3KAPA

Flavodoxin from desulfovibrio desulfuricans atcc 27774 (oxidized form)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
b'SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADGYDAVLMGCSAWGMEDLELQDDFAPLFDEMENMGLKGKKLAAFASGDMEYEHYCGAVPAIEEKARGLGAEVICEGLKIEGDASSDPDAVSAFAEDVLKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Crystal structure of flavodoxin from Desulfovibrio desulfuricans ATCC 27774 in two oxidation states
pubmed rcsb
molecule tags Electron transport
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kapA00
1I1OA 3N3AC 1AKVA 2FOXA 2BPOA 1XT6A 3K20A 4CETA 1RLJA 2Z98A 1YCFA 1YCHA 1D04A 3OWXA 2OYSA 4BMOB 3R6WA 1F4PA 4GR9A 4ZVKA 1XYVA 2HNAA 3U7IA 3QFCA 4BMPB 4D02A 3NHFA 1T0IA 1ZWLA 3TZBA 1KBOA 2FAXA 2QMZA 3NLLA 3OWHA 3B6JA 2XODA 6NULA 1YCGA 2R97A 2KLBA 3G5MA 3L9WA 4H6PA 3NHLA 4C14A 3HA2A 4CF6A 3FX2A 1AMOA 3B6MA 3W7AA 2XOEA 3QE2A 3NHWA 1C7FA 1CZUA 1GG5A 2BMVA 1QHEA 1JA1A 1H69A 4N9QA 3U7RA 3NHRA 3W79A 4LA4A 2A5LA 2D5IA 2M6RA 5JROA 2MT9A 2FZVA 2KQUA 4HS4A 1OBOA 5LMCA 4F8YA 1TLLA 3S2YA 3TE7A 5NULA 5LBUA 1J9GA 3KAPA 4LTMA 4U7FA 2BZSA 3O2NA 3EDOA 4NLLA 1CZOA 4YALA 3NHPA 2HNBA 2N1MA 4U7GA 5F4BA 1YRHA 1OBVA 3GFQA 2MWMA 2W5UA 2V5UA 4XDGA 2MOKA 2QX6A 1WSWA 1J9EA 3KLBA 1H66A 2QX9A 1XYYA 2OHIA 3OX2A 1X77A 1XI2A 4PU0A 3P0RA 2QWXA 4ESEA 1AKUA 3KEGA 3ESZA 5FUQA 1AKWA 4PTZA 5LVAA 4PTYA 2Z9CA 4Y7CA 4YQEA 2FX2A 1FLVA 2OHJA 1FVXA 2V5VA 2ARKA 1SG0A 1QRDA 3N39C 3SVLA 4ZVMA 5TGZA 4YAUA 4R81A 1FLNA 2BN4A 1CZNA 5LBTA 3OX1A 5B3KA 3OJWA 3ESYA 4YAFA 1CZKA 1FUEA 1NNI1 2FZ5A 1BU5A 4NULA 4ZVLA 2RG1A 1RTTA 4N82A 2X2OA 2Z9BA 5BUCA 1J9ZA 5NLLA 2F1OA 1ZWKA 3O73A 3LCMA 1VMEA 1OFVA 5EAIA 2Q9UA 2FLVA 3N3BC 4N65A 2B3DA 3OJXA 3GFSA 4OXXA 1DXQA 3HLYA 1JA0A 4FX2A 4QOJA 1RCFA 4Y9UA 1B1CA 4QOHA 3FJOA 4DILA 3W78A 3HR4A 2QR2A 4HEQA 1AZLA 3FNIA 1ZX1A 2HPVA 1D03A 5F51A 2FVXA 1YDGA 3W77A 1DXOA 3B6KA 2BF4A 3KAQA 3F90A 4LTDA 1AKTA 3LT5A 3FW1A 3UXEA 4DIKA 4YAWA 1YKGA 3EYWA 4FGKA 4ZVNA 1V4BA 1CZRA 2Q62A 4QODA 1WSBA 4J8PA 2QMYA 1BVYF 4FGLA 4DY4A 4M0CA 4ICIA 4LTNA 2ZKIA 3ES9A 4QOFA 3B6IA 1CZHA 5F12A 3NHJA 4GI5A 3NHYA 5LJIA 1E5DA 4S24A 1AHNA 3QFRA 3F6RA 2X2PA 1RLIA 1AKQA 5EMNA 1J8QA 5FA6A 4H2DA 1T5BA 2V9CA 4U7HA 4XDHA 3FVWA 3NHUA 4YAOA 3OVMA 3F6SA 4QOGA 1D4AA 2OHHA 3ESXA 4FGJA 1QBGA 4QOIA 5FX2A 1FTGA 2Z9DA 2WC1A 3RPEA 2MTBA 3TEMA 3UXHA 5EA2A 5ULLA 1CZLA 3D7NA 3OX3A 5LLDA 2AMJA 3K1YA 3NFRA 4QOEA 1C7EA 4C0WA 1FLAA 1FX1A 3NHKA 3GFRA 3NHSA 4GQIA 4C76A 1TIKA 5A4KA 2M6SA 5LJLA 3GAMA 1YOBA 2QX4A 2QX8A 2FDXA 2R96A 3F2VA 1AKRA 1DX9A 4C0XA 3L9XA 1AG9A 4LAFA 1QR2A 2FCRA 3ZHOA 3JSXA 1SQSA 4Y9RA 2GSWA 5B3LA 1KBQA 1FLDA
chains in the Genus database with same CATH superfamily
3AF5A 3ZHQA 1CLUA 2VF5X 2G3YA 1U3GA 4ZI5A 1UPCA 4OL0A 1GCGA 1BRTA 1YS2X 2ZVQX 4HI0E 5AD1A 2TMDA 3STWA 1XB2A 1DNPA 4EHAA 3NBAA 4S3MA 5K0JA 1C1HA 2CVFA 3AUAA 3KVNA 4J7UA 4QL3A 1E6MA 5EUBA 1XDWA 4ZYYA 1CEXA 1ETHA 5A04A 2FWPA 4PG6A 3FBGA 1X7HA 4URZR 3IEVA 4MUFA 5C1DA 3OP1A 1EWYA 3RSFA 3C41J 4HK4A 4TLEA 1RQ7A 1HDXA 2HYDA 3D4PA 2GVDC 2WTBA 1HNNA 3DFUA 3ED5A 3Q0EA 1OW3B 4RTRA 1HV8A 3C1UA 2XBUA 1MW8X 3R7NA 1RQ2A 1BIFA 3IAUA 2C7PA 1FYXA 4Z4FA 3PIIA 2YYYA 3OCYA 2C3UA 5T8KA 3ADPA 1CK4A 1N25A 3KFLA 4NMXB 1JG3A 5CHYA 4Z86A 2ONJA 1GADO 3LUPA 1TYBE 5JNWA 3FB4A 2QZ9A 4XB2A 3BFVA 3HJNA 3GHYA 3QG5A 2HU8A 4MKHA 2IY9A 3C85A 1M66A 1QFMA 1ST3A 2J9ZB 1XMQB 5CFRA 1XPJA 2VSQA 3DTNA 1PNVA 2AFHA 3PT9A 4ZDIA 2QJWA 4E31A 1PNOA 3EEIA 3TLMA 4UNQA 1L4LA 3IODA 1TJPB 1XQVA 1E0AA 4B2YA 2QW0X 1JMKC 1DOHA 1L8OA 1N2ZA 3RVRA 4OG2A 4PTLA 3LP8A 5BV8A 1U1EA 4RHEA 3ET4A 5H5JA 2GFIA 1WU8A 2JIDA 4A8JA 2RGCA 1W0KD 2WP0A 2ZSEA 3U7EB 3NNNA 1Z26A 1SB9A 4I1VA 1JEYB 3KYJB 3RIXA 3OA2A 3LPCA 3STTA 4WNCA 4LBYA 1JFRA 5K6AC 5EY5B 2ZRJA 1RTKA 3G2OA 5T3UA 4CM1A 3LBHA 1QHYA 1DV1A 5KWSA 3FG9A 4EFNA 5L7YA 4OSPA 1H69A 1XRSB 2BE9A 5CW2A 3VGJA 1X9GA 1Z5OA 3M5WA 5A7FA 4D0RA 2G9VA 1FFSA 4RPCA 1K3FA 1P9WA 1KDOA 3VR0A 4ZJZA 3ZV3A 1FDWA 1VHLA 3L7OA 4Q4AA 3TNYA 1NY6A 4CVNA 1QQAA 1KIMA 3NASA 4B85A 2X4DA 1QO0A 1WVGA 1VKRA 1PS8A 4M9SA 3N8KA 1CULC 2GM4A 3M1YA 1JJVA 3FAKA 5IDWA 1H2HA 1P91A 2D8AA 2GZHA 3HY3A 1FCJA 1HETA 1CF4A 1P1BA 4I2VA 2AH5A 3TCNA 1U11A 2Z5LA 1O7JA 4BJHB 2Q29A 2RBEA 4LOHA 3VDRA 1R4ZA 2NO1A 1OFHA 1I5OA 3D7MA 1JKJA 1UJMA 5IYZF 4M98A 3PYMA 3PFNA 1JDNA 2PT5A 1K4YA 2ZS8A 3JWEA 1B8OA 3MTDA 4E4YA 1PT8A 4H3SA 3ZV6A 1OB2A 1A1SA 2P78A 1Y8QB 4O4IA 2AMFA 3COYA 4DW8A 3AR4A 3KHTA 4E0BA 4E94A 3OM0A 1C0LA 4EF6A 4US1R 4F0JA 3RTAA 3NHPA 1YHZA 2QLBA 3QVWA 3WKCA 1QGUB 2BTOA 2PKYX 1SVNA 5AKYA 5KQMA 3PGXA 2NWQA 3QLJA 4CTMA 1TTTA 2H29A 3K8OE 3EWSA 2FN3A 4BQQA 1VE5A 5A06A 5KQLA 2DY0A 5CLHA 1NR1A 3W9YA 4ENPA 4R2MA 5I3CA 4KRFA 2ZYTX 3IPYA 4R9UC 5AXAA 3JVVA 5JAQA 3ZLTA 2W5UA 5KOHB 3K9FC 1RRFA 1L1QA 3AVQA 4RMGA 4RJIA 4X20A 1SXGA 4KIJA 4NOMA 2NZ2A 1UXKA 3GMIA 3L8FA 4DNXA 4QNMA 1RJDA 1MXHA 1WSWA 2GAAA 2YZMA 3KLBA 4LGYA 1V25A 2GPSA 4HLCA 5BNIA 4R1MA 1OC2A 2WNHA 4GI3A 2VI5A 4BVBA 1P77A 3IP1A 3V1UA 3T54A 1TO6A 3KR2A 1E5TA 1U8UA 4FMDF 4KSCA 1E69A 4KVAA 4GWGA 4QARA 4RHXA 4NJOA 5KO2A 3EIQA 2OE2A 2IY7A 4HDSA 3DHVA 1E2DA 2XA1A 2IIQA 5AHRA 2IYEA 2XYRA 3K2QA 4MWTA 1XAHA 2PGJA 3T5CA 3D7KA 1BDJA 2P9TA 5EJAA 2NU9B 2FSUA 5CA0A 2RARA 1G291 2LBPA 1G21E 2X0JA 2E1RA 2OHJA 1S6YA 2BFOA 1GZVA 1WXGA 3X2SA 4ZCMA 1NW6A 1AQJA 4JT4A 4AWAA 1LW6E 3T3DA 1H94A 2PD6A 2BJWA 3A6HA 4PXAA 4AURA 5J4LA 5ED4A 1B8NA 1FFYA 3N39C 1WB4A 3EVFA 1T35A 1D0VA 2YNMD 1MENA 5AOVA 3RU9A 4KNWA 4XGIA 1MAUA 1X19A 1UDAA 1U8EA 2BN4A 2MSNA 3JZMA 2Q6OA 4KRXA 2HA2A 3IT0A 5B37A 3V8NA 1Z63A 3HGTA 2XDAA 1QIIA 4HZUB 2K6GA 3LQ4A 2WQ6A 4EHNA 1MO5A 3EVDA 5B3KA 4EQ6B 4NZ9A 3RRZA 4DAOA 4FFDA 3BRQA 3INNA 4LY6A 4AJPA 1U4OA 4OHXA 2CDRA 4U7JA 3V2UA 2B4YA 3ETHA 1D6SA 2JJ1D 4X41A 1Z0SA 4YRRA 1N7GA 3NT5A 2FUG1 4IDQA 4MUXA 1W6RA 2FRDC 2J7PA 1BEZA 3SR0A 4WKPA 4EZEA 1AD2A 3V1TC 1JFFB 4J7AA 1PFVA 5KSZA 4R1OA 3QX9A 1T0JB 1AV7A 5L51A 1QGOA 3DV0B 1CY8A 4UC0A 4BNNA 4Z2AA 2H5EA 2R1VB 3WLPA 3GCDA 1I1QB 3K5IA 4AY2A 3AEXA 4OHCA 1NLYA 3WNQA 5IUKC 3CTPA 1JNXX 4K46A 3R5FA 1THGA 1T1RA 1TCBA 1UK6A 2GFQA 2GKOA 3EZYA 3FNRA 4HGOA 3O90A 3DKKA 2FSSA 4Y2HA 2NU8B 3VKGA 3EY9A 4A10A 4YJDA 3TIGA 1POWA 4UJ3A 2QVBA 2CFRA 4QBIA 4AKEA 2GD2A 3D6FA 5IJ9B 2OECA 3N3BC 1MGPA 1QS0B 2TMYA 4O4HF 3VOBA 2SECE 1W2GA 1PHPA 4N6NA 1QANA 3EIWA 4WZBE 4K9RA 2QPTA 5HIAA 5AXBA 5IFLA 1ZUNB 5ALNA 3WLFA 3FDJA 4C4AA 3DVAA 3VR6A 2YHIB 2OBMA 4XARA 4PN3A 1Q7TA 4P3PA 3IDOA 2OCIA 3S28A 4GI1A 4B5KA 3QUAA 2A1UA 3DOIA 3CH5A 4M8KA 4QNRA 3IKMB 2YR0A 1IWBB 4F6CA 3OIVA 4IJMA 4IXMA 4RUKA 2OG2A 2XYQA 3HBLA 2A88A 4GVXA 5DPMA 3INTA 1G20E 4CF3A 1X74A 3AHCA 2P3QA 2WV9A 1Y4DE 2W2OA 3KSZO 1QH0A 1V4NA 4L0DA 2G82A 3L49A 2AN9A 3AVOA 3BIFA 1QC5A 3PGLA 3HU1A 4H7HA 4BO8A 1GNQA 2PMCA 4B6GA 3KQHA 5F7JA 4HFMA 5JAHA 1MDFA 1PG5A 1WKVA 2BWJA 1J6UA 2CMHA 2FP3A 2IDKA 3FF1A 4IDFA 4ZAWA 3U9TA 5TIIA 5E4FA 2M98A 3NHAA 5K0LA 2PZAA 1Q14A 3IR6A 1E9EA 2CCJA 4C87A 1HUQA 3C0KA 1YHYA 2FWNA 3ENNA 5FEMA 3TTSA 1GLNA 2CXNA 1S7CA 2G6BA 2G9RA 4KTTE 1CVRA 2AXQA 2P2DA 4G0QA 2PKXA 3WL5A 1P9RA 2QI9C 4LJ5A 1GRVA 4CQMB 2FFAA 3KWLA 1DPGA 4TOIA 4PC1A 1A96A 4ZMRA 2WJ4A 1USGA 2JFBA 4GDFA 2O0KA 2DWUA 4V0RA 3DFKA 1RHQA 4NDAA 3OEHD 2W2LA 4TTQA 2C0QA 1FS4A 5KX5F 2XCSB 2VA8A 1PAUA 1LVGA 4DC9A 5EHNA 4DQXA 1Q0PA 4E5PA 1EBBA 3LY9A 1VLLA 1QNFA 3CISA 1R0SA 4ZZ2A 5TR9A 1BGXT 3L77A 2QAGA 4YAWA 3R24A 3T5DA 1AVTA 2VC2B 5BSHA 4BTEA 4EW1A 4BPBA 1U2EA 3ANMA 4RZ3A 4FOTA 3GX1A 3MWFA 1YUMA 3QLTA 4ZVNA 4O4JF 2IE8A 3HDVA 2GDZA 2C1EA 4BLRA 1MFZA 3GP8A 2O7SA 3KJZA 3AL0C 3PC6A 2R6GA 5BVGB 1QWSA 5IBPA 1QG2A 1E3DA 1JKMA 2C0CA 1IM2A 2GZSA 4OY3A 3QXHA 3P19A 4B3CA 1QJCA 2F1IA 1ZMBA 4JGIA 5G3YA 3PQ3A 1KFBB 2IEGA 5BQXA 3UPTA 4J8PA 3SM3A 4MA0A 1U5AA 1RZRA 1FNSA 2CZCA 2X6RA 2WYUA 3I12A 1ZO8A 1ZJ5A 2Q28A 3PEYA 3DUFB 3QSYA 3BIXA 3F2IA 4LGCA 1FW6A 5E1BA 1VI5A 3TKAA 4RH0A 4NTZA 1RJEA 4LTNA 4CTJA 1T6BY 4ALJA 1CUXA 3OG9A 1B93A 1NRXA 2A57A 3GV0A 4QC2A 2FN9A 1UMDB 4X71A 3V55A 3ST7A 4K88A 2DZDA 4H1UA 4MQ4A 5CDFE 4J7XA 2ZATA 3GRRA 5K0SA 2ZRDA 3B2EA 3QMPA 1VA5A 4AJLA 3CRRA 3H4TA 3MXOA 5D5PA 5TMDA 2A3NA 3LK6A 2NTNA 1ATZA 2PJDA 3FKQA 3ETJA 3NWJA 4C07A 1RU3A 1WOMA 4EG8A 1O3YA 5BY2A 5IJWA 3REFA 3IEPA 3QVLA 2YXPX 2Y76A 1DDGA 1OCEA 3CLVA 3DAGA 3A3YA 1VL6A 3A2NA 1L5ZA 1B16A 1RYNA 3GY0A 4ZGWA 3AIOA 2F3RA 1UPUA 3NNSA 4PAMA 3C3AA 2GEVA 5ITZA 4MS3A 1BX3A 1EP2B 3DE3X 5E9AA 3T1OA 3C3EA 4JZKA 3CB2A 4IWYA 3HB7A 5E38A 2ZAIA 5KTMA 3C87A 3PIDA 2Q5HA 4GAEA 5JQGB 3FVWA 3QZUA 5AHXA 2FSFA 2X0IA 2Y1XA 1DLIA 4OB6A 2V7XA 1Z35A 2FU5C 3NXSA 5E2AA 1ENOA 3PD1A 4QXMA 3R8FA 5JJLA 3GXOA 2CVPA 4FDVA 3CZ5A 3UAOA 2JIOA 4LGVA 1XXHB 5EGNA 1EXDA 3JQGA 2FG6C 5ARDA 3EUWA 2I91A 1ZM2A 1DC8A 2JAPA 3LCVB 3Q12A 4RPLA 2J0SA 2R84A 5REQB 2OKGA 2X19A 1G98A 2Q3DA 1HYGA 2CNBA 3NBYC 2MTBA 2PUVA 5A2GA 5EA2A 1Z83A 5CFPA 2W6ZA 3VO9A 3PFHA 2G70A 2I99A 1PQPA 1OWPA 4L4XA 1L3CA 1U0EA 2Z8ZA 1SHTX 1GL6A 5JE8A 3TUIC 2EKLA 3PXEA 3IMCA 1QIHA 5CVJA 1VMKA 2Y99A 1DINA 1T2DA 3CC8A 4BNIA 4QLBA 4REMA 3WZ2A 3I2IA 1Y48E 2W11A 4BNXA 4BMVA 2YJ6A 1AB5A 1OX5A 3PHLA 4HL6A 4AIRA 4OHWA 4RVFA 4CG2A 2HRZA 4M8NE 1TA0A 1U2GC 3A1DA 3WADA 2JA2A 1M7BA 1NX9A 2AFRA 3PNPA 3K1TA 3DDHA 4Q47A 3FFTA 4C04A 4P5DA 2GEKA 1XTKA 4A9AA 1UDBA 1C4KA 1E5XA 2XQKA 2Z04A 3R8XA 1EFHA 1A9XB 4M1OA 2IXAA 3KT0A 1GXSB 4OBEA 2J3LA 3SC2A 5SZIA 2HRRA 4IIDA 4BU1A 2IK8A 4XSHA 4OMUA 1IEWA 1S8FA 2ZIVB 1T4CA 2FA9A 3PNKA 4UMDA 4U9IS 4XD7A 2ZAMA 4ZPJA 2DFPA 4LKRA 5EJ2A 4TM8A 5F1OA 1Z75A 4Y9TA 4W6QA 4KQEA 1Z2OX 2JIPA 1Y82A 1YZNA 2QT9A 3SQMA 1KSGA 4DADA 2Y93A 4K0RA 4WVFA 4DANA 5FKJA 1JU9A 3TCKA 1OE0A 1KDVA 2J0VA 4B9EA 4MP6A 3WYNA 5IS2A 1JG2A 1BHSA 1TZJA 4COKA 3C4VA 2B1GA 2IELA 2HNKA 4MWCA 4N3NA 4DWOA 1PZMA 3CSUA 5IZ4A 1WCV1 4MW2A 4BB0A 4XYMA 3D0RA 2JCSA 2C2ZA 3D2AA 3Q9SA 4Z7QB 4ENRA 3QVGA 2RHWA 3U4IA 1V1RA 1DOZA 1IG0A 2GZ1A 3L92A 2YOFA 4MW9A 4WADA 4KGVA 3IURA 3MW8A 3HSYA 2B36A 3VPFA 5I4IA 2C2XA 1HH4A 2GD0A 5GY7A 4LF6B 4A91A 4HLNA 2PT9A 3RHFA 1E1RA 2YV5A 3MOIA 4Q6BA 5FPTA 4DCVA 1MR3F 2WYWA 5BR4A 1G55A 1YB2A 4FFPA 8GPBA 2Q45A 3PPYA 4BRSA 3MD9A 1H22A 3F6PA 4Q7EA 4IICA 1KQFA 1KY2A 1KEKA 1LV7A 3FPCA 4CDNA 2PQ2A 3SMQA 4WKGA 4W7HA 5B53A 5SZKB 3PWTA 1TIBA 1ISGA 3QA3E 3DCJA 1EUQA 3LHSA 3OT1B 4UPDA 2FOXA 3EA5A 2JJYA 4K81B 1U6IA 4DUGD 2E6KA 2BKUA 3CF4G 4GU5A 1E98A 4EQ6A 4PO9A 2CMDA 5GIOE 1M76A 2ODAA 3T35A 1OLOA 3B38A 1FFXB 4J0HA 2EARA 4FCCA 4XWTA 1XKXA 1DKNA 2PBFA 4XLZA 4PLPA 5HDBB 1YS4A 3WL3A 3CV3A 4LXGA 4HZIA 3VU3A 4ZVKA 5MFPA 1JFFA 2WVGA 1WWKA 3DCYA 4Q4HB 3JQ6A 5B55A 1ZHFA 4NSNA 4BRUA 2R1VA 1DCKA 2I2BA 4BFXA 1DEKA 1ZWLA 3FWYA 4EA9A 1QRRA 2FFRA 1A97A 3TZ6A 3Q0IA 3T34A 1KEUA 2QMZA 3CZ4A 3CZPA 3NLLA 1P1HA 2VP9A 3DQZA 5FBKA 5AVSA 1F2TB 1J2RA 2BMWA 2VUSA 2ZSFA 3DPIA 4PGFA 5KCMA 1V45E 3O1LA 3NGMA 3DV9A 2I3GA 5HFNA 5AIAA 2BGJA 2D1RA 3ZJYA 4BECA 4OJMX 1RWXA 3VISA 2ASEA 3DW3X 2EG5A 4JUIA 4O5OA 3HXTA 3IB6A 5A4DA 2JIMA 2XMZA 1ZA1A 5I8PA 2X9VA 2A5YB 2IUEA 3HUFA 2IDZA 1ZUNA 4G37A 1V9LA 2BL4A 3BA6A 1ZD4A 4Q1BA 3KQNA 4CEJB 2WWHA 4HO1X 3HZZA 4O1IA 5KSYA 1HQDA 4MV6A 3O3CA 5K3OA 2Q2NA 1PEYA 3I09A 5HHTA 3NHLA 5JQWA 4OH7A 1M7HA 1I32A 4KDFA 3UF0A 3K70B 1CT9A 4JVOA 2PLRA 3B6MA 3IESA 1PTKA 4UD6A 2W6PA 5BN5B 1OWNA 4KR0A 4IR7A 1UPBA 4Z6KA 4GBGA 621PA 2XY4A 3MTBA 3P4UA 4DM4A 3IAM6 1U2RA 3VVMA 3KQTA 1FYEA 1QVZA 4BFWA 2ZROA 1E3QA 4OREX 4MYCA 4S1VA 5FF9A 3W34A 1M1XB 3ZDEA 1O5OA 4PCVA 4LYJA 2D5AA 4RVCA 3TVDA 5L3SB 2A5LA 2XUJA 4X66B 4F8JA 4YY3B 3LQ2A 4UBIA 1IAQA 1LS6A 1GCIA 1G5IA 1QVVA 2ZB2A 3AEUA 3ZZTA 5AKGA 4YRGA 3D4OA 5K45A 1H3NA 1OB5A 1IM5A 2MR5A 1SNYA 3CZQA 3KJFA 4FS3A 3GNLA 1QH8A 2DBRA 1ZY2A 3RV4A 4QU9A 3SEZA 5KHLB 2VSYA 2W2PA 3L6BA 4L5BA 2J08A 3PXDA 3WWZA 1BCRB 2VAPA 4P4GA 3EQZA 1J9GA 1JIVA 2GF2A 3ZWXA 5HJEA 1YDHA 3WGKA 1D2NA 4ZIRB 1ISJA 4Q9NA 3TGWA 1CV2A 1PJ3A 1FW8A 5K0CA 4WERA 1NTOA 1JG1A 2PKCA 3F7MA 4IP0A 4R6WA 3SHFA 4HEHA 5IAJA 1QPBA 1FFWA 5CIWA 3FWPA 1XZKA 3CN7A 3D2CA 2ZJ5A 3EDOA 3MA0A 4LRYA 5T57A 5IM4F 1UQUA 1VG1A 2FZWA 4HGQA 4MQLA 3SDZA 4DV0B 2AMVA 1KFCB 1EGAA 3LDAA 4D4LA 1VBFA 5LL6P 2VF8A 2ZRBA 4OYLA 3A06A 1HG0A 1N9ZA 1W94A 2CHQA 2I6FA 2P2NA 3GVIA 4ZQHA 3SNHA 4YV1A 5JJCA 2CV0A 3K16A 4HQOA 5MGBA 3IX7A 1CJCA 3B53X 3GT0A 3Q9NA 4R9RA 1YRHA 3I8OA 3NXKA 4JBYA 3TPZA 3Q8LA 2Q3LA 4WCFA 1E7RA 5C3MA 2CLDX 2VN8A 5EQDA 5GOTA 3OETA 3WLSA 4DIFA 4DS3A 4ER0A 2GKGA 3Q7TA 1E6CA 2I2CA 1T2VA 4OOFA 4Q1FA 5CLIA 1SUBA 3NHMA 5C1BA 1ZVMA 2OFWA 2IE0A 2OP1A 3M1IA 1TUGA 4RZ2A 4DT1B 2FVYA 2QX6A 2QRQA 2XDQB 3H16A 4EMBA 4FWTA 5AVTA 1JQDA 3V00A 3MBKA 3WGYA 5DNUA 5DNWA 4GEGA 1FC0A 1X77A 4WD3A 5DNVA 3U3ZA 3W5UA 1ZP6A 3MGAA 4NOKA 4OHOA 2G25A 1ODJA 2CE7A 2AGVA 3ORHA 4KXWA 4Q03A 3LA6A 1PJSA 4EUSA 4NBKA 2GRAA 3ZE6A 1JHZA 1MOQA 1TO2E 4V2UA 4BEWA 1GKKA 1WDKA 1J25A 4YR7A 4BKOA 1IONA 2JA1A 4QTUB 4TYQA 1JI3A 3KCQA 3ICEA 3H42B 3H5OA 3RC9A 1IHYA 2MYNA 1E2QA 5EE3A 5BN1A 4IG9A 1OFUX 5BW6B 3BRCA 3IR7A 3JQ7B 4E12A 1XMXA 5CB4B 3A25A 4EQZA 1ZUHA 3JQBA 3BMNB 3RYCB 2J41A 3CVYA 1GO2A 4BLOA 4B2IA 1E9SA 3W06A 2P30A 1J2TA 3QV2A 3PZRA 3RUHA 2DWOA 3BHJA 3A1TA 3CE6A 4LZZA 5ALXA 2QPLA 1ZCAA 1M34E 4UTZA 2D5LA 4AJ2A 1GU0A 3K0CC 4YN3A 3KD2A 3DLPX 3HNOA 4PC3A 4KN9S 1M1NB 2DJIA 5I8ZA 5DGDA 2V6FA 4N12A 3TBFA 4WBNF 2A9RA 4INAA 4V0OA 3M3PA 1SXQA 3DHEA 1ZJWA 3COJA 1IC6A 4B7ZA 5HCNA 2OSVA 3VZQA 4M54A 3QKTA 2AN5A 3KL2A 4CMGA 4QKQA 1PR4A 1CUYA 4N7RA 2VIIA 1MLDA 4TMFA 4BHTA 2HU7A 4HX9A 1M5RA 3HA7A 1FRQA 4O4HA 3L02A 2VT6A 2YXBA 1JDPA 1L7EA 3ND7A 1T9AA 1HT3A 1LWNA 4LHWA 1J09A 4ZQIA 4C2BA 5LKAA 1TNDA 4PZ0A 2G4LA 1R3DA 5C31A 3EEOA 5D87A 1IJKA 1RTTA 3G89A 1IY0A 4EL0A 5DRYA 1JLLB 3EZLA 4TTIA 2OAGA 4UAUA 1Z2CA 1DP4A 2P6OA 5LA6F 3L4BC 4UHKA 4V24A 2Q0HA 2YVKA 1E0JA 1R9NA 1EGHA 3GUVA 1TGYA 1SRRA 2GNAA 2I80A 1CJUC 3PQCA 3LCMA 1TF2A 3ELBA 3ZDYB 3JW8A 4Y6SA 3RE1A 2BFFB 5HJ5A 3KXDA 1DO0A 5L4SA 4FQ5A 5FAXA 3L1KA 4NZYA 2Q3CA 1F4VA 2C29D 1DX4A 3IOYA 4L4RA 4LYYA 3E27A 4BQPA 4BYMA 1JHXA 3CT4A 3CLRD 2YY7A 3IELA 4IDHA 2RJ3A 2ZT5A 2QUJA 4XZ3A 3DOOA 4R16A 1E2BA 1MHTA 3TG8A 1KAOA 1U2PA 4K9OA 3SFTA 3R40A 4R5HA 4PM4A 5ICGA 5KNCD 5DLDA 4EG0A 3S70A 1KMIY 2HAEA 3ZI0A 4CMBA 4DSZA 2QRNA 1YMVA 1M72A 3TE6A 4KO2S 3V1MA 3TEJA 1OFGA 4DKJA 1ZD8A 5DTIA 2RAVA 3N05A 2D2XA 3PEEA 4HB3A 4M0MA 4PSDA 2WY2D 5LU8A 3HEBA 2ZXUA 4ZEMA 1YBFA 2XX3A 5TEWA 5KX5A 2MJLA 3RJ5A 4RIFA 2HA4A 4M1TA 4CKEB 5AM2A 2FUKA 1W73A 3D2LA 4M1EA 4P98A 4WA8A 5KOJA 4YROA 3TTVA 4JWTA 3FDZA 4FFLA 1GGJA 2Y1WA 4DWVA 3QVTA 3LG2A 4B4DA 2JLQA 4BTVA 4PYQA 2AE2A 4EGSA 4EUEA 1NBME 1XJCA 2F48A 2GF0A 3OQIB 1W9HA 3SBEA 5AVVA 1KC3A 3B1FA 1DKOA 4M0PA 1SULA 4G0PA 4UM9D 3LA8A 1K97A 1VMIA 1DKMA 3H7AA 1KAGA 4A2CA 1GJRA 4BN4A 4IZHA 3GCXA 5F5LA 5JPIA 1N1DA 5K8JB 3LAWA 1VKOA 2Y1DA 4QU8A 1Q1BA 4BO4A 3T15A 1P7WA 1Z8DA 1Y4ZA 3ICWA 4FCTA 1NUPA 4F1KA 4EMSA 2CGEA 4OHFA 3F5FA 4OK3A 2J1LA 3BKWA 5I8WA 2IYZA 4D3SA 4XQEA 4PANA 1AIPA 3OKAA 3B70A 1P0PA 2E4XA 1V8FA 4GX1A 3ROQA 2BSXA 4W63A 4P6VF 4PXSA 1E77A 1H05A 3LXRA 4HYQA 4DIKA 1SU6A 1YQEA 4B9AA 1RHRA 3IHWA 1SOMA 3DE4X 3HZOA 1AC5A 3HY6A 3I04A 1J8FA 1I2AA 1G5PA 1GPNA 1LVUA 3EYWA 3OTHA 4RK5A 3HC7A 1VPLA 1NQUA 2EERA 2PKEA 2R5FA 3E5MA 3F5MA 1I3MA 3LT1A 3TSCA 4DG9A 4EJMA 5EJ7A 1D8AA 3FFAA 1JHQA 2ZI3A 3RIYA 2RMKA 2WR8A 1J07A 1MJNA 3SYNA 3ND9A 1PCXA 2C9DA 2LV8A 2YTZA 5BWCA 3DL7A 3N2KB 2H9IA 5EE5B 3CUWA 3V3TA 2EFHB 2WK1A 5HQ3A 4HADA 2ET6A 2UUAB 1YZGA 3VDQA 1GDTA 1TDJA 3CSDA 2BGGA 1NQTA 1VPTA 3TNJA 3H5TA 2YMPA 1F38A 2H1IA 3EW9A 1LVHA 3ZE0B 4F84A 3U7HB 2FX5A 3A04A 1Z4PX 2H54A 1PZFA 2VFAA 2YJTD 1IEVA 3AERB 2D0DA 3QG1A 4FBLA 3M8KA 4RHCA 5E4YA 2AI1A 3KOWA 3LVFO 4ZODA 2BOVA 1F2TA 3ORRA 2RKWA 3DNPA 2P9HA 2CHVA 2PXXA 2ZE5A 3BYZA 3IT2A 2O57A 4ESOA 3UPUA 1OOEA 3L3BA 4F71A 1E2KA 5DM4A 1ISMA 3AI7A 4DMGA 2FR8C 2VT3A 3KJHA 4GI5A 3AHJA 1DAHA 2O2IA 2IPOA 1NYQA 3DEFA 4E03A 5BMOA 1F6WA 3DXXA 1GQ2A 5AO9A 2AI3A 3R0QA 1JH9A 5IT9A 1QYCA 1H3FA 3QE3A 5AHOA 1EWTA 4CN8A 4MYDA 2EQ5A 3K09A 5CVCA 3VU8A 1TT7A 3NATA 3BGWA 3MHPA 4GRDA 4NFSA 3L5OA 1E2PA 1KKMA 4PEVA 2C9OA 4F3CA 3ZDAA 1PEDA 2FG7C 4MB0A 4RFLA 1H0HA 3VPGA 1LLFA 5KKNB 5KVVA 4NXNB 1KYTA 3IHTA 1G41A 1Z29A 4JLKA 2PYDA 4MTCA 1CVLA 1MA3A 1WUYA 4L95C 2ZYRA 2H0RA 4BLQA 2ZVDA 1X7ZA 2ODWA 3FMFA 5AKJA 4RKFA 5K51A 3AF3A 3ZXYA 2HIMA 2YHSA 5EMNA 5B64A 1N6RA 1TTQB 1C8BA 2Y2VA 4L15A 4QICA 2V9CA 4LRSB 2P2LA 4AZ0B 3UCXA 7REQB 5EZSA 2A92A 3NH6A 3NHUA 3DYVA 1K5GA 4XM2A 3D6JA 1NUHA 1CUFA 4PSKA 3G17A 4B4UA 4BN0A 3PRHA 1ZD3A 3HB1A 1ZL2A 3OJCA 3OZXA 4UCQA 4AZTA 1YJBA 1SVIA 5AK5A 2EG9A 4GC9A 2B4KA 2VJYA 1SXJE 1QBGA 3IDAA 3IIJA 1HGXA 3O03A 5K6TA 4CQJA 4D9FA 5A02A 1RR6A 3FPGA 1GFIA 3N5KA 3NCTA 5LB2A 3F3MA 1BCRA 2WFMA 2ATIA 2ZE8A 3I6IA 2BJHA 4IFIA 2WI8A 2WAYA 3EBPA 4B6SA 5KEIA 4ZIRA 1JXQA 4XPZA 1P74A 3WLHA 4CUKA 2FMTA 2CMGA 3D4LA 3GO4A 1C14A 4JXKA 1W47A 3JRXA 3FHTA 1N8TA 3T9FA 4P38A 2BKAA 4KAJA 5I9BA 4DWWA 1ICIA 5JCOC 4ARCA 3WDKA 2NYRA 4V3BA 4BKPA 4XRRA 5LLDA 2IHTA 4ETWA 1SURA 2VJBA 1XTTA 3UYKA 2OMEA 3KXLA 3GLFB 1M9NA 1RLOA 2QRZA 2X58A 1VI6A 4G5YA 4URWR 4LMPA 1PJ4A 2OM2A 5CM2Z 4B6QA 4BBZA 1F9AA 4EB6A 2B21A 4AWXA 1IWPB 4BEVA 5HP4A 1E3WA 1FLAA 2C96A 3ENVA 4LDJA 1ZINA 3K1ZA 4QM7A 3OZCA 2JGMA 4X3PA 1BOOA 1YRYE 2JGNA 1IBSA 4G3XA 4V39A 2H8GA 2C77A 3F98A 3AR8A 4X1IA 5LC1A 3MMSA 5G2OA 3W1VA 1F8YA 1FK8A 1CQZA 2VLIA 4YDSA 2I6SA 1JSCA 1KS9A 2EC5A 3AUUA 3MJEA 3T41A 4AZSA 1G66A 1V39A 4HWGA 5G0VA 3RI3A 2ZUSA 4EO7A 2AV6A 1NXOA 3H7IA 3GRYA 2XTMA 2PAAA 1FNMA 4EG6A 2RHDA 2V0GA 4XGQA 3LZDA 1D6MA 4CF7A 4WY2A 3NIBA 4BQEA 5HZKA 1XPRA 3FLBA 1L1RA 2IIVA 2R47A 1R00A 2WYIA 3NI2A 4KPUA 3W0LB 5JVDB 1ZCFA 3TK1A 2YJZA 4C0XA 1Y1PA 1GRNA 3IDZA 4M0EA 3GK3A 4XLLA 3MWJA 3I5XA 4DIEA 1E6EA 1EFVA 2QMHA 4UZEA 5CB8A 1BA2A 3JWHA 1D2CA 1CHDA 1XALA 1MHPA 3AY0A 3BMOB 3MJVA 2AFIB 1FUUA 4KI0A 3U40A 3PG5A 2O7RA 3ZHCA 4ANFA 1J7KA 1T9KA 1KO8A 3FSGA 3HCPA 3IAEA 2JVIA 2HOQA 3JSXA 4G25A 3OECA 1PGNA 1H2XA 2E85A 3QQPA 4HEJA 5DNAA 2OXIA 3SQNA 5CFNA 6YASA 4S0XA 2FQ1A 3H4VA 4AMYA 5M04A 1WPXA 2AF3C 4NZMA 1FSSA 3ACDA 2QE6A 5BPHA 2ONYA 3EXAA 1RI5A 2CC2A 3R6TA 1J22A 2BFDA 1NXTA 2NTVA 4U5QA 3KG2A 1MT3A 5D5HA 2H17A 3TX2A 3ZUPA 2HIAA 4A03A 1TYCA 5KJFA 2X5OA 1DQSA 5H3HA 4F3YA 1QOZA 1GKIA 3ZIUA 4B4WA 1KAHA 2XTZA 3ELDA 3RK0A 2W42A 2HHAA 2OZLA 4EITA 1LTKA 3Q7EA 3JWPA 1PS0A 1F20A 2O4CA 4MVYA 4EG1A 2PSFA 1B23P 3K20A 5HOQA 3OEWA 1FJ2A 1TTHA 2XSZA 4IYRA 3JWJA 4LK3A 3SYKA 5F21A 3TVYA 5JR3A 5A0TA 4FCWA 2FPUA 4WINA 1PW5A 2P9FA 3B89A 2JFZA 2AR7A 1WZNA 1XN1A 3GLKA 3OWXA 3R3VA 3EEQA 1B3BA 1EZZA 1TU0A 4FDAA 3WAKA 3ZU3A 5C53B 2RONA 2HLDA 2HNAA 1BMQA 1WZIA 4V03A 1JLLA 2NZJA 3DWFA 3WLJA 3GRFA 1E64A 2PMBA 2Q2QA 5FBRB 2J0UA 1RJWA 1FP2A 2HQOA 4TKVA 4L8WB 4ARIA 1YTLA 3K6RA 1GV1A 3UV7A 5C4IA 3N70A 3AJEA 2EHDA 2YFKA 1XQXA 1Z36A 5FA5A 4A3SA 4J0JA 3FNGA 1UM9A 3QEKA 4Z2YA 2PD3A 3EK2A 2I5PO 3RJZA 2OR3A 2QLMA 4GKVA 4TYPA 4UEWA 2HH9A 4YRIA 1MJGA 2YCBA 4K6CA 4B71A 2HT1A 2LNDA 1DBVO 2R97A 1PSDA 1HDZA 1ZN2A 1LSSA 2FW9A 3DPSA 3L7LA 3GRCA 3NWBA 5FPPA 3SSAA 3UHOA 3WNBA 1DIBA 4YECA 3ZWCA 1USUA 5I7UA 1AGPA 4JWKA 1HYHA 5FPKA 2VJPA 2WG0A 1W1IA 1OIVA 1HYQA 3AL2A 3DB1A 4RH3A 4WLUA 4OMDA 5A71A 4FB4A 3ZBQA 5JECA 1RXWA 1R12A 2QLJA 3HFJA 5ECWA 4D4IA 1GQSA 5JZBA 2BY4A 3HA2A 3SIXA 1M6WA 5AVWA 3IMGA 1RJ9B 3RM3A 1V16A 1O6FA 1X1SA 1QYXA 2H52A 4LN1A 2EIHA 1JI0A 1HFWA 1KMHA 1ZN8A 3P71T 4NCBA 1WXFA 1GA4A 2TMKA 1XA4A 2RD2A 2V7PA 1U0BB 4YMWA 3DP7A 1QHEA 3UGTA 3G2PA 3QELA 1YUNA 2QM8A 4FHEA 3DGEC 4HJRA 2WZCA 2DUUA 5FUYA 1YQWA 3BXOA 3CPEA 3H87A 1X7DA 3CUSA 1L7BA 4R8LA 3AVYA 2O8VA 4RXUA 4UATA 4N5IX 3IVCA 4FDUA 4IEEA 5DBEX 5EMHA 5BN3A 3KQUA 4W8HA 2FW1A 2M6RA 5BURA 5IM4A 3OZUA 5JROA 5CM8B 2L2QA 5I7FA 3DXFA 3CH4B 3DDCA 3QEJA 2ODQA 1Z6GA 3A8TA 3FTFA 3TQTA 3EGIA 1WX1A 3NTVA 2XTAA 1KMNA 1EB9A 4GOLD 5ERGB 1GUDA 1O6GA 3TE7A 4IKOA 1LWOA 3VOSA 2ZANA 4BFCA 1WP9A 3K6JA 4EPWA 2NTEA 4PGGA 2DCMA 4EHDA 2X9GA 5ECGC 4MVJF 1KZYC 5EPEA 4FU0A 3HABA 1JUDA 4B34A 5IDVA 1E59A 2C03A 4E88A 1K89A 1KJJA 3GLHE 3PTAA 4RC9A 1T1SA 1OHHA 3DZDA 4G5QA 1AXRA 4IL5A 1Z34A 2C5SA 2O2EA 4HQFA 1YC2A 1WDMA 2DP4E 2FW0A 3PDHA 1ZDMA 5FOSA 1M1YE 2EKBA 3TJZA 2IYWA 2B20A 5CVVA 1RWKA 1KJ9A 3QQ5A 2QSJA 5B3JC 5HUHA 2VJDA 3TI9A 2SKCA 2X2FA 3CCBA 3ZV4A 2R25B 4MUKA 4TRMA 2I34A 2FXVA 3ONNA 4ZU6X 2GAOA 2R4UA 2SKEA 3ZOKA 4I50F 4Z49A 5T8KC 4LBWA 1E2HA 1RYEA 3CCFA 1WEHA 2YUTA 2GN0A 2UKDA 2VR1A 3AEQB 1X1BA 5KVAA 4AAYA 1GVNB 2O2YA 2D2EA 1PDWA 3PWKA 4LHVA 3T6KA 1CUJA 3TOXA 1TI7A 1SKYE 4AMGA 3EPPA 9LDBA 2R2AA 3AERA 4MS4B 4HFJA 4KE9A 3U5ZB 1GDHA 3F8SA 4C1NA 4KUGA 2R6FA 4XTCS 1UZLA 2BCGY 1AE1A 3BB1A 3B8EA 3H86A 1XRRA 2ZIGA 3PEFA 4NENA 1H66A 1LPPA 3V33A 4CT0A 1V4VA 1UBNA 1UQTA 3MYYA 4EYSA 1VBKA 3UMRA 2LWIA 3A2MA 4CMIA 2QJTA 3MMNA 1OTYA 2WHRA 3BC1A 3P0RA 2BEJA 2GZRA 2ZJZA 2F67A 3GRKA 2J6IA 3OA0A 1NJ2A 3QUTA 4A8JC 4EUFA 3K0KA 2XWQA 3EAQA 4UDNA 3NHBA 3K96A 1Y8RA 2D0PB 2R00A 4TKLA 2HYIC 1W96A 1JT2A 1W4BA 2I4NA 2VNKA 3QP9A 4FD3A 4KZPA 1SY7A 3NTQA 3HN7A 3OUTA 2ORVA 2HF2A 1HYBA 2JIZA 4K9NA 2DLCX 3ZS8A 3DP9A 4EW3A 2IZ7A 5AI6A 2YWEA 4K03A 1GOTA 2HCRA 1RZ3A 2GVZC 4A6XA 3ZE7A 2FY8A 2EBWA 3UAVA 2PXCA 4WN9A 1UEIA 3R20A 5GP1A 3AZQA 3NALA 4MINA 3SXPA 4C89A 2AA3A 5JEEA 4B3JA 4GKAA 3O0TA 4AUNA 3UM9A 4MDYA 2WZDA 2CXOA 3PYXA 3D1VA 4HDKA 4KSBA 3WI7A 4LS3A 3QNWA 4H77A 1JR6A 4E5SA 1J5EB 5GAJA 3HWSA 3U60B 3EGDB 1BMTA 1OH6A 3UWPA 4BV9A 1NASA 1XU7A 3LQKA 4TXNA 1X2BA 3DONA 4POOA 2DHQA 4H7PA 4HQRA 1UM8A 5HF9A 4DNQA 1M0SA 1FQWA 3DR3A 1DX6A 1ST2A 3KKMA 4BJ6A 3RUPA 4FS8A 2M1ZA 4W5NA 3MB5A 3D8RA 4XI9A 1L9KA 2OFFA 5JG7A 5DM60 3B85A 4L6CA 4PINA 3VZDA 5KQGA 4EKDA 4QTTB 3BOSA 4GMFA 2WA1A 2J4FA 5GGXA 1X8KA 3IQHX 5K4GA 4G5XA 4OJNA 1V48A 5I9NA 1LDBA 1P1CA 4EA6A 5THXA 3HZHA 1OX4A 1ESDA 4XIIA 2V6GA 5FNZA 3WJ7A 1M2OB 3UK7A 1QKKA 4N3CA 4E5DA 5JY1A 3ROTA 1FRFS 1GU1A 1P75A 2C2MA 4UNIA 4YUZA 4TQUS 5B30A 2PD4A 4L3WA 3X1XA 4UARA 3CY6A 4ZYZA 3H5NA 3P9QA 5BWBA 4HAXA 3WNCA 4MRMA 3WQSB 1GYQA 3QLVA 1WDTA 3JS5A 5C1IA 1F7UA 1JDJA 1CDZA 5CW1A 4DCNA 2IZ6A 1OWMA 4C4RA 5IC4A 3S81A 2ORED 1RFGE 3JAMA 1KK0A 1XEFA 3ENKA 3L43A 1ZHHA 4ZOLB 2EZ9A 3V5NA 1XZAA 2Y67A 5EKDA 2BFNA 3GCWA 5HTKA 2EFYA 1U7OA 2QTGA 3HLYA 4HGYA 2ZM5A 2D7DA 4ITRC 2W48A 1YKFA 3ROFA 3U0BA 5IULC 2ZJ2A 3ZHUA 4EO9A 2WPNA 3G6WA 1HDYA 2QP9X 4P4TA 1E7SA 1P62B 3ESQA 3V97A 4DILA 3W78A 4ZCRA 4JI2B 4S1PA 5J40A 3T5MA 3ZJUA 2B8TA 4GI2A 1FS6A 3HR4A 4MLCA 2DUJA 1YVEI 4UHEA 1QP8A 2O7NA 2P2CA 1XP5A 2QUHA 4ROTA 3U7QA 5JVDA 4BXOB 1A88A 2D3WA 1ML4A 1U0LA 4J29A 5AHKA 5ETJA 4EOGA 1DCTA 3ZU6A 3N75A 4IS3A 3L8YA 3X1MA 2DWQA 3RS8A 3LYUA 4D43A 3K1AA 3VYUB 2DKOA 5LD2B 1HE4A 2HMSA 4ENTA 2WRZA 1U8AA 2IIBA 4C21A 1H3EA 6ABPA 4YTEA 4M3NA 4MQFB 1KRHA 5LLSA 5KYNA 1FUKA 2IS1A 1Q7EA 4R1TA 1BJRE 1NXQA 9ATCA 3ZQKA 1NQ5A 2WTUA 2FZCA 1J00A 2NVWA 2VYND 4OXQA 1GWNA 1JHVA 1OVMA 5B57C 1P6QA 2IXEA 4RA6B 1N5IA 3LNCA 1AGXA 5BRAA 1RCTE 3W3ZB 3JAWA 5HIKA 2RE8A 5FOTA 4AG3A 5U4XA 4CMJA 1GZ7A 2DPMA 2OXCA 3VPBA 4IMIB 5KNDA 1IVNA 1VC2A 3O8QA 4HYEA 5GJVC 3U4CA 5L6MB 1WXQA 3JQRA 4Z0PA 1QV6A 4DB2A 5LZ7A 2XQGA 4ZI2A 2GZ3A 3ZJTA 2JI4A 1UWCA 4O3MA 4HSGA 1ZH0A 4NPHA 4FGKA 5JWHA 4DABA 3KTOA 2EF1A 4BQFA 3MTIA 3IUNA 4F2WA 1KI3A 4OTZA 4ZYUA 1GA1A 3U4AA 4WLEA 3ANSA 4KJXA 3HUUA 3TXYA 4LEIA 1XDUA 4ZANA 2AWOA 1K88A 4J16C 2I7VA 1LX7A 3HJCA 4G5SA 2AJLI 4FIDA 4P54A 2J07A 1QMPA 4Q3AA 4W8OA 4BMYA 2IS4A 3AUKA 3JQPA 1L4HA 4C01A 4RULA 3U61B 3JRWA 1LLUA 5BT9A 1HSZA 4QSMA 1HI9A 1T3GA 2W6QA 4XM0A 1EX6A 1X6VA 5KJ6A 3KUDA 2JFOA 1PE0A 3PL5A 4GLJA 2I1VB 1W29A 4I8IA 3H1PA 1Q7RA 2JKVA 1TL7C 3H1BA 3T12A 4UXHA 5GPBA 2W90A 2L69A 3M82A 5KMGA 1W2HA 1A8QA 1ZRMA 4WKNA 2BLLA 1IPFA 3DC7A 1XDDA 3DR5A 3EPRA 2WJJA 2FEOA 3X43A 1JHAA 2GM3A 3PFGA 3A1CA 1VRVA 2ATVA 2YWHA 3RT9A 4YRAA 3FFBA 4RTPA 5J1TB 2GUGA 4X1KB 4H0NA 2H5LA 3IKJA 3VR2D 4WKCA 2RAUA 4PHFA 3ND8A 2ZR7A 3V7WA 2JRCA 1NBAA 5A6SB 3A14A 3AFHA 5LJIA 3DE2X 4HZGA 5B36A 2ORWA 4CEHB 4C7MA 2JGIA 4KIUA 5DK6A 5T4HA 1QH9A 3CBGA 3LKDA 4JU8A 4QDTA 2I76A 5JWRA 3ZIAD 1G8GA 4PICA 3JQFA 3M2TA 1NPDA 4NYIQ 3PVSA 1NMEA 4K9QA 4TMZA 4TTSA 2NPFA 3UHJA 1B14A 1JDBC 1EESA 3U19A 2ZJ8A 5K5EA 5IJAA 4KN6A 4BX3A 4AK9A 3TZQA 1SCKA 1G0NA 4EYOA 4BNHA 1LBSA 3EAGA 2FMUA 3VC2A 2PMDA 4BO1A 4J0QA 4EAQA 1MRZA 1KO1A 1IHOA 3WGLA 3U44B 1T2EA 1FSGA 3LH5A 4QJIA 3U09A 2R6AA 4DDTA 1GPKA 2HI0A 4IDBA 1BJTA 3PQDA 1X1AA 3NCHA 2PLAA 3O8DA 3U1TA 4C3VA 4DMLA 1F7VA 1BWSA 1GSIA 4Q4JB 4KK4A 1A5ZA 5FTKA 1PQWA 1GARA 1FTGA 3A9SA 3OPXA 3CNBA 4N3BA 1ANKA 4BNYA 5JNRA 2O14A 4FC7A 3IBYA 1P4RA 2NQTA 4KLRA 3ZHBA 4EA7A 4XGKA 1RKBA 2QAGC 1UF9A 2FQWA 4MPDA 3IJEB 5AJXA 3HBNA 3EXEA 2XUDA 2EX4A 3QKRA 3WA7A 1A9RA 2QTTA 1VZ3A 1M0TA 1UBEA 2QN8A 1UOEA 4LQ4A 3QTTA 5J5AA 4AFNA 5H7XA 4BNDA 1WU7A 4C3OB 2XITA 3R8CA 3JVIA 3HB0A 3I6MA 4OJKA 4I5DA 2PJRA 4LF4B 4QQKA 2PR2A 4CN9A 1W5TA 5D1NA 3T9CA 2BGNA 4NHEA 4O0MA 3ER6A 1U3WA 1I8TA 3OCCA 4P4NA 4XKJA 5BOVA 4OGKA 1NX6A 4AVYA 5LDHA 4KXXA 2Q4DA 2PTHA 2PT6A 3EIXA 1RVDA 4EFKA 4CKEA 3ZDCA 3PXGA 4CIVA 1K8XB 1E2UA 1RWPA 4OOEA 1H5UA 1K6MA 3PRJA 3P4YA 3E15A 1AK2A 2ASVA 3AEQA 4WFIA 3SHVA 5I7HA 3DAFA 2HF9A 5JATA 1UBFA 5EE1A 2BE7A 4LSZA 3OZEA 4F4HA 3CLTD 5FWYB 4KHZA 4YRKA 2VHUA 3LXMA 1P44A 2GILA 4DQ0A 2AZXA 5K0ZA 4YIKA 1YU9A 2HPHA 5HK8A 1YOBA 2WWVD 3I5MA 4J2OA 1CF2O 5K2MA 2O3UA 4IKPA 3VR1A 1M83A 2HCFA 4EFLA 4RETA 5T3YA 2GH1A 1BG6A 1W36B 4HMPA 4AKHA 5DWQA 2R96A 1AM4D 4KO1S 5B12A 2X5NA 4NEGA 1H2AS 3OIFA 2YVAA 1KK2A 4TN5A 2H2GA 1KI6B 4M37A 3WHIA 4ASUA 3ZCUA 4Y2GA 5B1IA 1KPIA 4BP8A 1WL8A 1DELA 2XJ9A 4MKXA 1Y5NA 3PBKA 3U4HA 4DIDA 1GLVA 1K6JA 3T3MB 2ZRQA 3ZHRA 5K8LA 5EIBC 1IEXA 5FULA 2XOXA 3H5LA 3K35A 4U2DA 1M2GA 5A1TA 2PX5A 4ZYTA 1WXHA 3OZGA 5UKDA 5EKUA 2QYTA 3RWOA 3TCXB 3L4KA 1ZCBA 3IOEA 1YS7A 1GGFA 2W70A 1PT7A 2WWRA 4B3HA 1TMKA 1YF3A 1XCBA 1DV2A 1XF9A 2P35A 3SJCA 1S2DA 1OPXA 1Z2EA 3PJGA 2AG5A 1FLDA 5EUCA 4DG8A 2FF7A 3VUFA 3RAJA 3RROA 4XWAA 3DKVA 4BKQA 4GXTA 4XEUA 1L7VC 1ZBDA 2PVCA 4IVPA 4MWDA 4UU7A 2F8LA 3IL2A 2OB1A 1N0UA 1LKZA 2ZUDA 3P9KA 1DWOA 2AXNA 1Y7HA 3F71A 4IIGA 3ZE9A 5AYVA 2OAEA 2CJYA 3Q3HA 4N0MA 4YAJA 1PGJA 5BR7A 2VZ0A 4ZT3A 1EGMB 2JF0A 4BNFA 2B35A 3AVTA 1E2MA 2Z8XA 4B7UA 1ZXBA 1LPMA 3BFJA 3QHQA 3C5VA 3HO1A 1ONBA 1C3OA 3FXAA 1U7XA 1PK7A 1CRLA 2G1JA 2R1TB 2CKMA 3WBBA 4MVJI 1SN7A 1SBTA 4B0PA 1X1EA 1ZZGA 4HD8A 2C1XA 4RL4A 3ZDFA 1FP7A 3F1LA 1KSHA 4ZEOA 1OX6A 1LRJA 4NBRA 4CL0A 4G4SO 4JB0A 4ALLA 1N2XA 3R7SA 4UOQA 4G81A 3AMVA 2I3DA 3A26A 3IQGX 4OFBA 4WHMA 3SGLA 2XNSA 2Z0MA 3S1SA 2O2GA 4V0NA 3F1KA 4C7BA 1HDIA 1QIJA 2ZUWA 2QV0A 3AI2A 3OURA 1ECLA 3CXRA 2Y0BA 3HP1A 3VHXB 4JI3B 5JQGF 1G9XA 2OESA 3B5JA 4PAWA 4X8MA 4CV1A 4HXEB 8ABPA 3R9XB 3T8YA 4AZWA 1VG0B 2ETVA 4NY1A 4RSMA 2XUIA 7GPBA 1XQ9A 2BD0A 2NUAA 1ZU5A 1XTRA 4IV8A 1I3LA 5ALRA 2QGNA 7AT1A 4ZOLA 2X0KA 1G5HA 3UV6A 1EFKA 1FSZA 1RWNA 1VI2A 1L7PA 1XDBA 3DSRA 3GT7A 3LQ1A 3D8NA 4PBRA 4JA0A 2PAFA 4Q9KA 5D7BA 3SS9X 3DTVD 1MW9X 1W4RA 3IQIX 5JS6A 2NQ8A 2WM3A 4H6PA 5ALYA 2WWIA 2G63A 2IP4A 1RC8A 1JPVA 2B8NA 2VEOA 5LLTA 4DN6A 4DR1B 1VB3A 4E1BA 2P9YA 1K68A 3RRBA 2EZ4A 5T6MA 5CX4A 4PYLA 5C5EA 1CE8B 5IXJA 1OTHA 4TMXA 1PT9A 2Y71A 3IBSA 2C61A 3JWIA 1KFEB 2DPLA 4Y1RB 1B0PA 3SR4A 2VWQA 4MVJA 3EZXA 3PCRB 1XTBA 3SZGA 3WLTA 1V8PA 1DQNA 1GG5A 2AOUB 3DVQX 3H9BA 4P80A 5JS8A 1RCUA 2OORA 1WV1A 3L1HA 1D4OA 4IWXA 4NR0A 2QTCA 4KB5A 1IQPA 3PC2A 4TTJA 5KC9A 1E4VA 2GN8A 3DKIA 4G86A 4WL0A 3ZDRA 2XMPA 3FNEA 4QO8A 3F7OA 1TZBA 1Y80A 4PYNA 3ZWAA 1UXJA 3B5IA 2W2KA 1X38A 3QITA 4DIOA 3BD9A 3K9CA 4CI0B 4CWAA 2PMFA 3QYFA 3E81A 4BFTA 5K8TA 2Z5VA 4FFSA 1SCBA 3OPQA 4HS4A 3KX2A 1BH6A 5DU2A 2ACWA 1Q0TA 1KNQA 1FDIA 4AZVA 1Z68A 2QD1A 1DS6A 4KXFB 1USVA 3C3MA 4I50A 3UPDA 1BU8A 4OHVA 2HSJA 2QTBA 4WLNA 4XUCA 2EKZA 4DNFA 3HEMA 1YIDA 1AB6A 4QLOA 2Z8YA 5CURA 1NV9A 2ACKA 3T94A 1GAXA 1ULUA 3ABRB 4HNRA 3V6LA 1BEUB 2F1RA 4DV4B 4FCVA 2IKSA 1WULS 4WASA 2GNOA 4IHJB 4EGCB 3KV1A 4W99A 4OQ4A 4BV8A 3LE8A 1UXGA 3DAHA 2C94A 4NZPA 1VLHA 3G0GA 2C2KA 2CVOA 1V26A 5IG2A 2J6HA 3E3NA 4J94A 1NVMB 2PK3A 3QU4A 5AMXA 3ROZA 3I5AA 1Z3IX 3GJ8A 3E03A 3CU5A 3H0EA 3GLUA 5H4GA 1YK1A 3LY8A 4I1PA 1NRWA 2R8XA 3IO3A 2GVNA 1Z4QA 2E4ZA 3MTQA 4PLYA 4R2HA 4CIWA 2PS3A 2X0RA 1YB1A 1YV9A 1R8SA 1M1ZA 2F00A 1MKYA 3H8JA 1M2JA 3I4FA 3O4HA 4MITA 3U13A 5JASA 4DXDA 3ZI4A 4HX2A 4B82A 3LY5A 4TQAA 1OUMA 2Z57A 1OXUA 1Y7IA 3QXXA 3QY0A 4XDGA 1E3IA 3JYOA 3VC1A 1GT91 1TW3A 1W30A 2GJ4A 3GVCA 2C4MA 1W2WB 4H4EA 5CHEA 3VR4H 3WL4A 2IYLD 2XE8A 3B6ZA 3ZNNA 1YL5A 2VHYA 4GZ3A 3NOOA 5IAOA 3GN2A 3QVXA 1XZCA 1RI3A 1MJHA 2I4RA 2ZBQA 3L7MA 4IHQA 4LVCA 4O3FA 4BFZA 2UYGA 5DTJA 3V4SA 5JSHA 4ZHSA 2WFZA 2WPDD 1II8B 2ENWA 3C4JA 1VYHA 1BD4A 3HJGA 4NE2A 1UZAA 1ATIA 1FA9A 1PK8A 3FIUA 2MCFA 4QUBA 2O5EA 2OZVA 4O2RA 3PC7A 4DAEA 2XNDD 5FUQA 4CEHA 2XCQA 1BFDA 5THKA 1OLSB 4H7FA 5LU9A 4ESHA 3KZ1E 5FI0B 1T8PA 2FX2A 1IJEA 2AD5A 2X9NA 1FSPA 4M9XA 1XPOA 2XWJI 4LV6A 5JPDA 4Z0NA 3SBDA 3PFWO 1CD5A 3PLNA 1QRDA 4AW9A 2K87A 4KMRA 4OYYA 1IPEA 2ICAA 2FF5A 3DEIA 4NU8X 1G2PA 2J32A 5AI5A 5TGZA 3WOHA 4XYLA 2AHRA 1A8PA 4KOAA 2R7LA 1DG1G 5GZ6A 3U44A 4KYUA 1AY0A 5AVRA 2IV7A 3RFVA 4BKRA 3FUVA 3FI0A 4CFYA 2E37A 2WIAA 3LIIA 1J8VA 1XTQA 3AESB 2CDBA 3AF6A 1I3NA 3DA8A 3MUFA 1PDVA 3T3IA 4CF4A 2AKAB 4DC0A 1YT5A 3HUTA 1EIWA 4ZVQA 3WOVA 2BUCA 1CUWA 2B2CA 4F11A 1EM8B 4ZCIA 5CVEA 2NU6A 4RTJA 3DKRA 3I2FA 3WLNA 2CDAA 2FZ5A 5JSFA 4NULA 2RG1A 2XZPA 5TPZA 3JQAD 1NMSA 1ZK2A 3DZKA 4W6ZA 3AJRA 3DNFA 2G9QA 1TEXA 3KKQA 2PFGA 5AKXA 1MABA 5LKRA 1F2UB 1Z6YA 5JYCA 1NG9A 1P2FA 1XJWA 5LP6B 1U2TA 1P2SA 2AWNA 4GX2A 1DWUA 1EEXB 4MA4A 5I47A 4RELA 5ESRA 2W83A 3QBVA 4PFKA 1A7JA 2JZCA 3JTEA 4ON9A 2POCA 4II2A 4Z8YA 2WHEA 3NM6B 4NH0A 5EQFA 1GSHA 3KR9A 4K7JA 3U4QA 2P9GA 5E7JA 3TTTA 1F0KA 1JZTA 3D31A 3REGA 4DRXA 1EE9A 2N46A 3FPBA 5KJ1A 1U0NA 5CITA 3WIUA 3DL2A 4Y18A 1H0KA 3EFBA 1J06A 2IOHA 3KTAA 3OCVA 4QOJA 4U4AA 1VJ0A 1CVIA 1JQ5A 2KMLA 3I8SA 5IBRA 1RCFA 3RIMA 3O3OB 4Y9UA 3H1AA 4MDFA 2X5JO 2ZCJA 3O82A 2NUPB 4MUBA 3PL1A 3TRHA 3NDJA 3WFZA 1QQ7A 3LO5A 4HEQA 1BWPA 2CT8A 1T26A 1VSQA 2VRWA 5TNXA 4BGVA 4KTVE 4EGAA 3EF3A 1KEEA 1VGRA 1RRPA 1CSEE 1CUEA 4IJQA 1O6CA 4NL4H 1FP6A 2PSSA 3DXYA 3OJLA 1QLWA 2JKYA 5CT4A 3W8RA 3WNDA 1D03A 1C9EA 3LP5A 1U63A 3OY7A 5LZ5A 5IXYA 5DH9A 2QMOA 2XMRA 3DGFC 2QRVA 3JQBC 5AUPB 3JWGA 3W77A 3O5AA 1SXJB 2EBUA 4E6EA 1MEEA 1AN0A 3JAKB 3PITA 2BF4A 3T38A 4HH1A 4N8SA 1CNMA 2VRCA 3DPUA 1Q11A 1DJOA 1PZEA 3SF8A 1C1DB 1WV0A 4Z1MA 2X23A 3CVJA 5FL3A 1HDCA 5KSOA 2OC4A 3KT6A 2QMEA 4PZDA 5DFAA 4FDTA 2EXXA 2W6JA 2I71A 1Z8NA 2P2GA 1UZUA 5C1OA 1F0NA 3K0AB 4YP5A 3VU9B 4WQMA 1PV4A 3F4LA 3OMWA 1WKCA 3UY4A 1IBLB 7MHTA 5E2BA 4CKBB 2Q8PA 3UMJA 2FWMX 2VHJA 2CCGA 2YV3A 5EIWA 2QNBA 2RFLA 1ZH4A 2ZSJA 3NQ41 1I4DD 5JZMA 1CS0B 2OCBA 1WB9A 4R8SA 2ST1A 4I6JA 3OQ6A 4A92A 1TK2A 1JEOA 4G4SP 2BISA 1MB9A 4YO7A 4DA9A 4M1MA 2ZW9A 1IQRA 2Y66A 4TSRA 3WE7A 4JQCA 5CFMA 2ZQ5A 1EXNA 2HXYA 1U2DA 1BXKA 5GTDA 2OV1A 1B6RA 3EGVA 4JP1A 3FBWA 1D2EA 2NYVA 2V0NA 3OKPA 1JLRA 3VZPA 3R3WA 2HK6A 5EWLB 2F1KA 5EPOA 4YR9A 4HRAA 3O9VA 3K6SB 3RFCA 3RVNA 3FR7A 4UBNA 4RY9A 3VTKA 3H84A 3EISA 4BNLA 5EJ5A 4M0CA 3VHXA 2CXSA 4KK3A 1IMJA 1K9SA 1RXIA 2B92A 3BEDA 3GEGA 2V58A 4K6KA 2AHOA 3DAYA 1XQ6A 4TYYA 1RJFA 3IA7A 1MOSA 3ES9A 4QOFA 2C9BA 2GTHA 1DAFA 1QQ5A 1QQTA 2JKZA 2ZUBA 1JQEA 2O6HA 3IJRA 3OZFA 4LDQA 1WQ3A 1NHGA 2RBGA 5F12A 4U7DA 1TZ2A 2DTXA 2HDNB 2V0CA 2D1TA 4PS1A 3TNLA 3VSCA 5HZMA 4JVLA 3S99A 5FOVA 1L5SA 1J5PA 1LDEA 4PX5A 1VKJA 1JG6A 2ANCA 4X1OA 1O95D 2P0YA 3SHQA 1FMLA 4FE7A 4C7VA 3PXCX 4GDMA 1NGSA 5DSXA 1N9GB 3OFJA 2QVGA 2QMQA 4AO8A 3JYPA 1OFUA 4UZFA 3GH3A 4XAQA 1F60A 3EDMA 4D3FA 4FQ7A 3C7AA 1PQ4A 5DZSA 4BWYA 1UWVA 1DQRA 4I81A 4LXHA 3KJNA 1WD5A 3QBJA 1M74A 2X2PA 3H11B 3KHKA 3UK0A 5DGCA 1N75A 2FKNA 4R0VA 2E1PA 3ZV7A 1EU1A 4C30A 2YXLA 2PLFA 1QK5A 5AW7A 3THSA 4F96A 1U5BB 3BMCB 1JPJA 3QWHA 1IK4A 2OVFA 3FFWA 2QAIA 3D4BA 3JZFA 1YS6A 1B0ZA 3P2KA 1JB9A 1XMIA 4PVDA 2ZSIA 4WXEA 5FB3A 1IHUA 4NDZA 4MHTA 4JC0A 1DFGA 3ESXA 2TMGA 2LVBA 2X2EA 4INPA 3UW3A 1JDVA 4R8RA 3F9CA 4OSEA 3WIEA 3KPVA 1WM1A 5HDQA 4POAA 3UB4A 2V7QD 3SI7A 2ZCVA 3QBEA 3IRVA 2BFBB 2ZUUA 4D6PA 2CMKA 1M6NA 3LX4A 4LW8A 3L0OA 4O1MA 4WEQA 3UO8B 1FTQA 4B6RA 1WAMA 5T4BA 4CLRB 4IHJA 2YV4A 4B4VA 1W0KA 1XRNA 4L7VA 5KTNA 4HAOA 4KXMA 1NKSA 3AJ9A 4MQ5A 5LZ4A 4QPZA 1B26A 1XTSA 4IIYA 5AUNB 5DEOA 1JZSA 1TC1A 3EMVA 4JT9A 5HGJA 1ISPA 4ZI7A 1JIUA 1ECPA 2UZ1B 4TTPA 4LI3X 1Y1RA 3PDIA 3TSOA 4MB6A 1ZYUA 3MWDB 4GMGA 4V02A 3PVZA 1Z2PX 3TR6A 4URFA 4ABYA 2C84A 4CMAA 2CLCX 3WLIA 5HUQA 4JCOA 3MCWA 2CUKA 2YN0A 4J9VA 4E07A 3CF0A 4WOPA 5J2UA 3RU7A 2O05A 4TS9A 3UCFA 1FIUA 2ZIZA 1E2EA 2NVOA 1WXWA 2A3RA 3Q88A 4DDKA 2CF5A 2AC7A 1T5OA 2J3JA 3MG9A 3Q10A 1U9JA 1IH8A 3DBRB 4Q82A 1AA9A 3OCJA 4RDIA 1OKKD 5SYNA 2OG1A 1S9HA 4M1KA 4YMVA 1H2RS 1JA9A 1PFQA 2EZTA 2VZLA 3B8HA 2GTPA 1MORA 1Q19A 2Q5LA 4IDNA 4TLLB 4RSHA 3GWGA 4YCDA 1GR0A 1II8A 3CM0A 4HWSA 2V6BA 3E9CA 1PZNA 4NE9A 1CFZA 2KI5A 1R4NB 2J87A 2WWGA 4GLOA 3K09C 2AXPA 2D1FA 2X3YA 1HC7A 3FN4A 2C07A 3QXGA 2KYRA 2N9UA 4X7MA 5BO5A 3ZW7A 2GBFA 5CU7A 5CYOA 3U3XA 3UUFA 3V1LA 1MV5A 4ZOCA 1EK2A 1WHSA 2FLKA 5JYBA 1MVNA 2XMSA 1EG7A 1Q3KA 4WDRA 5JJIA 4UBOA 1SBHA 1OI2A 2V3VA 2QY9A 4YHHB 5JAOA 1F4LA 2YMLA 3C14C 3EG5A 4NWIA 3U31A 4FXOA 3HR7A 2EJUA 4JLPA 3D1JA 3LKZA 4ZI3A 4ZXPA 3GA7A 3ADDA 3LSYA 3FMVA 4HDAA 4PO1A 3GLHB 2PX0A 2ACVA 3KAJA 1AQNA 4GYKA 5BMVF 1GPUA 3FMGA 4FEAA 4WK2B 3GN1A 4DQKA 5IHPA 1NKVA 3IOMA 1EFRD 4KLAA 4ZCTA 1SXIA 1IJBA 1V3VA 3HJUA 3E2PA 1XTJA 4WXMA 3EEBA 1Z2DA 4I4TB 5AI0A 4KC0A 3I61A 2O5RA 1P0CA 1AK1A 1Z0KA 1SQGA 2AE1A 1O03A 4KXQA 2C95A 1R4MB 3W8EA 4X63A 2DMRA 5JBQA 2X5XA 4QJ4A 2NSHA 1PFYA 4XFKA 2IV3A 5DLQC 5JRJA 3AVUA 3MF4A 2JAHA 3A1WA 3O3MB 2F43B 2VNHA 4BMOB 4C4XA 1K8ZB 2OV3A 4RGQA 3W6UA 4KWEA 3QEMB 1K6XA 4DWJA 5HPYB 4OK6A 1FP1D 1SKYB 4RVDA 5EJIA 2AKYA 5BNWA 2JAQA 1HYEA 1J49A 2OILA 3SC4A 4CKZA 3T1YB 4M88A 4X85A 4W1QA 2XZLA 1IQUA 3HADA 3IULA 1E0SA 5L7WA 3DDZX 2GO1A 2HKIA 2KX7A 5DT2A 1F2UA 1QKJA 1ORWA 2ZZMA 5DWVA 1UKYA 2NNLD 2PZGA 1K9VF 2ZBEA 1Y33E 4AULA 4MHSA 2G08A 4DSNA 5CVTA 5JUWA 4GH5A 4MYRA 1N2CE 4QDKA 3OZAA 2O59A 6NULA 1QTIA 3GZNA 3MBOA 2A9QA 3K0BA 5LWHA 2HR1A 2HMYB 2KLBA 1HURA 4V0KA 5KDLA 2HBRA 5EHIA 4JLVA 5LUAA 2YNMA 4MI1A 1IZ9A 4K28A 1K8QA 5JSUA 4MWGA 4WZAE 1VHQA 5EZ5A 1R8JA 3LYAA 3TLGA 1JHYA 4TZ6A 4JK3A 4E32A 1Z22A 2BYTA 1Y9JA 2OY0A 1WABA 1EJBA 2QTHA 2DFLA 2I33A 4XVRA 2R60A 5CJ2A 5BQFA 3KT3A 3Q8MA 1ENPA 2WTXA 3KKOA 3T1VA 3L1IA 5KMGB 3HV2A 1QCCA 3RYFA 4C14A 1XVVA 1UODA 3OF5A 3QVMA 5DHUA 3C3YA 5B6PA 1DBIA 5SYAA 3HCAA 1N5RA 3E8XA 4KQCA 3BTUA 4RBNA 2JJ1A 3OZTA 3RCBA 1IPHA 4BIIA 1HA3A 3R77A 4P7FA 1IZ8A 3M4ZA 3HU3A 4WNIA 1U8XX 4NEQA 2WIDA 3MCAA 3UOGA 4JYCA 4QZVA 3FETA 5EJMA 1P6XA 3UWDA 4ZWNA 3LS2A 2HO4A 1CR0A 3W4JA 2VQ6A 3EOAI 3AR3A 1RHUA 3W79A 2AOXA 2EYQA 2PA3A 2V4MA 3F78A 3KLPX 4FM9A 2ZAYA 5KTTA 2X0DA 2D00A 4GR4A 4D9BA 1QDEA 1RLTA 2W4QA 2W71A 4FFWA 4J4BA 1ZZEA 4OI2A 3JAKA 1G1AA 3NUZA 3PUVA 3K9QO 1B6SA 2LPMA 2HCTA 2MINB 3LL7A 5EVCA 2OVBA 3QFSA 2BGRA 3L7CA 2ALJA 5FL7D 4BMXA 3LUBA 1Q1ZA 5KCZA 1EP9A 3I83A 3R5TA 4WX2B 1RABA 5NULA 3MQ4A 4IBOA 3RAGA 3BTOA 3KLMX 3ZOZA 3IEKA 3K0AA 4DC1A 3P9YA 5TQ0B 2WSYB 2G72A 3UJBA 4ER3A 4AO6A 3F5DA 2J9GA 3I28A 2BZSA 4UUPA 2M32A 1ZKDA 3QVKA 1EZ4A 3H5VA 1G8SA 3QHPA 4IMJB 2XIQA 3D4IA 5TQVA 1YFJA 1JALA 5HBGA 3K0FB 3RD5A 5IT5A 3FSJX 1JMYA 1SHJA 1Z7EA 1JKFA 5J5VA 2FRVA 4OLAA 1FUIA 4RM3A 1SBCA 1RXUA 1KIAA 1KP9A 1JXOA 2QZJA 3C4QA 5CGQB 2HNBA 2H7VA 3B1XA 3LDFA 1SUEA 1PJQA 1SVOA 2N1MA 1EX1A 3OI7A 5EYPA 1SU4A 3TMAA 4BO0A 5F76A 3W8FA 3PTLA 1XK7A 2W9XA 3PUIA 1M54A 3DE1X 4ZVUA 4DMRA 3F67A 4JT2A 5LMZA 3JATA 4BFYA 3C16C 1H1LB 4GGMX 5LYJF 5TY0A 3CEPB 5FTLA 3K6SA 3IAM1 4YGYA 3LX8A 1VE1A 2O2DA 3ASZA 4MV7A 3GLTA 3B3FA 1JLSA 3R5XA 2HSZA 2CXQA 1PUXA 3U17A 1A2OA 4RD6A 2Q7DA 4EB3A 5B2FA 1YL7A 4LHZA 4C7OB 4YS6A 3IPRA 2IC5A 3GRPA 2AT1A 2YWXA 3LJKA 5TX7A 3G13A 4YAIA 1XYYA 3A6LA 4N0PA 2OHIA 4B17A 4BFUA 3OEHA 5EVJA 5TQ2A 2OLKA 2ZXFA 4DHWA 3EPLA 2ZIEA 2BBTA 5JDCA 2DUNA 1PUIA 3PRKE 1E63A 4NK5A 4O29A 2WD8A 3SZMA 1L1EA 4OHKA 2WUEA 3EQ7A 3Q98A 1P3JA 1U1DA 1UBSB 3FTNA 4IUDS 5IM5A 3KEGA 2BDEA 1LU9A 3JASA 1XVUA 3ILVA 2YZ2A 4HUQB 4EEZA 1N9GA 2WAOA 1J39A 5DYIA 3IP7A 1PR3A 4Y7CA 2WW8A 3OE7D 4MZDA 3GUYA 3SC3A 1EDZA 4UCWA 4BNWA 5HCUA 1HX7A 1EEHA 3KB2A 2Q7OE 4DLPA 2NO4A 1IYZA 2BR4A 1MX3A 4O4LB 1P5HA 2YFYA 5BSMA 1PR5A 4M1QA 1A8HA 3VR4D 4DZTA 5JCJD 4WW0A 1PSZA 3H11A 2FPOA 3DMHA 1FVOA 3O74A 5DHSA 4B5LA 1J8YF 4OO3A 2ARKA 3E1KA 5FNVF 3G0OA 1R5OA 3TXAA 4JROA 4KITB 3D6HA 4Y67A 3FFXA 1QM5A 3IQZA 2QRJA 3H8SA 4FILA 3C5HA 4TWRA 3ETDA 4F91B 3GXBA 5KNBD 3K15A 5CYPA 1IXKA 1U5BA 5AKLA 6REQA 1UP7A 5FO1A 2GPAA 1GGKA 1N57A 2AFHE 2Z3ZA 2GM5A 2DPHA 5K8IA 4AJJA 2O1SA 2QKYA 3QGMA 1PJAA 4OHZA 3STXA 4HH3C 1MC8A 3JZAA 1E1MA 3DWGA 3E7XA 4FSHA 1V9CA 1ZUWA 3IYLW 2VCYA 2VNSA 3A3PA 3I1FA 4CMCA 4HBZA 4MCAA 5TMPA 4N54A 2VDMB 2FQYA 1ZEMA 1EK6A 5EP4A 2IYTA 4MI3A 1Y34E 1T5HX 1CZKA 2PZEA 4QRHA 2MSDB 3FLEA 1X3LA 2EWVA 1VKZA 2XF2A 1K6IA 3IPXA 4N8DA 5HQTA 3ZJVA 2ES4A 3G2QA 1LBEA 4PPNA 1QOPB 1SKAA 2J09A 3O7WA 1OD6A 4NMWA 4JOBA 2R6HA 3UA4A 2PXHA 3GI1A 1UBLS 3KQVA 4FOOA 5GONB 1SC9A 2A33A 1MRNA 4GLLA 1XHLA 4W1PA 3G5LA 3TLJA 4DJFC 4PLGA 1KF0A 4R3UC 1G38A 1U7UA 4HWRA 4R7TA 4RQAA 4ZO7A 4G01B 3T5AA 4JXJA 2A0XA 3LZ6A 4P81A 2X6TA 2O2JA 5EWJA 4QBGB 2GRUA 4LWQA 3RT7A 2ZRNA 3AM5A 2QVYX 1AUVA 1PL8A 3QWFA 4CM8A 4DLTA 1T8TA 1ZSVA 3WNVA 2B3DA 4RNDB 2YH2A 3HXLA 2BZ1A 2WAMA 3FPSA 1TVMA 5KQPA 2R7KA 5B1HA 5FCDA 5THQA 3FDIA 1C80A 4Q21A 1GTG1 2P5YA 1XEWX 1Z6PA 4HB2A 4Q9AA 5KNDH 2IP1A 5IU6A 5CX1B 2XJ4A 1U0OC 2HJSA 1X87A 4I9FA 3WYCA 4OXIA 3EDCA 5EN4A 2JEYA 4PZUA 4QOHA 4B74A 2DH5A 4ARSA 5IX8A 2NO0A 5F3RA 1NNSA 2Y05A 1R5BA 3I8XA 2R6CA 1ORHA 3BXZA 2R00C 1CUDA 2YDYA 4BFSA 2O20A 1WCXA 3CF2A 3PKZA 4MMYB 4B35A 4N7MA 5KUTA 5LQCA 1WLSA 4JGGA 1HTWA 2BHSA 3QNMA 3QUBA 3CONA 5ALPA 3THWA 3UOWA 5IUJC 4EGQA 2QSUA 3BULA 5EIOA 3U3JA 4Q1EA 1HEUA 3UTDA 1NIPA 2RGDA 3L8MA 4MUGA 4NJEA 1RAAA 4U3JA 4WFKA 2HJGA 1V1MA 5AKEA 1IOZA 4ZQCB 3ITDA 3F90A 3ZH2A 5DW0A 2O7VA 1SPXA 3BFKA 3I3SR 3LQFA 2Z95A 4D9JA 5DCLA 1N5LA 4HOYA 2WZBA 3WYAA 5E7IA 4EHFA 4TUYB 5M34A 2SKDA 2OHXA 2FLWA 1I30A 5AWFC 1VSBA 4OHUA 3T5BA 2Y4OA 2Z2YA 3CJRA 4PZLA 5CLJA 1VFNA 3RJMA 1TD9A 4YJ3F 3S1AB 1T29A 2AD1A 2OBNA 1EHIA 3BZUA 3D5TA 5C4MA 4RFSA 4OIMA 4MUMA 3A3NA 2BKVA 4PHGA 3C7TA 3K2BA 4YK7A 4JJ8A 5AJVB 4JC4A 5KYKA 5B6JA 2QBYB 3OU6A 2XKBA 3HB9A 1HKUA 5E1DA 4G41A 3AOGA 5DX8A 2Q5FA 3GD5A 4D4HA 1PNQA 2J46A 3HNPA 3RQIA 3PFKA 3SKVA 3U4GA 1SK8A 3N58A 3OHMA 3AFMA 4X6YA 3K5WA 2F43A 2XPCA 3KVYA 4PYMA 2Q62A 2BH2A 1QGED 1DUSA 4IINA 3DAPA 1OAAA 3WLQA 1OWOA 2XB8A 2IU0A 2P62A 5IKOA 2VF2A 4NCKA 4Y98A 3WHKA 5D6NA 3EN0A 3CA8A 1LJLA 5TPWB 2F3QA 5JV5A 2GLXA 4U0KA 4AS3A 1N5JA 4UM9B 2H1FA 1Z7YA 4MAMA 1LDNA 3QLVC 1YZ3A 3VTZA 1XCOA 5LD2C 1TJYA 4MTLA 2A4MA 1R8YA 4F45A 5LCXA 2IH4A 2OPHA 5CAEB 3EVNA 3NDPA 2ZB8A 1UC8A 3OPYB 4FD2A 2JH9A 4ZPXA 1CZHA 1Y8CA 2HCJB 5GM2A 3GJQA 1K98A 3WDLA 3NBFA 1PWHA 4EI9A 3AZOA 4UBJA 5BR1A 4BCDA 1TVEA 1K1EA 3OTOB 2ZEJA 5FWDA 2CLKB 3DVRX 3C6XA 3TIIA 1J8MF 1G7SA 2BM9A 2R66A 1RWQA 5M3BA 3ACBA 1NJ6A 2XB4A 3ICOA 1QMGA 4IIJB 2WNIA 3O75A 1IVYA 1N2SA 2XNCA 1QLHA 1DIGA 4IGKA 3NMUF 3E7DA 4Y7DA 4W7IA 1WBDA 3ZWPA 3OQ1A 1S2LA 4MGHA 4QJBA 2W6OA 1ESCA 1MX9A 1V6CA 2CJXA 1XZMA 2ODEA 1L7AA 2OGZA 2VVTA 3FUUA 4M8IA 4OUKX 2J4CA 1WCWA 1ZM3A 4RVGA 4AJHA 3USCS 2ACEA 4FE4A 2B82A 4XDHA 2O0HA 3JARB 3ME5A 1EVZA 2VTEA 4BKUA 1C7ZA 4Q7KA 4BY9E 4E5VA 4QOGA 2FN4A 2MINA 1K27A 2JB9A 3UHAA 1Q0UA 4MRNA 4UMVA 3TZEA 4QNNA 2X3UA 1B6TA 1QIMA 2C2GA 2O8NA 1Z7BA 3LLMA 4QYXA 4WECA 1L4NA 3ETGA 1HPLA 1ZGCA 2NUTB 4ITUA 1XA3A 4UU1A 4X97A 3K4PA 2TS1A 1Z0UA 3D3NA 5TF0A 3TW4A 1MC1A 5LA6B 3R7AA 3CTMA 4A6EA 2GJ8A 2JFFA 2PU7A 4IZ6A 3G68A 1IVSA 1N2HA 3BWMA 1OXSC 2BH9A 1UC5B 3B78A 2QTFA 4QGFA 4RJ2A 1TF7A 3UWSA 5JU6A 4REQA 1KDRA 3Q41A 3QVOA 2GA8A 3AKZA 2CL0X 2H5JA 4LZOA 4EG3A 1KRWA 3T0IA 5CLQA 3GPBA 3CKYA 1X1RA 2VHZA 1M3SA 1Z2AA 1C1XA 3H2GA 3FLMA 4F2HA 5ADWA 4Z9YA 4A82A 4NH4A 1QYWA 2WLTA 3K2IA 3H5RA 4MX8A 3CNHA 4OQLA 5L8VA 1NYRA 2E87A 2H85A 1YMUA 3NO4A 3ROKA 3VPXA 4DZZA 1IZYA 2Z6AA 4B8YA 2OD9A 4FHCA 4L72A 4CCYB 3IILA 1PWYE 4KV7A 3RV3A 3LOPA 4KN8A 2XCTB 2WB2A 1JJFA 1WB6A 3MPOA 3QWBA 5CA1B 3HEAA 2COKA 1L7DA 4G0NA 3P0HA 2GEUA 5KYTA 1H1LA 2IYFA 1BE6A 1P9LA 2H0AA 1YU6A 3IR5A 4GQIA 3C8HA 2ZJ1A 3OTGA 4PAQA 2CUNA 3P5SA 4INZA 1UJNA 1EIZA 1MZVA 1DOAA 1VBNA 3WMWA 4BGIA 5DK4A 1YZHA 4FNMA 3ESCA 4BMPB 3DFIA 2JZNA 4D44A 1O9GA 4LOKA 1C0PA 1LPNA 1YFZA 5AI4A 3MJFA 2UZ4A 2BGMA 1WUHS 3KIPA 3LBIA 3CHYA 2V98A 3ORFA 3UGKA 3QOFA 4K40A 4A8TA 5JPCA 2H1OA 2CHUA 2YINC 2WIBA 1F6DA 5CTAA 3OCWA 5DMHA 3DDUA 5DSZA 5FUVA 3ZJ5A 3NTUA 5TMEA 1NVEA 1SU7A 3A4TA 4I1UA 2AUMA 4LAFA 1ISIA 1NI4B 2EJCA 4J6FA 4EHLA 5BMVA 3FOFC 1O1YA 2HSEA 4R9VA 2JLVA 1LTQA 1G8MA 3EA4A 2G9NA 3GL9A 3R4CA 2PKQO 3EXFB 3MAAC 3R0XA 5JSZA 2P2SA 2ZTUA 1B43A 2WEKA 4YMIA 2BFAA 4LG1A 2F9FA 3C3CA 3RS9A 4XIJA 4Y9RA 4G1EB 1JLMA 1DKPA 1WVMA 4YBRA 1JPNA 3EBLA 4QM6A 4BO5A 2SCUB 3E1SA 3KSMA 4M22A 4CKYA 2B69A 2QRHA 2HDOA 3EASA 1RAEA 3FPEA 2VZ9A 3OY2A 4CRWB 1TVKB 3GBSA 4FT2A 5IEJA 2RGNC