2AC4A

Crystal structure of the his183cys mutant variant of bacillus subtilis ferrochelatase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
309
structure length
309
Chain Sequence
b'SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSACSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Metallation of the Transition-state Inhibitor N-methyl Mesoporphyrin by Ferrochelatase: Implications for the Catalytic Reaction Mechanism.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 120
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2005-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac4A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac4A02
2Q2OA 1N0IA 2XWSA 1HRKA 2HK6A 2Q3JA 3M4ZA 4KLCA 1QGOA 4KMMA 1L8XA 2PO7A 2HREA 3HCPA 2QD3A 2H1WA 1TJNA 2DJ5A 2QD5A 4KLRA 4CCSA 2C8JA 2XVYA 2AC4A 4MK4A 1AK1A 3HCOA 2JH3A 3GOQA 2XVXA 2QD1A 2XWQA 3AQIA 2HRCA 3HCNA 2XVZA 3W1WA 2PO5A 1DOZA 3HCRA 4F4DA 2XWPA 1LBQA 2AC2A 1C9EA 2PNJA 3LYHA 2QD2A 1LD3A 1C1HA 2H1VA 4KLAA 2QD4A 2Q2NA
chains in the Genus database with same CATH superfamily
5B64A 1BJKA 1LVUA 1N1EA 3PGXA 1ZOOA 1S7CA 4GG1A 3R6GA 2B34A 5TPWB 3VYUB 1BS9A 1KYZA 3LY8A 1X2EA 3AKEA 4X41A 4EG1A 3P20A 1EEXB 1P1KA 3V7NA 4HS9A 2BMJA 4LHEA 4BB6A 5IJ9A 3L02A 3IBCA 4F86A 4HNAB 2IEAA 1SZCA 1KQNA 3PFGA 3ZN2A 1TK3A 3ZE1B 4N5HX 1XD8A 1FFXA 1H2FA 1NAHA 3WRYA 2SCUB 1JXOA 3M49A 2D0PB 3WLFA 3N8KA 4B73A 3FRHA 4URVR 1V11B 3C8DA 5AW0A 1ODJA 3V8NA 5K8LA 4I2VA 3BL8A 4YP5A 1P5FA 1M0WA 4X7BA 1O5IA 3DO8A 1VMIA 1X3SA 4XAQA 1ZGAA 2G04A 1N5MA 1N2HA 4H7FA 5CD1A 2GZDA 3CW2A 4FU0A 1XQVA 3HJTA 2NZUG 1MOZA 2ZS7A 2IYZA 3QVXA 4BMPB 2C04A 3WMWA 3BGVA 1AHIA 1DQNA 3DA8A 2EEPA 3GAMA 1B74A 3ETHA 5J5AA 4H1HA 1O57A 1TJPB 5BUSA 1P7YA 4RULA 2IKQA 3OM0A 3AIKA 4UVDA 4F46A 1QK3A 5TMPA 3IUPA 3CXUA 1MJGM 3QHAA 3KLNA 1VCOA 3AEQB 1IC6A 1XTVA 1H4QA 2CY0A 2N1MA 4LCJA 4LQLA 3WIEA 3QE3A 2HU8A 3DHWC 1DKNA 2AG8A 3H83A 3PDUA 4IOKA 1XBTA 2WKPA 3H65A 1D6NA 3DOFA 7REQB 3KXIA 2ORYA 3HHEA 2V8OA 1PG0A 5DX8A 2IL1A 5F12A 1FBTA 3IOMA 1V95A 3RIHA 1Y1KE 1XCPA 5H82A 1PF7E 2HNBA 4HX9A 4KVZA 2H2FA 4ER0A 4J4TA 1YJXA 4R7GA 4QZVA 3UMGA 3GLVA 1MT3A 1XRMA 1ZN9A 3EPPA 3H5IA 4XCQA 5B2ZA 3DFUA 1G7RA 2CXTA 3JASA 4O4JF 2IV7A 4B3DA 1XALA 5HNKA 4NEQA 2X3FA 4RFLA 5JQGB 1YZUA 4QPNA 1N34B 2R6FA 1QVAA 2IOFK 3ADOA 2VK4A 2HMAA 2ERYA 3OICA 1M76A 3PE6A 1T2FA 3D0OA 3D3QA 4C3UA 5AKJA 3KJQA 2AN4A 4QXQA 2A1IA 4OOEA 5F23A 3VAYA 4GAEA 4G1CA 3L8DA 3Q8XB 4BUJA 1RQ7A 1EWRA 3A3PA 3RU9A 1N0VC 1NAIA 4K9DA 1MVNA 2ACKA 4ASUA 4BV8A 5LZ9A 1JGTA 5KQPA 2JIQA 4LZNA 3U5ZB 4HNTA 1KMHA 3H4VA 2REQA 4LSWA 3LPLA 5DU2A 5JJKA 1W5SA 1MUUA 4Z7NB 1K8YB 3U80A 1DVRA 1HT1E 1UPCA 1T6NA 3IR7A 1K0FA 3TOXA 5LZ2A 1EQUA 4N3CA 3S1LA 1FYDA 3DBHB 1TQHA 1NFQA 3ZWAA 3V4SA 2Z9DA 5IWCA 1M2HA 1VP3A 2PYZA 4ECEA 2O2ZA 3AZOA 4NFYA 2C2MA 1Z68A 1D8TA 1F2VA 1CUWA 3DS8A 1KMNA 1ZK0A 1VJGA 2C0QA 4O2RA 4OF4A 4KLAA 3EEQA 1O95D 2B94A 4CMIA 4F11A 1F6DA 3CUTA 4RIHA 4H3VA 5ETJA 4K9PA 4YRJA 4AWXA 4ERXA 1OBHA 1XDDA 3K1JA 3ZQUA 1YUMA 1HNNA 2O2CA 3JQ8B 1IH8A 3CU5A 3SHWA 5GADl 3OKPA 5AUPB 4BVAA 1SCDA 2YRXA 3ZWKA 4F9GA 3BYZA 3PUXA 5A2QA 4K6OA 2JAHA 2IX3A 1KSFX 4JXXA 3VZSA 1PV2A 2JJMA 1A9QA 2CB9A 3R2JA 3ZTTA 5IM4F 2NVOA 4NR0A 5EKSA 2WNHA 3L5KA 1E7SA 4WXMA 1U1DA 1J7JA 2P5TB 5IXJA 3EVFA 3KKLA 3QU7A 4FTWA 4UOEA 3GPIA 4P3YA 3EZ7A 3L1JA 4ZU3A 4F56A 1NY5A 2X4DA 1ADGA 3NIFB 4KX3A 2QRZA 2VH5R 1ZM9A 3DBVO 3E22B 4L08A 5KVVA 3UTCA 4B9AA 3AONB 1BEZA 1V4NA 3PF9A 3T1QA 3P2EA 2P11A 5IC4A 1QHHB 5IHXA 1RWVA 1DP4A 1ST2A 2PUVA 2YRWA 3ANYB 2XCIA 3THXB 2PEYA 1G20A 2FFHA 3U44A 2GVZC 2Z09A 3OPQA 4ZIRB 1GQQA 2QLNA 4OV6B 3KQKA 2XIJA 3HB1A 5JOQA 4YJ3B 2G08A 1FJ2A 3T3IA 2AOUB 4ZYVA 2V7UA 3L7JA 3X1JA 3RFTA 4F97A 2YVLA 1BD3A 3HEMA 3QF7A 3C3WA 3QKRA 1NBIA 5ALQA 1G41A 1XCOA 1W59A 2ZIAA 3IVGA 5ES3A 3FX2A 4DFDA 5IFLA 3V3TA 4YC7A 5FHQA 2YS6A 1A8UA 1TEXA 3A9VA 4FDLA 1NRXA 3PFFA 4P3XA 2JATA 3ZS8A 4BLUA 1DNPA 2CJYA 1IJEA 3SVZA 3CVYA 3IR6A 4HD8A 2XY4A 2K7FA 4MA0A 1OREA 4P2BA 4PX9A 4J0JA 4RPHA 4F60A 1YMQA 4MV4A 1UBEA 4WBNB 3JZDA 3PX7A 1NOKA 2PSJA 3VYWA 4CV2A 5TLSA 2JAXA 1WP4A 5AK6A 4XA8A 1UOPA 3O3CA 2F17A 1OH8A 4TWZA 4MVJI 2IZ6A 4NMLA 5IDYA 5CW1A 1QOQB 2Q0XA 4TMFA 1EVLA 3GNQA 2EERA 2VTEA 3QG1A 5EIBC 5JZMA 2PMWB 3NBYC 3E4CA 4HB4A 5DI9A 5ESDA 3QUSA 1IVSA 2FZEA 4IUBS 3AVQA 4V1CI 1EGAA 2BGRA 3JTMA 1VYTA 1VGRA 3CLVA 4C7VA 1IN5A 3RJZA 5BVHB 3K70C 1ZICA 4QBIA 4YIHA 3CISA 1E1MA 4P92A 1XZNA 2APJA 2AD5A 2HF7A 2PH7A 3DUFB 4AZ0A 1CY7A 4LRSB 4Y18A 5DRYA 3T9CA 1JU9A 2C4KA 2G83A 2KSQA 4OAPA 5DW3A 2R8RA 1OYWA 1EX6A 2JAOA 1AF7A 1K68A 1SXJA 2FMUA 4U9HS 1P6UA 3RIGA 1ZI6A 3NNDA 4LS3A 2Q0SA 4NYMQ 5EMKA 1G4AE 4HVLA 3CVUA 3ZY3A 1XPUA 3P0IA 1Q19A 1E1CB 2JASA 3ZX5A 4GKKB 1WM1A 3TE7A 1FFCA 1ANKA 1H2YA 2B2NA 3CM0A 5H3HA 2ONZA 1R8YA 5JCPA 4AJ1A 1B0AA 1Y9AA 5KOHB 2FYTA 3ZDAA 1KZYC 3ICWA 1F0YA 3WFIA 2BP7B 2VYNA 4PYMA 4ZQHA 4S1WA 1XX6A 4AZ3A 3R6WA 5JROA 4YGXB 4JB8A 2BOVA 1TDJA 2ACVA 4E88A 4CCYB 1TJNA 1K5GA 3ENKA 4DQXA 4KPUB 2IVZA 5FOTA 4C0WA 4DQ0A 4WOJA 5K01A 2J5XA 4FWBA 2IIQA 5H8WA 2V8BA 1BX0A 3AT1A 4HYEA 1JDNA 3LT5A 1JG3A 5LQAA 2HMTA 3WFZA 3HCRA 4A03A 2PVSA 1NM5A 4GUAA 4CQJA 2BGNA 1T4CA 1FXSA 2WE7A 4PGMA 4OM7A 4RVNA 2XTZA 4CM4A 4F8JA 1VRCA 3JVUA 4LXGA 4Q12A 5ELMA 5JS2A 3KYJB 1BFKA 3HJNA 1AQLA 821PA 4I19A 4HWPA 2H0RA 4MRPA 3RHZA 2IZZA 4U00A 5THXA 2CFOA 1QYVA 2PKEA 3EIXA 1MF7A 3K0CC 4EX6A 5IAEA 4F1JA 1XA3A 4ZHQB 1GZ7A 1R10A 3OQIB 2V5AA 1Z2AA 2I78A 4WLNA 2XDQA 3U19A 2VTBA 4Y6RA 3DMFA 1GQFA 1HQYE 2E5WA 2GCOA 1R6UA 4ZRDA 1XCJA 3FUVA 3CINA 1KNQA 1ULAA 5EVCA 3FTEA 4DRYA 4ZOLA 3IILA 4LF7B 4MI6A 1H3FA 1W6RA 3DG9A 4WDRA 1KFJB 1ZFNA 2F67A 3BMOB 1ZK2A 1ZS9A 1FS5A 3F2IA 2XXAB 1G66A 4KITB 4LWZA 3LYUA 1XQYA 1ZK1A 4AWAA 1DX9A 2Q07A 1EE2A 4WINA 4AY6A 4O59O 1ZD9A 1EJ0A 2DM6A 5AVUA 1HTWA 5M7EA 1M67A 3LMKA 4FYKA 2DMRA 4JV5B 1MABB 4UDNA 2BBSA 2JHPA 2NUTA 4I50B 1I7SB 1AK1A 2QBYA 5DCLA 3SKVA 4IV0A 2FUCA 4LF4B 3A14A 3I0ZA 4DC0A 2VF5X 1Y9EA 3MINA 4FDVA 1OZ0A 3GLIB 5FOXA 5ELXA 3A4MA 5HQ3B 5IAAA 4CM3A 2HF9A 3E2MA 3QVKA 1YGYA 4WCFC 1XQ9A 4BNYA 1L7NA 2O2IA 4NV0A 4W5WA 4M36A 2R5FA 5A4JA 2J0VA 5C1BA 4NG4A 4W1RA 1Y3AA 4L9SA 3OWXA 4N9WA 4RD6A 2P2CA 2XMRA 1OGIA 3KFLA 4EUKA 3G0HA 3E03A 3ET4A 4CWAA 1QQ5A 2XNDA 3ELDA 1B8VA 3HJGA 4UEQA 5D86A 3T4XA 3WHKA 4EO4A 5DBGA 5L3RA 3B53X 3KKOA 5LM3A 3IX7A 3L82B 4UVIA 3UAGA 1NP3A 3TNYA 3EG9A 4L76A 5HZHA 1RHUA 1N5JA 4C1BA 1JQAA 1E1NA 2XA1A 3QEJA 2XUJA 1EVJA 3LLVA 3OF2A 3R3ZA 2XDAA 1BQ3A 2ONKA 1Q3KA 2ZJ0A 1W19A 4FEAA 4GLJA 4GYJA 2OGUA 4HOYA 2CHFA 2J32A 2WIBA 1EKXA 3K0FB 3OCYA 2EQAA 2VPXA 2XRFA 3D0KA 4M8KA 1YB2A 1RD4A 5HA5A 2VR1A 3B1FA 3LBYA 5I7HA 4RS4A 4HGNA 2ZB4A 3L01A 2W43A 1QYDA 4F3RA 3A1WA 1GAWA 3GCZA 4B09A 2MCFA 4BVHA 1SXQA 2JF0A 4XIYA 3V2HA 2Z1NA 3BWYA 2R8OA 5JXHA 3GUUA 1Q2XA 4AIIA 2ZPUA 4K7JA 3T7AA 4G2TA 3WLAA 4DSUA 4P38A 4LBWA 4IDBA 2C3YA 3AJRA 2AYZA 2UDPA 3K9NA 4GU5A 4K3VA 2DWQA 4J3NA 3RGWS 2Q3MA 2JZCA 3RRMA 5BW4A 5JIBA 2UXDB 1PWXA 3MYRA 1FRFS 1PDOA 2P9TA 4FLMA 1P9WA 1W4CA 4FI3F 4PCLA 1Z6AA 4IGKA 4OP2A 2YFYA 1GZ5A 1QJCA 2GCGA 3FF4A 4K9MA 4FIDA 5AXCA 4EJ0A 3I53A 1G4HA 3QA9A 2FETA 2AZXA 3H5LA 5BSEA 4AMYA 1E2BA 2WA1A 1ZAYA 2OXRA 3AESA 8AT1A 2X7JA 3BTUA 3VTAA 4CM8B 2BRUC 5SY4A 1GPWB 3P9IA 5DJ5A 1NDUA 3AWIA 4N82A 4Z0HO 5BOVA 1DRWA 3VR4D 4A27A 4QXOA 4BLPA 5EINA 2P6NA 2ZWVA 4MP6A 4DCTA 4HR7A 2J48A 1CHNA 3OWHA 1TZCA 4OIMA 4I1PA 5AKIA 4DDUA 5ALMA 3IQGX 4QDJA 5KHLB 2CE2X 3HZZA 4RABA 3KSDO 3DDUA 3QXGA 3GXOA 1X7DA 2HQOA 1IG3A 2ODTX 3BTSA 3G5MA 4Y9DA 1ML3A 1T2EA 5DZSA 1OWNA 2P91A 4BFYA 5IVPA 4J7CA 4JA2A 2BUCA 2PAFA 2QP9X 3FB1A 4C3VA 1EPUA 3CJTA 1XNHA 2DFTA 1P1IA 3QQ5A 4QLOA 1ZU4A 2Q3EA 1NRIA 3HU5A 3IKJA 3L6DA 5EHIA 3TVDA 2PZLA 4DR4B 5M3BA 4DM4A 2WAYA 4I5IA 1A9ZA 3ILHA 4N03A 3X2FA 4YV0A 4D26A 2IEZA 2K5UA 3JAKB 3I2HA 1C8VB 3HFSA 5FA6A 13PKA 1VA4A 1BHJA 3E7PA 1C1XB 4B47A 1VE9A 1XEWY 2FQWA 2R68A 2VP2A 4ND1A 3WI7A 1RLJA 3PQ7A 4CU5A 4ZDJA 3DQZA 1GGJA 5IKMA 4LBYA 1NFRA 1PK8A 3EW9A 4DIBA 4G56A 2IHZA 3A32A 5BN3B 3FDIA 4N3NA 4WEQA 2H9IA 2O2HA 2DFPA 4I9UA 3P9SA 4LPSA 3UEOA 2Y4NA 3O90A 3K1AA 2GK3A 1FMCA 2ZPAA 3KQWA 3GA5A 2JGLA 3F7TA 4NS1A 5FNVB 5GPBA 1JTEA 2B82A 2XOKA 3GJ5A 1M1NB 1G16A 1JFFA 1KZHA 2OO5A 4I4LA 4WN3A 1U0EA 5CVUA 3QJ5A 5L3QB 1WBJB 2EZUA 4EW2A 4KRGA 4OHKA 1C8BA 1ZH0A 1ZQ1A 1BFDA 3I64A 3LIPA 3IYLW 3M4XA 3ORQA 3D7NA 3FWYA 2P6UA 3PZBA 3MS2A 4LYYA 4QOGA 3KJNA 4UPVA 2N0SA 4QOFA 4J4HA 2JBHA 1JWAB 4WZBE 2OHFA 2CE7A 3W79A 1P75A 1U0BB 4PIMA 2ZT5A 3BCRA 4D9MA 1PYGA 2ZSUA 5B3AA 4ZI3A 2YWDA 5LMCA 2L18A 2GN2A 4HEHA 4HDQB 4P1ZA 2NXJA 1VE3A 4H7JA 1QRAA 3IULA 3GT7A 3W9YA 1CQIA 1OV4A 3KEMA 1VL8A 3MFQA 4FBLA 4RIFA 4RXTA 4WA8A 2ILVA 4Z4GA 2PL9A 3RAGA 3WL4A 5E2IA 1XC7A 3EZ6A 4EHBA 4ZZ3A 1DKRA 3G7NA 1YHZA 4NZOA 3ZBUA 5LZ4A 3VU0A 1ZI9A 3L0ZA 1E9EA 2RHMA 4QRIA 4ZV4A 5I01A 3VDNB 4EJ2A 2GM5A 1E5DA 3S28A 3FGOA 1N25A 4JSYA 1XJCA 4UTVA 1DDIA 1L1EA 1RP1A 4IJVA 2BFBA 4D44A 1SKQA 5JNSA 2QI9F 1LBSA 5ALXA 4R2WA 3TZQA 4DABA 1W34A 3SYRA 3G2JA 4C6RA 4OM8A 3PLNA 3HB7A 1JF8A 521PA 3OZTA 3K4HA 4R01A 3HADA 1SKBA 2C8LA 5KTRA 3GC6A 4RTOA 4DUZB 4PFJA 1MLDA 3BDVA 2R85A 3DE6X 1K2WA 2PVPA 4O0MA 4P4NA 2DAPA 3GFTA 3WNBA 1N5IA 5JO9A 1AQNA 3O93A 5GONF 3D3JA 1HLFA 4UBKA 4EP1A 3QENA 3EBOA 3K35A 4IYRA 1KQOA 4MUIA 4WASA 4Z6KA 5AVSA 2QM3A 4PXSA 5A5FA 2WFAA 4WKBA 4A0QA 4EGCB 1L4HA 2VJLA 1VJRA 7ADHA 3H9CA 3MTEA 4ZCIA 3H75A 3D6JA 3I5UA 4Q16A 4XRRA 5ITZB 3TYXA 3U3DA 4Y2HA 1QC5B 3V1MA 3RSCA 3ON5A 2IJGX 4D3FA 3ZG6A 1N0UA 1I7QB 1N6LA 1DQPA 2JLUA 2G0AA 4RZSA 1YS7A 3CZRA 3OTIA 2HI0A 4IIVA 4X94A 2PO7A 1X3LA 3EVAA 4M9RA 4HH4A 3SF8B 4EGJA 4HC4A 1OQAA 1GG9A 1CUAA 2BT4A 1HMPA 3DHVA 4DDKA 1OZGA 4DV0B 3AZPA 1Z4LA 3OTGA 1KEVA 3GGOA 5AK4A 1RAFA 3EQ7A 1E6LA 2BKXA 3TIIA 1W6UA 2YYYA 2Y1WA 4HFRA 5BW6B 1JAZA 4QDXA 2E4UA 2R8ZA 4WUTA 1FRVA 1IN6A 1D1PA 3TR5A 4O29A 1GPH1 4UDXX 3C5WP 3WG9A 4BN4A 3HXMA 3LUCA 3VC7A 4PQRA 2E7ZA 4F3YA 3Q3JB 1QIEA 5HBRA 3TEJA 4M0DA 4FZVA 4ASUD 5AVQA 4M0LA 1G0NA 1JQ5A 3C85A 1GPKA 1TZMA 3OQPA 3KCNA 1K1EA 3U7RA 3V46A 4Q4DA 4MCAA 5J4VA 2Z43A 1U1EA 3LQ4A 1E9RA 1YR1A 3K6RA 4FGZA 4O4HA 2Z2XA 5DTEA 4C2UA 4MYDA 4GWLA 4NOJA 3BKXA 3Q12A 2HA6A 2DFLA 4BVKA 5GJVC 1U0JA 4ARIA 2FN3A 1NBOA 1RXIA 4LZJA 4JJ7A 2EGUA 3RREA 4IR7A 1MQSA 5LYJA 2AUMA 2QXUA 1CRWG 3DZKA 4GP6A 4GZ6A 1Q91A 3H84A 5DBIA 2YQZA 5TQJA 3WKBA 3VNBA 5CT5A 3P32A 5A3VA 2HLNA 3O4GA 5T8KC 2HHLA 3TOVA 2I33A 2QYOA 2JHAA 4OAQA 4GR9A 1BXRB 1FDWA 1Z9BA 2VT6A 3HUUA 2L19A 1ZIXA 3SBXA 4EITA 3VFDA 1JDJA 1V2HE 4QFMA 2Y8EA 1XYYA 4JI5B 3W0LB 4C9BA 1UEJA 4Q19A 1F14A 4P9NA 4NE2A 3P2KA 3M1LA 2EFEB 4LZOA 1ORIA 1I7NA 4DCPA 3A6FA 1BCSB 1JEOA 3TUZC 1IB0A 2XXJA 2V0CA 2HLDA 2WWHA 1P0QA 3N9IA 4PVCA 4NYMR 3KOXA 3VU9A 1WIWA 3L1HA 1TQ6A 2DCMA 4FS3A 3W7BA 4EMTA 2N75A 3L7DA 4ARUA 2BKLA 2GAJA 3WDSA 1X39A 2PX8A 4FE7A 2C1ZA 2EBUA 1KH2A 1OXTA 3AR5A 4HNRA 4JBXA 1QFMA 3MT0A 5FOWA 4OQNA 4M60A 3WZMA 2Z5VA 3RU7A 1EJ2A 3OLVA 4QU0A 1Z0AA 4IVRA 5AW7A 2P6RA 3PVCA 1ECFA 4MR7A 5SYNA 1SCQA 1TIPA 4AVYA 2O0HA 3LQYA 3IXQA 2GBIA 3ZE0B 1E59A 1PR6A 2FUG6 2F4VB 3ZCSA 4M87A 1KFKB 4CXMA 1FNSA 4MK4A 4LY9A 3DL2A 4TX1A 2DEUA 3OM1A 5K4HA 4MAFA 3E8MA 3IVRA 4LI3X 4KQXA 1QZUA 2YZ2A 4BE7B 3F6EX 1G8KA 2HUNA 1RPJA 1EGQA 3TL2A 5IEJA 2GBPA 4HO1X 1CP3A 3V55A 3KS9A 3H16A 1EMDA 3N75A 1ZQ9A 3WNCA 4EPYA 2C9BA 5LSAA 1EXNA 4F5WA 1FYFA 1NDQA 3LX4A 1KDOA 3QYAA 3A70A 3AVUA 3BQ9A 3LC1O 2AZTA 1E7QA 5FI1B 3UAYA 2JAWA 1MW9X 1OPRA 3T1NA 2V7QA 1RE0A 3PIIA 1AK2A 2R8YA 1BC5A 1U2ZA 3PXXA 3CRMA 5AMXA 3IO5A 4ARZB 3ZWMA 2AKAB 2HK6A 4ECAA 4ZYLA 2NU6B 1LZLA 2PN1A 4O4JB 3WL6A 5CA0F 3LTNC 4UUQA 3V6MA 2Q49A 3BWDD 2NMVA 1JVNA 4ZYWA 4ZZ1A 3BJIC 4LISA 5BWCA 1TM5E 3ZCUA 2FPPA 4DJEC 1MZVA 1C4KA 3TVYA 5C8ZA 2PWBA 2ZSDA 3W5DA 4JI2B 1SVWA 2DX7A 1AZWA 5DCYA 2YBEA 4JP5A 3RF7A 4DL9A 3GZTB 2WA2A 2ZUUA 4AUEA 4E5MA 2WIGA 4WQMA 3OIUA 3ACCA 4ZEOA 1W8DA 3CSDA 3BJEA 3I4LA 3L7YA 1UP7A 2BM8A 4Q82A 3FBWA 2Z9CA 3VYTB 4TTAA 3IBTA 4F6RA 3G7SA 1R4ZA 4URZR 1E9FA 3NONA 5CTJA 3LVBA 5C8XA 4RTQA 3PDJA 2G9VA 3HGTA 1LNZA 1AF4A 4H15A 2JBWA 3RRJA 4C88A 4BATA 5BNTA 2DECA 5G0SA 2Z30A 5REQB 1LTHR 3OBBA 1Z0DA 4JLOA 4QT0A 1SXJD 4CIXA 2X8BA 2P1DA 4RWZA 1I3KA 4OUDB 3BIWA 3PZRA 5C81A 4M49A 1OLXA 4ZYTA 1SHZA 4R9RA 4IMPA 1HNWB 4E3WA 4Q1AA 1JZQA 3OIDA 1F4VA 1RYYA 4HAZA 2FEMA 1E32A 2F1HA 3MN1A 3JWEA 5EZYF 1R4MB 2CL5A 2D2IA 3RRXA 2GEDA 3QKIA 5I9TA 1J2EA 4GR5A 5IF9A 2JFGA 2VYND 1PEDA 5JS8A 3B20A 2Y9PB 5AWFC 4R1OA 4ZOQI 3CF4G 1YE8A 1XEFA 1S1MA 2BKEA 3B7GA 3P9RA 4BWYA 4DCVA 3L0SA 1RTTA 2ZJBA 1R6DA 2QT9A 4YMWA 1Z37A 3PUKA 4KH1A 3H05A 1R0XA 3CNOA 4G0OA 1TGYA 3V2GA 4BKMA 1NG1A 1R6XA 4LRWA 1XMOB 3DT8A 2CF5A 3TKAA 1GDTA 1Y0BA 3TLXA 4XGQA 1XMPA 2J9FB 3N2IA 3Q5DA 4IIFA 3R3YA 1TUIA 1FLAA 2B61A 2WYOA 4MHSA 2HH9A 2W00A 2GMWA 4JEHA 4C6SA 1RWPA 3THWB 1BHSA 4OMCA 3LK6A 1FVFA 4AC9A 5IP5A 2HQ1A 3QI7A 4HDMB 1IDOA 1SUAA 4OB6A 3HDQA 4URUR 2V7GA 2Y0EA 4OQYA 1JT2A 3E23A 3P71T 4XWYA 1ZO8A 2ZKIA 3B6KA 4O1HA 1M2JA 4R1UA 5J1TB 4QM6A 4AECA 2CYCA 4UE3S 4LGYA 4ZD6A 2AMJA 3Q0IA 4CDGA 1M2VA 1E1QA 1PTJA 2VN8A 2AUTA 1Y98A 2UZIR 1L4LA 2O2EA 1BXGA 1J1IA 1AKQA 1GZ3A 2INGX 2QNRA 2VHWA 2X5NA 3EF1A 1PFVA 3F47A 1G2OA 4RPJA 1X13A 3II6X 4MYCA 4PSKA 4RSRA 2ZWPA 3RFXA 2NTVA 4R98A 5IT0A 2AMYA 4V0LA 3ZHXA 1QAQA 2GEKA 4CMCA 1R18A 2WMDA 3B5JA 5EUCA 1OHHA 2F64A 2I6QA 1PL6A 1K6MA 5E6RA 1U7DA 4LWPA 3DEKA 1DG9A 3NRJA 1ZXLA 4O33A 1ZUNB 3R8CA 5KSWB 1Y4AE 5JSFA 3VA7A 1MEEA 5CM8B 2GBLA 2YDXA 3K70D 3VNUA 3NHMA 1F0PA 4NRDA 3EA4A 3DD1A 2X1MA 2QY6A 5TPZA 2ICAA 3HO6A 3ZPXA 4B3XA 3B2NA 3DKPA 3AP1A 4P86A 3WGUA 1GGVA 1WMFA 1SHKA 4W1QA 4EGSA 1T1JA 2KWIA 1JEEA 2WJHA 3GELA 1ISRA 3ZDDA 3SE7A 2FSUA 3EGVA 1UL1X 3FWPA 1A50B 1NJ8A 1Z7EA 2JIBA 3AXSA 4N0DA 4MRSA 3OZXA 4NPHA 2AF4C 4IDEA 3R4VA 4JLJA 4R40A 2XI4A 2PSFA 4B7XA 4CJXA 1U0RA 5ED0A 2I4TA 1QHYA 2H4YA 3AHCA 1VMDA 3TS1A 3UJBA 1P18A 3GLFE 2ZI9A 5CDSA 3R5TA 1AXEA 1P3Y1 3LLUA 4FGKA 3VHLB 4UAVA 1P4RA 5DTRA 4JGGA 2CYAA 5IVIA 1NF9A 4QQNA 4EHJA 2FFAA 3LA6A 1EA7A 1EDOA 3K2QA 4F4UA 1GPUA 1WO8A 2HN9A 2JGFA 5CAEA 5ISMA 2JK0A 4JSRA 3F8WA 1B8PA 3HDTA 2J59A 1H8ED 3BWEA 3DYIA 4BFWA 1Q5PA 3GRCA 3D3WB 3IV7A 1QWOA 5TF0A 2DUJA 4XDYA 5EJMA 2PLWA 2H1RA 4MH0R 5AHOA 2JCXA 3RS4A 1QTNA 3FPSA 4R54A 1QH8A 1HT3A 4IP0A 4ZVSA 5EY5B 1WHSB 1I2CA 1YHNA 2W0MA 1L4FA 3EZLA 1K7EB 2QN7A 1Y63A 4UTNA 4RTKA 2FWAA 5EHQA 4NS4A 1V16A 3H0EA 4G1FA 4P80A 1TK9A 1EBUA 3HJRA 2BTEA 1T4BA 1YR7A 2GOYA 3G2MA 4H0CA 4XUDA 3T7CA 4BQSA 1XCGB 2XB8A 1VPLA 2PPLA 4KAAA 4YMGA 1ZC4A 5BWMA 3FOZA 5BMVA 1MH9A 5TJHA 5JSQA 3G2LA 5TE9A 4RZHA 2I4OA 3WLKX 4CM5A 5DNCA 2WZCA 1KRHA 3U39A 1SVUA 5B4TA 2V4UA 3CVOA 5H4HA 1U7UA 4KFRA 3VBCA 3PNSA 4ITRC 3R5KA 5FPQA 1Z0ZA 1NJGA 3CXRA 4TTIA 5KAMA 4B5LA 5KB3A 3O0DA 2UUBB 1XI2A 3U7IA 2HC9A 4BV2A 1P1JA 1OE0A 3O8OA 4MQ4A 5BSMA 5C1DA 4UUNA 1DBVO 1AVTA 3GZNB 2AGVA 2QX9A 4NABA 5IAOA 1XJQA 2PS9A 1LSSA 1QHIA 3WLRA 1CQZA 1VGQA 4KN9S 3DEFA 4ND5A 3C3BA 1XLVA 1L5KA 5IU6A 1XMQB 4EYGA 1GSHA 1N9KA 3DV0B 1SIWA 1MFPA 3P19A 3ZJYA 4A5SA 4DXAA 1OB2A 1NW3A 1GITA 1ORDA 2Y67A 1RI3A 2OHGA 3GQBA 1ZUD1 1TF2A 3NHAA 5TV2A 1MG0A 1S6YA 5AJXA 5KOJA 1IG0A 1QRTA 1KBOA 4IGAA 4ME6A 4IWNA 1X7ZA 3VJLA 4DNPA 5JZBA 2GARA 1GYQA 3O4JA 4G5GA 1RABA 2I7XA 3A3OA 2ZRPA 3AQIA 1B2LA 5L45A 4RD4A 4GX0A 1NPYA 4G0YA 4EABA 2PFSA 1M0SA 4YECA 2A6PA 2JG3A 5BT9A 3FROA 3LH5A 2QE7D 5EGSA 5ALUA 1GN8A 2OFWA 3IAS1 2D0OB 2J87A 4N7BA 4HDRB 1U7XA 4F2GA 3G1UA 4MITA 5DCUA 3S55A 4UAGA 2BGUA 2OMKA 4GH5A 2XWSA 2IYUA 4NEGA 4Z9BA 3TQFA 1ID8A 1Q12A 5JY6A 2IE0A 4CKCA 1PR2A 3TH5A 4NBVA 2XQVA 3MCUA 4WACA 1ZGZA 2BI7A 4S1PA 1OFHA 3PDWA 5B55A 4M1ZA 3IVMA 5GWXA 1MAHA 2AFHE 2PZFA 2Y2UA 3PEUA 4ZT2A 1P2FA 2IU6A 3LOPA 3EWNA 2NU9B 4D4IA 4NNJA 3V80A 1DWPA 3IDSA 4A3SA 1XAJA 3A6PC 1FMTA 1JAIA 2FN8A 3BE8A 1P73A 1Y81A 2COUA 2H5IA 1J0BA 4RGVA 3H1PA 4RPGA 3B36A 3O74A 3SZUA 5KYNA 1JI0A 3H4TA 1ISPA 1GDHA 2BCGY 2AJ8A 4G8DA 1T35A 2G8NA 3JQ7B 3KSRA 4TTRA 1RZ3A 1W94A 2R6DA 5AXAA 2HMSA 2F48A 5J4YA 4IJMA 2P3QA 2POQX 1NASA 3DXXA 3TIGA 1J49A 4D8YA 1V5WA 2HGZA 2B20A 5H80A 5A05A 4IDFA 4L0QA 5EYPA 3WQQA 2FKNA 3KDAA 3FOBA 3OZRA 1CZLA 4MKZA 4U6NA 3FKJA 2F00A 4GC9A 2P67A 1JU3A 3C74A 3TUIC 1H23A 2H48A 2VUIB 2BSAA 3LCRA 3AVXA 4YCMA 2C7PA 3KEOA 3G23A 5F7ZA 5C5EA 3SQWA 3A9TA 4ZGGA 4LJ9A 3RS3A 3I09A 5J59A 2AS0A 2P5YA 3WHPA 2DWOA 2VDQB 2PGDA 3DNMA 5F7XA 1PV1A 2O8BB 1D09A 2CUZA 1ADCA 3E70C 1Q0UA 3PHCA 3EDYA 3QNWA 4F04A 3DCIA 1C3VA 1N5DA 2JIRA 3MJCA 2DHQA 2DRIA 1NN1A 3BXPA 1PO7A 1L7BA 1KDPA 1PGPA 3ZDQA 3ZKWB 4ZOLF 3L4JA 5CDFA 3E18A 1BVRA 3ADKA 4Z9XA 2EQ5A 4TSFA 3FCAA 2Q0HA 3GFSA 4LYGA 3NHWA 3SHQA 4YCAA 5MN6A 3F9IA 4HAUA 3COZA 4ZAFA 2ECQA 2W22A 3OM8A 2NVUA 4DR6B 4CKEB 2YWJA 5EP1A 4RL4A 4GX2A 1TM2A 1NUTA 1FFHA 4QGHA 5FA8A 4H3HB 3QNUA 1M6EX 5JI2E 3T5AA 4C2AA 1M2OB 4PC6A 3NC0C 3EXHB 3ZHVA 2JJ2A 3BXXA 5HJ5A 1ZUIA 3B2QA 3WIUA 3QQPA 4Q4JB 4QYIA 2OESA 4QEZA 1DC4A 5KDOA 2Y4OA 1TO1E 2F8MA 2GD0A 4XYEA 4CDMA 4U7TB 4TM8A 1XLTC 4CKWB 2F55A 3DQQA 4ZQIA 1PNTA 721PA 4LYHA 1KF0A 2AFIB 3IA2A 2P1RA 3O4RA 3QBJA 4DIOA 2GXAA 1UXIA 2Q3JA 1XRNA 1L5YA 4RMGA 5CXSA 3UB2A 2XKBA 1NYLA 3EC1A 3NATA 3NWOA 3JQPA 3QYFA 4X1KA 4UU1A 3VVBA 1T9HA 2IEIA 1IEQA 1PR3A 3DV2A 4J0IA 4CTJA 5A5VA 2HSGA 3N58A 3OE1A 4RTJA 1E6WA 1JDPA 3JZIA 4DMCA 2QD1A 5HM6A 1RRPA 4K1LA 4XX0A 4E5SA 2PLAA 5A4AA 1LFAA 4MR8A 1X9HA 2MYUA 3HGQA 1NMEA 1OMOA 4O1MA 2V98A 3N74A 5CLJA 2HJ9A 3HWX1 3MGBA 2EFYA 3CZAA 4MB0A 5D5PA 3AKZA 1NONA 1NVTA 3OPYB 3N2ZB 5SZJA 5CYGA 4YRIA 1KAGA 2X1HA 5A7FA 4Y0NA 5H3LA 1HYHA 1RWOA 1E4OA 1Y9ZA 1Y6JA 3F67A 3S6JA 4E3ZA 3HI6A 2IEGA 1X74A 3GUYA 5K2MA 3TL3A 3GVXA 1ZW6A 3CRRA 1KE2A 2H51A 2MOKA 4UHEA 4HUQA 4DV4B 2O7RA 1XKXA 3OCUA 3LGSA 4AKSA 1AZTA 3CTMA 4DCSA 1RHMA 3LCUA 3SZGA 1HI9A 1NKSA 1R64A 4ZO8A 4LDJA 3C24A 3C6BA 5SY9A 5AVRA 2KBEA 4BP8A 1QV6A 1D1QA 3AR3A 3KEQA 4A6XA 4KFSA 1UINA 2H4FA 3STTA 1TJ4A 3OMWA 4QTTB 2F3UA 1Q7RA 5JWHA 2CBXA 4G4SP 1EH5A 1DBWA 1BDJA 4MUBA 5I4IA 4N76A 4I1SA 2JZNA 2GJ9A 3RVPA 3SFTA 2AOXA 3Q8LA 5DNDA 5H9VA 1TQ8A 3IH5A 3H5TA 2H63A 3DF9A 5G1PA 1PQUA 3LBFA 4IGEA 2GF0A 4R41A 4WW0A 3DMTA 4BJ6A 1Q95A 1E5VA 1Z4JA 2HA4A 4ZT7A 1QHEA 2OD9A 2GTHA 4LW8A 5BUQA 1ZRHA 1W0KD 3C3AA 3HKBA 1VI6A 1G8HA 4B3RB 1M0EA 1L4YA 2CW5A 1RYFA 2CXPA 2GDJA 4JUCA 5DYWA 4ZREA 3B1VA 4FZ3A 4K3UA 2P4SA 3B3GA 1LWOA 1WXXA 3E9QA 3SHTA 1KO1A 3GDHA 4Q1CA 3INTA 2PRKA 1I36A 1JLHA 1DKQA 5F1KA 6NULA 2Q0QA 1JKXA 3NHZA 4IMIB 1US8B 1X80B 2VBIA 3CLTD 1UK8A 4MKXA 1FFGA 2J5BA 2EFDB 4TL9A 3TWOA 4F92B 3DL0A 1M8FA 3IJRA 2GQ0A 2MJLA 5I9LA 4RTPA 3AKCA 4UZSA 5IJ0B 4UBNA 5I5EA 3GLGA 4MULA 1X77A 4RWEA 2Z4TA 4HRXA 3QMWA 3FBGA 2WLTA 4EY6A 2HLDD 3LUPA 3LXRA 3Q7PA 1JHRA 3WHLA 4YJ2A 4ZZIA 1KK1A 4EHIA 1BZYA 2VH1A 3USES 1AM4D 1SC6A 4P2GA 4N4AA 2ZI3A 4PG6A 3UPUA 3H1FA 4LMRA 3CLUD 3H17A 3MB8A 2VUTA 4JKOA 2CJPA 4EUFA 1LBHA 1U7OA 4OKIA 1K4MA 4INAA 4R8SA 4XDGA 4EB0A 1DJQA 3P7MA 4FP9A 3MK31 1C0LA 3F4BA 4NAUA 1UBOS 3FLAA 2GEBA 1OI7A 3O75A 4IRUB 4OMDA 1JSRA 4TV9B 3U31A 4Z5XA 5KSOA 5DNWA 2VSQA 4FDUA 3ULKA 5BR4A 3QFRA 3WO1A 3DFFA 2H7VA 2PZKA 2RH9B 5SZKB 3FNFA 2F7SA 3SXUA 1OR8A 1SBHA 1Q77A 4JXZA 4ZCLA 3E5RA 3LQQA 1JS1X 2BZ0A 3IE0A 5EUBA 4Y9SA 4G0XA 2CLSA 2QTFA 4ATNA 3HNOA 2VP3A 1W1IA 4DTIA 4H1WA 4DMLA 2V9ZA 1LVGA 3RR2A 3FM9A 2HADA 5H83A 5C4GB 4AS2A 4GBED 3IE1A 2CGEA 5DVZA 3ZLTA 3GGJA 3EARA 1XVIA 4HRYA 4R7TA 4GRDA 5F77A 3IP7A 4DZZA 2XOXA 4F0JA 4YIKA 3IEMA 1G6OA 2OPBA 5A9TA 1CEXA 1GPNA 1ZRNA 2NSDA 2ID4A 3ZH9B 4MJ3A 4BGUA 5JZOA 3EXEB 1JMYA 4O4LF 1ZIOA 5U9CA 2VJQA 2NYAA 4JD5A 3T1OA 4BNUA 3FZQA 5FQOA 2ZJ1A 1CE8A 2C9ZA 3C3PA 1J4AA 3KHKA 5FUBA 4LKRA 2WU1A 5K99A 2J6CA 2X9NA 3KJGA 1WLYA 2YV1A 1JT9A 3T52A 4MDYA 3WWCA 1KC1A 2B83A 1MG5A 4DWVA 2PFKA 3DFMA 4AJ2A 4EB3A 1EI9A 2EC5A 2ZB8A 5MN5A 2QL7A 1R37A 2YXEA 3H1BA 1X8LA 3R5XA 2AKEA 4B0PA 4MQ6A 3PGA1 5AW4A 1ZA1A 4W5QA 3ADCA 5AKYA 5D6NA 3ZE2B 5JR3A 2ZRBA 4QYMA 3LE8A 3TLGA 4CN8A 3RIMA 3TRFA 1RM4A 2OHIA 4O02B 1ZZEA 3EGIA 3SNHA 3WK8A 5DLPA 1DAIA 4OQLA 5IARA 3ZE8A 5JCJA 2BR5A 4K6FA 3PQ8A 4LV6A 4A82A 1VI2A 2H9AA 3H8VA 4GM4A 5E2AA 5ENVA 2PX6A 2QZZA 5BXQC 1BGWA 4G0UA 3A2LA 1Z6TA 3IUQA 3ZNOA 5EMNA 4DLUA 1Y3FE 2P2SA 2VAVA 4MROA 2CLOB 3W5VA 2GXQA 2WWFA 3ZTYA 4TZ6A 1WXWA 1Y7HA 1SU4A 4IOLA 2R65A 2QN9A 3FUXA 1QGAA 2I8CA 3BZUA 4NENA 3RS2A 4Q3CA 2UZ4A 2H1VA 3DQPA 1V48A 5SZHB 4F9EA 2XUFA 2PE5A 5CR9A 4CFSA 1MGOA 5BRAA 1G5RA 1IN8A 2FW8A 1HLDA 3ZJVA 1ZCFA 4Y1FA 3UWPA 4NBSA 1NVMB 1I5RA 1DRUA 2CXHA 5G1NA 4BOYA 4PQGA 4EZBA 4C0JA 1ZSYA 4WOCA 4C22A 1TQ4A 4JI3B 3DLAA 1EM8B 4G5FA 4I1UA 3V8PA 5HTOA 2C7OA 3HMQA 1C7RA 3MCVA 4QODA 4WOBA 2F1JA 3OHSX 5FO0A 3I39X 3I0NA 4NATA 4M83A 2DT5A 1LLFA 4BQEA 5K20A 2F1IA 3ZCVA 4I5EA 3C2QA 1E1QD 4MPPA 3RKSA 4FKBA 2QQEA 4E6EA 5AOBA 4DNQA 3MT9A 2R4UA 5HIKA 1MO5A 5CH5A 3H99A 1B43A 3FHLA 4L5AA 4KOEC 3RJ9A 1FFYA 4A1OA 1XMXA 4L1KA 4BNVA 3HDHA 1CRZA 1BMTA 2YZNA 4O4HF 2NU7B 2VPQA 1OHHD 3ITKA 1RFLA 4LYEA 2D5LA 4I5DA 3CX7A 1LS6A 1WB6A 3LO5A 1NXXA 3OZGA 1ONPA 4WK0B 5CA0B 3LQRA 4TXHA 3AQ4A 2PHZA 3C0KA 5TPZD 2E18A 4HWGA 5LYJF 1II9A 4JMLA 4REMA 2W6MA 1HXHA 1P0CA 1PFQA 3GRFA 3N76A 3PENA 3QLEA 1XGKA 1JJIA 3HDVA 1UBGA 3H7IA 1R50A 4XVQA 4X61A 5IJ9B 4XUCA 2L69A 3PC3A 5EG5A 2IYFA 4M54A 4C08A 1IQPA 4UFOA 2NN3C 5AXDA 3Q7QA 3QA3E 3NTUA 1AO0A 1Q1EA 2JRLA 3I3OA 1FFXB 3EVZA 4BTEA 2GN4A 3T5PA 3NBUA 5F1YA 1C1DA 4WKPA 3E35A 3DZBA 3TB6A 2VXYA 5HDQA 4MHOA 4LMPA 4LVCA 1L0BA 3NALA 4OCZA 4FS8A 2QSZA 1U2EA 3NM4A 4MRMA 4FQ5A 1SIUA 1QHFA 1YU9A 4HXGA 1QK5A 4XX0B 2V6JA 1GRNA 4HWKA 2B8TA 1PT6A 4PV7A 1EGMB 2HBYA 1UT8A 3UYLA 3NTRA 4RZUA 4C5BA 4EJ6A 4II7A 3WRXC 5K4GA 1U7TA 3O8CA 2GFIA 1IBSA 3G2NA 1ONBA 2WIAA 1KFEB 5AI6A 3HN6A 4G1MB 2DR3A 4G23A 1K5HA 2QJWA 1A9YA 4HCJA 4HXEB 5CCDA 3EVGA 3FNGA 4E32A 4FNGA 4P58A 1IUKA 2PD4A 2RHHA 4IYJA 1PQWA 3PC7A 2XF2A 2QMOA 1K66A 4BY9E 3S99A 1LPPA 2ZJ3A 2B7LA 5DYIA 4BX8A 1E2HA 2XKAA 5EJ7A 2D0IA 1WZ2A 4UU0A 4GI1A 2WMYA 3U37A 1CR2A 3WQRA 1FL9A 1T3GA 3LI2A 1T9BA 2B8NA 1XPOA 1L5HB 1DMSA 5B30A 3G49A 3V3KA 1JEYA 1YZGA 1SUBA 2IZ1A 4U2BA 1GO2A 1UM8A 4U63A 4D9IA 3OLCX 8ADHA 1ZCAA 1TYDE 3FKQA 3GLUA 3IJEB 3LWBA 3JASB 3LBNA 5C4IA 2RGGA 4KWTA 2XGJA 3ASYA 4F06A 2B25A 2Q6VA 3IUYA 3PPYA 2ZR8A 2Q1TA 2J30A 1AS0A 3ILSA 3A7EA 1ZN8A 2J5QA 2AH5A 2XV1A 1W29A 1MN6A 2R9VA 2V4ZA 2W9XA 3F5SA 2I2XB 4M99A 5BR1A 4YV1A 1JXAA 1YS1X 2A1TR 4F96A 4Y2TA 3HHPA 1WHTA 3GCWA 1AH2A 5FUYA 5JXJA 3HB5X 1Y1LA 1IJBA 5DHAA 1G6Q1 2IOHA 2OA0A 2FU5C 1J5XA 3KTFA 3VPBA 3CRVA 4BRUA 4MTLA 1CZNA 1VKRA 2XQFA 4X85A 4A2QA 4OATA 4DYDA 1MNQA 1YIOA 2VIIA 1ZJ6A 3N3BC 1D9XA 2PJDA 1KMHB 2B9EA 2REQB 3VVLA 3OPXA 1CYDA 6CHYA 2C2KA 2ES4A 1U0GA 3FPEA 1I8TA 1XTJA 5TRTA 4TT3D 3WLNA 5AVTA 1NXPA 1GGKA 1EHYA 1Z4IA 2P8JA 4UM8B 4D8WA 3S7ZA 2H54A 1FX1A 1FJGB 3A7DA 3EF0A 1FQOA 1WY7A 4TSKA 3FAKA 5IC6A 1IHOA 2IF2A 4CMIB 4BNTA 3I9JA 1XTPA 1RM0A 1URPA 2JB9A 2Z5GA 4O08A 3ZGXA 4EFKA 2OCIA 2Y77A 4OFWA 1FTSA 4W5TA 4OSPA 1E1RA 4ZTZB 6REQA 1GKKA 4IX1A 1TTHA 4R68A 3DMHA 4IHJA 5ENDA 1M34E 1FUUA 2NLOA 2J3JA 2HU5A 2WHYA 1JFSA 2HHHB 4TWRA 5D7NA 5LZ7A 5I4KA 1Z5OA 3H6HA 2CLEB 4QXMA 2FPLA 4YCNA 2GZ3A 3ICPA 2WB2A 3TXXA 4KAXA 2RK3A 4TYNA 4XIFA 1C3JA 2LNDA 5JFTA 2I6UA 3B1XA 2BHRA 2VP5A 4RLFA 3JYLA 3IAS6 1OASA 4AP5A 1IBCA 2C4TA 1TW3A 4L8LA 3TR0A 1AGRA 3SDZA 4TS9A 1HLGA 2XUQA 2AVNA 1JKIA 2Y76A 3WB2A 1EFAA 1G20B 3U44B 4Z4CA 2G7MC 2QRKA 2I4MA 1OIWA 2GNPA 3NHRA 3T94A 1YR9A 4JC0A 1LRLA 4TTPA 1U9CA 4BGEA 3OQNA 1FDVA 2PUTA 4CN9A 3Q0EA 5BNIA 3GLIE 5AI9A 1QG2A 2E4YA 4NOMA 3A3KA 3QKRB 4U7HA 3FUWA 4G36A 3BJZA 1EFRD 4XOIA 5F4ZA 5HK8A 4CNQA 4H59A 3Q6MA 1XFDA 3BIXA 2PBZA 4QO8A 1KHTA 2DPMA 3OTHA 1CW2B 2PRSA 3BORA 4QXPA 3WNQA 1GCIA 2QUIA 2Y1OA 1DLIA 4TKZA 2MSWA 3EPKA 1XDUA 2X2EA 4MICA 2V3CC 1JALA 1KXJA 3M6MD 1GL3A 4BLVA 2O2YA 4EMUA 4RVSA 1GQ2A 1HC7A 3M4ZA 4OFZA 4UNSA 4EUNA 4NZPA 4D9GA 1YB7A 2QTNA 5K3DA 2WMNB 3BXFA 2RGAA 2O6LA 1F2UA 1A95A 2EP8A 5FBRB 3JRNA 2A9VA 1O95C 1AXGA 3TDKA 4E7OA 1U2GA 3PRHA 1ZL0A 2CNWA 1DTSA 1LPSA 3NYRA 2R66A 3OC0A 4KC0A 4X20A 4D57A 1N3YA 3COSA 3P4YA 3TDMA 2YVKA 4R0NA 3RQSA 3AUSA 3PGKA 5JTTA 3VZQA 4TXLA 3KKEA 2GT1A 1DC5A 2QL5A 1HGXA 2HD4A 4ZV9A 4EA7A 1E1DA 1G63A 1MBZA 2XECA 3KSZO 5H0IA 4B46A 2FUEA 4I9GA 3ZWOA 3M6UA 3O9ZA 3MBIA 1NVAA 3F49S 2FW9A 3Q7SA 4U5XA 1CDOA 4AZ0B 4C7KA 3EGOA 1W2HA 5JSKA 3W3ZB 2BEKA 1DC3A 3OFSA 5SICE 2HO5A 4F2PA 3L0DA 5BW5A 1SXJB 4IO0A 2P35A 1BWSA 4XH9B 1G9XA 4WD3A 1E9CA 3T0FA 4ZEXA 4OGLA 3GBPA 2B30A 3OI7A 4KBGA 5SYMA 4QUDA 1OWPA 4MS3A 3TRHA 4BP1A 3TW4A 1XZ8A 3DVSX 4Y2PA 4KACA 2HK8A 4BQQA 1ZWLA 1LJ8A 3WFJA 5JW6A 4FFWA 3VMMA 2AIRA 2Q50A 2R6AA 3LWZA 3WLJA 3BHJA 3VO2A 4AZ3B 1WXIA 2CMKA 3GEIA 4PTLA 1QFZA 3AOGA 1DDOA 2J3EA 5H7XA 1Y48E 3ODGA 4DLBA 1SUEA 3O1JC 2WWIA 2Q41A 4H3SA 2AN5A 4P7FA 5BMVF 3WL8A 1JEAA 4HGQA 3SBEA 1GUAA 3H2BA 2P2LA 4L0CA 1U2DA 3CONA 4ESHA 3GJSA 3FKSD 4ZT6A 5JSHA 4ZCSA 5CPBA 4EA8A 4CM4B 1T4CB 4ID9A 3SF0A 1CJBA 4FFPA 3PEVA 4FI3C 3NUQA 2I80A 1H69A 1WSAA 1RCFA 2FSVC 2BWJA 2X2FA 5E9AA 4M0EA 4J4BA 4C20A 1Q0LA 1U02A 3D8BA 5GQSA 4UDYX 5K4AA 5TQ2A 2VYVA 4CDNA 2ANBA 3CEHA 3EXFA 3EXHC 4HB3A 2D6FA 1IWPB 2WTUA 2JA2A 1KI1A 2O06A 1KBZA 4BP3A 3GLHA 1HPLA 3I76A 3PSAA 4GE0A 1FRQA 5EHGA 2XMZA 2XDQB 1CQPA 2VTBB 1YZQA 1AK9A 1U31A 1UBNA 2GCOB 2PRZA 3ORSA 4L15A 4EY7A 5HUJA 3AF6A 2ZG6A 1Q92A 2CBGA 4MVJE 3R0XA 1MTOA 1UWVA 3THSA 3BIOA 4J7AA 4WMLA 1TFUA 4IIDA 2HSJA 2DFNA 1P6QA 1OLUA 1RT9A 1UC4B 2GI4A 2O48X 1O94A 2Q27A 3HH8A 3UCXA 2AC2A 1DXQA 1QDEA 2OZKA 3KYCA 2XBMA 2R47A 3K70B 3L41A 1NVXQ 5F7JA 4KKVA 1A77A 4Z4FA 1TM3E 4L75A 2ZUTA 1UAGA 3K15A 4A2CA 1KBQA 1H9BA 2PL5A 3EDQA 5J5CA 1FXWA 3URMA 2H1SA 4QDTA 3PNYA 1U3FA 3EGXA 3KETA 2QPLA 4PLPA 2YJTD 2RIRA 4Q1VA 5DGCA 1CY2A 2CZQA 4MW6A 2NUTB 4IV5A 5T6BA 2PZMA 2QBYB 2O4UX 2XCUA 4L57A 3PFIA 3PEYA 1VIYA 3HFJA 2BR4A 4K6MA 2H1CA 4RF3A 3IQFA 4DSOA 1JIKA 1FFSA 2W6PA 3MINB 3V8RA 4ARVA 1GGMA 4CF7A 4D79A 3PI6A 3W7AA 2Q8PA 4FW8A 1QQ7A 4CIWA 1RCTE 1QU2A 2II6A 4IINA 4OI0A 3CKYA 1FSGA 1QU3A 3GARA 2ZDHA 4FZJA 1NZJA 1ZD3A 5ITWA 4WN9A 2Z83A 5I8PA 3I52A 1A9XA 1Z4NA 1DSSG 1SBCA 2OOKA 2WF7A 4KQ1A 2D00A 4DF3A 3BK1A 4UUOA 2RDMA 3OLYA 3C7AA 1XZAA 1AUVA 3RANA 1Y7LA 4DLVA 1H1LA 1CY0A 4UU7A 3INNA 4LSMA 3TI7A 4DNOA 2AWNA 5DNAA 3CNQS 1H94A 4X95A 5DXJA 3CLKA 1AUOA 1TRKA 5HUHA 1UMCA 4OQMA 3T9DA 4V02A 2EKZA 3AY6A 3N2KA 3PIRA 3IHKA 4BJHB 3WYEA 4F38A 1YQEA 3TLCA 2J9ZB 1CZOA 2FFBA 1RYZA 2OGZA 2JIZA 1JQJC 3CUSA 3PFBA 1SUIA 2YXPX 1YVDA 3GN1A 3QKTA 1L8LA 3D9QX 3MJHA 1AGPA 1L3CA 2OAEA 1FZQA 3IKLA 4GOXA 4OI4A 4XVHA 3RAEC 1KRWA 1COZA 1Y37A 2A30A 5KKAA 3ER8A 2IPXA 1RLUA 2GFHA 1Z17A 4Z99A 1VL0A 4WTOA 3DDOA 1A9TA 2OPHA 3H3FA 3WK9A 3PGJA 3INYA 3QY9A 4KMRA 3P2YA 4H4DA 5DFAA 2WILA 1ZN7A 3FTPA 3VXKA 1UANA 2HV8A 2AG6A 3NHPA 4F71A 1DUIA 1LNSA 2G9ZA 2XNJA 3VYVA 4WKGA 4QQKA 4EUEA 6ABPA 4X1YA 4NMMA 4U2DA 4BMVA 1JQEA 1N33B 1QF6A 1G8FA 2BONA 3DOIA 1U3DA 4FYVA 3D02A 4C7BA 1AHPA 2XCLA 1P0IA 2LP4Y 4C4SA 4TM7A 4WKCA 1KZ4A 1XXHA 5AVKA 4RY2A 3RJTA 4F21A 3G82C 3FPCA 2JFHA 1DWOA 1BE0A 3E9MA 2QI9C 2GBFA 4BKQA 4CFYA 2PX3A 1ZMBA 2FFRA 4NMXB 2M6LA 3RAPR 3IP9A 4EA6A 4XJVA 3CEAA 1KK0A 4L4UA 4QUIA 2QZ4A 3VNRA 2X0NA 3TLKA 3E9RA 1IZ7A 2WYWA 2DQYA 3AESB 4M7PA 4HDOB 5E3IA 5IAGA 2OBBA 4G9EA 3WGLA 5HGXA 4DA4A 1I24A 2Q2OA 5FTMA 3WGKA 3K92A 5AUNB 2VYQA 1MFZA 2IXTA 4BPRA 4NWIA 1FX0A 1OKKD 1RMYA 3DKKA 3N2EA 4BBPA 4GC5A 5JCJD 1DCTA 2NO5A 3B85A 3BWBA 1E3LA 1BMFA 3DE1X 2V3VA 1VHJA 3LQ2A 2AR7A 3NX4A 3QH4A 1P2DA 4MEAA 1Z34A 3H9EO 5DSZA 1I51A 1H05A 2B4KA 5LWQA 3F73A 2AEEA 2DT8A 2FR0A 1NW9B 2Q3LA 4GICA 4OHRA 4UARA 2JVJA 4LK3A 4WEOA 1L5NA 3TX2A 1XKQA 2YIJA 2YJ6A 4X7MA 5IG2A 4N0MA 10MHA 1YL7A 3HNPA 1T9KA 2X0IA 3O1LA 3P9CA 4IJ5A 5C0OE 2FOLA 4MVYA 3GVPA 4LTNA 2WM8A 1OXUA 2Q1WA 4EF6A 4LZWA 4LVOA 3C3MA 4L07A 4RKRA 1R6VA 3A0RB 3RCBA 4Q7KA 1N7GA 4MW9A 3GHYA 3IQXA 5IMSA 1YDEA 4NBTA 2I3DA 5CA1B 2HIMA 4R9VA 5IS2A 4C78A 2FB9A 3IIEA 4JLBA 2J4CA 2FX2A 1NQXA 4BC0A 4KR3A 1HKUA 2FG6C 1D0IA 3IUSA 4J0FA 3S5UA 5BV7A 1UBCA 3R7SA 3S1SA 3A31A 2ECFA 5DWQA 4DADA 1W25A 5JLJA 4QG7A 3GRKA 4G0MA 4O5AA 1R5BA 1RWMA 5C7YA 1EXVA 1SXIA 1A5BB 4UBJA 2HEGA 5TSDA 2HJSA 1XP8A 4EVQA 4ML3A 3KD2A 4GXTA 2OM6A 1D4OA 3DP7A 4I9FA 5F2KA 3U3RA 1SPXA 3PRKE 4NOKA 3DAOA 5CM2Z 3WR5A 3K1AB 5DYGA 3ONFA 4YJDA 4L72A 3TLEA 2VTDA 1OPXA 2A84A 1LXCA 1M2GA 1JMKC 2C9DA 2ZT8A 4M1QA 1N8TA 5HZGA 1SZDA 3PR1A 1JFFB 1DTEA 4YAJA 4ZJYA 1R00A 3QPBA 4MDHA 5JZ9A 1AURA 1CHDA 3FZEA 4X45A 5A6VA 1EB9A 4TLDA 4OGKA 4WI1A 5JH7A 2R60A 4YS6A 4B4UA 4ND7A 1M1ZA 5IVKA 1P19A 4E07A 1DCKA 4O8ZA 4QJ4A 2IC5A 4KQWA 4Z1MA 4ZICA 3V4RA 1CD5A 4DSNA 4GKAA 5A2GA 2EKDA 1YVPA 4AN1A 4RIIA 2RHTA 1GM5A 3QEOA 1HNXB 2DHCA 3EZFA 2I03A 4BQOA 4I66A 1WULS 4YDRA 1PNOA 2HF8A 3CH5A 3EDCA 4P82A 4RMHA 1UXGA 4CLDA 4YAOA 3R9WA 2O59A 2V5VA 4QOJA 4NK4A 1CQIB 1GNTA 2CVOA 3VJRA 3MCTA 1N0HA 1LX7A 3IAXA 3MC1A 1MC4A 2I99A 1JAXA 4JT9A 3NJRA 2FMKA 1VSUA 2PR7A 5JECA 2O54A 2FDXA 1TVEA 3TZEA 2WYVA 4A23A 4DLPA 4QOEA 1LV8A 4ND8A 1CIJA 3R5SA 3WAGA 2BFBB 4GECA 4ZARA 5HJ7A 5EHXA 4UASA 4YROA 2P6MA 2JFOA 2NWQA 2X8JA 4MAMA 3FSEA 3GH3A 1EFUA 3RBAA 3ZGNA 3N5CA 3TW8A 1EUDA 4YJ2F 4WT7A 1I01A 2FPKA 3K6SA 4F2WA 2IY7A 3DUWA 3O0TA 4UTPA 1X94A 1ABEA 3FFAA 5ICCA 4F3TA 1D8AA 2GAFA 2R1UA 4D4JA 1Q0QA 1J42A 1MX5A 1IWOA 1UR5A 2PNJA 1I2ZA 1W76A 2JDIA 3ETNA 221PA 3QBVA 3SBDA 4BB0A 5AJZA 1P62B 2E48A 3IERA 4ZKEA 1DGQA 2EJCA 1QRSA 3VSEA 3BDAA 1VRVA 5A5DA 5JPIA 4CDRA 1DWQA 4MA4A 2DTDA 2P4EA 4CM6A 1VXRA 2VF2A 2EP7A 5IAKA 1P3DA 1G1AA 3JX9A 1LRJA 3MTAA 2ZYGA 5L9AA 1RZVA 1Z82A 3HSYA 1D6SA 2P7IA 5FI5A 4DLNA 1JJFA 2C2HA 1EDEA 2AVDA 4GEGA 2J4DA 1XD9A 1TQDA 4MGIR 3JYHA 5ALPA 2WAOA 3QBEA 2C98A 2OV6A 4MUFA 3PS9A 4L9AA 1MB3A 2CXUA 5AKKA 2CNDA 2FP3A 2J0QA 2Q3DA 3GRRA 1E2MA 2CV2A 3KJHA 4LN1A 2G5CA 2A9OA 4N7MA 2ZIVB 3EASA 4RV9A 3U81A 1EDZA 4HYTA 1RI1A 1HSOA 2VF4X 5DNEA 1LK7A 3TLJA 2CT8A 3NV9A 1JR3E 1KS9A 3A6DA 4J90A 4Y7CA 3SSNA 1KI2A 4LV5B 2WDZA 4ZDKA 1F6WA 1V6SA 1R5JA 2OCXA 3ASUA 4GM0A 2Y0PA 3WRYC 4B84A 2V6IA 1RCUA 3G89A 1QIGA 1QWSA 2UZAA 4RQUA 3R3XA 3UVEA 2ZROA 2CV1A 1C3LA 4O4HB 4KXLA 2OGTA 4REOA 3Q3EA 4EFMA 3ECCA 1S8OA 4B2LA 4X54A 2BFCA 1UPBA 2I1LA 3NUGA 3FMGA 3OQJA 5CDGA 3REQA 1F51E 2P27A 4NZNA 1Z4KA 4DLXA 4LF5B 1J8FA 3AW9A 3JAWA 3PFHA 2MSNA 4JLUA 4KDEA 3PFNA 4LZAA 3VU8A 2PR2A 3FFWA 5LYJB 2W2QA 1LC3A 2XVXA 3Q6IA 4GNKA 1UBSB 3H5RA 1WE2A 3COVA 1PR5A 1WL8A 2MSCB 3E9YA 3NTOA 3TQIA 1NN0A 3E8XA 3NHFA 1X1AA 2JK1A 2ZREA 3PU6A 4Y30A 2QXTA 3AL0C 5DM2A 1CUJA 4ZI7A 3QHPA 1AQYA 1WDKA 4BO2A 1QMPA 3RAJA 1D04A 1K08A 4UJ5A 4KHZA 4RDHA 3UG6A 3CUVA 1WNTA 2ZXUA 3IQZA 4MKHA 2VHCA 4NBRA 4LJ7A 4IS3A 4QHSA 4HRVA 5FYDA 3UTDA 4BLWA 3HXQA 2G07A 2IHUA 5KS2A 1TYBE 3L18A 3ZU4A 4ZPJA 4ROSA 3QTTA 4QXAA 4ZC1A 1NUSA 3I58A 2QUJA 1P9NA 1F2TA 1XEAA 2H65A 3ONVA 1NXTA 3VU9B 1OAAA 2AI3A 1WY5A 2EKPA 3R3HA 2FE4A 3ZR4B 1RC0A 1HEIA 1OVMA 3GGDA 4DIEA 1ACMA 2BEWA 4BS9A 3UB4A 2C5SA 3HYRA 4LOLA 1G8SA 2BDTA 4PPGA 3I04M 4MGHA 5LDGA 5BSKA 3ROTA 1SBQA 2QJTA 3F3SA 3RYTC 1F8XA 2PZEA 1W5FA 3EJ6A 4MR7B 2VNSA 3RSSA 5HZKA 3ZJUA 3D2AA 3G5TA 4YPOA 2WHEA 3AFGA 1PR1A 1T4DA 2QRQA 3BD6A 1N1DA 4BJ1A 4TVOA 5C3MA 4LE2A 2C7BA 3WQBA 2ZIFA 4PFKA 2AXNA 3OE4A 4FPXA 1TO2E 4A91A 4G63A 4P84A 2QZSA 5EUMA 4BMDA 2YINC 4LG1A 4DDWA 2EIXA 5JS1A 2EJVA 1CR6A 1LPOA 4WFIA 3HPQA 2IOQA 2PU5A 2R6HA 3AHGA 4WGGA 3CUKA 5J23A 2R96A 1HSZA 1T5TA 1WEHA 1J2YA 4E11A 4LFCB 1HDZA 3Q10A 5EKTA 1I3LA 4X6LA 4BAGA 1G19A 1PR0A 2WAMA 4RENA 3VZRA 2LKDA 4BQFA 2ZCVA 1AD2A 4ND6A 3ZGYA 4B6RA 2HHAA 3KPUA 2FX5A 4JXKA 1I2DA 3IT0A 1PSDA 2RKWA 2I76A 3NPAA 2FPPB 3G79A 1KDVA 1GSIA 5IZCC 1RI5A 2HUPA 4PG4A 2XQIA 2CNWD 4W7HA 5COQA 5B1DA 3UT6A 1HNZB 3FNRA 2ODPA 1Q0ZA 3EA5A 3GEHA 4P5PA 2NQTA 3UWOA 4C07A 2O6HA 3T3NA 3MPOA 2P9YA 4TLCA 5BMOA 4AP9A 4ZOCA 2Q3FA 1G60A 1Q1GA 2PKCA 1KERA 3GZJA 4R0VA 2XJ9A 4YQYA 3IE2A 4AULA 1FLNA 1SQ6A 2OT3B 1Z35A 2FX3A 4I46A 4DUPA 3T1TA 4F6RB 3TEFA 3FVQA 2WTMA 4MB2A 5C8VA 1OF1A 1PR9A 3RVBA 2LE0A 5L4SA 4KGVA 1ZNWA 3J80A 3RC8A 1KA9H 1V5EA 3CSSA 3IDOA 4K9SA 4N6GA 4X6XA 4YRTA 2AJTA 4ZZ0A 2JCVA 5LDDC 5PGMA 4RLQA 4RCYA 1GT6A 4JXJA 4FGLA 1B23P 1OLXB 1R74A 3GPBA 1W5TA 3ZGVA 2F43A 1V37A 4RVOA 3VZPA 5E1MA 4C0AC 3LQFA 3AY0A 1HE2A 3QG5A 4X93A 4ZT4A 2IYXA 1ENOA 1Z8HA 2QTVA 3MD0A 1CT9A 4HATA 1NF2A 4HGPA 3ZKAA 3S8YA 3N2NA 1SK8A 3PQ6A 1OIXA 1QOPB 5KMGA 4JY7A 2X7XA 4OYLA 1OXBB 4HH3C 5KQRA 2YQ5A 3PDCA 3W8RA 3ANTA 4BUZA 3C4VA 1VB3A 2YWCA 4YUWA 2IQIA 2KE5A 3B6MA 3I6IA 3L6UA 4MOWA 4OQQA 1Y33E 2UZ1A 2ATVA 3GWGA 4C1NA 3R9IA 5JD4A 1I5OA 2WZDA 1DKUA 1K3UB 5HQTA 2VQ3A 3KCQA 3DKVA 1MV8A 3HXLA 4OHPA 1Z2EA 5JMWA 4G4JA 4FHCA 2GBGA 4PLYA 3I83A 4UQPA 3SZLA 5KJEA 2Y66A 1VYHA 2E3JA 4P33A 4E5YA 3BN3A 3W05A 2ZYVX 5ALZA 4TOIA 2PIAA 4BBAA 1USVA 2H59A 4F3CA 2X4GA 2VPIA 3OX1A 2M2IA 2P4HX 1YJQA 1JW9B 1J56A 4BKOA 4B85A 4WCDA 2BF4A 3M1IA 2VYVD 3R0QA 4C5CA 2V5UA 5YASA 2I0FA 1WUKS 4MI1A 3U49A 2G4VA 1W7AA 4K9RA 2Y1GA 4PGFA 1N1GA 4W8GA 1M2VB 1WCV1 3I5MA 3LUDA 2D2VA 1V6AA 3UN1A 1JJ7A 4Q9LA 1D5CA 1BXGB 1EYZA 2J6HA 1VE7A 2V9PA 4MKGA 4X9XA 2F3TA 3CZMA 4ZVVA 2QW8A 5JY1A 1AGYA 3UIEA 3FMFA 5JNLA 5FBZA 4B6FA 5K2OA 1TW2A 2XQKA 3TVTA 1KGDA 1FDSA 2WC1A 2RBEA 3NDPA 4DYVA 3AVVA 4M55A 4DE5A 3ESCA 3ZHSA 1QV9A 5E6RB 1O94D 2V58A 4XARA 4MV0A 2ZTHA 4B6QA 1SXJC 1NQAO 4DWWA 4HQOA 3OPVA 4M3NA 4BO8A 2ZSIA 4FBMA 1BAPA 5T3YA 4D4KA 5A4FS 5B4UA 3KXDA 2G1PA 2GERA 2I9KA 3CSUA 3QZUA 3NBQA 4CT4B 2LIPA 4PYNA 5D84A 1XEXA 3L0BA 1TEVA 4HEA1 3UICA 2DUUA 2BDEA 4BMZA 1ZVMA 4DYHA 5CLFA 1SVNA 3GBVA 3I3SR 5BV8A 1UKBA 4JDUA 3JS5A 4IHJF 4Z7OB 2NW6A 2QG4A 5EWLA 3U0BA 3W6UA 1L4EA 1NATA 1W4ZA 1UMKA 1PL7A 5G4KB 4NYJR 1NOJA 3QVOA 1R0ZA 3Q8WA 4ETIA 2H5EA 5HF6A 5AVYA 3TX6A 5LU9A 1JDSA 3QKUA 3RVKA 3B7WA 1SRRA 1ZGJA 5TEWA 1TYCA 3WLIA 5A4MS 3TZCA 1YI8A 3ED5A 3OX2A 3M6AA 4NVRA 3UK2A 4N01A 1CRPA 4YCBA 5CAEB 2UVDA 2G6BA 1NM5C 2VP0A 4MWZA 1M6YA 4Z3DA 1KK3A 1YTLA 2ETXA 1QZXA 1DFHA 3IEXA 4PZZA 1CP2A 1Y4ZA 3HWWA 3S70A 2F1OA 1IIRA 2GJAA 3FGNA 3K2IA 3PNBA 4JBGA 1K5PA 2I3GA 3NWEA 5EIBD 5HRAA 1QH8B 4JKIA 2H52A 1RRVA 2ENWA 5DN9A 2C8KA 4IMJB 3R3SA 1RQGA 2WTBA 1V96A 2OYSA 1PN3A 4RK5A 3RLIA 4EYKA 4MWTA 2A9RA 3K53A 3DZ8A 4DEXA 4XCVA 1V16B 3EIFA 3DTVA 1XKTA 4ZAXA 1JYFA 1SWWA 4NXNB 5GAJA 1KYQA 3WS7A 3AB7A 1SJ9A 3MG9A 3PUWA 3IBYA 1UPXA 4JZKA 4EAAA 1SQGA 2AFIE 2BZSA 5JBNA 3OT1A 3PT5A 5BMVB 2H3HA 2H8GA 3DVQX 4BZWA 1DQZA 1WVGA 1F7UA 1QLJA 2BFOA 3QPAA 4S24A 4RF4A 1OFIA 4OSEA 2Q9BA 2RC5A 1N0WA 2GPNA 2WLSA 3WLSA 1U63A 2O1WA 2H1IA 2Q4TA 3UPTA 1HURA 1L4MA 3EODA 1FQKA 3SJZA 5L7TA 1V47A 2AN1A 3FMPB 1BKSB 1B14A 4K0RA 3WWOA 4R1LA 4DG9A 5ES4B 3HYLA 4NEHB 1JWLA 3IPLA 3O8OB 2PGIA 4IDHA 2JI4A 3Q8MA 4CI9A 2JLZA 5AW1A 5BVGA 1U2TA 4I8DA 2WF8A 1CEYA 3RROA 2PKYX 3GAAA 3BWVA 1NLFA 2X0DA 3V4PB 5LJLA 1F1JA 2YXBA 4U9UA 2B8EA 2C3MA 4JBIA 1CNEA 4DN6A 1YR6A 1JHOA 3GU3A 4FR0A 2YC4C 4HDCA 3F46A 4MJLA 1KARA 3ZDEA 3GQBB 4H1TA 1MOPA 4RW0A 4TS3A 5TGTA 5KOJB 1SIOA 5J63A 3ZY2A 1BMFD 1LY1A 1X7ZB 2A1TS 3QVJA 1E8NA 4QNNA 5DM0A 5J2UA 1T36A 4P4UA 2H7XA 2EF1A 3F7OA 4M0FA 4PONA 5KBYA 4H0NA 3NTXA 3RVNA 2QENA 2EBHX 3DCNA 3RWBA 5ED4A 1OXXK 2W4QA 3QOFA 3TAUA 1ENYA 4G0ZA 4V03A 2CVFA 2JGDA 4TVBA 5B12A 5J3JA 2EWVA 2GZSA 3BG5A 4BVLA 2HL6A 1DUVG 1DKPA 2E4AA 2Z0MA 1V6CA 3ICOA 2PH5A 3JSAA 3R3UA 3PL1A 4BO4A 4CKCB 3GGCA 3DTYA 2R79A 4HNVA 3O7MA 3H0CA 3EPJA 4DV7B 1MPXA 1TT7A 4RC9A 2J31A 2OB2A 4EW1A 5KO2A 4F5ZA 3JQ9C 5EQJB 3B89A 1A8IA 3UNXA 1O6BA 2BFFA 2REOA 1Q22A 4TMWA 2VK8A 3FFXA 2BYTA 4UNNA 1YFZA 4MUGA 2P6OA 4CM9A 2VHXA 3RYCA 1L5VA 4PFQA 1P5JA 5KHAA 2B2XA 2JAPA 1TB4A 3PUZA 1KMMA 4ZVMA 3A1NA 5DTMA 3ZOZA 2FKAA 2B3DA 1JDZA 1MJNA 4DCOA 4DUYB 1QX3A 5EYPB 2IYNA 5F2EA 1B0UA 2QSUA 4UPEA 4V24A 1RSZA 4YRBA 3L06A 1FF9A 5JYCA 3CCFA 1ZBQA 2VOEA 4AF8A 2C7GA 5FUWA 3K1ZA 4QT4A 2YMPA 1UBUS 4Z1MD 1RXVA 5DM1A 4ZGWA 3A25A 4PS0A 2JLXA 2B7BA 3R8XA 1QS0A 4KVGA 2NVBA 1E77A 1ELOA 4PRZA 1FTGA 2JH9A 3PGLA 2ISCA 4HGRA 5D85A 3ROMA 3Q8KA 3G8AA 1IY8A 3G8CA 1Z6YA 4B45A 3NOXA 3V2UA 2E55A 4IILA 1QP4A 1N6NA 2FEKA 5LQUA 3ET5A 2VRBA 5E9WA 2WZBA 4WY8A 1N2XA 2VQ6A 5AI5A 4ZJUA 3CF6R 3QXJA 3BQNB 2XDYA 4RKEA 3IT3A 1M8GA 1TFRA 2JGEA 2FG5A 4GP9A 4G0VA 3QJYA 5ALNA 1M83A 3UA3A 4V0MA 1ZL2A 1RI4A 2NVUB 3DEYX 4XDZA 3LF2A 2PPVA 4BN0A 3QITA 1UWKA 1C7IA 2WUVA 1FXWF 3BZBA 3IMCA 3S2GA 2XEXA 3BTOA 3OT5A 4MDFA 2HTFA 2PCLA 3BA6A 2PGAA 1ENPA 1K6XA 2QX6A 2NV2B 3GIWA 1OX4A 2CHQA 1YK0A 3MUEA 4FUTA 4MVWA 4K40A 1N8KA 3MMXA 4MUAA 3HEAA 2VDJA 4QYIB 5KX5A 2ZP1A 5K8VA 5K3BA 5HRCA 1CJUC 3T7EA 3QX3A 1DZ3A 1QLHA 2R00C 4I1VA 1MB9A 2DR2A 1UF9A 1ULBA 2CXNA 4Q4HA 1E8DA 1L7PA 5B36A 4KRYA 2P8SA 2QTCA 2IEDA 4X1KB 2P3LA 5L51A 1ZGBA 2G06A 3IALA 3U9LA 1ZGGA 3GDWA 4O63O 3U7FB 4KGZA 1NBAA 1CNFA 4RJIA 4MW0A 4YK7A 1OV6A 2ATCA 4KMOA 4MZXA 1BXKA 4TL8A 3FSGA 5ESRA 4BB5A 3GJ7A 4C06A 1CWUA 2C8JA 2DBRA 2E85A 3Q40A 3QUQA 1UH5A 2AJDA 2V74B 4MR8B 1U2PA 5JD3A 3EXIA 1I0IA 1MV5A 1TE2A 2HCBA 2NZ2A 1T3LA 2OO5C 4HK4A 4JKYA 1EVYA 3WP1B 2QMEA 2A92A 1C81A 2ZE8A 3MWEA 4POOA 2P9HA 4RHFA 3BRQA 4DDTA 1SKMA 1EUYA 2R6GA 4D8TA 1ZESA 4RDIA 2YHSA 4LJYA 2BELA 3U17A 1NN3A 2JEZA 3OJEA 2B8WA 2HX1A 4GNRA 1E2IA 1KQPA 1ZIDA 4A73A 5JBIA 4J76A 3SG0A 2G25A 3UMVA 1J21A 1RKBA 4LXTA 3BWCA 5FD8A 2BKVA 5JD5A 4HUQB 1BDBA 1RLIA 5FWXA 1DOHA 2QVXX 5HKKA 3T3GA 1A9RA 1WKVA 2O2JA 4OK6A 4P7JA 4BCBA 4UBLA 3V8QA 3NCTA 4M0MA 3AB8A 2YOFA 4D6XA 4YPFA 3HA5A 2GR9A 3AIMA 3ZCRA 1ZC3A 1PU2A 3N3AC 3FPKA 2YZKA 5D2CA 3UBTA 4I08A 2GK6A 5LXTF 2IHNA 4IJWA 1CIVA 2WWTA 1QP0A 4MLPA 1LFDB 4N5LA 1RAIA 3O9MA 2KYRA 2WJJA 4GKJB 3NC1C 3NBKA 3MHPA 1PZXA 1WABA 2DHRA 4X71A 3QBDA 3BFXA 3FPHA 4D9NA 2J9GA 3I9MA 3JQBA 4P3PA 3HKBB 3C98A 4QIHA 1CU1A 3F0TA 5FWDA 5C8DA 2HMWA 2Y2VA 4LMBA 3H9JA 4I4TA 2DPLA 3VTFA 4A2WA 2G7ZA 4GF5A 4QX6A 1KZ9A 3B3QA 4XGKA 3R7LA 1XTKA 1GAQA 1GSOA 1Z28A 3A37A 3WGNA 4QA9A 4JLSA 4DLRA 4FMCF 5GTDA 5DRTA 1P4SA 3CUUA 4O3MA 1PG5A 2IGTA 3PYLA 1GXSA 2RG1A 2GVDC 2ZUSA 1T25A 3E1SA 4I5GA 5KYWA 3SXPA 2XB2A 3VM6A 4OIFA 4PS1A 3SKYA 3T5BA 2B1GA 2EFHB 3GLGB 2D54A 2JZOA 2C0PA 2CDNA 2JKVA 3ZQ6A 1XRJA 3TRJA 3BH6A 4RK7A 5SY6A 4YJ2B 1ZD4A 5CBPA 5I7EA 1V7PC 4DAEA 5EL0A 1R12A 5LQJA 1QDLB 3HNRA 2YNMA 2FEWB 1EINA 4UHKA 2ZIEA 1U4OA 5SZIA 1T1RA 1JHXA 1NF3A 4E14A 2ZRFA 4Z86A 3H3JA 1SVSA 4Q18A 3QVWA 2KPOA 4FD2A 1VBFA 1YQTA 1U9ZA 2QZJA 1W44A 1XVUA 5AHKA 2WWXA 1XZJA 4P5EA 4XW2A 3SDSA 4D92A 2PJRA 5LLTA 4FOPA 3MBOA 1RXCA 3UXYA 2P65A 2VKTA 4G65A 2OXFA 2CHUA 5G2OA 4XYBA 3SXUB 4PO1A 3U0VA 1R6AA 3AGQA 2O3UA 4U7PB 1M5UA 1SVMA 3ONNA 3I28A 4IDOA 4QQFA 3I1FA 5JH7F 4CKZA 3DV9A 1J07A 2Y1FA 2I1QA 3EPRA 3WMFA 3IPCA 1CUEA 2TYSB 1SO8A 4I55A 2GCNA 1JYEA 3E9EA 3OSUA 3Q4GA 4BQRA 4PIVA 3ZGOA 3T5CA 1UKVY 4HB2A 2NXWA 2C20A 2VT3A 4BHTA 4Z53A 2BI4A 4PAWA 1KVTA 3HVUA 4PNPA 2WHRA 3U4AA 5ALYA 2QYTA 3LRXA 2B0JA 3B6JA 1UXHA 1VCHA 4B2IA 2Q9UA 3ZI4A 4AKTA 1TA4A 1TIKA 2QP4A 1XRLA 2GTPA 5DGIA 5CPFA 3D4LA 4J0KA 4RHXA 1CE8B 2FA9A 3SR0A 4IDDA 4ESEA 2BF7A 2CDRA 2LW7A 2P77A 2HA3A 3AG6A 2JANA 3F1KA 3QHQA 3RC9A 3WOVA 4BNJA 2YWGA 4NFLA 4C0BA 3AR7A 3ROXA 1MO2A 5JATA 2K4MA 4DILA 4D0SA 5KSZA 1IPFA 4YMIA 4A7PA 3MTGA 4B6PA 3FVTA 3AIOA 1Z12A 4MJ7A 1GU7A 5EP3A 4IV8A 4QJIA 1W9HA 4CMGA 1PJLA 2F8LA 4PCVA 1ODTC 3QSYA 3ZE6A 1Z3CA 3L0PA 3EHEA 3FNHA 3T7DA 2HNKA 3DR5A 4IVPA 1RU3A 5IDVA 4E0BA 4J8PA 5ECWA 5DBHX 1K4KA 1LK5A 5CM9C 4KAFA 4KJXA 1GUFA 5KUTA 4R7ZA 1VL1A 1EWQA 1KKMA 4BE4A 1AGNA 1A97A 3TLGB 4Z4EA 5CFNA 2PLRA 2HYIC 1D5WA 2HBRA 2NU8A 2DSTA 2AJCA 4FYIA 4M38A 4MNTA 3BHMA 1KI9A 4MVJP 4A16A 3WL7A 1B42A 3HL4A 1E64A 1O4VA 1X7XA 3LRPA 3RVOA 3MCAA 1YZHA 4R51A 1FFAA 1G21E 5BY2A 1O54A 4PO9A 3WLOA 4DXHA 3FFTA 3RJMA 2V03A 1Y1RA 2GCIA 1Y8CA 4C14A 2EFCB 1F7VA 2FVYA 2RGDA 3MUNA 3BXHA 4NENB 1EE1A 2XF8A 5AKZA 3D7MA 4D5EA 4CV0A 2PUBA 3TW6A 3VI3B 2PG3A 3IGFA 1FCJA 4BX3A 3N2LA 4YBZA 1VHLA 4FDTA 1Z5WA 8MHTA 1TYAE 4IEEA 1E3JA 4V2UA 5EWMA 2W2OA 1O6CA 1EK2A 3CWCA 4X8MA 2P0YA 3AI3A 2ASEA 2DBVO 2ZVPX 5GY7A 4PHCA 1KORA 1LQUA 3HYTA 1A4UA 2PSHA 3G0GA 4MQEA 3LQ1A 1E96A 1ZM3A 4QQ8A 4NBKA 3WKDA 2Y0CA 4KFCA 1UBFA 1LQTA 2DF8A 4FJ1A 3MXOA 3FVRA 2WWWA 4P83A 2ZLBA 3KQVA 2O5RA 4PZCA 4W1PA 3AF0A 2FF7A 1RADA 1EK6A 1SU6A 2NZJA 5FAXA 1EXDA 4Y0VA 1WF3A 1JSZA 4CMAA 4I3HA 5ALKA 3GFBA 1PJCA 5E95A 2EG9A 3G9TA 2EZ9A 2YDYA 1T4MA 1X8XA 3OCXA 4P31A 3UENA 2NTNA 3WADA 3JQGA 1T8UA 3TZBA 3UC9A 3DBIA 2BC9A 3R3JA 1UFKA 4QGSA 2R8XA 2YYAA 1QZ3A 4KRXA 1SBTA 1MB0A 4N3AA 4RORA 5U1PA 4EFDA 5K6AC 1TMOA 4L5CA 4MV1A 1LX6A 3N8IA 1PJQA 2AZDA 2BEUA 4KQHA 2ACEA 3GMIA 1IXSB 5IK2A 1AIPA 3I9NA 4KIFA 2WF9A 1GJRA 2O4CA 2YV2A 3A9UA 3ABZA 2WNSA 2Z2IA 3THYA 1DJOA 3TKLA 3V97A 2GAIA 1ZVQA 1UFRA 3DLBA 4TPKA 5A9SA 3UANA 3UMRA 2JHFA 3D1JA 3PKIA 4Y2QA 2Z6AA 4KN8A 4BFLA 2GKGA 2ZYAA 1HG1A 2ZJ8A 3GCXA 5HRUA 3U4QA 3D1LA 1G5HA 1Q21A 1NUHA 4QAJA 1G20E 4MLZA 1T91A 4GOMD 1GV1A 2ZBVA 3WQHA 1KYVA 2BH9A 1XEWX 5K3EA 2QD3A 3D2BA 2HRRA 1U4NA 2XMBA 4TTSA 4D9EA 1C1DB 2ZRQA 1F0KA 1YRLA 2FUKA 1Y5NA 2J08A 3OFKA 4RHYA 3RSHA 3TTWA 3WNVA 3DULA 3H2IA 2J07A 4NJMA 3QIVA 3RC3A 5E7MA 2X41A 4OJTA 4QDZA 3PNVA 3PR2B 4Q15A 5ALJA 5EHNA 1UBHS 4L73A 4DWOA 1ADBA 1KO4A 4MRMB 5CVDA 1Y8ZA 1B8NA 2FEOA 4G4IA 4PFSA 4WJKB 2QG6A 3CEMA 2G09A 3QVUA 3N8NA 1LBIA 3A58B 5IEBA 3N8GA 4BO5A 5K0GA 3C43A 3LVFO 4GRAA 2HAEA 4MYSA 2JLCA 1B3BA 4G0QA 4KUGA 3O5AA 4QGBA 4ZAGA