3KAPA

Flavodoxin from desulfovibrio desulfuricans atcc 27774 (oxidized form)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADGYDAVLMGCSAWGMEDLELQDDFAPLFDEMENMGLKGKKLAAFASGDMEYEHYCGAVPAIEEKARGLGAEVICEGLKIEGDASSDPDAVSAFAEDVLKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Flavodoxin
publication title Crystal structure of flavodoxin from Desulfovibrio desulfuricans ATCC 27774 in two oxidation states
pubmed rcsb
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kapA00
3NHWA 1JA0A 2X2OA 4YAUA 3NHKA 1AKWA 3OX2A 3NHJA 1AKUA 4U7FA 1AMOA 4LA4A 3W78A 2Q62A 5ULLA 4GI5A 3GAMA 2MT9A 4U7GA 1AKTA 2HNBA 3OWXA 4FGKA 5LJLA 2QMYA 3EYWA 2MOKA 1JA1A 4QOIA 5A4KA 1RLIA 1XYVA 3F2VA 1GG5A 4QOGA 1QR2A 2FLVA 3O73A 4FGJA 3OJXA 3B6JA 3FW1A 4YQEA 1YKGA 4DILA 5EAIA 4XDHA 3B6MA 2Z9DA 1KBQA 3TZBA 1J9GA 1SQSA 4DIKA 4HS4A 2FZVA 2V5VA 1WSBA 2D5IA 1FUEA 4PU0A 3ES9A 4QOJA 2A5LA 3KAPA 3FJOA 2X2PA 5LBTA 3F6RA 4N9QA 2Z9CA 2OHHA 3F6SA 3ESZA 3NHFA 3ESXA 3W79A 3U7IA 4LTDA 4YAFA 4NULA 4F8YA 1TLLA 3B6KA 2BZSA 3LT5A 4QOFA 3L9XA 1X77A 1CZLA 1AKRA 3TEMA 3N3BC 1I1OA 1C7EA 4FGLA 6NULA 3N39C 4FX2A 1ZWLA 4R81A 2ARKA 1RLJA 5B3LA 4BMPB 3D7NA 1XI2A 3NHPA 4U7HA 5EA2A 1D03A 4ZVNA 3UXHA 1RTTA 2BMVA 3S2YA 3NHLA 5BUCA 3G5MA 1FX1A 2HNAA 3QE2A 3FX2A 1BVYF 3W7AA 3EDOA 3K1YA 1QHEA 2FCRA 4ZVMA 1XT6A 4ICIA 5F4BA 4YALA 4ZVKA 1DX9A 5JROA 2QWXA 4D02A 4LTNA 1OFVA 1RCFA 1SG0A 4HEQA 4Y7CA 3OX1A 3K20A 5LJIA 2OHIA 4GR9A 2BN4A 3P0RA 4QODA 4YAOA 2FVXA 1OBVA 3HLYA 4ESEA 2Z98A 2FZ5A 2F1OA 3HA2A 1V4BA 1F4PA 5NULA 1AKVA 1YCGA 3NLLA 2RG1A 3U7RA 1J9EA 1YCFA 2M6RA 4XDGA 3OVMA 3O2NA 3GFQA 2QMZA 3NHRA 4H6PA 2B3DA 1XYYA 1CZRA 3W77A 1J9ZA 2KLBA 2XOEA 4Y9UA 2HPVA 1YRHA 3RPEA 2AMJA 1AHNA 1J8QA 1FLVA 3FNIA 1T5BA 5LVAA 1QRDA 1FLAA 4C0WA 3KEGA 3NHYA 2FDXA 3GFRA 1TIKA 5FA6A 1AZLA 2OHJA 1NNI1 4M0CA 4QOEA 1FLNA 1FTGA 4CETA 4J8PA 3ESYA 3N3AC 1H66A 1CZUA 3L9WA 3FVWA 2N1MA 2OYSA 1CZKA 3B6IA 4H2DA 1AKQA 5FX2A 2QR2A 4C0XA 4CF6A 2ZKIA 2FOXA 5F51A 3QFCA 2MWMA 1CZOA 1YOBA 1B1CA 1VMEA 1FLDA 1C7FA 1E5DA 1CZHA 2KQUA 2WC1A 4PTZA 2BPOA 5LBUA 3TE7A 1YDGA 3NHUA 4N65A 4Y9RA 5B3KA 2V5UA 2FX2A 3OX3A 1DXOA 5LMCA 3UXEA 4DY4A 5EMNA 2V9CA 1DXQA 1OBOA 3ZHOA 3HR4A 3JSXA 3LCMA 2M6SA 2Q9UA 1BU5A 2Z9BA 4LAFA 4ZVLA 2XODA 4C14A 3SVLA 4N82A 5TGZA 4BMOB 2FAXA 2BF4A 4C76A 1FVXA 2R97A 3NFRA 3NHSA 1T0IA 1D04A 1D4AA 1QBGA 1YCHA 4LTMA 2QX4A 4S24A 2R96A 3GFSA 4QOHA 5F12A 3KAQA 1H69A 3OJWA 2QX6A 1ZWKA 2GSWA 1KBOA 2QX9A 3F90A 2MTBA 1ZX1A 4NLLA 4YAWA 1CZNA 3QFRA 4PTYA 5FUQA 3R6WA 1AG9A 2QX8A 5LLDA 5NLLA 2W5UA 3OWHA 3KLBA 4GQIA 4OXXA 1WSWA
chains in the Genus database with same CATH superfamily
5LYJF 3LGSA 4EIWA 4EKDA 3IUBA 1FMFA 1AKWA 4LNHA 4ZALA 4FDUA 3JQ7B 5K8VA 2VNHA 2H2FA 3D4OA 1N9KA 1NWCA 1J8MF 1TAHA 4J1TA 2HSWA 4NP6A 5E1DA 1WDKA 5DM60 2EKLA 5E4JA 2HQBA 2QYOA 4G5HA 4LGVA 3U3OA 1CNEA 4XQ9A 3IAAA 1KVUA 4FEYA 1BRMA 4GX1A 1MVNA 1JFRA 1YR8A 4TV9B 3RT9A 3FYDA 1SU7A 3FPEA 3NAZA 5C8YA 5KYTA 3UBMA 2IP2A 4A23A 4QYIA 1J0BA 2PRJA 2V7BA 3HYLA 2B4AA 4RFSB 1IAQA 1Y1LA 3WKBA 3LUHA 4R2MA 2NO4A 3EVDA 4IO1A 2PLWA 3MJRA 2XF2A 4LDAA 3SVZA 4WNAB 1JHRA 5DTRA 4BLOA 1B8PA 3OWXA 5EPOA 5LJLA 3OLYA 2XMSA 3NU1A 4R1TA 5JYEA 3EYWA 5CG1A 1XVVA 1G0NA 3RE1A 1QZUA 2X3UA 3FOBA 3GZJA 3HKBA 2AHRA 2BC9A 4FVTA 4RCYA 3ZW9A 4UPEA 3PQ3A 1E5VA 1HTWA 1IEQA 1GFZA 1KYZA 5JSKA 3UK6A 4N0QA 3CLSC 4LHYA 2BGUA 1IEXA 3WC4A 3WLHA 5AMXA 2HA2A 1U28C 1XYVA 2H2HA 2R00C 2XEXA 3L4BA 4KQFA 4PM4A 1G4HA 1ZXXA 4QXOA 4Y6SA 2D1TA 1UBHS 3A2LA 3V46A 1WJGA 1KJ8A 2FHSA 1MAUA 2Y1DA 2GPBA 2WRZA 2WV7A 3EGOA 5SICE 2JGMA 2TMYA 3LRTA 3VZQA 4BV2A 4E7OA 4GSLA 1WPXA 3KEOA 1TT7A 3A10A 3E23A 3F98A 1XZJA 1BOOA 1ZCBA 1VKRA 3DNPA 2XUFA 3GBVA 1E2MA 5ESXA 4X0EA 4NAUA 1EFVB 4HEHA 5GIOE 3QX8A 4MCIA 1KH2A 5CBKA 3L7BA 1SVIA 2QAIA 4B2IA 3E0QA 3IJ5A 3FD8A 3TZBA 3N2IA 5JJLA 3OX4A 2IS4A 4ZEOA 2PG3A 1LJLA 3FLAA 1RLUA 3UZUA 1IJEA 1BDJA 4B3FX 2B3TA 3BGIA 1YIDA 2I67A 2K4MA 3MWJA 4QNRA 2YXEA 4XE5A 2CDCA 2D5LA 4IFTA 4M54A 4MS3A 4G4SP 4JKYA 3CW9A 4M8SA 2BIFA 3ZGVA 4DDKA 3F9CA 4G1MB 2CJWB 4CEIA 4MV4A 4E08A 2JJYA 1W46A 2MSEB 5AVXA 1MZVA 4U8HA 3QVWA 3VV3A 3THWA 1ZINA 3JD2A 3L8GA 4NF2A 4YJ3A 3U9TA 2DLNA 2EJCA 3V3TA 2LW7A 1LLCA 3B60A 4IJWA 2R7KA 5EGSA 1I7NA 3SJCA 1LDGA 4IIJA 4D9GA 4BY9E 3U3XA 2PEYA 1J5PA 3ICOA 4UZEA 1GWNA 1E5TA 2XGSA 3IQHX 4FZJA 5LZ7A 4QO7A 4TV8B 3F6SA 3HKCB 5FORA 5ICFA 1MO4A 3TSZA 1M75A 5JADA 3LC7O 4ETIA 1X8XA 4DLNA 4DMHA 4DUPA 5J4VA 1SB9A 2BHRA 3O95A 3RO7A 4MLZA 3D3JA 5AKEA 4PGGA 2BONA 2NVWA 3N07A 3QVMA 1WMSA 1KZ7B 4LXUA 3LFUA 2AOUA 1M1XB 2WP8J 2WZDA 1P18A 3E7XA 2EFCB 2OV8A 5CM8B 2AIRA 2IXEA 5FTJA 1J23A 5C7OO 4WBSA 2HTEA 3B1WA 1BTOA 2Q2VA 2Q45A 4XEHA 3DMFA 1EK6A 2XGGA 1W5TA 4E6PA 4JX8A 3SS7X 2AI3A 1E79A 3F3KA 1L4BA 4IILA 2XJ9A 4R3NA 3K32A 4WDQA 4GC5A 5EJAA 1JLKA 5BQXA 1UC4B 5DBFA 1ENOA 4MX8A 1P5HA 5AKLA 4M36A 3ZK7A 4RQAA 2AZ4A 2W4MA 2ZT5A 3O4JA 1GL9B 1CDDA 2O2SA 4P36A 2X40A 4KRYA 1SXJA 3RVRA 2W2XA 1BAPA 4EFMA 3F96A 2ZIAA 2P2YA 1MAHA 2QAGA 3IYLW 3G9UA 4IFIA 3C5EA 4DA9A 1GYRA 1R18A 1I10A 2JLBA 4XSHA 4CCWA 1PJSA 4QBKA 3NDJA 3V7YA 3G3EA 4G36A 4Z9AA 5G40A 4N76A 4UFPA 5IAEA 4PN7A 1LBSA 4YMGA 1CRPA 4Q9IA 5C8YB 3F74A 4K9OA 4LOHA 2WDPA 3I4FA 4QYIB 4RLSA 5GZ1A 1Q0PA 1E92A 1XJ5A 1QGED 1TVCA 3QLEA 2BUBA 2F62A 2O0KA 4PZCA 5A04A 1QYWA 5JS7A 1F2DA 1CUHA 2DKFA 4NBKA 1THGA 3RGGA 3YASA 3MHTA 1GPUA 1AK2A 1M7GA 2I7TA 1DWOA 2FQQA 3WDMA 4HB0A 4B1FA 4Q3EA 2AJTA 1EWRA 4ITUA 3RVPA 3HKBB 2GF2A 3O0DA 3EHDA 1VKOA 2BSQA 4KVGA 3R3WA 5AT1A 5IDVA 3PPIA 3U4GA 4RQBA 4JI3B 4QQ8A 3A6KA 4EW2A 1PL6A 3L7MA 1PZHA 3GARA 4II2A 4DTCA 3ZKWA 4EY5A 2ETXA 3M83A 1XMIA 3D4LA 3E58A 4QVKA 2XPCA 2JAQA 5F4BA 4PPGA 1UZLA 2BDUA 3REQA 1ZJYA 4EBFA 3IT2A 4FLFA 1WZCA 3QVTA 5LZ8A 1GR0A 1OI4A 1T5LA 1UANA 2J6IA 2JKYA 5YASA 4L4UA 3ZVRA 1NVVQ 1YHZA 3JR3A 3L0YA 3WIOA 4CM6A 2JHPA 4RWEA 1YH3A 4OA8A 5CCDA 4EF4A 2J4DA 1K2VN 4XD7A 4M87A 3ABZA 2PXAA 5G1OA 3VISA 1ZNQO 2B99A 4F06A 1JILA 5LP6C 4C9BA 3DYBA 2GRAA 1NIPA 1WY5A 4HUQA 4EO7A 1OU4A 1A7AA 4DUGD 5CNKA 2ILVA 5BW4A 4LJAA 3MCWA 5H59A 5KQSA 4HH3C 4MUFA 1XQ6A 2GASA 3JQFA 4YGYA 4Z2YA 4LRTB 1G64A 4AS3A 4L72A 4RHCA 3RVLA 4C2UA 2JKZA 4WH0A 2A9KA 4MV1A 2CCKA 3RS3A 2X9LA 4MS3B 2PBFA 3QWHA 1OYVA 4IRXA 5ALDA 1KS2A 3TLKA 5HKKD 4TS4A 1JQKA 5ES3A 1Z34A 2C4NA 3H2IA 3KHKA 4OVKA 1U4OA 2B1QA 1TEXA 4CEIB 2EBUA 1YCGA 5JATA 4Q0MA 3HBLA 2REOA 2ZTHA 3CNOA 4IV5A 4Y9SA 1VM6A 5FOWA 4D96A 1JEDA 2VTBA 3THWB 2XI4A 3AM3A 3C6YA 2YYYA 1TM1E 1Z35A 2ZAOA 2ZT6A 4YJ3B 1XBTA 3FNQA 1ZCJA 5A0FA 4IIJB 2GWRA 4XIIA 3QX3A 3GFQA 1ICIA 2BR3A 2IPAB 3KWFA 3TNFA 1VCNA 1I3KA 3A32A 1OWOA 2IYFA 3EIQA 4G09A 5CT4A 2W2OA 4AB1A 4ZZ1A 4UHKA 4KKXB 2F1IA 2V0GA 3CO0S 1LF0A 1PR1A 5JSQA 1BH2A 2WSMA 4XXHA 5BNWA 5L4SA 4GPAA 3DEAA 1RRPA 1Y1QA 3KBBA 5FQOA 3OI7A 1EAMA 3AOEC 1XTUA 2HMAA 1IZZA 3TUZC 2C3OA 2A7QA 1FYXA 3QU4A 2AB0A 4F85A 1CR4A 2PS9A 1L7VC 1VYTA 4TV9F 3LUKA 3CF4A 2RGDA 3LOQA 2EG9A 2AOUB 3GLHA 3IUSA 3KLOA 3QLUC 2WJWA 4JEIA 1UBTS 2AYXA 4BFCA 5EINA 2BMDA 1P9WA 3MJFA 5GINE 2FWBA 3KWLA 4RIFA 4RTSA 2FH5B 2YC4C 4MW1A 2ZTSA 3ADBA 2B94A 2FSVA 4UUAA 3MQFA 1R16A 4QSMA 1Z15A 3T1OA 1VLLA 1DP4A 4GKAA 5FB3A 3KKMA 4LN1A 2O0JA 4RVCA 2AQIA 4G5QA 3A1NA 5FBKA 2CKDA 4HH1A 1Y3AA 2EWWA 4QUJA 4HJXA 1ZHHA 3SOZA 3NHYA 4WGGA 3LKDA 2G7ZA 1P73A 4N0MA 1OAOC 1SXJB 2EGHA 1UP7A 3LK6A 4JZYA 4L9WA 1QK3A 2C2YA 2OG2A 2ZJ2A 1FBNA 1USGA 2QAGB 1CR2A 1T4BA 3LI2A 4LOLA 2PE5A 2AN5A 3VUFA 2FUNB 2DX7A 1S7CA 1A97A 2G63A 2PAFA 3IAFA 1H66A 3OIVA 5CDSA 1I6WA 1OXKB 1PSWA 1LQ2A 4RACA 3RK1A 4A1OA 1ULAA 3PHBE 2BF7A 3MF4A 2H1OA 2HWKA 4V3CA 3TJRA 3WLPA 3VU9A 3W2IA 3T3EA 3NAMA 1YAJA 1P2UA 3L41A 2X3FA 1IXYA 1P5ZB 3HZZA 1NONA 1YA8A 1Z6YA 2VF7A 1T8UA 2Q7XA 2NV6A 3PR3A 1GKLA 1WZNA 2IYOA 3B2NA 2UDPA 2GD2A 1GUDA 2HF7A 4NTZA 4C07A 3BQNB 2OBBA 1UBRS 2P9ZA 4OB6A 1JHVA 2CNBA 4OQEA 3WGKA 5EC8A 3DMPA 5M7EA 3AVWA 1T1JA 2XB6A 2IYPA 1P5JA 3ICWA 4YC7A 3SXPA 1DEHA 1E6CA 5IYZA 3UENA 2QN6A 5J4KA 2JLSA 4F5WA 4RF5A 1DLIA 1P4AA 4NARA 4WLVA 3ZKWB 2IXBA 1Y80A 1IM5A 1DRUA 1OKKA 2NVOA 3MCVA 4PWZA 5B58T 3RUEA 4BWVA 3HGTA 2OTCA 2XVXA 4KRGA 2ZXUA 2QTWB 1C7FA 4LECA 4G0UA 3WFJA 2ECQA 2HBQA 3REQB 2WC1A 4LF7B 2J3KA 3EVAA 2C95A 2Q9AA 3VHQA 3H0EA 2IXAA 2ZWIA 2BPOA 4LJ5A 2HLDA 4YCDA 4H1UA 2CFSA 1DFHA 3B53X 5LYYA 5H7XA 4KPFC 3OCVA 2V7GA 4OL0A 4UE3S 3HCNA 621PA 1R2QA 1S8OA 2CF5A 4TV8F 3BMXA 1H5QA 3OQ6A 4OXRA 2DKOA 3N2GA 4IY1A 1YZVA 5DNWA 2HRBA 4A0QA 3EZXA 1XZEA 4NCHA 3PTAA 4HUQB 3UV3A 3ZZMA 4Z6KA 1NNSA 5EPEA 5HMLA 4M53A 3OQJA 4FSHA 2BEVA 2H11A 2V7QD 1HNWB 3HQ4O 2F9FA 1A2BA 2FR0A 2EFEB 5DASA 1KJ9A 4MW6A 2BI8A 4H6WA 3UJ3X 1NLFA 3BTSA 1BXZA 2H5IA 3EWSA 4I3GA 4TMYA 4DIFA 2BR5A 5LD2B 2EC5A 5DBIA 2W2LA 1YZYA 1UCFA 4GAEA 1Z62A 2F3SA 2OB2A 2VDKB 2XD9A 2VYFA 4TYPA 3M9XA 3INNA 3MLBA 2XX3A 3HVHA 2OLKA 4IDQA 5IABA 1ZQ1A 1K7XB 3OCJA 3ZGYA 1FA9A 4B4VA 1B8OA 2QMHA 3GGGA 2PQMA 3IP3A 4OKSA 4RY9A 3GLGA 2VTBB 2D1RA 2VCYA 2F90A 3V9PA 2XCLA 3EOZA 3PFWO 1USUA 2E6KA 1KMIY 3S8YA 1VMIA 5FL7D 1YMQA 2O0MA 2B7CA 1Z8NA 4HMQA 1Z16A 1PCXA 5CDTA 3A4LA 4OQXA 3WL8A 4BNKA 1NQOA 1OXUA 2ESRA 1KKUA 1U0EA 3WGTA 1P0CA 4JI8B 3LUFA 1WBDA 4Z4CA 2ZB2A 2BGNA 1NVBA 4I14A 1WCIA 2BLNA 2KHZA 3KKEA 3OU6A 1AM4D 4KXMA 4B7UA 1NXWA 4EJSC 2Y9PB 1ODCA 1C2YA 3I9KA 1Z2PX 1XAHA 5BR7A 4IS3A 3KJNA 4L2IA 1U2GC 2CLDX 3PR1A 1W6UA 2RJOA 2VRCD 4TPKA 5BN4A 4FOSA 3NALA 3ZDFA 4RHEA 5C8YF 4ZPJA 1RWMA 3Q6NA 1PS9A 1P4GA 4NMLA 3GLHB 3TD9A 4BO1A 5KZMB 2ZW9A 3OIFA 1KGDA 3JQ9C 1O9BA 1TUBA 5U1PA 3NWEA 5EXSA 4L3OA 3L93A 1N3YA 2PMFA 3D4BA 1LNZA 5DZSA 3OJWA 1UC8A 1Z6PA 2X8BA 2IELA 1KDOA 2AG8A 1DAHA 2GXQA 4B8ZA 1VHQA 2GZ3A 1VJDA 1ZW1A 3IDZA 4UATA 5EJGA 4F1KA 4UEKA 3Q98A 3S2FA 5JCOC 1ZK3A 1PYDA 1WABA 4P92A 1NJ6A 3B8EA 1RBMA 1BKYA 1OLSA 2Q6IA 3HBNA 1V47A 3M33A 4JUDX 4WWHA 2CVQA 3DOIA 4ACBA 1Q83A 5K8UA 3TIIA 4P38A 2YXLA 3WGLA 4H3HB 2NG1A 4DBLC 1WO8A 2QE6A 2RKBA 3I9FA 5G2OA 3U26A 2IYSA 4MI3A 1JMVA 3WNDA 1VQ1A 3RADC 1KFKB 4CMGA 1UMBA 4EK9A 1U6IA 2ZUDA 3DMDA 3H1BA 5HK8A 4M7OA 1LS6A 4TOIA 3JTMA 4ND7A 1C8LA 4X84A 3AVUA 3R23A 3RUCA 3VU9B 2WYWA 4WLUA 3CX3A 2LPMA 5AJHA 3A1EA 2Z6UA 2WG0A 2XMQA 3HXLA 1ZUD1 4K6OA 3ZDYB 1LVHA 4BKQA 1TJPB 2D0OB 2JJ1A 1P17A 4E5UA 3UK7A 5FTLA 5KU1A 1CHNA 5CXUA 1WRBA 1X86B 2H57A 1Z37A 2XE8A 3EG9A 3OX2A 4EPYA 1P60A 3OLCX 4NHEA 1K6MA 3AKEA 2J3EA 1JDTA 3FMVA 4MUEA 1E1NA 1EXVA 4H27A 4RTRA 4TT8A 1NBOA 2VATA 1NBIA 2AXEA 1LH0A 2AS0A 2DSNA 2V45A 1BFKA 2ZE6A 3CSSA 3NPMA 5DYYA 5A6SA 4V0LA 3EW9A 3C8HA 3KE9A 4J0KA 4OHWA 4R1LA 3VPBA 5IUNC 2J3MA 1J42A 2GPYA 5IYZB 5GJBA 1J5XA 5KB3A 2CV2A 4FCVA 4LGCA 1YDWA 1B8NA 1LVUA 1Z12A 4N5MA 2ERYA 2W2TA 4RAOA 4UDOA 3GG2A 4YJ3F 3VOAA 1GNVA 4H18A 2XOXA 4IIJF 5ARCA 3CZ9A 4GGPA 4F93B 1K7CA 4LHEA 1ZK4A 1FUIA 2RHWA 1EAYA 3HY4A 4CKWA 4EOGA 3K72B 4WLOA 1NULA 1JR3A 1GNLA 5IBPA 1IH8A 1X1RA 3ZXIA 3LWZA 4UZSA 3N05A 2Z3ZA 4RH1A 5TR9A 3THXA 3N2GB 4PZZA 3P0HA 1PJRA 4IGKA 3Q87B 3SKXA 2HXYA 2ZYTX 4DCTA 2E4XA 1DJNA 1YS4A 2I71A 3T7EA 3VKGA 4PS1A 4ARCA 4JP1A 3MINA 4IH9A 3O73A 4Q3NA 3VH2A 3KRTA 2BEVB 2WKPA 1HM5A 4HDOB 4RF2A 1JDNA 5LFAA 2JLXA 2QAJA 4PSKA 4N7JA 1RWPA 1ZC4A 1CJVC 2JHGA 2WTXA 2RHTA 2P0AA 3EGCA 3ZI4A 2D00A 2OM6A 3C45A 5ERGB 3T5AA 1N4DA 1KFCB 1M2GA 2GZSA 3WZMA 2OP0A 3PUXA 1UOEA 2HC9A 4GHWA 3I2FA 4HGZA 4U39A 3C70A 1Q1ZA 1XCLA 1W8DA 2CXNA 3JQGA 2F9LA 1C3LA 4DTIA 8GPBA 1PJ8A 1YA4A 5IXYA 2YASA 3UT5B 3GLGB 1E1RD 4RNDB 1LWOA 3UMYA 4WMLA 1PHRA 5EZSA 3K0HA 3STTA 1QU3A 3K15A 3RNLA 1W0JD 8ABPA 5CT9A 4WA7A 1D9ZA 2YIMA 1T3LA 2JEYA 3DZGA 1NVAA 4L22A 2PX2A 4A26A 4B5KA 1JSRA 4FE7A 4A2CA 1IDOA 2H85A 5D86A 4PXAA 3ZCVA 5AUQA 1SUFA 3P5SA 4UDNA 1GDTA 4BVFA 5B7NA 4WNCA 2VAMA 2GN6A 3G9QA 2NUTA 2R8XA 4L2IB 4IMIB 3N6XA 3H9CA 3GEIA 4LK3A 1N75A 1WY7A 3RKRA 1ZJJA 1BMDA 2PV7A 3O9ZA 2K7ZA 5BN4B 2WTMA 4CIXA 5BPHA 1B00A 4INJA 4WKCA 4ACAA 4EVRA 1EUDA 1VOTA 1XZLA 1H22A 1ESMA 1XZBA 1TUBB 2BMEA 1G6KA 3WO1A 4DL9A 1ZJZA 1M8FA 2W6MA 1YK0A 4HAUA 2WABA 4GOJA 4OK3A 2H54A 1NAIA 2HPZA 4OYRA 2GM3A 3CLVA 3PG5A 3QPUA 5HXAA 1V48A 3CZ5A 2WQ6A 4K9KA 5T67A 2OHFA 1N4AA 4AMVA 1XB2A 4O63O 1OB5A 1T3SA 5JMPA 3MS2A 3WJ1A 4HL6A 1Z5WA 1J2EA 1K4YA 3ETEA 2JLCA 1TLLA 1X2EA 4PLZA 3D3KA 3BKWA 3VJRA 4IDEA 3QSGA 3ELDA 1CNFA 5H81A 4HJRA 1XLTA 3KS9A 4QXRA 4A0HA 1Z5UA 5JT1A 2NZVG 4RD4A 4NZPA 2VKQA 2JCYA 4BMSA 5AICA 5JCJD 1XHFA 4CUJA 3ZVNA 1RCUA 1Z0JA 3I01A 4X64B 4EMBA 3LFTA 1OLSB 1Y1RA 4ZZIA 1M74A 4RVHA 1U1EA 1THMA 1WXHA 5BNTA 3VR6D 5JJIA 2DU8A 1PJTA 3QV2A 3IQEA 4MA0A 5ECGC 5IAKA 3U48A 1O3YA 2GZDA 3FSGD 2VJDA 4NNPA 5JD6A 5FPKA 4K6HA 5IUKC 2VDUE 3FE2A 3UXMA 3DMTC 4RJLA 3VAYA 4AXBA 1UMBB 3ASYA 3L0DA 1WPQA 3G5UA 1ISGA 2ZRAA 3MMSA 3W2TA 4AMYA 1PSDA 5DXJA 1C8VB 1ZI9A 1YC5A 3H5VA 3M89A 2JLRA 3U40A 1GJRA 4O4HA 1F8XA 4KW7A 3X1XA 1R6TA 1EVLA 4FX2A 3UOGA 1Y3BE 3CJQA 3Q7IA 4E4YA 2JH8A 4CCAA 1VG0B 1DU4A 2H5JA 2RDMA 2CLOB 1RLJA 3EG9B 3MQ4A 1YR6A 4P8RA 3ZIUA 3L84A 4COOA 3ULKA 1L7EA 5E3IA 1ODLA 1ZGZA 2CXRA 3VR6H 3A31A 1QO0D 3G79A 4E1VA 2G6BA 1RZ3A 3PGJA 1RQ2A 4B6EA 5A02A 3IIEA 1CY2A 1BZYA 3IDOA 2AEFA 1TA0A 5A6SB 2F2TA 4YECA 1J2JA 4L4XA 4BV9A 1Z74A 3WK7A 2FR8A 5GY7A 1W1WA 1WB5A 3FMOB 5KWJA 2O4CA 5EKXA 3G6KA 1B73A 5K0GA 1SRRA 2OXCA 1FVHA 3HV2A 3PX3A 3FOWA 4IUDS 5J4LA 4P4SB 3PCTA 4M76B 1ESCA 3F46A 3LHKA 3RJZA 3O9VA 1ZK0A 4FYHA 3S2GA 1VPDA 3RC8A 3I0NA 2W70A 3UTDA 3THXB 5DYWA 3BMQA 1GTMA 4DV4B 1YQXA 3AC0A 1GU1A 2O2EA 2BZ1A 1YL6A 4LYDA 4XWAA 4CCSA 4DNPA 3V55A 1NI5A 2JFQA 2O0HA 1UDBA 1Z13A 2OG1A 3MINB 5BN3B 3TL3A 2NP6A 2YN0A 2WM8A 4L08A 2H29A 4WBNA 1P61B 4PICA 3AU9A 2OMKA 2HRRA 1TTPB 1Z6AA 4DNOA 1G7SA 4GXRA 3VDNB 4AZ0A 1K89A 1EINA 1SB8A 4IF6A 5JNRA 3DEZA 4CG0A 3ZZNA 3MRTA 5D2CA 1RCFA 1E32A 2QX7A 5E7JA 3X1WA 3KYCA 4TKZA 5H4HA 5EHIA 3JQGB 4DIBA 4JAVC 1A3CA 3D6JA 1Q22A 3H3FA 4ZJUA 1ML4A 3EDMA 5LJIA 1YB7A 5EUCA 3UK2A 3ZGNA 3WSTA 2QTFA 1EXWA 2C4WA 4N8EA 4YAOA 3C6MA 1X1TA 4EMUA 5AKKA 4DZTA 5AW5A 3RUPA 4AKHA 4BAZA 1LPOA 4QVGA 1J0DA 1UKAA 1N8NA 2VBGA 3MQ2A 3WISA 3ZH9B 421PA 1IBMB 1GA4A 3PDIA 2JGLA 3HXPA 3GUYA 2O59A 1N92A 1NBWB 1VJ1A 4LOKA 4ERNA 4RXUA 3GRVA 1D6MA 2CMFA 4IH4A 4J0FA 3KVYA 3FFXA 4TQUS 1R66A 3GDHA 5HUJA 4QT4A 4P7GA 1II8A 1Q7RA 4IZIA 4OIFA 3PENA 1M1UA 2NUTB 2PJDA 2Q6KA 2R6FA 3QYAA 1OFIA 2FI1A 3HC7A 4G2TA 5FBVB 5J1TB 1RMTA 2Q4OA 3MB8A 4KDCA 3LK7A 4ZZ0A 1RP7A 2QT0A 4NZOA 5KVQA 1EUDB 1QX4A 1QOPB 1L5MA 1X7YA 2CBGA 3K9LA 5GONA 1G0OA 2XY4A 5CTAA 3VNVA 4G0OA 2GEUA 4MV0A 3U5TA 1JXAA 4J91A 1KJYA 1PQWA 2FRDA 3OIWA 3ZD7A 4QDTA 2NGRA 4PYJA 2KLHA 3OM1A 3L7AA 4YK7A 1C0KA 1OC2A 1VFNA 3HI6A 1OILA 4M55A 2V98A 4CEJA 4AKSA 1DQZA 1HPLA 2XYGA 4MVJA 1M8GA 4IMRA 2H1LA 5CIWA 2BW0A 2P2CA 4Y1RB 1OXVA 2VO1A 3RT7A 4ZFNA 3PHCA 1N0UA 3VSEA 2RJNA 5FLXA 1FE8A 2P9JA 3I5AA 4G8CA 5IYZF 4Z9BA 1XZNA 3THYA 3N87A 3QVLA 1J07A 4HTFA 2WLSA 4L5IA 4F2WA 1C4XA 1FX0A 2Z8XA 3GCXA 5A4AA 5BQOA 4E2WA 5CDGA 3TZEA 1Z4IA 1G5QA 3K4QA 3UT0A 2H2DA 3RK0A 2JGKA 3PNKA 4Y0NA 1FLVA 1UKZA 1YTLA 4QDOA 4UMEA 1EEHA 2SICE 5HS6A 1SULA 2OAGA 1ENYA 1QRDA 2C4UA 3HY3A 3KZNA 4UHBA 5ICSA 4TYWA 5AW1A 1QGAA 4X6XA 3NONA 3NDRA 5JZSA 3S6JA 3TLMA 2FPIB 4EMTA 1AV6A 2PUVA 1Z22A 2CXTA 4O4HB 4HSEA 3G49A 2ZRIA 1V5WA 3NTLA 3CW2A 2Y3IA 5FUQA 2D5AA 4J3FA 1DRKA 4CM9A 4EX6A 4EX7A 4FMCB 1L4KA 1N9ZA 1NP3A 1DFIA 1FLNA 3GRCA 4JLMA 4BNUA 4J8PA 1JEQB 4HS9A 3W1VA 4KC0A 4PRLA 3VR4D 1DKNA 1Z28A 2B20A 5F1OA 1M5RA 3IMCA 2RGEA 3UHAA 3VOBA 4EG7A 4BVAA 3GD5A 3REFA 1T6NA 5K51A 4ZAVA 2NYAA 3ST7A 4CDMA 5AFSA 2O1WA 1DO2A 3U1TA 3UVEA 3U19A 4I1SA 1QZZA 1G8JA 2D5BA 2H5EA 1TEZA 1XC7A 3GAZA 1EQUA 5BYAA 4XYGA 3GUVA 3FTNA 3B7GA 4QKQA 3DLIA 1P6XA 3PKIA 1W47A 2I6TA 4REQA 4UULA 1B16A 1A88A 1DWPA 1F8FA 1XDWA 2WNSA 2AUTA 1P0MA 5EIFA 5DCYA 2VQFB 1THTA 3L46A 4JI6B 4LZJA 4TSFD 2JARA 3BMQB 1CUIA 4NHOA 1HNZB 4BGDA 1NBMA 3ZW7A 3VR4H 1JSCA 2HR1A 4MJXA 1EK0A 1M2HA 4Z0PA 1OXBB 2MWMA 3E2IA 3DHNA 3NWJA 4W7HA 4F3KA 4A27A 4F4CA 4BPBA 3E9QA 3LC2O 1SQ6A 4WBNB 1FLDA 5C4MA 2I4LA 3ILYA 2AUMA 3C39A 1JDZA 5REQA 4AZ0B 1TC2A 5EHQA 2G07A 1NXTA 1A9XA 4JI0B 2WIJA 3SMQA 5ESRA 4EFNA 1JHXA 1CIVA 2CXOA 2GN0A 1NN1A 1JVSA 1R0ZA 4Y1GA 4J2TA 1E9FA 3Q9UA 1QP8A 5HIIA 3IEMA 1W36C 1F4VA 2VPPA 3HJHA 3KYCB 4YWJA 1FW8A 1RI5A 4B43A 4YQFA 5A4JA 2QG6A 4RTQA 1P3Y1 1CR1A 1G19A 3AQ4A 1R1DA 4QJ3A 4EG1A 2X1MA 3RS4A 4N65A 3SJ7A 5F77A 4CM7A 1ST3A 2FFQA 5CH3A 4E07A 4KTTE 1G9TA 3D8SA 1SCQA 1U8TA 3ZNQA 2O05A 3S2UA 3C8DA 4Q3BA 3M4XA 4IIHA 2WFAA 4MA5A 3ZEAA 1A82A 2I2AA 3PDIB 4M0LA 2RFLA 1U5BA 2QL7A 4P53A 4RSGA 4TS3A 3V1LA 4WXYB 2C3PA 5F98A 5CA0A 2RK3A 2QE7A 1Z73A 4UNRA 1YJQA 3OT1A 4DR2B 1E9EA 5A7FA 1II8B 3RI3A 4TLMB 3MERA 1L7OA 2VR1A 2IUUA 3GLUA 5EJ2A 1V9LA 4KPEC 1HWYA 2IOFK 3P9RA 2Z6VA 1OQAA 2H48A 1RYHA 3ZWQA 3WO0A 3DG9A 3CZCA 4QHTA 1KP3A 5DMXA 2Q49A 5FEMA 2I1LA 3G8CA 1PDOA 3PA8A 1QX3A 2W58A 4I66A 5GONB 2AD5A 1U2ZA 2HOQA 3P0EA 3RQSA 1SBTA 4ODIA 3ITEA 4WKOA 3HEBA 1YRLA 4WY5A 4RZIA 4X66B 2DWOA 4PLYA 2JZOA 2E4AA 1ZAYA 3ILVA 3K70D 3JZFA 4B83A 2HYIC 1C9NA 2YIDA 5HE8A 1OI3A 3PWTA 1GXSA 1S96A 5FT9A 4CI0B 4RA6A 4KSCA 3OQHA 2HB6A 4CEJB 3HUUA 4UDYX 5C31A 2IZ7A 2QRUA 3K1AA 3PQEA 1NXOA 3IE0A 3QG5A 3RU7A 1J24A 4JYPA 5HIAA 1Z4LA 1ZOPA 1P6UA 2OOKA 4W6ZA 2V8BA 1YZFA 2W71A 3E8XA 2FF5A 3GYBA 4HTFB 5EXEA 3TQCA 2B5OA 2GO7A 2QZPA 3H4VA 5COAA 4MWSA 4LK2A 3UH0A 4PR3A 5B36A 1X2BA 1J49A 1FS6A 1OWPA 2EZ9A 5J5VA 1RXWA 4BMVA 1DRWA 2QQ5A 1PVDA 4WOJA 3MWYW 2ZTLA 3DOCA 2WQZA 3R3JA 4M7PA 5AI9A 4PZPA 3RKUA 3TNYA 5JBNA 3NDIA 5IT9A 1ZIPA 1XZPA 5AUNB 3R6LA 2WDZA 2X77A 3ANTA 4RENA 3UFBA 1WW8A 2WKQA 3BJEA 5TIIA 4DS3A 5HJ2A 3TUJC 4BBZA 5K6RA 1F38A 3MC1A 2GPTA 1UAGA 1C0EA 3D0QA 5IG2A 2BHNA 2XYQA 5DLEA 3SFZA 2VP3A 3DTYA 4FYPA 1OBFO 3GMDA 3IP5A 4DHWA 2ZWMA 3ON5A 5FXMA 4YHHB 1SQ5A 1Y5NA 2DQZA 1QGDA 4XDZA 1MJ5A 3D8HA 1QE0A 2EL7A 3CZMA 1M1YA 4N8DA 1PF7E 1PK9A 2NOAA 2W6QA 3BHIA 3MN1A 1FL9A 2QSZA 3CR8A 2K2WA 3FBGA 5KTYA 1U8UA 2HKIA 4RPIA 4WCFC 3ZX5A 4F7WA 4XKJA 2NO5A 4YAKA 3N5CA 3TDMA 4YRGA 3NHJA 3OU7A 2A3NA 2HCTA 5DBGA 4REQB 2YV4A 5B53A 4FHEA 3SQLA 3X3HA 4RMGA 4WBXC 4FOLA 3B2EA 2CUZA 1KQ3A 3I05A 4GMDA 4IJ5A 2D0IA 2ZBEA 4Z0NA 4UM5A 1F14A 2Q41A 2JIQA 2A6PA 4ALJA 3VPHA 4JLDA 1FZQA 4JBHA 2YUIA 3MHPA 3EUAA 3SAJA 5FOQA 3AEUA 4GBED 2OGWA 3K73O 5MFPA 3P97A 2D54A 3H1EA 1HE5A 4RHYA 3H2HA 3VTKA 3NDBB 3CIFA 4ZVUA 5JJBA 1CP3A 5REQB 5A6VA 1I32A 1A9XB 4UUQA 4FONA 4FOOA 2R6CA 4EPVA 4W5JA 4EJ0A 3L8YA 1XPRA 1HDZA 4MV7A 1DMRA 4FOPA 4BNYA 4DCPA 4ND6A 3K9FC 2EBFX 1N2HA 1FB5A 1JG1A 2JCGA 4LC0A 4EYKA 2HY7A 2VPZA 2XBLA 3FDJA 1OI2A 3UGKA 3GLFE 1IXRC 2I4TA 3KR0A 1IZ7A 2O2IA 3TZLA 1Z0FA 3HN2A 5FR2A 3WK9A 2C7PA 4AY6A 3OF2A 4FDTA 2O19A 2PGLA 1XDDA 2Q8NA 2YXPX 4KTVE 3H3JA 5BSTA 3MS4A 4IX1A 2FZLA 3AGQA 1U5BB 1ZJ4A 1RAEA 4NJEA 2PZGA 1V8BA 2QVXX 1ZIOA 4L76A 2HCBA 2YMMA 4H4CA 5T8KC 5CA0B 2PUFA 3AETA 3OT1B 5JHHB 1LPNA 4LJLA 3C5CA 3FF4A 1N3LA 3PLNA 2JFOA 3GGJA 2ZZKA 1J25A 2FW9A 4LZNA 4URHA 2D0PB 2ZUTA 3FFTA 1YGYA 2LIPA 1VDZA 3OOJA 5CRIA 3RW9A 2V0NA 3CCBA 4PX5A 3PJEA 4AJLA 2ZROA 2C5FA 5AI4A 1N2OA 1KK0A 1QYCA 3F71A 4O4HF 5CVJA 4QBGB 2ZJOA 1GCOA 2BEJA 2QN3A 4ABTA 5KEIA 2WJPA 2DPLA 3HB9A 3WICA 4EB8A 5IBCA 5K3DA 3WDKA 3GA5A 5ALZA 1AA6A 2GCIA 1BGWA 1SQFA 2CYAA 1GXSB 2HT6A 2GM9A 2NTVA 3GV0A 4FMCF 3ESDA 4D8TA 3OTOB 1KZ6A 1DDGA 1K7SN 4KXQA 4YCMA 2BFNA 4YPFA 3VX3A 1KEUA 1ZU4A 2BY4A 2J9XB 1JI0A 3K1AB 2ZCVA 4LRWA 3C16C 4QBFA 3BWVA 4TVBA 4D3FA 2DH5A 2PSSA 4FEEA 2XUAA 3LD9A 1KIFA 4WSOA 2YRFA 4BNZA 4RV5A 4BMXA 2OV2A 4U2GA 2KWIA 3BD8A 2Z9CA 3FSRA 4EFKA 3R3YA 2Y4NA 2ASVA 3MCAA 3NH6A 3DTTA 2P35A 2GA8A 3G7SA 3QYPA 4HNGA 3FHLA 4NH4A 1I4OA 2XTAA 2ZR0A 4F9GA 3RG8A 1NIJA 3BDVA 3FMFA 2RAVA 1UXHA 4EHJA 1HYEA 5C34B 5KU7A 2GEVA 2C42A 3PNLA 5E7IA 4CF5A 3V42A 4B6RA 2R2AA 1KAHA 2YZ7A 3KUCA 3WWPA 1ETHA 2XAUA 4BTLA 1T0UA 4BIIA 1B93A 3B5JA 4V38A 4O59O 5IXJA 2VT2A 1JDJA 3L77A 4EPWA 2RBKA 2X58A 2GCPA 1D7OA 5JW6A 3ONEA 3OOYA 3AUSA 3M4ZA 3TCXB 2CHUA 3ETDA 4QQFA 3TSCA 1XJCA 2Q4BA 1PJBA 5CFOA 3S7ZA 2A5YB 4LQLA 3RVJA 2CXQA 1RCTE 3SYMA 6CHYA 5LL6P 4LZOA 1G2OA 2YJ6A 3IPYA 3N3BC 2R8PA 3QUTA 4L75A 5JWHA 4EDHA 3I09A 2PGJA 3EGDA 3SICE 2VT6A 4OK5A 3LO8A 1M1YB 3V8VA 4DADA 1OJ7A 2QPLA 2VHYA 3FYHA 1S3SA 2BV3A 2PY6A 2VCEA 3E5MA 2F59A 1I9GA 5LUBA 1TQDA 2ATCA 2LNDA 3HMQA 1D6JA 3ZI0A 3GRRA 4RE6A 1P9RA 4YCAA 5B1EA 5ELLA 2C7QA 1K92A 3I62A 5AYVA 3U7EB 2I9PA 1U31A 5FA8A 2ZVQX 5AW2A 4PLPA 1AHPA 1DPFA 2I4RA 3CKMA 1I2DA 5FOVA 5JD4A 3GI1A 3L8EA 4QXQA 1ZM2A 1K3TA 5IAOA 1T9AA 2OSVA 4MV3A 2J46A 4NU8X 3T5MA 3VOTA 1XI2A 3CNLA 3GFBA 3UW1A 3NHPA 3KALA 1DG3A 2DVMA 1AVTA 3WK6A 2UYGA 2WWIA 1EBBA 3AEUB 4D57A 4RZQA 1YS9A 1NL3A 5IDYA 3IFSA 4K9NA 5JNWA 2HUNA 2ID8A 5CT5A 3MJCA 3IULA 5EYPA 3EDQA 4FXPA 5DOZA 4MOWA 2FPWA 5DHRA 1P4HA 5GONF 3UXHA 3FXAA 2HJ9A 1PJQA 1JHUA 3EZ6A 3I04A 3RIEA 1J7JA 1A8PA 1SBCA 1UDAA 1WXIA 4R05A 3SMVA 5HQTA 1MO3A 3U81A 4HLQB 3BSSA 1B0AA 3ILHA 1AIPA 1FFBA 1ZKDA 2WV9A 4EYQA 4PFQA 4MVJF 2FV8A 1ZGCA 3CKYA 1KP9A 1IQUA 5IJ0A 4DV3B 3LY9A 3RBVA 3UC5A 1GAWA 3M1IA 4MW7A 3SLRA 4IXNA 5C2JB 2QRZA 4QYWA 3SJUA 5LWQA 3KETA 1PJZA 5EIXA 5D6OA 1IBCA 4OLAA 1D5CA 4NJEB 4Q1VA 1K9SA 1R6AA 2YRXA 1VPTA 3SR0A 4AO8A 4U0JA 1CRWG 1QIDA 1T1SA 1NZJA 2CC2A 3AETB 1HX7A 4BVBA 4LF8B 1QH0A 4DY6A 1T9HA 2C58A 2FMUA 2H08A 3QXCA 1L4MA 4FSXA 4R41A 4YAJA 2EX0A 2BN4A 4QODA 4UPDA 4V0ME 1O4WA 3L7KA 2HXSA 1HQDA 2OZLA 4TTJA 1L5HA 2P0EA 3IR5A 5T41A 2ZT8A 2BM1A 1C81A 4HY3A 5KTKA 1WB4A 4LSMA 4PINA 4DYVA 2VJCA 1JDBB 5HW0A 4XUDA 4ZICA 4BLRA 5BUQA 3P1JA 1T8WA 1Q21A 3O75A 3PUYA 5KREA 2ZSDA 1NYTA 4JYCA 3SIRA 4BJ1A 4JJIA 4J29A 3CUEF 1AKVA 4I4NA 3ZDRA 3PPWA 3E27A 1OAAA 1Y98A 4OD0A 2GYVA 3KB2A 1UZAA 3E70C 4OH7A 4RS4A 2AH5A 3CH4B 3OVMA 4X41A 1JTVA 4QEDA 3LYHA 2ZIXA 1MJHA 1XQWA 3IMFA 3HFSA 2KB0A 4LF9B 3BCUA 4BMDA 2QYHA 3BFVA 1GCGA 2B3DA 4KXXA 4AJ1A 6AT1A 5LQCA 1NJFA 1XV5A 5AVZA 4JJ7A 2A9VA 2IUEA 5IT5A 3LM8A 1XPUA 1J97A 2ZANA 3TBFA 3GJTA 3H1AA 1FYDA 1WXWA 1KO8A 3JALA 2AXQA 3N74A 5AP9A 3PQ4A 1R4ZA 4L0CA 3IBSA 2A14A 1BEUB 3FR8A 1LB1B 3IB3A 2VPYA 4IDBA 5CBPA 5K8IA 4E4RA 4OATA 3IB6A 2GNOA 2Q4EA 1XEXB 1FDIA 4BQRA 4Q4AA 5KSZA 2HIMA 5HS4A 5BSGA 2C2GA 3C74A 3EFOA 1H9CA 1KH3A 2XE6A 4BNIA 1P29A 4DVJA 1QFXA 3NUZA 8OHMA 2PKEA 4IHJA 2HLNA 1WV1A 3PQFA 4P86A 2ID4A 2ZUEA 4W5NA 4DSOA 2QRJA 3FYUC 1IOWA 5KINB 5E9QA 4H60A 4LJ7A 4TMWA 3I6MA 3IUMA 3S5UA 4Z0TA 3BPSA 1IOVA 1CW2B 3EGDB 3TI9A 3IOBA 2NTEA 2ZAIA 1X7XA 4MXDA 4A8PA 3QEMA 4AECA 1YVRA 2P9TA 3GVPA 5D8DA 1JG4A 3DL4A 4L8YA 1TK3A 5A3SA 3S1AB 4BB5A 5DISB 3UUWA 5JQWA 1TIKA 1J8DA 3PTZA 1Z2OX 3Q2IA 3IAS6 1LGYA 3IERA 2Q5CA 2G1UA 1OX6A 2EP7A 4FDAA 3DKKA 2H1SA 1WKVA 3BE5A 2OECA 4IOLA 1LI5A 4ZQIA 1Z08A 2Z83A 1D0VA 1X6VA 3WGMA 5CA0F 1X14A 4JOQA 2ZI4A 2Q1TA 2AG6A 3KIPA 3M6WA 2HU7A 1ECCA 3LP6A 4ZC8A 4ZVOA 3L92A 2BFWA 1H42A 4QAQA 3T5TA 1YBFA 1HSOA 3ADPA 1YI8A 2EW8A 1MOPA 1IB6A 3D7RA 4FFVA 2OXIA 4BB0A 1F7UA 2UZAA 4XJTA 2WJVA 2OFOA 5I7SA 3HVIA 1E7YA 1J0CA 2IV2X 3VYWA 5JVDA 2A1UA 3NRJA 5EYPB 3NV9A 1A9PA 1P9OA 1C7ZA 2C84A 2VRCA 2IDZA 3VPXA 2C2ZA 1SN7A 1SZPA 2C04A 3F4KA 1DJQA 4X97A 3W90A 3QPDA 4C3ZA 4DR7B 4M98A 2P4EA 4KMSA 1T8PA 1VCOA 2P9FA 4UBKA 4PSCA 3QZUA 4PVCA 2JD1A 2MSLA 4ANFA 2EW1A 1ZD1A 2G09A 2JBAA 4U5XA 3I34X 3TTYA 3EB9A 5IJ0B 2H9IA 5BYKA 2ZWPA 5AOBA 2EJVA 2DE0X 4KBYA 1AX9A 1W5FA 3PNPA 3L6UA 4N5HX 6LDHA 3O1IC 4OQPA 1XLWA 1M9NA 3GFVA 2WJGA 5HIJA 1CY7A 4B7XA 3WAGA 1RWBA 3LLCA 4XGNA 4BNDA 1YFZA 4PQEA 4N0DA 3RFCA 3WHIA 1B6SA 1C9EA 1BVHA 2B1RA 5D7BA 1HE4A 1WHTA 4B35A 4WJKB 3K1ZA 4FHCA 5DHAA 3J7AC 1GG8A 2CY0A 4MROA 1XPJA 2EYUA 4K8OA 3BMNA 4N5LA 4ZD6A 5FR1A 1CCWA 4GZ3A 4B44A 2PH7A 2FF7A 1L5HB 1F0PA 2JIOA 2XXBA 4PBSA 5AI5A 3TECE 3C2QA 4TYYA 3EX7C 3CKLA 2O3SA 3SX4A 5DHSA 3W3AH 3W4JA 3ZGZA 4KV9A 1S1MA 2XNCA 1JIJA 2V9CA 3CT6A 1ZZGA 3BH0A 4RPCA 1ULHA 2ZLBA 1P2FA 3EK2A 4RSRA 4DCVA 4E13A 3UJNA 5EKSA 2V1UA 1RPJA 4PZ9A 4OHVA 2H7VA 2EIXA 3RHZA 1HTBA 1Q1QA 1Z07A 4JJKA 5AW8A 5KQMA 1Y7LA 5AW0A 1NV9A 2QRKA 2AQ8A 1PTJC 4W82A 1MEJA 4AKIA 1NASA 1VRWA 5LDGA 1H3FA 5LSAA 3MPOA 1Z7GA 2R7AA 4HXFB 4ZT3A 4YFVA 4JP8A 1SUDA 5EE3A 1HG1A 3OF3A 4FNGA 3HNRA 3HUTA 2SCUB 2LVBA 1V5GA 2ZIXB 4ZAZA 1U2TA 1QGUA 2RGYA 1PEYA 1W4ZA 1KFJB 1J06A 5EP4A 1QO9A 2CT8A 2HYDA 5CP8A 3T9AA 3GQBA 4JGBA 4E2XA 4IJVA 3U3MA 4DXDA 3DF7A 1PR2A 2N42A 3E5HA 1ORRA 2D59A 2FPPA 3GJSA 3OA2A 4JLJA 2X23A 3M6FA 4EDFA 3JALB 3IVAA 2Q9CA 1Z18A 3ZV6A 3JWPA 1MDFA 2O06A 2ZIZA 1P0QA 3UA4A 2E3JA 4IVRA 3AUYA 1G3IA 1M3SA 1SHZA 4JSYA 5DW3A 1WXQA 2ZUWA 5EJMA 1SKMA 1QGYA 5GIPE 2VRWA 4Q4AB 2J3DA 4ECAA 1EB9A 2JANA 1T2CA 4Q1CA 1Z56C 2PVCA 1SKQA 3EFOB 3KPWA 3WB9A 3ZQKA 1CB0A 1KARA 3GFSA 5CFRA 3H9UA 3PC8C 4Z5XA 1RM5A 4BUCA 1R5OA 4F1JA 1H2HA 3P2JA 3WLMA 4IHJB 4I6JA 2NADA 3OCXA 1VP3A 2JGNA 1DAGA 4URVR 3I2IA 1J5EB 5A4IS 1LUAA 2GSWA 1WTCA 4GEGA 1AHIA 2C78A 2GN4A 3HADA 5CA1A 1X7XB 3HSYA 4JJ4A 3QEMB 1JW9B 3UHFA 4D41A 2LKCA 1MAAA 1CT9A 4DQKA 3V8BA 2QVZX 2QUBA 1XTJA 2GPWA 3C3XA 4TYNA 1E6MA 1CY0A 1XP8A 2JS7A 1V7CA 1AKNA 1FMJA 2J48A 1SGWA 1OY1A 2ZYDA 4RH3A 3BMCA 5D84A 1GKYA 3HABA 1G8HA 1H05A 3MJ4A 3NOOA 4F11A 3TDNA 4NU5A 1U81A 4EATA 2UVPA 1JG7A 1LPBB 1WUKS 2UUOA 3GRFA 3RJTA 3IILA 4RIHA 4X8HA 3O31A 3S27A 1V1MA 4BUJA 3PJDA 4J1NA 4KR6A 3HCPA 4OXXA 2GBCA 4K6KA 3IPCA 3NHWA 3M6XA 1DAMA 1TPYA 4HWKA 5KKAA 5ES4B 2PJRA 3V00A 4YAUA 2I03A 2OV6A 2R11A 1IMJA 2M2IA 3MCUA 3F1LA 5K0NA 5JVDB 2FWIA 2Y67A 2A1UB 1JFVA 1UBUS 2AG0A 1H65A 2NZWA 3Q2OA 4FBMA 4XCVA 2V0CA 2R6DA 3V8MA 1MNQA 1RPNA 2ECOA 1X3LA 1L7XA 3DOHA 5LN1A 3RR2A 1RYEA 3DFFA 2G1AA 2XRYA 2Z1NA 4KQIA 5CDFE 4Y7DA 3TW8A 4P84A 4S0ZA 1MTZA 3K1TA 5JS8A 1FFHA 4Q21A 3NBQA 2BM8A 3I4LA 5AOAA 1QP0A 1U0HC 2NU8A 5FADA 4U7GA 3NUQA 3U7HB 3AIMA 3D1VA 2NPIA 3LXRA 3TRJA 2BFEA 2HNBA 4DM3A 2P7IA 4ZOQI 1R27A 3IV6A 3I2YX 1MV8A 5AI0A 5H82A 4BNDB 4OAQA 3R0IA 4ZYWA 2GM5A 1TYEB 2J6CA 1CUBA 2XDQA 1SHLA 3DE5X 3IODA 3K30A 3LPAA 4IGIA 4OJNA 1SUPA 4LJ4A 5DHQA 1WHTB 4GYWA 1UBCA 2HZ7A 1IY9A 3C3YA 1TU3A 4NJOA 1YQQA 4RW0A 1IG3A 3VR6A 5EVCA 3BMNB 4URYR 4C6TA 5B4TA 4KGVA 1CR0A 2JI7A 3A3OA 5F23A 3VZCA 3THSA 1SG6A 3TLXA 4LHSA 3VO9A 1E1MA 2BR4A 3Q0TA 5L40A 1EQ2A 1KZGB 1F2VA 3OZSA 1BE6A 3PNSA 5TT0A 2HQRA 3B6MA 5EE5B 3OPQA 4QDKA 1W4CA 3RSOA 1D0SA 3UUGA 1DCTA 5CPBA 3I45A 4NZYA 1Y48E 4LBZA 1U99A 1EFHA 1OAKA 4JWKA 5M5BA 1J2YA 1R6DA 1QZ3A 1AN0A 3MTAA 3ZY6A 1XNHA 3OP1A 1EWKA 1JQLB 2P1DA 5GV8A 5DCUA 4OYLA 1Z4NA 1ORVA 1X1BA 4HQNA 3EBOA 5CLHA 1QGUB 2CXSA 4L0MA 1NNLA 3L8MA 3GJYA 3O1JC 1Y1SA 3WMXA 1YS7A 2F67A 2R2GA 5IC6A 5EIAA 4KMMA 3GQBB 3JZAA 2EERA 4MGIR 2YW9A 2QUZA 2FZVA 2XA9A 4BPRA 3ENKA 2ZM5A 2FP4A 2R8ZA 1F17A 2FFHA 5GVRA 2VHQA 3KQKA 2AKAB 2FPPB 2P67A 2RH8A 1I80A 1PG0A 1Q1AA 2ET6A 4CV1A 1D2AA 2IKSA 4QLBA 3OU2A 3C4QA 4IDHA 3AZPA 4F7DA 1DADA 2DF8A 2IODA 1CWUA 1P0PA 2Q99A 2CNWA 2ZCUA 3PUIA 4M8LA 5F2EA 3ZHTA 1IBKB 1KO4A 4JQSA 2QP9X 3M6VA 1G6OA 1NMSA 1NVGA 4O1HA 1A9TA 3IQZA 1G5HA 3G68A 2IV7A 4Q1FA 4F9FA 2PEZA 4NCKA 3EJ6A 4Q4JA 5ENZA 1PJ4A 3VMFA 1I3CA 4CKCA 4OBWA 4QX6A 3TG8A 5THQA 2C7RA 3CFYA 2CBXA 3ZV3A 3MTBA 3CJRA 4J1QA 1O95C 4QRHA 5H02A 2Y1WA 3BT7A 1MRZA 3BRCA 3HL0A 2VP6A 1R8YA 3SS9X 3TI7A 4AMGA 4UBOA 1XMQB 3EZYA 1XVUA 5CA1B 3AEKA 1Q11A 1QFSA 3AF1A 3N86A 2WA2A 2WJ3A 3E82A 3NVMB 4GI2A 4N01A 4QOFA 4C0QC 1RYBA 2AGVA 4Y1EA 5FTKA 1GSHA 4BFLA 4DZRA 3PFGA 5C5CA 1E2QA 2JVIA 1N5LA 2ACKA 4LFAB 1ZIXA 3W05A 3SM9A 3FKQA 4CNQA 1XK6A 2Z5VA 1SU8A 2ZPTX 2IY9A 2OFPA 3EQZA 3LPNA 3M1YA 4YA6A 5DGTA 3MK31 3BMCB 3CRMA 3PRYA 2QRNA 3SG0A 2EU8A 2IH2A 4DY4A 4DB4A 4Y0VA 2CMDA 4R3WA 3PEWA 1W96A 4PTLA 3R9XA 2UVPB 3LKZA 4Y6QA 3KQSA 3PXDA 4YRCA 3W6UA 1VI5A 5BWCA 1EWQA 3DLPX 3KV3O 5CNIA 4C7OB 2HMVA 1V1MB 3A9WA 3JD4A 3HDJA 3ADCA 2HI0A 2XUHA 1UAYA 2V1XA 1RXSA 2PBLA 1DCMA 1FFGA 1IN4A 3EASA 4C4PA 4JT9A 4GD3Q 1HF3A 2NP7A 3P2YA 4MULA 4YONB 1G1MA 1RSZA 1WUJS 5CCEA 1CUDA 1QB7A 4IBOA 4H7DA 1H8HD 3SIWA 3WOHA 4IV8A 4DEXA 3PLRA 2YHIA 4MO2A 1XGKA 3K5HA 3HVRA 2PVPA 4PIMA 4AK9A 4GX5A 4S1OA 4ERXA 2MR6A 2P2GA 5FPPA 4ETNA 2JJ8A 3TW8B 3LIIA 4BKMA 5J63A 1ECLA 4Q1DA 3N8NA 2Z8ZA 1JBQA 4UHJA 3D59A 5HF9A 1BROA 3K53A 2ZXFA 3PUKA 4BE4A 1TK2A 4UTRA 1R5NA 1QORA 1CY6A 3NYWA 2NU8B 3WJAA 5A5VA 1MO2A 1HDXA 4MEAA 2XT9A 5EJIA 3V1NA 1IVNA 2BFEB 4GF5A 1UZUA 1E4VA 5LZ4A 3EXAA 2VH5R 3C3CA 5AR1A 1KE2A 1ND6A 3BHMA 2XDQB 4RTPA 3W5VA 2P11A 4JU9A 4OHZA 4W8GA 3S2YA 1XZHA 1B2LA 2BDTA 1V95A 3AFHA 3IPXA 2BTQB 3FZQA 5DCLA 3WLFA 2Z2ZA 3UMSA 5TQ2A 1OA0A 4RVNA 2DFNA 2A58A 1AUQA 2VAVA 1QIJA 3P2OA 2G1JA 3UWMA 4C6TB 3ICVA 4OFWA 2FLWA 5B1DA 1QIEA 4KO1S 2GO1A 2ODEA 4D4GA 3OE5A 4NYIQ 4GSKA 4ZVMA 3RD5A 4DBLE 3CBGA 5DU2A 1ECPA 1CUSA 2FPUA 4HDCA 4CR8A 3KL2A 1IY8A 2Q3JA 3ZWBA 2E4ZA 1A95A 3DNFA 5HNKA 4M21A 1LI4A 2WZBA 3PUWA 1J56A 1DKRA 2AI2A 2QL9A 3UANA 1W36D 5THXA 3MFYA 1NFQA 1ZHOA 3SZRA 2DUUA 3VMMA 3OA0A 1MEOA 1WBBA 4UREA 2VZ0A 4IHJF 4P32A 2P2NA 4JBXA 3M3DA 4AP9A 4W5WA 3QFSA 3JTEA 2OGTA 2F1KA 2ZSUA 4DB2A 4LQ4A 4UMFA 3OTGA 5TRTA 2C2WA 4QGHA 5FUXA 3TZ6A 5AW7A 1T3ZA 5EMHA 2XZLA 1QM5A 4QGGA 4ZPXA 1MORA 2E1PA 4R8RA 4HEJA 4KLCA 4TMFA 3VR4A 4UOZA 4REMA 2MJLA 2Z98A 4EL0A 5K05A 2VJYA 1ILWA 1B0PA 3PYXA 4B3JA 3HU5A 1I2BA 5EL0A 1JQJC 1P9LA 1V4BA 3CX4A 3E84A 4L5JA 1VGVA 1YHYA 2FP4B 2D6FA 4GNRA 5IP5A 1PV1A 5BMOA 2XXAA 4MJ7A 1GZ6A 4CM8A 4GKVA 1TLTA 2G5TA 2P9BA 3KZOA 2PQ0A 4TTVA 5IVIA 3HEMA 1M2JA 4WZBB 3AUUA 3IUPA 5KOYA 1O96A 3HUFA 1GR1A 1QCZA 2FEXA 2CL6X 2QUJA 4MRVA 3I1FA 1MGPA 3SIPA 6PFKA 2F8LA 5CDUA 3L1IA 4TSFA 1YJ5A 5HYVA 4JUIA 3DGFC 3C14C 4R51A 1JBKA 3AUFA 4I5GA 4RIIA 5FP0A 3TRHA 2IZ1A 4Q4JB 3V1KA 3TN7A 1EVEA 4CKCB 5JVDF 5EP1A 1M2VB 5DX0A 4QG3A 4E3WA 3RRMA 4GOLD 4A2WA 4YMSA 4JGGA 3B38A 2QD3A 3KFXA 1L5FA 4K9SA 3GHHA 5H0IA 4AC9A 3HCCA 1DQPA 2NV0A 1L8QA 1H6AA 3KLMX 4K2HA 1F8GA 3T12A 1F6WA 4I2VA 5EMLA 1U9IA 5BSEA 3JV7A 2C59A 2UKDA 3QHAA 5IKOA 4NQZA 3TYXA 4DR6B 4M9CA 1A8SA 3ZIAD 3A3PA 3OJOA 3ASUA 2GKSA 4IQFA 1BGVA 1U28A 2ECPA 2R00A 2OO3A 4LYHA 1SELA 1NQVA 2GJ4A 5KQPA 1GUZA 4M1MA 2HUPA 3WKCA 2BGIA 2Q1SA 4QNMA 1Y7HA 2ZYUX 2FWJA 4CT5A 4F2DA 5EJ6A 2B8EA 2GSDA 3GJ4A 3R9XB 4PF1A 3RYIA 4F4HA 2WWGA 1Y3DE 3X1MA 3H8VA 6ABPA 1AQJA 4QDJA 1L7RA 5LB4A 4B32A 1H5NA 3NDPA 1NDQA 1JGTA 1QCDA 1YBHA 1V8FA 2O5VA 5IZCA 2DAPA 4NCBA 3FCUB 4FD2A 4ZYUA 2ZSFA 1P75A 1BCSA 3B5IA 4O0MA 4YP1A 3SCZA 1NQWA 2YHIB 1IBSA 4CZ2A 1SBQA 5JQGF 3SYTA 4TKVA 5DN6D 4RJTA 4DNFA 2FPSA 1HQCA 4IDAA 3CVVA 1U0LA 1RM0A 3E0XA 2ZKLA 3FVWA 2QMQA 1DJOA 3FI0A 3O26A 4OQFA 4UXHA 1UMKA 2C2MA 4WKPA 2ACEA 2YY6A 1MB3A 3ZHXA 4RMJA 3ZS9A 1A4IA 5CVDA 4IMJB 2X76A 1AKQA 2Q3BA 1Z0IA 2W8BA 1GO2A 3BIWA 3V7UA 4D9JA 4JP3A 5BUSA 4BZZA 4B34A 2GZ2A 3ILSA 5B37A 5DM70 4OCZA 2J5RA 4CF6A 4E31A 5E3HA 3AF2A 4KH1A 1Z3CA 3ROKA 4ZGGA 2CWDA 3M6IA 5AVUA 5A2GA 5F51A 1TJYA 3GRYA 1XLVA 5TQ2B 4UOQA 1A98A 2CZCA 4WASA 1K7YA 1RKXA 2HA3A 2JBHA 2RBEA 3L04A 3FDFA 3ND5A 3GEEA 4RXMA 1JI3A 3G7NA 3LW7A 3SU8A 4MZDA 4A0GA 2GFHA 1QSGA 1SK9A 4G81A 1Z25A 4BUZA 4ENVA 1GGEA 3D6UA 3PS9A 4EGAA 3MT9A 3NV7A 1SCJA 4LFCB 2I3GA 3SI7A 4E2FA 5FUBA 1VPWA 3T7IA 4QGAA 3FB1A 4PTZA 2YHAA 1VPVA 2YWRA 3HDVA 4RF3A 3VJMA 1J20A 4D9IA 2JH3A 2EFYA 1YDGA 2O48X 3ZK9A 1ZNWA 2PGIA 3AHCA 4MS4A 5G0VA 3UT6A 5AVRA 5AM4A 2AWNA 4KYIB 1JSZA 1NNUA 1QG2A 1D5WA 4Q02A 4R54A 3FNRA 5KJ6A 2ZU0C 1L6RA 3RS5A 2VSYA 2ISQA 2PS3A 2R87A 2G0AA 2YYAA 3ORQA 5KNBH 5DTMA 4D4LA 4JNKA 5CA1F 4KXVA 1N1EA 1ZEMA 3IOEA 3OX3A 2J3QA 3WB2A 2ONYA 5BWBA 4J3JA 3WYFA 1GAXA 1Z5PA 1ZN2A 2NX2A 2HFJA 3SM3A 4AJKA 2I7XA 4H0NA 3K9CA 4C4AA 3GLSA 2ONCA 5G41A 2VHTA 1DC3A 4MLDA 3R7WA 3TW4A 3EVNA 1O2DA 3DXZA 2KMLA 4G1EB 3AV0B 1H85A 2VP0A 3I1IA 4G5SA 4J0CA 2XXAB 3AYXB 3UIEA 3H13A 4UFNA 5EGNA 4B6JA 4CM8B 1V3QE 1N6NA 5HBGA 1H2YA 1B6TA 3T5BA 1BIFA 2X13A 4L9AA 3RS8A 4EGCB 1O96B 3SDBA 4P58A 4WXRA 5HZMA 4O0LA 4OHYA 5AJXA 1Q0TA 3E3MA 4TWZA 1U2SA 2YJNA 2ZWAA 3DD1A 1K7EB 4DABA 1U1GA 4WEOA 2GJSA 1E0JA 1RKBA 2OZEA 5IWAB 5DYTA 1X8KA 4Y2SA 3AIKA 3K8YA 3UMCA 4BNMA 1WEHA 1QP4A 2ZPAA 3ADOA 5HJEA 3NFRA 3NHSA 4ED9A 3U4AA 3I76A 3SYNA 4PHFA 1KAQA 2I4MA 5CVTA 1ABBA 3PXEA 1PLJA 4XB2A 5GJCA 5JAQA 3O5AA 4C7VA 3N59A 4XI9A 2XCOA 4DHEA 1I7DA 1IY2A 3AR3A 1HT1E 5DHFA 4QIHA 3QK7A 2H1IA 2IZ5A 4NRDA 5CITA 5MHTA 2EOAA 2CHEA 2PV0A 3VKFA 1DEOA 1FNBA 1AF4A 3GEMA 2JC3A 1UPFA 1WP4A 2J3JA 2NACA 1UBSB 3HCFA 4DEYA 5MDHA 1WD5A 3H1FA 5B6JA 2Q0XA 3JQCA 2UUBB 2J9FA 2P3OA 1I0LA 2H3EA 4FQ5A 5ALKA 1UDRA 2AKYA 1EFDN 3G1WA 2QX6A 3HJTA 3K0AA 5H16A 4KMRA 5LNK1 4P82A 1PGQA 3HBMA 4TYQA 2QX9A 3RYIB 3WXBA 4BBPA 2HA5A 1GFWA 2Z2KA 1CQWA 4QYTA 1QKJA 1PGNA 1TU4A 5GM2A 2Q50A 1QIGA 3TSOA 4DJ5X 5KHOC 2WPDD 3V6MA 1XEFA 4P5PA 4URXR 3WFZA 3UC9A 1C1HA 5TF0A 4BN5A 2ZWVA 1S89A 2XH8A 5ALLA 5LP6A 2QW8A 3LSYA 3OPNA 1BCSB 1M2NA 1OI7A 4E5KA 3I0MA 1CZNA 3COZA 4QJBA 1VJCA 5DFAA 4C22A 3AUJB 4MHSA 1RAFA 1SAYA 2Q5IA 2W11A 3AM4A 4TKVB 2WHPA 1Y5MA 2WD9A 1SOWA 4QREA 5EWLB 4LRUA 3AUAA 2FZGA 3EULA 1LWNA 3A4TA 3K9HA 4IRUB 4BX3A 1C3OA 4ZMBA 3Q85A 3O91A 5IASA 1HLPA 4TWBA 2AQHA 4QA9A 2AEEA 1IYZA 1LSUA 3BXEA 4YAEA 4GQIA 3RTEA 4EELA 1JUDA 4FYJA 1JQDA 3ET5A 5AHXA 3D3NA 4CMJA 4WE3A 3A2MA 1FNNA 3N2KA 3WBKA 4HQFA 3QXXA 3R6TA 2AYYA 1S3GA 2VQ6A 2IH5A 2QU8A 4B84A 1DQSA 3CUUA 3VR1A 2A67A 2DBRA 1J99A 2WMDA 2QN2A 3R77A 2AZDA 2GNPA 1ZS9A 3TSWA 5EJ5A 3JQPA 1IK4A 2AF3C 2Q62A 1YI1A 5DGDA 4MVXA 4ZT2A 1KI2A 3AF3A 4H17A 5KKNB 1T91A 4RZ3A 2VHXA 4U5QA 1T8YA 3FYTA 3QLJA 1TM5E 3V33A 3I4CA 4YRBA 5COQA 3AOEA 1DQNA 4UTNA 2LCFA 2GZRA 8ATCA 4OHKA 1BHSA 2DWCA 5E0OA 2JFZA 3X43A 2CNKA 5C7IO 4EW1A 1LQUA 4MQ5A 4CV0A 2XRMA 3L7CA 3W5AA 1L0BA 5EOVA 4L4RA 2BM0A 3O6VA 3JAMA 2JZNA 1U7XA 3A06A 3QLUA 2K5UA 4ZVQA 4MS4B 2OGZA 4D79A 4GBGA 4ZI5A 4ZRNA 2ZJFA 2ZTMA 1RLIA 1KY5A 1XD8A 3QPWA 4DPLA 1CHDA 2B7BA 4UCFA 3LOUA 3BIJA 1CJSA 4IGEA 1HSZA 3TLBA 2COEA 2OD7A 3ZD9A 3H9EO 1PT7A 2Y99A 1T4GA 2FJPA 1XCOA 1ZN8A 3P0IA 5EJEA 1JU3A 3PXAA 4ZANA 5BSUA 2IZOA 1T6YA 3AONB 3PX7A 1DC5A 1X7DA 1DAKA 2IEGA 3K35A 3MJTA 1QHXA 3NYQA 2Z30A 4R9UC 4HN4B 3R7WB 2AZXA 5IS2A 4AICA 4B4UA 2VVTA 5JH7A 4LXXA 3WYBA 1DE0A 1OAOA 2GRJA 4B85A 3PGVA 3G7UA 4DCGA 3CE6A 4DLVA 2QUIA 3FDXA 2V3CC 5B5SA 1KIAA 2I55A 1P7VA 2PYZA 4RY2A 3I2GA 1D6NA 4V1CA 2OHGA 2R79A 2YRWA 3VR3D 3GVCA 4I0WB 4V0NA 3EQ7A 3BB1A 1QQBA 1Y5LA 2YXDA 4EKEA 4YV1A 1DCKA 3F7TA 3TXXA 1WDWB 1E9SA 1EWVA 3DA8A 5IRCD 1Z2NX 3LUJA 3QFHA 2WJ4A 4JDUA 4QBTA 3L1UA 2MHCA 3C6BA 5IN4A 3GP8A 1XRSB 4F12A 2PS0A 3RUAA 2WIDA 3EZ2A 3W9YA 4B46A 1GLNA 4EZBA 1A2OA 2Q3CA 4Q12A 4KWIA 1JNYA 4N7MA 4DM4A 2WVJA 2FXVA 4ZGWA 2GF0A 2WIKA 3U56A 1Z9BA 1G5PA 1ODTC 1CU1A 1EVJA 2H8GA 2VDPB 1HG0A 3JZMA 2W98A 3ZDCA 3ESZA 1S0UA 2J9FB 2GDJA 1BW9A 3U7IA 5L6MB 4AAYA 2I6QA 3BSYA 3K0AB 2P8JA 3ANNA 2GKOA 1YUMA 3E9NA 4HWTA 2VLBA 3CVOA 5FL3A 4BNWA 4YMLA 1E9CA 3OIGA 3QWBA 5AI8A 4KE7A 3KFLA 3ERCA 4O4IA 1H2RS 1OD6A 4MP6A 1FJHA 4OXQA 4N47A 3UMFA 2C9MA 1LK7A 1MAWA 2VSOA 4H7KA 2IEZA 5LP6B 4H7HA 5F1YA 2JJMA 3MD9A 3ZUPA 4DBVO 2G36A 1N2EA 5FBWB 3GRPA 1BEEA 1VKJA 3CEMA 1RHJA 4QHSA 1SVNA 4DN6A 4F1WA 1CE8A 3GUCA 4AFNA 1NW3A 4MQFA 2AN9A 5DRTA 1E3JA 2WHPB 3IUEA 4KN8A 4UJ3A 3RHSA 3TEMA 4DW8A 3X1DA 4OUKX 2PLFA 5HGXA 3K9NA 1C3OB 4MAMA 3IO5A 3VGPA 3BA1A 2WUFA 4P81A 4NCAA 2CL0X 1LBIA 4R6XA 1KRXA 3HYRA 3S8MA 3Q3IA 3OCCA 4YI5A 3N2KB 1M66A 3WV4A 4HWSA 1CY4A 4LMBA 1HE1C 1KAMA 1KI6B 3GXOA 4WAUA 2X3YA 4IDGA 5JS6A 1V8ZA 4IIDA 3C8UA 1IOLA 1WMAA 4JDPA 1C7RA 5KDOA 1B14A 2Q4RA 4UBJA 5ED4A 3BCSA 4F4FA 3JVUA 5DX8A 4PRZA 3LS2A 4NV1A 1JE0A 3W2GA 4DBZA 1F51E 2ZCJA 1P1FA 4U2BA 3I6YA 3RUFA 4KNWA 3JQQA 3Q0IA 5LQKA 5C8VA 2JBWA 3DEFA 3HY6A 5IAJA 4RPGA 3L0SA 5EA2A 1Z2DA 4E30A 3LC0A 1LSSA 1LY1A 1Y8ZA 4LVUA 4M7WA 5D51S 1KSGA 3UMBA 1M6YA 2OPBA 3LNTA 4W7SA 1ECBA 2CHFA 1U2GA 4ZVNA 2A3RA 4B79A 3L82B 5J40A 3T95A 2AFIA 3N7UA 1MR3F 4DRYA 5JV5A 3AB8A 4C3OB 2A9RA 4MQBA 2AVDA 3JQ9A 4AG6A 1M6NA 1G4UR 3R0ZA 1QVWA 2HNAA 2BSXA 4UBNA 5BW6B 4UTVA 1NUQA 2IQIA 3QE2A 3OIYA 1UJ6A 4NCNA 3RRFA 1YJXA 2RH9B 3CCFA 3K7EA 2H1HA 2QD4A 1A71A 3V3KA 3W7AA 1Q1BA 3PK0A 2I87A 3DQPA 3R24A 1L5SA 3GRKA 1OJLA 3HDTA 3H18A 3OPYA 1SZCA 2H1RA 3RCBA 3U61B 1U3DA 2WFMA 3GR6A 1IWOA 5JXGA 2D4AA 1P1CA 1XKXA 4QASA 1YB4A 5JCOA 3J80A 5JH7B 1L8LA 4INPA 3V48A 4JL6A 1TK9A 4Y7CA 4LY0A 3K20A 1TADA 2QEQA 1YONA 2Q5HA 1I7PA 2OHIA 1XTRA 4NE2A 1JTFA 3RRBA 3UCEA 1PG2A 5B55A 1FS5A 2G4CA 3P0RA 3ZY5A 1T3GA 2R751 3IAM6 5HJ7A 1D9XA 4V1CB 5C52B 1I24A 3QKSA 5AI6A 4UE6A 2WF6A 1TYBE 4RV9A 5DV9A 4B9EA 3LY5A 3SE0A 3CMMA 1P80A 3FN4A 3DFUA 2VBCA 2CLMB 3VFDA 4KQ6A 1DAEA 3NHBA 3WTBA 3VU3A 2OK8A 3MGGA 1G3MA 1JWBB 2GTIA 3M82A 2YL2A 5LQMA 4URFA 2Q29A 4GMXA 1TMYA 3T3HA 3VR2A 1ZRHA 1H3EA 1YS1X 3CF6R 4RK4A 4BP1A 5K99A 4Y2UA 4QOSA 4R84A 5JY6A 4CEHA 1Y81A 4WV3A 3U7RA 2EZUA 4ZI7A 1DKQA 1G55A 2ORIA 1J9EA 2IDMA 3D7KA 3F9IA 3ZJTA 3KJGA 1YTUA 1SIUA 1N5DA 2WKSA 2ZPUA 3GN1A 3O2NA 1PNRA 4ZZ3A 3ROFA 4JWTA 1AZTA 5AVOA 4A8HA 4WPGA 5LZ9A 1AV7A 1CQIB 2P5TB 3B1VA 4I4LA 4KE9A 5H80A 3L8HA 3DEJA 4WXMA 3TKYA 4ARZA 2ZP1A 3GW8A 5T7BA 1MZPA 3W3AA 1BW9B 2W6ZA 1MOSA 1KAGA 2AE1A 2I2CA 4HQ6A 3WHLA 3WK5A 4BO3A 4CQLB 1NXVA 4PX9A 5K01A 3V7FA 4TUYA 4TN1A 3IBTA 5D5PA 1BE1A 1M73E 2ECKA 1M5UA 2CDBA 4RLQA 4DG9A 5I4KA 1YRAA 2EF1A 5AXAA 1M8PA 3DAFA 4PCLA 1T8SA 3LQYA 3QVVA 4J49A 5ESDA 1QE3A 5G53C 4O4IB 4CJXA 5BW5A 1HMPA 5K3FA 1YKFA 2II6A 3N75A 1TZ2A 5EIWA 3GGDA 3V8EA 4LVCA 3D6AA 4NZ9A 4OHBA 3ILXA 1UK8A 1YVPA 1RABA 4MGEA 1DOHA 3RPEA 4GVLA 3X2FA 3OFND 2JLUA 1T2DA 3SC6A 4NZNA 1ZGGA 1XWWA 4UM9B 1CE8B 5CLLA 4MQFB 2OKGA 1OX5A 4ZU3A 4JB8A 4AYTA 3KOUA 3M9LA 3J7TA 1CUWA 3LY8A 3H5OA 4C0WA 1DJLA 3I5YA 3KSZO 4J7CA 4YQYA 2WK1A 2LZ0A 2CVHA 1XJ0A 2R44A 1DIAA 5LDHA 5FIUA 2E85A 2GZHA 2RHHA 2C2OA 4LJ9A 4X3CA 4ZOAA 1UP6A 1W34A 2EBHX 3BFKA 4J0JA 2CHGA 1K75A 4IVNA 4ENRA 1OH6A 1HGXA 1AOXA 4ZQHA 5H9VA 2OV1A 1I6KA 3KJZA 2CFTA 3RNOA 4DMMA 4LFBB 1PRYA 4IKOA 2YZKA 1ZQ9A 3OFJA 3D2CA 2DQSA 3LGXA 1MXFA 1TQ2A 5GP1A 1EFUA 1B0ZA 3WJ7A 1AQLA 3A36A 4E51A 1GQOA 4MW2A 2H6EA 3BMOA 1FDUA 4JJGA 4DG8A 5T64A 1Z4OA 2XDYA 5LP1A 4HAVA 2WB2A 4FFWA 3AG6A 2E55A 5LQUA 4M0PA 1GZ7A 3SFVA 3UATA 2CL7X 3PB3A 4RK1A 1QWSA 4XCQA 4KIUA 3K96A 3GJQA 4IXWA 1RRCA 3OAAD 4MVJG 5CHYA 3VNAA 2COUA 1F4LA 3B6EA 2C7GA 3WMEA 4FJ1A 4TTPA 1CJTC 4Y2YA 1CUAA 1FYEA 4AJHA 2W0SA 2WSSA 3T0IA 4BDSA 1OBHA 5C0OE 3QH4A 9LDBA 1Z7WA 3AK4A 2AFIB 2XT0A 4H9GA 5F73A 3FUVA 3PJRA 3O4GA 5BMVA 3BRWA 4YJFA 2IIBA 1DINA 4G9EA 3KT3A 5PGMA 4B80A 3NM6B 4NMMA 2FOXA 3WGYA 3KE8A 4ZCTA 3T34A 4ER0A 5LOVA 3TG2A 1LI7A 4BP9A 3F8SA 2P4SA 3BZWA 1K8QA 1NVWQ 4CNBA 3UF0A 1GGKA 3N6RA 4NFYA 2XVYA 3M5PA 5A5FA 1WXGA 4MI1A 3OPYB 1YRBA 1E5DA 1E96A 1CZHA 3LUGA 4HNTA 2AOTA 5E38A 2X14A 3DOEA 4JUFA 2ZUFA 5EUBA 1T6ZA 3DD5A 1GAEO 5K1ZA 3FKSD 3ZX4A 4D8XA 4H35A 3PUHA 2OAQ1 4BRZA 5CB8A 1YVEI 2HHCA 2ZB8A 3ADKA 3GY0A 2IGBA 2CV0A 2PUBA 6REQA 2JI4A 2IHBA 2V6JA 3RROA 1EP1B 1E5QA 1V9SA 1ZESA 4GDMA 4NR0A 3RHFA 5SZHB 3QKSB 4RS3A 1K8XB 1XLUA 4UUMA 3RYCA 4FU0A 4LXHA 3Q41A 3JU3A 4L50A 4M0KA 3HN7A 2O1XA 4DA8A 2ONZA 1JZQA 3GAFA 3BRQA 5LP6F 1GGVA 1E6UA 4D9MA 4AQ7A 4RCVA 5K4AA 1TW2A 2P9YA 2YZ2A 4Q18A 2P78A 4LV6A 1JYFA 4KK4A 4BFTA 1JR6A 5JBIA 1HQKA 4FFOA 1ZGHA 3F8TA 3FPKA 2L42A 4RDCA 3SQNA 1W1UA 3A6FA 4GLLA 4TS9A 4YLGA 3OJFA 4DZZA 2P6PA 3C7TA 2B1JA 3TOSA 3H9GA 2OQ2A 4MKXA 1CV2A 3KEFA 5CM9C 4BJ3A 2FMIA 1WZUA 1RNLA 1XU9A 1WA5A 5FFNA 4AX8A 3DAOA 4O5AA 3AL2A 3J81k 4ZJPA 2ZIFA 5JFTA 3CONA 2C97A 1VECA 2R8OA 1U7DA 4FFLA 4CN8A 4I1PA 2Z6QA 4H0CA 4POAA 2FGJA 1UXGA 3NJ8A 4OGWA 3W5UA 4MRPA 4ARZB 2QZ4A 4MPJA 2HIAA 4LYGA 1OMOA 3VA7A 2IYNA 5HBRA 3WLRA 2VYVA 4B6OA 1PVVA 2YS7A 4Q7KA 3NANA 2HDOA 4TUYB 3T7SA 3U1VA 3UA3A 3NEPX 4KNYA 2IWRA 1DFGA 1PYOA 4GNKA 5IJ9A 4KXUA 3CNBA 3BCRA 3QIAA 3H65A 3AJ8A 5ITZA 3LV8A 5K3FB 3OMLA 2OWDA 3TKLA 1CSEE 1PWXA 1Z0DA 5AJWA 3F97A 1WW2A 2ZOSA 3HJUA 3BJMA 3IP1A 2PANA 4FD3A 4QJ5A 1HLDA 3X1YA 4H6XA 3LVRE 2ZSIA 3ZC3A 4HGOA 1M34E 5EZYF 3WV5A 3BM5A 3R40A 3EG5A 1I4LD 1N3BA 1O95D 4AZSA 4CIVA 1QHFA 1XP5A 3CNQS 4LCBA 1KJQA 1YDMA 3AUTA 3KV1A 3W2HA 3X2SA 4Y3UA 2JHFA 3ESQA 1CJMA 4OHUA 3RK4A 1TKAA 5DI9A 2SKDA 5FI0B 3OZDA 4OG2A 4XVCA 5BN1A 4JCCA 5HR5A 4ZARA 4HLUC 2CBZA 4C5CA 3D7LA 2FMHA 4EKYA 2QJOA 4CKEA 3SSMA 4HPXB 3GPCA 4D9FA 2I6FA 1D1SA 1N2GA 2ISCA 3A04A 2W2KA 4MA4A 1DBQA 1Q1GA 1OLOA 1OIXA 4NLLA 2P9EA 4D1YA 3F4BA 1C41A 2VOJA 4J4BA 1D8TA 2VOEA 2X7XA 3DONA 4N3AA 5BT8A 1QQ6A 2VSQA 3BH6A 3R6GA 1VE7A 4FGSA 1MHPA 4MK4A 3P9IA 4CV3A 2HMWA 1NW5A 3BMOB 3FPAA 1V2GA 3W6ZA 3WLLA 1TFUA 1L7NA 5F9MA 2NZXA 3WL6A 5JNUA 1TUEA 4KBFA 5JH7F 4DFDA 3HCWA 3UGQA 2BOVA 3WP1B 4FEAA 5TE9A 2WNHA 3NRCA 3AY0A 3PPYA 3Q6MA 4K9PA 4PFSA 4U2KA 5CU7A 5AUOB 2O8DA 8MHTA 4NECA 2ONJA 3CVUA 1KMHA 2XGOA 3AKYA 4BFWA 3JSAA 3OZVA 3C0KA 4C4ZA 4CV2A 2NZJA 1A5SB 2JG3A 2JZCA 2HJWA 2CLIB 3ZQ6A 2XEDA 3NBZC 2NXCA 2HPHA 4OHMA 4KWTA 1UL1X 4OXNA 3V80A 4RESA 3KL4A 1I1NA 1USKA 4W8HA 4QQKA 2UXBB 4NJMA 4DMRA 4YV0A 2QB5A 5BMVB 4YJFB 2J0QA 3IBCA 1T34A 3W2EA 1CFJA 1MCZA 1YUNA 1JZSA 3EF3A 3U0BA 1F7VA 5LOVB 4JNCA 3L4KA 4XRRA 4MWOA 3IAXA 4OI0A 2RB5A 1P7YA 1MVLA 5ENVA 1GITA 4KLRA 4ESHA 1YHNA 1AKTA 1MH1A 1NF9A 3NP9A 4K88A 4F4JA 4HFRA 1CRQA 2GEFA 4PZDA 1KOJA 2AOTB 1HK7A 2Y4OA 3EW7A 4WUTA 4E11A 3IE2A 2A88A 3HGQA 4MEBA 4BNHA 3CH6A 5IM4A 3TCKA 2QMOA 2W6JD 3U7QA 1I7QB 4PQYA 4XR4A 3ER8A 3UG7A 3COWA 3O94A 1QUFA 3IKVA 4BNTA 4LSZA 5DTIA 1SURA 6REQB