3R40A

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
291
Chain Sequence
b'LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 112
structure length 291
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r40A00
2Z3WA 1H2XA 3H1AA 1NU8A 3R3WA 1N1MA 3QZUA 1QZ3A 4EY5A 4F0JA 5IVDA 5AKEA 4EY8A 1XRMA 3WWCA 2GZSA 2Z8XA 5ALJA 4G4IA 4U2CA 2JEZA 4BAZA 3A2LA 1ODTC 2XMQA 4J0JA 5LKRA 2PPLA 2AXEA 3KD2A 3V1KA 1QIIA 3FSGA 1XZEA 2XB6A 5AM3A 1CUIA 3V1MA 2QJWA 3KOOA 4RE6A 5AK3A 4DNQA 4LXGA 4Q3LA 3QMMA 4V2IA 4A16A 3NUZA 1HQDA 1K8QA 3LS2A 2RIPA 1R88A 1TCCA 3OURA 1YCDA 3A70A 1E8MA 4ZV7A 3QPDA 3WK6A 1ZJ4A 2DCMA 3A6ZA 4DGQA 1ISPA 4PV7A 1KU6A 1DT5A 4C87A 2WU4A 4MYSA 4EB0A 2XUJA 4DLNA 2WHPB 4FBMA 2I03A 5ALGA 2HFKA 4DMKA 2WIDA 3WMRA 5T4HA 5LIPA 4J0HA 4Y2TA 2ZSHA 1QGED 4JYPA 4UBKA 1CFJA 4WFJA 3WKAA 3ZLUA 4OUKX 4NMWA 2VJDA 5CXUA 4IH4A 1BEEA 4GEGA 3O9VA 3PE6A 1KEZA 1PFQA 2O2HA 5BWCA 5IVKA 3E0XA 1YS1X 4C4YA 3WL6A 5K3FA 3I2KA 5ALRA 4N5HX 1VZ3A 1XRRA 1CUFA 1E3QA 4J03A 2K2QB 3AZQA 3QPAA 2XLCA 4X94A 5LP1A 3Q8WA 1BN7A 4M0FA 4OYLA 5C8ZA 1AX9A 1YR2A 2RGUA 1EB9A 4B7ZA 1CUAA 2WG1A 1R4ZA 3EQ9A 3WL7A 2QMQA 4L9AA 1VZ2A 4AO8A 3GFFA 2E3JA 2Z3ZA 4Z49A 4F21A 5AKJA 2XDWA 3G0GA 3H04A 1N5MA 3UUEA 1MN6A 3OM8A 3I6ZA 3G9ZA 2EDCA 2I78A 2H7YA 4Y2SA 3RARA 2WFZA 3CCCA 4K6GA 4X93A 1QIJA 4LKOA 4KRYA 3NWOA 1BCSA 2HFJA 1P0PA 4C4XA 4G1FA 3D2BA 1W6RA 3A2MA 1F0NA 5D7BA 5ALFA 4IQ4A 4IO0A 4UPDA 1CUZA 4CG1A 1F6WA 4GXNA 2I3DA 2PSJA 2Y2VA 2DHCA 1J1IA 2JGFA 4G4GA 4E14A 1ZD5A 1ZI8A 2W22A 1MNQA 3WZMA 2G63A 1XQVA 3R3UA 2PX6A 5K3DA 3FSGD 3K9BA 1A7UA 4QDTA 1CEXA 3D2CA 4J0GA 4ZV9A 3H2KA 3I6MA 1G66A 5JARA 4AXBA 5JALA 4U2BA 1CPYA 1R9MA 2XMRA 5JAOA 1ZIYA 1MTZA 5T4BA 4BP9A 4GDMA 4BZWA 1CR6A 4RNCA 3AZPA 4OCZA 5HQ3A 3G9TA 3PFBA 3I28A 3M83A 4EA6A 1VKHA 5K3EA 2AJLI 1U2EA 2G5PA 4QLAA 1DX6A 2H7CA 1HL7A 1XRPA 2XMCA 3STUA 2B4KA 1LPOA 4G8DA 3B12A 1L7AA 5IVIA 3BWXA 3C87A 3UUFA 2QRUA 3B3QA 1UOOA 5JADA 2AJ8A 3FLAA 2HADA 1YB6A 4DSAA 5AH0A 3ANSA 2YASA 3A2NA 4EY4A 1K5PA 3QITA 3MUNA 3C6ZA 4QDZA 3C70A 1EX9A 2CB9A 1QFMA 3F96A 4ZRDA 3WK4A 4Q3KA 4PF1A 4QDOA 4LXHA 4QDUA 1DTEA 3G0DA 1W75A 1VLQA 2VJAA 2QZPA 5T4EA 1E66A 1ACJA 1JJBA 1YSCA 5AOAA 1R50A 3K2IA 5AI8A 1ACLA 3MGAA 1XQYA 4HXGA 4B83A 2XUHA 1X70A 1IUPA 4S0XA 1ZI9A 3IUQA 1JT2A 4Y2RA 7YASA 1GPKA 2B61A 3BL8A 3HACA 2QKYA 4CCYA 1Y7HA 4Y2JA 3OC0A 5CMLA 3VVMA 5AKZA 3H2HA 1UK8A 4E46A 5H3HA 2X8BA 4B9AA 3G9XA 1CUGA 1XZAA 1GXSA 4H7KA 4FLFA 5CRIA 3R3YA 4ZXFA 5ALZA 2Y1KA 1FFBA 3HZOA 1CUDA 1CQZA 4AN1A 4ETWA 2DFPA 4P93A 5F4ZA 4N8DA 4QE3A 2X76A 1Q0RA 4EUSA 3FYUC 1XKTA 3H18A 3C6XA 3IULA 4MQMA 3WKEA 4I3FA 3GZJA 4LIPD 3GUUA 4KYVA 4MXDA 3QYJA 2BGNA 1QONA 5LZ4A 4CG3A 2AJDA 2WU3A 4EBBA 2DQYA 3DD5A 5K3FB 3BXPA 3F67A 4DYHA 4OD0A 3WWOA 4K6HA 3AIMA 3BE8A 4K2AA 4AO6A 1UWCA 1XZDA 4B0PA 1MX5A 4X85A 3HYSA 4BCDA 5BV7A 2VT7A 2XQFA 5AI5A 1XZKA 5C81A 2PL5A 1CUVA 5AM4A 4ARBA 2IIVA 3TGLA 4KE6A 5AK5A 1CUYA 1NX9A 5AKHA 1L7QA 1H23A 5KBYA 4P9NA 2RONA 3EF3A 3M81A 4KAJA 3HRHA 5C8XA 3DJYA 3FWHA 2HL6A 1TKRA 4M0MA 4UBNA 1DWOA 4MEBA 3H17A 4HS9A 1DU4A 5CBKA 2R8BA 4OU4A 4L0CA 2ECFA 4AN0A 4I19A 2XQIA 3I2IA 4O08A 2YH2A 3SX4A 1T4MA 2WUGA 5T4FA 2WQZA 4CIBA 4MQLA 2ORYA 4Q05A 4E15A 2XUGA 3VVLA 1XRNA 5K3AA 2XUPA 2HU7A 3BF7A 3FLBA 2QOEA 2NW6A 3KXPA 4Y2VA 1JJIA 1UK7A 3PICA 5CW2A 1QIFA 3I2HA 5JAPA 1LPBB 4PQEA 1P0QA 5ALVA 5ALXA 2G4LA 3BDVA 5DYYA 1E8DA 1EDDA 3QM1A 2WIFA 1D07A 2VAXA 3HEAA 1A88A 5DNUA 2DSNA 5HQ3B 5K5EA 3DDUA 4NZZA 3ZPXA 4DM7A 2BUAA 3PDCA 5EHZA 1N8SA 5A7FA 5LZ2A 4Q3OA 1XLUA 4TPKA 1BS9A 4G5XA 3ZLVA 2QXUA 2ACKA 2H1IA 3BIXA 2DQZA 1UZAA 5HFNA 1U8EA 3WZLA 5CURA 2IITA 3R3VA 1J07A 1XRLA 2XLBA 3UMJA 4X3CA 4UBMA 1FJ2A 4AO7A 3BF8A 3O4GA 1CUUA 1VA5A 1QE3A 4BP8A 2H7XA 3ESCA 4E11A 3I1IA 2GBFA 4YASA 2FX5A 1XZFA 1ZGBA 2C58A 4L3WA 3E1GA 3N2ZB 1THGA 1ZIXA 1U65A 4BCBA 4FHZA 4BZZA 1CUWA 1HBJA 2Y6VA 1QTIA 2GZRA 3R40A 2QUAA 3YASA 4W9RA 5JZSA 1P0IA 1W4LA 5CT9A 2JGLA 3STYA 3O4HA 2HM7A 4AMZA 2QT9A 4WJLA 5IKXA 5ISMA 3WKDA 1HKHA 4PO3X 3W2TA 4EY6A 3HJUA 3WKBA 4XWGA 3VISA 1CUEA 1IMJA 3I2GA 2IX9A 3I6YA 4X71A 4WDRA 1THTA 4KE7A 5LYYA 4CCYB 1QIEA 4LYDA 4ROTA 5JIBA 4H7DA 3OTQA 5I8PA 1Q83A 2OPHA 4MWSA 1TIBA 4B9EA 1JU3A 5D3ZA 2VF2A 1CVLA 1ZD4A 4X90A 2HA0A 1F8UA 2PVSA 1SFRA 4PSDA 4J0DA 5ALHA 4HAIA 3W9UA 5ALDA 2QS9A 1MT3A 3U1TA 2X5XA 1IUOA 2HDWA 3GA7A 4B82A 2BAGA 1MAHA 4F60A 1XQWA 3WK8A 2YYSA 2JBWA 1PV1A 2QVBA 1G42A 1ZJ5A 4IHAA 1ORVA 4QWMA 3V9AA 4X6UA 4PSCA 5EFZA 4I4CA 1XZIA 1Y37A 4J0CA 4BDTA 4JEIA 4WY5A 2W6CX 4H7JA 4GW3A 4KE8A 3MUOA 4P92A 3PI6A 2HA4A 5AHXA 3FVRA 4UUQA 4BRSA 3ICVA 3EBLA 1AKNA 2XMGA 5LZ5A 1QIMA 1TCBA 1WB6A 4HXFB 2VA9A 4K6KA 5AKXA 3SWWA 1JMYA 3WK9A 4L72A 4LYEA 4NS4A 3BIWA 4DSZA 3CN7A 3I2JA 3WK7A 2XUAA 4RGYA 4ZWNA 3C45A 4UFNA 2PM8A 5SYNA 3EQ8A 3RM3A 3IURA 2C7BA 3QVMA 1GGVA 2XUQA 3D2AA 4Y7DA 5A7GA 4DMFA 2EDAA 2XUKA 4ZREA 5LKAA 5E2IA 2XUFA 3O4IA 3F9CA 1WB5A 3FLEA 1MAAA 1B41A 4BE9A 3C5WP 4N8SA 2OQVA 2ZYIA 5JANA 5A62A 5FKJA 4HRYA 5AKKA 3F8SA 1K6EA 2PSFA 1LZKA 5ALKA 4FDMA 4QDXA 1MJ5A 3DLTA 2Y6UA 2QTBA 4TVKA 4U2DA 5AM1A 3WIBA 2HU5A 4IH9A 1DINA 3STVA 2CZQA 1LGYA 3DEAA 4KR0A 1TK3A 1ZD3A 1JU4A 1JI3A 3SC2A 5DLPA 1VXOA 3IA2A 5DYWA 4C6HA 2ZJ6A 5CT8A 1M33A 1EDBA 1CIJA 4ZI5A 2XMBA 4CCWA 3WYDA 2HA7A 4WY8A 5JZ9A 1ZGCA 4KRXA 1WCYA 4W1QA 3IUJA 5AKYA 1UFOA 4Y2QA 2XUDA 1USWA 3ZWQA 1GPLA 1YA8A 1R1DA 3WJ2A 2BKLA 4UFOA 1EK2A 3MVEA 1BROA 2JIDA 2C5FA 4EZIA 1J2EA 2XMDA 2O2IA 5HF6A 1ORWA 2VSQA 1LLFA 1QJ4A 3I1YA 3HC7A 1OILA 1XZMA 2C0PA 1QLWA 2JGMA 1LZLA 5FPPA 4CIAA 2QXTA 3LCRA 5CH5A 3KWFA 3K6KA 3GELA 1YASA 3BJMA 5LZ9A 3HABA 5HZGA 2WUFA 4YK7A 4Y9SA 5AKGA 2XMZA 1XRQA 3LLCA 2JGIA 1EB8A 3ED1A 5JZBA 4J0KA 3HSSA 1LPSA 2RHTA 1GKLA 4F5ZA 4H35A 1CUSA 4BTVA 3PUIA 1ZICA 5JASA 4UHCA 3WYNA 2BUBA 4QZVA 4H7HA 3P2MA 3WA6A 2XQKA 5AI9A 3DQZA 3G02A 1DQYA 5BWBA 3C6BA 3F97A 3OG9A 4X00A 1XZCA 1A8QA 2OGSA 2XE4A 3ZLTA 1ODSA 3KDAA 3V48A 3IBTA 5HFAA 1IZ8A 1UT6A 4X91A 4AMYA 1SCIA 1UK6A 5ALYA 2VTVA 3H0CA 4H77A 3ILSA 1JMKC 2CJPA 1G4HA 5A2GA 5FLKA 5K3BA 1LNSA 4FFWA 3V1LA 5CT6A 4G9EA 2WIJA 4HVTA 2OGZA 3DKKA 2QJRA 1ETHA 3PF9A 4DMCA 3R41A 2WHQA 3FNBA 3DKRA 3KSRA 2OGTA 1YAHA 3AFIA 4JH0A 4BVKA 4C4ZA 5AKLA 1OCEA 4BVLA 3VKFA 1UOPA 3QPCA 4JNCA 1JJFA 2OAEA 1BN6A 1H22A 1H2WA 3WWPA 1XLVA 3OOSA 4LXIA 1CUHA 4KEAA 3TRDA 5JAUA 1VE6A 2Z8ZA 4H7FA 3I2FA 3H19A 5FPQA 1WHTA 2J3QA 4KJXA 2Z5GA 5HCUA 1YS2X 1EXWA 3HXKA 1ZI6A 1EI9A 1EVEA 1VE7A 5CH8A 5LZ8A 5ALEA 4Y2UA 4BAUA 4C89A 1TAHA 5DWDA 1RYYA 4GLBA 3B5EA 1W1IA 2D0DA 1FFCA 4H18A 4C88A 4Y2PA 1FFAA 2WJ4A 1XZJA 5DYTA 4G8CA 1SOMA 4FLEA 1K4YA 3T4UA 1DWQA 1MNAA 2RHWA 3E3AA 1QIKA 4OYYA 3G0BA 4TGLA 4P08A 1XQXA 4FBLA 3WQHA 2AJCA 3HLKA 2V98A 1QOZA 4DNOA 4XX1A 5D6OA 4UBJA 5AI6A 4B80A 2PSHA 3H2GA 4HTAA 1H2YA 3AUKA 3FCXA 3L1IA 3IB3A 5HF5A 2GYVA 5EHNA 4K5QA 3O9MA 1Y7IA 2JGEA 3WWEA 3DL4A 3L1HA 1LPNA 4J3JA 5AK4A 2LIPA 1WPRA 1CUXA 1UK9A 5EIEA 1HDEA 4UBIA 1UKAA 3FBWA 3CCBA 4MYDA 4YX9A 1VA4A 4QLOA 5ALSA 3AILA 2GYWA 5KREA 1Z68A 3QMWA 4QNNA 4DIUA 3D7RA 3O0DA 5AICA 4RE5A 1L7RA 2J4FA 3VJKA 4FFVA 3FYUA 1H2ZA 1QTRA 4WFKA 3AZOA 2WTMA 3DYIA 1DWPA 3AINA 4AZ0A 1C4XA 1UKBA 3VJMA 4XIIA 4HXEB 5EHQA 5AI4A 1GT6A 1G5FA 4GWLA 4BE4A 2WFMA 4LHEA 1CUJA 2R11A 2WKWA 2WILA 4UFPA 3VDXA 3N0TA 1VXRA 1ZD2P 2G5TA 4X6XA 5JD4A 5KWJA 3M3DA 5SYMA 2PU5A 2XUIA 5ALIA 4XVCA 2WJ3A 3W9BA 5DNVA 1JFRA 2EEPA 2I3ZA 1NU6A 3WK5A 2WLSA 5C8VA 1EHYA 1FFDA 1I6WA 3KWJA 5ALTA 4UBOA 3CN9A 2FJ0A 2WUEA 5DTJA 5FV4A 3V1NA 2GBCA 1CUBA 4OSEA 1LPMA 5ALQA 4H7EA 3LIIA 4H0CA 2V96A 3D4LA 4QEKA 2QUBA 1K63A 5EGNA 1GPNA 4GECA 1F0PA 4AZ3A 3LP5A 3STTA 2XQJA 1AUOA 2J3DA 3JYHA 1MX1A 1FFEA 4G8BA 3FAKA 4BB0A 1RWQA 3WJ1A 5JD6A 5AIBA 2GBIA 2CKMA 2HHAA 4W63A 1W76A 3EQ7A 5CTAA 4YPVA 3W04A 1YAJA 4FNGA 1GQSA 2WG0A 1LBTA 3WKCA 3BJRA 5CXXA 2B20A 2HU8A 2ZYRA 1EH5A 1U4NA 4G4JA 1ZOIA 1IUNA 3JWEA 3TEJA 2YXPX 3O95A 2Y2UA 1EINA 2VQ6A 2WSLA 3E4DA 2JGKA 2JEYA 5I7UA 1ODCA 1DT3A 2HA5A 1GZ7A 1VOTA 5HKAA 3R3ZA 2BJHA 5FOQA 5JYCA 2OAGA 5ALWA 4MJ3A 1W52X 4PSUA 2VEOA 4FMPA 1QFSA 1SCKA 1AC5A 1E89A 5I9IA 5LZ7A 4OB7A 4MEAA 1LPAB 5DNWA 4JYMA 4HZGA 1A8SA 1R3DA 2VATA 4OB6A 2ZJ7A 2ZSIA 2HA2A 2WIKA 4Y2YA 1EVQA 1WB4A 5E4YA 1TQHA 1OXMA 2PU7A 2OXEA 2WFLB 4X6YA 3PFCA 5J3JA 4W1SA 3VXKA 3IVMA 5YASA 3R0VA 1JKMA 1AURA 4N8EA 4CG2A 2BGRA 3S2ZA 3Q0TA 2V9ZA 4C01A 1XZLA 1XZBA 2V97A 2D5LA 3IUMA 4AX4A 4Y2XA 2PUJA 3C5VA 4FKBA 1CLEA 1WOMA 2PBLA 1LBSA 5ALOA 2XT0A 3QMVA 1C7JA 3WL5A 3AJAA 1B6GA 2DR0A 4IH1A 4KAAA 4NVRA 5AKIA 3S8YA 5HK8A 2DHDA 1EK1A 4BBZA 2O7RA 3QH4A 2CUTA 3ESAA 2C4HA 4FNMA 1R9NA 2CEKA 2BCEA 5E4JA 5AOBA 4X92A 3LIPA 1WM1A 4JUIA 5FP0A 1GQRA 4KACA 3FYTA 2XUOA 1SC9A 2UZ0A 1Q84A 4B0OA 4U2EA 4FOLA 5EIAA 1HPLA 4B85A 3RLIA 2RAUA 3STWA 4M0EA 3FOBA 1EDEA 2O2GA 1KU0A 4AB1A 5AM0A 2AJBA 5ALPA 4OU5A 1QO9A 4X97A 1AGYA 4J7AA 1DX4A 2CMFA 3FYUB 3G7NA 3U0VA 4QWWA 1CV2A 2HRQA 4BAGA 3DL7A 3X3HA 1UXOA 2DHEA 3G9UA 1MPXA 1GKKA 2PSEA 2VJCA 3ANTA 3WIOA 4PNZA 3G8YA 1BRTA 4GHWA 3ICWA 4B81A 2VJBA 1CUCA 1XFDA 1MX9A 4CFSA 4W1PA 3FCYA 5ESRA 5FXMA 2GBGA 4U2FA 5JAHA 1AMNA 2XQGA 1DQZA 4Q82A 4DMHA 3R3XA 5AO9A 5KWIA 1MO2A 2GYUA 2ROQA 2HA6A 1SCQA 5E4TA 1CQWA 1Q0ZA 3CXUA 4OPMA 1EA5A 4GI1A 5ALLA 4DNFA 4FLMA 5IH7A 1MU0A 2WM2A 5AM2A 1QIHA 1T2NA 4D9JA 1IVYA 2J4CA 1CRLA 3IIIA 3WA7A 2WHPA 4UHDA 3SK0A 6YASA 2JF0A 4KAFA 3DOHA 4B6GA 1TCAA 5HKBA 2OQIA 2HIHA 4QA9A 3FVTA 4RPCA 5FRDA 4FTWA 1IZ7A 4EHBA 5A6VA 1BCRA 2OG1A 3JW8A 4J0IA 4MWTA 5EIHA 3O4JA 3RKSA 4FWBA 1YA4A 5C7YA 3EIOA 3AIKA 5ALMA 1E5TA 1UKCA 4DNPA 3ESBA 3WLAA 2ACEA 3IUNA 5JATA 5EHXA 3DS8A 5FDFA 4UHHA 4DTCA 4G9GA 5AI0A 4KE9A 4UBLA 3PF8A 2ZYHA 1O6GA 1X2BA 1XLWA 4BYMA 3D3NA 4BC1A 3IDAA 3W06A 4BRZA 2WIGA 3C8HA 5CH3A 1BEZA 3NGMA 3G0IA 1YB7A 4W1RA 3GROA 2PUHA 2OLEA 4UHEA 1XZHA 5ALNA 1QO7A 3DOIA 1E8NA 5AIAA 5HF8A 4U2GA 1C7IA 1QIDA 3H2IA 4HRXA 2WFLA 1HLGA 4WCVA 1QIGA 4INZA 3RK4A 3ZV7A 2QM0A 1PJAA 1BE0A 4ARAA 1BU8A 2OCKA 4Q34A 2OCLA 2ES4A 3NOXA 1X2EA 5A71A 5D3KA 4H7IA 2BFNA 4BCCA 2FJPA 4XJVA 3HI4A 2WUDA 4PW0A 4N5IX 3C43A 3BDIA 3DCNA 3H1BA 3OPMA 3D5EA 1XROA 2WTNA 1FSSA 4BATA 5AM5A 2PSDA 1P0MA 2OCIA 2HA3A 2XI4A 3ZI7A 5BOVA 3C6YA 2QR5A 2ZJFA 4UHFA 5AJHA 2O7VA 3T52A 5HK9A 1WPXA 1XZGA 3DYVA 2H9YA 4X95A 4OB8A 1S8OA 1WHSA 3D0KA 5AK6A 5JD5A 3PUHA 4A23A 2C5GA 2BUCA 3STXA 3WI7A 4CI9A 2PKYX 2XMSA 2VAVA 5CT5A 4BC0A 5A7HA 3L1JA 4ITVA 1TRHA 1O6FA 3DNMA 5AOCA 2C0QA 3TJMA 3AIOA 3WWDA 2JGJA 4BVJA 5K3CA 2RI6A 3VJLA 5EI5A 2WG2A 2WHRA 2P8SA 2OCGA 1LPPA 2FUKA 3C8DA 4X7BA 3H2JA 3QBJA 2WJ6A 1AQLA 4ZGBA 3W05A 2ZVDA 4GBGA 3WL8A 5FUMA 5LLSA 5DJ5A 1N5RA 5HF9A 2ONCA 4EY7A 4UHBA 4WDQA 4A5SA 2VT6A 3GBSA 4BDSA 4B84A 2CBGA 3ESDA 4WFIA 1VJ5A 5CT4A 1UOQA 2B9VA 3M82A 4AQDA 3G0CA 1A8UA 4Q1VA 5ALUA 1XKLA 5DTIA 5IVHA 1AZWA 2ZYSA 3F98A 4BTLA 2HRRA 3D59A 1J06A 1RP1A 2Q0XA 5AP9A
chains in the Genus database with same CATH superfamily
4XW2A 1JPUA 3EA4A 4FOSA 1H2XA 1OF1A 3MCZA 1NU8A 2IHYA 2B1JA 5LB4A 4YXWA 3HA5A 3FCOA 3KZMA 2ILVA 4UAJA 4CMJA 4D9HA 1M2WA 3PYLA 2VPWA 3H4VA 5JSKA 3DHYA 3RC8A 2X9VA 1Y0BA 4NG4A 3HCWA 1E58A 2J8ZA 3M1YA 4DJ5X 5KQLA 2GZMA 1W5BA 1XTIA 2HJ9A 3UV7A 4AJ9A 2P79A 1CK4A 1TF2A 3LX6A 1H0KA 1UWLA 2GZSA 3L0SA 2YOFA 3VRHA 1FRFS 3RFFA 1EAMA 4BAZA 2JEZA 1GAXA 2WZBA 2C92A 2CNLA 4JI8B 1Q6YA 1ZGGA 4TYMA 3NUGA 4PIMA 4E6EA 4U6QA 4Q48A 3FJ1A 1QGUA 4URZR 3WL4A 1PS8A 3VVCA 3Q3IA 3O82A 4UNIA 5JSUA 4FT4A 1FVFA 3LBHA 4NAVA 2Q8QA 3NIGB 2QAGA 4MV7A 2EG9A 4M3NA 2QJWA 3KOOA 5HGJA 2H9AA 4MQ6A 3ROFA 1RAAA 4O33A 5KYTA 4DNQA 1QGDA 2A88A 1TF7A 4URWR 3I09A 3DZCA 3GAFA 3NYIA 1TDJA 4RF3A 4YRIA 4Q7QA 1NQTA 1IJKA 5F23A 4C0KA 3NUZA 1UZUA 3EXEB 3LS2A 2QD3A 2F9FA 2JIZD 2WBLC 3HXPA 1HOXA 3TO5A 1OLUA 4LQLA 1WCXA 1W1UA 5K20A 4XA8A 1PNRA 2RIPA 3O4VA 1FRVA 4GQBA 2IXTA 3IXLA 1VKNA 4NJEB 5JPCA 2XGSA 3KKOA 2D7CA 4O8ZA 3MQ2A 4RA6B 1LQUA 3OURA 1L5OA 1DC4A 3IP3A 1JLMA 1C8LA 5CDUA 4Z9AA 2AN1A 2YXBA 3T3OA 4ZV7A 2RK6A 2YN2A 3EOAI 3LQFA 3CLUC 3O4RA 3WK6A 3WQSB 3QG1A 1W25A 1ONPA 1ISPA 1DT5A 1XC7A 2V0CA 4ILKA 1UOEA 3RT9A 2C8LA 4C87A 4PTYA 1G5IA 1KFEB 5B1HA 1T2VA 2HSGA 2O52A 2E7ZA 5JFGA 4KUHA 4PGFA 3ACBA 2O5EA 3A58B 3H8VA 1Y9DA 1ZUNA 5KAPA 4XLLA 4I9NA 1GG9A 4KBYA 1UBLS 5KOJB 1MGOA 3DO5A 2I6SA 4I7EA 3H3JA 4FB5A 3KWMA 4LYJA 1COZA 2WOJA 3BH0A 3Q2IA 4GGOA 3LKVA 2EIHA 5ALGA 1YVUA 2DUJA 3O47A 3WMRA 5LIPA 2Z6UA 4L8GA 3THXB 2JLBA 1QPGA 2ZJOA 1YJ8A 1NZJA 5B36A 5DHAA 4PO9A 3DOUA 2XGMA 3ZLUA 1ULHA 4WECA 4NE7A 5KWVA 4NMWA 5EE3A 1O89A 3OQIA 2ZE5A 3IDZA 3OC6A 2JLRA 2GCPA 4TXNA 1PTJC 3MUFA 3ZWKA 5B2EA 3OJLA 4YP6A 5AVXA 1FYEA 1Q7TA 3ZHTA 4Y18A 2FP4B 1KS9A 2BGUA 2EZ8A 1A9RA 4GEGA 2NU8B 1Q91A 3U9LA 1Y81A 2B2CA 1DC7A 3WL6A 1DBSA 1SU7A 3OE4A 1QP8A 4X20A 4EHAA 2NUTB 4N5HX 4EGFA 1VZ3A 2FPPA 3OHMA 1BC5A 2A9QA 2XA1A 4H7PA 3WBJA 5B6IA 2POCA 4KQHA 4PLVA 1HRKA 2AF4C 2O06A 4U6SA 3K70B 3UT0A 1OQAA 3AY7A 3ZGYA 3UJ7A 3RFUA 2VO1A 4ZI7F 4U6NA 5BXQC 3C6KA 3JATA 7REQA 2J3EA 4OYLA 4B6SA 3KSZO 1LJ8A 4JC0A 3E53A 4L08A 3UOWA 1EB9A 1GGKA 2G8LA 3HV2A 4JD5A 2Y0CA 4B7ZA 3K6SA 1UINA 1R4ZA 4EHJA 2FHPA 3R0IA 1Y5MA 3USZA 4P6VF 1X7DA 4BX8A 2HF7A 2I7XA 4UTVA 5EWLA 4ZICA 3LWNA 4N5MA 2QN6A 4UTZA 4OO3A 2XZDA 3QVWA 1D7OA 1U7PA 2K5UA 2H0RA 1FS6A 2X6RA 1ZAKA 3CNEA 3FNQA 4FNAA 4HC4A 4XH9B 1Z4IA 2DYKA 1EKXA 2YIJA 2H1LA 2AQHA 4E5MA 1R8XA 5KX5A 1MW9X 2CXUA 2GPAA 5AKJA 3PDIA 2X4IA 2XDWA 3G0GA 3RFTA 2GK3A 1QYWA 2VDPB 4DWOA 4ZN6A 2YIVX 1TZCA 3EIUA 3OIWA 4HN4B 3GCXA 4J0FA 5TLSA 3I6ZA 2Q2WA 1M8GA 2JAWA 6REQB 1B42A 1QV7A 5FUBA 5TMPA 3WLKX 3OCXA 2FPIB 2OB1A 3Q0EA 2C42A 4L15A 1VE5A 2YFQA 4Y0AA 1B43A 5TQVA 4AS3A 5DLQC 2PUCA 5CK5A 1I6KA 4Y2SA 5L9AA 1XQ6A 3AWDA 5T6BA 2IUEA 4JYZA 3DZFA 1UL1X 3JCZA 5FBRB 3RARA 4A03A 3C3KA 2Y4OA 1JSRA 3GY0A 4K6GA 5EIBC 1O95C 1TU3A 2QX4A 3IKJA 4R1UA 1BCSA 4OQXA 1CTQA 4EA9A 1B1CA 3ZCSA 8OHMA 1RM0A 3NORA 1C9EA 2VDWA 3KJQA 1G98A 3D2BA 1W6RA 4NBUA 2VQ3A 3LSYA 3A2MA 2AX4A 2GX6A 4FW9A 5D7BA 5TQJA 5TS2A 1AT1A 1KI4A 3SPXA 3WG9A 4DY6A 4Q7LA 1MIOB 1R6XA 1R8QA 2BHNA 3RJMA 2BFCA 3QLJA 3IP6A 3MUEA 2C3PA 4HGZA 4BNJA 1KEUA 4RSMA 3TLZA 5M04A 4GVPA 4CG1A 4Q93A 4B3MB 3D0QA 1NX6A 2WF5A 3QFHA 1N6NA 3OP4A 3OCJA 1ZMOA 3ZCRA 2F3SA 4DLRA 2DHCA 1W9HA 3ETNA 3I4FA 3BFKA 1JTVA 3EXFB 4IIJF 3KKKA 5M29A 3M4JA 4G4GA 4YAGA 3DFUA 1OX5A 1JI0A 1HE4A 2PQ0A 4PICA 2NTVA 4RA9B 4XUEA 3TPCA 3G7SA 5KPJA 3OPYA 2IW1A 2ZAIA 1GQYA 2ZUVA 1YMQA 1N7HA 3BKWA 4TM8A 3DEYX 3OMWA 3CO5A 3OF5A 3ZTWA 1JIVA 2BDUA 3E9CA 3FROA 3R3UA 1SKYE 3WYFA 4IP0A 3T3EA 2PX6A 3P45A 1KEPA 3EFOA 4BX2A 1R4AA 3JX9A 1E2PA 1V5EA 2ZEJA 4FYIA 4V0RA 3EMDA 2RJNA 4WLUA 3RS5A 1ZISA 5E0OA 4AJJA 1HI9A 1TM1E 5EE1A 2YY7A 3GN1A 2HBYA 4RIIA 4EECA 3RVBA 1U3UA 3FNIA 4R8LA 4IMJB 3M89A 3FNGA 4L8YA 2H1HA 4YCBA 4ER7A 1K3TA 1ZINA 2IH5A 1EGMB 1QCZA 3H2KA 3JALA 4HHEA 4LHZA 2MYUA 3EA0A 3EWNA 5G3YA 1G66A 1SGWA 1NDQA 2RI1A 2YRFA 1TAGA 4U2BA 3W5HA 3KRTA 4C21A 1KRXA 4OXQA 4DRXB 2G9UA 1RJGA 1ZIYA 1JJAA 2PWBA 2PWAA 3OIVA 1MTZA 5EPOA 4E22A 4AUKA 2AOXA 4TSKA 1CNFA 3L6RA 4TVBA 4GDMA 4F92B 3ZUGA 2Y0PA 3TN7A 3OTOB 4GKAA 2QRGA 2QP3A 4OCZA 1UBFA 2QA5A 1FU4A 1C3VA 1NRIA 2CSXA 1HLDA 1F8GA 2XHEA 1TK9A 3I28A 3MRXA 121PA 5A1TA 3OCCA 2FF5A 2R1UA 3NP9A 2VHXA 2QXYA 4EA6A 1ZD1A 1VKHA 1P4AA 3BBLA 3HDQA 2OHOA 5K3EA 1Z0DA 5GTDA 1YZVA 3OQVA 3ICPA 2QN1A 2OHGA 6AT1A 1E3MA 2FW6A 3R6GA 2FGKA 4XB2A 1X38A 5M3BA 2G5PA 4U0KA 2AUMA 2OYSA 2BFFB 4IKOA 2H7CA 1J6UA 5I7EA 1K3FA 2FKAA 4GX2A 2I7DA 4EB3A 4TMWA 3O2QB 5D51S 4RAQA 2C3OA 2FPGB 3W5JA 1H2HA 4ZVMA 3TRIA 4C4AA 2XWSA 1MG5A 1WUJS 3E23A 1GCAA 4FZRA 4LJLA 4HX9A 2MWMA 5D6NA 3M5WA 4LDPA 4HJXA 4P58A 4HDMB 3R9XB 3RUDA 2Y93A 1NMXA 3WGHA 3V8PA 5IVIA 4QPPA 5THXA 1NN0A 2E55A 1XHLA 4OGFA 5EJ6A 5GJWC 1QX3A 2MINB 4E21A 3B3QA 3GLFB 4QGSA 3CRMA 4ID3A 4LDQA 2Z1MA 1BVYF 2H2GA 1X13A 4LOIA 2GPYA 3B89A 2Q1UA 3FE2A 5A4IS 5LU9A 1UBSB 3BE5A 3OKFA 1J9GA 1SB9A 1FK8A 1PG2A 2VKTA 1OZFA 5AT1A 2ZTVA 1XO1A 3IEMA 1J09A 3PRJA 3PQ8A 4RD3A 4ZVRA 1Z63A 3LBNA 1KVTA 2WWGA 2YASA 4LSWA 4N0QA 5FUXA 5CA1F 2OK7A 1IOZA 1EP2B 2Y1CA 3IVGA 5EEHA 2H2HA 2IYAA 3DXFA 3U7IA 3ZN2A 1TB4A 4F9FA 4II2A 3GT0A 3C6ZA 3MUNA 5JBNA 1USKA 3C70A 3C8UA 3BUSA 3PJGA 5TT1A 4JI1B 2GSDA 3I5AA 4G81A 5F3DA 5K0FA 4I99A 3K2QA 3SIPA 4B45A 4DARA 3AVVA 1F8XA 1DE0A 2IDMA 2XNJA 1RFLA 5IDXA 2BE7A 3AX6A 4PF1A 5AVQA 4XFKA 3AERA 2YY6A 1PRYA 5ADWA 3QTTA 1G6OA 3M2PA 4QNRA 1FXWF 1HH4A 2IEIA 2DLNA 2IOFA 2O8VA 2WRZA 2KBFA 3G0DA 4QNMA 2IA5A 1EVKA 3KKMA 2QZPA 5FHRA 3UO8B 1E66A 4OQNA 4DV3B 3SBDA 2WT8A 4UAGA 1WMAA 1JJBA 1YSCA 4CMAA 3CVXA 1GCGA 3WIEA 4YRQA 3I12A 3K2IA 1DKPA 4Q39A 3K1AB 4LWPA 3WHPA 3DDSA 2D2XA 2JIMA 5AI8A 3ESRA 4CV2A 4EELA 3ZE2B 1IBMB 3DONA 2I22A 3UMGA 4EVSA 1HTBA 3N6VA 5IBRA 2I6GA 3W2IA 2IHBA 1X70A 4C5CA 4DKXA 1AQ6A 1GGJA 1QGUB 2C3YA 1JR3A 3IUQA 4HQLA 4M9XA 4WNIA 3UYKA 1UBMS 1CJKC 4M1YA 2EW8A 4Y2RA 3IMGA 5KUTA 1GPKA 2B61A 1Z2NX 1GHTA 3F6BX 3HACA 4HK4A 4UTXA 5J4KA 2QAGB 3RIMA 4R8RA 4Q66C 1UP7A 1VDZA 1YB1A 1ECPA 3AY0A 1Y7HA 4JOCA 3QK7A 4WESA 5AVSA 4S1WA 3H1PA 1P5JA 1V26A 3N2KA 4OM7A 4Y2JA 5ICCA 3LYLA 3G2OA 3V1YA 3TIVA 2FMTA 3HA3A 3ET4A 5BVGA 4JVNA 3E8MA 3WOHA 3B78A 1IYZA 3UMVA 1X1QA 5IG2A 1UK8A 2FSVC 2ZIUB 4ZOBA 4DCNA 1OLUB 1E5VA 1P80A 2GF0A 3KPYA 3G2IA 3O0TA 2F1RA 4GRDA 2FSSA 3NH6A 5B55A 2A9RA 4XOUA 3QPUA 3T1NA 3VR1A 2R4UA 1KP2A 4IW3B 5JS2A 1CUGA 1V11A 1J8MF 2XKJE 4AKIA 1Z5OA 2FR8C 4R0VA 3RWBA 2XCRB 5DHSA 4TKLA 1V0JA 2PGAA 3I4LA 3V8EA 1AF4A 1WG8A 4MR7A 3DE7X 3EAFA 4KTVE 5AW9A 3T7JA 3A4TA 2Y1KA 4KSBA 4L8WB 3S1LA 5DBEX 2PFKA 3PPWA 2O19A 4RMGA 4D9EA 2HWYA 3V7FA 2PX2A 5H80A 2FMHA 3WMEA 3FKSD 4ETWA 4FDTA 4RDHA 1LFDB 3K9HA 5I5EA 4LEIA 1QDLB 3D3KA 2IU0A 1GYQA 1ZUNB 2O3QA 2W43A 1N2HA 4MPRA 2GHQA 1HE1C 1IAQA 4TRNA 4DSUA 5F76A 3Q7PA 3SLGA 2GCIA 5IJAA 3ICCA 1VHJA 1W36D 3ABZA 1WIWA 2GERA 2C99A 3IUEA 3JQDA 4Z3KA 1E9VA 2H2IA 2NVBA 4LIPD 4PLFA 5LUBA 4ZGWA 5A4KA 1A5ZA 4Z1MA 3H87A 5LOVF 1GGEA 1Z4PX 2PKQO 4GIBA 1P4JA 4HEA6 2E4YA 1VHTA 5FR2A 3OZCA 4L07A 4LYHA 2ZFUA 3QYJA 1QZZA 4BFCA 2BGNA 1QONA 1KKMA 4CG3A 3S8MA 5WRFA 1EUDA 3M4XA 5A9SA 4IJ6A 3O94A 3B6EA 1Z2DA 1VJGA 2HCBA 3KZVA 4UD6A 5H5JA 1RHKA 4BIMA 5DSTA 5LIRA 5BRJA 4JGGA 2GTPA 2TMKA 4OD0A 1C30A 3WWOA 4X20B 3AIMA 2E2WA 3VZDA 2CE2X 4EG3A 2OHHA 1UWCA 1XZDA 5G4KA 4B0PA 2FWJA 1V25A 3DO6A 3FPHA 3GK3A 3L07A 3MTDA 4TYPA 1NBOA 4BCDA 1QCYA 1EVJA 4GMGA 3ZBPA 4K86A 3SIXA 2X5JO 2NQ2C 2PL5A 1VHDA 2K4MA 2A8YA 2IYLD 3JATB 3NIFB 3PFWO 4RCYA 7REQB 5K8CA 4ARBA 1E1DA 5AM4A 4RDIA 2IIVA 2R3SA 1TUBB 2W6IA 2V7QD 2XY4A 3HVHA 3IESA 4H3SA 5AK5A 5SY4A 2CDRA 2ZJBA 3EVDA 4Y7CA 3K6SB 3M3HA 4YWJA 4N3NA 4EEXA 1Z0IA 4RPLA 5EWLB 4CTNA 4C76A 4IAOA 1L7QA 5IDWA 2GD6A 4DLAA 3ETJA 4RULA 1Y8QB 1RWMA 2WF9A 3NBYC 1KY5A 2QAGC 2R8ZA 3MYYA 2QORA 4FEGA 4MQBA 5DCUA 2OK8A 3E1KA 4MP3A 2RONA 2QNIA 2QX6A 4C6TA 5CFOA 1RTKA 4DV0B 5KX5B 3FRIA 1VI6A 4K9QA 3I61A 3PDIB 3SDSA 4ER5A 1QLJA 2X9LA 3DJYA 3JPYA 1DG9A 2QR3A 3TIXB 4M0MA 2AC7A 5TMBA 2L19A 4CLOB 4B32A 4PX2A 5C34B 8AT1A 3ZXXA 1O6ZA 3HB4X 3PJDA 4MEBA 1Z5GA 2PL3A 4BZXA 1I8TA 1T6NA 5JSHA 1S4QA 3TG2A 1SD5A 2VOJA 5LU8A 1PEYA 3PQ5A 4EF4A 2FOXA 1FQWA 2HK9A 2VJQA 4Q21A 4L0CA 4UPEA 4EL5A 3F5SA 3BPSA 1TI7A 1TL7C 4UEJA 4YUVA 4AN0A 4YR7A 3RYCA 2XQIA 4GMDA 1VMDA 1E63A 1L7BA 3I2IA 2QJTA 4O08A 2YH2A 3EODA 4OY3A 5T4FA 2ZBPA 2ANCA 1SPXA 4JIGA 4GMKA 1J7KA 1XEAA 3FZYA 3IL2A 2VRCD 1UBNA 4L76A 4OUDA 4L27A 4US1R 2ZULA 2V45A 1T1IA 4HJRA 2BFCB 1FTSA 1CJCA 4MNTA 5I7SA 2UYYA 1Z0ZA 3M8KA 1MX3A 2IHUA 1M1NA 3AETA 2NV6A 2WTAA 4PPGA 3DHWC 3M4YA 4YCLA 1XRNA 4AJNA 3NTVA 2HUNA 3VAAA 3UHOA 1XD8A 4F2WA 4EJSC 2ZYWX 1GKIA 5C5CA 1H6AA 2HU7A 4BMPB 4IJMA 3L6EA 3H05A 3NBXX 1WMDA 3H13A 3T5DA 5F1OA 3BICA 3OPYB 2HQRA 2FZLA 2Q9CA 4FCWA 1QJCA 3WLMA 2A5JA 3O93A 4Y2VA 3TD9A 1RNLA 3LCJA 5E1BA 4R2XA 4F9EA 3W9SA 2W93A 3VC7A 2PD6A 4GZLA 4TN1A 3EFOB 4IGEA 4MIYA 4Q19A 1G8AA 2Y1XA 5AUPB 2GF2A 1HTWA 5CW2A 4EP1A 3ZI4A 5EG5A 2QLBA 5BQOA 1QP4A 2IEGA 4CLXA 5DHUA 4ABTA 2OVFA 3N2YA 5EXXA 1K3UB 4EUHA 5JAPA 5K0CA 2FMIA 3RD5A 4AKSA 1P0QA 3EPHA 2MSKA 5ALVA 1CQPA 5D5PA 3OX4A 5ALXA 1A2KC 2G4LA 3BDVA 3KTFA 3NTRA 3PR1A 4Q1FA 3R76A 3W77A 2PIDA 3IUBA 2WIFA 1NW7A 2HC9A 3PGLA 3WMFA 1SUEA 2N0SA 4RPJA 2YS6A 2R00A 4MV3A 2G71A 5TS3A 3ROEA 1IOLA 4NZZA 4RVNA 4A91A 3U40A 2ISCA 2W2NA 4N65A 1FUKA 1LBEA 2BUAA 1P61B 1ODFA 5AUNB 1EFRA 4FIDA 3GZNA 3IEUA 2VPZA 5F7JA 3WP0A 5EHZA 5K8IA 3UV6A 1GGNA 3OZTA 2NUAA 3F1LA 4QXQA 1UPAA 5FI1B 1VG9B 3S3TA 2DTDA 3AYXB 3KZCA 4ZCTA 2C83A 3GJRA 4L3VA 1FA9A 5H59A 1B6TA 1GZSA 2JLWA 5JMPA 3P97A 4AQ7A 4ZQGA 3WNDA 2VHQA 4OFWA 2OZKA 2H48A 4NBNA 3X44A 1KRHA 3BIXA 4KBGA 1LY1A 2FPKA 1LTKA 2YJNA 3PV0A 4B3FX 4DV4B 1RAGA 4IX9A 3QI2A 2D5IA 1UR5A 5HFNA 3WZLA 4Z4CA 2F9MA 1PN3A 3U7EB 2IP1A 2F8SA 2HXSA 1Z5ZA 3W2FA 1PSDA 3ZG6A 4TXMA 1ADFA 2LD4A 3RS0A 1CD5A 3K70D 2IZOA 1WDMA 3MMXA 4S0ZA 4X3CA 5A5EA 4QOHA 2ZRJA 1IFXA 3VOTA 3WYGA 3MTGA 4PBTA 5CVTA 1DC8A 1CQJA 3QY9A 4GX0A 2KLHA 4HSEA 3TD6A 3V7YA 3PQ4A 4DILA 4E5UA 4DR6B 2H7XA 1RWNA 2FG6C 2J3JA 4XB1A 1E7MA 1YQEA 5FR1A 1HRDA 1PZGA 5IAJA 5H82A 4YASA 1IK4A 3CNHA 2O7QA 2JCBA 1SUDA 2FX5A 4NBSA 1CYDA 5T64A 1AHNA 3VBCA 1TO6A 2V4ZA 1ZGBA 1GNVA 5IDYA 4FGLA 1XOIA 3QWIA 2WJGA 4LCJA 4NBKA 3ZHSA 1MAWA 5JTUA 3MC1A 3RHFA 4X64B 4B47A 2HOQA 1UBHS 1Q0LA 1QQ5A 3NB0A 1U65A 3G59A 5BRAA 2C04A 3GRFA 4PCUA 1E6MA 1CUWA 1H1LB 1NTRA 3OM0A 4FGSA 1GTVA 1QTIA 5DCYA 4AS2A 3BHMA 1GR0A 4CIDA 4E1BA 1KEEA 1U63A 1Z2OX 3ORSA 3R40A 3L7JA 5JR3A 2QUAA 1CY4A 2FNAA 4LHSA 4W9RA 5SZJA 3TZEA 4KXVA 5JZSA 1HT2E 2MSLA 2Y1GA 3A6KA 3AERB 5GONF 3EH1A 4BL5A 1N2ZA 2ZRPA 3WLJA 3EYAA 3GRYA 3AM3A 1U2GA 4PFSA 1I6MA 3STYA 2HM7A 2G0TA 4YP5A 5AK0A 2QYOA 1WUHS 1ZL2A 5DP2A 3I32A 1IZ9A 3CZQA 1X0XA 3WKDA 1Z7YA 2JFZA 4UD2A 4XLTA 5AQ1A 4LX0A 3PK0A 3EK2A 3B1JA 3HJUA 3V6MA 3AHCA 4LZAA 2R1ZA 2E48A 3D8BA 4XWGA 4CM8B 3DDHA 4MUXA 4DCJA 1XCPA 3HLYA 1UAAA 3R0ZA 3QVSA 5KB3A 3FXAA 3IUSA 4ED9A 1OIVA 4OQZA 1N9ZA 4LJYA 1Y3DE 1CUEA 3NHAA 3HLTA 4G0XA 4W8GA 4S1OA 1R6TA 5L6LB 1E7SA 5TVKA 4BWYA 3QE4A 1LLQA 2HH9A 3SVTA 1HORA 3C2QA 1IQPA 2VL7A 5LYYA 3FPSA 3KHUA 4QKQA 2F9LA 3N28A 4WESB 5IP5A 2O5RA 1KJIA 2VIIA 3FDZB 3OFND 2I4RA 1P2SA 1TCVA 3LPCA 1SVUA 3C4VA 3QUBA 4FZJA 4H7DA 2YRXA 1N2GA 4QO7A 3ZHYA 5BVGB 5IZCA 4MEJA 5B3KA 1R5JA 3MN1A 3SZLA 5HSGA 1Q7RA 1TIBA 2G9RA 4Q16A 5H68A 3KB2A 3TIIA 5D3ZA 1SM4A 2B34A 4M54A 3A1EA 2JLYA 3RG8A 4E30A 4H08A 1V11B 4EB8A 3WV4A 1G3RA 1PSZA 2J7PD 1LI4A 4FVTA 4KMMA 1Z36A 2ENUA 2HA0A 2X2EA 2GN4A 2ZK7A 3LRXA 4LV6A 4JI4B 2PVSA 1SFRA 3NBAA 2CDBA 1MP0A 5ALDA 4MR7B 5AVOA 1DV1A 5CLFA 1MT3A 3NQ41 4KPUB 1RYDA 2I4OA 3BXFA 1IUOA 2HDWA 4B82A 3C3CA 4C08A 1VI5A 3RJTA 3OZVA 1NUQA 4GP7A 4ENVA 2ZE6A 4I8DA 1Q0PA 3EWAA 1PR1A 4R7GA 1ONSA 3B1KA 3D8UA 3WK8A 2IHVA 5BW6B 5MN5A 1NI4A 3GHYA 2VF7A 5EQDA 4XJXA 3I6BA 1W4CA 2J5QA 1TJNA 3DBRA 3MWJA 4JBIA 2RD2A 3MLBA 3H11A 1CEQA 2CVPA 1MRZA 1ORVA 2BEKA 3B3GA 3D8TA 4QWMA 3CJRA 4B2IA 2OO7A 2QE6A 2XQVA 4PSCA 4MIKA 5EFZA 3NDRA 2DECA 4CEHA 4B3RB 2E4ZA 1TRKA 3K6RA 4NXMB 1OBCA 1I4DD 3JQ7A 3PUVA 1XVUA 1U80A 1JHVA 5CLIA 2BOVA 1QK3A 2GAFA 1YU6A 5DNDA 3L5KA 4F45A 1Y1KE 1H8EA 2CNDA 2NV0A 2X19A 1JWLA 4LFBB 4YRNA 4RC9A 1EUDB 2DUNA 1XA0A 3VU8A 1VPWA 4JEIA 1JIIA 2WM3A 1PVVA 2QMYA 4M9QA 4JXZA 2Y66A 3RRBA 4GW3A 3ND9A 4KE8A 2ODAA 4F4CA 2XB2A 3LKDA 2A6PA 1C30B 1N6LA 4UQPA 1MC1A 3NBUA 2DVMA 3CUVA 3K9CA 2HA4A 2PRKA 5CDSA 4ONEA 4DREA 5G4KB 1JQJC 1O77A 3N2LA 4JJZA 3DXYA 4NU0A 3JYQA 3DW1X 3ICVA 4AKGA 3GD5A 3N74A 3HJFA 1OX6A 2OLJA 1EWKA 1AKNA 1Z2AA 2P4QA 2XMGA 1DC3A 3DMTC 3PHGA 1NW6A 3EH2A 5IEJA 2H18A 1J5XA 4LVCA 3C4JA 1WB6A 4PGGA 1JSXA 4KX5A 3AFOA 2GJ9A 4G0UA 2GD2A 3HNOA 3SWWA 3I52A 3VU9A 3WK9A 1RT9A 3KUXA 2ZYTX 4AWXA 4DQKA 3F7NA 1NUAA 2O7SA 2RGWA 2VT2A 3FMIA 3QKSA 1GOTA 1IG3A 2DSTA 4HVAA 5C8YB 3H65A 3DZKA 1OMOA 2H0AA 5EQTA 4L4ZA 2XUAA 4QICA 4MUIA 4V2UA 3WK7A 4HBZA 4C6TB 4ENPA 2XGGA 3CNNA 5F9HA 4YROA 2BMDA 1QHNA 5K1ZA 2GNAA 4ZWNA 1E6CA 2AN5A 3TZBA 3L6CA 2PM8A 1H2BA 4UXIA 2C88A 3A9WA 3I76A 2X7JA 4X24A 5B1YA 3L1VA 3MT7A 3ENKA 3PWSA 3BAZA 3KZKA 1JA1A 4UUNA 3DVLA 3T9EA 4UM9D 4J1NA 1ZITA 2C7BA 1H4QA 3QVMA 5C0OE 1YFKA 4RD2A 4S12A 1CNMA 3W3AH 4NPHA 2O20A 2EDAA 3ENQA 4L50A 4UEWA 4G5YA 1OWLA 4AJ2A 2WWYA 3RYCB 4KFUA 3SBXA 3WDLA 3RJ9A 3NI2A 4G4SO 2OP0A 4ZREA 4EGCB 1Y98A 3OEEA 1DDOA 1TLTA 2VNSA 1NOIA 1D1SA 4A82A 2WDPA 3M5CA 3LBYA 3FLEA 5EMMA 1B41A 3PVZA 2J67A 5SZKB 3SZMA 2D3WA 3HY3A 4D8VA 1JR6A 5LYJA 2M1ZA 4ZTZB 1A97A 3HR4A 2AKAB 4L4UA 2PKCA 2XH8A 1RYEA 3EJWA 3LAWA 5AKKA 5FKJA 3TCKA 3LT4A 3T7CA 2VDMB 3A3OA 2X1LA 4H4EA 1M1NB 1SQGA 3AETB 3HB0A 1M1ZA 5ALKA 4FEYA 3MB5A 4ZDJA 4FDMA 4HL6A 2PLFA 3GGJA 3I45A 3MEQA 1ZM7A 1MJ5A 3PRKE 2EFEB 1NPDA 5INTA 3ZWBA 4DJEC 2A78A 1VPVA 2Y6UA 1P1KA 3OLQA 5CFLA 1C0LA 1KO8A 2FXIA 3KSDO 2QTBA 4QVIA 4P5PA 2QU7A 1O58A 5JHHB 2YTZA 4GC5A 4YBZA 3PEFA 3ZZUA 3GLFE 4D9IA 5CA1A 3DEAA 1RXYA 4KR0A 1OR8A 1AH2A 1ZD3A 5L3RA 3FNRA 1P1JA 3U7HB 4QOGA 3TE7A 1O5OA 4I46A 1YRLA 3PX2A 5JSZA 1HF3A 3PDHA 1YS6A 3FWNA 4RQUA 3EW9A 1VXOA 3RW9A 2CLIB 4PANA 4C0JA 4B6FA 1D6MA 1ZSNA 4HNHA 1VLMA 3QWBA 4MCHA 3M6VA 1YI1A 3B1XA 1M8PA 3H75A 1JIKA 3EZYA 3UBMA 4L0QA 1TD1A 2Z3VA 4B6QA 2L42A 1YR6A 3FJYA 3HVRA 1QS0A 3DMHA 1GARA 4ZI5A 2R8OA 2XMBA 2CDNA 1MORA 1S0UA 4M9ZA 3SEFA 1SCDA 3LT2A 3WYDA 4ZCMA 3TQHA 1ZOPA 4I8XA 2H57A 5P8WA 1RYNA 4FZVA 5AW0A 4G85A 3BE4A 3V34A 4KRXA 4XFDA 3IUJA 5DIZA 5AKYA 3OPNA 3TVTA 2HDOA 1Z2CA 3P0EA 1I5RA 4Y2QA 4KPEC 2J08A 2B4TO 1HYGA 1TJ5A 3L3BA 1ZUHA 2XRYA 4D4GA 3EFHA 4FI3C 4TQGA 2ZTUA 3ZI0A 1YA8A 3JZMA 3VTAA 2GHTA 8GPBA 5C2JB 3T5PA 1NE2A 3C6QA 4BQIA 1R1DA 3GZNB 3O74A 1N3IA 1NXPA 4U9IS 4UM8B 1E20A 2WYOA 3R7LA 4ZJPA 1ZW6A 1QVAA 2ID4A 1T13A 2NUAB 5CA0F 1NKTA 1J99A 2C4WA 3MVEA 4B87A 2ATCA 1XT6A 4YR9A 1JFTA 1YL5A 3KLNA 1W8DA 2JIDA 1E92A 3NALA 4M1TA 4M22A 3F46A 4UVEA 4UDYX 2NXNA 1NVMB 1Z28A 5J40A 3QJGA 5KHAA 2RKOA 3RIEA 3TDNA 2PXHA 5C18A 1T6XA 1J0XO 2O2IA 4GPAA 1ZS9A 3O9ZA 4RMNA 5HF6A 3JV7A 1AKYA 4D6XA 4DSOA 1UWVA 4EHIA 3JZFA 4J2HA 2EFDB 4BVAA 3T1TA 1V1RA 4L5JA 5JI3E 2C0PA 2YHUA 1C0PA 2CJWB 3ZHCA 4YY3B 4C20A 4AMVA 4X66B 5HHTA 4FQ7A 3UEOA 4WPGA 4ZVKA 3G2HA 4HEJA 1OU4A 4I2VA 3ZY5A 1T9GR 1Q92A 2JGMA 1W88B 4A0SA 3CEPB 2QIOA 1LZLA 2FZWA 4OJYA 4AJEA 4YJ3F 5JE8A 4DC0A 3CY6A 3P20A 4F38A 1AO3A 2PMWB 1L4GA 2E6KA 1RYMA 2I80A 1REQA 1EEXB 1FU8A 4K1XA 2HK6A 3A6PC 4N6OA 3RVJA 4BNWA 4A6XA 4CG0A 2HD4A 1XAGA 1IBKB 5GJCA 3PPXA 4ZZ0A 1W87A 5C46F 1QHYA 5IKMA 1N6PA 5LNK1 3TQTA 4CF5A 2VYVA 2JI4A 1FYWA 1I1HA 1QH9A 2ZYAA 3AF3A 3L9WA 5D1NA 3T5MA 5FLEX 3TSZA 4PVCA 4BNFA 1RHRA 1W0KD 2ZI3A 1DBVO 1V1MA 3GELA 5FBZA 1WDLA 1Q3KA 3HABA 3S7TA 2WUFA 4JDPA 4DTIA 5ELXA 2QPAA 2B0CA 2Y3IA 1I0ZA 1NPYA 1KEEB 1XD2A 2O8DB 1H65A 3EUFA 3KB8A 5JZBA 4KQCA 4J0KA 1L7VC 3AVYA 4NHEA 1DO0A 4RHFA 4GI2A 1LPSA 3PNBA 3P9KA 2XTZA 2EKLA 4H15A 4MULA 4AJHA 1BE1A 1UFRA 1ZLYA 2A4KA 1CBUA 4DZZA 2QL6A 2QE7D 2XWJI 3OQ6A 1DXHA 3CNQS 1LC0A 2FPLA 1CUSA 4YJ2F 4S2EA 3ISJA 3TFWA 4B73A 2PNJA 1BVRA 3AB3A 3BB4A 4BTVA 4NESA 4PYOA 3GPLA 3DOCA 4GI7A 3B1WA 4AP5A 2DY1A 2IYZA 4K9DA 3IQFA 4JP2A 3AY3A 3EHEA 1A9TA 2BUBA 3OAAA 3E70C 4UHCA 2K7ZA 3A3YA 4YRBA 1H4SA 2VRNA 3B2EA 2OUKA 5TDHA 3WLRA 3ZUPA 5HGXA 3WA6A 3OLYA 5K8UA 4WZAB 2AD5A 2XQKA 3PRYA 2BFEA 3RWMB 4D0GA 4QBHA 3DQZA 4XYEA 1MG0A 4FJ2A 2CL0X 4F7DA 5F7XA 4DJFC 2OHXA 3IELA 3LPDA 5EIWA 3AF4A 3NBZC 5BWBA 3MFYA 1OI7A 3TIGA 3S2YA 4R9SA 3K73O 2FRDC 4X00A 3AF2A 5G0VA 1XJQA 3O8QB 1UP4A 2ODTX 5IKEA 1EUZA 3DYBA 3VSBA 3UGJA 1XTSA 4LC1A 1WCIA 5IMBA 2ID7A 5BPHA 1E0KA 1IB6A 1P8AA 4QUJA 1WSWA 3ZU6A 1JHXA 3CJQA 1IVNA 4MUGA 4RKWA 3C85A 1FTGA 3V48A 4XSHA 3JQFC 1QCDA 1YBMA 3NM4A 4IWNA 1UT6A 2O2SA 3B1YA 1I0LA 4AMYA 4EAQA 3O92A 2EZUA 1PFGA 2XNDA 3N1UA 2G5GX 1PFVA 2JIBA 5EKSA 4RW0A 4XWOA 8ABPA 1PHRA 4WADA 4PGMA 4G67A 1Q7EA 3O8BA 5AOVA 3EIXA 1LS6A 1O57A 2RHHA 1IBRA 3MBIA 3TOSA 3H8WA 3IVAA 3Q40A 5K0SA 1WDKA 1JMKC 1VSTA 1XNHA 3RTAA 2F62A 2CJPA 1LK5A 4YUXA 1I30A 4C7XA 1OI4A 2BHSA 1YKGA 3L1KA 1U81A 2VR1A 1O5IA 3ZQ6A 5K3BA 5CX1B 5AHKA 4A1FA 1MO4A 3MJTA 5EFOA 1KBQA 5CT6A 1TM3E 2HLDA 4ID9A 5B3JA 4G09A 5L3ZA 3VUEA 3WGVA 5I48A 1E2KA 4D3ZA 2CMKA 4NLLA 2CXSA 1JNYA 1TNDA 4NP6A 1QG6A 1WP9A 2IEBA 2V1XA 1R0LA 2BKAA 3B6ZA 1NI4B 3U4DA 5L7YA 1ETHA 2FGJA 2H08A 2IY9A 1QPBA 4N6GA 5B30A 3V7WA 1V9CA 2FEKA 3H11B 2ZKLA 4GLOA 1I0IA 4P4TA 4DMCA 4Q1EA 1IY1A 1L1EA 2WHQA 1J42A 3T95A 3FNBA 3C3WA 2FUG1 3H4MA 3VPBA 4L75A 3C1AA 4J16C 3R6LA 3JQ7B 4JDUA 2UZ3A 3AFIA 1ACMA 4CN9A 4OAQA 3KTDA 4P5DA 4JK3A 2PX0A 4KCGA 3NWJA 2R86A 5E1DA 4C4SA 3QPCA 3CT6A 2IF0A 1RRMA 2OBFA 4G0PA 4P3KA 4NENA 2O2YA 3MJEA 1JJFA 2VJMA 1H22A 1U3FA 1H2WA 4TV9F 3WWPA 4Y0VA 4MPDA 1XMJA 2J0UA 4M86A 4DWVA 2FWAA 1YS7A 1NVVR 3OOSA 3JQPA 4DA0A 4EHNA 4KEAA 1KSGA 1NC3A 1OH7A 1ZN9A 3PNVA 2NXEA 5IYZA 5L40A 3ZD6A 1RKUA 1HE8B 1UEJA 4KITB 4HDAA 3U17A 5I7WA 1SOVA 4B7XA 1Z6TA 3N53A 2QPOA 1PFUA 4H7FA 4IIEA 3TSYA 3L6UA 2JFVA 3KKLA 1DFGA 2C2XA 1U9IA 5CEFA 4E1VA 2NIPA 1PR9A 3G8DA 2BVNA 5FPHA 4KWHA 1KARA 3VU9B 1J0EA 1PQWA 1XCLA 3ELDA 2QTVA 3H19A 1JR2A 1P19A 1CJUC 1I6LA 1F2DA 1XEFA 2P2YA 3H3XA 3H4IA 3QLUA 4FBGA 2QY6A 5FPQA 2FR0A 1WHTA 1XGKA 2EWVA 3FYCA 1JB9A 2J3QA 3EASA 4QPCA 3SF8A 3EPPA 4EW2A 1UEXC 3EIEA 4EMBA 1AY0A 2Y4NA 2Z5GA 1YS2X 2B8WA 3A6FA 3HXKA 3MWDA 4WSOA 2OO3A 5SZIA 1NUTA 1J39A 1ZI6A 2GASA 1E7YA 4NU5A 5IZCC 1RLUA 1XELA 1GUDA 3MT8A 2AWOA 5CH8A 4UJ3A 1TEXA 4XRGA 2PPVA 2QQ5A 1SK9A 3CINA 4BAUA 1L5FA 5K3OA 1FRQA 3B5EA 5JJCA 2JIRA 4RHTA 2D0DA 3EARA 4KQKA 4R8VA 1N7IA 4PZYA 2WPDD 4AWBA 3VOBA 2IPXA 3DAFA 2Q7XA 4JXJA 1HEIA 5E6RB 2ZRDA 4TS4A 3UG6A 3I73A 5JCPA 1MDFA 4JP8A 4GPEA 3ZGXA 4PYKA 4WOKA 3RLFA 3ZNQA 1UC8A 1IC6A 1PR4A 2ACWA 1ODKA 2WUVA 4D9FA 3E7PA 3C97A 3UJPA 5BY2A 3CVYA 1K4YA 5FWYA 4TTAA 5JW6A 2FPOA 2G07A 3T4UA 1SG0A 3IR7A 5BOSA 5LYJB 1JHPA 1G2IA 3BWVA 4PGAA 1A8IA 3NDPA 4JMLA 1WU8A 1R6AA 1JSZA 4KG7A 4I3HA 1ST2A 1PGPA 2RHWA 3EIFA 3B70A 4EG8A 1QMGA 2HEGA 3E3AA 4FR2A 2C97A 2PMEA 2HHHB 5BT9A 3RIXA 4PWZA 1QIKA 1F20A 1C2TA 1TIPA 3N8KA 3G0BA 4JYCA 4POOA 3A32A 3UJCA 4K46A 3ZU3A 2PTGA 3DHEA 3DBVO 3MS7A 3ZNNA 4FBLA 1TEVA 3WDSA 1PNVA 4Z4GA 2RGEA 4TWAA 5A04A 3GGCA 4G0MA 3HQ4O 3W3AA 1RPAA 2X22A 3CLSD 3F3KA 4ESOA 1CWUA 3G8CA 3AKCA 4U1RA 1XVVA 4QBTA 2A1TR 1NNSA 4PHCA 2F90A 4HBGA 1M6YA 4ZT3A 3LLUA 1N5DA 1N7GA 3NTQA 4I6EA 5D6OA 4ZI2A 3Q7EA 5JSZB 4RZ3A 3SFVA 1JDBB 4HTAA 2I2DA 3AUKA 4XWYA 1G8MA 2NTEA 4KLAA 1Z12A 2N1MA 3COWA 4L95C 3T34A 4WE3A 2PUFA 1PEKE 4TLAA 4Z1OA 4BO5A 3O8OB 3GUYA 3ULKA 4EX6A 2R6R1 2D06A 1DKUA 2XXBA 4G0NA 4ASUA 4D82A 4K5QA 3S4YA 1QS0B 1ZN7A 4H1UA 1GGHA 1WS6A 4DLKA 4XRRA 3RS3A 4GF5A 4PGHA 4CM6A 3L1HA 2OV8A 5AW8A 2K87A 1RBMA 1RPTA 5EUMA 3EUWA 3GEDA 4GX5A 3DMDA 4HGYA 4Y6GB 1BDJA 3Q0IA 2QTMA 4U3JA 4YO8A 2LIPA 2PGXA 3ZXUB 1HX7A 4TTVA 1BWPA 3S29A 4RLSA 1F17A 1Z4MA 1CUXA 5EIEA 1HDEA 3COYA 3Q10A 4KBFA 4BZPA 5JMOA 1AKRA 1S7GA 1RJFA 2G5CA 3MTJA 1KC3A 2P30A 4R3NA 3RSQA 2IOQA 5EZSA 1ZNWA 1UMDA 1XEWX 2Y0EA 3DAGA 3SR0A 4AW9A 1U3GA 3I5YA 3CXRA 1W5TA 4MMZB 3M6UA 1NSYA 1U6IA 3R20A 4RL6A 1NIJA 3EDCA 3QMWA 4RQAA 4UXJA 4DIUA 5KREA 4TL6A 1ZEMA 2QLLA 1RRPA 4XCQA 3HJGA 3ZDFA 1HNXB 4RE5A 1GG8A 3D2LA 1NMEA 9MHTA 1ZAYA 4NEQA 1JDSA 1I3KA 2OLKA 3GO4A 1N78A 5CB6A 3NVAA 1B4DA 1PVDA 4JGBA 1J20A 4M7PA 1H69A 5JT1A 3AL2A 3P5BA 3HXQA 1RWXA 2YJ4A 3HHEA 3TH5A 1DRUA 2EXXA 1L1RA 1JR3E 4RCVA 2A3NA 1EXDA 3G6WA 3FTQA 4ZV4A 4B71A 5ECGC 1V1RB 1BS1A 2J4DA 3IQWA 3LT5A 4WWHA 4AZ0A 5KKCA 1C4XA 4F4UA 5HX7A 3KG2A 2DEUA 4GGPA 4OXIA 1IQRA 5AJUA 1QDUA 1W9MA 3KOWA 3GT3A 3C7CB 3IQDB 4AYWA 3IKLA 1YRAA 5CK4A 3B9PA 4MV5A 3A1VA 2Q3HA 1IAVA 2ZKIA 1P2GA 2JVIA 3H9EO 3N5KA 3PC6A 2CLEB 2WFMA 2MIIA 2WF8A 3IP8A 3NM5A 4KGZA 2CJYA 3HK2A 4N18A 1X1RA 1OBOA 1REQB 2BHTA 2WKWA 1A1VA 4K05A 1RKXA 3FFWA 3ICQB 3N0TA 4MVJP 1C7FA 2ZQZA 1NBMD 4K9NA 5KWJA 1CB7A 1WPGA 2PZKA 2VH5R 2WSMA 5A9TA 1R16A 4DSNA 4AJLA 3COSA 3AHFA 4FDUA 4GKVA 4EG4A 4LY9A 1EG2A 1V1MB 3AKDA 4QEZA 4F04A 3W9BA 5DNVA 4EPTA 5B7NA 2IYSA 5IBCA 3QVGA 1SO8A 4URHA 2FN7A 1U6JA 2I6FA 1U2PA 1XD2B 4JLNA 4MVXA 4R2LA 3RRXA 3UGTA 3OQOA 4GT1A 4Y30A 4KO1S 4OXNA 3WK5A 3DR5A 3GJSA 5C8VA 4GOJA 2R2AA 3GZTB 1I6WA 5TMDA 5FQNA 4Q7KA 5ALTA 4CMEC 2OORA 1Z4NA 1XWFA 5SY9A 2I9KA 2GO7A 1L9XA 3VM6A 1DBQA 2IUTA 4UUPA 4BEBA 4ZJUA 1RYHA 2BTEA 1A96A 5C1BA 4QGBA 1SPBS 1BWRA 4NH0A 3JASA 3BXOA 1KE2A 2PRZA 3I8OA 4ZHQA 3RODA 1G4AE 1KFKB 3KKEA 4CI0B 3RJ5A 3LIIA 4H0CA 1RR6A 2VYNA 2VK1A 2PA3A 1U0RA 3QLTA 4RZQA 3CU5A 3RADC 2YV4A 2XXAA 4FS8A 4OJKA 1UJ5A 1G2OA 1FYDA 3GWGA 2IXFA 4FYMA 4Z0HO 1JQEA 1CY7A 5FJJA 4ZYLA 2XTMA 1HYBA 4U7HA 5TPWA 1PK8A 4UUAA 1P4HA 2E0IA 3I9V1 4ND7A 1XP8A 3TLXA 3SY8A 1H5UA 2I76A 3JYHA 2J3DA 1GUBA 3N8GA 2LTAA 1OBVA 2XVYA 4CYMA 1A9QA 3W3ZB 2V54A 4IOJA 3GMSA 4G8BA 2GFQA 4IDHA 3O2SB 4QUAA 2C7OA 1YTUA 4QOSA 5TARA 3WJ1A 4AUEA 2O54A 3WIDA 3PHLA 4G24A 5AVZA 1G3MA 4FFBB 5AIBA 2GBIA 5MDHA 1Q0QA 2WMOB 2HHAA 4UU1A 4Q9NA 5EJGA 2NVWA 2XE8A 1JEJA 2P6MA 4L5YA 4F5EA 4YAUA 5JWRA 2WDZA 3W04A 3HXTA 3RB8A 4TL9A 1SKBA 1AK1A 1LBTA 1BU5A 1O4VA 2GFIA 1RCFA 2B20A 4C7VA 4DC1A 3WGZA 5AUQA 4MWCA 2B1GA 4QODA 1X94A 2WAYA 2OAP1 4LZZA 4RMIA 2ZYRA 1XNJA 3GIDA 1NBME 4V0NA 3U39A 3U7QB 5DMXA 3T3GA 2W2PA 4NFHA 5IVPA 3AVUA 4HNGA 4Y6SA 3OX2A 4B3CA 2HBZA 4HY3A 4DLBA 1S2NA 1GFWA 3F8TA 4I1RA 2QUHA 3NGXA 1CDEA 3ONDA 2P41A 4AI6A 3O95A 3RBVA 1YZTA 2Y2UA 4EZEA 1VCHA 3CX7A 1ZKMA 1BIFA 3KZ1E 2IYRA 2HRCA 3LUCA 3C6MA 4NONA 4D6PA 3Q6NA 4ERXA 5C1PA 1E99A 2FE4A 4HVLA 3B1VA 4HX5A 3A26A 5A5VA 4BFSA 5LXTF 3IXQA 2HPHA 2Q62A 3ZDQA 5DM0A 2G88A 1BHJA 3TOVA 2HA5A 2ZBRA 4HGNA 4FB4A 1EWYA 5JSQA 5JSYA 1YJXA 4W4TA 2XOXA 2IWHA 4C04A 5JJ5A 4A2PA 5A3QA 3VKUA 4IF4A 1ADCA 2JRCA 2VJNA 4PZLA 5IC4A 3HY6A 2AFRA 3MOIA 3DE5X 1PKEA 3U81A 4GVXA 5LQCA 2C31A 1MQAA 1Y63A 3RK0A 5BNIA 1W52X 2AW5A 3GBVA 4PSUA 5HRAA 1HYQA 1RABA 2QJFA 1C7ZA 1WVGA 1RTTA 3DBHA 1UBGA 3OIGA 4UUOA 1AK9A 3GCZA 1HXHA 2VJMB 2F1KA 3PC8C 4IWYA 1DIRA 1SVWA 1AC5A 1NF2A 1DAEA 3FNEA 2YXDA 5F9FA 1O96A 2J0UB 3AWIA 3H2SA 4N0EA 1R0BA 2OQRA 2ZUDA 5LZ7A 5EPEA 1HFKA 4MKXA 4D9CA 3RUFA 1JZTA 4MEAA 5IYZB 1QPZA 3VYWA 1F5SA 1X1EA 2FFJA 1WZNA 1R3DA 2BRUC 2H63A 1COWD 1QG2A 1Q11A 2A0XA 3LC2O 2ZJ7A 2ZSIA 3LQ2A 2HA2A 4IWXA 5EXTA 4DVJA 2WVGA 1NA5A 1WB4A 2ZYUX 3MILA 5CDYA 1NNUA 5E4YA 1XU4A 3NBKA 4MR9A 4RH3A 3F7MA 2VG8A 1JG4A 3TW0A 5JZVA 5FPYA 4CW7A 2YHBA 2QTVB 3J81k 2IHJA 4ML3A 4NK5A 1C5KA 1NXWA 2FSIA 3MQ4A 4Z2AA 1QUEA 1E59A 1WHTB 1OY1A 4LZPA 5ERXA 4BU0A 2JLSA 1NMSA 4Z7QB 2BM8A 3SBOA 3KB1A 2JGDA 5CVJA 3SF8B 5J3JA 3W1EA 3WSVA 1WAMA 2R4QA 1FDTA 3GUZA 4DXHA 1CS0A 4QOIA 2VAWA 1IE3A 3MWDB 1LTQA 2XECA 1EE2A 1P7VA 2FDXA 2PVCA 4AURA 2QM3A 2QVGA 3BK7A 3KUDA 3W34A 2HJVA 1U3WA 1G3IA 1AURA 3N2NA 4KXQA 4MP8A 4ZAGA 5BSMA 3GLIA 4G2TA 3CRZA 5E8RA 3EGOA 1EVZA 1MRSA 2YYZA 3S2ZA 1ID8A 2NSLA 4IV8A 4TSRA 3L41A 2PNFA 3Q0TA 4WXYB 1YBFA 2P62A 2VNAA 2YHSA 3E5RA 2X3FA 1IBLB 4RH0A 1YT5A 2LR0A 3OJOA 2QZZA 4HQOA 2KS6A 5BRNA 2V97A 5C32A 4IYJA 2IPLA 1YR8A 4AX4A 2UXDB 1R4NA 4FW8A 2MSCB 4Y6OA 5CNKA 4BP3A 2Q46A 4R8MA 4YLEA 4KSCA 1AZTA 4ZZ3A 1IL0A 1YB5A 1WOMA 2FCRA 2PBLA 2BIFA 5FWYB 1YUMA 3D3JA 5BYKA 2RE8A 3ZGVA 2OZVA 2XT0A 2B35A 3QLEA 4MRPA 2X2OA 4L4RA 3QMVA 5A3RA 1P6XA 4XPZA 2UYCA 1IK6A 1U9JA 1B6GA 2DR0A 1ZR4A 2GEUA 3BZWA 1DXQA 1ODIA 4IH1A 1EFAA 1FQOA 2O8BA 1TA4A 2ZITA 1CR2A 2QW0X 2Q3EA 3NETA 1J9EA 1R6BX 1U5CA 3GGOA 4M38A 4W8OA 5K6TA 5FYQA 3QH4A 3GLGA 3NC4A 1TKBA 1GRCA 2C4HA 4L8FA 3IUYA 4JJ7A 3BT7A 1JHAA 3K0SA 1KI1A 2P4EA 3WFJA 1N0WA 2YRWA 2HSWA 2ALJA 2GDZA 4LRUA 3T3IA 3VUFA 4Z4IA 2WYHA 2YV5A 1K7SN 1ML4A 1CIVA 2QV0A 5E4JA 3ZVLA 1SZPA 5TGTA 5GZ6A 1Z16A 3BFJA 5TY0A 3LIPA 3FB1A 1VSQA 3HEBA 1GKYA 3CLVA 3IEVA 4CMEA 2XUOA 5BQ5A 2CUKA 3BMXA 1BXZA 3I9JA 1MABA 1QG4A 2VQSA 1Q3HA 2IC5A 4AJ4A 5J2TA 2D62A 2Z43A 4IRXA 2BDTA 4PHGA 5EIAA 2WJAA 2WD7A 1OKKA 1DZIA 1OH5A 1GSAA 1U1EA 1K8YB 4HLDA 3USCS 1GNTA 2Q99A 4J9UE 5K4GA 3O8NA 4B85A 2J5XA 2G76A 1QB7A 3HBLA 2V7UA 4YAKA 2WTXA 3C98A 4QO8A 1OTXA 2A14A 3O75A 3PR3A 2P67A 5LL6P 1E2BA 3PCRB 1S2MA 1UC9A 2X6QA 4MS1B 3STWA 5L7WA 4E09A 1OTYA 2D1RA 1NVWQ 1FP7A 3DP7A 4M0EA 4S3MA 3VQTA 1L3BA 2YXEA 3FKQA 1L5SA 3Q9SA 3OM1A 3LY9A 4FXPA 4Y6PA 1IATA 5TEVA 1KU0A 4U5QA 1IDOA 3FTPA 5JXHA 1YRBA 2CHEA 1PZMA 2AXNA 1G9SA 4PC7A 1FVOA 3TLEA 1UMDB 3SZ3A 1KH1A 1QO9A 2WWTA 3IPYA 4DDHA 3GC6A 3I6IA 4ZI7A 5DI3B 1E3WA 1VJCA 3HMQA 4DCSA 1JXOA 1Z18A 2PLWA 2XOKA 3KQOA 4J7AA 2ZJ1A 2H4HA 4NV1A 5JBIA 2PSSA 2FW9A 4DF3A 4D7AA 2C2YA 1M72A 3OOWA 3F6EX 4XGRA 1H8ED 3ZTYA 4BQFA 2I33A 1OLSA 4M1KA 2I2AA 2A67A 4QWWA 4XE5A 1RJEA 1CV2A 3AF1A 4WZAE 5CVDA 3A4LA 1Q6ZA 2FSFA 4QXPA 3SE7A 3DL7A 2HSZA 3V4PB 1KY2A 3WB9A 1XYGA 3FNFA 2VAPA 3X3HA 2C4TA 2DHEA 2OD7A 1MPXA 1P7YA 2YDYA 3M1AA 4LC0A 3TOCA 1P2VA 3UVEA 1T4CA 4J94A 1M34A 1FEZA 1T5IA 1P81A 3PU6A 3T41A 5HWSA 4Z4HA 1U8AA 2PSEA 2OSBA 1LK7A 3KUKA 3N86A 3NOOA 4H1TA 4QPJC 4AZ0B 2PYZA 3GQBA 1BRTA 4Y1FA 3WLEA 2CE7A 4LGCA 5C52B 1JYEA 4KYTA 1YIOA 2QVXX 2H1CA 4JQOA 2DBZA 3INNA 1ZWKA 2OV1A 3HJNA 1D04A 2XAAA 4TKMA 5DHTA 4EO9A 5BN4A 3LW8A 1Q19A 3MJDA 4DWWA 3R5JA 4BKRA 4HPWA 4I4TF 1UT8A 4CBVA 1MX9A 3PQDA 1NVGA 4OBEA 1G41A 1X39A 2CCJA 4W1PA 5SZHB 1LSUA 3NJ8A 4AN4A 3FCYA 1L6RA 4KI0A 5ESRA 4DLZA 2QLJA 5ETJA 4BO9A 3U61B 2NO5A 3MRTA 4DUZB 3LCMA 3TX6A 2O9JA 2Z8YM 4U2KA 3QV2A 3MAJA 3PPVA 1Y6GA 1CJBA 2B8JA 2PH7A 4L8VA 4IFBA 4MYUA 4JVLA 1XMVA 5KWIA 1NASA 1UDRA 1DPGA 1MO2A 1ULAA 2GYUA 4URFA 4QGHA 4ALKA 3RVQA 2DBVO 4ENWA 2HA6A 2ZUFA 4HLUC 2D1SA 5KYKA 2XSZD 4C1NA 2Z8YA 1CQWA 1G5RA 1TYDE 2HX1A 4ZEXA 4INJA 3C3JA 3EXG2 4PYNA 4A36A 3CXUA 4OPMA 4LF9B 1BQ4A 4KGVA 3ZYZA 3FW1A 3HVJA 2Z9DA 1KJJA 1KYXA 1R5BA 1TAQA 2LKCA 2QJOA 3SKYA 2V8OA 1F1BA 2PLAA 4HFMA 3C15C 2VUIB 5EEGA 3WWZA 4JJKA 1BGVA 2F1HA 1Z83A 2WM2A 1QIHA 3JASB 3KQWA 4KFCA 3OQMA 1SKUA 3MWEA 3Q12A 3IOCA 2OHVA 1RHQA 4ZHQB 2R7LA 5JFTA 5ENVA 1CRLA 2QX8A 3SQLA 1WTCA 5MN6A 4W5NA 1VRVA 4ER0A 3DCYA 3KKNA 1YQTA 1SBHA 2VPPA 3FDJA 4KAFA 4N7JA 4F2GA 1LW6E 4F46A 2W6OA 4O02B 1KIAA 3IE0A 4BFUA 5L4LA 2PGOA 3E7FA 1KL7A 2OQIA 4DLSA 5B7PA 1VC2A 2XAUA 2WJYA 4CQNA 4Z4QA 2HIHA 2OC9A 3AP2A 1Y82A 4LTNA 5TPWB 3MXOA 4CLEA 5KWSA 3ADBA 4CV1A 4QA9A 4K40A 2HF9A 4RPCA 5KQSA 3FY4A 5JTTA 2FP3A 1IZ7A 4N47A 3PXGA 1KPIA 2B37A 5DH9A 5A6VA 1BCRA 4FQ5A 2OG1A 3FUXA 5JWHA 1G0NA 5E7QA 5BN1A 2AFHB 2GXSA 4WK4B 4KK3A 1XCBA 3RKSA 2RG7A 1YA4A 3EMVA 5C7YA 4C2BA 4KQEA 1KYYA 1W5EA 3AIKA 1P44A 1DEHA 5ALMA 5KIAA 4MB2A 1E5TA 1FYFA 1UKCA 1W4ZA 2EAUA 3F2VA 4DNPA 2V9CA 4MW4A 3P27A 2ZJ5A 3AU9A 3MGGA 5D3QA 4AJOA 1GPAA 1XDSA 3IVRA 3AM5A 2G70A 3TLGA 1GCOA 4PBRA 2IH2A 4RO0A 3DS8A 4J91A 3PDUA 4DTCA 3L0BA 4XARA 3ZDYB 4MZXA 1V41E 2H2AA 2DERA 3CEHA 1RZRD 2OBNA 4DEXA 1Q44A 1QOPB 1P1CA 3PF8A 4P83A 4KVGA 4BUZA 4RY0A 2ZYHA 4LNAA 4WXPA 3FWPA 3KEOA 2VDOB 3PZRA 5FWDA 4X1IB 1E1LA 4BO7A 2PKEA 3N7AA 2C0CA 4A2WA 1V16A 3GOQA 2PR2A 4YRDA 1P31A 5E6SA 3OLVA 5EY5B 1WA5A 1QRSA 4G5HA 2D0IA 2WIGA 1YDGA 3BRCA 1PSWA 5HDBB 5IK2A 3IE2A 1IBSA 4LKRA 4CU2A 2HJGA 4F4HA 1EBUA 3LPNA 2G7ZA 2GJ8A 3E5NA 3FUWA 4OI4A 3QWFA 2GN9A 3EVCA 2A2ZA 5EXPA 4GZ3A 1F2VA 1UCFA 3GROA 4N3CA 4DW8A 2O48X 4H1HA 3QQ5A 1Z6ZA 2IP2A 4D25A 1QYVA 2XJ9A 2Q21A 3IXMA 3FF4A 1QO7A 4PLZA 4UUQA 3DG9A 3SIRA 1E8NA 4TXLA 2H1VA 5FORA 5DO9A 2EP8A 4U2GA 5EWMB 1JTFA 1JKJA 1AB5A 3DBHB 1JQAA 4PLHA 1C7RA 1V5GA 3C3MA 2C8JA 2W9XA 3H2IA 1P8JA 3OZAA 4I50F 3V4FA 4DCPA 4EKEA 2WFLA 1WD5A 1Z2PX 3E0QA 4NV0A 2IQIA 5DWQA 5EVCA 3GEEA 1JGTA 1XQ9A 1U90A 3HA2A 3JWGA 4QG7A 4LJAA 1Y4AE 5EZ5A 1Z26A 5HE9A 3ZV7A 1E61A 2IYEA 4BJHB 1TUIA 3VR0A 3ZE8A 2DAPA 3I9FA 3U3JA 1YOVA 1PJAA 1YUBA 2QAJA 3K4QA 3QWHA 1HYHA 4HDNA 4L4SA 4E5VA 4LRWA 1YONA 4CTJA 4Z4FA 5KMGA 4MYHA 1R66A 2ZRCA 3PE4A 2ES4A 3CRRA 3H1EA 3NOXA 1IZYA 5GQSA 1FXWA 3GFRA 1QKJA 4Q1DA 1SEVA 2I2XB 2OBLA 3E9QA 1YFJA 4MR9B 3ETEA 3QX7A 1V37A 1I1OA 3A4NA 3HI4A 5I7OA 5KNDA 2NYUA 4H3KB 1ESDA 3O1IC 4RHCA 1WABA 9LDBA 3LWBA 1L8LA 2WICA 1NF3A 5LSAA 1ZOOA 4NC9A 1RJ9A 1FQKA 1J2UA 3S7ZA 3DCNA 5EE0A 3UOGA 3BYZA 4J4BA 4DPMA 5KQPA 1HDGO 5DLYA 2JGDB 3D5EA 721PA 4C43A 3HXOA 1Y89A 2CLOB 3DT8A 5JEDA 1HDRA 1GQQA 1DCMA 2ZUWA 3IPCA 3LY7A 3AKYA 3DPSA 3RUAA 2JFXA 3ORRA 4W9MC 1IWBB 3EZGA 4U63A 2JH8A 3C6YA 2IYYA 2VP9A 4G56A 4M99A 4N41A 5FOWA 2CK3A 3VYTB 4OP2A 2JJYA 4K0KB 4QT4A 4D80A 4RTOA 1HEUA 2O7VA 2GLUA 2W6PA 4KW7A 3GHHA 2VNHA 3PFNA 4MARA 1E9DA 3KFVA 4HTFA 4NZNA 5F64A 4HNVA 1ZVMA 5HK9A 2CGEA 4UU7A 5FB3A 3U0BA 3OH8A 3I8XA 1HFWA 2I1QA 2IY8A 2B98A 2JZCA 1XZGA 3DYVA 3EDMA 3FHJA 3PWTA 1R4NB 4HPXB 3GJTA 1X42A 1A5SB 1OUMA 2EP5A 4LOAA 3SS8A 3MOGA 3U4IA 2OHFA 3TJZA 4BLOA 2BP7A 1H0HA 1YI8A 4BS9A 1ESEA 1KI7A 2VYCA 4CWAA 4OOEA 4UOZA 3D54D 3BGOS 1USUA 3GGPA 4E88A 2FHSA 4RVFA 3BXHA 2BUCA 2GUGA 2PJZA 4N39A 3WI7A 1ECJA 3FR7A 3VTZA 4CI9A 2B3TA 2PKYX 3EWIA 5CT5A 1JV2B 3OPXA 2ZJ3A 4NICA 5A7HA 3SHQA 3EXG1 3WHLA 2AI1A 4AECA 4WBNF 3LRPA 2O8BB 3TI7A 4B7CA 5KTYA 3Q3VA 4TMXA 3TFQA 1O3YA 3P7MA 1XAIA 2NT4A <