA 3FYUA 1YB7A 4FWBA 4H7FA 5AM3A 3NGMA 4FMPA 5DTIA 1SOMA 2HIHA 1CUJA 1BCRA 5DNUA 4X3CA 1AC5A 1P0QA 1CRLA 1J06A 4BP9A 1VE6A 2B61A 2WQZA 3PUIA 4DSZA 1FJ2A 2H1IA 3WZMA 4QA9A 4QWMA 2OAGA 3JW8A 2ZJ7A 4C4YA 2VAXA 5AHXA 1EXWA 4MQMA 2QR5A 2OCGA 5AM2A 1WHTA 3C6BA 4FKBA 3AUKA 4QDZA 2RAUA 3A2LA 4PV7A 1XRMA 2CMFA 2V98A 4C88A 2JGLA 3ESBA 4IH1A 2Z8XA 4JH0A 5D7BA 1XQYA 3B5EA 5ALYA 2PUJA 5AKIA 1ZD4A 4WFIA 3FLEA 2GYUA 3KXPA 4QDOA 1CV2A 4IO0A 4C89A 3I28A 3H2KA 1ACJA 4KE7A 1XRQA 2EEPA 3FWHA 3ZI7A 1CR6A 1GPKA 3FVRA 1J2EA 5I8PA 4RGYA 1DQYA 1YA4A 3IB3A 2HA6A 3EF3A 3K6KA 4AO8A 3S8YA 4G8CA 2Z3WA 4AQDA 2YH2A 2WU4A 2I3DA 4QNNA 1GKLA 4J03A 3C6XA 2VEOA 1R4ZA 3OC0A 5HK8A 3SWWA 1J1IA 1W76A 5ALWA 3STVA 2PSEA 4BAZA 2DFPA 3H0CA 5JD4A 4TPKA 3D2AA 1EDBA 5LZ7A 4QLOA 4UFPA 1ZICA 4HXFB 4GLBA 4OSEA 3HC7A 2H9YA 1LNSA 4PSDA 1M33A 5AKYA 2BFNA 3SC2A 4X97A 4FNGA 5HK9A 4W1QA 4A23A 2XDWA 4G8BA 3WWEA 3G0GA 3EQ8A 4UHHA 3WYDA 2HA0A 4Y7DA 1GPNA 1YB6A 3GUUA 3V1KA 5ALHA 3F9CA 2B9VA 3DD5A 2ORYA 4FNMA 1A8UA 5JYCA 3D0KA 4H77A 2RHTA 3MGAA 4KE6A 3PF9A 5HQ3A 1QIDA 4MJ3A 5ALNA 5D6OA 2YASA 5C8VA 3STUA 1DT3A 3H1BA 2OPHA 4FLMA 1U2EA 5BV7A 3T52A 3Q0TA 3WWOA 4CCYB 1PFQA 1PV1A 1EH5A 4ITVA 4J0HA 4L72A 3OURA 1H22A 5D3ZA 4B9EA 2HFKA 4AO6A 2C5FA 5AI0A 1WPXA 5K3EA 3BF8A 5AKXA 2WFLB 3OOSA 2VAVA 2ES4A 4M0FA 1CEXA 2CZQA 3FNBA 2G5TA 1CUUA 3GA7A 3R3UA 4ARAA 1GXSA 1AUOA 1O6FA 4X90A 4X91A 2HM7A 1X2BA 4XJVA 1YAJA 2OQVA 2XMGA 3STTA 5SYNA 3O4JA 3V1NA 1JU3A 1W6RA 2JGEA 3EQ9A 5CBKA 2WIKA 1W4LA 1SC9A 2ZSIA 4J0JA 1BRTA 1GQSA 1CUIA 3F67A 4YASA 3GFFA 2GBIA 4L9AA 5JAOA 5ALQA 4N8DA 4MYSA 2OGZA 3QZUA 2BAGA 1H2WA 2AJLI 1K8QA 3SK0A 3IURA 5ALDA 1MAAA 5JADA 3LCRA 1CUBA 3HJUA 3C45A 2E3JA 3WK4A 4BB0A 4Q82A 1UK7A 4U2EA 2UZ0A 5FUMA 2QOEA 4M0EA 1XZAA 5EIEA 5JARA 3LP5A 1AGYA 4KEAA 3PI6A 4BE9A 3EIOA 5ALOA 3V1LA 2CKMA 1WB6A 4EZIA 3F98A 2QKYA 4S0XA 2C4HA 5E4TA 4LXHA 5AKLA 2WTMA 3NOXA 5SYMA 5CURA 4INZA 3ESCA 4OB6A 4B80A 4O08A 3G0BA 1C4XA 2EDAA 5AP9A 3ZPXA 4ZREA 5ALRA 1TQHA 5LZ4A 3STWA 1SCIA 1E66A 2XUJA 1EDDA 5E2IA 2OCKA 1OCEA 2WUEA 1WHSA 3AZPA 2Y6VA 3QMWA 2LIPA 4G9GA 2VSQA 1XZGA 3G9XA 5CH3A 4QEKA 2CEKA 5AI4A 1R1DA 3WA6A 3QVMA 1ZD3A 1UKCA 1G5FA 3I1YA 2ONCA 4Y2JA 2HU7A 1P0PA 1K63A 1R9NA 1AX9A 2DHEA 3V9AA 2VJCA 3WKEA 4Q34A 3AIMA 1VKHA 1FFCA 3I1IA 2XUDA 4UHDA 3DL7A 3HEAA 4XVCA 1XZMA 2WUFA 3RKSA 3R3ZA 3BWXA 5AIBA 3WMRA 4DMKA 1CUYA 1Y7HA 2DCMA 3OG9A 3I2HA 3WK7A 1LPBB 2XUOA 4PF1A 1R88A 3HI4A 2Z8ZA 3IVMA 4K5QA 1LBTA 4BE4A 1CUXA 3PFBA 3VJLA 1MU0A 4IHAA 4E14A 5HF8A 2X76A 3A70A 4UHEA 3OM8A 1K4YA 3VVLA 1LPOA 4EBBA 2QM0A 3BJRA 1JJBA 4ZI5A 1Q0RA 2OGTA 5A62A 1XZHA 2V9ZA 1EK2A 1HL7A 4JYPA 3WK5A 5HF6A 4CG1A 4H18A 4AMYA 2C58A 2XUHA 2VT7A 1UK8A 4PSUA 5AI6A 3WWPA 2C0PA 4TGLA 5K3BA 1QIHA 4RNCA 2BKLA 2HA7A 3IUJA 3EQ7A 3FOBA 1AMNA 2BUBA 2VT6A 4Y2VA 5I7UA 3D5EA 2Y2UA 1E3QA 1NU8A 1XQWA 2FJ0A 1SCKA 3MUOA 1EHYA 3FVTA 3UUFA 4GHWA 5AM0A 4FBMA 4YK7A 1W75A 1MN6A 3GROA 1AURA 2QJRA 2P8SA 3QYJA 4I3FA 5I9IA 1A7UA 3O9VA 1EVQA 3O95A 3R3WA 1XLUA 3PF8A 3RARA 2J3DA 4PO3X 5DYWA 3DKRA 1IUOA 1C7JA 1VXRA 2ZYIA 2RIPA 4BRZA 2XUFA 5KREA 1UOPA 4DMHA 1BS9A 4F5ZA 4DLNA 2DR0A 4DGQA 4U2DA 4FFWA 4JUIA 3PDCA 4AXBA 2XMQA 1USWA 1EDEA 1ZJ5A 1CFJA 5IVHA 3QMVA 5AM4A 5ALTA 5A6VA 1E8DA 2C5GA 4UBIA 2XI4A 1G4HA 1HLGA 3DYIA 4CIAA 5KWIA 4DM7A 3LS2A 5ALMA 2G4LA 4BRSA 3PFCA 1G66A 1LPMA 4X71A 1SFRA 5AKJA 5ALGA 4CG3A 5K3FA 1QO7A 3KWJA 7YASA 1JMKC 4FFVA 3E0XA 1OILA 1WB5A 1Q84A 4K6KA 4X85A 2OGSA 2R11A 1DWPA 1CUVA 1VA4A 2FJPA 5LZ9A 2WKWA 1XZFA 2AXEA 2DQZA 4MEBA 3G9UA 3LIPA 3M3DA 1A8SA 3QMMA 4H7HA 2WM2A 5FRDA 2HADA 3QPCA 4BYMA 4C4XA 2VF2A 1E8MA 1QFMA 3WL7A 4HXEB 1JT2A 2OCLA 4N8SA 1QLWA 4AN1A 3WJ2A 3WK8A 1X2EA 3K9BA 3IA2A 3DYVA 2PU5A 3YASA 2ZJFA 2BUCA 4H0CA 4D9JA 4YPVA 4NZZA 5AM1A 4WFKA 5DNWA 4X93A 2OXEA 1QIGA 1YCDA 4DMCA 3IUNA 4J7AA 1LPSA 4WDQA 3WIBA 4JYMA 4XX1A 4L3WA 3WKAA 1RYYA 2ACEA 2J4FA 3KWFA 3AZQA 2QUAA 1CUGA 5HFNA 5HKBA 5EHZA 3W9UA 5AICA 4N5IX 3FYTA 5AI9A 1E8NA 4OB7A 1N5RA 1BEEA 1J07A 5FPPA 1O6GA 3BE8A 1XLVA 4JNCA 5C8XA 3ED1A 2Q0XA 1VE7A 2XLBA 4X7BA 2B4KA 3WIOA 1F0NA 1WM1A 5C7YA 3SX4A 4ETWA 4IH4A 1YA8A 4AN0A 1YSCA 1YS2X 3DJYA 5DNVA 1GPLA 4IH9A 3HACA 3WKDA 5HQ3B 1XRPA 4B6GA 4CFSA 5EHNA 2GZSA 1DX6A 1LPAB 3G9ZA 4B81A 4X6UA 3HXKA 1U8EA 5DYYA 3C70A 4U2CA 4P9NA 3O9MA 3VISA 3VJMA 2QT9A 4K6GA 4UFOA 1GGVA 2HU8A 5LZ2A 5ALFA 2ROQA 4HRXA 2WG2A 2XQIA 2V96A 4DNFA 5EI5A 1CUDA 5AIAA 4HTAA 1XRLA 4ZV9A 3DOHA 2WLSA 1UZAA 4CI9A 1DWQA 1GZ7A 4EY7A 4QWWA 3ICVA 5ALVA 2ACKA 3ZLTA 1ZI9A 1YS1X 3HRHA 1F0PA 2BUAA 5CT5A 4UBMA 4BP8A 2XUPA 1BN7A 1IMJA 5T4HA 3F8SA 1UOOA 3TRDA 5CT8A 4KAAA 5AK5A 1XZLA 3EBLA 2WFMA 3ESDA 2V97A
chains in the Genus database with same CATH superfamily
1N6LA 2FPUA 2YJTD 2FG7C 3JQAD 1N0UA 2O8BB 1A9XB 2ANCA 2ZKLA 2QSUA 4MW0A 3ZHCA 5EP2A 4DV2B 5KOIA 2O8NA 3MMPA 5CVJA 4TSKA 2WIFA 1BMDA 2D4AA 4H6VA 3D4LA 4XW2A 1OWMA 2MSKA 4P4SB 3HQ4O 5BR4A 2H85A 2BM1A 1JHDA 1GYPA 3FSJX 3FYDA 4FW9A 4II7A 5HMMA 3AHHA 1QCDA 2ZVDA 1ZU5A 4PN7A 1A5TA 1P0MA 1FVHA 1IHYA 2CJFA 3QXCA 1DQRA 4ZALA 3R20A 5DW0A 1VL6A 5ESWA 5HG0A 2DG2A 2BMWA 1JAXA 2VKTA 3LKBA 4I14A 2HMSA 1LSOA 2DSNA 4QPCA 3L49A 4R1QA 3VNAA 3WNQA 3UAXA 2VHQA 4W99A 3AY3A 4JYZA 3GLKA 1N1GA 5FOSA 1M1UA 1MA3A 1KYQA 3SIRA 3WB2A 3T9CA 4ASUD 3I6IA 3N2NA 1IWOA 2WE7A 2GVZC 3E2IA 3QJGA 4PHFA 3PHCA 1FX0B 1NN5A 1WUTA 2X8WA 4JGGA 4Y6GB 4Q9AA 3QVJA 2Q8NA 3K2BA 1E5XA 4K9SA 2WIDA 1W6UA 2Q8PA 5JZ9A 1VE5A 4X9XA 3ZY3A 1R66A 3DONA 4MKGA 4RCZA 3PQDA 3OE7D 3K0FA 5F77A 3ZWKA 1K0UA 3BXZA 1EG2A 2J5QA 1SUCA 5DIFA 2K2WA 1B42A 5FL7A 1UBUS 1D2RA 1K7XB 3KQOA 4JLSA 4HOYA 4NS4A 4YONB 2UXCB 2J0UA 3O8QA 1Q1ZA 4Z8YA 3ZWNA 2WWXA 1YQGA 1T35A 2HJSA 3GT7A 4E5MA 1MX9A 5IWCA 3CX6A 1QS0B 1J7JA 2G9VA 2RJOA 2XUKA 3GAFA 1SRQA 2QL7A 1PEKE 2NW6A 3RHFA 1P7VA 1OTXA 4YRTA 1JLKA 3HBJA 3Q8LA 4EENA 2WUDA 3B12A 2FEOA 2J08A 1BD4A 2WAMA 3GFPA 5CTAA 2V9PA 4NJEA 1A0OA 4KN8A 4D3FA 4OB8A 2V6IA 3HABA 2EG9A 3FOAA 2PMBA 1SD1A 3UJ8A 3NUZA 4F0JA 1SK8A 4CMHA 4RSMA 4PC7A 3ONDA 5LBIA 4O59O 4YV1A 1DFGA 5KMGB 1B16A 2YIMA 1VFPA 1ZHHA 1EXMA 3ENKA 5IXSA 1IL0A 2B8JA 2GCNA 1QP8A 1UAAA 2C3MA 3B8HA 2X1HA 1P44A 1PFGA 1G8GA 4R3NA 4H7KA 1AKYA 2DHQA 3LUGA 4MYDA 1JG2A 4R9RA 4RFSA 2QRZA 1NFRA 3GWGA 3FPAA 2FSGA 1JHOA 2HOQA 1GDDA 4NECA 4PG6A 5DKFA 5DWDA 4JSTA 2P2ZA 2O1SA 3JASA 4HAIA 4MGIR 4CMGA 3EDRA 5CB4F 2BYTA 2EDCA 1IVYA 4E94A 1SB8A 4DSOA 1EFUA 4JXJA 3MWJA 5FTKA 3W1VA 3W5IA 1J0BA 3PDWA 1XFDA 4BO1A 4ZT5A 1SO8A 1SVLA 2LCQA 3B9BA 4IDDA 1V16B 4O5OA 4DNQA 1G6HA 5MN5A 4AX4A 2CV1A 1CEEA 1CJTC 1LSUA 2CXHA 2X1VA 4WN3A 1XB2A 3T94A 5H4GA 1KMHA 4DEXA 1PT7A 2DERA 1FJHA 3U2QA 4QASA 4AJLA 5FBZA 5BQOA 5FR1A 1B6GA 1E9SA 1Z0KA 3H3XA 4QJ5A 2C7QA 1XG5A 1X1EA 4MLDA 3OLQA 4FFPA 1T25A 4IOLA 4YP7A 2WZDA 2P4SA 5FOQA 2IXBA 4ZQIA 3KYJB 1JNYA 4U7DA 3MWYW 3T5PA 4X1IB 2ADOA 3H11A 5LQKA 1BE1A 2W6JD 4TS3A 1QV7A 1U2GA 4C01A 3K0AB 2I3AA 4V0OA 3GLRA 3OE7A 3UEOA 3TEMA 2XTJA 2R65A 1ENZA 3STHA 3WG9A 5JEEA 4P86A 2JLQA 1TRKA 3U60B 3U40A 3HCAA 2ZDQA 2PWBA 4PLYA 2YRWA 1H2YA 3LQ2A 4E2WA 3OZUA 4P53A 1M1YA 2V54A 1FYEA 1M6NA 4XUDA 3U3RA 1O96A 4KYVA 5JO0A 3TKLA 4BLTA 4M0MA 2YIJA 1G59A 1DBWA 2C57A 1TDJA 3QW2A 2ZBUA 5CFLA 4MI6A 3S70A 2PUFA 4IIYA 3L7BA 3BJMA 4BKUA 2D6FA 1TTPB 3ZQ6A 4PBSA 2J09A 5IN4A 2CLDX 2JLSA 3KDAA 1PGOA 5KU7A 4JFAA 1HH4A 1O9HA 3A1UA 3A4YA 3GFRA 3JAKB 4LDNA 2X77A 1D8AA 1T1GA 4NCHA 4PCUA 3OBIA 2NT4A 2HA4A 4R6XA 2TECE 4ZCPA 4E2FA 4O4IB 5BNIA 5DRYA 5GONA 1T26A 1W49A 2QL9A 3KJQA 1P81A 2JFNA 1G9TA 2C2MA 1U2PA 3JARA 4EG0A 3AYZB 1JTFA 3ETNA 2PGLA 4MQEA 5HZMA 2PXCA 5JMOA 2BDUA 3CZ9A 1KS2A 4IGIA 3UQYS 2AFIE 5JVDB 4ENWA 4I9FA 4P98A 5J1SB 2E48A 3VKVA 4HX2A 3KSBC 4GKKB 2PVPA 5YASA 4OU5A 2WY2D 2DPXA 2CVZA 4F38A 1IBCA 3O6VA 1D4OA 3CH5A 4OV6B 4B3DA 3PR2B 1M2WA 2W4QA 4WT7A 4CIVA 1V7PC 1Z5OA 2CXNA 2GHIA 3W9BA 3WE7A 1K0FA 1KRHA 3JVIA 5BMVB 1E2GA 1ILWA 1L7QA 2BIFA 2P4EA 1KI8A 1UKZA 4GM4A 1ZOSA 2QGFA 1PTJA 2EZ9A 4MVJM 3SSOA 1VKOA 3WLIA 3ZV6A 4DXHA 2QX9A 5ALZA 4FEGA 4U2FA 3ILSA 3R4VA 4EVRA 2JIDA 3TZ6A 1X86B 4JZKA 4R7TA 1P2FA 3C3CA 5CB4A 2CUNA 2EJVA 3F90A 4JI2B 1W5SA 5HIIA 3PXUA 1X74A 5IJ9A 1ZN7A 2GYVA 3WXBA 5BXYA 2WWHA 3LG2A 4RULA 2BFPA 1Y5RA 5J5CA 5JZOA 3PTZA 3SMVA 1NMSA 3NEAA 5PGMA 3P2YA 5CNJA 3K0SA 1P0CA 2CV0A 1C4WA 5FWNA 1RKQA 4OATA 4IWXA 1ORIA 4FZ3A 2O2GA 4GI1A 4H1TA 2ETXA 5ELMA 1QONA 1VIVA 3WGHA 4BDSA 4JR1A 5AJYA 4TLCA 1XCPA 4QEDA 3DZCA 2CVPA 3AY7A 4GOND 3W0LB 3UK0A 3O90A 3SCZA 3DOOA 4PSCA 1Q0SA 1A9PA 2HDNB 3F49S 2NXJA 3PEVA 1XLWA 2I6TA 3QMPA 2C2HA 2YV5A 4RVCA 4UE3S 4XFDA 5AJXA 4AXXA 3Q6NA 1MJHA 2QX4A 2OEPA 2Z83A 5FWAA 3W79A 2BHNA 4CCSA 3C8UA 4PINA 2HV9A 1WQ1R 3EULA 2DPYA 4F4JA 2LR0A 1QE5A 3RJ9A 3ZJUA 3DLIA 1JIVA 5A5EA 1MRNA 4UUPA 5LLDA 1G64A 2I67A 4YI5A 4Z9XA 5EE5B 1H6BA 1PQWA 1ZUNB 4MH0R 4BL5A 4DCMA 5DP2A 3GZTB 4CNQA 3EARA 3UQZA 4ZC1A 1DSSG 3VV2A 4Y2QA 4C5CA 5BVHA 4YRLA 5KDLA 4MUKA 2IX3A 1FLNA 3KBBA 3NHUA 3QE4A 1E5VA 1SVMA 4F5WA 3HI6A 3WB9A 4YFVA 2OR3A 5GGYA 1DAIA 3IV6A 4KX3A 1WQ4A 3ETCA 4UTNA 2OM2A 4HUQB 2ZJ5A 1TCAA 5BYBA 1JQKA 3LKDA 1PL7A 5CT4A 5G53C 5TQ0B 3COSA 4CMEC 1N2GA 2C59A 2GETA 1G2QA 2JRLA 4NX2A 4Q24A 4TL9A 1UP6A 1PR9A 2GJKA 3E7PA 3V48A 1QZTA 5JROA 1TTTA 3GLGB 4M1KA 1UPCA 1E18A 3Q2KA 1NBME 4G84A 3WBKA 5AKKA 4ND8B 5L3QA 1KAHA 2WHEA 3GDOA 1I30A 1ADJA 2IY9A 4OD0A 3K53A 2HBRA 2GHTA 3UUGA 5HRCA 1VSTA 4OAPA 2HQ1A 3DW3X 1SC6A 2MR5A 3UA3A 4NONA 4OMCA 1E6CA 2ZJBA 5TRTA 4D45A 2HSWA 3HTXA 4CTNA 4G3XA 1GKKA 3VPAA 5CW2A 4XOUA 4WZZA 1TYCA 3RYIA 1GY8A 3R41A 2P0EA 1O6ZA 4FE7A 3O1IC 1SUIA 2JJYA 1DU4A 2Y0DA 4WY8A 4MULA 3BCSA 3HBNA 1FU4A 1VJ1A 3LSTA 3PWTA 1F20A 4OQXA 3MGCA 3O8RA 2NOAA 4M99A 3ZK9A 4G6ZA 1B2RA 2GJ4A 5TX7A 1PW5A 2CZCA 3W1EA 4ZZ1A 3RVOA 3IHTA 3JWIA 1NE2A 1DQPA 1OVMA 1EJ0A 2HTFA 2O14A 3KPJA 3O8NA 4FMCB 1N3LA 1RRPA 2Z9DA 4HGZA 1LDEA 2EKZA 3I23A 3MMNA 3JAKA 1Z0IA 3RWMB 4IILA 1H5QA 4C1NA 5AUOB 4IFBA 1SVWA 2XRYA 3K9NA 4HQRA 4F5EA 1Y9ZA 1CQWA 3AFGA 4CKWA 2XDYA 1QAQA 3WGMA 1Q7EA 1RQRA 2W6IA 2HRDA 4NU6A 4GMHA 4FM9A 2YHBA 7MHTA 3HUTA 3MRVA 2FQ1A 1J22A 2O2HA 3F4KA 2ILTA 1IBLB 1PGPA 3QF4B 1UKVY 1XFAA 3VO9A 3MWDB 3HV2A 3IA7A 1QE0A 2QI9C 4F04A 3SXUB 4HO1X 3D5QA 3DDUA 4E7PA 2QTZA 3QEOA 4U9UA 3EGEA 4AJEA 3JX9A 3R7SA 2VDWA 4NMWA 4OPMA 3RC7A 4N41A 1K1EA 3SC2B 5H68A 1KA9H 3DLAA 4BUCA 4YCNA 4HNAB 3RKRA 3LA6A 1HM5A 3GPIA 3M9WA 2HXSA 1DIBA 2VDKB 4FQ5A 3NWJA 4OVKA 1TF2A 2V1XA 4EUNA 4Y2TA 2J3JA 2EW8A 1U3CA 3I4CA 1YB4A 1BJTA 4LHZA 1O03A 2M1ZA 2WJAA 2QD1A 3K70B 4QRHA 2IUFA 1ESDA 2PUDA 4JLDA 4U5XA 1LEHA 2V0GA 3UHPA 4NABA 5HGJA 4GXNA 3TW8A 1C2YA 1U9JA 2GM9A 1UJ2A 4TTAA 2XTMA 3GDWA 3R3JA 3TJMA 1E2UA 4MYRA 3IMCA 2VAPA 4OQ4A 1JVNA 1U3GA 3OF5A 1G5RA 4IMJB 2BKAA 1HEIA 1RAEA 5C8YA 6PFKA 2W42A 1N92A 3GRPA 2QN2A 4F56A 4KQ9A 3OEHD 3DMTC 4CT0A 4QOFA 3LOPA 1M1NA 3IOEA 1PS9A 1SZJG 1X6VA 2Y1WA 4W5NA 5EJEA 4TV8F 4Y0AA 5AW4A 1C7EA 1WZIA 3BGVA 1N77A 2H54A 2O8CA 3ZS9A 4MO9A 4I1YA 5ANRB 1OLXA 1TKAA 1VRVA 4EK9A 2PMDA 3CLRC 4PRYA 3L0OA 2P1DA 1OH8A 2P0AA 2A9KA 1L7NA 5A04A 3R7WA 2OZEA 1DRKA 1FPMA 2D2FA 4AG5A 4Z9BA 5TJ9A 2J9FA 3S6JA 5DNAA 1GU0A 2VDRB 4ETNA 1HGXA 4N9QA 1C30A 1Q6ZA 2V6BA 1U2QA 3PX2A 4GE0A 3SFTA 4ANFA 5K7SA 1OB5A 2IBTA 1B26A 1DINA 1PZNA 3E61A 1ISRA 1H5NA 3WLOA 2BFEA 4Y2XA 2GBFA 2RG1A 1MOSA 2CXPA 2MYNA 4EF6A 1PBTA 4MTCA 4P5EA 4Q3CA 4DBZA 5FNVF 2RG7A 2PO5A 2VBIA 1MOQA 5AKGA 5JECA 1OZFA 1IU9A 1XKXA 2JBHA 2PV0A 2YXEA 2EGUA 3FRHA 3RI3A 5F1PA 4OXQA 1A50B 4UNIA 1FL9A 3EVEA 2ENUA 4LOJA 3FPJA 3DEYX 3VSBA 1C1YA 3JD3A 2P3OA 3G2NA 5T64A 1WOYA 2YBEA 3QI7A 4RM3A 1JV2B 4P84A 5KC8A 2F7SA 2I3GA 1HPLA 3KEQA 3T9FA 4BEVA 2CC2A 4Q39A 1KTVA 1D5WA 5DTRA 3WLQA 4YMUA 3HEMA 1V48A 1P3JA 4FFBB 1FTQA 3IODA 4KQGA 1H2XA 2DPGA 3N3BC 4IINA 1C3OB 3NPAA 3REOA 1V25A 4L1KA 1RC1A 1U0JA 2AK2A 3G1TA 3FPEA 1N0VC 2NIPA 3RAEC 2ZIZA 4RENA 5JPIA 2FZLA 5JYBA 1U2TA 5DBEX 1Y7TA 4MP3A 4ZRMA 5LBTA 5A7FA 3IEXA 3VZCA 2WZQA 4E5SA 3CPEA 4UU7A 1SKYE 4CL8A 3P2OA 4OUKX 2NZXA 4XYMA 3TW4A 3K9CA 1NM5C 2D2EA 1XZJA 3IEIA 1OOEA 4M0LA 8GPBA 3SSAA 5LKRA 1BHQ1 1CF2O 1BDJA 3DOEA 4RORA 2W48A 2CSUA 1IG3A 4U6SA 4P0TA 4UHCA 1PKEA 2ONZA 3UV7A 2C2ZA 3AUXA 3GG9A 3PCXA 3WO0A 3UWKA 5JCZA 2IUTA 3NDRA 4BX9A 3TSCA 1XVLA 4PLZA 5DM4A 1C7RA 4X92A 3ZHYA 2HRZA 3FCAA 1E9FA 1RD4A 1NV8A 1YC5A 1U90A 3MCZA 3R7WB 3NHJA 3ZZUA 2R0QC 1JEJA 1EUDA 1ZUWA 3FCOA 1C3XA 4QDTA 1QANA 4KWCA 3RC9A 1ISHA 3WVNA 5EPEA 4BBPA 4LJ9A 2Q29A 3F3YA 3M6LA 4YROA 3N59A 2ZKIA 1QQBA 4XKJA 4AK9A 2C7OA 2WAXA 4U6QA 1TK3A 1ESEA 4ZCSA 4F8EA 4JLMA 2Q1XA 3ZWWA 4YRMA 2Y1LA 4KMRA 2NZUG 2Q4DA 3UFXA 2HFJA 4N8EA 3SC4A 2ZW9A 4CLDA 5IPFA 1ULZA 3QUSA 1ZXBA 2BM9A 1EX1A 2IL1A 2W6ZA 1JHAA 3IHLA 1AJEA 1NF2A 2G4CA 4QULA 3WLAA 4EUSA 2RARA 4DA8A 3GZ4A 1EWQA 1T6BY 1UQUA 4INJA 4ALKA 2VA8A 4HS9A 1XZBA 2XQGA 1YTLA 4TLBA 5CXUA 1HKHA 3BXPA 1B76A 4AMGA 5LFAA 3DLTA 4TMKA 3DTNA 4QQRA 2DB3A 1GZHB 2I4OA 4MW7A 4OXIA 1Y4ZA 3DBRB 5ECGC 1KU6A 1Y8ZA 4BNMA 3OPXA 1RXCA 4Y2PA 3ESXA 3UJNA 1X8KA 2RGNC 3PHLA 3C8MA 3SZRA 3T34A 4MWTA 2HDWA 5FCDA 5T41A 2WJ3A 2PKYX 1Y3IA 2GDJA 1HDYA 2O2JA 3OZGA 1RJWA 4L4RA 3T0FA 2ISQA 3BMCA 3BXGA 4KVAA 4KO3S 5ES4B 1GLNA 1Y1RA 4RESA 4DANA 5IAOA 4WKCA 3AZOA 1CQIA 2XRMA 2LGJA 2VP2A 5KVQA 3EJWA 4O8ZA 2W2MA 2A9OA 4JLOA 1TLTA 5LYJF 3FMVA 2A1UB 2PZLA 5J4KA 4CE6A 4J1TA 2E9SA 2ISSD 3JVDA 4N5LA 4WESB 5LYYA 1UQRA 4BV8A 1OZGA 3I62A 3RFUA 3I6ZA 2XGSA 3H17A 3ZZNA 4ZHQF 3IELA 2MIIA 3RU7A 3IQHX 2XE4A 2AC2A 2P4UA 3BCUA 1XP5A 4IDGA 3RVNA 1VXOA 4OM8A 2KI5A 4IS3A 2FY8A 3V6MA 3NT2A 1QH8B 3A3KA 3AUTA 2WM9B 4HQOA 3SG0A 4AYTA 2BTQA 1RAAA 2ZIUB 2GB4A 4RLFA 3WLEA 5KTPA 1RC8A 1O54A 4X66B 3DVRX 1OREA 1H23A 5HCNA 3RODA 4EO4A 2OFXA 1T9CA 1UMBA 4TZ6A 2UU9B 5JLJA 4U63A 1UXIA 3AF4A 4E0BA 3PHHA 5KX5F 4XFJA 3OX2A 1T9KA 4I50A 3ZHOA 3AFMA 1T10A 2XUIA 4JLBA 5TMEA 2YNMA 4Y1RB 4I5FA 4LJ8A 3D3WA 3QG1A 4GMDA 2RONA 4AB1A 4I4TA 3PJRA 1IXZA 1U8AA 2JL1A 4JOQA 3QX7A 4H3HB 4NZ9A 3AVUA 2EW1A 1MNAA 3K9HA 3L1JA 5CA0F 1T3LA 2P6UA 4E31A 4F96A 1Y34E 1ZH2A 2O6HA 2Q3LA 5J2TB 1JG3A 1K68A 1SG6A 5IAGA 3HVRA 1YZTA 1QU3A 1AHHA 4KAXA 1P9NA 2NV0A 2A3NA 5BY2A 1UDAA 4G1MB 1NLZA 3ZVKA 4YMVA 2O8FA 2KBFA 5LB4A 1D8TA 3O7MA 4Q4HA 621PA 3QKRB 4AQ7A 5JS1A 1BXGB 3MCTA 2ZPAA 4K40A 4WA7A 5EKUA 2QRVB 4A8JA 4LI3X 5LQMA 3VKFA 1ECGA 1Z7EA 1L5WA 1XZCA 2I34A 2GCPA 3C85A 3W3ZB 3IEUA 3TG2A 2PCJA 2P40A 2XTAA 3E15A 2ZS7A 3CKMA 5TXGA 2RGWA 4JB3A 4DCCA 1E62A 2HXGA 3GYGA 2IYFA 4LJ4A 4TMYA 3RUIA 4HN4B 5HZGA 4FCWA 3DDWA 4HZIA 4NZMA 3SDZA 3OJFA 3VDXA 1E2IA 3V9PA 3DVQX 3LYHA 1C30B 2FN3A 3F6RA 3C3JA 4DDKA 1VSBA 5LN1A 1DBQA 2EFCB 3NTXA 5DLYA 3X1MA 1X7HA 2EBUA 3B20A 3J80A 2D5CA 4O2AA 4QOEA 3M89A 1Q0HA 2WT9A 3Q7PA 4UREA 5FLYA 1VGVA 1AZSC 3HNPA 3LRXA 4RIEA 1RC0A 2H2DA 3MB5A 2Z04A 1Y3AA 2HMUA 3KX2A 4EF5A 1I1HA 1AKNA 4BX2A 3CNOA 1NQWA 5BOVA 2W8BA 3V55A 2RKBA 1E5TA 2GZ3A 3I01M 16PKA 3NTOA 4I9NA 4A5SA 4JYCA 4Q7LA 4DWOA 1JIUA 1O94A 1X0XA 3EY4A 2O5CA 4N5NA 4EB6A 1F8XA 2FSHA 2YS7A 3L8HA 2BGJA 2DHRA 4F2GA 3UF0A 4YMIA 2C00A 2K7ZA 4P08A 3U4CA 5LZ5A 2ZYRA 1ABFA 1M8PA 4KNWA 2QK4A 5CFPA 1YCHA 1OX4A 3PDIB 3KL4A 1GTVA 1TA9A 3I2FA 2QTVA 5DJ5A 3EQ2A 2AFHB 3IP9A 1Y1SA 3PD7A 1DKLA 4OJKA 4KQ1A 4WKOA 4JXZA 1CXZA 3RS3A 4NJMA 3RTGA 3ZV5A 1DZ3A 1ODKA 5KYNA 2JI8A 1NQAO 3TZHA 3KHKA 4TMFA 2QHXA 2X5KO 1AXEA 3D4NA 1TA4A 3F6YA 4MWOA 3HFRA 4F1KA 2C7BA 1L7DA 4C6RA 1CDOA 4I0WB 4W8HA 4E5NA 4D80A 4C4AA 2JGNA 3Q9UA 4Y7CA 5CCBA 2Y9PB 3VR6A 4ZPXA 1VHDA 3C6QA 3Q1KA 3K9GA 3P2JA 4JEIA 4FPXA 3GBPA 3H04A 1YJ8A 2JFZA 4NKRA 5E2AA 5JMWA 2H6EA 5I48A 4DV5B 1A8QA 1IM2A 1ZD2P 2FXVA 3AR4A 2GFIA 1XNJA 3R5KA 4FZJA 4NBSA 1LFAA 1U4OA 3C4JA 4MCHA 3L41A 2J32A 1TKRA 2DKFA 2IPXA 1HDEA 3IRUA 4R51A 2ODAA 1NVFA 3DC7A 1XQ9A 3N5KA 2PRKA 3HKCB 2HWUA 4QXOA 1DADA 1FP4A 3JQ7B 3THSA 3G2LA 1QF6A 3Q72A 4RA6B 2ZWAA 1CP3A 1GGFA 1CZNA 1L7AA 1MR3F 1XDWA 2XB6A 2XW6A 5CGQB 4WUVA 4I4IA 5CIYA 2NU8A 4EUKA 2RIRA 1RRVA 2RGAA 2ZJ4A 4OXYA 3TE7A 3V4RA 1VSVA 3ZNOA 1N5MA 1EE2A 2C9CA 2VATA 3RSGA 4WKGA 5SICE 4I55F 3C5HA 3D81A 5H82A 3KDSE 1W9HA 4Q5IA 1G3IA 3VJKA 3UTDA 1O9GA 2XITA 3D8NA 5C53B 3DGEC 3B3GA 4HZUB 2MINB 4MI3A 1E9VA 3PNYA 3RVRA 1NTRA 1I7SB 4GL2A 3L9WA 1WS6A 1FB5A 4DQLA 3DFUA 4C0HA 3COJA 4BC0A 5GOZA 3RTEA 4EIWA 2QAIA 1OE0A 2YC4C 3G2IA 3T15A 3ROFA 3ZLVA 4E32A 2A5JA 1GR0A 1IG0A 1N6HA 1LU9A 1PEAA 1QSGA 5NLLA 2QMOA 1AD2A 1M34E 1P7ZA 1T0IA 2AG0A 4FD2A 5IS2A 4HEA6 1JPNA 1YVRA 5IKXA 1ZUNA 3T1TA 4AZ3B 5JZSA 4EA6A 1N2IA 1PSDA 2Y1XA 4B5LA 3LDGA 1TM4E 4J1SA 4B3HA 1L7RA 4NCAA 1DJLA 1UOQA 1FMJA 3V8BA 4MS1B 5EEGA 1QYCA 3IAAA 3K1YA 4BAUA 1ADFA 2FEXA 1M75A 3EYAA 4OYRA 3JQ9C 5JWHA 5BMOA 2ZDGA 1FFXA 4BOYA 4QBKA 3KXIA 4GX2A 4HVAA 3VXKA 1MEJA 2Y05A 3H2IA 3PDHA 2AC4A 1EI9A 2ZYHA 3N9IA 3S2FA 2WIAA 3K5PA 4FJ2A 4H2DA 3HO6A 2VHCA 2O05A 3LCJA 3OQIB 2Z2XA 3MHPA 3OPNA 1UT5A 5JALA 1YE8A 1JSCA 2PWYA 2DULA 5AW9A 3FW1A 1LFDB 1QIEA 2W98A 1DAKA 4UTRA 1GN9A 1YZQA 1E96A 4HY3A 1I9GA 3PLRA 3Q6IA 4JMLA 2CXOA 2FI1A 5EGSA 3OUTA 5HS6A 2RDMA 3DKKA 1NMEA 2NWQA 4JBWA 5TY0A 3VZQA 1WULS 5CHEA 5SZIA 3AUJB 2GPAA 3ZGVA 4MUEA 4L2IB 4QBHA 2RB5A 1QH1B 2XMBA 2DPMA 1V35A 3LXUX 5KNDH 4NOKA 4CR6A 5K0CA 3O4RA 3AH8A 2WVAA 4LIPD 1VJ5A 5CFRA 3OU6A 4IFEA 1TYAE 4BZPA 4GUAA 4YAJA 2VT3A 4TLMB 1CY8A 4O0MA 1CSEE 2IYQA 3L0PA 4XUGB 4EPWA 3QLJA 3IGFA 3QUQA 4WKPA 1C7IA 1ZCBA 3ND9A 4I1UA 4LY0A 2P9FA 1UPFA 3NEJA 5JSKA 2HLDA 1TMGE 1CJUC 2CFCA 1NQUA 4LJLA 3FJYA 3OWHA 4Q9NA 2E4VA 2OFPA 5BXQC 5LYJB 2AEJA 1OU4A 4PGMA 1DZIA 2XYQA 4HG2A 2QRPA 1SOAA 2RHRA 2HIMA 1SKAA 1ETHA 4ZRDA 2BBWA 2QS9A 2VJLA 4EI8A 3TGLA 1MABA 5BT8A 3DXFA 2CDNA 3V2UA 4FBLA 2BE7A 1WOMA 2FR8A 5DM2A 4HAUA 4BWYA 2HRQA 2B7LA 5LMUB 4UC0A 1GZSA 1QE3A 2CNLA 2Z4RA 2AZXA 1QFJA 1KWGA 3AHFA 3T5DA 1XTJA 2HNBA 2YHAA 1EVJA 4YHHB 3Q3HA 5K3OA 1MX1A 3KQVA 1BKSB 1HYQA 3L0SA 3RYHA 5K0SA 2R7NA 4A6PA 2PGDA 3QUBA 4CU2A 2WFLA 4C5BA 2PX8A 2C9BA 1M1XB 2CYAA 3O0DA 2MSDB 1W96A 3IIKA 2WQ6A 2JJMA 3UMSA 3S1AA 4QUBA 2YN4A 4YAKA 1QB7A 2ZATA 3OZDA 2PX6A 2H18A 4MITA 5AOBA 4RZ2A 5EWLB 5G0UA 3RS9A 1FTWA 4BRUA 3IVXA 2GZAA 1QOZA 4Y2RA 4GU5A 3FVWA 3OT4A 3RVDA 1RVV1 3TZLA 2ZRQA 1DRVA 4MKIA 1JZSA 2G1AA 4WZAA 5LBUA 2I7CA 3DVAA 1EVEA 3G0CA 5HSGA 3QKIA 2ADMA 3BGWA 2YQZA 4RUKA 1UKBA 3EC2A 4ONEA 3ULKA 2VP3A 3OFJA 1J0AA 1EVLA 1RHJA 3KPWA 5M7EA 3FNHA 4UDOA 1WCIA 1V26A 2YS6A 1R8JA 4JT4A 5CIWA 1R74A 2XB9A 3PEEA 3ABZA 1OXVA 1L4YA 2CDAA 2O5RA 5E6UA 3GPCA 2FPSA 1P45A 5HP4A 2YV1A 5KBYA 1MHPA 3WZ2A 3AIKA 3ORYA 2ZSBA 3QXXA 4OYLA 4AFNA 1U1IA 1ML4A 1ZA2A 1OXTA 4RWZA 4Y9SA 3ZR4B 3GP5A 4KLZA 3CUWA 1I6MA 3LUJA 1JR3D 1E3DA 4W9NA 2OORA 4KSYA 1SG9A 1KAMA 2OHIA 2IDKA 3D0RA 4J0FA 5DH9A 5BN4A 1K7CA 5D51S 2X4IA 3WA7A 5GJWC 4EVSA 4LOLA 4Q1AA 1J09A 2AN4A 2G72A 2VCEA 1N3BA 1D4AA 5A05A 4URXR 5J4LA 4UATA 2Y4OA 2J9RA 1AXGA 1WLSA 2H51A 3LPNA 4IXTA 3V7YA 1H3EA 1LSJA 1UFKA 3K4HA 2QL6A 4TL8A 5JSFA 3I9LA 3AFIA 2FU5C 3ZCSA 1SBZA 2AKYA 2GZDA 1KQGA 3UXEA 1PRYA 3HU2A 5T8KC 3KSAC 1KVQA 3NIDB 3KG2A 4AM8A 1RSZA 3Q12A 2AFHE 1CHDA 3R0ZA 4D8WA 2WNIA 4MAMA 4TTVA 5BSGA 4RZUA 2Z2ZA 4DV7B 5G4KB 2FGJA 3JQDA 4F8YA 3JAWB 4OLHA 2J48A 3OH8A 3CS3A 3EXFA 4R8VA 3R3XA 3CEPB 2WT4A 4ZIRA 2VNJA 3O3OB 4JC4A 5F35A 1KEPA 3UXYA 4DBLE 1DWOA 1ZD9A 2Z08A 3HUUA 3EIHA 4EA9A 1VPWA 4M6WA 1QYXA 1JE0A 2IHBA 1MPTA 2W2TA 4RCYA 3TRIA 1RPTA 1ND6A 1NMYA 1UBKS 3ACDA 2IU6A 3DTVA 4MOWA 1BW9A 1BMQA 3TIGA 4BVJA 4PC6A 2W9XA 5KSWB 5BPFA 2JCYA 1GVNB 2XNHA 4N12A 2AR9A 4URUR 4O29A 4OXKA 4WADA 4HMQA 3U49A 2B82A 1G42A 2VZ0A 2PQ0A 1MG5A 3SZOA 2FUEA 1X7ZA 3MWGA 3U3DA 2HWWA 3LQRA 5BUSA 4EFKA 2YXPX 4I1OA 4RLHA 4QATA 1AA9A 3KO8A 3TLXA 1DJMA 3K0FB 1YDEA 2D5IA 2NSDA 1T8UA 2GBLC 4KQJA 3VU9A 1RI5A 1YNOA 1WXEA 3AP2A 3HU5A 4DS3A 1J23A 2R8BA 5JAUA 2H8GA 5CDGA 4JEUA 1GPH1 1OASA 1ZSYA 4RGBA 1B2LA 5A4IS 3A6HA 5FDFA 1XAIA 1Z4IA 1KE1A 3TB4A 3GLGA 3HU3A 4NMXB 4YQYA 1FTYA 4ZANA 4EMTA 4KBYA 1L5ZA 4R5MA 5KQMA 3CXUA 4B09A 4K1LA 4UAJA 2Y76A 4FDMA 4AKIA 3KSZO 1E63A 3PQ7A 2HO4A 1M54A 4TRMA 5T6MA 2GEUA 3QP9A 1ZNQO 2VNHA 2YL2A 5FL7D 4HL6A 1WMEA 3LMKA 1U1FA 4FUTA 2HBYA 4EB8A 3LX5A 4B4DA 2NO6A 2CKDA 3DAOA 1I1OA 3G8DA 3QVVA 3M5WA 5TQVA 1P9LA 5KTKA 3QPBA 2CXUA 2QUBA 1J8FA 2OVBA 3FFWA 3PEUA 4XWWA 4GOKA 5IX8A 1Z35A 4O3MA 3VR2D 4DLKA 2IY7A 2NU9A 4OBEA 1P0IA 2JGJA 4XDYA 2OHHA 4E51A 2SKDA 3VNRA 5BVHB 2ORED 4QFMA 1ZZEA 3O82A 5LQAA 4L8VA 4S1WA 1V8BA 3H7IA 4WKBA 1SU8A 1Z3IX 4YRCA 3HRKA 3X1ZA 1G7SA 1HURA 4PICA 1ELOA 4TXNA 1PT8A 4CKEB 4EX7A 4INAA 1XJ0A 1GQOA 3B5JA 2ZB4A 6CHYA 1SOWA 3KEFA 4R1PA 5KCMA 1F1BA 1ZQ1A 5J3JA 1QQ6A 3IDAA 4GI2A 4PR3A 5HM8A 4TTTS 2O7VA 3VDNB 2FEKA 5C4GB 2CCGA 1U3VA 1KEWA 3TMYA 4ZCRA 5B36A 1U6KA 5AO9A 4LZWA 2PIAA 6REQA 3H2HA 3AF3A 3CE9A 3UK7A 1ZNZA 3L8MA 5B4TA 2BE9A 3AGQA 3TBHA 4YMHA 3L6OO 1PZEA 2N9UA 1PVOA 3EOBI 3OM0A 4IIGA 1TAUA 1AS0A 1SIUA 3H5OA 4HEHA 5EZ6B 5JCOA 3NHBA 3WGYA 1K3FA 1HTBA 3UV3A 3M6FA 3ZEIA 3GL9A 4M76B 5ESRA 2EFJA 3DWFA 4GP6A 2DPHA 2Z6QA 3WRXA 3GVIA 4C20A 1Q6YA 1WVMA 1H69A 2ZRJA 3LF1A 3R6DA 4G8DA 1PZXA 3M2TA 2QJWA 3GG2A 2DRIA 3BIFA 2ZGVA 1QHEA 3G2OA 1TJ4A 2X4DA 3VU3A 2OP0A 3WQSB 4MPPA 1IM8A 2I0FA 3G8YA 2WV7A 4G01B 3VZDA 3H86A 2P2CA 1XDGA 4GBJA 1U94A 1PG2A 1W44A 2BVNA 4A0HA 1X1CA 4WWHA 3RLIA 4P5PA 1PO7A 4FXOA 1PG5A 4JDUA 1KZ7B 1FFSA 4FQ8A 3CF6R 4F7WA 2WSSD 5L4NA 1YR8A 2NTJA 4C0KA 1ULAA 2V5AA 4LA4A 3E53A 1HTTA 3TM4A 3X44A 4CMEA 2FPGA 4R83A 1DT5A 2R7AA 2WSBA 4HLUA 1U3UA 3RIGA 2KQUA 3K0CC 2KE5A 4MRPA 4FT2A 2CUKA 5F7ZA 3A6PC 3FHTA 3GBVA 4LYAA 3IIIA 1SAYA 1MVLA 3DUFA 4QGFA 1MC1A 2EWWA 4I55B 1AB6A 5AH0A 1SIBE 3A7DA 3VR2A 4N82A 5DT9A 4EMSA 5HZKA 4R9VA 1MZVA 5F1YA 5B55A 4LTNA 2EXXA 4UZEA 5D84A 3WQQA 2V3CC 2XTZA 2I7XA 1OV6A 3IE1A 1CUJA 5K8JB 1G20E 1VG1A 4WPGA 4ZJUA 5DNUA 1YQXA 2ZQYA 4ES6A 4CDNA 1WF6A 3SQWA 2XOKD 1MVOA 2DSTA 2HBQA 2WSMA 3NBUA 3U7RA 1RI1A 1Z0FA 3OMWA 1G8YA 3FZYA 4O4JA 4X3CA 3TWOA 3TXYA 3GLIE 4KREA 4R81A 4RK7A 2A0UA 4EECA 5IJZA 4WL0A 2IHUA 2C9DA 1XEXB 1AOXA 1CRLA 1XPOA 3D8TA 4EZBA 2BRUC 4FFOA 4QBIA 4MP6A 2GD0A 4YPOA 1VE6A 1U7OA 3CPSA 3L7NA 4JJKA 1EDOA 4DXAA 2EYUA 4Z86A 3ZK8A 2C3UA 2IXTA 4GPBA 4JR2A 3CA8A 3FGNA 4F6RA 1FXUA 2REQA 2WQZA 3N6VA 4J7UA 4FYWA 2IODA 4A0SA 2IDJA 3PUIA 3QG5A 1XCMA 2DE0X 2VWQA 4DSZA 3DCIA 1FJ2A 3I5UA 2O23A 1UUFA 1RZRD 2H1IA 4Y8VA 3WZMA 2OAGA 3JW8A 2ZJ7A 5FIUA 4BMCA 4YIHA 1I3KA 4G0MA 2VAXA 3PQ6A 4N0PA 1L4EA 1HXHA 5J43A 4IDHA 2IYAA 2LV8A 4I50F 4QUIA 3ICPA 3JD1A 4MQMA 1FIUA 2OCGA 2GLUA 2Y1GA 3NYIA 4HPWA 3UO8B 4C3UA 1KK2A 2DR3A 2F1KA 2BR5A 2FFAA 2ZR8A 4FKBA 1ABEA 3AJDA 4EFMA 3R76A 2XRZA 4GSKA 3ICQB 4WTOA 1R4NA 1CRQA 3UHAA 3FCUB 5F9FA 5E9AA 5CFMA 5EJFA 5AXDA 1GGKA 3LUFA 4XIFA 3GJQA 4LDZA 5CK5A 5JFTA 4DMGA 3JYLA 1J42A 5CD9A 2O5EA 1WSWA 5D7BA 1LXCA 4A0GA 1QRDA 1UWKA 3CGGA 1XMSA 2AK3A 1VHWA 3LLVA 1NXXA 1ZM3A 4NMMA 3SHFA 4DM4A 3QEKA 4XTRA 5AKIA 1ZD4A 5IUNC 1GRCA 3C3AA 2PT5A 4MV4A 4J8PA 4MWZA 4ON9A 2C92A 5E6SB 5EHIA 5LYJA 1R6DA 1U0TA 4GI3A 4LPKA 4CF5A 1DG3A 4P58A 3ESYA 4ZYXA 4MMXB 3THWB 4IO0A 5IDQA 2AXNA 4P80A 5FWXB 4EEXA 3EXHC 2AKAB 2D1YA 3NUQA 5EXSA 4PCAA 2CNWA 4RZHA 2QROA 3EW7A 2BHSA 4YJKA 5EUCA 1GGJA 5L7YA 3EXEB 3H9EO 1NHWA 2OQVA 3BWYA 1KZ1A 3H2KA 1E6EA 3LXMA 2F17A 5EAIA 3IO3A 2CLEB 2FF5A 2Q9UA 1ZNXA 2AI1A 4OI4A 1L3BA 4P2GA 3PR3A 4QD3A 4RLQA 3V80A 3NRCA 3ZI7A 1Z0AA 3HA5A 1CX9B 3KZMA 4R1SA 4EG1A 1V11A 2XOKA 3FVRA 4WXEA 5I8PA 2NZ8A 3R4CA 4CN9A 1H8HD 4NU8X 4LC9A 4MR8B 3IB3A 4MCIA 1MX3A 4YP6A 3ZU5A 3ER6A 4JJFA 3P71T 3FPSA 3SVTA 1NYTA 1PJQA 1ZVKA 2OAP1 3IVAA 4V0LA 4ZO8A 3IEVA 3WLPA 2H0AA 4S2UA 2B8WA 2FX2A 3LCCA 4RH0A 4BWFB 3KTFA 5E38A 4EQZA 3GDFA 4XWYA 1EX7A 3VBCA 5ECWA 3A1NA 1V1MB 4A8TA 1SQ0A 2NACA 3GVPA 1WXWA 3DQQA 3L07A 3C6XA 3T1HB 3PGJA 2FZKA 4QXAA 5HK8A 4BVBA 1E2LA 5DWQA 5FUQA 1HV8A 1YBVA 1FBNA 3RSSA 1T2EA 3STVA 4DY6A 5LNK6 3NUGA 2GXAA 2D7CA 4D1YA 1GCAA 1P7YA 3G2QA 5KSPA 4V38A 3H0CA 5IUJC 5JD4A 4RNDB 3NBXX 4V0NA 2FZ5A 3GJ3A 2DX7A 3D2AA 3SMQA 4BX8A 4KR2A 2QDKA 1EDBA 1F2UA 4JAVC 1TZCA 5AWFC 3FUXA 1EUZA 1GA4A 3EGDB 4QLOA 3RJMA 4QX6A 4YS6A 3DF9A 4M53A 4UVEA 3S7ZA 5KI6A 3TZEA 4GLBA 3L8GA 2QIOA 3IXLA 4X63A 2QGZA 4M6WB 5JJ5A 1M8KA 2P2YA 4PFKA 3HC7A 1A3CA 2KBEA 2WYHA 4KHZA 1KNQA 1GV0A 4N01A 1NBWB 4QUJA 3FPGA 1DQNA 5MDHA 5AKYA 1ICEA 1I3LA 4FMCF 1NJ1A 4RY9A 1HO3A 1P33A 5EE0A 2BFNA 4PPQA 4XWOA 4LK3A 4OHXA 4X97A 221PA 4BASA 3KBOA 3Q4GA 2F90A 1DTWA 3L84A 4CBVA 4G5HA 2BFCA 4WZAB 2BWJA 1MIHA 2P2DA 5EZSA 3T3OA 3K5WA 1HYEA 1T5LA 1QFZA 1RLUA 5DYNA 1Y5IA 2CUZA 1U1EA 1E3EA 3EXHB 5CFNA 3UPUA 1FNBA 3WR5A 4DRXB 4DLTA 1YB6A 4GXTA 1Z63A 1OAAA 1EUCB 3DD5A 3FBTA 4M0UA 4M8IA 1HLFA 1UBCA 2ORYA 1NVXQ 1A8UA 1YVEI 3TE6A 4B35A 1UJ5A 4H77A 2J3KA 4CETA 3PJGA 1BYIA 3EZYA 3HKCA 3IMGA 5BN1A 1F9AA 3F71A 3OCCA 4LX0A 1PQUA 2O2DA 4DWJA 3HJCA 3T1QA 3ZU3A 2VYND 4W6ZA 3V8VA 5HQ3A 5LLTA 4TS4A 1OLUA 5C37A 3CR8A 4A2QA 4MJ3A 1E2KA 5ALNA 1J39A 2GVDC 2DBVO 5D6OA 2VTBA 3T3GA 1C1HA 5K09A 3AL2A 2H0RA 3STUA 4BFTA 5I7AA 1MVNA 4ZKEA 3FOFC 3RK0A 1KY2A 3DZDA 1NVWQ 2PWPA 3OD1A 2OGWA 2IYXA 5G02A 1F38A 3B6MA 2AN5A 3W6NA 1NC3A 3FFBA 2WABA 3GMTA 1Z5NA 2DT8A 3A10A 3PHBE 1UJ4A 1FVFA 3T52A 5KS2A 2GNPA 4NDNE 1TT5A 1MEOA 3GA0A 3CH6A 4JJAA 3ORSA 4O4HF 3SEAA 1NXPA 1BFUA 1PV1A 1R9JA 1T5OA 1K4KA 4ITVA 4QOIA 3W8EA 5EIXA 3LW7A 5C80A 2AA3A 3MAGA 1F51E 3V3TA 2NU7B 4BKRA 3WWYA 4AO6A 2Q4RA 5EXEA 4JELA 1YS7A 2RFLA 4LUCA 5JE8A 2C5FA 3UJDA 5AI0A 4O1MA 1ZNYA 3KT6A 5T3UA 3LZ6A 2I65A 4O4JF 5AKXA 5EINA 5TJHA 3VOTA 4LMBA 3KVVA 1NF3A 2E4WA 2OFFA 2WFLB 2A1IA 3E3OA 1MB4A 2BGTA 3KTDA 3KDPA 4LDQA 4EMUA 3B2QA 3WLFA 4ERXA 1USGA 4F86A 1CEXA 4C78A 2CZQA 3KQSA 1M2OA 4WQMA 1WZUA 4C3OB 2AQ8A 1Z7WA 1F9EA 2W83A 4FGWA 4EG8A 2AMLA 4GKVA 5H9WA 3AR5A 4CU5A 3GA7A 2Y27A 1TVEA 3FF4A 1IDOA 4DYVA 1CZKA 1BVRA 1QHNA 1YV9A 4ZARA 3V46A 4ED9A 1ZO8A 1O6FA 2GZ2A 2WPNA 3FH0A 2H1SA 2TMDA 4XQCA 4ID3A 4Y6SA 4XJVA 3VR4H 2IUEA 1L5RA 2PMWB 1QRRA 3A31A 1I6KA 1Z4QA 4R16A 2XMGA 1BX0A 1L5MA 4XB1A 3S27A 3K6SA 1JKJA 1TJ5A 3FNEA 4QGBA 4R9UC 4ZYZA 2I4RA 1JS1X 1WMFA 2PX2A 2ZYUX 5I7SA 3VU9B 4AKEA 1CERA 5EP4A 3QYAA 3CUEF 3EEQA 3HFSA 3RG8A 3ZLBA 1JU3A 2JGEA 4AUEA 2GCOA 5GGXA 3PC7A 3CHYA 2ZSIA 3WSWA 4A2WA 3CKYA 4UVHA 4F9EA 5DGDA 5AESA 1BRTA 2ZBPA 3TRFA 3CLSC 3MLBA 3D7MA 4RQBA 5INTA 3HXLA 4YO7A 2LCFA 1XVTA 1PDVA 4RY8A 1TCVA 5EQFA 2G9UA 2L0XA 3DAHA 4PVCA 4MYSA 1RJ9A 4G36A 3QLVC 4H1UA 3O93A 5TPZD 3WL3A 1K8QA 2RC5A 1TJNA 2X8JB 1WU8A 4HDOB 2BEJA 2ZZNA 4RDXA 1VLHA 3LCRA 3GGJA 3HDYA 1IBMB 4FC6A 3B1WA 3W7BA 4BB9A 4FP9A 4C76A 4H1HA 4DSTA 1O0BA 4FZVA 3KOXA 2RGRA 1J97A 1YBHA 4Q82A 1W2GA 3OLZA 3QVGB 1J00A 3FETA 4BB0A 4CV0A 4EQ6A 1UK7A 1UZUA 2GO7A 3DMHA 5A3VA 1B6TA 2HQSA 1RFLA 1JHXA 2N0SA 3HVUA 2UZ0A 1XJQA 5FUMA 4M0EA 4CEIB 4YV0A 3L4BA 1PL8A 1DO0A 1R3UA 3CZPA 4ZQGA 3RRJA 1KEKA 2C96A 2FG6C 3ZD6A 4YV7A 1AGYA 4KPUA 4NS1A 1V96A 5GV8A 1U28A 1W5BA 2DH6A 4JLUA 5TC4A 1NVDA 2FPPA 4BE9A 5ALOA 1JWAB 2CKMA 1UXGA 3RHTA 3IQWA 2GTIA 2QKYA 5REQA 4R1MA 3ADKA 2C4HA 4PTYA 5FUVA 3G5TA 1CQJB 3IJEB 3T3NA 1TU0A 3W5CA 3TOCA 2BF7A 3GU3A 3ZHVA 4IIJA 2OVFA 2IEDA 5DO9A 2DLNA 1ESCA 1L4KA 4OHUA 2X86A 3KHSA 1CS0A 3IXQA 2HF7A 2QMZA 3C3DA 2A1UA 3IOYA 4WACA 3EMKA 1A9QA 1LS1A 4INZA 5EERA 3RUFA 4BWGA 2VDWB 2ID4A 1KQNA 4OB6A 4PXAA 1G7TA 4ZI2A 2NT3A 1OKKD 3DBOB 2OB1A 2CBXA 1SVUA 1SHTX 4JL5A 5DGHA 4BX3A 2NYAA 3UW1A 3HJTA 4BQIA 3EDMA 2M6RA 2QTMA 4K81B 2NYUA 1ZN8A 1GARA 5HJEA 2OO5C 1RYMA 1UPBA 4MS3A 5ALRA 1LV7A 1AF4A 1OGIA 1TQHA 3VR4A 5DX8A 5LZ4A 1OXUA 2XYHA 1N6NA 2QMEA 5HDBB 4RS3A 5E2IA 2ZVPX 2G08A 2OCKA 2XVAA 1V8FA 2FPRA 2ERYA 1OCEA 4YRBA 3M33A 4YR9A 1H5UA 4XRGA 1OF1A 1Q0UA 3I9KA 4Y9RA 1FNNA 3QMWA 5HA5A 5JQGA 2LIPA 5TMDA 2VDNB 5AVSA 4PZ0A 1N6RA 4RKWA 4X5OA 3IP5A 1TYEB 1TO1E 4DDWA 3HCOA 4MGKR 5CH3A 1XC7A 2W90A 1WBBA 2H1HA 3V1TC 3I0NA 2B4TO 2K7FA 5DN6A 3WA6A 1ZPDA 1NBOA 2YZGA 3GJ0A 1FRFS 1YE3A 3OMLA 1Y5LA 4ZDKA 1V2HE 4ZJYA 4BMSA 1ZD3A 2ORIA 5KJEA 4HQFA 4AZTA 1BCSB 1G5FA 4Q12A 5KQRA 3PBKA 2ONCA 4ACAA 4K8OA 1QGOA 1IAVA 2HU7A 4FGLA 4O2AB 5K0FA 3FHCB 1K63A 3T5MA 4FFBA 3TYXA 1QS0A 1SG0A 4L6AA 3A4MA 1XHFA 1ZBDA 2OYSA 4Q34A 3RFXA 1BQEA 3WDMA 5L51A 1YF3A 1RI2A 2QZSA 3JQ8B 1VKHA 5TF4A 2JA2A 1FFCA 3I1IA 4X1KB 4YBRA 4KYTA 2XV1A 2IW3A 4UHDA 5GJVC 1KZHA 4PG4A 5C7LO 4M1SA 3Q0EA 2GWHA 2O4UX 3ZVLA 4YTEA 1Q1NA 4E09A 3PU6A 4LYJA 2AE2A 3AKCA 3F2VA 2RH9B 5B2FA 4QRDA 2XGGA 1I0IA 1XZMA 5TQ0A 3EDQA 4AP6A 3RKSA 4WH0A 2ZRNA 3GO4A 4ZHQB 1XP8A 1BXGA 1YO6A 3R3ZA 2OQ2A 4LJAA 4AC9A 5AIBA 2E87A 1SCUB 2GILA 1IOVA 3EZLA 1E0JA 3UJCA 3B51X 3WMRA 1CZUA 1G8JA 1QH0A 4G5OA 1Y7HA 3JTMA 3F7TA 3H9QA 3C3KA 3G3EA 3KQPA 5FD8A 3RS2A 2ZYVX 3RYTC 1HI9A 4A0QA 3OG9A 4B3BA 2IBSA 2XTNA 4DV0B 1NW3A 5EUBA 4NENA 1P39A 2VKQA 2P2GA 3S2SA 4C22A 2PUTA 2XUOA 4FMBB 4FXPA 4FGKA 1PR0A 4WINA 2REBA 3WISA 1Z6GA 1R88A 2VLIA 4PF1A 1DJQA 2VH1A 5K8UA 4DRZA 2IXDA 3IVMA 3NCHA 4WERA 4H27A 3PKIA 4ZQBA 3RU3A 4BE4A 2HJGA 2EVWX 2YOFA 4ZVPA 2RGGA 2GH1A 4Q47A 4MIYA 5FTNA 4HB2A 1H0RA 3IAS6 4BLWA 4HB0A 4HWSA 4ZT2A 3GRVA 1WNTA 1RQLA 1Q7GA 2Q4EA 2QTHA 4IHAA 5HUQA 4XGNA 5K8IA 1Y8QA 1HA3A 3EPHA 1T4DA 5IASA 1A9XA 1D2NA 1C8LA 2QW1A 3IAEA 1VL2A 2RHGB 4JK3A 3UMVA 3TLKA 4A10A 2BZ0A 4RC9A 4B2YA 3TSWA 1K4YA 1Q7TA 1X7DA 1LWOA 1KY5A 1VL8A 4Q1DA 4RJKA 4AUNA 3OKCA 4XGRA 2AW5A 4EBBA 2HW8A 1F2TA 2EX0A 1XNRB 2XMPA 3KL2A 3EXAA 3TFQA 1JJBA 2CF6A 4IHQA 4XIGS 3RIXA 1DPGA 5J5VA 3RW9A 4K9QA 2NPFA 3T99A 1C3LA 2OGTA 3LC2O 4MRMB 4ROSA 3SOPA 1SBHA 2ZVQX 3CNHA 5A62A 2L69A 3KJIA 2E4XA 4X45A 5U9CA 3OPYI 3B48A 5DN6D 3QVOA 3AHEA 1ISIA 4XYGA 2M6LA 1RE1A 3BFVA 1ZM4A 1HL7A 1QK5A 1XTIA 2A94A 4JYPA 1L5LA 3UJBA 3WK5A 1T29A 2DP4E 3FF1A 5KVAA 1FSZA 1GA6A 4LE1A 2QUIA 1X7WB 5F2NA 1HQCA 3KHUA 4XD2A 1UK8A 2PANA 4INOA 3ABIA 2OV1A 2G36A 3RNLA 4CLOA 1OH7A 4B6EA 2OD2A 3RHSA 1GKYA 3FI0A 4RFVA 5FA8A 3TPZA 4JGIA 3DTVD 3GT3A 1S4QA 2G06A 3R5SA 4MQFB 2FWNA 3WWPA 3WNBA 4REOA 3CZ5A 3WB1A 4GUDA 3FOEC 3NNDA 3FM9A 2QN3A 2SBTA 1KERA 5EMNA 2IYWA 4LGYA 4E5KA 2VAWA 2BKLA 3AR9A 1V5IA 2HA7A 4MYHA 5IBPA 4COKA 2YQ5A 4NDZA 4EHNA 4R1TA 2BUBA 1KQFA 1EIZA 4DC1A 5CEFA 3UJ3X 4AZ0B 4B71A 4IYJA 5JDCC 1VYUA 3ZDYB 3U1BA 2QY6A 3OF3A 2XNDD 1L7PA 2IPMA 3ILXA 2AL7A 4PHTA 3IUYA 4AJJA 2LCIA 3MCWA 2HMAA 1E1KA 3L18A 2HCTA 4CPDA 4FEYA 3VPCA 1XQWA 2P75A 2H92A 3A0RB 3CUKA 1G3MA 1RHRA 3ET4A 1BFKA 3A3NA 1IPEA 2PNJA 5ICMA 1AHPA 5BV1A 3MT0A 1AO0A 3BUSA 3BZBA 1Y5NA 2XR1A 3F5QA 4FBMA 4EW2A 1NY5A 2FA9A 4JJEA 2COEA 1CB0A 4G5YA 3GLFA 1N2BA 4XYLA 1EG7A 1DRJA 2ZBGA 1NA5A 4BLSA 3VTKA 4G81A 1P6XA 4MNTA 5JBIA 3KQWA 1WBDA 1BHJA 1J24A 2WWGA 1JEAA 3AJRA 1H9BA 3ORRA 4OL9A 2DQ4A 1R4AA 1JDNA 3ZIUA 4C1BA 1W85A 1FYWA 4B47A 1A7UA 1T5TA 4NXNB 4OP3A 2DXIA 2PUCA 3CIOA 1KI4A 4UAVA 3S44A 2CWWA 1X9HA 4D8VA 2BTEA 1M8FA 1HYHA 4KYUA 3X43A 3G0OA 4ACBA 4KR9A 3TDMA 3W5JA 1ILEA 3E81A 4FR0A 3D6VA 2J3DA 2PYZA 4KO1S 3KKEA 3SBXA 2Q9BA 1G291 3BH7A 5ARBA 2RIPA 1O0CA 1IJBA 4MUHA 4HBGA 1W36B 1DCTA 1ZN9A 1AKMA 1XBTA 5IJAA 2QN8A 3RF7A 1R16A 3B6KA 1HE8B 2Q1YA 4K6MA 1P75A 1BS9A 5ITSA 2Q6TA 2ZAOA 4KOEC 2O0HA 5IC6A 3TECE 2DR0A 3ROGA 2ZRLA 3P9SA 4FFWA 3D4OA 2PA3A 3ETJA 3JQ9A 3PENA 2NUTB 3M5DA 4JUIA 1FUIA 2QAGA 4KIUA 3TUJC 1DEKA 2Z2JA 5A5VA 2RAPA 4PYIA 2AIRA 2W2QA 1EDEA 3WGZA 1CFJA 2V6GA 4LDAA 4TWRA 1E3WA 1RWBA 4PZYA 4IR7A 5ERGB 3WGNA 5I4KA 1ZY2A 3QMVA 2WMOB 4YXWA 1N2OA 5AM4A 4JUDX 3ZWCA 4R40A 3HR8A 4QYXA 2C5GA 4N6OA 5JSZB 4JXKA 3AF6A 2C9MA 1FMTA 5E3JA 5BR7A 3C3XA 4HEA1 4N7JA 1AQUA 1EBFA 1P1BA 3O2QB 2P90A 2IEZA 1Z38A 3TO5A 1EFLA 2HSZA 5HJ5A 4KX5A 3R7BA 1N6PA 3BQMB 1M9NA 2HXYA 3PC4A 2I54A 1E2FA 1FSGA 4UCFA 3SR4A 3V8MA 4LGVA 4J7XA 9ABPA 4YR7A 4YCJA 1NPTO 5ALMA 3MZ0A 3NHZA 3PFCA 1LPMA 2C4TA 1A5AB 2BN4A 4DLSA 1P74A 4PZUA 2YMLA 3L46A 5AKJA 2GPJA 2RCNA 3ONNA 4GMXA 5B12A 1J8DA 2IVFA 2R2AA 3FTCA 1S3IA 3W2EA 5DZSA 4TL6A 1IVNA 3U3OA 4MR7B 1IEWA 4EQ6B 1RMQA 1NLFA 2A5LA 2I2WA 3VH3A 4RJIA 3K4PA 1Q84A 2CLOB 2VPZA 2YJNA 5IDWA 2FH5B 4F4UA 4DCGA 4XSHA 3CX4A 3H9BA 3JATB 4PGFA 1QK3A 2V45A 4TSFD 3HA2A 4TV9A 4NYJR 2R11A 1DWPA 4ZI7A 2H2IA 1CUVA 1XDUA 1LK0A 3QIAA 2NV2B 1PX2A 1ZAKA 3INRA 4Y2GA 4RSRA 2PE5A 1R6XA 3Q9NA 4IQFA 3OICA 2AXEA 2RK3A 1RR6A 3O92A 2DQZA 1ODJA 2H1LA 1V3TA 4JC5A 4YMSA 4P81A 3M3DA 1N7IA 1YS4A 5TS2A 1E5DA 4H7HA 2QD3A 3E03A 1UDXA 1YJXA 4D02A 4KPYA 1KZ6A 4IJMA 1VLLA 1BGVA 2WP8J 3JALA 5B64A 2HT6A 2LP4Y 4IMIB 2OCPA 3OU7A 1YZLA 1JT2A 3OY7A 1KF0A 4HUJA 4JFRA 2MINA 4L4XA 1A9YA 2OCLA 4UNQA 1N0WA 2PUGA 2D8AA 1T4CB 2QJTA 1P5HA 2FWJA 2VHTA 2XB8A 3C1AA 4HYQA 2QSZA 2GRUA 3A36A 3DTYA 4TXJA 3ZN2A 4BLPA 2JZNA 4A6EA 3ND8A 4Z7NB 1MT0A 4G5SA 3V34A 1R6VA 2QQ5A 3IA2A 1QXSA 4DREA 3OX3A 1OH6A 2FN7A 4GGOA 4XQ0A 2YIVX 1Q1BA 4D9JA 5A5GA 2X40A 3F74A 2FMXA 3B7PA 3PNBA 3U16A 3KETA 1GCGA 2P9HA 2IHYA 3OHSX 1ZX1A 2OECA 3GLTA 4Q3BA 3TX6A 1K2WA 1MP0A 3JWHA 1SQ5A 4C08A 3SN6A 2F64A 5B58T 1FTSA 1RIFA 3S5JA 1MG0A 1ULHA 3DLBA 4BQPA 4JQCA 3WIBA 4M8LA 1W2WB 3OY2A 1VBKA 4AJ9A 3PPIA 4RD6A 4QRIA 2IV3A 1G5HA 1WUJS 4R1UA 3ESZA 1TMYA 1XL0A 4MVJA 1HDIA 1XVAA 4L28A 4M1QA 4TYMA 1MO4A 3V42A 4HNSA 3Q7RA 4X1YA 2CCJA 4UQPA 4UJ5A 5HFNA 4L4ZA 4LBYA 3WK8A 5TQ2B 2A92A 1JB1A 4CKCA 2Q7DA 4IRMA 4UEJA 4BFLA 4Z0TA 4IFIA 2UAGA 2MSLA 4ZK2A 3IVGA 3WRXC 3FYTA 2A88A 4OQYA 1V1JA 1R0XA 4DR2B 1N5RA 2OBBA 2F3TA 2QPTA 3L6EA 4A27A 4Z54A 2W11A 4U3JA 3BEDA 4QLBA 3MELA 4D4GA 3RDPA 2TSYB 3IQIX 1M72A 4JUAA 3EIXA 3GAAA 3W34A 2C31A 1XIVA 2UUOA 2JA1A 3JQCA 1WX1A 1WDMA 1OI4A 2WKPA 3CFYA 1SXHA 3TZCA 2Q2OA 1WM1A 1EAMA 2QM7A 2JDID 4WNAB 5C7YA 4HYTA 2XAUA 2Q5CA 4IH4A 1H94A 1R8SA 1P7PA 4U1RA 4MHSA 2OORC 1FDVA 1QG0A 5DCLA 3S2GA 3W77A 4D9IA 3PPWA 4Q9IA 1YRYE 4TKVA 3S3TA 3JQFC 5FI1B 1C4KA 3FOCA 2Q5FA 3T3IA 1GGEA 2GDZA 1GPLA 1XUOA 2DQSA 2Y9MB 3WJAA 1GG9A 3W8FA 1QRSA 1DDIA 4NPCA 2FETA 1OHHA 3W6ZA 1P1FA 1V8DA 2AUTA 1IM5A 2JKZA 2DFLA 3NVMB 4YJHA 5EHNA 1HE4A 1PNVA 3TPCA 3ELUA 2PD3A 3LPAA 4WCFA 2VF5X 4LOKA 3A1FA 3A3PA 4GZ6A 1VCNA 1MDBA 2PN1A 3VOSA 4NRDA 1FNSA 2X0IA 2F9FA 1KQ3A 1ZGZA 2PKWA 3SJAA 2Q5EA 3EFOA 4N54A 6REQB 1E4OA 2QT9A 2DT5A 3VJMA 1M2EA 4HAZA 2C3OA 4DUPA 4K6GA 4UFOA 5C8YF 5ARCA 2OHFA 3H1GA 4LBWA 3D3EA 2HU8A 1BH2A 2FWIA 4IJ6A 1K97A 4YRQA 5EVJA 3TLZA 4E4RA 4KU4A 5E1DA 1AM4D 4F3CA 1G5QA 1YRBA 4TV9F 4A82A 1ZOPA 1E9BA 2R1ZA 3IP1A 3HM2A 4HRXA 4J6EA 3FE2A 3V8RA 3OQOA 1KFJB 3HN7A 3K6SB 3MINB 4YJFA 1WXDA 1CUDA 4HGNA 4DNFA 3UWDA 3ER8A 2ZRKA 3E7WA 1BEUB 3FNIA 4ZOEA 1I4LD 4ZC8A 1NXOA 4E2XA 1JDBB 3AEYA 3CUYA 1YJQA 1G2PA 4M37A 3IUBA 1QORA 2YXDA 1M0EA 3RABA 4LTDA 4D2IA 1JDJA 4R84A 4CR8A 3G79A 3S2EA 3N6RA 4HGOA 3ZCUA 1B0PA 2F3PA 4TKUA 4KN6A 2FSPA 4MV0A 3NBFA 3AG5A 3NGLA 1LV8A 2FSUA 3SYTA 4F2WA 3K0BA 1YS1X 1Y6FA 2FW7A 2YHSA 5KYKA 1UXJA 4L15A 2BUAA 1ZK4A 1TC1A 3DP9A 3GEIA 1Z08A 4GPD1 4UBMA 5CT5A 1BMFA 1BN7A 4BP8A 1IMJA 4YN3A 3AFNA 3ERCA 2H17A 1MQAA