3KAPA

Flavodoxin from desulfovibrio desulfuricans atcc 27774 (oxidized form)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
b'SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADGYDAVLMGCSAWGMEDLELQDDFAPLFDEMENMGLKGKKLAAFASGDMEYEHYCGAVPAIEEKARGLGAEVICEGLKIEGDASSDPDAVSAFAEDVLKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Crystal structure of flavodoxin from Desulfovibrio desulfuricans ATCC 27774 in two oxidation states
pubmed rcsb
molecule tags Electron transport
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kapA00
1C7FA 2V9CA 2FZVA 1I1OA 5FX2A 4BMOB 1QRDA 3OWXA 2RG1A 1T0IA 5A4KA 4Y9UA 1J9GA 3LT5A 1KBOA 3GFQA 3OWHA 4D02A 1TIKA 1OBOA 5BUCA 2Z98A 4LA4A 3TE7A 2Z9DA 3UXEA 1D4AA 1WSWA 2QMYA 3B6JA 3NHWA 2V5VA 4C0WA 3QE2A 5TGZA 5F51A 2QX9A 2QX6A 1CZUA 1YCHA 3ESZA 5NULA 3NHRA 2HNBA 4GI5A 2ARKA 2OYSA 3KLBA 3SVLA 1D04A 3W77A 4FGKA 3F6RA 4PTZA 5F12A 3EYWA 1SQSA 4ZVKA 5LBTA 1ZX1A 1F4PA 2W5UA 5ULLA 3GAMA 1GG5A 4F8YA 3ESXA 3OJXA 1RTTA 1FVXA 2QMZA 2V5UA 2M6RA 2QWXA 3FJOA 1OFVA 4ZVMA 4YAFA 3B6KA 3N3BC 1XT6A 1YCFA 3NFRA 2FCRA 1BVYF 2B3DA 5FUQA 3W79A 2D5IA 2MOKA 5B3KA 5LJIA 1CZOA 6NULA 4QOFA 1C7EA 2Q9UA 2XOEA 4DIKA 3FNIA 3D7NA 4H2DA 1XI2A 1VMEA 1CZKA 2MTBA 4GR9A 2HPVA 1V4BA 1XYVA 4YQEA 4N65A 2F1OA 1J9EA 1AKRA 1YOBA 1RLIA 4HS4A 2FOXA 3NHSA 5EA2A 2M6SA 3B6MA 5F4BA 3W7AA 1DX9A 1CZNA 4LAFA 1FUEA 1CZLA 3K1YA 3LCMA 4N9QA 4FX2A 3QFCA 2FX2A 3FX2A 1AKWA 1TLLA 5B3LA 4H6PA 1YRHA 2FZ5A 3NHLA 2R97A 1H69A 1NNI1 3NLLA 4YAWA 1QR2A 1KBQA 2QX8A 2MT9A 4S24A 2FLVA 2BZSA 3R6WA 4C0XA 4QOGA 1AG9A 2BF4A 4ZVLA 2MWMA 1JA1A 1QBGA 2AMJA 2Q62A 3NHYA 1J8QA 3L9XA 3KAQA 3N39C 2X2OA 4YAUA 3OX2A 3ES9A 3RPEA 3OX3A 3OVMA 4LTNA 2HNAA 4HEQA 1RCFA 3G5MA 1OBVA 4QOJA 1D03A 3O73A 1CZRA 2KLBA 4U7HA 4YALA 3OX1A 4PU0A 4CETA 4NULA 1YCGA 3NHPA 2OHHA 5EAIA 2BMVA 1FLVA 1X77A 2X2PA 1T5BA 1WSBA 2GSWA 2BN4A 5NLLA 1AMOA 2FDXA 4U7GA 3O2NA 3FVWA 4QOIA 3S2YA 3EDOA 4LTMA 3ESYA 4CF6A 1AZLA 4QODA 3KAPA 4ICIA 2XODA 3OJWA 3NHKA 1DXOA 4NLLA 4XDGA 3HA2A 2OHJA 4DY4A 1CZHA 1FLNA 3NHFA 3QFRA 1FLDA 5EMNA 2QR2A 3UXHA 2R96A 2KQUA 2ZKIA 3L9WA 4XDHA 4ESEA 4PTYA 5JROA 1AHNA 1RLJA 3JSXA 4J8PA 4OXXA 4GQIA 4R81A 5LJLA 3K20A 4Y7CA 1SG0A 5FA6A 1QHEA 1AKTA 1YDGA 5LLDA 3NHUA 4FGLA 4C14A 1E5DA 1J9ZA 4LTDA 3F2VA 4C76A 2N1MA 1FLAA 4N82A 1XYYA 4DILA 2OHIA 2WC1A 1AKUA 4ZVNA 3F6SA 4BMPB 2Z9BA 4QOHA 2Z9CA 1DXQA 4U7FA 2FVXA 3KEGA 1H66A 4YAOA 3N3AC 1JA0A 4FGJA 3P0RA 3U7RA 3HR4A 1ZWLA 2BPOA 5LMCA 1AKQA 3GFSA 3F90A 3HLYA 3FW1A 1B1CA 1AKVA 4QOEA 3GFRA 1FX1A 1FTGA 2A5LA 1YKGA 3TEMA 1BU5A 3NHJA 5LVAA 3W78A 4Y9RA 3U7IA 3TZBA 2FAXA 3B6IA 2QX4A 1ZWKA 4M0CA 3ZHOA 5LBUA
chains in the Genus database with same CATH superfamily
1HSZA 2QV0A 3GMDA 3HB9A 4JU9A 1VLMA 3E84A 2C9ZA 5J4KA 5BV8A 5K0CA 3TFOA 3D6HA 2JATA 2FP4B 3HHEA 3NT4A 2JFVA 4YRNA 2IIQA 2ZJ5A 3TFQA 3PUXA 3ZIAA 4BNLA 3K9FC 2IGBA 2XQKA 3LO5A 2LTAA 4WOJA 1IBLB 3OWXA 4E7OA 1BHQ1 4HTFB 1ZVKA 2D7DA 4A0GA 3LAWA 3W2TA 3HACA 3IJPA 3LVRE 4EF5A 2F62A 3QMMA 4XVCA 4JGBA 2H4WA 2HOQA 5GOTA 2CEKA 4KJZA 2OZVA 2GJSA 1O6FA 1H85A 2A59A 1A7JA 2PJDA 1M1NB 4BVJA 4F6CA 3KT0A 3GJ7A 4DHWA 3TRFA 1D2GA 2PUGA 1GPYA 3LT5A 4NL4H 2Z6QA 5JJIA 3E7FA 1Q0TA 4MYHA 4GKJB 2O59A 2Z4TA 3DV9A 1SUEA 3QOXA 3ZY6A 3OSUA 3K9NA 1E1YA 1TM4E 2ZATA 1ULAA 4Z4EA 3WL4A 1ZH8A 5HKLA 1HETA 4I0WB 4MH0R 4I9FA 3MJ4A 4M21A 2FRXA 4WNAA 1RXWA 2X15A 3KUKA 4BO2A 1JZTA 3LBAA 4BQFA 4ALLA 4QEKA 2QPAA 3SQOA 3LGSA 2GLTA 4WVLA 2QRQA 1R15A 1UFQA 1VIDA 1U2ZA 3A36A 1A4IA 3DM5A 1YVDA 3AKYA 4OIFA 2H7YA 5J5VA 3WLPA 2QX9A 4DZRA 5FAKA 3SC3A 1T5HX 2IVFA 1YQQA 4JLUA 2I99A 3TTXA 1Z6YA 2PUJA 2H1WA 2QS9A 4Q3LA 4D44A 3N2YA 4HS9A 2DHEA 2BEJA 3K53A 1ICIA 2PMCA 2JH3A 4Y2SA 2G9NA 3ESZA 3JQEA 5J9FA 5AXDA 1T34A 2JVKA 2XCOA 3H0KA 5ALNA 4Q6WA 1YMVA 3ILHA 4O1MA 3TLMA 3U39A 1E7WA 2ARKA 2OYSA 1F0NA 4UUQA 3IA2A 1KP9A 3B8HA 1WKBA 4KXYA 3TRDA 4BO1A 2OXIA 3A27A 3AIKA 3N07A 2B82A 1JH8A 2DUWA 3RC3A 1CUSA 2ECPA 1G7CA 4IQ4A 4R2XA 3LSYA 4ZQCB 5FAXA 4NZYA 3L04A 2A4MA 3DOFA 4UAJA 1ESZA 4QBKA 4UAGA 5AVSA 2IHNA 2X86A 4IIVA 4XWYA 1HV8A 2X7JA 4L5IA 3OOJA 4RUKA 5HUHA 2BEUA 4QUGA 5ULLA 3ZH2A 1QV6A 1H1TA 2PKQP 3BMCB 3OJXA 1CUEA 4BNYA 1DTSA 3CX3A 3VH1A 3EBOA 2R1TB 1SO8A 3VNSA 2R6CA 1VG8A 3KR0A 2M6RA 1W5SA 3QVWA 4HQLA 4E88A 3GJSA 3SSAA 1RIIA 3ZI0A 1ZAYA 1QK5A 3NDPA 5AVRA 4MR9A 4OVKA 2ZP1A 2PZAA 4WASA 4FR5A 1G3RA 5LB4A 2FN8A 1WY5A 3NBKA 4BEVA 3A1VA 3KSUA 5KNBH 3VX4A 4JZKA 1Z88A 3W06A 3Q1KA 4ESOA 4GLBA 3V4LA 4IXWA 5B3KA 3QA3E 2Y93A 3CUEF 4H18A 4DTCA 1TO6A 2V7WA 3NWPA 4E4RA 2QLTA 4LYDA 4D5EA 5B7PA 1KZGB 1XU9A 2JANA 5LJIA 4M83A 3OESA 1FXWA 2Z0MA 5HIKA 3DVAA 2K7FA 1S9DA 4WHMA 3T3HA 1HFWA 3LLUA 4JB0A 3TMKA 3ZUPA 3WKBA 1FRNA 4LRQA 2R48A 2GRUA 1Q5PA 2JLQA 1I14A 3D7NA 3TNLA 1MXHA 2H65A 2CHEA 2X8BA 5CB4F 3VR1A 3U09A 3OPYB 1T2FA 5AM2A 1YB1A 3B20A 3SEAA 3EVFA 4IG4A 4YUVA 1OTYA 1I10A 1JBEA 1GUZA 1VA4A 3D7KA 3EQ8A 4JI2B 1T4CB 2EKQA 4QGHA 5CA0A 4RY0A 2FMUA 1MTZA 1VSVA 2YN0A 2F1OA 2IYPA 2W6MA 3LA6A 5SY4A 3VKVA 3OLZA 5KJCA 5TT0A 3ABQB 3MTEA 4UDNA 1JJBA 1O94A 2VHEA 1DKPA 4ZGWA 4AFNA 3KSMA 1PT9A 3LPMA 1JIJA 4KE8A 3H4TA 3PGLA 1OA0A 4X91A 2Q5CA 4DMGA 2ERYA 3CTPA 3ZU3A 4CTMA 3SZOA 5K9ZA 4B3HA 1BWSA 2BEKA 3R5XA 4GO1A 5K3CA 5F2EA 5SICE 1QXSA 2CLIB 4X66B 1A95A 2XSZA 2NUAB 3W7AA 4EJSC 2AQ8A 3KC2A 2ZU6A 3G8AA 3NHBA 1RJFA 2AC2A 2QTRA 1M33A 1MGPA 2IJGX 1U1IA 3DMHA 4M9CA 4YRTA 4E1VA 4H4CA 4YV1A 2OORC 1J0XO 4FWBA 5BSTA 3UJPA 1O5OA 3P52A 4TKMA 3MAJA 1R3UA 1JDPA 3AFOA 3R4VA 4RHYA 4TXNA 5T41A 3ZDAA 2WFZA 1GNLA 4IO0A 4JJ8A 3FPAA 3TZQA 4CQJA 3MWGA 4EECA 1OSNA 3ZDEA 5CLFA 1OKKD 2NAFA 3PYMA 4WFQA 2WUDA 4FTWA 4KXMA 4G24A 2IXAA 4M6WB 2PNJA 4G1MB 4M9ZA 4PYIA 4MRPA 2ZBEA 3JYHA 1TUIA 3QXCA 1Q7TA 2IUYA 1E18A 5AKIA 3OIWA 3PNLA 3RHZA 2BCGY 1K4YA 4JJ6A 2ZRCA 2BLLA 3KKZA 4UDXX 4XIJA 2ZKLA 5G1PA 2G17A 1P0MA 3R09A 5LU9A 4F72A 3EZFA 1MG0A 3EF3A 4GPZA 2EF1A 1XVUA 5ALLA 4I55F 5IABA 3RASA 3QFFA 3OSZA 4Z1MA 5HCIA 1T3SA 4X44A 2VRBA 4CF4A 5KCZA 1T3LA 4OJQA 4ESVA 2Y1DA 1JKJB 2NU8A 1GZ3A 3T3OA 1Y33E 4HAUA 5B1HA 4OHZA 4JL8A 5HYVA 3TR0A 1KDYA 2O54A 1FF9A 3DE2X 3D6MA 6LDHA 1B6SA 1J33A 1Z4NA 1UP4A 4Y8VA 3SJZA 3T8YA 3Q3EA 3EMVA 3GP8A 4DXDA 4LUCA 1E3LA 3USCS 3N8GA 5KU7A 2PT7A 3HK2A 2HDHA 4BWFB 5AKYA 2Q1UA 3IAFA 4M0FA 1JHAA 4P3KA 4ZT5A 1T29A 2AWNA 2PZGA 4WLFA 1ECPA 1B15A 2XDQA 4YNBA 1RVV1 3OZDA 2FLVA 4FYIA 3KWFA 2Q1SA 3F5FA 4MTLA 2HLDA 2FR8A 4UQPA 3UA4A 1YZTA 3UZUA 1N25A 5E2IA 4DIMA 1PZEA 3QHPA 2DFTA 1AOXA 1J8YF 2A9OA 4EB3A 3GGCA 1DO0A 1JLHA 2Y3IA 2F55A 2ES4A 2GS9A 2AZDA 3ZW8A 4ZYYA 5DNVA 1AUPA 1TD1A 4I50F 3SK0A 4TMWA 1MTOA 4ON9A 3JTEA 2RH9B 1L8LA 3PHBE 4HCJA 4ZOCA 4HGRA 4YWHA 3VOTA 4B7ZA 3JRWA 4Y2XA 4XYGA 1FZQA 1DJQA 1WVGA 4ZAYA 5BMVF 3DJFA 3MAAC 3OX2A 4G01B 2FPLA 1P7WA 4Z9BA 4BO9A 1OAAA 1FFEA 1TVEA 3A1TA 4ME6A 4CKWB 3M1IA 4Q9NA 3ASZA 5COQA 5IH3A 4CL8A 4DHEA 1A50B 4X64B 5AKEA 2CBXA 1IXRC 4DT1B 4PGHA 5DHTA 1IXYA 3SVTA 4N03A 4B2PA 3CXUA 1S4QA 1ZITA 3GDFA 1U99A 3SQWA 3CIFA 1YUMA 4JJ7A 2ZYGA 3EN0A 1M34B 1KSFX 2R8ZA 4ZEMA 2VEOA 2W6CX 2XTZA 4LBVA 1G63A 1Q1NA 3PDCA 3HS3A 3PZBA 4RM3A 5IMBA 1KSGA 3VTFA 1FRFS 2OUIA 3H5RA 2JGDB 4GM0A 4D92A 3KDSE 5BN5B 1HYBA 5G1OA 5JY1A 3GX1A 4BEWA 3I34X 1BOOA 4Q05A 4KXLA 3OZUA 4MGZR 5LCXA 5G0SA 4Q24A 4D9HA 4GW3A 2R6ZA 1UZMA 2MR5A 3JARB 2V7EA 3GG2A 4P3PA 1VBMA 2JH9A 4NULA 4UHHA 3OT1A 1OT3A 4PRKA 4URHA 1H3FA 4W5TA 4IW3B 4ZU3A 4YP5A 1XFDA 5AOCA 1GKLA 3B9QA 4TWAA 1E20A 3WMGA 4JR2A 5CG2A 4KLAA 2CMDA 3FGPA 4PW0A 2XOXA 1NQAO 3ND6A 1FLVA 1X77A 1WUYA 3GJXC 2IYSA 3QYAA 4LNHA 3VZRA 5JH7B 3K05A 1RM0A 3F98A 3TZCA 2B0CA 3ICEA 1XPRA 4C2TA 2WG0A 5EG5A 2RONA 1FFCA 1FXSA 1KC3A 1L5YA 3NNNA 1WP4A 2DWCA 1M6WA 1Y3BE 4UZSA 4DV5B 1JDSA 1TU4A 1XDBA 4QOIA 3JYOA 3NM5A 4FGSA 3I5YA 2N0SA 1COWA 1HMPA 3D8UA 3DYVA 2CVPA 2GD0A 3BFXA 4B74A 1N4DA 4YT4A 1CR0A 5JDIA 4DV1B 4ZJZA 2GA8A 4H3VA 3A6JA 1TM3E 1N3LA 2GKGA 1NBEA 1V39A 2NM0A 3GO4A 3OZIA 4HQFA 5FCDA 5E0OA 2QD1A 2Z30A 3OJWA 4L4XA 4OH7A 3D59A 4EO7A 1IBKB 4H7PA 1JTEA 2CBGA 2EL7A 3R77A 2Q9BA 3FI0A 4LYJA 2LR0A 2DZDA 2ICAA 4UU7A 4DLVA 2DY0A 2WUGA 1NUAA 2VA8A 2B4QA 3LWBA 1X7GA 1ZM2A 4OQPA 3GRPA 4EHDA 3HFSA 2IH5A 5DOZA 1I5EA 2I29A 1LPSA 1JEQA 1L7PA 1ZG3A 3CE9A 4E46A 2ZZNA 4TYWA 4CFZA 1RXUA 1ZM3A 1MN6A 4KN9S 4JUAA 2ZI5A 1P4RA 1NQXA 1ZK2A 2OB2A 2O7SA 4OA5A 3ZE0B 2QBYA 2XA2A 1O2DA 4BZPA 5BRAA 2PKYX 1AKEA 2GHRA 2IOHA 1YZKA 2A5GA 2DETA 4JL6A 1XWFA 2CEAA 3AW9A 5IAAA 2YKGA 3G8YA 4GWLA 4OJYA 3E5MA 5EMNA 5IS2A 1MZPA 5L4SA 5IUKC 3DFZA 2Q4OA 2J3JA 3DUFA 4RTKA 2DQZA 2TMGA 4XYLA 1FNSA 3ZHUA 2XHEA 1ONSA 1E3QA 4PTYA 1U9IA 3BL5A 3C43A 3KFLA 2Q5LA 3LXMA 1SXJC 4R6XA 3DAHA 4OXXA 2DG2A 2XMGA 4UFPA 4G1VA 2FQWA 2AOUB 5IAKA 2PSDA 5BOVA 4LWOA 5C52B 4DC1A 4WFIA 2UUOA 2BEVA 1SG0A 2GVNA 1GA1A 4BO0A 3BK1A 4F86A 4FINA 3Q6MA 4BVEA 3QGMA 1AA6A 3UAVA 3UGTA 1TYEB 2C78A 2GYYA 3S70A 3L7JA 4JI6B 4G4SP 2CL6X 2AR7A 2NYVA 3DCNA 4AWBA 5LLDA 4TWZA 2ZRNA 1QGOA 3DBLA 3LUGA 3CUYA 1N2EA 2IPOA 2C9BA 1DJMA 3HL0A 1NXQA 2OD7A 2R79A 3L0OA 3MWDB 1GRVA 3PYLA 3R0XA 2XUDA 4Y18A 4UUAA 2XTNA 5D86A 2KMLA 3GFTA 1QYRA 3T5CA 3KXPA 4O63O 3PI7A 3Q85A 3U1BA 3VVBA 1J2TA 3VM6A 4JK3A 2RK3A 4F7WA 1QQBA 1RYFA 3KQVA 1U4SA 4S0XA 3R3JA 3HFRA 4J0IA 5JO9A 4D8TA 1BCSB 5DRYA 3WADA 3UMMA 1W75A 1N5LA 2IHYA 5DIFA 4IIYA 4QFCA 1IBSA 3QV1A 2VF2A 2QE7D 5GVRA 1DTWB 4ND8A 1I2DA 5HKKA 4W5WA 4BMZA 1ZGJA 2H6EA 2J9RA 3O1JC 1FE8A 3T1QA 1PT8A 2ZRMA 5JQGB 2C2WA 1F38A 1I0IA 2E4YA 4URUR 3ELBA 1WABA 3IQDB 4EY8A 2NW6A 3TUZC 3W2FA 1RLOA 2D2IA 1TYZA 1AQNA 2DF8A 1Y3FE 4B3MB 2NACA 1UXJA 3RUHA 1KJWA 3I05A 4GAEA 4BMVA 5J2UA 1RQLA 1KJIA 1XZAA 1QX4A 1WUTA 1EFDN 3Q0IA 2QV7A 3QVJA 2XQVA 4HDNA 4WCFC 2OHVA 4E5KA 1QFZA 1HQKA 1RACA 2P2SA 4ZI7A 3CCCA 3DW1X 4EL0A 4UTNA 4D6YA 1S7GA 4JXZA 5AW9A 3ZJYA 5FBHA 3JQ9C 4MSUA 5IM5A 5A6SA 4DLLA 3EC1A 3ZWQA 1TJ5A 2PBLA 1OIXA 1ZSYA 1QGUB 4YYEA 2DERA 5B64A 1AS0A 2YHAA 2YXPX 3AZQA 1FTGA 4J0FA 4PRZA 4OLBA 3ROZA 3PICA 2YWRA 5TQ2A 1Z0FA 1M8JA 1RWVA 1YKGA 2V3VA 5LXTA 5LQAA 3U9SA 3ICOA 4R51A 3L07A 3SR0A 2XCSB 4UCFA 1UC9A 1X9HA 1TQDA 1UXGA 3MUOA 4BE9A 1NYLA 1TM5E 3Q0TA 4HNHA 4NJEB 4XPZA 3T4PA 4CMIA 2PH5A 2WFLB 4FYXA 4R8KA 3ZX5A 1P29A 4TM7A 3TDNA 3WK8A 3UPUA 3UW3A 4OX9Y 5JHGB 5K6AA 5KYNA 1VLQA 4J7UA 3ESDA 5EQTA 1AMNA 4LOIA 4MEBA 3DC2A 4HNQA 3NNSA 4G1CA 4LF4B 1B2RA 3L7NA 1E9AA 4J0HA 2OHOA 4A7PA 3RYCB 2IYNA 4JI8B 4CVNA 4KR7A 3LQFA 3JSAA 5JRDS 4MKZA 1XALA 5BNTA 5DBFA 5ALIA 2B2NA 3W2EA 1O4VA 4JVOA 4HPXB 1MNAA 1RAEA 4IKEA 3MT7A 5AM3A 4UOEA 4LHVA 3P9ZA 3JQRA 2PIDA 1OXMA 3OU6A 4P3OA 2XKKA 4B7XA 2JFHA 1OLSA 2FPWA 3SEZA 4Z7NB 2FMXA 2WTBA 2WSBA 3W3AH 1QRDA 1TK2A 3U37A 5T8KA 1AS3A 1JQ5A 3SQNA 5E3HA 2CMGA 721PA 5EUMA 2ZSHA 5T3YA 1IONA 1R0ZA 1M2FA 5A4KA 2WWTA 4EB6A 3LMKA 2C96A 2FZKA 4RZQA 4E4YA 1QK3A 2XGSA 4BNIA 1HNWB 1TPZA 2B7LA 1KBOA 3W9SA 4JNKA 1N77A 2JF0A 2XA1A 4P4LA 1YQTA 1FDSA 1C7IA 1TCBA 1A0OA 2BKUA 2QVGA 3IPXA 3WLFA 5EP4A 3K35A 4I4TF 4QEDA 4ND1A 1E2UA 1NR7A 4TLMB 3WYNA 4FS3A 4ARZA 5I4IA 3PXAA 3VR4A 3I1FA 2PPLA 2O2CA 1NF8A 3CUSA 2P6MA 1W29A 3L49A 5BV7A 2H7VA 3B3QA 5DI9A 1GAQA 1A8HA 3JTMA 2HXGA 4I14A 3UK6A 3EXIA 5T3UA 4CIBA 2BFAA 1QPZA 2UAGA 3MEQA 1XMXA 2I2AA 1IY1A 3DL2A 3IC5A 4BGEA 3ZNQA 4BBZA 2H5JA 3RUPA 2JJ1D 1GEGA 4DMKA 4EK9A 5HSGA 1GA4A 5F51A 1K3UB 4FYKA 5AJUA 3SSNA 2LIPA 4JR1A 1J25A 1IXKA 4QDOA 1OB5A 1ZK1A 3DDUA 2HMUA 3KQQA 1BXZA 4MLDA 1SBZA 3IHLA 4FFDA 4C01A 4AZWA 1Z6XA 4O33A 2ERCA 1HEYA 1SXJD 3LUJA 4P4UA 2VTKA 3TQTA 2ATXA 4BEBA 3VC2A 1GHTA 2G06A 1UBCA 1L5LA 4ODIA 3II6X 3SAJA 3L6CA 5JSZA 3NZEA 3QEMA 4YWJA 4YMUA 1F2DA 3KLBA 5EJGA 3V8PA 2Q8NA 2A14A 1E2MA 1X0XA 2QY6A 2ZYHA 4IV8A 4KYUA 1P61B 2EVWX 3TG8A 2YUTA 2FEWB 5C53B 2RHCA 5JAQA 3A05A 2FR1A 1GGHA 4QUHA 4AMZA 2OGWA 1DBWA 2IYEA 4BIIA 1N7GA 2NO0A 1K8QA 3DL4A 3KZOA 2CVFA 4L7VA 4JV5B 1KVUA 3H4VA 2RGCA 1BEEA 3O2JA 1O96A 3PL5A 1LBSA 1EUZA 2P2GA 4G84A 4KVAA 4MDYA 5U4QA 4J3NA 4DMCA 3T3EA 4X6YA 2YYAA 4ZTUB 1OASA 1ZLYA 3F5MA 3GAMA 2CLOB 3N86A 2WF6A 1TA9A 1RD4A 3SZLA 4YMLA 4EPTA 3H6HA 2Q46A 2P9GA 2X3FA 4NOKA 4R3WA 4RV9A 3HCNA 3F8WA 3RU3A 3TLYA 3FPHA 1YIDA 2EKZA 1DJOA 3I73A 4B3TB 4KFCA 1U02A 2PSJA 3CYFA 3EVTA 3NHMA 4EUHA 2B78A 1TQ8A 1U7XA 1JKXA 2BKLA 4GMHA 4MS3B 1UDBA 2EC5A 2XUJA 1WQ3A 5GQSA 2OXTA 3R75A 1E3WB 4AMVA 1NVGA 2XVZA 4KV7A 2P40A 4LJYA 2ZYUX 4U0KA 3G5UA 4RAQA 2J3EA 2B3DA 2NU7B 3T9CA 1U8UA 4MRVA 3ZWNA 1Y5NA 3LYHA 3B7WA 5BVHB 2NQ2C 2IGTA 2O06A 4F3TA 3LCUA 2H29A 1N5DA 4ZD6A 4AJIA 2VQSA 3RVDA 2AI3A 4EAAA 1F7UA 2OXEA 4MPJA 4MKIA 1VE5A 2F64A 1O94C 1P8JA 4GWKA 5G4KA 1HLPA 4ENSA 2YJ6A 1U2TA 3DOEA 1P18A 1P2UA 2VP6A 1S01A 3GLKA 3UMYA 4PYMA 3IH5A 4QU8A 2BR3A 2ZUCA 3GRRA 4OQZA 5D8DA 1WCIB 3ITDA 4CV3A 2JKZA 4OAQA 3NOXA 3ESQA 1VMEA 3OCCA 3OUUA 3DFMA 4K6CA 1E1CB 4Q9AA 3RFCA 5K05A 4MHTA 2QDXA 1CJUC 1U8TA 1KI2A 4YDRA 1X7ZA 5BR1A 3X44A 2FWRA 3PJRA 3FFTA 2GRJA 3GLHA 1LPNA 3TOCA 4D5GA 3F6YA 2JG3A 2HO4A 3I23A 1BHSA 3TQOA 4G5SA 2E87A 2GAAA 3TTTA 2RGYA 4AX4A 2IIVA 3KJIA 3WOHA 1EFPB 4AYXA 3RRYA 3K2IA 1HZJA 2C2BA 1AGYA 2CSXA 2HA7A 3OCXA 4AUKA 4QUKA 2QW1A 4E2XA 4F5ZA 3QH4A 1FEZA 1D6SA 1KEKA 1EGHA 5DNYB 3KQPA 2CB9A 2LCFA 4D9KA 1UCFA 1T36A 3H42B 2RC6A 4BMNA 5CFLA 4RF2A 3DM9B 4JGIA 1U8ZA 5LA6A 3UTCA 4OLHA 4KL8S 4OXIA 4YR9A 5CVVA 1Y1RA 3KHSA 3WDSA 1VJRA 2H59A 3HRKA 2LZ0A 4Q39A 3PTZA 3DO5A 1GKUB 1QX3A 3I0ZA 4FE3A 3RS5A 5K8JB 1XFAA 1C8KA 3HCDA 1MB2A 4LHSA 1DMRA 3DWEX 2I34A 3PR2B 3QLUA 1SXPA 5JNUA 3PEUA 4DDTA 3H4IA 4MWSA 4R1SA 4BVFA 1C29B 5JJ5A 1XJWA 3SYNA 3QVSA 4QLBA 2Q6VA 4EG5A 2HJRA 3GGPA 1NY5A 4KN6A 2BFBB 4HUQB 2FFRA 1O57A 3OM8A 4D97A 3A3NA 4PQFA 1L5QA 3GRUA 2FZ5A 1GTVA 4GGPA 3BH0A 2YVAA 3U5ZB 3F6PA 4ZAVA 1XTKA 3RLIA 2KLHA 4OLJA 3ZJVA 1UDRA 1G8MA 4CTKA 1W5TA 3GT3A 1A7KA 1K7FB 1KY3A 1PDVA 1UPAA 5FTNA 3C6KA 1NXXA 1R0WA 4FEGA 4N9WA 5T64A 4B1FA 1I6MA 2BGWA 4U2FA 2H9IA 2RHOA 2EJCA 4FCWA 1GQRA 4MUYA 3OIYA 4EA8A 3D4IA 1PR9A 1BGVA 2D7CA 5ADHA 4F4HA 2C31A 5M29A 3ZQ6A 1RYZA 3FYDA 1OA1A 2IPNA 3AG5A 4HXYA 1Z7WA 4CEIB 1I7QB 4G6ZA 2I7DA 1OI7A 1BFUA 4KBYA 3PLAE 3KZMA 3A4VA 3BQMB 1SM4A 5E9JA 8AT1A 4XZ3A 2D8AA 3UCXA 1YA8A 3KCQA 3NXKA 3ZGXA 1QVWA 2YBEA 1EVIA 2OR3A 4G0UA 5K0EA 1IWBB 1GGJA 3GJ3A 4HH1A 3CPEA 4TTAA 3GP5A 2W70A 2ACWA 3GEPA 3RREA 3ZYCA 2F4NA 2F1HA 3O31A 4MYTA 4EFDA 1ID1A 4AB1A 3F6CA 1KY4A 7ADHA 3D1LA 4NCKA 1J1IA 2J46A 4BV2A 4BP9A 1PCXA 4NV0A 4CFYA 2E6KA 4V1CA 4QD3A 4RXUA 3OQVA 4BP1A 1XRSB 5JAZA 4LHYA 3T7SA 2I2CA 1Y5RA 2AMJA 2VYNA 2I1LA 2JHCA 1XDWA 5G0TA 3EF1A 3L9XA 3O83A 5I51A 2X0DA 3L77A 4IHJA 5GMOA 1A69A 5ESRA 2BBSA 2MSNA 2QTGA 3B9PA 3L2OB 3ID6C 5FFFA 4BGDA 1TTTA 2E2WA 2O05A 2KBFA 1GOTA 3GJ4A 4H7JA 3VNVA 3G0HA 3N75A 3PQCA 3KZNA 4KQXA 5T4HA 4IHQA 3NOQA 1JKIA 3R3HA 3R76A 3WFJA 4ZK6A 5A1TA 5CEJA 2J4DA 2NV6A 1IM5A 4C7OA 1KMCA 1WLYA 2RMKA 4NZOA 3WP0A 1MQAA 2I3AA 3EXHB 3LFHA 2GAOA 3S1AA 1EJ2A 2PUAA 2Z5VA 1L8AA 1RCFA 4XWTA 2YWBA 3HRIA 1U0HC 3HYTA 2VAWA 2VRWA 4W6QA 1TI7A 1WX1A 3QKIA 4UVDA 1L7MA 1QAMA 2FWMX 3NIFB 1T2NA 4QAJA 3T1VA 1ZL0A 2IF2A 4BE7B 1GV0A 2IYXA 1GL6A 3IVXA 3EY4A 1YJAA 1NW7A 2VTDA 3B3FA 4LDAA 3NVMB 3QV2A 4LWQA 5G41A 4Z7OB 1L4LA 2OZPA 2GZMA 1OJLA 1WBBA 1C0PA 2OBXA 2F3PA 4M1WA 5FR2A 4B6OA 1E2BA 1PWZA 2PX8A 3PJGA 3FZGA 4CODB 1N6KA 2ZIEA 1RQRA 1UM9A 1DJNA 4XPIB 4E33A 2ZJ3A 3IAM1 1XNJA 5CLIA 3KUXA 4LF9B 4RFSA 5FEUA 4C6HA 1P6XA 4FKZA 1O94D 5FOQA 1Z0ZA 2BI7A 3TVYA 4PZ9A 4MUKA 3H2BA 4DJTA 1YAHA 4Z7JA 1EHYA 2RB4A 2W2LA 4ZEXA 5C8YB 2DTEA 2O0KA 2HRZA 2Z3VA 2EJTA 1QYCA 3A7EA 3NC4A 5EYPB 3WGHA 4M8LA 3HU2A 4HRVA 5JDIC 5JQWA 1X80B 2OFXA 1C1YA 1JJ7A 3PQ7A 3QEAZ 2IXDA 1W4AA 2QRGA 4JI7B 3WGGA 4CFSA 1E96A 3QVGA 2XSZD 2G5CA 4PWZA 2B1GA 1R7RA 4YFYA 2VR1A 5D7BA 3W5IA 3BMQB 1E7RA 1PBTA 4AP5A 4V0SA 3RSLA 3G13A 3BWBA 4C22A 1QU3A 1HLFA 3TSYA 3KUCA 1ULBA 5E7IA 4UEKA 3L6DA 1CETA 2JARA 2W2PA 4FC7A 2Y77A 4YRDA 3C70A 2WSYB 3C97A 3JR3A 4HSEA 1P4HA 1IRXA 2UYYA 1JT2A 3NIWA 1R8YA 3R7WA 5JZSA 2VP5A 5IJXA 5AKGA 2O2XA 1SBCA 1Q14A 2AFIA 1AGNA 1KA9H 1CHDA 1XMQB 4DWVA 3DF9A 1DQZA 3R3WA 4WBNA 1QM5A 4IILA 2I6QA 3BC1A 4RO0A 1X19A 3S2EA 3E7DA 3GBVA 4HX5A 4CV1A 2OO7A 2OEPA 1DAEA 3K9CA 2CVOA 1KEPA 4XDGA 5EKXA 1U9IC 1IQUA 4PVCA 4XGNA 2VZ8A 4QLOA 1HDRA 3GFOA 4F4CA 4H15A 1T1JA 2QF7A 4OSOA 1QWSA 1C1HA 2LNDA 3IUEA 3JVUA 2A9VA 4JT2A 5TQJA 4CW7A 4IWNA 1Y63A 3H16A 4BQOA 3TE6A 2AOTA 4KE9A 4HH3C 4IH4A 5FFNA 4HVAA 1PL6A 2AJDA 1U2QA 2GHIA 2XADA 3CT4A 2W0SA 1IWOA 5HDQA 1DWUA 1R8JA 2GTHA 2X0KA 4XKJA 2YNMC 1JZQA 1STOA 4C0JA 5KTYA 5IT9A 4AQ7A 4DLKA 5J43A 2ZJ1A 3SD7A 3LDGA 3BIJA 3G2OA 3OC0A 3ZOKA 3ACDA 3B12A 3WB1A 2YRFA 2Z83A 3V2UA 1OUMA 4DQ0A 3DMFA 3ROQA 4DR4B 1KMNA 4EO9A 1HOTA 5JT1A 3DQPA 2VH5R 2WAXA 3NOOA 2O52A 2Z2JA 1OX4B 2OV4A 3TB6A 3DT8A 2FN7A 2DFVA 2BM0A 4MLCA 1N7IA 4E2ZA 5H82A 1C7ZA 1SR8A 2B3TA 2CLHB 3IUNA 2FKNA 3A6GA 5JEDA 1BEUB 2QMEA 2GZ1A 2ZUTA 5DNDA 3RC1A 4K8RB 2JPDA 2DYKA 2X8JB 1PEDA 2C8LA 1NOKA 2ZRBA 2P4UA 2VF8A 3G0BA 4Q12A 4RVFA 3ROEA 3W90A 5D2CA 3GLVA 2P7HA 4FGLA 4F21A 2MIIA 3R3UA 1JAHA 3VKFA 4NMWA 1K8ZB 5AOBA 1H4QA 4EPYA 4CCAA 2K6GA 2VCYA 4NZPA 3TH5A 1C8BA 4K6GA 1WUIS 4RHFA 4ZYWA 2PGNA 1WNFA 3EGDB 1XRMA 1XXHB 1SA0A 2WD8A 3I0NA 3PE4A 2QRMA 3TAHA 3U44B 4XWWA 4RETA 1G55A 4RPIA 3SXPA 1U0TA 4C7KA 4D3YA 1U3DA 4G63A 4DILA 4DRZA 4B3SB 4U5XA 3V2GA 1IPEA 2FRDC 3GLFE 5B1SA 3D64A 3ENQA 4C88A 5C8ZA 5F3WB 2RIRA 3A32A 4WACA 5F3RA 1K8XB 3OZXA 4F2PA 3DDWA 4QTXA 5KX5B 4X8OA 4Z9FA 1COZA 4UMVA 4BNGA 1PX2A 3HEMA 3PIIA 1I0LA 1KGDA 4I1UA 4X45A 2P6NA 4YMTA 2GN8A 1YTUA 1MHPA 1H93A 2EDAA 4A92A 2JK1A 4RCVA 4MUIA 2QLFA 2Q3FA 5CJJA 4DJFC 3AY0A 4PLZA 1XJQA 5EXEA 2IBMA 4LYFA 4PC3A 5C31A 1QJ4A 1XKQA 3E15A 4N5LA 1ECFA 2QLBA 1VGVA 5DJ5A 3G49A 4A1FA 5EESA 3EVNA 2RHWA 4RY2A 3ILXA 5ITZA 3V3TA 1B1CA 5DHRA 3UWOA 2L42A 4BO3A 1O9HA 4A4DA 1MOPA 4P22A 4YQYA 3THXB 2WSSA 5JBIA 4PXYA 3PE6A 2CW5A 3CKMA 2ZDGA 3N2EA 4US1R 2GOYA 5CDYA 5LQKA 1CVRA 1EWRA 4MV8A 1HKHA 1WTCA 1ISMA 1DOAA 3IKMB 1EHIA 2RGAA 5IFKA 2VBGA 3AFNA 2WJAA 1XEAA 3C3MA 3E3OA 1JQDA 2XNJA 2P5SA 3IBFA 3HN2A 5DYIA 4E51A 2PTHA 1UXHA 3IV7A 3B1XA 3C2QA 1FNMA 4YQFA 3WFIA 2D62A 2WBLC 3ETEA 5F1KA 2OPBA 1JDJA 1WEKA 1XTVA 1FFBA 1N6OA 1QS0A 1W581 4DCVA 3LC0A 2HF9A 1MX3A 4TV8B 1QTIA 3E03A 3IOEA 1Z4QA 4R31A 1YZ3A 1YK0A 3JQAB 1MA3A 1U0FA 5LUAA 4GL2A 3EZ9A 1QGYA 4L6IA 3VH2A 5EQJB 2C1XA 4P8RA 4LGCA 4IGKA 4KO8A 4TTVA 5HIIA 3KS9A 3I3SR 1W52X 3MINB 4E5PA 4ZZIA 3QW4B 4RPHA 3VKWA 1GGFA 3T1TA 3F4LA 1NLFA 1ZD1A 3GYBA 4EG7A 2V9CA 2HDNB 3GMSA 3UN1A 1BE8A 1C9KA 5CR9A 3GMIA 1KE1A 3K16A 2EEZA 3L18A 4QM7A 3SQMA 2XQIA 3J81A 2UYQA 4PO3X 1YU6A 2ZUUA 1BS2A 1J8MF 4GECA 3KYDB 5HNKA 2O8EA 1JEJA 1CULC 3F5QA 2GVDC 1ODCA 1P5FA 1Y1QA 3ZWAA 2PO7A 4PYQA 1QDEA 3KVNA 3C1AA 2G28A 1WCV1 3DPUA 1N3YA 1QIFA 4L07A 2OGSA 4HVTA 2ZUVA 3BKXA 1WF3A 2O4UX 3GT7A 3LGXA 4M9QA 1QP7A 2YVKA 4ZQHA 4E31A 4PICA 2V7UA 4NAHA 4KLRA 2MCFA 1JTFA 1I5OA 2R8OA 1DKQA 1ORTA 5TNXA 5GINE 3P2MA 1AQIA 3JWHA 1E77A 3CB4A 2V4UA 4YRIA 4MJLA 1Y9EA 1EVEA 2GB4A 3ZQUA 5KTSA 2GN0A 2ZDQA 3JQGA 4CQLA 1UJ6A 5K0JA 4KQ2A 4E13A 2CK3A 3L8EA 4L50A 2Y9MB 2XIQA 5G0UA 5SY9A 5A62A 3UT6A 3WGVA 1G6OA 1UBUS 5A4FS 4OQMA 2R6FA 4I8XA 3ZKAA 4YC7A 1NQUA 1HT1E 1FXUA 1YRYE 1ODKA 1ZD8A 2YNMD 5MGBA 4ASUA 2XAAA 1T9GS 1P4AA 1FFDA 4PGAA 3VJKA 1JR3E 3ZHRA 5LQDA 1UOQA 4K9SA 4JYPA 4O4LB 5GONB 1GGVA 4BMDA 1GSIA 4EIWA 2VT7A 4HBGA 4FOLA 3KD3A 3EEIA 2XR1A 1JRLA 2CBZA 2RGDA 4OB7A 3G85A 4JCCA 2CSUA 2EP8A 1K97A 1YWGO 4MAAA 3N2GB 4M4SA 2QM7A 3KOUA 3SVLA 4MUXA 2WSMA 3W8RA 4C2UA 1C3OB 1K7YA 1GG9A 2DBQA 2IPMA 3K7EA 3REOA 3DE4X 3EC2A 2EQBA 2G0NA 1F5NA 2WM2A 3FBGA 4H4DA 1Y7HA 4OH1A 4ZOEA 5FNVA 5SZIA 1ND6A 3OWOA 1F2UB 1NTRA 5KYYA 2JASA 2HSZA 3U6BA 5HF8A 1JIKA 1H5NA 1VSQA 5JXWA 5K4HA 6PFKA 1GAJA 3OLCX 3I9OA 4CRWB 2EP5A 3A06A 3UWDA 3WX0A 5IJWA 2QU8A 1UXOA 5ICFA 1FFXA 1DT3A 3CWCA 3ODPA 4A5SA 1WMBA 3DGFC 1QRSA 4Q1FA 2HA6A 4FWIB 3SS9X 1VE3A 2JIMA 4TTPA 3S8MA 3ZIUA 2QM0A 3E81A 4B4UA 4KODA 3RT7A 2UXBB 3ZTWA 3S1LA 1RXSA 4UM9D 5HRUA 1PSWA 2F9LA 3D3NA 2VYFA 4YIHA 4RE6A 2XDYA 3VHQA 4NU6A 2ZANA 3FBTA 1VIVA 4PAWA 3OPVA 5KQGA 1V43A 4V3CA 4LK2A 3B9RA 1GKIA 1CBUA 3MJRA 2ISCA 5ELMA 1YQWA 2WABA 1FUUA 2VSXA 3O8OB 2B8EA 4RABA 4A10A 1AF7A 4K9OA 4F9EA 4UDYX 3HGTA 1KEVA 4AG6A 1D7AA 1WB9A 3NANA 3QKWA 4GXQA 3IMKA 4EKYA 2UU9B 2WJVA 3G6KA 3UYKA 5JH7F 4IXMA 4CMHA 5JSUA 4ZT2A 2VDKB 4YJHA 4X00A 2PRKA 1VMDA 3DOHA 3AI2A 1SN7A 3GA0A 4H2DA 2O9JA 4L9AA 1V7CA 4NNPA 1FSPA 1NDHA 5KWVA 3ONEA 5A02A 3E82A 4P93A 1YQXA 3MELA 4D4LA 3DV0A 2VZ0A 2DX7A 5GV7A 1B16A 3FDJA 4EUEA 4YX9A 5MN4A 16PKA 1J1UA 1YVUA 3PGMA 1XYVA 2HF7A 3FUTA 2FLKA 4KN5A 4KV9A 2P30A 4S1VA 1ZPDA 2CHUA 5K01A 4JFRA 5D3ZA 1U3WA 1CT9A 4JELA 4FIDA 2F59A 3W5SA 3UW1A 4CG0A 2F9MA 1UF9A 1GG8A 1ZGCA 5ALZA 4NR0A 4F2WA 3QLUC 3LLSA 5H9WA 2JIOA 3A9SA 4MITA 4DV3B 4URFA 1AGPA 3GZJA 1EQ2A 5AM4A 3AF6A 2DFDA 3F49S 4DPMA 1JFRA 3AH8A 1PWEA 4HB2A 5JO0A 2M6SA 1O9GA 3I8XA 5AW0A 1YU9A 3DZFA 1O6GA 4NQZA 1F4LA 1A4RA 3K0KA 3AETB 4HPJB 4AAYA 3BHIA 4JB3A 3SXUA 1U3FA 1ESNA 1U1DA 3W4IA 1V1MA 3QXXA 4PAOA 1CZLA 3QPWA 3IJEB 3LCMA 3EH2A 3EVAA 2CVZA 4OAPA 1O54A 1MRSA 2RKWA 1P80A 4F96A 4MV6A 3GK3A 1TA0A 4BNDA 5L7TA 4C3OB 2ZRIA 1U1EA 2P9BA 5A5FA 1W73A 4ZRMA 4F84A 5EXDA 2JGIA 3VR4D 1CC1S 1XZQA 2JJ2A 2OFOA 4JDUA 2GDZA 2PQ0A 2ZCJA 3DLHA 2WRZA 4D3DA 1Z4IA 4PQGA 4WJZA 3GT4A 3OLWA 1RS0A 4P6VF 2GKOA 4Q4HA 3VBEA 1QHNA 2X4IA 5EIHA 1A1VA 4JJZA 5FL7A 1TTHA 4EWLA 4BLWA 4GUAA 1WXIA 3O26A 5FWYA 5FIUA 3NKLA 4Q0MA 4YCCA 1CVLA 2HYIC 3HVIA 4W99A 4PZPA 4KE6A 4TLBA 3GU3A 2OOKA 1PDOA 1TIPA 1IJBA 5CVEA 3TVTA 3VDQA 3CUKA 1GGEA 5JHHB 5JJBA 1ARZA 1UMDA 2RK4A 4QT4A 3Q3HA 4BN5A 5A3SA 4MRAA 4P84A 4Z9YA 5EJ9A 2XTMA 3IEXA 2NVUA 4L4SA 1GNRA 5CB4A 3WA6A 2VNKA 3NO4A 2Q3DA 3MJCA 3C7DB 3O82A 3OLVA 4NHOA 1QP8A 2CHGA 2IPLA 4B8ZA 1ZGZA 1JECA 1LNQA 3T9DA 4WXHA 3FFWA 4YRSA 3FYUA 4TKZA 4YMIA 1J2YA 4G8BA 3LOPA 4TYMA 5ADUS 1PQYA 2P75A 1U2EA 2VVTA 2I87A 4GD3Q 3BIFA 3G7UA 2TMDA 3IPYA 4HB3A 4QYXA 4BRWA 4LJLA 3U9TA 3JRXA 5H80A 4JN6B 4MKGA 1KFEB 4DFDA 3KJHA 3X1YA 5INTA 5JQGF 1G2IA 1YBHA 2AQKA 3EIEA 5FLEX 8OHMA 2VQEB 3GROA 1QHHB 1R0KA 2WTAA 1TM7E 1BA2A 3CUUA 2R1VB 3FYHA 3OE4A 3OQIA 4GLJA 3HBFA 3M83A 4FXOA 1VKHA 1VI2A 4RGYA 2N42A 5EGSA 4BKPA 5KOHB 2Q2VA 3QM1A 2EYQA 3LHSA 1X2EA 4G9BA 4OEHA 3JY6A 3PA8A 4G8DA 2W90A 3EF0A 3GOQA 4PV7A 1VBKA 3P9SA 1XPOA 3PKZA 2RHGB 2XUGA 4MROA 4OBEA 1Z08A 1E7MA 1EE2A 3PUYA 3D4OA 1L7NA 4WXEA 2AQHA 1T35A 2A1UA 3JVDA 4MR7B 3Q11A 4M99A 4DS3A 5HE9A 3ZWMA 1SVUA 1W5BA 1EI9A 1WD7A 2PMDA 1A27A 1QRRA 2ZJOA 4WNIA 5A5EA 4PBRA 1LXCA 3G7SA 4Y0AA 3DZGA 3FZNA 3I28A 3BSSA 5E2AA 3R74A 2VDNB 1S8OA 1DO2A 3O73A 2TSYB 2BCEA 3UJ7A 1CP3A 4EGCB 4MLZA 5JTUA 4C20A 3RFUA 1QSGA 4BCBA 2OCIA 4UEJA 2D2EA 3FTQA 3PWZA 4I55A 4QGFA 3E5HA 1E2QA 3OZFA 4Z9AA 3HM9A 2WILA 1DBIA 1GT6A 1P1FA 2PVSA 3KEFA 4HP8A 3BOSA 2QD2A 2C4UA 1KEZA 4FHCA 4DV4B 3PSAA 2OK8A 4IICA 4FVTA 1JS1X 4IOKA 4LC0A 2GN9A 4KGZA 4WERA 4YA6A 5HXAA 2WEKA 3E53A 2OXCA 4DDUA 5AQEA 2B4RO 2OHHA 4JITA 1G42A 1L4HA 3EOBI 4HAIA 4RZHA 1QZXA 5HUJA 2P9HA 4PYKA 4RVSA 3NC1C 2PRYA 1GYPA 4WNCA 1Q1AA 1U9ZA 2V7QA 3JQ7B 1QGDA 1H1LB 4XLLA 1RE0A 4MRMB 4AO8A 1ISFA 5IN4A 3D3WA 1VL8A 1SQ5A 4BEJA 1AMOA 1M2HA 2VHJA 5NLLA 3D6AA 3KZ1E 2J0UA 4A8JA 1UEIA 4BLRA 1TYBE 5DLYA 1PVOA 1SUWA 4Y6LA 1Q21A 4YAEA 4F97A 3HY3A 4O8ZA 3GJ6A 3ZCSA 1TJ3A 3EASA 1M8PA 1U3UA 2FX3A 4MGKR 4NE2A 3SBDA 1WMDA 2BFMA 1X0VA 2BONA 2P5TB 1M6EX 2P5YA 2VYCA 4WEQA 3E9YA 3W5HA 2GZDA 2VDWB 2NZXA 2YJGA 1QIKA 4DC9A 3GLQA 4FSHA 5LL6P 3ZVLA 3QUAA 4I50A 5CDTA 2HMAA 3OOEA 4UFOA 2WPDA 2R8PA 4NLLA 2KI5A 3PC8A 4TN1A 4L02A 4MW2A 3SYTA 4H6WA 1C5KA 2YR0A 2O2IA 4OXQA 2MSDB 5BMVA 4HI0E 1JYSA 4A0RA 4CMGA 5LDDC 1MNQA 2JI9A 3S40A 1QZTA 1NBIA 1LX6A 2VHUA 2Z2ZA 2J3QA 3BJMA 3CSDA 4WTOA 1VL5A 3IA7A 3W6UA 4U6QA 5IM4F 4ER0A 4AYTA 4L85A 4LN1A 1T9AA 1PZGA 4D4HA 1P8AA 1YA4A 2NU6B 3COWA 1VGRA 3VU0A 3HXTA 2P5UA 4TTJA 4DSUA 2F8TA 1PR3A 2PWBA 5IJ9B 3U3ZA 3V80A 4LNUB 3RHFA 2HMWA 2R8RA 3L9WA 4ZEVA 1QU2A 1KO4A 3HNPA 2FSVC 2C2KA 4DMRA 3H1PA 4OI4A 4B6RA 5JTTA 4QARA 1SD1A 1ZK0A 3N53A 4MQUA 1H0RA 1NFFA 3I42A 4G5HA 3MJFA 4WN9A 3DZHA 1NG1A 4H08A 3ZWXA 1X74A 3PPIA 2XT9A 5HQJA 3LKZA 3MFYA 2OT3B 4YV2A 4OK5A 1ZSNA 3H84A 3DKRA 2PWYA 3HUDA 3WO0A 4LX0A 1G16A 1JSZA 4RWZA 4TZKA 4BKQA 3NRJA 5D5PA 5B7GA 4HNGA 4LK3A 5K0NA 3VI4B 3TKYA 2L17A 4LZWA 1JHPA 1F20A 2GETA 2AG0A 3DKVA 1QMGA 2AZTA 1Q2XA 2GM9A 1DEXA 1KJ9A 3B1ZA 3I39X 2O8DA 1WWKA 2VYND 4N0MA 1ZCBA 1DO8A 3KIPA 4R2JA 4JQOA 4UJ5A 2ORYA 3DNMA 4NU8X 3IEPA 1P1BA 4FOOA 1MIOB 1GTSA 2HY7A 4RA6A 2I4OA 4UTRA 1V11B 1OZ0A 1UKYA 1V5FA 2WZQA 4K9NA 3I5XA 5DN6D 3X1XA 2VAVA 1P5JA 1ZISA 3MMPA 2C5GA 4LTDA 5BN1A 3O93A 1AV7A 2EV9A 1TGYA 3V9AA 1H8HA 4HDRB 3R9IA 2QSJA 3R41A 2XUQA 4ZVNA 4BMPB 2R6JA 5FUMA 4MI6A 1X70A 5B12A 2YJ5A 4QOHA 1M2VB 2NUTA 4LQLA 2OO5C 1NWHA 2VHWA 1VL2A 5JS8A 3ZBPA 4DIFA 1HORA 3KR9A 3DO8A 3O6VA 4Q3DA 1C80A 2RHBA 3UWSA 1IEWA 2HM7A 2W98A 1DWPA 2JJ8A 4RJJA 4UVEA 5K0GA 1NU6A 1WL8A 4HMPA 4HXFB 1ZWLA 4OHBA 2YYZA 3IBCA 4CV0A 3N28A 3T35A 5LMCA 1T3HA 5CT9A 4B3DA 1N33B 3INNA 2WU3A 1E4EB 4BB0A 4YRAA 2X14A 5AI6A 4OQEA 2XVAA 4OXKA 3BX1A 4R98A 3RC9A 2CFOA 3RIHA 1VL6A 2W2LD 4L1KA 4FMBB 4FM9A 1L8QA 4ZT3A 1G20E 2C98A 1I8TA 3RM3A 4BX3A 2OBLA 4RPKA 2CLLB 3PQ8A 4LFBB 1ZMOA 3A4YA 4RIGA 2HHCA 3ZVRA 5CDFE 5HZHA 1MC1A 3FA2A 1NNEA 3P0EA 2B7BA 3OZVA 5CFMA 5JCXA 5DK4A 2W58A 4HAZA 5BVGB 2W2TA 3GQBB 3TEMA 1Z73A 2AZMA 2DOKA 2JZNA 1H5UA 4LZNA 4PRYA 4DSNA 1R10A 1A9XB 1YGYA 3H5LA 4KFTA 5IXJA 3AR2A 1NNSA 1RQNA 2CNBA 5JYEA 3JWPA 5J4VA 5C3UA 2ZAGA 5AW1A 3E9RA 5CH8A 5KUTA 1U8FO 1SQGA 1NVVR 3N8KA 2H2IA 2XNSA 4MV5A 3GIWA 5HJ7A 4YAKA 1MJFA 3DFFA 2O7QA 5I7FA 1LPPA 1MO6A 2NO9A 4WLNA 5JZVA 2C4KA 2YY5A 2O5VA 2Y1FA 2J87A 5ENVA 4E09A 1D2RA 1L4EA 1E0DA 3B6EA 2ENWA 2G9UA 3AY3A 4P1ZA 4CWAA 2VRNA 4JEIA 2OILA 2QB5A 3FJ1A 5IARA 3HFGA 2PL1A 2CLSA 1UXIA 3QKRB 3NBYC 1Q7RA 3ROGA 2AUMA 4KI0A 5AKLA 4C7JA 2BISA 1T2AA 2FPIB 4XTRA 3L1UA 2XEXA 5GV8A 2GEDA 1XVLA 1XEWX 1PNVA 2P4HX 5ICGA 3IR5A 1ADJA 5F1YA 2I2BA 2EP7A 4A82A 4DV2B 1NQOA 4D3FA 3GW8A 5A3JA 1QF9A 3LP8A 1GKKA 1C1XA 3G02A 3EDRA 1EFHA 2HA5A 1ZEJA 3VTKA 2ZJ7A 5EZSA 1LTHR 5K3SA 1RNLA 3WLAA 1RBYA 4ILEA 1QH9A 5LB2A 1K2VN 1R0LA 2EYUA 2O8NA 2V6GA 2EZ4A 3BF7A 4JJFA 4TL7A 5H81A 1GIAA 1CUJA 1RCTE 3WIUA 4DGSA 4JLOA 3QG5A 3NATA 3TE7A 4HAWA 4XD2A 3UQZA 3V1MA 4AS3A 1ZUWA 2IZ5A 1UMBB 3N70A 1ZJZA 3LT4A 1L1FA 4DQKA 4X90A 4GM1A 1DC6A 2QMYA 2ZIGA 1SUCA 3DMGA 4KVFA 4QEZA 8ADHA 1OZHA 5J4YA 3NHWA 1FDTA 4X62B 5EL0A 3IUSA 2V5VA 2ZIUB 3HR8A 4FBLA 5BP7A 2H4HA 3AI7A 4WXPA 1A2KC 5FPTA 4HADA 4KACA 3O1IC 1ZJJA 3A70A 1E2EA 2WU0A 2R00A 5I9SA 2WZBA 4AJOA 1UPTA 5KTMA 3B5EA 4CBVA 3ER8A 1WVIA 3LL7A 2BM8A 2QW0X 1Z6AA 2C4WA 1IOVA 3I3OA 4CDNA 2QR5A 3P45A 5DHUA 1C9MA 1WHSA 1ZIPA 2GESA 2OOSA 4KWHA 2AJ8A 1GPMA 2HH9A 3SX4A 4ZDJA 2G9ZA 4PNHA 4PPYA 2BFDA 3THWA 2XRMA 1BWPA 2PL9A 5ARBA 1IIRA 3PT5A 1VDMA 1E5XA 5JNTA 1IATA 2Y2UA 1HT0A 1R0CA 2OBNA 3A25A 2CF6A 3FWNA 5EE1A 1D04A 2O7VA 4DCMA 2ZWOA 2X8WA 5AI5A 2FB9A 2ACVA 5DO9A 4YT2A 1XHLA 2OXRA 5IDQA 1FDUA 3CEAA 3P9CA 2PAAA 3HKDB 3ZG6A 4D57A 4PTZA 4R1NA 1R4NA 2A3NA 4EH1A 4XSVA 4LKOA 4EFLA 7GPBA 4JFAA 2Y99A 2GX6A 4HNAB 4EHBA 1RMTA 3STVA 3VR0A 1W36B 1K5GA 4P92A 1ZBDA 4RLHA 4OUKX 4Q34A 3V8RA 4GZ6A 4P53A 1N0IA 5EMKA 2WIDA 4OYHA 3ZHZA 4EVQA 2CUNA 1UDXA 4TLAA 3T1OA 3A9UA 4F46A 1PV1A 4W1QA 5CYPA 4UUNA 4ZT7A 3SCZA 4BJHB 4KQWA 2A9JA 1JXAA 2JB9A 3AF1A 2A84A 2QGFA 2CL5A 4UXJA 4ZVMA 4ZVVA 4UMFA 3TQCA 1X2BA 3GPCA 1LCIA 4CLDA 1YCFA 1H2FA 4IZOA 4W5RA 3HPRA 1L5SA 1BVYF 1ULTA 2WSSD 2YXNA 3FWPA 3P0IA 3NONA 4AJ2A 3ZJTA 1QUFA 2WWGA 4NJMB 1KK0A 3ZU4A 2I4RA 4FDUA 4BASA 4XSHA 1KZ6A 1WVMA 4FKBA 5C8YF 3DTVB 4IMJB 3COYA 4V0MA 3P9YA 1FMLA 5JE8A 3NYWA 3SX2A 1RRFA 1ZDMA 3FDZB 3A10A 4I4TA 1W9HA 5CVDA 4MVXA 3U26A 4OI0A 2GK4A 1P0FA 1NVFA 4LY3A 5EIFA 1RXYA 4EEXA 5A4JA 2H2FA 2QUJA 5JAMA 1P9OA 3EPHA 2AT1A 2Q1WA 1QIIA 1ACLA 1J22A 3OF5A 1I3NA 3E2MA 3LI2A 4RHTA 1M8FA 3HC7A 2IY7A 3QF7A 4YI5A 1IN1A 3SJAA 1PWHA 4DR6B 3GB9A 1K3TA 3JRNA 1V4BA 2QI9F 2Z2KA 3AKCA 5HMLA 5JIBA 3FPFA 3INRA 3F73A 1THZA 1VKZA 2DY1A 5J2TB 5A7GA 3GRYA 1I3KA 1IL0A 3RRBA 3OC6A 5AM1A 4C4TA 3M49A 4R9VA 4WRRA 1WPGA 2CXQA 5D84A 2BBWA 2I6FA 3LQYA 2ABWA 2QTBA 1XD8A 3DPIA 3GDHA 2H3HA 3G2NA 2VHVA 3QLEA 1DBRA 4HMQA 4KYVA 4MVCA 3VKUA 3PTAA 1A8IA 3U7GA 3N9IA 1BRTA 1L7DA 3CEMA 8ABPA 1TOAA 1FRQA 1QIEA 2W8BA 3CZ9A 3FGOA 3E4DA 4FFNA 1RBMA 3HCCA 1MR3F 1PV4A 3EVCA 1BAPA 1GUDA 1ZGAA 1OE0A 3LX5A 3VU9B 4QU0A 1S89A 2NWQA 5DWQA 1CZNA 4GX0A 1IZ7A 4IUCS 5IBPA 3G8CA 3B53X 3AIMA 3QBVA 5M34A 1Z18A 4P5PA 3O7WA 3WYBA 3QG1A 4KRXA 3ZHYA 5K7SA 4KVGA 1ZCAA 4MWZA 1XTBA 1FK8A 1LC3A 2ZT8A 3H1AA 2R8XA 4FX2A 5AKHA 4HDKA 5H4GA 5KSZA 1BIFA 2JLVA 2H1HA 5CG1A 1FTQA 1D5CA 1FFHA 1Y4DE 2HRQA 2OHXA 2H1CA 4RH0A 2BT4A 2BGMA 4DIDA 4JP5A 1ZI6A 4AKHA 1D07A 4ZAXA 2CK3D 4E1BA 1QUEA 1P1KA 3NGMA 3HGQA 4BRSA 1W35A 4L3WA 2HPAA 4MA4A 3A4TA 5CNKA 4A0FA 5BSEA 5F7OA 2FX5A 2ASVA 1P33A 4J07A 1EMDA 3DOUA 3O7MA 3HB4X 3URKA 4LPKA 4M7RA 1NTOA 3B8EA 2PS0A 3T94A 4M1EA 2UVPB 1KKLA 4JUBA 2CDCA 2P6PA 4W82A 2JHGA 3NLLA 4XUCA 5B53A 2P9TA 4BJ1A 1G8SA 2HFKA 2OLEA 3IMFA 3JD4A 3AR7A 1PTJA 3KKQA 4CHGA 3IO3A 4LJAA 2H4XA 3GJ8A 3DV2A 4TQGA 1T2VA 3IT1A 3MWFA 4W4TA 2FEKA 1VPVA 2JAUA 2WOJA 3CRMA 3JZIA 4DE5A 3ERCA 5DH9A 2JAXA 2CVHA 1SC9A 3FR7A 2CLKB 2P9ZA 3CB2A 3L3BA 4TVKA 4DBVO 2CY0A 1ZK3A 1P2GA 4M22A 4ND2A 4XYEA 1P5ZB 4D8YA 3MSXA 3KEQA 4TT3D 1EBBA 2K4MA 4O5AA 4F8JA 1NR1A 2CZQA 1VTKA 2L18A 2QLJA 3PXCX 1SQ0A 2NOAA 1Z28A 4COKA 1W30A 4AO7A 1B8UA 1D6JA 3AV3A 2NUPB 1P91A 2Q4BA 2R4TA 1L7RA 1TU3A 2AYYA 3ICWA 4KTTE 1R00A 4GKAA 4X61A 2AI1A 1WV0A 3G9TA 4AMUA 5KX5F 4YJ2B 2AFHB 4G07A 3OPMA 3RS3A 3K5PA 2ZUBA 5IF9A 3RVMA 1EUQA 4RZSA 2MWMA 4M55A 2AF4C 2ZEJA 1G66A 4MXDA 2INGX 3UOAB 1OILA 2ZVDA 1UOPA 1N5JA 2X7XA 4TMXA 2UZ3A 1UWVA 3CRZA 1OH7A 1VIAA 5TVKA 2EXXA 1MEJA 3C1TA 3IUYA 4JNCA 5F77A 3D54D 1PWYE 1MUUA 1W2WB 5LWQA 2XNDA 5KNDD 1C4KA 3MMSA 5ALOA 1ONPA 4P9NA 3H9CA 1E61A 3C4VA 1YZVA 2IWRA 3UBMA 5JS7A 4FCVA 4MK4A 3LF1A 1QHSA 2QLNA 3ED5A 3BB1A 4J49A 4LZAA 3WK6A 4BC1A 1UQTA 5I4BA 1CRPA 4LTNA 1FMFA 1Q7BA 5IDWA 1D0VA 1NMZA 1M2EA 1L9KA 3ZGVA 4Y67A 2VP2A 3IXMA 4BUCA 4ENRA 3RRJA 4ZZ3A 1I2AA 2I7TA 2JCVA 3QU7A 2FQQA 4HYEA 4KEAA 4N3AA 4NPAA 5AUQA 4WE3A 4KOEC 1BQ3A 5KYXA 2FUNB 2AG5A 1RWOA 2XZOA 3L0YA 4XJSA 4LZPA 3W04A 1FYVA 3COZA 1NR5A 4BGVA 1JNXX 4P7GA 3OTGA 4JHLA 1V1RA 4TV8F 4D9IA 2DEUA 2CMHA 2YV2A 3R0ZA 3ZE1B 2BP7B 3QNMA 3GG9A 2VK4A 4A8JC 1WF6A 5C34B 1Z4KA 1DQYA 2EATA 3EFBA 1M3SA 1ELOA 4TWRA 1GADO 4RK5A 1BO6A 2G76A 4EI9A 3CCBA 1JEYB 2BKEA 4S04A 1KP2A 1U2GA 2QTHA 3G23A 3MK31 4R8LA 4EQ6B 3P7MA 3PEFA 1ZR2A 4U2GA 5ER6A 3BE6A 1GT91 2HF2A 2O2DA 4TWJA 5H3LA 1IG0A 1ZQ1A 3CSSA 2VDVE 1ZGBA 4H7IA 1ZCFA 1RZRA 4HWOA 2FQXA 4BLQA 1L5VA 1UPFA 2XKJE 4EMBA 1CXZA 3X2EA 3IQIX 3PC8C 2CDRA 3F6BX 3ZEIA 1P3DA 3F47A 3DWFA 2ERXA 5L3ZA 2IX3A 3IS3A 1L5FA 2GPAA 4O2LA 1SUSA 1I24A 3QJ5A 4GICA 5KWEA 4UEOA 3GEDA 4GOOD 4F56A 2A35A 4YPVA 2UYGA 3CEHA 1HDIA 1GZ5A 1MJHA 2WIBA 4O0MA 3VJLA 2LP4Y 4HFMA 5AKKA 4EKIA 3GFBA 2PGLA 1UXKA 2HLPA 4NQRA 3O4GA 1AZLA 2PLFA 1CIPA 1Q0UA 1F2TB 3HQ4O 2JJ2D 1L5KA 4KFRA 2EBUA 4X1KA 1XZHA 4E21A 4QJ3A 5EWJA 1JWLA 1RFLA 3R9XB 4N7MA 5DZSA 1CU1A 1MB3A 2AG8A 4NYJR 1E3SA 5E6UB 3RC7A 1EVLA 3D8BA 2E18A 1IHXA 1Q77A 2ODTX 3TL2A 1CUAA 1AQ6A 3IKVA 3UJ6A 3VISA 4XM1A 5C32A 4TVBA 1WUJS 2PG3A 3ZCVA 5EJ5A 4DV7B 3KSAC 2LXNA 1ZH0A 1PJBA 3BD7A 3JV7A 3UHFA 1BVRA 1NT2A 1PS0A 2Q3MA 2QG6A 1TFRA 3BH6A 3MNFA 3JD2A 2AMFA 3PCXA 2BGTA 3SZRA 2WA1A 4MS1B 4C4ZA 2NU9A 3D2LA 4C5BA 3O21A 1G21E 2OZKA 1VPDA 1B76A 2ETVA 3O91A 3HXPA 3NAQA 1ID8A 4M8KA 4O4LF 5FF9A 5GONF 3RGWS 5JJCA 1XRPA 4MLPA 2GNAA 3A9VA 1LW7A 2P6RA 4OQFA 3AX6A 4G5YA 4ND7A 4ESEA 2UVDA 3TD9A 1VYUA 1N9GA 3SMVA 4AQDA 4UHCA 5D3MA 4GMFA 4EYQA 4EYEA 4ZCSA 1VZ3A 1EXVA 1DAGA 1RMQA 3TPCA 5HBGA 3BE5A 3BIXA 5GIPE 2H57A 1ORIA 2EU8A 4ZQBA 2C9YA 4PLYA 4A9AA 3D5EA 2BTQA 4ZYUA 1XEXA 1CJBA 2REXB 4NYIR 5A6VA 1DBPA 3Q8KA 3TLZA 1CUCA 1LBIA 3F2IA 2P91A 3D3KA 4UM9B 4YRRA 4FI3F 4FS8A 5ENDA 4PO1A 4R41A 1TRHA 3T7TA 2CFSA 1YDGA 2PH1A 2I65A 5EKDA 3IXLA 2QY9A 4G36A 2BMEA 5BV2P 1I6WA 1JTVA 2FP4A 1W88B 2C2YA 4YREA 4OHMA 4MP8A 4R1QA 3KOWA 4X8LA 4DCOA 3GLIB 2MSEB 1A82A 2RFLA 2UYOA 3TYXA 1I9CA 4S1PA 2D7JA 3ORFA 4HTFA 3QPDA 4MGEA 2VXYA 1SU7A 2X4LA 5F5XA 3VAAA 4QU5A 3H04A 3TPFA 3UKDA 3QMWA 3U4IA 4AY2A 4PY2A 2DQYA 1R8XA 2C0QA 1M1NA 2ZJ2A 2A1TR 3F6SA 2O5EA 2CT8A 3UG7A 4KXXA 2Q1XA 3N76A 3OCJA 4HDSB 1U5BB 3H65A 4AKSA 2EG9A 4FYJA 5HZGA 1X7XB 4F3RA 1JQAA 1NV9A 4D56A 5DLDA 3K9HA 2SKEA 5AK5A 3N59A 3ZHTA 1AXGA 2PGXA 3ABZA 5KMGB 3LNCA 1XCOA 2PQ2A 1J2EA 1XKXA 2ZTVA 3ETNA 3IYLW 2O3SA 4ENWA 5U9CA 3TZHA 3NW9A 1E7QA 3EIXA 5FA8A 1JG4A 1BHO1 2HQ1A 3TOVA 1BQEA 5CPFA 3R3VA 5CT5A 3PRJA 2GEFA 1XN1A 1AUVA 2GCGA 3H1FA 3LCCA 4GDMA 1Q22A 3QUTA 2EBHX 4KG7A 2OWDA 1YZUA 3LDHA 4LPSA 3WQBA 4CMBA 1YO6A 5DSZA 5ALEA 4S12A 3P9NA 2JK0A 1EWKA 2J6CA 1IU9A 4QAQA 4W5JA 2PPVA 4QOEA 1N4AA 3SOZA 2PKRA 2QUAA 2FUEA 2G4CA 1IIBA 3OUTA 1OBFO 4L95C 4MA5A 1PVDA 4KUEA 1QHYA 2BFEB 2P68A 2Z4SA 1CJVC 2V7QD 3PXBA 4BNFA 3JQBA 5M2QA 4TQAA 1SU4A 1YVEI 3IOCA 4ZVTA 4F7DA 4A5OA 3SU8A 4K9RA 1L5GB 3GVCA 1UPXA 1GN9A 3N8DA 1OGIA 4KO2S 2G83A 1IULA 4X95A 4ZGBA 5JD4A 1W87A 4D99A 1CF2O 1IE3A 2ZE5A 3C3EA 3DEJA 3FTNA 3ISJA 4K2AA 1IEXA 1YQUA 4TSRA 4UU8A 4P0PB 1F7VA 1Q15A 3RFFA 1C8LA 4WL0A 2XRYA 1Q92A 1PW5A 4MW6A 1TUBB 3GUVA 4QHYA 4DNPA 4EW6A 1KFJB 3KV1A 3URMA 1KSJA 1WY7A 5BSGA 3CZ4A 2GRAA 3WIBA 2MSWA 3N8NA 1MVNA 4JVLA 2FU5C 2YWEA 4J4HA 4IIEA 4PG4A 4U2BA 2KYRA 5ECYA 3BAFA 1KZHA 2W2OA 3SZUA 5C1PA 5A3RA 2R1TA 1ZW6A 3D7RA 1BSVA 2J5BA 3FWHA 4XB1A 3TMAA 1RAIA 1SD2A 1XDDA 2WF5A 1N8SA 2HWYA 3QUCA 3QWFA 5F1PA 3G3EA 4TRJA 3BFJA 3HP1A 2QM3A 3KJXA 3AR3A 1TCAA 2A33A 3J80A 3TW0A 2O1WA 3GRZA 1NBOA 1A9QA 3GLUA 1NVWQ 3U31A 3HKEB 4AJEA 2ZSAA 1S3IA 3BTOA 1XCPA 4FQ5A 3EWSA 2WJ4A 1D2MA 4QBFA 4B73A 4RTPA 4BUJA 4JWTA 2H85A 1T0IA 4IDDA 1PYDA 1QGZA 4HGYA 5CAEA 2LE0A 4TWBA 1KH3A 5BMOA 1DKLA 1QH8B 2HK6A 1ULHA 1KMIY 3QQPA 3OWHA 5DBOA 4YY3B 1UMCB 2A0UA 1XAIA 2ISQA 3K73O 1U9YA 2OG2A 2PX2A 4OQQA 5D87A 5FNZA 5FPHA 1W1WA 4EB0A 1G38A 3QIVA 1PR6A 4WESB 4LOKA 3SJBA 3IULA 1EFTA 4RXMA 3PFNA 4GS5A 4B6PA 3EIHA 3W3ZB 2G25A 2Q0HA 3DGEC 3L7DA 4L4ZA 4R05A 3WMXA 5BN3B 4KR3A 3KQNA 5AYVA 4LDQA 1KETA 2WNIA 3DVSX 4XVQA 5ALJA 3OPYA 2DLCX 5IP5A 4PBTA 3S2FA 3VR5D 2BKAA 5C35A 4OBXA 3I9V6 4D3ZA 3IX7A 4JI4B 2X5JO 1N1GA 4ZT6A 1T4CA 2PQMA 1E79A 3C0KA 3DVLA 3OG9A 3V1KA 5KVCA 1GPDG 2XB2A 3C3XA 4IUDS 5K4AA 2W0MA 2GNOA 2HREA 1YAJA 2ZGVA 4H1UA 1VKJA 2H63A 2OGUA 3ZU6A 3QPCA 1KERA 3RUCA 2V8BA 1TKCA 5HF6A 1Z39A 4P54A 2IHZA 3DFKA 5CJ2A 2WINI 4N8DA 3NHRA 1G7TA 5LNK1 5JY6A 2FZCA 4DRXB 2NO6A 1Q0PA 2QG9A 5CX1B 2NUAA 4KXUA 4Y2YA 2YFYA 3WISA 3F3YA 3BD6A 1H8HD 1P45A 2E48A 4GI2A 1SVMA 3WTBA 4F5EA 4L5CA 2CXOA 3KT8A 3RSOA 1SRRA 2YWJA 4ZYZA 1IZZA 3IXQA 5CURA 3KZVA 1DFIA 6ABPA 3MJTA 3LA8A 4I3GA 1KWKA 3QVMA 3AP3A 1DIRA 2P3LA 3ILYA 5TMPA 1TZ2A 1U7ZA 2FWPA 1OOEA 4LSZA 2RAFA 1RTKA 4FK8A 4WCDA 2CJYA 5EJIA 4DQUA 2PD4A 4DDMA 2JCYA 4TGLA 4M6WA 2EZTA 1P9NA 4L78A 1KTIA 1U94A 1FVXA 3VKGA 4PSUA 4RD4A 2DWPA 2L82A 1CKEA 2OYRA 4QICA 3SQLA 3KYCB 4UDOA 1DJLA 1OAOA 2BHNA 4FT4A 2XT6A 4KPGA 1SVKA 3T34A 1JALA 4MVJH 4JSTA 4MV9A 3SI7A 4KUHA 1P7VA 3PHGA 5EP2A 1DELA 1SC1A 3AHEA 3P4YA 4R83A 5ETJA 2IV7A 4EYGA 1T4BA 1P9RA 1UBKS 1GNPA 1TVCA 3OMWA 2G40A 4RGVA 2ZB2A 1JKJA 4WLEA 4B45A 1HYQA 1T2DA 3WGIA 1HNZB 3A1NA 2E4UA 3H8VA 2O1SA 3ZJ5A 5JCPA 3KFXA 1DUVG 2Z6VA 4XX0B 4B2IA 3Q1LA 1Q1ZA 3IMEA 5ALKA 4M8IA 5L95A 3VR3A 1M74A 4NFHA 1MEOA 3FF4A 1VP3A 1DGQA 4K26A 4RPCA 2C5AA 1VJDA 2B37A 3DJYA 4LISA 2QX7A 1Y8RB 4HKTA 4BAZA 1YDFA 3WL7A 3FNIA 1SZCA 1Q0RA 1KEUA 1L5HB 3DHYA 3KHUA 3MCWA 4K46A 2QVXX 3LC2O 5KVQA 4HEA1 1J8DA 1PI3A 2JAWA 2WJ6A 5EEHA 4KBGA 1NN0A 1YACA 2EFYA 2IYZA 2OSBA 2I9PA 1M67A 3PI6A 5C5DA 2X9QA 4JKIA 3RE1A 4DKXA 2KSQA 4URZR 4X3OA 4DR3B 1P4JA 3PUZA 4PQEA 4UM8B 2ZBGA 5HKBA 2VO1A 3DBRB 4FDVA 4PHHA 2IEYA 3KP1A 5CLLA 4EYOA 4W1PA 4IQFA 4US2R 3U4HA 5LD2C 3PFBA 5E2BA 3UV3A 4R68A 1S7CA 3KSDO 1IN4A 1E1QA 3C3CA 1E9VA 4IXTA 4C0HA 5E9WA 4A15A 3DXFA 4AZSA 1T8WA 4M8SA 4RS3A 3AR8A 1JXQA 3M1LA 3A6LA 1FY2A 1WAMA 5KQRA 3ESRA 4JYZA 4L9WA 1VDZA 3M6AA 1BKDR 1E6EA 3NH6A 3UANA 1K6EA 4FN4A 3B1WA 4FQ7A 2H8KA 2YIVX 4OATA 1KIAA 1N1MA 2YC2C 4CKWA 5KVVA 5B3JA 4G5QA 4LAFA 2NZ8A 2HRRA 2O3TA 4OI1A 1FUEA 3KU4A 1DBQA 4L51A 4DCSA 2Q3EA 1A9TA 4DT1A 1LJLA 4EGFA 3GR6A 1KFBB 3CLVA 3DQZA 3I6QA 4I4LA 1ZXLA 1MOSA 3HZZA 4OO3A 1T10A 3WLJA 3LHKA 3B85A 3L4SO 5SV2A 4Z51A 1M34A 3FX2A 3L0ZA 3RRMA 3V8MA 1Q84A 3DDHA 2A88A 5K8IA 1OQAA 1P7YA 1MGOA 2PL3A 3AO0B 3OY2A 3PLNA 4I08A 1PTJC 1NASA 4UOQA 1R5NA 4X8MA 4A27A 5HIAA 4C06A 1ZN2A 1MKYA 4IDFA 5BN5A 4F92B 3TWOA 3NRBA 1XRNA 4OFWA 3RC2A 1UZAA 1HPLA 3E23A 1AK2A 2GPBA 5KHAA 3ZZ1A 2C5BA 3RTEA 5JCOC 5T7BA 1M2GA 1TUGA 3AM3A 4MGYR 4N8SA 5FDFA 3C3DA 4LYEA 1J39A 1MJGA 3E3AA 3JARA 1E5LA 3CW8X 4B43A 5CGZA 3LUBA 2II6A 5KTKA 3I04M 4C7OB 1DUSA 1SY7A 5AW2A 3HVHA 1O95A 3HB5X 3N2IA 3JASB 1GRRA 3OPNA 3PXUA 1ZIOA 2B1RA 2H2HA 4RC9A 4RIFA 5EUQB 3T12A 5T57A 1W2GA 3TXAA 3I6IA 4DA8A 1OR8A 4Z3KA 4JEMA 4PC7A 5JH7A 4GFDA 3RV3A 1O77A 3VA7A 1PWXA 3QOFA 3KLMX 3WWYA 1G3QA 2DPHA 2ZR8A 3NPAA 4QPJC 5IULC 1KQOA 3H75A 4EY6A 4LV5B 4NFSA 1TIBA 1HFKA 1CB0A 1T0JB 1SK8A 1TB4A 2X0IA 3KEMA 1Y3HA 3SLRA 4ADSG 4DRYA 3QE9Y 3ZI4A 1JLKA 4RKEA 1A97A 3WC4A 3DP7A 3B2EA 1GL3A 4NWIA 4P4TA 4PE5B 1BROA 4MA0A 1JHQA 2GN1A 4RVOA 1DI0A 3JWIA 1DV2A 2Q1YA 3QTTA 4JBLA 3Q7PA 3PJFA 4JB2A 3AIOA 4AZ3B 1IM2A 1I33A 1KIMA 3PQ5A 4K40A 3NS7A 3Q15C 4M0KA 1MPTA 5CNMA 2RGEA 4YP9A 3WS7A 1ZSVA 2CZGA 3E22B 5CDHA 1SBHA 1W93A 2LVBA 1BNCA 4EG4A 5AW8A 5GTDA 4H3SA 1PSDA 1Y3AA 4X97A 1RHJA 1UDAA 4KUGA 2WNSA 3QJYA 1VPEA 3DAGA 1RYHA 3IBYA 3SS7X 5FD8A 3ZCUA 1XYGA 4YJKA 1YR9A 3BJRA 3QA9A 5K3BA 2F43B 2NO1A 4XM2A 3OVMA 3WFZA 1AUQA 2HI0A 3E8SA 4BX2A 5I7EA 3QVOA 2GZRA 4G5XA 5D3KA 4IHAA 3ZGYA 1J5PA 2W2MA 1HFEL 4I81A 3D1JA 1XDUA 1ZXBA 2X40A 3R6TA 3R5JA 4UTOA 4XA8A 4GBMA 1DIOB 3KTFA 3BWCA 3IBGA 2AOUA 3CX7A 4TKUB 4C9BA 5TJ9A 2WVHA 1JBKA 3NALA 2AFVA 3OKPA 4YCNA 3A4LA 5REQB 4DA9A 5JFOA 4RPLA 5LQNA 1L7EA 1G7RA 3C3AA 3PHHA 2PS1A 3AJDA 1JG6A 3RVKA 2PRZA 3EDCA 1XTRA 5CBKA 2B92A 1GSHA 4L5BA 1XK6A 3W34A 3H5IA 5CUQA 2Q28A 3SHVA 3ZWDA 1V25A 5I01A 1JVBA 4BVLA 2V45A 5EAIA 2AKAB 4NDAA 2PUDA 1NLZA 4LQ4A 3CX6A 5UKDA 1BVUA 3WY9A 3BBLA 4RVHA 1E9CA 2EFDB 3W4KA 9LDTA 3U5TA 3K8QA 3GJTA 2Z1DA 4OKSA 1JR3A 3HG7A 3ZGOA 1Z75A 2CL7X 2ZWMA 4XQEA 4UPEA 1BCSA 1U63A 3ZPXA 2OWEA 1CD5A 5LYJB 3FN4A 4ZALA 5B7NA 1GU7A 3TLXA 2F7SA 4ARAA 3WLHA 2FDCA 1DTWA 3O2NA 4HTAA 3QHAA 5KJEA 3DEAA 3FRJA 3M4NA 4G81A 4EGSA 1NJ2A 3WMFA 4QZVA 1RHUA 1YR8A 2GCEA 3NTQA 3EDOA 2ZT5A 4YBZA 5E3IA 3TNJA 4E5MA 3GNTA 5JQGA 3WYFA 5ALGA 2EF0A 3G17A 3RKUA 1PJCA 3WWEA 4ZTZB 4RLQA 1WLSA 5KSWB 3NTUA 4FYVA 4Y2VA 3W05A 3ZEAA 2OAGA 4CM4B 5LSAA 1F8FA 4NV1A 1A9OA 1EK2A 5DSXA 2XF2A 2WWHA 2GXSA 1I1NA 2ATEA 4NS4A 3WDMA 3OFJA 3PVSA 1H2YA 1GFWA 3KKPA 5BSMA 3AJ8A 2DR3A 1TMKA 4PNZA 5ALTA 1QCZA 2K5UA 3T0GA 1WPRA 2DSNA 1CDOA 1EGVB 2VIIA 4WZBB 2ZSEA 4EUNA 4W5NA 4I1VA 2L69A 1ZD5A 4JI1B 3SDBA 3DOIA 5EJMA 3AHDA 3HXQA 3SFZA 1OH6A 1FLNA 3VSCA 2I7XA 1QGUA 2Q2QA 5K51A 3RSHA 3U3XA 3MN1A 3PEYA 3W2IA 5EHZA 4AT1A 2ZB7A 2GEKA 1EFLA 3LYUA 4MIKA 1PIWA 1XVVA 5H83A 5IKOA 4XGQA 1N6PA 2ID8A 1PKXA 3MOGA 2ZKIA 3LG2A 4D25A 5HTOA 2C4HA 2VCHA 4NJEA 3S2GA 2AYXA 1RLJA 1X8JA 3QE3A 1LLFA 2ROQA 2WFLA 4A0QA 3ZDDA 2YJ3A 2C9OA 1JT9A 3HCAA 3RSCA 4PCAA 4Q1VA 1G6Q1 4ZQGA 2ZSFA 1F51E 3E7XA 3HA5A 4HZGA 2Z09A 5EGNA 3CKYA 3ANLA 2O14A 3M6FA 3THRA 3RYCA 2JFBA 2W93A 3EVGA 3FZQA 3TR6A 4B82A 1N9KA 3QFTA 3T3PB 2GBIA 4BQSA 1E9EA 1JDBB 1T9BA 4K5QA 4UFNA 2PMEA 3SLGA 1PN3A 2C2MA 4A03A 3RG8A 5B36A 4KNYA 5IZCA 4BPBA 1RJ9B 1L5RA 3K4QA 2XXAB 5L7WA 5CRIA 1W49A 3LCJA 5EN4A 2YOGA 5DE3A 5L7YA 3T0FA 3MMZA 4IH1A 4M1OA 5I5EA 2GILA 1YXMA 1JWAB 5AVYA 2JIZD 4EFNA 3FOZA 1L5WA 2GJAA 2PL5A 4ZXFA 3BXEA 4Q16A 2CXPA 4LG1A 4KHPB 2AJLI 1K4MA 2EFEB 1J07A 3RG2A 4JBNA 2BH2A 1Q16A 4JY7A 2WKRA 3NFYA 4LGMA 3QBEA 4MUAA 2OZEA 4UHKA 5M3BA 1RKVA 1JX6A 2R4UA 2YYSA 2ZUSA 2WVGA 4ITUA 4IX1A 5A2QA 1XSEA 1HEUA 4O4IB 1SCUB 4LW8A 3WLMA 2ZRGA 4XRGA 4QRIA 4QPPA 1QFSA 2VDRB 2ZWIA 3C8UA 4A36A 1Y37A 4PZEA 2VDPB 5JSQA 4RZUA 3CVXA 2QRKA 1Z26A 4U7FA 1T91A 3T9AA 4W5QA 1XLWA 4GYJA 2A4KA 3RWMB 4QDJA 1KHTA 4HDMB 3U7RA 4ZHQB 2IS2A 3SS8A 4AXXA 1E6WA 3R7SA 1Q83A 2B1JA 5HOQA 2J3DA 2EW8A 3RR2A 4HDCA 2VHCA 1RM5A 4JX8A 2G5TA 4YUZA 4BL5A 4XX1A 5KYTA 1PT5A 1TUEA 2PGIA 1I4DD 2ZSUA 4NOJA 4FFMA 2B4YA 2Z6UA 1M5RA 5KNCD 1GUAA 3TLAA 1LH0A 3M6WA 2IXBA 3IVMA 1NHGA 4BQEA 5JNVA 4RTRA 5J2TF 2OGTA 2GWHA 4ZREA 2IF0A 4O8CA 1SHUX 4E4TA 4EZBA 1DFGA 1RWKA 3M6IA 1V71A 3BEDA 3UICA 4OYYA 4F9GA 1F1BA 2COEA 2FTKE 3KALA 4O02B 2A5LA 1RZRD 4UEQA 4NCHA 3NP7A 2Q2OA 3O2QB 1ABEA 1QDUA 1ZM4A 4XIYA 5HHTA 3NNDA 2VWPA 4DBZA 2AVDA 2WJZB 1P2TA 1ZESA 2CYCA 4KFSA 5TMBA 4E5UA 5LQUA 2QQ5A 3F1KA 2AJBA 4U2KA 3DE3X 3BF8A 1E7YA 3E9ZA 4OM8A 4X85A 1HRKA 4B5LA 2IOQA 1U98A 3W8NA 2QP4A 2I6GA 3TB4A 4KMOA 3ZNPA 2FEMA 2AX4A 5C46F 4ZXPA 2GVZC 1PK8A 4DDKA 4YAIA 1G8PA 5FO1A 5EHXA 3EMKA 3AZOA 4A3SA 4G9GA 3AUTA 4B40A 1JIUA 3UO8B 1TLFA