3R40A

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
291
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 112
structure length 291
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r40A00
1LLFA 2OAGA 4MEBA 4PO3X 5EHQA 3FBWA 3Q8WA 4TPKA 3E4DA 2XDWA 2WHRA 3AUKA 1W52X 1IZ8A 2XMZA 1CR6A 3CCBA 4UUQA 2G63A 2HU7A 2WUGA 3LS2A 2ONCA 4AX4A 1N5RA 1U65A 2WG0A 1UZAA 4AMZA 4P08A 3ZLTA 4FWBA 4MXDA 1ACLA 4QLAA 4Y2YA 4X6YA 2XUDA 1DINA 1WCYA 3QITA 5JAUA 1HKHA 5CRIA 2WKWA 1F8UA 3BL8A 2VEOA 3A6ZA 4I19A 1AGYA 5HK8A 5LYYA 4OU5A 4BZZA 2W6CX 3FOBA 3MVEA 5AOBA 1E89A 3GUUA 2WIJA 4EBBA 4H7JA 4AO7A 1AUOA 4KRYA 1UWCA 1K63A 2AJLI 4AQDA 2HIHA 2GYVA 2WLSA 1MNQA 2PBLA 4DNFA 4H18A 4BCBA 4M0MA 1BN7A 4F60A 5HQ3B 1JMKC 3LCRA 4QDOA 1MAAA 5AI5A 3C8HA 1XZMA 3I2FA 1XRQA 2OQIA 3C45A 2JF0A 5EFZA 4L9AA 2RGUA 5C8ZA 1BROA 5ISMA 3JW8A 1EDBA 1QONA 2BUAA 1WHTA 5AM4A 2XQIA 1LNSA 5ALLA 2XT0A 1FFCA 1CUJA 4GI1A 4MYSA 3IUQA 3PICA 1CUHA 5A6VA 4P93A 3H19A 2HFJA 5EHZA 4OYLA 5ALHA 4X71A 5KWJA 1SCIA 2WIKA 3HRHA 4X93A 4C6HA 5ALVA 4UBMA 2IX9A 2B9VA 4Q82A 4EY8A 4PW0A 3WKBA 5A62A 4L0CA 3I2IA 1PFQA 4JNCA 4Y2VA 2XMQA 4A23A 3D0KA 5ALUA 1ACJA 3DS8A 5CXXA 2QUBA 4DMCA 1VA5A 2LIPA 1ODCA 3U1TA 5AM2A 3O0DA 1YAHA 3AIKA 4NZZA 3D7RA 1H2ZA 1EINA 4L3WA 1WB4A 3IBTA 1RYYA 1FFBA 4PSUA 1XLUA 2WUDA 5A71A 2Z3WA 4CG1A 4CCYB 4JYMA 3BF7A 1ZI6A 1ZOIA 2HA3A 4J0JA 2GYUA 1UKBA 1QOZA 1VXRA 4QLOA 3C70A 2Y1KA 2ZSIA 1T2NA 1TAHA 4OPMA 2BAGA 4FDMA 3STTA 1DX4A 2J3QA 2I03A 1TCCA 1OILA 2ACEA 5CT8A 4C4YA 2DQYA 2WUEA 1AKNA 2QM0A 2VJDA 2WU3A 4QWWA 2WG1A 3T4UA 1SFRA 3WL8A 1ZD4A 1HQDA 2WIGA 4K6HA 4XVCA 3C8DA 4Q3OA 1W1IA 2JGFA 4N8EA 3C87A 2WHQA 4H35A 5AIAA 3QBJA 4B7ZA 4BRZA 1LPMA 2VSQA 1ZD2P 4DM7A 2XMDA 3O95A 1LBTA 1G66A 4BVLA 3FCYA 4C87A 2WTMA 5H3HA 3WWDA 1BEZA 5ALNA 1MU0A 1QFSA 4B6GA 1CUGA 2CEKA 1QO7A 5FP0A 4O08A 1R50A 1JJBA 2BJHA 4TVKA 2G5TA 4X7BA 3OC0A 5BWBA 4ZI5A 4FLFA 3X3HA 4BVJA 4KYVA 1R4ZA 4H77A 1ZICA 4KAFA 2OCKA 1Q84A 2PUJA 1WHSA 4LYDA 2JGLA 1XZHA 1H2YA 4OSEA 3DYVA 1E3QA 5CURA 1NU6A 3SC2A 4Z49A 5JAHA 3EQ7A 1P0PA 2ACKA 4PQEA 3VJMA 4E15A 4U2FA 4B85A 1R1DA 5K3CA 4FBLA 4HAIA 1CRLA 2RONA 5FV4A 3RKSA 4BATA 2WFMA 4Q05A 2PSFA 2AJCA 1A8SA 2QR5A 2HA6A 2ZSHA 3FYUA 4UHBA 5FLKA 3IVMA 3SX4A 5C81A 4N5HX 1MNAA 3I1IA 4E11A 4X95A 4J0IA 5DTIA 3DD5A 4KACA 1J07A 1K5PA 4W1QA 4HVTA 1JU4A 1U4NA 4WFJA 1MN6A 3OURA 1WM1A 2VJBA 3WK9A 1LPPA 3F97A 5HF6A 1UK6A 3R3VA 5DYYA 4U2GA 1E66A 3HABA 5FRDA 3O4IA 1PV1A 3H1AA 5DNWA 2Q0XA 4AO8A 1EDEA 3IUNA 2ROQA 1Y37A 4Q34A 5CXUA 5A7GA 1N1MA 2OG1A 4KJXA 5AI8A 1EDDA 4Y2SA 1DTEA 3UUEA 2WUFA 3H1BA 5K3FB 5IVKA 3WQHA 2W22A 3T52A 1A8QA 4Y2UA 4B83A 1B6GA 3M82A 1X2BA 1QTRA 3TJMA 2I3DA 1CEXA 1KU0A 1AQLA 5HCUA 4QE3A 3S8YA 1AMNA 1VKHA 1ZI9A 3KSRA 4WY5A 3ILSA 3O9VA 1CUSA 1E8DA 4UHEA 1WPXA 3FLAA 3PF9A 2RHTA 1Q0RA 2VATA 4BCCA 4BCDA 1NU8A 3WL7A 3L1JA 2Z8XA 2WIFA 4U2CA 2C58A 4G9EA 2WTNA 1UOPA 1OXMA 3H2JA 5K3AA 1E5TA 5EIHA 1TCAA 2O7VA 3WK5A 3G9ZA 2Z3ZA 3V1NA 1U2EA 4C01A 3F96A 1UK8A 4G4JA 3ANSA 1GQSA 3A2NA 3D5EA 5CH8A 5JAPA 5JZBA 1H23A 3LLCA 2JIDA 1XZDA 2O2GA 5AKEA 1GGVA 1USWA 4G8BA 5ALQA 3KWJA 3G9XA 3WKEA 1W4LA 3ESDA 2BUBA 1H2XA 1BN6A 4C4XA 2YXPX 3PE6A 1W76A 3FAKA 5BWCA 4UBIA 4BAZA 4GHWA 1DWQA 4LIPD 5HF9A 2PU7A 3N2ZB 1P0IA 2H9YA 1QIFA 4X92A 1W75A 1XZGA 4B0OA 3QPCA 3G8YA 1SC9A 4YASA 2XMGA 5LZ4A 4KAJA 1ZGBA 2ZJ6A 4Y2RA 4B0PA 2CB9A 4BYMA 5ALKA 4EZIA 4J0DA 5EI5A 5ALEA 1EVEA 4J03A 1HL7A 1Z68A 2IITA 3P2MA 4J0KA 3S2ZA 5ALWA 1ZIXA 4B80A 2OAEA 3R3XA 5DJ5A 3MUOA 1QIGA 4IH1A 2CBGA 2XUIA 1L7AA 3BE8A 3QYJA 3L1HA 1IVYA 3W05A 3IDAA 2XQJA 4DIUA 2PSJA 2AJBA 1QZ3A 3I6MA 2HRQA 2C4HA 5C8VA 1X2EA 3SWWA 3R3WA 2DCMA 1UOQA 1CUIA 1QLWA 4FLMA 2B61A 2HA5A 4XWGA 4RNCA 3UUFA 1L7QA 4P92A 4C4ZA 1YAJA 5JD5A 3EF3A 3H0CA 4BVKA 2OGTA 3VVMA 2PKYX 5AK6A 1LZKA 3KOOA 4UBNA 3STXA 2XLCA 3D2AA 1WB6A 1GKLA 4UFPA 5JALA 3DEAA 1CLEA 1CUUA 1GPNA 3FNBA 3SK0A 2WJ6A 5JIBA 2RAUA 4DSAA 4AB1A 4GBGA 4H7EA 5AKKA 2Y2UA 3OTQA 4Y2PA 1TQHA 2PU5A 4UHDA 5AM0A 3B3QA 2O2IA 3KDAA 6YASA 4QEKA 2CKMA 1A8UA 4MWSA 1CUVA 1VOTA 4CG2A 2AJDA 4M0FA 4FFVA 2XUKA 4Q1VA 2J4FA 4H7HA 1XRLA 2WHPB 3RM3A 2J4CA 4FOLA 2X5XA 2WFLB 1QIJA 3HSSA 2YH2A 3D2CA 4ZV9A 1EHYA 3O4JA 3W9BA 3MUNA 3G7NA 4DMHA 2HFKA 5K5EA 4J7AA 1DT5A 5SYNA 4GECA 3EBLA 5AKXA 4BP9A 4JYPA 5F4ZA 4CCYA 2ZYHA 1MX5A 5HFNA 1CUDA 5D3KA 5ALFA 3VKFA 4F0JA 5AM5A 3FYUC 4UHFA 3M3DA 1BRTA 2XUGA 4CCWA 3PUHA 4CG3A 3W04A 2XUQA 1CQZA 5T4FA 3I6ZA 2QXTA 2VJCA 2RHWA 2WFLA 1THGA 2NW6A 2K2QB 4ZV7A 4DMFA 1HBJA 4W1PA 5HZGA 1HPLA 3B5EA 3WL5A 1K6EA 1QIIA 1MJ5A 1XQYA 1J2EA 1UXOA 4AN0A 2G5PA 2VF2A 3R0VA 5AKYA 4C88A 5FKJA 2VT7A 4HXGA 5AK5A 1XROA 3V1MA 5C7YA 3K9BA 3KXPA 3FSGD 1O6FA 2YYSA 5AK3A 1CFJA 4GXNA 4Y2XA 3EQ9A 3QVMA 3KWFA 4QDXA 2OLEA 2GBIA 4EUSA 4TGLA 2C0QA 5ALXA 1IZ7A 4HXFB 3WA6A 1CUWA 1LZLA 2IIVA 3FVTA 4BE4A 4X00A 5AI9A 2CMFA 3F67A 2JBWA 3QPDA 5HKAA 4ARAA 3HJUA 5AM3A 2R8BA 4DTCA 2ZVDA 4L72A 1QE3A 5AH0A 1C7JA 1QGED 3OOSA 4HTAA 4AZ3A 1J1IA 3I2KA 1T4MA 2I78A 1S8OA 5E4JA 4X90A 1GXSA 3VDXA 5JD4A 2C5FA 3M83A 1EX9A 1K4YA 3IUMA 1CUAA 1GPKA 3DYIA 2AJ8A 5DYTA 3IIIA 4GWLA 5HQ3A 2QZPA 3HACA 1YASA 1XZIA 1H2WA 2HA7A 2DFPA 3BJRA 2BUCA 2HRRA 2JEZA 4X3CA 4ZREA 5A7FA 3WIBA 1LPNA 2HDWA 4PSDA 2Z5GA 1ZD5A 3AJAA 2GZRA 2CZQA 2JGMA 1Q83A 3IA2A 1QIKA 1D07A 4INZA 4CFSA 4DMKA 4E46A 3OG9A 5LZ7A 4XX1A 1FSSA 5T4HA 2OCLA 4G4IA 4J0GA 2HU8A 1E8MA 1YCDA 3GZJA 1EK1A 2PSHA 5JASA 1TK3A 4OUKX 3G0CA 3CN7A 4G1FA 4GLBA 3HZOA 2OQVA 3Q0TA 3M81A 5BV7A 5HF8A 3R3ZA 1P0MA 1GPLA 1YS1X 4RGYA 1QIDA 3W06A 1XKLA 5JZ9A 1N5MA 1VA4A 1VZ2A 1CVLA 2GYWA 2XMRA 1NX9A 3HLKA 1MX9A 2VA9A 3WWEA 3D59A 5FOQA 4KE8A 1OCEA 3W9UA 5T4BA 3NGMA 3IUJA 1VE6A 1IUPA 2H1IA 1H22A 5EHNA 5T4EA 2G4LA 2HA0A 1ORVA 3BIXA 3U0VA 3V9AA 5FUMA 4RE5A 3IULA 2JGKA 1UK7A 3H2IA 3WYNA 4LHEA 1AC5A 5BOVA 4X91A 5JATA 2HM7A 1XFDA 5K3EA 2V97A 4OB8A 2QMQA 4NMWA 1DQYA 3WA7A 2R11A 2VAVA 2WILA 4MYDA 3HXKA 3CCCA 3I28A 4BDSA 1EA5A 1DU4A 3WJ1A 2FUKA 4FKBA 5ALSA 3AINA 3I6YA 3WKDA 5CT4A 5ALOA 2D0DA 2XUFA 3B12A 2ZYRA 2HU5A 2E3JA 1E8NA 2WG2A 5K3BA 1WPRA 1RP1A 3UMJA 3AZQA 3F9CA 4I3FA 3W2TA 4DNOA 3C6YA 3K6KA 1CUXA 2QRUA 3V1LA 1SOMA 4LXHA 3TEJA 1CV2A 4N5IX 4BDTA 4KE6A 3DNMA 4IHAA 4BTVA 5CBKA 3AFIA 3G0BA 1XZJA 2JEYA 4H7KA 2QXUA 3I2HA 4Y9SA 3R41A 1RWQA 2VQ6A 3HC7A 2XMCA 2P8SA 5AK4A 4EY7A 4EY6A 4J3JA 5YASA 4EB0A 5FPQA 3BJMA 1AZWA 4UPDA 3DLTA 2QOEA 4QDTA 1MX1A 2DR0A 1P0QA 2OXEA 2Y6UA 5AIBA 3WMRA 4U2DA 1ZJ5A 1TCBA 4FLEA 3PI6A 3C6BA 5J3JA 5AKLA 3IB3A 2QJRA 5AKHA 2Y2VA 4BBZA 1TIBA 4ROTA 3G0DA 2D5LA 3WJ2A 5ALPA 1QIMA 3WIOA 4E14A 2X76A 5AKJA 1YS2X 3FVRA 4KR0A 4BC0A 3STUA 4OD0A 2O2HA 4J0HA 1FFDA 4N8DA 4X97A 3VXKA 3WYDA 4KEAA 4M0EA 4HZGA 3HI4A 4LXGA 2OCGA 4G8CA 3PF8A 1GZ7A 4RE6A 1JU3A 1XQVA 4V2IA 4B81A 5HKBA 2DSNA 2XB6A 5I9IA 2QT9A 1XLWA 2ES4A 3QH4A 4UBJA 1WOMA 2WM2A 5LLSA 4FMPA 1ODSA 1VJ5A 4H7IA 5IVDA 3H2GA 3TRDA 3AILA 1DWOA 2PSEA 5FDFA 4DLNA 1QTIA 3GELA 1THTA 1LPBB 4X94A 1XRPA 5LIPA 2BCEA 4K5QA 3LP5A 3QZUA 1F0NA 4EY5A 1BS9A 4NVRA 5E4TA 3OM8A 4BZWA 4OCZA 3WK6A 1XZBA 4UBKA 3GROA 3QM1A 4DSZA 2ZJFA 4FNGA 1BEEA 2XUPA 1VE7A 3BF8A 3GA7A 4RPCA 2BGNA 3A2LA 2B4KA 2PVSA 4B82A 5SYMA 2C7BA 5AO9A 1JJFA 3QPAA 1EH5A 2Y6VA 4FHZA 3ICVA 3WWCA 3C43A 1EB9A 2XMBA 3DL4A 3JYHA 5A7HA 1XZEA 3STYA 4LXIA 4D9JA 1CUBA 1UFOA 4QDZA 1LGYA 5CT6A 1LPSA 3C6XA 4Y7DA 4KRXA 1ORWA 3CN9A 3WLAA 3D2BA 4AO6A 4FNMA 4IQ4A 4S0XA 1CUFA 3ESBA 5EIEA 5E4YA 2PM8A 5IVIA 4MQMA 2VJAA 5AKIA 4EA6A 1QIEA 2ECFA 4MEAA 1VLQA 1PJAA 4A16A 3RK4A 4W1RA 1X70A 1YA4A 1JFRA 3VISA 1HLGA 5CT5A 3LIPA 1EVQA 4XIIA 3RLIA 1GKKA 4U2BA 5ALZA 4EHBA 1XRRA 4Q3KA 4H7FA 2C5GA 3BWXA 1U8EA 4W9RA 2V9ZA 4WDQA 4Y2TA 4HRXA 4WY8A 3IURA 2CUTA 4F21A 3DCNA 1JT2A 3O4HA 1C4XA 4Y2QA 5AI0A 3WI7A 2XQGA 1EB8A 3JWEA 3R3UA 4AZ0A 2ZJ7A 1R9NA 1HDEA 3ZPXA 1GT6A 2WSLA 5KREA 1LBSA 1CUYA 1N8SA 3FLEA 1G5FA 4BTLA 1F6WA 4ETWA 2EEPA 3I2JA 4BAUA 5DWDA 1G4HA 2BKLA 3K2IA 2XI4A 5AKZA 2HADA 3WWPA 1K8QA 2XLBA 1R3DA 3A2MA 2QJWA 1QIHA 2VAXA 1XLVA 5AOAA 1MTZA 1CUZA 5DYWA 2VT6A 3ZLUA 2DHEA 4X6UA 1TKRA 2PUHA 1LPAB 5LZ5A 1O6GA 1DWPA 2UZ0A 4ZGBA 1VZ3A 1CPYA 1FFAA 4KE7A 3HYSA 3VJLA 4MWTA 5JANA 5DNUA 2XUJA 5HF5A 2VTVA 2DHCA 5CH5A 3C5WP 1J06A 2HL6A 2ZYSA 1JJIA 2XUHA 4JEIA 1YR2A 1XZKA 4UHHA 1XKTA 2X8BA 1ZI8A 5DNVA 3I2GA 2GBCA 2PPLA 3R3YA 5CW2A 2PX6A 1CUCA 3FLBA 1XQWA 2FX5A 3YASA 1UKAA 1M33A 2BGRA 3ZLVA 2DHDA 4PV7A 4JH0A 4ARBA 2QUAA 1UT6A 4B9EA 3WZLA 4DNQA 1IMJA 4FBMA 3EQ8A 3E1GA 2AXEA 1KU6A 1G42A 3PUIA 5EIAA 2H7XA 4WDRA 3HEAA 4OU4A 1C7IA 4PF1A 2HHAA 4UHCA 5K3FA 3BDIA 4QA9A 4F5ZA 2Z8ZA 1UKCA 3C6ZA 2H7YA 3E3AA 5AP9A 3GBSA 4K6KA 4CIAA 3D3NA 3WKCA 5JADA 5LP1A 2CJPA 1A7UA 3G02A 3WZMA 5KBYA 1Y7HA 1WB5A 3H18A 4IH4A 4ITVA 5EGNA 2WQZA 3AZOA 2WJ3A 3VJKA 2H7CA 1Y7IA 3WK8A 2XMSA 2OCIA 2DQZA 2WU4A 4HRYA 1ZGCA 2WJ4A 4C89A 2XQFA 5CH3A 5LZ2A 3FYTA 1XZFA 2I3ZA 3AIMA 4U2EA 3LIIA 1QJ4A 5HFAA 1XRMA 3WL6A 5ALIA 3G9TA 4YK7A 4CI9A 4FFWA 1F0PA 4CIBA 4GW3A 4W1SA 5ALDA 2GZSA 5ALJA 5ESRA 2EDCA 5IKXA 4K6GA 3PDCA 5D3ZA 4A5SA 4BRSA 4Q3LA 1ZIYA 4MQLA 3DOHA 4B84A 1BE0A 3ICWA 2PSDA 4GDMA 3N0TA 2GBGA 3WKAA 5ALYA 4EY4A 1QO9A 3DDUA 3OPMA 4X6XA 3H2KA 5D7BA 4UBLA 3RARA 4Y2JA 4WFIA 4IH9A 4K2AA 3BDVA 2RI6A 3BXPA 1ISPA 3MGAA 3QMMA 4HXEB 4AXBA 5ALGA 3G0IA 3ESAA 3FYUB 3EIOA 5JD6A 4LYEA 4QWMA 5JZSA 4MJ3A 5AM1A 2O7RA 2PL5A 2QS9A 3DKKA 4YX9A 1MPXA 3G9UA 1ZD3A 1VXOA 4UFOA 1JKMA 3PFCA 1ZJ4A 2XE4A 5DLPA 4LKOA 2FJ0A 5ALMA 1TRHA 3A70A 2QKYA 4BB0A 1XQXA 4N8SA 2OGZA 3DJYA 4G8DA 3O9MA 3DQZA 1IUOA 2JGEA 5E2IA 1L7RA 4OB6A 3G0GA 1A88A 4QNNA 1BCSA 4AMYA 4BE9A 1JMYA 5IVHA 3R40A 7YASA 5C8XA 2OPHA 2XUOA 5IH7A 1AURA 1UK9A 2OGSA 1EI9A 3GFFA 3WK4A 5CTAA 3E0XA 1EXWA 4J0CA 3STVA 2WIDA 5LZ8A 4UBOA 3FWHA 5K3DA 4WFKA 4QZVA 5D6OA 3D4LA 3ANTA 1JI3A 3NWOA 4DNPA 2J3DA 5LKAA 3I1YA 2GBFA 2RIPA 1MT3A 5FPPA 4PSCA 1ODTC 3BIWA 5JARA 1GQRA 3NUZA 5I7UA 5A2GA 1CUEA 5AI6A 4WCVA 3L1IA 2JGJA 4QDUA 3DOIA 4G9GA 5AOCA 3F98A 4DYHA 4DGQA 5LKRA 4ZWNA 1YB7A 3AIOA 3DKRA 4BP8A 5HK9A 4JUIA 3ESCA 5AI4A 3V1KA 4XJVA 5AJHA 1IUNA 4X85A 4FTWA 3WWOA 1SCKA 5JAOA 4NS4A 2WFZA 3ED1A 3ZWQA 4G5XA 1XZCA 3H04A 4H7DA 4W63A 3ZI7A 1SCQA 1DX6A 2B20A 3ZV7A 2HA2A 4HS9A 3H17A 4ZRDA 5CMLA 1FFEA 2QTBA 2YASA 5I8PA 3NOXA 5AKGA 2WHPA 1ETHA 2XUAA 1BU8A 2XQKA 3KD2A 3WK7A 1KEZA 1XZLA 1XRNA 1YSCA 1CIJA 1MO2A 1UOOA 1Q0ZA 3V48A 2HA4A 5KWIA 2JGIA 4OYYA 4KAAA 4GEGA 3PFBA 4BC1A 1R88A 3CXUA 2ORYA 5EHXA 1FJ2A 3DL7A 1QFMA 5LZ9A 1I6WA 4WJLA 3AZPA 4ZXFA 1EK2A 4AN1A 3FSGA 2V96A 3TGLA 1CQWA 4H0CA 4YPVA 2QVBA 4OB7A 4IO0A 2BFNA 5ALTA 5CT9A 4KE9A 5AICA 2FJPA 1MAHA 3C5VA 1R9MA 5DTJA 3F8SA 5ALRA 3QMWA 2C0PA 1BCRA 1XZAA 3FCXA 4I4CA 4UFNA 3STWA 1AX9A 2EDAA 1DQZA 1LPOA 1B41A 2V98A 1YA8A 3H2HA 4PNZA 3O4GA 5FXMA 3QMVA 3VVLA 1YB6A 4BAGA 5JYCA 4B9AA 5AHXA 4G4GA 1W6RA 2ZYIA 4P9NA 1DT3A
chains in the Genus database with same CATH superfamily
4LGVA 5BN5B 2VUIB 1X77A 1FFHA 4HAZA 4MEBA 3K4HA 2MYUA 4Q93A 2YMPA 3B51X 4OXQA 3WYAA 5G0SA 1PBTA 3FTFA 2QQFA 4G36A 5C37A 3QTTA 3TOXA 5KWVA 3QVSA 2ECOA 2XMZA 2XYPA 1I2AA 4FONA 4ZODA 3UQZA 1OFUX 3AR8A 2IU4A 3C5EA 3UB3A 5I7HA 4CW7A 4UUQA 1WB9A 4UTVA 5I4CA 3CUSA 4CLOB 1N5RA 4N5LA 2FZKA 4RLHA 2J3JA 3EH1A 2VP9A 2DLDA 4BKUA 1AOXA 4C2UA 3C8MA 4MXDA 5CYFA 2UVDA 2R8RA 4CYMA 4GSKA 3QXJA 2SBTA 2Q29A 1WAMA 1N0WA 1TYEB 3INNA 4QULA 3SZ3A 2EAUA 3U26A 4XH9B 5BUZA 2Q2OA 4C78A 2FW9A 5JAUA 4D4IA 3MRSA 1J21A 4BS9A 4N54A 4B6PA 1F8UA 1MR3F 1E0KA 2VEOA 4JI6B 3A6ZA 4TSFA 4BLOA 1I13A 2HMVA 3GG2A 1X13A 5HK8A 3DNPA 1Q0SA 3QV2A 4ZK6A 1XCPA 2RHBA 3W6PA 1FL9A 2A5FA 1V26A 3MVEA 3EDQA 1E89A 2NV2B 2KQUA 4ZU6X 5HRUA 2PLWA 2W83A 3QE4A 3QLTA 4H7JA 1IZ0A 4MMYB 1E2DA 4TV8A 3T9DA 4PNHA 4AO7A 4I5DA 1AUOA 3A4TA 3EISA 4KRYA 1UWCA 1WDWB 4QRHA 2O1EA 4KDRA 4XD2A 4ZC8A 1N3YA 3L8CA 4I6EA 1IVNA 2GZHA 4AQDA 3U3MA 5JMPA 3HP1A 4NYMQ 4XWKA 2B2XA 3BVPA 4L0DA 4XQCA 2Q1YA 5KUTA 2IUSA 1A82A 5LOVB 3S0JA 1SIUA 1V7ZA 4H18A 2H6EA 3RRBA 3OI7A 3T7IA 1HO3A 3A6HA 2GM9A 3E6AA 4YAUA 4WW0A 3EA0A 2JHAA 3DO8A 3G2JA 2R7KA 5H0IA 2AEEA 3C3MA 1P2SA 3UH1A 1CZRA 1KL7A 4O2AB 1OT3A 1R64A 1AKRA 1ZWLA 2ZATA 4J1TA 2Q8PA 4OBXA 4F8EA 2IBTA 3KEMA 3C45A 4GS5A 3AI3A 4JVSB 5EFZA 2RGUA 5C8ZA 3V4RA 4F4UA 4XX0A 3H84A 1I94B 2VKQA 1KJWA 1Y6ZA 4DA9A 5ISMA 5CA0F 3RAGA 3WMGA 1WHTA 1AZSC 4U0JA 1OE0A 5K0GA 2XQIA 4L9SA 1LNSA 2E4XA 3SBDA 3T5BA 2PKQO 2BHNA 3WA7A 3C3AA 4RF3A 2JLRA 1G18A 2QY6A 3GH3A 3WP0A 1SUCA 3EOBI 3RT9A 3X1DA 1R9JA 4RPHA 2MSDB 3CNHA 3ZCSA 4RTKA 5AJUA 1NUQA 2BEJA 4EUEA 2POQX 3PICA 4QUGA 2YFQA 1Z6ZA 2W70A 4A27A 4R01A 2PUEA 2IDZA 2ZRFA 2JAUA 4BEWA 5A6VA 2AFRA 3A10A 1QGUB 2Q7XA 2PLFA 1SRQA 2SKEA 3UNXA 1OLXB 4YXWD 4M1WA 4XDHA 3ZIDA 3KWLA 2HFJA 2Q4EA 3FFTA 3M6AA 2NAFA 4EG5A 4YLGA 3AB3A 4XPZA 2VBGA 3CSUA 1XDBA 5FHQA 2H2FA 2P5YA 2BBTA 2YZKA 4RDHA 1QX3A 1SCIA 3GJYA 2QLTA 5FYDA 4BPBA 1KRWA 3OUZA 4HSGA 4X93A 1XD8A 2ZGVA 3QX9A 4FHFA 4HAXA 4C6HA 5BT8A 4G5HA 3LGSA 1JJ7A 3RRMA 4UBMA 3W6UA 2A78A 3NPMA 1XD9A 2B9VA 4WT7A 4LUCA 1AQJA 1BDJA 1QH1A 4Q82A 1EX6A 1VP3A 2GO1A 3C14C 1A4RA 2GPSA 3LCJA 4FK8A 5DTEA 1EZZA 3RFCA 5CFZA 2ZM5A 4RCYA 4AWAA 4NMMA 1JR6A 3SLKA 4KPYA 4GX5A 1PHRA 5CUQA 4Q9LA 3WB2A 1E4YA 1EXDA 2WABA 3WLOA 1N6IA 1P2UA 3D0KA 4M0CA 5ALUA 5EE3A 3ROMA 2V6FA 4PEVA 4HQOA 3PITA 3DS8A 1XQ6A 1SY7A 2DBRA 1H2EA 2O0MA 1PS0A 1QB7A 3JYNA 3OAAD 4MGYR 5CXXA 5K8TA 1D7AA 1E59A 5JNTA 4NE2A 4C7VA 1XZ8A 1RWXA 3GT3A 1PL7A 1VA5A 3DAHA 3REQA 3ROKA 4B71A 1ODCA 5FUXA 3U1TA 2YWBA 3H4VA 4FMCB 4MPDA 4XB6B 5KYKA 4K9OA 3PFIA 2OD9A 3I62A 1DBWA 2NPOA 3ZCVA 1KWKA 4BFYA 1S01A 1NPTO 4E6EA 3FFWA 4HY3A 3RS9A 2HEGA 1YAHA 5JE8A 3ZXUB 1F06A 3P4XA 1FK8A 3WAKA 1N2CB 1H2ZA 2CGEA 1MOPA 2H4FA 1E9AA 3FBGA 3IP5A 4E5VA 2E21A 3G88A 4D0LB 1VL2A 3C98A 5JCXA 3DLCA 5FTNA 2AFIE 2ZPAA 3OMLA 4L3WA 5EZYA 3V2IA 1NI3A 1Y8RB 3IBTA 5HGJA 4AJ2A 4HN4B 4DDTA 3U48A 1FFBA 3EWAA 2CK3D 4WLEA 5CHEA 1XLUA 2HI0A 2IOFK 3VI4B 4JU8A 1UDXA 3T5AA 4CG1A 1KO7A 1W2HA 4CCYB 3OT5A 3BF7A 1PR2A 2BPOA 3TNFA 1JPNA 4DRZA 4FOTA 3ZU6A 3BMQA 4J0JA 5E1OA 2GYUA 3BBLA 3PDHA 1QOZA 1NW5A 2YMMA 4G5YA 5EP4A 4D79A 1BA3A 3KUKA 2VNHA 4KZKA 2GM4A 1ZUHA 5FBKA 1NHGA 2Y1KA 2Q3JA 3K6SB 3KYJB 1P2TA 2C4UA 1GGKA 3DSRA 1RMQA 3PK0A 4MKRA 1QZXA 3H7IA 1XAJA 4LY3A 4FDMA 2ZSUA 3TTYA 2J0EA 1P7PA 1XI2A 3STTA 2J3QA 3T0FA 1TCCA 4RKYA 4D9MA 2NYVA 3LT2A 3K70C 4OLJA 1F6DA 3EUWA 5JLAA 3TZLA 5CT8A 3UG7A 4QICA 4L02A 5CIYA 1ZCZA 3KUUA 2O54A 1XHEA 4LNHA 5HS4A 1X7DA 3IQGX 3IX7A 1AKNA 4B47A 3OEEA 3ZGZA 4KX3A 1OSNA 1Q0QA 4KV9A 5MFZA 1SMKA 1AXRA 3SZUA 3B3JA 1ABBA 4QOGA 1OGYA 3JRXA 2QTAA 1GZ6A 1ZD4A 3JQEA 1GUFA 1W94A 2W2LD 2K6GA 1EWTA 4EPRA 2RHJA 3L02A 1E94E 4K6HA 1UC4B 4NZMA 1MXHA 4POOA 3CVOA 3W2EA 4Q3OA 1DKOA 3TVTA 1D4AA 4II2A 3T8YA 4W9MC 1O9HA 2WZQA 3ZDYB 2EWWA 1TUEA 3GNSA 2QI9F 4L8YA 4IMRA 3DTVD 4N8EA 4PYMA 1POWA 4YDSA 3MJEA 5DXAA 4ED9A 5I3ZA 4L6CA 1AKVA 4GLOA 4MRMB 1ST2A 1TUIA 2FB9A 1L7OA 4ZCTA 1QDUA 4II7A 1UODA 1ZCFA 5TARA 4LRWA 5K1ZA 1NJSA 1W19A 2VSQA 1RDFA 4Q48A 1NX6A 2EL9A 2FQWA 5IMBA 5KQMA 5KOHA 3EPJA 3DZIA 2POCA 4PXYA 4DS3A 2XMDA 4FFMA 1RQXA 4CIWA 3EUFA 4HZUB 3UAYA 1TU0A 1TYZA 3Q3CA 4C87A 2FXIA 4N3CA 1EIZA 1EVZA 1VL1A 2WTMA 1G8SA 3BRQA 3HA5A 4HEA1 2YIMA 4I4TF 4RCZA 821PA 5KYWA 5LP6A 5LU9A 1NF2A 3SVTA 1R8JA 1Q16A 2C4TA 1EJ6A 1L8LA 2PQ6A 1RAIA 3HGMA 3ZN2A 2E5LB 3QNUA 3VHRA 1PEAA 2BFDA 4KNVA 1A9RA 4QFCA 3F73A 2IOFA 1CUGA 2GERA 2JAOA 3L8HA 3OQ6A 3PENA 3RHZA 4JJ4A 1UKVY 1AZLA 4BKOA 3CEPB 1QO7A 2JD0A 3BH0A 3E9EA 3NJ8A 5BSMA 1PHPA 2P79A 5FP0A 3FNIA 4C4PA 3G2KA 3H75A 1J9EA 3IA7A 4MRNA 5EHGA 4ZXPA 4CLXA 3VNVA 5FUQA 3TFWA 5ER6A 2AQ8A 5CB4A 1E2UA 3Q8LA 4NK5A 1C80A 4PZ9A 5TDHA 3NYIA 4A8JC 1VSQA 3SHOA 2PLNA 2ZRIA 4X7BA 5JS2A 2OZKA 4M36A 4FGWA 2NUPA 2DWOA 4FFLA 3C16C 2JFUA 3V8MA 3SAJA 1XRJA 1PFVA 2XA9A 2O6LA 3LY5A 4Y98A 1NKTA 1P18A 3D4NA 4I1IA 4G86A 4MGZR 3EVNA 4F5DA 2G1AA 2H1SA 2RB5A 3KOMA 4YDHB 4D6YA 1EFTA 2VH2A 1N6LA 1HMPA 3OKPA 1NJ2A 1M1XB 4EEXA 1G2PA 2FFBA 4WINA 5BMVF 1XP8A 4JLOA 5F1YA 2WPNA 3KQHA 4JSRA 1EE1A 1QYXA 1R15A 1SCJA 1E1DA 1Z34A 2AF4C 2IZ6A 3S5JA 1YVPA 1WCXA 1TNDA 1XCGB 3IT3A 3QKSA 4OSEA 4V0OA 1R16A 1QC5B 2RBGA 1T4CB 3BX1A 1RQRA 2F1JA 1DAHA 3E9RA 3QA9A 1NYRA 3EQ7A 4IHQA 4WACA 3WFZA 4CCAA 4I4TA 5JXWA 1P4GA 1V71A 3QRWA 3LUFA 2IXTA 2C29D 5KSPA 4MI6A 1NUHA 2RCYA 4WZBE 3VR3D 3RJ9A 3CLRC 1CQIB 1X7GA 4FBLA 2IV3A 4CQNA 1UADA 5CLGA 2EJBA 4BP3A 5FV4A 3IS3A 3V6MA 2YIDA 4BATA 1Z0KA 2WFMA 2Z04A 1G55A 3KXIA 1FYDA 4LI3X 3X1WA 1OAOA 3E1KA 4P22A 3AHCA 1DQPA 1PQ4A 4XD7D 2ZTMA 3HLTA 1A8SA 1T8PA 1WQ1R 1E0AA 4OKIA 1OB2A 3F46A 4YXFA 3FYUA 4S1PA 2BM8A 2B25A 2WINI 4IDPA 1UIRA 3W3ZB 5L53A 1C9DB 3GUHA 3DUWA 4TVSA 3KQNA 2ZE8A 1JF8A 3R6GA 1E0SA 4QUBA 4WEQA 1DAEA 2VRBA 4OKSA 3SX4A 4JL8A 1OIWA 1NURA 1IEVA 1U0LA 2FEAA 3P71T 4OK5A 3R75A 4N5HX 1EUZA 1E20A 4UAVA 2C2GA 5IW8A 1GUZA 4HQNA 3SHQA 1P72A 3OPYI 3QEKA 2RHDA 4J0IA 5EJEA 1PNRA 3TNJA 1YZLA 2ZUWA 3UT0A 2H17A 1B6RA 1P9NA 4XSGA 4HVTA 4PQRA 4MRSA 4PAWA 3AERB 4Z4QA 2O8CA 4MYCA 1JU4A 5D8DA 2IYEA 3OIUA 3L6OO 3N8IA 1FXWF 1S3FA 2OOKA 1K6XA 2HWKA 2VJBA 4FIDA 3PNMA 4ZZ2A 2P3OA 4QYTA 1ZQ1A 1AA6A 4H17A 1GTG1 1UM9A 3VR6A 4NFYA 1AHNA 3CKLA 4D41A 1UK6A 1Z17A 5JSFA 2FPRA 2CXHA 4GP7A 4DEXA 4DA4A 3HABA 1OLSA 4V3BA 1XL0A 1J9ZA 4KVZA 5JH7F 3H1AA 1I7PA 3OQIA 5E9JA 4MNTA 4NBUA 1G7CA 4DLWA 3BTVA 4YNBA 4PG8A 2RKOA 1NI5A 2IX3A 1NULA 2PANA 1WXHA 4JJKA 4AO8A 4IJWA 3OBIA 1EDEA 3R76A 3P96A 2PS9A 4HB3A 5F2EA 2B5OA 4HXYA 1CVRA 1Y37A 2D1TA 5JAZA 2H0RA 5CXUA 4CN8A 3GGDA 1ZVJA 4LJ7A 2Z2YA 1LSSA 3O9ZA 4WFQA 3QELA 2GXUA 2MCFA 3R77A 4R1PA 2WJJA 4D0SA 4FEGA 3WNBA 2JLVA 3KTAA 3MJHA 3HP4A 3U3XA 3VPGA 4ID3A 3KEFA 4Y2SA 4GOJA 1SVOA 3IKLA 1DTEA 4RF5A 2G28A 1PR3A 1PW7A 2WM8A 2WUFA 3TI9A 3H1BA 4IIBA 3ZHCA 5CG2A 1X9GA 4A3SA 2BOVA 2R65A 4LOAA 2VQSA 1FLDA 1IK4A 1H94A 2JIPA 2W22A 3MJFA 4KWTA 4LVNA 4RD0A 5JNRA 1SB9A 4G0WA 3A0UA 4B83A 1II0A 1FMLA 2FPGB 2G08A 4CM6A 3M82A 4WA8A 5EOVA 5JMWA 5KYGA 4S3MA 1QTRA 1PT7A 3TJMA 1WMSA 3B7GA 1RM0A 1TMYA 2NIPA 2I3DA 3QOXA 4HX9A 5GVRA 1CD5A 3HCDA 2BISA 2YBEA 3GFGA 3OO0A 1AQLA 4GQAA 4QHYA 1EU1A 4QE3A 4JS0A 4X63A 3JQ8A 4CLEA 3EH2A 1N2BA 2GXSA 2JFZA 2X23A 1XVLA 1ZI9A 3O1JC 4MGEA 2KWIA 4JB0A 2XRYA 4HGPA 3W2FA 4J2OA 6GPBA 1KWGA 5JLJA 3PC4A 3NIDB 1HRDA 1G59A 1FP1D 4PTZA 4B6FA 4UHEA 1KSGA 1WPXA 4OI0A 3MWDB 3TSOA 1MAVA 2RGBA 3OCCA 5BV0A 2D2XA 1GRCA 3M9LA 2YS7A 4LOLA 3KB1A 1C9NA 1RI5A 3ZDZB 2VDWA 4Q0MA 1FFXB 3AR3A 3QBTA 1AQNA 1TTQB 4KC0A 4M98A 4F93B 3VUEA 2A4KA 1LFDB 1XAHA 2WWIA 4RAQA 3IT2A 3HGQA 1PS8A 3VR1A 3L1JA 4W6QA 1GKIA 2NTVA 4XXHA 5IYZA 1YRWA 4C22A 2QN6A 1PD0A 1HE2A 3MJVA 5GV8A 5LLTA 2ZITA 3ZK7A 5K8CA 3ND8A 2W0SA 3CLRD 4HTFA 2CSUA 4FD2A 4ZAFA 5JSZA 3WYFA 3ZWAA 4M7OA 2X7HA 4XYBA 2P3LA 3H2JA 2J9FB 2B21A 4CF4A 1S3GA 1W25A 3NAMA 5DK6A 1X92A 2GM5A 4WCDA 4P6VF 2O5RA 1VJ1A 3KEOA 5EVJA 5K0CA 3E0QA 3F8WA 5DI3A 5C35A 4KQ1A 4AZSA 3CEHA 3UJ8A 5A5VA 4ZT3A 3KJXA 1EBBA 3OCUA 1SELA 4O5OA 1J8MF 1KDRA 2CLKB 1AQIA 1U2EA 1QPGA 2Z1NA 3HS3A 4XYGA 2ICAA 1KZHA 2R6FA 3K5HA 4MJXA 4U7WA 4M1MA 3EBPA 5ERYA 1HEIA 3DXXA 2W6JA 3P0FA 1RBQA 2GAJA 3K6JA 3PJGA 3BKWA 4MX8A 3U62A 2O2GA 1YQDA 4B3DA 1T6XA 2OXFA 3NCTA 4Z86A 5MGNA 2JLAA 2NTJA 3HKBB 1PGNA 2VQEB 4CG0A 3M5DA 5DCLA 1IZ9A 3KJIA 1OXBB 3PCXA 3G9XA 2ONJA 4EG0A 3CF4A 3WKEA 3I09A 2V3CC 1C7ZA 1BC5A 3B9QA 5KU1A 2Q8QA 2N75A 4HI0E 2C0CA 1E2MA 3NBUA 1HUQA 1R4NB 2XD4A 3TLCA 3G13A 2CF6A 1W47A 2ZUSA 1W76A 1PGPA 4ZEOA 5C8DA 4K26A 4O8CA 4UBIA 4BAZA 4ZC1A 4DDKA 1BH2A 2WNSA 3ZJTA 2V6GA 2YHIA 4L95C 4R4JA 4WPGA 4HWGA 5CNJA 5E9AA 2PU7A 3V00A 1WF6A 4JV5B 1QKKA 3ITEA 3B1WA 2FEXA 3M1AA 3SXJA 2H11A 1PR1A 2CFTA 1WPGA 4O59O 1J5XA 3TVDA 1ZM2A 5HJ7A 3JVIA 2BSXA 5JISA 2TECE 4TRRA 2ZREA 3F7OA 4WKOA 3ETJA 3KR9A 4BV8A 1K8RA 4UMEA 4AWBA 1RBYA 5ECDA 1GZ4A 1QYCA 2JLBA 1LVGA 1SKUA 3MIIA 3NTQA 4WZBB 4XQEA 5D5PA 4BNWA 4E2WA 2RHRA 4D5GA 4BWYA 3CLSC 5LN1A 1RKVA 1R12A 2I54A 2P2SA 4UATA 2ZCVA 5E6RA 1H4SA 3IMEA 4MW7A 1VG0B 4JHXA 4OQDA 4LK3A 1E9RA 4Y2RA 2AN1A 4XYLA 3PNPA 4I9FA 2IW1A 4BYMA 4HB2A 4K7JA 3TZCA 1GGMA 1EGVB 2J45A 2Z0MA 2DUJA 4RZSA 4L4RA 4TMVA 1X7WA 3E22B 4C4AA 4F1JA 3W5CA 1K9SA 1VJGA 2BL4A 4CEIB 5EI5A 1CDZA 2JD1A 4B75A 1PQYA 3SY8A 4ETMA 3BD8A 2R60A 1KOLA 5LPNA 3N2IA 2JIZD 3FOFC 4J0KA 3LA6A 3GLHB 2F8SA 2FPGA 3MOIA 2AFVA 4OHUA 4R9UC 4KOEC 4B80A 3H5AA 4NXMB 3T3OA 4NQRA 3OCYA 4QFBA 3UJBA 5EJAA 3UKOA 3HBNA 4BO9A 3ZE2B 4Q9KA 4F84A 2WI8A 3LXMA 4CT0A 5DJ5A 1U2DC 3CZQA 4CIVA 4D8UA 3D3EA 4IH1A 5J9FA 2PUTA 3O91A 4P1ZA 3MWLA 1OFIA 3DE7X 4MQEA 4RVDA 2FLWA 3LC7O 5C2JB 4MUKA 3MYRA 3DW3X 3KQKA 1IVYA 3EGVA 5ES4B 1L4NA 3SFTA 3SSMA 2R86A 1C30B 3AG5A 2XYGA 4FGLA 1O96A 1LLQA 3BMXA 4WADA 5FT9A 5LQKA 3QEAZ 3OLWA 1UOEA 3LQQA 5JPIA 4DV5B 1I30A 3L7DA 5C8VA 2IZZA 1LU9A 3M6LA 3KLBA 1YQ9A 1MEJA 1O97C 4D8TA 3PE4A 5BN5A 3EY4A 2OD2A 3R3WA 2W2QA 5EPOA 1UOQA 4LF4B 1I7DA 4CTOA 1YUNA 1TU3A 1CUIA 4F4JA 4FLMA 2IY9A 4FFSA 4OQNA 2GD6A 1QV7A 3HMKA 2XD9A 3ETEA 2ZYUX 4DABA 1UM9B 1OZAA 1K8ZB 1RE1A 2FFAA 3D4BA 4GZLA 1DJPA 4M1EA 2YXEA 1GKYA 4HYTA 3PNYA 2PUAA 3AWIA 1KPHA 3EVBA 1QS0A 3EAFA 3KQSA 1Z6AA 1QPZA 4P92A 2CXQA 5JSKA 2F67A 5JD5A 2EFJA 1N5OX 2YQ5A 1DTSA 3H0CA 4M37A 4U5QA 1XYYA 3OJEA 3VVMA 1H4VB 2AYZA 3ZHUA 2NP7A 2WP0A 1FDIA 1LV8A 2QN1A 3AVQA 3F2IA 4UTXA 5CX1A 5GONA 3OD5A 5AK6A 1HI9A 3S2IA 4DLPA 4H4DA 4UBNA 1MABB 1TVKB 1G9TA 2XLCA 3D2AA 3F8TA 2QVGA 3ROPA 1IXSB 3QE3A 4L3OA 3RJ5A 4FFOA 1KTIA 1W6UA 1ZM7A 1PYGA 1Z88A 3GZNA 1WV0A 4DR4B 3GLHE 2VAMA 3ZNQA 4HQRA 4CWAA 4UFPA 1JSRA 3A3OA 1CLEA 1GY8A 1NKVA 1MJGM 1RXEA 1Z4LA 3OLZA 2GJ9A 4OF4A 3VSBA 1UIMA 1YZTA 4IF4A 1LQ2A 3W77A 4EOGA 5DM2A 3ABIA 4YRJA 1KBQA 5IT5A 4XQ0A 2IU0A 2WJ6A 3BL5A 5HQTA 3NWBA 1OXKB 4ALKA 3PFNA 2BGIA 1DJQA 1R8XA 1XYVA 1E9CA 2H57A 2ZEJA 2ZYTX 3F6YA 1W9HA 4H7EA 3RFUA 3WO1A 4Y2PA 1YUMA 3A05A 1TYCA 1KI1A 3FMPB 1E0JA 1TQHA 3FTPA 2CFIA 2PU5A 1MV8A 4D8YA 5ITZA 2HWXA 2M9MA 3GLIB 4UHDA 5H3CA 1PS9A 5AM0A 1HNWB 2O2IA 1LCIA 3KDAA 3MGGA 2P9CA 1YA6A 3E27A 1GU0A 1S8AA 2ZIEA 4Z5XA 1EUYA 4DA7A 1S9DA 6YASA 1BHO1 1Q1BA 5DGTA 3OJOA 1GL7A 3FZGA 3IEIA 3RUCA 4BFCA 4IXDA 4Z4IA 3TD6A 5I45A 4BU1A 1A8UA 2IKQA 1KEEB 2J31A 2YYAA 4EZEA 5AJWA 3HDGA 4AP9A 4RK6A 4V3CA 2FMUA 2AJDA 1AHIA 4M0FA 1OY1A 1QWOA 4FFVA 5EAIA 5KSZA 2C92A 4WBSA 2FP3A 2VHUA 2I76A 1CWUA 2QAGA 3E53A 1H0HA 1GITA 1PD1A 4J4TA 1ZIPA 3DQPA 2WHPB 4NBWA 2CY0A 2F2TA 1AGNA 2J4CA 1X8KA 2X5XA 2ZULA 3SF8B 4IJ5A 3PWSA 4CL8A 1KYIA 1WP4A 4PTLA 3M89A 5DWVA 5HE9A 5F98A 1H3EA 4ZV9A 4ZAVA 1ZHHA 3SEFA 3ZXSA 2QE6A 2C00A 4TV9B 4OK3A 3MUNA 4Q1CA 5D87A 2D7DA 4DR2B 4KR6A 4LV8B 4ZOBA 3HFGA 4CDGA 4ZFNA 2WHXA 1DKRA 5KKCA 4QFMA 4BBAA 2V7VA 4DMHA 4ZO4A 3U5ZB 3QXHA 4HR7A 2HFKA 3OOJA 1YFLA 3OLYA 4N9QA 2O8BB 4BQOA 5SV2A 3PRYA 3G23A 2I0FA 4FE7A 5TC4A 3MT8A 3QVXA 3UMVA 2V0CA 3VH2A 2J6IA 1S5PA 2VT2A 3T99A 4KXMA 2Z98A 3AK4A 4WY2A 5AKXA 5LNK1 2XRZA 4E22A 2GMWA 1IBMB 2ZYWX 4CCYA 4EGAA 1NNEA 1TM1E 1MX5A 4L5YA 3PD1A 4R8KA 5P21A 3RTAA 4BO5A 3EG5A 3KFVA 3S2GA 3V1YA 1TUBA 1ZMXA 2HIMA 4EJSC 3ROGA 1HQKA 4GU5A 5CLLA 1WXIA 3FCOA 4KIGA 2R5FA 4JBGA 3FZQA 2GFQA 1BRTA 4HUJA 1Y8RA 5A4AA 2XE6A 3UVEA 1XTUA 4HQFA 4LE2A 1H1DA 3K9HA 3I76A 3KZNA 1EG2A 1WXGA 3N1UA 3OZCA 1YCHA 3PUHA 4QAQA 5P8WA 1E3EA 4TWRA 3GMDA 5FYQA 3W04A 2XUQA 2NVUB 3H1GA 2EL7A 3ZH2A 4OQLA 1CQZA 2QTCA 2Y1DA 4AS1A 3ACBA 3AG6A 1GD1O 5IJZA 1AMOA 1NLUA 1OKKD 2YZNA 2VJCA 3K96A 1NUUA 1MOZA 2DECA 3LCMA 5CYPA 1FXWA 1QCZA 2NW6A 1KQNA 4EHLA 4ZV7A 2CXNA 4OJQA 1GZ5A 2BR5A 2PT7A 2E4WA 3M34A 4P5DA 2QIOA 3B5EA 3HADA 5EMHA 3U39A 2QAIA 1ZS9A 1NRXA 1M2JA 3LHIA 2AOXA 4RVFA 4TROA 4CT4B 4OYRA 1YOVB 1UXKA 1FFWA 1X1SA 3MCUA 4HADA 4E2XA 3CVUA 5AKYA 4MTCA 2IHKA 2VNKA 3FAZA 3JQCA 2G0NA 4L76A 5K0LA 5TS2A 5JNLA 4HPJB 3C24A 4OFZA 5TIIA 1SBTA 5CNMA 4PY2A 1F7UA 1PJ2A 3ZU5A 2SNIE 4DDVA 4MAFA 4BMNA 2ZRJA 3F4KA 4EFMA 1TQ4A 4GG1A 4RF4A 3Q3GE 4QASA 2AH5A 5LDHA 1HZJA 3FSGD 4BKPA 5AW0A 2JJMA 1HYEA 2H1LA 3NVMB 1PFYA 1X39A 13PKA 3MMXA 1M2OA 1ZUNA 4RM3A 4EHIA 1O94D 1F20A 5HDBB 3CW2A 4WK6A 1Z37A 2HWYA 4P3KA 3AR4A 3RKUA 3TR5A 4V1CA 3KWFA 3IP3A 1N9KA 3G2LA 2V0GA 1CYEA 1E92A 1IY8A 3AGQA 1U5BA 3PX2A 5DTRA 2HUNA 1YFKA 3IIEA 2C0QA 2COUA 5TQ2B 4BQSA 3TW0A 2I3AA 5IJ0B 1GAXA 1RI3A 4OJTA 2PGOA 1RSZA 4HXFB 3WA6A 2YFYA 2WSBA 1JFFB 3FGZA 5BN4B 1NN5A 3MTJA 2QTTA 1C9MA 1FU8A 2Q1UA 2IV7A 3FVTA 1IXKA 2C9OA 4O29A 4PFQA 4GX0A 1QU3A 4X00A 2ODEA 3PUYA 1M0SA 1Y6QA 5FWAA 2ZBRA 4LYHA 1W46A 3B1KA 3T9AA 4CM4B 4WBNB 4UTZA 1Q0TA 1TTHA 1II9A 2V5UA 2G9QA 4ARAA 3TQRA 1KMCA 1AGPA 1W8DA 2WJVA 3HJUA 4N65A 1G8JA 4DTCA 2F62A 2OKCA 1R6UA 5M3BA 2Q6IA 3IOMA 4G8JA 5AXDA 2E5WA 4K9SA 2AHOA 1UPXA 3WAGA 3SVZA 1JMVA 3M7IA 1N9ZA 4LTDA 4HO1X 1GADO 2JIZA 2IE8A 4JDUA 5AH0A 5KJ1A 1JHXA 1G8FA 3MTIA 2IYYA 4WOKA 5ELMA 3DBOB 3G7UA 5G02A 5GGYA 5BQOA 4F86A 5AVRA 1A1VA 1J1IA 1VSBA 3I2KA 4KLAA 1T4MA 2RKBA 5HIAA 2QHXA 4UAUA 4PZCA 2I78A 4RCVA 5CG1A 1QQAA 4W7SA 1RM5A 1NP3A 1S8OA 1J0EA 1VL6A 2C5BA 2JCVA 5IN4A 2IWHA 4EIWA 2GARA 4GOLD 3ZR4B 5CDTA 4UUOA 3PYMA 3VTAA 2V54A 1E4VA 4DLSA 1T9GS 3GRZA 4KDCA 1GPKA 1PFWA 3TGWA 1CR0A 5TPWA 3A32A 3BIJA 1FNSA 5DYTA 1E3IA 1PWZA 2REOA 3UFBA 2PMDA 4MR8A 2WD7B 3IEPA 2QPOA 2VXOA 4KAXA 4ZVTA 5DLQC 1XWIA 2MYPA 1RI4A 3HACA 5JOQA 3ETCA 1KZ9A 5DZSA 4Q6WA 3NLLA 2JZCA 4L0MA 4YRFA 1IDN1 2HA7A 4K03A 2O8NA 1JB9A 1NJ5A 2XCUA 3T4PA 4IIVA 2JLCA 1CZUA 1ZAYA 1WBDA 2R84A 1T8SA 2FE4A 3GOQA 4EO4A 3JY6A 3KB8A 1MGOA 2I4IA 4XWAA 3S81A 3AHJA 1LJUA 1QK5A 4LHYA 3IO5A 4Y1GA 1NJ1A 1F60A 3KR1A 5I7EA 4KQJA 4FILA 5D85A 4DV4B 3AR6A 2NUTB 4KBYA 5B1EA 2Z5GA 1YJ8A 4GR4A 2R8XA 1EGAA 3PIDA 4NYMR 4R69A 4RBNA 4Z0HO 2DM6A 1ZK3A 1ZD5A 4Q6BA 3G2IA 1L5KA 4TYNA 4MCHA 4KWCA 4DYDA 3AJAA 1XALA 4LJ4A 2GZRA 2JGMA 5EZSA 1Q83A 5A3SA 2VYCA 4DRXB 1L9KA 5JRDS 1JLRA 5C4IA 3KQLA 1A9YA 5F7XA 2LE0A 4I36A 7REQB 2H4HA 3GGPA 4ZVUA 1IM5A 3TPCA 3CW9A 2NADA 1EK0A 3KR0A 4Q5IA 4E46A 1BFUA 4YRIA 3SLRA 1GFIA 1ZJYA 4XX1A 1IG3A 2N42A 1RRMA 5T4HA 3WL3A 2VWQA 4J0GA 5BNWA 4B6SA 3CB4A 1ZG3A 4OX9Y 2V8OA 3UT6A 2RGGA 4OMFG 3H3XA 4NBSA 5JH7A 1Z5OA 1YCFA 3GRVA 5CA1B 1RJFA 3NVAA 3ASVA 4WNYA 2FMIA 4M0UA 2R87A 4O5AA 2EC5A 3G0CA 3IV6A 5FHRA 2XHZA 2H52A 4WN9A 3R5FA 5FWDA 5SY6A 3SYLA 2ZIVB 4RIHA 3M81A 2UZ4A 1NNI1 3ESZA 2PS0A 3KT6A 1YQUA 3VPXA 3HNOA 2BMEA 2NNWB 5L6MB 3R3ZA 4XX0B 4B17A 3SYNA 1YS1X 2NO1A 1DDIA 5I6DA 4YALA 2A88A 5DM4A 4RGYA 1MAWA 2V03A 1QIDA 2I1LA 3W06A 2E87A 3M6VA 4RDCA 5G1PA 2LR0A 1X1DA 3NB0A 1N5MA 3JQFA 4YEDA 2XZDA 2OHOA 2P27A 1UFRA 1VA4A 3NR2A 4RUKA 4BYGA 4DLXA 4KIUA 1VZ2A 3DOJA 1ZO8A 1CVLA 5FAXA 2OAQ1 4ZVSA 3P9QA 3HZZA 4YBZA 1IQRA 1CE8A 2HQBA 3AEKA 3B5JA 4AJHA 3FCUB 5LQUA 4QJBA 1V5EA 2OGUA 2VA9A 3TR6A 3EXHC 1XV5A 3TIXB 1VRVA 2UU9B 1QGZA 1KORA 4OSPA 2ZVQX 3CG0A 4RIEA 2J0UA 5EMMA 3T1QA 2W2KB 5IK2D 5ITWA 3JATA 3QF4B 4OO3A 1QTQA 4KPUA 1TKCA 3Q9UA 4PPFA 1WUKS 2OCPA 3IUJA 4F8YA 4G0VA 4I9GA 5FV7A 3UMGA 1W48A 3UJNA 1YGPA 2WICA 3QFSA 1YE5A 1IUPA 3K0HA 3MZ0A 5CB6A 3I1JA 3WP1B 3TSZA 2G4LA 4HYYA 2HQ1A 1ORVA 2DUWA 4RQUA 1WLSA 5G40A 5IJXA 1YWGO 3EB9A 3JD3A 3ZCPA 3W5HA 5KC8A 3E22A 1IMOA 4KNWA 4RE5A 3VU8A 1JEQA 3IULA 3NONA 1O5OA 5LIRA 4QKQA 1V8BA 3COPA 3R8FA 3WIUA 4CUKA 1DLIA 2N46A 4R1OA 4X91A 1ML4A 2B78A 3GWGA 5C3MA 2HM7A 2B94A 2ZBGA 5I8ZA 2P90A 4QSHA 3FPHA 3M3HA 4YB8A 5DP2A 3WTBA 4W4TA 2VQDA 1YMQA 4KQWA 4R8SA 2WWHA 2WVHA 2ASVA 1RRVA 3IPXA 4LVCA 2EX0A 2QPTA 4IQFA 3FHLA 3ZV3A 1D7OA 2VOEA 2XAAA 3PUKA 4QNMA 4YT5A 4QGSA 5CFNA 1NBMD 2B35A 2JC3A 3EN0A 1ISMA 1FMCA 4OV6B 3HXKA 4WZBA 5DCYA 5FLEX 2OXIA 3W7AA 421PA 3ZJUA 2Y8EA 1Y0BA 4JL5A 2R3SA 3OZVA 1ESZA 1NSYA 2PT6A 2WD9A 2REXB 4HNAA 3T0IA 3QGMA 3QK7A 1OJLA 3A1WA 3BCRA 4MR8B 5ALSA 1H6BA 3I6YA 1FFXA 4Z7OB 2VDWB 1VPTA 3MWKA 3KSDO 4J2HA 1A98A 3FPJA 4PFSA 2WOOA 2D0DA 5ALOA 3EGOA 3Q7IA 5KEIA 2XH8A 1C1DA 2F7SA 2ZYRA 3RVOA 1K92A 2FZWA 2YV5A 3CNLA 2E3JA 3EXEA 4L28A 4N03A 4S05A 3AONB 5KNBH 1E8NA 1W5FA 1KJ9A 2WF7A 1HK7A 1T3GA 3RUPA 2NQ2C 3GOHA 3KKZA 4FWIB 2RE8A 2FOLA 3AZQA 3UKJA 2W7TA 2PMKA 3F9CA 1FYXA 3IAUA 3ZD7A 5AVOA 3HO8A 4EGFA 5D5QA 3V1UA 1YACA 1WVGA 2OM6A 4XGKA 3JQ8B 2QRQA 3K6KA 4JXKA 1CUXA 4C21A 3P7MA 4ZVVA 1VKZA 5EJGA 3LOUA 4FN5A 4XCXA 4RY0A 4X1KB 8ATCA 2IXBA 1BWRA 1KEPA 1M1NB 1NXXA 2O5VA 2X58A 1B0ZA 1NDHA 2GUWA 2NO4A 3K09A 3T95A 3TEJA 4C0LA 2B4TO 2L82A 4ZOEA 2WTAA 5BUCA 4F92B 4BDTA 1NRJB 3PGVA 4QOFA 2F4VB 3S99A 3ZTYA 4X54A 3H9CA 3LBFA 1KOGA 1EAYA 1NA5A 1LBHA 1TW3A 2A30A 3VV2A 2FZGA 3GGSA 3NHBA 2BFWA 2CK3A 1J9GA 3PGMA 5I4BA 4KN6A 3PPIA 1GPDG 4R2WA 2JEYA 3NUGA 1HFKA 1TADA 4BZXA 1IZZA 1RBZA 2Z09A 3NHSA 4IHJA 1WZNA 4Y6OA 2WJZB 1U0GA 4YJDA 1XEWX 1OTYA 1RWWA 2A9VA 2YJ5A 3H8JA 3HXPA 3HCPA 1T5HX 1WDLA 3K94A 4P5EA 4Y9SA 2QLBA 2ZM6B 2F9FA 5JCJA 4DT1A 4P36A 4YV2A 2CFCA 3C6KA 4HQ0A 1Q95A 1ZMTA 2UUBB 3EZ2A 5TXGA 2H3EA 2P8SA 3ONWA 2BV3A 1JDNA 4QBKA 4URYR 2IS1A 4OP1A 5YASA 1MP0A 2IYSA 5EUCA 4PICA 2HSEA 3A26A 5FPQA 3LDFA 5JBQA 1RPZA 1S4MA 3DHEA 2J09A 2I66A 3MB8A 5K6AC 3LY8A 4R5MA 3JYPA 2XNHA 4JUCA 4RVUA 1LB1B 1V8FA 2JB9A 2QQ0A 2K7FA 2FUNB 1ELOA 4R7GA 5H02A 4HT3B 1NONA 1FQOA 2DY1A 1GZVA 3U9SA 1MX1A 2ID8A 4O1MA 5K3OA 1GUDA 1DFGA 4FT2A 1QFYA 3MGBA 1PR0A 2Y6UA 3CS3A 2C3MA 2EU8A 2PL1A 2VHJA 5AIBA 1ZOPA 5KTRA 1QTNA 3FPBA 1AK1A 2I29A 4L4XA 5J3JA 5F5LA 3OLVA 2QJRA 2HN9A 3HVIA 4IIJB 3DVQX 1LDEA 4JODA 4LW8A 5AQ1A 1T25A 2VF7A 1S1CA 1K1EA 1S2OA 4OLAA 1II8A 1AKMA 3JAKA 3T35A 1IQ0A 1VHJA 2FWJA 4MYRA 1YB4A 3F78A 1TJNA 4ZYYA 1QIMA 3DPIA 3L07A 1BQ4A 4UNPA 3FTNA 1NQWA 4LWZA 4TKVA 1X1TA 2YIVX 2LCFA 3AJEA 2X76A 5B2FA 2QVLA 1YS2X 1VMDA 1XA0A 1GAQA 1YQTA 4UAGA 3R4VA 1NIJA 2DT8A 4KR0A 4UDNA 5G1NA 2PMWB 1TA4A 1U0FA 4ML3A 4MUHA 4WX2B 1TUBB 1FDVA 3BXZA 3BBPA 1TO1E 1NVKA 2VP4A 1NJ8A 4JL6A 4TMYA 1GCOA 2PH3A 3HI6A 4X97A 1P1HA 3ZCXA 4BJHB 4ESOA 4XWOA 1GCUA 1OC4A 4JBYA 3O8QB 3BH7A 3OO1A 3GLSA 4G41A 3K9QO 5FIUA 1CCWA 1Z75A 2E1PA 1YKGA 1NMYA 3CIFA 5IJ9A 1BXRB 3DAOA 3MWGA 4BX0A 4DC0A 2OORC 1D8TA 1RCTE 5EZQA 3PF8A 3NTOA 1OH5A 5HVNA 1JU3A 2FEPA 1TLFA 3ONNA 2HPAA 3MTGA 5HJ2A 3FFXA 4MAAA 2PIDA 3D7MA 3GCDA 3JWPA 1O0BA 1QE0A 4OGWA 1GZDA 1QKIA 3RNLA 1DMRA 4K9KA 4R8RA 1M7BA 4S0ZA 4PX3A 3I3SR 1NUSA 3DV0B 1L4HA 1PWHA 1RYNA 1MOQA 2BRUA 4IIXA 4YMUA 4L4UA 4RPLA 4W5WA 4B7AA 2FPXA 1H5NA 4IO1A 4ZAWA 3HG7A 3E35A 3QH4A 4MV9A 1Y80A 2IFTA 3FGOA 5COBA 2HW8A 1O87A 4JC4A 5A6SA 1M2VA 5FI3A 1XCLA 1CR2A 4M99A 4YMIA 5BRNA 3JALA 2Q4TA 3RF6A 5LB2A 1VJ5A 4AJ1A 3ZZTA 2N3ZA 1ESDA 3JAWA 1Z4PX 2BRUC 1ENYA 4PO1A 1TMGE 4XE5A 6Q21A 4C5AA 3FCAA 1JHUA 1L3IA 1Y63A 3NKFA 3H2GA 4M0PA 3GLTA 4Z2YA 4H6XA 5FDFA 2IXGA 5B1IA 5K8JB 2ZB8A 2O8FB 2E4AA 4LDJA 4DQUA 4GX1A 3GHYA 1SHLA 4P0PB 4C3OB 6NULA 2BCEA 1U7PA 3P0IA 3GQVA 4GDFA 1QORA 5TF0A 1YBFA 2VHCA 3TR0A 2YJNA 2YNMA 4KXYA 2BFDB 1VE5A 4NVRA 4PANA 3OM8A 4PZZA 2OAP1 1KOFA 4OCZA 4KLNA 1XZBA 4RQTA 4YN3A 3UJ3X 2E6KA 2FW0A 1ZXXA 5K8VA 4Z1MA 2A57A 2OEPA 4NHOA 5JXHA 1EXVA 2FWNA 2IE0A 4EW3A 4EW1A 5K20A 1W88A 1UDRA 3I0NA 1GN9A 2PRIA 2ZJFA 3I34X 4RLFA 4YO7A 4KBGA 5B7PA 2XUPA 1VE7A 3UOWA 3BF8A 1U8UA 1VKNA 1UPAA 4ZKDA 2K4MA 2FEMA 2IEGA 2GNPA 2XNSA 5K09A 4OMCA 3QU2A 1K66A 3LW8A 2RSLA 2PVSA 5A0FA 3K0FB 2X0NA 3K8ZA 3S44A 1QBKC 1M34E 1Y3CE 1MIOB 2VSXA 2YC2C 3DGEC 3KSMA 1GPAA 3DHWC 3MSXA 4JP2A 2RDMA 3TRHA 2X41A 3N6RA 3FOZA 2AC2A 1GPH1 1LI5A 3L8FA 1IXZA 4KQKA 1ZLXA 2GGSA 2X8AA 1EB9A 1W9MA 4OGLA 5EE5B 5L3SB 3DL4A 5JROA 3O1IC 1XCJA 1U9YA 1EFCA 5LQCA 4ZDIA 1XZEA 2JH8A 4PRYA 2AZMA 1RNLA 2WJHA 4OHVA 2C7PA 3IBCA 4JGBA 5HFAA 3ABRB 5KYUB 1K89A 5GJWC 3CU5A 4W5NA 2VPZA 3HJFA 4FEYA 1KYVA 2C5HA 1VB3A 4DG8A 1UFOA 1TCUA 3QKTA 4OBEA 1SEPA 1LGYA 4QDZA 5CT6A 1LPSA 2PKXA 4PC7A 3SS9X 1Z38A 4Y7DA 4W5OA 2DBQA 2AZ4A 1JNXX 4DEYA 3CN9A 4EUFA 1RLTA 2IY8A 1NI4B 3KU1A 2JHGA 4RYDA 2IYTA 4TOIA 3AFMA 1P5FA 3DZGA 5DM0A 4YUXA 3DT9A 3DTTA 4H1HA 5AHWA 3ESBA 1GL9B 1E3WB 1P1RA 1QYVA 2OFPA 1HL3A 2B69A 1X14A 3CG4A 2PM8A 1V47A 3D1VA 3N2GB 1MC1A 2KS6A 3MJCA 3D6AA 3RVSA 4UM5A 2UYCA 5EXPA 2VBFA 2M6RA 2X22A 3SJ7A 1LBEA 1QIEA 1UF9A 2W6IA 2ECFA 3RUDA 2XZOA 2OV8A 1PJAA 1Q7RA 4ZEWA 1WUIS 2I2CA 2WTUA 4CNBA 1SVMA 2DH5A 1IDOA 3T7DA 1GEGA 3QLVC 2AS0A 4FZ3A 4L15A 1KYTA 3IL2A 1PJRA 1RWBA 4KW7A 1W8IA 2TRSB 2W98A 1EVQA 1T8UA 3C3PA 3NAZA 4XIIA 2XXAB 3HXTA 4V1CI 4DQLA 2XY4A 2YZ2A 3DMFA 1GILA 4MUYA 1U11A 3VKHA 3N8HA 5A2QA 1COZA 5ER9A 1ABEA 4LX0A 3ZE6A 5ALZA 4RJIA 1HTWA 5HG0A 1Y6FA 5B1YA 4RENA 1C2TA 2XA1A 3FB4A 4IJUA 1R10A 4MR9B 1UFKA 2QRNA 4YONB 1MORA 1D4OA 3MCAA 1DBIA 3BE4A 1HC7A 4D96A 1DG9A 4IDHA 4DOMA 4AT1A 4R71A 5ED4A 4REQB 3QQ5A 1U3CA 2HGZA 1TC2A 1JG1A 4N6GA 1O6BA 4JC8A 1U3GA 1XWFA 3ONVA 3UB2A 5L9AA 2CHVA 1U1CA 3N39C 5LB4A 2GEVA 5IUKC 3MT9A 3IURA 4RQAA 3QHPA 1JDSA 2M2IA 1T5LA 4WZAA 4DSNA 2VZLA 4CF6A 1XG5A 3OEED 4MO2A 1IWOA 1U28A 4UOQA 2Z2JA 4Y2QA 5AI0A 4ZOLB 5FUBA 1IWBB 3EDYA 4DMLA 3RC2A 3TZEA 3WI7A 2XCIA 5AJYA 3T9EA 4DIEA 2Y0CA 3BREA 3JWEA 3OVMA 1HDEA 4GRAA 3BWEA 3N53A 2HYIC 3D1LA 3OUUA 3JYOA 4Q9HA 1RABA 4QU0A 4XASA 5EMJA 3RLFA 3UUWA 5J4LA 3W1EA 5KREA 1D5WA 3IUEA 4A26A 1VHTA 5BXYA 2VP0A 3EEQA 4YCSA 4N1AA 3EIUA 5IWCA 3DG9A 1O0SA 2UYGA 5B12A 1A5SB 1N92A 3HB9A 1V8OA 2W6ZA 4H3VA 5IG2A 4ANFA 2EEPA 2EARA 5DWDA 1YT5A 3IIMA 5EYPB 4WLUA 3BMQB 3VYRB 4LTMA 2HADA 4RS4A 3OBBA 1NM5C 4LJAA 4C06A 1UBGA 1K8QA 4YMSA 3D3QA 3ZS9A 1DBVO 1WVMA 4ZN6A 2VAXA 1QIHA 2HNBA 1ZESA 3HEMA 1XTJA 2G1UA 3LPCA 3QJYA 4MLDA 2ZI3A 1QV6A 3EMBA 1RAEA 3MLEA 1COWA 2WE8A 2YQ4A 4DHWA 3LLMA 3GI1A 2AXPA 5EP2A 5CFOA 5IABA 1M75A 1NYTA 4RANA 4KUHA 5IEBA 2P4QA 4OLHA 4DZZA 5FTKA 4IXMA 1L1FA 5LZ5A 4BNKA 1KR5A 5CIQA 4ZGBA 1VZ3A 1HOTA 2FZEA 3AF4A 3ESRA 1GJRA 1NLMA 4IZIA 4UMDA 5AVSA 1LQUA 3NHPA 1WR8A 3GLKA 1N2CA 4CMKA 4DUYB 3D2LA 3CVJA 4BNDA 4Z8YA 1RXIA 2H07A 3DC7A 3HYSA 3VJLA 1QP7A 5DNUA 1JFLA 4MS4B 5CH5A 2QDKA 2A0YA 3ANMA 1GLVA 1OIXA 4P5PA 5AVJA 4IFEA 2AMJA 2HL6A 4BNNA 5HCNA 2IU6A 4CMCA 4QXMA 3UWPA 5IYZB 1MTOA 3MUFA 3TNDA 4HYQA 3H5LA 2PXCA 1KHHA 3THWA 2VIIA 1D2EA 2W4IA 2XUHA 3UMYA 3T5GA 1Z29A 2PX2A 3K9NA 3PWZA 1T2CA 2DWQA 3E18A 5NLLA 1JBQA 3AEUA 1E1CB 3SIXA 3C7AA 3EULA 3V3KA 1SQ0A 3E03A 3ND9A 2XUZA 4HNAB 2X8BA 5L7WA 2FR1A 2VSNA 3L7AA 3SG0A 2C07A 3MWDA 4RTPA 4ND3A 5BQ5A 2GBCA 3WB9A 4LA4A 1XPJA 3R3YA 4F6CA 2R6CA 1U0TA 2IP2A 1KYXA 1XZNA 2PX6A 2IQ5A 1CUCA 2Z57A 2X4GA 3RJTA 2ENUA 1TA0A 4Y6LA 3U1VA 2UZIR 3FLBA 3HKCA 5MF6A 3ECCA 1ZOOA 2AUTA 4PLVA 2JK1A 4TTTS 1AUPA 1DQNA 4C9BA 1M33A 3ZLVA 3O8BA 2ZUEA 1G60A 2PCLA 1G291 1MGPA 1UT6A 2QUAA 4C20A 1TT5B 1T35A 3PKIA 3H6HA 1ACMA 3WHLA 3WZLA 4FBMA 2J7PD 5GMOA 3FX2A 4CKCA 5K4GA 4M6WA 2ZKIA 4XDYA 5IH3A 1B15A 4RKEA 1AKEA 3PUIA 1JHVA 3H2BA 3A1CA 4BEJA 4YRGA 1KH2A 1PZGA 4J8PA 4MW6A 5EIAA 1ZNWA 4X20A 5IAJA 3I04A 5J5AA 4JA0A 1P2FA 1VLVA 2FCAA 3WV5A 1FMJA 5K3FA 4UNQA 4UEOA 4BN0A 3C7CB 4GMGA 4UVGA 5LM3A 5EWJB 4B7UA 2XJ9A 5EA2A 2QRVB 1F12A 1V6CA 1LH0A 2P5UA 3OQ1A 2F90A 3C3BA 3L79A 1BVUA 1RQGA 3NPAA 3E3AA 4AMUA 2NO9A 2FSVC 3C1AA 1QRDA 2PJZA 3R0JA 2CMKA 4IBOA 5I5EA 1ENZA 4UC0A 4E94A 3ESQA 4DR5B 4GZMA 4BVHA 5LP1A 4CKZA 3JQFC 2CJPA 4TXJA 1BX1A 3UB4A 1KJNA 3G02A 2BH2A 1FQKA 4LC1A 3WZMA 5B4VA 3C7TA 1IRXA 4D4JA 1G9SA 1QK3A 3RIYA 2J0QA 5AHKA 1R0YA 3TZHA 4ZZIA 3ZXIA 4DLAA 1D2RA 2OY0A 4K40A 3KNZA 2BGJA 5HKLA 2X8LA 3WYCA 4EY3A 3HWWA 4ZI2A 5BVGB 3W5SA 5F12A 3U09A 3U3OA 2JCGA 5EGNA 4NZYA 5ICFA 3LNCA 2WQZA 3GFTA 4TLDA 1RWPA 3BRWA 4TX1A 3TRKA 3VJKA 4B7XA 4BUZA 1A8PA 1YQQA 2HZBA 3O90A 4ARIA 4OG2A 3A6LA 1UXHA 1CJMA 1P33A 2JAHA 3THXA 2QROA 1U28C 5LOVA 2FSHA 9LDTA 3WHIA 3P2OA 3ZV6A 4A03A 5A9SB 1A2QA 3TTUA 4GKAA 2EGUA 3F5SA 5K2OA 2B34A 1USGA 4G84A 2DFVA 1RQNA 2C1ZA 1EUDB 2J59A 1P3JA 1E7RA 3C3JA 4PYOA 4AYTA 5I9LA 1WMBA 2QN3A 3C3EA 3FM9A 1GGNA 4U2EA 3AMVA 1VKJA 4EQ6B 3JVDA 1JDUA 4URUR 2ZK7A 1ECBA 1FUKA 2QSUA 2Z9CA 2WZCA 1JHZA 3M70A 4GBMA 3QLJA 2OT3B 3GBVA 1VPWA 3BA1A 3PFWO 2CDAA 5ALIA 2JIBA 3J7TA 2JFNA 1TLTA 4IGFA 4JKIA 4MQFA 4E1VA 3EF1A 5KO2A 4EKGA 3GHHA 5M34A 1EWYA 4EG8A 3NBYC 4WIAA 4MB6A 4V0NA 2GBLC 2HHLA 1W4ZA 3WLPA 5WRFA 4QPZA 3VR2A 1F2UA 1H1LB 5ALJA 4ZOQI 4V38A 2EDCA 2H3HA 4GWKA 3MJ4A 4PBSA 4S1OA 4ZZ0A 1JEYA 4J49A 1YJ5A 2BEWA 2JJ1D 2CNOA 2EKPA 3GVIA 1WU8A 3EC7A 4HPWA 4TV8F 3JCZA 3ME5A 3MLBA 3H16A 3V4SA 3G5LA 3GVXA 5KKNB 4V0LA 4HL6A 1XJWA 3S28A 4Y1RA 5LQMA 4ENPA 5CXQA 5LNK6 5TPWB 1ZM3A 3DR5A 3CR8A 1N6OA 3LQ2A 4V0ME 5T6MA 2IODA 3DAPA 3ICWA 2PK3A 4MGHA 1LDBA 3GNQA 4WCFC 3UH0A 2PSDA 2ZJ2A 2IW3A 3EDRA 2NSDA 5KNDH 1E7MA 4E3ZA 3ILXA 3ISVA 3X2EA 4X1IA 2IYLD 3ERCA 4L9RA 1PT9A 4PGFA 4AF6A 3JD1A 4YGXB 2OXCA 1FMFA 4GSYA 4RFSB 1WDKA 5JYDA 5CJ2A 2VYQA 1RTTA 2Y76A 1V5IA 3E4CA 3T0GA 4WCFA 5JBNA 2XB9A 2ZAOA 4KHZA 2CXXA 5B57C 3CX8A 1H5QA 5ALYA 1M2KA 3WNVA 1AQYA 4PQGA 1QO9A 2FMKA 1ULAA 3RC1A 2OOSA 1PWYE 1WCWA 1Z0FA 3KSAC 2XGOA 4X6XA 2WU1A 3H2KA 3RARA 1MX3A 4IR7A 4M8KA 4RPGA 4UBLA 1YVDA 2OMKA 3DP9A 2D5CA 3WGUA 3VJRA 4Y18A 1Z5ZA 2Y77A 3C7DB 4IH9A 4K2AA 1HKUA 3KYIB 1QHXA 3B85A 4AZWA 1KMMA 5LCXA 1NXVA 3QE0A 2QMEA 5FOXA 3BXPA 1QRSA 3SZOA 2QTZA 2FSSA 3GJ3A 3MGAA 2OCDA 2YW2A 1R0BA 3GRRA 2C59A 5GAJA 1LKZA 1Z08A 2FWIA 1G98A 3JQDA 2B4YA 2ZU0C 3L7OA 1SHUX 2PS1A 3LDUA 1N8TA 4GM4A 4H1VA 4BE7B 3F3SA 1KY5A 2WJIA 4ZDKA 5I7RA 5F5XA 3B7WA 2H08A 4M1ZA 3U4HA 4RMHA 1GM5A 4Y8VA 3K9GA 4JLBA 4JOQA 4R2JA 1QQ5A 4C0HA 1ITZA 2QS9A 4L22A 3C4JA 1UZMA 4QYIA 5J4VA 1D0IA 1PFGA 4YMLA 2IZ0A 2F3UA 4JGIA 3Q3IA 4NG5A 4AJ9A 3D9QX 2G88A 3K2BA 4UFOA 3TTVA 5KTPA 4HYEA 1EHIA 1WQ3A 2W6NA 4LDAA 5DGIA 1AMUA 3GO4A 1B73A 4LE0A 3ICEA 2OVFA 2XE4A 3NV7A 2PT9A 3QNMA 3OZRA 1FUEA 2GKSA 4OQPA 3KZOA 3NDRA 5ALMA 4BLQA 4Q9JA 4YJ2A 4HVAA 2JATA 2H1RA 3TB6A 4IDGA 1KSFX 2QTNA 3E7WA 4KMSA 3GWZA 5FTWA 1KYQA 1EBUA 1G20B 2RAVA 5CBPA 2QKYA 1DC3A 3N3BC 1DQSA 4IMIB 4YMVA 1WG8A 5DGCA 1HNXB 3COZA 4KWHA 1XMJA 1R00A 1SG6A 3LLSA 5DCWA 1NW6A 2JAQA 3R5KA 2FWRA 5FEMA 3A27A 3VTFA 1C0LA 2AMFA 4Q9NA 4G8DA 4AUKA 1LXCA 1SXJE 2FFHA 4FDAA 2JA1A 4B3XA 3RYTC 2GKOA 2WF6A 2OHJA 2JGEA 3LUDA 3ZNNA 4KHPB 3ZHOA 1E4EB 3DFUA 2DPYA 3I4CA 4ZYZA 5B1SA 1SM4A 2KI5A 2M6KA 2YMQA 3A31A 1ZJWA 1MEOA 4A7PA 1SVLA 4W82A 4D0GA 3TE7A 2OHIA 4LRUA 3CGGA 3RU7A 2IUEA 1KYWA 2E4UA 2CL7X 1BCSA 1CY7A 1P80A 2Y0BA 1DIGA 2ZIGA 4P4NA 5FA5A 3OU7A 3UK2A 3V32A 4DV6B 5KYYA 1ZD9A 1HE5A 1G1MA 1PVVA 2ZJ4A 2VF5X 2XBMA 1IFXA 4DWJA 3FGPA 5IVHA 2XE8A 1IEXA 2EYQA 2Y71A 3OKAA 3JRWA 1U7UA 4FN4A 2A1TR 4M49A 4INJA 5T5QA 3LYUA 4NOKA 3RD5A 3PNQA 3RPEA 1A27A 3NDJA 4JI1B 3HJGA 3I9JA 3KAKA 3DFFA 2XODA 4BX8A 1SBHA 1UK9A 2HKIA 2X40A 2A8YA 1T2AA 2PAFA 5KOYA 4TMXA 3GFFA 4IXNA 1QH8B 1L7PA 2E6UX 1KQPA 3A9SA 3CM0A 3QVTA 5DIZA 3E0XA 2L42A 3M9XA 1EXWA 1NKSA 3UK6A 2CFSA 3DDSA 4FCCA 2RIRA 4PLGA 3STVA 3T4EA 3WC4A 5ICCA 3MWEB 1DE0A 1USUA 5GPBA 2VSOA 4M76B 5LZ8A 2W2LA 4JIGA 3ZQ4A 2E4VA 1BZYA 4GVXA 2ZDQA 5K3DA 3LTNC 3LGAA 4LF9B 5FPHA 3PHHA 3B9BA 1KEUA 2E48A 1RKBA 3EGIA 4P83A 4QZVA 7MHTA 1JR2A 4E70A 3N7AA 4ITUA 4TYQA 4NXNB 3E8SA 1Z8DA 1M0EA 3KKPA 1ONOA 2QAGB 1JI3A 1QHSA 4C3UA 4DNPA 4YRKA 5CEJA 3WKAA 2D74A 3RRJA 5JW6A 3I1YA 4I14A 4K05A 2AOVA 2X19A 5ENVA 2ZYVX 1R0KA 4N5MA 4RX1A 1S1MA 3QXXA 5H1YA 1T2UA 1C1XB 1GQRA 4LNUA 4IIUA 1E3SA 1AM4D 3OOEA 2FQYA 3IAM6 2VTKA 2CLIB 3CYFA 1ATIA 1CDOA 4M55A 5JDIA 3L18A 1Y4SA 4FYJA 1V1RB 1YV9A 3ZOKA 2DJIA 5ELXA 3FNFA 3P19A 2F3SA 2ZE6A 2GJKA 3OEYA 1TU4A 3MN1A 4YAWA 2IYOA 5BWMA 4Z51A 3EC1A 2D5IA 2JGJA 4BNLA 3JRNA 3DOIA 5JMOA 1P2BA 3F98A 3L8MA 1ZL0A 2FPMA 1M76A 1NY5A 1W85B 2EKBA 2OB2A 2TMDA 5HIMA 3RU3A 3W5UA 4A9AA 4NJOA 4EFDA 4YR9A 5AVTA 2R68A 3KRTA 3TLJA 4S2EA 3KETA 1E3MA 5LKRA 3JQ9A 2EF1A 3O8DA 3T9FA 2QWXA 3QKRA 1E98A 2G0AA 4ZHQA 2H18A 2IYNA 3DBRB 5I7SA 3AIOA 3MCZA 1KKMA 3H4IA 4Q66C 4YJ3F 3BWBA 3DKRA 2J33A 4IX1A 4I6GA 1YVUA 5H68A 4CMEC 2DTXA 3ZDAA 5CVJA 5DMHA 5HK9A 1GTL1 1Z3IX 2BBOA 1F2VA 1EHCA 5CA0A 5LQRA 4GSLA 4F12A 1ISIA 3QENA 5CX1B 4F96A 4C4RA 2REBA 3WGNA 2AXQA 4NS4A 4BV2A 2Z9BA 1TD1A 3K35A 3ZHXA 4EEKA 3GPLA 1WBBA 2E89A 3C85A 3G49A 4M9SA 3TPFA 4PRZA 2WYOA 2Q3DA 4G5XA 1R18A 4AU1A 2KPOA 1XZCA 1YRHA 3R8XA 3HDQA 3ZI7A 2ECQA 1CEEA 3ONDA 5BQXA 3HVUA 3QLEA 1DX6A 4RD1A 3NWJA 2B20A 3E5HA 2D1RA 1HM5A 2HJSA 3OPYA 4I4NA 1K3FA 1WHTB 4ZRDA 3FIJA 3Q15C 3WXMA 3TQTA 1S3IA 1LDMA 2VYNA 1Z39A 4BV3A 5E95A 2JFVA 1TM7E 6REQA 2PGLA 3QF7A 3GJTA 5EXTA 3PX7A 3LX6A 4AY5A 2R6JA 1ESNA 5DBOA 1F8XA 1NT4A 3PX3A 5AKGA 1XN1A 2CZCA 3KD2A 4MQUA 5EUMA 3WK7A 1Q74A 3ASUA 2H63A 4UNIA 4O1HA 1KEZA 1PVDA 1ICIA 2QD1A 4YUZA 1O96B 1H4TA 3E9YA 1XVUA 1XRNA 3A11A 3D0QA 1TYDE 3V33A 1MO2A 3LSYA 2Y9MB 1H6DA 1SRRA 1Y6RA 2P2CA 2R1VB 3F7NA 2OHGA 4MLCA 2I1WA 1E2PA 1KVQA 3MCWA 3PDUA 1KPIA 4YMTA 1GTSA 1JQLB 4DJEC 3GJ0A 5CDHA 4YRSA 4OYYA 4NZNA 1F0YA 2IZ5A 4YYZA 5T7BA 4S2UA 3ZHZA 3L7JA 1X3SA 2XKBA 2CUKA 4DYVA 3IIKA 3UAOA 1CG6A 5I3CA 2P75A 4BMCA 1E6WA 1M6EX 4A6DA 2GF0A 3PFBA 4ZTUB 1JA9A 4U3JA 3SFVA 1DIRA 3DWEX 3ELUA 2EFGA 1PFKA 3OSUA 4KRGA 4M8NE 1JQJC 5FBZA 2PX4A 5GV7A 3EFBA 3EC2A 4UDXX 3VO2A 5FEUA 2JFXA 3OZXA 3QG5A 1BXKA 2O8DB 2C9YA 3KZXA 2ID7A 1N5JA 3DFKA