2AC4A

Crystal structure of the his183cys mutant variant of bacillus subtilis ferrochelatase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSACSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metallation of the Transition-state Inhibitor N-methyl Mesoporphyrin by Ferrochelatase: Implications for the Catalytic Reaction Mechanism.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 120
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2005-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac4A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac4A02
2AC2A 2XWSA 2QD4A 2H1WA 1DOZA 2QD5A 2HREA 2XWPA 2QD1A 2PO5A 2PO7A 2XWQA 3M4ZA 2Q3JA 2AC4A 3AQIA 3HCNA 2C8JA 2PNJA 3GOQA 2Q2OA 2XVZA 2HRCA 1LD3A 2XVXA 3LYHA 4F4DA 2XVYA 4KLAA 3W1WA 2DJ5A 1HRKA 1TJNA 1N0IA 4MK4A 1QGOA 1L8XA 3HCRA 2JH3A 4KLRA 3HCPA 2H1VA 4KLCA 2Q2NA 2QD2A 3HCOA 1C9EA 1LBQA 2HK6A 2QD3A 1AK1A 4KMMA 1C1HA 4CCSA
chains in the Genus database with same CATH superfamily
2C2XA 5GGYA 5E6SB 2HPAA 2MYUA 2RHDA 2J9XB 4DIOA 4QOEA 2OECA 3KYJB 4R1LA 4BO4A 1XLWA 5CXUA 1F8UA 1HC7A 5JAHA 3B7PA 2C92A 4O4LB 1OD6A 3TWOA 4AW9A 1WD5A 1TECE 3I4CA 1MW8X 1RYBA 1PZGA 1SD5A 3LDGA 3OJFA 1A97A 4DMMA 4ZRNA 1ZK4A 2O3UA 4RU1A 4HGNA 1G16A 4PAOA 4UD2A 5J5VA 3OZGA 3PQ8A 1ORVA 2AR7A 3FN4A 5BMOA 3LO5A 2M98A 1AIPA 5T3UA 2NUBA 3ZE8A 4GRDA 2GJ4A 1M6VA 5AXCA 1QDUA 3BG5A 1R0RE 1FXUA 2QRUA 3BMOB 2G83A 1KFCB 3QVSA 4KK3A 5D3MA 3RUAA 5JNLA 3C1UA 5IKXA 3EXHA 5ER6A 1LLDA 2DWQA 3J81A 4BNIA 1ZGJA 2YOFA 3EUEA 4RANA 1JZQA 4CLDA 5KQSA 1J1UA 1Z7WA 2WOOA 2O5VA 3TNYA 3JPYA 1SHTX 4CTMA 1SXGA 1U6KA 3L9WA 4RMIA 3RS2A 3VZSA 2FTKE 3QKWA 5LLSA 2ZYDA 3FHOA 4C6HA 3LKDA 1E9AA 2B8NA 2W2VA 4AXXA 2ZYAA 2EDCA 1FNCA 1UC5B 4QLBA 5HRCA 1ECFA 3GCDA 3T12A 2OV1A 1WNFA 1Z73A 2WF9A 3OEHA 3RVKA 4CIBA 1BHSA 3LT0A 2XCSB 1G3QA 2XJ9A 1O94C 2OO3A 3G79A 5AVZA 3NP7A 1BZYA 2GEJA 4QNRA 3RF6A 1F7UA 1GTSA 3QOFA 3E3LA 4UDNA 1ZL0A 4FFVA 4NZMA 2G5TA 2NV0A 2VDMB 1CQXA 3C16C 3IUPA 2C96A 3IP1A 4Q3CA 5EJIA 4BGEA 1ABBA 1GPYA 4AIIA 4UHKA 4MITA 4AZ0A 3VR5A 2RCYA 4M3NA 4DRZA 2OD7A 2FMXA 2B21A 4L28A 1E1CB 3AFNA 1H0RA 1T2EA 3FDIA 4UM5A 3U7QA 4BZXA 1EWTA 3W2IA 3WIVA 4F71A 4FEEA 4L16A 3L7OA 3LH5A 3JZAA 5UKDA 1DEOA 2AN3A 5AO9A 3RFFA 4YHHB 2JFXA 2UZIR 2XUOA 4OATA 5JZBA 2NTEA 3N74A 1L9XA 1Y1SA 6Q21A 3C8MA 3IYLW 4LRSB 4F91B 4TMFA 3DE4X 1GPUA 1YXMA 3OAAD 4Q1FA 4F7WA 1TVMA 3ICEA 5FDFA 1HTTA 4JYBA 2J6IA 1IXKA 3A6JA 4PX9A 4U4AA 3V9AA 4ND3A 4ZICA 4EPWA 3MNFA 1JKJB 2XMBA 1S8OA 1FRFS 3FLEA 2UYHA 3ROPA 1GNTA 3MGGA 3I5XA 1Y34E 1ZCJA 3H8WA 3MILA 5FOQA 2A9JA 2Y71A 1W25A 3V55A 4TQGA 3KSDO 1ZU5A 1CYDA 2XVAA 1TFUA 4N5DA 5C7IO 4G5FA 3RTEA 3A1EA 2QL5A 4MQ5A 3SE0A 5AHOA 3VDQA 2GWHA 3ROFA 3CONA 5HP4A 2WD9A 1N78A 2G17A 2J4DA 3BICA 1CJUC 1W8IA 3GR6A 2ZIGA 2L42A 1VZ3A 3NTXA 1UC4B 2CB9A 3O74A 4PN7A 2JLUA 5J2TF 1N2OA 1MA0A 5K0EA 4B9EA 3DF9A 3HBJA 2CY0A 4TTTS 5JAQA 1JAHA 4J4TA 4Z54A 3ZCTA 1L7QA 5A3SA 1BDJA 2NVWA 3L4BC 1DRWA 1V25A 4UDXX 2QN8A 3GJ7A 4LZJA 1K08A 4J1TA 1DAHA 1H3EA 5AK0A 3K05A 3QTTA 3IAEA 3M1LA 4TZKA 4EGFA 5JSZB 4YCBA 1O08A 1GGEA 2VDKB 2P2YA 3L7KA 4A26A 3AW8A 5KOJB 2ZIZA 3R5XA 1O58A 4D5GA 4QDXA 3TYXA 5JSFA 4MNTA 4IRUB 4Z0HO 5AW7A 3AHFA 3BL6A 2ZSIA 4NBUA 5EC8A 1G8SA 3GEEA 4MA0A 1FUKA 1U0LA 1UBTS 4MKGA 2GGSA 3CKKA 3W77A 5A5GA 4DR4B 1X38A 1Q7EA 1LJLA 4FEAA 4B85A 4BV8A 1EFPA 5CCBA 1JAYA 4N40A 3QKSA 1EVZA 3U3KA 2XGOA 3HPRA 3UJHA 4H18A 4DHWA 5EKDA 4NCAA 2CGEA 1RQ2A 4W5QA 1JHAA 5AW9A 3VJLA 4R9VA 4D9JA 1ACMA 5TSDA 5K0TA 3KB6A 5E7MA 2WTEA 1GSIA 3DC7A 4FSHA 3TTYA 2IDZA 1H8HA 3LC0A 3LHDA 1KDRA 2V1XA 2IZOA 4HAVA 4PV7A 1VKOA 5K3FB 4HFRA 2VHQA 4FMCB 4G5QA 5ECWA 2JHGA 1U8EA 1SC1A 3USZA 1ZW6A 2BHTA 1A95A 4MQFA 3UH1A 2FXIA 4QQRA 1KPHA 1PJRA 1Q3HA 1TYEB 2Q2QA 4D82A 3ACCA 2EX1A 2H0RA 4MJ7A 4IOMA 2GASA 4LUCA 4PGFA 4CR6A 1I30A 1K7YA 3NBKA 3TPFA 1BXRA 2E5WA 2HRQA 1W1IA 4J0CA 5KNBH 3UWDA 1XKTA 1LI5A 1KPGA 1N0HA 2GKGA 1ABFA 1VE3A 3CJRA 1FFHA 3CN7A 3H1BA 3I3OA 1C9DB 1HT2E 1RKQA 1WXEA 2PWBA 1D7AA 1WCIA 2JASA 5EXEA 1QQTA 2HI0A 2WW8A 3KVYA 3ZR4B 3UOAB 1WBDA 5F23A 3BJEA 3CUUA 3AUJB 5JPCA 4OXXA 4YH1A 1P74A 2NPFA 1L4YA 3EPJA 1RWQA 2ON6A 3C5WP 4IO1A 3M1AA 5FO0A 5HQTA 1AQNA 1WF6A 2QM8A 1CY8A 3HI4A 1HDYA 4PQYA 5KC8A 3QLEA 2OAQ1 3KKPA 5T64A 3GC6A 4C05A 3O4IA 1L3CA 3CB4A 2W2TA 4JCOA 3M9WA 1QANA 4HRYA 4LJKA 5FV7A 1KVUA 4NC9A 3L4JA 2UZ1B 4B7ZA 5IF3A 4N3CA 3ZLTA 2ODQA 4YAOA 3U49A 3MHPA 2WAOA 3VO2A 4BVLA 1GDTA 4KMRA 4TWJA 4DNXA 4JJAA 1KP2A 3F78A 3O31A 4K9KA 4EPXA 2F62A 4B0OA 4EVIA 3ICWA 1DUSA 3GRRA 4JQCA 3QNWA 4KPUB 4RA9B 1H1DA 2CVHA 1EU1A 1EJBA 1A2OA 3K2IA 1DKOA 3UYLA 3BMQB 5DM60 1S3SA 3KEOA 4HYQA 3GUVA 2XKAA 3A58B 3PENA 4LSMA 3RWBA 2C2YA 1DIRA 3D6TB 4KQCA 2ID8A 3NV7A 4B35A 3NBYC 3AUAA 3MJTA 2NQ8A 4IRMA 2ZBGA 1VYVA 3QMMA 5COBA 2QL7A 3JZFA 1D2MA 3PE3A 4RLQA 3GP5A 3VSBA 4AJJA 4KR0A 3N0VA 4B80A 3OJ0A 2CNKA 4REQB 5BVHA 1XXHB 1BX1A 4AY6A 4IHJB 5IJXA 1F2TB 2XMSA 3NBAA 4GOKA 3HCEA 2NN3C 1Z5UA 1SXJB 5L6MB 4WKCA 4JLVA 4ITRC 3SBEA 5IRCD 1NVXQ 5IZCC 2CMDA 2D5IA 1JX6A 4JJ8A 3SE7A 1BH2A 2JLVA 1W59A 2ORED 2BP7A 2FSPA 5FPQA 1DFGA 1A8HA 4HDQB 1UFOA 1QNLA 1FMTA 1WXHA 2F3PA 2XSZD 3EGWA 2IYEA 2GS9A 2Y3IA 3IMEA 2ZYTX 1MX5A 5IYZB 4IEFB 3K6SA 1NW9B 4PG7A 3OHPA 4UCQA 3LKBA 3UZUA 1J2JA 5DSZA 1OFTA 1N9KA 2X8JA 3GUCA 1KZYC 1XVUA 1NMXA 2CFRA 4XTCS 1OAOC 2XOKA 3QVVA 4Y0VA 1ZDMA 2R2AA 4FMPA 2B37A 3C70A 4AWBA 4ZAXA 3H3JA 1RAGA 3EXFB 4WBNF 1E1KA 3RVMA 3ZXYA 4HDNB 3UT0A 2W98A 2J1LA 4MKZA 4RSRA 3WGIA 4GVXA 4LRUA 5EEGA 1DBIA 3AIIA 5A7GA 3U4CA 2CYBA 1XN4A 3U9SA 4HNUA 1RHJA 1RXSA 5F5XA 3M4XA 3HVUA 1JAIA 2PTGA 2WUDA 2EWMA 2KS6A 4QVKA 4X20B 3VSAA 3KQLA 2VQEB 3BB3A 1XJ0A 3I0ZA 3UV7A 1XC7A 1BKDR 2JK0A 3PICA 3QF4A 4QAJA 4X1YB 5JAPA 5LR6A 2P69A 4XWTA 2YHIA 2QAGA 1LK7A 5I9BA 1UZAA 1VIVA 2HMYB 1SCDA 2Q5JA 4NMXB 3VHRA 4FZVA 3HCBA 4IQ0A 4M1SA 1YKFA 3DO8A 4AK9A 2ANBA 4LCJA 2CL0X 4W4TA 3GRZA 2ZSKA 2X9QA 3F5SA 2B61A 4RIFA 3JRXA 2XTZA 4P4UA 4ZQIA 2VQDA 5F35A 4D4JA 2GN8A 2IL1A 1NRWA 4WEOA 3WL6A 3QX7A 4F3TA 1PVVA 3FE2A 4DMUB 2VSYA 3NATA 4DC0A 3IQFA 3TM5A 2F1RA 1MNQA 3TUZC 3HXMA 4RF4A 4WI1A 5H3LA 4V0LA 2NUTB 1NM5C 1DIGA 2J46A 5AJUA 3SHOA 3ZXIA 4B79A 4B3TB 4OTZA 2X40A 1XMIA 5KYWB 1G63A 1QO0D 2E4YA 3AG6A 2ISQA 3S99A 2V45A 5FA6A 2GXQA 2HCRA 3OZXA 4BMSA 4OLBA 3K16A 4QULA 1CFZA 5JRDS 4KVZA 2VHUA 4DANA 1A72A 2H5EA 2PH3A 1RYFA 4QTZA 2ZT8A 1P75A 4TM7A 5GQSA 7YASA 1WUHS 1J5PA 2WI8A 2P67A 3REOA 5ITZA 4J3NA 4CEHB 4WASA 5E1BA 3VSCA 4GQBA 1JMKC 2BHLA 3V4RA 1PRYA 3L82B 1SO8A 3B78A 5IJ0A 1UPBA 2QUZA 3LP6A 3ZIDA 3PDCA 3OFKA 3O1IC 5GVRA 5TJHA 3B2EA 2Q4BA 4JI8B 1ES9A 2IYZA 3BQ9A 4MEBA 3ZZNA 1USKA 2BFMA 3OOYA 3WE7A 2WYHA 4G25A 2GZ3A 2XA1A 3DBHA 4MKIA 4WERA 5A9SA 2PSEA 4OKSA 1VCNA 5KKAA 1JDVA 1CR4A 2IUTA 3ED5A 1PLJA 3K6JA 1LJUA 4RS4A 3KOXA 3I45A 4BNYA 5JH7F 2HIGA 1M73E 1B6RA 2G76A 2XMRA 4Q03A 3ZTTA 2AK2A 5CDYA 1ZHOA 3FH0A 1R66A 1ULHA 2H5IA 3D7LA 5ADHA 2ZJ2A 1EFUA 2IPXA 2QP3A 2O1XA 3PA8A 3GEIA 2XGSA 2FCRA 1Y6QA 2PUDA 2CFOA 2ZXFA 1SN7A 4IVNA 4PWZA 5I7RA 3PR2B 2EX4A 3G9ZA 4LCBA 1L7XA 2VDQB 4JAVC 2VT2A 1FP1D 3BGIA 3K09A 4QRDA 2QX4A 4ZAWA 4ECAA 4QOHA 4Q4HA 3UTDA 2C3YA 1C3JA 3AF0A 4BFXA 5BN5A 1GAWA 3ZH2A 4WVLA 1GU1A 2HOQA 3UUEA 1HA3A 1UINA 2PUTA 1BFKA 4E5DA 2Q5LA 4EG5A 2Y4OA 1IEQA 3HCFA 4D0NA 2JZOA 4ONEA 4LSGA 1L4EA 1ZOPA 4BC0A 1S3FA 4IIFA 1RPJA 3BE8A 4A2QA 2QUAA 4BFSA 1C9YA 4WFQA 5CB4F 1V26A 2CNNA 3R6LA 4K40A 1P45A 4LYEA 4RK1A 3AR8A 5B58T 4L7VA 1LS6A 1KMIY 2X76A 3I8OA 4NCKA 5ELXA 2FY8A 4TVSA 2PJRA 2ES4A 4ML3A 4MH0R 4JLUA 4M1KA 2PEZA 4MIOA 5ALFA 2FX2A 2IUUA 2AA3A 4M0CA 2B8WA 2JARA 1SKMA 3VNSA 4JBLA 4YCDA 2BFCB 2FPIB 2PRKA 5J63A 2J7KA 2Z4TA 5HYVA 4MW1A 2FRDC 4HS9A 4JJ6A 1JR3D 2YNMC 3ICVA 3N39C 1Z8DA 3RBVA 1W36D 1A8QA 4C22A 3PC4A 3D4LA 3MELA 3B8HA 4KR9A 4FILA 1Q14A 2GA9A 3KYCB 1UBUS 4NZOA 4TKMA 1WR8A 1EWRA 1JSZA 1YB1A 3K1AA 3E1KA 5CVUA 4TWBA 2A0KA 5MN6A 1JR3E 4U63A 2RONA 4EPVA 4EL0A 4DMKA 1P2UA 5MHTA 3O8NA 3KS9A 1J2RA 4EA6A 2VPQA 2QTMA 3IULA 4CIWA 2Y67A 3NC4A 3PXAA 5I47A 1NF3A 1QZUA 2QTVB 1Y81A 1YRBA 3PQFA 4FEGA 1XD2A 1CVRA 3W1EA 3WJ1A 3X2SA 4LX8A 4DCPA 2MSCB 2VJLA 1T0BA 3G0CA 4MW7A 3TRJA 3OJEA 1NBIA 4I99A 4PFJA 4P7GA 4WWHA 1I32A 4AMBA 3ADCA 3LBAA 2Y6VA 1LLCA 4JUIA 4LOAA 3GELA 3R3UA 3BTOA 5T7BA 1N5JA 4PY2A 2H1RA 2VH5R 2H1SA 3IXLA 4GOMD 4KITB 5B4VA 1HXHA 3A06A 2W2MA 1DB3A 3MB5A 4H7EA 2X9VA 2EXXA 2Q9CA 4D9IA 1RHUA 4HFNA 2SCUB 1PEKE 3S29A 5K3EA 5DX0A 1JDBC 1XQVA 4PZCA 4QZVA 5IASA 3OT5A 5FNVA 4NXNB 3SQMA 1KEUA 4YCMA 3OLWA 3MCVA 2ZPTX 4JASB 4JU9A 4QYTA 5LNK6 1OFGA 2O2HA 2GKOA 2VT7A 1R8QA 4HUQB 4ZYLA 3LT5A 2CL6X 4MZXA 3ZHVA 1ZHFA 4JJFA 5PNTA 1XWIA 3HS3A 3QMWA 1V5WA 5DOVA 4MWBA 3KQOA 4PIMA 2IHKA 2GFQA 2GZHA 1NVKA 2GBCA 5AI6A 4N8DA 1BVHA 1P2BA 2WVGA 3ES9A 4NTZA 1NOJA 1I1NA 3ZGNA 4QASA 2RGEA 5CA1B 5CX1A 2DQSA 2K7ZA 2LKDA 5ALUA 1P1RA 1N2JA 2ALJA 1KZ1A 3HP1A 1ZL2A 3L8FA 5CLGA 1Z0IA 1FW6A 1ZUNA 3DLBA 5CX1B 4ZCIA 1QIDA 2W6NA 3B51X 4P32A 2VP4A 3FF4A 4H1TA 4BFVA 1SUDA 5EJ6A 4NWIA 4Q3EA 3DFFA 3RT9A 4DSTA 2EF0A 1KQFA 1VLVA 2WIFA 3H9EO 4LTMA 4JP2A 4WOJA 2F2TA 4ENWA 4TYWA 1KJZA 2C03A 1IBSA 4Y2RA 4NV3A 3AEKB 4J76A 4K9DA 4BEWA 1UWLA 3K8ZA 1DQRA 2WJPA 4RD4A 4GLOA 1CUAA 3GT0A 1FYEA 1TJYA 4B76A 1YK1A 4HNQA 3N8GA 3K9CA 3OZVA 2AG8A 1F3LA 2JAXA 3CLKA 2XSZA 3F73A 2I6GA 3KQPA 3OQMA 2EVWX 3TMAA 4FOSA 3H65A 3GNLA 2YS7A 1ANKA 1M1YA 2AOUB 4ZYVA 1PL0A 4QODA 2FEAA 4GD3Q 4R1MA 3UFXB 2OV2A 4A6XA 4EUFA 3OU7A 1V95A 2GR9A 1KI8A 3TAUA 1R3DA 2ZRFA 1QIIA 3EZNA 1K6MA 5FUMA 4R7TA 1U7DA 4QG3A 1N8NA 3EPPA 5LMNB 2C2BA 1R0ZA 1D0IA 3KXIA 1X8XA 3LQ4A 2TS1A 5HCNA 4NJEB 2RGCA 1ML3A 2EJUA 4GW3A 5E4YA 2K7FA 4FYMA 3VVMA 5EJFA 4M7WA 2VT6A 5TQJA 2R8PA 1XWWA 3AL3A 3U5ZB 1TYZA 1B23P 1FVHA 4XGRA 3MK31 4N39A 5HXAA 1G5RA 2E6KA 4QO7A 4M1ZA 4YJ3A 3WO1A 2FEWB 1EXVA 1VKNA 3VR5D 1OFUA 2HJ9A 3FPHA 5IK2A 3I73A 1KJIA 1CX9B 2W6JA 2RBEA 2IDKA 2KHZA 2DTXA 1UK6A 4YI3A 3PNOA 4IDAA 1YQXA 2CN1A 3UH0A 3EC1A 1EDDA 1DRKA 3A14A 2IH2A 5BWBA 4RQAA 4WLFA 2REXB 2O4CA 3NG1A 3T52A 3TMKA 4BU0A 1P1BA 1XCOA 5C5EA 4YP5A 1ESCA 3F5QA 4E15A 2EJTA 4S1VA 2WEKA 1R4NB 1D03A 1G8HA 1LZKA 2HMAA 3BDAA 1BDMA 1VPDA 4N82A 4FYWA 3CEPB 3X2EA 3FTQA 1P1IA 1AGYA 2E37A 4INAA 4HT3B 5AW0A 1OBHA 1KI6A 1WV0A 5H81A 3KETA 2JG3A 2P6MA 4NEGA 4MRVA 4S35A 4PRYA 5IFLA 1RQGA 1ULSA 4PC1A 1AXGA 5FH9A 4AF7A 2DHQA 3MLEA 5GP1A 2JGJA 2ZS7A 3STWA 3LF2A 2QTZA 2FKNA 1KO5A 1MABB 3G5AA 4LC1A 4GX1A 1T3ZA 1M0WA 3I2HA 2J3QA 3BH0A 3FVWA 4Q4HB 3K9NA 1BU8A 3KLNA 1U1EA 2WB4A 4CU5A 2PKQP 4UEKA 1A3CA 2WMYA 1P5RA 2QX9A 4X44A 3RODA 1X7XB 4IH1A 1W76A 4MRPA 3ZXSA 4KE8A 4PCVA 3UK6A 1UBSB 2I7VA 2UVPB 1U8UA 2JIOA 3AIOA 4ICIA 4K81B 4II3A 5DRYA 1QU2A 1J0BA 4ZVNA 2A2ZA 1OILA 1V45E 1PLKA 1KAOA 2EDAA 4HX5A 4LS3A 1L4FA 1UBNA 1MJHA 2A5YB 1JZTA 5E8JA 4PRLA 5L7YA 3ZXXA 4FHGA 4YAGA 3ZI4A 2I80A 2GTIA 3E5RA 1JSCA 2ZSAA 3I5YA 3P26A 3FZQA 1KE1A 3L1UA 2BEKA 2L19A 3WLTA 3C74A 3HEAA 3ISTA 3KYDA 4KYTA 5D5QA 1UT6A 3F98A 4E07A 1ULUA 2I7TA 1P8JA 5BW6B 1I7QB 2ZTSA 2E4UA 4WT7A 1T9CA 8GPBA 4MB0A 4BBPA 3Q10A 1RLIA 5F4ZA 5JECA 1IBLB 3BCHA 3ETGA 1TT5A 1UBEA 2PUCA 2E9SA 1JHRA 1MW9X 3TL6A 3Q7SA 3CSSA 3THWB 3HHEA 3R0VA 1P6UA 2GZ2A 1GG8A 1CHDA 4RZQA 4WN9A 2XB4A 4ALJA 1D6MA 2QE7D 4DR2B 5HE8A 1JA0A 4YX9A 4RWEA 2Q4DA 2HCBA 4J43A 1KORA 5AJYA 4DXDA 1SBCA 5KTTA 4MWTA 1BDIA 2OCAA 1QGZA 4JLWA 4GT1A 1WSAA 4LY9A 2PCLA 4P4LA 1E59A 3UICA 2P5SA 1C4KA 2PU7A 5EG5A 4DV7B 4X3OA 1G66A 1VMAA 3A32A 3BXGA 4PX2A 2W8BB 1CRWG 1YRLA 2OCYC 3COYA 4ZZ2A 5LYJF 4Q6WA 5KKCA 3PPXA 2WUWE 4EEXA 2X4DA 3DVAB 1X19A 4LXHA 5EA2A 2XEDA 5TEVA 1KSGA 3NT2A 2R6HA 1NLZA 1G7RA 4DARA 3RIHA 1YIAA 3N8NA 1EA5A 2Z58A 3ACBA 2AI2A 3DKRA 3P2JA 3WLIA 3OC6A 3FTPA 1GGNA 5F5NA 2KMLA 2G5CA 3EVBA 2JVIA 4O3FA 3B6MA 3ZQJA 1KMNA 1R8XA 4X1YA 2H1FA 1G6OA 1ZD2P 2LWIA 2NUAA 2ZB7A 4C6RA 1QOQB 3VISA 2J3IA 4EKIA 1AZSC 2AFHA 1P5JA 2YV4A 3A2NA 4M8SA 5G0SA 5L45A 1T4CB 1Q2UA 5CHEA 1CDDA 5DYTA 2HU7A 3LQ2A 1GZ7A 4W5OA 4EBBA 4KNWA 1ZBQA 4M7RA 4OOEA 2CK3D 2XCQA 1JXOA 3FIJA 3MIZA 1JG7A 4AP5A 2A88A 2B94A 3LSYA 4C3UA 1OA1A 4HGZA 4BMNA 3IQHX 3R6WA 1CY7A 1TA9A 1XAHA 2CLEB 1BC5A 1DDOA 4PZLA 4RYLA 4XLZA 4MUJA 3T3IA 4DEXA 5HRAA 2V96A 3DAOA 2ZIEA 4O1IA 3QPAA 1PKXA 3T61A 3SF0A 1TFRA 3V1UA 2X8JB 1J0XO 3HG7A 2WKWA 2FSIA 4UJ5A 4WEQA 2HA4A 3WWCA 1TCUA 4BNJA 3OJCA 4D02A 4ZGGA 4EUNA 5F4BA 5B4TA 3EZFA 4JVMA 2HHJA 3GF4A 3WHPA 5KPJA 3IDAA 3HUUA 2OSBA 3KAKA 1G59A 5DF1A 3S7ZA 3ICQB 3HGTA 3D0RA 4FBLA 2GCIA 4FXPA 3WQQA 1I4OA 1IHYA 2ARKA 2GPNA 2KLBA 3A3NA 3D59A 2XCIA 4H7DA 1SCUA 5H9VA 1XELA 3IQGX 3NOVA 4KUEA 5ALHA 3KVRA 4C29A 4NCBA 1B8VA 1R9GA 2DPLA 4IKEA 1Y6FA 3PZBA 2BW0A 2AD5A 4XLTA 1O89A 2FWAA 4N9WA 2LPMA 1FCJA 2O3QA 4GM0A 4EX6A 5ESDA 3DOCA 3EMBA 2A9QA 2WSLA 2AW5A 3H1FA 3A6ZA 1G8AA 4FGSA 4DZRA 4MDEA 1K8XB 3SQXA 2GJ8A 3FR8A 4TN5A 5AJWA 3ZOKA 1TQ6A 3BC1A 3MTJA 4OHBA 2UXCB 3GLIA 1G20B 1QVVA 3FLBA 2WWIA 5KNLA 1X8JA 1XQ1A 4V2IA 2V6BA 2ZM6B 1BE6A 2ZJZA 3HYNA 4I66A 4JOQA 4WLEA 4X64B 4HAXA 2N42A 3QP9A 4KPUA 4RA9A 3ML1A 3RFCA 4M0KA 4LECA 3Q3CA 3QV2A 2NP7A 3FYCA 2QE6A 1CR2A 2GEUA 3Q2KA 1ZFNA 2BGMA 1BYUA 1ZW1A 4KMMA 4YS6A 3AHDA 1IZ8A 2QT0A 2KPOA 3QLUA 4WD3A 2D5LA 2ZG6A 2HJHA 1DC4A 4I14A 3B1FA 5P8WA 4C3ZA 5KNDH 4MKRA 2A5FA 2H1OA 1FNMA 3EBOA 2XEXA 4AY2A 3BM5A 4WY2A 3LHKA 4GGPA 5AR1A 4DFDA 5DBEX 2CLHB 3SXUA 3ZKWA 1PZMA 1RYEA 3H9BA 2CBGA 4CR7A 1GAXA 2DY1A 1GCAA 1JQBA 2JD2A 3AILA 3SYTA 2V7GA 4M9UA 5ECGC 3VYSB 3V8BA 2QYTA 1YB5A 2NZVG 1RRFA 1XEXA 2FPSA 3SC3A 4UTZA 4UW9A 1J07A 3UMSA 4F12A 1NW4A 5A1JA 2LUOA 3L92A 1VP3A 5TGZA 3A4TA 1WCIB 1HF3A 3MRTA 1DPGA 1P7ZA 4INPA 1DAMA 1DMRA 1TYAE 1G42A 4OMFG 4CIDA 1G5FA 2EOAA 3VPXA 1W1UA 2C31A 5BVGA 2D2EA 3CX8A 2F8MA 5CNKA 1DAOA 4X7RA 4X65B 3V8PA 1H8ED 2H5JA 1KYIA 4C03A 1DEHA 3R5FA 4KSCA 1PSWA 3FJYA 4P22A 3WWEA 3A36A 2NW6A 3CF0A 1SCUB 4YVFA 2OXTA 3WB9A 4EY7A 3ZY6A 1B8OA 4CKZA 2BFAA 1LSUA 5E0OA 3GUHA 3ZY3A 1TPZA 4DIKA 4DQXA 2XKBA 3JD1A 3IIKA 4GRIA 2Q1SA 2QRZA 1A7AA 2ZJOA 2WQ7A 4ARCA 1I4LD 3HR8A 3VO1A 3I2YX 5TX7A 2NXJA 1H2EA 1NSFA 3DMPA 4Q4LA 3ADOA 5K3FA 1CZUA 2I3BA 5JFTA 1WW8A 1XYGA 1XLTC 3T34A 5JWRA 3D5QA 4A0FA 1AU9A 2BGIA 3IP5A 1W581 1PFQA 4L0DA 5K8TA 4NNOA 1X1EA 2WIAA 1E5TA 3EDQA 1M8PA 5A6VA 1N32B 3TNLA 2FXVA 3GJ8A 4I4NA 3O9ZA 2WINI 3EISA 4YUXA 1C7RA 3MD9A 2O5CA 2DBZA 5EKUA 5H7XA 1N6HA 1SVIA 5C46F 2E87A 4QOIA 5MN5A 4M9QA 1JJVA 3CF6R 4NHEA 2VTVA 1AURA 4PS0A 1SOAA 2QMOA 1TE2A 5ICFA 3WNBA 4K6HA 1CZNA 2H51A 4AZVA 2Q5CA 4MDHA 4BQIA 2OT3B 1YHZA 4LY6A 1J70A 3FI9A 3IV9A 1WSWA 1YUMA 2SBTA 3FOWA 3LI2A 4MPDA 4N8EA 3K15A 5DGHA 3EZXA 2G3YA 2Z30A 1AG9A 2AFHB 2BRUA 4IKOA 4DC1A 1XHEA 1T5OA 2PX6A 1Y4DE 2NUAB 4EARA 1XZNA 4PO3X 4UQLA 4M7OA 3GFGA 1PEYA 1Y4ZA 2R8BA 4MAAA 3W9SA 1KO7A 5KQGA 1UMCA 1VJ1A 1QHYA 1COZA 4O2BB 4WKGA 3NVMB 3JQBA 3RM3A 1QLWA 4QQKA 3LLMA 1AOXA 1M5TA 1MIHA 1MTZA 5FPSA 2ZWPA 1H42A 5JSZA 1DLJA 3H3FA 5ILQA 1Y9ZA 1W36B 2YHUA 3QVTA 3I2KA 4GHWA 2AG0A 2ZRHA 2X41A 1MJ5A 4CXMA 4GXRA 1RLOA 1AUOA 2WD8A 4ED9A 2PAAA 4M54A 4GQAA 2OHGA 3LT1A 3TPZA 3HU3A 5K03A 1MFPA 3AUYA 3KLMX 3JW8A 1B26A 3CLSC 3FJ1A 2J41A 4ZOAA 3ZI0A 1CUDA 1CUGA 2QUBA 2JK1A 3EZ2A 3IOMA 1ZAKA 5EPEA 4E6PA 4Z5XA 4CI0B 4LF9B 4L1KA 1N1MA 3E9QA 4OXNA 3DDCA 3NWBA 1U4NA 2HXSA 3RWOA 4HZGA 2WFMA 4RJKA 1FS4A 4WN9B 4MVXA 3HRHA 4NDZA 4GWLA 3ZJ4A 2VCEA 3PYXA 4BTVA 3KD2A 3EPKA 2HYIC 4M0DA 1ULTA 4M6WA 2WJGA 2O07A 2IHTA 2WG0A 1EVQA 5TMDA 3WK5A 4JLKA 4MV5A 3FVTA 5BSRA 2HO4A 2X8WA 3A1VA 8ABPA 3QFRA 2W4IA 3PUYA 2CV2A 1MXFA 3FXAA 4NEQA 2L69A 4QLAA 1GZSA 1YVEI 3L04A 4BGUA 3HRKA 3LCJA 4RVGA 3HWWA 4JBIA 5KREA 3OSZA 3KSRA 1DCTA 3M4YA 1VL1A 3JATA 4YRPA 5JD5A 1N1EA 4QXMA 1AHNA 1EP3B 2PCJA 4NL4H 1F2UA 4HRVA 5L7TA 4NG5A 1LV8A 1Z33A 1E1CA 2ZTMA 4CM1A 1OU0A 5JI3E 2D3WA 3ZHSA 1WUYA 2UVPA 2VYCA 3E70C 2QA5A 3D8RA 3NV9A 1EFVB 5H5JA 5THKA 3WB2A 3WKEA 1RRCA 2P3LA 1FFAA 3PPVA 2XE4A 2IOYA 1V1RB 3KWFA 4TROA 1JA9A 3AWDA 1R6DA 3GB9A 5E4JA 3W1VA 1UPTA 3FFTA 4KFTA 3G2KA 4G4JA 2FPOA 3M5CA 1KWKA 2Z3ZA 4EYKA 2HSZA 3MJHA 2JB9A 3SF8A 4P2GA 4OQLA 1V8FA 2X8AA 4UPEA 1QFJA 1LU9A 2WJAA 1DFHA 1ZVVA 2GVZC 1KIFA 2J3EA 1XAIA 2PJUA 5EZYF 1XPJA 1BOOA 3AI3A 2A0FA 1N2GA 2WLTA 3KE9A 3Q6MA 5CW1A 1FU8A 4PC3A 5EZSA 2EYUA 1VSUA 3EYWA 1PNVA 2WIKA 1M6YA 3KXDA 3GBPA 1YUBA 3OE1A 1UR5A 4X60A 4OQXA 4MPRA 4P2BA 5H70A 4BJ5A 2XH8A 4REMA 2HHLA 5D51S 3K0HA 2CFSA 3PA6A 1RZRA 2JJQA 5IAGA 1M6VB 1VCMA 1U0RA 4MLCA 1JN0A 3D2CA 4XIIA 1EG7A 3ZWNA 4F9TA 3EVDA 4BLTA 4H4DA 1UWVA 3WLEA 4EUEA 2W58A 3HNPA 4TT3A 1I94B 1TTHA 2QG9A 4RKRA 4RX1A 1O6ZA 2WHXA 5BV8A 3VH3A 3DOJA 2RI0A 4ZGBA 4WFJA 4DDHA 4AKSA 1GXSB 4JVSB 3PQDA 4FDLA 2M9MA 1M7HA 1YULA 5LUBA 5I9TA 4RVNA 1UOEA 4FFOA 4FONA 3TRFA 4LPSA 2F43B 1ODFA 3D3JA 3OSUA 5LKAA 2DLDA 2QLTA 1CNEA 1GITA 10MHA 3RCBA 1YVUA 3CLTC 3K94A 3X1WA 2ZJ3A 3E4CA 4C3VA 4C6TB 1AS2A 1P0MA 3RW9A 4B43A 4BN5A 3ICPA 4ASUD 4F46A 2WAMA 4AUMA 2F9FA 1QHHA 4EQZA 5I4KA 1KS2A 3WAKA 3OZBA 4LDJA 1GUBA 1Z39A 2EFCB 4KLAA 2GUGA 4ZQFA 1QGUA 2VF2A 2XKJE 4WOPA 5C7YA 3I72A 4RTOA 2ORIA 5JAZA 2ZXUA 2BZ1A 4F1KA 4B75A 5EHQA 3NWJA 4KAFA 1UH5A 5CT5A 3U9LA 4K9LA 1U8CB 2JFWA 3L6RA 2ZJ7A 1TF5A 3AUXA 3IQEA 4LDAA 3WK6A 3B6ZA 4C4SA 1I7DA 2Z6UA 4PPNA 1QUEA 1UT5A 3CRVA 4IVRA 1XYYA 1V8DA 3QUBA 1UP6A 4JOCA 4UEJA 5NULA 3ZE7A 1DBRA 3DMTA 3SC6A 1DBWA 4ILKA 2FR1A 3W5UA 1NXXA 3ENQA 1E7SA 3W7AA 3WMFA 2RKWA 3EAFA 5AI4A 1HR0B 1PUJA 1XAJA 2QG4A 3HXKA 1BA3A 3QBJA 5AW6A 4CMEC 1FJGB 5SYAA 4YK7A 4B09A 4KPYA 1X6VA 3HHPA 3FYUB 2YYAA 4HQOA 3RVJA 3PF9A 3QYJA 3F6EX 2VNHA 3TINA 1MQAA 3IHLA 4DPLA 2FF5A 1F4VA 2ZI3A 3AEKA 1XAGA 1NUSA 2JFZA 2AR0A 5CA1F 3AJDA 1XTTA 3DDNA 3DV2A 3P2KA 4MWCA 3H11A 4HSGA 4LDZA 1VGRA 1T29A 3T7JA 2DT8A 1YOBA 2FEKA 2JW5A 1Q7RA 3TRHA 5AVVA 3U3XA 2CLMB 1NPDA 4I1VA 4MB6A 4U2CA 5ALDA 3V4LA 4NBTA 4BN0A 1OLXA 1DEXA 2VN8A 1SB8A 3IBCA 3SXPA 5BRJA 1UJ2A 1J25A 1Y82A 2CUTA 2PLNA 4E70A 1WXQA 1K9VF 1M0TA 4KC0A 1U2TA 2JFFA 3UGKA 5MFPA 3LBNA 1K5GA 2FMUA 1QIMA 2WP0A 3K9FC 1XRMA 1N5MA 1I7LA 3IAAA 1PZNA 4IDCA 5KYVA 5LZ5A 4DSNA 1HX7A 4TLMB 2B1GA 3AR9A 1NU6A 2Q4EA 3RC3A 5I01A 4U5XA 2VS1A 4LG1A 1Q7CA 3ZWWA 2VZ9A 4C7XA 3DOEA 1T8PA 4MGIR 3DAPA 5ICMA 1A5BB 1RI1A 1G9SA 4HB2A 1DAGA 1ZXLA 1NUTA 3QSGA 3AHIA 4MVJD 3O8QB 1HLPA 4LVNA 1ZONA 2XHZA 5L3RA 1ESZA 4FYPA 5KDOA 2WBLC 3VQTA 2Y9MB 4OP3A 2C04A 1HI9A 4J1SA 4XB2A 3ZQ4A 4UTRA 1O0BA 1ENYA 4TXHA 5U1PA 5FNVB 5B3LA 2NO7A 5AKJA 1GUZA 3X1ZA 5TV2A 5G02A 3JQ8B 3VC1A 5L3QB 1ID1A 1I4TD 3V1KA 1XA4A 4B4KA 3ORYA 3CUVA 3AJAA 4F06A 5AVYA 2ZPAA 3ZVLA 1ENOA 2IZ7A 3RJZA 5IHXA 3EPHA 2KB0A 3BIOA 3EG5A 3IELA 4Q05A 2B98A 3I4FA 2P1RA 4NFSA 1E69A 5I9MA 4JI1B 2YWCA 3S4YA 4GPD1 1SVLA 3I6MA 2R8RA 1R7RA 2IODA 4QOSA 3LDHA 5I7AA 4UHHA 1FRNA 1EEHA 4KQWA 4MWSA 3UHJA 4G1VA 8LDHA 2HT1A 1XIVA 3U60B 2Q3DA 3VU3A 2Q0SA 3F90A 2DRIA 3K4HA 1AB6A 3KHTA 4QXQA 2TYSB 4TTVA 5E2IA 5J1TB 1XFAA 5B6PA 2PRIA 3PD1A 3RIXA 2ECOA 4P3YA 3T0GA 5F2OA 2PUWA 4RDHA 1O54A 3P45A 3W5IA 5T5QA 5J2UB 4KR2A 3P32A 1YZUA 4BMXA 3EEBA 2C4TA 3DLTA 2OD9A 2X3UA 5T8KC 2QUIA 2WIJA 4I5DA 3KV1A 2P0EA 1WXGA 2Q4OA 1IQRA 4IJUA 4OSEA 5JLAA 5LP6B 1E5LA 2VNJA 4YMIA 5E3JA 3ZS8A 1OU4A 4LKRA 1CE8A 4ENSA 4DAEA 2RB5A 4HB4A 1B1CA 2C0PA 2W6QA 1Y0BA 2VSFA 3OMLA 5ESRA 2P4EA 3SS7X 3JAMA 1AC5A 3I61A 5JXGA 1MVLA 1OXSC 2WTNA 3WK8A 1CDEA 1Q74A 4G8JA 2CZCA 3C3JA 4R9NA 3RS9A 3PRYA 4BFYA 5L7WA 3K9BA 3A0UA 1SXQA 2JAWA 1XU7A 2BFBA 2E55A 4K28A 1CQJA 5FEUA 1TIKA 2JH9A 1Z29A 1WW3A 3CX3A 3TMYA 2IHJA 4HP8A 5F3DA 2QUKA 1OFHA 3B3FA 2FP4B 2LNDA 3B5IA 4BO0A 3ZJTA 2LDBA 2INGX 3O03A 2IEZA 4N0MA 3VYTB 4F7DA 2O3SA 1Z0JA 2CXQA 3PC8A 4B1FA 1XP8A 1Y8QB 1CRZA 1I3CA 5FL7A 2NOAA 1RPZA 3F67A 1LS1A 2I99A 4LKOA 3HABA 1RE0A 3Q0IA 1FJXA 5L3SA 1F20A 5LA6A 1UDXA 3K8QA 4KWIA 4PLCA 3H2ZA 2R6GA 3EGDA 2H31A 3N2EA 2GHRA 1EGVB 2NXCA 2Q1TA 2Q1WA 2HPZA 5ARCA 1VLJA 3UN1A 4BVJA 1W0JA 3KD3A 2FPMA 1NXTA 3T5AA 1D6JA 4KYIB 3O4JA 1W4CA 3C8DA 4WK0B 2TSYB 1R8JA 2QI9F 2ONCA 4C6SA 5KVVA 5AQ1A 1GYQA 2FPPA 3GVPA 3KJQA 1G6HA 2AXPA 2J9FB 3QEMB 3CX7A 2BM1A 2IELA 3BJRA 5JRZA 5JS1A 3KLPX 2I29A 5CP8A 4OA5A 2YVKA 3IPLA 2ZCUA 1A9TA 2BLLA 1T35A 4I08A 2E49A 4RCVA 3V4FA 3FCUB 4HO1X 4QWWA 2TRSB 4P9NA 2F1HA 4ZPJA 3ZVRA 1SVUA 4P5DA 4ZI7A 2PXCA 1FX0B 2BMAA 4BQFA 3HFGA 1DXQA 3KKQA 4GX5A 7MDHA 3ZVKA 2CDCA 5DNWA 2BUBA 3DB2A 1VCHA 3KT8A 2J8ZA 4L8GA 2BI7A 5JBIA 3QI7A 1BFUA 4Q3LA 5C81A 3AVVA 1ZC3A 4X6YA 1VYHA 4UD6A 2PTHA 1XQ9A 2FPWA 4KB5A 3GO4A 1MMFB 1KFEB 1ISIA 1VE7A 4GPIB 4Y7DA 1T15A 3WKCA 3ZN2A 1QQAA 1UJBA 4R2MA 4TXNA 5KYUA 4BX0A 3KK0A 5KTSA 3GHHA 4DIDA 1UADA 3DCIA 2XD4A 1PV2A 3VPSA 2VRCD 1W4BA 3FYUC 4B5LA 2HSWA 1A7UA 2F3RA 2XY4A 1V6AA 3DF7A 1XU9A 5K0NA 5K2OA 2ZKLA 3GRAA 4OGFA 4FFMA 2G77B 2QJTA 3LPNA 2PA3A 3Q1KA 2IU0A 2JLXA 1YCFA 1V3QE 3ZGVA 3V1MA 3ZHUA 4XX1A 1P91A 4K2AA 4BNDA 4YQEA 1HFEL 4EI9A 3LKZA 4B3FX 1SEPA 1CIVA 4IYJA 5GV8A 4GPAA 1U7WA 2X2FA 1U5CA 5C1BA 4CIAA 3CGWA 4R2JA 3EXAA 2REBA 1PTJC 4L3VA 1DOAA 3DBIA 1PR5A 2XGGA 1Q15A 5JCPA 4C4PA 1HFKA 4WADA 5G4KB 1PS8A 3H13A 4O63O 1KSFX 2J9GA 3K53A 2P0AA 2QNBA 5DBGA 3L6UA 1UANA 2I0FA 1MDFA 3TS1A 3MOGA 4ZI7F 3D31A 1KIAA 2O19A 4IZOA 4MMYB 4HWKA 1XD8A 4KFSA 1PG2A 4L5YA 4LV5B 2XGJA 2WUEA 2H0QA 4V0MA 4A03A 3ITKA 1RE1A 1GA1A 1W1WA 4ZQCB 5I5GA 1RYDA 1JUDA 1SVSA 3OZSA 1T5SA 3CKMA 2P1DA 2QZPA 4Q7QA 2PD6A 4UM9D 2QGFA 1YQEA 2VAWA 3BZBA 3COPA 2A0WA 2DMRA 4NCXA 3CNLA 1AS0A 4ZOCA 1MUUA 3RS0A 1U2SA 5B2FA 3DYVA 4I2NA 4DJEC 1F17A 2ASVA 4V0ME 5BOVA 1CB7A 2NIPA 2R9VA 3HL0A 3EXFA 3Q88A 2ET6A 1YI1A 2ZJ5A 3QITA 4NI5A 1DTSA 1PQ4A 4DNFA 4OHUA 3ZE2B 4NARA 5JJKA 2YWGA 1EIWA 3HB5X 2XYGA 1SG9A 3NJRA 5EMNA 1O6GA 4A0QA 1NURA 3L79A 4EHJA 4IQ8A 1RTKA 2EW2A 5DMHA 3TLAA 6REQB 3PIIA 3W05A 2FZ4A 4KKXB 1J2YA 1EFRD 3PYMA 4TPKA 1AKYA 2GCPA 3C3YA 3HKCA 1ISGA 1JALA 2QOEA 2VJBA 3M6XA 4OLJA 2HFJA 1QS0B 2YHBA 3AP2A 3TQSA 4IXDA 4C07A 4LXYA 1U0HC 3URKA 1YDWA 3MYYA 3QE0A 4YAFA 5ENVA 3RNLA 3VZPA 5IYZA 1MD9A 1P4SA 3DT6A 3PXDA 1KZ4A 1XTBA 1YL5A 1A8UA 4O5AA 1R6BX 2H63A 2WZQA 4GUDA 5JQGA 1ZIDA 5C80A 2NADA 3QWHA 4OX9B 5CHYA 2AG5A 5FR2A 2PXXA 5IJ9B 4N6OA 5GJCA 4BRUA 1TLLA 3UAVA 2O6LA 3A04A 1JVSA 2GTPA 3BFPA 4UE2A 5FOUA 3TLGB 1U4OA 3MMXA 4FCVA 3DOIA 2JAOA 3EE6A 2NYAA 1OV4A 1S1CA 1UKYA 1TM3E 5E6RB 2ZAMA 2CNWD 1F4PA 5C8XA 2ZULA 4CUZA 4KKVA 4V39A 1RWBA 4ZD6A 2P6RA 4MWEA 1ZVQA 1TK9A 1D04A 2X2OA 1EVEA 1WO8A 2O1SA 1XKLA 3P8ZA 1YS4A 3STXA 5K6AC 2ZJ1A 1FSPA 1TA4A 2XVMA 3O21A 4HG2A 5JRJA 4ZVLA 5LQNA 3RKUA 2O8FB 4IF4A 2H9YA 3E03A 4L8VA 1DV2A 4WZAB 5FPKA 1U6JA 3IEUA 3PKZA 4N7BA 1SAYA 4QGAA 3LYHA 1PDWA 3IPXA 4ALLA 1O3YA 4JH0A 4NICA 4H0CA 5FTJA 4A15A 4J2HA 2H9IA 3KB8A 3SNKA 4P3NA 1CW2B 2YZ7A 4AF6A 2BGJA 2PEYA 3M5PA 3PG5A 2BR4A 3DHWC 4X62B 3H19A 3H4TA 4EF4A 1LX6A 1BTOA 3LXRA 1DEKA 4NFLA 2R4QA 1D0VA 3R5KA 1RM0A 5BV0A 3GH3A 4WK4B 5JO0A 1DJLA 4I50B 1EP9A 2NT4A 4RPIA 2ONKA 2FCAA 1O95D 1E1RA 2QL6A 2WNHA 3OO1A 3WRYC 3ZZTA 3F49S 4RMJA 2XCTB 4PAMA 1KJQA 1HDXA 2WFZA 3GK3A 4M49A 3EIFA 3L0YA 3B89A 3K1JA 4DCNA 2FW7A 4L07A 2BBWA 2AN1A 2FQXA 2C3UA 1N6KA 2IYNA 2OFPA 3I01M 5E1MA 2PYIA 4YV0A 3N2YA 1GPBA 1S1MA 2PUGA 1J4AA 3HJBA 2I76A 4BNXA 4MUFA 3OQIB 1QORA 4WKBA 3IVMA 4XIYA 4LZZA 2HA6A 3I0MA 4IPTA 5DLQC 4G2NA 1DZ3A 3FD8A 4JHXA 3UWOA 1I80A 5CT8A 3K1ZA 2C4VA 1DWOA 2VTDA 3KXLA 3ZQ6A 2X22A 5CNMA 5DM0A 4EW1A 4HJXA 3T35A 3NJ8A 4P3PA 3U4GA 4QBFA 4B46A 4EMUA 5IAEA 2HM7A 1N6RA 1WSDA 2C94A 4YJDA 3DVSX 3FG9A 5IEJA 2UU9B 3EQZA 2CLOB 4Q39A 5ALOA 2GD1O 3KR9A 3QXHA 3EIXA 4JU8A 3ZLUA 4CLOA 4PPQA 2FKAA 3TLJA 4KXMA 5EJ5A 2ATCA 2OO5A 1KPIA 3B3GA 3C48A 4FZRA 5KTRA 1FFWA 1VI2A 4AO7A 1O4WA 5K01A 1DS6A 3DJYA 4QPPA 2R7MA 3N5CA 3UJ3X 5KBYA 3P9XA 2VHEA 1UBMS 5AQEA 1OC2A 1TA0A 2I62A 1RQPA 4EB0A 3HFRA 4HMOA 3UT5A 1COWD 2HQSA 3CVVA 2Z57A 5IKPA 2E5LB 2O05A 4RLFA 1SURA 3FPSA 3RIEA 4O8CA 3DAYA 2EV9A 3P2IA 5DGDA 2QTFA 5JISA 2ZRIA 4DCGA 1I4EB 2LBPA 5CLQA 3FLMA 2HQBA 4AY4A 5KB3A 1WCWA 2WPNA 5CDUA 2OKGA 1FJ2A 2ZJBA 2YFYA 4NPAA 2BLNA 2UYGA 1M5UA 4KFUA 1N0IA 4KXWA 1CK4A 1KH3A 1MDBA 2OO5C 1XGKA 4BKPA 3IAS1 4UXIA 1GPLA 4LF8B 1N6LA 4D46A 1NXPA 1UXJA 1OMOA 1OPXA 2XMGA 1SC9A 4FYXA 3DPUA 3IEVA 2AC2A 3WP0A 3ZDRA 1ZCBA 2VP0A 2NZUG 3L6DA 2GYWA 3RANA 3MTQA 2CXHA 4MCAA 3PUVA 5C5DA 1DX4A 2VF5X 1D0SA 2LKCA 3RRFA 4E0BA 3H86A 4K46A 4TWAA 5AI0A 1GGVA 4FCTA 4IR7A 4DA4A 1ZJJA 3TCKA 4ZYXA 1BW9A 1NASA 4FWIB 1SNYA 2AQ8A 3AH8A 3WGHA 3SM3A 4CCWA 2A1UB 2D7CA 4DXAA 5ABPA 4KQIA 5ICCA 4KIFA 4F4JA 3WGZA 5ADVA 2Q6KA 4D8XA 2OTCA 4A4DA 2C4WA 5LVAA 5HZGA 2V65A 5F33A 1UEIA 3HDJA 4M0LA 4OXYA 4X71A 5GMOA 4JI4B 1R1DA 3IO5A 3SS9X 1DJMA 2PMKA 2FPGB 3AKYA 4OCZA 1M2OB 1ZUWA 4QUBA 2O2JA 3HDGA 2Q5IA 4J3FA 3NAMA 2PE5A 1W7AA 2HN9A 2XZOA 1KVQA 3FGOA 4G5XA 3GG2A 1VIMA 3PFFA 4JGIA 4KUGA 3ILHA 4N5MA 3U3ZA 4AS3A 5BW4A 1JYFA 5KUTA 4F3RA 2P8SA 4K1LA 1PGNA 5G41A 4D3ZA 4S1WA 2IV2X 1E0DA 2GETA 2ZTUA 5IJWA 1BJTA 3HUTA 4KACA 3ASVA 4XEUA 1MRZA 3FA2A 4A36A 4PNPA 1DI0A 1DUVG 2D5AA 2AFIA 3GZJA 3CVUA 3KE8A 4IIGA 1E20A 2QAJA 4Y2TA 1DT5A 4RSGA 3N86A 3A2LA 1AKMA 2JCVA 5DHAA 1G7CA 5U4QA 1VIAA 1QC5A 3B70A 2I55A 4Q9HA 3Q8XB 2Q3MA 4GXQA 4Q3BA 3IO3A 4JUBA 5IT5A 3VOBA 3WSTA 2D4AA 2O7SA 3TD9A 3HPQA 4JL6A 7REQA 4LYFA 1JG4A 1KK1A 2YBDA 2RAFA 3K5PA 3STYA 4D9MA 3KKLA 4W8GA 4FU0A 2X0DA 1GG9A 1EK5A 2AB0A 2ZQ5A 2VZ0A 2GB4A 3WVNA 1MPTA 3OFNA 4DLKA 4GLJA 1UFRA 2OVBA 4LGCA 3QWAA 3LQQA 1T13A 3UF0A 2DR0A 2YFQA 1CETA 2QV7A 2JHCA 1E8MA 3PJEA 1QE5A 4C0JA 3GPIA 3B60A 1TVKA 3V8MA 4BO2A 1KJWA 1U1DA 2JH3A 1Q0ZA 4B3XA 4BWFB 1U2PA 1SU7A 5AI5A 2OQVA 3OHMA 2ADOA 3PEVA 4DSOA 2YQ4A 4LVCA 5AW5A 5LDGA 5EMMA 3RV4A 1O8CA 1I10A 3EVGA 4G86A 4QU9A 4LXTA 4F8YA 1KQPA 4RVFA 1VFPA 4LBZA 3O4RA 3Q7RA 2H8GA 5JADA 1S2OA 1EDBA 2V5AA 5CX4A 2NX2A 4ZT5A 5CLHA 4Z4FA 2RAVA 2CXSA 1YIOA 5M2QA 2G0TA 1JECA 2RARA 4L76A 2DFVA 1NF8A 2CF6A 1KAEA 4KDFA 3RC9A 4I55A 4W9MC 5LZ9A 3EQ9A 1XI2A 3PT9A 4LOIA 2VP6A 3OPQA 3EZYA 4IHQA 4MQ4A 4O4IB 5D8DA 2FETA 5K8CA 1F9AA 4DLAA 3IVGA 3RUIA 1V48A 3GT3A 3FFWA 3L5OA 2EZUA 1D2HA 5ALWA 5H83A 2QT1A 1JVBA 1LI7A 1NIJA 3BE4A 1Q7GA 3IILA 1NC1A 3NO4A 1NQ5A 3PJFA 4G5OA 1NNLA 3IB3A 1WMSA 4H6VA 3U62A 4AYTA 2EZ4A 4NS4A 3KX2A 1FW8A 3T4XA 5KPDA 2QY9A 4EF5A 4S12A 2HSDA 2W2LD 1LLQA 1SCNE 2WWFA 3O26A 1QJCA 1VSTA 4R54A 3HA5A 1WP4A 3PF8A 3MT9A 4D41A 3UV6A 3TXAA 1MZPA 5EHGA 1Y3FE 1V4NA 1X7YA 4Q21A 1C7IA 2X0KA 4ENVA 5LA6B 4BNHA 3CNNA 3REQB 4BWYA 4HNVA 3BIWA 2ZRAA 4AULA 1XPUA 1I0LA 2ILTA 2QVYX 4FFSA 1YR8A 2YWFA 1M6WA 4IDQA 5L3ZA 3LBIA 1GNSA 2PBFA 3ONDA 5G0VA 3ORHA 1GUFA 4TXLA 4MYCA 4ZANA 4IIJA 5IT4A 2X9NA 5HMMA 4DXHA 2XLBA 5KTOA 4LYHA 3RG2A 3WTBA 1YOVB 3LWDA 3KYBA 1F6BA 1AM4D 3QU7A 4Y6OA 5AM1A 2RHOA 4CCAA 2IXFA 3MINA 3OEYA 4F2PA 3ZHTA 2XUGA 3K70D 3TFOA 1WCV1 1H2YA 1RJGA 3PDIA 4B81A 4HTFB 2MMCA 2O8BB 1LK0A 2ZJ0A 3HV0A 3KKZA 2PBRA 1X1AA 4XB1A 4Y1FA 5ELLA 2TMYA 5IAJA 5LZ4A 3N2IA 1HDCA 4KDEA 3B38A 3FROA 4O8ZA 3HP4A 4RHCA 4Y98A 2HTFA 5GAJA 2XUDA 2YWDA 1ORWA 2VYND 3KJNA 3QENA 4KYVA 3D6UA 3OOWA 2EBUA 2HRZA 2HA3A 5E38A 2HJRA 3FGNA 5LN1A 4GI2A 3IIMA 4X24A 1KJNA 2BF7A 2O52A 2G80A 2PKYX 4B3DA 5A7HA 3K32A 3K0CC 3O8RA 4QG7A 3EC2A 1BCRB 3GBSA 1Z07A 3L1VA 1P9OA 2A57A 3R0QA 1RR6A 3EFOB 3OCYA 3B9PA 4I1OA 3H2JA 3D3EA 4RK4A 5B12A 2AQKA 3EXEB 1R6XA 3R23A 1CQZA 3C39A 4E6EA 4WBXC 2V7WA 4UM9B 4ZDIA 3ND9A 4A2CA 3V2IA 1W94A 3JQ8A 4BATA 5L3QA 1PX0A 4WFIA 5AP9A 1N7IA 1Q21A 1XBTA 2IHBA 2CJWB 3RUFA 4EVRA 1Z5ZA 2B34A 4P53A 4RLSA 4IG9A 2ZUDA 4LRQA 5ICGA 1BX0A 1NVBA 1L5SA 4K6OA 2XWPA 4KRYA 4R7GA 3UJDA 1NGSA 1Q77A 4E32A 5FLXA 4OX9Y 1DBSA 4L5AA 5C8YF 1ZN7A 4RULA 1KA9H 3U2QA 4JB2A 4JN6B 2LVBA 1F8XA 2O20A 5KMGB 4B2YA 4HFMA 3ROEA 3WFIA 1R37A 4IDBA 1LD3A 5IZ4A 1FMCA 3C7KA 2FYTA 2R85A 3MTIA 4NYJQ 2AMFA 4DV0B 2KSQA 4KR7A 1SUIA 2YR0A 1LVUA 2JFBA 4L5CA 1LDYA 1HT1E 3JZMA 1NJ2A 1IM5A 1DIBA 1LPOA 4FQ5A 4N65A 1OASA 4Q02A 3WZMA 3FOFC 2I4LA 4GFDA 1CJSA 1WHTB 1GPWB 1OLXB 3QZUA 3F74A 1GKIA 3SZUA 3V1YA 4TRMA 4WZBB 4LXIA 5AJXA 4TQUS 4YJFB 3UXMA 4KXLA 4G1MB 3DTVD 1E2IA 2FW0A 1NI5A 1OC4A 1UC8A 1CU1A 1Z18A 4FLFA 4N5NA 4QELA 5DM70 1OVMA 4JB3A 1G21A 5G53C 2YXLA 1KEVA 3RC1A 4B8WA 1M33A 3VHXB 4WW0A 3AY6A 4N48A 1CUEA 4N3NA 5AD1A 3ZLVA 3W5JA 5HK9A 1H1LB 4PZYA 2CEKA 2VCYA 1VL0A 2XUJA 3MOSA 2O2XA 4AO6A 3BZWA 2CE2X 1C8KA 1OTHA 1T8TA 2WAXA 4OK6A 2PG3A 3ZWPA 5A3JA 4EUHA 1SQFA 2DQKA 3CJQA 3CN9A 4GE3A 4IGFA 3A1SA 4M1OA 4RYDA 3OZFA 2WU0A 3AEXA 3W5VA 3CSDA 2ZB3A 4KBFA 2FUCA 2ZYRA 4I2VA 2OZPA 3DBRA 1IEVA 1AGXA 1KDOA 2ZRBA 3LUGA 3DGFC 1WV1A 3QU2A 3SZLA 2EBFX 2PSSA 2KJQA 2ZROA 3OC0A 4PQGA 2V7EA 4ZKDA 1CT9A 3DH0A 2C88A 3K0EA 2A9PA 4CL2A 3UMRA 5F7XA 4G5RA 4OB8A 1MC1A 1U1IA 2F3SA 2IEYA 3MUNA 4PLTA 3T94A 5FUYA 3V4OA 1NW7A 4D4KA 3OLXA 4URYR 5FOXA 5FWXB 3MUEA 2FMTA 3P9SA 2XYHA 2RH9B 4P0PB 1HOTA 2O0JA 3C3AA 5K1ZA 1U9IC 1A7KA 2QXUA 1DE0A 1X77A 4KO2S 4YJ2A 4KO4S 1VHWA 2PSDA 4DR5B 2ZSEA 2KWIA 4M9RA 4RH3A 4XCXA 4RM2A 2ZI6A 4QXOA 2QMZA 1NMSA 3F1KA 5C1IA 4RM3A 2A4KA 2GPAA 5AVTA 4IIDA 3V1NA 4ARVA 1RNLA 1GVHA 3QVOA 4E31A 3A4VA 1SVKA 1BKYA 3EZGA 2EIXA 4G26A 1C1XA 2EQAA 3CNQS 4I4LA 4TZ0A 3EGXB 2E1PA 3KTDA 4K6KA 4BFCA 3ROQA 1RWWA 2Q99A 3I9OA 1YA4A 4OF4A 4BO3A 2P77A 2W6MA 3RARA 2DKNA 3T5TA 3PRHA 1P5ZB 3E53A 2M6LA 1OIXA 5DEOA 3D6FA 3UGQA 1N36B 1FPMA 1PR6A 1AKWA 2XWJI 2ZB2A 3H5AA 4G89A 1JRLA 1KQ3A 2BEJA 1CD5A 2QRPA 3DOHA 4IJKA 5KTKA 3IT2A 4M0MA 4RPGA 3AESB 5CLLA 2Y27A 3OIWA 5AICA 2C99A 2AOXA 1OBVA 3PFNA 4FJ1A 4CM9D 4AJOA 1ELOA 4R83A 2J3MA 5L53A 3AV0B 4MVJA 5AK5A 3MSCA 4I19A 3TUJC 3DTNA 4YJGB 1QQ7A 3R6TA 2HGZA 3LD9A 1PT9A 3B48A 4NU6A 2IOHA 1HQDA 2FRXA 5BNZA 2FPLA 2ZKIA 2VDRB 5AKZA 4G0NA 1PQWA 4MW4A 3D64A 1M0EA 1XEWY 4BQSA 3AHHA 4G8BA 2QW1A 3I28A 3O4VA 3IMKA 1OWNA 2IYPA 2C9YA 3MPUA 5E2BA 3H5NA 4JROA 5B57C 4DCUA 3A9WA 3HM2A 3GRVA 1JQKA 2Y05A 3QELB 3DOUA 4AZ3A 5FHQA 3KLBA 1C4WA 1H0KA 3FZGA 2W4QA 2QVBA 4IH9A 1PHRA 3HFJA 3ZWDA 1Q50A 2FPKA 1KZ6A 1R9MA 3USES 1QLJA 2C3PA 2QJOA 3R9XB 4BO9A 4HLCA 3RJMA 2XCUA 3AR6A 4YMWA 3LX8A 1X9GA 1CUJA 3KFXA 4TYMA 3KUCA 1GPDG 2B5OA 1YDFA 4W5TA 5JXWA 2C9MA 4PWYA 1HNWB 3WZLA 4U7JA 2EYQA 1E0JA 3EA4A 2W0MA 2WWVD 2UZ4A 3KDAA 2G36A 2P4SA 1DZIA 5TQ2A 5DW3A 2JGNA 3LCCA 2QVZX 1XK6A 3KPJA 4ZYUA 3HBFA 1SHUX 4JDPA 1ZD3A 3L6EA 3N0XA 4A6PA 4KVAA 1OHHA 2FQWA 2GWRA 2Q1XA 2R6AA 2UUOA 4URUR 4BDSA 5A06A 5K4HA 1AGPA 1S9DA 1OX6A 2CDRA 2QAIA 2ONYA 1HYGA 1ONSA 3A05A 3O90A 3Q7EA 4N5HX 1BX3A 4BCBA 3P0EA 5IKOA 3ZV6A 4ETMA 5JXIA 2DJIA 1XB2A 5DTQA 2V54A 5FP0A 1UWCA 2B7CA 2XXAA 4P5PA 3NFRA 1NV8A 3B1ZA 4IFBA 3T3NA 5GINE 4HQRA 1KKUA 4GSKA 4NATA 1ADFA 3VPFA 4BBJA 1L1RA 3D2AA 3WICA 1E2FA 4J7UA 4JUAA 2RC5A 2GF2A 3BXZA 1XP5A 1WVMA 3K4PA 4GNKA 4RJIA 2AJTA 5C34B 3LQFA 4IQ4A 2ZIAA 3BH7A 3UYKA 2KE5A 1Z6GA 1VCOA 3IX7A 3O38A 3WIUA 3WOVA 3F71A 2FDRA 3TTVA 1A50B 1YR7A 2B1QA 3ADKA 3FWPA 1J00A 3C7TA 2BDTA 2Q0XA 2HIAA 4D4LA 2DFPA 2KYRA 3V5NA 4DG9A 5A3QA 3W3AH 2P9EA 1NX6A 3CCCA 1Y8ZA 4AZ3B 4MWOA 1L5QA 2C5FA 3GGGA 4LFBB 2FEOA 1GEEA 2VWPA 2JAQA 2Z5GA 3GNSA 1WZNA 4NMWA 2X0EA 3UEOA 4B2IA 2A92A 4Y2HA 2NO0A 2W70A 3UJ7A 2J5XA 5CNJA 3UENA 1QK3A 4ZOLA 3KVNA 3RNOA 1GNQA 4EYEA 4Q1DA 3X1DA 4HNAA 3GPBA 5KWVA 3ERCA 4IQGA 3IBYA 1Q1EA 1BRTA 1U28A 3GAFA 3KBBA 4ARBA 4P08A 4OXRA 5KVAA 2RI6A 1N2HA 3QFCA 3WYFA 5DE3A 3TKLA 1JEOA 3RU2A 1HO3A 4FGJA 2BGGA 3VZCA 1J49A 1ODIA 4S04A 4WCFA 5BW5A 4CF7A 5JXJA 1MENA 1ODCA 4GL4A 1UZLA 5SZHB 2PIDA 2G70A 3V97A 2QSYA 2R7LA 1U5BB 3LZDA 3QBEA 4J0FA 4TSFA 4XSGA 4EYOA 1LBSA 4MRRA 3D3KA 3MBKA 3GCZA 1QFYA 3SJAA 3KSBC 5HKOA 4EB3A 2R8ZA 2SNIE 4RV4A 3E23A 2YS6A 3TTWA 4IWXA 3R5TA 4WK2B 1C9JA 5CYGA 2R5FA 3UGJA 1UK8A 3AM5A 3ZU5A 4F97A 2AMLA 2VNAA 2XUPA 4ID9A 4KXNA 3QLVA 3QIAA 3WBKA 1N3YA 2V3WA 1C1XB 1FLNA 2RJOA 4HTAA 4RE5A 2WTMA 5AJHA 5FIUA 4DLZA 4ZHQF 5FBZA 1T6NA 3EOBI 4UAVA 5DB4A 4J0KA 4DS3A 1XZLA 4JITA 4UOEA 4Z7QB 1R6TA 1O0SA 2AW3A 5F78A 3BRCA 1SQSA 4YJ2B 1B74A 3LW7A 3PVCA 4M38A 1SRRA 3AETB 4NKRA 2LV8A 5G40A 3BK2A 2OV4A 2K6GA 3DEFA 5AUOB 4WZ6A 3PNKA 3RRYA 3ANMA 4BKOA 1VE6A 4F5DA 1UKZA 1SHJA 2IP1A 1A69A 3P9IA 2FZEA 4EJ0A 5J23A 2G28A 2JA2A 4H6WA 1EWKA 3OKAA 4OQZA 5FUVA 4CLEA 4FFWA 1IXYA 2HMTA 1BS2A 3O8CA 4RXMA 4C5CA 4K26A 5K0SA 2MJLA 1TUIA 1AUVA 1WG8A 3K3PA 3HC7A 1FNBA 3GMSA 1EAMA 1SQ6A 2WYOA 3QVJA 1Y80A 4I4CA 3OU2A 1JEQA 3DXZA 3SVTA 4PGHA 4Z3KA 1YZGA 2QY6A 1N25A 3DKIA 3HSYA 3I30X 3MGBA 4HWGA 4KL8S 3X0DA 1Z26A 4RHTA 4RDXA 5FAKA 1T4DA 1EM8A 4PAGA 4FNGA 4F3YA 1J09A 4DL9A 5KSOA 3WDKA 1RWKA 1F1JA 3AERA 2P6PA 5HW0A 3S1SA 3DMRA 4FS3A 5DXAA 5EOVA 3L8EA 2G6TA 3ZD8A 3CRW1 3DBOB 3LL7A 2AF4C 3RVQA 3T5PA 3HJFA 2O4UX 4KGDA 1GRCA 1IUOA 3BRWA 2P68A 3ITEA 2X42A 3B7WA 3F6YA 5FNVF 1N2ZA 3AEQB 4YJFA 1C1HA 5D6NA 3AK4A 3H3XA 1ONPA 1SULA 2J87A 4R41A 3V7UA 5EIEA 1HDRA 1WHTA 2O2ZA 1JFFB 2QJWA 3AKDA 4BFZA 4QGSA 5GTDA 1T36B 1KGDA 2BTQB 4ETNA 4J1NA 2BONA 8OHMA 5TE9A 5LP1A 1GTL1 4LPKA 1DG3A 1XQWA 3OI7A 2M6RA 3R09A 3DMYA 4D9CA 2AKEA 2X0NA 5IP5A 4JZYA 3VMMA 2IS1A 1GA4A 1JSRA 4W8OA 3WKAA 4B83A 5IU6A 1Z45A 5KMGA 2E4WA 4EHFA 4L9SA 5A05A 4D81A 5EMHA 1CUXA 3E35A 3GEGA 4OY3A 4ENPA 4OI0A 4OHZA 2R6DA 2IU4A 4JODA 3SZOA 1TJ4A 4G4SO 2GERA 2YYYA 1NDQA 3W79A 1DKMA 4WOCA 4B3MB 1RYHA 5KQPA 4HLUA 4LJ8A 1TL7C 2O48X 1GQOA 2J67A 3PI6A 1TQHA 4U2KA 1YFZA 1BEUB 2JJ1D 2WUVA 1OLUB 4CF6A 3WLKX 1V5GA 1VBNA 4ZJYA 3V4VB 3FRHA 1IN1A 2ANCA 5CVJA 1KYTA 4CV0A 3VC3A 3IUNA 4YJHA 1M1ZA 1I6LA 1B76A 3GWGA 5FBRB 4R71A 4QJIA 4WTOA 4DBZA 4MO2A 1RKXA 2R44A 3FDFA 2WE7A 4RPKA 2EJCA 3X3HA 4YB8A 3AL0C 4ZO8A 2DWCA 3PNMA 3S70A 2CLKB 2L18A 2QTTA 4JL5A 4AG3A 2R6CA 2D0IA 2AZDA 1X7DA 1G2QA 1PJCA 3CRMA 4IM7A 4XWGA 5JCXA 1ZM2A 4JYAB 3M8KA 1O6FA 4Z2YA 4NHOA 3NYWA 1SIOA 3DLCA 2RGNA 1EHCA 4JY7A 1PYGA 4X66B 5DTJA 2HUPA 4LX0A 3O1LA 4NDAA 4XWWA 4JI2B 1JEEA 3OICA 2P9YA 3LS2A 4CN9A 3PGXA 4JL8A 1OXXK 2X14A 5BN3B 3E4DA 2Z5VA 2AXQA 2C5BA 2G6BA 2BSAA 4OQMA 3O4GA 1OFUX 2R1UA 4BLQA 2PL1A 1C8VB 1A0OA 2R4UA 3ON5A 3DFMA 3R7WB 1JLHA 2BFNA 4Q1VA 3T3OA 4KR6A 1VMEA 2I9KA 2QRMA 3PQEA 2V7TA 3AIKA 5IM4F 3LCUA 1IVYA 2ST1A 4AN4A 2BFEA 4NOLA 3W9UA 5LIPA 3EPLA 1YOVA 3PEYA 4CMJA 3KCNA 2ZJ6A 1UKAA 4BV3A 2FFHA 3GD5A 3GIDA 5BV1A 1JP7A 1Y1TA 5C7OO 4CODB 4B6RA 5HNKA 1FNNA 2HF2A 5BQ5A 5CDGA 4P3OA 5LZ2A 3THWA 4OJKA 1NUQA 3JVDA 1TT5B 1ILWA 2WM9B 3F1LA 2HCJB 4Q4DA 1ZEMA 1AN0A 2IYYA 4QE3A 3ETDA 2AVDA 5JEDA 5JSQA 1Z6TA 3RAEC 1T43A 1IWOA 5EE0A 1C7QA 1T3HA 3HBLA 4IV5A 2BV3A 4R9UC 4ND7A 4EVSA 3KHKA 4HQLA 1ILEA 3Q7PA 3GXOA 3NHSA 4G65A 4ME6A 1T5LA 4LZPA 1BH6A 1QWSA 1SIWA 2QLFA 3OPVA 2C9OA 2ENUA 4MS4B 5A1TA 3RU9A 1RXVA 2NVBA 6YASA 3A6LA 1DDGA 4AKIA 2FW8A 3HB9A 4BVFA 1RAEA 4CM7A 3IFSA 4ABYA 1ZBDA 4J49A 4QTUB 4PSVA 1FYFA 4EI8A 1UKVY 2YKGA 2A5GA 4MI6A 4WY5A 5JZ9A 3EF0A 4RKEA 1G20E 1OZGA 3TJMA 4ZHSA 1G8PA 1QH0A 2GBLC 2H7YA 1JXAA 3A6FA 2ZSFA 3ESRA 4Y2XA 2P5TB 4KPEC 1JQAA 2ZCVA 1NUPA 4CMIB 1EUQA 3V4ZA 1BJKA 3NVAA 5REQB 4NENA 3RSFA 1EFKA 2EJWA 2OESA 4WSOA 3W4JA 3WV4A 1UMBA 1ETHA 3EVNA 3ZV5A 3Q11A 3FCEA 2VUIB 3ILSA 4PN3A 5BWLA 1QF6A 3WRVA 4Z4EA 1NBOA 1J9GA 1VTKA 1Y7PA 3RFUA 1QP0A 2OZVA 3DZCA 1MEOA 3G8CA 3IV6A 1W48A 2JFUA 4QU8A 4FD2A 2C8KA 3VU1A 4MRNA 4TMWA 3KQWA 2V8BA 3P2MA 4O4HF 1IH8A 3NCHA 3BIFA 5AM5A 3C3EA 4MIKA 3MCZA 3E9MA 2H00A 4IS2A 2IPLA 5EYPA 5KU7A 4EPRA 3C7DB 4JI0B 1K6EA 2ZAYA 5BURA 2GJAA 5F1KA 3FVVA 1EAYA 1QAMA 3SZGA 1C29B 2WMDA 4IWYA 4C04A 3R7FA 5KJFA 1YJQA 1F6DA 4E3WA 3G0BA 1J22A 1YZLA 2G1AA 2VA9A 3TI7A 1IIRA 1DC3A 2YQZA 5CLJA 2IEAA 1VBKA 4Y1EA 4W7IA 4YMUA 2BD0A 1M6NA 1DWUA 1Z88A 1VRVA 3A7DA 3CKYA 3E58A 1RWXA 4NNJA 4NPCA 1YVRA 2JCXA 3CR3C 5ISMA 3F4KA 4FDVA 1KZHA 3QTBA 4LF6B 3KEFA 3CEMA 2WJZB 3TQFA 1ZWKA 1DXOA 1NOKA 2NYUA 4NZNA 5FI5A 2QSUA 2Y0BA 2QEQA 3EQ7A 5BNFA 3TLYA 5F7ZA 3VH4A 3N5KA 3FWYA 3I5UA 3PL5A 3PPIA 1TQDA 3C3CA 2Q8NA 1O94A 4EHKA 4FLEA 3OZUA 5AXAA 1B6TA 4WJKB 3TVDA 1SUFA 1C7EA 2WU8A 3TTTA 4NE9A 4IJ5A 1AQ6A 1M2OA 2NPOA 2ECKA 5ES4B 3FPJA 1KVRA 1E3DA 3C3MA 1O95A 1K88A 1UQUA 1ISRA 3W8FA 4Q1CA 5BV7A 4RW0A 3FCAA 4XASA 4RDIA 2CXUA 1WY7A 1QFMA 1ZITA 2R7NA 2XMQA 3QMPA 3NTQA 2GI4A 3FWHA 1ORDA 4L9RA 4QGBA 3HWSA 1UPAA 1E79A 4F8EA 3PHIA 1QIFA 3EYAA 3R20A 4YMSA 3WXMA 2Y92A 4KQ9A 4DLXA 5IDXA 1XMSA 2AZMA 2RHWA 2WF7A 2ZIXB 4RK5A 4DQLA 3C15C 3G0HA 2NXWA 3GGDA 1B0UA 4WDQA 5IM5A 5JARA 1GN9A 3NAQA 4CTOA 1V47A 3TQCA 1JHXA 3GRFA 2ZCJA 3FFAA 2R6JA 3FSRA 1KQNA 3TJRA 1E1DA 3K73O 3NPMA 3FDZA 4X84A 3UM9A 121PA 2PQMA 4V02A 1YQWA 1NQTA 3P2YA 2WQ6A 3QEJA 1GV1A 1VKJA 3ABIA 3T1TA 5BR8B 4GU5A 4IIYA 4YMVA 5ALMA 5C31A 3ZE9A 1I5RA 1XYVA 3KZOA 4E22A 3T1OA 3EGCA 4BKQA 4EY5A 1B7GO 3TTUA 1HRDA 4JQSA 4DREA 4QU5A 5GY7A 3RYFA 3P9NA 5ERXA 4ZDWA 1PFVA 4QFBA 2UZ3A 4R5HA 3E7PA 4XARA 1RXUA 3G5LA 4XI9A 3V3TA 3HB1A 4KIUA 2XAUA 4AYXA 2XB9A 1KR5A 3BWEA 4Q16A 2PLRA 4Q9LA 2OA0A 3VBEA 2X6RA 4BS9A 1Z4IA 4DSZA 4PZAA 1KEWA 5EQTA 2B8EA 4A8JB 1XVLA 2NAFA 3H2YA 1ZU4A 2DECA 3RHFA 4OLHA 4D80A 4EW6A 5KYXB 5D87A 4KQKA 1ETUA 1E99A 1C3XA 4M86A 4XVQA 4JMLA 4F85A 2AN9A 2J9ZB 3V7YA 2DY0A 4WLNA 1VHJA 4ZV9A 3LYAA 2RHMA 2O5RA 1USWA 3UOGA 4CLOB 3PUHA 2A33A 3A28A 4H1UA 3WR5A 2W6PA 1Q1BA 1J90A 2O0KA 3RYHB 1EUCB 2A30A 2PM8A 2VPYA 4MVJE 1MB4A 4YRRA 1KQGA 5AM2A 3CTMA 4NZYA 1BEZA 4G0WA 1DHTA 1J24A 3LZ6A 3IJRA 2B30A 1G5QA 2G08A 1E4YA 1HDGO 3L7IA 4I3FA 4UZSA 2WV9A 5GONB 4XM1A 3RS5A 2WKQA 5EZ5A 1H8EA 3IKVA 4E5SA 1QCCA 2QPLA 4GP6A 4KE9A 2VNSA 5CITA 3KWJA 1MT0A 2B1IA 2VBCA 2B69A 3GFTA 2QMUA 5TVGA 5MGBA 3DHVA 4Q3OA 3PHLA 4OSPA 4FBGA 1BQ4A 4UBOA 1E89A 2BHSA 3OQIA 3PSAA 1E1RD 2I6QA 1TU0A 3BA6A 3DA8A 3SLGA 1DIHA 4MSUA 1SY7A 3VHLB 1XD2B 4QOGA 1YHNA 5DM1A 5TGTA 1JDBB 5F1PA 1WMDA 2F7SA 4LYGA 3BSWA 1QG0A 2C8LA 4MCIA 4RKYA 4URWR 3WDSA 3L9XA 4XLLA 1AH2A 5KIAA 3GUZA 3JS5A 3ZDCA 4KW7A 2OQ2A 4L8LA 1P2VA 2Q8QA 1Q20A 3EDYA 1XZPA 4FS8A 4KHZA 4PSAA 1XTZA 4CDNA 4UMFA 4B47A 4H7FA 1IB6A 1T2UA 1ISMA 2AI1A 2C20A 3AHEA 1YS7A 3K1AB 3KYCA 2P4HX 1NVFA 3ORFA 1DKUA 3O3MB 1IHDA 4TKUA 2O14A 2O7VA 1L4HA 2IZZA 2RJNA 1QAQA 3G7SA 4ETWA 1Q84A 3LV8A 4LVUA 4WBSA 4L08A 4MV4A 1N34B 5FBWB 1II0A 5JWHA 2J08A 2GRAA 3AZPA 3GQBA 3PGJA 4TXJA 1K2WA 4UCXA 4O25A 1V11B 1DBQA 2W6CX 1IMOA 1R0XA 2ZWOA 4HGYA 4TUYB 4FOTA 1XQYA 4FHDA 4WZAA 4TM8A 2X1LA 1O6CA 4TLBA 3I9JA 2FW9A 2ESRA 5B64A 2ZI9A 2I03A 1LDNA 4P1ZA 2CVOA 1JSXA 3FNIA 3KELA 1UXOA 2QMQA 1TOAA 2G1KA 4UDOA 1LTKA 1Y7IA 5L6LB 2XUHA 2AHRA 4JBWA 3G9UA 3E22A 3C24A 3AVTA 1FP7A 3CISA 3CF2A 2VXCA 1JXQA 4FC6A 2AE2A 2KI5A 3G17A 3HJUA 4J75A 2DPMA 1OYOA 3RYIA 4K9SA 2C1ZA 1G17A 3BMXA 4D74A 2PSJA 4RJLA 2YRWA 5CFRA 1E2GA 4PVDA 4IDOA 2Y1XA 2XDAA 3NZEA 3H16A 3NASA 3WYGA 4HI0E 1ZD5A 1QPGA 2W37A 2Y2UA 5DNVA 4PYRA 3THYB 2IT1A 2PZ8A 3UNXA 4OHCA 4FFLA 1KTVA 5LZ7A 5ED0A 1E64A 5DWVA 1RQXA 4X1KB 4V0SA 1Y7HA 4HATA 4RABA 2F4VB 1U9CA 1OAKA 1NZJA 3OTHA 2X2EA 3WLLA 3WQSB 2R8XA 5B5SA 4A5SA 1QX3A 4J03A 1WUKS 2P7IA 3NDJA 3NALA 4IBOA 3AGPA 1J39A 1E7WA 2O2DA 2H9AA 3E82A 4MV9A 1LWNA 3C2QA 4ZI2A 4YACA 4UBKA 3VTKA 1L2TA 4HB0A 1SIBE 4OLFA 4YRSA 4PC2A 1XNRB 5AVOA 1T1GA 4RXTA 1JEAA 3LM8A 4CM4B 2X7JA 2IYFA 3IDQA 1KMHA 2WVHA 3CX6A 3R3XA 3EF1A 2NZJA 4KO1S 1N2BA 4OI2A 1TRHA 2I4RA 2RIPA 3JQRA 3ECCA 3WLNA 4DJFC 4EA8A 1KO1A 3VYVA 3IRUA 3WIDA 4ZK6A 4LOLA 2P7HA 4LWQA 2D1FA 5FFNA 3WWZA 2DVMA 3NHYA 3ET5A 3AU9A 4X8OA 1S2NA 4K9MA 4P82A 2AQIA 2V7QD 1ICIA 1U8XX 1UPXA 4IZ6A 2I2FA 2P2GA 3RVPA 4AG5A 4NU5A 3OESA 4IJ6A 2XWQA 1OFVA 3UBMA 1U9JA 1JLRA 1FUEA 1M34A 5AKLA 4EYSA 2H48A 1R8SA 3JD0A 4PHTA 4BZZA 4BEVA 2XCOA 1HYHA 1N5LA 3ZYZA 3VPAA 5EIOA 1IC6A 1NWHA 1R50A 2R47A 2ZWMA 5DWDA 1PS0A 2IF2A 1L5HA 2FSUA 1HKHA 2VWGA 5CB8A 3FKSA 2E5FA 4TV9B 3WWOA 3ZEAA 1IJFA 1FU7A 1OLOA 1M34E 2H1LA 3N2NA 4IOKA 4LJ6A 4OL0A 1YB7A 4EB8A 2V7QA 3M0EA 3UFBA 1VPWA 1DO0A 2YJZA 2B4AA 3DKVA 1A5SB 1YZ3A 4JSTA 3ZTWA 2CLSA 4C7VA 2ZRLA 1FEZA 3I83A 2QR3A 3LUHA 4Q4JA 4MWDA 3HR7A 4S1OA 1R4MB 5AOBA 1H65A 1VSBA 2GVNA 3EMDA 1YE3A 3WXBA 5L9AA 3S81A 1UP4A 3RADC 3ANTA 1N8KA 3CWZA 2HIHA 3HN2A 2XLCA 3R5HA 1QK4A 2WNSA 4H27A 5HCUA 1L5RA 3GJ3A 1XEFA 2Q50A 4A1FA 4D97A 4JC0A 2GK6A 3WL3A 1X1RA 3U13A 4B6QA 4IP0A 2JCBA 3WYEA 2JH8A 3Q0TA 4YRBA 1KOFA 3VJMA 4U7DA 4RFLA 5H68A 2B36A 2JIBA 1LFAA 2EWVA 1KMHB 2IY9A 4Q1BA 2JJ2A 1XZMA 2D1SA 3MJCA 4OYHA 4UM8B 1T10A 2ZLBA 5DN6D 1KOLA 1T8SA 2YJTD 4OUKX 3KCQA 2QIOA 3BFJA 1PJQA 1Z6PA 3LX4A 4PICA 4BLUA 3WA7A 4LJ5A 1UQRA 2ZAOA 3LY7A 4G97A 2PY6A 2AUNA 5BSHA 4UUAA 2A0UA 4JENA 4PGMA 4ZP1A 3ZDYB 5KX5F 1ODJA 1AKVA 4QBKA 1K5HA 2NTJA 5KHLB 3QEAZ 2E7ZA 2BMVA 4X6LA 3QBTA 1OT3A 2G40A 3TLBA 3AKCA 4C76A 2B9EA 3GA7A 3THXA 8ADHA 3C8ZA 3CVWA 1R16A 3D02A 5JLJA 5IJZA 1ZRMA 1QZXA 3OZTA 1IMJA 1N57A 2C2KA 2O2CA 4JIGA 4QGGA 1XJCA 1GPJA 2GCGA 4DIMA 5IVHA 4ITVA 1VOTA 3CINA 1J23A 1Y3IA 2I3ZA 1P44A 3UWPA 4DVGA 2Q2NA 1PNRA 1AQIA 5C3UA 5I8WA 1FXWF 4JYMA 4YR9A 1Z5VA 4TMTA 2CLDX 2H3EA 2Z9DA 3GZTB 1EMDA 3QQ5A 4IHJA 4N01A 3P4UA 3RPEA 3EGDB 2NU6B 2G4VA 4FKZA 4H7JA 3LTEA 4Z6KA 4B6OA 5EJAA 1GNRA 3C6ZA 4MIEA 3JQ6A 5L3SB 3JQGB 2CSUA 3HA2A 4BLOA 3KR0A 4AFNA 2IU6A 5EUBA 2CHEA 4JBNA 1L5NA 1M5RA 1GOTA 3FFBA 3H0KA 4W63A 4DJ5X 2WFLA 3UG6A 4QC2A 2YMQA 4Q37A 4YXWD 3OTOB 3TG8A 1QQBA 1T1SA 3WC4A 3C3PA 3H5TA 3AIMA 1KJ8A 4DR7B 1U2GA 4NYJR 1JMYA 3A9SA 3PXEA 3MERA 2EF1A 4UTXA 2XUQA 2O8CA 1V4BA 1CQJB 1YZHA 2W2OA 3U1TA 3GJQA 3QOXA 2CMKA 4YTEA 5A5EA 3JARB 4CKCA 1E8DA 4O4HA 4D96A 4ZZ3A 3WL8A 3F2VA 4TVOA 5DLDA 1E62A 2VR1A 1ZM9A 4I4TB 2BKEA