2RHWA

Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Basis for Inhibition of BphD, a C-C Bond Hydrolase Involved in Polychlorinated Biphenyls Degradation: LARGE 3-SUBSTITUENTS PREVENT TAUTOMERIZATION.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
total genus 103
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rhwA00
3HJUA 1DWPA 5HQ3B 4PF1A 2ZJ6A 3DL7A 2WG1A 4EZIA 2HIHA 1SCIA 1E3QA 3KDAA 3VKFA 1MX9A 1UKAA 4ZV9A 3I6YA 4LHEA 1CUGA 4H7FA 2XMDA 1U2EA 3DQZA 3SC2A 3E0XA 4WCVA 4EY5A 5HKAA 2XUQA 1DWQA 4CFSA 1UT6A 3D5EA 4ZREA 1UFOA 4U2BA 1WB6A 1CUYA 4MWTA 3R3WA 4FNMA 2QUBA 4BAZA 4BTVA 1WB5A 2QVBA 2R11A 4NVRA 3ILSA 1RYYA 5JAHA 2Y1KA 1A7UA 4B85A 4TGLA 2BKLA 3WA7A 2PUJA 5EI5A 1Y37A 3G0BA 1R9MA 4H7KA 1U8EA 5CMLA 1GXSA 4EUSA 1WM1A 4RGYA 1J2EA 4C87A 5IVHA 5AI8A 3I1IA 1O6FA 1A8SA 1X2EA 3FVRA 3NWOA 5AI4A 1QO9A 3G0GA 4Y2PA 5AKEA 1F0NA 4EY6A 1XZKA 2Y2VA 3LS2A 3IUQA 1MAAA 4YASA 3ZLTA 4KE7A 2DHDA 2H7XA 2JBWA 3FLBA 1YB6A 2WIGA 5ALYA 5AM3A 5A7HA 1EHYA 3E3AA 5AKXA 3V9AA 1MX1A 1IZ7A 4UUQA 5JD4A 2WHRA 4AN1A 3O9VA 4FOLA 5HK9A 1XRPA 2CZQA 2WJ6A 3AZOA 1XRRA 2AXEA 1UK7A 3ZI7A 4EY4A 3DYVA 3SX4A 5C81A 5IKXA 2XUJA 4WJLA 1TKRA 1WHSA 1Q0RA 3S2ZA 3CN9A 4Q3OA 2OLEA 4FDMA 4PW0A 2XLCA 2JGIA 4QDOA 5JASA 4QDTA 3VISA 1H22A 4LXGA 4IH4A 5CXXA 4BVLA 1JU4A 4E46A 3WK5A 5DNUA 1JFRA 1QJ4A 1K6EA 3IDAA 2WKWA 3H2HA 1XROA 4X6YA 3WMRA 3W2TA 2OCGA 3I2FA 4LXHA 4J0IA 1R3DA 2QJWA 1CUZA 5LZ9A 4G4GA 4KRXA 1LBSA 2VAXA 1ODTC 3QH4A 3FCXA 4DIUA 3TGLA 3FAKA 3STWA 5ALDA 4OD0A 3R40A 4DLNA 4EHBA 5JAUA 1XZLA 1L7RA 3R3ZA 2XQKA 2VTVA 5FV4A 4DMKA 3I2HA 4PO3X 3R3UA 4W63A 1ZI6A 4U2GA 4BP8A 5DTIA 3ZPXA 1ODCA 3WK9A 4Y2VA 4DNFA 3O4IA 4BBZA 1ZD2P 4WFIA 1W1IA 2AJLI 3G9XA 5AM2A 4CG3A 2C5GA 2RAUA 3WL5A 4BDSA 3MVEA 2IX9A 1CUAA 3IB3A 3GUUA 4MEBA 1L7AA 1S8OA 2VF2A 1J1IA 2X5XA 4PSCA 1MT3A 2D0DA 4J0CA 2CB9A 2OCIA 5K3FB 5ALFA 3IBTA 1CRLA 4A5SA 3UMJA 5LZ5A 5JZSA 4MXDA 5FP0A 2QXTA 4Y2JA 4QWMA 2Z8XA 3FLEA 3O9MA 4QA9A 5ALIA 4GW3A 5LYYA 4BVKA 1BCSA 5ALKA 1EDDA 3GBSA 2HA3A 3TEJA 4ZWNA 2XQGA 4C4ZA 1UOPA 4UBMA 4BATA 3C5WP 2NW6A 4AXBA 5ALGA 2I3DA 5ALXA 3I6ZA 1UXOA 5FOQA 5A7FA 3QMMA 4GHWA 4WY5A 4UHHA 4U2DA 4H7JA 4Q05A 4OU5A 3FOBA 2ROQA 4W1SA 2BJHA 2XUPA 1NX9A 2QM0A 1PJAA 5ALSA 1DX4A 2Y6VA 1U65A 4H0CA 2W22A 4XJVA 2WHQA 3DKKA 5CBKA 1UKBA 3PF9A 3D2AA 4OB6A 4G8DA 5E4YA 3STTA 5EHNA 1G42A 4QLAA 3OTQA 2HU7A 2I78A 2B4KA 2QRUA 5F4ZA 2WTMA 3NUZA 5LIPA 3ANTA 4X6UA 1JMYA 1SCKA 1WOMA 4HXEB 1XZIA 4K5QA 1AC5A 2WHPB 4WFKA 1C7JA 2HA2A 3IVMA 2ORYA 3STVA 3ZLUA 2CMFA 3R41A 2OG1A 1UK6A 2XMZA 3BF7A 3BWXA 2V97A 1CUCA 5HF5A 2QMQA 3C6YA 4AQDA 3VJLA 2WILA 3SK0A 3PUIA 5DWDA 4KAJA 5AHXA 3V1KA 2XLBA 1TK3A 4DNOA 1E8MA 2OQIA 5AOBA 3OURA 1U4NA 2GBCA 4G4JA 4I19A 3WQHA 1QIJA 3QYJA 1EDBA 4NMWA 4DSAA 2OGZA 3W9UA 3QITA 2FJ0A 5E4JA 5KBYA 4H7IA 1MU0A 4X94A 4FFVA 1LZLA 5CT4A 4ARBA 1W6RA 3Q8WA 2PSJA 2X76A 4H77A 4Y2RA 2OAGA 1AQLA 3C8DA 3WWOA 5AOCA 3FYUC 4UBJA 2YH2A 4OYLA 2WLSA 4BDTA 1VA4A 3DOIA 2LIPA 2C58A 1DINA 4IH9A 1YA8A 2WFMA 3G7NA 2O7VA 4CG2A 4KE8A 1HKHA 1P0MA 1UK9A 1XQWA 4YX9A 1ZOIA 4U2FA 1ORWA 4H18A 4Q3KA 4J0KA 1UOQA 3NGMA 1HDEA 4N5IX 4W1QA 5AKLA 2XQJA 3PFBA 4ZV7A 1HL7A 5ALQA 1XQXA 1CR6A 3DEAA 5JD6A 3W04A 1MX5A 5ALRA 5IVDA 1CUXA 4F60A 4LXIA 3UUEA 5AJHA 4J0DA 2ACEA 2HRRA 1JJFA 5EHXA 4UBOA 1UK8A 1DT3A 1FJ2A 1W76A 2VSQA 5ALUA 4DMHA 2ZJ7A 1E89A 1UWCA 5DYTA 1CUEA 2BCEA 1FFCA 1R4ZA 3H04A 4HXGA 2DHCA 5ALLA 2AJDA 2BGRA 5I8PA 4C01A 4GBGA 5HQ3A 4PNZA 5BWCA 2JEYA 2JGMA 2PSHA 5C8XA 3PE6A 5H3HA 4OUKX 2EEPA 3QZUA 1QTIA 1K4YA 3PF8A 2QKYA 2HU5A 1KU0A 1LPNA 1XZMA 5DNWA 2WUDA 4GI1A 1ACJA 3D0KA 3WYNA 5ALOA 1ZGBA 2CEKA 2GYUA 1Y7HA 5JANA 5LP1A 3F67A 2C0PA 5T4HA 4AZ0A 1DX6A 4P08A 5EFZA 3EBLA 3LLCA 3WKCA 4X6XA 5CRIA 1VXOA 3DYIA 5JZ9A 3GA7A 2OCLA 5CXUA 4BAUA 2WIDA 5HFAA 4BVJA 4FBLA 3WWCA 4BCDA 2XUAA 1EI9A 4K2AA 4WFJA 1XKTA 4ROTA 3H2KA 4G9EA 1QIFA 4ZXFA 1VLQA 1ORVA 5DNVA 3ZWQA 1H23A 4ARAA 2W6CX 4UBKA 1NU6A 4X92A 3QMVA 4U2EA 4B9AA 4BC0A 4MJ3A 1F0PA 1ZICA 2VJAA 1QIEA 3A6ZA 1A8QA 1RWQA 2O2IA 2GZSA 3M81A 3VVMA 3PICA 3AIOA 1BEEA 1AX9A 2CKMA 5FXMA 5K3FA 2HHAA 5EGNA 1BEZA 4BE4A 2EDAA 5HF9A 4MQLA 4PSDA 5EIHA 3STYA 4L9AA 3C6BA 1QO7A 5C8ZA 1QONA 1ACLA 4UPDA 4GLBA 4X93A 1MN6A 5T4BA 3KWJA 3BE8A 1DWOA 3G0IA 1ZJ4A 4JEIA 2J4FA 5A62A 4HTAA 4NS4A 4DM7A 5LZ7A 1FFAA 4IH1A 2RI6A 2J3QA 3I2JA 2Y2UA 1QIMA 2RGUA 1MTZA 2QZPA 4L3WA 3VJKA 5CT6A 2WIJA 3QBJA 4Q82A 2CBGA 4BYMA 5YASA 3LCRA 1XZAA 5IVIA 4LYEA 1G4HA 3FSGD 1TIBA 1CUUA 1QIGA 3IIIA 3W06A 4TVKA 1SOMA 1CLEA 3I1YA 4AO8A 2HFKA 3W05A 3G9ZA 2JGEA 5DLPA 2XQIA 2HDWA 3H2JA 3Q0TA 4X91A 5AIBA 3PUHA 4OB7A 4LIPD 5CT9A 1Q83A 1A8UA 2Z8ZA 1WPRA 1ZJ5A 1HLGA 3WZMA 1XZEA 2VAVA 4EBBA 4XX1A 3WYDA 4Q3LA 1N1MA 3I6MA 1CQZA 3E1GA 1QGED 1LBTA 4WDQA 1CEXA 2ZYSA 2G63A 1EH5A 2ZYRA 2XMGA 2EDCA 5C7YA 3AZQA 4Q1VA 5A7GA 3I2KA 3STXA 3WKDA 2UZ0A 3M3DA 4KAAA 1GPNA 4YPVA 2C4HA 1CUBA 2RHTA 4FHZA 4DMFA 1YS2X 2OGSA 1H2YA 5LLSA 3WJ1A 2PX6A 4BE9A 5FDFA 4GEGA 4F21A 1EVQA 1J07A 4J0GA 5JD5A 2HFJA 4OSEA 5AOAA 4J0JA 2XUOA 4FTWA 3STUA 3WK7A 4BZZA 2OQVA 3OG9A 2C0QA 4ZRDA 3K6KA 3WL7A 1UKCA 4RE5A 2VA9A 3ICWA 5EHQA 2WTNA 1VJ5A 1B6GA 4RPCA 5AM4A 2J3DA 3N0TA 3LIIA 2ES4A 1YR2A 5FUMA 5E2IA 4MYSA 3E4DA 5K3BA 4C4YA 3PDCA 4GXNA 1VZ3A 1EVEA 3WKBA 2DCMA 1DQYA 2XUDA 5EIAA 2B20A 4Y2SA 4H35A 1ZIYA 4UFOA 2G5TA 3TJMA 5KWJA 4Y2XA 1CUVA 4FNGA 7YASA 2DQZA 3WZLA 4DTCA 1E5TA 3D3NA 1XZGA 1LPOA 3F97A 3V1LA 4J0HA 3TRDA 2ZJFA 2G5PA 2H7CA 4G9GA 5AI9A 1JJIA 3R0VA 2ECFA 4CCYA 1HPLA 1BN6A 2XQFA 2XUFA 1ETHA 4UHFA 1HQDA 1WCYA 5CH8A 5SYNA 4IQ4A 1CUHA 5AP9A 3HI4A 5D6OA 2HA4A 2HU8A 3OPMA 4JH0A 4QEKA 1EK1A 4GWLA 4XIIA 1R1DA 3ESBA 3RLIA 1T4MA 4X85A 4RE6A 4UHEA 3F96A 1OXMA 2G4LA 2Z3WA 1FFDA 1YAJA 1IUNA 3C6ZA 5JAPA 2GBGA 4B84A 5LKRA 1XKLA 2ZYHA 1MPXA 1EB8A 3C5VA 5LKAA 5AKHA 2XB6A 4HRXA 1GKLA 3DD5A 3C6XA 1GZ7A 1MJ5A 2XUHA 1I6WA 2HA0A 1W75A 3IULA 5LZ8A 3QPDA 2WUEA 1CUJA 3WK4A 1USWA 1A88A 1EB9A 5AH0A 3WI7A 2QR5A 3O4HA 5AM1A 1E66A 1MNQA 5BV7A 3M83A 2PSDA 2Z5GA 3ESCA 4X3CA 5K5EA 2GBFA 1C7IA 1VA5A 3VJMA 3G0DA 4KYVA 4BP9A 3MUOA 3HZOA 1CQWA 1QIIA 5ALJA 1GPKA 4A16A 1LPPA 5JADA 4D9JA 2WSLA 3A2NA 2QJRA 1G5FA 1DT5A 1LGYA 4Y2YA 3NOXA 3G8YA 2FUKA 3HXKA 1YASA 4N8DA 1JT2A 5JARA 5JATA 1XZHA 5ISMA 4H7HA 4DGQA 5AK5A 3AJAA 2XT0A 4X97A 3O95A 4Y2UA 4X00A 2CJPA 4E11A 2PVSA 4EY8A 2XDWA 2FJPA 1GT6A 1GQSA 5HF6A 4O08A 3H1BA 3G02A 1K5PA 2JGLA 2WIKA 4UHBA 1CUFA 1BU8A 1CUWA 3VVLA 2VJCA 4KACA 4A23A 1XZJA 2ZSHA 4W1RA 2B9VA 1IZ8A 5ESRA 1Q84A 5AK4A 4N8SA 3OM8A 4DMCA 4QDUA 6YASA 4XWGA 2ZYIA 3O4GA 3D2CA 1ZD5A 2XUIA 2X8BA 5T4EA 1N8SA 1MNAA 2PUHA 1K8QA 2AJCA 4QDZA 1CV2A 1SCQA 3U0VA 1AKNA 3D59A 3K9BA 1IUPA 2WG0A 3FBWA 1ZGCA 2WU3A 3BF8A 3ANSA 4MEAA 5K3DA 5HFNA 3C45A 3EIOA 4UFNA 1QTRA 2AJ8A 4CIAA 3DS8A 4XVCA 4UHCA 4FMPA 4JYPA 1GQRA 4B7ZA 4I4CA 3EF3A 5FRDA 4AO7A 4E14A 4W1PA 1P0PA 5AKJA 1YB7A 3FYTA 5E4TA 4P93A 3A70A 2BUCA 1BE0A 2PSEA 1QFSA 5IVKA 3HC7A 3G9UA 2WG2A 1K63A 3KOOA 5FPPA 3HYSA 5ALWA 1G66A 1XRLA 1VE7A 2C5FA 3FYUA 5ALPA 4ZI5A 2BUBA 4H7DA 5HCUA 3OOSA 2WU4A 1PFQA 3JYHA 1FFEA 4PQEA 4C6HA 1X70A 4I3FA 4P9NA 1J06A 5C8VA 1FFBA 3IA2A 1UZAA 2WM2A 2PPLA 5AICA 2PM8A 2O2GA 3G0CA 2RHWA 1YAHA 3C70A 2JEZA 1MAHA 1R50A 3RK4A 1XRNA 4Y9SA 1TCCA 2WJ3A 5EHZA 2JF0A 3AIKA 3UUFA 2DFPA 5ALTA 1ZI9A 4CCYB 3DKRA 3AFIA 5IH7A 1Z68A 4UBIA 4BC1A 4PSUA 5D7BA 4KAFA 5EIEA 1F6WA 3WJ2A 2JGKA 2VQ6A 4UBLA 2OXEA 3KWFA 4KRYA 1IMJA 1BS9A 2ONCA 1CUSA 1YS1X 4WDRA 5ALVA 3GELA 1Q0ZA 4KEAA 4K6HA 3V1NA 4JUIA 4WY8A 1ODSA 2OCKA 2HRQA 2GYWA 2PL5A 3H2IA 4AMYA 5FKJA 2ZSIA 5HF8A 1OCEA 5JYCA 4K6GA 4EB0A 4DNPA 3I28A 3H19A 3D2BA 1F8UA 1DQZA 2V98A 4OPMA 3K2IA 2ACKA 1EA5A 4BZWA 1R9NA 1XZBA 2OAEA 5AK3A 5ALNA 3WKAA 2XE4A 4Q34A 4U2CA 4BRSA 3FYUB 3ED1A 3QM1A 5CH3A 2E3JA 2CUTA 1B41A 3O4JA 1X2BA 4YK7A 3IUJA 4CG1A 1BN7A 1THGA 3BDIA 4CIBA 3WWDA 4X95A 4ZGBA 2GZRA 1GGVA 2I3ZA 1Y7IA 3CCCA 2VT6A 4X71A 5ALMA 3ESAA 2O2HA 3EQ7A 1D07A 4J7AA 2J4CA 3QPAA 5D3ZA 2HA6A 5AKIA 1DU4A 1L7QA 4B6GA 3SWWA 4HRYA 2O7RA 4HAIA 3B5EA 1AGYA 4GECA 3B3QA 2WHPA 1BRTA 1LNSA 1VKHA 4J3JA 3FNBA 3WLAA 3H2GA 3C43A 2VATA 1CVLA 3D7RA 2RONA 4IO0A 1H2WA 3KSRA 3F8SA 4L72A 1TAHA 1YA4A 3H1AA 4G1FA 4M0FA 1VXRA 3OC0A 2DQYA 4M0MA 2WJ4A 3O0DA 2XI4A 4DNQA 2HA7A 3L1JA 5I9IA 4QE3A 4B83A 1EK2A 3HSSA 2V96A 3BDVA 4FWBA 4Y7DA 5BOVA 2XMRA 3DNMA 2YASA 1E8NA 3KXPA 2H7YA 3JWEA 5JAOA 1SC9A 2Q0XA 1HBJA 3EQ9A 1JI3A 1QZ3A 5KREA 1W4LA 2BGNA 5HK8A 4QNNA 3MGAA 4DYHA 3BJRA 1ZI8A 1EINA 3WWPA 1WPXA 5FLKA 2GBIA 1QE3A 1GPLA 5CT5A 3HACA 4W9RA 5I7UA 2BUAA 4BAGA 1CUIA 3S8YA 2DR0A 3BL8A 2BAGA 1MO2A 2WFLB 5AM5A 4ETWA 4FFWA 1H2ZA 4HS9A 3FLAA 4MQMA 1DTEA 3BXPA 3PFCA 4TPKA 5AM0A 3WK8A 3CN7A 3DLTA 5AI0A 3AINA 3ESDA 3AILA 4QLOA 4NZZA 5DJ5A 2DHEA 3C87A 2IITA 4J03A 2QXUA 4CI9A 4DSZA 3DCNA 5D3KA 3VXKA 1XRQA 4INZA 1EXWA 1KU6A 4M0EA 5CT8A 4FBMA 4G8CA 4P92A 1CFJA 3WIBA 5KWIA 1TQHA 5K3AA 5DYYA 4F0JA 2PKYX 4KJXA 3U1TA 1N5MA 5FPQA 3T4UA 3A2MA 3B12A 3W9BA 2HA5A 4IHAA 2XUGA 5HZGA 1RP1A 3ZLVA 2XMQA 5AKGA 4BTLA 4AX4A 4QDXA 2OGTA 3BIXA 4HZGA 5AI6A 1QIDA 1AZWA 4LKOA 4QWWA 1OILA 4KR0A 3C8HA 4X7BA 2VJDA 3RKSA 3M82A 3V1MA 2XUKA 1THTA 2XMBA 4C89A 1XQVA 1XLUA 2K2QB 1UOOA 4BRZA 3WA6A 4BB0A 4MYDA 3T52A 4JNCA 1JU3A 4H7EA 3WK6A 4RNCA 4QZVA 4MWSA 4B0OA 2WIFA 1JKMA 1LPMA 3F9CA 1QFMA 2V9ZA 5AO9A 2PBLA 2I03A 3H17A 3I2IA 4AZ3A 1CPYA 3H0CA 3I2GA 2VEOA 5AKKA 4EA6A 1N5RA 4Y2TA 4OU4A 3KD2A 4V2IA 1TCBA 3HLKA 1VZ2A 2VT7A 2DSNA 2WUFA 3VDXA 4G5XA 5JZBA 4UBNA 3FWHA 3GFFA 2JIDA 4JYMA 3MUNA 2HM7A 5ALEA 3D4LA 3V48A 1QOZA 1XLWA 3H18A 3IURA 4AN0A 3HEAA 5CH5A 1BROA 2XMCA 4ITVA 5J3JA 1AUOA 1XQYA 5ALHA 4OB8A 5DTJA 3IUMA 1H2XA 2QTBA 4Z49A 3R3YA 4N8EA 1LPSA 4G4IA 5CW2A 2ZVDA 3ZV7A 1C4XA 4B82A 2H1IA 4FLEA 3IUNA 3X3HA 2R8BA 2XMSA 2WFZA 4B80A 5LZ2A 3PI6A 4HXFB 1XZDA 1P0QA 2VJBA 3HRHA 1R88A 3DL4A 3QMWA 4B81A 4AO6A 4C4XA 3AZPA 4X90A 2P8SA 3CXUA 4AMZA 3CCBA 3DJYA 3L1HA 5AIAA 4S0XA 5AK6A 1ZD3A 1QIHA 3WKEA 3FSGA 2HADA 2B61A 4KE6A 3DDUA 4F5ZA 1M33A 4B9EA 1LPAB 2GYVA 3FVTA 5A2GA 2Z3ZA 2QUAA 1KEZA 3BJMA 1NU8A 2QT9A 4N5HX 4B0PA 1LLFA 1JMKC 3ICVA 5CTAA 1VOTA 4GDMA 1GKKA 3WL8A 5BWBA 2RIPA 3A2LA 4EY7A 1ZD4A 3YASA 1JJBA 4K6KA 5HKBA 1CUDA 2WUGA 1O6GA 1XFDA 3RM3A 5ALZA 3AIMA 3R3XA 2AJBA 1AMNA 5JALA 1T2NA 4BCCA 1XZCA 3RARA 1P0IA 3JW8A 3AUKA 5K3EA 3LP5A 2JGJA 2BFNA 4AB1A 2OPHA 4PV7A 2HL6A 4L0CA 2QOEA 2PSFA 5A71A 4KE9A 4LYDA 3L1IA 2WQZA 1E8DA 5CURA 3LIPA 1QIKA 1XLVA 1EDEA 3HABA 1WHTA 2WFLA 2C7BA 4Y2QA 1SFRA 3EQ8A 1IUOA 4OYYA 3WWEA 4FLMA 1TRHA 3QPCA 3WIOA 5LZ4A 2YXPX 4FLFA 1YCDA 5T4FA 1XRMA 2PU7A 5SYMA 1LZKA 4G8BA 2H9YA 2QS9A 3WL6A 5K3CA 1CIJA 2D5LA 5AI5A 4C88A 3F98A 1QLWA 2JGFA 3GZJA 1PV1A 1BCRA 4E15A 4BCBA 1AURA 1ISPA 3N2ZB 1VE6A 5DYWA 3QVMA 3P2MA 2YYSA 3BIWA 4HVTA 1XZFA 1WB4A 1LPBB 3DOHA 5A6VA 3GROA 4UHDA 1IVYA 4FKBA 5AKYA 1FSSA 2Y6UA 1W52X 5AKZA 4CCWA 2FX5A 3FCYA 5JIBA 2PU5A 1YSCA 2IIVA 4UFPA 3R3VA 1EX9A 3G9TA 1TCAA 4OCZA 1ZIXA
chains in the Genus database with same CATH superfamily
2ZB7A 1I5OA 2JJ1D 4KBFA 4D0LB 5BSWA 3HVRA 1DWPA 1QUEA 2IF2A 2YZ7A 3CLTC 1TDJA 4UVHA 3RS5A 3UJCA 5C51B 3BJZA 1BE1A 3GL9A 1SHUX 2QW8A 4LHWA 3ZOKA 1C0LA 5KSWB 1EUCA 2HIHA 2DH5A 2JKVA 1QF7A 3AVYA 4O63O 1SHJA 3KDAA 1PX0A 1AZSC 1E6UA 1NLZA 1W88A 1XL0A 4X3OA 7YASA 3FCUB 4MV1A 2JJ2D 4Y6PA 4OBBA 4DQXA 1J7KA 1PZMA 4WCVA 2OMKA 5LYJF 1UCFA 4C4AA 1K3TA 3HA3A 1KVTA 4EX7A 1UT6A 3D5EA 3N2IA 2O7NA 1LJLA 1VMIA 3ACDA 4U2BA 1WB6A 4EFMA 2R6CA 1CUYA 3NH6A 4KGZA 4QGSA 2O3UA 1OLXB 3Q41A 2QMHA 1DBPA 3HDYA 4MWTA 2BSAA 5EGSA 3VZDA 4WH0A 3CVUA 3KG2A 4QOHA 1N8TA 1PFGA 3SQMA 1COWD 3WFIA 4RSRA 5C32A 3ZLJA 2ESRA 3S1AA 5AESA 4LZLA 1P33A 2D1RA 4FNMA 2J9RA 3EN0A 4DWOA 1HDIA 4DLLA 5CP8A 3VSCA 5FTWA 4PICA 3GUCA 2QVBA 1JFLA 3KB2A 3KKKA 1OFHA 1J70A 3P7MA 4PAQA 4JODA 4XD7A 5JAHA 2C2ZA 2Y1KA 3QG5A 2EJUA 3LPLA 3R5HA 4Q9JA 1HE8B 1NPTO 1XVIA 3TIVA 4A8JB 1F14A 4TGLA 4Z2YA 2WM9B 3EW7A 3U4QA 1N9ZA 1UJCA 4QATA 2BKLA 3FCSB 3SSOA 3PQEA 3TW4A 2CWDA 3RF6A 5DI3B 5CNKA 1ICIA 1LLUA 1RJ9B 3E61A 1V7CA 2C7GA 3H3JA 1QHNA 3N7AA 4G3XA 4H7KA 1P0FA 4MIKA 4N03A 4XUCA 3S7ZA 4BB6A 2UXBB 2PLFA 3A28A 4UUAA 4K03A 4DMMA 3L4JA 2BFWA 5AHWA 2FWPA 1HNZB 4NYMR 1Y3IA 5TNXA 1WDTA 2JVJA 1Y1KE 3E7FA 3OZAA 1SZDA 4RENA 4XTRA 1Q19A 1A8SA 1J00A 1X2EA 3Q15C 1YL6A 3NWOA 3PHLA 2EL7A 1L5HB 3G0GA 3NTRA 4Y2PA 5CM8B 3RG8A 4DW8A 4ER0A 4I8IA 5KNDA 2VR1A 2OKGA 4OAOA 5DTRA 4EB3A 5MDHA 1G5QA 1WZNA 2V7GA 1ADJA 1K97A 2OCBA 4MROA 4NAUA 4NJEA 4QSMA 2Y2VA 3OFVA 4PYKA 1TADA 2JI9A 1J0AA 3B5JA 4R7ZA 1MAAA 3HLYA 5LOVA 2BCJQ 3WSWA 4KRFA 3R3HA 4LZNA 4IZOA 3U3JA 3T5CA 1SBIA 4KE7A 1U4OA 3HCOA 4KGXA 3WLFA 4ZRMA 3OUUA 3RUDA 4MOWA 4HDNB 6GPBA 3OLQA 2QP4A 1GZ5A 3JARB 4ZCLA 4C5AA 2QZ4A 1K4MA 1N2ZA 3B53X 3AJ9A 2VSYA 1T8SA 5FAKA 4BVBA 1Y9EA 3A3PA 1C4WA 2O3RA 3E3AA 1CE8A 4YBZA 4CWAA 3L84A 1O9GA 1E9FA 3I6BA 4K9NA 4QTUB 3T35A 5H4GA 1WO8A 3NHLA 5I9SA 3R6WA 1N8NA 4AN1A 4XCXA 3AWDA 4FOLA 2WC1A 5F4BA 3V8EA 1Y1QA 1YZYA 2CZQA 1BS2A 5HK9A 13PKA 2WKPA 5A4AA 2W7TA 2P6MA 3I72A 3P8ZA 4HNHA 1YA6A 3JWHA 5LNK1 1YF3A 2P6RA 1G16A 1RHRA 4LZJA 2JIOA 1GZUA 3L7KA 2P9HA 1CSEE 4RV5A 4WADA 4DMLA 4HNTA 3RC9A 4BKUA 4QSHA 1Q0RA 1SH7A 1A9ZA 2OAQ1 2QQFA 3BMNA 5CJ2A 5DLYA 2GPTA 2VUIB 2OLEA 3TR6A 2FFAA 5GQSA 4G56A 3D1LA 3UGTA 5TR9A 2B21A 3ZQ6A 4BQFA 1Q50A 4ZEXA 3SS8A 3W6PA 1QVZA 2I66A 3NHJA 4P3NA 3AY0A 4POOA 4MHTA 5GV7A 4QAJA 6PFKA 1QC5A 3X0DA 4B4UA 3NR2A 4QDTA 3CW8X 3B7GA 5B7PA 2Q8QA 2X0RA 4IPTA 1O9BA 1CB0A 2HNAA 1P9OA 4IVQA 4TQUS 4DPLA 4B47A 1GPYA 4B6JA 3L07A 5AW2A 4E46A 2AE2A 1UPFA 4ZVMA 1E79A 4PLPA 5DNUA 1WU7A 1JFRA 1EUCB 2CEAA 4MKIA 4CETA 1R6AA 2D3WA 1T36B 1B2RA 2H16A 2ODBA 4TWIA 4B87A 3FRIA 3QFRA 4YAGA 1BMTA 4C0JA 1N34B 2JLXA 3IBGA 2J3JA 3Q3EA 2DLDA 3W79A 2F8TA 1WEKA 2R6GA 4LYAA 2AWNA 4K86A 3CWQA 3JQ9A 5EJ7A 3VH4A 2OCGA 1G9TA 3I2FA 3F6SA 2BMFA 1K6JA 5U4XA 2IEAA 1G55A 2FW6A 3HU5A 4LXHA 5BYBA 1MO4A 5LBTA 2XGJA 3N3AC 2QJWA 4BXOB 3ZS9A 4O1MA 1VKRA 4JIGA 4IIBA 1CUZA 1PLKA 1XHFA 5B1SA 2CC2A 1QQBA 5LZ9A 2ICAA 2X5OA 3C14C 4MLZA 4EGCB 2OV8A 4PE5B 4BO7A 4CKBA 4YV0A 1TX4B 3MA0A 3JAMA 2V58A 2EHJA 3FCXA 3V4OA 3OZBA 1GUAA 2AC7A 1DL5A 4JUDX 1ZGHA 3PNMA 1IUKA 1CZRA 1FOEB 2GK4A 1XZLA 4AKEA 4ZU6X 1MAWA 3KJNA 4IUBS 5G2OA 1OFTA 1WCIA 3UENA 1T36A 2CBZA 2P6UA 4DMKA 4EO9A 3R3UA 3IESA 2QMOA 3E23A 4JL8A 2VYFA 1V5IA 3AM3A 2YWRA 4Q4HB 1PT9A 3OICA 3PJDA 4HUQB 4EFLA 2ABWA 3QY9A 1JNXX 3DCYA 3I83A 1GM5A 1P2DA 1DTSA 1F8XA 1R6TA 3G5LA 4ZJZA 2OQRA 5CA1B 4CEHA 4DB2A 3W4JA 2IHUA 3GGPA 2QGFA 1DADA 3TLGA 3BKWA 1YI1A 2KBEA 3EGWA 3KWMA 3LOPA 1UAYA 4N40A 1STOA 1W1IA 2YC4C 4NONA 3BGWA 2HRBA 3KOMA 5IARA 5BYKA 1PR4A 3AETA 1FX0A 3UGQA 2IWHA 1J9GA 1C1XA 4QGBA 3GEIA 3DDZX 4HLUA 3PEYA 5G1PA 1AKQA 1OXXK 5LP6C 1IAVA 4YO7A 2J6IA 4PRKA 3K9HA 2AZXA 4CMGA 1G0OA 4J6FA 1HKUA 4IRMA 1U7DA 3E05A 1I13A 2X1HA 1WSWA 2PPVA 3GJQA 3OJFA 4B3FX 3LBIA 1P72A 4P4NA 3B38A 1KYYA 2PEYA 4RK6A 1NRXA 2P77A 1SVIA 3V8VA 1F7UA 1P17A 4Q19A 1B8VA 5SZJA 4JUCA 5AVVA 2BEVB 2HBQA 5I7OA 5DGHA 2OCIA 3H4MA 4IIGA 5K3FB 2Q5JA 1O97C 3VPXA 2WJYA 1K7EB 3IBTA 4YFVA 5LZ5A 1YJQA 4B46A 5L9AA 5J58A 1XLTA 1JQBA 5FP0A 1TJ3A 1V26A 4CIXA 3BH7A 4GRAA 5E0KB 5C18A 2ZRBA 1G8YA 1D5WA 1W87A 2R7AA 2VP2A 3FG9A 4LC1A 3ZZNA 4FB4A 1YQWA 3C48A 4QWMA 3KOUA 3QRWA 2BR3A 3FLEA 3ZXXA 1V5EA 3O9MA 3ABQB 1AF4A 1IQRA 4GW3A 4KLZA 3C24A 4RKFA 2HIAA 5CG1A 2QTCA 1ZAYA 2PANA 5CA1F 1VE9A 4DANA 1EDDA 2HD4A 2CDBA 4BOYA 2BEWA 5I3ZA 2CYBA 4RDIA 4B6EA 5H83A 3M1LA 3A4MA 4MKZA 4ZWNA 4A1OA 3GXOA 4OM7A 3NNNA 5KDDA 2JJMA 4TL7A 1HUQA 1BRMA 1FRFS 3C3WA 3IMCA 4FE7A 3A10A 3LWNA 4BMYA 2RIRA 3PR2B 4UOQA 1CZLA 3ZE0B 4BATA 1ML3A 3HJHA 2PQMA 1MQAA 3GYBA 2AFHB 2FUEA 4AXBA 1DC8A 3JZFA 4NAHA 3LDAA 5ALXA 4NE9A 4DIOA 1KDVA 2N3ZA 2N1MA 2IWRA 3PQ2A 4KSBA 1RYEA 4IQ8A 4OMCA 2AYZA 2XNDD 5LWHA 3C6MA 3O8OA 3QMMA 4QX6A 2QUIA 4HAWA 2WVAA 3R24A 1NFFA 3ZE7A 4Q05A 1D2HA 1KEPA 3IKMB 1PWEA 2D5AA 4GLFA 2H0RA 3GAAA 2BJHA 5K4GA 3OOEA 1PJAA 2GN9A 2XBLA 2YHSA 1ZRHA 1WD7A 2W8BB 4H0CA 4TOIA 1KI3A 1R0KA 2JAHA 1E2JA 1XCLA 4Y6SA 3IERA 3NHMA 5CBKA 3NJ8A 1VKZA 4EIWA 3D2AA 2VZLA 4LJ6A 3AHEA 2WYVA 1PTJC 3M9XA 2ETVA 2YWXA 3I01M 1WTAA 3IT0A 2ZROA 5EHNA 3VV2A 1DV1A 2BH9A 3G8DA 1B16A 3PNSA 4QLAA 3WQRA 3AGPA 4ECEA 1QVWA 3HCAA 3WHKA 1AHNA 2PDAA 3RSHA 5DRTA 1LRJA 2I4OA 3EPRA 2WJZB 1M1NB 5GOZA 2B4KA 3Q5DA 4BKPA 3SNHA 3DEIA 5JSZA 1FBTA 2WTMA 3NKFA 3SJ7A 4E33A 1Z6ZA 3LK7A 3R5KA 4X6UA 2HWUA 4JHXA 2XCRB 3HKCA 1DI0A 1WOMA 3ML1A 4DQLA 5HKOA 1UBHS 1VDMA 1XZIA 1XJ0A 2WPNA 1HDZA 1R0LA 4LC9A 4K5QA 1A4UA 3BCHA 4RWZA 3ZZUA 4DY4A 1BA2A 5A9SA 3FW1A 4OHOA 2AK3A 5HQJA 5KC8A 3GP8A 1F5NA 2HKIA 1M2OB 2VK2A 1WUYA 1C7JA 4PVCA 3IVMA 2X2PA 4CKXA 1Z4PX 2VPWA 4U9UA 4FFBA 1O89A 1ISJA 3ER8A 4UE2A 4ACAA 4CU2A 2NO1A 1MG0A 2GEBA 1VMEA 2RKBA 2V5UA 2ZREA 3A0UA 3NVAA 4M9UA 4MR9B 3WGTA 4REOA 4EKYA 1MZPA 5HRUA 1KBZA 4Q1DA 3K1YA 3Q3GE 5EWLA 2IS2A 1F51E 2Z43A 3AT1A 3IPYA 3UFXA 1JKJA 1Z5PA 2OG1A 3KKMA 2I8LA 2XMZA 3TQTA 3OZXA 3BF7A 1QOQB 2GNAA 3BMOB 3WL4A 1QHHA 4MS1A 3AVVA 1SXJE 1SPBS 2FMTA 3EC7A 2JLVA 3KOZA 4DCJA 3N0VA 5CK5A 2JJ1A 3QE4A 5AT1A 4UREA 2PX5A 5CPBA 1LK7A 1UXGA 1T8UA 1V96A 2QNBA 3BFXA 4KP7A 1UDAA 1VGRA 3JYPA 1E2IA 2BFBB 4PZCA 1RMQA 3PQ3A 4MJ7A 3SZMA 1S2IA 4KNWA 3P9XA 1NQUA 1FQKA 2H2DA 3MGGA 5DYGA 4YDHB 5AHXA 5J23A 1U8TA 1P4HA 2XLBA 2QLNA 4KPYA 1ZM4A 4DLUA 1IM5A 4M38A 3QNMA 1PQPA 3NWJA 4BFYA 4GD3Q 3FKSA 1YD7A 4EECA 3OI7A 4I5DA 3PYXA 4UVDA 4A4DA 4MKHA 1U4NA 1T3HA 2GBCA 4G4JA 1NJ1A 3DMYA 4GFDA 1AQIA 2J33A 3WQHA 3DA8A 4P38A 1VG1A 4OMDA 3JWJA 1WCV1 3O21A 2OGZA 2QUZA 4KPGA 1SU4A 1J8YF 1DC3A 5TMDA 4DDUA 2FEAA 2FJ0A 2AKYA 2QSJA 2FCRA 1E69A 4U7TB 4X94A 4RPHA 5CT4A 3ZZ1A 3UXMA 1B42A 1KF0A 1QP0A 3BMOA 3OBBA 5EEHA 3RT1A 3TW0A 3Q8WA 4BV2A 1YRHA 2W2VA 2WZQA 4Q1FA 3TGWA 3AEUB 2X76A 3GBPA 4PR0A 1B76A 1UAGA 4H77A 2ZQYA 4Y2RA 4B4WA 5IANA 2JAWA 2ZJ2A 3TTYA 3Q6MA 3K1TA 1E94E 1P31A 2UUOA 1MOQA 1TT5A 3GDHA 3SHWA 5KTSA 2NYUA 2ZTSA 3SMQA 3CZ5A 3E27A 5AOCA 1QHEA 2W93A 5KWEA 1WETA 2WFAA 3OKPA 4YGXB 5CD1A 3AW9A 1FTGA 1UDXA 3DEKA 1D0VA 3OEEA 3H0EA 3IMKA 3WGOA 4PG4A 1C8VB 1P77A 2E6UX 2WM8A 4LHSA 2NZVG 2C1ZA 4KXFB 4QOEA 4WZZA 2IUUA 3KE8A 4BDTA 4AJLA 2K7ZA 2LKCA 5JTUA 3GPLA 1H5QA 5EIXA 5K6AA 3L8MA 4NH4A 3MGBA 3FWKA 1T10A 4L3OA 3MXTA 1NQOA 1U31A 2P67A 4NV1A 4OFXA 4S0ZA 5K51A 5KOHA 1RYZA 4IOKA 2CKDA 4GMGA 5DIZA 1D9XA 4D92A 1ZVVA 3X1KA 2OOSA 1TVKB 2VXYA 2XRMA 2G25A 3ZU2A 4FHGA 4DABA 4OLBA 2VRBA 1QX4A 1VE1A 2QYHA 3PCRB 3UANA 1RFGE 2ZE8A 4TLCA 4AZTA 4NYMQ 3ZXYA 4WXMA 5JI2E 1L9KA 1WXWA 3N59A 4BECA 3ANXA 3OESA 1EXDA 4KWHA 5F77A 3H2SA 5JY1A 4JJIA 4M7PA 3GDFA 1QFJA 2CDCA 3OCWA 4R2IA 3JALA 4C20A 4CUZA 3QMPA 4YALA 2WT8A 3SM9A 3CKMA 4Q7KA 1PL7A 1UOQA 3ONVA 4DCGA 1ZISA 3K5PA 1HDEA 1ADGA 4ABTA 4GR4A 4W1QA 3WGMA 4GMFA 1QZZA 1XJ5A 2CNLA 1NW8A 3BICA 4MCAA 5AKLA 1MAUA 3A6GA 5T5QA 2G0TA 4TL6A 2HLDD 2CLEB 3N74A 3NZEA 4O4IA 3UB2A 2HHCA 5JE8A 5ALQA 3V8BA 1CR6A 1OR8A 3PJGA 4P36A 3LKZA 3VTFA 3DEAA 4C0AC 3EXFA 5LL6P 1K2WA 1UMBB 3NHZA 3W04A 1RRFA 1UXKA 1YULA 4ZU3A 1N2EA 4QJ4A 2CB0A 5EKDA 3DMDA 2XITA 5BUSA 4MAFA 1J2TA 3QQPA 3C1UA 1X39A 2V4MA 5HKLA 3UUEA 5A4IS 1MEOA 1ZKDA 3ZU5A 5EJ9A 2NTJA 1W4BA 4ZVNA 2CXTA 3RFUA 3AONB 3G2OA 1QCZA 1JLRA 1K7CA 1RWWA 3T7IA 4BO1A 5CR9A 2FPPA 2HRRA 1JJFA 2J48A 2JC3A 2P0AA 2QV0A 4IDHA 4LVOA 5EHXA 5BSMA 3PIIA 5E9JA 3ECSA 1A2KC 1G41A 4UBOA 4MMYB 4XFKA 2FPUA 3D1VA 4POAA 4OFBA 1UZNA 4E7PA 4BIIA 2P69A 1ZS9A 5ILGA 1EJ0A 3SLGA 3D4OA 4M1MA 3H6HA 2ZJ7A 1K8XB 5F78A 2I6TA 1RDFA 1JQ5A 1KORA 4YT2A 1CUEA 2AZDA 3DM5A 1ZK3A 3KAJA 3Q6NA 4O2BB 5F5NA 1FTSA 2RJ3A 3FJOA 3G89A 3H04A 4MS4A 2H2HA 4FSXA 2QTVA 2IE8A 3ZK7A 5JWRA 4ZJPA 4M8NE 1VMKA 3MS4A 2IV3A 4B71A 2B1RA 1U6JA 3GR6A 3O4VA 2O2JA 2AJDA 2BGRA 1Z8HA 1B8NA 3ILXA 3MTAA 1IOWA 2DRIA 5CB6A 1D7OA 2HJRA 3CRZA 4KQ6A 5FLEX 1XMIA 4LC0A 4IDAA 2DUWA 3KR9A 3L7OA 2PYDA 3SQOA 1VCNA 5K8IA 2JGMA 1Z8FA 4GWGA 3I42A 1DBRA 1KMNA 3TPFA 2NO0A 1M8PA 2DFTA 4YONB 4YN3A 4LW8A 5BO5A 3NBUA 4MH0R 2GZAA 5B55A 4IYJA 3RS7A 4OUKX 4UUMA 3QZUA 1E0AA 3LPMA 4RVUA 1K4YA 1JSCA 3PF8A 4HX9A 4IF6A 3MPOA 3DZDA 4ZT5A 4BPBA 2I6FA 2QKYA 3SEFA 1YDGA 5F2OA 3QE9Y 2O54A 3V55A 3JXEA 3TZKA 2DT8A 4ZALA 3Q5EA 4FS3A 4D9CA 1XTPA 5AW1A 5DNWA 4NBKA 1T1IA 3E1SA 2XZTA 4MVJG 5EC8A 3ISVA 5BP7A 1KYXA 1XTJA 1HXHA 1MVLA 1W85A 2OCDA 4P5PA 5C7OO 3DDHA 3TJRA 3OQMA 2GM5A 3UYKA 3X1XA 2YQ5A 2X9LA 3GDOA 3SC6A 3WYNA 3QG1A 2PNFA 3CC8A 3G49A 3PFIA 1GTRA 2JDIA 1SZJG 2GCPA 3HSYA 5C8YB 3F49S 1QDUA 1R4NA 3F6PA 4WX2B 1H8EA 1V7PC 1Y7HA 2YMQA 1AZTA 3GJYA 3ZWWA 4LNUB 5EWJB 1OLSA 1T3SA 4DV1B 3F67A 4U00A 5IUJC 3WMEA 4IDOA 3QSGA 3VI3B 4EHFA 1AHPA 4GO1A 2R00C 2WOOA 2BFOA 1EE9A 3O03A 4FMCB 4N9WA 2HSWA 1XTSA 3EBLA 3LLCA 4OQZA 4ND8B 1AS3A 2ZAOA 3WO1A 4EJFA 4CIWA 1VFPA 3WKCA 3IXMA 5KHOC 4X6XA 4NU6A 5KPDA 5CNMA 1FFXA 3E9NA 1M5TA 5MN6A 2A0UA 4L8YA 2OCLA 1RABA 5LXTF 3VMFA 2DWCA 1N5OX 5HFAA 1PSWA 2O4UX 2EKQA 4FBLA 3RUCA 3ZWYA 4AAYA 2NQ8A 5CD9A 3EJ6A 3GPIA 2GT1A 4I7EA 2ONKA 1BS1A 3JQBA 4INOA 4P22A 1E3MA 1YDFA 3KM0A 3FCEA 4F8EA 621PA 3MPUA 4RZIA 2AZ4A 3FMOB 2HJVA 1M6NA 5GJBA 4E13A 2VDVE 2ZIUB 1HT2E 1QIFA 3AJ8A 4O3FA 4BQOA 3THYB 1OTXA 4KITB 4D56A 2HPVA 2E4ZA 3AF1A 1W36B 1SXJB 4M7RA 2H2FA 3MMPA 1E4EB 3ZWQA 1H23A 1U0OC 3RJ9A 1WRBA 2PKEA 2RCNA 3NETA 3CBGA 4X92A 2C9ZA 1M1YE 3LGXA 2DLCX 1PG0A 2I99A 4QFBA 1YRAA 5F33A 4RD6A 1ZPDA 3VKUA 4F3RA 5CCXA 1W44A 4PLCA 4TYNA 3ISTA 4NBLA 2ZJOA 4WRRA 3REQB 4B9AA 2ARKA 4YMGA 4MJ3A 3SLRA 1CZKA 1A1SA 1LSSA 5LU8A 5HKKA 4R8LA 2BZ0A 2G28A 1TVEA 2VJAA 3MOGA 5GONF 2JKYA 5TX7A 5LD2C 2G4CA 4BUCA 1KPIA 3OZCA 1UBCA 5F9MA 1FP4A 1P61B 1M6VB 1E0SA 3ZBTA 4E1VA 2BFAA 1PNQA 2ZE7A 3AEQB 4PZ9A 5EHGA 1USIA 5HTOA 3B7WA 4B3CA 4EW2A 1X7WB 4NYIR 4TUYB 3OQIB 3UCEA 3KQWA 1BEEA 1MXHA 1K6XA 2OP1A 2QP9X 2C2WA 1T9HA 2I3GA 2BHSA 2J1LA 3CZ9A 3HCRA 2O5CA 4LTNA 1N2SA 1Z73A 1V6CA 4MW0A 5EGNA 2XQVA 4RTMA 2EDAA 2R9VA 3TD9A 3Q8MA 4J2OA 5J59A 1PHRA 1SPXA 2QGZA 4L1KA 1H5NA 1FJHA 4ILKA 2GAJA 3QTTA 1Q0QA 2XVMA 3JVEA 3N70A 1OXBB 3RHTA 2EC5A 4H59A 2O48X 4D3XA 5D87A 5C0OE 3STYA 2QGNA 3NG1A 1MFPA 3HUFA 4NCJA 1XWFA 4TYMA 1H1DA 3M5DA 3CZQA 4K3VA 1I4DD 4BJ5A 4BVAA 1QO7A 2DU8A 2MYTA 3ON5A 5CLGA 4GBMA 1JPNA 3LRPA 3QOWA 2XHZA 5ETJA 1PVVA 2F7SA 1Z9BA 4M3NA 1W96A 3KV3O 2ISSD 1E1NA 2JFGA 2NXEA 4UPDA 4YRCA 2XBMA 4X93A 3LY9A 4Q16A 4W5TA 5H81A 2CE7A 1EHCA 3MIIA 5HYVA 3PC4A 1E5VA 1NN3A 1KBQA 3CUKA 3CF4A 3GEHA 3IILA 2P2GA 4EQ6B 4EYOA 4C7OA 2EGHA 3BXHA 3WMWA 2EYQA 3G5UA 4DZZA 2DLNA 4NABA 1NI4B 2Q1SA 2OO3A 5KNCH 1FF9A 1UZMA 2IUEA 2RKWA 1G3UA 2FI1A 5COBA 2XB8A 1FJXA 1N4DA 1IQPA 1FNBA 4G07A 3I1FA 4NS4A 4BB9A 3L7DA 2JA2A 5LZ7A 2O1SA 1HFWA 1OJLA 3AU8A 3G5MA 4IH1A 2P1RA 1X9GA 1JW9B 5E0OA 3CGWA 2I65A 2J3QA 5J9FA 3ZCRA 3R9WA 5DU2A 2RGUA 1GIAA 2DMRA 4K81B 4E12A 1DC7A 3PR1A 3U17A 5J4LA 4CM9A 1JZQA 7MDHA 5IJWA 5TF0A 2AFHE 5BORA 1H05A 2FDRA 2JJ2A 2WIBA 1M2EA 1ZA1A 2ST1A 1SQSA 3CX3A 3DPIA 3MRVA 1M2HA 2EHDA 4PFSA 4WXEA 3RYFA 5AUPB 3I9V1 3G1TA 4DARA 3JWPA 1DJOA 4DJFC 4P35A 1XDBA 3FUXA 1TMGE 4L8GA 4RFVA 4BYMA 1XZAA 3GEBA 3GEMA 4QBTA 3USES 3PK0A 1H2FA 3FWZA 3L7AA 3S2GA 1WXIA 1R8JA 3T4EA 1CS0B 3VR4H 5BVGB 4Q9DA 3ZVNA 4TYQA 2Z8YA 2ZRAA 2WJJA 4Q66C 4DM4A 1A9YA 3ICOA 4F4IA 1UAAA 3Q9LA 1ODIA 1OFUA 2JVIA 2WWFA 2QRVA 2H1WA 1NZFA 1QTNA 1SOMA 2R00A 3I1YA 4QOIA 3BAFA 3KZNA 1P1RA 2FNAA 4EARA 5LVAA 2WYHA 4ALNA 2JCGA 2Y76A 1NVTA 2XQIA 3ONEA 4JEHA 3Q0TA 1Z74A 1B0AA 5TGTA 2O8BB 1T15A 1Z75A 3PUHA 5IC6A 4L02A 4DA9A 4HQLA 5KOJA 3AL0C 1X0XA 2VI5A 4B7CA 1GSAA 4J16C 1Q83A 2I1WA 4PZDA 4Z9FA 2C04A 2IOHA 2J6HA 3D6VA 3ABSB 3E5NA 3M6VA 2Z8ZA 3HO6A 1WPRA 2FX2A 4AY5A 1XNGA 1FEZA 4X61A 3A4LA 3WZMA 4F7DA 1GKUB 4ZCQA 1KOJA 4JSTA 3WYDA 3LL7A 4Q3LA 1I4EB 5HDBB 1Y48E 1CQZA 3GPCA 1NBIA 1RLIA 5LMCA 1OBCA 4RKYA 3A32A 1NVMB 2YIVX 3SLKA 1Z3CA 3BBPA 1SQGA 1LBTA 2YV4A 1LS1A 3UW1A 1U99A 1QUFA 5JPCA 2VTBB 2ZYSA 2D5CA 2DY0A 3G7SA 4P7BA 4C0BA 2XWSA 1CY0A 1DVRA 1FLAA 4W99A 1NP6A 4YYEA 4C3UA 4CLEA 5G41A 2V6IA 3ESXA 1J49A 3R5FA 4W4TA 5CLIA 3EIFA 1FYFA 2R2AA 1G8SA 2EDCA 4GZ6A 1CXZA 3OBIA 2HSGA 1NN1A 4J7UA 2ZYDA 4L7VA 4Q1VA 4AKSA 3IEVA 1C7RA 3L8YA 1RQLA 3Q2OA 1XAHA 4LMBA 3NI2A 4O4IB 4D3SA 2P6OA 1PJQA 4KG7A 4PQYA 4G5SA 5CVVA 5AVKA 1N2HA 2A33A 4RL6A 5DBHX 1BHO1 1ESMA 2J08A 3ZXIA 2FR1A 3MWDA 2DSTA 4HGNA 2AFIE 4LY0A 4V02A 4Z9BA 4B32A 3L0YA 4YPVA 3HMKA 3NRCA 4Y0AA 3RIHA 3HHPA 5KNLA 5IH3A 4BQSA 5CFNA 3J80A 4QU9A 1UC5B 4DYVA 4BKOA 2PKXA 4G24A 4XARA 4JZYA 3TUIC 4PPQA 4N5DA 5LLSA 1CJCA 1PJRA 2I6XA 1I2ZA 2OXRA 4ZVLA 3F73A 3DQPA 3UK1A 3HCEA 3C8ZA 3OAAA 1J6UA 3T12A 2WRZA 3GH1A 4OQDA 3DFUA 4E2XA 4EPVA 1OV4A 4KLRA 4F21A 1CVRA 2C3UA 4DLYA 2H4YA 1JLLA 4XZ3A 3ORFA 3GV0A 1EZZA 1I33A 3CLRD 3KVNA 1T1GA 1MQ9A 4JD5A 2MWMA 2Y1OA 1VG9B 4YVFA 5DT9A 3STUA 3CSUA 3FOWA 1KJNA 4BO8A 2BW0A 2VPTA 2VN8A 2WDPA 2FDCA 2E2WA 1J9EA 3L7NA 2OYCA 4D4HA 1A4IA 4QPJC 3CIFA 1GVNB 5G4KB 1UKCA 1ORHA 3QK7A 3ICWA 1JG7A 3UB3A 3DAPA 3BZBA 3G7UA 1P4JA 3U0BA 3NBYC 2QX9A 2W2XA 1XK6A 5JPDA 3V4ZA 3G2QA 3G2JA 3L4EA 3LU1A 4U0JA 3TM5A 3R7WA 3T3OA 2FPSA 4P5DA 2I91A 1FP7A 4OQEA 3FGOA 3MMNA 2PNJA 1SRRA 2VAMA 4B6OA 4D4JA 4DL9A 3I9OA 3VU3A 4S3MA 3N0TA 2GM3A 3I8SA 2WTAA 4DSUA 1SU6A 4AY3A 2ES4A 1L5QA 2WNSA 3IUYA 1NJ5A 2IYOA 1JSLA 2XOKA 1B26A 1VJDA 5K3BA 1RYMA 1XEFA 4ZVUA 4AZ3B 4PBTA 4NARA 4TKZA 4TV8F 1LI4A 3FD8A 1O57A 3IPRA 3MQ4A 3INGA 3O3MB 3K0AB 1FP4B 1DQYA 1RWOA 3FTDA 3EBPA 2B20A 1S3FA 1VYHA 1Z2OX 3O1LA 4H35A 4MDYA 4Q0MA 5I3CA 1TKAA 3AL2A 4CCSA 4J8PA 4L16A 2D13A 4G85A 2G6TA 3RK1A 4HAOA 3CW2A 4Y2XA 3RYTC 1D7AA 1I6LA 3HTXA 1CVIA 2FPXA 5GJVC 2XB9A 1EGVB 1W30A 2QT0A 4J90A 3Q40A 3TDNA 3DLPX 1QB7A 1NAIA 1NR5A 1PKXA 1CIVA 3DTNA 3P9KA 4LX8A 4E94A 4DA8A 4F2WA 1T2AA 2BBWA 5IMBA 3RCBA 1R4MB 3JQAA 4CKCA 3T7EA 2FZ4A 4KWTA 3O6VA 4Y9DA 3UIEA 3CNOA 2BTOA 5SV2A 3Q7PA 4TSFD 4DTCA 2RE8A 3IHWA 3PHHA 1XZGA 5FPYA 1QV7A 5BRJA 1I80A 3V1LA 4G97A 1QPZA 5NULA 2W6JA 3KJEA 1ZSYA 2H7CA 3E48A 2WEKA 4HFJA 3OOWA 4HB3A 4G9GA 1LBQA 4X20A 1AA9A 4NBUA 3UJ6A 1JJIA 1QKJA 2W2LA 2ECFA 2X6RA 3B6MA 4JVNA 4CCYA 2XTAA 4Q24A 5L7TA 1OPXA 1ZH8A 2AT1A 2XQFA 3GFSA 3QV1A 2ZT8A 2FSPA 2IF0A 4HWTA 4YHBA 3W90A 4AF6A 4AVYA 3TCNA 4JX8A 5A0TA 1WCYA 2JH8A 2VJMA 1YI0A 3IS3A 1TOAA 1PHPA 1Y5MA 4XDGA 3PC8C 3GAZA 4FILA 4ZARA 4RUKA 3T7JA 2TECE 3FFXA 3JX9A 3P0FA 2NPIA 4GPBA 4JT2A 1G3MA 4FE4A 5SYNA 3W3AH 5ITWA 1EWQA 3T1TA 1OIXA 2VHUA 3HA2A 3Q9UA 5KNBH 4P0QB 2WZDA 5AP9A 4H3SA 1N6HA 2F43B 5EPOA 1LDMA 4HY3A 3KQUA 5D6OA 1Z39A 4WESA 4JLUA 4M0DA 4ZAGA 2VUSA 1NWCA 2B8NA 4FE3A 3DVAA 3VPGA 2QX6A 5GTDA 4QEKA 1IRXA 2FJUA 1EK1A 5KWSA 1M8KA 3CURA 3FSRA 4JC5A 4NKRA 1FVOA 1W73A 2PVCA 3ET4A 4XQCA 5K0LA 1NLMA 1R6BX 2IP4A 1CB7A 3B60A 4XLZA 1DO0A 1W5TA 4XIIA 4CM4A 3M2PA 4H08A 3IP6A 3EH1A 3TZQA 4RTQA 2REBA 1Z5UA 3FLMA 1R0ZA 4ZI3A 4WKGA 1T4MA 1WZEA 5L3SB 3RWOA 2JDID 4RE6A 1PT8A 4WLNA 1NX6A 4UHEA 2QD1A 4R68A 4UNRA 2VAWA 3Q5GA 3MFYA 4RELA 1A76A 2YHAA 3D0RA 1VIAA 1ZMOA 4KXQA 4OBXA 3UBTA 3C6ZA 4B3JA 4DMRA 5JAPA 3VPSA 1FDSA 3ES9A 2ATXA 2P2NA 4RABA 2QRVB 1O2DA 3WGZA 1DEKA 1MPXA 3PR3A 4WKOA 1UFKA 3W9SA 5A4FS 4ZCMA 1EWVA 1XZQA 4GP6A 2A0WA 2W2KA 4I55A 2GTPA 3F5MA 3B7PA 5AKHA 2V74B 3UJ7A 4DWVA 4Q4JA 3BZWA 4M83A 4TN5A 2P3LA 1GGEA 1XTBA 5TRTA 1J25A 2FP3A 3A6DA 4N0QA 3SDZA 1SUPA 4BNDA 1PLJA 1U8FO 1UEJA 2JBAB 3F78A 1C3OB 5EPUA 3KSBC 2B69A 5AJVB 4LZPA 2OAP1 4AX8A 2YXDA 4HZUA 1V43A 2GZHA 1QPBA 2YV1A 2UXCB 1DUIA 4HWPA 4Q3CA 5CFPA 1KJZA 2FN8A 4JMLA 1QFYA 1G3IA 4IO1A 1Q20A 1H6CA 4YDRA 5EXDA 1GTSA 1AJEA 1M9NA 5JWHA 4IXMA 1K5DA 5LZ8A 3U44B 4NRDA 3OE7A 1S2DA 3TLZA 1Q14A 3EB9A 3EXEB 4JR1A 3UKOA 3VUFA 2Y1DA 4JOCA 4NFSA 3UMVA 3L7BA 3UV3A 1W5BA 1EB9A 2PSSA 3DVAB 4UC0A 2B1GA 4WNIA 4KWCA 3MTGA 3A1TA 1N2OA 4EG5A 2GFIA 5AM1A 1E66A 2X5KO 1MNQA 2LUOA 2BEUB 1FUYB 2FZ5A 5IN5A 3ZDEA 4C4PA 4HH4A 5AVZA 4CT5A 1J09A 1ZH2A 3BILA 1YRLA 2W90A 3AOEC 4LHYA 4NZNA 2B99A 3P5SA 3SIRA 5LA6B 4F3CA 4ZGWA 3C3BA 1B6SA 2Q62A 3A11A 1K27A 1X3SA 5HIJA 3V46A 5CYGA 4YHHB 2X3UA 2ZUDA 4QUKA 1T3LA 4JEUA 4OA8A 4PXAA 3JZIA 3G0DA 2NYAA 1WDLA 2OECA 3E9RA 3K09A 3OEYA 4DV2B 3GUYA 3SHQA 1DFGA 3W2HA 2FU5C 2YY6A 3E2MA 5IS2A 3Q7IA 5K4AA 2EKBA 3ROKA 3EZLA 1HSZA 2R7MA 3RFVA 4DA6A 3ZWKA 2RGRA 2F62A 4DILA 3D3WB 3JYOA 4D8TA 1GPKA 2VWQA 2Q2VA 1E6EA 3PI7A 2GASA 4A16A 1USUA 2DVMA 4FDAA 2C5BA 5E8RA 5FNVB 3GGCA 2ZQZA 3GPDG 1ENZA 1KOGA 4RCZA 1IBCA 4DCSA 1SBYA 1M1YB 1PQWA 4WOCA 1XPOA 3OP4A 2ZJ8A 2QJRA 3JAKB 3FDZB 2O0MA 1KAQA 4JJKA 1H2RS 3CF2A 4HSGA 5AW8A 3IAXA 2ZBFA 4R5HA 4FZ3A 3Q2KA 3FOEC 1YJXA 4LDZA 4NK4A 3FHCB 4N8DA 5FOUA 4Z0TA 1ILEA 1XTRA 1T9KA 1FX1A 1YACA 2DTEA 4J1QA 1NV9A 4KLCA 4EGJA 4ZI7A 1YZKA 2VNKA 4LJ4A 2R8XA 3T94A 4C0XA 3RUIA 5KBYA 4KIFA 1S3IA 3QEJA 5AK5A 1HTTA 5B2EA 1E1LA 2QN9A 2BE7A 3B2QA 1Y5IA 4KI0A 1Q7TA 3ZCQA 2RH9B 4HDNA 4P80A 1JDNA 1SNYA 4G8JA 3QUBA 3DO5A 3B1ZA 1YBHA 2C8LA 3FNGA 3F7MA 4X00A 3PRHA 5ENZA 4ZT2A 4LBWA 3WHPA 1APBA 5LA6F 5CNIA 1VTKA 3ZUGA 3DMFA 1E61A 1FW8A 3NYIA 3OT1A 5HEKA 4YIKA 2QPLA 3UOGA 1MHPA 1MORA 2RHHA 2Q0SA 3VC2A 3BQMB 1EWYA 4K28A 1EUZA 2IZ7A 1QNFA 1JXQA 2QVZX 3AR5A 1NBEA 2ALJA 1ZOSA 4KWEA 4JI8B 1N9GB 2EBUA 4N12A 5J2UA 4ALLA 1PGQA 4GNRA 3GJ8A 3K0EA 3OEHD 1O8BA 4KYTA 4TT3D 2JGLA 5ED0A 4R2JA 3KQSA 4UHBA 5FWDA 4D9MA 1FFXB 3VHXB 2J5XA 3K0AA 4ZOEA 1N0HA 2I33A 3K32A 5FNZA 4EK9A 3LFTA 1FDIA 2VJCA 3LV8A 3DXZA 4KACA 1FSPA 1TU0A 1NE7A 1WVMA 2EFEB 3K30A 2DULA 1Z35A 5GINE 5I4CA 4FQ5A 1MQ8B 4KX5A 3M5CA 4W1RA 4DCMA 2BF7A 2O2ZA 2D1SA 1H4TA 1UFRA 3GIDA 1IZ8A 4G89A 4E3WA 3DUFA 3GGSA 4K6CA 1XU7A 2Q5EA 3D6HA 4M1ZA 4YJKA 3D4IA 4LY3A 1S4QA 3A58B 3KPYA 3LKDA 1Z0DA 3UY4A 3OC6A 4FW8A 1EFRD 4UQLA 4EF6A 1VRCA 1T9GS 3GRZA 4V0SA 4WZAE 3R5SA 4D3ZA 3O8BA 1QQAA 3IDZA 2MDTA 4LF7B 4BNFA 4EPYA 5JQGB 2HK7A 1T0BA 3O4GA 2OP0A 1K86A 3P1JA 2XUIA 3K9QO 2ZB4A 1IBLB 2AC2A 5KDOA 1LCIA 1E2QA 1Z5OA 3EVFA 4H3VA 1VJ1A 3ZKWB 1BGWA 2J5BA 4EGSA 1PQ4A 1BH6A 2FRXA 2AJCA 4EMTA 1ZU5A 4HGQA 5A6SA 4Y1GA 3F2IA 4G67A 3OSUA 3UTCA 2A9FA 1AKNA 3FTNA 4F04A 2C8VA 2DKFA 4INJA 3RW9A 2WQ7A 1E5LA 1X14A 2QT1A 5F1YA 1MB4A 1I2BA 5G0WA 1ZGCA 3BF8A 1BVHA 1VLLA 5EVJA 4AM8A 4D7AA 1IVSA 1W1UA 5HX7A 1GA1A 3C45A 4UFNA 3VR6D 1QTRA 3R4CA 3QUSA 4O4JB 3DS8A 5DRYA 2R79A 3MAAC 4IP0A 3B9PA 4UHCA 5KU7A 2VH2A 3SF8A 1T1SA 1BJRE 1JEEA 5GMOA 1KVQA 5AR1A 1W0CA 4AO7A 3GD7A 4BIMA 4M53A 2IFTA 1CG6A 4W1PA 1KMCA 4LE1A 2VTDA 4P98A 2CDRA 3F71A 2EGUA 1SVNA 2Q45A 3ZC3A 1P0PA 5AW5A 3TBFA 4FX2A 1HYHA 4DLBA 3FYTA 1UDBA 2F90A 4P93A 3TQOA 5FUVA 1A82A 1F17A 1PS9A 1UKEA 2HHLA 1NQVA 3G1UA 3JZMA 1QFSA 5G3ZA 5GGXA 3OM9A 4AP5A 1WAMA 1JB1A 1QYRA 3DLCA 3DULA 3V7NA 3B6ZA 2BFEA 3EDRA 3VHLB 3CONA 5FPPA 3IEIA 5ALWA 4AUEA 1VE7A 3PBKA 5HCUA 4H7DA 5KU1A 1KXJA 4R3UC 4EHHA 5KYKA 1UPTA 1Y5LA 4XJSA 4UNIA 3VSBA 3S4YA 2NAPA 3JYHA 2F3QA 4JOQA 1A2BA 4F1WA 4RDCA 2DOKA 4PQEA 4C6HA 3EEOA 1PWYE 2AFVA 3ITKA 4I3FA 1KR2A 4P9NA 4QPCA 3ZDBA 3TIGA 3BSWA 2RGEA 2QRPA 3PNBA 2AUTA 1FFBA 5EKUA 1KYIA 5JMWA 2BFBA 2QTAA 1L8OA 1PS0A 2POQX 4JBWA 4KXMA 4QQRA 2VDNB 4XWYA 5AICA 3LBFA 2MINA 3G2IA 4L2IA 5JAQA 3P4UA 3JQ9C 4RFSB 4BNVA 3IT2A 2BM8A 1VB5A 3G0CA 3P2YA 4JGBA 5T57A 4HT3B 3JD1A 5KQRA 5ENVA 5AVTA 1MAHA 2V6JA 3OFKA 3SHOA 1PJ2A 2V0CA 2W4IA 3FR8A 4LE2A 1XRNA 2IXEA 4U6QA 4WEQA 1EVYA 2V7TA 3INYA 2GCNA 3OFNA 4CE6A 3NIBA 3HDQA 3TSOA 1UMCB 1Z5WA 3ZHTA 5K7SA 3CGGA 2WJ3A 1LU9A 4NCIA 1SG9A 3SN6A 4GOKA 5B4TA 2X6TA 3UHPA 3FCOA 4K9LA 5ALTA 1ZI9A 3HKDB 2BIFA 4HI0E 4L5JA 4M99A 1QYCA 3DKRA 2YC2C 4R40A 4RW0A 9ATCA 1AY0A 2CT8A 3VAYA 4MLDA 4BC1A 1H3NA 1Q7EA 3URKA 2QAGA 5EIEA 3HV2A 2IC5A 1K7YA 2W43A 2XZDA 3I76A 4HMOA 2O8EB 3K9GA 4AKGA 2ZBDA 5C34B 4CEJB 1NTOA 5CVTA 4GOMD 2EQAA 5KOHB 1RKBA 2FOIA 2QTNA 1UMDA 4WDRA 5DHFA 1F1JA 2Q50A 4R0VA 4UOZA 1Z08A 1YDMA 3NHFA 2Z9DA 4ARZA 1LDNA 3GJ6A 3EOBI 1AOXA 2Q6LA 4BWFB 2DR2A 5G3YA 5FLXA 3OJCA 1KMHA 1PJ3A 2NU9A 4JUIA 1ZYUA 3LBYA 4NDNE 1PT6A 2R8EA 4PZYA 4RK5A 3QFFA 2AVNA 1ODSA 3DOJA 3M3PA 3LLUA 4G5QA 2AG0A 4TMZA 1IJKA 3QUAA 1Z2DA 5F2NA 4ADSG 4OYRA 2JB9A 1WV1A 1JR6A 3S8MA 2B8TA 1P4AA 1VG0B 2VJOA 3HDTA 1OBHA 1J33A 3L8GA 1OZHA 3AUSA 3KD3A 3N6VA 3W78A 1CY4A 2CFCA 1L7VC 1E9AA 2EXXA 2YYYA 3MWKA 3VHRA 5BSHA 3W7AA 4AF8A 4D26A 3GCGA 5D5QA 4Z4GA 4D45A 3H7IA 3DHYA 3HZHA 1M1ZA 2ZULA 4WY2A 2VL7A 5KJCA 2QB5A 4HUJA 1WCXA 1Z06A 3ZKAA 3TQCA 1N7IA 2AUMA 2V0NA 3NB0A 3HJGA 4EHIA 3ZIAA 4K26A 2Z1MA 2VK1A 1N1GA 1MDFA 2YDXA 3BGOS 1J5PA 2V98A 4B3XA 4I50A 4F8YA 3K2IA 1J5XA 4HN9A 3L1KA 4ER5A 1QG2A 1ADCA 3AFHA 2I80A 2VRCD 1ILWA 1EA5A 4HLDA 4JQOA 3NJRA 1OE0A 3TI9A 4DQVA 2ZWVA 3QFTA 3NDBB 1U4SA 1XZBA 1O1YA 1IDOA 2OAEA 1ZKMA 4NCHA 4ZT3A 4UM9B 5K8CA 4Q34A 3ZVKA 3BDAA 2BBTA 4I9UA 4BRSA 3FYUB 4U7HA 3ED1A 4IGEA 2HUPA 4DXAA 5F3DA 4OQLA 2WP8J 2Z4SA 5J4KA 4Y67A 4B48A 3K70D 1DUVG 5D6NA 2LPMA 1NN5A 4OK6A 4HDRA 4EYKA 2CL0X 5KQGA 2VFAA 2DFLA 2YN0A 4QYSA 1BN7A 1GKIA 3B6EA 4FZ5A 3TK1A 3ZK9A 4CG1A 1NDQA 5LMUB 1THGA 2QG6A 1MABB 4P0PB 3B6JA 3BWDD 4UAVA 2F48A 2JANA 3W77A 4DA4A 1T0JB 4ER3A 3LDHA 5T3UA 9GPBA 1U3FA 2CLDX 1N6NA 3ER9A 1X94A 2ZYWX 4P7FA 4X20B 2NU6A 3MT9A 4X71A 1KZ7B 5ALMA 5CB4F 5CFOA 2HC9A 2BEWB 4ODIA 4R05A 4Z8YA 3IQWA 5TT1A 5ITSA 1CYDA 3KT8A 2PMKA 4OTZA 1WLYA 3QPAA 1RWNA 4KW7A 3KSMA 3BTUA 3JYNA 3LPDA 5D3ZA 1JN0A 5LD2B 3HSKA 4BX0A 4WKBA 4CMJA 3HXTA 4TXHA 1EVLA 4NYIQ 4MW4A 3TVDA 4G1MB 1CKEA 2IXDA 4D74A 1R0RE 1GTL1 2WF9A 5J43A 1AGYA 3DM9B 1IONA 3CWZA 4GPTA 4H17A 3ZKWA 3B3QA 4BQQA 1LC0A 2D6FA 1V4BA 4NY1A 1RRMA 5NLLA 2VYND 5FNVF 2MT9A 1O8CA 4QVGA 2JK1A 4AYXA 1JYEA 1JDBC 1OI4A 2QZZA 4GYJA 3RRFA 2XZPA 2Y99A 5CDGA 1N25A 4RHCA 1VJRA 3KEOA 1ZRMA 1N32B 3IO3A 1QP8A 2QDXA 1NW4A 2CMKA 2GUWA 1U11A 1UJBA 2L2QA 2VP5A 2VATA 3OX4A 4B7UA 1C9DB 1Q22A 4WBXC 1ZITA 4UMEA 4DFDA 4FPXA 1J21A 1RXEA 4IO0A 5DF1A 4J3NA 1UBOS 2OFXA 4LJ9A 3INRA 4X8HA 3R9IA 1BDHA 2P79A 3ZGOA 1KDPA 1DG3A 2EJTA 3QVGA 4G2TA 1E3LA 1L4NA 2VXBA 5F52A 4KJZA 2FOXA 4M0MA 1JH8A 3WGJA 2WJ4A 4F84A 2HA7A 3LNTA 3K9LA 4L4YA 3SXJA 1FMCA 1GFSA 3WTBA 2Q3FA 2REQB 4W9NC 1PRYA 5IDYA 1XZ8A 3KO8A 4LFCB 4RU1A 3HRKA 5E2BA 1EK2A 1N92A 3BDVA 3DLAA 3OECA 4Q6WA 1QAOA 5BOVA 1S2GA 1V48A 1C3LA 4ATNA 2XMRA 4DBVO 1SVLA 1QM5A 4JBYA 4ER7A 4E03A 1E8NA 2Q6KA 2SHKA 1Y1LA 2WSMA 2Z30A 5EUQB 3VSDA 4EJ0A 2V6BA 3KLOA 5K0GA 1U2QA 3I9MA 4K87A 1JI3A 3RSSA 1QZ3A 3FYHA 4ERXA 1QRTA 4RD1A 2R6ZA 4QGAA 1ISRA 4RV4A 2WQ6A 2DQ4A 4DXHA 1BHJA 4C2TA 1EINA 3QI7A 2ADMA 2XCOA 4QM7A 3NT4A 4GL2A 2W0MA 3ZX4A 4EVSA 4E5PA 3NANA 1CR2A 3Q7RA 5TARA 5ADHA 2CHUA 4QFCA 5FPTA 3VFDA 4LSGA 3LPCA 1NDHA 4W9RA 1YC5A 3A27A 3MF4A 2PQ2A 1DKUA 2B35A 3WYCA 5EYPB 5I7UA 3KKPA 2BUAA 3JQGB 5E7MA 5U1PA 1XK7A 3DFZA 5IVPA 2VTEA 4D9FA 8ADHA 3EIHA 4IQFA 2IYXA 2DG2A 2GZ1A 3QKSA 3T9DA 1OH8A 2HLPA 3FNQA 4HQOA 1CERA 1UL1X 2BR4A 1ONBA 1I7LA 1PW5A 3EA5A 1JFVA 5K6TA 1VYTA 2PL1A 3NFYA 4ETWA 4FFWA 4MUEA 3N2NA 2H8GA 2ZKLA 3NPMA 4NJEB 4MKXA 4B5LA 4ND2A 2DXIA 4FGKA 1H2ZA 1PJTA 5ADVA 3O3OB 1UIMA 4X44A 1DTEA 4H4CA 3A3KA 2QRMA 1A9QA 5B30A 1SXPA 2HPAA 1DJMA 3UTDA 2Q6VA 3DLTA 4HDAA 1SU7A 3MC1A 3ESDA 1C4OA 3GGGA 3K8OE 4GGPA 3W5UA 2Y92A 2GEUA 2PBZA 4OQMA 4JZKA 5GGYA 5L3SA 4XRRA 2K87A 2IITA 2MSCB 3C87A 3MXOA 3N07A 4OHKA 3U3RA 4AJPA 4CI9A 4DSZA 4L15A 1S8NA 3BS4A 4GICA 2BYTA 1L7DA 3E8MA 4INZA 4ARVA 5DVZA 2XB4A 3DOFA 4L7QA 4GQAA 3CH4B 1KU6A 4M0EA 3QVVA 2AH5A 3P0JA 4FUTA 3AFGA 2UUAB 1ZCAA 1DX9A 4LV8B 1AMOA 3KSZO 2I67A 1M6WA 2GEKA 3NAZA 1X86B 2GSWA 3CZMA 1FX0B 3FPSA 4O2BF 3NHYA 3WIBA 4W7IA 4G0NA 2C7QA 3ZI0A 1R4NB 4BKQA 5KSOA 3JSAA 4BFTA 4EHAA 5JQWA 1EIZA 4M9CA 1C50A 1NYQA 1QANA 2E87A 2O3TA 2B8JA 5DWVA 3FNFA 3Q7QA 3GZNA 1DC5A 5EFOA 3P45A 4LRSB 4R98A 5K99A 1CDZA 4H1TA 4PN3A 4DZTA 3B2EA 3NNDA 4E51A 4MPPA 3E7DA 4AULA 3T4UA 2X77A 5ICMA 3T0GA 3GMSA 4R7TA 5GZ6A 4LYFA 2ZTVA 5BOSA 5FTLA 3S55A 4E30A 4ZCSA 2G70A 1N6OA 1GJRA 1ND5A 1H1LA 1T8PA 3DV2A 5CB4B 4B3TB 3VA7A 4Z53A 3EMKA 3AGQA 3L7CA 1HI9A 4O4LB 1ENOA 4QRIA 5HJ5A 1YBMA 2IZZA 2IUSA 2J3KA 4BTLA 1XN1A 3MWDB 4OGKA 2OGTA 1OI3A 4PZZA 3BIXA 1KAOA 2A0XA 2JIZD 3DONA 4XVHA 2ZRDA 3ZWOA 1XEWY 4RIGA 5CEEA 3SDBA 4ZI2A 4XVUA 5KNCA 1P3Y1 4KSCA 3EG9B 2GPSA 3CX6A 5C52B 3FHOA 1V1JA 1BMFA 3W34A 5T8KC 4WZBE 4OXQA 4ML3A 2C98A 2VG8A 4EZBA 3DTTA 2LVBA 1Z4OA 2REXB 3K1AB 2I9KA 4RTJA 2VYCA 4DADA 1W25A 5J4YA 4RK1A 4Q3AA 3W8DA 5I5GA 4R16A 4B75A 3RKSA 3V1MA 4D57A 3TD6A 1BE6A 2I2FA 2XUKA 3DOCA 1B43A 2JFZA 3OFJA 2NP6A 2V6MA 1SWWA 2RHLA 2OBBA 2FSUA 2I6UA 4HR7A 4QO7A 2ZUFA 2AXNA 2REQA 6Q21A 2FV8A 1G60A 2VDKB 4UMDA 2D5BA 4PTYA 1TZJA 2K2QB 1E3WA 5LBIA 3E5MA 2XXAA 4RF5A 3MJ4A 3SYLA 3C39A 5JVDF 5DW3A 4N0PA 4BB0A 4Q9LA 4Q39A 1MOPA 2QRLA 2YRXA 4DXDA 3HHEA 1XEWX 4NP6A 4OHXA 4J7CA 2ZIXA 1AKTA 4NOMA 3T9EA 1FXWF 2I34A 2NZWA 4RVSA 3ACCA 5ECDA 4N6GA 3FPAA 4ARIA 1IHDA 4WVLA 2AN4A 2P6PA 2NPFA 5B7NA 4QZVA 5FIUA 3IJEB 4KQEA 3WDLA 1U7HA 2ZSKA 3WGNA 5SY9A 1SO8A 1T0HB 5DTEA 2B82A 5H4HA 3UMMA 3P9ZA 4D8YA 1IRIA 4RCYA 2QQ5A 2PKRA 4MHOA 1KYQA 2PD4A 1U7WA 2RHJA 4PHTA 2I03A 4YLYA 2DPHA 4C3ZA 5L45A 3I2IA 1W4RA 1B73A 1CPYA 3LXXA 4EA6A 5B6PA 3AFNA 4Y2TA 2ZBQA 3VSAA 3HXPA 2BM1A 1QORA 1C14A 1TCBA 3HLKA 3O3NB 1YQDA 2GJAA 1S3GA 2DSNA 2H2GA 2VT7A 3PFWO 3PXBA 4MCJA 5K8LA 3ERCA 3CEAA 1J8QA 4G5XA 4LSWA 3JTMA 1S01A 2R4QA 2ZUTA 3IAHA 3W2EA 1GG8A 3OT1B 5IWCA 2P2YA 2HBYA 4PZEA 4D4GA 4X1KB 4WNAB 1X1DA 1ZNXA 2VLBA 2ZBGA 2JIDA 3H05A 3IMEA 1XMQB 1U3VA 1Z7BA 4GZ3A 2Y68A 4HATA 5ALEA 2AR7A 1EZ4A 2ZSEA 5HBRA 3V48A 1ZH6A 1D9ZA 2DTDA 4YAUA 1M74A 3ILVA 3KQLA 2JLQA 2H1VA 4M7OA 4TTQA 4LHXA 1N7HA 3IURA 2IP2A 1ANKA 1XELA 1VKJA 2AMVA 2X8JA 1X74A 1XDUA 3B48A 3GJ4A 3P5BA 3ROZA 2FFJA 4AN0A 5I7HA 3QJYA 5BSTA 1OAOC 1RKXA 3DWEX 1WXDA 2HJGA 1Q77A 3G5AA 3RRMA 4ZAXA 5B1EA 4WN3A 4MX8A 1CC1S 1AQNA 3DAGA 2X8LA 1O0BA 5J3JA 1C30A 4OAPA 1AUOA 2FF7A 1JVSA 1Q6ZA 2BN4A 1UJMA 3EW9A 2Z6UA 4AJ1A 1ZJWA 1B23P 4YT8A 1JALA 2KHZA 5H16A 3ZE1B 2IYZA 3M7IA 3HY4A 5DTJA 4MNTA 2BVNA 3IUMA 4L74A 3T95A 4PWYA 1WQ3A 2QL5A 3K8QA 5L7WA 4CR6A 3R3YA 1SUBA 1LPSA 4ZK6A 3X44A 5CW2A 1SXHA 4OK5A 3KU1A 3IDOA 2HMSA 3A06A 3JAKA 2H1LA 1Q1BA 5C7LO 1WPGA 4FLEA 5SICE 2EBFX 2Z2ZA 3X3HA 4AJIA 4ASUD 4W7SA 2B1QA 1PAUA 1EWKA 2SBTA 4NNJA 1MB2A 1XZDA 2E4WA 1P0QA 4YJFB 1OTYA 2W6MA 2ZYAA 3IOCA 1HE3A 1GO2A 4DRXB 4BX8A 2ECKA 1XIVA 5J40A 1E1QA 1JI0A 2R47A 2B1JA 3LQFA 5KYTA 3QMWA 3S8EA 4BLQA 2HCRA 1AV7A 4F06A 2D4AA 3COYA 1CTQA 5CCDA 4NQZA 1NLYA 2AG5A 3KP1A 4E22A 2IA5A 4YT4A 3N87A 3TTVA 4EJ6A 3MUFA 1HL3A 1OTHA 3AB3A 4JJ4A 2NT3A 3CLSD 4S1PA 4U8HA 2QXYA 1IG3A 4S0XA 1CY2A 1II8B 1RNLA 2XGGA 3TDMA 2PT7A 7REQA 1RU3A 3EHEA 4FFOA 2IKSA 1QIHA 2P11A 3PDIB 2HMYB 4WQMA 3LWBA 4E2WA 2HUNA 1D2MA 3AXTA 4JA0A 4IM7A 2PBRA 2C1EA 3OT5A 4LOJA 5GM2A 1GAEO 3P0IA 3RUPA 4Q4JB 3I4CA 3ND8A 1M34B 4GS5A 4MO9A 1YKGA 4ISCA 2JHPA 2QYTA 1MP0A 3KYCA 4CGYA 1NIJA 2H29A 2IY7A 2Q3DA 1ZJZA 4UPVA 3G6KA 2QRJA 1JIQA 3PKJA 1WQ4A 1CHDA 4RJIA 4BRUA 3NVMB 4GPZA 1DTWB 1Q91A 3NVDA 1Z8DA 4CBVA 2QUAA 4UEWA 4RTLA 4US2R 1MCZA 1GPUA 2QX8A 1M0TA 4GC9A 1H4SA 1YVRA 3F6RA 3D1JA 4HQ0A 2QT9A 4N01A 4B0PA 3LX8A 1PFVA 4D3YA 3OZTA 3RGGA 1MJHA 1K8RA 2IW3A 1L7XA 4UZSA 4LBVA 1I2CA 3PGVA 3F8WA 2WUVA 2COUA 3EXHB 1GKKA 4DRXA 1QCYA 1TO2E 3CF4G 3E7WA 1XWIA 5BOSB 4E31A 4QDJA 1VJ0A 4RZHA 2ZDHA 2C3OA 3DHEA 1YR9A 1SHLA 5B6IA 5LP6A 2LDBA 3NHUA 3A2LA 2OZLB 1Y3AA 4KXYA 4KQHA 4CUKA 1W49A 2Y8EA 2JFPA 3D7MA 4K6KA 2GYYA 1Q1AA 1Q1EA 2WPDD 5HCNA 2HT1A 4IJMA 3OKAA 1XFDA 5ALZA 4CKBB 4DLTA 1XZNA 3AIMA 3HE3A 5TV2A 1UODA 3ZQJA 1Y0BA 1RLMA 4RKEA 3R3XA 3GT0A 1ND6A 2A86A 1Z6PA 2XYPA 5CDUA 1ECJA 1QG0A 2QIPA 5KWVA 2R7LA 3HWSA 4M1KA 4FQ8A 4MK4A 3PHCA 1G7TA 4KO4S 2O4CA 2R6R1 3HBJA 1WCIB 1UZUA 2PWPA 1KWGA 1KAMA 5K3EA 4XDZA 5CX1A 2V54A 4IMRA 4MUYA 2OR3A 4Y1FA 3M4JA 3RVSA 2D59A 3O93A 1WZCA 4X7MA 2JGJA 5MGBA 4YJGA 3PX2A 5LQSA 5IULC 3NWEA 4Z9YA 1E63A 1E3WB 4L9RA 5DKFA 5DSXA 4WBNB 3T38A 3TOSA 1X3LA 4PV7A 2HL6A 1UPCA 4D6PA 1A04A 3PUKA 2BGTA 4RPKA 3T4PA 1LS6A 3DFKA 4EX6A 1XX6A 4I4LA 3QIVA 4TMFA 2YN2A 4KE9A 1TM5E 1ST2A 3FDFA 3NM6B 2V55B 4Y18A 5JLAA 2F1IA 2WQZA 4M21A 1S96A 3LIPA 4U0KA 1LH0A 1U1CA 2VXOA 4DT1B 1EDEA 4YP5A 4CM1A 1EJ2A 2PGAA 2WFLA 1NW3A 3ICPA 2N46A 3PFFA 1OVGA 3F5QA 5F1PA 4DR3B 1R6XA 4LF6B 1JQAA 3EFOA 3U7JA 1R5OA 3HYLA 5CCEA 3Q3HA 4I5FA 3FY4A 3OA2A 4C4SA 1SFRA 3UH1A 4RDHA 4BO4A 4C14A 2F9LA 1B0PA 4OYYA 3WWEA 4RIHA 3QPCA 2AFRA 3MWFA 1KBOA 3H5RA 3NHWA 1Y8ZA 4G0WA 1JU9A 4C5CA 5LZ4A 4RYDA 1JQJC 1BWPA 1D4OA 1T5HX 2YXPX 2X1MA 3FHLA 3AEXA 4KQ1A 1HE4A 4QXMA 2FG7C 1LZKA 3VBEA 1UM9A 3QBVA 2BEVA 3NP9A 4EHKA 4OSOA 3AX6A 2FKNA 1JBKA 1SU8A 5LJLA 4Q4CA 2QS9A 1FY2A 4JWTA 5H8WA 3CZ4A 3EGXA 5K3CA 5PNTA 1ZLYA 2DETA 4ZU1X 4QM6A 4C88A 2FSFA 4NAVA 2V4UA 4JP3A 3W2GA 3WLEA 2Z2XA 1KDOA 4PWZA 4CCAA 3EZGA 3PRKE 2MSDB 2BFCA 2JRLA 4NV0A 1ZFNA 2Y1CA 3ROEA 4U5XA 4XSVA 3JV7A 3K4QA 3GZJA 2I2WA 3CPSA 2VJQA 4R6XA 1IJBA 3KQTA 3DEFA 3X1YA 2F9MA 5KYXA 1NNSA 5AVRA 1IQUA 4JXJA 3N0WA 5J5VA 3G2KA 3KT3A 1QP4A 1I6MA 2ZRHA 2VHTA 4ZDKA 1LQ2A 1E6WA 3D3KA 3I9KA 4HVTA 4M0PA 5DX0A 1Z83A 4EW1A 1MD9A 2UVDA 1YS9A 2NM0A 1E5DA 4KR6A 3PXGA 5A6VA 5CFMA 3I6QA 2C83A 3T3MB 4RH3A