2RHWA

Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
publication title The Molecular Basis for Inhibition of BphD, a C-C Bond Hydrolase Involved in Polychlorinated Biphenyls Degradation: LARGE 3-SUBSTITUENTS PREVENT TAUTOMERIZATION.
pubmed doi rcsb
molecule tags Hydrolase
total genus 103
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rhwA00
4KRXA 1U8EA 2ACEA 1W76A 4Q3KA 4JH0A 4BZWA 1JMKC 4QDTA 1AGYA 4BP8A 2OLEA 3V48A 3KD2A 1FFDA 3DL7A 1QIKA 1YR2A 5ALHA 5AKLA 5AO9A 4LKOA 5H3HA 4CI9A 1RYYA 5FXMA 4B84A 3LIPA 5AI4A 3PICA 3STWA 4OB7A 2D0DA 5DNVA 3FWHA 2XDWA 3BF7A 1MAHA 1TIBA 2GBGA 1BEZA 5ALEA 1ISPA 2I3ZA 3QPDA 2FUKA 4QDZA 3WKBA 1ZJ4A 1L7QA 3F96A 4QDUA 2ZVDA 1WHSA 4AB1A 3K9BA 5CT4A 5ALWA 3H1BA 5ALOA 4B7ZA 5ALFA 1WCYA 5A62A 3LLCA 5KREA 4WDQA 2EDCA 5ALYA 3WL5A 1MTZA 5JZ9A 3D3NA 4HXFB 3V1MA 5CXUA 1EB9A 5FOQA 4BAUA 1Q83A 5A7GA 4B0PA 4RNCA 3C87A 3AIOA 4RPCA 3BL8A 1DX4A 4ZREA 3WWDA 4UFOA 5D7BA 1GPLA 4FWBA 2ZYIA 3BJRA 3G02A 4HXEB 5ALKA 3FSGA 4YPVA 4Y2XA 2WTMA 4BRSA 1DTEA 1AX9A 1EDDA 4QZVA 3ZWQA 4E11A 1ODTC 4FHZA 5HF8A 3O9VA 2XQGA 4J0IA 1JJFA 5JAOA 5IVIA 4CIBA 1QIJA 2WJ3A 1CUWA 3U0VA 1R88A 1AURA 1UT6A 1CLEA 5LZ9A 1LPOA 4UHHA 5K3AA 2ZSIA 1H2YA 4KE6A 1K6EA 3VISA 4UBOA 5KBYA 5ALJA 2WUEA 3AJAA 3VJKA 1U4NA 1UXOA 3BIWA 2HHAA 2XLCA 3F98A 3FVTA 1CR6A 5CXXA 4OSEA 4ZXFA 1VE7A 4Y2PA 2JIDA 1N8SA 2I3DA 2ZJ6A 2ROQA 5HKAA 7YASA 2WFLA 1JU4A 2WHQA 3ZLUA 4XX1A 1XRQA 2ZJFA 1DWPA 4H7EA 3H2HA 3A70A 5JADA 3BJMA 3R41A 4P92A 5JD6A 2OG1A 1TAHA 4WY8A 3RM3A 1SOMA 4BE4A 1ACLA 2WFLB 2QT9A 2HA0A 5A2GA 5JANA 4MXDA 3WK9A 4UUQA 1T4MA 3IVMA 1XZFA 3S8YA 2RI6A 4U2GA 1CUAA 3WA7A 4B80A 1ETHA 1UK7A 4H77A 3VDXA 1OILA 5F4ZA 2HA2A 4FDMA 1CUEA 1NU8A 4Y2UA 5FKJA 1LNSA 1OXMA 1LLFA 1GZ7A 1IUOA 1LZKA 4UHCA 3WL6A 4G1FA 4LYDA 2HA4A 4B0OA 1G5FA 4WCVA 4YK7A 1AMNA 1FSSA 2XT0A 4QWMA 3HSSA 3M82A 4D9JA 3MUOA 3RK4A 1E66A 1QIDA 1H22A 1ACJA 1F0PA 3I1YA 2O7RA 4L3WA 4FLFA 4GBGA 3IURA 5DNWA 5ALNA 1G42A 3G0IA 2OQVA 3FYUA 1LPAB 5AKJA 3WK6A 4B83A 3C6ZA 1S8OA 1MN6A 3HEAA 2HA5A 1K5PA 1CUYA 1E8NA 3V9AA 3OTQA 3W9BA 4Q3OA 2PSFA 3FYUB 2OAGA 5E4JA 3G0DA 5ALPA 3DS8A 5FDFA 4OU4A 5JARA 1VZ3A 1DT3A 1JI3A 2JGFA 4EY7A 2IITA 1E89A 2DCMA 1E5TA 2JGMA 4DM7A 1ZD2P 3ESCA 2XMCA 1B6GA 1BRTA 4OU5A 4X94A 4H7IA 4QNNA 4U2FA 3T52A 4BDTA 5K3FB 5ALQA 5FUMA 1YAJA 4BC0A 4M0FA 3NOXA 5LKRA 1USWA 2VF2A 3IA2A 5LIPA 3DDUA 3LP5A 4CG3A 3O95A 4QLAA 5CH5A 5E4TA 2VJCA 5ESRA 2BUAA 3DLTA 3DOHA 4DMHA 2XMZA 4M0MA 3MUNA 1DINA 4X00A 1BROA 5E4YA 4NZZA 4BVJA 1UZAA 1XZKA 3QMWA 1NX9A 4HZGA 2HU8A 4DNQA 1WHTA 3R3XA 4TVKA 4LIPD 1CFJA 3GA7A 4UPDA 4KR0A 2ACKA 4B6GA 3H2KA 2PX6A 2WUDA 1J2EA 1E8DA 1N5RA 1AUOA 3WK4A 1XZMA 5ISMA 5ALXA 4C89A 2B9VA 4U2EA 4UBLA 3K2IA 1THGA 2EDAA 2HU7A 2PUJA 4CG1A 5BWCA 3VJMA 2HRQA 1LPMA 3GROA 2CBGA 3STYA 2C4HA 1SCKA 4AO8A 2BFNA 1LPBB 1FFCA 4WFJA 2QVBA 3BF8A 1P0IA 1YSCA 1CQWA 4ARAA 4Y2YA 4J03A 3DKKA 1IVYA 5ALUA 3CN9A 1O6FA 4B9EA 2HIHA 3DL4A 5LKAA 2XUHA 4G8DA 3C6XA 1IMJA 3LS2A 1XZJA 3G0CA 1M33A 3VJLA 2Q0XA 1I6WA 2W6CX 1LPNA 3E1GA 4BRZA 1ZI8A 3QMMA 4N8SA 3HJUA 3ZV7A 1DX6A 5K5EA 1E3QA 3JWEA 4H7HA 3I2FA 2Z3WA 3GFFA 2XMGA 1EVQA 4FKBA 5C7YA 3RLIA 4AZ0A 5LZ5A 1MJ5A 3V1LA 5LZ8A 3STVA 3QVMA 3KOOA 4V2IA 1K63A 1YB7A 1MO2A 2RGUA 3ILSA 3UUFA 2JEZA 2VAVA 1F0NA 3H2IA 1ODCA 2I78A 4FBMA 3G7NA 3P2MA 2XMDA 3WMRA 4QWWA 1EX9A 3F67A 4F0JA 1CUSA 4BAZA 2RIPA 4LXHA 5ALLA 5DTJA 3G8YA 4CCYA 3WKEA 2W22A 1OCEA 4UHEA 2C5GA 2ONCA 1VJ5A 2DSNA 4W9RA 4OB6A 2RONA 4IQ4A 1LPPA 2CEKA 4OYLA 4KE7A 1XZBA 4IH9A 2WG2A 2ZJ7A 4X6YA 2P8SA 4GEGA 3OPMA 1R1DA 2CB9A 2OAEA 2HFKA 4XJVA 2XQKA 1AC5A 5HK9A 5HQ3A 4CIAA 2QM0A 2XUAA 4IH1A 4X97A 3E0XA 4H0CA 4KE9A 5D6OA 1JFRA 3GBSA 1MX5A 1XFDA 1QIEA 2XMRA 4A5SA 1J07A 2WIGA 1HPLA 4G9GA 1C4XA 3JW8A 3AFIA 2QXTA 2PPLA 3G9XA 1CVLA 1JU3A 2HADA 5HQ3B 2HA3A 1QIMA 1KU6A 1EH5A 1W75A 4L9AA 2XMQA 4KAAA 4H7DA 5BOVA 1LBSA 1J1IA 3WI7A 1FJ2A 3H2JA 4C4XA 5IVHA 4ETWA 1CUJA 1JKMA 5HFNA 3MVEA 2O2GA 3O0DA 5ALSA 4XWGA 1GPKA 3WYDA 1GXSA 4A16A 3WZMA 2JF0A 4I4CA 2AXEA 2DHCA 3LCRA 5CT8A 4X90A 2PL5A 3WL8A 2OGZA 3IUNA 3B12A 4EY8A 5T4FA 3PUHA 4DNFA 5A71A 3D2CA 3FYUC 1XZCA 3BWXA 5EHXA 2YH2A 1QFSA 3T4UA 5IKXA 4GXNA 5DWDA 4C6HA 2BJHA 5CMLA 1GKLA 4PO3X 2H7YA 1GT6A 2Z8ZA 1TCBA 4FFVA 1BS9A 2AJCA 1CUHA 3C6YA 3ICVA 4Q05A 2QJRA 2XUGA 5CBKA 2CKMA 2JGIA 4ZWNA 2WJ6A 4DSZA 4Y2JA 5E2IA 5HF6A 5AH0A 4AN1A 4H7KA 2FJ0A 1A88A 1UKBA 3BIXA 2GBCA 5AI0A 3L1HA 2QUAA 1RP1A 4G4JA 2CMFA 1XZEA 2BUCA 5AJHA 1SC9A 1DWOA 2XUDA 5A7FA 5I7UA 1XQVA 2VQ6A 3IB3A 2DHEA 4W1RA 3EQ9A 5CW2A 4B85A 1R50A 5J3JA 1E8MA 4OYYA 4BVKA 4UFNA 1L7RA 2YYSA 1GKKA 2ECFA 4FFWA 5D3ZA 3AUKA 1RWQA 2O2IA 1EK2A 3QMVA 4RE5A 1UOOA 2PBLA 4BYMA 1H23A 3ANSA 2WUGA 2GYUA 3SC2A 2G5PA 3PFCA 4BC1A 2WHRA 2WJ4A 2QRUA 5JAPA 1GQSA 1FFBA 1TK3A 5AHXA 2PKYX 1F6WA 1UFOA 3AIKA 3ZPXA 2Y2VA 4KJXA 3W05A 1HDEA 3V1KA 4J0JA 4JYPA 1DQYA 4FNGA 3EF3A 3Q0TA 2WKWA 4Y2QA 1G4HA 3FBWA 1VXRA 2WHPB 4BE9A 3HRHA 4EBBA 3K6KA 4B82A 5AKEA 4X6UA 4WFIA 2IX9A 4XVCA 1YS2X 2WIFA 2QTBA 5AM4A 3G0BA 1VKHA 2G4LA 3UMJA 1UKCA 3FSGD 4AMZA 1MNQA 1XKLA 3G9UA 3ESDA 1MT3A 6YASA 1GGVA 2C7BA 4UBNA 5AOCA 3I2GA 1QTIA 4DTCA 2QKYA 4C4YA 1X70A 5DNUA 1YS1X 2ES4A 3ZLVA 1AQLA 3W04A 3CCCA 3X3HA 3HZOA 1VA4A 4J0DA 5ALZA 3PFBA 4GWLA 1CUVA 5JIBA 1Y37A 4Q1VA 2XE4A 4OB8A 5I9IA 4ROTA 3DCNA 3WJ1A 4RGYA 2K2QB 4DGQA 1QIIA 1UK6A 2YXPX 4CFSA 3DYIA 4CCWA 1A8QA 4LYEA 4B9AA 4F21A 1ZGCA 1XZIA 5ALGA 2HDWA 5AM3A 2C0QA 3O9MA 3D0KA 3GZJA 5CURA 1QLWA 2HU5A 5EGNA 1AKNA 3R3VA 3O4IA 3A2MA 2V98A 4JYMA 2WG1A 5LZ4A 1MAAA 2QOEA 4AXBA 4E15A 2EEPA 5HK8A 1EB8A 1BCSA 3STTA 1G66A 2O2HA 2JEYA 3AINA 3H2GA 3L1IA 2AJBA 1P0QA 4UBKA 2BCEA 1QZ3A 1PJAA 2V96A 5K3FA 4HS9A 3VKFA 2JGEA 3QPAA 1MNAA 5JZSA 3WLAA 2PU7A 2OGTA 5AIAA 4ZV9A 2XLBA 3F9CA 2HA6A 1LZLA 1CUZA 4BCCA 2YASA 3HABA 3WWCA 4G5XA 4EUSA 2ORYA 1Q0RA 2D5LA 4J7AA 4AZ3A 2VTVA 4DMKA 1XZGA 5BV7A 5AK4A 5AI8A 2RHTA 4DLNA 2XB6A 4AMYA 2V97A 1WPXA 4GI1A 5ALTA 2PSEA 1XRLA 2UZ0A 5ALDA 1UKAA 2QS9A 1LBTA 3KWJA 3QH4A 5KWIA 3PF8A 2VSQA 3SK0A 3STUA 1XRNA 4PSCA 4BTVA 1K8QA 1XQYA 5ALRA 2XUJA 3TRDA 4UHDA 1BN6A 3H18A 3OM8A 2PUHA 5FPQA 4C4ZA 3PDCA 3L1JA 4PF1A 1P0MA 3R3WA 2H1IA 3WKCA 3PUIA 3OOSA 2DFPA 2H7XA 4YASA 1XZDA 5ALVA 4OD0A 4BCBA 2J4CA 1EXWA 3WKAA 3B5EA 1ORVA 4LXIA 2ZYHA 5AK5A 4K6GA 4JUIA 2PVSA 2VT6A 4U2DA 5AI5A 4W1PA 2WILA 4MJ3A 3G9ZA 3EQ8A 3DJYA 2FX5A 1XLWA 3A2NA 2R11A 2FJPA 3CCBA 4H35A 5AKIA 2WM2A 1QE3A 4G8BA 3FYTA 1QFMA 1VLQA 3HC7A 1IZ7A 2XQJA 2NW6A 1Y7IA 3IBTA 3WIOA 2BUBA 4Y9SA 5C8ZA 3FVRA 5FLKA 2OCIA 2OCKA 3QYJA 4GLBA 2WFMA 1DU4A 5AOAA 5YASA 3DQZA 4N8DA 1XKTA 4HXGA 1A8UA 2WG0A 1DT5A 4ITVA 5C8VA 2E3JA 4J3JA 3W2TA 3STXA 5LZ7A 4K5QA 4FBLA 3DYVA 3EQ7A 5AOBA 4AN0A 3FLAA 3H19A 5JYCA 4BZZA 4IHAA 3HLKA 1HLGA 4KYVA 1HQDA 3WA6A 4MWTA 4WFKA 3I1IA 1CUGA 4BBZA 1PFQA 2Y6UA 3H17A 4LXGA 5DYYA 3GUUA 4GW3A 5FPPA 5JALA 2B61A 5HFAA 5AKGA 2PSHA 3BDVA 3PE6A 3H0CA 3AILA 3ZLTA 3I28A 2WIDA 5JAUA 2VJBA 4FLEA 4IO0A 4MQLA 4U2BA 2C58A 4X92A 3OC0A 4HVTA 5CTAA 5HKBA 2QMQA 3BE8A 5IVDA 3DKRA 2J3DA 4ZRDA 1WB5A 2XUFA 2BAGA 4N5HX 5CT5A 3D59A 2X8BA 1CIJA 4JEIA 4EA6A 2OPHA 1CPYA 3RARA 4DSAA 5DTIA 4Z49A 1JJIA 3R0VA 3AZPA 4MQMA 3C70A 2BGRA 2XI4A 1MU0A 4BTLA 1ZICA 4J0HA 5EHZA 5T4EA 3F8SA 4B81A 1H2ZA 3DD5A 5I8PA 1DWQA 4W1QA 1TCAA 4P9NA 1W52X 2JBWA 3JYHA 5K3CA 5IVKA 4TGLA 5SYMA 2QJWA 4HRYA 3O4GA 5EHQA 4PQEA 1BN7A 2HRRA 4Y2SA 5K3BA 3O4HA 4Q34A 4RE6A 4Y2RA 4J0KA 3KXPA 1O6GA 1BE0A 2HM7A 3QZUA 4QDXA 2R8BA 3WK5A 3H1AA 3D4LA 4P93A 5AKKA 4ZI5A 3DOIA 1HBJA 4X7BA 4MEAA 3EIOA 1GQRA 4ZV7A 4PSDA 4G4IA 4KACA 4AQDA 2JGLA 1QONA 2BGNA 3M81A 1WPRA 5LYYA 1N5MA 5AK3A 3TGLA 5D3KA 3ED1A 4JNCA 4K6KA 4FTWA 3WWEA 1EINA 1D07A 1YCDA 2B4KA 4EHBA 4N5IX 3WK7A 1XRPA 2GBIA 1WOMA 1TCCA 1NU6A 4XIIA 1XLVA 2OCLA 1CUBA 2WQZA 3W06A 5CT9A 1W1IA 4ZGBA 5AM0A 3I2HA 3CN7A 4E46A 4AX4A 2JGJA 3PF9A 3ZI7A 2ZYSA 3WL7A 4U2CA 5ALMA 1R9NA 1B41A 4QE3A 2Z5GA 2OGSA 4QLOA 4S0XA 4X93A 1X2EA 2GBFA 2DR0A 4KAJA 1VE6A 1T2NA 4HRXA 3WQHA 2XMBA 1LGYA 3VVMA 3WK8A 2G63A 4QA9A 1QTRA 3W9UA 2X76A 3H04A 3OG9A 5K3DA 3C8HA 3WKDA 4Y7DA 1LPSA 3D2AA 1HL7A 4GDMA 5EIEA 1C7IA 3UUEA 4PV7A 2J4FA 3HYSA 5AM1A 1ZIXA 5AM5A 4DNOA 3B3QA 5JD4A 4FNMA 2H7CA 3G0GA 4TPKA 1VZ2A 1VA5A 5LP1A 5CT6A 3VVLA 2WIKA 1HKHA 3IUQA 5EHNA 3TEJA 4J0GA 4BATA 2OQIA 1R3DA 2V9ZA 4Q82A 2WHPA 1XRMA 1QGED 3WYNA 3E4DA 1QJ4A 2WTNA 2HL6A 2AJLI 4INZA 5KWJA 1Z68A 4UFPA 4N8EA 3LIIA 4X95A 3FCYA 1MX1A 5CH3A 4F60A 3I6MA 5FP0A 4EZIA 4UBMA 2XUKA 4FMPA 1SCQA 3O4JA 4G9EA 2GZRA 2GYVA 1ZGBA 4HTAA 4KEAA 1MX9A 1ODSA 5DYTA 1CQZA 1UOPA 3IUMA 4I3FA 5EI5A 4MYDA 2JGKA 1CUUA 4OPMA 2RAUA 4EY5A 1KEZA 2PM8A 1JJBA 1CUCA 1DQZA 5JASA 2WU3A 5T4BA 1GPNA 1CRLA 4A23A 2PSJA 5DJ5A 4QDOA 1CUXA 4MYSA 1Q84A 5K3EA 3C45A 1SCIA 3FLEA 2XUOA 4YX9A 4OUKX 1TKRA 3I2IA 5AK6A 3ANTA 2GZSA 3TJMA 4EY6A 1A7UA 4X6XA 1THTA 3CXUA 3RKSA 4DYHA 5C8XA 1KU0A 1BCRA 5EIAA 5AI6A 5AI9A 5EFZA 5AKXA 5AKHA 1YAHA 1WB4A 1ZD3A 4GHWA 5JZBA 1EDEA 3WZLA 1C7JA 4C01A 3HXKA 2ZYRA 3WWOA 2B20A 4H18A 1EHYA 2WIJA 1Q0ZA 5IH7A 1WB6A 1H2WA 1JMYA 4BCDA 4W63A 2C5FA 1CUDA 1CV2A 2OXEA 4KAFA 1Y7HA 1FFAA 4FLMA 1JT2A 2O7VA 3FLBA 4H7JA 2XQFA 1TQHA 1XQWA 2VT7A 1IUNA 3S2ZA 1FFEA 4KRYA 3ESAA 1PV1A 5SYNA 1IZ8A 3N0TA 3QM1A 4H7FA 5A7HA 1X2BA 5T4HA 3SWWA 3I2KA 3R40A 2Z3ZA 4DNPA 4HAIA 4X71A 1UK9A 5AKYA 2GYWA 1QIGA 2CJPA 2CZQA 4O08A 4Y2VA 2Y2UA 4CG2A 2VA9A 1J06A 3SX4A 2AJ8A 2HA7A 3V1NA 3I6ZA 5CH8A 2QR5A 3Q8WA 3PI6A 3YASA 5EIHA 3D5EA 3EBLA 3I6YA 5AICA 4MEBA 4C87A 2X5XA 2C0PA 3FCXA 1XQXA 1TRHA 1ZI6A 2BKLA 2QXUA 3M3DA 4NVRA 1ZD4A 4KE8A 4UHBA 1XZHA 2RHWA 4BB0A 4QEKA 3ICWA 2VATA 1W4LA 4EY4A 4L0CA 1EDBA 2WUFA 3A2LA 4DMCA 3OURA 1A8SA 4X3CA 1UOQA 4PSUA 5BWBA 3NWOA 1L7AA 1K4YA 3N2ZB 3FOBA 2Z8XA 2HFJA 3C8DA 2Y1KA 3A6ZA 3R3ZA 1EK1A 4BP9A 2WSLA 2WLSA 4J0CA 3R3YA 3GELA 3C43A 4OCZA 4UBJA 1R9MA 1AZWA 1BEEA 3FNBA 4UHFA 3QITA 4NMWA 1N1MA 5HZGA 3U1TA 1CEXA 4GECA 1QIHA 4WY5A 3KWFA 3IIIA 4L72A 5HF9A 4G4GA 5AP9A 4F5ZA 1XLUA 3AZOA 2VAXA 1P0PA 4G8CA 1QO7A 2ZSHA 3NUZA 2WU4A 2LIPA 5C81A 3KDAA 1R4ZA 1F8UA 2PSDA 3D2BA 1IUPA 3WIBA 1MPXA 5LZ2A 5JATA 2PU5A 1VOTA 1XRRA 4X91A 5AKZA 3HI4A 5AIBA 2VJAA 3NGMA 4AO7A 3FAKA 1YA4A 1ZJ5A 3R3UA 3VXKA 2XQIA 3C6BA 3AIMA 1EA5A 2AJDA 1ZI9A 1ORWA 2OCGA 4P08A 5JAHA 4NS4A 1CUIA 4DMFA 1YB6A 1ZIYA 3IUJA 3WJ2A 5FRDA 4MWSA 3G9TA 2DQZA 5LLSA 4WJLA 1WM1A 1VXOA 3C5VA 2DQYA 2QZPA 4BDSA 3D7RA 1SFRA 2WFZA 2H9YA 3BXPA 3MGAA 4PW0A 1W6RA 3I2JA 3WWPA 4FOLA 1XROA 4I19A 3AZQA 4X85A 4C88A 4Q3LA 5ALIA 5AM2A 2DHDA 5JD5A 2XUQA 2Y6VA 4Y2TA 4K6HA 5CRIA 4M0EA 1U65A 1YA8A 3QBJA 4AO6A 1U2EA 1UK8A 3E3AA 1H2XA 4PNZA 2XUIA 3M83A 4DIUA 1XZAA 4BAGA 2VJDA 3QPCA 2XUPA 4UBIA 2J3QA 4CCYB 3F97A 3IULA 2VEOA 2CUTA 4EB0A 4LHEA 1YASA 2QUBA 1EVEA 3BDIA 4BVLA 5A6VA 1ZD5A 4ARBA 4E14A 2I03A 1UWCA 4K2AA 2IIVA 3IDAA 1QIFA 3ESBA 5DLPA 5FV4A 1XZLA 3DEAA 3DNMA 3C5WP 4IH4A 3HACA 2G5TA 1ZOIA 3KSRA 1CUFA 4WDRA 4W1SA 5DYWA 5HCUA 2XMSA 1QO9A 1EI9A 1QOZA 1BU8A 5HF5A
chains in the Genus database with same CATH superfamily
4MR8B 5DT2A 5DULA 4Z53A 5B7PA 1YFZA 4F5DA 2ACEA 1I3MA 1Z4JA 2J45A 4FZ5A 1QMPA 3KCNA 3IP8A 1E9EA 3NU1A 4B8YA 1R3UA 3HCAA 1M6VB 2CWDA 3OOHA 3JWGA 1DOZA 2DY1A 1BEUB 2ZWIA 3BSWA 3RBXA 3KD2A 4DLSA 4DUYB 4PN7A 1C1YA 4ZK6A 4QSHA 5T6BA 4BMDA 4RTLA 3FPEA 4RVSA 3DL7A 2HK8A 2IS6A 2RHCA 3F7NA 3NBXX 1A71A 3ND5A 4OOEA 1YR2A 4EEZA 2BCJQ 1N0WA 2V8BA 5AKLA 5FNVB 4LKOA 1TKAA 3EGDB 3BIJA 4TS3A 4Y9RA 5I7RA 2X2FA 2IUSA 2O7QA 2E18A 3WLHA 5BQFA 2GA9A 2I6UA 3E8MA 1TB4A 4OGWA 3SZGA 4DJDC 3PRJA 4E22A 4Z6KA 6CHYA 5BR8B 3HJTA 3DDZX 2ZRKA 3D1LA 3ZGYA 4NQZA 5DX0A 5FXMA 2Z58A 3RUCA 4JVNA 1OU4A 1KBOA 1ZBDA 1RYBA 3Q2KA 1QSGA 3IFSA 4H6PA 2OL4A 4WBSA 1CF4A 4POAA 1V2GA 3STWA 2HRCA 4JA2A 3UW3A 2IUUA 3CF4G 2BELA 5IXJA 3GLHE 3PA6A 3QXJA 1WXQA 4YMVA 4OM8A 3BF7A 3E9RA 1NNUA 2Y1EA 3M6VA 4AIIA 1RACA 4Y30A 4U5QA 1YZVA 1U2TA 1BEZA 2ATXA 1V5IA 4MKFA 1OPXA 2XQVA 4BNGA 4G3XA 4UZSA 3GH3A 2J6IA 3GGDA 3GLRA 4J07A 4K3UA 2C7GA 4QDZA 3TNJA 1YHZA 1JKIA 1FTQA 3WKBA 2XCQA 5A5GA 2EWVA 4QDUA 4F4CA 4BZPA 1AQJA 1G6OA 1R8XA 4WLUA 3D6MA 1WHSA 5JVDA 1BVYF 2YCBA 3RU9A 2OMEA 5HJ7A 5K4HA 2VP0A 2ZBRA 2A1UA 3FPBA 4HQOA 4WLFA 5IJ0A 3TEMA 2WSSD 5IRCD 3SX2A 4B7ZA 3M2PA 2YQZA 4WKNA 1EFTA 1TW3A 3LLCA 4N65A 5ALFA 3T8YA 4FE4A 1LLQA 2YWFA 4TS4A 4BQEA 2OZLB 5KREA 3EK2A 1S0UA 2GFHA 1IN8A 1ATZA 1DXQA 1P29A 1SVSA 2J59A 2WAMA 1MTZA 3IJPA 3NYIA 5CDFE 3OEED 4KDCA 4R3WA 1L5KA 3WZ2A 3Q6MA 4Z4HA 1YMVA 3A4NA 1YKFA 1DXYA 2WDZA 1MAWA 3BGVA 2O6LA 1HFJA 3GEMA 1L6IA 4KBFA 4I08A 4NG5A 4R2HA 3ZC3A 2CVPA 3CINA 5CDUA 5JMOA 3R5FA 1I7LA 3EPKA 1CK4A 3NRCA 2OCYC 1B3BA 1NMXA 1ZNZA 1WDLA 3BJZA 1X92A 1O5TA 4FGWA 2V7WA 4NK5A 1TM1E 5LWHA 5LBUA 4GRDA 3V55A 4D3ZA 3G2PA 1WL8A 4ZA2A 3VMFA 4FZRA 1M7HA 5CIWA 1J8FA 1AS0A 1N7JA 3NTOA 4FI3C 2ZTMA 4EBFA 3C87A 2H18A 1CZRA 1SBYA 3D7SA 1Y7LA 3KB8A 4QOJA 4TXNA 3VO8A 2FY8A 1MFZA 5DT9A 3COZA 5GOZA 4MDEA 1B73A 2RGNC 2RGDA 4ZQIA 5IU6A 3DMYA 4NK4A 4LF5B 4HHEA 1N9GA 3FHOA 4RD4A 2HCFA 4BMVA 5D3MB 2I1WA 2O2EA 2PA0A 4CR6A 3ZQJA 3UWMA 4I5FA 2ZYIA 3BJRA 5HQTA 4HXEB 4QPJC 4S12A 4D80A 2P62A 4MW2A 2OCPA 1FMJA 1JGTA 1D9XA 3DYBA 3E53A 4NYMR 4BRSA 1AX9A 3ABSB 1MB3A 5BR7A 1X9IA 1OTYA 4O1IA 1A9YA 2V0NA 5KYWA 3UVEA 2OB2A 4IGIA 3KXLA 1U0BB 4WGGA 4JZKA 1GWNA 2HHLA 3ZWQA 1UR5A 1MD9A 1M2VA 2F1KA 1RMTA 2PVPA 1IZZA 3MTIA 4B76A 5JYEA 3O9VA 4R1TA 4RVHA 1R5JA 4MP8A 4CM4B 5K4AA 2QF7A 3AUUA 3O83A 4MK4A 4RF2A 4B79A 2ZAMA 2REBA 2GLTA 1OXTA 2HEIA 1NBEA 3U31A 2PD6A 1FYXA 4D8VA 3DFUA 3AR5A 3UWSA 3AF1A 3KOYA 4CL8A 3EFHA 1KMCA 2XVYA 1JIJA 1Q7GA 3MAGA 3P19A 4WKCA 1NR5A 1SU4A 1A77A 2WJ3A 1CUWA 1YRYE 3B7PA 3C4QA 3GJSA 4WUVA 3M4NA 3U0VA 2QNBA 1ORDA 4JI5B 3LGXA 3KKEA 5IJ9A 4RTSA 1UT6A 1WDTA 4CLOA 3FMGA 3U4QA 4JWKA 1CLEA 5JRJA 5H3CA 5LZ9A 2XT6A 4TXJA 2A1IA 2ZSIA 5F51A 1K6EA 1POWA 2FW8A 4YJFA 3RBVA 2VWPA 3G6KA 3LXUX 1WV0A 3LXRA 2A0KA 4H1TA 4RBNA 3VISA 2OCXA 4UBOA 1HT2E 3U26A 5KTMA 3RREA 3TW0A 1EVLA 3CB2A 3D0RA 5BYJA 3DZBA 3K15A 2C2XA 3KT8A 4R8RA 1U4NA 5H1YA 4C3VA 2R4UA 3FJ1A 1A9TA 3OE7A 4WZBE 3CR3C 2J0EA 1BHO1 1XYGA 5K8JB 5CXXA 4NV0A 4BLVA 5MGNA 4AT1A 2HWXA 4RV4A 2JZCA 4FYJA 4OSEA 4R6XA 2IPAB 2C0CA 2J7PA 3B6MA 1F8GA 3AL0C 4W8GA 4XVUA 1I2ZA 2QLFA 2AG5A 5IEBA 3BSSA 1YVPA 2JGNA 4Q02A 3R5HA 4D9BA 4XJTA 2H2GA 2F3RA 3RS4A 3QQ5A 3CBQA 4P2BA 3FUXA 1BIFA 2YJ5A 2YRFA 3SC2B 2CXTA 1Y9DA 2XPCA 3ED5A 5TT0A 4JR0A 1IZYA 5LBIA 3RUFA 4YRTA 5AVOA 3ZG6A 5JPDA 1Y8AA 2W0MA 2IXGA 3HU3A 4MUHA 5AJWA 3WBBA 3ERCA 2A1TR 1EUDB 2DMRA 2EKZA 2WHQA 3E7XA 4DQXA 1KI4A 1NVTA 3KZMA 3ZHQA 3GLSA 5KX5A 4L5AA 2C1EA 4CIDA 2NVBA 3UV6A 1DWPA 2YRXA 2CZCA 2ATIA 1TM4E 4QQKA 2FZCA 2I4OA 4UAGA 4YJKA 5E9AA 1DSSG 2HO4A 3X1KA 3ITEA 4LZWA 2VBGA 5D1HA 5IAJA 3PV0A 2PN1A 1JR3E 1T35A 4EW1A 3C74A 5EESA 3L0YA 1QH0A 1YE5A 4P92A 3O1LA 3TBKA 4D45A 1TK2A 1LB1B 2EKQA 2QPAA 1HSZA 2R86A 3DEKA 3BGOS 3E4CA 3TQRA 1TAHA 4F5WA 5J2TA 3FUWA 1SOMA 3GCWA 5CXSA 4J90A 1RYEA 3CT6A 3EPRA 4RVDA 4PG5A 2R8YA 3I8XA 3IAS6 5B58T 3CLSD 2QTFA 2LTAA 3WRYC 4UUQA 2VYQA 1GRRA 2MMCA 3S8YA 4TWIA 2OV2A 1U2GA 3BG5A 2IE0A 3OZDA 1ZOLA 4YDSA 4DSUA 3WA7A 2CL5A 4HJXA 3FDFA 4RGVA 4B80A 2G1KA 4HQRA 1O6ZA 3CQ9A 1KHTA 2NZYA 4OBEA 1R7RA 5CAEA 5FYQA 3K0CC 1GNLA 4R7ZA 1RE1A 3MIZA 1WIWA 4BKOA 1UMCB 2I9KA 2EF0A 2WWFA 4JC4A 5CNKA 1NU8A 5AW1A 4MH0R 1EFRD 1JALA 1OXMA 2IZZA 4E1BA 1KQFA 4JMPA 4RSHA 1KJNA 1IUOA 3QVWA 4RMHA 1DLIA 2Q50A 1AGXA 4M86A 3Q88A 4JBLA 4UHCA 5AVWA 2ZT7A 2WVHA 1NLUA 3ZS9A 4MGYR 1SHTX 4GKVA 5D7NA 4RZQA 5EXPA 2X3UA 4XGQA 2B7LA 3PKJA 3VV3A 4ZI3A 4W9NC 3TOXA 1PW5A 5DGDA 3VC7A 1G5FA 3QYFA 3B1KA 4YK7A 1C1DA 1G3IA 1SXJD 1Y1KE 1XL0A 3ZU3A 1VE9A 3ZE6A 3O90A 4YCNA 2LR0A 2XT0A 1P2UA 2W42A 1CR2A 2Q5QA 4CV2A 1AG9A 3HSSA 1CU1A 3B5JA 4OGGA 4X7PA 2UZ1B 4CMEA 4D9JA 5KQLA 5I6DA 1B74A 1NNI1 1O6CA 3BGDA 3C41J 3P9KA 5SZHB 1E66A 4LHYA 1P2VA 1VI6A 2R6ZA 3E2IA 3C1AA 1ZKDA 3KG2A 1IB6A 1H65A 3HUEA 1R4MA 4U7TB 1P2DA 2O7RA 2OQRA 3AT1A 1JF8A 1LC0A 3C5HA 3FAZA 2OV8A 4FLFA 2Q4EA 2ECPA 4DJ5X 3MNFA 4FYHA 1NBIA 1Q14A 4URWR 4YEDA 3HB9A 2YXDA 4E5DA 1VKZA 3E81A 5JBNA 1G42A 3G0IA 1RRKA 2Z83A 3J7TA 2FPGB 2J9FB 3CPSA 3FYUA 3O7MA 5TXGA 2FPOA 2HJRA 1QRUA 4GX0A 1JIKA 3WK6A 3C8ZA 3C6ZA 4LJLA 2ILTA 3EYAA 3JVIA 5JUWA 1VL2A 1Y4UA 4XTCS 1MN6A 3IVRA 4BV8A 1Z6ZA 1QC5B 1K5PA 5U1PA 3W3AH 5LC1A 2JI6A 4YIHA 4UTPA 2C3UA 4H1HA 3OQOA 1E8NA 1JXQA 4R1OA 3ZWYA 2DULA 3N2IA 2RE8A 1N6RA 4P3XA 2PMWB 1A27A 1J25A 1HTTA 4J91A 4DT1A 4TL9A 2VWQA 4CTKA 2R7LA 1CSEE 1GVNB 4TMFA 5B7QA 2ZPAA 2QP3A 2PSFA 5CB4F 3A4MA 2OAGA 4EMTA 3ODPA 4DW8A 4QUIA 4BJHB 3QU4A 3ZLBA 5CEFA 1NYQA 3SZOA 4XIGS 2QP4A 3DS8A 2VXYA 2CFCA 2WA2A 1ECGA 2C9ZA 3HE3A 3I34X 4IUCS 5H80A 5FDFA 3AB8A 1XD2B 4MPTA 2L42A 2O07A 1GAXA 3R8CA 1W9MA 5CFOA 2J9GA 4UEKA 1VZ3A 1DT3A 5EJAA 4LS3A 2G28A 2JGFA 3JQ8A 5KQGA 2PUCA 4EY7A 2IITA 3CNBA 3KR2A 2FSFA 3IGFA 1PI3A 4YJGB 3Q3HA 4C76A 1JHYA 1ZD2P 4BRWA 2C9BA 3MJVA 5CFRA 5EJ5A 1H2EA 1BRTA 4X94A 3IL2A 2ZXUA 3HHEA 2YICA 3B1ZA 5J5VA 5K0GA 2E85A 4RTQA 3CNNA 3CY6A 4ZAVA 1BVUA 3W7BA 5CB0A 1BH6A 3F2VA 3QNWA 3I45A 4J0FA 3JZIA 3S1AB 5L6MB 3UHPA 3RF7A 1JSLA 1JR3D 4Y2HA 3IIKA 3VYVA 4EJSB 5DGCA 4L73A 1Y8ZA 3UWDA 5CBPB 1G55A 1EU1A 1YUBA 5FNZA 4HC4A 1RIIA 3A6KA 3HB5X 3IA2A 3FCCA 3WBFA 2BEJA 2NXNA 4XDHA 1XWIA 5G4KB 1TO1E 5H9VA 4G5YA 5AD1A 1IEWA 1UWKA 1G6HA 1XG5A 5LP6F 2IV3A 4QXQA 5KC9A 4L0QA 5E4TA 1MQAA 1ADGA 2P9JA 3QTBA 4PHCA 2B2CA 3OOEA 2HI0A 5ESRA 2WHXA 5A5EA 4R8LA 2IZ7A 4Y3UA 4AJHA 3KSZO 3DLTA 2RDMA 3QA3E 4OFBA 4BMCA 4WTOA 4KN5A 3EHDA 4LCBA 4M0MA 3MBKA 5ITZB 2ZM5A 1ABEA 2H1WA 4K6CA 1WO8A 5EZYA 4YUVA 2BFWA 3TCKA 3WLSA 3X1WA 2QM3A 2IXBA 1S2IA 4V2UA 1I4EB 1XZKA 1AHPA 3DW1X 1HURA 1NY5A 3LDFA 3PL5A 3AEUA 4N4AA 3ZOZA 3GT3A 3LBFA 5J4LA 3G8AA 2QBYB 2YBDA 1EVKA 1JIUA 1T4CA 3ZHZA 2IA5A 2NYUA 2Z5FA 3FDIA 4TVKA 4NBUA 4LIPD 4YDRA 5B55A 4BVBA 2Q1UA 1M8GA 2GPSA 4A4DA 3OECA 3BB4A 1CFJA 4X8MA 1WXHA 4MJ7A 3NHBA 3VR3D 3VC1A 1AXGA 2P6MA 3UFXA 2QM7A 4HNQA 1Q16A 3UMCA 3BOSA 3H2KA 2QTWB 3ZNQA 1XVUA 1TEVA 2IOFA 4TMXA 4UVIA 1J2UA 1R0YA 2YIDA 1ZHHA 4RD1A 3R8XA 2VRNA 4CDGA 3GRCA 1IATA 4LDAA 3WWYA 5L3SB 4I66A 1HYGA 4BNTA 1WSBA 2QRLA 2A0FA 1JEEA 1XZMA 4YMWA 5AXDA 4O33A 1NZDA 5LDHA 4TLDA 1J09A 3T5MA 1GTZA 4ZARA 1OPRA 4LJYA 5AJUA 4ISBA 3P7MA 5F7JA 1XRSB 2HPVA 1WP9A 4B71A 4QM7A 3M4ZA 1MV5A 3JXEA 4UTXA 4UBLA 5I7EA 3K2IA 2I6GA 4PIVA 2XWSA 4MMZB 5CK4A 2HU7A 2QZ9A 1SA0A 2H8KA 3BB3A 4BXOA 2BVNA 3OJCA 1TCUA 5BWCA 3NYQA 3Q7PA 2HRQA 3PL1A 1N57A 1UPXA 3OFKA 4G86A 1URPA 3D5QA 3GROA 3KB1A 4C4PA 4BLRA 4G89A 4WCFC 4IRXA 3CH4B 1AN0A 1BJRE 3WIVA 3WRWA 2LGJA 2YV1A 4M55A 4KX5A 4ILKA 4P3OA 4LY6A 4UUOA 4AO8A 1LPBB 2RHJA 2XW6A 8GPBA 1MRNA 2IRWA 5FTNA 4NBLA 5K3OA 2JCVA 3BWYA 4ESEA 4Y6LA 1CQWA 4EHAA 1ZOSA 3FOWA 1EBFA 4ARAA 3PNOA 1B43A 2ZAOA 5LOVB 3PEUA 3AVUA 3RU3A 3ZHUA 4ASUA 3L2OB 3NTVA 2QD5A 4DA9A 5KKCA 1YF3A 3MTEA 3ICPA 3QENA 1M67A 4Q4AA 4G4SP 2X42A 4MKZA 2BISA 1YIAA 3I62A 1V1RB 5ELXA 4MV6A 5EINA 3LE8A 3OIYA 2HJHA 1IMJA 4Z0NA 4LFBB 1Y3HA 3M0EA 2J0QA 1XZJA 3G0CA 2IXTA 2PUEA 3BUSA 4P31A 4OX9B 3BHNA 1ENPA 1UEXC 3SCZA 1MBZA 2II6A 2ADOA 2I6FA 4EO9A 1KH2A 1LPNA 2NUPA 2VRCD 4LZPA 4PC3A 3E1GA 2IXFA 2VZEA 3L7KA 5SV2A 1JJVA 3AEQA 4N8SA 1F8XA 2AN4A 3V42A 1UFQA 7REQB 2HY7A 2NO7A 2YW2A 2A9QA 3U4AA 3PD1A 1NVWQ 1SUPA 4HWRA 5LMZA 3OIWA 5B1DA 3QE3A 4B8WA 4XWAA 2GCPA 2VRBA 4MV5A 4MRRA 5EHIA 3AOEC 2GM9A 4EVSA 3IT0A 3KQYA 5JDCC 5K5EA 4H7HA 1CWUA 1E3WA 1D2HA 2ODPA 1K5HA 3I3OA 1G8KA 4QBKA 3GFFA 5JJIA 2B30A 4I3HA 4W7HA 5JSFA 1QAMA 3PNBA 1ADJA 3NKLA 3KR1A 4DA6A 2XWPA 1HMYA 3ONDA 4YWJA 1T91A 5LZ8A 4UM8B 1NE7A 4E51A 3QVMA 1WAMA 4L8LA 4P82A 3URMA 3L40A 4ADSG 1TVCA 5ICSA 3QHPA 1NNSA 1MO2A 3UUFA 1QXSA 4WRRA 3UMBA 2JEZA 2VUSA 2BZ0A 2QVGA 4TV8A 5GAJA 4WKOA 4CMJA 4YJ3A 2P9YA 4WL0A 1W4ZA 2WICA 3UJPA 3PX3A 4FBMA 2ECQA 4MPJA 1MDBA 2VDMB 2XMDA 4Z4QA 4WN9B 5KNDD 2F3SA 1NHWA 2Q4BA 3L0IB 3A1DA 3FI9A 2QG4A 1Y6FA 2HBRA 3L0BA 1F3LA 1MT0A 2KSQA 2BTQB 2ZAIA 5DX8A 4HFJA 4LHSA 1HO3A 5DPMA 1TECE 3Q15C 3VKWA 1WG8A 2EFGA 4RESA 1X6VA 1FNDA 2QMUA 3MD0A 2XTNA 3CIFA 2W2VA 5ALLA 5A03A 5E7QA 3VSDA 2PT6A 3GEIA 3R6WA 4CCYA 4NY1A 1M54A 2QW0X 2R6HA 3M6IA 4TWRA 2ONCA 3OCUA 4IEEA 2B36A 2FZ5A 3E05A 3M3HA 4CEJA 3PR2B 4DWJA 3L7OA 4OQPA 2SHKA 4JJEA 4OB6A 1G8SA 2PJRA 4MRAA 2ZUDA 2MYUA 3F1LA 2O4CA 5JS7A 2C1XA 3LTEA 1RT9A 1UOEA 1Z0IA 9GPBA 1U9JA 2FLWA 2PPVA 3KO8A 5EKDA 3C6QA 3QUQA 2A58A 2FEWB 1RWWA 2ZGVA 4JGGA 4KE7A 2GARA 2LP4Y 1XZBA 1B2RA 3RYIB 2P9BA 1YZLA 1F2TA 1Z5GA 2R8OA 2F43B 3FNFA 5ELMA 3PFGA 4X6YA 3VYSB 9ABPA 3ZDAA 1T5BA 1CDDA 4RK6A 1IOLA 1B7GO 4QEZA 4TM8A 2CB9A 3TD2A 5F52A 2HFKA 2A7XA 3P32A 4X62B 2XQKA 2AKEA 1MVNA 1ULAA 1RKVA 1U9ZA 2Q5FA 3ILHA 1AC5A 4NJEB 5H82A 1RWNA 2OTCA 3IHLA 3NAQA 4IAOA 3VO9A 3BL5A 4HXYA 3LV8A 4N7MA 5K03A 4L8YA 1M1XB 2QM0A 1H6AA 2OO5A 3LSYA 3UPDA 5B2EA 2FU5C 2F48A 1VYVA 3ESZA 3NXKA 1R0BA 1DC6A 1TM7E 4DDTA 4RY9A 4KE9A 4TV9B 1BMQA 5FO1A 3ILVA 2ZQ5A 4I1SA 1JFRA 1KOJA 1Z74A 2X2PA 4RF4A 1RCTE 2QORA 1R8YA 2HK7A 4HQKA 3H0EA 5IZCA 1NG1A 3O8NA 1KQPA 1HPLA 2IPNA 1C4XA 4H08A 5A02A 1O9BA 3AFIA 3IMGA 3G9XA 5KNBD 3H9GA 1L6RA 6REQB 5AVYA 3T1TA 2UXBB 1MOQA 2Q0SA 1XAJA 1E9CA 4LSWA 2AW5A 1GNVA 4ZAFA 4GC9A 3ROPA 5F7XA 2HHHB 4CKBA 1VDMA 1JDBB 5CFLA 3TFOA 5J2UF 1RLOA 3ILYA 3NYRA 2O6HA 2MCFA 1E2BA 5A4KA 4JHXA 4H1UA 3DMTC 4LPSA 3RGWS 4KAAA 1AQUA 2FSVA 2JDIA 5BOVA 1SRRA 5LMNB 2F7SA 2SNIE 4OBBA 2DH6A 1ZSNA 4QX6A 5FOSA 3T9AA 2YS6A 3OEEA 3UW1A 3WOVA 1J1IA 4MA5A 2B7BA 5AHWA 1RZUA 1SUAA 2JFHA 1HLPA 5E9WA 2HBQA 5EOVA 3PWSA 4ETWA 1V1JA 3WMXA 2D1FA 2YHIA 3C16C 5EKSA 1WEHA 3PQ6A 5EJ8A 2V7PA 4M9UA 4Q66C 3WYFA 1M2OB 5KQRA 1XK7A 3O74A 3D31A 3OIUA 3T5DA 2V6FA 5K2MA 1BJKA 4IDHA 3UZUA 3LYLA 2JF0A 4P0PB 1G2IA 1OAAA 3KFXA 2WKRA 4RHUA 2Z6UA 2DHCA 2WLTA 5CR9A 5CA1F 5CT8A 1CY1A 3MJEA 3MMXA 2IIBA 3IAEA 2V3WA 2Q5EA 5TQ2B 2JLZA 2YCLA 3KALA 3WL8A 4CKEA 4P54A 5JQGA 5K9ZA 1I5EA 2OLKA 3IUNA 5DI3B 4EY8A 1VHDA 2FZLA 3L4JA 3FR8A 3TR0A 3GLVA 2WWTA 4CGZA 3ELYA 3PUHA 4DNFA 5DM1A 1X1TA 1XTSA 1KQNA 4D4KA 3RH0A 5DMXA 4ER7A 3D2CA 1C9MA 1NVKA 1ZC4A 3HBMA 2RGWA 4J16A 3F6BX 3MM4A 3KLBA 2YH2A 1GXSB 1DEAA 1GSOA 2QXYA 3AFMA 4I8IA 1J49A 3VHLB 5IKXA 2ZQYA 3BXHA 1MKYA 1MW9X 2HIMA 1KDRA 4N6NA 4PRYA 2RFLA 2O57A 3PT5A 4AKSA 2AT1A 2QIOA 1AB5A 3LHSA 3NBYC 2X9VA 3RS2A 3U19A 5DNYB 1G3MA 5U9CA 2ZAYA 4CU5A 2Z8ZA 2AGVA 1N5JA 5IH3A 3U7IA 2AJCA 2RKOA 3T7EA 1W4BA 4KO4S 3B20A 5ENZA 3G2NA 3B60A 1WSWA 2IEBA 3ICVA 1TC1A 1MGOA 1QGYA 4Q05A 1NJ6A 1H1DA 4OGKA 1PX0A 2DAPA 3PFHA 4OXKA 1PJRA 4PYKA 5HGJA 5HTOA 1XD9A 2YWJA 3SIRA 2Y0DA 3LDHA 1E2KA 5LB2A 4BVHA 2GB4A 4DUGD 1WTAA 1NTOA 2CE2X 1OASA 1OXUA 2DWQA 3OEYA 2R48A 5CM9C 4AFNA 2IZ1A 2ID4A 4PZ9A 2YZ7A 4CLXA 3QTLA 4X7RA 4NCXA 4Z4GA 2V7QA 3FJOA 3UPTA 3QLTA 4JJFA 2PGNA 4XM0A 2ZJAA 1R5OA 2AFIB 3LUAA 5HF6A 1T5TA 3GAAA 2DPYA 1ZXLA 2X13A 4RWZA 5H8WA 4H7KA 5JLJA 1KPHA 4QU9A 1A88A 1DEKA 5F78A 4GPEA 2P5UA 3L1HA 1UPCA 4XD2A 3ACCA 4UU1A 4F7DA 1L5QA 2X6TA 2CMFA 2V6MA 5IJXA 3WGVA 5KYYA 2QN3A 5B57C 2Q2VA 1DV2A 4QOHA 1RM4A 2W2LA 1XVVA 5J4VA 2EG5A 3KUCA 1DC4A 3L8FA 5JO9A 5AJHA 4FINA 1OAOC 3T41A 5KQSA 1SC9A 2QD2A 2CMGA 4LXUA 5KAPA 2WVGA 1U6JA 1XMVA 1ZSVA 2FRVA 4Q48A 1DRUA 1R0XA 2VQ6A 4DR3B 3EE6A 1N32B 1I0ZA 1I2DA 2VFAA 3GLHA 1TLFA 5HG0A 1NI4B 1CETA 5ES4B 5J3JA 3AX6A 4MR9A 1E0DA 4IX9A 4PQGA 3R9XA 1D2EA 1GTJ1 4HUTA 1JHXA 2PZJA 3NIGB 1KFEB 3QVLA 3FRIA 4UFNA 5E38A 4F4HA 1VLMA 3ZV5A 3GCDA 1OX4A 3D8UA 3W9YA 4Q9NA 1Q91A 3K8YA 2YYSA 4Q1AA 1I24A 3VBCA 1BDHA 3UM9A 5D3ZA 4UDYX 3AUKA 2KJQA 3K1YA 2OD7A 1VMEA 3QUCA 3RIGA 4FYWA 1D03A 4EFNA 2O2IA 4EMBA 1T3TA 1FX0A 3N6XA 1L7OA 4I9FA 5C46F 2RD2A 1PJ4A 2O50A 1GV1A 4EX6A 1L4KA 5JI3E 5J59A 1ZXXA 2PIAA 3HWX1 4ZO9A 4NXMB 3KTFA 4NE9A 1JQ3A 2P3SA 3B3JA 1IONA 2B4RO 3MN1A 3W8FA 4E4TA 4XR9A 1FSFA 4D9CA 1FXWF 1QOPB 2PO7A 3QE0A 2H2FA 3T7CA 4DV1B 1MHTA 4PX2A 4E09A 2IY9A 5CDFA 3QWAA 2WJWA 3BKWA 1VKJA 1UWVA 2PBLA 4K9NA 1UBCA 3KZOA 1GP2A 3RVMA 5JNVA 5A06A 4OQEA 3VNRA 2WUGA 4RX1A 4NNOA 4DB2A 4Y1RB 2PLRA 2GZDA 1D9ZA 3CS3A 3OZSA 2GYUA 4PHFA 4X65B 3GU3A 2HXSA 4U02A 4P0TA 2YFYA 3L7JA 4Q0MA 3PGXA 3A6EA 1H8ED 3M5CA 4UULA 3X2EA 5JAPA 1HY3A 1GQSA 1ZUHA 2O0KA 3AL2A 4X8HA 4YYEA 5KVAA 5DYNA 3UK2A 2VZ8A 4K1LA 1YQUA 2EHDA 4YO7A 3D8BA 4FYVA 2Z1MA 4V39A 2CE7A 5LN1A 1FMCA 1UFOA 4X20A 3AIKA 4PLFA 3AH8A 4ZT2A 5EJEA 3AWDA 5TSDA 4UMEA 2NG1A 3NM5A 3NTXA 5JDIC 5AVTA 1HE2A 2MYNA 4CE6A 4AY3A 1NT2A 3PSHA 3ZY4A 4DMMA 1KRWA 3V7WA 4K7JA 4ZJUA 3W05A 3O9ZA 4QT0A 4A36A 3EIUA 4LK2A 3CRQA 1NFQA 4UU7A 3Q9UA 2N75A 3JQAB 3KDSE 1CY7A 5DZSA 2C9CA 3IODA 5FOUA 3SE7A 3PEVA 5MDHA 4IDCA 3VPCA 1XGKA 3UYKA 4Y18A 5KHOC 5F9MA 4AZTA 3JQBA 5KTRA 5TPWA 4JITA 3A6LA 2XKBA 3Q0TA 3K30A 3HP4A 4V0QA 2CV0A 2I2FA 4BY9E 1G4HA 1VXRA 3OLQA 4P3PA 4NEHB 4PC6A 1ZQ9A 4QOFA 2EWWA 1Q0SA 1E1RD 2CL7X 3KKNA 3BHJA 3HU2A 3TW8B 3FZGA 2XYRA 3FGOA 1B93A 1T8WA 3K6KA 4NBVA 2OKCA 1FLNA 2ZLBA 4DEXA 3R24A 1KAGA 3LOQA 1MZPA 3CMCO 5AKEA 4UNPA 4X6UA 4K3VA 1OFUA 1YS2X 1ZISA 2EIHA 1O97D 2WIFA 3PPYA 3Q98A 1U0FA 3QP9A 5ENDA 3ZK8A 4EVQA 1RTTA 2G4LA 4E70A 8ATCA 3FNIA 1UKCA 4KR3A 4GBED 3T5CA 4KQ6A 3TQIA 2CK3D 2ZI4A 1MNQA 3G9UA 1L3CA 2GBLC 4UM7A 3SN6A 1G0NA 5IANA 3SVTA 1MT3A 1VJ1A 3VOAA 2ZBQA 3OOJA 1W1UA 4UBNA 4OP3A 2IIPA 1WRBA 3LG2A 3RVSA 1NY6A 4IDDA 4QKQA 3LK7A 2NADA 4D02A 1NQVA 3IUBA 1E3EA 3C5EA 5K3SA 4BWGA 4WZBA 1AE1A 1HFKA 2XHEA 1CE8B 1VQ1A 2ZUCA 4KV7A 1TF7A 1YS1X 4YRQA 5DP1A 4KPUB 3U80A 3W6OA 3GMIA 4YRPA 3V4ZA 1WMDA 4UTNA 2QX7A 4KXLA 2AFHB 3CCCA 3X3HA 2W98A 3LK6A 5ALZA 4YRFA 1UJBA 3NIFB 1WXWA 4PCLA 4YQFA 4E12A 5KCZA 3PFBA 4UDNA 1IBKB 4OLAA 1YFJA 1CUVA 1QYDA 1XTQA 2FSGA 3I9LA 3SLRA 1XN4A 1PSDA 3WXMA 1IM5A 1D6JA 5JIBA 1A0OA 2VP5A 5DASA 2JIRA 4C21A 1LF0A 1UL1X 3WLLA 2K4MA 4L5JA 1E6UA 2PWPA 2AWOA 4OIMA 3DCNA 2Z1DA 4ACBA 4C0QC 4X41A 1KYYA 1VCNA 4KLZA 3R7SA 4D8UA 2WHYA 4W99A 3TUZC 2D5AA 3Q8XB 1W9HA 4CCWA 4LYEA 5EEHA 1JEAA 4BFXA 2J4DA 1FU7A 4IJUA 4KSCA 1A8PA 3FUVA 1ZGCA 4C9BA 5B30A 2G5GX 4HI0E 4GOND 3NPAA 1CERA 1M1YE 3LQ4A 4YAEA 3TFWA 3OE1A 4N3NA 6GPBA 4IV5A 2HU5A 3BVPA 3ONNA 3BTSA 3M2TA 1CY6A 1F51E 4FP9A 2X3YA 3GYBA 4R2XA 4BU0A 1I7DA 2O8BA 3GDOA 2D62A 4JKYA 2VK8A 4U7GA 3U2QA 3A2MA 1NUAA 1ISGA 3TNFA 1WZCA 2V98A 1MC5A 1N6OA 2I8AA 1ISSA 2WW8A 3BCRA 3IELA 2RHOA 5B12A 4KN6A 4MUKA 2Z6QA 2AOVA 1VHLA 1JDNA 1XKQA 5E6UB 2V58A 1MAAA 2QOEA 4S3MA 3NTRA 4PVDA 1ZO8A 2OUIA 4M22A 1TVKA 5CX1B 5HK8A 1BMFD 2ZRBA 5REQA 1Q3TA 3SVZA 2ODBA 1IDN1 3QVJA 1G66A 1G20E 1T0BA 1XALA 4CF7A 4DMUB 3QXCA 3AINA 2QQEA 4BX9A 3D6UA 3K5HA 4O2AF 3MRTA 2IUEA 2PBZA 4M54A 2Q62A 2YHUA 2L0XA 3LRXA 1NRJB 5BVHA 2HQBA 2JFPA 3NONA 1WLYA 4UBKA 3ROGA 3TGWA 4X64B 4NYJQ 4ETIA 2CCJA 2WSMA 1RCUA 2W43A 2CCKA 1SVWA 1NR7A 2GM4A 2O19A 1TCVA 2AUNA 4M1OA 3AYXB 4PZ0A 5IAEA 1B8VA 1YZKA 4W6ZA 3AKCA 3LFTA 1BS1A 3QPAA 1LWOA 3ZWVA 3GP5A 1LK0A 2VYNA 3JQ9A 4LJSA 3WNBA 1AZSC 4UPEA 3GY0A 2ENUA 3S2FA 1U8YA 3FPKA 4A8PA 1Z2OX 2FPPA 4JN6B 4Z4EA 1DO2A 1BWSA 4IVQA 2OGTA 3KQOA 4ZCQA 4B3JA 4ZV9A 4EYOA 1MC4A 5B36A 1G38A 4XGIA 1XJWA 2X23A 3O8CA 2HA6A 1KVRA 5D3QA 1D4ZA 1OT5A 1UCFA 3IUYA 4R1PA 1DRWA 5EYPB 1RZRA 2YZKA 1JH9A 4V0LA 13PKA 1EA7A 4B3SB 1OC4A 1XQ9A 4BGUA 3PX2A 3CTPA 4HX2A 1TOAA 3U44B 3D7KA 3PNPA 4FEGA 2IYEA 3G85A 2HSZA 1LD3A 1TPZA 3E3MA 2ZSFA 4TLLB 4EQ6B 4P38A 4LJ9A 2CD7A 3F4BA 1TVEA 2CXRA 2IP2A 1I01A 5AW9A 4F2DA 2OFXA 2JIZA 3W7VA 3KT6A 1C80A 1YBHA 3Q5EA 4IYRA 2CHUA 4F1JA 3LTNC 4ZVKA 1Y34E 2QN7A 1QH9A 3H86A 3TIFA 4BB5A 4ZI2A 5FOVA 1KK3A 2V97A 1QU2A 2EG9A 1EQ2A 4KGXA 1O94A 3GA0A 1AXRA 4OJNA 4GBMA 1XLTA 4FOPA 5LR6A 1G8PA 2VQFB 4BJ5A 2UZ0A 4D5EA 4TKZA 4A9AA 1T2DA 1XTUA 4IPTA 5ALDA 1UKAA 4M9QA 4DIEA 4ZO4A 3RJZA 3SJAA 4DDKA 2RI0A 3T3OA 3L7CA 2O48X 1LBTA 4AC9A 3QH4A 4MQ5A 3CGWA 4JLDA 5KWIA 2VSQA 4CODB 3L05A 1KIAA 3EGWA 3STUA 5TEVA 5CB4B 4HLUA 2IPLA 2VDQB 2X7XA 4NNJA 2O8DA 2PAFA 1KI7A 4BTVA 1K8QA 2HGSA 5ALRA 3DKPA 2F64A 3RVQA 3U3KA 2FUCA 3R3HA 4F72A 1KO8A 1T1SA 3C3PA 4MHTA 1KDOA 2FA9A 3HG7A 1FUEA 1P3Y1 3ZK9A 4D9HA 1H4SA 4HPWA 3DVAB 2REQB 4RGBA 4ER6A 1OROA 4MLZA 3BULA 4NG4A 5FPQA 3PQCA 4C4ZA 5D2CA 1SC6A 4L22A 3FDZB 2H65A 1L1RA 2WT8A 2W4QA 3QBVA 2H1IA 1N5IA 1ZH4A 1CXZA 3OTGA 3R3WA 1ZQ1A 2VP9A 3RGGA 4DABA 3L41A 4NCAA 4OI2A 2I34A 4QUDA 3OEWA 3W5SA 3HV2A 1ZVMA 4RH1A 4Z9BA 1HQYE 2VYVD 1EX6A 1W0KD 1CFZA 4OD0A 2R8RA 2AR9A 2VJMA 1U4OA 1TM5E 2YZGA 4PAMA 4BO9A 4DPLA 5KNCD 3EWIA 2EX1A 4M1TA 1TVMA 1CZKA 3CZMA 3LQYA 3LSTA 3P26A 1E4VA 1V8FA 2JAPA 3BX1A 5H70A 5CEEA 2HWYA 3O8OB 3IERA 2R1VA 3QU5A 2AHRA 2D3TA 2ZI6A 3FFXA 3G7UA 4CWAA 2V5AA 2D00A 2QMYA 3ONEA 4D92A 5AW3A 9LDTA 2YHSA 4A03A 3QUSA 2O3QA 4MKGA 5CYOA 2QLJA 5LP6B 1HNNA 2QW1A 1N4AA 3LLSA 3QRWA 3EQ8A 3UQZA 1C7EA 1I1QB 2CHVA 3RAEC 1XLWA 3A2NA 1NV8A 4UCWA 2FJPA 1U7OA 3WNVA 1Q1NA 1SQ0A 2P90A 4H35A 2OCBA 3HVKA 4J49A 4JLAA 2JS7A 2R4TA 2WM2A 2ZBPA 4O59O 4X5OA 2XOKD 2H0AA 4HDNB 1NQXA 1WKCA 1J2JA 3GHYA 1IU9A 2A8YA 3HC7A 3CLUC 3LBHA 2HZBA 4LEIA 2ZPTX 1T5IA 2Y1XA 5EJ4A 3I5UA 1Y7IA 1RBZA 3BXFA 5C8ZA 2QRPA 1KORA 1O95A 5BNWA 1LC3A 3FPHA 2HWUA 2C29D 2IXEA 3IEKA 5FLKA 2C61A 4AG6A 3QHAA 2HW8A 1JHMA 2DCUA 2QG6A 2NO1A 4OLFA 3TX2A 3DVQX 3IEPA 5G02A 5JFOA 4G65A 4JLWA 5AT1A 1LSOA 1PNOA 3NFRA 5SZKB 1XKTA 4EUFA 5EJIA 4HYTA 5MN5A 3DT8A 4B75A 2QSUA 5DBFA 1GPUA 1X0VA 1VHWA 1KZ4A 3S2YA 5BW5A 5HS4A 5FT9A 5JJBA 4OX9Y 3EVEA 1TMKA 2P67A 3DZHA 3MRXA 3KCQA 4LDNA 1TJPB 5L3RA 4LSZA 3W77A 2XB2A 3W2TA 2VDOB 4O4LA 4XWYA 3KEMA 3BBPA 3GJ0A 4TL8A 3SEZA 3VZQA 1E5QA 2VSYA 2ZDQA 4MI9A 5TDHA 2XKKA 2A78A 5HS6A 4MUXA 3SEQA 2YC2C 4EHJA 5I7SA 2JLBA 3AVXA 1RYNA 1NZFA 1R0KA 2PE5A 5DLQC 3D8RA 5IT9A 1SVOA 2F8SA 5TMBA 4E0BA 4GOXA 3T1YB 1N2OA 2FEPA 1J5XA 1YJBA 3HLKA 4I4NA 4B4DA 1S2MA 1M2KA 3OLZA 4D8XA 4BBAA 5G3YA 1G59A 3ZI0A 1YBFA 2IWRA 5JQWA 5C8DA 2FZGA 1ST2A 2GO7A 4P98A 3RAPR 3WR5A 3HFJA 4B3BA 4LOJA 2CJFA 2OFPA 2QUHA 2W93A 1CUGA 2CEAA 4I55A 5HTKA 4BO2A 2NUTB 2HEGA 3NBQA 4MWBA 4CMIB 1DAGA 2ZRHA 3VR6D 2IYZA 3B1XA 2FYTA 2WPDA 3GUUA 5DWVA 3K9GA 4H31A 3F4LA 3TEFA 2Q4TA 4YGXB 1U3VA 1H5QA 8ADHA 2XTAA 2CVZA 3B7GA 2V74B 5HFAA 4HAOA 2HPAA 4JC0A 1CS4C 1PR4A 2GJSA 2N46A 3U7QB 2PSHA 3BDVA 3P27A 1C1HA 3OCWA 1NW5A 1KJZA 2H1VA 1UXHA 4HQNA 2FB9A 3IHWA 4R1MA 2IWHA 4MW4A 3UMFA 2VJBA 3TI9A 3ZXYA 1DVRA 4KIUA 1QH1A 3SS7X 3MCTA 3HJAA 4F2GA 3AI7A 4IO0A 3GMSA 3M6XA 1CRZA 2IGTA 2Y27A 3HR7A 5BSVA 3DVSX 4RXUA 3FY4A 4X92A 5A4IS 4U6NA 3A2KA 1CVIA 2IHTA 3L9XA 3OO1A 5CJJA 3D2LA 5IX8A 2EKLA 1MIHA 4ZCSA 5JCJD 1WCV1 5HIKA 1YCGA 2PLAA 2YYYA 3OHSX 3PYXA 4XRRA 2JHCA 1Z83A 2PMCA 2X5NA 3AWIA 3QHQA 5T5QA 4UNRA 4JENA 1TJ4A 4CHTA 5BSMA 1VMAA 1WSAA 5EE0A 1FBNA 1ZH0A 1MR3F 4CN8A 3HA5A 2FHPA 2M1ZA 4G63A 4HWPA 3S2EA 1J9EA 3EFBA 1PJ3A 3BMOA 4I50A 2CNWD 2KPOA 2VZ0A 3M6UA 2P9ZA 3Q3CA 5CT5A 4C78A 1JBQA 4KGVA 4PYJA 1YQGA 2C78A 2F59A 5E0KB 1QFYA 5A3RA 2EFYA 2OXRA 1DCKA 2IYRA 3MCWA 1CY8A 1CIJA 1US8B 1PNVA 1ZGAA 2FDRA 2J85A 3A4YA 3AKEA 4UKDA 5G1NA 1MW8X 1IBCA 1T24A 2W4MA 5C80A 1NVEA 1LK5A 2FG5A 4P7BA 3TI7A 4OI4A 1KETA 3WGGA 4UHKA 1DLJA 16PKA 1UQTA 3SZ3A 1WETA 1CPYA 1VMDA 3HWWA 1LDMA 2MYTA 2VPYA 4Z7OB 3TLGA 2V7EA 3DTTA 4OQFA 3R0VA 4XDGA 3TAUA 4WLOA 3U9LA 2X0FA 1HG0A 3FOEC 3AZPA 1N5OX 4FGLA 4PBRA 3SIPA 1LVUA 4IJWA 3C70A 1VHJA 2Q3CA 4ZI7F 2AVNA 2WZCA 3H87A 1KBZA 2QUZA 3P94A 1DC5A 1YVDA 1M34E 4J0HA 4PSKA 3FZNA 5EHZA 4ALJA 5L45A 2BP7A 2YJ6A 3F8SA 4G5QA 2QJFA 5P8WA 2E4ZA 3NLLA 1GYRA 1YTLA 3AP1A 1XEAA 3KLMX 2H31A 4HLDA 4BFZA 3UK1A 3DEIA 3L8DA 5BN1A 4R3NA 5I8PA 3L8HA 1KDVA 1NAHA 1SQSA 2Z4SA 1DWQA 3L8MA 3OX2A 3RNOA 3ZHOA 1CQPA 4FSDA 4W5HA 3S2UA 2YKGA 1BXRA 1ES9A 3PNLA 4L8FA 2ODTX 1W52X 2YTZA 3ZIAA 2Q4RA 4LFCB 4GMHA 4S1WA 2QPLA 3DFFA 3ZDQA 4TGLA 3SLGA 1I7QB 1V35A 3H75A 2QJWA 3WLOA 4Q7QA 2UYGA 5EHQA 2E4VA 1H8HA 1JUDA 1SBCA 3W1WA 5B3JC 5E8RA 4YV1A 1T36B 4Y2SA 1Q7BA 2V3VA 3G2LA 3QELB 4YAIA 1MA3A 4IRMA 4HVCA 1EUCB 1Y9ZA 3PDIB 4EUHA 1RHKA 1XYYA 3CO0S 1K1EA 5F4BA 2GD2A 3WLTA 2C5SA 2D6FA 3CW2A 1TT5A 4L51A 1YB4A 3CR7A 4WI1A 2DQSA 4XDYA 1C8VB 1ULZA 2JAUA 3GP8A 3UJHA 1T2VA 1BE0A 4JMLA 1ZPDA 1R6DA 4YC7A 3ONFA 3PGKA 3SYLA 2QIPA 2CFRA 1ZGHA 3AKYA 1A1VA 1UPFA 3MRVA 4MGIR 1BX1A 2R3SA 4LBZA 3KYBA 5AUQA 3DOIA 1W85A 3ZE8A 1E1CA 2GBPA 3CKYA 3DMDA 4LGMA 4Y6SA 4AJIA 5BN5B 2V4UA 5THQA 4KR9A 3QUAA 2AF3C 1Q12A 1ZDMA 3FPAA 1DAPA 4B6QA 4ENVA 3S5UA 3U3XA 2F1JA 1X1DA 3EIOA 4PZEA 1FVOA 3V2HA 1N2ZA 4PSDA 4AQDA 5AUNB 2JGLA 3PC3A 1DTWB 3LCCA 1HZZA 1S96A 2ZIFA 3QKIA 4UREA 5D5QA 4A0RA 4ENWA 3TGLA 2YIMA 3NXSA 5FPYA 3ED1A 3ELDA 4QYWA 10MHA 3A9CA 4FTWA 2QYOA 3AM5A 1VSTA 2KLHA 1YCDA 1D07A 1EWTA 1RR6A 2B4KA 3FJYA 4LHWA 4TRNA 4V0NA 4N5IX 2Z2KA 5CLHA 5J2UB 4EHBA 5C2JB 1A97A 1E4YA 2GBIA 2OG2A 4TWJA 3UT5A 3VOBA 4JC5A 1ZY2A 1RWVA 3ROMA 5CFMA 5B2ZA 3HK2A 3MLBA 1VYUA 3SQXA 1FP7A 3KBOA 3QG5A 1EG2A 1XJ0A 3OTHA 4WVFA 1EM6A 1XLVA 4BL5A 2HSEA 2OCLA 2VAMA 4URHA 3JYOA 3T3NA 3LVQE 3OZFA 1EJBA 1GN9A 5BVGA 2QAGC 3C3DA 3TKAA 3W06A 4AUNA 5IDVA 5FHQA 3DBLB 1L4HA 5AM0A 4E46A 4AX4A 2Q3MA 3AEXA 4YP9A 3VNQA 3ZWDA 4B8ZA 4CKYA 4EJSC 1JEDA 2BGIA 3PIDA 3H65A 1GDHA 2GD6A 2SECE 2R44A 1TA4A 3REQB 3LZDA 1N78A 1TTPB 4R5MA 3LUDA 3T5PA 3EEFA 2FSUA 3PC6A 4O63O 1XTZA 3WC4A 4DLRA 4YRGA 1J97A 5HZMA 4OQMA 2NSLA 1EM8B 1GUDA 4FS8A 1UZUA 3VX3A 4IHKA 2ZFUA 4LDZA 4U39A 1ZKMA 1K7SN 2XIJA 4HY3A 5CA1B 2A9RA 1DELA 2Z5GA 3HJCA 1RCFA 1XAIA 4GEKA 5CPBA 2PNFA 4QRDA 2GEFA 1LFDB 3B7WA 3H5RA 1THZA 4K26A 5LU8A 3RHFA 2G72A 2O8EA 2H5EA 2IYOA 2F4VB 2KWIA 2JJ2D 2Q3BA 2V9PA 3K5WA 3NHUA 3WQHA 2BKVA 3DR5A 1L9XA 2D06A 4OKSA 1PT6A 1DMRA 3WK8A 2BCGY 4QM6A 1N2BA 2G63A 1L4YA 1U0HC 2OZVA 3COYA 3SM3A 1KNQA 1QTRA 3EOZA 4TMKA 5EE1A 3A1TA 1QUEA 2ZBVA 2P9QA 1KY3A 2OVBA 1Z34A 2AKYA 1Y1PA 2X76A 3K32A 1U5BA 4GR5A 3QEAZ 1AIPA 1EEXB 5DSXA 5KDDA 5BYAA 5MFZA 5IAAA 4DCUA 2ZCVA 1NDHA 2HV9A 5FJIA 5IUKC 1UBOS 3EXHB 3HDGA 2PG3A 1V26A 4Y7DA 4C3OB 5EIEA 1JPVA 2HF8A 3KYDA 3BJIC 4D74A 3KVRA 3H5VA 1KRHA 4J0QA 1QF9A 1BH2A 5GV8A 4HZUB 2J9RA 2OMKA 3BIFA 3PWTA 3FDXA 1YWGO 3O3NB 3Q8MA 4BBJA 2SKEA 1H3EA 1HDYA 4FSHA 3C97A 4A6EA 2APJA 4ZZ0A 4FFRA 2NZ8A 2IU0A 3RC9A 1NXXA 1V7QA 3BMQA 3BXZA 3Q7EA 3R3JA 3DOCA 4IW3B 3X1MA 2FN7A 4PFSA 5EN4A 1XOIA 2VJLA 5LFAA 4D1YA 1NYRA 5F3WB 1I1OA 1ZBQA 1UJ2A 1E3LA 3Q8KA 3ZU5A 5H81A 2ZZNA 4HB0A 2CNBA 1FCJA 2DWOA 4FNMA 1NQ5A 4L02A 2WD8A 3OFNA 4IGKA 1VZ2A 4BO5A 1UXGA 1BE1A 1L7EA 4LBYA 3VVLA 4OQNA 2QK4A 3Q3IA 2LBPA 4GLOA 5DM0A 5GZ6A 1M1UA 2BEWA 4RFVA 2QAIA 3ZS8A 4D6XA 3EIWA 5HIIA 1PTJA 3IUQA 2RARA 1N2HA 2BL4A 4G84A 1H4VB 3V1TC 4GBJA 1ZRSA 1ZU4A 3IE1A 2I4NA 1JAXA 3L8YA 2AK3A 3FCEA 4KN9S 1R3DA 2RC6A 4D2IA 1JXAA 3D3EA 2YC4C 3AFGA 4FHGA 4L1KA 2WD7B 4TRRA 3HXPA 3B6KA 4EJ0A 3E4DA 4DZZA 1RQGA 5KOHA 3NBAA 2IELA 1GM5A 3TUIC 5FLXA 3GXOA 4GI7A 4UFPA 3ZE9A 3E9DA 4JU8A 3HDJA 4RVOA 9ATCA 3LIIA 1ZEJA 3OIGA 2C20A 3FCYA 4GPIB 5KJEA 4WW0A 3WHPA 4PGGA 2UUAB 3PC8A 4NQRA 2NO6A 5I01A 2SCUA 3OJFA 2ZWMA 2FVXA 4L4ZA 5AUPB 2H2IA 3N2KB 1CRQA 1U02A 4L0MA 1FMLA 4NCIA 5E9QA 5FP0A 1K3FA 1Q0PA 4FMPA 4HB2A 4TQUS 4AZSA 4BUZA 1KQGA 1EQAA 4NAUA 1P73A 2Q6LA 4DLBA 1O87A 4LMRA 2V0GA 1LSSA 3NTQA 2IYVA 4XWOA 1WMEA 4II3A 3EBPA 5LU9A 4HTAA 4LVOA 5DYIA 4C08A 1MX9A 1XJQA 5KNCH 3NBZC 3PQ5A 3S55A 1BHSA 3PPIA 4P34A 1PKEA 1SCJA 3OHMA 5JI2E 1UOPA 3IUMA 1TI7A 4LNHA 2FMIA 3MJTA 2JLQA 4LY9A 4OHKA 5AW5A 4QYXA 4HGQA 3TLBA 2PWBA 2BJWA 1VPLA 3EC2A 2ZB3A 1BMFA 3I37X 1JQDA 2W8ZA 3JD2A 3L0SA 2RAUA 3REFA 3JASB 2W2MA 2PM8A 3IT3A 1JEYB 2ZT5A 2VPQA 1U9IC 3VSCA 3ZZ1A 1DQZA 2Q5OA 1ACMA 1WZIA 3RRZA 3DZCA 4JXKA 4ZO7A 2AFRA 3EG9B 1A95A 4M6WB 2M32A 4MEJA 1GPNA 1RQLA 3L82B 1QE5A 2R5WA 4P53A 2OGWA 3ANMA 1I0LA 5ITVA 1NW9B 5T3YA 2QAJA 1NOKA 1CUXA 3JARA 3DDWA 1CHNA 1RAFA 3GRKA 2Q7OE 3RU7A 2CLSA 3CF4A 4R51A 2B5WA 1SCIA 1M75A 1A76A 2W9XA 4PLWA 4OUKX 4YX9A 3I2IA 3CURA 2XDQA 5AK6A 4D6YA 1GCIA 3GARA 3EZGA 3Q9SA 3LT0A 1KXZA 1OYYA 5D5HA 4KHPB 1NBWB 1E9VA 1VHQA 2GF2A 4DNXA 5CVUA 1M2WA 4YMIA 2WMDA 4WHMA 1BX3A 1M7GA 4QGBA 3CLHA 4X6XA 2OFFA 2Z43A 2IV7A 5IAOA 1F2UA 1K97A 1TJ3A 1EFUA 5C8XA 2PKWA 5L4NA 1E6LA 3VTAA 1BCRA 3S40A 2G77B 2GGSA 3OPYI 3H8JA 2FWPA 3K8QA 5I7OA 5EFZA 3WB1A 4FHEA 5IDYA 1USVA 3ADCA 2GCOB 3ZNOA 3DZFA 5LSAA 2RKBA 1JPNA 1QWOA 3IRUA 5ELLA 4UPVA 3RRMA 2OD2A 3BT7A 1C7JA 1W59A 3PE3A 2O4UX 4MWDA 4PXAA 3RSHA 4QG3A 5I7WA 1M1NB 4ZHQA 1V8OA 4LSMA 3SLKA 2I7DA 2CXOA 2HJSA 2JLUA 3MPUA 3NBUA 1OLUB 2G9VA 3OJ0A 4QTTB 4B2IA 1L5HB 4DXAA 5HP4A 2WIJA 2VAPA 2BJVA 1YDGA 2QTVB 3FMIA 1OD6A 2N9UA 2H59A 3GN2A 4QJIA 4EFMA 4GH5A 4I3GA 2I2DA 3K1TA 3BICA 2GHQA 4F56A 1DAEA 3KUUA 4G6ZA 3GQVA 2A0WA 4MA4A 4EHKA 3KTAA 3QJYA 3WHIA 2J67A 1U99A 2ZB4A 4K81B 1CUDA 3VR6H 3DE6X 2ZI9A 4MRNA 1DEXA 1D09A 2FN9A 3WVNA 2GEDA 3SG0A 3FLBA 1N2CE 1TQHA 4ZOLA 2I2XB 2OQ2A 3QNMA 1JXOA 4EGCB 5AVJA 4AJ1A 1WCIA 1U8FO 2G88A 1Z2EA 3RK0A 2Z95A 3TOZA 4EDFA 1IJEA 6Q21A 4ODIA 3GJYA 4I99A 1F5NA 3UK6A 4QGFA 1ONPA 2W5UA 1EWQA 3KLOA 3QM1A 2OV1A 3TPCA 4IHJA 5IYZA 2XD4A 2AOUA 4EB6B 5FH9A 1HEYA 3M4XA 5IKOA 2WOOA 1T0IA 2VYVA 2Z3ZA 3VDRA 4F85A 1HLFA 1QWSA 3TAHA 4Z4FA 1U8CB 2ONYA 2XEDA 2AW3A 1DFIA 2OUKA 3EA5A 2RIRA 3QOWA 4ZOAA 3B70A 3RC1A 1XTRA 2G1PA 1X1QA 1O58A 1SKBA 1QIGA 2IYQA 2J3LA 3IEIA 2CJPA 2X0NA 4NBTA 3PNMA 1QTNA 4MI6A 4DVGA 3CVUA 1L3IA 2FCRA 1D8AA 1M1YA 2GJ9A 1JYEA 1ZLXA 2HT6A 1SELA 3IVGA 2B94A 2V4ZA 3I64A 4UVEA 1U2PA 5BWNA 1UADA 3TRIA 3MUEA 5BUZA 7ABPA 1CQIA 5EIBC 1B16A 1Q57A 3AU8A 3VTKA 4CG2A 1NF9A 3AIIA 1J06A 1GCAA 3SIXA 1VL5A 3VKGA 2HA7A 1YE3A 3HSYA 3L9WA 3PQ7A 1KH3A 3G23A 4MTLA 4D0GA 4GOOD 3I6ZA 4M21A 5CH8A 2GM3A 2XTZA 3JQGA 2OGUA 3NORA 3ZXIA 2B3DA 1OT3A 2CNLA 2P9GA 3COVA 3EBLA 4J43A 1G20A 2G76A 4MEBA 4ZZ2A 1JFLA 3IBFA 4O2AB 1MLDA 2CUNA 2X5XA 1N2EA 1BW9A 3BFXA 1NZJA 1XQXA 1S6YA 2RGNA 3FCXA 3H13A 1R66A 3KQVA 3K70C 1TRHA 4JKOA 3M3DA 2GRJA 3NVMB 4NOKA 1UC5B 3GUVA 2WSBA 4UDXX 1QVAA 4ZVNA 2VDPB 4WXPA 4ZCRA 2EGHA 1F12A 3QTTA 1KJ9A 3RFVA 4C7BA 1AN9A 2D54A 3P9RA 2JLXA 1ECCA 1NI3A 4AQYB 1SKYE 4NDNE 1Z9BA 2NU6B 5LA6B 1FDOA 3TCXB 2IBTA 1JR6A 1XZHA 1Z35A 5J40A 4RA6A 5B1YA 1G8AA 1P9OA 5DVZA 5CK5A 2R7KA 1A72A 2CC2A 3AJ9A 1HA3A 3NHFA 4M8IA 1ENZA 2L19A 4AMVA 5DXAA 3M8KA 4HTFB 5DTMA 3EGEA 4EY4A 2ZJ0A 4PFKA 1XNGA 3AESB 2JD1A 3LYAA 2JFNA 3A2LA 4DMCA 2B99A 2YWCA 3OY7A 5D87A 3UJDA 3OURA 3IV7A 1RXVA 3ZHRA 2CSXA 2XRFA 4L74A 1B8NA 4X3CA 3SHFA 3QFSA 1UZNA 2Q5JA 4PO8A 1M0WA 2VSFA 3CZAA 3NWOA 4YB8A 4XSVA 2C5EA 5IMBA 1G7SA 1L7AA 4MVYA 1K4YA 2Q1SA 1LFAA 1QG6A 2HKIA 3FOBA 3HUTA 4MR7B 2HMWA 4OP2A 3DF9A 5DBEX 3KXDA 4BWVA 3ADBA 1NUTA 1KY4A 3RVLA 4MKHA 3RUAA 2WU8A 2O3RA 3A3PA 1WZNA 2Z4TA 4MCAA 1ABFA 4YP5A 4GZ5A 4YRRA 4GNKA 3GAZA 1TYZA 5JOQA 2OORC 1BMDA 1XB2A 1YACA 3H5NA 1WF3A 3R3YA 4B4VA 1QB7A 1KVQA 4JT8A 2VLIA 4KQXA 1C0EA 2VHXA 3AEYA 3TNLA 1A5BB 3NIDB 4D41A 5AQ1A 5JH7A 4R0VA 4WOPA 2C2WA 1XXHE 5PNTA 1EP2B 1K6XA 2R6FA 4QUEA 3VR1A 1WHTB 1A4XA 1M83A 3P45A 4PCAA 4L6AA 4XFJA 3VPDA 5I9NA 4H1WA 4LFAB 1I51A 3NAGA 5SY6A 3UHAA 3BH7A 2VPWA 3NNSA 2JIPA 2WAAA 3O2NA 4NMWA 5BXQC 4N01A 5HZGA 3FOZA 3MJCA 1K89A 3HZHA 1K8YB 2O3TA 1K7CA 3I1FA 4GECA 2FEOA 4WY5A 3UTCA 3AI3A 4ZO8A 5DBGA 3DLIA 5JCOC 1Z62A 1EFCA 3JRNA 1W48A 2Q4OA 3KWFA 2UUPA 5J43A 2EKBA 4G4GA 3AERB 3OCVA 4J4HA 1A2KC 1XLUA 1Q1GA 2W6MA 4GKJB 1B15A 3SQDA 2VAXA 2JAOA 1P4JA 3PDJA 5A4DA 4G8CA 5BYBA 3L7LA 2XE7A 3MC1A 4H0NA 4ZIRA 1TUBB 5BQXA 1W8IA 2D7DA 3ETCA 3NUZA 1NMEA 4CKWB 1AKTA 3G89A 1QPZA 3VPFA 1R4ZA 3RBZA 5KTKA 1ML4A 2VP3A 1F8UA 2PMKA 4Q7EA 3NEPX 1JE1A 2BC9A 3IMFA 2PUVA 1Q50A 3HY6A 4M98A 3T1NA 3VU8A 4Z7NB 3VSEA 1IUPA 1JWLA 1MPXA 3IPAA 2BIFA 3VZRA 5FA8A 2ACVA 4DV3B 3RC8A 1Q77A 1WQ1R 1PEAA 1EAMA 4GL4A 4DIDA 1NNLA 2Z30A 1COWA 4UM9D 3RABA 5EUCA 3OJOA 4X91A 4C0BA 3DFMA 4KVAA 3WRYA 4FFLA 4ERXA 3FYSA 2X8LA 4FILA 2HGZA 3II6X 4URFA 2PX3A 3ULKA 3ICCA 1E9BA 4CTMA 3M34A 3ZWPA 3LRTA 3M6WA 3FAKA 3QPWA 4P1ZA 2P2SA 3F2IA 3PR1A 4KR6A 1P2SA 4OREX 3W8RA 3EXIA 3DZKA 4O4JA 5I7VA 3K0CA 3MUFA 1Z4IA 4W7IA 1NN0A 1Y80A 1YNSA 1T25A 3JQEA 5A9RA 2Q8PA 1TMOA 3AIMA 4NCJA 5FWYA 2E5LB 4CTNA 1MQ9A 1AS2A 4UZEA 3LQRA 3L5KA 4J2HA 1W94A 3ZY3A 2JLRA 1ZIYA 4DMFA 1P60A 3IUJA 1X94A 2IHKA 4HOYA 8AT1A 5HVNA 1EZ4A 4HDMA 4P86A 3A7DA 3QF7A 1KJIA 3ANNA 4FFDA 4L3OA 2QZPA 3DUWA 4W9NA 3IDFA 2ZTSA 1JEOA 3SX0A 1QB8A 1SFRA 3UJNA 3UMYA 5TF0A 2P78A 4JBXA 4MVJP 2GMWA 1NXTA 4OXRA 1XROA 4AWXA 3C4JA 3GJ5A 5HE8A 3V4OA 2H4JA 1FDVA 3KSBC 1Y6GA 4Q3LA 2Y99A 1OOEA 2C2YA 3O8BA 1ZJYA 2AUTA 2FGJA 4GGOA 5ALIA 5E1BA 3VGPA 2WP0A 3E5NA 3VR4A 2VYFA 5BWOA 5JD5A 2Y6VA 4PRZA 1UKYA 5L4SA 4PQYA 5GM1A 1A4UA 5CRIA 5KYUA 1CDEA 3CF6R 4WLVA 4BFCA 1KE2A 2EGGA 2VH2A 2XADA 5EJFA 4C7JA 4AO6A 2GEKA 2VEDA 1F8YA 6NULA 2MWMA 1EVJA 1PL0A 1CZUA 1TTHA 3MOIA 4PC1A 4NZMA 3M83A 1X13A 1EE1A 2AYZA 1Z0SA 1PZNA 2PRJA 3AKDA 2O0MA 3OEHA 4YP0A 4PYIA 2C7OA 4JYCA 3BQMB 4NABA 1T5SA 4E08A 1NOJA 4UBIA 5MGBA 2J3QA 3QVGB 4ARVA 1AY0A 5EP4A 3HZRA 1KERA 2VEOA 2QI9C 4QFMA 1KO7A 1SQFA 1VIMA 3NB0A 3LUCA 4HFNA 4J94A 5CPFA 4ND5A 5DHPA 5A3SA 5L9AA 2OXFA 2UVDA 3OM1A 5B58C 1Z8DA 4WZAE 3D6NB 5TX7A 1RXIA 1O0CA 1T5LA 5DCUA 4NJMA 2RK4A 2W6JA 4Q16A 3E84A 3T0GA 4TMYA 4WVLA 3QX8A 3L84A