2RHWA

Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
publication title The Molecular Basis for Inhibition of BphD, a C-C Bond Hydrolase Involved in Polychlorinated Biphenyls Degradation: LARGE 3-SUBSTITUENTS PREVENT TAUTOMERIZATION.
pubmed doi rcsb
total genus 103
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rhwA00
3HACA 4Y2RA 1XZKA 1CUYA 2VJCA 2CMFA 4WY8A 4OYLA 1EDBA 2XUOA 3I6ZA 4CG2A 5CMLA 2WJ6A 3HRHA 4DMFA 4JH0A 3WQHA 1VJ5A 1N5MA 1GQSA 1EK1A 3AIMA 3W05A 1BE0A 3K2IA 4K6KA 1ZGBA 4B85A 3H2JA 4AB1A 5AKHA 5EGNA 2HFKA 4FMPA 3C5WP 2BAGA 2OXEA 2RAUA 2ROQA 5AI0A 2H1IA 5C8VA 4EZIA 3FLBA 1QONA 1DQZA 3EBLA 1DWQA 5K3FB 5E4JA 3PF9A 4W1SA 3ILSA 5FKJA 3WL8A 1Y7HA 2HDWA 2RHTA 4KE8A 1CFJA 4AX4A 4UHEA 4MWTA 1QLWA 1XRRA 4Y9SA 3WK5A 1FFBA 3DCNA 5ALEA 1UZAA 4RPCA 4OB7A 2WFZA 3AINA 5K3CA 1GPNA 1OXMA 4OUKX 3ZLUA 2CJPA 3BL8A 4G4GA 1UFOA 1CUBA 4OCZA 4CIBA 1ETHA 2DHEA 2QXTA 3WWPA 3R0VA 1KU6A 4B82A 3ANTA 3F67A 4FKBA 5DYWA 3VVLA 4C4XA 3KWJA 5ALDA 1R50A 2HADA 4N5IX 2PSDA 5E4YA 3N2ZB 2XB6A 1XZEA 3WA6A 1YR2A 3WKCA 1QGED 4UBKA 3D7RA 3IIIA 4UPDA 2CEKA 4BZWA 1GKKA 1R1DA 1F0PA 1ORVA 4C01A 2XT0A 1J06A 1HQDA 3NUZA 5LKAA 1P0PA 1JJBA 4CIAA 2BGNA 2HU5A 4GHWA 5JASA 3R3UA 4FHZA 4IH1A 1IUNA 2AJDA 4EBBA 2WLSA 3KSRA 2XUDA 3QITA 4DMKA 5HKBA 1A8UA 5HK9A 2BUBA 1XQWA 3V1KA 2JIDA 2XUQA 5CTAA 1QIMA 1WHTA 2AJLI 3QMMA 5AI5A 5HCUA 4HRXA 1XKTA 3EF3A 2PVSA 1YA8A 2W6CX 5AO9A 2HA3A 1Z68A 4K2AA 5JADA 1CUDA 1ZI8A 5HZGA 1QFSA 4J0JA 5ALGA 6YASA 2R11A 3IBTA 1XQYA 4PSUA 2OQVA 1DWPA 1XZDA 2XUFA 2XUGA 2OCKA 4HZGA 3BF7A 4U2EA 3R3WA 2WFMA 2QM0A 3H1BA 5ALFA 2VJDA 5FP0A 4E14A 3IUQA 3KOOA 1CEXA 4BVLA 3H1AA 4MWSA 4MXDA 2JGIA 4J7AA 5EI5A 2VEOA 4P08A 3I2GA 5IVDA 1FFCA 3ZWQA 4U2CA 3JYHA 4BTLA 4ZWNA 4QDTA 4PQEA 4XJVA 4Y2PA 3S2ZA 1GPLA 1JI3A 2H7YA 1CUIA 4DMHA 3DQZA 3JW8A 4M0FA 3G9TA 4U2GA 4G8DA 2BCEA 2G5TA 3DL4A 1G66A 4KRXA 4G9GA 1ODTC 3R3VA 4H7EA 2WUEA 5AKEA 3BE8A 3R3XA 4C87A 1B41A 5DNUA 4DSAA 1YA4A 4OB8A 1DWOA 3RKSA 1IUOA 1VE7A 3IURA 1CRLA 1VA5A 1AGYA 4G4JA 3ICWA 4MEAA 5AH0A 4AMYA 3LCRA 5C8XA 3FSGA 5K3EA 4TPKA 4UHBA 4BE4A 2Y2UA 4HRYA 4QNNA 5AKXA 1CV2A 5DJ5A 3NOXA 4F21A 2WQZA 4IH9A 1DTEA 3A2LA 5LP1A 1WPXA 4INZA 2WJ3A 3WK4A 1CUVA 3W04A 3STYA 3MUOA 3WA7A 1THGA 2XUPA 1TAHA 3CCBA 1LLFA 5HQ3A 2WUGA 3EQ8A 2XQGA 4GLBA 1T2NA 1IZ7A 5FPPA 2Z5GA 1ODCA 4TVKA 4X00A 4IH4A 2VAXA 3T52A 1Y7IA 2PSEA 5AOAA 2Z3ZA 2QZPA 1MNAA 1USWA 3RLIA 1H2ZA 3FAKA 5KWJA 3JWEA 5EHZA 1UOOA 3IA2A 4G8CA 4QE3A 3WKEA 5JANA 1TKRA 3F97A 2DHCA 1I6WA 2GBIA 3DL7A 5BV7A 5LZ7A 1WOMA 4NMWA 2GYWA 1MX5A 3DKKA 4HTAA 4B9EA 4Q05A 1UK7A 1VOTA 5EHXA 1PJAA 4BDSA 3QVMA 1F0NA 1CUEA 4GECA 4C6HA 1VZ3A 4V2IA 5IVHA 3O4JA 2BKLA 1XRMA 1XZLA 3O4HA 4Y2XA 4EY8A 1ZIYA 1JMYA 5JD5A 3CCCA 3C6YA 3CN7A 2QJWA 4GI1A 1J07A 3PDCA 2BGRA 3FVTA 2PSJA 3WWOA 3OURA 1EDDA 1CUGA 4UBLA 3G8YA 2HM7A 5JZSA 3DYVA 5AM3A 2EDAA 2QJRA 4H7IA 5CH8A 1XLUA 4J03A 1LPMA 1UWCA 2PU5A 2WIKA 4FDMA 5C8ZA 1WM1A 2WG2A 2X8BA 5EIHA 2G63A 1SCIA 4HVTA 3WK7A 2JGMA 1R9MA 2WILA 3C8HA 3OG9A 4BVKA 1MN6A 2J3QA 2VJAA 2XMCA 4NVRA 3HXKA 2QT9A 2DQYA 3DLTA 3BDVA 4U2FA 4J0IA 4PF1A 1SOMA 3H0CA 4AO6A 4XWGA 3AZPA 4M0EA 1AQLA 4AZ3A 4W1RA 1QO7A 4GEGA 2QS9A 2XLCA 3C5VA 1MJ5A 1ZJ5A 5AHXA 1YB6A 4FNMA 2WSLA 4AQDA 1BROA 3IULA 3EIOA 4RNCA 1C7JA 4IO0A 3AJAA 2DSNA 4AZ0A 4F60A 3ICVA 2PUJA 5DTJA 4MQLA 3G9UA 1Q0RA 2RGUA 4P92A 4DSZA 5AM4A 2JEYA 3FSGD 3WKBA 1K6EA 1P0MA 3VJKA 2WUFA 1N5RA 1F6WA 1G42A 4ARBA 1HDEA 3VISA 4G4IA 4I3FA 4MJ3A 1QIHA 1DX6A 4LXIA 2X76A 1QO9A 1TCBA 4E11A 3LIPA 2ORYA 4FNGA 4KE7A 4A23A 2WHPB 4B80A 3I6YA 1LZLA 3BJRA 5ALQA 5AOCA 1E8NA 3V1NA 4JUIA 2ZYHA 4PNZA 5D6OA 2ES4A 2ZYSA 1PV1A 3X3HA 4OYYA 5IVIA 4QLOA 4UHCA 1XQVA 5ALIA 3C6BA 4ZI5A 3STWA 2OLEA 4G9EA 3LP5A 3TEJA 3P2MA 5LZ5A 2I78A 5EHNA 2P8SA 2FJ0A 1YS1X 3WYDA 3FYUB 1HLGA 1BS9A 1AX9A 1QJ4A 1UK9A 2OCGA 4X90A 3N0TA 4K6HA 4X71A 2WIJA 2WM2A 3A70A 3PUIA 3HC7A 3VJLA 1R88A 4DGQA 5ALTA 1LPBB 4M0MA 3G0CA 1ZI9A 5LIPA 4MYDA 3M3DA 2VSQA 2HU8A 1VKHA 3KXPA 3D5EA 3HABA 3IDAA 3FCYA 1JT2A 3AZOA 4Z49A 3HZOA 4H35A 4UHFA 3QBJA 3O4IA 4X6UA 1E5TA 5DNWA 1R9NA 2QRUA 3QPAA 5BWBA 3BDIA 2GYUA 4XVCA 1VA4A 5JARA 2C5GA 2O7RA 1XZJA 2XDWA 1UK8A 4U2DA 1LPSA 5T4EA 1TIBA 1QIIA 1UOPA 1MAHA 2VA9A 4BZZA 4JNCA 1U65A 1QIKA 1S8OA 4L3WA 4GW3A 4QDXA 5T4BA 1NX9A 4H7DA 2XMRA 3WKAA 4EY5A 4J3JA 4AN1A 4X97A 1THTA 5EFZA 3TGLA 1QE3A 1CUCA 3STXA 4BRZA 3NGMA 4L9AA 3I2IA 4GBGA 3QZUA 1O6GA 2IITA 5ALRA 3WK6A 4AXBA 3DNMA 1YB7A 5J3JA 3STTA 1MX9A 2LIPA 1G4HA 1CQZA 2GBFA 2WKWA 1JKMA 2Z8XA 3PI6A 4KAAA 5ALYA 4AMZA 4C89A 5BWCA 1DT5A 1L7AA 3T4UA 3FYTA 1IZ8A 4WY5A 3O9VA 1AZWA 5CT4A 4EY7A 5HFAA 3FLEA 4CG1A 2B20A 3BXPA 4G8BA 5AK5A 4ZRDA 4J0DA 2OGSA 3WWDA 2QVBA 1ORWA 1LBSA 2G4LA 1ODSA 4QDZA 2XMZA 1PFQA 3R40A 4DNOA 5E4TA 4DYHA 3OTQA 1XLWA 1XRNA 4QDOA 4BCBA 4Y2QA 4BAUA 3PFBA 4BCDA 1BEEA 4N8EA 1AC5A 4I4CA 2XMGA 2OCIA 4UBIA 5ISMA 2X5XA 5LZ4A 2RONA 4L0CA 3B12A 5JALA 4FFWA 5FXMA 2JGFA 3AIOA 3ESAA 4BTVA 3CXUA 3G7NA 3WKDA 3V1LA 5FUMA 2JGLA 1H2XA 5D7BA 3SK0A 1EH5A 5K3AA 4DLNA 2XE4A 4W9RA 2ZYRA 1CUXA 5AKKA 4BAZA 5ALMA 2RIPA 5AKJA 1DU4A 1UOQA 2BUAA 3Q0TA 4E15A 5D3KA 1CUJA 2Z3WA 4A5SA 4X7BA 2D0DA 4QZVA 2B4KA 2ZSHA 4ZREA 1BU8A 2HA6A 1ZGCA 5AI8A 4CCYA 3WL6A 4HAIA 4K6GA 3KWFA 1ZD2P 1NU8A 1DINA 2WJ4A 4W1QA 4X91A 3EQ9A 5K3BA 3W9UA 2YH2A 2UZ0A 2I3DA 5T4HA 1CQWA 5LYYA 1WCYA 2AJBA 3D3NA 3OOSA 4YK7A 5JD4A 3STUA 4Y2TA 2WTNA 3UUEA 2JF0A 1XZCA 4OPMA 4J0HA 4DNQA 4Q34A 5AI4A 3M81A 4A16A 5CT8A 4EA6A 5HF8A 1UT6A 4FTWA 2H9YA 3D2AA 4OU5A 1QIFA 5LZ8A 2XQFA 3VKFA 1CUWA 1L7QA 2WG0A 2G5PA 4YPVA 1K5PA 3LLCA 1RP1A 1R4ZA 2O2GA 1JJIA 1W76A 1XZIA 1HKHA 3KDAA 5AM5A 2HFJA 4X94A 1VXRA 3WJ2A 2NW6A 3FBWA 5FPQA 1MPXA 4FWBA 4QLAA 3WIBA 4J0CA 5HF5A 5ESRA 5A71A 3DOHA 3L1HA 4LHEA 3M82A 1IUPA 1CVLA 2WG1A 4CG3A 1X2BA 5CXXA 2C5FA 1XZAA 5ALKA 2VTVA 1H23A 2V98A 3WK8A 2H7CA 2WU4A 3E1GA 3SWWA 1W75A 4N8SA 3WLAA 4AO7A 1ZJ4A 1WPRA 4KRYA 2CKMA 1BN6A 2QTBA 4WFIA 5DYTA 3B5EA 5CXUA 5CBKA 5AIAA 4QWMA 2FX5A 3UMJA 3C45A 4W1PA 2PPLA 1JJFA 2I03A 3M83A 2CZQA 4EHBA 5AI6A 1ZOIA 2GZRA 4H18A 4HS9A 2C7BA 4RE5A 5AK6A 4OU4A 1W6RA 2WUDA 1BRTA 4MYSA 4N5HX 2RI6A 3FNBA 1K4YA 1LPOA 4PV7A 3G9XA 4F5ZA 1CUSA 1CUHA 3K6KA 2ONCA 4X95A 4X6YA 1IVYA 4QEKA 4QWWA 2W22A 3C6XA 4H0CA 3W2TA 1H2YA 3AUKA 1LZKA 4TGLA 2GBCA 3MGAA 5EIEA 4WDRA 5AJHA 1GGVA 1VE6A 4KE6A 1FFAA 2VF2A 1ZIXA 3QPDA 5YASA 3CN9A 1ACJA 3V48A 5JATA 2PSHA 3E0XA 2XQKA 4J0KA 1AUOA 1JU4A 3E4DA 5IKXA 4ZXFA 1BCSA 5JAOA 4F0JA 2EDCA 4LYDA 5CH5A 3PFCA 1ZD4A 3GUUA 3STVA 3R3YA 4CFSA 2VT7A 2JGKA 3ZI7A 5AK4A 4BVJA 4DM7A 1EB9A 2WIDA 2JGEA 5IVKA 3VDXA 3PICA 5A6VA 4XIIA 4G5XA 1XRQA 3D59A 5I9IA 4EY6A 1QIEA 5ALLA 1SCKA 1EDEA 5AK3A 3DDUA 4UBNA 2O2HA 4BBZA 1P0QA 1XQXA 1MAAA 1C7IA 5FOQA 4J0GA 3MUNA 1QFMA 2ZJFA 3H2IA 4KYVA 4FBLA 4RGYA 2FUKA 3DJYA 1WB4A 4HXGA 1YS2X 4FLMA 3ZV7A 4KR0A 3QYJA 4DIUA 2DQZA 4CI9A 5BOVA 3V9AA 1E66A 2WHRA 5D3ZA 1DQYA 2ZSIA 2ACKA 4WFJA 4ZV7A 1OCEA 4KE9A 5EIAA 1A7UA 1X2EA 5JAUA 1JFRA 3GA7A 1Q83A 3FVRA 4NZZA 3I2HA 3FYUC 3I6MA 1UKCA 2HA2A 2R8BA 4Y2VA 5DNVA 1TRHA 1EK2A 3KD2A 4Q3OA 2JBWA 1LGYA 3UUFA 4PW0A 5A7GA 3IB3A 2XUAA 5HFNA 4G1FA 4Y2UA 4UBMA 4H77A 1QZ3A 5F4ZA 4ETWA 2XQJA 1XZBA 3YASA 1EA5A 4DTCA 4OD0A 2DFPA 1VXOA 5JAHA 5FLKA 4BRSA 5SYMA 1A8SA 2BJHA 3QPCA 2C0QA 5IH7A 4GDMA 2XLBA 5AKIA 5CH3A 3BF8A 5LZ2A 2B61A 1VLQA 3WIOA 5CT6A 4BYMA 1Q0ZA 2HU7A 4WCVA 3E3AA 3ZPXA 1XZGA 2J4FA 5FDFA 1GT6A 5I7UA 2QR5A 1MO2A 4H7HA 1BEZA 3W06A 2YASA 1AMNA 3IVMA 5KWIA 5AKLA 2CUTA 1H22A 2C0PA 3H2GA 1FFDA 1HBJA 1U4NA 2XUIA 1XZFA 1FJ2A 3TRDA 1W1IA 1C4XA 5SYNA 5I8PA 1J2EA 3I1IA 2OG1A 2ECFA 4KJXA 1ZD5A 1KU0A 4WJLA 5ALPA 2ZVDA 2I3ZA 5T4FA 3QMWA 3I28A 2HIHA 1GZ7A 3WL7A 4HXEB 4BCCA 3ESDA 2ACEA 3DD5A 1TCCA 4X93A 2H7XA 2BFNA 2WTMA 3IUMA 1LPPA 1F8UA 3NWOA 3L1IA 3DS8A 3F9CA 3VXKA 1RYYA 3H19A 4E46A 3ZLVA 2VQ6A 4BDTA 5KBYA 5HK8A 1RWQA 1E3QA 2DHDA 3RM3A 5C7YA 1DT3A 5ALUA 5LLSA 1XKLA 3G0IA 1XROA 1X70A 2E3JA 1EHYA 3C8DA 1LPAB 5H3HA 3WL5A 3WI7A 3D2BA 5K3DA 4AN0A 1YAJA 1OILA 2V9ZA 2WHPA 2WFLA 1E8DA 4P93A 3A2NA 1XFDA 3ZLTA 4BP9A 3I2FA 3QMVA 2HA0A 1LNSA 1SCQA 2XMDA 3V1MA 3GROA 4UBOA 3H04A 3AIKA 2OPHA 2C58A 5AM2A 4UFPA 3OPMA 4OB6A 3I2JA 5CT5A 3AZQA 4YX9A 5LZ9A 2C4HA 2AJ8A 3VJMA 1TK3A 3WWCA 3FCXA 3F98A 2FJPA 3FLAA 2JGJA 5ALVA 3FYUA 4DNFA 2VT6A 4UHDA 2XMBA 5JD6A 2VATA 4CCYB 1LBTA 2XI4A 2OGZA 4JEIA 1Y37A 2YYSA 1N8SA 4B6GA 2Y1KA 5ALJA 5AKGA 5A7FA 3BJMA 4GWLA 3HJUA 5HF9A 4B81A 4Q3KA 1Q84A 5AKZA 1EXWA 3BIXA 5AI9A 1T4MA 4ARAA 3D4LA 1M33A 3S8YA 1FFEA 4B0OA 2DCMA 2HRRA 1TQHA 5ALWA 5CURA 2IX9A 5JZBA 1ISPA 1CR6A 1BN7A 5K3FA 4BC0A 3I2KA 4Y7DA 5AOBA 3PE6A 2WIGA 1O6FA 1U8EA 1K8QA 1VZ2A 3D0KA 1UXOA 4BC1A 5K5EA 3PF8A 5LKRA 2QUAA 1DX4A 5HF6A 1MX1A 1EINA 2QKYA 2AXEA 1QTIA 2WHQA 3H2KA 4KAFA 4FOLA 2PSFA 1CUFA 3SX4A 4D9JA 2ZJ6A 1W4LA 4RE6A 5HQ3B 1QIJA 3WK9A 4B83A 4Y2JA 1ACLA 2O2IA 1ZICA 4FLFA 4Y2YA 2QXUA 2ZJ7A 2GYVA 1CUAA 2XUHA 4BP8A 4BATA 4K5QA 4Q1VA 1A88A 1GPKA 1YCDA 5AM1A 1HPLA 2J4CA 5ALNA 4QA9A 3F8SA 1LPNA 1H2WA 1L7RA 4BE9A 2XUJA 5CRIA 1U2EA 3L1JA 1UK6A 3OM8A 5DTIA 1QOZA 4DMCA 4X92A 5DWDA 3C6ZA 3R41A 4Q3LA 2GZSA 2OCLA 1G5FA 2PKYX 1NU6A 5JZ9A 1MNQA 1K63A 3HSSA 4Q82A 1BCRA 5ALZA 5AKYA 4ITVA 3RK4A 1ZI6A 4UFNA 4X6XA 3DOIA 3VVMA 2XQIA 2OQIA 1YASA 1ZD3A 4HXFB 4IHAA 5FV4A 1JU3A 1UKAA 1CIJA 4UHHA 5JAPA 1FSSA 1P0IA 2OAEA 1W52X 4CCWA 5HKAA 3MVEA 4X85A 2HA4A 3U1TA 5AICA 5ALSA 3ANSA 5JYCA 3O95A 3SC2A 4MQMA 4EY4A 3C70A 3GBSA 2CB9A 3FOBA 5A2GA 4O08A 5A7HA 1D07A 2Z8ZA 2QMQA 3R3ZA 5ALXA 4UBJA 4B9AA 4KACA 2QOEA 4I19A 3G9ZA 1XRLA 4EB0A 3HI4A 4AO8A 4FBMA 4LIPD 3I1YA 2JEZA 4PO3X 4UFOA 3D2CA 1B6GA 3H17A 1WHSA 3HEAA 3G02A 5FRDA 3DKRA 3G0DA 4P9NA 3LIIA 3HYSA 3U0VA 5AP9A 4H7JA 1XZHA 3TJMA 3O0DA 1CUUA 4LXHA 3H18A 5A62A 3QM1A 4BAGA 3AILA 1SFRA 2OGTA 2GBGA 2O7VA 3A2MA 2V96A 3BWXA 2HA7A 3ESCA 2XMSA 1AKNA 4C4ZA 1EI9A 2PBLA 2WIFA 2B9VA 4UUQA 1CLEA 1XRPA 3WYNA 2WU3A 2XMQA 2PU7A 5ALOA 3A6ZA 2VAVA 1TCAA 5DYYA 3GZJA 1GQRA 1GXSA 4WDQA 3PUHA 4Y2SA 5AM0A 3C87A 2J3DA 4H7FA 4JYMA 4XX1A 2RHWA 4C88A 3LS2A 1J1IA 1XZMA 3O4GA 4BB0A 2Q0XA 1SC9A 5EHQA 1AURA 4IQ4A 1EVEA 4H7KA 1E8MA 4YASA 2D5LA 1YAHA 2PUHA 1CUZA 3WZMA 1A8QA 4S0XA 2HA5A 3WJ1A 3WWEA 2CBGA 3F96A 7YASA 4FLEA 1R3DA 4B84A 1XLVA 4QDUA 2VJBA 4X3CA 1MTZA 3DEAA 2DR0A 3G0BA 2V97A 4WFKA 3RARA 5AIBA 2ZYIA 3GFFA 3GELA 3WMRA 4NS4A 4ZV9A 1GKLA 1WB6A 1EB8A 1JMKC 5DLPA 2PX6A 3C43A 2Y2VA 2HHAA 3Q8WA 2BUCA 3ED1A 3O9MA 2PM8A 2K2QB 4LYEA 3ESBA 5ALHA 4ROTA 5KREA 2QUBA 4DNPA 4U2BA 3EQ7A 2HL6A 2AJCA 2Y6VA 3AFIA 2HRQA 1CPYA 1MT3A 2Y6UA 4N8DA 1WB5A 2XUKA 3H2HA 3HLKA 3OC0A 3QH4A 2IIVA 1KEZA 4B7ZA 4JYPA 1IMJA 4PSCA 1YSCA 3BIWA 4EUSA 3FWHA 2OAGA 1UKBA 4FFVA 3B3QA 4C4YA 4LXGA 3WZLA 5CT9A 4ZGBA 1MU0A 3G0GA 3DYIA 2WFLB 4KAJA 4GXNA 4W63A 2EEPA 3W9BA 1EX9A 4MEBA 1N1MA 1E89A 1EVQA 4B0PA 4OSEA 5JIBA 3K9BA 4KEAA 1QIDA 3IUJA 2PL5A 4PSDA 1QTRA 4L72A 4LKOA 1QIGA 2YXPX 5E2IA 1HL7A 5CW2A 3IUNA 5C81A
chains in the Genus database with same CATH superfamily
2WU1A 3HO1A 1CUYA 4NMHA 1G2OA 3SQNA 4EL0A 5LN1A 3ORFA 1PV2A 1VL5A 3E9ZA 3KQNA 1PS8A 2Y1OA 2EJUA 2VJKA 5I7AA 1BFUA 4KSBA 1X0XA 3SPXA 1RIFA 4PZCA 4YUVA 3OQVA 5IULC 1U94A 1TF2A 3PJDA 5U4XA 3E48A 4JBYA 2QT0A 4DMFA 3RSOA 4EGJA 3LY9A 3T9EA 3WQHA 1F0KA 1N7JA 4DANA 1N5MA 3UV3A 4P35A 2ZULA 1JR3E 4RD0A 3FNRA 5DCLA 2OLKA 5AXDA 1RHQA 1ZWKA 1A7AA 5GONF 4ZT3A 4DJFC 4FB4A 4ZJPA 1KMQA 3B36A 2UXBB 2PX3A 3M3HA 1NWHA 5CFLA 1ZOOA 3OZFA 3TSYA 1EFPB 1HE8B 1KS2A 2SCUA 3HCNA 4H2DA 4R9UC 3H11A 4ZZ0A 4R16A 4L75A 3CV3A 2XRFA 1Q0TA 2DJ5A 4FZRA 3KOUA 3HBMA 2QUZA 3P2JA 2MSKA 3ILVA 2YWBA 2HSEA 1PLLA 4XPZA 5LQCA 3LQKA 4CM4B 4M87A 4N3GA 4Y67A 5JS2A 1SZDA 2A0UA 4LF6B 2RAUA 3UWMA 4Q12A 1DEXA 2P3LA 4PNHA 3WISA 4N3CA 1Z7BA 3EVNA 3JWJA 4J94A 4EVRA 5DRTA 4C07A 1F14A 1QONA 2P6MA 3OTIA 3EBLA 4GZ5A 4Z4FA 1FDSA 1AUXA 2N9UA 3N05A 2IY8A 4OQZA 4PLPA 2FOXA 5DHAA 5ELLA 1HY3A 2F00A 2RHRA 1L5LA 4WK2B 3ZCPA 1DRKA 2WSBA 2ETXA 3PF9A 4J9UE 4W1SA 1D2HA 4IHJF 3G13A 3R5KA 2MR5A 1GRVA 3ILSA 3NOQA 1MJGA 1SIBE 2FTKE 5B2FA 3PGJA 2E5LB 1AUVA 3DXZA 4L73A 3VC2A 1LCIA 4RU1A 4QUKA 4ALJA 3BM5A 3NH6A 1DRVA 1JNYA 5KNBH 4P38A 3TTSA 2OV4A 3ZWOA 3CVJA 3R9XA 1DRJA 1EBUA 1FOEB 3D6FA 4GNRA 3HU5A 4Y9SA 4D3XA 4RJ2A 1GV1A 4EB6A 3L43A 1PR1A 4QELA 4HUJA 1VCHA 1N1GA 3L7NA 1BMTA 3L9WA 3NV9A 2I4NA 1UZAA 3RVJA 1D7AA 4ZVSA 1YULA 4CKXA 4ES6A 2VTBA 1J1ZA 5CNIA 5IKPA 3SYMA 1VG8A 3GEDA 3UMSA 2O59A 2BIFA 1RAIA 3DUFA 4H3VA 2E4AA 3AINA 4CIDA 5K3CA 1ZVVA 2P79A 5DCWA 2I9KA 2TECE 3KJQA 3ZCRA 4N3BA 1X19A 3ZE7A 5FX2A 4DABA 2CJPA 4I4NA 2GMWA 1UFOA 1QHFA 4U3JB 5IARA 3VX3A 3ZLJA 2PX5A 3CUWA 1VYHA 2MHCA 4INOA 4ARVA 5JCPA 4YLGA 3OZ7A 1C50A 4R3WA 5TMPA 2QXTA 5DW0A 1SC4A 1YL7A 2YW2A 3FDXA 3M4NA 2IELA 5A6SA 5K0TA 4DV5B 1CQXA 4HO1X 1B4DA 2ZPUA 3UFXB 4NCIA 4C4XA 1E2PA 1JQ3A 2AX3A 3GIWA 5ALDA 3FOCA 3PNQA 2Q5FA 4DUGD 1FYDA 1WWKA 3EG9A 5DTEA 4P54A 3V6LA 4HRVA 2PSDA 1Z08A 1SVUA 4ALKA 3N2ZB 3RCBA 1P1FA 1RFLA 1XZEA 3VX4A 4I1VA 1DRUA 1JFVA 1ESCA 4JYBA 1YR2A 2QX8A 1VJTA 2O2DA 4ZGGA 3L7OA 4KX3A 4YCCA 5CCEA 3GH3A 3U3MA 1L5HB 1MVLA 3EARA 3WS7A 1CYEA 2CHGA 4WZAE 3C3YA 5JQGF 4PE5B 4IKPA 2H06A 3SSMA 2NVOA 2WKQA 3Q9SA 2QPTA 3PSAA 2J9XB 3D7RA 3HJNA 4O59O 3T7JA 1HYHA 4RSMA 5DM4A 3ITDA 1FL9A 1ESZA 3N2KB 4S05A 1GKKA 2V3VA 3P20A 3PUJA 1F0PA 1ORVA 3KU4A 3LDAA 1ZUHA 3O4FA 4MV7A 4C01A 2DT8A 2LP4Y 1SCNE 3C14C 1J06A 3DDOA 1XTKA 1JZTA 1W5FA 2CLIB 5LKAA 1P0PA 2D4HA 2ZE7A 3R24A 1I7LA 1ZGAA 1YRLA 2C5LA 3D0OA 2QMZA 3FSJX 4R2KA 3SBOA 1YBHA 2HU5A 4GHWA 3HR7A 2MCFA 1AT1A 1XB2A 3C1TA 3WNBA 2JIBA 3ZHXA 4NOKA 4FHZA 4PZZA 4J29A 2RK6A 1J8MF 2O5VA 3PGMA 3TZ6A 5LL6P 1GPMA 1Z56C 2EL7A 1JDJA 1CZNA 1ZESA 2UUOA 4C4AA 2HIMA 2H29A 4KPGA 3GLGB 5KJEA 1TZMA 1BDHA 4CCSA 3QITA 2CV2A 4BFLA 3H6GA 1RE0A 3MIZA 3PWKA 1NNUA 3H3FA 1ISHA 1W30A 3OJFA 3SZGA 3OEWA 4B35A 5AT1A 5AVUA 1CDEA 4IMJB 1JEEA 1G6OA 3ZWMA 2VUHB 1WHTA 3LBFA 4C7KA 3WZ2A 3MWJA 2Y66A 4BLPA 4BQNA 1X8KA 1TT7A 1VECA 1XKTA 2PH1A 3O94A 5FYDA 3VBEA 4GGOA 1MRNA 3JALA 3C16C 4LC0A 2AI1A 2Q1TA 3D8UA 3QEMB 3PZBA 3AKZA 5CIQA 1KMNA 5DX8A 3TX6A 1J90A 1I7SB 2QVGA 3ZZTA 4AM8A 2Y92A 4ESVA 4MKIA 4AZTA 3R7SA 1FLNA 2A14A 3A1FA 3UAYA 2QB5A 1HSZA 3LGXA 1WD5A 2PKRA 4A91A 5EQJB 4Y6SA 3QVOA 3PL1A 2R11A 4O4LA 4WN9B 3TLAA 5IU6A 4PFSA 2H8KA 4ZCMA 1NF8A 1TO2E 3G85A 3QX7A 5ECWA 4PSUA 5DVZA 4IRUB 2J0VA 2ZXEA 1H5UA 1PEDA 3NAQA 1FFYA 3K1ZA 1J9EA 2IH4A 3A4IA 3H5WA 1B8UA 1DIBA 2ODWA 1JNXX 1XVAA 2B1GA 4H08A 3SZRA 3TAHA 4Q3DA 4OV6B 3KM0A 3OE7D 1ISSA 2B7CA 2AMJA 3LDFA 5D00A 3REQB 3F73A 3BF7A 4RH1A 3BCUA 3GAAA 3N0RA 3RTEA 1PVOA 1RHRA 1KOJA 2DFLA 2FK8A 1Y5LA 3HGQA 4HQOA 4L5AA 3LCCA 3PFNA 4OK6A 4U2EA 1O4VA 3R3WA 4IS3A 4NBKA 2O8FB 3BTVA 2WFMA 3LP6A 3WDMA 3VTZA 2V7EA 5ALFA 3GRRA 3L8MA 2VJDA 1JR4A 4WXHA 5LQMA 3IQEA 4A0QA 5B4UA 2FMTA 1A76A 2BM1A 3JQAA 3GT3A 5JFGA 4ZEOA 5ICCA 2H2AA 3A3NA 5KTOA 3BK2A 4GLFA 1G2PA 2QZ9A 4IIUA 1YE3A 2Z2JA 3MRSA 4JL6A 2R7MA 4KL8S 1XTVA 4NBNA 1JBKA 4R7GA 4MXDA 3RFTA 3PGLA 3ZN2A 1Q0PA 4B4KA 2FFAA 2GD2A 3TTUA 1A8PA 1NSYA 4J7AA 1ONBA 1T1SA 4OSOA 1KOFA 1Z2DA 3L0BA 1W5BA 4MV8A 3I2GA 4P08A 3A1NA 4HDNB 4QT0A 3ZWQA 4GMHA 2QW8A 2QD4A 2GXUA 1V9SA 1UBGA 1T1EA 4XE5A 1GPLA 1TJNA 3GLIA 1N7GA 1IQ0A 1MC1A 4LF7B 3P2KA 4DC0A 1K06A 3DO6A 3BG5A 4F1JA 1IMOA 2B1QA 4MV6A 4W9NA 3SX0A 1RSZA 2REQB 3N28A 3RVRA 2C04A 3LQQA 3UAOA 2G5TA 1UXKA 3OCWA 4G9GA 1YWGO 2ZBRA 3CFYA 4DHWA 2VPTA 1AQNA 2G5GX 4UD2A 5JMTA 3A28A 1RYDA 2QV7A 2OBLA 3V4SA 3BB3A 3DNFA 3NTRA 2H57A 1PGOA 4H7EA 4HHEA 3K30A 1EK5A 5HBGA 1SUFA 3GN2A 4JFRA 4US0R 3LNCA 4PZUA 1TQ2A 4J16C 4XQ9A 5K09A 4EEZA 1ECCA 1N5DA 3FDJA 5J4VA 1DWOA 5F3WB 3K53A 3KSUA 4HX2A 2H5JA 5LB4A 2V7GA 1IUOA 1M34B 3IURA 1XVVA 3S2GA 1P3DA 1G5RA 1PNVA 2AFHE 1TCUA 2FZ4A 2KX7A 4JJ7A 4K0RA 2W70A 3ZY5A 3W1VA 3NBYC 3BE6A 3WC4A 2XE8A 5CVJA 1HFJA 2EZ4A 1AGYA 1QHHB 1SELA 3B8HA 4R2IA 2DE0X 3LVQE 2PRKA 5LB2A 5C8YF 3BAFA 1E0JA 5K3EA 2I7CA 3OE5A 5DYNA 2AR9A 3D4OA 5IK2D 3DTNA 3MJTA 4LF4B 3Q7SA 5AKXA 2EWVA 1N2CE 4S1NA 3DM9B 3IC5A 1MOQA 1V25A 1KDYA 4LNUA 4F21A 2BCGY 1OV4A 1SU8A 4A5OA 2Y3IA 2FRXA 3AETA 3N70A 3A2LA 3W8RA 2IL1A 3RS7A 1KERA 1QS0B 5LP1A 4ZEMA 3DP9A 1ZQ1A 2ESRA 4I9NA 1L5VA 3AEUA 3EWAA 4NBUA 3RUHA 3MUOA 4IUYA 5EERA 3UYKA 4KMMA 3T34A 3EEIA 1GT91 1PJLA 2AI3A 3DEIA 3L40A 4J9VA 4RPIA 4F7DA 4U7DA 5FA6A 4PC7A 5JVDF 4A1OA 2OQRA 3GZNB 3PTZA 3KALA 2QTMA 3S68A 1Q7GA 4EDFA 2GF9A 5HQ3A 2WUGA 3DTVD 2XQGA 5IM4A 1RCTE 1MOPA 3H16A 4NCXA 1K7SN 4XUEA 1T2NA 1EFKA 1ZN2A 1QAQA 221PA 2NO6A 4AIIA 5IWCA 3TWOA 3U13A 2IZZA 1ODCA 1P4HA 3EXFB 3ZW7A 2P35A 1OREA 4X00A 4V0SA 2JFHA 1DG1G 5SV2A 1IBKB 3IPAA 3LT2A 1QZUA 2XVAA 2ZDHA 1AQJA 1CF9A 3IP7A 4A10A 2N3ZA 4KLNA 2PNFA 3RADC 1UWLA 1GGMA 3DD1A 2PSEA 1JFFB 2GDJA 4NE9A 4QPNA 4AWXA 4FQ7A 3QUTA 3WSVA 2QZPA 3CRRA 3P2OA 4HR7A 4TSKA 1OX6A 1KYQA 1MNAA 4PIPA 3HN6A 1USWA 1XCLA 5J5CA 4BKQA 1KBOA 2LGJA 3M5CA 1IEVA 1N3IA 1Y3FE 3BD7A 1M1ZA 4JP5A 2W83A 3COWA 1B6TA 2I4IA 5EHZA 5EUBA 4DG9A 1IHUA 1J8VA 5EIOA 3KKKA 1V71A 3C3DA 2GO1A 3DTYA 4X61A 3IA2A 4QE3A 5I7WA 5H70A 4D8UA 2OBMA 1EEHA 4KPUB 3SLKA 5JANA 2UZ4A 2F1RA 4WK4B 4WLOA 1Y3AA 2IBSA 2DHCA 4O6VA 2C2YA 3DL7A 1RC0A 3SP1A 2GKSA 5BV7A 4K9QA 1G5HA 2H52A 4YCNA 1ADCA 1I2AA 1WOMA 5EL0A 3LHKA 5FR1A 4N5LA 3ZWWA 3PGXA 3Q87B 1MX5A 4UAJA 3WGUA 2HBQA 1NMQA 2JLZA 5AVKA 3UGQA 4LMPA 3LNTA 1NJFA 2F1HA 3DVLA 3NBFA 4B9EA 2NU8A 5FBRB 5J40A 1UM8A 1ZAKA 3I76A 4HH4A 1AQIA 2QXYA 4PCAA 2Y67A 3STUA 1IHYA 5KQLA 1DJNA 1VOTA 3DOJA 2I2WA 4NATA 1WKVA 4RMHA 3W3AA 3RYCB 1WCIB 2WSSD 3ILXA 2O7NA 1TRKA 3SNHA 1ENOA 2QK4A 4NYIQ 4M8SA 3RHTA 2IKQA 1CUEA 4KVZA 3IOYA 1KI7A 1KY4A 1RCFA 1U98A 3L6OO 2P9TA 3LVBA 4GECA 4EFMA 1QR6A 4S35A 4BLOA 4D3YA 2YUIA 4V2IA 5A1TA 3ZGOA 3I34X 4P3NA 1T5SA 1WF6A 1XRMA 2BKLA 4Y2XA 2R79A 4HV4A 2IH5A 1OI7A 1FZTA 1SVNA 3UEOA 3DULA 1GA4A 2OB2A 4CM7A 3ROZA 1M1NB 4R6XA 5JD5A 1D2NA 1IOZA 4RQTA 4DT1A 1MG5A 3M4YA 4G81A 3GVHA 2GZAA 2X58A 2YBEA 3CWQA 4FQ8A 4I5GA 1ZO8A 3KTDA 5CYOA 1E2NA 3RC1A 3ZJ4A 4B8WA 4BLQA 5AVWA 1ZVKA 3COZA 3PDCA 1MAUA 4NV3A 4BQIA 3WWOA 2XNDD 1Z5GA 2R1ZA 4UW9A 1DAHA 1L5ZA 4NCJA 1MF7A 1H8EA 2GN0A 4FW8A 3RTDA 4EHJA 1JEQA 2GRJA 4JWKA 4PN3A 3U4IA 4HY3A 3TEMA 2OORC 2R00C 1K8ZB 3QU9A 3K0EA 3EZ9A 4JVOA 5BUSA 4HWOA 4V0OA 4URVR 4FDUA 4JBNA 5I7SA 2I80A 2BFEA 2AWNA 5ECDA 3ZGYA 2W9XA 2QJRA 3ABSB 4QYSA 2RK3A 1M0EA 3C6KA 1XLUA 2QJTA 1G1AA 2O05A 1I1HA 5CH8A 4DDHA 3MHTA 3QPUA 1LPMA 2J9GA 1L9KA 1NBEA 3SI7A 2TMKA 1HLDA 4BFYA 4YUWA 3IIJA 4AQYB 3U4MA 2KPOA 2D2IA 3MS7A 4XUCA 1U3TA 4YCJA 1WM1A 4E21A 9LDTA 5FOVA 2B7LA 2JLXA 2X3FA 1GRNA 2CV0A 2J9ZB 3J7TA 3AP1A 2CNBA 3O26A 3RJZA 4G0WA 1SCIA 1OLSA 2JLBA 1AO0A 3FUXA 4JZYA 4HVTA 4WI1A 1Z07A 5HA5A 4E3ZA 2RDMA 4BNZA 1M6HA 1XAGA 4HNQA 1CW2B 2A3NA 2YOGA 3SXUB 4I4TA 1APBA 1C81A 3OG9A 2H85A 6REQB 2Z6QA 1YUNA 1PL8A 1XPRA 4OQMA 1VYTA 1UPUA 2YDXA 9ABPA 4L5JA 1SQFA 2PMKA 1WQ3A 4NH0A 4XIYA 4BQQA 4DQ0A 4G26A 2XMCA 4WNCA 1SXIA 1G21B 2XVMA 4NVRA 4X8OA 2CDBA 2ODPA 1P2GA 5CFQA 1CS4C 1C9MA 1KDPA 3TN7A 4RHTA 3OTWA 5GGXA 2FI1A 1JLRA 2VNSA 3TTTA 5B3LA 2BBTA 4XDZA 5TS2A 4F9EA 1AKEA 3IHLA 1ILWA 3EGXB 13PKA 3QBTA 3I9V6 1XMIA 1SOMA 3D02A 4DCTA 3H0CA 1KI3A 3K4QA 5EC8A 4AO6A 3UVEA 3UENA 3AZPA 2HRZA 4KSYA 1BHQ1 4LZNA 2E4VA 1FDIA 5KAPA 3FZGA 5CITA 4AZ3A 1YRBA 2YHAA 3JYOA 4PPGA 3VMMA 4C3ZA 5REQA 3JARA 5DCYA 3IQXA 3C5VA 3THSA 3TLMA 1RJWA 4FYIA 1Y5MA 3VKHA 4IF6A 3U9SA 1YQWA 4PPNA 3OEYA 4LTNA 4M9RA 4FFBA 5CDFA 3ND9A 1X14A 2HHLA 4R6WA 4EHLA 3G6WA 5KTYA 5BW8A 1KO7A 3NRBA 3A1CA 4H4EA 3AJAA 2DTEA 3AOGA 3ROGA 2EP8A 4CW7A 4AZ0A 2GEJA 3Q5DA 4R1NA 1QXSA 1V9LA 2R8OA 1DBVO 2NO9A 2YNMA 3NEAA 3BN3A 4S24A 1JDVA 2EVWX 5TXGA 4POOA 1JIIA 1BTOA 1Q0RA 1VMAA 3WBJA 3D0RA 3DB1A 4YACA 1X1SA 4B6SA 3I1FA 5AM4A 1RR6A 1BH2A 1OBVA 4LZAA 1SXJD 3M1IA 1GPH1 3FSGD 3NHRA 3PL5A 5JCOA 4CWAA 1TK2A 3LH5A 5JFOA 4J1QA 4G1UC 3THWA 1S6YA 3UJCA 4ER7A 4A2QA 2WUFA 2EFJA 3OLQA 1YZYA 2IUFA 1P4SA 4W82A 1XD2A 4P0PB 3B1VA 3TXYA 1K7FB 1RYMA 2LRHA 3DV0B 4JKIA 4HYEA 2EWMA 3ZGLA 3V4RA 2L0XA 3E7WA 5DHQA 4AUEA 4I14A 3ZX5A 1KDOA 4G4IA 2CMHA 2WUVA 1CK4A 1YR1A 1DX6A 1QCZA 3AEQB 4OO3A 1UPCA 4PHTA 1TCBA 2CVPA 1M6VA 2R3SA 3NKLA 4O1HA 3R6WA 2F3SA 5BN1A 4X1KB 3JAWB 4YJ3F 2BHSA 2O3QA 3L1KA 4NH4A 1GFIA 4FNGA 3VOTA 4BZPA 3S2FA 4B80A 1HYQA 4AF7A 1VIMA 4JHLA 4TM7A 3KHSA 1CNEA 1RWBA 2XE6A 1SVIA 2XTJA 3I6YA 1QHXA 3SYLA 1YZNA 3RTAA 1IM5A 1QF7A 3WDLA 4AKHA 1WV1A 1IIRA 1DDOA 2OYSA 1VGQA 4YLYA 1OYVA 4XJTA 4HGPA 4BNYA 2BV3A 2Q21A 3EA0A 3FPFA 4ML3A 2XUZA 4NENB 1WX1A 2Q1XA 1DOZA 3H6KA 2ZYDA 3OQ6A 1O08A 4OQFA 3TAXA 1KZGB 4LTDA 3DTVB 1AV7A 1MVNA 2JRLA 2N75A 1NQOA 3M2PA 3IAFA 4DADA 4DIMA 1PR0A 1J23A 5EMKA 4ZIRB 2ES4A 5IN5A 1PNOA 2OC9A 4JT9A 2H1CA 1PV1A 5DNYB 1NYLA 3X3HA 2Z43A 4PYKA 3R76A 1GNLA 4TMVA 4HPWA 3NPAA 3GFQA 3F3MA 4HYYA 2J1LA 4OYYA 3MGKA 2CJFA 2NT3A 2GVNA 2YYAA 2AOUA 3QKRB 4EUEA 2A58A 5GONB 2JCBA 2QN9A 3ONEA 2A5GA 3QF4A 4Q7EA 2OLEA 4ZCSA 1VRVA 1KP9A 2VDVE 2ZDQA 3EZ2A 3Q4GA 4RMIA 2NWQA 2P6UA 2XZDA 1TA4A 3LP5A 1Q1NA 3P2MA 2I29A 3TEJA 1FS4A 1NVGA 3H9GA 4ZDJA 2QL6A 3EULA 4TV8F 3BHIA 3ZZ1A 1N2OA 1NVDA 2FJ0A 2EERA 4Q3BA 1I30A 1KYYA 1UBCA 2FXVA 2XB2A 1T43A 1BXRA 1IDOA 1BS9A 4OLBA 1L7MA 3O6VA 1D9ZA 3P94A 2Q1WA 3TM4A 3H84A 1X1TA 1SB8A 2X9NA 4K6HA 4LQLA 4P86A 4PR3A 4ENWA 1N78A 2QL7A 1GGFA 5KEIA 4K9KA 4CMEA 1IOLA 1I4EB 1GZSA 2BKXA 3A70A 4NCHA 1KVRA 1TT5A 1R88A 2W6QA 2ZROA 4LTMA 1Q5PA 4D3ZA 2FK7A 2CLEB 1GSAA 1RAHA 2QG9A 3A9SA 4XYBA 3P0HA 2OA0A 3U62A 3WP0A 3NXSA 1E6LA 3NBAA 3OC6A 1V4BA 1LPBB 1D2MA 2IQIA 4K46A 4KJZA 3ROEA 4YDSA 4ENUA 1JKXA 2P69A 3DE7X 3KKMA 4WOJA 1E0KA 1NA5A 3IDSA 2VPIA 1NW7A 2H63A 4PICA 4IHJB 2QDKA 3R8XA 4WKOA 1K2WA 4DIKA 3LM8A 1NP7A 4MV3A 3ZQ4A 2G76A 1NM5A 3KLPX 3KXPA 2GT1A 4QTZA 2WD8A 2CXQA 3HABA 5D1HA 5EWLB 4Q93A 2GA9A 2AIRA 3KB6A 2OM6A 2A86A 3HA7A 1T36A 3I6QA 3ETJA 3Q0EA 3AZOA 3RYHA 4TRRA 3NT4A 3I53A 4QUEA 5KHOC 3I32A 3N58A 4HL6A 2M6LA 4AY2A 1EWTA 2MSNA 1QBKC 4H3SA 3NKFA 2PYDA 2QX4A 4N82A 3DMHA 1E5TA 4D99A 3IVCA 2XKAA 4TQUS 2QGFA 2G7MC 1L4BA 5H1YA 5L8VA 2YIVX 4X5OA 4BO3A 4OTZA 1R10A 2GRUA 5DF1A 3IAEA 3LXMA 3SOPA 2CK3D 3HWRA 4ZAWA 4AKEA 4F8JA 2ZQZA 1E1KA 3WGHA 4XVCA 2FCAA 4EKDA 2TMYA 5A0VA 1I10A 3A6DA 2VH5R 3K5PA 4PQRA 3TD2A 4KFRA 4C6RA 4CQNA 2XDWA 4CM8B 3A4YA 4FONA 5EXTA 4YV2A 1LPSA 4G5FA 1KTIA 1Q1GA 1RWVA 1LTKA 2A1TS 4OJMX 5HIJA 3ZE1B 3RYIA 2AK3A 2QAIA 3SQXA 2BSXA 2PLWA 4QHYA 3QVTA 1E77A 2CT8A 5JCXA 1L7PA 4FNOA 2NO7A 3O8QA 2J5RA 3JQ8A 1OAOC 3BGIA 4OHFA 1Y3IA 3QYFA 3U4GA 2FFRA 4QDXA 2J3MA 5HZKA 2DCUA 3K09A 3GIDA 1RYNA 4H7DA 3VKUA 1Z0AA 1UC4B 3OOYA 4RVNA 4RXTA 3SF8A 4EY5A 5KYVA 1L1EA 1WY5A 1DBWA 4J3JA 3U3JA 4EG8A 4A0RA 4ZT6A 2EJCA 4JBHA 4X97A 5B57C 1KY3A 5JQGB 4AG3A 4C20A 3ZK8A 3X1KA 4EJSA 1GN8A 4OBWA 1M9NA 2JIRA 1VKZA 1BQ3A 2XNKA 5KOJB 3OWOA 5BY2A 3F9RA 4P6VF 1Z12A 3AB8A 2ZYVX 3OSUA 1DAEA 1YL6A 2PIDA 5FF9A 5TARA 5JPDA 2ZUUA 4GBGA 4IJ6A 4EAAA 2FSIA 4QFBA 1MC4A 1F48A 3F47A 2LKCA 4G2TA 3CG0A 5L4LA 3QZUA 1PJBA 4W5TA 1O6GA 5K0FA 5CDSA 1P80A 2AG5A 2YWCA 4F06A 1J20A 1U0LA 3JYNA 4NNPA 4DREA 5KVSA 2WTUA 3STTA 3BFJA 1C4KA 3LFHA 3V34A 1IJEA 1OIVA 2NUBA 3OCUA 3OZEA 2XOKD 1Y6RA 1CNMA 2H7VA 2QAGA 3JASA 4JLBA 1HQKA 2D1RA 3VZRA 1O1YA 2WMOB 3ZXUB 1C7EA 1TTPB 3IAXA 2ZJOA 1N3LA 4YYEA 4RS4A 3JXEA 5JHGB 4KAAA 2PA3A 5ALYA 1M2OB 1XTBA 2YWDA 4XB6B 4WK0B 3TDKA 4C89A 4UOZA 5A9SB 2YZ7A 3RANA 4W6QA 1HE2A 3K73O 2V7VA 1Z5PA 4U0KA 3QENA 3IDZA 2I3AA 1Y8RB 4OYRA 4B3XA 4N48A 4RIHA 4JJGA 4RAOA 5CT4A 5ETJA 4EY7A 3MB8A 4ZEVA 1IY8A 2CVOA 1Z28A 2E48A 2JJ2A 4C0BA 4OGWA 4WVFA 1OZAA 3L0SA 2I1LA 1BDJA 1I01A 4RK7A 4RJKA 1JIVA 2FX3A 1EFPA 2X5OA 4JGBA 4J0DA 2GSDA 1V5GA 2JCGA 2OGSA 4ZO7A 2DPHA 3B9QA 1AMOA 4A6DA 1KR2A 4L8FA 3VSDA 3WYAA 2H92A 3NAZA 5CA1F 2LNDA 1Z4IA 3GCDA 3WWDA 4WCFA 1LBSA 4QDZA 3WLPA 5EXXA 2DY0A 1VRCA 2V74B 4N0EA 5KNCD 1J2RA 4XXHA 3BWVA 4ZVRA 4CM4A 5KYWB 2WP0A 4DYHA 1PQPA 4MW7A 3OTQA 2EX4A 4Y18A 3DZDA 4OHCA 3OA2A 1W88B 2QSJA 2RH4A 1XRNA 5L3SB 2C9DA 5ER9A 4H59A 3FPSA 3DP7A 4P7JA 2J3KA 4BCBA 4Z54A 3JV7A 1E20A 3IVRA 1ISJA 3JQ9A 4EI8A 3AR3A 2P9QA 3OO1A 4DKXA 3PFBA 4BCDA 3KPWA 1BEEA 3IODA 3ZV4A 1KQPA 3F3KA 4N8EA 2BTQB 4KFCA 3WX0A 4AJOA 1ZHOA 2KB0A 3U2QA 4MS4A 3WGIA 3A6HA 2XKJE 4Q48A 2BFPA 3R0JA 3I9JA 3ACDA 3N8HA 3TL3A 2EW8A 2ZGVA 3FYDA 3CW9A 4U5QA 4LV8B 4Y6GB 4L0CA 3QLVA 1TU4A 4H1UA 3KJFA 1JQKA 4FFWA 2YMQA 1WCXA 1XVUA 3RUEA 1YC5A 1Z2PX 3PQ6A 3QUCA 1U7UA 1TX4B 2I8CA 1R6BX 2PFSA 2JK1A 4PY2A 2G9QA 2FXIA 2VWHA 1ZBDA 4BTVA 4B3TB 3JZMA 3QVGB 3WHIA 4KFUA 3SC2B 2P9CA 5FUMA 4BMXA 1J1UA 2WF9A 3FB4A 1H2XA 3MK31 2IHYA 2LCQA 5FFMA 2H5IA 2W6MA 1O96B 4U3JA 1Q1AA 4WXYB 3ANMA 1FNDA 3AG5A 3O2QB 3G2JA 3OLZA 3HCWA 2PZKA 2PZ8A 2C8LA 4QJ3A 2QUIA 4N0QA 2A5JA 3P9XA 1F6DA 2W11A 3VO1A 4I7EA 2XE4A 1BU5A 1MLDA 1YBVA 2WOOA 4LF8B 2C5SA 4L0QA 3NMUF 2PMWB 4EFNA 4MKZA 3TIGA 1VYVA 5EJ6A 2XGJA 4BAZA 3AF6A 4ZI2A 3PVZA 5E1OA 5JBQA 3M6XA 4LFAB 1F5NA 5A5FA 1YR8A 3DJFA 2ZXFA 5H16A 3Q0TA 3T7IA 1DARA 1PR2A 4QYWA 5D3KA 2ZAGA 4ED9A 1W48A 3PQEA 4IY1A 3EC7A 1ZRMA 4PQFA 5LP6C 4A5SA 3RC8A 4GOJA 5HNKA 4X7BA 5SZKB 3JY6A 4GOOD 2IIBA 2D0DA 4B4OA 2GPBA 5C1PA 3H05A 2WZBA 2AYZA 1L5HA 4QZVA 5EZ6B 4HN9A 2JS7A 3RK1A 3DC7A 1TUIA 1NQXA 2GPJA 1BU8A 4BNTA 1FE8A 3IO3A 3IIEA 4B6OA 4K6GA 4ZTBA 1X80B 4O0LA 4C0JA 3EY4A 1ZD2P 1QGOA 2E9SA 1L4UA 4S12A 1AD2A 2HQOA 4ZYZA 4RF3A 3EUWA 2WJ4A 1KK2A 4Q16A 3KSBC 4TKUB 1C7QA 2AMYA 2ZI6A 3DW3X 5K3BA 3V00A 5CEEA 1URPA 5C8YB 3N8NA 3LK7A 5HS6A 2YH2A 1KQGA 2I3DA 3PIRA 5IP5A 2GBLA 3VKGA 2QVCA 2AJBA 5B37A 2WMDA 1A5ZA 3A6GA 1GGHA 1Z13A 3EN0A 2R1UA 3U6KA 3AY7A 5B3JA 2PLNA 3ECCA 2C2GA 2NSYA 3V2HA 5CAEB 4NFHA 2J3HA 1T9GS 5CHEA 1P7VA 2PWBA 3PITA 4FYWA 3W2FA 1GSIA 5IHPA 4MWEA 4UHKA 3RD5A 3W5JA 3WGGA 3GAMA 2W00A 4MPJA 4DQDA 5TLSA 3GGJA 3ISVA 4CEHB 4YRBA 4RDIA 3GLGA 5D5HA 3OD1A 1I14A 3PQ3A 4Z5XA 1O8BA 4R41A 1VPDA 2QROA 1M74A 4Q34A 4ZPJA 3V32A 2W6JA 3PFIA 2A8YA 4JK3A 5LUAA 2XCRB 3ZW8A 4A16A 5IT9A 4YMTA 1LS6A 3L06A 1ZJZA 3TPZA 4WIAA 5JVDB 4EIWA 6CHYA 3BFXA 4L74A 3LK6A 3ZIAD 1MV8A 2H9YA 3VAYA 2PRYA 1YDEA 3R7LA 1R9JA 1LJLA 4A0SA 1ZL2A 2CVFA 2I7XA 1CUWA 2P62A 4ZTUB 4M1ZA 4WQMA 3H2SA 3L0ZA 3QEMA 2GBPA 4RGVA 1PDOA 4IIBA 5CNJA 5CXSA 1FSGA 1E4OA 1FRVA 1WAMA 2E37A 4IIGA 4P5DA 1X9IA 2ZWVA 4FOTA 4G5SA 4E08A 4KHPB 3VHXB 2XTNA 3VTFA 2O2GA 2PLFA 1TU3A 1TJPB 3KQOA 1IJFA 3ZH2A 2E89A 2GJKA 1E92A 4WN9A 3T4XA 4WUTA 1FBNA 1QFJA 3FNHA 2Z56A 4Q01A 2QRVA 4X94A 4K1LA 3C0KA 5DTRA 4ZYUA 3EMKA 1N0HA 5I6DA 3CVWA 1CY7A 3FBWA 2WF6A 3DFKA 5FPQA 1QVRA 4RM3A 5BR4A 4WV3A 4QLAA 5EJ7A 3IGFA 5HF5A 5A71A 3JD0A 3NTUA 3OZBA 1RHJA 2NQ8A 3CLUD 1ZEJA 2BT4A 1A95A 3REQA 1HFEL 2NADA 2QDXA 2E18A 2OEPA 4KK4A 5BXYA 4JQOA 1P7WA 2FZLA 3INNA 1JFLA 3CZRA 1FYEA 2IV7A 2Q28A 4DIOA 4DMRA 3JZDA 2QEQA 1DUIA 3W34A 3CUUA 1E6WA 2VTVA 5FWDA 2V6IA 1JH8A 2DWOA 2IEIA 2H7CA 1QTNA 5AUQA 1QNLA 1Q50A 2JVKA 2FW0A 3GGDA 3ISJA 3MSCA 4UUBA 4IZ6A 4AO7A 4TVSA 4IDAA 5JS1A 1D2CA 4V0ME 1PT7A 3LW8A 4KRYA 1GVNB 1RZRA 3M1AA 3AI3A 2JARA 3G59A 1TTHA 4IMIB 5EIXA 2DTDA 4KU4A 2NZXA 1IDN1 4WFIA 1EUYA 5ILGA 2IKSA 1DIAA 1G3MA 4HDNA 4RETA 3AL0C 3ZE6A 3H1EA 4CMBA 3PHLA 4F12A 1FEZA 1GAQA 1QE0A 1R7RA 2PKXA 2VOJA 3WGQA 1VFPA 2PPLA 5TMEA 1LUAA 4BZQA 4JJFA 2J59A 4XB1A 5AI6A 4EDHA 2ACWA 3OTGA 1ZOIA 2REQA 3RKRA 2GVDC 4LXXA 4HYQA 2VYVD 3GQVA 4L6IA 3EVGA 1JVBA 5AK6A 4OU4A 1W6RA 2B0JA 3WWZA 3JPYA 4LSZA 4WZAB 1NVVQ 1DC7A 1XN4A 4DXDA 1W25A 1C3EA 1SOWA 1ZVJA 2CEAA 3OPNA 4IFBA 4N5HX 1NXQA 4COOA 4E33A 5G0VA 3OUUA 1K4YA 5HKOA 3GQBB 4MQUA 1LX7A 2F43A 3CZ5A 4H6VA 4PV7A 2UVQA 5SICE 4C6SA 4CM9A 4F5ZA 2HX1A 5EKSA 1ZJWA 2C4UA 3IVGA 4CF7A 3K6KA 3ICPA 2JCYA 2JEOA 3DAFA 2CNLA 4X6YA 1C0KA 1JVSA 4KH0A 4X95A 4ZEXA 4G0PA 1KEEB 1VL8A 1GTMA 3C8ZA 2Q7DA 5KSYA 2W22A 4YFYA 4HB3A 3N0XA 2DWCA 4G65A 5DKFA 4KLCA 2GEKA 3KLMX 1YS9A 2AZ4A 3MGAA 5EIEA 1FMCA 1OTXA 1PD1A 1IBSA 4HP8A 4XI9A 4B2YA 4XWWA 3MA0A 4QGBA 1SOAA 3KTAB 1FC0A 4KE6A 1NMXA 4PXYA 3A2KA 1EK0A 4OA8A 3ROQA 1QHHA 3QPDA 4PR0A 3K9WA 4AZVA 5CD9A 1DADA 4QGHA 1Y4AE 3CH7A 2Z4SA 4MV9A 1S0UA 4EYEA 4HNSA 1M83A 1T25A 2R8ZA 1PU2A 2NYUA 3R09A 5SZHB 3IBGA 4UTZA 5EA2A 3GU3A 3NVAA 1FRZA 2YWEA 1QVAA 1VIYA 2FSSA 4J0KA 1AUOA 4M1EA 1F8YA 4PXSA 2EYQA 3PP8A 5IKXA 3RREA 4ZXFA 1KFCB 1H69A 3PGKA 4O2AF 3ZJ5A 5TS3A 4R9NA 2X1LA 3L8FA 2CDNA 1UJMA 2P78A 1U63A 4QBTA 2OC4A 5EESA 4BBAA 2AD1A 2Y1DA 2AN1A 4LYDA 4O02B 1QS0A 2V3WA 5G0WA 2FG5A 4TLEA 1G8AA 1YS4A 2W0SA 1ETUA 3GUUA 4EYOA 1BVHA 2FR1A 4OF4A 3MWGA 3R3YA 3I62A 4CFSA 4GP7A 3GY0A 4OBEA 1PYOA 2AOWA 1L8XA 1R6XA 2C20A 2YZNA 3LWNA 4YCAA 5FULA 1XKQA 1FP4B 2W6ID 4URWR 4YUAA 1UINA 2AR0A 2WIDA 3SHWA 3N7AA 2XA1A 1BA3A 3GZNA 3PICA 1E3IA 3UA4A 1BDBA 3OZDA 5A6VA 1ULSA 3OKAA 3KQKA 1QZTA 4TTTS 1MIHA 2XYGA 1OYYA 2PBFA 4XIIA 2QN3A 1SHLA 1YI0A 4GWGA 4MKHA 4NARA 3U4DA 3V3TA 4FHGA 3D59A 5AW7A 3T54A 3EB9A 3OIFA 1OIWA 1AUQA 2OY0A 5K8IA 5KJFA 4G97A 4YYZA 4Z51A 3EXFA 1RYFA 2DPXA 1MOZA 1PJCA 1NQWA 4FR5A 4GPTA 2PK3A 1RWXA 1XQXA 1UC5B 1MAAA 4JNKA 4ZMBA 3VR6A 2IS6A 5FOQA 1QF9A 2RC5A 1E2IA 2BTOA 2F8MA 1EG2A 1CD5A 3A05A 3BRWD 2MJLA 3B9BA 3MUNA 3OZAA 1JFFA 4F71A 1IOWA 1T5DX 3GWZA 3FFWA 4FBLA 1ZG3A 4QL3A 1S3IA 3TG2A 3BRCA 4HXGA 3ROMA 2G1AA 1T9HA 2HQBA 4JLOA 1YS2X 4FLMA 4KWHA 3SZMA 2PFGA 5AW4A 2AC4A 4TMTA 1DCMA 2XNHA 4KR0A 1HKUA 4UMVA 3TTYA 2B34A 1H2EA 4CI9A 3WTBA 3EVDA 2OXCA 5D3ZA 3TPCA 3O7WA 2ON6A 3T06B 1TVCA 1EZZA 5E2BA 1N0VC 2VL7A 1RFGE 3GFOA 4KPUA 4A8HA 2AR7A 4FXOA 2Q0SA 3UAGA 4BO9A 4WOPA 4FD3A 5EIAA 3B6ZA 3QX3A 4QUBA 3U44B 1PEKE 5J5AA 4E1BA 4XTCS 2KQUA 1XTSA 1QP7A 2HQRA 2PS9A 5FOWA 3E3OA 4QKQA 3N9IA 5EPEA 3T7CA 4G85A 5DCUA 4RLHA 2YVUA 4IZOA 2RG1A 4KQXA 3R7NA 2Q0QA 3GNTA 2PUWA 1JFRA 1P9LA 1Z2CA 2ZIGA 4KR6A 1Q1EA 1Q83A 2OZKA 4FGWA 5IG2A 2X2FA 3P9IA 3O8RA 2QNBA 4N0PA 3B89A 2FETA 3FVRA 1PW5A 4WHMA 3KELA 4UE2A 5FTMA 3UKJA 2R48A 5K6TA 2QTAA 4KGXA 1EHCA 3IESA 5KZMB 1V95A 1RBQA 2EKDA 2O2EA 1OD6A 1WCIA 2XB8A 1AVTA 3NHMA 3RYCA 4QGAA 4F2PA 3RNLA 3IQDB 3RWBA 3ASYA 2IS1A 1YB1A 1W1UA 2ZE8A 3KPUA 1Z0IA 4LYJA 4O1IA 4CTJA 4FMDF 1XE3A 2Q3FA 2R8BA 4MTLA 4Y2VA 5DULA 1P5HA 2WIAA 4YJ3B 4E5YA 3OQNA 2WJHA 2BMWA 3BE5A 4FPXA 5FA8A 4DA6A 2A7QA 4MB0A 1U2RA 3FPCA 3T3GA 3BIFA 5A7GA 3KQSA 2IYUA 1X3SA 3IB3A 1GCGA 2CNNA 2JAXA 3EGVA 3L0PA 1M1NA 3N59A 1ZJ6A 1A1VA 2V59A 3W5UA 1X94A 2AFHB 2YTZA 3CISA 1PZNA 1AZSC 3N76A 1G3RA 4KVGA 1YZGA 4Y2UA 5A03A 4JITA 1Q95A 2X42A 3GRAA 3UTDA 5IT5A 4LJAA 2PMEA 3RC9A 3V8BA 4ETWA 2I7DA 2J6HA 1TL7C 3WV5A 2PXAA 3AU8A 4S04A 4JSTA 3A04A 1ZUNB 2DY1A 4HEQA 3VVBA 1NX6A 3VU1A 4AJLA 4Q9JA 1GPYA 4D9IA 4XM1A 4UREA 1PW7A 3BCHA 1E3JA 2AMFA 2IOFK 3V8MA 4MW5A 2V54A 3MMZA 1JB9A 2ZS9A 1EXDA 3A1DA 3AWDA 3UYLA 2NTEA 1N2CB 1WMBA 3QQ5A 3CEPB 3HCBA 4RXMA 5ARCA 3T1OA 3LZCA 3WVNA 1TIPA 5B12A 2NP7A 5KYKA 1BG6A 2B4AA 2NZWA 5JAHA 4ISBA 3JRXA 1PJSA 1S96A 4TV8B 4EG1A 2BH2A 2RG7A 4FOOA 2HGSA 3VI4B 1EIZA 4EGCB 5SYMA 2G0AA 2I33A 1SC1A 2CL7X 2I4LA 1VCNA 3OE7A 2QTNA 3QYPA 1G6Q1 2G67A 4GDMA 1AHHA 1PSWA 2DFDA 3B9PA 3ZY6A 4AVYA 2AFVA 3BF8A 1XDWA 1A9SA 1RHKA 4YEDA 5EMHA 1ZW1A 3MXTA 1Z34A 4MDYA 2I4MA 3F6CA 4E5MA 3D6AA 1VKRA 1A2OA 5CT6A 4OQDA 4YRAA 5A3RA 3SXUA 1VMDA 4BFSA 3IQGX 3MOSA 3G2NA 6REQA 2E2WA 3KUKA 4N47A 2B5VA 1NRJB 4Z7QB 4YDQA 3RUPA 1JDZA 4FEYA 4JC5A 5BSWA 5I7UA 1OB5A 1JYSA 1ZR2A 2D6FA 3D4NA 2FW1A 5L95A 3GVIA 3GT7A 2XYPA 1AS2A 1NUUA 1SG0A 2VYFA 5G0TA 4JDUA 3HYRA 1U99A 3UB3A 2X0EA 5HUHA 3K1TA 4PRLA 4KQ1A 5TRTA 4ZI7B 3HLTA 4Q0MA 5DNDA 1H22A 2BM8A 3UGKA 4US2R 4G86A 1UODA 3RNOA 1EXVA 4LZLA 1U4NA 3K3PA 4WKPA 3EGXA 3IUEA 5AK0A 3RIGA 4IDPA 3LYAA 4Z3KA 4MGIR 3FW1A 4NDNE 2C7QA 1ITZA 1Y89A 4BUZA 2VHQA 3UBTA 3NIGB 2FA9A 5I8PA 2WHXA 4RQAA 1J2EA 1F20A 3F5SA 3HMQA 2ECFA 3L7MA 4GUDA 4RD6A 2EF1A 3WGKA 3PFGA 1I80A 1NDHA 3OF3A 3ZWAA 4BGUA 4TLLB 1OXTA 2AW3A 3I61A 1DCTA 2ONJA 3H7AA 4ZZ3A 3IEVA 3PCRB 5CHYA 4WJLA 1ONOA 3U7EB 1PZFA 4HWKA 5ALPA 3BILA 1PX2A 1G41A 1VHDA 3TJZA 2QRMA 5M5BA 1Y3HA 2DAPA 5IBQA 3H75A 5I45A 4TS4A 3AY3A 3SEQA 1HGXA 1OWPA 1UBNA 3KVOA 4N03A 2FPWA 2OV6A 5IVPA 3EIQA 4COKA 4X41A 3UG6A 2CUKA 2O0JA 5EKXA 2NMVA 3GRFA 1C3JA 1U1DA 2YY5A 3G6KA 3R1IA 1ECFA 4X93A 3WYFA 1N2SA 2GZ1A 2RGNA 5K0NA 3RO7A 3TO5A 4D0RA 4TLDA 3IUMA 3VR4A 5K8CA 3F8TA 2LW7A 1TM3E 3UHAA 1GDTA 2DPYA 1U3FA 4JUCA 1BXKA 4Q6BA 4QPDA 5FORA 4TTRA 3UA3A 4K9OA 5UKDA 5K01A 1JWLA 3OBIA 5JRDS 1FYXA 5FI0B 3GJ0A 3HRIA 3RT9A 4B3GA 1QRUA 4RO0A 1Z63A 1U90A 3DZJA 2C8VA 1U9CA 2YHIB 4C76A 3D7LA 1SZPA 3FMOB 1PI3A 2RI1A 3HHEA 4R0VA 5EJ4A 1CKEA 3QBEA 2JVJA 1RWQA 3UICA 3DV0A 5CBPB 2H4JA 2UVDA 4ZCQA 5ALUA 3L2OB 2GXQA 3OZXA 3PKJA 4F2GA 1IBLB 5CX1B 4RD3A 1JTEA 2P5YA 1XAJA 3E7DA 1EHYA 2BGKA 3AEQA 2I6XA 3GJZA 3ADBA 3MQFA 5CCBA 3GMDA 5FPSA 5H3HA 1J39A 3VUEA 4UULA 3D2BA 1G8YA 3L5OA 4X1KA 3JAWA 3PXDA 3KDPA 4CR8A 3VSAA 4KITB 4WNIA 4FP9A 4L6AA 1N92A 1E63A 5FUXA 4JJ4A 5K45A 1M0WA 1NV8A 5EINA 1EWKA 3KC2A 4B3JA 3WYBA 2WQ6A 1FSZA 4M8NE 1Q1ZA 4PRZA 4CV0A 1NONA 4MV0A 4Z4GA 3LW7A 4P93A 1OX4B 4BU1A 1Y1LA 3ZLTA 1XFDA 4B3MB 5L6MB 1SKQA 2WJAA 1N6IA 3W3AH 3FTFA 2COUA 4G01B 1Z88A 5HCIA 4ND2A 2BLNA 2VTDA 3NHBA 3OWHA 2IYNA 4KR7A 1RAEA 4YQZA 2DLNA 3IV6A 4BJ5A 4ARCA 2P5UA 3JCZA 3DTVA 1G2QA 3GROA 4UBOA 1OFUX 1GU0A 1YGYA 1XU4A 3ER6A 4N0DA 2O8DB 5JRJA 2ADOA 2VUUA 4ZIRA 4Q7LA 1UZLA 2W93A 3I2JA 3OFND 4P2BA 4UEQA 1DKUA 4YRDA 4OHMA 2NYAA 2CFIA 2WVHA 2R8RA 3UNXA 5LZ9A 3G2OA 2CLDX 4RTSA 1LDNA 4U9IS 1DKMA 2WYIA 4M76B 1II9A 5EIWA 3H1FA 3QKRA 3I04M 3LWDA 1XTJA 4QRDA 5GONA 4BWGA 1RYZA 4JB2A 4PEVA 4PIVA 4UUAA 2BN4A 2H1RA 3ACBA 3F6YA 3H9UA 2KBFA 3C97A 1Z2OX 4JJKA 2IZ6A 3REGA 3TCKA 4D79A 3DZ8A 4HLNA 4J91A 2F3RA 2G7ZA 4W5WA 4XYEA 3N7TA 2J0UB 4M1KA 3S5UA 2V1UA 1XQ6A 4S2EA 5CA1B 4UHDA 4DV7B 5ESWA 1TMKA 1Y9AA 2HKIA 2XXJA 4KXFB 4C7VA 3Q7PA 1U3GA 2AE1A 4CU5A 2TMGA 4NYIR 1LBTA 3P4UA 5F52A 4CT0A 1XOIA 3D6TB 3IPYA 3TLYA 5FFNA 1A2KC 2JFWA 2QQEA 1Y37A 4JEIA 3PA6A 4PU0A 3D43A 2YMPA 3LX4A 2W42A 4ZDWA 2EATA 2MMGA 2Y1KA 3BH6A 4NXNB 2BGIA 5A04A 5A4KA 1O6CA 4FDLA 3H8JA 2Y1LA 3UK6A 4IIDA 2BJWA 1E3MA 3QE0A 3LUGA 4BVGA 1MDFA 4CV3A 3H9BA 1TYZA 2OECA 4Q3KA 2CFOA 1WXXA 1PYGA 1O54A 1QNFA 3R6GA 5AI9A 1T4MA 5T8KA 4ARAA 3O21A 1IXSB 2Q1SA 3NYRA 1TCVA 3GBPA 1DUVG 1M8GA 3NTVA 3S8YA 4YXWA 5GPBA 1WOYA 5BMOA 2ODAA 5EWLA 2DCMA 1DO2A 3LUAA 3AOEA 4FE7A 1RP7A 3B1XA 1L4HA 5ALWA 2F9MA 2HUNA 4PZDA 3C3EA 3PD0A 3GJXC 4HLCA 3PQCA 2Y05A 1KOLA 4BMVA 5KSWB 1BMDA 2CGEA 5JZBA 1ISPA 1G17A 1W9HA 3K20A 3BZWA 4TT8A 3HDYA 3LMKA 4FE4A 4I9UA 5K3FA 1ILEA 5K99A 2DH5A 3JWPA 1X1QA 4LI0A 3PE6A 4TKVB 5COAA 4B76A 3KZVA 3I9FA 3RSHA 1UWVA 1A5BB 4BC1A 1DBQA 5JJLA 2WAAA 1SURA 4Y9UA 2DZDA 2X4DA 4UXIA 2CYBA 3PPXA 3TZEA 1DX4A 5HF6A 3IEKA 4N7MA 4NPCA 1NXSA 2QTLA 1PQWA 1VCIA 2AXEA 2IPOA 3NDJA 1QTIA 1UZMA 3CPSA 1QANA 4LPSA 3Q12A 4M37A 4CM8A 2OO5A 2Q45A 4FOLA 2J8ZA 4TLMB 3V8RA 1RBYA 2IK8A 1NMYA 5HFJA 4DAOA 1YI8A 3EK2A 4FFSA 3OQMA 1XYVA 2IQ5A 4Y6RA 3W77A 2H4FA 2C7VA 2LR0A 2TYSB 4YAKA 3CF4A 3K9LA 2I4RA 4YXFA 2ZRLA 4JUBA 1SAYA 5B1DA 2WWVD 4F3YA 1KJ8A 1L8OA 2RHDA 4YAOA 3VZSA 3CMMA 4A6XA 4F9GA 1OGIA 3CX4A 4DM3A 1G9TA 2O2IA 4R1SA 3EODA 3NHAA 4M21A 4Z2AA 3GJ4A 1KAHA 4YAUA 3UMMA 3SR4A 1KZ4A 3OCCA 3IUBA 4K9NA 2QRHA 5CCDA 1WXHA 2DUUA 2HZBA 5TJHA 4YDHB 4DJJA 5JQGA 3A6PC 3RHZA 2NGRA 2DBZA 3RBAA 2BJVA 3UT0A 4K5QA 4UTPA 1CWUA 2NUPB 3A4VA 1J8YF 2QW1A 1GPKA 4F4DA 4GZMA 1C0PA 2UUPA 1QKJA 4HCJA 3R9IA 2ACVA 3OI7A 1HPLA 5IJ9B 1IHPA 3Q15C 1SOVA 2IEAA 5ALNA 5TPZA 1JDNA 3EF0A 5JZOA 3DDSA 3F8SA 3V1UA 3DOCA 1UJBA 1YMQA 2XTMA 1QFXA 3X44A 2QE7A 3HV2A 4EM6A 5E2AA 4ZC8A 1KMHB 3SXJA 5JAQA 1H2WA 2W8ZA 3ETNA 3PNKA 3ER9A 1XTRA 2OMKA 4RUKA 4GAEA 2CHUA 3EGIA 3F9IA 4N3AA 5EPUA 1FIUA 4PNPA 3L6RA 4DA9A 4DDVA 2HB6A 5CRIA 3MINA 4AUKA 1GKYA 2FLVA 3M70A 4ZEWA 3KIPA 5DTIA 3AU9A 5JTTA 2J46A 4WRRA 2F64A 4CF5A 4E2WA 5A9SA 1M2OA 2IPLA 4JI8B 2GAAA 1YCHA 2H3HA 3RHSA 2BRUA 3GLTA 1LBEA 4Q4HA 1JPNA 4OSPA 4Y9RA 4G1MB 3P5SA 2D5BA 5G1OA 3GEEA 3TR6A 2ZIWB 1R6DA 2P2LA 3HA2A 3HPRA 2VNKA 4XAQA 4ESOA 1Y8RA 4BMCA 3ROFA 2O8BB 4RPHA 1ZNXA 5U4QA 1L5GB 2HV8A 1MNQA 4BZXA 1J42A 4GM1A 2CYAA 1DIHA 1K63A 1P2TA 3HSSA 3KB2A 3QLJA 1W59A 4OH1A 1XJCA 2OBYA 4GZLA 5FFFA 2ZUVA 3RB8A 2OCBA 4L16A 4JJEA 4E6EA 3JWGA 4KP7A 5K8UA 4G67A 2P9BA 1S3SA 2FP4A 1KR5A 1NI5A 2H3EA 4UFNA 4I6EA 1XC7A 3HNRA 3LUFA 3DLIA 1I3OA 2H18A 5G1NA 3VVMA 3AC0A 4G5GA 2IXGA 4MI3A 2XQIA 3VNRA 1DO8A 2VQ3A 2PLRA 2Y9PB 2IP2A 5IMBA 1HG1A 3L0DA 3PLRA 3QHPA 2BP7B 4KPFC 5KYWA 1OC2A 1DAPA 3HKCB 4QPZA 1RPNA 1V6AA 1UPBA 4PAGA 1W88A 1MB9A 3URMA 5ERXA 5L3SA 1ZD3A 1W49A 4BPRA 2WYWA 3KJGA 3LKDA 3PPYA 2P9EA 5EE0A 3F6PA 1CDDA 1OWMA 1YQDA 3A1SA 4ZVVA 2F62A 4OGLA 4G1EB 5THXA 3I01A 1NR7A 5BSHA 2A84A 5TX7A 5CFZA 3TLZA 1K4MA 3DSRA 2BTQA 4MIKA 4QUJA 1VC2A 4OLFA 1YBFA 1QGDA 2HU2A 3WQQA 4IV0A 1YJ8A 2P2NA 4MMZB 4DIFA 2MWMA 3OCXA 1P0IA 3IUSA 1NYTA 2ERYA 4RY8A 1Z5OA 3UC9A 1PGPA 4B6PA 1QQ5A 3TDMA 4CCWA 2JIOA 2C42A 3ZE2B 4YQEA 4BFUA 4MCIA 1RMTA 4TUYF 3A3PA 5JCJA 3E9NA 2F3PA 4DLTA 1ZCZA 1JAXA 1WXWA 4IWNA 1UH5A 3E70C 1N9GB 2NYVA 3AUXA 1TLTA 3FNQA 4ZQBA 3ZTYA 4EUFA 5HOEA 4GI5A 3G23A 2J31A 3LCVB 1CF4A 1XYGA 5CB4F 5JYCA 1M5RA 2C2WA 4DEVA 1KJZA 2C82A 4MQMA 3SC2A 3UWPA 3KKZA 4GBMA 2YJ4A 4ID9A 3FOBA 2BHNA 1K0FA 4RD1A 3TLKA 1O96A 4O08A 1I24A 5A2GA 4M2LA 4B9AA 2OHOA 4KACA 1RRVA 1RI1A 3VR2A 4N41A 2GETA 4JQZA 4ETIA 4I19A 2CJWB 2P41A 2YZKA 1KJ9A 1UMKA 1AQ6A 5JY1A 1JTVA 1AY0A 4HJRA 3HWWA 4PYOA 3TOVA 3ZVLA 1OY1A 3IS3A 4PO3X 2Q1UA 2ZTHA 5KTPA 2HMTA 4AKIA 3VNQA 4C5AA 3JD4A 1SBZA 4NFYA 4EFDA 5E38A 1RJDA 3T9FA 2O1EA 1M1YE 5T5QA 4UMDA 4JP2A 3I9LA 4ZU1X 1J2YA 4HLUA 4BNXA 3UJ8A 2ZM6B 1U7TA 3GPBA 3LQ4A 3F78A 3AEZA 5FBHA 2ZBVA 1QP0A 2QN2A 3OQBA 1GYQA 1UPXA 1X80A 2BONA 3H9EO 4GXTA 4EUNA 1BFKA 5AP9A 4H7JA 5FUQA 2NP6A 4NCNA 3TJMA 1L0BA 5FTJA 4K7JA 1CUUA 1HEUA 2KS6A 4HNVA 2EG5A 2YMMA 5C8YA 5CG2A 2GHIA 3EAFA 1Q77A 1UFQA 3QM1A 2ZU0C 4G41A 2C95A 2PZLA 3UN1A 4BAGA 5KC9A 3IT0A 3TNLA 3PFFA 4CMHA 1OIXA 5DHRA 1D0SA 1TADA 3U4AA 2FPRA 4I99A 4RKRA 1UJ2A 1CQJA 4QX6A 3IP6A 4N7RA 2GBGA 3CO0S 3QNMA 2W2KB 2YWRA 2O7VA 3LUJA 5C3UA 3TNYA 2DH6A 4O2AB 5CLJA 2DETA 2ZQYA 3ZIDA 2EQBA 3NIFB 2YN2A 1JR3A 2LXNA 3ESCA 5JBNA 4LI3X 1A5AB 1FQOA 4AP6A 4KO1S 1U02A 3IJRA 3LCUA 2WTXA 4JR0A 4F11A 4FE3A 5BV0A 4CEHA 4WNAB 2XRZA 1V16A 3QMPA 1EI9A 4GPEA 1U3UA 3U7IA 2P3OA 3VZPA 5T3YA 1C3OB 3QXSA 4N76A 1GY8A 2R65A 3NDIA 4XH9B 1DL5A 4DZZA 2WU3A 2WY2D 3G5LA 5JVDA 1Q14A 3FD8A 3FN4A 1P4AA 1ZONA 1W87A 1H42A 3LYLA 1FTSA 2CNOA 3Q72A 4E12A 1A9PA 1TCAA 1S9DA 3EZXA 4F9FA 6Q21A 1C0LA 3KLBA 1GNVA 5GV8A 3K71B 3CA8A 1M7BA 3R3HA 1TJ4A 4LYAA 5KNDH 5M3BA 5EP2A 1JLSA 1E3DA 4ZVUA 2VBGA 3AEYA 3JZIA 3C87A 2A57A 5CUQA 2OOKA 3DDWA 3RU7A 3VHXA 1OKKD 4BX8A 5HX7A 5KJ6A 2N46A 4JYMA 2HTFA 1HEYA 4KMSA 1PLKA 2VK2A 3ADOA 4WGGA 1PS0A 1WPGA 1P19A 4L8WB 2O4UX 3FJYA 1B16A 5CYFA 2H2HA 2C96A 2B82A 3SF0A 3D8NA 4GO1A 4AXXA 2XWJI 5EVJA 3DZIA 1IRXA 3MYYA 2C88A 3A9UA 2OP0A 4LZZA 1J5XA 1XZPA 1OLXB 1BJRE 2C07A 2XOEA 2C57A 3DDZX 3DVAA 3ZKWB 1YB5A 1XX6A 4Z4IA 4AJNA 3KYBA 3AT1A 3EEQA 5K0GA 3HP7A 1AURA 2P1DA 1U9IC 4KXWA 4MAMA 4PSAA 3QI7A 2YV5A 2XKBA 2GD6A 3H13A 4H7KA 1W46A 1KH2A 4NWIA 5H9WA 3TFWA 2CJXA 2PUHA 4QDJA 1QTQA 5JO0A 1W7AA 1A8QA 2WTEA 4GL4A 2XZPA 2RD2A 1YVDA 4Z99A 3GLIE 2QPLA 3OX3A 4S0XA 2HA5A 2PWPA 5LDDC 2FNAA 1NVTA 3WWEA 1VJ1A 4KQIA 4Y8VA 1OZ0A 1Q3HA 1L8QA 2QU7A 2X6QA 4FLEA 5I5EA 2EKPA 1JIUA 5D84A 2D2EA 1WUTA 3ER8A 4X1YB 3DV9A 3W5CA 4QDUA 2IYLD 3KB8A 2ZRNA 1D0VA 3C4VA 3Q3VA 3K6RA 3GJ8A 1VHWA 1UR5A 3DEAA 3IBYA 3FR8A 4TRMA 4WINA 4LZPA 2WWGA 3G0BA 2FWIA 4WFKA 2FQ1A 4NJMB 5EMJA 1DWUA 2IYPA 2YDYA 4HBZA 4F85A 1XMOB 1E5VA 1SUPA 4UU7A 5TB5A 4MWCA 2CXTA 1WBBA 2UDPA 1Q3TA 4HWTA 2Q6VA 4FMDB 4NIMA 3WI7A 3K2BA 3SZUA 3HB1A 5BT8A 1PR4A 4LRTB 5J47A 4TWAA 3VO8A 2J5XA 1RJGA 3CGGA 3KYDB 4BVEA 2I2FA 5KQMA 1PFGA 4ZVMA 4ZV9A 3ZV6A 2ZRFA 4ODIA 5JSQA 5F51A 3AERA 4X3PA 4PQYA 3GQBA 2B7BA 1L7NA 4OJTA 1KBQA 1VE1A 1RQPA 2ECOA 3NNSA 4HFRA 4IXTA 1UT8A 3ADPA 1HT2E 3GF4A 3Q8WA 3ZK7A 1SKYE 3BYZA 4F5EA 5CFOA 1E2QA 3HR8A 4YPOA 1LQTA 5B58C 2BF7A 3LHIA 5FOTA 4F4JA 5K51A 3BGWA 3IR5A 4YRLA 2RB4A 4N4AA 3UMCA 3TRFA 4N6GA 1KEEA 4PAWA 3W5SA 3VH3A 5JBIA 4C3VA 4FZ3A 2PZAA 1TVMA 1LNQA 1XU7A 2LZ0A 2ONKA 2PZBA 2HL6A 2FGKA 3AFIA 1NVUQ 1XL0A 4MV4A 1E3TA 2HRQA 4R2MA 1AA9A 4NRDA 3UW1A 4AJ4A 1CPYA 3QHQA 2IEZA 3KTAA 3Q3CA 4RKYA 3RTCA 3DT9A 4D9CA 2WVAA 3BXXA 1FQJA 3H2HA 3DLBA 3EZYA 2ZBGA 3OC0A 3BD8A 3OMLA 4CL2A 2J87A 4RDHA 1KEZA 2IU6A 5DTMA 4B7ZA 4BLWA 4D57A 4XR9A 4QM6A 4RFVA 4XASA 4M1QA 4UTXA 4ZJUA 4QXQA 1G38A 5ADWA 1X8XA 1GZVA 1E4YA 2Y4NA 3FYSA 1YSCA 1VYUA 3U4HA 1A82A 1C30B 2DHRA 3ED5A 3QWFA 4YB8A 2IE8A 2Q50A 4GDFA 3R5TA 2FEAA 4NDZA 5AVRA 5FR2A 4M7WA 1KZ1A 1TLLA 1UKBA 2XT9A 3FMPB 4C4YA 1MXHA 3EPRA 4O4JF 1BIFA 1CY4A 2P0EA 2UVPA 1GA6A 2WWTA 3V7WA 1MU0A 5GGYA 4E7OA 5K0ZA 4ZCIA 4MCAA 5K6AC 4H7PA 3GGGA 2E21A 3O38A 1FP4A 4F45A 4XQCA 1ZS9A 1XL1A 4HB2A 3J81A 5B1YA 5C8DA 3EMDA 4G5OA 4UASA 4J07A 3EXIB 1EX9A 2HLHA 4MUIA 3VAAA 4JQYA 2M1ZA 4QJ5A 1N1MA 1U3VA 5HZHA 5I7HA 1CR2A