2RHWA

Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Basis for Inhibition of BphD, a C-C Bond Hydrolase Involved in Polychlorinated Biphenyls Degradation: LARGE 3-SUBSTITUENTS PREVENT TAUTOMERIZATION.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
total genus 103
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rhwA00
1UT6A 4BP9A 2HU8A 3BXPA 1BEZA 4PSUA 2VA9A 4YASA 5IVDA 5IKXA 4FLFA 5ALRA 2XUDA 3WA7A 4OCZA 4B80A 5A7GA 4WY5A 5HK9A 3AZQA 1YAJA 3T4UA 3WK7A 1XRLA 5DWDA 1TQHA 5CTAA 3DNMA 3DL4A 3O4HA 1QFSA 4GW3A 3B5EA 4JNCA 5A7HA 1EDEA 2XLBA 2HA6A 4G8CA 4HXEB 2WSLA 2WG1A 4NVRA 5AKJA 2VEOA 3QPDA 2QKYA 3C6YA 1CUYA 1XLVA 4WCVA 3WZLA 3D2AA 4UBNA 1U4NA 2G5TA 2PU5A 3WKCA 3Q0TA 4PV7A 1C7IA 1SCIA 3H18A 4ZV7A 5ISMA 3EQ8A 1ZICA 1J06A 5CH5A 4IQ4A 5DNUA 3W9BA 2VJCA 3C43A 1P0IA 5LP1A 4DNPA 5AK3A 1W76A 2GZRA 4X6XA 3O95A 4S0XA 5EHXA 5CT4A 5JZ9A 1Q83A 2HA0A 5ALWA 5DTJA 4CCYA 2AJDA 1XRMA 1L7RA 2WM2A 2HDWA 5AOAA 4HZGA 4Y2PA 5ALQA 2WIFA 5I8PA 1CEXA 5AIBA 5AOCA 4H7IA 1IZ7A 3H1AA 2EEPA 5HK8A 3O9MA 4X85A 5AIAA 3L1JA 4UHEA 5HF8A 2XUQA 1CUUA 3EBLA 3AJAA 2RGUA 4G5XA 5AO9A 1AMNA 1P0MA 2ZSIA 3LS2A 4HXGA 4EB0A 3TJMA 3PFCA 1CUIA 5HKBA 5BWBA 1ODCA 1E8DA 1QE3A 4I4CA 4DSAA 5AM0A 4BE4A 1ETHA 1QGED 4G9EA 2WHPA 4Y9SA 5JATA 5HQ3B 1AURA 1BU8A 5AOBA 5FP0A 1XKTA 4QEKA 4UHDA 1WHTA 1A88A 1MT3A 3A6ZA 5ESRA 3I2KA 1EXWA 1USWA 3C6XA 3FVRA 2WFMA 4EZIA 3QM1A 1AKNA 5LIPA 5J3JA 1AUOA 4W1QA 4QNNA 2YXPX 3MUNA 2HM7A 3H19A 2GYVA 2JGJA 1LPMA 1R1DA 2QZPA 4Q3LA 4QWMA 1LBSA 1ZJ4A 3OG9A 2HFKA 2RAUA 1H2YA 4FFWA 4HTAA 1R9NA 1TKRA 3H0CA 4PSCA 1XZIA 2JGFA 3FAKA 4H7HA 4JYPA 5CT6A 2G4LA 2NW6A 3D4LA 3KXPA 3QZUA 1VZ3A 1VXOA 1LNSA 2QOEA 4IO0A 5BV7A 2B4KA 5HCUA 3WK4A 4U2CA 3FYTA 4LHEA 1ZIXA 1MU0A 3HYSA 4C87A 1EX9A 1L7AA 3H2JA 3STVA 5AJHA 3IULA 4X00A 2XUPA 4K2AA 4J0GA 1DT3A 3I1YA 1A7UA 4BDSA 1LPSA 2PKYX 1LLFA 2PPLA 3NOXA 5BWCA 4C4XA 3CN9A 5EFZA 2PU7A 1ACJA 1G5FA 1NX9A 4KE9A 5CT5A 5CH8A 1P0PA 1LPPA 2CMFA 2I3DA 1MAHA 1BROA 1QO9A 2IITA 2XE4A 3OPMA 3WQHA 1GPLA 3WK6A 1WM1A 2OLEA 3M83A 4W63A 4B0OA 5I9IA 2WUGA 1GZ7A 2XUGA 3CCBA 4F60A 2HIHA 5FOQA 4KE6A 4DTCA 1CUZA 4H77A 5DYWA 1N5RA 4C89A 4ARAA 1CUBA 1ZOIA 4Q05A 1XZLA 4BZWA 4QLAA 1W1IA 2OAEA 2VJAA 3VXKA 3F9CA 4ZI5A 1C4XA 2QJWA 4X97A 4BRSA 3PDCA 1H2WA 3LP5A 1UOOA 3G0IA 1UKCA 4DNFA 1FFCA 2X8BA 3QMWA 3O4IA 4DMKA 5AKHA 1GKKA 3E4DA 1E3QA 5EIHA 1CUHA 2CBGA 4FBMA 5AM5A 5KWIA 4W1PA 5C8XA 3U0VA 2RIPA 3WZMA 3JWEA 2PUJA 1H2XA 5DYTA 3I1IA 4M0FA 1XRQA 4BAGA 2WUFA 4G8DA 4EY4A 5DNWA 2WHPB 4GI1A 2C4HA 2RI6A 3ICVA 1GQRA 2CUTA 1R4ZA 2I3ZA 4CG3A 3OC0A 1XZGA 1IUOA 1EI9A 5JZBA 3HSSA 4J3JA 3H17A 2WTMA 3EF3A 4BZZA 3DJYA 1ZGCA 4IH1A 2WU4A 3FCXA 2RHWA 5AKYA 4GBGA 3ZI7A 2J4CA 4ARBA 4MXDA 5IVHA 5LKAA 2XQJA 3WWCA 4H7JA 4RE6A 2ZYIA 4FWBA 1CPYA 3JYHA 4BVKA 1MPXA 3E3AA 1XQWA 5D6OA 1Q0ZA 2B9VA 2Y1KA 1DWPA 3I6ZA 4RE5A 3V1NA 1QIIA 3IUQA 4HXFB 2XQIA 1FFAA 5AM3A 3R3WA 1X70A 5AHXA 2Y6VA 3FYUB 3ANSA 1ZD4A 4X95A 3PI6A 2GZSA 4BCDA 4HRXA 2DCMA 3BF7A 3C8DA 2V97A 1W52X 3LCRA 1UK8A 2VF2A 3QITA 1CUGA 5LYYA 3FYUA 1K5PA 1ACLA 2DQZA 3S8YA 4F0JA 4BATA 2C0PA 1RYYA 1WPRA 2XQGA 2WUDA 2AJBA 5JAOA 3DKKA 4DNOA 1R3DA 2G5PA 3R3YA 1QIKA 4BAUA 2H9YA 1F0PA 1T4MA 1XRRA 2EDCA 3HABA 1YS2X 2PL5A 2OCLA 1BEEA 4C4YA 2OGSA 1K63A 4YK7A 1AX9A 1XRNA 4BVLA 3F98A 1UOQA 1RWQA 3STXA 1D07A 3NUZA 4N8DA 4XX1A 4DYHA 3W06A 3PF8A 2DSNA 3VJMA 1QIJA 3MVEA 4J0DA 4V2IA 4MYSA 4B81A 2OGTA 1S8OA 1EB9A 1TRHA 1CUSA 2VT7A 1GPKA 3FYUC 5A71A 5ALPA 4BDTA 1AGYA 3DOIA 2OAGA 4CCWA 4EY8A 5CXUA 1WB5A 4NMWA 5LZ4A 2PX6A 3IDAA 2HRRA 4TPKA 5JD6A 4N5HX 5FPQA 4B83A 3PUIA 3H04A 2AJCA 3BDIA 1QIDA 1KU0A 4UBMA 4U2FA 2IIVA 3C6ZA 3WK5A 4BE9A 3I2JA 3A70A 4LXHA 4MWTA 3DQZA 2JEZA 1XQYA 1K8QA 3HXKA 1QTIA 5BOVA 4G9GA 2JEYA 3C5WP 2V96A 4N8SA 5DLPA 3WIOA 5KBYA 1HL7A 3I2IA 3R3ZA 3PF9A 1XZDA 4FLMA 3GUUA 3C5VA 1VKHA 1VOTA 3H1BA 3AIOA 5CT9A 5HF9A 2AXEA 5K3CA 4J0IA 5F4ZA 1DU4A 1A8UA 4J7AA 5DTIA 5E2IA 1JU3A 4KAJA 3VJLA 1XKLA 4LXGA 4AN1A 2WIJA 2XQKA 2ZJ6A 4HS9A 3HC7A 2XMQA 2HL6A 2H1IA 1IUNA 3LIIA 1AZWA 1E8NA 3ZV7A 3HLKA 1BCRA 3ANTA 3SX4A 2BCEA 5DJ5A 4CFSA 4JYMA 4K6GA 1EH5A 2B61A 3HJUA 3QYJA 1BN7A 1EK2A 1MX9A 1AC5A 1HLGA 3I2GA 4E14A 4CIBA 1UK9A 2O2GA 2XT0A 5A62A 1KU6A 2BFNA 3PUHA 1JI3A 5EHZA 2JBWA 5AK6A 1H23A 2UZ0A 1YA8A 3AZOA 3WKDA 4C01A 3G0DA 1MN6A 3H2KA 5CBKA 2JGEA 1ZIYA 1U65A 1K6EA 5HF6A 3A2LA 5C8ZA 2CEKA 3LLCA 5AI6A 3S2ZA 4PW0A 4UBOA 4MYDA 1I6WA 1YAHA 2BJHA 4OPMA 4G1FA 2WFZA 1JT2A 5HQ3A 2O2IA 1HQDA 1YS1X 3PFBA 3I28A 2Z8XA 3RKSA 3X3HA 3F97A 3I6YA 2O7RA 2RHTA 1J1IA 4BAZA 5AI5A 1CQWA 3QH4A 4UBLA 3BJRA 3IURA 3D2BA 1U2EA 3TRDA 3WJ2A 1R50A 3E1GA 2FUKA 2H7XA 2VAXA 4H7KA 1FFDA 2ORYA 1HBJA 4EBBA 4N5IX 5JD4A 3VDXA 3AIKA 2BGNA 1CVLA 3WJ1A 1PFQA 4O08A 5ALSA 3AINA 2WFLA 1THGA 1DX4A 1ODSA 2DHCA 4Z49A 4GWLA 4FDMA 1HDEA 5AK4A 1DWOA 4M0MA 4U2BA 1LBTA 3ESCA 4WFIA 3KWJA 4B85A 4BBZA 5T4EA 5EI5A 4EHBA 4QLOA 1VLQA 3G9XA 3GFFA 3DDUA 3PICA 4AO6A 1CUAA 2WU3A 4EUSA 5JAUA 4Y2TA 1DTEA 2WLSA 4LKOA 3G9TA 4P92A 2WIGA 4KRYA 3K9BA 4AO8A 2Y2VA 5AM1A 3DOHA 3VVLA 4KAFA 3WYNA 3GROA 2YASA 2WILA 5HFAA 1R88A 2X5XA 2ZYSA 1J2EA 5AICA 1B6GA 1QTRA 4P08A 3D59A 1CUFA 2HA5A 1PV1A 4INZA 2ZVDA 4G4JA 5KREA 3F96A 1FJ2A 1UFOA 4Q82A 2WUEA 3R3VA 3TEJA 3IIIA 5FLKA 4LYEA 3ESDA 5CURA 4Q34A 5CRIA 1TCBA 3H2IA 4UHCA 2HA2A 3G0BA 1E89A 3STWA 4Q3KA 1QIHA 4B6GA 4QDTA 3WKAA 4KEAA 3WK8A 4IH9A 1RP1A 1TAHA 2Z5GA 2FJPA 3W9UA 5ALFA 2PSHA 3IUMA 3WI7A 3C45A 4KE7A 1BRTA 3C6BA 4J0HA 2XDWA 4J03A 3ZWQA 4G4IA 2B20A 5ALYA 1CUVA 4MJ3A 4Y2VA 1LPOA 2XMRA 1GKLA 1ORWA 2VJBA 4X90A 4U2GA 1CR6A 2HA4A 5EHNA 4HAIA 1LZLA 5IH7A 1MNQA 2GBFA 4XVCA 3C70A 4H7FA 3R0VA 1MAAA 1EVQA 3W2TA 3KSRA 3DKRA 3W04A 4QZVA 4QDUA 2PM8A 3AILA 2YH2A 4BB0A 2BGRA 5HKAA 2DR0A 4MQMA 4Y7DA 3DEAA 1QZ3A 3LIPA 3AFIA 3UMJA 4OSEA 1K4YA 4Y2XA 4X91A 3G7NA 3WWOA 1JU4A 4UBIA 2WG2A 5JIBA 2CJPA 2WQZA 5AI4A 1GGVA 3K2IA 5HFNA 3G9UA 3ESBA 5YASA 2VT6A 1CUEA 1EK1A 4AQDA 1FFBA 5AP9A 2Z3ZA 1CUDA 1IVYA 3H2GA 2PSDA 2OCKA 4FNGA 4L72A 3IBTA 4GEGA 3DCNA 5LZ9A 2HA3A 4IH4A 1GPNA 4B7ZA 3WWEA 4EY7A 1UWCA 4OB6A 2PBLA 4PF1A 1W4LA 4B84A 4DNQA 4CG2A 3OM8A 1U8EA 5C8VA 1XROA 1XZCA 2V9ZA 3B12A 4JH0A 4X92A 1YA4A 1EINA 4DMHA 5FUMA 3RLIA 3GELA 2OGZA 4QA9A 2VSQA 4WDQA 2K2QB 1VE7A 4FFVA 4GXNA 2DFPA 1UK6A 5ALKA 1E66A 1CLEA 3VJKA 2HRQA 4M0EA 1QJ4A 4Y2RA 1OCEA 4JUIA 1Q0RA 3HZOA 3DS8A 2X76A 3G0GA 4OYYA 4QDOA 3YASA 4BYMA 2OQIA 2HADA 2HA7A 2GBCA 1H2ZA 1ORVA 4FMPA 4HVTA 5LLSA 3VVMA 2XUKA 3G9ZA 3KDAA 4C6HA 2XUFA 5FV4A 4BTVA 4J0KA 5K3AA 5K3EA 3R3UA 2WTNA 4Y2UA 3QMVA 4P9NA 1LPBB 5ALZA 5AM2A 3SC2A 2QUAA 1NU6A 5EHQA 2VAVA 5ALHA 3O4JA 5K3DA 2WG0A 4NZZA 4GDMA 2ZJ7A 3CXUA 1C7JA 4C4ZA 4YX9A 5EIEA 1EDBA 1LPNA 2GBIA 3D2CA 4UFNA 1BS9A 3FSGA 3CCCA 1W6RA 4J0JA 1JJIA 1XZKA 1CV2A 1N5MA 4WFJA 2XMGA 2JGKA 3FNBA 3STYA 4UHFA 5EIAA 4Y2JA 3I2HA 3M81A 3AIMA 3VISA 4I3FA 5IVIA 1LGYA 2QXTA 2R8BA 2WHQA 4AB1A 4ZXFA 4E46A 1Y7HA 2C7BA 5LZ7A 4KE8A 3BJMA 2VATA 1XLUA 4H7EA 1YCDA 3KD2A 4AMZA 1QONA 4FLEA 1UKBA 3RARA 1JJBA 2VTVA 5JARA 2XI4A 5FPPA 1SCKA 4EY6A 1DT5A 1NU8A 4FBLA 2VJDA 1EDDA 1IUPA 7YASA 3OTQA 2XUJA 3STTA 3IB3A 1YB6A 1GT6A 3WL8A 2RONA 2ZSHA 2DHDA 3D0KA 3M3DA 2QT9A 2J3QA 5SYMA 1ISPA 3BDVA 2CZQA 4A5SA 3EIOA 2E3JA 3D5EA 4I19A 1BE0A 5E4TA 2QMQA 4L9AA 3WKEA 1CUJA 5A2GA 3G02A 1XZEA 3N0TA 2ECFA 4BP8A 1HKHA 4F21A 5ALLA 3EQ7A 2BUCA 1DINA 2PSFA 4EY5A 3L1IA 3D7RA 2O7VA 2DQYA 2R11A 1MJ5A 1JMYA 2P8SA 5CMLA 2WHRA 1ZD5A 3FWHA 3TGLA 1O6GA 1UZAA 4W1SA 4UUQA 5JZSA 1GQSA 1A8SA 2XMBA 5H3HA 1LZKA 3FBWA 1B41A 4DSZA 4ROTA 3CN7A 4UBJA 4CIAA 1WCYA 1DQYA 2XMDA 5ALIA 5I7UA 3ZLTA 3HRHA 5JASA 5HZGA 3KOOA 1TCCA 4KYVA 1QIFA 2HHAA 4AZ0A 5ALMA 4K6KA 3IVMA 4J0CA 3H2HA 3G0CA 2ONCA 1F0NA 4BVJA 1VA5A 2XLCA 4ZGBA 3IUJA 2LIPA 3ZLVA 4MEAA 3FVTA 4AXBA 1SC9A 4PNZA 1ZI9A 3F8SA 5FXMA 4H7DA 1UK7A 1ZJ5A 1N1MA 4H35A 4BCCA 1G42A 3D3NA 4DMCA 4E11A 3STUA 3DYIA 1UKAA 2QM0A 4XJVA 2CKMA 4KRXA 5AI9A 4MEBA 2QR5A 3E0XA 4BTLA 1QIMA 5LKRA 1TCAA 5C81A 1J07A 2GYWA 2PVSA 3WL6A 5JADA 2Y2UA 4WFKA 2OG1A 1THTA 4IHAA 5JAHA 1F6WA 2WIKA 4PSDA 5SYNA 1DWQA 3WWDA 4F5ZA 1XZBA 3QPAA 4CI9A 2XUHA 1WPXA 4TGLA 1AQLA 2QJRA 3C87A 5ALXA 4NS4A 4BC0A 1FFEA 5IVKA 3KWFA 4KACA 1ZI6A 2XUAA 3U1TA 5ALGA 2I78A 1CUCA 5HF5A 2Y6UA 1Y7IA 4W1RA 4G8BA 1A8QA 1IMJA 2H7CA 1Y37A 1QOZA 3IA2A 2HU7A 4XIIA 3JW8A 1YSCA 4B0PA 3WL7A 1VZ2A 3QMMA 4ZWNA 2HFJA 2WJ4A 2G63A 5JAPA 1MNAA 5ALJA 2OQVA 1XZHA 4UHHA 2QXUA 4Y2SA 3FSGD 4BCBA 1E8MA 4DIUA 3BIXA 1XQXA 3WMRA 2AJLI 1XQVA 5AKGA 1R9MA 1ZI8A 4UFOA 3WYDA 1VE6A 3V1MA 1ZD3A 5ALTA 2GBGA 5DNVA 4OD0A 3IUNA 1JMKC 2HU5A 1YB7A 1QIEA 1TK3A 5CH3A 5AH0A 2V98A 3BL8A 4Q1VA 1Z68A 2J3DA 2XMSA 2QVBA 4GHWA 1PJAA 4AN0A 2C5FA 4K5QA 1X2BA 1CUWA 3C8HA 1X2EA 5ALNA 4QWWA 4B9AA 4X6YA 2PUHA 1SFRA 1TIBA 3FCYA 3B3QA 4G4GA 2OCIA 4ZRDA 1LPAB 2QS9A 1UOPA 1CRLA 1WB4A 3BIWA 4CG1A 2ES4A 3PE6A 3MGAA 2C0QA 4OYLA 2JIDA 1N8SA 5D7BA 5FDFA 3RM3A 3ICWA 4LXIA 2H7YA 2I03A 3UUFA 2PSEA 3AUKA 1SOMA 1OXMA 5K3FB 1MO2A 1VA4A 1XZFA 2JGLA 3O9VA 2ZJFA 4GECA 1WOMA 5ALDA 1QLWA 1F8UA 2JF0A 2VQ6A 4C88A 1WHSA 5LZ8A 3ILSA 4WY8A 4KR0A 5FKJA 3WL5A 4WJLA 4PO3X 3O0DA 4U2DA 3R3XA 1YASA 1YR2A 5JANA 4QDXA 4FTWA 3ZPXA 1QO7A 2DHEA 1MTZA 4JEIA 3WA6A 3QBJA 5AKZA 1XLWA 4U2EA 3QPCA 2Q0XA 1CFJA 4RGYA 5C7YA 1EB8A 5JD5A 2PSJA 2OCGA 5ALUA 2YYSA 2FX5A 1P0QA 5ALEA 4UBKA 4DLNA 5AM4A 3HACA 2AJ8A 2XUOA 5JALA 4DM7A 2FJ0A 2J4FA 3FLBA 6YASA 3RK4A 2WFLB 1CQZA 4DGQA 2WIDA 3BE8A 3O4GA 5A7FA 2D5LA 3HEAA 3DLTA 2D0DA 5DYYA 2XB6A 3V1KA 1E5TA 3GA7A 5AKKA 3MUOA 2IX9A 3V48A 5AKIA 1EA5A 4RNCA 5AK5A 3WLAA 1CIJA 3P2MA 4N8EA 4AMYA 4FKBA 4PQEA 3M82A 2BUBA 3SK0A 3N2ZB 3NWOA 3ESAA 3R41A 4H18A 5T4HA 3K6KA 4UFPA 5CW2A 1CUXA 4A23A 1EVEA 1QIGA 4Y2YA 3FOBA 1XZJA 4OU5A 3W05A 4KAAA 5T4FA 4QDZA 1WB6A 4MQLA 1BCSA 5A6VA 4B82A 3I6MA 4HRYA 1Q84A 5T4BA 4Y2QA 1XZAA 1FSSA 3NGMA 3WWPA 2JGIA 2QUBA 1H22A 1SCQA 3GBSA 4UHBA 3UUEA 2CB9A 2OXEA 1ZGBA 4EA6A 2XMZA 3BF8A 4OUKX 1T2NA 1O6FA 2W6CX 2C5GA 4OU4A 1G66A 2BUAA 4X93A 5K3FA 1W75A 4Q3OA 3I2FA 4W9RA 2ZYRA 4AX4A 4ETWA 5ALOA 4L0CA 5K5EA 1ZD2P 2XMCA 4ZV9A 3SWWA 1IZ8A 4X6UA 4AO7A 4FNMA 4OB8A 4B9EA 2ACKA 4ZREA 4D9JA 4X3CA 5E4YA 3ZLUA 2O2HA 1BN6A 2Z3WA 4BRZA 1M33A 1G4HA 5LZ2A 2ACEA 3A2NA 4A16A 4UPDA 1L7QA 5E4JA 4E15A 1QFMA 2C58A 4X94A 1XFDA 3DYVA 2WJ6A 4L3WA 4LIPD 5FRDA 1EHYA 4TVKA 3G8YA 4OB7A 3F67A 4BC1A 4RPCA 1JKMA 4K6HA 4QE3A 3GZJA 1VJ5A 2W22A 1VXRA 5D3ZA 1JFRA 2BKLA 3R40A 3L1HA 3Q8WA 1KEZA 1JJFA 4XWGA 2OPHA 1ODTC 3V9AA 3EQ9A 4X7BA 1HPLA 4FHZA 1MX5A 3QVMA 4LYDA 4P93A 3DL7A 2GYUA 3DD5A 3T52A 3OOSA 4X71A 2XUIA 2XQFA 2JGMA 3A2MA 5CXXA 2QTBA 3V1LA 4DMFA 2EDAA 3WIBA 4CCYB 4H0CA 3HI4A 2WJ3A 2Z8ZA 5AKLA 2ZYHA 3BWXA 5JYCA 1MX1A 2QRUA 4ITVA 4GLBA 4KJXA 4YPVA 5EGNA 3FLEA 4FOLA 1XRPA 3AZPA 5LZ5A 3OURA 2BAGA 2WKWA 1UXOA 1OILA 5ALVA 2ROQA 3FLAA 5KWJA 5AKEA 5D3KA 5CT8A 1GXSA 5AI0A 5AI8A 3VKFA 3ED1A 1XZMA 4WDRA 3WKBA 1DQZA 4MWSA 5AKXA 1DX6A 3WK9A 4AZ3A 5K3BA
chains in the Genus database with same CATH superfamily
4QT4A 5AJYA 4BP9A 4YUZA 4PLWA 1NBEA 3VNAA 2X19A 3CMCO 4EEZA 3JQBA 4QU9A 2VA9A 1U28C 2QNIA 4YASA 1M10A 3B51X 5ALRA 2XUDA 4OCZA 3FW1A 3P9NA 3EAFA 3GLIA 1PNTA 1JDBC 1IXSB 2XMPA 5KTMA 2P8JA 5A7GA 5A5FA 3CUTA 2QRVA 4WY5A 1W85B 3IAXA 3TLZA 5BWNA 5HK9A 1EFAA 2GASA 3LOPA 3AZQA 4MUXA 4U63A 2PDAA 3CX7A 3OVMA 3T4UA 2HRDA 3WK7A 4P3KA 1AH2A 4EQ6B 5CCEA 1ZVKA 3NH6A 3ONVA 2ZROA 1FY2A 4B74A 1SKMA 1K9VF 2DULA 1Q7CA 3CLUD 5DMHA 4EEKA 1TB4A 3L8EA 3MEQA 4A27A 3DZIA 3C74A 2PYDA 3ZBPA 3VKWA 3P96A 2HK6A 3PVZA 3B5EA 4ZVTA 3RT9A 2GI4A 3CEJA 4JT8A 1I2BA 1TVCA 3GHYA 3QW2A 3D8BA 1EDEA 2AG8A 2GKOA 2PPVA 2XQVA 4UXIA 5HM6A 4RHUA 5JROA 3R9XB 1P5JA 4II2A 2JIRA 3M4JA 4QGGA 4LQ4A 4L4YA 1OXBB 3JWGA 4HXEB 2FQQA 1NBHA 1SRQA 2IELA 4YAKA 4U00A 2BZGA 4YYZA 2HCTA 2O8CA 3N2EA 1K89A 1ULTA 3V00A 1Z12A 1DC6A 1VG8A 2VEOA 1YKFA 2NU9B 4BNDA 3HCRA 4R98A 3IT0A 3FVVA 4LY6A 4LJAA 1CTQA 1UADA 1SQ6A 1Z6AA 1CF4A 3OKFA 4X8OA 1DNPA 5FQOA 3X1DA 4W5HA 1NY5A 3GGOA 1HM5A 2X9VA 1N78A 4M7OA 4LDRA 4LYGA 2IGTA 4YJ3A 4UBNA 3BAZA 1XTVA 1ESMA 2D1QA 3OHPA 3ZDDA 3MS4A 4YS6A 1NRXA 3C98A 3DE0X 3P0FA 1IK6A 2C2WA 2V7WA 4PV7A 5DULA 1SCIA 1B8UA 2ADOA 1PE0A 2EP5A 5EFOA 4FHFA 2R6AA 1IL0A 1J06A 2P79A 3FF4A 4S2EA 4HZIA 4GQBA 1YACA 4MUAA 4S1OA 5CH5A 4EL0A 4JT4A 1XU9A 1EJ6A 4DA4A 2NUTB 2IOFK 1B6TA 3AVOA 2VJCA 5DP1A 2VRNA 2I6GA 2IVFA 3DLIA 1DIAA 4YFVA 1BE6A 2NPIA 5E9WA 3RS8A 1A5TA 2G1PA 4YJHA 4KREA 3KEGA 1RS0A 4WNYA 5AJXA 3S8MA 3Q5EA 4O02B 3B3FA 2ZPTX 4L95C 5EHXA 2P2LA 1FVXA 2CXUA 2P5TB 3EVNA 1GV1A 3LDUA 3O5AA 4TSRA 2VT2A 3DO5A 2QP9X 4AKHA 5D85A 1YQXA 1PK7A 5JS7A 4MW0A 3PUJA 5GIPE 1USIA 3CVJA 1WMFA 2OBYA 1FFGA 5JXHA 2PUFA 2YNMA 2WF5A 3ZWOA 2BPOA 2JIMA 3Q7EA 3EXEB 4PCAA 5I8PA 1CEXA 3F9IA 3WDLA 4WNAB 2P4HX 3KK0A 3PTLA 4YRCA 2IVZA 2RGWA 1CHNA 1Z2OX 4F4DA 4U0JA 3T3OA 3QE0A 3IBGA 4KHZA 4G41A 5HK8A 2V0GA 1H5NA 2B21A 3O9MA 3NWBA 4X85A 5AIAA 3GZNA 5IMSA 3HDQA 4UHEA 2NZVG 3IDOA 5KYUA 1CUUA 4B3TB 2V4MA 2RGUA 1K92A 3DB1A 3A1WA 1JF8A 1EVYA 3AM3A 2M6KA 4YJKA 3TR6A 3U5ZB 4G0UA 2OB2A 4NCNA 3V4SA 2OTCA 1UFVA 2HDNB 1C2TA 1IY8A 5SZKB 4NPAA 4PQGA 5L3QB 1P0MA 2MWMA 2ZSIA 4LF4B 4R8VA 2CHVA 3LY7A 4TUYF 5FX2A 3N8KA 2OYSA 1Z18A 4ARZA 4EB0A 2F64A 4LX8A 3PT9A 4ZVMA 3DGFC 3SJCA 1X7WA 1PUIA 3QKRA 4M0UA 5KOHA 1CUIA 1Z0ZA 5HKBA 4TYPA 1U8XX 3JR3A 3TF5A 3A7EA 3JQDA 4W4TA 2PX5A 3EJWA 4FN4A 3L0SA 2IU0A 3IP7A 2Q5JA 1XDBA 3BIFA 4DSAA 5BW5A 4EX7A 4NAHA 1YDWA 3JAKA 1ETHA 4RXMA 5JC1A 3FD8A 1R4NB 3GUCA 4GI5A 3ZZ1A 2QBYA 3VTZA 3P2KA 5DLEA 5JATA 3EVFA 1FU4A 1BU8A 1Y4DE 1GRQA 4XH9B 5DHUA 3KL2A 4GPZA 1EK0A 2F43B 1WMDA 3W5JA 1XKTA 2YINC 3TQOA 4WK2B 3UMFA 1PJBA 4UHDA 3M9LA 1A88A 3IQEA 3GV0A 2CXSA 3OHMA 3QLVA 5LDDC 5EVJA 5C18A 1GSIA 1RJGA 1S7GA 2QTTA 3KQWA 3OFJA 5JE8A 5IEBA 2ODEA 3C6XA 4DOMA 3RVQA 1S3SA 4R5MA 3QU5A 5KCZA 2WFMA 1UMKA 4RSHA 2Q49A 4EZIA 5BNWA 4ENQA 1ST2A 1TYDE 3VH3A 4R05A 3A25A 1A04A 2QI9C 3GFGA 3SFZA 2P0YA 5L6LB 2WJIA 1JSRA 1AUOA 4KNYA 3NR2A 1MB3A 1BKYA 1BQ3A 4M9QA 4GPD1 3VR0A 4W5RA 5HBGA 1AKRA 3DTYA 2C82A 2Y71A 1PR1A 2ZTHA 3K31A 3TXYA 3VX3A 1R00A 1LF5A 4K87A 5DWQA 3RUPA 2ZRPA 1WXXA 2EIHA 3PJDA 3R75A 2HRZA 2VPTA 3IPYA 1YS7A 2OO5A 5BN3A 5BNTA 3GWZA 1O0CA 3JQEA 3VTKA 4DG8A 1CQIB 3GDFA 4BOYA 4R1SA 1A2KC 2QDKA 1XDGA 7GPBA 5KYNA 2Q1UA 1KO8A 2ODBA 3RTCA 3VPCA 4D6XA 3ER9A 1FXWF 4CE6A 3N7UA 2FPGB 4TOIA 3UNXA 4IJ6A 3B5IA 4RPIA 5ITZB 2RH9B 3RJMA 1RJ9B 5MFPA 3OOYA 3RT1A 3LLUA 2O6LA 1H2YA 4RKYA 5K4HA 1GRNA 2OO7A 4NENA 5CPBA 3IL2A 2BLNA 3TKLA 3JQAA 1YL7A 2IL1A 5GQSA 4HTAA 2ZE5A 3IT2A 2AC7A 1LVUA 1OV6A 2GTHA 4JLOA 3TTUA 4RV9A 1E5VA 1XZIA 3BRQA 3TX2A 3HCCA 2HNBA 1UEJA 2JGFA 4JYPA 2HMYB 5CT6A 4JC8A 3NBFA 5BN1A 5K6TA 4MGEA 3D4LA 4RTJA 2XNDD 1ECLA 4FZ3A 4YONB 2O8FB 2O2EA 2HMTA 3SQLA 1R0KA 3BVPA 2JGNA 2IWHA 1EXMA 1KAEA 3E22A 3PNOA 5TF4A 2NP6A 4V1CB 1LDGA 1G2IA 1XDZA 1F14A 2Q2NA 3IESA 2B2XA 4LRSB 1VXOA 3U4AA 2E4VA 2QOEA 4A15A 2EBHX 6CHYA 5JSZA 1WZIA 3L0PA 5LUBA 3D6NB 4AKTA 2ZWAA 2CE2X 3WK4A 4B6OA 3ZGLA 4KUGA 4MVJG 3Q10A 2WJZB 2HU2A 2QVYX 4LHEA 2QTVB 3T5BA 4EK9A 1SVOA 3NAQA 4CNBA 3Q85A 3T8YA 4L4SA 1ZIXA 3ORYA 3HYSA 4PZ9A 1XNJA 1VCIA 3QKSA 4HDAA 2POQX 1EX9A 4QTZA 3CF4G 3QV1A 1VIAA 3STVA 1NVEA 2QZ4A 4DSNA 1AXEA 1G21B 2ABWA 2COUA 5HUQA 3DMYA 4D26A 4NMMA 4QFCA 4N3BA 2R87A 2EFCB 4JB3A 2YJ3A 3LDHA 3RJ9A 1IG3A 4WRRA 1QH1B 1T35A 3OZ7A 3VBEA 1UMBA 1L9KA 4IIJA 5E6RB 1PD0A 3DTNA 4A6DA 4K2AA 3WNVA 2J7KA 2V7PA 4K9NA 2JFGA 3GNLA 3TBHA 1IK4A 4XPIB 2C7GA 2DE0X 3DBLA 5EIOA 4YCCA 1EUDA 3ANXA 3DDOA 2OO5C 3CUSA 4OQZA 3WISA 1CLUA 2C9CA 4V0LA 4ZOLB 3RYFA 3B6IA 2GJSA 4JC5A 4OUDB 1O5TA 4WKNA 2WOOA 2XVMA 3T6KA 1XNRB 1V6SA 4U39A 2ISSD 3DVAA 3CN9A 3ZBUA 1N92A 2JVIA 2IHNA 4PAOA 1KP3A 2WD7A 4YRNA 4G24A 3MWYW 2VYND 3FFWA 4Q7EA 3DDNA 3K0FA 1QGZA 2I33A 4LQLA 1XNGA 1NSTA 1IPFA 3BTOA 3DAGA 1OYVA 4YXWD 1H0HA 3MILA 4KE9A 2WUVA 5CT5A 1WR8A 5TGZA 5KOJB 4G1MB 4YP9A 4CT0A 4C3OB 3H8WA 2ZRIA 3ZC3A 1Z0SA 1EX6A 3EIUA 3NTXA 1ONOA 1OPXA 1WQ3A 2VDKB 3GK3A 2H2GA 2WSMA 3OKPA 3EGDB 4FQ5A 3SF8B 4HC4A 4D8YA 1DKLA 1BROA 2JK1A 2WAYA 2CDRA 2Y76A 3AV3A 2Q21A 3QVJA 1D7OA 2F3SA 1BJRE 4MKFA 1CY1A 5HUJA 2PZEA 5EJFA 3SGLA 3AFHA 3WK6A 3L84A 3FR7A 3HQ4O 2QPLA 2CB0A 2V5AA 3SYLA 3V9PA 2WUGA 5I9IA 2H4XA 4ZT7A 2BGLA 5LWHA 1MDFA 2UYYA 2GERA 5E7IA 2HIHA 2JIPA 1PYGA 4RF4A 3TNYA 4MRVA 3LTEA 3CRW1 2FUG1 1OR8A 1NR5A 3PEEA 4P82A 4YRFA 3EZ2A 2PMWB 1NP3A 1YD7A 3FR8A 4F5DA 1DAEA 2ZBQA 1CULC 5DYWA 3SCZA 1YA6A 5C8DA 4M1MA 3L9WA 4Z1MD 5IWCA 2WF8A 3WICA 4LSMA 2GCOB 3AEXA 2RGEA 3T15A 1M0EA 4HQOA 4G97A 1A5SB 1T1JA 3KQPA 2IHJA 1MO4A 3IAM1 1ADGA 2R44A 3P9CA 1XEWX 2BMFA 2GEJA 4TXNA 4B4OA 1CZUA 1F5NA 1N6LA 4LW8A 2OGWA 3UMRA 4UUPA 3FHJA 2VHZA 4ZCMA 2C7QA 4XX0B 2AK3A 3BTUA 4CEJB 1AUXA 2QJWA 3GY0A 2OXIA 4YP6A 3O6VA 1NXVA 4PZUA 3ID6C 4UEJA 2NO4A 2WF6A 3DLAA 4JB8A 4ALNA 4EGSA 2BKVA 3FX2A 2WSBA 2CNLA 3A7DA 1Y63A 3EG9B 3LP5A 2WY2D 4INJA 1NYQA 4B3CA 1ZK0A 1TADA 3U5TA 1JX6A 3ZWAA 1VQ1A 3E9NA 5TR9A 4S05A 1OWNA 3M6IA 5A6SB 3M6LA 4NJOA 4BJHB 4DF3A 5MDHA 1GKKA 4DCVA 3BHIA 1ECCA 2R2AA 5CK5A 3WFIA 1NLZA 3E4DA 4GUAA 4ZVQA 1QPBA 3PC8A 5EXPA 1J70A 5HILA 5TVKA 4Y3UA 1Z35A 3UK6A 1E2BA 5KWIA 3OCJA 3VR4H 5C8XA 5KYXA 5ILOA 2NVOA 1BMDA 3WDKA 3ZGOA 3ZVNA 3C3YA 3WZMA 3JWEA 2FUNB 1NF9A 2ZE8A 5EXSA 1T34A 1QZZA 1H2XA 2INGX 2R8PA 1Y5NA 1XRQA 4Z7OB 1QMPA 4ARUA 1IOVA 4KXYA 1HLPA 2XNJA 1L4FA 4EY4A 1NSFA 1GAEO 3HCAA 4JI5B 4GI1A 1AD2A 2J1LA 3T4XA 4ZCSA 1X42A 4QHYA 1XSEA 4EPYA 4M88A 5EMHA 1PT5A 4JL6A 2PAFA 3A1VA 4JA0A 2AR0A 4W82A 2IZ0A 3TE6A 4HZUB 1UWLA 3ZHOA 5KVCA 3BPSA 2VYVA 5A1JA 2BEVB 5JZBA 3A1SA 3HSSA 2WSYB 4QOIA 4QRDA 1L5KA 2IYYA 1UT8A 5JRDS 4RY8A 1RFGE 4NH4A 4UHKA 5JCJD 4BZZA 1E3SA 1ZGCA 2J07A 3DJYA 3JQ7B 4GWKA 4KJZA 1DBIA 1LTQA 1BXGA 2JFPA 3HB9A 4FSDA 2R5WA 1CJBA 2C57A 3UTCA 4DQLA 4FU0A 3EXG2 3INNA 1Q44A 1W4BA 1G7TA 3LC0A 2QYHA 2BFCA 4AJ9A 3OUTA 3D1JA 4GBGA 1TZ2A 3Q7PA 5DLDA 4ZVUA 1EESA 1DPGA 1QUEA 4XWKA 2O7SA 3DKIA 4ARBA 1DVRA 2YRFA 5DNAA 2X1MA 1R7RA 3TOXA 4L6AA 2PIAA 3DEJA 2XQJA 3C3XA 4MVJP 3REGA 1QQBA 5I7HA 2CD7A 2ZYIA 2VP5A 1TF5A 3CR3C 1GTMA 3F6EX 3W8NA 4JV5B 5CA1B 5I7EA 1PS0A 4TN1A 5FI3A 1SCDA 1VJ0A 3NX4A 1UM9B 4BMZA 5J2UF 3B82A 4JWKA 3R0IA 5DZSA 4GLOA 1RDFA 3R6TA 4OQDA 5D6OA 2Q6KA 4JFAA 1Q0ZA 2B9VA 1E96A 2V7TA 1KZ1A 3VR6H 5EXXA 5AW6A 4G36A 1VSBA 3QENA 1MF7A 3TI7A 1T3LA 1W88B 2I7TA 4KFSA 3SR4A 3BZWA 5JS2A 3U7EB 2KX7A 3E1SA 2HMSA 3V1NA 1M7HA 3G2HA 1QIIA 1JYSA 4PHFA 2JHFA 1CXZA 5M7EA 4E51A 4GH5A 4CM9A 1XXHB 5FA8A 1HNNA 5LMUB 2F8TA 1CZNA 3A1CA 3ZQ4A 3FYUB 5I4KA 3ACDA 2G9QA 1IWPB 1D1QA 1P1RA 2N1MA 2REOA 3EEBA 1Y8RB 4YT8A 4IXTA 1A76A 2DG2A 3AUUA 2YV3A 1MAWA 2DC1A 3K72B 3IOCA 5K8TA 3GOQA 4MW9A 2R1UA 3I01A 5HZKA 1Q21A 1T10A 1UM8A 3JAWA 3CVXA 1KVSA 4BMCA 2ZIVB 4JU8A 1I4DD 2F55A 2CDNA 3IXMA 2DCMA 1P1IA 2E18A 2VK4A 1P4SA 2UZ3A 4ENVA 3AGPA 2PUDA 1VG0B 2XTNA 3A0UA 3ZD6A 2RK4A 3K0BA 5BSUA 4JENA 1ESNA 4M9XA 1BS2A 1OE0A 1W52X 3UMVA 2WB2A 2R8OA 2VF2A 1ZN7A 3DMDA 3RUCA 3UG6A 1QTNA 1DAPA 2PIDA 1K5PA 3ZDYB 1ACLA 2DSTA 1ZMRA 4OH7A 4WXPA 4MLZA 3TD6A 3PQ4A 3TSAA 2ZULA 2PR7A 5DFAA 3V7FA 2C0PA 2B4AA 3GNTA 2FLVA 1PW7A 4DC1A 1JIUA 3OOHA 4NOJA 2AJBA 1WCXA 3DKKA 1I5EA 1U98A 1DBQA 4YI5A 1QYWA 1FDWA 1E9VA 2BEVA 3R5TA 1G3RA 3HKCB 3S7TA 2D0IA 5H5JA 2EBUA 1TD9A 5CM9C 3R3YA 3I9FA 4GMXA 3CIOA 5FUBA 4E6PA 2ZUCA 4MA4A 1E0SA 3BOSA 3F6YA 3HZRA 1KJWA 5IAGA 3DMTC 3KALA 3MQ4A 3K6SA 2EDCA 2C8KA 3AY3A 3FKSA 4P34A 2BMVA 4QU8A 1N8KA 2ENUA 1DFGA 1OVMA 1UBRS 3TLCA 4BP1A 1DTWA 1EDOA 2OGSA 4FZRA 5GOZA 3RBXA 1XTSA 1GPJA 3EUEA 3GJZA 3MS7A 1W59A 3C3KA 1AX9A 5GJCA 3T06B 2HJHA 1ULBA 4D9FA 3INRA 5HM8A 3BMOA 3H5LA 4K03A 1RWQA 4JLMA 3FYHA 3H5NA 4WLFA 4J7CA 1D07A 4FFNA 1E9EA 2J32A 2QRVB 1WS6A 4N8DA 2XY4A 4RIEA 5C32A 1XCLA 5JZVA 4DDTA 3PF8A 1FYXA 3RC1A 3CLRD 1MABA 1N7HA 3PTZA 4G26A 3AHGA 3HNOA 3MWJA 2ATXA 2DMRA 4JP1A 2M1ZA 4MIYA 1GSAA 4Q1CA 3MVEA 4XVHA 1QH0A 3DEHA 4XOUA 9ABPA 1NM5C 3QE2A 4V2IA 3QX8A 1N0VC 4XD7A 3I1FA 4RTLA 1ZH4A 3FG9A 2V9PA 1OIVA 2XYQA 3CX8A 4O5OA 2AL7A 4JQYA 2OV4A 4B81A 4DCNA 1Y3AA 2C07A 5HQTA 5LQMA 2GF0A 3ONWA 4IEFB 1S8OA 2ILVA 1J33A 4D96A 1Y3BE 5D84A 1MO6A 3IPXA 2ZI5A 4RMGA 2RK6A 2IZOA 1A4IA 1J7JA 1YR6A 3ETEA 4RCZA 4AURA 5C5IA 3A6DA 4ZO7A 4NCIA 4BMDA 3A2KA 1N6OA 4OMCA 3A9RA 1WDMA 1IQUA 3AR6A 4HBGA 3UMYA 2C4VA 4LJSA 3M2PA 2Z2YA 4NMWA 2NVUB 5CXUA 5FEUA 5LZ4A 3LX5A 2PX6A 2AW5A 2HRRA 4KI7A 5JD6A 3WMEA 4F85A 5C7IO 5A0TA 2M2IA 3ZE6A 5FPQA 1DFHA 1JRLA 2AI1A 4WKGA 4FYJA 1P1CA 3X2EA 2IDZA 3BDIA 1HTWA 1W88A 1Y1PA 5COBA 2YS6A 2QU8A 4B47A 1XEXA 2WZBA 4ARIA 2FN7A 4GMGA 3ZN2A 4C7OB 1V9CA 1P39A 3FF1A 2R6JA 3C6ZA 2Q5QA 4AO6A 1J8QA 4RMHA 4P8RA 2H2DA 1IEWA 3EMKA 2ZK7A 1VKZA 1IQPA 4P1ZA 3M6XA 3HK2A 3A70A 3RV4A 3A9WA 1OOEA 2XOEA 3M3HA 1G8JA 3N28A 2JFFA 3F8TA 3MOIA 1W25A 4LK2A 4ONEA 4EVSA 2NIPA 1QWOA 3EC2A 3H9GA 2FEWB 3BWMA 1XK6A 1YQGA 2HV9A 4L5AA 4IX9A 4OEHA 3K71B 2DU8A 2ZJOA 4G9GA 4RA6A 2XTJA 4KX3A 1WW8A 2V96A 2BFAA 4X20B 1E2MA 2AN1A 3GJRA 5DLPA 4F1WA 3R24A 5CCDA 4UQPA 3O8LA 2Z3VA 5KJFA 1HL7A 2RJ3A 1U7PA 4LOLA 4HDNB 3GUUA 3KOYA 3DW1X 3A6FA 1VKHA 2FVXA 5CVVA 2WT9A 4X54A 5FLXA 1V4NA 3VAZA 1MC4A 1FP7A 1WY7A 3AHCA 4TKMA 1IDOA 2Q7DA 1X1AA 3FFAA 4G8JA 4L22A 2A3NA 2CVPA 2ZRQA 4EUNA 3AIOA 1T8YA 4RA9A 5CT9A 3KAQA 2AXEA 3RJZA 1UAAA 2IODA 1TLTA 1U9IA 2BHRA 1WVGA 1LLCA 2FSFA 1C0LA 1ZU4A 1O4WA 1X86B 4P4NA 5TS2A 1HC7A 2R66A 1DU4A 3W6ZA 5DBFA 2PZJA 4J7AA 5DTIA 4P4TA 3R7WB 1GNVA 1EVKA 3K0CC 5ERYA 5H8WA 4IHJA 2JD1A 1JU3A 3MRVA 4E33A 4EJSB 3BMCB 4KAJA 3NIBA 1YJBA 1YOVB 1L8LA 1X7XB 2P78A 4BNKA 4JI4B 4N5DA 4E5NA 4A2CA 4M0PA 1QF7A 2VJLA 2WIJA 1Q1AA 5JCXA 4A2PA 3T9AA 1Q7TA 2ZJ6A 2GXQA 2K7ZA 3HC7A 1RSZA 1DC7A 2QRHA 4HUQA 2HL6A 3BZBA 2H1IA 4Z86A 3RASA 5H4GA 5G4KA 2GCEA 1JHVA 3LIIA 3ZVMA 2V7QD 4CMBA 1AZWA 2B7BA 3WNZA 1E8NA 3PWTA 3ITKA 3B1ZA 2FNAA 4YDQA 3LC1O 4DV5B 5C5DA 3LK6A 3AUTA 4O1HA 2GDJA 3VUEA 4CFSA 3LGXA 2CNKA 1QGOA 2Q99A 4NBLA 3HHPA 1WZCA 3AOGA 1EH5A 3C1OA 5D8DA 3HJUA 3JPYA 3CMMA 4JEUA 1FTYA 1T5DX 3F5QA 1EK2A 5D3QA 3ZZUA 1SIWA 221PA 3WVNA 5LXTF 3NDBB 3B2EA 4PYRA 4UOEA 1EUDB 2A1IA 2D5BA 3NQ41 5FLEX 4IDAA 5EJ8A 3PZBA 4MUFA 3KKPA 4O2BF 3J81k 2DLDA 3H5AA 4TT8A 1CG6A 1N0UA 2QD2A 4B8ZA 3I8SA 4Q12A 3PUHA 5I7OA 1VPLA 3MYYA 4LYAA 1RM4A 3GRAA 3SKVA 5AVZA 2CLMB 2NXJA 3A32A 3W6NA 4R7GA 1JQKA 3R20A 1OZGA 6LDHA 4TXLA 1F9EA 2H48A 3IPCA 1LI5A 2QMOA 4F72A 5IABA 4Q01A 4FYXA 2DBYA 4ZANA 3FPLA 5FA6A 2DFLA 1DXHA 3G0DA 1NASA 3MMNA 1NXTA 1WAMA 1W0KA 1WVMA 2AFVA 2YXEA 4NMXB 1CD5A 1U5CA 2Q6IA 2XYGA 2FOIA 2I22A 2VK2A 5EKSA 2L17A 3GJ5A 3RKRA 1HSZA 2JFBA 1DKMA 3F73A 1RPTA 1VDZA 2BC9A 2NGRA 5C8ZA 1K8YB 2R8RA 3HPRA 4TL9A 4L9WA 1JQAA 2JHAA 2ZU0C 1QE5A 3O2NA 3U49A 3S2GA 3HA2A 3LPDA 3CINA 3NWJA 3S2ZA 3KYBA 4M8LA 3WHKA 4ZA2A 3W1WA 4UBOA 3G6WA 4C9BA 2CHGA 2PS9A 4OPMA 4G1FA 3T3GA 3VKGA 4EO9A 1RJEA 4G2TA 5JMPA 3U4CA 3HBMA 2QRLA 1E6MA 4QBIA 4R1QA 1I7SB 3H6HA 4HUJA 4CZ2A 2PCLA 1GIAA 4EJ2A 3PLAE 2WFZA 5EVCA 1RWMA 2BBWA 4BLPA 3SHWA 2JBHA 4G0WA 3PGA1 2IIQA 2Z9BA 1BH6A 1PGJA 2NG1A 3I8OA 4X7RA 1F20A 5TSDA 3DZFA 4PRLA 2C2GA 4L74A 4DRZA 1J49A 3QXHA 2BEUB 5EZSA 2G6TA 4ZQHA 4BNNA 5E1MA 1IB0A 1FYDA 1L4EA 1RR6A 1S01A 1Y98A 1XTKA 1GITA 2W2LD 3AXTA 4PBTA 1JHQA 1RTTA 1UFQA 2BLLA 4MTLA 1TECE 3K4PA 3I6YA 5LUAA 2JFVA 4PG8A 3JCZA 2UDPA 4JOCA 4EPXA 1R16A 4UTXA 4CV1A 4M7RA 3EEFA 3O9ZA 4F5YA 4JI8B 4BGDA 1Z47A 2O59A 1JB9A 2ON6A 3AJDA 3D7NA 2Y0CA 3OEHD 1D3AA 1WULS 3P2YA 3WJ2A 1IDN1 3HFJA 1TUGA 3FTDA 4HQFA 3E1GA 4OFXA 1FDIA 1PZXA 2H7XA 2O2DA 4J1TC 4MV5A 3J7TA 5DXFA 4EFKA 5BQOA 4NS1A 1JEYB 4H7KA 1V37A 5CIYA 3GJTA 2FX3A 3EGXA 3UYKA 1LQUA 5FL7D 5K03A 4DBZA 3BB3A 2X5OA 3M4XA 1K2VN 4K05A 1VJGA 3I4FA 4JOBA 2XDYA 5KWSA 2P9TA 2HMUA 2Q3BA 1HE5A 3SVTA 2B1GA 3ENNA 2HWWA 2BGNA 1CVLA 4FT2A 2HF9A 2IRWA 3CONA 1SQSA 3OLXA 4L5BA 4URFA 1G8KA 4O08A 3ZJYA 4C3UA 1VE9A 4AUKA 2O3UA 2WFLA 2HO4A 2MSLA 2FLKA 1NVWQ 1Z36A 1H9BA 1OLXA 3VPAA 3O8CA 2H4WA 1O95C 4Z49A 5M04A 1XN4A 4TMXA 3CKMA 4GWLA 2FE1A 2ECQA 4FDMA 2A4KA 4LJ7A 5LSAA 2IH2A 3FPFA 1PNOA 1Y9DA 1O96B 1T2VA 4M0MA 9MHTA 3T99A 1LBTA 1SO8A 2IQ5A 1YULA 2QMYA 5FFMA 3LVFO 3GOHA 4GXQA 4EA9A 1GQOA 1V5FA 2I34A 3KWJA 2JFXA 4B85A 5LL6P 1F8YA 3UAGA 4IGFA 4PONA 5JXJA 2A2ZA 2J48A 1YB4A 1OLUB 2HF8A 4UM8B 3Q3HA 4EHBA 1DGQA 3ZWKA 3FPJA 4BEVA 3I5AA 4BL5A 4QLOA 3G9XA 2I4LA 3L05A 5AVTA 4CIXA 4DRXA 5IS2A 1HYHA 1KDTA 3DT9A 3JYOA 4YACA 1L0BA 1WHSB 3QRWA 1U9YA 2EKZA 4I08A 2WU3A 3AW9A 4YMSA 2H1VA 3HGQA 5CM8B 4CXMA 4EHIA 4EUSA 1XWFA 4IV8A 4YR7A 3UZUA 1Z0IA 3KOUA 1H9CA 3IAAA 4LKOA 3X1MA 5FWAA 1DXQA 4FGJA 3JATB 3S2IA 4MRRA 3V4VB 3M70A 4KRYA 4HDKB 1GL6A 1HZJA 3CF4A 4AO8A 3FHOA 3NC4A 2B98A 3VVLA 1ZX1A 2ZAOA 4NL4H 3WYNA 2AMJA 3QELA 1GUDA 2VH2A 1EWQA 2YASA 2FQYA 1TMOA 1JEEA 2C84A 4HEA6 1OBCA 1O0SA 1G0NA 2WILA 4HNHA 4JAVC 3BD6A 4O0LA 1EFCA 4JEMA 4NG5A 5HFAA 5AJZA 3RF6A 2OFWA 1TT5B 3B1WA 4FHGA 1GN8A 3DHEA 1DFIA 3FCSB 5FO0A 1KPHA 2D2VA 1YZVA 1E1YA 2IP1A 1CNFA 2BF7A 4LJ5A 2AT1A 3BCRA 3H6KA 3N6XA 4ZVOA 2CJXA 4FKZA 2QPAA 1IPEA 1JTVA 1NJ8A 2CYBA 2MR5A 5E0OA 4B40A 4LHYA 1O95A 4Z8YA 1W29A 3W5IA 2Y8EA 1OFUA 3PQ6A 1NWHA 2H06A 2CHQA 1JIXA 5KREA 3TTSA 4GZLA 2Q6OA 3F96A 3SE7A 2PXXA 3KM0A 2X58A 3AH8A 4RH1A 5IAJA 1X7ZB 2JZOA 1FJ2A 2ZUVA 3T7KA 3AETB 4Q82A 2WUEA 4G0ZA 5CPFA 4BUJA 1GGEA 3DYBA 3DPIA 5EESA 3TEJA 4KRGA 3U3MA 3NHAA 1X87A 2XT6A 2QTRA 1NBMA 4I5FA 3L6CA 4LYEA 4WOKA 4F6RA 2C4UA 4HPXB 2AQIA 5BSKA 5JBQA 2ZIZA 3E82A 3K92A 4QUBA 4AZVA 4Q4JA 3GRUA 2ZYTX 1F1BA 1A69A 4OFWA 1IN5A 2GAAA 4ZPXA 4BNYA 5CRIA 2FMTA 3FYCA 4H17A 1ZAKA 1A0OA 3MJFA 3MM4A 1RPZA 4DQVA 4QNRA 1NBAA 3PUXA 1G21A 4CV3A 1E89A 1SUSA 3STWA 1N6IA 1L7XA 1QIHA 1TJPB 2XIJA 3T7AA 2V54A 4MV3A 4QM6A 2NU6B 2YBDA 3NEAA 4QDTA 3AEUA 1FX1A 2PZLA 2QLFA 1EZ1A 4HYTA 2C8VA 1R9JA 2YRXA 4R6WA 2PFGA 1HZZA 1XD2A 4GDFA 1CR0A 1XZ8A 2AG5A 4CKBA 5GV8A 2DHQA 4PC2A 2ZDHA 5JSZB 1HQCA 3NHBA 2H2FA 3O3NB 2PS3A 3KLBA 2JCXA 2AA3A 2AFHB 2WVGA 4HH0A 4JYCA 1W0JD 2VYQA 1QYXA 4ALMA 1X7YB 4XSVA 1I51A 5DCWA 3TNDA 3V2HA 2PBFA 2ZSFA 1M54A 5K05A 4QTTB 5ALDA 4EECA 4FOSA 3ZW9A 1N33B 2WVHA 1Z33A 5IDQA 5JNLA 5EKXA 1UBCA 3CT6A 3WI7A 3E0QA 4B6SA 5BW8A 4KE7A 5JT1A 4JBNA 1DJLA 3TINA 2H3HA 1L7DA 4B32A 2GPTA 4C4PA 1TLLA 1F12A 2XDWA 3SYRA 5KWEA 4HDSA 2CC2A 2QU7A 1WRBA 3WZ2A 4LUCA 2I8CA 1P45A 2O4UX 1L7OA 1Z6GA 1CUVA 2XVAA 2Q5FA 4OI4A 4BJ1A 4BQEA 1TFUA 5I3CA 4WMLA 3BXZA 1DAMA 3ZU4A 2XMRA 4ZKDA 5H02A 4CKXA 1ORWA 2OESA 3QE4A 1NJ6A 2JDID 2QIOA 3L6RA 4ME6A 4TTRA 1AUVA 2J0UA 1HV8A 2ZJYA 4N9QA 3DV0A 4E5VA 2C3UA 2J5QA 3KPJA 5B55A 2UYHA 5LB4A 3R44A 4HAIA 1TU0A 3ZHYA 1EJBA 3KWMA 2BJWA 4ITRC 1CY0A 5IH7A 4Y0NA 3IKTA 1P62B 2IYZA 2G7ZA 3QHAA 1XX6A 3EVBA 3NNSA 1SR8A 3SEFA 4XVCA 1J6UA 1PDVA 3DCJA 4PLFA 1H2FA 1PJ4A 3VNVA 3VNRA 2EOAA 5CBPB 1P4GA 1S2OA 1I5RA 3E5NA 4RLSA 1PZNA 1RRMA 4TXJA 3QLTA 1E2GA 2QN3A 4CLOB 2E82A 2FFBA 2LDBA 3NC1C 3U13A 3CB4A 3NS7A 2G1UA 3ZCXA 3V6LA 4C21A 4PGMA 4DLTA 4YH1A 4XQEA 1KHHA 4K0KB 1FX0B 3W04A 5E3IA 1DRKA 4D5EA 5IBCA 3ND5A 4OFBA 3CTPA 2UKDA 2A0UA 4FP9A 2J6HA 2YS7A 2AZ4A 4II3A 4UAGA 1TM4E 2YH2A 1Y4ZA 4GG1A 3UVEA 1B6SA 1FW6A 2A92A 3FIJA 1TVMA 1JAIA 4B8WA 1SBZA 2F8MA 2BGRA 1G6HA 3O8OA 1C8KA 1GAXA 1FMCA 5A02A 1GGKA 3A6KA 3HU1A 3Q7TA 2N1BA 3KBBA 3T7DA 4Y7DA 3WLQA 3Q98A 1C3LA 3MCAA 1R4MB 3N07A 4FE4A 4D46A 1UMCA 4N9WA 5SZJA 4G5GA 2LTAA 4DM3A 4WCDA 2EZTA 1OW3B 4LBZA 2CFSA 1J0BA 3OC6A 4I9NA 2WYHA 3BYZA 2YXBA 5DASA 2HIGA 2XRFA 1JAXA 1U4OA 2WOJA 2CJPA 3COSA 2CV2A 2HNKA 1G5PA 1T0UA 2R7MA 1R6XA 1JLKA 1QKKA 4R68A 5JMTA 1G4AE 5AT1A 4K7JA 4DV4B 2IZ5A 5CX1A 3RYCB 3BILA 2WF9A 3AVTA 1NG1A 1D5CA 3T9BA 3A4MA 3I37X 4RVOA 4YV0A 1YJXA 3N0XA 1NWCA 2GNAA 3O31A 4GX0A 2X0JA 4QGBA 5A06A 2C0CA 3Q9NA 1R8JA 1SU8A 3THXA 3V42A 3EDQA 2QRGA 1IVYA 1GPMA 1TO6A 4B3JA 2XBMA 2PS0A 3O1HB 4HGPA 4PICA 5JSKA 3VKVA 4N7JA 2Q28A 1RAGA 5T57A 2E1RA 3H2GA 5IUJC 5BV2P 1H6DA 3TBKA 2PSDA 3RFTA 3DMRA 3O7WA 4L72A 4E4RA 1L1EA 3LRXA 5JTTA 1U2GC 2RGRA 2O8EB 5FPHA 4O0MA 3T9FA 1KIAA 4EY7A 1FTNA 2Z5LA 4OB6A 1CRWG 5CX1B 5BR7A 1JIKA 2ZI4A 3Q15C 3B6MA 3HY3A 4S1WA 2XTMA 3D8SA 3IIJA 4LZJA 5JSYA 4A92A 1HDRA 1QZUA 1SMKA 1CVRA 2X0RA 1XROA 3AP1A 1L1QA 1XZCA 3AQIA 3KBOA 3OPVA 3PIRA 4WLUA 1Q74A 3N53A 4OO3A 1JHPA 4YREA 1QP0A 4PINA 3SHOA 2H2WA 4R0NA 1EINA 3KYJB 3MT9A 1E4OA 2FZEA 3CWCA 1ZSYA 1MB0A 4RZ2A 3WQBA 5FA5A 1UKEA 3DHNA 3Q5GA 2ZWIA 2TSYB 5F3WB 1QANA 3G3EA 3QV2A 1JEJA 2FPKA 1TGYA 4R2MA 3UWKA 5HZHA 4GXNA 1C3OB 1C81A 3AGQA 1J00A 4NTZA 1IXRC 1UK6A 4G9BA 5FNZA 5ALKA 1E66A 2WBLC 3PHBE 3UK1A 1UOEA 2DF8A 1CLEA 3U40A 1ZGAA 4B3SB 3ANLA 4IVRA 1PWEA 1GGNA 2ZIXB 3JQPA 3S8EA 3HKCA 2HRQA 3F4BA 4M0EA 4QDKA 4R3NA 2PUCA 5GADl 3CH7A 2VQEB 4O1IA 1B43A 3MUFA 4JUIA 3GCXA 1Q0RA 2DBRA 2PZAA 4TT3D 3SS9X 5DNYB 3P9IA 4HVAA 4OLFA 1R0RE 1GWNA 1VPVA 1KAMA 2XECA 4MS4A 2TRSB 3DZGA 2XZPA 2P1DA 3R23A 2NVWA 3HEMA 4JVNA 4MRSA 2Q5EA 4Q7LA 4ZI7B 1IATA 1U5BB 4DLSA 3FBTA 3I0MA 2HA7A 4WXRA 4JDUA 4F6RB 1WETA 4CKZA 1ORVA 1KI4A 1NNEA 4FMPA 3ZQJA 2Y67A 3VVMA 1FUKA 4MW4A 5DTQA 3K32A 3NKVA 4IGAA 5DB4A 2G80A 3HUFA 2WINI 5MGBA 2XUKA 3G9ZA 3KDAA 3R0JA 1HT3A 1Y8ZA 3PLNA 3DFFA 4RVCA 3E84A 3N39C 4QQKA 3EZNA 3F1KA 1Y33E 4LAFA 1RLTA 4II7A 4WCFC 2ADMA 2VPYA 3NBQA 5PNTA 4BTVA 4CN8A 4N41A 1W93A 4XA8A 4KSYA 1GNPA 3K05A 5K3EA 1HEUA 2R8YA 4OAPA 1RI2A 4EDFA 1PGNA 4JEHA 5KKNB 1I6MA 2DUWA 1ENPA 1YZHA 4IEIA 3GVPA 3MAAC 3HUDA 4J2HA 4IYRA 3TLJA 3OQIA 1DOHA 1T25A 4BFTA 1GZSA 4M55A 5CA0B 2Q6VA 1NYRA 2YZGA 3GGPA 3TIFA 5JOQA 1BDHA 1CDOA 5JNSA 1R8YA 4DJJA 1X7YA 1G8HA 2FEMA 2ZJ7A 4C3ZA 3WQQA 4PLCA 4Y7CA 1XEWY 1NAHA 3TO5A 2NMVA 1PFKA 3N0WA 1SCAA 5F33A 1IPHA 1IAVA 1X8JA 1G0OA 1JR2A 4LJ6A 2IPXA 2A5JA 3PC4A 4RYDA 1IJFA 4UZEA 5FQNA 5TJHA 3LT5A 1S3GA 4E31A 5GTDA 1NY6A 2QPOA 1Y1TA 3R7DA 1WPQA 1YB5A 3OM9A 5GAJA 3RT7A 3SF0A 1W6RA 4P7GA 3H9BA 1NT2A 4K8RB 1JJIA 1CV2A 2C2KA 3HWX1 4WFJA 2JGKA 2DZDA 4WH0A 4QULA 5LQDA 4UHFA 2GN1A 1VPEA 5BXQC 4LFAB 1XVLA 2H1OA 3L4KA 3RWBA 3H5WA 3IPLA 4LJKA 5I47A 4Q1EA 3UH1A 3VISA 3JYLA 4XJXA 5EJAA 1E7RA 2O0MA 5I9TA 3PQ7A 1LRLA 3W34A 4B3XA 2I7CA 5DHFA 4GO1A 4N0EA 2BR4A 4MR8B 4Q1AA 4E2YA 3AJ8A 4ZXFA 1U2DA 2I3BA 3I73A 1E3MA 1XCOA 3JRWA 2H6EA 4R2IA 4JBXA 5LZ7A 2IOFA 3WYCA 1M34B 3BJMA 1T4GA 3DXYA 3VI3B 4W5TA 2BR5A 1U3TA 5JJBA 4N01A 1EZZA 4Z3DA 3TAUA 4PFQA 1XLUA 4LYJA 4QC2A 3I0NA 1N2CB 1OT5A 2PT6A 4DWVA 4H6PA 1IRIA 1FC0A 1SY7A 3DC2A 1QONA 4WCFA 3VO8A 1NMXA 1UKBA 1D0IA 3OAAA 4JXZA 2HTEA 3P9XA 2BEUA 1UM9A 1Z7BA 2EQAA 4M8IA 1JJBA 1PLJA 4KLRA 2EJBA 1UZMA 3LF2A 5H70A 3EVAA 4CM3A 4E7PA 2VJPA 1SUEA 1FDOA 2XI4A 5JARA 1SCKA 3ZJVA 3M7IA 3ZWNA 4FDLA 2XDQA 3PG5A 2FZVA 3PXAA 5FBKA 3PKZA 3SMVA 1VYTA 2AC2A 4QOGA 1DT5A 3UPTA 3V4PB 2FGJA 3DOUA 4Q66C 4ARCA 4EYOA 4FBLA 4HYQA 3QTLA 2JIBA 2VJDA 3Q12A 1P72A 1VHLA 3GAFA 5TE9A 2ZVQX 4LOIA 4KXXA 4RWZA 3SSMA 3TS1A 3OFSA 1M1YB 2HLNA 1LW7A 3BL5A 3E5MA 4CLHA 1I4TD 3PNLA 4M1TA 3TI9A 4M0CA 3A9TA 3OTQA 4JKIA 5AHKA 3OEHA 1DDOA 4J07A 4LJLA 3DAPA 5DYIA 8AT1A 5THKA 3X44A 1KJQA 1N6PA 2Q5LA 5JHHB 4EHJA 1N25A 2NYVA 3RK1A 4BVAA 2QTLA 4PX3A 5JO9A 1Z5PA 1KJZA 4M54A 3RVSA 2X5JO 2RONA 4CF7A 4C05A 4HWGA 1T91A 2P69A 4JOSA 3MTBA 5DK6A 1S4MA 2RGDA 3O90A 3N7TA 2ZSHA 5ELXA 3KHTA 2W2PA 1JG4A 4PZCA 4LJYA 5EP2A 2QT9A 3AW8A 4M53A 3S68A 1E6CA 2FG6C 4QJIA 3T1OA 3P97A 3RVPA 3GPIA 9GPBA 4RD2A 4QICA 3VPGA 3V80A 4HHEA 5FOTA 2O4CA 2BTEA 3C39A 7REQA 3AR2A 3SYNA 5C5EA 2QMUA 3EIOA 2E3JA 2NP7A 3LUPA 4ZVPA 4PO8A 4A73A 3NAGA 3B7WA 3B6KA 3DPSA 2PMFA 4XR9A 3TVYA 3HDJA 2AYYA 1KE2A 3G02A 3U9LA 1QRAA 2R97A 2ECFA 3HMQA 3N0TA 4IMRA 4NF2A 2WKPA 1RRCA 1J22A 1U3WA 2QVXX 3FDFA 1NL3A 3UATA 2QSJA 1EUZA 1AHIA 1EU1A 4Q3DA 3RS0A 5I3ZA 5JFOA 4MW2A 3A31A 4DADA 3KTOA 4R1PA 5IEJA 4Z7QB 1NBME 4EY5A 3DZHA 3L1IA 4WK0B 1JHRA 1FDUA 4BMXA 2EIXA 2O7VA 3ZZTA 4Q1VA 3GFRA 5E7MA 5CJPA 3VR2D 4BKQA 2QORA 4LQCA 2D1RA 2VNHA 3OCXA 3ER8A 1SC3A 4M36A 2CXPA 4F11A 3QFCA 2VBGA 3FPHA 1ZD5A 1UXGA 3RU2A 3IELA 2DPHA 3RVOA 2XNDA 4NDNE 1PV2A 3A28A 1YDFA 1CR4A 3QPWA 1V3QE 3LHKA 2O2XA 4WINA 1M2KA 2WKRA 3V3KA 2I6SA 4YRAA 3ES9A 2ZJ3A 2Q3DA 3PX2A 4CIVA 3JARA 1T0BA 1NT4A 3BL6A 4DSZA 4ED9A 3U17A 1EX1A 2WQ7A 3ASVA 3EXHB 3UAVA 4BVHA 5IUKC 1JSZA 1CQXA 4KX5A 3TQTA 3QOYA 3WMFA 3NETA 4UBJA 1BYUA 1T3GA 2AW3A 2NSJA 4FR2A 3DE5X 1DL5A 2FQ1A 4YN3A 5I7UA 2ZM5A 3OZUA 4B31A 2JHPA 2IS6A 4IDNA 4WERA 5G3ZA 3HRHA 5JASA 2FLWA 5KVSA 1KVTA 2CUZA 1PTKA 3FRHA 2FRXA 1TCCA 3KOOA 1RXYA 2DQKA 4ZO6A 5F64A 3U44B 2EFJA 1QIFA 1YVUA 2E21A 3H11B 4FWIB 4IIJB 3NWPA 5E6RA 4JLAA 2QD3A 3VH2A 4M0LA 2YOFA 1U7ZA 3CBQA 3MWEB 3UWDA 2DERA 4UDNA 1RM3A 2LCIA 3CX4A 3EWNA 4AZ0A 2ZZMA 1M8PA 3DBRA 3IT1A 3TW6A 4D92A 2J0SA 4R2JA 4WECA 1RABA 4R1MA 2GJKA 2WM9B 2HAEA 3G0CA 5L4NA 2C29D 1VI2A 3S1SA 4FSHA 1PL7A 2PX2A 3G68A 1M9NA 1PEDA 2XLCA 2HJVA 3N2KB 2LIPA 3ZLVA 3KZNA 2O1SA 4ODIA 2QAGA 2BOVA 4OBBA 1QBGA 2CVZA 2NYRA 3ENKA 3LYUA 1YBVA 4XYMA 3ZX5A 2C5BA 1ZJ5A 2IZ6A 4B6PA 2B94A 2WD7B 2WPDA 5AK0A 1G42A 3SZMA 1R15A 1HX7A 2R48A 3DYIA 2PWAA 4P84A 1PT9A 5F9MA 4CQMA 2QM0A 3SN6A 2GFQA 2VNJA 1QGAA 1PR2A 3GAZA 3TBFA 2VQ3A 3H5TA 3P2JA 1FFXB 4RTQA 1IY2A 2X42A 3U4QA 1KHTA 4EZEA 1DCMA 1CK4A 5IUNC 2EW2A 2PGXA 3IKMB 4BTLA 3JD2A 4CV2A 1BWSA 5CHYA 1GFIA 4F06A 2IZ1A 3UMMA 1TCAA 1J07A 3TZKA 1KRHA 1YR8A 1RHUA 3RV3A 3KFVA 1QP8A 1NQUA 1QC5B 2G1KA 4Q7MB 3IP6A 1A7JA 4XQ9A 1MD9A 2FR8A 3JQGA 1B0UA 1NF3A 3EH1A 3KYCA 4H1TA 2PQMA 5F77A 3W7BA 1W5BA 1SQFA 5K6AC 4S35A 2CNDA 1K5GA 3GD7A 1ACMA 3OE7D 5JAHA 1SULA 1V8DA 1GEEA 2B8JA 2OBLA 2Q7XA 2R4QA 1H65A 4IPTA 4PSDA 1DWQA 1RLJA 3WWDA 5JISA 4F5ZA 4ZU6X 1DBRA 3QEOA 4QGSA 1XZBA 3GR6A 1KS2A 3QPAA 5CYFA 4MUNA 3P0RA 4D6YA 3KJEA 1UC9A 4ND6A 5HKOA 4TGLA 4HX9A 4TSKA 1CYDA 4MPDA 3C87A 1C3JA 5ALXA 5IT5A 2CXQA 4BC0A 4FXOA 3LBAA 3T5GA 1ZMTA 3OY2A 3CA8A 2H0AA 2C04A 3K9NA 2BKAA 4BQIA 4W8OA 5CM2Z 2JFYA 4A91A 4X0EA 2PZMA 2CDBA 3CISA 4KZKA 1LNZA 2W00A 4M0DA 4R9UC 3R8FA 2XUAA 2PJRA 5CFOA 1EBUA 2Y9MB 5DHAA 4AWAA 2B8TA 1ZOPA 3MCWA 1NN1A 5MGNA 1Z6XA 4AG5A 2I78A 5ECYA 4KR7A 4TLBA 4V0MA 1KQNA 2DETA 2ZUDA 4KR9A 4ABTA 1P2FA 4YGYA 4BLVA 3MJDA 3GGSA 1KJNA 4IQGA 4KQIA 3EYWA 4QFBA 1WQ4A 1QOPB 2DFNA 3NBYC 4W1RA 5HSGA 1QH8B 2QUZA 3QUBA 3KYCB 3HS3A 1FBTA 1Y37A 3FOWA 4OBWA 2HU7A 1WSWA 2FMIA 3QOWA 3RYIA 2ZXFA 3SDSA 1UDXA 1X77A 4OM8A 4MP8A 4OL9A 1UPAA 4ZWNA 5IC5A 2CMDA 1AZLA 3Q88A 1R0CA 1ZQ1A 3KFLA 4D56A 2PUGA 2XEXA 3JQFC 5EMNA 1TT7A 2GCNA 3GRPA 2WJ4A 2CLFB 4J9VA 4MV7A 1BE8A 3G2NA 4C06A 4DCPA 5TMDA 1AV6A 1FYFA 4P54A 1KE1A 1GHTA 1OAKA 1XZHA 4ZAXA 4RQBA 3R6DA 5G4LA 3THYA 4Y2SA 4BMOB 3PLRA 1WDWB 1E8MA 4PTZA 621PA 1R5BA 1BA3A 5DLQC 3OTOB 2C3OA 2ZWOA 1GCGA 5IW8A 3G89A 1CETA 2FR8C 2NVUA 3KJGA 4ZOEA 5F2EA 3BIXA 4N0DA 3LXMA 2ZJZA 2P6RA 5A4AA 1P8JA 4MKIA 2R4TA 2H52A 1V1RB 3ZE2B 5AKGA 4J49A 5KTPA 2Q1YA 1KVUA 4DTIA 3BULA 3LKVA 3NV9A 2BTQB 4XASA 3VQTA 5KPJA 1HO3A 2EF0A 2SCUA 1E77A 3V1MA 1IOLA 2GBGA 2JJYA 1W5EA 4O3FA 4XQGA 1G2QA 2JANA 4OD0A 4HJXA 3MA0A 2BJVA 3IUNA 1SU6A 2CHFA 4JC0A 4ZAGA 1MOSA 4PY2A 5BSVA 2YFYA 4EA7A 3DMPA 1U7TA 4GX2A 5T41A 4LY0A 4MGHA 4K9KA 4BVGA 3BL8A 4N4AA 1NW7A 2HYDA 3PJEA 4FINA 4J91A 4L5IA 1PJQA 4IF4A 1GG5A 4DV3B 2IOYA 3C3BA 3OPQA 4URXR 4FWTA 1VP3A 2XMSA 4CIYA 3NAZA 4GI2A 4J0FA 4L78A 2C5FA 4PWYA 4QPJC 1RU3A 3FZGA 4IWYA 3GUVA 3UMCA 1X2BA 5JECA 4PQYA 3TW8A 4DANA 3C8HA 4WEOA 1JQDA 3AUYA 3H2YA 3FNIA 3AY7A 3EW7A 4LPSA 4ZDWA 3VC2A 5IM5A 3DR3A 2HF2A 3I05A 3B3QA 3PRYA 2UVPB 2P5YA 2X8LA 4IDFA 3GMTA 4NBTA 4O33A 1AGNA 4YLGA 5EKUA 4CJXA 1ZMBA 3TN7A 5L95A 2BN4A 4QOJA 3LXRA 4KB5A 5JLAA 3RUDA 4YJGB 3L8CA 5LQCA 3Q7RA 4KMMA 1NNI1 1Z0AA 4BLQA 4DGSA 4XKJA 1F51E 2CYAA 2XADA 1UOPA 3AG5A 3NHSA 1ZH8A 3B3AA 8ABPA 1WB4A 2FVYA 3TIGA 5JCZA 2RBKA 5EC8A 1GPDG 1GADO 5ICCA 1T9ZA 4G5OA 3REQB 3S81A 4KN9S 1VIVA 2CVFA 3QWFA 2VXBA 3BGVA 4S1PA 4OGGA 5D7BA 3T54A 5BY2A 3V8EA 5LR6A 4DV0B 2IIPA 2OKGA 3BREA 4C08A 1HI9A 1G21E 2HWKA 2CXNA 3K4HA 1D5WA 1U2SA 2B6NA 3GRVA 5B53A 5JQGA 1N6KA 4U7JA 2I03A 2C54A 5DT9A 4G23A 1JLSA 3UW1A 3AM5A 4YDRA 4BHTA 4I81A 5K3FB 3U61B 1Y3DE 4JP5A 1MO2A 1VA4A 3EGEA 1HMPA 1OI4A 2Q6TA 2ZLBA 1XZFA 1NYTA 1PS9A 1OZ0A 2VAPA 1LY1A 3AT1A 2ZJFA 3O9VA 4KDFA 5G0SA 4EUKA 3MUEA 5BN4B 3W8EA 2AIRA 1XWIA 2DHRA 4YECA 4AU1A 2I71A 2OV2A 4C88A 3TZHA 1ORIA 1SIUA 3VR5A 3PJRA 3IOYA 1QHGA 3QKWA 1AK2A 4OI2A 3UOGA 5B7GA 3KPWA 1K5HA 5EE5B 4BB6A 2XBLA 4FM9A 2CUKA 2FW8A 3EBOA 2CMGA 3H3XA 3NYRA 4KMSA 4WN3A 5FKJA 1M3SA 1QVZA 2D1FA 1E1CB 1BFKA 1WD5A 1ZEMA 2FK7A 2GZHA 2R1VA 2D2XA 3CZCA 3NO4A 5FF9A 5CCBA 3WL5A 1Z29A 2ZXEA 3KSMA 4WJLA 3L7BA 1TQ8A 1V2HE 1J2JA 2QRMA 4PO3X 3TSWA 4EQ6A 5GIOE 4GPIB 2RJOA 521PA 1TUEA 2JS7A 2O57A 1E18A 3HJRA 5KYXB 2QY6A 2ZBUA 2R79A 1PJ8A 1JQLB 2BGIA 1ZH6A 4NPHA 3SAJA 3UV7A 5EQTA 3Q3EA 2VCYA 3CRRA 1C9MA 1YR2A 5JANA 3W3AA 3ZJ4A 1DAKA 1AQYA 4F4FA 1P60A 5EUBA 1PG2A 4QDXA 2Q0HA 3AVXA 3SQMA 1V5WA 1MTZA 1HNWB 1DJMA 4JEIA 1A4XA 1MORA 1GV0A 1WXHA 2GCGA 2Q3JA 3PA6A 2RHDA 3WLNA 1D9XA 3E53A 4L75A 1J0AA 1TZJA 3WGTA 1AGPA 2VLIA 3W3AH 2OG2A 2ORWA 1T13A 3MWEA 4LGYA 1NZJA 1LBIA 1KOGA 3TRJA 5JD5A 5FNVF 3KVYA 3GN1A 2MINA 2WYOA 5DM1A 4MJ7A 5G1OA 3TCNA 3CB2A 3EXFB 3B7GA 3G85A 1E1RA 1NHWA 2DQSA 5AUQA 4PRZA 1F5SA 1OX6A 4UBKA 1ZYUA 2B37A 3JD1A 5F1OA 3NHYA 1A9PA 4YMVA 2AJ8A 4S12A 1QORA 1U0BB 1ECPA 2M32A 4UU1A 5CLGA 2SKDA 3OIDA 3N05A 1K4KA 3MJEA 1MP0A 4HH4A 5CLQA 1IM2A 1D1TA 3ON5A 1FNBA 4ES6A 1H8EA 3PU6A 5L51A 1SG6A 5CW1A 2B25A 5CLFA 3K9QO 3L7DA 1YHZA 4RZSA 3BXOA 5EE3A 2XTZA 3FUUA 3V4RA 2A84A 3EZXA 2OB1A 3FLBA 3PGXA 4HUTA 5DEIA 2EFGA 2FG5A 4JBGA 4EKNB 1UAYA 1ZSNA 4OQLA 4DGQA 1UJ6A 2ZRFA 2H4ZA 2WIDA 3CHYA 1FFHA 1RLIA 4TVOA 4AAYA 1EFUA 4BEWA 3F6SA 1KJIA 3DBHA 2VNIA 4OHBA 5EGSA 3E2IA 4U0KA 1BJKA 3BCSA 3B1VA 1SEVA 2AUMA 4YAFA 5A5EA 2D5LA 3GA0A 4LV6A 1GQYA 3LG2A 1NIJA 1IUKA 1YU6A 3I39X 3QIAA 2EF1A 1ZD9A 3EDMA 3V5NA 5KO2A 4N65A 3VJRA 2BFCB 1BDJA 3F74A 3NKFA 1DG9A 2P9FA 2EP7A 2YY5A 5JCPA 3MUOA 3SFVA 3GCWA 4XWOA 3LX6A 3QUCA 3EC7A 1RPNA 5DX0A 5IULC 3G17A 5AKIA 3UIEA 3V48A 5L6MB 1W4AA 3VMFA 1BHQ1 3AESA 4AI6A 1EFTA 1XL0A 5DBGA 2XBUA 3WLAA 1XJ0A 2DFDA 3KQYA 1RKXA 5L3RA 4D98A 1CIJA 4BQFA 3K0CA 3ODPA 3NM4A 5F51A 3TB4A 2XZTA 3BZUA 3O4RA 3WGQA 4KQKA 4F45A 5CEEA 2D4AA 5FORA 3W8DA 1MV5A 1WWKA 2BELA 5CDFA 2LP4Y 3W8FA 2OMEA 3HE3A 5DM60 4P0PB 3OY7A 1WDTA 2W8BB 3VZCA 1SM4A 1DS6A 2OL4A 3M9WA 3RSOA 3CLSC 1JVNA 1OLSA 1YJAA 4PSAA 1HYBA 4FX5A 3NBAA 4MO2A 2W2TA 4O4HF 2CL7X 3ESAA 3L8FA 3RB8A 4YRJA 4HWKA 4TV8B 3RC2A 3ZK8A 4Q4AB 4UFPA 2HCFA 4S04A 5K09A 4G0PA 2C9YA 1CP2A 5EQFA 5EMKA 4AJNA 4EG6A 4ALLA 4NDAA 4KOEC 1I6KA 2BSXA 4GOOD 2OYCA 3GXOA 4A23A 3OQJA 5DIFA 2ZIAA 3G5TA 1B8PA 2G9ZA 2VTKA 4WBNB 1B42A 2YIVX 5C4MA 1J90A 1EP2B 5LD2C 4JROA 1XLTA 3HCEA 3FDJA 3L1VA 3OOJA 4LF9B 1QIGA 1QDUA 3FOBA 3KTAA 1BZYA 4NBNA 2X0EA 1R12A 3EEYA 4G86A 3ROMA 4ZOLF 4DHEA 1KETA 3ZDEA 3M0EA 2L19A 3CCFA 1HUQA 4KAAA 3AEKB 3LA6A 1ATZA 1WB6A 1ZC3A 2EKQA 3FROA 3UK2A 1JJAA 3G6KA 2GESA 4ZVVA 4AT1A 1LVGA 1ZUWA 2AWOA 1BCSA 2OENG 4HDMB 2JL1A 1JIVA 4HRYA 2OSBA 4LNUB 4IQFA 4Y2QA 4DA6A 1XZAA 5AOVA 1FSSA 2H0RA 2J0EA 2PBZA 1BIFA 3HP1A 4BIMA 3PQDA 1T29A 1XDUA 3Q2IA 1P0CA 5LN1A 4NMLA 1QYVA 2VEDA 2O3QA 3O2QB 5FHQA 1C3EA 4C2UA 1NTOA 3ZYZA 3U7QB 1U0HC 4XIFA 3SP1A 5JYDA 1XMQB 1Z88A 1RMYA 1U31A 1ZGBA 3IQFA 4M21A 3S5JA 5FBWB 3HYTA 1WCIB 2GCPA 2NX2A 4TV9B 1NV8A 2XMZA 2YOGA 1JFTA 3HV0A 3OJ0A 3T7JA 4E4TA 2BP7A 3IDSA 3GRKA 3PUVA 4QREA 1JKJA 4FJ1A 2AZMA 4BN5A 4B6QA 3PB3A 1G59A 2VJKA 5J2TA 4L50A 4QU5A 4ZT5A 3EG5A 2HOQA 3QLEA 2BMEA 2H3EA 1L5MA 4U5XA 1QHIA 2F4VB 4EKDA 5K3FA 1S7CA 2HMVA 4LZLA 1W75A 3K1YA 1F8FA 2KJQA 4AX4A 4H7PA 3WLJA 4L0CA 2BM1A 4LGCA 5K5EA 1BU5A 3GVCA 4NG4A 3TIIA 3DGEC 3IVRA 3P9PA 2PHZA 3E22B 1ETUA 3QQ5A 5EG5A 4D1YA 3QBDA 1HYQA 3HXOA 1Z34A 3O91A 1L5YA 4PZLA 4D9IA 2ATVA 2JZNA 4M98A 1XLTC 3ZS9A 4MQEA 4LXYA 2A9RA 5ICEA 5KJ6A 4B9EA 2GPYA 4PM4A 1F1JA 2EFEB 1Z4NA 2IBSA 2GZ3A 2O2HA 2E89A 2WTEA 1W30A 2Y68A 3TD9A 4UULA 3OQOA 1ABEA 1II8A 1M33A 2PUTA 3L93A 4HNRA 4IWXA 4MGZR 1WP4A 4POOA 4DRYA 4ZGGA 5LZ2A 4A16A 2P4EA 3R4CA 3UQZA 3PXGA 2H5LA 1GEGA 4GVLA 2WZQA 4MSUA 1QCZA 1QFMA 2QF7A 2CXTA 3EASA 4L3WA 5FRDA 5IDVA 3WGIA 4KVZA 3U7FB 3QBVA 1U5AA 1BCRB 3QVKA 1Z45A 4KO1S 5DTEA 1G3QA 2A5LA 2LKDA 3Q3VA 3RIEA 1MDBA 4B4KA 2SHKA 3F67A 3HVKA 3E3LA 4BC1A 4QFMA 5GJWC 2ZRKA 4EKYA 3KQNA 3LGAA 1JXAA 4PGGA 1UP4A 3LCMA 4RPCA 1SOUA 4K6HA 4QXQA 4JBYA 3NXKA 3JU3A 2AXPA 1JJVA 4EJMA 1TPYA 4GYWA 5TY0A 1KQPA 5A3RA 3IIKA 1N2ZA 1TVEA 5D3ZA 1K4MA 1FYVA 5AQEA 1PZGA 1YVRA 3BSSA 2O3JA 1KEZA 4ZOAA 1P18A 2Y4OA 4YRIA 4GL2A 4BGUA 1AHNA 3QYAA 4A2QA 4YJFB 3ZCUA 3VPDA 4KYTA 4NHOA 4BNZA 3QEMA 5EP4A 4RKEA 4R9NA 2J3KA 1ODTC 3U56A 3K8YA 3HYRA 1EHIA 3V9AA 4QTYA 1OLSB 4V38A 4EHFA 3DTVA 3Q8KA 1PG5A 1UWVA 5K0LA 3KOWA 1ZUNA 2CWDA 1I4WA 3OLQA 1CQIA 1URPA 3QVMA 3PC3A 3COJA 4CW7A 3UHPA 3VC3A 3G5AA 3C3MA 3HBNA 1DMSA 1U0SY 3A26A 2FYTA 3T5MA 1N57A 5JU6A 3A10A 3RC3A 3DD5A 3T52A 1A95A 3BGWA 5KTYA 2ETVA 3TYXA 3JAKB 1NZFA 2WAAA 3B53X 1WUKS 2AF3C 3ROQA 4BNHA 3CH4B 1Q0SA 1QP7A 1NP6A 2PL9A 1E1QD