2AC4A

Crystal structure of the his183cys mutant variant of bacillus subtilis ferrochelatase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSACSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title Metallation of the Transition-state Inhibitor N-methyl Mesoporphyrin by Ferrochelatase: Implications for the Catalytic Reaction Mechanism.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 120
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2005-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac4A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac4A02
2HRCA 2C8JA 2HREA 2JH3A 2PO5A 4KLAA 2PNJA 2HK6A 3LYHA 4KLCA 2XWQA 1AK1A 2Q3JA 4KMMA 1L8XA 4MK4A 2AC2A 1C9EA 1TJNA 4KLRA 2XWSA 3HCPA 2QD2A 2QD1A 3GOQA 2QD5A 1LBQA 3HCOA 2PO7A 1DOZA 1HRKA 3HCNA 2Q2NA 3AQIA 2XWPA 3M4ZA 1QGOA 2XVYA 2DJ5A 2AC4A 1N0IA 2XVXA 3HCRA 2H1VA 1LD3A 2QD4A 2QD3A 4CCSA 4F4DA 2Q2OA 3W1WA 1C1HA 2XVZA 2H1WA
chains in the Genus database with same CATH superfamily
3TQHA 5LNK1 2ZJ2A 3WBKA 1P61B 2EX0A 3SSNA 4EGFA 4MMXB 4DWJA 1ZH2A 5AKKA 1KNXA 1YTUA 4RFSB 3HJTA 3SP1A 5MN4A 1Y5NA 5JMWA 4P0PB 3PFGA 3IALA 4I8DA 3N0RA 1VLLA 3LCJA 3FHCB 2ZKIA 1G20B 1COZA 2OB2A 4NCXA 3NHPA 1W5BA 4L3VA 3L7KA 5EJ4A 1ULHA 3QNMA 1HG0A 3EASA 1Q3HA 5AOAA 1G42A 5DX0A 3QX8A 1W34A 4G8JA 3R23A 3K8OE 4BGEA 4KR9A 3U44A 2VA8A 1R8XA 1E4VA 1Y9DA 4NMMA 4H3SA 4WFJA 5EKDA 5KOHB 1D03A 2BFAA 4TTIA 1J8DA 2CB9A 3IMCA 4RF3A 1IQPA 5DGCA 2W2NA 1EUYA 2QBYA 2C98A 4WOBA 2WKRA 4QTZA 5AW3A 3IR6A 4HWKA 2FG6C 3THRA 4O4IF 3IR5A 5DBHX 3OQVA 2DX7A 2JI9A 3DHWC 4XQEA 2EXXA 2PPLA 3E9NA 4PNPA 3SSOA 5AKZA 4G84A 4XDGA 1DDGA 3I9JA 1NJ8A 3KQLA 1EH5A 4BFTA 1JBKA 2C99A 3C1OA 1NM5A 1JLMA 3QU7A 4GAEA 5DLYA 3TI9A 3IDZA 4Z4HA 2YUTA 2UZ4A 5LQDA 4OA5A 1ONNA 4BMSA 1MGOA 3IUSA 5JVDB 3H6KA 4HD8A 1A72A 4ZIRA 4PBTA 3G5TA 4JVNA 5KNLA 3DLPX 1PJZA 2Q9AA 2X13A 4D9HA 5A5FA 3AETB 1QLJA 1DEAA 1CRZA 2EBHX 4BLQA 4DLLA 1OLUB 3OQNA 2IOHA 5B58C 1ND5A 1UMDA 3DPIA 3PDJA 2H0QA 4H7EA 3K72B 4OKNA 5FD8A 2PM8A 3UFXB 4A6DA 1XEXA 1L2TA 5JLAA 5DMXA 1O5TA 5BWOA 1G6Q1 3CLRD 2GN2A 1LW7A 3KLOA 3Q2OA 1HLDA 3FM9A 1V3VA 4J4HA 5AK5A 3RYFA 4GVXA 1KU6A 2XWQA 2RGYA 1PT6A 3AIKA 3U09A 3RUFA 4GL2A 3NP7A 1QO0D 3T1YB 1U7PA 2GD2A 2UZ3A 4DMLA 3GXBA 2G70A 1GGKA 3NT5A 4JHXA 4MS3A 2NZJA 3UWOA 2DPYA 4FIDA 1PS8A 4LOLA 3OQOA 3H8WA 3L7BA 4O1IA 2GEKA 1XRSB 3BULA 3N0TA 4JL8A 4RH3A 3WOHA 1CB7A 1F5NA 3ELDA 4B35A 4Q4DA 2BPOA 2OMEA 1IPHA 1PSZA 2G1AA 4PLHA 1S9HA 3DUFB 1J21A 4N8EA 2P1DA 3KTDA 2Y1LA 1JAHA 1GQQA 1LJLA 1PHPA 2ZYHA 1GUZA 3STYA 4FVTA 3OHMA 4OOFA 4IIUA 4LXXA 4ZCPA 3I32A 1EXDA 2EFHB 3L6BA 3DO8A 3PNQA 4TKMA 4D0NA 3L1KA 4A8HA 3DGFC 4NEGA 4NENB 4UNSA 5IYZA 4WUTA 3PPIA 4W9MC 4YCAA 4H4CA 3N7TA 1FXWF 2C9BA 1I7DA 2K87A 1KMHA 2P3OA 1NZFA 2LIVA 3GLUA 4Z7NB 1R0CA 3U3MA 1C1YA 2O2HA 3IT3A 5ALFA 5EEGA 1QE0A 5FOTA 5AIBA 4E30A 2IVZA 3GG9A 5IULC 3K9LA 2YY5A 3NQ41 1WV0A 3KG2A 5TQ0A 3U40A 2I62A 4JUAA 5BVHA 1KJJA 2WE7A 5P21A 3OJCA 1P1CA 3OT5A 3DQZA 1ODIA 2CDCA 4CN9A 2Z6UA 3ET5A 4KXMA 4FOLA 4L2IB 4TV9F 2DM6A 3C7TA 3VR4A 5K0BA 3L4SO 5L6MB 1WV1A 4WTOA 4L4ZA 4RSHA 1VL8A 2FE4A 4AY6A 1MUUA 2B1GA 2H51A 1R9JA 1Q1NA 4L0DA 4IF4A 4AXXA 4BV8A 1NVKA 1CYDA 1AY0A 2BJVA 3COYA 3E5MA 3S2SA 4XDHA 1QIEA 1E0JA 3GRYA 5IN5A 4AN1A 1QGED 3CTMA 3TF5A 3LYUA 2ECKA 4Q3BA 3LIPA 5GOTA 3OI7A 2CXUA 3PC7A 3QKRB 1T0HB 4W4TA 4FK8A 4LJYA 3HCBA 1CDDA 1PO7A 2B6HA 2BGKA 2I80A 1P9WA 2Q1SA 2RHJA 2W2QA 3AJRA 3I2HA 3WRWA 3HVRA 4DMGA 2W6JA 3QEKA 5JAZA 4ID9A 4XM1A 5LIRA 3NUGA 4BQNA 1ZSYA 3KXIA 5A9SB 1SU7A 2BAGA 3L93A 3TK1A 1G0NA 1KAGA 4M7PA 1NVVR 2I8AA 2O2ZA 3PL1A 2BM0A 4IKOA 4QXOA 5LUBA 1KXJA 2IXGA 3NKFA 3O03A 3FUXA 4GI7A 2O8FB 1OQAA 2LCIA 3QI7A 4B0PA 3GEDA 3C1TA 4URHA 1OA0A 5HE8A 2DKOA 3WJ7A 2I6QA 1OXKB 1JEYB 1I6MA 1LU9A 2QB5A 1QH1B 3AYXB 1U1GA 3B36A 1LY1A 3AL2A 3O4IA 4DCVA 4DWWA 2RONA 4C22A 4OLBA 3IKLA 1LTQA 3UT6A 1YFLA 3STXA 2ACKA 2XB2A 4TSRA 3TRIA 3A9TA 1YS4A 5ALEA 5G4KB 4BN0A 5CDTA 3NOQA 1Y8ZA 1PNQA 4QPDA 2LXNA 4FHFA 4WT7A 3BB1A 3WIUA 4GKAA 1FYFA 3M8KA 1VIDA 1Q1ZA 2XMQA 3NAMA 1E0SA 3CX8A 4P08A 3WLQA 4KGZA 1UANA 2X9GA 4TXMA 3TQSA 4I19A 2E1RA 2D1QA 4E15A 2AFHE 3CRQA 4LJ9A 4X61A 2GWHA 2EP7A 3TLAA 4IIXA 1MV8A 1C1DA 1KYVA 1Q11A 2CC2A 2DLDA 4JU8A 1ZDMA 1TZMA 3ZV5A 5ICMA 4RZIA 1ZI6A 4FMPA 3NZEA 3PHJA 1P60A 4IAOA 4HFRA 5BURA 2W2MA 1G4HA 4UBMA 2BISA 2BM1A 3AB8A 3WAJA 3FIJA 3K3PA 1O96A 2ET6A 2OAGA 3EODA 4HNAB 3PI7A 3SC4A 4ZCMA 1FFXB 2B8EA 2CT8A 1Z45A 2HWUA 3UV6A 4E5SA 1QRSA 2AEFA 2I66A 3I0ZA 1V47A 4RFLA 3DEAA 4BBAA 4BLUA 4H27A 3ZZ0A 2BD0A 5F4BA 1BXZA 3W9SA 4C14A 3ANLA 5K8VA 2FQ1A 5KAPA 3PTZA 3MD0A 4I08A 1D6MA 2WAAA 4PGAA 2BH9A 3V55A 4ZPJA 4D9NA 1WY5A 3DNPA 4JY7A 3LT2A 1QGDA 2R7MA 1HDYA 1WM1A 3WICA 2G9QA 4GXNA 4YEDA 3U4MA 3T06B 1X9GA 4HGZA 3SGLA 1EU1A 2D4AA 1JT9A 5EPUA 3M4JA 3VH1A 3NHJA 5ULLA 1QVAA 4DCGA 4UAJA 2FQXA 5DNEA 1QG4A 3DP9A 4QA9A 5H80A 5C7LO 1M5TA 3O8QB 3UMCA 2KLBA 1C3JA 1KYIA 4GP7A 4H77A 3UO8B 3BCHA 2EQ5A 1HDRA 2FQWA 3WKAA 3G1TA 3WL7A 3U1BA 2C7PA 2F8TA 1OWOA 1Y4DE 4EBFA 5A5EA 2ERYA 4L3OA 4RA6B 1GITA 1NMZA 1R0YA 3ESCA 2F1HA 3W3AD 2C1EA 4S35A 3MZ0A 3KQUA 1OFHA 1PL6A 1RZ3A 3RARA 3MG9A 2FMTA 4HEJA 5B5SA 1EBBA 4AY4A 3ZHQA 3P4XA 4ENRA 2X2EA 1VKOA 1Y37A 1FTGA 4OY3A 5AOCA 4MPDA 1W0JD 5JEEA 5U4QA 4II7A 4EGSA 3SF8B 4Q5IA 3DE5X 1BRMA 2W2VA 1RVDA 2PUGA 4QTTB 2YWXA 2IK8A 1RWQA 3B8HA 4GOOD 4OHUA 4PIVA 3H9JA 4AKGA 1OFTA 2CLEB 3IV7A 3MINA 4Q7JB 4XQCA 2PSFA 3EFEA 3SHFA 4C4XA 4X7PA 2WIKA 3P9ZA 3WLJA 2VATA 1DUVG 3AHJA 1HWYA 1M34A 2R79A 1SC3A 3EXFA 1DFGA 3QEMA 3O3OB 2CJXA 5F12A 1RHKA 4B81A 5C46F 2OFPA 2QMHA 2UZ1B 2GZDA 4IIDA 4HNGA 5JYDA 4BLVA 1KHTA 3N76A 1U94A 2J3JA 3V9PA 4B43A 1D7AA 2QVXX 3C3CA 3V2GA 1FTQA 4GDMA 4IILA 2I3AA 5BWBA 4JNKA 3B2QA 2CJYA 5JXIA 5KQSA 3GDOA 1RJ9A 3P9CA 4LZPA 4W9NC 5JD3A 5K99A 2VSYA 1M2OB 4MTLA 4RA9A 1IN5A 1CRLA 5EN4A 5BN5B 2FB9A 4JYAB 3HB7A 4BNWA 5BUCA 3MRSA 2C4NA 2NOAA 3I9OA 1BXKA 1DBQA 4KXUA 4OJKA 3ZEIA 2FZCA 1QVRA 3HU5A 3OOWA 2WB2A 2EKQA 2Y0DA 1KQNA 2XCRB 4JXZA 4CMJA 1DBVO 1G8GA 2F1IA 5EL0A 3KKMA 3N8GA 4CIBA 2H4YA 2ZB3A 2Z2KA 4EJ6A 2I87A 1A9ZA 3GUHA 3MS2A 4PSCA 2ESRA 1U04A 2Z0MA 2ZSJA 3QVLA 1T1GA 2HNAA 4EGCB 3RF7A 2P41A 5LQKA 2FKAA 5I8ZA 2NZ2A 1VCNA 5EOVA 2AN4A 2Q9CA 1V39A 4E0BA 1Z6TA 3M6MD 4TXNA 3L7LA 2X77A 3DO6A 1QB7A 1U99A 2JZNA 3HR4A 3LIIA 1PV1A 1W88B 3L41A 1J39A 1OXSC 1I4LD 3QTBA 4IIJF 3QG5A 3R3UA 1HT1E 4V02A 2EFCB 1UXOA 3KPJA 5CP8A 1NG1A 1BDHA 3O5AA 2D5LA 4LTNA 4NE2A 1L3BA 3TGWA 1Y5IA 4I55F 5H9VA 3REQA 3W4KA 3VMFA 4PAWA 4EYGA 3M83A 3FUCA 1HZZC 1UFKA 5T67A 2XWBF 4DC9A 3ZWNA 1SVWA 4CLEA 4F8YA 1JAXA 2FMKA 5BUQA 3UA4A 4L08A 3VZRA 3R4VA 3V48A 1UXGA 4K5QA 1G1AA 1JLLB 5REQB 5F1PA 1WX1A 1PJ3A 3MJVA 3PCRB 3R7WB 3W5IA 4BNDA 3H86A 4KOAA 4LMRA 2DWQA 2PUAA 1GSHA 4PYRA 3VYRB 4MULA 3GT4A 3MQ2A 1KP2A 1T2UA 3BXFA 4MUXA 5CB4A 3Q7EA 1YA6A 4PLGA 5J23A 4J0QA 1IEXA 2H2HA 4BC1A 3M4NA 1VP9A 2GZAA 1W36C 2FX3A 5FO1A 1XZLA 2AQKA 3PQ3A 2XUZA 3MOGA 1AHIA 5U4XA 4BCBA 5J47A 4JFRA 4TKLA 1CUZA 1KERA 1UK9A 4L78A 1HZJA 1K86A 4I2VA 4CEHA 2BGTA 4BNLA 2QRKA 4X6XA 2XKKA 3H5WA 3QF7A 3VTZA 5CFZA 1Y5MA 4WY8A 3QW4B 4Y98A 4Q3CA 1YDEA 4DSTA 1DIOB 4R1PA 2PR2A 3D1VA 1T8SA 4EVQA 1RM0A 5FFFA 1SXGA 2ENUA 2MINA 1O0SA 1E5QA 3M9XA 3ZE6A 4J43A 2C2GA 2HA3A 3IUBA 5I7UA 1FU7A 1PVVA 1LSJA 3R0JA 2PMBA 4H9GA 4PXAA 1WWKA 1U8UA 4ID3A 1AQNA 4FZRA 2QXYA 1YIDA 4QHTA 5EIBC 3WL3A 2ORED 3ROFA 1W25A 3I05A 1G8KA 4BC0A 3ESYA 4FP9A 2HJWA 4H3KB 5LBTA 3F0TA 3N07A 3U1VA 4NMHA 5I7RA 4A5OA 4H2DA 1WZNA 4ERXA 4YJ2A 1XTRA 2J59A 1NOIA 1EAYA 2ZRKA 2WNIA 4GP6A 2IXDA 2PSSA 1YDMA 3DDUA 1UBMS 1Z83A 3G9QA 5G4LA 3KBOA 1YV9A 1NF9A 2XUAA 1D2NA 3PIRA 4NBNA 2C7GA 1EFRA 3OIDA 1JQBA 4WXRA 1YRLA 4NCKA 4IS2A 1SUCA 4C29A 1H4SA 4LMAA 3PUIA 4JITA 1EVZA 1UDAA 3S55A 1NQOA 3FNHA 5CDSA 2AEEA 1EVQA 1FP2A 1E58A 4IUCS 4FE7A 5FNVA 2C3YA 4BAGA 3P2JA 2XB6A 2JAUA 4MWBA 1ZH0A 2PKEA 4KVZA 3OU2A 4MAFA 4X63A 5TSDA 5TVKA 1V3TA 5KYGA 4LJKA 4QRHA 3HG7A 4HAOA 1FRFS 5JZVA 2OGWA 3TIFA 1I6LA 4TWZA 4J4BA 3S44A 3DNMA 2OAEA 1F2TA 3AF2A 3RSCA 4BTVA 3BRQA 3IESA 4G9GA 3U49A 3AEXA 2PGLA 3L6DA 2P78A 4BQPA 2PH3A 3BWXA 3DDNA 2YJGA 3OUTA 4AKHA 2PIDA 3FCEA 2JIRA 2O1EA 2G7MC 4ZT5A 2RAFA 4LYEA 4R2WA 3DM5A 1R0WA 3BK1A 3E81A 3QMVA 1Y1LA 1DAFA 3GP5A 1MXFA 1L0BA 5HP4A 4CV1A 3LSTA 3ZLVA 4ENQA 3OHSX 1QQAA 1C1XA 3FHJA 2GN0A 4O25A 5D3KA 4ARZA 4Z7OB 5KC8A 3R41A 4FD2A 3SMQA 2YHIA 2VEOA 3I8SA 3U4HA 1E79A 1BGWA 3BIOA 1EAMA 3H1GA 3V4FA 2HHCA 2NYVA 4Q1EA 1XXHA 4OHRA 1X77A 1UBOS 3CT4A 2TMYA 1QC5B 3BHMA 3OC0A 3ZU2A 5I7SA 2OO5A 3NWJA 2WZDA 4J0FA 1DC8A 2P65A 5IKEA 1BU5A 1GRRA 4CI9A 1RZRD 3IQZA 3Q3GE 3RFVA 2VFAA 1DAOA 2F2TA 4NOLA 3TDNA 4HDNA 2JCSA 2O2IA 5IK2D 1XIVA 4DEYA 3PX3A 3GHYA 1DSSG 4ZVKA 3PFBA 3UCFA 4AL4A 4EO7A 4L07A 4BNXA 5CD9A 5KSWB 5E6SB 3BH6A 3QWFA 3KNZA 5CU7A 5DYNA 3O7WA 5I4IA 5JSUA 1NXWA 3LVBA 5EPEA 2EBUA 2A9OA 4HADA 1BCRA 4U8HA 3MA0A 4D3SA 1Y34E 4Z7JA 1SA0A 3AEUB 3KQYA 4ITVA 1XZJA 3PR1A 3NGMA 4UEWA 4E5MA 1KMNA 3OKCA 1UBUS 3C70A 1X1AA 1M1UA 5CVDA 4EJ2A 4TZ0A 1R6AA 1YL5A 2WP8J 3NAZA 4ZAXA 2Q3BA 2WQ6A 2B1QA 3MYYA 5JHGB 1VJRA 4GFDA 4KXQA 4KTTE 1M5UA 2G9UA 2HREA 1CC1S 5FA6A 3WK8A 4W8GA 2GEBA 3EDMA 4YV7A 2JFGA 2XI4A 3C5WP 5CMLA 3I5XA 1FDIA 2QUIA 2IZ5A 1U0JA 2FW6A 3VRHA 3E2IA 1SBHA 4DNQA 1GG5A 3U3OA 2BIFA 3C4QA 4IOLA 1GNRA 2XVYA 4ZQEA 1GNSA 1Z0IA 4Y2PA 1DO8A 4XWTA 4MV8A 5KPJA 1QYIA 1SKAA 4K6HA 2WU1A 3HJAA 3JQBA 3CEPB 3CE6A 1QFZA 4TM7A 1BA2A 3I1IA 2CJWA 3E18A 1J97A 4WXMA 2IUUA 4R54A 1CT9A 3ILVA 5JS2A 3ZW8A 5EJEA 1UQRA 3BF8A 3A6JA 3JQDA 1RWKA 3LVFO 4G97A 4LJ5A 2GBLA 1NQUA 1ELOA 1C30A 2W4MA 3K9QO 2D62A 2JLYA 4TL7A 4X1KA 4LHVA 2YR0A 3HKDB 4GR4A 5AMXA 4BXOA 1NKSA 4F60A 1VXOA 1VFPA 4JT9A 5DHQA 5TR9A 4TVSA 3WRYC 3DV0A 2P7HA 2BEWB 1XALA 3JU3A 3PZBA 4Z0PA 5B1HA 1X8JA 3UENA 1IXSB 4XB1A 1M8FA 3V1LA 1QNLA 2Z08A 1RRMA 2MR5A 2O8DA 3VO2A 4Z1MD 2I76A 3PKJA 4TMZA 3SAJA 3KT0A 3U1TA 1KS9A 4MIOA 4U7FA 1CNMA 5I9SA 4WBNB 3GU3A 2VPWA 3ZKWA 4EHDA 4HY3A 5JECA 3V42A 3KCQA 2QN1A 3SFZA 2BR4A 1PWHA 1W6RA 3ISJA 1K9SA 3F6YA 2QI9F 4U2GA 2JFBA 3FH0A 1TAUA 4IG9A 4FM9A 4CV2A 1KI8A 5KOJB 2NVOA 3H8VA 3C8ZA 3L18A 4AECA 3BMQB 4BIIA 2VJNA 1G3UA 2A5FA 2YIMA 3D5EA 1S6YA 4KQ1A 1L1FA 1GILA 4OK5A 2GKOA 1F12A 2JS7A 5B2FA 5AW0A 1TW2A 1B8PA 3U7QA 3EQ9A 2Q4EA 2ZKLA 1DTSA 5ADVA 1SHKA 3QPDA 1DJOA 4KVAA 2NSDA 5JD6A 3IEVA 2FP3A 3Q6MA 2WTUA 3GH1A 1W19A 2IEZA 3HDQA 4WJKB 2ZYRA 2MT9A 1GSOA 1FQJA 1Q7TA 4IHJA 1HYGA 2GH1A 3CSDA 1EP2B 2WT4A 3ETJA 3L02A 2D0DA 4WCFA 3EGXB 1RLMA 3NORA 4PZLA 1JNXX 4WX2B 3TW6A 5JJCA 3FBGA 2I29A 4Q34A 3T0GA 5JNUA 3BJZA 3KE9A 2VJKA 3D1JA 5KC9A 1MJHA 4NECA 2ZR9A 2AMYA 3TQCA 3X2FA 2YV5A 4WN3A 1E60A 5CA0F 1EB9A 5BWNA 3FSGD 3R3ZA 3MQFA 3CURA 3FOWA 2GF0A 2XRZA 3DDCA 4OYYA 2PNJA 1ZM7A 2OXFA 1JG3A 1JQDA 2V03A 4OJMX 5IBQA 1VJ5A 1DPGA 2V7XA 3FZNA 2XMPA 3PNLA 5H3CA 3G8YA 2X0IA 3UV3A 1G17A 4BRSA 2R1TB 1TYBE 4B6JA 4UDXX 5J1SB 1YS6A 2GLUA 5I4CA 3H75A 4Q7KA 5EUCA 5LMUB 2F59A 2R00C 3T3NA 1I01A 4ER5A 1VPWA 2YVAA 3QXHA 1P2FA 5CLJA 4D8XA 5K9ZA 3PR3A 2G80A 4NR0A 4B47A 1M8GA 2HLDA 4LK2A 2ZAMA 4TZTA 1UMBB 1TZCA 4E5YA 5JJ5A 2PX3A 1CNFA 1CV2A 3B89A 4OKIA 4AWAA 3EQ2A 5TJ9A 2ID4A 1CQPA 4CR6A 2NVUA 3BMCB 4IKEA 3FHLA 1QF9A 1C9MA 2QRPA 1BMFD 1KAMA 2RKWA 5IFLA 5AUQA 2JJMA 1IUOA 4CF4A 2H85A 2QG9A 2RI0A 2J5KA 2H17A 3IHLA 1CY1A 1SIBE 1T2EA 3NTXA 3ZHCA 3N2KB 3MWEA 1FYXA 2H3EA 2WJPA 5IW8A 2WYOA 1TTQB 4K86A 4B9EA 2GCEA 2DQYA 2WQZA 3KEQA 3NRBA 2P9FA 1D09A 4MWDA 2VT6A 4YMSA 4RM2A 3GCWA 4UVGA 4F3KA 5EQFA 3MSXA 1IOVA 4R2HA 1DFIA 3FZGA 2NV0A 4HXFB 3WWYA 5E1DA 5C34B 4OQXA 1N25A 5BQ3A 2BGUA 3LX8A 4YFVA 4BTLA 2QN6A 3SYTA 4V39A 4LOJA 2PZBA 4FYKA 3OOEA 1F0KA 1J99A 3JQ8A 3OLCX 3E1KA 5DEOA 2UUPA 4TSKA 4XCXA 3CVVA 3ZI7A 2NT3A 3L8ZA 4KQ9A 2QR5A 1JR2A 1XZ8A 4KPUA 2WIFA 1SUBA 1OW3B 1IATA 4JC0A 1PFYA 4QGFA 1T91A 3QPVA 3IRUA 2BMWA 2W7TA 1BN6A 3S8EA 2R0QC 1NF2A 2YCBA 1XZIA 1JSZA 3OP1A 2G5CA 4MINA 3IDAA 4ZYXA 4Z4EA 1UPXA 4BGUA 2KLHA 3NATA 1XNQB 2DFDA 5EEHA 4WZAE 1XD8A 1PEKE 2RBGA 4W1SA 1FFEA 4EUNA 4PPGA 3C3EA 2KB0A 5TT1A 2H1VA 3DDWA 5LQSA 4DDUA 2QYOA 4ENSA 5TS2A 4TSFD 4WESA 3GAFA 3RYCB 3NBZC 2W58A 3AHGA 4DJFC 1R6XA 4PEVA 1D1SA 1FLNA 3CWCA 1CKEA 5UKDA 4QAQA 4ZZ3A 4RFSA 2E2WA 4ZVUA 3PHHA 1Z73A 2WMNB 3CZRA 2E4YA 3SN6A 1A8SA 4BMNA 1H6DA 2C1XA 3EBPA 3HPRA 4FUQA 1GLGA 3KV3O 4XSHA 3RS0A 5GADl 1G20A 3JTEA 1IULA 4UNIA 3SXJA 2QGNA 4M38A 1T6XA 2V7BA 2AMLA 1UR5A 4MUJA 4L5YA 4IGKA 2AUMA 1WMFA 3QENA 4R1MA 5AO9A 3NEPX 1YASA 3PWSA 2PY6A 1WPGA 4PO1A 1XI2A 4WZBE 3W6OA 1JR3A 1ECJA 2IH5A 1TJ4A 4OLJA 3SR3A 4E08A 3FCCA 4X5OA 4HK4A 4HYEA 1V95A 1SUPA 4GKBA 1P39A 1P31A 2L19A 3A36A 2BGWA 3HM9A 4KR7A 1KY4A 1ZK0A 2WJAA 3A2MA 3JZDA 2OILA 4LHZA 1WSAA 5J4VA 5HKLA 2IYFA 4U7GA 4LYGA 5LYJF 4CM3A 1ZMXA 2C03A 4N40A 2BTEA 4H6VA 5K3BA 2QDKA 3H2KA 2Q2QA 1BWQA 1D4FA 1L7MA 1PTKA 3H2YA 3I1JA 3WY9A 4ESOA 2AQHA 2J3EA 4LPKA 2C3MA 1FVHA 5ERYA 1L5HB 1IM8A 5LA6B 5CDFA 3ZBUA 2IE0A 5JVDA 4DR3B 1TKCA 3QVSA 1SOWA 4TWIA 2MDTA 2ATVA 3HXTA 3R40A 1Z4OA 5AWFC 4F8JA 4NAVA 1GUFA 1RLUA 3K05A 2FJ0A 4HO1X 1NFFA 3WMGA 5CLGA 2IYPA 1SWWA 3NH6A 3UFXA 2GZSA 4JUIA 2JAXA 4QO8A 4WDQA 4RDXA 4BP9A 3EXHC 4V38A 1SUIA 5JBQA 2F9LA 5A4JA 4XUEA 5DO9A 5LOVB 3R0XA 1F3OA 1R50A 4QJ4A 2J5RA 3WRXA 4F2WA 1NVFA 3I76A 1W96A 1XA3A 2W6PA 3RT1A 3UAYA 1TIPA 5B57C 2ZE8A 1L1QA 1REQB 3PYMA 4XFDA 2HNBA 1ORIA 2XSZD 4QQ8A 5L6LB 4OHZA 5EJ8A 1H2FA 1NFRA 3R1IA 2IYUA 4K3UA 4OQEA 1G5IA 5T57A 2O0KA 2VYNA 3CKKA 3OTGA 4K9KA 4OB6A 1O6FA 4PTYA 1GKKA 4W82A 2F55A 4C88A 4R68A 3RSLA 4KGVA 3P9SA 1N34B 2YV2A 2MCFA 2RHOA 3EG9A 1V26A 1JE0A 1O89A 2FR8C 2UZIR 2X76A 3J81k 3DUFA 3TYXA 3DXZA 3WGNA 5KREA 3NXSA 4MRPA 5CFNA 2V1XA 5EQTA 1NKVA 3DDOA 5HDQA 1PR9A 2QTWB 1G60A 3HZOA 1JMKC 4Q16A 4BWFB 3TD9A 1IY9A 1X8LA 4LY0A 2I55A 4LYFA 5KMGB 1M6EX 2HK8A 1N0WA 2CB0A 3LD9A 3MCZA 2ODAA 3JVUA 5ANRB 3ANNA 4PLYA 1T9CA 2RAPA 4MVJI 3I04A 3KB2A 4MQUA 4NENA 2LDBA 1VI6A 2I34A 4LHEA 4AIRA 3UAVA 2IIBA 2GDZA 1X3LA 3MAJA 1JFSA 4WZZA 4R71A 4WJZA 2HIGA 3T3OA 4F9TA 4EUFA 1RYYA 4WA8A 2EKLA 4YACA 3EVFA 4ZOAA 4EG8A 4LGCA 2GM9A 4ARZB 3T9AA 1LK7A 1G6OA 3FTNA 2MSEB 2GRUA 4JLPA 3O47A 2FN7A 3QLJA 2Q29A 1I1NA 4X20B 1QS0B 2QT9A 3IOMA 3HZZA 3S29A 2AK2A 3EIOA 3KPWA 5FI0B 1XVLA 1M2FA 4FI3F 2F8SA 3UTDA 3UOAB 4LJ8A 5DI3B 5E3IA 4L2IA 1Y6JA 3AONB 3I3SR 4RNDB 3GX1A 3CG0A 3Q88A 3ZGNA 3VR6A 1AMOA 4R83A 5HKAA 4HZIA 2Q6IA 3I6BA 2EDAA 1MTZA 4ZTUB 4ZEVA 5DNCA 3ZNOA 1ZC3A 1ZMRA 4CU2A 3JRWA 1UM9B 3STUA 1ULUA 1ZK4A 3IQWA 4QO7A 2ZDGA 1G7TA 3UC5A 5AVRA 3C7CB 4YAFA 1NW7A 2G09A 2JAWA 3GW8A 3PJDA 1VA5A 3EZ2A 2Q5QA 3PDCA 1GXSB 1I6KA 1PJAA 5B6IA 1DAKA 3NPAA 4I1YA 1E2FA 3OF5A 5HHTA 4ZGWA 1ZCBA 1N2IA 1PRYA 3QKRA 3LLVA 4IPTA 2GTPA 5CB6A 2IT1A 1XZMA 1G5QA 1V5EA 1TVKB 1FZQA 1B0ZA 2GPYA 3NB0A 4R7TA 3OIVA 2Y6VA 1TUEA 3A9SA 1WDLA 4E6EA 1GCIA 4B5KA 3UAGA 1WXWA 4LV8B 4BVLA 5A9SA 4OAQA 1BKDR 1NZDA 1WF6A 5JCOA 5KSOA 1RQGA 1HMYA 2OZKA 1Z35A 4QUAA 4DQUA 1JKXA 4YBRA 2JLVA 5HXAA 1CZRA 5FF9A 4C05A 3HWRA 2O8FA 4QBGB 1DTWB 4KLNA 1JHOA 1TJ3A 4XTRA 4EHAA 5BNFA 2FMIA 3K4PA 4LHSA 1KJIA 1GPNA 4JA0A 1ZRHA 2IUYA 2PSDA 1L8OA 2H8GA 3EGOA 2O48X 1YA4A 3FETA 4GPZA 2MSLA 3S2UA 4DG9A 1JEYA 1QH1A 4Y0VA 3V7WA 4AS1A 3RC9A 1U7OA 2XGGA 4IDAA 1L7AA 4JVMA 5AHOA 3BGVA 5BSGA 5CBPB 3QH4A 5A62A 1APBA 2VPIA 4BIMA 4DA0A 2HCBA 7YASA 5G4KA 1YD7A 3T4UA 3MJ4A 2Q3LA 3A11A 3AK4A 2FFJA 4AQYB 3U3DA 3BXGA 4AZWA 5SY6A 4H6XA 2CJFA 5DOVA 4RTPA 3GUCA 4DDHA 5IZCA 1Q0UA 2OUIA 2G76A 3ENZA 2W2LD 1U0BB 1G8HA 4OJTA 1KDRA 4FYXA 1A9RA 4B33A 5CYGA 3BRWA 4I9UA 4AWXA 4HP8A 1CWUA 4C9BA 3FWNA 2ZJ0A 3OZDA 2A0YA 1EFDN 1QP4A 1QGUB 1KYYA 1TZKA 1Z26A 2BF4A 2AZDA 2C5FA 2FPKA 2HDWA 2IDZA 3FNEA 2AS0A 3L79A 4U7WA 4ZRMA 2YIJA 4DIOA 3TTXA 5L45A 4QG7A 4OXXA 5GZ6A 4CLRA 2G1PA 1WXFA 2OOSA 3UB3A 2HJHA 3AR3A 2J0VA 4HNAA 1JE1A 2EEZA 1FFXA 3CLHA 3M5PA 3LPLA 4A4DA 2CYBA 3FJ1A 3WXBA 3OZTA 1GCGA 2GPNA 1BS1A 3R3XA 2O9JA 3ROEA 4CTOA 3FJOA 3OUUA 5D3MB 4NHOA 3T3PB 2JVJA 4C89A 5DBFA 1RCUA 2FUG6 4YRKA 3HADA 1BXRB 4HLDA 4EG5A 3DLCA 1DS6A 4MGEA 1USUA 1S7GA 3T7DA 1KEVA 3KIPA 3UAOA 1QHYA 5JAMA 4RCYA 2QR3A 4DM4A 1E2DA 1LWNA 2HB6A 4EB6B 1YA8A 5BR1A 4W5HA 2PAFA 3O8CA 3A9CA 1G8JA 3A4VA 1U3FA 3GG2A 3HJRA 4RX1A 1VB3A 4F7WA 5FL7D 1Z5NA 3TTVA 4QUBA 4CODB 4RL6A 1ODJA 3PF9A 4HQLA 5CGZA 2Q1UA 3ZCRA 4CQNA 4K05A 2QMEA 3I0MA 1M67A 4UU1A 3FKQA 4MHOA 2Q99A 3PLNA 2A1IA 3AVXA 4HGRA 2PZ8A 2H1RA 4Y2HA 3B1KA 4RBNA 4OSEA 5D5PA 2N9UA 3UW1A 5HA5A 4YPOA 3AR5A 3F96A 4FQ8A 1SULA 2YQ5A 3C5CA 3H42B 4F56A 2UXCB 2MMGA 1XK6A 3KHTA 4RA6A 2EKBA 3QV2A 3U37A 1IXRC 3HI6A 5A3QA 2SKEA 5JAQA 3JVIA 1QH0A 5E8RA 4A9AA 4ZI2A 4XR9A 3BWBA 2AOWA 3NI2A 4RYDA 1GTZA 4D45A 2PUFA 721PA 2ODNA 1Q57A 4HQOA 3EC2A 1HKHA 3QX9A 4HX2A 4PYQA 4BBJA 1PJBA 3A06A 1H0KA 1OOEA 3GQBB 4L95C 3SF8A 3KSAC 2LIPA 1KHHA 4KAAA 3F73A 1GGVA 2YN2A 4NU0A 4WKGA 1BA3A 3M3PA 2OXCA 4EPVA 5L3ZA 3U4AA 1RI1A 2XTMA 3L8FA 3P0FA 4EENA 3D2CA 1V3UA 4BKQA 2EEPA 3JYOA 3H6GA 3EOZA 3RODA 3TRFA 1VMKA 5GIOE 2A6PA 2ZJ7A 4O33A 2P4EA 2PS3A 3RU9A 5JAOA 4ARCA 1AJEA 3LQQA 5DHTA 1BKYA 4Z2YA 3HA5A 3INGA 4EA9A 2W0MA 4F5EA 3QMPA 4CQMD 2UZ1A 1XNGA 4LECA 4OB8A 1JW9B 2X7HA 2IWHA 3TNJA 3ETCA 4YN3A 5JCJA 1SG9A 2E4WA 2R7NA 4DZRA 2O5CA 1ISHA 4H4DA 1T8UA 1KI9A 3NC1C 3TGPA 3INRA 5IM4F 2FEXA 1GPBA 1L7OA 3OA2A 1OVMA 2XV1A 4LDAA 5ETJA 5AVZA 1U90A 1HT2E 1M2OA 1AM4D 1QYRA 2BZ1A 5C3UA 1DKLA 3C41J 3T38A 5TPWB 5ER9A 3VR5A 3PCTA 4J16C 5DT9A 2RHMA 2CXXA 1JYFA 3A1EA 2GD1O 3WYBA 4DUGD 2YWJA 3ZTTA 3FSEA 1T4DA 2AW3A 4HS9A 2BWJA 1MAHA 3OIGA 4ND7A 4HRVA 3R7FA 5JNSA 1BKSB 1K6XA 1P44A 3VZQA 4CF5A 1VRVA 4AMUA 2CL0X 3FDZB 3HFJA 1G7SA 4WK2B 4ZRNA 2CD7A 5FORA 1QOPB 5CPBA 1EFPB 2ONKA 4G0ZA 1II0A 5FOUA 1XC7A 2FFRA 2OYSA 5CG2A 2H8KA 3ZE0B 2B4AA 3GLFB 4Q47A 3BMNA 1GCUA 5BW6B 4D9JA 2QK4A 1RP7A 4OD0A 1F6BA 2ZZMA 2AF3C 4S0XA 3ZQUA 3WMWA 1EGHA 3ESBA 3RSOA 1QZUA 2WQ7A 3KKNA 2QYTA 3TSAA 3LVQE 5IT5A 5L53A 3KHUA 2G07A 5AI0A 3VUFA 2DZDA 2QI9C 3QXJA 4V2UA 4C0BA 1Q92A 4GUAA 1H2RS 1XA0A 1RKQA 4J1TC 4QXPA 5IAKA 1DE0A 5I7AA 4YRAA 3K20A 5BRJA 2WSLA 3ZLUA 1P33A 2Q4BA 4C2UA 3KWLA 5K1ZA 2G25A 1KMMA 4WXEA 2I8LA 3NOOA 1SC9A 2ALJA 2JGLA 1WE2A 3JYNA 3IKMB 4TQAA 3W8FA 2VUUA 3ZJTA 2VYQA 1YZKA 1G5TA 4JIGA 2FY8A 1SVOA 3G0HA 1TLFA 1NBEA 1JLLA 1V9CA 3LK7A 3DMHA 4GPIB 3BWEA 4KEAA 2AF4C 5REQA 3R7WA 3U7EB 1QQTA 5E2BA 3E5RA 1K9VF 4J75A 1W85B 2GETA 2RBEA 2ZOSA 3IURA 1NQXA 4B6EA 4BFLA 5AJUA 1FYEA 1ECBA 1N2CB 1TUBB 3RB8A 3LECA 2P69A 4PHGA 1AKYA 1H0HA 2AV6A 3E3AA 4GQIA 2H1SA 3CUUA 1CULC 1XMPA 5IK2A 4CLDA 5KTPA 1LQTA 2GCOA 3MSCA 1JH9A 2BF7A 1XDSA 5B37A 2X8BA 3R4CA 4Y30A 4WLFA 1GKUB 4ZCSA 4AP5A 2W90A 1PZXA 4G4IA 4JB8A 3LY8A 4B3IA 2L69A 5KOIA 1P5ZB 1YU9A 1RMTA 1IY8A 2IOFA 4KU4A 4B7UA 3OFNA 3PFNA 3R5HA 4DDVA 2EGHA 1ZAYA 1SUFA 3K0CA 1ZUNB 3ZLBA 1X70A 4EO4A 1FFWA 4GS5A 4D8TA 1VHJA 9ATCA 5KSYA 1V16A 1WR8A 4KQ2A 5CT6A 3REGA 5JS8A 3VX4A 4RULA 4JEMA 3NCHA 1IHDA 1SHTX 4MJXA 1S8NA 3QYFA 4F3NA 5LBIA 5FYQA 3COVA 3CHYA 2IHNA 1SXJD 1E0AA 2VUTA 2PX6A 2I65A 1PFVA 2P0YA 5CA1F 3IEUA 3LXMA 3LUFA 3EC1A 3HBLA 2GJAA 1X9HA 4QYTA 1GZVA 4RHFA 4IWNA 3G02A 2HY7A 3QWHA 1L7QA 3ZJYA 3DL4A 4LQ4A 4U4AA 3Q8LA 4P22A 5NULA 3CNOA 3CMMA 3RRBA 1H65A 1BDJA 1M2EA 1MX1A 2HJSA 1MABB 3G0CA 3L92A 5EQJB 1B0AA 1IQUA 2OHFA 4ZKEA 5BUSA 5HS4A 1ORWA 4KMMA 2G71A 1BGXT 2NO1A 3PT9A 5DW0A 2BT4A 4REQB 2J9RA 1Z68A 1IIBA 4ZZ0A 1H0RA 1YR2A 3FY4A 3W1VA 1JG2A 1MCZA 4E88A 2Z57A 1QG6A 3ESDA 1XTBA 4GC9A 4Q3EA 3G2MA 3VFDA 3E9MA 3SBEA 1TVCA 1M6WA 2CKMA 3AFMA 3O3NB 3QKWA 4LK3A 4G86A 1JP7A 4PLPA 3S4YA 5JDCC 1FQWA 2I2WA 4P1ZA 2HCFA 3L4BA 4P5DA 3QUQA 1YZTA 1H2ZA 3FZQA 4CWAA 1T8TA 3CLSC 1MA3A 2C2KA 3FI9A 4EG6A 4F91B 4QPZA 5K0CA 1K68A 3AIOA 4NG5A 3S2GA 1SEPA 4QRDA 2FWIA 5F1KA 1Z38A 3A27A 3UH1A 4YAWA 4EJSB 3T5BA 1ZJJA 5MGNA 4I4NA 4J6FA 4N54A 4LFBB 2FMHA 4FW8A 4KODA 2D5CA 1N0IA 3NGXA 1U0SY 1WPRA 3IQXA 1QC5A 1A4RA 1Z07A 3L7NA 2BONA 3EVBA 3LFTA 4R3UC 3VC3A 2VF7A 1MJGM 3A6FA 4AJ9A 4F4IA 4ODIA 1OXBB 1VA4A 1DELA 4ND6A 4KIUA 4W8HA 2C5AA 4UUNA 2JFQA 1IN4A 2PZGA 3AI2A 1R0ZA 1Q17A 3E3MA 3LV8A 3QQPA 3MBKA 1R3UA 4MLZA 5EP3A 2NAFA 10MHA 3O31A 4YJ3A 3UVEA 3ACCA 5EE0A 5E6SA 3NVKI 1USWA 1HQYE 1ZNZA 3T3HA 4TROA 2ZTUA 3WS7A 1NQWA 5K0GA 5K4AA 3S3TA 5INTA 3RQSA 4PSVA 3LP8A 3U19A 3FSGA 3VPAA 2Q3MA 2P6UA 2XJ9A 4FHCA 2I6FA 4FNGA 1EVJA 4TMYA 1L5FA 1UP7A 1TCCA 1I0LA 1ZGGA 1W47A 3AEUA 3R2JA 4WY2A 2B98A 4PYLA 5K8IA 4N7BA 1P7VA 1NFQA 2HEIA 4LC9A 1MH1A 4GT1A 2QR2A 2QLBA 3V8MA 5HMLA 4L4UA 1PJQA 4DILA 3IP6A 2P9QA 1EFKA 4P2GA 4L72A 1VC2A 2AG8A 3NUQA 3PKIA 5K05A 5ARCA 3ETHA 1B43A 1E2KA 2R2AA 5E7MA 3NJRA 3ST7A 4Y2JA 4E5NA 4YAGA 2Q49A 1XHFA 3OPYB 1P9RA 1V6AA 1EKXA 1VCIA 4AJ1A 4CM9D 1RXCA 2CKDA 2VP6A 2Q5EA 3CRMA 1WHTB 3I9FA 5B3JA 2R8PA 3V7NA 4ZMSA 1E6EA 5BT8A 1ZK1A 3WGHA 1BMFA 2OSBA 1NVGA 3L7JA 5H3HA 4YT5A 2PX5A 3D0KA 3EMBA 3B9QA 3OJWA 4ZO9A 1ISMA 2OQVA 4MVWA 4X1IB 5SZJA 4DDKA 2Z1MA 4EVRA 2W00A 3B1XA 4GLOA 4L8LA 2ZXEA 3U60B 4JP8A 4DANA 2XVMA 5ICGA 2QD3A 1F6WA 5KYUB 4OQYA 3F5MA 5I7VA 5LP6F 4RHXA 5KBYA 1PFWA 4Z49A 2IIVA 4UM5A 1WBDA 3CH6A 4O59O 2RHCA 5SY4A 4RJLA 4BAZA 4D4HA 1BJTA 5IH7A 2FZVA 3HKDA 3LDUA 2YJ3A 3IQFA 4C0LA 2VHZA 3QFHA 3REOA 3UUGA 2ZI3A 3X1ZA 1QF7A 2M98A 2BEWA 2X8LA 1I0ZA 3CX3A 3IB6A 3LC2O 2DPLA 1W44A 5F7ZA 1KMIY 1IZ9A 1GTL1 1DARA 2HWKA 2JAHA 3FRIA 3G2PA 4K6KA 4LBWA 4LNUB 3SHTA 3PHLA 2VPYA 2ES4A 3QOXA 4Q9KA 2VOEA 4JOQA 2HWXA 1A96A 3H65A 4ZU6X 4WBNA 5EWMB 2CK3D 4ZK6A 5ALVA 1XPOA 3TEJA 3K0BA 3H5IA 1E3WB 1KXZA 5KJ1A 2NIPA 3DT9A 3U9SA 1UKEA 2DQSA 3CINA 2G6TA 4RHEA 3OBIA 1O57A 4XRGA 5KNDD 1U98A 1DTEA 2DULA 1B26A 1J8MF 1V1MB 2BSXA 2J33A 3AR8A 2PXHA 1VJCA 3GMSA 3FPBA 4K9SA 1WUHS 5FR2A 1FOEB 3BMQA 3SDZA 1SXJC 1OREA 1AGNA 1L1RA 2FJPA 1N6OA 2CHUA 2ONJA 1SUEA 2BFCB 5AI4A 1RQ7A 3LU1A 4HLQB 3SM9A 3UBMA 4DR7B 4K9MA 2FN8A 4NABA 4TSFA 5ECGC 5IKXA 1RM3A 2L42A 4QYWA 5EJ5A 5JAHA 4YC7A 4HI0E 4F12A 2IE8A 2Q3FA 5DYWA 4XLLA 3IAM6 3D7SA 3ZNQA 3KQNA 2XGMA 3EOBI 4ZV7A 1LDYA 3EGXA 4TS9A 2E89A 1HLGA 2JHFA 2JVIA 5ICSA 3HXQA 2RGEA 1ENOA 2D7DA 4WL0A 1UWKA 3PC6A 4OMDA 2QRJA 1GP2A 3VDRA 4F3YA 1X1SA 5JISA 3KKPA 2YJTD 1DC6A 4IJ6A 4U8GA 3RTDA 3ASVA 5A6SB 3ZJUA 1FNCA 1KP3A 4RH1A 4C0QC 1LNQA 4I1UA 3WGYA 3CISA 3SQMA 3DBLB 1SNYA 1RKXA 2R1TA 1GTRA 1KGDA 2DHEA 3LGSA 1GRVA 3MTGA 4UXJA 1S3IA 3E3OA 4IEIA 3ORYA 4NYMQ 5E3JA 1FRQA 2IBMA 2ZIAA 4RK6A 4MCAA 2Q1WA 3DMDA 5J59A 3I64A 4X7BA 1GQSA 3RIHA 8LDHA 5LJLA 1P0QA 1EBUA 1SC1A 1Z2DA 3D7NA 3OX2A 4ND3A 4V2IA 3TBHA 4EG3A 5JV5A 1UMBA 3H1TA 2GZHA 4WADA 1NIJA 2K4MA 3V3KA 1LC0A 3PGA1 3B82A 4MVJH 4DGQA 3RAFC 2O05A 3BXHA 5KDLA 1S2DA 3WE7A 2N42A 2AZXA 1D2CA 2GVZC 3KVVA 4DA6A 5KB3A 1SELA 2CXRA 3TFOA 1GYQA 1OTYA 3UJNA 1AS0A 1QRRA 3D8HA 4KH0A 4ZN6A 1R2QA 2H0RA 5LLDA 5KQRA 1WMAA 4HXEB 2ANBA 3GEHA 7MDHA 3ZBQA 3N2KA 1UDBA 2WM9B 2J9YB 3OIWA 3D6MA 2V58A 1GZSA 1UZAA 2YVQA 5FWYA 5LXTB 1NAIA 1OAKA 2R8EA 3E8XA 1ONSA 2J0QA 1GR1A 3N70A 1A7KA 2CNWA 3PK0A 4TKZA 1A50B 5JAPA 1U4SA 4PICA 4F1KA 2V9PA 3OTQA 5B4UA 3UATA 5AM0A 5LSAA 1JHMA 2BRUC 2XUQA 1C80A 2IGTA 4LI0A 3MTQA 4MW6A 4RKWA 4ZD6A 1UT8A 2PJZA 3RWBA 2PKXA 1KDYA 2FU5C 5IS2A 4KRGA 1QP7A 3LGXA 1YHYA 4MWOA 1RBZA 4RDIA 3DZHA 1E20A 4XJSA 5AKLA 3SJAA 5AVKA 1UK6A 1JXAA 4BY9E 4O1HA 3EVDA 1CY0A 1YHZA 5AYVA 2WAYA 2C4TA 4M88A 2VF8A 5LQNA 4LSMA 2IZOA 2FMXA 4N3GA 5EGSA 3V34A 4PYNA 5EIEA 5IU6A 3A9WA 3S1SA 2OY0A 3Q8WA 1L7NA 2IYNA 3H4MA 4QT0A 2EWMA 3VDXA 1SXHA 4JJ7A 5B2EA 3SZLA 2R5NA 2YJNA 2GCIA 1UBCA 4D25A 3OPXA 1W0CA 2R48A 5GONB 2ZRBA 3A2KA 1XNHA 2J3LA 4WECA 5DJ5A 2JBAB 4RS4A 5DP1A 3W04A 1M3SA 2XYPA 2PQMA 2B99A 3RYCA 3COJA 2RH4A 3CWQA 1PN3A 2G5TA 2BKEA 3BUSA 1MTOA 4OJQA 1I7NA 5CTJA 2Z2ZA 3F1LA 1POXA 1MEEA 1V1JA 3ZK9A 1AGYA 3KQVA 4O4HB 4LXQA 3SQDA 4BBZA 3KQQA 4TTQA 1NJGA 3L0CA 3JYQA 4ZEXA 3QYAA 1THMA 4AQ7A 1GPH1 2JCVA 1II8B 1W30A 3N8NA 3FR7A 3G17A 5I7OA 2IZ6A 4LBYA 3OLYA 5T64A 1U7XA 1KIMA 5LMZA 2HIMA 1YS1X 1EXNA 4JJKA 2QQFA 3RKRA 1N32B 1EGMB 4ON9A 3KKZA 2PLWA 4FGSA 4TQ9A 1KFEB 4FE3A 4JV5B 4PX9A 5AHRA 3CVYA 2XQKA 4DIMA 2D5IA 5DHAA 3KQMA 5EMHA 4DR6B 3RVNA 3IJ5A 4BZZA 5THXA 2H2FA 4I6EA 1K4KA 3G89A 1SC4A 1T36A 2GX6A 2X4LA 4IMJB 5FB3A 3USES 3O8NA 1TO2E 2AXEA 4ACBA 1MKYA 3S68A 1R6UA 4UBKA 2F8MA 4QOHA 4AIIA 1PUXA 2FEWB 2EG5A 2HCJB 2HV9A 2VXBA 4P83A 4MEAA 4WNIA 5LA6A 1L5HA 4BNVA 4ZEMA 3ZV7A 4K0KB 1TT5B 1TTPB 4U2KA 3IMEA 2O8CA 3CPHA 2I3ZA 3FVTA 1WJGA 3OKFA 4I50B 4J7CA 4MV5A 4G25A 2BI8A 3FDFA 4NBLA 1ZUIA 2HXSA 1NBWB 2JFFA 1KL7A 2VNJA 2W98A 3VSCA 3W05A 1L5VA 1RYBA 3NHRA 4BN5A 5FBRB 4DLWA 1OB2A 1C9DB 4MEBA 5EZ5A 5F78A 2ZJ1A 1E5LA 1VL6A 4Y6PA 1Z0JA 5BUZA 4NLLA 2W71A 5LOVA 3AUTA 3AW8A 3KM0A 4TTRA 3SJZA 5BRNA 1OKKD 3DB1A 2JEZA 1NNI1 2BGJA 1SBQA 3AJEA 1REQA 2GILA 4EECA 1SPXA 3AP3A 4QPNA 5BOVA 1NNLA 3V3TA 4CKXA 4PPNA 4DXDA 3QJYA 1MA0A 1DBIA 3HCDA 1XZEA 4IYRA 4JOSA 1RKUA 3O83A 5KTMA 4NC9A 4E2YA 1LSSA 1PR5A 2YVLA 2CFCA 1T4BA 5ILOA 3P9YA 2E9SA 2B7LA 3U4CA 3RHTA 1YE8A 4V24A 2CF6A 2WPDA 3CH4B 2IW1A 3JD0A 4L51A 4DDWA 1ATZA 4Z6KA 4A0RA 5EIXA 5CD1A 1ZBDA 1ADBA 3ZZNA 4YT2A 3FWPA 2ZFUA 1GQ2A 4KYIB 3W7VA 3A6KA 1AZSC 1G291 5KMGA 2VH1A 4KR6A 3RJ5A 3CZPA 1EEHA 1OZAA 2QLJA 4OJYA 5FFMA 3X2SA 2EL9A 2VCHA 4E5DA 1JHAA 2FYTA 4JLUA 5AK6A 2F3RA 3RFFA 5LPNA 3UPUA 1GGJA 2W6QA 3D64A 4P9NA 2F9MA 2XAUA 2GJSA 4YP9A 2AN9A 1FNBA 5TMDA 2XDWA 3MTDA 1C8KA 1EEXB 3IOBA 4YB8A 3A9RA 2KHZA 5KSZA 2PBLA 3IBFA 3DT8A 1ONPA 3CW2A 1QS0A 3E7XA 4X20A 5TRTA 3ZGYA 1ISRA 2WT8A 4IJVA 3RRNA 2NP7A 5F2NA 1KJWA 3QX7A 2IY9A 1TF5A 4OGGA 4L4YA 3PUZA 2LBPA 5DI3A 4R8LA 1SOAA 4EYEA 1G21B 1GA1A 4U1RA 4AY5A 4ESVA 2LRHA 1E2BA 1X7XB 5JC8A 1QWSA 5CHYA 4I0WB 4LXYA 4WNAB 1YF3A 2YC4C 1OFUA 1A97A 2I7VA 4HWPA 5K20A 3PPVA 4LX0A 4KHPB 2VTVA 1MB0A 1UM9A 1PR2A 3ENVA 1UP6A 1ZVKA 4V0LA 5FBWB 5FL7A 5TPZD 4ENWA 5L3VA 5D00A 1JF8A 3TLJA 2HR1A 4HB2A 3VNVA 3ZDFA 3ZTWA 3CN9A 3RIXA 1RYHA 1TQ4A 2VEDA 1GXSA 2VRCA 4X6YA 3SICE 2FSPA 4YT8A 4PONA 2E85A 3FYSA 3F6EX 5KWIA 2FSUA 4EEKA 1AQLA 3OCZA 3I9V1 4CCSA 4XR4A 3E05A 2WVAA 5EHIA 1TVKA 1BN7A 1JDZA 3B78A 5HFNA 1FJHA 1KAEA 2VOJA 2OXTA 1A8IA 3TW4A 3FGZA 1L4UA 3VJRA 1SUDA 4L50A 1SBCA 2ZUCA 2XNHA 1L4EA 4LDRA 1AHNA 1YUBA 2WJ6A 1FFHA 4GI1A 4HAVA 3RJZA 3HXLA 3TKLA 3TOSA 3KZ1E 4LXIA 5A9TA 3O2JA 2YZ2A 1T2FA 1DTWA 1TU0A 2XNSA 3WDLA 3CVUA 2ZWMA 3J80A 4DLYA 1K7XB 2PJDA 2WNSA 4NBSA 2P3SA 3PVZA 3PWKA 4BVFA 4CL8A 4D9EA 3HWX1 3DHNA 2DKNA 5DGHA 4LN1A 2WWRA 3AB7A 3GGGA 1BCSB 3L6UA 4YWJA 1Z0AA 5CBPA 1F6DA 3G13A 3D02A 4MUKA 3GGCA 1D9XA 1XDZA 2R86A 4FSXA 5CT5A 5IP5A 3VI3B 3HU2A 4ZC1A 2IYTA 1BVRA 2WTNA 4L5BA 4G5QA 1ZD2P 5G1NA 4BUCA 3OP4A 3WV5A 4MV6A 1Q0SA 3GUYA 3RC8A 4R98A 2GI4A 3LWDA 1C0PA 1RHQA 3BCSA 5DTIA 4YMWA 1WNTA 4HEA1 3CNBA 1B0UA 3EF0A 2HBQA 3WAGA 4GYKA 3IP3A 3AY7A 4WZ6A 4ZEWA 2IL1A 2M1XA 5FYDA 3E2MA 4YRIA 1N0HA 4LYDA 1NHWA 4CFYA 3AEZA 1QGUA 4JLWA 1ULBA 3FLMA 4M8KA 1I0IA 1RYFA 4X84A 1EM8B 1O08A 1QVZA 4ETMA 4B3TB 2ZITA 5A4FS 2AOVA 3V8QA 3FG9A 3QJ5A 1RJEA 5ELXA 1KAHA 3FCXA 4MV4A 4YRQA 3SBOA 4F1JA 3EGCA 1MB9A 2CFRA 4PR0A 3DCNA 3FPHA 5G3ZA 1U0NA 2PQ0A 3L5KA 3VO9A 3EEOA 3QVJA 4E4YA 1WVMA 3HGMA 3I2JA 3LKBA 5AVYA 3WRXC 5D3MA 4FBLA 4JLDA 4QODA 4R2MA 4YQFA 4IDHA 1KJ9A 4G07A 1E3EA 1YR9A 2C4KA 2Z58A 3A05A 4NCNA 1LSUA 4LKRA 3VU0A 1BXRA 1LF5A 4DKJA 1J2EA 5K8CA 1CEEA 3IBCA 2ZBDA 3PRHA 4O4LA 2AGVA 4XGKA 4U6NA 1DXHA 3TO5A 1JZSA 4YCLA 3QPWA 5HZKA 1TKBA 3AEYA 2PUTA 1Z8FA 1RHRA 3IXMA 1OBFO 4L8GA 3NTOA 1L7XA 2VIIA 3AHIA 3K1AB 4HWGA 3M3DA 3IBGA 1DLIA 4PIMA 1H05A 3ZWYA 3OIUA 1TQHA 3E9QA 4N5MA 3ZLTA 2F3SA 5TT0A 1Z8HA 1XCGB 2XA9A 1PL8A 3ZVMA 3OFVA 2DCMA 5KNCD 1G7RA 1EE9A 4HBGA 3NHAA 4FGJA 2N1BA 1HEYA 4MUHA 5DFAA 4FYIA 2R44A 2Z9CA 4DB4A 1C0EA 4Y6SA 3RFTA 4BWGA 5KTYA 5L3SB 2D59A 2KQUA 2Q3EA 4QNRA 2I7CA 1IVYA 1U9YA 2IY8A 1B74A 1SEVA 3QKUA 3RS8A 1NURA 4UQLA 5HE9A 1YBAA 3ABIA 4EUKA 1GEEA 3OIYA 4XXHA 4ZZ2A 3ZU3A 3DEJA 3EEFA 3H2GA 2PH7A 1OI4A 1S0UA 6YASA 1ULSA 2C2YA 2X4DA 4KPGA 3GQBA 4BJ3A 3UHOA 3LXRA 1ZLXA 2VN8A 3E22B 4GZ5A 2YC2C 4O1MA 5CYOA 3G68A 5C5IA 1TQ2A 3QYJA 3N8HA 5K8JB 5HF9A 3LO8A 1KRHA 1E6WA 4KIWA 4LRQA 4JROA 1XX6A 1PDWA 2Z83A 4PRLA 5JMTA 3UJBA 4NOMA 3NUZA 2YOHA 4L4SA 3AC0A 3PPXA 4HXYA 5ABPA 1E7QA 5KX5B 1XTTA 3CNEA 3W2HA 4Z1OA 2EBFX 5J4YA 2VWPA 3OZCA 3ADKA 3RUAA 3UXEA 2LVBA 3B60A 2Z8XA 3TGLA 2X8JB 1N2GA 2J45A 5T4FA 1RC0A 16PKA 2PT9A 1XTSA 1A9SA 4CM8B 4OQMA 4CMCA 3KVRA 1FS5A 2PTGA 1X1CA 5JROA 3O9VA 1K7FB 1MJFA 1TU4A 4JI1B 3EXG1 3IUEA 3LKVA 3N7UA 2V7UA 4HHEA 3RSQA 4MLDA 4X8HA 5EWJB 2HMVA 4EYOA 5G40A 5LQUA 5FOQA 4FX5A 3GEPA 1UJCA 1AQ6A 3LO5A 2EFYA 5TPWA 3FF4A 4FNMA 3B85A 3VM6A 3EGDB 4AY2A 4JUCA 4J3FA 4LF7B 4TT3A 1KZ6A 4DC1A 2DAPA 5C37A 4D0LB 4QYXA 4BP3A 5JCOC 2R60A 1F4PA 3CCBA 3WFIA 4EL0A 3PA8A 1R9MA 3QE2A 4IMIB 1JDJA 1B8VA 3FDZA 4QIHA 3ZHSA 3U39A 4YO7A 5I9TA 2DFTA 3P8ZA 4HB4A 5JWHA 1EFPA 3O2SB 2D00A 1K08A 1R18A 1W5TA 3QMMA 4JK3A 4RLSA 5CDGA 2BI7A 1ZJZA 4RYLA 3GLFA 2A1UB 1LA2A 2J07A 1RBYA 5B3KA 3D8SA 3EA5A 4YI3A 4BEJA 3GCXA 3FIUA 3LDGA 3F3SA 4L8VA 2CDNA 4Z99A 2O8NA 3GIDA 4KXWA 3S1AB 1O1YA 1MGPA 4WKOA 2XUPA 2ZWVA 3RJTA 3T9EA 3QELB 3L1JA 3HMQA 3F97A 4OF4A 2PA0A 3E84A 5HBRA 3WLPA 5JZ9A 4GECA 3B6JA 2AMVA 3IKTA 3ZHRA 2M1ZA 2HZBA 3H97A 1GL7A 5MN6A 3EA4A 3M7IA 4RPCA 3TZQA 1MR3F 2RH8A 5HRAA 2POCA 1IE3A 4RMHA 2Q6LA 1ZS9A 4M9RA 1UOPA 2ZYDA 5B3AA 1M7HA 1X8XA 2V5AA 5L3RA 5I9MA 2V7TA 2X7JA 3NWOA 5FULA 5IH3A 1ZXXA 2UVPB 2FPIB 2ZVPX 4IDCA 1JKFA 1A5AB 5L7WA 4FOPA 3TTYA 4CT4B 4EATA 3L40A 5HF5A 1L4YA 4B3FX 1NC3A 4DQXA 1W85A 1WCYA 4KVGA 5CB8A 4KE6A 3W2GA 2C7BA 2DUUA 1MC1A 3FYHA 4K6OA 1B1AA 1PWZA 3FTPA 1XTPA 1ORHA 4HX5A 1N2CA 3MWLA 1XRRA 1AK9A 1TUBA 4IDGA 1N9GB 2D1YA 1CQJB 2FXVA 1FP4B 4KN6A 3PEYA 4Q1CA 2QUBA 4CKBB 2H9AA 2I2BA 3GFTA 2ZBPA 4RO0A 2FZGA 1DCTA 1E6MA 1JHRA 2GNAA 1X13A 1OE0A 3KKEA 3L6EA 1QIJA 3I4LA 3LUKA 3QXXA 2A5JA 4QOEA 4Y2SA 3RUHA 4R8RA 4PN7A 2BKUA 1G2IA 4RW0A 4AYXA 3COWA 5CX1A 3A1FA 3G1UA 2FRXA 3KZOA 1TMYA 3W1EA 5IUJC 1GYRA 1WG8A 2QN9A 1ZUNA 4XGIA 5KTOA 3UJDA 5F77A 3Q3CA 3OZSA 1GDDA 1PR1A 1H0SA 3DZKA 1BQ4A 1M2VB 2Q9UA 1E2HA 4E13A 3GEGA 2GTHA 3NLLA 4MS1B 5DNVA 3PUYA 1V35A 2QX7A 3DEYX 3EC7A 5E1BA 3SNKA 4DLAA 3M6WA 2R25B 1J8FA 2FPUA 2PRZA 3ESXA 2C82A 3NHYA 4YUXA 4AUEA 4X90A 1J4AA 4L22A 1M2GA 1F8UA 1GPJA 2P6MA 2QSJA 3ZIAD 2DF8A 5ELMA 3T4EA 4EJMA 3IL2A 4PCUA 5T4EA 1GUAA 2IF0A 1T5LA 4QL3A 1AKNA 1BC5A 4UTZA 5DHRA 3U48A 2QUAA 1BU8A 2VZEA 2BC9A 1SH7A 1MABA 4ZV4A 3R8CA 1SXJE 3H4TA 4RK4A 1E1MA 4RIIA 2WWXA 2NTNA 1X7WA 2QL7A 4HRAA 1VMAA 1HBJA 1W5AA 1OX4B 3BRCA 3I5MA 3NIWA 5IABA 5IKOA 4PX2A 4ZVMA 2HDOA 2WM8A 3B7PA 3NBUA 1DZ3A 3OSZA 1N4AA 4DCPA 5B12A 2VS1A 4GXQA 3TXXA 1DQPA 3BAZA 8MHTA 1HKUA 3B9BA 4D57A 1I1QB 1TC2A 2H9IA 1Z12A 3AU9A 3LCCA 1EK5A 1YCGA 2BP7B 1LW6E 4FR2A 4M8SA 4N7JA 5CLIA 5HM8A 1W4RA 3D7MA 2DHRA 3B52X 2VL7A 4AMVA 3P32A 1K3TA 3KJZA 4FB5A 4PO8A 4PWYA 5SICE 4MMZB 2UYQA 4B3XA 5K0FA 3ZCXA 5KWJA 2CSUA 4KQIA 3WQRA 1D6NA 1FW8A 1NWHA 2XOKD 2RGGA 2IA5A 3ND8A 4JJFA 3OCUA 3BD6A 1IQRA 1MQSA 2Z3VA 2P6RA 5JYEA 1TXGA 1J2JA 1PG2A 2MYNA 5FHQA 2GFQA 1FMFA 2DWOA 3FTQA 3MS4A 4HAUA 3U62A 1JKIA 5BV1A 3TSZA 1RWOA 2VDUE 4UM9B 2JJ1D 4EJSA 3ROKA 1JS1X 1R4AA 1R8YA 2OV8A 3S2YA 4U5XA 3AHHA 5AXCA 3DL7A 1WXHA 3T7CA 2AC4A 3FB1A 3CF2A 1DG9A 3E1SA 2I7DA 3AM3A 3KTOA 3EZFA 3H7AA 3O26A 4G9BA 1HDOA 3O2NA 1Q7GA 1G16A 4LHWA 5H82A 1YIAA 1YQWA 2Z5FA 1XQ9A 2FQYA 2R8OA 2XMRA 4ZJUA 3GCGA 4XDYA 5ALHA 2TMGA 4FS3A 4D6PA 2A88A 4YMLA 2YWDA 4M22A 4V0SA 4AAYA 4UOEA 1CW2B 4YJGB 4WKNA 4C4AA 2QP9X 1SXPA 3QOFA 4EK9A 4CBVA 4AI6A 3U6BA 4HH3C 4NCHA 1WQ4A 2X0DA 2IS2A 2PGJA 2C2HA 3LWNA 5IANA 4BEWA 2XDAA 3CQ9A 2K7ZA 4O6VA 4JOCA 4PHTA 3HKBB 1J2RA 4DBLE 4EI8A 5HM6A 1NL3A 1JVNA 4UU7A 3EMVA 4LOKA 4J4TA 4MVCA 5IM4A 1ZY2A 3ECAA 4G81A 3BA1A 4BFVA 1UC9A 1J7JA 4I8XA 4I5FA 3M1YA 4M83A 3SWWA 2VQ3A 1N2HA 3IKJA 4Y6GB 2FZ4A 4BFXA 3DLTA 4XCVA 2ZJAA 4PGMA 1SKBA 1SRRA 3AF1A 2YV4A 2GXUA 3DDHA 2G82A 5JWRA 4ITRC 1J5XA 4N7RA 4NQRA 3OPYA 4GRAA 4TWRA 4A8JC 5JYBA 3OEHA 4NI5A 4O2BA 3LNCA 2ZUEA 4BX8A 3OCXA 1RBQA 1WHTA 3M49A 2WUDA 3TL2A 1KTIA 2X9LA 2E4XA 1UMCB 3GN1A 5K03A 3NDJA 2L17A 3JZAA 5IUNC 4LE1A 2IZ0A 3UPTA 4KVFA 4X1IA 3RHSA 2XNKA 3R0IA 3VNUA 2NLOA 2VZ0A 1A9PA 4NY1A 2AYZA 2ON6A 1GPDG 2ETVA 2YZMA 2ZU0C 3DV9A 5KYUA 3RVJA 3D6AA 5T3UA 1KZ9A 2HO4A 4B2PA 2HM7A 3G8BA 3R7AA 4RHTA 3HVJA 1J06A 3CYFA 1Y1PA 1LI5A 2ATCA 2FF7A 4PYJA 3TIIA 1ZR2A 4C1NA 1WW2A 2DTXA 4TYWA 2VHWA 2AR9A 1N5OX 4RF5A 1L8XA 3K0CC 2DHCA 3EMDA 3U7GA 4HRYA 3DO5A 3GLTA 3RVBA 1UZMA 4LNUA 1E1QD 4A6XA 5BMVB 3BXOA 4JN6B 2E48A 3AVWA 1EFTA 5T5QA 2QM3A 5EWMA 1RXSA 4M53A 3GD7A 1E3WA 3ESQA 4QU8A 1M5RA 4PX3A 1HK7A 1RI5A 1QYWA 3DEZA 3LOUA 4G85A 3UOGA 2XYHA 3P0EA 1B23P 1V1MA 3PS9A 1P77A 5EP2A 3BSWA 1ZGAA 2VT2A 2ZIWB 4FCWA 2C54A 1MEJA 5B1DA 2G17A 4MQ6A 221PA 4OX9Y 3GIWA 1COWD 4MV7A 2BFCA 4UULA 1OFUX 3K2QA 3OO0A 2II6A 4IIBA 4DAEA 1Z36A 5JARA 2R1VB 3O8LA 1I3NA 4EDFA 1V8PA 1QHEA 2XDQB 5FLXA 2WR8A 4QJ3A 2GD0A 2ZIXB 1P1IA 1O95D 1RCFA 1VI2A 8ATCA 1RWPA 3KOMA 3M82A 3H9EO 5PNTA 1ZXLA 2RJNA 4DSAA 4HVTA 3U17A 3H2ZA 3IVXA 4JYCA 4ARAA 2B30A 3HUEA 4C43A 4E94A 4C7OB 4MHSA 3I09A 3MGCA 2JLWA 2BDUA 4X3CA 4GGMX 1L9KA 1XCJA 3GUZA 1CY7A 2ZUTA 2QGFA 4D92A 5A6SA 4I9GA 5BN3B 5AW6A 4LF5B 1JHUA 4JDPA 4ROTA 3SFTA 3EVEA 2WOJA 1IFXA 3GOHA 1NW6A 4MYTA 3DBLA 1FFCA 3MT9A 3SS7X 3QP9A 1OWPA 3S27A 3L4BC 1MV5A 1NRIA 1TO6A 3NVMB 5EFZA 1LDMA 2FWNA 3ZCSA 4GMHA 3OLVA 4MQEB 2JASA 2H3HA 2PQ6A 3WB9A 1QUEA 3HCPA 2G1UA 1DMSA 1X80A 3RTBA 4KLZA 4DA4A 4FZ5A 1U3UA 1X38A 1T5IA 1Z0SA 1XL0A 4WN9B 1LTKA 5HRUA 5DISB 2BFFB 3IVMA 3T3GA 4MIEA 4NOJA 2I7TA 2WF9A 3ND6A 2WWIA 3NHKA 3TJMA 2BEVA 2J46A 3ZGLA 1Y1TA 4X00A 3I52A 2QPAA 5E9QA 1BZYA 1IBSA 1UOOA 1R3DA 1XDDA 4CCWA 1H2XA 2IYSA 2P4QA 3UPDA 5IT0A 1ISJA 2I99A 2NQ8A 4QQKA 3GL9A 5H59A 1XD9A 5DN6D 2ZE6A 3WYAA 2QN3A 1YRHA 4YUVA 3LVRE 4X54A 1JG4A 2XKJE 5LXTA 2X5XA 1LC3A 3A37A 4NZPA 3OLZA 1P17A 4N47A 3LG2A 1J20A 4GYYA 5CA1B 1N1MA 2ZTMA 2AJBA 3HUFA 121PA 1NUUA 2F48A 3LC1O 5E3HA 1SBIA 1JI0A 4Y3UA 5DI9A 1N3YA 4MDEA 4P92A 1NN0A 2X3YA 1BWRA 1U9JA 1MMFB 2GA8A 3MS7A 4PFKA 4RSRA 4EBBA 4AS2A 3TCXB 3ICOA 4ZDJA 1XEWX 2AXQA 2GF2A 4J2HA 1T1JA 4JYBA 4OFXA 2EYUA 4JL6A 4ZP1A 5DCWA 5BN4B 3ZN2A 1P9OA 2EF1A 3QJGA 4PZCA 1PWEA 3RLIA 1QLWA 1HOXA 2BUBA 4DTCA 5HKBA 1LLDA 5CCXA 3KOYA 3IYLW 5C80A 1IUPA 1E8MA 5IPFA 3ZUPA 3BGSA 3P71T 2VAWA 5T6MA 4US1R 4URWR 1WMBA 4DHWA 1ZGCA 3CX4A 2RBKA 2CF5A 2H2WA 3U9LA 3KR0A 5L40A 2BHNA 4DUYB 3WQSB 4YRJA 4NNPA 2CV2A 5B3JC 1XTJA 1YB2A 1WCV1 4YRGA 2OQRA 4UPEA 5GONA 5JT1A 2ZBRA 3OTWA 3ELYA 3G7SA 3GVHA 2JBAA 4B74A 1LRKA 2M6SA 4RVNA 1JVSA 4FKZA 3SKYA 4TS1A 3DWGA 2P4UA 2QAGB 4D3DA 3SZ3A 1G1MA 1CS0B 1I1OA 3CNQS 2RGWA 1WVIA 2VDLB 2ZAYA 5C53B 4XPIB 2PBZA 2X15A 4L9AA 2IQIA 4POAA 2I4RA 4O4HA 4MYSA 3T7RA 2FNAA 4O8ZA 2FVXA 1V45E 3JQAB 4PG4A 5AW2A 1PW5A 1II8A 1K6JA 1T13A 2BY4A 2PZMA 2QTTA 3H2JA 1B2RA 3T5GA 4A2QA 4LYJA 4XASA 5HPYB 1T24A 1VCMA 5BR8B 1CF4A 4R0VA 3V7YA 4MO2A 4BKMA 2VDKB 4CDGA 1Q74A 1RPAA 1SWVA 4UJ5A 1HQDA 1VQ1A 1V8FA 3SYMA 2GBIA 1WW3A 2PSEA 1BS9A 2F3TA 1ORDA 1ZD5A 1EG7A 1XAGA 4Q15A 5KINB 2L2QA 1QE5A 5JS1A 1A0OA 3GHHA 3HCWA 5FWAA 3J81A 3PC2A 2DB3A 5HR5A 1ZPDA 4ZCRA 1PSWA 1QHSA 4PZ9A 4YHHB 1M6VA 3ULKA 1HE4A 4BX2A 5TPZA 3FI0A 2IXBA 4TTPA 5D85A 2Y3IA 1NXOA 1RQNA 3ZWOA 1YFJA 5AD1A 1OFGA 2YBDA 4NU5A 3ZXIA 5L4LA 3RIGA 4ER6A 2G67A 3T52A 1TT5A 3KJQA 3A4YA 4B3DA 4I50A 3SR4A 4S2UA 2ZRPA 5K4GA 3I1YA 4X8OA 4PZAA 3RSHA 4E4RA 2GBFA 4B09A 3UJ3X 3H3JA 4MQ5A 3WGLA 3NALA 1NBMA 2V6JA 4QDUA 2MOKA 1XPRA 4KJZA 1S96A 1ZICA 2PL3A 3OM1A 5ARDA 4KQEA 5H7XA 4M3NA 1DIRA 2ERXA 1QXSA 3HBMA 2VR1A 3JWPA 4ADSG 1D4ZA 1GPLA 1Y3BE 1UKVY 5BXYA 3K0EA 3DM9B 2Q1TA 4DIEA 3NKVA 3TLEA 4UNNA 1IHXA 3DOJA 4DV5B 4CI0B 1AN9A 4REMA 4U2CA 3BK7A 1CD5A 3UJPA 2H48A 2JKZA 3UT5B 2XX3A 3VYVA 4DIBA 1XDGA 1MZVA 3F8SA 1MP0A 4CNQA 4X3OA 2VP0A 3CXRA 4Y1RB 4QEKA 5EZYF 4C4TA 3S8YA 1JR6A 3OZEA 2WC1A 5DPMA 1T15A 5F51A 3T5DA 4QKQA 3FZYA 3B1WA 3STTA 3HU1A 5C81A 4TUYF 2PLNA 3TXYA 1CSEE 3BGIA 1SVIA 1I2MA 1P6XA 1XVTA 1CJSA 2DH5A 2OQIA 3K6JA 4KI0A 4OAOA 3K1JA 3P4YA 5HDBB 5DU2A 3NV9A 3QUAA 4UAGA 3AR7A 1JG6A 1U6KA 1IUNA 1CZNA 1YR3A 3KUUA 3HU3A 2ZE5A 3D9QX 1QRUA 3DLBA 4N48A 2X1HA 1P62B 4BRZA 2GYUA 2HBRA 3T1NA 1V4BA 2PGIA 3VNAA 3QUSA 1WOYA 1FU4A 1C3OB 2ADMA 4LJAA 1C4XA 1QG2A 1R0SA 2ZYUX 3TKYA 1FNNA 4OQPA 1BVHA 2PPVA 1DAEA 3GYGA 1Z15A 4DR2B 5A3SA 1JNYA 3PBKA 4Y8VA 3WLOA 3IQHX 1SCUB 2Y93A 3BDAA 3DUWA 3H1FA 4ENUA 5EKSA 1MB4A 4YQZA 1R9GA 1A9TA 1I7LA 3QPBA 4YV1A 3V4PB 4DCCA 1GQFA 3ROTA 2CYCA 2XPCA 2I1QA 3HLKA 4HDMB 1K6EA 3KYDB 3A9VA 1E1KA 5F2KA 4AWBA 4N5HX 1XN1A 3ZY6A 4HL6A 2X41A 1UJ2A 4YV0A 3PXAA 3WSTA 4JLSA 1G21A 4RGQA 3VDQA 2PO5A 2GPWA 3HKEB 1BTOA 3NBMA 3LUHA 3IR7A 4LE2A 4DLVA 5LQCA 4NZNA 1P2UA 1XRNA 4WNAA 2Q8PA 1OLSB 3BHIA 1X7GA 1KOJA 3HJHA 3HEAA 1WLYA 5TX7A 4NZZA 2OAP1 2BYTA 3BEOA 3VYTB 3D31A 2Q6VA 3TPFA 4PX5A 4QREA 2IYEA 5TF0A 1Z6QA 2I6GA 2QX4A 3NHMA 4DYVA 4HVLA 2IEAA 2XLCA 2QRUA 4Z0TA 1C14A 3M70A 1DJMA 3CVJA 3GA5A 1X15A 1XGKA 4P31A 4ZQBA 3W90A 1G9XA 4OK3A 2HHAA 2ORVA 3HFGA 2BZSA 1UKAA 3C5HA 1K5HA 1SU4A 1Y80A 3LI2A 1GN8A 1WZIA 3D0OA 2XUGA 4OFZA 3NOVA 2O6LA 1Y9JA 3H0CA 4NAHA 4U6QA 1Z7BA 4LY9A 4UHJA 2PUHA 1TD9A 1H2HA 1ZN2A 3TL3A 1J8QA 1QIGA 4OYHA 5IVIA 5JBIA 1O03A 1YZVA 2LUOA 4QYMA 4B4OA 4FC7A 1JA0A 1GQRA 3KJGA 4G1CA 1FDOA 4OLHA 4HN2A 4RTLA 1FTYA 4XGQA 1RRCA 1TM2A 1H2WA 2GTIA 3F3KA 3V4SA 3L4KA 2AJTA 1CVRA 2HMSA 3E7PA 4MW4A 2QOEA 5EXXA 4F5YA 1OB5A 3FTEA 2QX6A 4EQZA 1YT5A 3QVUA 1BX3A 1RW4A 4PYIA 4LBZA 3KL4A 3CNHA 1GAXA 4HQKA 3RYTC 2R87A 1SFRA 3F1KA 4F8EA 3G8CA 2V6FA 1NMSA 2NW6A 1L7EA 3H1BA 3QPAA 4TZ6A 4M1WA 2QLTA 1OMOA 4O3MA 5F9HA 4TLBA 1G19A 1PUJA 1W2WB 2XMSA 1NDUA 3BD7A 4MUGA 4UUOA 5FV7A 4E33A 4M86A 2P79A 4EFDA 1QIFA 1SD5A 1EFUA 3Q11A 2OO7A 3ZWCA 2V6BA 1K8YB 1PT8A 3FR8A 4JXXA 4A8PA 4F96A 4C7XA 3K6SB 5EXTA 4G0MA 2QRNA 4JT2A 4OHCA 3BD8A 2GYYA 4XB2A 3ILXA 1Z2EA 1IAQA 1WP9A 1XVVA 4PC3A 1KK2A 2C8LA 5FEUA 4TTTS 1ACJA 4DEVA 5B1SA 2CEKA 1EM8A 1LK5A 4PINA 4P34A 5DX8A 3TQRA 5T7BA 4FMCB 4ASUA 4JKIA 5CEJA 1M9NA 3DKRA 3VPSA 2JFZA 2NYRA 5YASA 1NLZA 1F48A 2B5VA 4QQRA 2QLNA 4AS3A 4BLSA 4BUJA 1RWBA 4EA8A 3W8RA 4PANA 2ZU6A 3OFJA 2ZT8A 4NE7A 2Q27A 1W8IA 1WXDA 3BQMB 3MJSA 4UE2A 5CRIA 4LOIA 1GFIA 3T1HB 4CV3A 2PTHA 1QGYA 3VR4H 1DOZA 1TI7A 1FJ2A 3KQTA 3WGJA 1H22A 3DVRX 1U7HA 5IRCD 1C7JA 1JHZA 1X86B 4KQKA 1G8SA 5BWMA 2PKQP 3P5SA 1FSFA 2IELA 3RRMA 3DTNA 4BTEA 1INLA 2QYHA 2AE2A 1RR6A 1XB2A 5D5HA 4BV9A 1MNQA 3HY3A 2YY6A 4E7PA 1BX1A 2ZULA 3VVBA 1NP6A 4L0QA 5F2EA 3BOSA 3DYBA 1E5VA 4EFMA 1Y7LA 3T9DA 1T5DX 3RUPA 2IU3A 4EKEA 2DHQA 2A9PA 3QI2A 4Y9DA 1HLPA 1VB5A 3A3KA 2O5EA 3AUKA 5L3SA 2YFKA 1Y6QA 1RQLA 1UWLA 3CF4A 4C4YA 3KSMA 3U0VA 5IHXA 2A7XA 2XD4A 4II2A 3OU7A 2X6QA 4DA7A 2PKWA 3EDOA 4ZI7A 3HMKA 4Q4JB 5THQA 3W34A 5JNTA 3KUKA 2VNKA 1Z4LA 4N6OA 1JJIA 5DTQA 5K0JA 3HDJA 5AP9A 3H05A 5BSRA 4RSGA 2G9VA 2C7VA 2A9KA 3E22A 3QFRA 2VYVA 1P2DA 4KK4A 1XQWA 2L18A 4QVGA 4TUYB 4B4WA 4E7OA 1FMLA 4DV3B 4XWAA 1KQFA 2XQJA 2GMWA 1DWPA 3PSAA 4GX5A 2DBRA 4PLTA 1SC6A 3VSDA 2QN2A 2XCLA 3C6KA 4CHGA 5ADHA 1XCPA 4C03A 1FVFA 1NSYA 1JTEA 2CL6X 2H1FA 3F4KA 4N0DA 3ED1A 1JFVA 5KX5A 3INNA 1F0NA 5JSZB 1IWOA 5AVUA 1ZOSA 4Y67A 1H2YA 2BMFA 1QYCA 2FZKA 4G4SO 4NCIA 4DREA 4WOPA 3CEJA 4EFLA 3EAQA 4D02A 1YCDA 2X8JA 1FSGA 3HA2A 3EIEA 1QJCA 2QX9A 4JUDX 4EJ0A 3K1YA 2JFUA 1PDOA 4YTEA 2BTQB 3B13B 3GNTA 3ZU4A 4EHKA 3NYRA 4LI3X 4ZVPA 4GMKA 1SHLA 4P38A 5F1OA 5LMNB 3IVRA 3C15C 4BDSA 3U3KA 5EWJA 1ZC4A 4A26A 1LFDB 5AQ1A 4Z3KA 4FFSA 3M5DA 1SKYB 1XCLA 4Y9RA 4S1NA 4S1PA 4XUDA 2Q2WA 2YWEA 1QU2A 3EGDA 5E2AA 4GICA 3PJFA 3QLTA 2XNCA 2HA6A 4DGSA 1FLVA 4M55A 1NRWA 3AGQA 3W5AA 2J9XB 3DZGA 4S05A 4W5RA 4Y9SA 2C83A 521PA 2PV0A 5F3DA 1DX9A 3OX4A 1HT0A 2Q6TA 3AO0B 3PEVA 4XVQA 3AMVA 2XUDA 4BNNA 2O3QA 1XKQA 5A4MS 5AKXA 3VU8A 1XP8A 1QV6A 2A1UA 2ZTLA 3VYUB 4XE5A 1SR8A 3RD5A 4ILKA 3S1AA 1RLIA 3KOZA 4YDHB 1TC1A 1TU3A 1MPXA 1EP9A 3L0YA 4OQDA 3QELA 4KQWA 4QXRA 3ZY4A 5LD2B 1JHXA 5IZ4A 1IWBB 3EZLA 5ALTA 3BL5A 3PHIA 2FPSA 3ER6A 3FMVA 4RF2A 5A6VA 3QVKA 4E22A 1XLTA 4OUKX 1XTVA 5D8DA 1UFOA 2DT5A 1G8YA 5K4HA 4J8PA 1NYTA 2OPHA 1EX9A 1J33A 4WOKA 3KOXA 4GNRA 4ZT2A 2DTDA 3CCCA 4LV5B 4CT0A 5JZMA 2RHTA 2HHLA 1CQZA 3E5NA 2B20A 3HLYA 2ZVDA 3NHFA 4MWCA 1Q2UA 2OYRA 3WZ2A 2UVPA 2FPIA 2DTEA 1PYOA 3D8TA 3OZXA 3JWEA 4G5YA 3C3KA 2HMYB 1Y4UA 2MSWA 3REFA 5COAA 1TK3A 1VL2A 3EVZA 4DBVO 4UHKA 1TLTA 2GBCA 3UANA 4UHDA 1N9GA 3C98A 1BXGB 1EHYA 1CQJA 1B42A 2I78A 1YHNA 4CKBA 1Z7YA 1RPTA 1URPA 2XOEA 5JSYA 1BQEA 2JCYA 3A70A 2HTEA 2F17A 4HC4A 2GK6A 4RMGA 4W8OA 1JEJA 4YWHA 5IF9A 1NTRA 5AOBA 4DM3A 3RU7A 4O08A 2JEYA 2PX2A 1CY2A 3R7BA 4FCVA 4YP0A 2AFVA 4ZI5A 2TECE 2NTJA 1L7PA 3OOJA 4FKMA 3N8KA 2DY0A 1YB1A 2FSVA 2RK6A 4ZOLB 5FTWA 4F4FA 3OZUA 2QL9A 1DLJA 2PVCA 3UAWA 2OL4A 2WTEA 4LVOA 4AKEA 1M2VA 5J4KA 4MCHA 2ASEA 1Q95A 4DV0B 4MS1A 3BN3A 4TQGA 3W9UA 4BZQA 1U7ZA 3WMRA 3T3MB 1TECE 2D2VA 4NS1A 4E70A 2CNLA 1K0FA 3EIFA 2G83A 1Q83A 1XJCA 1UUFA 3PPWA 5F1YA 3K0FB 3AKCA 2YRXA 3C3PA 3GZJA 2HGZA 1OUMA 1HFWA 5HJ2A 1H8ED 2LR0A 4GQAA 3ZU6A 4UHHA 3V8VA 1CUVA 4J0GA 5BWLA 4PTZA 4E03A 1H9BA 4TS3A 2RMKA 4OHPA 3IT2A 2Z3WA 3RK0A 3V1TC 2FTKE 2OC4A 3WIBA 4KHZA