3R40A

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
291
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 112
structure length 291
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r40A00
1CUGA 2X8BA 2XMGA 3BE8A 3H2KA 4F0JA 4F21A 2GZSA 4GLBA 1D07A 4BYMA 2WHQA 5AIAA 4Z49A 1UWCA 4OYYA 4WJLA 1F6WA 5EHXA 4PSCA 3OURA 1GKLA 1R9MA 1ZI8A 3UUEA 1S8OA 2GBIA 3DKRA 1MT3A 2R11A 1KU6A 3WK9A 2Z5GA 5LZ5A 5FUMA 1QIFA 2ORYA 1HQDA 3GELA 3WZLA 3EBLA 4YASA 2OPHA 2C5FA 5LIPA 1QJ4A 4HXEB 1L7QA 3BF8A 4MWSA 2B20A 3H19A 5JALA 4OUKX 5K3FB 3DOIA 4C87A 5DTIA 2RI6A 3QH4A 1GQRA 2QS9A 5EHNA 1VE7A 1SC9A 2WHRA 1MX9A 3LCRA 4PNZA 4U2FA 3V1LA 1CUZA 2VAXA 3E0XA 5CH5A 3ZLUA 2FUKA 2JGFA 4HTAA 4XIIA 4LXIA 5K3FA 2Z3WA 4PF1A 5ALWA 5JIBA 2WFZA 4FLMA 4W1PA 2WJ6A 3OPMA 1JKMA 2WHPB 3WK5A 2D5LA 5DNVA 1M33A 4OSEA 5HF8A 4H7IA 1YR2A 2V97A 4W63A 5JATA 5AM3A 5HF9A 2WG2A 3EQ9A 1ETHA 1R9NA 1JFRA 3G8YA 1VZ2A 3BDIA 1C4XA 1ZGBA 1W76A 5FRDA 3Q8WA 3QM1A 1FFEA 3STTA 3O4HA 4KACA 5CT8A 2WHPA 4P9NA 1WB5A 2OGZA 4B9EA 1CVLA 2PX6A 1FFAA 4LYDA 4EB0A 1HLGA 2V96A 5FV4A 4UHDA 5C81A 3TEJA 3N0TA 3WL6A 4B81A 4Q82A 4H7KA 1ODSA 2DHEA 2OAEA 2HU7A 2XMDA 3SC2A 4WY8A 4U2CA 1K8QA 5AKZA 3ESCA 2OCLA 3CCCA 2WUEA 2G5TA 5EHZA 5LLSA 3IVMA 2C4HA 2JGMA 1BN6A 3AINA 4UFPA 1ODCA 2C58A 2XUAA 1CPYA 4BVKA 3WI7A 2Y1KA 1E3QA 4BCDA 4H7JA 4RPCA 2BUBA 4DNFA 2PSJA 4FLEA 4WCVA 3PF8A 4KAFA 3BXPA 2QUBA 2HIHA 3AZOA 3FOBA 1MX1A 4B0PA 4BP8A 4S0XA 3IUNA 5ALPA 1ZJ5A 4KR0A 2PSFA 1LBTA 1UKAA 4J7AA 3WL5A 4MYDA 1WPRA 1RWQA 1QIKA 1BCRA 2BGRA 5JD5A 1GPLA 4JNCA 4FTWA 2OCIA 1H2WA 1WCYA 3O0DA 4JUIA 2QTBA 5E4TA 4WFIA 5ALNA 5IH7A 5CH3A 1EXWA 2QT9A 3C43A 1MNQA 3BJRA 1EDDA 2J3DA 3N2ZB 4E46A 1F8UA 3O4JA 1CR6A 3C6XA 2CUTA 3FSGA 5ALFA 1CUUA 4Q3LA 2HA3A 3I6ZA 3PI6A 1CQWA 2WIFA 5HKBA 1NX9A 5K5EA 3A6ZA 1YAJA 2WKWA 5E2IA 4QA9A 3QVMA 5I9IA 4GW3A 1TAHA 4H35A 2XQGA 2ZYIA 1EINA 4BBZA 1XZMA 4X95A 1CUFA 3G0GA 4X6UA 2QUAA 3IURA 1XZEA 4E15A 1GPKA 1P0QA 2GBCA 2WM2A 4GDMA 1U8EA 3D0KA 1TQHA 1ZICA 5AM5A 5CXUA 1DT5A 3WWOA 2OQIA 1QZ3A 1YS2X 4FMPA 4EY8A 3KXPA 4EY7A 3HRHA 1ZI9A 3D4LA 3FLAA 3WK7A 2JEZA 1CEXA 1AURA 3CN9A 2V98A 2WFLB 5AKGA 2H1IA 1BROA 3VJMA 5FPPA 5T4FA 3H2JA 3WKEA 5LZ8A 1Q83A 2WJ3A 3E3AA 2XQIA 2VAVA 3H1AA 3ESAA 3RLIA 1MX5A 4CG3A 3WIBA 4A5SA 3R3XA 3DS8A 5AKHA 1CUYA 3EQ8A 1BU8A 2XMQA 3M3DA 4ZV7A 2CKMA 4DNQA 2R8BA 3H1BA 3DLTA 3DL7A 4X00A 3C5VA 2UZ0A 2ZVDA 2WIJA 1XZKA 3M82A 1EVQA 4BCBA 1SCQA 5H3HA 2VA9A 1QONA 3HXKA 4KE9A 1ZOIA 4K2AA 3G0BA 5FP0A 4PQEA 1QTIA 3OTQA 1LPMA 4O08A 1XLVA 5A6VA 5KWJA 3I2JA 4G4GA 1EX9A 1KU0A 4IO0A 5I7UA 4F60A 5AI5A 5ALEA 4DLNA 5FLKA 2O7RA 3G7NA 4K5QA 4MWTA 2AXEA 3R0VA 4X3CA 4TGLA 4UHEA 4INZA 1I6WA 3WLAA 2J4FA 2O7VA 3I6MA 4HAIA 1HDEA 5AK4A 3WYNA 1W75A 5JAOA 3ED1A 5IVIA 3QMWA 5DYTA 1U4NA 4OB7A 4EHBA 5ISMA 4FBLA 3W9BA 5A71A 2CBGA 1QIGA 5FOQA 4HZGA 3C6ZA 5A2GA 3B3QA 4C4XA 4B80A 2C7BA 4P08A 1UOQA 2OXEA 5IVKA 1QGED 4V2IA 2VATA 1QIDA 1AGYA 3EIOA 2PSDA 1Z68A 3AFIA 2FX5A 5K3AA 1XZBA 4M0MA 1EH5A 1QTRA 2DFPA 1NU6A 2WIGA 4B6GA 5ALHA 2QZPA 3C87A 1A7UA 1VJ5A 3I1YA 2EDCA 3IUMA 1XZDA 3FYUB 2XMSA 4BVLA 3A2MA 4LXHA 1E8NA 2OQVA 3BDVA 3GFFA 1B6GA 5BOVA 3DYIA 5ALRA 1BE0A 3WK4A 1AMNA 1GT6A 1N1MA 1X70A 3G9ZA 1Y37A 3STUA 1XZLA 2WTNA 4PO3X 5AK5A 4DMCA 3C5WP 5HK8A 1MO2A 1XQVA 3FYUA 5AKJA 3F9CA 3VVMA 1IUOA 1MTZA 4ZGBA 3DYVA 5ALYA 4Q1VA 2HHAA 4N8EA 4J0HA 5CBKA 2JEYA 2C0QA 3F97A 2OG1A 1XLUA 4K6HA 4KRYA 1DTEA 3D7RA 4BDTA 3H2IA 2HA5A 5FPQA 5ALDA 4YPVA 4H7EA 1W52X 5CTAA 4OPMA 1CUEA 2HL6A 5AKIA 3PFCA 1XQWA 2E3JA 2HFKA 4G9EA 5HQ3B 1VA4A 1PJAA 5D3ZA 5SYNA 1K63A 3G0DA 3GUUA 4BC1A 1DWQA 4IH1A 4W1QA 3LP5A 3WJ2A 2ZJFA 2G4LA 5D6OA 3W05A 5DNWA 1IUPA 1SCIA 4WFKA 2OAGA 5CT5A 4X93A 1XQYA 2I3DA 3ZWQA 1SFRA 4CCYB 3D2BA 5KWIA 3HABA 2BGNA 2QOEA 4FFWA 5AHXA 4F5ZA 3PF9A 3RM3A 1UK7A 1LPNA 3FYUC 3W2TA 3D2CA 3KOOA 1UKBA 5HQ3A 4FKBA 2DHCA 3FCYA 4X7BA 3WKAA 3WK6A 2Y6VA 3CN7A 2QVBA 4BCCA 2IITA 4BRZA 5E4YA 5C8XA 2AJBA 5ALJA 3T52A 1XKTA 1QIMA 5BV7A 2PL5A 1R50A 2PSHA 2GYWA 2XMCA 4G8CA 1CFJA 4J0DA 3QMMA 1DQZA 1XRMA 3KWFA 3WKBA 1THTA 2IIVA 5AK3A 1CUAA 4RGYA 2G5PA 1P0MA 3UUFA 1C7IA 3OM8A 1TRHA 5K3CA 3C6YA 3D2AA 4X85A 3W06A 4HXFB 4GI1A 4B0OA 1ZD5A 4WFJA 4H77A 2FJ0A 4Y2TA 4EA6A 2ZYHA 4FNGA 1ZJ4A 4N5HX 3BIWA 1K5PA 1IZ7A 2XQFA 4X90A 4DMFA 4UBJA 4BATA 1LNSA 2JF0A 2WJ4A 2WG1A 4U2DA 3FNBA 3IB3A 1Y7HA 1EK1A 1EHYA 5AOCA 4IH4A 5JZSA 5EIAA 1K4YA 2YXPX 1JJBA 3FCXA 1J1IA 2RHTA 2PU7A 1G4HA 1CUCA 2HU8A 3H2GA 5A62A 4L0CA 2BCEA 2YH2A 1J06A 3OOSA 1W6RA 1DINA 1VXRA 4B83A 4UUQA 1O6GA 1GXSA 1XZHA 3D5EA 4C4ZA 3C70A 2QXUA 4QLOA 5AKXA 4EBBA 2HRQA 4B84A 4X6YA 1N8SA 5A7GA 3JW8A 4GEGA 4UHFA 5AO9A 2YYSA 3R41A 1XKLA 4J3JA 4DSAA 3QBJA 5EI5A 4X97A 3C8DA 2WQZA 4WDRA 5LKRA 2Y2UA 2ZYRA 1XQXA 3ZLTA 1Y7IA 3WKDA 1CUVA 3BF7A 2AJ8A 2ECFA 4AZ3A 5JAPA 1USWA 2ONCA 1XRLA 2RGUA 5C8ZA 1XROA 1BCSA 3STVA 1N5MA 3WK8A 1CUWA 3F98A 3VJKA 3B12A 3ESBA 4QDXA 1U65A 3LIPA 1JJIA 1J07A 2OGSA 3MUOA 1VOTA 1IMJA 7YASA 1YCDA 1SOMA 4NS4A 1AX9A 4G8BA 1MJ5A 1DX4A 1MNAA 4UBMA 3IIIA 5CURA 4M0EA 2Y2VA 4Y2UA 4EY5A 1ZIXA 5HKAA 4AB1A 3LLCA 1JMYA 3ZPXA 3TRDA 3G02A 5D3KA 2PKYX 4AN0A 4DNOA 3KDAA 2PUHA 1RYYA 3I28A 4QWWA 3WIOA 3X3HA 2VJDA 2J4CA 5K3EA 3LIIA 5FXMA 4KAJA 4Y2XA 3HJUA 5AICA 1WB6A 3R3ZA 2EDAA 4PV7A 2B9VA 2JIDA 1QOZA 2IX9A 4W1SA 2W6CX 4G4JA 1P0IA 4H7HA 1EI9A 3MVEA 3SX4A 3R3VA 3PE6A 1QIIA 4BTVA 2ZYSA 3FLBA 5CT9A 5HFAA 2DHDA 5CH8A 1HPLA 4MEBA 2PPLA 1TIBA 4ZWNA 4ZREA 2XUKA 4BZWA 4EUSA 1FJ2A 1LPSA 3H18A 3DJYA 4MXDA 3HEAA 3AIOA 5ALOA 2XUGA 3GROA 4Y2JA 3G0IA 4LHEA 1ZD3A 4UBOA 1LPAB 2HA6A 1CUJA 3VDXA 1IUNA 1HKHA 1AZWA 5ALLA 3NOXA 4Y2PA 1BN7A 3HC7A 2XB6A 4OU5A 1AKNA 2VSQA 2DQYA 3G0CA 3CXUA 4JYMA 1E8MA 5DWDA 1H2ZA 3DDUA 4L9AA 2VT7A 2QRUA 3STWA 1AUOA 1EA5A 1GQSA 2HM7A 3HZOA 5E4JA 3C8HA 5AH0A 1JJFA 5JARA 1WOMA 3WWDA 5I8PA 3U0VA 2CMFA 3O95A 3L1JA 3IUJA 1E8DA 4HRXA 5CT4A 3TJMA 1HL7A 4KE8A 1QIJA 1PFQA 4RE5A 3F67A 3FVTA 3VKFA 2XUDA 4AZ0A 3C6BA 3HSSA 2H7XA 5LZ9A 4LIPD 5FKJA 2XI4A 1EVEA 3T4UA 4NMWA 4LKOA 3NUZA 2WFLA 3JWEA 4UBIA 3WA6A 2XQKA 2P8SA 3V1NA 3E4DA 2RIPA 5CXXA 2VJBA 1IZ8A 4Y9SA 3RKSA 3ZV7A 3AZQA 3RARA 4Y2VA 4W1RA 6YASA 4RE6A 5AK6A 1A8SA 2WUDA 1ODTC 1LZKA 1ZD2P 2WU4A 5CW2A 4Q3KA 2XMZA 2G63A 3R3YA 3WMRA 2VT6A 3FAKA 4J0KA 5HZGA 2JGJA 2B61A 3WWEA 5AI4A 4KAAA 1R1DA 5DLPA 1B41A 2HADA 4BVJA 5HCUA 5AOAA 1JU3A 3U1TA 2OCGA 5T4EA 3CCBA 1CUIA 4XVCA 1CRLA 3G9TA 1GKKA 2XLBA 4WDQA 5IVDA 2I3ZA 1YSCA 4C01A 3PDCA 1BEEA 2W22A 4JYPA 4C89A 5LZ7A 1Q0ZA 1Q0RA 1YB6A 2WUFA 2PUJA 5BWBA 5EIEA 5LZ2A 4BRSA 5CMLA 1XZGA 4L72A 3I2FA 1XRRA 3QYJA 4QDTA 4C4YA 3ZLVA 2VQ6A 4OD0A 4Q3OA 1TK3A 4UHCA 3JYHA 3K9BA 1CUDA 4HRYA 2VJAA 4ETWA 1FFDA 2DSNA 1RP1A 3STYA 3QITA 4QNNA 5ALSA 2CZQA 1W1IA 5AKKA 3EQ7A 1JT2A 4E14A 1VLQA 5AM0A 4K6KA 5C7YA 5JD6A 3WL8A 4PW0A 1AQLA 1QIEA 2H9YA 1CQZA 1VXOA 5AIBA 1W4LA 1KEZA 5EFZA 3IULA 4AO8A 4G4IA 3UMJA 3MUNA 3Q0TA 3I2GA 3HYSA 2HA7A 4CCWA 4K6GA 1WPXA 3A2LA 5F4ZA 2GYVA 2Z3ZA 1K6EA 1G66A 2ACKA 3TGLA 3STXA 1O6FA 4QE3A 2LIPA 1MAHA 3EF3A 5JZBA 1T2NA 3M83A 4I4CA 3H0CA 4H18A 2JGKA 3DOHA 1WM1A 5AM2A 4QWMA 2ROQA 4U2BA 3V48A 2XUIA 4PSDA 1ZGCA 5LZ4A 4CIBA 1XRNA 4XWGA 4RNCA 2GZRA 4OB6A 1XZCA 1DT3A 3KD2A 1A88A 3S2ZA 4N5IX 1AC5A 2O2HA 4GECA 1DX6A 4BP9A 4Y2YA 4WY5A 4KEAA 4ARBA 2ZJ6A 2BUCA 1A8UA 2BFNA 5J3JA 4AO7A 1TCCA 4A16A 4N8SA 3R3WA 3NGMA 4QDZA 4Y2SA 1YAHA 2FJPA 4FOLA 1ZIYA 1VA5A 2PSEA 4BTLA 4M0FA 5T4BA 4P92A 1CUXA 2K2QB 2H7YA 4C88A 4I3FA 4BZZA 1UK9A 3AILA 3YASA 3WKCA 3QPCA 3O4IA 2OLEA 3AJAA 2QXTA 2QMQA 1CUSA 1TCAA 5AJHA 4EY6A 4JH0A 4DMHA 4CCYA 1F0PA 3A70A 4BDSA 3I2HA 1ISPA 1LPBB 5IKXA 4FBMA 4UBNA 1BRTA 2J3QA 4OB8A 2XQJA 4AQDA 3DL4A 3BIXA 4BAZA 3SK0A 1WHTA 2BKLA 4AX4A 3R40A 5AKLA 5EIHA 1YA4A 2VEOA 3BWXA 2OCKA 4ZXFA 4X94A 2CJPA 5ALMA 3W9UA 3K6KA 4X6XA 1XZIA 3GBSA 4IHAA 4Q34A 2OGTA 1WHSA 1N5RA 4CFSA 3QPDA 1LPPA 1L7RA 1LBSA 2QR5A 2XUJA 3F8SA 4N8DA 1H2YA 1R3DA 3AUKA 1OXMA 5ALKA 4CG1A 4UFNA 2I03A 1MPXA 2BUAA 3WWPA 5AI6A 4ITVA 2XT0A 4MJ3A 4GXNA 4QEKA 3RK4A 3S8YA 4UFOA 1LPOA 1GZ7A 5CT6A 5BWCA 3AZPA 4IQ4A 4TVKA 4MQMA 1CV2A 1GPNA 4EY4A 4PSUA 1DWPA 5DJ5A 3VISA 4BB0A 1HBJA 4J0IA 1UZAA 2XUFA 2QM0A 1QO7A 3D3NA 2RHWA 1FFCA 3C45A 4OU4A 3ILSA 5AI8A 4QZVA 5AM4A 4E11A 2WIKA 2PVSA 2I78A 4UHBA 4BAGA 1ORVA 2BAGA 1UOOA 3VVLA 5JD4A 3WA7A 5SYMA 4D9JA 5AM1A 5JAUA 4EZIA 2ZSHA 4X92A 5JAHA 4GWLA 3ANSA 2Q0XA 2WUGA 3OC0A 3LS2A 1YS1X 3QZUA 5K3BA 5LKAA 1E5TA 5AOBA 2XUPA 1L7AA 1QE3A 5ALTA 2ACEA 4B7ZA 1QIHA 3I6YA 4UBLA 3I1IA 3ZI7A 2QJWA 3OG9A 3MGAA 3AIMA 4MEAA 1VE6A 1EK2A 3D59A 3FLEA 1MN6A 2XUQA 4OCZA 3H17A 1XLWA 1LLFA 4LYEA 5ALUA 3O4GA 3DD5A 3H2HA 5K3DA 5IVHA 2O2GA 4B82A 1LZLA 3IUQA 3IBTA 5A7FA 1YASA 3V1KA 4KE6A 1DQYA 4KE7A 3P2MA 1XZFA 2CEKA 4ZV9A 4XX1A 1CUBA 1T4MA 5DYYA 4AXBA 3IDAA 1J2EA 1H23A 3V9AA 2O2IA 3F96A 4AMZA 2QJRA 4HXGA 3W04A 3QPAA 1X2BA 1UXOA 4AO6A 5AKYA 4AN1A 2VJCA 4KRXA 1OCEA 5HFNA 4W9RA 3FBWA 5JADA 2XE4A 4G9GA 5HF5A 4CIAA 3SWWA 5JASA 4NZZA 3VJLA 3DCNA 4C6HA 4HS9A 4KJXA 1JI3A 4DTCA 2PU5A 4MQLA 1YA8A 5ALZA 4J03A 2JGEA 5ALVA 4KYVA 2B4KA 2JGIA 4Y7DA 5KBYA 2C0PA 2XLCA 3GZJA 1QO9A 3VXKA 3WQHA 2HDWA 2X5XA 1Q84A 5AI0A 5T4HA 5JANA 1SCKA 2XMBA 3H04A 3ESDA 5AI9A 5LP1A 3DKKA 2AJDA 3FYTA 1R88A 4Y2QA 5D7BA 1GGVA 4YX9A 2HA0A 2AJCA 3O9MA 4Y2RA 2AJLI 2Z8ZA 4G5XA 3AIKA 3E1GA 3G9XA 1UK6A 2D0DA 4H7DA 1E89A 3WL7A 3NWOA 4J0JA 2WIDA 2HRRA 4TPKA 5KREA 1F0NA 1ZD4A 5ALQA 5YASA 2GBGA 1UFOA 2WLSA 2RONA 1UK8A 1X2EA 4J0CA 4B85A 2CB9A 5AP9A 4DM7A 1TKRA 3BL8A 4DNPA 4MYSA 3FSGD 3R3UA 1R4ZA 1QFMA 1BS9A 4J0GA 2PM8A 2WSLA 2WTMA 2GBFA 1CUHA 5C8VA 5ESRA 1MAAA 2HA2A 4XJVA 1NU8A 5LYYA 4NVRA 5AKEA 3B5EA 3GA7A 4HVTA 3DQZA 4BE4A 3M81A 2X76A 2HU5A 2XUOA 4ARAA 4H7FA 4X71A 3KWJA 4QDOA 5ALGA 4BE9A 3WYDA 2JBWA 3FVRA 2PBLA 1BEZA 4GBGA 4FDMA 4U2EA 3IA2A 3PUHA 1XZAA 4DYHA 3L1HA 3DEAA 2YASA 4L3WA 1IVYA 4U2GA 2Z8XA 3PFBA 1XFDA 1DWOA 4Q05A 5FDFA 1G5FA 5ALXA 3G9UA 1VZ3A 5DYWA 1QFSA 4A23A 1EDEA 1OILA 3PUIA 2WFMA 3K2IA 4FHZA 3WWCA 4CG2A 2H7CA 4YK7A 1FSSA 4FWBA 2ZJ7A 1DU4A 3HLKA 3WJ1A 2WILA 5JZ9A 1VKHA 2NW6A 4DMKA 4ROTA 5CRIA 1EB8A 2ES4A 2DCMA 4DGQA 1ORWA 1H22A 4ZI5A 4UBKA 1ACJA 1YB7A 1TCBA 2DR0A 3I2KA 2QKYA 3HACA 2XMRA 1EDBA 2VTVA 1U2EA 5DTJA 4BC0A 1LGYA 4AMYA 1QLWA 3O9VA 5A7HA 1G42A 4QDUA 1WB4A 4ZRDA 2HA4A 4CI9A 3DNMA 1A8QA 4P93A 5DNUA 1XRQA 4QLAA 2RAUA 1UOPA 1THGA 2HFJA 2XDWA 4UPDA 3WZMA 3HI4A 2XUHA 4G1FA 4B9AA 1ACLA 2ZSIA 1XZJA 4DIUA 1ZI6A 4DSZA 5ALIA 3BJMA 4G8DA 1H2XA 4FLFA 3KSRA 4OYLA 2DQZA 3PICA 4GHWA 5EHQA 2V9ZA 1P0PA 3I2IA 4H0CA 1CIJA 2WU3A 3QMVA 5HF6A 3A2NA 4JEIA 4IH9A 4I19A 3L1IA 1UKCA 1UT6A 2BJHA 5HK9A 1C7JA 1E66A 2EEPA 1JMKC 1FFBA 4FFVA 4X91A 3ICVA 1PV1A 5EGNA 2Y6UA 2WG0A 2C5GA 1MU0A 1JU4A 3V1MA 4BAUA 4LXGA 3FWHA 3ICWA 3ANTA 5JYCA 4FNMA 2GYUA 4UHHA 1XRPA 2VF2A 2JGLA 1CLEA 1EB9A
chains in the Genus database with same CATH superfamily
3RYFA 1C3EA 1IVNA 3PVCA 1INLA 2NQ2C 2JGRA 2XMGA 3WVNA 4QGFA 4F0JA 4QVIA 3DW1X 3QGMA 1T0PA 4O3FA 4PZCA 1WB9A 4G8JA 2PGDA 4PLVA 3ACCA 5LOVA 5LQDA 3UHPA 1L2TA 4OQZA 4UD2A 4LFBB 4C76A 2WHQA 3PDIA 5AIAA 4A0QA 3CVWA 1C7EA 5EYPB 2JJ1A 4II7A 5BW4A 4B79A 5JWRA 1F6WA 4DQLA 3P0RA 3UT5A 2R6HA 1DC3A 4RLQA 3OURA 1PR3A 3K0KA 1R9MA 3ZWOA 3IOMA 3IPXA 1NONA 3GFQA 3JQQA 3MRSA 4AJJA 4DLXA 2I9KA 1GGHA 2VJLA 3EFOB 1THMA 5HMMA 2F9LA 1O4WA 3UUEA 1BYIA 1NLMA 2OV8A 2P1ZA 3JZFA 3L0OA 4IINA 4D9GA 3LVRE 1DBIA 4EATA 3U4QA 2FX2A 2QLTA 1B6TA 3L7OA 1MT3A 4LVOA 1WNTA 2R11A 3B70A 4HC4A 1IG3A 4JB2A 1KRWA 1PWXA 1MOZA 3U4CA 4TT8A 5CYPA 5HIKA 2ORYA 4XQGA 3GELA 2X40A 3WZLA 5TRTA 2EKZA 2I8LA 4XH9B 1JLSA 2CKDA 2C2YA 4YASA 4JP1A 1PQ4A 1OFVA 1SK9A 4NS1A 3ZJTA 2ZBRA 3IIKA 1EVIA 1L7XA 1H0RA 1QJ4A 1XAJA 4LOHA 4BS9A 2IY8A 2Y66A 2FRDA 3NEYA 1DZ3A 4HXEB 4RKQA 5FOWA 3RS8A 1YKFA 4L8YA 1EK5A 1KO7A 1QMGA 1PCXA 5EYPA 2OXIA 1ZHOA 2B20A 2QM7A 2VK4A 1TUEA 4UPEA 1NNEA 4NABA 2OKCA 1RE1A 3K0EA 3KAKA 3DOIA 3HS3A 2RI6A 1VL0A 4CMEA 3EDMA 2ST1A 2PEYA 2XRYA 4RCZA 1GQRA 2Q3EA 5EHNA 1XAIA 1T9GR 3MJRA 4NPAA 2WHRA 1FP4B 2HK9A 2BTQB 3LP8A 3J81A 3LCRA 5ICMA 1XPUA 3CIOA 2M2IA 3R77A 1X1QA 3NAMA 5JNRA 1EGMB 3H5NA 1JE0A 4PNZA 3CZ9A 4U2FA 1N92A 3SXPA 2ZBEA 2O8VA 3KL2A 4WNAB 4YO7A 5CEEA 2HHJA 3GJ6A 2ODWA 4F1KA 3FMGA 1K06A 4C3OB 3BL5A 5CH5A 5F2NA 2YC4C 3TZ6A 1IB6A 4AJPA 1DIBA 1OAAA 4GP9A 3K7EA 3HNRA 1KDOA 3CSDA 1TT5B 5FPHA 5P8WA 1GU7A 2ZS8A 3JAKB 4OVKA 1HEUA 1E0JA 3AFOA 3X1KA 3F2IA 1ZU4A 3MSCA 3P9YA 4OQNA 4CL2A 1Z29A 2VSFA 4OAQA 5DNEA 3WB9A 5FI3A 3D8UA 2QX9A 2JS7A 3H7IA 2WFZA 1W5FA 1EVYA 4NJMA 1NXVA 2HCBA 1WS6A 2G04A 1FP4A 1JIVA 3UOGA 2YWHA 4BB6A 3ZE1B 3G2PA 4CF6A 1KJZA 4MVXA 3C7AA 2CL7X 3H1PA 1QCZA 1ZCFA 1C9NA 4KGDA 3FZEA 5CK4A 2AG6A 2VRBA 3NT5A 1YR2A 3ZVNA 1HNWB 1LK0A 4GH5A 4LVCA 4D41A 2GKGA 4DBLC 4LGCA 2VRCD 1HT3A 1UDBA 1UXGA 1Y5MA 1GNQA 1KP2A 1NN3A 1SQ5A 2D54A 2Q3LA 1ETHA 4TS1A 2C31A 4JXJA 4XOUA 1W8IA 2H65A 4JD5A 4LCEA 3ST7A 3PEWA 3JAKA 4Q39A 1R6UA 3IAUA 4EG5A 1FDUA 5KNCH 3GVCA 3K5WA 5BVGA 3I39X 1JSRA 4HXYA 3I4FA 5KTRA 3RAJA 1RMQA 3QXSA 1E2KA 4UUBA 4DVJA 4INPA 3UJ8A 4BVHA 3ICEA 3LQ2A 3QXCA 3Q8WA 1F1JA 3QM1A 3EK2A 1QCYA 1NMZA 1N7HA 2O23A 2LDBA 3BXOA 3GGOA 3H2ZA 3C15C 4C2BA 5E3HA 3BILA 1DAEA 2G6BA 4JCOA 5CT8A 1M54A 3NC1C 3NTXA 2OGZA 3MTQA 4HAUA 4B9EA 4EMSA 1Y89A 2PMFA 2PX6A 3SR4A 1XCPA 2ZJ3A 4DEYA 4RTPA 3S2GA 4UNRA 3GMTA 1DARA 1OREA 3EEIA 3E81A 4K1LA 4DJEC 1GADO 1B8OA 4CQJA 2OYSA 5JRZA 4LMBA 5C8DA 3DLAA 3MINA 3V00A 2JCSA 2H4WA 4B81A 1BWSA 5LUAA 4XFJA 4G07A 4IV8A 1WW3A 4JGIA 4FB4A 4IG9A 2DHEA 2R1VB 4OJNA 4BMDA 4BVGA 4MJ7A 3W7VA 2O52A 3LI2A 2OCDA 3WB0A 1WDKA 4FX2A 3SC2A 3B1YA 3LWBA 4EO4A 3DAFA 2BYTA 4WIAA 3VFDA 2FK7A 1T9DA 4IZ6A 2IA5A 3RV4A 1YDHA 4OJYA 5J63A 4WY8A 5EKXA 1VKJA 3V9PA 1SCJA 3MTAA 4TYMA 4XGIA 2HC9A 3SI7A 2YWXA 5HTOA 2J3JA 2OBNA 3PCRB 4I2NA 3MMSA 4WASA 5H70A 4E30A 4EKNB 5IABA 1U0LA 1U3TA 1XTRA 3AJEA 3M9LA 5BSUA 2AVDA 4MO2A 3ZY5A 2GAJA 4JI4B 1FL9A 4DS3A 5EHZA 3IEXA 1RC1A 3EA4A 2OBLA 3NBYC 1RFGE 3O2SB 4LRSB 3WGQA 2C4HA 4B3BA 3LC2O 3L93A 1BN6A 1Y3HA 2C58A 2XUAA 2R1VA 4V39A 5DI3B 2V6JA 1NBMA 2XCLA 3P9KA 2HLNA 2P78A 1F3OA 5TJ9A 2JI9A 1CPYA 3OO1A 5NULA 2PLAA 4Q4HB 2JIPA 3WI7A 2BL4A 2CLDX 1WV0A 1HOXA 2V5VA 3FAZA 5A9RA 3V3TA 1KYQA 3KYCB 1ZCAA 1U8FO 2XCRB 1VSVA 2PYZA 1MBZA 5CU7A 3GNSA 3DC7A 4FLEA 4WCVA 3OH8A 4BQPA 1OC2A 1KKUA 4OXYA 3PD0A 3I5XA 3GN2A 3UPDA 1QO0A 1T1GA 4JOQA 5DHQA 1XDGA 1SUFA 1N2HA 3G2JA 1FNCA 2YWBA 4Z1MD 5IP5A 1HYBA 1W36B 5ECGC 3MQ2A 4B0PA 3FOEC 4L5AA 5GM1A 2VXCA 3PRHA 3BHIA 4O59O 3HKEB 3MLEA 3ELUA 5ALPA 4N41A 4W8GA 4E1AA 2PSFA 1LBTA 4DLZA 5CEFA 1O5IA 5DI3A 1BXGB 2X14A 1Z15A 3AK4A 3KYDB 3BAFA 3R5FA 4NBNA 5C1IA 4E5NA 1YK1A 2HRBA 2AFHE 2LRHA 4MUYA 4MYDA 4TLCA 4EPXA 1VLVA 4NX2A 3FYSA 3BMNB 3HR7A 1TW3A 3GRRA 4CM3A 5K8IA 4D3ZA 3SZRA 2VHTA 2FKAA 1JW9B 1C9YA 2BGRA 3DP7A 4G9BA 2P77A 4ZVQA 2WWTA 5FL3A 3DLBA 4Z7OB 2P3LA 4O4IB 4AW9A 2FEWB 3R7LA 1XYYA 4FTWA 2QMZA 3CSSA 3BK2A 1XCMA 3MF4A 4P4GA 1KI4A 4M99A 5E6SB 5JV5A 1P6QA 4P8RA 3CB4A 4BP3A 3OLYA 1YNOA 3NOQA 5AUNB 5ALNA 2C00A 3SEZA 1B4DA 5EC8A 2HRDA 1QDUA 3MS2A 3Q3EA 3GZNB 1EXWA 1Q16A 3GJTA 4XUGB 3ZY2A 3GLSA 4D6PA 4ER5A 2V55B 3C43A 3P96A 1ZIOA 3M4NA 3VSBA 1BXGA 3KYDA 2FPKA 1UBCA 1J9ZA 4LJ5A 4CV1A 4WZBB 2WNHA 3PTLA 2GF2A 4YAOA 2PUCA 1U0TA 1R6VA 4I9FA 2G9VA 4WQMA 1XUOA 1CR6A 1H2RS 4N40A 4A0RA 4NV1A 4EG4A 1OE0A 1JX6A 2C2XA 3BMNA 3RSOA 1GG9A 2MU1A 3GF4A 4IDPA 4PBTA 4M1ZA 4JUCA 1AKWA 5BMOA 5FFMA 2J5XA 2WTAA 2BMDA 3TDKA 2EFHB 3EIEA 4QPCA 4DV7B 5HRAA 3U44A 2N47A 4KWHA 3I6ZA 1Z56C 5E6SA 1UANA 3EWNA 1YKSA 2CJFA 1IB0A 1NX9A 1KHHA 2C4MA 5HKBA 3PUXA 1B43A 5K5EA 4BE7B 5U9CA 2WU1A 2WKWA 1WXEA 2QVCA 4KO2S 1TUBA 1ZLYA 1T3HA 2H51A 1M1UA 1A9OA 3HJAA 3EQZA 3R9WA 3I04M 5C7OO 1IC6A 3D4IA 1XU7A 3GO4A 2QU8A 2XXBA 2QN7A 4Y6QA 4BBZA 4ZAZA 5B2FA 3MZ0A 4X95A 2QUAA 1NJGA 4BLQA 1XZEA 1P4GA 1P4AA 1GPKA 2IYUA 3EUAA 3HDHA 1P0QA 4N48A 4PG5A 4CM4A 1S8AA 4YYZA 4M7WA 3AMVA 3LGAA 4H0NA 1WUIS 5AM5A 5JHHB 1J42A 2CD7A 3W2IA 2OESA 3HDVA 2FHPA 4W7SA 1Y8RA 3G23A 4NBUA 4NIMA 3OF2A 4XWWA 3TMAA 4BASA 1G8HA 3K32A 1E5XA 2Z58A 3CEAA 3IFSA 4OHBA 4II2A 1U3WA 1YS2X 5EKDA 4AIIA 2ZK7A 1VLHA 2I6SA 2IZ5A 2FMKA 3LUHA 1O96A 4LHSA 5CLGA 2ODPA 4FJ2A 2ZREA 1PL6A 1LVHA 2JCGA 4OQDA 2AV6A 1N75A 2G76A 1YXMA 4HD8A 5BRNA 2WUVA 1KQNA 1ZI9A 3C24A 3FLAA 1RD4A 1UKZA 4Q7KA 3VNUA 3KM0A 3NM6B 4KXMA 1AURA 4ACBA 4JIGA 1YDMA 3CV3A 4G0VA 4DB2A 3HBJA 3NORA 2Z30A 5TSDA 1C0LA 1YRYE 4IIHA 2PMCA 3BX1A 1A9QA 1RTTA 1QV7A 3BULA 1BROA 1E63A 1I9GA 1BX0A 1ZGJA 2GUGA 3KFXA 5FPPA 1LV8A 5J1TB 2D0PB 4NCAA 2VZLA 3FUWA 2IHNA 2PWPA 2QSUA 4PC7A 3IC5A 4MS4B 1JR2A 5FNVA 3E3AA 3L8CA 2XQIA 1XVIA 1YMVA 2VAVA 2VCEA 3KZMA 5DLYA 3WNQA 3OY2A 3EXG2 3WIEA 3LFTA 2G72A 1XD9A 3W6PA 1G64A 3CO0S 2GJ4A 3DV2A 3ENWA 4QTUB 4TV9B 3AKEA 3RLIA 2R4QA 4CG3A 1E98A 2MHCA 1AKEA 2NGRA 1XVLA 3F6SA 3WGTA 4LJLA 4ZJUA 1OFUA 4QVKA 4S1OA 1JHMA 3Q7RA 2DH5A 2XMQA 1LRJA 4BO5A 4AD8A 3UGKA 2ZXUA 1D9ZA 2I22A 3SDSA 4YQEA 3EDCA 2ZI7A 2F1RA 3FW1A 1ZH0A 3GLHE 4U8HA 4DLVA 2ZT8A 1SD1A 3U4AA 3FNFA 4PCVA 4UU8A 5DM1A 1KEKA 2H5JA 1JAXA 1W34A 2JK1A 2ZUWA 3HZZA 1CY0A 2XTMA 5FV7A 1IUKA 2XF2A 3MN1A 2UZ0A 1NRJB 4AURA 3UW1A 1T5TA 2WIJA 3K0CC 4MS4A 2FSGA 3NBMA 3KPWA 2E37A 2GN2A 3NVAA 4CIYA 3P19A 1EVQA 3DMNA 4CQNA 2WB2A 1K08A 1SCQA 3C3PA 3N6VA 3RSCA 3WADA 1X13A 3K0AB 4TV9A 4RJJA 2GPTA 1ZMOA 3IKTA 1JALA 1ZOIA 1LWNA 3HKCB 3Q7QA 3RUCA 4XASA 3D6NB 2QT1A 4Z0HO 4J1TA 3VZPA 4EG8A 4ARSA 4RTJA 4KFTA 3A9WA 1KZ6A 4K46A 1LBQA 3RSSA 2X2PA 1OJ7A 3FTNA 2VYND 2XZDA 1XLVA 3HR8A 1AB5A 2ATIA 5I7AA 4I55F 3VU9A 1HH4A 5A6VA 4NICA 3MXOA 5IKOA 2A0WA 1PS8A 3H8JA 4JS0A 3LT4A 5U4QA 1JWBB 5KTKA 1KQFA 3E18A 1XO1A 2C7PA 5MF6A 2OFWA 3IQXA 3PGMA 5IHPA 1R64A 3SPXA 1I5EA 1PGJA 3HDQA 3WV5A 4FDTA 3EFHA 1F60A 1GAXA 3A3PA 3G7NA 1E7MA 4HWKA 2WNSA 4MWTA 3CRQA 5FI1B 4MVJD 5IDYA 4B2IA 2QD3A 3OTIA 2X77A 4B3XA 4DR3B 3C0KA 4X3CA 4OX9Y 4UAGA 2O8NA 5AVTA 2VKTA 3K0AA 2P0AA 4PO9A 3T7CA 3PRJA 1NVAA 4LSMA 4YFVA 4INZA 4PLCA 5CNMA 4MV5A 3DDSA 1IG0A 2W6QA 3WLAA 2VNAA 3PLAE 2SICE 3KJEA 2YV4A 3ANLA 2ZBFA 3F5MA 4CMIB 5KOIA 2WR8A 3INTA 5EIXA 4G1VA 5AK4A 2FRVA 3WYNA 2HO4A 1CDEA 2AMVA 3HU3A 2VYVA 3OZBA 1PZFA 2WHXA 4IFEA 2PH7A 3VH3A 4RTRA 1RLIA 2OXCA 2NP6A 2H8GA 3GCDA 3PRYA 4HCJA 4TM7A 3KXIA 3ZBTA 3G5TA 3AKDA 1JFSA 3PNKA 1KFCB 5DYTA 1G4UR 1U4NA 2B4RO 2RI0A 3KPVA 3VR5A 1R7RA 3HV0A 1YVEI 4PX3A 1XVVA 1B42A 3JQCA 2ESRA 4G24A 2G1AA 4PYOA 2R60A 3U81A 1WZCA 2MIIA 4PS0A 3CEHA 3P9NA 4HRVA 4F4DA 1HUQA 4X60A 1RM5A 2VQSA 4HZGA 3TE6A 1YE5A 5CHEA 2P2ZA 3DQPA 4YV1A 5A2GA 1GNLA 4GYYA 4BO6A 1E4EA 1SA0B 2BN4A 1UOQA 3LDUA 4CMIA 2AN9A 5IVKA 4TMFA 3JYLA 1WY5A 4Q6WA 3COJA 2B4YA 1NUTA 2WJVA 1RQGA 3MJFA 1JLHA 3CJQA 5DP1A 3ULKA 3LA6A 1HNXB 3P9XA 1O58A 3BJZA 2C2GA 1H8ED 3TSAA 2PSDA 3W5DA 4IDOA 5A3QA 4CTMA 1D1PA 2OB1A 1DIHA 3OLZA 1E79A 1T1JA 3CWQA 3ZKWA 4EW6A 1DIGA 1CEEA 1KIFA 3TOVA 5EPEA 1P5JA 1GGMA 1DAMA 2B8JA 3SSAA 4BJ1A 2DFPA 1NU6A 5JQGB 4UAVA 4B6GA 1E4YA 4YH1A 2E4XA 4HUTA 1Y7TA 5ALHA 3GFBA 3WB1A 2HV9A 4Q16A 4NK4A 2P1DA 3CS3A 4YRKA 1Y1KE 2CK3D 2QZPA 1EFTA 2VDWA 4KBYA 5JBNA 3VR2A 3AF4A 3PWSA 1PFGA 4NU5A 1UZLA 1JWLA 3QV2A 2WZBA 1A7UA 2AFHB 1WDWB 2OMKA 2VHXA 1UC4B 2XA1A 1SA0A 4IJVA 1QXSA 2PHZA 3EW9A 2DPLA 2JA2A 4HQNA 1JHVA 4HPJB 4RO0A 4ZARA 2Q2QA 4EA7A 4JMPA 3JQ9A 2AN4A 4BVLA 4TS4A 4IJUA 3E0QA 5B5SA 3BDVA 2XB8A 3TD6A 4DLBA 1C8VB 4NG5A 4F93B 5BT9A 3DWFA 1ATZA 1UDRA 1PWYE 3I73A 4LY3A 5ALRA 1A72A 1BE0A 2QA5A 1JEYA 1MJGM 3BXEA 4GKJB 1GT6A 2VYCA 2JFGA 5JQGA 2H4JA 4OHRA 1N1MA 5ETJA 4E6PA 2G9RA 1NN0A 5D3MA 1DC8A 1Y37A 2OEPA 4UQLA 4NSNA 3M6FA 2Z9BA 4NRDA 3X43A 3ZCVA 1GRRA 2W2OA 4LNHA 1V3UA 3AXTA 1R0CA 2AFHA 4EVIA 4BJ6A 4WL0A 1ULZA 3H8SA 4BVBA 1D09A 1NNLA 2L18A 3TR0A 4HWOA 1SVIA 2Z04A 5FUWA 5KYVA 2BFAA 3QFRA 2IVZA 1XQVA 3IEUA 1DWUA 4GP7A 4OHCA 3VNSA 1NPYA 3ONVA 4BMOB 4MR8B 1X38A 4P58A 1BYUA 2R86A 3HG7A 2AEJA 4FD3A 1TD9A 3OM9A 2C3YA 4PGGA 3ZWYA 1O0SA 4ONEA 2I4TA 1KJYA 4FD2A 1J90A 4KQJA 4D3FA 4ZGBA 1EFUA 2AC4A 1E18A 2R6ZA 5ALYA 4ER6A 4YRZA 1G4AE 1T5BA 2PBRA 4C0JA 2HHAA 2GZHA 1X7WB 2NO4A 3W77A 5L3QA 3DA8A 3OZUA 1I7PA 4EGCB 4Y18A 1NVKA 4X1IA 4AG5A 3AIIA 4P5DA 2QZSA 3TTSA 4DSTA 2GESA 2NTVA 1GPDG 4ESVA 1QTQA 4BN0A 2OG1A 2FPMA 3AHFA 3UM9A 3L7JA 1AF4A 3QVTA 1QFJA 1EFPB 2HA5A 3ICOA 1L5VA 4ICIA 4G26A 4RDCA 4WK6A 1TE2A 4X9XA 5ALDA 4EQ6B 3WTCA 3NW9A 4A0GA 1PFWA 4R7GA 1W52X 5DULA 1DTWB 4PX2A 4W9NA 1QM5A 4IBOA 2H11A 5HP4A 3KYIB 4PC2A 5AKIA 3TG8A 4QYSA 1MPTA 1HV8A 3DO8A 1FYWA 2HFKA 1M34B 4TN5A 3C2QA 1PJAA 5D3ZA 3PC8C 1J0XO 5B4VA 3HVHA 4BC1A 3G0DA 1ESMA 4IH1A 4KVFA 4W1QA 1S2MA 3SXUA 3VAZA 4EFNA 1NR1A 2ZTUA 4X3PA 4YECA 3GLGE 3I58A 1UQRA 4RKFA 2C4TA 1RKUA 3CG4A 4C0BA 1AKQA 4YMTA 5BMVF 4BMXA 4XARA 3WOHA 1BVRA 8ADHA 2HREA 2OAGA 5CT5A 2JAPA 1R8QA 4IS3A 4X93A 3T61A 1RLTA 3K35A 1EFPA 3K9LA 1D5WA 1YRBA 4MWZA 1LLCA 1WJGA 2ZUVA 1YIDA 3ZWQA 3L4KA 2Q6LA 4Z9XA 4MAMA 1A1SA 4PWZA 3A10A 2BGNA 2NZXA 4ZXPA 3KOXA 5DWQA 3U9LA 1S9HA 4KO3S 1DTWA 4GR5A 4YAEA 2P4HX 5BSWA 1G9XA 3RM3A 4MIEA 2H8KA 3FPBA 5ECDA 3FYUC 1PJ4A 3NWPA 3WBBA 1KDRA 1W0JD 1JFLA 1R4NB 3D2CA 4N3NA 3KOOA 5IJXA 5AW4A 5KWSA 1GUZA 1K6JA 4IL5A 1DMRA 2DHCA 1G3MA 4IX1A 2HO5A 2YXDA 4CLEA 2Q27A 4K9DA 4QIHA 1IHDA 2FFBA 4R2WA 3WK6A 1II9A 2Y6VA 3LCUA 4JVMA 4QM7A 1D6MA 1TC1A 2PKQO 1P7YA 3CN7A 2B3TA 1BZYA 3B3FA 5TMEA 4BQRA 3PGJA 5B1DA 5SY6A 2GTHA 3TFQA 1JA0A 2F8LA 1MO6A 4R2LA 3NTUA 5INTA 2AMFA 3EC7A 3I32A 1SBYA 3ZWDA 2IS2A 4XDGA 1KZ1A 1Z07A 4YV2A 3DFIA 5ALJA 1QORA 3F6CA 2GFIA 4Q3CA 1LC0A 1QIMA 3T52A 2WVGA 3NNNA 1VYVA 2PSHA 1T4DA 2ZRNA 1NVXQ 3LDHA 3V3KA 3IJRA 1CFJA 4PZDA 3KELA 3QMMA 2FLWA 1DFGA 3LPLA 3T5CA 3DR3A 1JXMA 2NSDA 3ISJA 4HDNB 5B1IA 3WKBA 2GN0A 2JBAA 1K3UB 3DAHA 2ZSKA 2FWRA 1WHSB 2VRCA 2DPYA 3EXHC 3G5AA 1K75A 1XWWA 1EJ6A 2JHGA 5EL0A 3E9DA 4RGYA 1XTJA 3IJPA 4ME6A 1P0MA 4HGOA 4JQOA 3MRTA 3R8XA 3OM8A 1ZONA 5F2EA 5FWXB 4XUDA 3A6PC 1EVJA 1FE8A 1N57A 4MVJE 2BFFA 5DLDA 4CHTA 5KZMB 3TTWA 2GNOA 5T8KA 2B1JA 1VI2A 2UYYA 1JBEA 3JZAA 4TKMA 1WVGA 1G18A 4RM2A 2PLFA 2YJ3A 4IFIA 4Y9DA 1RKXA 3GJ0A 4HXFB 5DHRA 5AOVA 1E3WA 1SPBS 2DBZA 4K6FA 4G4SO 4MS1A 4ND3A 3IS3A 3A6DA 1GNRA 5LQCA 5C2JB 1FVXA 2I99A 5JU6A 2ODBA 2FJ0A 1QG6A 4Y2TA 4BHTA 3ZQ6A 3MFQA 2I1LA 1W5SA 3GLHA 2IUUA 3WQQA 2HJHA 4MWEA 1HORA 3HE3A 4AM8A 2GYYA 3HP7A 4HDNA 3FKSD 3M8KA 3PPYA 3PR3A 3QHPA 4LOJA 1EWTA 2QX7A 4LX0A 2XA9A 3C98A 3OCUA 3QKRA 3TLEA 1T2FA 3WNZA 3DB2A 1U1DA 2XB4A 5FOUA 3ONEA 2Y1GA 1I14A 4K8OA 1QWOA 4PG4A 4ZDWA 2WG1A 2VUIB 1BMFD 3QVJA 2TECE 4QAJA 2HD4A 3IB3A 2VWPA 4WLOA 2NYRA 3DMHA 4IUBS 3PJEA 4V03A 1ZVMA 3ZWMA 5LPNA 4LF7B 1E1QD 4PONA 4YMSA 1Q2XA 1E1NA 4GXTA 3RREA 1C50A 3CRZA 5J2UA 1L5HB 1J1IA 2VJMB 2QPTA 1RTKA 3KQLA 4A03A 4B73A 2A4KA 3H2GA 3SQNA 1DBSA 1RAEA 1GP2A 4KSCA 4X62B 1J06A 3QA9A 1JKXA 3OOSA 5EZQA 1W6RA 1EBFA 3QSGA 4J8PA 4J1SA 3OZAA 4BP1A 1DINA 4RD0A 3OJ0A 1Z62A 3LD9A 2VUUA 1QUEA 2JAQA 3FFTA 1SUBA 3G2LA 3JR7A 3AVTA 2JFNA 3SBEA 1XELA 3C70A 1DO2A 3TF5A 4O2RA 3QHAA 3AF6A 3S29A 3IXLA 5JS2A 4EBBA 2E5FA 2ZYDA 4Z54A 3G6WA 3AVYA 1H1LB 4I5GA 4XCXA 1E32A 2NX2A 1LV7A 5MN6A 4DUGA 1UXJA 3QU4A 4GEGA 4JNKA 1YQWA 4UHFA 1VTKA 2X7XA 2YYSA 4JU8A 4QRIA 1N2JA 1L7DA 2F1OA 2UVPA 4YRRA 2VT2A 1QG2A 1IULA 4JP3A 1TCVA 2HWWA 5EG5A 2VQFB 1EVKA 3BTSA 1OAOA 1VHDA 2P9FA 4IDQA 4MCAA 4Q47A 5EI5A 2VJMA 1L5HA 1F2UB 1NT2A 1ZKMA 4CGZA 1EFDN 1IJFA 1NRWA 1P77A 5IDQA 1Y6FA 1BFUA 1T29A 3GVPA 4M38A 4C0AC 4W5HA 3ONNA 4XLLA 5A05A 3MIZA 1JLRA 2IHTA 1EPUA 1F5SA 2AFVA 2BJVA 2C94A 2PUTA 3A1CA 3I64A 3D3WB 5KSOA 4QYMA 4ETIA 1KH1A 3W2EA 1QDEA 3KKEA 3G82C 1ZH2A 4ISBA 2CNWD 3MT0A 1QVAA 4NCBA 3BDAA 4Z1MA 3WKDA 1ECLA 1GFSA 1P2TA 1CUVA 1K8XB 1LJ8A 3L0YA 4M7OA 2ECFA 3ESYA 3PWTA 2Z6VA 2BONA 5TF0A 4EYQA 3HU1A 3NEPX 3UAGA 1QC5B 4LYAA 2WMOB 4MP8A 2I4RA 4UCQA 5CBPA 1RKVA 1QZZA 4Z0TA 4QELA 3SP1A 3VNVA 2RKBA 3STVA 3SHQA 1P45A 4OHUA 3PVZA 4BQQA 5CPFA 4YRDA 2OZEA 5IM4F 1UP6A 1Y48E 2WF6A 2NZUG 1RLMA 2WV7A 2DWCA 3EEFA 5AW9A 3WG9A 2GN4A 3ESBA 3PQEA 1JJIA 3LIPA 4CIDA 4GLFA 2EW8A 3I0MA 1EBUA 3MUOA 5DIZA 4BO7A 4GOOD 2BJWA 1JQ5A 3DMRA 3BXZA 2QW0X 3OOHA 2GD6A 1DCFA 1RAIA 1RBQA 5BYBA 1FXUA 4FNAA 4BMPB 5IF3A 4O8ZA 5KU1A 1SOMA 3LVFO 4NS4A 2XF8A 4I6EA 5TPZD 3KFLA 3RJ5A 5ITZB 5IXYA 2ZRQA 2IS4A 1XFAA 3TUZC 2XYPA 1NI5A 5EQDA 4EX7A 3W1VA 1RYHA 1LFAA 1QC5A 2Y2VA 4Y2UA 4EY5A 1E1LA 3FNIA 1QFZA 1M1YE 3OWOA 2IGTA 4JJ6A 1HI9A 3BK7A 3ZPXA 2IOQA 1G3UA 1S2NA 4R81A 3NUQA 3QX9A 2EF1A 5FO1A 4AN0A 2W58A 4DNOA 3QXGA 1MO3A 2DFLA 3P4YA 1K7CA 4TMWA 2H2IA 3JYOA 2E2WA 3WIOA 2Y1LA 4EARA 3C14C 3NHFA 4ZOLB 1Z08A 1DOZA 2FMHA 3LIIA 4DT1B 4DY6A 1PT5A 1K1EA 2ZIVB 4L5CA 4Y2XA 1A7KA 4ZQIA 1V5FA 3Q0EA 4OP3A 1PFUA 4NC9A 2V6GA 1MO4A 1N5KA 4JELA 5TMBA 4PU0A 3R3ZA 4IJMA 5AVJA 2ACVA 3LPMA 5J2TF 2OILA 2VDPB 3FY4A 1KZYC 4C2TA 5GPBA 1XDDA 1DQSA 2CB0A 2B9VA 4D4MA 3RH0A 1FSZA 2XCIA 1UEIA 4EO7A 3FRJA 3QX3A 4W1SA 2W6CX 4XUEA 5L53A 3KPYA 4K81B 3BFJA 5DOZA 1EXNA 4AP9A 3B38A 4TWZA 4JEHA 4LN1A 5A3RA 3FFXA 3MJSA 4DLLA 1O57A 1SCBA 1YFZA 4HQOA 4M9QA 5SYAA 4BTVA 1BD4A 5HFAA 2WIBA 2YFHA 1J8FA 4ZOLA 1P2BA 3RTDA 2YC2C 1GV1A 2ZTVA 1Q20A 2QWXA 3ZCQA 1T0IA 2GERA 1HPLA 2X6TA 4KVAA 3O1JC 1JXAA 1C1XB 3T6KA 1T9ZA 3LSTA 2Z9DA 4ZWNA 3CEJA 1E77A 4RF5A 1U3GA 1PJZA 2PX5A 2NO1A 4FFRA 2ZBQA 4RVGA 3ZGLA 4HATA 1JG4A 4EUSA 3ODGA 4S12A 3GRAA 3WNVA 5JSZA 2D2FA 3GJRA 5LNK1 4JBYA 1UXIA 3A4TA 1FPMA 3HEAA 1WX1A 3ZV4A 1RT9A 3KJFA 4BRWA 1QHNA 2I1VB 1SOUA 3GROA 4QHYA 4XVHA 1CQIB 1K66A 2XRFA 5DU2A 2VYFA 1YC2A 2C2WA 4TV8F 4IMRA 4AQYB 1RBZA 3AV0B 3E3NA 4UOZA 4REQA 1PQYA 3UJPA 4UBOA 1N33B 3L4JA 3M49A 2Q8NA 1Z5ZA 3QLTA 2C2MA 3SKXA 2HSZA 4XXHA 3GFTA 3USCS 3R2JA 2ENUA 4O2AB 5F5XA 1RPJA 1PUIA 1NULA 3K16A 3UXEA 4NAHA 5DLQC 3RRFA 2VHJA 1DLJA 5KB3A 4K9PA 2YR0A 1DOAA 2XB6A 3ZK8A 2C5SA 5KNLA 3GLGA 1AQYA 2QRNA 4JI1B 2XOKD 2VSQA 2DQYA 3BK1A 3HNOA 3ZWWA 2PQ2A 1SUAA 3K5HA 3RHTA 1Q1ZA 1UR5A 3NWBA 1YRQA 2JAUA 5C7LO 1YUMA 1W9HA 1W73A 3JR3A 4LS3A 4C1BA 4D2IA 4LF8B 1DKRA 1QGOA 1R15A 1U9IA 3G2OA 1QG4A 4L9AA 4XSVA 4XX0A 4MPRA 4OH7A 5H68A 3WO1A 3QU7A 3FDIA 2V45A 4LOIA 2W48A 3EVZA 2QL7A 2VAPA 1GQSA 1XHEA 1Y1TA 3HZOA 4RTOA 4E5MA 3C8HA 4H4DA 4N7JA 1JJFA 5JARA 4K87A 3ISVA 1HC7A 1W0KD 4PYMA 3A25A 2VTDA 3NRBA 3RAGA 3U0VA 5I8PA 3O95A 5CB0A 2BGTA 3G2QA 5I5EA 4JR2A 4WTOA 4B3MB 3CPHA 3IUJA 4OHKA 5A5VA 1NJ8A 5BN4A 4FCWA 5ERGB 3GJQA 5L3VA 2FP4B 2B4AA 3IAFA 2C98A 2A7XA 4MO9A 3LBYA 3N39C 4NJEB 1VFPA 4FIZA 4RJKA 5CT4A 2EAUA 5D51S 3TUJC 5ARCA 1P7CA 4JDUA 1HL7A 5HIJA 1PFQA 2VYNA 1SRRA 3OLCX 2CDNA 1GRCA 1TAGA 3JRNA 3N7AA 1IY1A 4P4LA 4RE5A 4LGYA 4ZC8A 3T0FA 2ZTMA 1JEYB 3PD1A 1QH9A 1XNQB 3QPWA 3UJ7A 4TXMA 1JG2A 4L74A 5KVVA 3C6BA 3AOGA 3E7FA 3P94A 4DUYB 1P31A 2QRZA 1GCAA 1ZLXA 3IMCA 4NMHA 2VHEA 3P1JA 4HLCA 3FIJA 2GFQA 4TRJA 2X6QA 2F7SA 1ZISA 3LVBA 1JAZA 3PKIA 4YJ2A 2V58A 3RROA 4R2JA 1SVLA 3FR8A 2AL7A 4MVJA 1A1VA 3GRZA 3HYLA 4JJAA 5B12A 4BGEA 4PAOA 1E9SA 3NKFA 3QVGA 1V6SA 1TX4B 5EE9A 5HILA 5EZYF 2XCUA 3JWEA 1MJHA 2FP4A 4BMSA 4C7KA 4IHJF 1DKNA 2ZYGA 2P8SA 2R84A 3FNRA 1U98A 2RIPA 3F7NA 1DGQA 1W44A 5EWMB 5J5CA 3LLSA 1NVMB 4AG6A 5FAKA 2QX4A 5JRJA 4BO1A 5EKSA 1SUSA 3AZQA 3B51X 3W8NA 2Y71A 1WETA 1IXYA 1OU4A 1H6DA 1SJ9A 1RE0A 1T91A 2AMJA 4Y2VA 1GLGA 2LP4Y 3ES9A 2IIPA 4EJSC 5LLDA 1FY2A 1J25A 2F1KA 3L4EA 4N3AA 4UCXA 1LZKA 3N2LA 1VPEA 4LC0A 2PNJA 4D8VA 3BWDD 3AONB 2X5NA 1Z0DA 2OZVA 3W7AA 3WLRA 1P44A 4I81A 4DB4A 5B3KA 5BSVA 1SC1A 1UAGA 2Z6UA 3L7CA 2J07A 3TOZA 4MGYR 2QUIA 1QRUA 4WX2B 3R7FA 3TUIC 1PG5A 1GOTA 3MB8A 4FEEA 4MITA 1MABB 1WW8A 4M8SA 4B4UA 1U7DA 3WX0A 4FBGA 3KQYA 2GEUA 4PG6A 4Z99A 5EWMA 2EQBA 4YCJA 2MMGA 2EJTA 1R0ZA 3IIJA 3GDOA 3AC0A 3FAKA 5G1OA 1Y9JA 3R6GA 2GJAA 2IYSA 3L82B 3NVDA 3R0XA 4B6FA 1Z63A 1NJ6A 5BOSB 3LCVB 1NKTA 1H8EA 3L2OB 3SLRA 2H9IA 3U26A 1HFKA 3H8WA 5LXTF 3H84A 2DUMA 1XTKA 3TQCA 2HJSA 3D8TA 3KTAB 1YZLA 4YACA 4AZWA 3CZ5A 1BXRA 1LI4A 3WWEA 3BCHA 4UDXX 2VLIA 2YHIB 4MI9A 3KC2A 4YRTA 4BVJA 4TSFD 1UADA 1HNNA 4XM2A 3QI2A 4R6XA 2ZDHA 1K3TA 2XECA 3E3LA 2NSLA 4M1QA 5EJ2A 3B3AA 1OH6A 1T9KA 2QN2A 1DXYA 4MLCA 3LT0A 2H0RA 3SQDA 2CK3A 2FOLA 3JQGB 3LQQA 4C3ZA 3DDCA 1SIUA 1FRVA 5FOVA 2ZE6A 2Y76A 1JVNA 3MTDA 1MABA 3HJHA 1T4GA 4NECA 4RKEA 4CR6A 3QBTA 1Q7BA 4BNWA 2C9CA 4NENB 4E2FA 1FTSA 2SKDA 3KETA 4C01A 4GOJA 4BRUA 1ZN8A 2GARA 3HH8A 1ZR4A 1CHNA 10MHA 1UJNA 2GI4A 5BOSA 4LDQA 2X1VA 4PQGA 2I7VA 5J4LA 5LZ7A 1B0UA 4X41A 4O8CA 1Q0ZA 1NAHA 7REQB 3BA1A 5C4IA 1ZMTA 4OQFA 4B2PA 1PR0A 3KTAA 1Z35A 1WR8A 2B5OA 3COZA 1QH1B 3ER6A 1IXSB 5AVOA 3D4OA 5IFLA 4NOKA 5DOVA 4BRSA 1IBMB 4PAQA 1Z3IX 2YHIA 4WN9B 1E96A 2HDHA 2IF0A 2DSTA 5BN3A 2EX0A 3E8XA 5KYUB 3EY4A 3EXFB 4E5SA 2QRVB 2WD9A 4YMVA 5CYGA 1U63A 1M1YB 4MPTA 1E2JA 4R5MA 4WT7A 1F8XA 3RR2A 4EUFA 1QH8B 4C4YA 1Q95A 2WV9A 1J0BA 3HSKA 4Q3OA 1KVRA 4L2IA 1PGOA 2JCYA 4YQFA 4YY3B 4AG3A 4D3XA 2PFKA 2AWOA 3DLHA 1Z2NX 4OJMX 3B5JA 5AW6A 4OAOA 5KTTA 3IUBA 3Q6NA 4Z86A 4ZT2A 1EFRD 4D5GA 3ZS9A 1FFDA 1U31A 1ISIA 3M3HA 2KYRA 3STYA 1SIWA 4IIUA 1E5DA 4LZAA 5K2OA 2NUAA 2QD2A 1Z5OA 2AJTA 1XK7A 4D9CA 5CD1A 3H13A 5AKKA 2IODA 7REQA 1FNSA 1GCOA 2WNIA 5SZJA 4BNXA 2GPSA 1JT2A 4LHXA 4E14A 3E9RA 4QSMA 4Y98A 3A9VA 3C1UA 3TQRA 4DM4A 4Z9BA 1NAIA 3UWDA 5C7YA 4M6WA 3DVLA 4QUKA 5JD6A 3KQOA 4MV9A 4DIDA 3WL8A 5KYUA 1SZJG 1WKVA 2Y0CA 4R1QA 2IU6A 3EXFA 3NZEA 1AQLA 2QRVA 3P2JA 4EBFA 1JJVA 2GK4A 2H9YA 2QROA 4RK4A 1DAKA 1M1YA 1DC5A 2ZI9A 1Q0PA 2BKXA 3OHPA 4QDKA 3T7DA 2BSQA 3EGWA 3D8HA 1IBCA 2YXLA 3L8GA 3WOVA 1W4LA 2FPSA 4JC5A 4YIKA 3HM9A 3CC8A 4X8MA 3GA5A 1G16A 1E2IA 3OZRA 2LIVA 3JVVA 3I2GA 1BDJA 3HYSA 1NL3A 2IEZA 2VC2B 4TZTA 3W3AD 1UQUA 2Z2IA 4RH1A 2XADA 3RTAA 1Z18A 5IT0A 1FZTA 1SULA 3SHWA 3IXMA 5EJ9A 4B5KA 2BZ0A 5KC8A 2QD5A 4ID9A 2NU7B 1GEGA 1K7XB 1NFRA 1KMMA 3MK31 1OB2A 4P7JA 4RF3A 4A10A 3STXA 1R18A 2RGNA 3EGEA 1W46A 1FNNA 4YI3A 2RHMA 2PZGA 2Z83A 1M6YA 4PC6A 5F1YA 1BXZA 3JQDA 3WC4A 4EEKA 2TMDA 4QU9A 4MUBA 1MAHA 3ASUA 1TW2A 4R1OA 5DHUA 3RJMA 1V48A 1XTIA 1W581 3AB7A 1YZFA 3LNCA 1IJBA 1C8BA 1T2NA 2DRIA 3M83A 2COKA 3F46A 2YNMC 2OXFA 5HJ5A 3II6X 1W5AA 3C7CB 3GMSA 2BC9A 3IQDB 4L7VA 2I62A 3SMQA 1VBFA 1IOVA 1SU4A 1W2HA 2P30A 2R87A 3CKMA 4N39A 5K9ZA 3OP4A 3DEHA 1FYFA 1E9RA 2DY1A 3B52X 4LV8B 4DHWA 4OI1A 4F2GA 1Y7PA 3QV1A 2Y67A 1W0JA 3VU3A 3HDTA 1E1MA 1XE3A 3UK6A 1OT5A 5B53A 1DIAA 3TIXB 2GPWA 1A27A 2DQSA 2ROQA 4NYIQ 4U2BA 1Z33A 3NBXX 4GKVA 4Y9RA 2XUIA 2VQDA 4HSGA 3M5CA 3V48A 3NDBB 2QIPA 2R8PA 4QQNA 2G9NA 4B7AA 3QVSA 3FUXA 5LZ4A 2V5UA 3JQ7B 2O06A 5ITWA 2B69A 4UOQA 4XWGA 4RNCA 1PGPA 1EQ2A 3DKVA 3WLEA 1M6WA 4KK4A 1QLJA 4F6RB 3WLLA 1XA4A 3UK0A 1CY6A 2R8EA 4P32A 1DT3A 4M37A 1UKVY 1A88A 1NW4A 5JFGA 1KPHA 2WU8A 1ZYUA 4N5IX 4OQYA 3ZD8A 4BFZA 4D9IA 4MV3A 3AUTA 4DXHA 5BSMA 2V3CC 4GDFA 3Q12A 4RCVA 1XTZA 3SGLA 5TT1A 1G3QA 4JL5A 1DX6A 5CJJA 1TIKA 2WJHA 2O5EA 5FPSA 4MHSA 1PNTA 1YHNA 5FUYA 4WY5A 5E6RB 1YJ5A 5AUQA 4OA8A 3WQSB 4KEAA 1DRKA 2SCUB 1QE0A 1PIWA 1A8UA 1SO8A 4UUAA 4NU6A 4A7PA 4K9QA 3OLQA 4A16A 4EP1A 3DG9A 3C97A 1OUMA 1NJ5A 1QYCA 3OT1A 5CLQA 1T9HA 1VI5A 2YV1A 2IPLA 4IP0A 4YEDA 2V6BA 3RBVA 1C0IA 2AF4C 3JQ7A 3PZBA 2DJIA 4H31A 5K4AA 1NC3A 1WPGA 1KNXA 1Z0FA 4Y2SA 3T12A 3WGMA 3OCCA 4HBZA 4MPJA 4OL0A 3ZHCA 4B43A 1TK9A 2PZLA 1OT3A 4BTLA 2GZ2A 2JIZD 4UVIA 5T4BA 2BGLA 2J3EA 4P92A 5F64A 1N1EA 1WO8A 3GAAA 4ZJPA 2ZIXB 1ULTA 1KNQA 2K2QB 4HWSA 4DDHA 3KJNA 4DABA 2AT1A 4I3FA 1I7LA 5AQ1A 2XGGA 1TXGA 5E7IA 1E92A 1F06A 3FKSA 3M1IA 1GAWA 1XTSA 5MN5A 4DIFA 3WSWA 1Q77A 1W29A 2OLEA 1BTOA 3AETA 4GNRA 4UVEA 3IEMA 1XEWX 4IKOA 2XH8A 5ICCA 4PYRA 2OHIA 2E55A 3SS8A 4DR5B 1KE2A 2XKAA 4IJ5A 4X5OA 2EBWA 2YZKA 3KB6A 2VNSA 1BMFA 3AI3A 4WECA 4JJEA 2EKDA 4R41A 2HMTA 4J1NA 5TDHA 1E1QA 2RAPA 4I66A 5E3IA 3VR6D 4DXAA 3ASZA 1RCTE 3I9FA 5JAQA 2O0HA 3I2HA 3K20A 1W0CA 3ZZ0A 5CDFE 1D03A 5FHQA 3C3XA 4YXWA 4FBMA 4ZVOA 4CDNA 4XW2A 2PRYA 4PGHA 1PR6A 1BRTA 5JYEA 1U7HA 5GADl 4FHDA 5HOQA 3AVOA 1GYQA 3QLEA 3ADBA 4UE3S 2CBXA 2NSJA 3L6CA 1PL8A 3PUYA 2XQJA 3H42B 2BFDB 1UJ6A 4TLEA 4AQDA 4KREA 2OHFA 3BIXA 3Q10A 4DIMA 3SF8B 1WHTA 2HMWA 3R40A 2CLEB 3KHTA 1GARA 2P79A 1CSEE 1MT0A 1UBJS 1Y7LA 4G86A 4WMLA 3SZUA 2M1ZA 2YCLA 5IWAB 2OCKA 2VJNA 1UWKA 3EWAA 4X94A 2CJPA 1KIMA 1WUKS 1PL0A 2NV0A 3W9UA 5I8ZA 3OCXA 2YQ5A 1WZIA 1QR2A 2RB4A 3KEMA 5F5LA 4NZ9A 1PKEA 5IK2D 1KQ3A 2MR6A 1OX5A 3C5HA 4NP6A 3SZ3A 4PNEA 4PTZA 4IHAA 1KZ7B 3AV3A 3BCSA 1NJSA 4GFDA 3W4JA 4ZA2A 3HLTA 4GOMD 3JVDA 1RHKA 3LRXA 1QBKC 4HB4A 4MWGA 4NY1A 1TZJA 5AUOB 4U7TB 1ZWLA 4FCVA 1N36B 5J43A 2VHYA 3GRUA 5F1KA 3KIPA 1GKYA 4NU0A 1IE3A 4RZHA 3FSEA 1TU0A 3TTUA 1QQ5A 2BFDA 1AHNA 2JIMA 4FP9A 2QR5A 5K4HA 4UEJA 5L95A 4D9MA 2XUJA 1JDBC 4N8DA 3IBFA 1FMLA 3IHWA 5ALKA 3SY8A 4EG6A 5GVSA 2CNWA 1H3EA 3GL9A 2YRFA 5FAXA 5LP6C 1T3LA 1EBBA 1EM6A 1GRQA 3RBZA 1NQTA 3BRCA 1P1HA 1HETA 1Z6PA 2BUAA 4DJJA 3WWPA 5ICSA 4LNAA 1AS0A 2CMKA 3O8OA 4LRWA 2FX3A 3D5TA 3OJCA 4MRMB 4M0DA 3B6ZA 4QEKA 1BDMA 1QHFA 3ZWXA 2AOTB 4DQDA 3EEBA 1H2HA 2ZAOA 3D81A 3IAM6 4UFOA 3A7EA 2WT4A 4RK5A 1KSGA 4YREA 3WBKA 1USIA 4FSHA 5EQFA 1LQ2A 4LOLA 3A37A 3KOZA 5JROA 1XIVA 4HLUC 3RS0A 4QGSA 1TYBE 5C5CA 4R16A 1V1MA 3BXGA 3HBMA 3AZPA 1J7JA 3MEQA 4TMZA 1KEPA 4LXYA 5FUBA 5TY0A 5ARBA 3MM4A 4F8JA 3S5UA 2JFVA 1YT5A 4CL0A 2HZBA 4TVKA 4F3KA 2A2ZA 2SNIE 4G0QA 1JLLA 3F5SA 3IXQA 4QXMA 4MQMA 1WDLA 1XTBA 2ADMA 3ITDA 5FT9A 4DLSA 4DLAA 4C7OB 2WAXA 1GPNA 2K7FA 1DBRA 3O8NA 1M74A 4PSUA 1ZRNA 3DDWA 3IOYA 1G59A 3BHNA 3OZGA 5TPZA 3FTFA 2I0FA 1WMAA 4BB0A 1LFDB 1NGSA 4DC0A 3P2OA 3N2KB 2K2WA 4GPAA 4C78A 1RRGA 3A4NA 2QM0A 3KSZO 2FPUA 3W2GA 3D3NA 1OLOA 4I55B 3TKAA 1FS4A 4UTNA 2W8ZA 1ST2A 2RG1A 2Q46A 4KQHA 2TMYA 2G08A 3FPCA 2ZQZA 2EFYA 1YBHA 1ZUWA 3ILSA 4ON9A 5COBA 3WRXA 2WINI 3N8DA 5AM4A 1C80A 1R5JA 2B8EA 2EIHA 3HO6A 2GN1A 4WACA 4BAGA 1WD5A 4TXNA 1JEOA 3GCGA 1OLXA 1TUGA 2HSWA 2BAGA 1R37A 1Q3KA 1SBZA 2C5BA 1UOOA 2JRCA 3K6SB 4ITUA 2D62A 4FYMA 5AJVB 2JCBA 1BE8A 3T0GA 4DILA 5JD4A 5BWLA 3H3JA 5SYMA 1RRCA 1XAGA 3VZDA 5EPOA 2XCSB 3K0SA 1LSJA 2UYCA 4MDHA 4ZODA 2QQFA 5JH7F 1EFVB 2YN4A 2BGIA 2J85A 3H4VA 2PX8A 4NYJQ 4QUGA 5KNDD 4LXXA 4KUEA 2FE1A 2WUGA 3NIGB 3OC0A 4BNVA 4RK1A 3K1YA 3QE4A 4L73A 3TTYA 2FWPA 4I55A 1UPXA 3TE7A 2CXOA 1E5TA 1XZNA 2BRUA 2EL7A 3N2GB 4N65A 3OIGA 3FHJA 3AQIA 3DOOA 4G67A 5AOBA 5IRCD 2JFHA 1L7AA 2X0KA 5ALTA 3ZK9A 1GR0A 2ACEA 2B9EA 2D13A 3OJEA 2RHLA 1QIHA 3I6YA 2OVFA 3I1IA 3MTJA 4FIDA 3HUUA 3PNLA 2QJWA 3ZI7A 3MGAA 3NHRA 4U9HS 2P4QA 5E6UB 5E1MA 2EZUA 4XGNA 1X87A 3PQ4A 2FY8A 1VG1A 1EK2A 2OR3A 2QJFA 4ZPJA 1A4XA 3LXXA 4CWAA 3K6SA 2P35A 1EAYA 1LXCA 2XAAA 3TM4A 4OCZA 9ATCA 2NTNA 3FJOA 1C7ZA 2BSAA 2CJWA 3UZUA 4MZDA 2Q3DA 5IG2A 3TXXA 2B2XA 3O5AA 3NONA 3NATA 5DYIA 1VLJA 4Q1DA 2PD6A 2BKAA 1YR3A 5TT0A 5K0CA 4KPUB 1Q0LA 3OEED 5D6NA 5K3DA 4MWBA 2GSWA 1U3VA 5CTJA 1EFHA 4ZQHA 5H0IA 5JZMA 4M1WA 2PX4A 4IRXA 4B82A 4D8WA 3IUQA 1E3DA 4BN4A 4RPHA 5LB2A 1JXQA 5JJLA 1CDDA 4Q4JA 1XEXB 2Q6TA 4PYIA 3DMTC 3Q2IA 3V1KA 2WE7A 1DJQA 1DQYA 4FHEA 4H6VA 1M72A 1XZFA 3DMFA 1BCRB 3K31A 4KE7A 4NE9A 4XX1A 4ND7A 3R74A 3M3PA 1T4MA 3L01A 5E6UA 2C1ZA 2PS3A 3RJZA 4ZYWA 1I1HA 4Q03A 1ZWKA 4RZIA 4DCMA 4X63A 2LUOA 3G1WA 3GD5A 3V9AA 2O2IA 3IDZA 2K5UA 3F96A 3HCPA 2D1FA 5EMMA 4AYWA 3ADPA 1DC6A 3H0EA 2O9JA 2NXCA 3THXB 2EBFX 2XITA 1L9KA 1DAFA 1N2OA 2PY6A 4Z0NA 3TIGA 4N54A 1U0HC 4ZZ1A 2ISCA 4JZYA 5KYKA 1QHHA 1X2BA 2OV3A 4FFPA 5TMPA 4PX5A 4AO6A 5AKYA 1O97C 2XOKA 4AN1A 3D54D 3CBGA 3GFVA 1Z8NA 4DLWA 1BMTA 3LHKA 5HFNA 5JSUA 4XD2A 2EIXA 1U99A 3HDJA 3HKBB 5G0VA 4B6QA 4OI0A 2GUWA 1R5OA 3EODA 4J7CA 5HYVA 5HF5A 2QRQA 4L85A 4CIAA 2CCKA 4R5HA 4YDQA 2FMIA 2B8NA 1EEHA 4FHGA 2R65A 4P3PA 4IYRA 2FPPB 1JI3A 4DTCA 2PU5A 1NF2A 2CLFB 3I9MA 3K96A 4JYBA 4O4LF 5FUVA 2H2HA 1STOA 1T8PA 4JIMA 4D02A 1A2BA 2B82A 1ZM9A 4Q37A 1LNZA 1W0KA 1MG0A 1WUTA 5K8CA 3QHQA 2GTIA 4BNKA 4LJRA 1IONA 4UZSA 1JEDA 3V8MA 3ZQJA 4PBSA 3MJEA 1KEEA 2HDWA 1C3VA 2X5XA 3HL0A 3ZCRA 1MC4A 5AI0A 1M1ZA 2F43B 2F3UA 1EUDA 2J87A 3GT7A 2VH1A 4Q02A 4QEDA 5JANA 5F9HA 2F9FA 2PGXA 1KSJA 3V7UA 2JJ8A 1G8SA 1PJQA 4KXWA 5JDCC 3W9SA 1EGVB 1FOEB 1XQ6A 1QSGA 3I1JA 3JWPA 1O0BA 1F5NA 1O89A 1TA0A 1Y8QB 2EW2A 3ESDA 1B23P 4U1RA 3M33A 4DIOA 1YULA 2KE5A 3SFVA 3T3GA 2LVBA 1K8YB 4Q7MB 1ORIA 4LPKA 3RT7A 2FPPA 1UKEA 2Z5LA 2X0EA 3T8YA 1CG6A 4KQCA 2FWBA 3BWYA 4G81A 1A04A 4HWPA 1GGVA 1GPUA 3LY8A 2JFPA 3CUEF 2BKVA 3QU2A 2Q9AA 3TTVA 4XQEA 4ZFNA 1L5WA 2QMOA 3EIXA 3F6YA 1T36B 2IXTA 2JJ2D 3QWIA 5CB4F 4UM8B 2W4QA 1P60A 4MGKR 2X8JB 3CKYA 4F4CA 1KHTA 4L16A 2X22A 4IQ8A 1HYHA 2CL0X 2F43A 4RIFA 1P7VA 3DBVO 5CJ2A 1NXPA 1WCIB 1Y4ZA 1JHUA 1RS0A 4G5XA 4KXQA 1RI2A 1VL8A 4LXQA 2JKZA 1KMNA 1G6Q1 1V7CA 4G0UA 2AI2A 4LEIA 3AFGA 1E94E 3G9XA 4WAUA 1YKGA 4NZNA 3THWB 4GQIA 2E4ZA 4GSKA 5IYZF 3WL7A 2POQX 1OJLA 2O3SA 2VH2A 4DJTA 3K8OE 4QQKA 2F2TA 2VHZA 1KARA 2ID9A 5CVCA 5KREA 5KHLB 1U3CA 3I3SR 4KLNA 3NTQA 4LMPA 3NAGA 3T3PB 3TIVA 5BMVB 1Z6YA 1ZD4A 3R7DA 4IJWA 4EGJA 1T36A 2QAGC 3ZW7A 3ZVKA 1SBTA 5FBHA 1KWKA 1T0BA 2PUEA 4WKBA 1GWNA 3SDBA 3ZU3A 2X8JA 3C3KA 2CB9A 3VKHA 4NCKA 2H92A 1DCKA 1TTQB 1VJTA 3MWGA 1WCIA 4Y8VA 5H59A 2PZJA 4YRJA 1TFUA 5CDFA 1B3BA 1T3SA 2ECOA 3B9RA 4QFBA 1M0WA 1SU8A 2KW5A 2E21A 5CFRA 5EE3A 3H83A 4UARA 4HMQA 3EZFA 1TL7C 3QE9Y 3SBDA 1LF5A 1BS9A 1JDZA 2CUNA 3DYBA 5KO2A 4RTLA 1ST3A 3M6WA 3AM3A 2J46A 2WTXA 1EK0A 2CCJA 4NOJA 5ESRA 5BMVA 1GZVA 4HNAB 4TSFA 1BMQA 3SYRA 1DS6A 3TH5A 3VYWA 1C4WA 3T9AA 1XALA 3W5JA 4F4FA 1VG9B 1JQBA 1ESZA 2JW5A 1M2VB 1PSDA 3H9GA 4Y6RA 3GGGA 1Z4KA 4BX3A 5LWHA 3CURA 3GOQA 3B20A 2FSHA 5IEBA 3Q11A 2H5IA 2WSBA 3DQZA 1IDOA 1D8AA 3ERCA 4KK3A 3JS5A 3ORQA 1ZRSA 2NVUA 3CRRA 2C8KA 1OX6A 4FONA 4FYHA 2EJBA 3MJ4A 2NYAA 3FDFA 4X71A 5BUSA 2KSQA 4NAVA 3P2YA 3KWJA 3TR5A 2OD7A 3IT2A 4PXYA 1U2DC 2ZJ4A 1IN1A 2AVNA 2A0UA 4QDOA 1WBJB 2PL9A 3D8BA 1C7FA 1JEAA 2C4NA 1OFUX 4D9HA 1O2DA 1FS5A 3FVRA 4KO4S 5IZCC 4KH1A 3KYJB 3LPCA 3N2IA 2F67A 3MQFA 2XHEA 4ZDIA 1EG2A 4U2EA 3TNJA 3HYCA 1UPFA 2BY4A 4HKTA 4HNAA 4KYTA 5H81A 3IA2A 4WUVA 3D4PA 3GJXC 1P33A 4WOKA 3FWZA 1XZAA 2J9RA 3CZQA 1JUDA 3BHMA 2ZAGA 3IVRA 4L3WA 4UAUA 2B5VA 3PC3A 1M5TA 3UN1A 4K6CA 2Z8XA 1V16B 2WYVA 3FIUA 2A57A 2LCQA 1XFDA 5E9JA 3HWSA 3EVCA 4YMIA 4HUJA 1A5SB 2BFMA 1Q1QA 3KR0A 3OUZA 2HV8A 4JZKA 4K26A 1DWOA 2P9HA 1YJ8A 3T7TA 4D0NA 1UJMA 1MFPA 1V37A 2HQRA 4BV9A 1XN1A 1EFRA 1O4VA 4P54A 1S6YA 3G9UA 5CVDA 2VOJA 4R8SA 4ZT5A 5BSTA 3WDKA 4DG5A 4Z9YA 3UW3A 2Z4SA 3BOSA 4PXSA 1UBGA 1RQLA 1LY1A 1OILA 2HBQA 3EVDA 1KJNA 3GRKA 3KVOA 4JVOA 5AJZA 2HBRA 1OIWA 3GBVA 3O1HB 4PIPA 3KJGA 1RC8A 3MB5A 2W6JD 2WFMA 3G2IA 3OZWA 4S3MA 3K2IA 5LDDC 3WWCA 2PBFA 2R5FA 1ECPA 4CG2A 2GK7A 1NG1A 3CLSC 3NOVA 4EMTA 4V0NA 5LYJA 3RC3A 1FSSA 3SYNA 3VC7A 4A2PA 4DCOA 1IBRA 5F1OA 4ZDKA 3NBUA 3NHMA 3JARB 1H9BA 1N6LA 2V4ZA 2V7WA 3KG2A 4O5AA 3V4OA 3ZY3A 1NYLA 5JZ9A 4JEMA 3GUVA 3E70C 3QUCA 5FADA 1VKHA 3IDQA 1MDBA 4LI3X 2YUIA 1RZ3A 2NW6A 4I50F 4IWYA 1GNTA 3QXJA 3QLUA 1ENZA 1R4MB 3HGMA 4OEHA 1RM0A 2YJ6A 4FOSA 1JN0A 3T41A 1J2TA 3VAYA 2QLJA 3T4PA 4HTFA 4MQFA 2VNJA 4DVGA 4Y6GB 3COSA 3KEFA 3W3AA 1A9XB 4LSZA 1KQGA 4AJ4A 4CLOB 5JY1A 5DNYB 2W6OA 2I66A 3D43A 1YS9A 2PXCA 3N58A 4PLYA 2P9GA 1A0OA 5D84A 1E1DA 1C3OA 5BURA 1XB2A 1E0KA 2R00A 4YS6A 4L8FA 1Y6GA 1NQWA 1QGUA 2DT5A 1B0AA 1K5DA 2YJNA 4JLDA 1BQ3A 1M73E 1UP7A 4ZI5A 4AJLA 4UBKA 3HSYA 3A2KA 5EMJA 4CFYA 4CLHA 1TJ3A 1Y63A 3JARA 4N0MA 2YRWA 1K4KA 1IK4A 1C3XA 1TCBA 1OBOA 2DR0A 2UYQA 4KNVA 4Y30A 2QKYA 2H52A 3CUVA 2BLLA 3A4VA 1VFNA 4GPTA 5E38A 3W90A 2IKSA 4URXR 3VR1A 1KRXA 3ETNA 1R4MA 2KPOA 4X1YA 4EJ0A 2AZDA 1CKEA 2ZIWB 2CLLB 2XOEA 3Q7TA 4WOPA 4ND4A 5TPWB 4UU0A 2WMDA 3UTDA 4DOMA 4O3MA 2ODQA 2CNKA 3CLRD 4CLOA 1Q22A 1LGYA 4IF4A 4IM7A 3CKLA 3OD5A 2GGSA 3T9CA 1H4VB 3VBCA 1I10A 3DOCA 4RD3A 5A7HA 3RRZA 3MBIA 4BO8A 1FP1D 1J6UA 2HA4A 4CMHA 1XQ9A 1A8QA 1Z6AA 2ZIGA 3QOWA 4G2NA 4N7BA 5EJFA 5E9AA 1R8XA 2CBZA 3JASB 5IZ4A 1GLNA 2O8BB 3D9QX 3K72B 3RUIA 3RYCB 3PLNA 4J2TA 2RAUA 4GSYA 2H00A 1Y8CA 2CHFA 1RACA 4OREX 3PQCA 1JSXA 4XB2A 4ENWA 2G9QA 1I13A 1YWGO 1N77A 1G20E 1GAEO 4JEUA 2I8CA 4EMUA 2BELA 4K9MA 4DIBA 4BQFA 2NNWB 2I3BA 4CF4A 1QYDA 3A4YA 4EAAA 1Q0HA 4L0DA 2WVAA 3N2EA 2BGMA 2OC4A 2XZOA 1ZHHA 3AOEA 1JHPA 2P9YA 3L9WA 1PVOA 3LTEA 4LDPA 4G1FA 1T5LA 3JPWA 3O91A 3P26A 4GM0A 4NKRA 4KN6A 2E85A 3ROGA 3RRNA 2Y1OA 4EZEA 3GT3A 4OKSA 1T43A 2ZWPA 5B1EA 4GYWA 3NHKA 1C1DB 1ZI6A 2YL2A 4B2LA 3L41A 4DSZA 4NNPA 1AV7A 2RHDA 3A1EA 2GTPA 4F97A 2B3DA 3D3EA 2FZLA 4FOPA 3NYQA 5L4SA 2ODTX 5JD3A 1P5ZB 3JASA 3DWEX 3ML1A 3RRYA 3SJUA 3H11B 4XCVA 1CF2O 3MMPA 1CHDA 1FEZA 2I4OA 3COYA 2F1IA 16PKA 2WU3A 2JIZA 2WI8A 1OGJA 2ZAYA 4JEIA 4DAEA 4ENPA 5JOQA 3RWOA 3ZW9A 2NO0A 3P20A 4IH9A 4I19A 1USKA 4JQZA 3HUFA 2Z08A 2PSSA 1UKCA 5EAIA 2D00A 2WSYB 1PR1A 1K7YA 2BJHA 3PDJA 4YB8A 5HK9A 3UJ9A 1E3JA 2QN8A 4AKEA 2BFPA 3NV9A 1XC7A 1RLUA 5I9MA 2EFJA 2C2BA 1CRWG 1JPUA 1VCIA 4WEOA 1JMKC 4X8LA 5EZ5A 1Z06A 3UQYS 4ERNA 1YTUA 3VR4D