3KAPA

Flavodoxin from desulfovibrio desulfuricans atcc 27774 (oxidized form)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADGYDAVLMGCSAWGMEDLELQDDFAPLFDEMENMGLKGKKLAAFASGDMEYEHYCGAVPAIEEKARGLGAEVICEGLKIEGDASSDPDAVSAFAEDVLKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Crystal structure of flavodoxin from Desulfovibrio desulfuricans ATCC 27774 in two oxidation states
pubmed rcsb
molecule tags Electron transport
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kapA00
2HNAA 2RG1A 2A5LA 2FZ5A 1YCGA 2QX4A 2Z9DA 1YKGA 3P0RA 4PTYA 1XYYA 3LT5A 2V5UA 3JSXA 2V9CA 4YAWA 5JROA 1RTTA 1DXQA 1YRHA 4ZVLA 3W79A 3KEGA 5LJIA 3HA2A 5EMNA 3OJXA 3L9WA 4DY4A 1CZLA 4BMOB 3U7RA 3FVWA 3RPEA 1FLDA 4Y7CA 5LJLA 4R81A 1QR2A 2AMJA 5B3LA 1RCFA 4ZVMA 2FZVA 1AKTA 4LTDA 3KAQA 2FAXA 1SG0A 3ESZA 3OWHA 1D04A 2OHIA 4GI5A 4N65A 1OFVA 2M6RA 1D4AA 5F51A 1TLLA 1VMEA 5EAIA 1CZUA 5FUQA 1AKQA 2V5VA 3OX1A 1RLIA 3NFRA 3NHUA 4YALA 4YAOA 1CZOA 1CZRA 4C76A 3NHPA 3FX2A 1AG9A 5NLLA 1ZWLA 3N39C 1H69A 4CETA 1RLJA 4FX2A 1CZHA 3G5MA 2HNBA 4HEQA 3U7IA 1YOBA 2QMZA 3KAPA 2FVXA 1C7FA 4DIKA 1GG5A 2XODA 1OBVA 2X2PA 5F4BA 2BF4A 2MOKA 1F4PA 1FX1A 1FUEA 1FLAA 4LTNA 1T5BA 4N82A 3OWXA 4YAUA 4ICIA 1B1CA 2X2OA 1AKWA 2ZKIA 1BVYF 3W77A 3K1YA 3EDOA 1YDGA 1ZX1A 2BN4A 3NHSA 4M0CA 2MWMA 5ULLA 2GSWA 4LAFA 4S24A 1AZLA 5LVAA 4LTMA 1OBOA 1AHNA 2KQUA 4FGKA 3NLLA 3QFRA 4H6PA 3NHLA 1QBGA 1KBQA 5A4KA 4J8PA 5LMCA 4QOIA 3F6RA 3UXEA 1AKRA 4QODA 4PTZA 3D7NA 3QFCA 2BPOA 2F1OA 2OYSA 1XYVA 1FLNA 1QHEA 4QOHA 4Y9UA 1I1OA 2Z98A 4FGLA 3OX2A 3B6JA 1AMOA 4U7GA 4NULA 4BMPB 2M6SA 1C7EA 2R97A 3HR4A 2QX6A 2QX8A 3L9XA 5TGZA 4QOGA 1J9EA 3F6SA 3ESXA 1BU5A 3TE7A 4D02A 4HS4A 3GFSA 3KLBA 3LCMA 4GQIA 3TEMA 1FVXA 3FNIA 1X77A 2FDXA 2ARKA 3SVLA 1XT6A 1DXOA 5BUCA 2XOEA 4H2DA 4U7HA 5FX2A 4NLLA 3F2VA 2W5UA 2BZSA 3OX3A 2QX9A 4OXXA 3HLYA 6NULA 1KBOA 3ESYA 3NHWA 4YAFA 2Z9CA 1H66A 1SQSA 4XDGA 5NULA 1ZWKA 5FA6A 4QOEA 3B6MA 3OJWA 4QOJA 4LA4A 1E5DA 3R6WA 2QR2A 3ES9A 1FTGA 1XI2A 5LBUA 1J9ZA 1TIKA 2D5IA 1YCFA 3N3AC 4FGJA 4C0XA 4CF6A 4ZVKA 4GR9A 2B3DA 2FX2A 4ZVNA 3TZBA 4N9QA 1CZNA 3FJOA 5EA2A 2OHJA 2HPVA 3W7AA 5B3KA 1WSBA 1CZKA 3NHRA 2FLVA 3O2NA 3W78A 2MT9A 3NHKA 4DILA 2MTBA 3O73A 4QOFA 1V4BA 1J8QA 3GFRA 2FOXA 1AKVA 4F8YA 3GFQA 3OVMA 5LBTA 5LLDA 3B6IA 1NNI1 1FLVA 2QMYA 2Q9UA 4PU0A 3EYWA 3QE2A 2FCRA 4C14A 3F90A 2Q62A 2BMVA 4U7FA 1T0IA 4YQEA 3N3BC 2KLBA 3ZHOA 1QRDA 1AKUA 3NHFA 2QWXA 5F12A 3S2YA 1J9GA 2Z9BA 3GAMA 1YCHA 2N1MA 1DX9A 3K20A 4ESEA 3B6KA 3NHYA 2WC1A 2OHHA 4Y9RA 2R96A 3NHJA 1WSWA 1JA0A 3FW1A 1D03A 3UXHA 4C0WA 4XDHA 1JA1A
chains in the Genus database with same CATH superfamily
1PQWA 1JVSA 3QVLA 3LYAA 1NJ6A 2KX7A 3DYIA 2XE4A 2QTVA 3WFJA 2WYHA 2JLRA 3N2IA 2EDAA 2Q99A 4PLTA 5TPZD 3SDSA 3PG5A 1PBTA 3S5JA 1YCGA 3CRRA 2GVZC 1N9GA 3DO5A 4HNHA 1QMGA 1G8AA 4MV6A 4RK6A 4UASA 1ZK2A 2XT6A 4IIFA 4BGIA 3K16A 5HQTA 5MN5A 2DC1A 3T4UA 2JCYA 1XXLA 2WHPB 1SQ0A 1NDUA 2G9ZA 1PYGA 4CEHB 4C22A 1LWNA 3KOXA 4BZXA 1F7VA 3BXPA 1VMDA 1DOAA 1OBCA 9GPBA 1OI7A 4PZDA 2JVIA 3MCWA 2BFBB 2R8EA 3P2JA 3FPKA 4FEAA 4HC4A 4DEVA 5JAPA 2XTAA 4WI1A 2C7PA 1BMTA 1RE1A 4ZZIA 2QTZA 3UJ9A 3O4IA 4P0TA 4ZCQA 2XZDA 3JVEA 2IYNA 2QLFA 2K87A 3JWEA 2JHPA 2VHTA 1BS2A 2UVPB 1L5VA 1XHEA 3G0DA 2YWGA 2FW7A 1O1YA 3A2NA 3LGAA 4MW2A 3GLIA 1XVTA 3GEPA 4KN8A 3VOAA 1YD7A 4UMDA 1CD5A 4J0IA 1TPYA 1JQAA 1X42A 2GCNA 2R11A 2ACVA 2ZXFA 3H5NA 3FPAA 4QJIA 4OGGA 4RQAA 3PUIA 2PUJA 5BO5A 4UU1A 1VG9B 3W04A 4B4WA 3SHVA 5U1PA 2WJYA 2DY0A 3JQAB 3R4VA 4N48A 1RAGA 1M1ZA 2VDUE 1KY3A 4JJ8A 4DY4A 4YXFA 2F1JA 2ZANA 2WTXA 5FUBA 2GHRA 1W5TA 3ZY3A 2XMQA 3DV0B 5FWYA 1YV9A 4Q3BA 3S2SA 3DZKA 3FNEA 3CEHA 3L5OA 1FS4A 4RABA 5CLFA 5B5SA 1Z0DA 2W48A 1SH7A 2AMLA 1RKXA 1KA9H 2C8KA 1T6XA 5K8UA 3KFLA 1OLUB 4KRYA 4RHTA 2C84A 3OLVA 2HDNB 4ZD6A 2AQ8A 1T4CB 1VIVA 3FAZA 3HMKA 2VC2B 4KO1S 16PKA 3O5AA 3V4FA 1K5HA 2C7QA 1MO6A 1XHLA 1PR0A 2JGIA 2QD1A 4YT5A 4ZYLA 1IK4A 5L4NA 3T0IA 2VNIA 2C29D 4BNWA 4EF5A 3W6UA 1C7QA 1FTYA 2D2EA 4ZVPA 4CJXA 1OMOA 3WJ1A 2H16A 2WIAA 1S9HA 5ESRA 5CK5A 4NAHA 8ADHA 4MDFA 4UBOA 1GNPA 2AFIA 4JQCA 3ESZA 3NP7A 4LEIA 4JYCA 4RHXA 1AE1A 3L2OB 2FSHA 1FVOA 1ONNA 4X7RA 3LBYA 4DGSA 1IU9A 3B5JA 3DZBA 2RGDA 4N65A 1LCIA 1XNGA 2GN9A 5FBRB 1KDRA 4RS3A 5KMGA 4BASA 1UXGA 1ZK3A 3HNOA 1L8XA 2GAFA 4C1NA 2FG6C 2GEKA 3K2QA 5EAIA 3W3AD 3EVEA 1XDGA 5JPCA 1ZM7A 2FP3A 2ZLBA 3AUSA 2EATA 3WZLA 3L8YA 4AT1A 2V5VA 4NYIQ 4K9DA 3AL0C 1Q74A 4XTCS 2VAXA 3D3WB 2R00A 4N0DA 2Z5GA 1CNMA 3CZAA 4G4SO 3WGJA 1RLIA 4A8TA 1ZGGA 3CTMA 2R8RA 3HM2A 2AN4A 4O2RA 1QH8B 3NHUA 3HUDA 5AP9A 5E7QA 5HM6A 4LYGA 5D3QA 4LOJA 4ZJPA 2JCGA 1E89A 4EAQA 3GAAA 1KIFA 3ZBUA 4B6RA 2QVZX 1E3JA 2XJ9A 2ZAOA 3F67A 3HV2A 3PWTA 1A5ZA 2XI4A 4UVIA 5E1DA 3ZYZA 1UWVA 1ENPA 1CZRA 2J9XB 3HP4A 2YWXA 4TYPA 1XVUA 3D8TA 3O1IC 5LP6C 3L77A 2ZGVA 3B1ZA 4LV5B 2R1UA 3OM9A 4ESHA 4M8NE 4LF8B 1VSVA 1YZVA 3ZZ1A 3LCRA 1Q1NA 4QM6A 4MR8B 1V3TA 3HCNA 2ENWA 3VVMA 1FRNA 5KHAA 2XY4A 3KJXA 2G6TA 3QM1A 1PWEA 1A5SB 2PV7A 2XRMA 1BMDA 4KOAA 4MKZA 5JQGB 4TL8A 3KQSA 4CIWA 1T36A 2IXFA 2IZ6A 2DSNA 5H8WA 3IIJA 3GJQA 2ZB3A 4DB2A 4P5PA 5KYGA 1X38A 4Q9DA 5BV7A 1C9MA 1CB0A 5AXCA 3HU1A 5KQPA 4CODB 1EFVA 4G0QA 3NWPA 1OPXA 4BFSA 5L3ZA 4KTVE 2ZIVB 1KC3A 3OPYA 3MA0A 3WLNA 2EU8A 4LTNA 4ERNA 3A9WA 5KAMA 3DZFA 2C31A 1TRHA 3E18A 3FTNA 3N2KB 3ZY2A 2XZOA 3THYA 4I50B 1N32B 2G40A 1R5JA 3A1TA 2HV9A 2O4UX 3Q7PA 3I1YA 4HUTA 4MGIR 3FHCB 3VM6A 3LQFA 1M1YB 4HX2A 2GVDC 3AT1A 3OF5A 4DIEA 3QVTA 1B1CA 1D07A 3LP6A 1E6WA 1IK6A 5FDFA 2V7XA 5LBIA 3WC4A 4GOJA 3QLVC 3K1ZA 3QHAA 4KL8S 1O95D 2ZKIA 3VR4D 3BGWA 4AP5A 3Q1LA 3T5GA 4RK1A 1SOMA 2FN3A 1UDRA 3FM9A 3EDOA 4X3CA 5TT0A 1JRLA 1SC3A 4OP1A 3CUKA 4A6DA 1Y7HA 5IWCA 5FLXA 2V7UA 3WLIA 4JH0A 5JO9A 2AI2A 3SAJA 1KVSA 3UGQA 4CHTA 5HJEA 2WA2A 3HYCA 3I9NA 2R751 3CX6A 3SCZA 4CIAA 4Z4IA 4NIMA 1K98A 3FKSD 1NW3A 3LKZA 5C51B 2Z04A 4S24A 2WM9B 4CQJA 2EZ4A 3U3MA 2RJNA 4Y0NA 3GPLA 5LVAA 5DTMA 4LTMA 1BE0A 4NCNA 3DDWA 3HNRA 2VF8A 2KQUA 2ON6A 5KVSA 2ZB7A 5K6AA 2BGTA 3HJHA 3PFWO 3DOOA 3E0QA 3ZW7A 4LE1A 3RC8A 2Q21A 3D8RA 4R9VA 4KFSA 2Q1XA 4L4ZA 2W90A 2IHUA 2DFPA 2FFHA 3CO5A 1IQPA 5A6SA 1YMUA 2K5UA 1UUFA 3BOSA 3O93A 5CPFA 2WT4A 4CT5A 3GLHE 1TZJA 4BQPA 5ALXA 2ZSDA 3PKJA 1EESA 3Q7TA 2WFZA 2XBLA 3M6LA 4X20B 1FDRA 1N6NA 1ZI9A 3I72A 4NBKA 4PTZA 3DKRA 5DULA 3FDZA 1N0IA 1XCLA 3OIYA 5HIIA 3S3TA 5IXJA 1M1NA 4H16A 4HLDA 2EL9A 4G1CA 2OB2A 1PJTA 1FDVA 2I2BA 5FPYA 2IZOA 4KMRA 1XYVA 2KSQA 2H06A 3D0OA 3RUFA 4UOEA 3M5PA 2VCHA 5HKLA 4Y9SA 2Q2QA 4E2WA 3LL7A 5A7HA 5FRDA 4DREA 4PG6A 3R5TA 5D85A 3TW8A 1J23A 4Q5IA 3ZWCA 5IM4F 3TF5A 1PJ3A 4BMZA 5FTJA 2WABA 2TSYB 4RIFA 2ZRMA 2TS1A 5IX8A 2H0QA 3E9DA 1NBMA 2ZSEA 1N5OX 3R5FA 1KEWA 1TT5B 4Z6KA 1U0NA 3NO4A 2OK8A 5C32A 1KYTA 1PFYA 3BICA 4DWWA 3AHIA 2X5KO 1CJCA 5HRCA 4MJ7A 4ETNA 3C39A 2J1LA 4PZPA 2DH6A 1BXKA 4Q39A 3H17A 1PYOA 4DMLA 4KUGA 1J39A 2O5RA 3ZHRA 1CDOA 1NBAA 1XC7A 4UATA 2HCFA 1TMKA 1SNYA 4P82A 5IKEA 2FB9A 2BHNA 4B8WA 5C1PA 3K6SB 1AHHA 4M1WA 1SUAA 3ROGA 3R9XB 1LI7A 1O94C 5DLPA 1SKBA 5HCNA 3RNLA 2H92A 4DG8A 2F2TA 4NDNE 2DPHA 3R5JA 4YJ2B 3Q7EA 4EKYA 4QFCA 2PZ8A 3JV7A 3CH7A 4FZRA 1PL8A 5IARA 4KQMA 3GX1A 3K3PA 1J5EB 2FWIA 2Q7XA 3ONDA 3U62A 1CLEA 4DA8A 4X7PA 3I39X 3U13A 2QZZA 2RGNA 1R9GA 2NU9B 1ZK4A 3ZHYA 4F9TA 1QF9A 5I45A 4R05A 1N8TA 2ESRA 2Q5HA 2XKJE 5DF1A 4DTIA 1U80A 1YDHA 2XDWA 4KFCA 3CLVA 1JJVA 2W0SA 3LLMA 4HS4A 1V5EA 3TNFA 5IZCA 1N5LA 4HWPA 3TAXA 4AX4A 3BK7A 1BMFD 2C9OA 3QPCA 4G01B 1NTOA 2C2GA 2YC2C 1WD7A 4RZQA 4BX3A 4ZJYA 4JGIA 5FORA 1NRIA 2GYWA 3QNMA 5BV1A 2NVWA 4FDUA 2I3AA 3FIJA 1T9HA 3OCUA 2ZKLA 5KCZA 3O2QB 1P73A 1AVTA 2C96A 3LPNA 4W1RA 2SKEA 1G5PA 4O1HA 3ENNA 5BSHA 2DERA 1TLTA 1UP6A 1EVIA 2ZBRA 5BUCA 4Y6PA 2Z5LA 3BCHA 5JNSA 1NL3A 2OV2A 3MCAA 5HIKA 1X74A 2KBEA 5FX2A 2AMVA 1NW8A 5FWXA 1U5BB 3FOAA 4HXFB 1PNQA 1HUQA 1QZTA 3AVUA 4MV5A 5ED0A 5AI4A 3ESYA 4XJXA 4BCBA 3PXUA 4M6WA 3BD9A 5BXQC 4F92B 3R6TA 3ZQKA 1WCXA 2HIGA 3RTCA 2EQAA 5AI8A 5ITWA 1ZDMA 3MELA 1NVXQ 3C97A 1FIUA 3PR2B 1YGPA 5JW6A 3SYNA 1UMBA 2BM0A 2OCBA 1FPQA 2VJCA 1AHIA 4CKCA 2AE1A 1XNHA 3RSOA 3JXEA 3LX4A 4O4LF 1L1FA 1LK0A 4AURA 2YZNA 3FSJX 1G59A 4L0MA 1QO9A 4YT8A 4LA4A 1C1HA 5KWSA 2VYVD 2I62A 5HF5A 1XKQA 4OLAA 2X9NA 4BN4A 5DDIP 3H1FA 4LXTA 1I7NA 2TECE 5CNJA 1UFQA 2EJCA 1GZ7A 4PPNA 5LB4A 1X87A 4AJNA 4R8RA 4R01A 4ZARA 1H2RS 3ZK7A 3G68A 3RWBA 2ZEJA 3EGWA 4JLKA 5LN1A 3NJRA 2RMKA 2JF0A 2W93A 5B1HA 1FFAA 2GXAA 4QPJC 5A4FS 5DSXA 1S7CA 1ATIA 2CUTA 2W11A 4L16A 1JPNA 5DB4A 5BN1A 5JHHB 5GINE 2FTKE 3WL7A 4IL5A 5D3MA 2D5BA 5DI3A 1CZNA 1U0GA 3FJOA 4TQ9A 2I54A 2CLMB 2HCJB 2PZKA 4G41A 4M55A 3RARA 4OKSA 1QGOA 2IY9A 1M6EX 3C1OA 4G97A 4BQQA 4ERXA 3DV2A 1EZ1A 3VSBA 3HC7A 3VPBA 1WIWA 1UMDA 2QD4A 3UMFA 5FTLA 2B4TO 2Y71A 2NX2A 1J5XA 1KR2A 1USKA 4Q16A 1SCDA 1IN6A 4UPVA 1XMIA 1KI2A 1DEXA 5EKTA 2DKOA 1E94E 3UB3A 2P67A 4FFOA 2Z4SA 5JBQA 1SURA 4GS5A 3RV3A 3MG9A 2BKEA 3OPQA 4FHCA 1KDYA 3WKEA 3CR7A 4RQTA 3G8CA 3CIOA 1AKEA 4A8HA 4FW8A 3RWOA 1BDJA 3FPFA 3ZWQA 1XU7A 4LYAA 4OI1A 3SEAA 1PG2A 2C4KA 2GN4A 3II6X 3OE1A 4NBRA 5A4DA 3NGXA 1PDVA 4L9SA 3T1HB 3BD6A 1TT7A 4BX0A 5AIBA 5KDOA 1MQ8B 3GT4A 2P9QA 4FDLA 1ENYA 1JJBA 3KYIB 3NTLA 1BJKA 3FOCA 3R3SA 1FMCA 2FOXA 4R6XA 3HGTA 4CTKA 4TTSA 3RM3A 1VLHA 4CV1A 2DSTA 4EG5A 5JAQA 5P21A 4A0FA 3M2PA 2Z3WA 4Q4AA 5CD9A 1OUMA 2O05A 4EO9A 2PO7A 1Z4JA 4WK6A 1WBDA 3HBMA 2IOQA 2IH4A 2DQYA 2OORA 1EYZA 2CMDA 4IIUA 1K68A 3DVAA 3EUWA 3OLZA 3TIXB 2X76A 3M1YA 4ND2A 3W6ZA 5JSQA 4C7OB 5FJIA 3FPHA 1N0WA 4B6GA 5EZ5A 2VRCA 4TRRA 5D6NA 3V2UA 1P17A 2CK3A 3VU9A 4N5DA 4W5RA 5DK4A 3QI2A 3PFNA 4F4FA 2BGNA 3CVWA 3B82A 1WG8A 2ES4A 2NSLA 1XF1A 1THTA 1HI9A 3GB9A 1K4MA 2GCGA 3ADKA 3E3AA 5K1ZA 5JALA 4GEGA 3G9ZA 4YN3A 4OXQA 3MS2A 2QM3A 1FRQA 2OCKA 1HSZA 2GEFA 2ZE5A 1GSHA 1KZ9A 4FYVA 4QHSA 5B2ZA 1GNQA 5L9AA 3GGDA 4BFCA 5BNFA 1U1CA 3Q8KA 2BT4A 3PGMA 4MS4A 3B6KA 5C18A 3VR5D 4NV0A 4S2EA 4C03A 3VR6D 3BB1A 4C78A 4RMNA 2PFKA 3WA6A 4BMDA 1I7DA 3AR7A 4OI4A 2HWWA 5EE0A 4UAJA 2XUZA 2QMEA 1TQ8A 2QUIA 3HWX1 1XDDA 1MNQA 1XGKA 4IJ6A 3WSTA 3L8EA 3D3JA 5AFSA 3UXYA 4B7CA 2IDMA 3DZJA 3VZBA 3RTBA 1U8UA 1FK8A 3WICA 3LVFO 3ZDZB 1E3IA 7YASA 2NU6B 3CMCO 4CEJA 3B78A 1NN3A 1L5MA 2AYYA 1X19A 4S1VA 4OY3A 2I5PO 2OOKA 3FPLA 5CXXA 4RMHA 4LSWA 3SYTA 4GL2A 1U8AA 3BWCA 1J00A 1OASA 4MVCA 2NT4A 1ZW1A 2VJLA 3C5HA 1TZCA 2ZZKA 5JSKA 2C4NA 3EAGA 1PQYA 2PN1A 2ZDQA 4Y2RA 2QAGA 1VRCA 2GBPA 1X9GA 4G0YA 2NG1A 2IW1A 2G82A 4MUIA 4ND5A 1YI8A 4XYLA 1TQ6A 3C6KA 1Z5WA 3T7RA 2IU6A 1CY7A 4X1YA 4F6RA 4C0QC 3THXB 2C98A 1IHYA 1DEAA 1LS6A 2HUNA 1T13A 2NM0A 4XX0B 4ZQGA 3ROZA 2QE7A 3UKOA 5AVYA 1YIAA 3ASVA 3WMEA 3LK7A 4IXMA 1N2SA 4F7DA 1FYFA 4H7JA 4B8ZA 4M0PA 4QUAA 3PC7A 1FFXB 4H4DA 4HB2A 4EA9A 2M98A 2XB8A 1CS0B 4WWHA 4AKTA 3B9BA 3IQIX 3PFFA 3T1TA 1WPRA 5HGJA 1W0KA 2O2IA 4Q1VA 2Q9BA 2I6GA 3R76A 1GPBA 1W9MA 2NAFA 3Q88A 4J94A 1PIWA 4INAA 4BVJA 1ODLA 1EM8A 1CRPA 3OJXA 2BEJA 4IVRA 1J06A 4JB8A 4RVOA 1SBCA 3W7BA 3E5MA 2IHJA 3KHTA 2RGWA 3T3HA 3FOZA 1TJ4A 4MEAA 1Y0BA 4EKEA 1DWOA 2R60A 1YR7A 3W06A 2O8VA 4MYRA 2FQXA 4BHTA 2VZEA 2ZAIA 3AEZA 3AONB 4CM1A 2PH1A 3MS7A 4XJSA 4AK9A 4MRSA 3RRYA 5C7YA 3DG9A 3ZLVA 3AF3A 5EKUA 4KXWA 2CHGA 4URZR 4Y7CA 1YS2X 3EXFB 4R3WA 2VL7A 4NBTA 4R81A 1C3OA 2GAIA 4CQNA 1W59A 1Q7RA 2C9DA 2FGJA 4Q24A 1AA6A 3HJTA 2P9JA 3ETHA 2V74B 4XVCA 4A0HA 3M6AA 4R84A 5HQ3B 3ID6C 4XI9A 3BE8A 1XDWA 2JFUA 2YHIA 1EE2A 4EY5A 5LQCA 1I3LA 5GOTA 1KYXA 4E3WA 2VHYA 4K6KA 1GUBA 2NTVA 1N6HA 2ZYAA 3CLRC 4NABA 4Q7KA 1MO4A 2X23A 4RJKA 4GZ6A 3ZWOA 4ZI7F 5JATA 5KQSA 4Y2TA 3D5EA 1SCQA 3JQCA 4EB6A 3OSUA 1XKTA 1O03A 3LBIA 3K9BA 3OLCX 4C2TA 5EI5A 1ZEMA 1T2AA 3CE9A 5C7IO 5IVKA 2P6RA 1Z2PX 2NOAA 4V0LA 3G2QA 5DHAA 3A6DA 5A3VA 2FSVA 3NTXA 4JGGA 4M83A 4BLPA 2XZPA 4BVLA 2PE5A 3WWOA 2NO5A 2YVKA 5ALDA 4HMOA 2HRZA 2ZYHA 2PKCA 5FOSA 3W2FA 4TXHA 4HWKA 3VV3A 3SE7A 1JAYA 1SCNE 2P3QA 1U2DC 1J8YF 3L8ZA 1W30A 3Q3VA 2P3SA 4Z3DA 2ZR7A 1LS1A 4RMGA 3RABA 3ZVNA 4RDXA 5KOJA 3HA3A 3B53X 4RIEA 1TIPA 3T7IA 1J1IA 1LI4A 2KPOA 5JRJA 1NDHA 1UH5A 1JJIA 3HVIA 4K2AA 5HS4A 1E2GA 3BH0A 5KYKA 3EHEA 5AKGA 5E4YA 2BFPA 2QXUA 2V6MA 1B16A 4G1EB 4DLBA 4OOEA 4UQOA 2OK7A 2HRBA 4KZKA 1L7BA 4Y67A 4CLHA 2FH5B 2LPMA 4DQDA 2H07A 3LUCA 4HWGA 3RJMA 1J2YA 1LPNA 5KSOA 5KTRA 2FFAA 1DUVG 4MDEA 3RQSA 1D8AA 4XAQA 3PYMA 3HUFA 5FTNA 3GA7A 1RZRA 1OX4B 1ZUHA 2BEKA 2O57A 1EFDN 2XSZA 3UENA 2EFYA 3DMDA 4OJYA 3T94A 3R7SA 1VBKA 3CVYA 3ZXUB 1Q7EA 3IQEA 4H3KB 2CLOB 2MSLA 4J7AA 2IE0A 5G0TA 3FTPA 1R6DA 1ORTA 5F4BA 2JZNA 3MWDA 2IBSA 3SD7A 4DA9A 4JIMA 2CLDX 1Y42X 2GBGA 3HCBA 3CJTA 2W2XA 3QU7A 4YJGA 2HK7A 5JSZA 3EOZA 3G6KA 2AN5A 2FETA 3GD5A 1RR6A 3SM3A 5HRUA 2FLKA 3TD9A 1VIAA 1WMSA 2ZXEA 1FUEA 2JJ1D 2I3ZA 3EARA 4P1ZA 2PJZA 3BILA 1AQNA 1H5UA 2CT8A 1ZJ6A 5E6UB 1UDXA 2GBIA 2JCVA 2FP4B 2O0LA 3TQIA 4EHHA 1FCJA 3OMXA 2WWYA 2GYUA 4HN4B 5LA6B 4BXOB 3K1JA 4YLEA 2BH9A 3AIOA 4GZ5A 4W5WA 4G6ZA 2VHUA 5IW8A 2VXYA 4FDAA 2UVDA 3VAAA 3EWIA 4ZP1A 3N7TA 5FTMA 3FSGD 1RHKA 3GFOA 4ZQCB 3ZR4B 5TV2A 3C16C 3QNUA 4KPUB 5EEHA 2WIKA 4QFMA 2PMFA 2W2KA 1JU3A 3BMXA 1XKXA 4JROA 6GPBA 3Q3CA 1H6CA 4PO1A 4X92A 1VIMA 2W8BB 3AM5A 3TM4A 5DTRA 4WVLA 4MGHA 1Z35A 1ADJA 1P7ZA 3L8GA 3M4NA 4G63A 4EABA 421PA 4NTZA 3PGXA 1IEQA 3UOGA 4LJRA 2NZJA 3JZAA 3ZBQA 2CFTA 4I1IA 3KZKA 1CQZA 2GRAA 3L6UA 4YDRA 2C5FA 3ZGVA 4BWYA 2J6HA 3FLEA 3ICVA 3PHLA 2C2OA 2HPZA 3LPAA 4S3MA 4ZO4A 4ZQBA 5IFKA 4F8EA 3H0KA 1VE7A 3VRHA 1P1RA 4F2WA 2QM8A 5KYTA 1ZMOA 4QTUB 1ZD9A 1A9XA 2F1KA 2ZIXA 2QI9F 4EG0A 1I30A 1QVRA 4RZIA 3PPYA 4A1FA 4DFDA 2J5QA 5DVZA 5DZSA 3U1VA 5JMTA 2J6BA 1JIUA 2WJ4A 2VATA 1OH8A 3DB2A 1EE1A 1N5JA 4LGVA 3UGTA 5T6MA 1K6XA 5A05A 2ECFA 2PKXA 3CRZA 4PS0A 3CXRA 3ANXA 1Q0RA 2HREA 3AY7A 4QOIA 2R25B 1E99A 4NBVA 5DN6D 3RUDA 2E4UA 4BWVA 2ZRGA 3CH4B 2GF9A 4AP9A 1K86A 1F9AA 1YR8A 2GYYA 4PC7A 4OP3A 4BKPA 2J31A 5AVSA 4D9JA 1NY6A 3UYLA 3LX5A 4JNKA 1P4JA 1XRQA 1V7PC 2C8VA 8AT1A 3GP8A 2XB2A 4EOGA 2WF7A 2I78A 4OQEA 3ED1A 2OGUA 3ESAA 1K6JA 4IH1A 2EWWA 3O8OA 3OH8A 3W6NA 1FLNA 2QTCA 4RZ2A 3H18A 2UYYA 2PWYA 3ZIAD 1IMOA 1CJMA 2VUTA 2VBIA 3RYTC 2XZTA 2AJ8A 8GPBA 1X7ZB 4I4IA 3LFUA 2ONCA 1X8LA 1V71A 2OHFA 3SZGA 4DSOA 4PCUA 1UEIA 2IZ1A 2RH8A 3NKLA 2WE8A 2I6TA 2K2WA 4RDCA 1LD3A 2XDQB 4CLOA 1QPZA 1M5TA 1KYZA 1LDMA 2GK4A 1XTQA 3OM8A 4N4AA 2GN8A 3EA0A 3KPVA 4MGEA 1G3MA 4CT0A 4K3UA 4DPMA 3OZFA 4FONA 2NADA 1F1BA 2R6ZA 4ZT2A 4RA6A 2GJAA 2DUNA 2QX6A 3Q9SA 4JUIA 2B4KA 3L05A 1IN4A 4YHHB 2X1MA 3C3AA 3PJEA 2BM9A 4LI3X 4NE9A 5BRNA 3O3CA 1EI9A 1X1SA 4NAUA 2H18A 1PR5A 5JVDA 1VXOA 5AJUA 1OWNA 4WL0A 3AEQA 5E8JA 5TGZA 3SU8A 4AUKA 2O2CA 3PFHA 4LF9B 1RLUA 3ROFA 4LRSB 4XYEA 4R1NA 2QB5A 3K32A 3JY6A 3JRWA 4KH1A 3ISJA 4ZGGA 4JI6B 1T5DX 3QW2A 1GG2A 2HGZA 1J2RA 4F3TA 1JIQA 3AFHA 4X97A 3T5TA 3UPUA 1PZXA 2OOSA 1M66A 2Y1GA 4CIDA 5AO9A 1XMVA 1NR7A 3EJ6A 5JAUA 4IS2A 3WISA 5CBPB 3F5DA 1G42A 4S1NA 4DDHA 2NXWA 3ZZUA 5JYBA 1K06A 4EDFA 2Z3VA 1C9NA 3Q6MA 1UIRA 2AEMA 1CETA 1URPA 2WUFA 3K6JA 1V11A 4IXNA 3ITNA 4TTVA 4XA8A 1EWVA 3PEEA 5CW1A 4LECA 4B3HA 4L15A 2QVGA 5SV2A 3LYLA 1KMCA 2ZCJA 3KOWA 3K72B 2PQ6A 3PDUA 3JPYA 4EPXA 1ZR4A 3A36A 3LHSA 2W9XA 1KJNA 4CG0A 1N0UA 3PITA 3D4NA 3NR2A 1L4NA 1PJ8A 3VGPA 4CF7A 1AK9A 3U60B 1UWLA 4PBRA 3TDNA 4Q3AA 1YE3A 2EKZA 1E7WA 1L5OA 1U3WA 3U4HA 3B9PA 4D99A 2V4MA 1O4VA 4D96A 4HNVA 5CD1A 1Q84A 1D2HA 2ZUEA 2EL7A 4E21A 3EVNA 4K05A 1NX6A 4B3SB 4MQMA 1N75A 4CLRA 5TQJA 1O0CA 4G86A 1X14A 3KOZA 2BBOA 1UKVY 3HJCA 1VPDA 5EE3A 2IPNA 5CRIA 5FEUA 5JTUA 2D4HA 3DMNA 4REMA 4A23A 1GILA 1T1RA 2YTZA 3A9VA 3DKKA 4OL0A 3G3EA 4ZYYA 3GK3A 3MRXA 4PGHA 5G0VA 1Y6JA 3SZLA 5FI5A 5CA0A 2QT9A 1Z29A 3OPNA 4DR3B 4RYLA 2ODBA 3RF7A 1JGTA 5FO0A 3PE3A 4GKAA 5LYJF 2JAPA 3FAKA 3ZOKA 2FUEA 3HUEA 4LVUA 1AB5A 3H9BA 5JWRA 1EUDB 2FR0A 3JU3A 2ETVA 2QXYA 3B13B 3KYCA 1SU6A 3MWYW 5FI3A 3U3OA 4AF7A 2RHCA 5HKAA 2BFEA 2VDJA 2VSFA 3GOQA 3KE8A 1Y5LA 3ANYB 1R88A 2W6QA 2XF2A 3QMVA 3SR0A 3O3OB 4CU5A 4J90A 1CRLA 2GWRA 4MWGA 1OPRA 1JFSA 3IEVA 3EEBA 2F9FA 3I32A 1T3GA 4NU0A 5GY7A 3VHXB 3ZQJA 1K1EA 2WILA 1GZDA 1XSEA 4TQGA 1FX0A 5F1KA 1E5XA 1OA0A 2HMSA 1CP2A 2PX6A 2QQFA 4N8SA 4WAUA 5SZJA 4GNRA 3CWCA 5LC1A 3E9CA 4DW8A 4LC9A 1QLJA 3ZCVA 4Y2GA 3TRHA 5D51S 5EZ6B 2GTIA 1ECLA 1XCGB 4INJA 1KGSA 5TY0A 4E5YA 4RKQA 4TQAA 4F5YA 2FRXA 3C8UA 5HNKA 4KREA 4UJ3A 1LPSA 2ERXA 2DJ5A 4HQNA 3FVVA 5ENZA 3EQ8A 4Q48A 4TV8B 3S99A 1E3SA 3DB1A 4LDPA 3VH4A 3KT0A 2WSSA 3ZX5A 4JYZA 2FRDA 4UEOA 4Z2AA 5G1PA 3TLEA 1ZVJA 4ILEA 3G2MA 4OXNA 4IUCS 3GLKA 5I8WA 4R1PA 1NN0A 2V3CC 1W36B 1MX5A 3QXGA 2W2PA 4NATA 4IKEA 2OPBA 1KJQA 2VK2A 3NBYC 3AFGA 4RV4A 1BO6A 4KFUA 2X2FA 4H1UA 5BQXA 3B6EA 2P69A 2DQKA 1UP4A 4PQFA 1MJFA 1HMPA 2JFBA 5EIEA 2YCBA 1X1DA 3AZQA 3GFRA 4IBOA 3EB9A 2AF4C 1BYIA 3LUBA 4D4KA 5LDHA 3FRJA 2B9VA 4G5GA 2R7LA 5A3SA 2B69A 3OJ0A 5M7EA 1H3EA 1QZZA 2ORWA 1MRSA 3GJSA 1SCKA 4UCWA 5KTYA 1DKPA 3H2ZA 4KKXB 1NRJB 4D3SA 5ALEA 1TAQA 2EJTA 4IQFA 3KKZA 1DAGA 2Q62A 3TWOA 1QCCA 1I7SB 3ZGYA 1YU9A 4AJPA 5LOVB 3BK2A 4PS1A 1K3UB 1H4VB 5KAPA 3I34X 2XOKD 1MJNA 2DXIA 2MCFA 1OI2A 3N0TA 1L8QA 4PLVA 4ZOEA 2Q07A 3QEAZ 4V1CA 4WK2B 1OJLA 5ALMA 4TOIA 2FY8A 3LDUA 4J0HA 3VU3A 2LIVA 1Z0KA 4HMQA 1RNLA 2QR5A 3ZBPA 4MS3A 3BIFA 4KE9A 3Q8WA 4EJ6A 1LDYA 1FFGA 3BMCB 3WIEA 2YINC 1BOOA 3UWSA 3RGGA 5JS6A 5KCMA 1A96A 2ZUUA 3RS3A 1OR8A 1W1IA 4HX5A 4DZZA 1YHNA 1PJLA 4GAEA 1PJRA 3I4LA 3D6UA 1GRNA 1YB6A 2CDBA 2YFHA 4WNCA 2R3SA 5I8ZA 3WI7A 5K6AC 4JR0A 4QGHA 3UG6A 1TAUA 4D9GA 3QKTA 1Q15A 4LJ9A 1WPQA 2AD5A 1EDZA 1LK7A 4MW5A 4W7HA 1UBLS 3K2BA 4XARA 3TQFA 3NETA 4L6IA 3FRIA 4FD3A 3R7FA 1O97D 2P2NA 1SQGA 3UXHA 3CRVA 5JMPA 1QGYA 1BTOA 1QFSA 2R6R1 3SWWA 4KBYA 1X70A 3A9CA 2XJ4A 3PTZA 2FMXA 2XUHA 3G9QA 1AN9A 3HZOA 4M9CA 2GAAA 2BBWA 4J9VA 3VUEA 1CK4A 1F0KA 3QUBA 4PLWA 5ALVA 2BLNA 2CDCA 3K6RA 1AKNA 1VHWA 3WOVA 1QLWA 3FRHA 1EWKA 1P2DA 2F17A 2HLDA 4JC0A 1W29A 3ND6A 4R68A 3I04A 4AMBA 1KAQA 1NJFA 5LWQA 3F4LA 5HW0A 5CYOA 1QGZA 2IYXA 4KR2A 4L51A 1VYTA 4D9MA 4NYJQ 3ZDEA 4F45A 1KPHA 3MVEA 1WEHA 1U3CA 3LT5A 4RWZA 5I3ZA 1NPDA 2PFGA 4W6QA 3FI9A 3LDAA 4WXMA 3DP9A 4E30A 1VKHA 1RABA 2JCSA 2P2YA 3EZNA 4CT4B 4AY2A 2CLLB 5AW4A 2JBAB 1QHHA 5DHPA 1QYCA 1KRXA 4EYGA 3NT2A 2I6XA 1E79D 2HF2A 3A4NA 5L7YA 1MJHA 2IEBA 3HYSA 4LZAA 2ROQA 3IILA 3KZOA 3CVXA 4HUQA 4FP9A 1CT9A 2GDJA 4AULA 4EJSB 4A2QA 4TWJA 3IBCA 1UWCA 3OU6A 3QVKA 4GSKA 4KW7A 5AI0A 5A4AA 3LKVA 5HZKA 1KQGA 2Q3BA 4U6QA 4B17A 2YBDA 4BQFA 2R6HA 2QGNA 3I8SA 4K46A 4LX0A 3T7TA 3DLIA 3HXOA 1XJQA 4JVLA 1XZBA 1TMOA 4PN7A 2ZWAA 1IAQA 1ZICA 1KO8A 2ZRFA 3DV9A 2AEJA 2G5CA 1RKQA 1UJNA 3DMTA 1VPLA 1KQFA 2Z6UA 3WNDA 1LQTA 4QXAA 3ZKWB 4DAOA 3VHLB 1UXKA 4NZNA 4ROTA 1IE3A 1Z6QA 2RGNC 4UUNA 3GMTA 2JH8A 4I5EA 1XCPA 1N7JA 5LJLA 2XYPA 5CXQA 4BFYA 4J07A 4DJJA 3VHRA 4HBZA 3GFGA 3TRKA 3IPCA 5K0NA 4N8EA 1PJZA 1NY5A 2HQRA 5IZCC 1RAFA 4A0RA 2FF5A 3K1AB 4A1OA 4I19A 4IX9A 3U3ZA 4A8PA 2GK7A 4DNOA 4PEVA 2B6NA 4ZVMA 2WU4A 2PZMA 3LA6A 1R4ZA 2QTLA 1AKTA 1F9EA 1WL8A 1GTJ1 2WFLB 4IV0A 4MQEB 1GNTA 1TM1E 5D8DA 2NVUB 5BR8B 4YUVA 1TJ3A 1WXQA 2VP5A 4V03A 3OWHA 4EPTA 3KETA 3FYHA 2HSEA 3LT1A 2B5VA 2ZROA 4IS3A 5DRTA 3ZLJA 4IFBA 1KHHA 4ZCMA 2BFFA 3DO6A 4GI5A 5AK6A 3ZHXA 2XLCA 1OYWA 1PJ4A 3QY0A 4JXXA 2WV7A 4BP3A 4UBJA 4QUIA 2VSNA 1RKUA 3VTKA 2NLOA 2VNJA 4C6SA 5DEOA 5EUBA 3USZA 3GU3A 1Q0UA 1G5QA 3BWMA 2VUHB 1QIJA 3LTEA 3PUWA 4RDIA 5AJXA 5IANA 2PLFA 3R7DA 1U63A 2VDLB 1N2IA 2PM8A 2BKUA 3BWDD 2OPHA 3PDJA 4AJ2A 2X1LA 4Y0VA 1STOA 5IBRA 2DWUA 1GRQA 1NNEA 4F38A 4QPPA 2ZIAA 4B9EA 1X3SA 3D7RA 1W25A 4HSEA 2NACA 3OEHA 3ET4A 2XE8A 4LHWA 5LIRA 7MHTA 3N8HA 4YALA 1Z88A 1JI0A 2XYQA 1FEZA 2AQHA 1P1FA 3N5KA 1KYQA 1RWQA 4ZZ1A 2DWCA 3QEMB 2HBYA 4RVHA 4JLPA 3M9WA 5DBOA 1CIJA 4YP6A 5TX7A 5CA1B 4GZ3A 3PX3A 3ZG6A 1N2GA 3G5AA 1KFKB 1NKSA 5EPOA 2GGSA 3ISVA 1OWOA 4FBLA 5C5DA 3GEGA 5LMZA 3HDTA 1AG9A 4EH1A 3CFYA 2OCXA 3H8SA 3N39C 3D8SA 4F9EA 3IMKA 4ZZ3A 1DBIA 1SY7A 1XEFA 3O7WA 4HDAA 3U17A 5CFOA 3EPLA 5JZBA 5G40A 4WZAA 1C9KA 3L0IB 3NM5A 1CP3A 4D8XA 5CAEB 1KJJA 3D8HA 3P9NA 3IYLW 4HRXA 5J2UB 1BYUA 1VQ1A 4Q1DA 4CBVA 1JDJA 4RH0A 3UJCA 2IU0A 2W2LD 5AHWA 5A0FA 2QD2A 5B4UA 3FB1A 3NNSA 3OD1A 3RYCB 2AJDA 3LOQA 5CHYA 2O3TA 1FZQA 2XVZA 3EGCA 3GRAA 1UBRS 4L8FA 1AY0A 3DAYA 1ONPA 3L0PA 2HKIA 2QKYA 5THKA 4LY6A 3CF2A 4DJTA 5A62A 3TAUA 4RBNA 3OT5A 3PYXA 3ANLA 3QBTA 4H4CA 4GO1A 2ID8A 4A3SA 4AICA 1Z63A 2P4HX 1LBIA 1NUSA 4GW3A 1YH3A 3C43A 3WGNA 3KZNA 2V8BA 2ZM6B 1QTRA 2POCA 4WNAA 2IL1A 2VHWA 4XJVA 2VSYA 3DDHA 3GAZA 4TT8A 1WJGA 2XDAA 3BRQA 4FGWA 1G6KA 3QU2A 4OQLA 3TO5A 5EJGA 2E18A 1KK2A 4MQUA 1NV9A 2FMUA 2G0AA 3AXSA 4GI2A 4TV9A 4IAOA 4B80A 3G0IA 4EI8A 1E3MA 1YRBA 1IY2A 4MZDA 4B6FA 3RS4A 5C1DA 4JXJA 5DTEA 1VPVA 1R0WA 3MMSA 1SBTA 3HB5X 3DTVA 3V8EA 3RBAA 3ETEA 1M2VA 4JLNA 4LXYA 4YQZA 1ZONA 2PVPA 2XNJA 1BVYF 1GCAA 1I0ZA 2A58A 5K09A 1CB7A 2ABWA 2VP4A 1EA7A 1MX9A 2IY8A 3JQEA 3S28A 4AP6A 2ISQA 1AGYA 3COWA 4KR6A 4PVCA 1RXUA 4DQVA 2A0YA 5AH0A 1R74A 3TRJA 3KJIA 5IK2D 2QTVB 2W2MA 3HKDB 4X93A 5CGZA 5EY5B 2D5LA 4OQQA 3TXYA 2AW3A 3HDQA 1AD2A 1MW9X 4GC5A 4TWBA 4OFBA 4YRPA 5KNCA 3ONWA 3U48A 1I80A 2P4EA 2ZVPX 4C4SA 3DT8A 1UPXA 3ODGA 3OICA 5FADA 5KREA 2OORC 2VFAA 1K97A 2NU7A 4W1SA 1W93A 3GNTA 3W8FA 1NI5A 1DGQA 2I1WA 1QRUA 2EBUA 4YBZA 1H42A 2A59A 2IYYA 3GJ3A 1PS9A 4Q9LA 5AOCA 2FPMA 4AMGA 3GRFA 3L4BA 4OHOA 4DADA 3V4RA 4YR7A 1GSOA 1SVIA 4DRXA 4GX5A 3AHJA 4RE5A 2RC5A 2J87A 4O4HA 5LPNA 3BE5A 5AQEA 2JFYA 2OCGA 3I9JA 3NDIA 1W0JA 4TLCA 3KSBC 1Y5IA 1ZC4A 1HDCA 3OZ7A 2QBYA 5AKYA 3GLIB 1U3TA 1BHJA 2G5TA 4ARZA 4AXBA 2F59A 1VJ0A 4YRNA 2CL6X 3LCJA 4PR3A 5HX7A 1YR2A 4JKIA 5TPWA 3KU4A 1PQUA 1NVAA 4YONB 3WYAA 3NOXA 2HQ1A 4X94A 4TSKA 2BMWA 1GUYA 1U8YA 1UKBA 4ARSA 4L8WB 1Z74A 5HRAA 1TKCA 1TF2A 3B12A 2PU7A 1P0FA 2BOVA 5BN4A 4LCBA 1ECFA 2JEYA 4UBMA 4EB8A 1JPVA 3CV3A 3NIBA 1LNQA 2I7CA 2EC5A 3WYNA 2IYRA 5GJCA 1SXIA 3E22B 5CBKA 1GKUB 1GAXA 1E7YA 2HSGA 3AR5A 3BIWA 1ZKDA 2QTMA 4ZO7A 1KFCB 1K5DA 4LVOA 1QO7A 2IV7A 3E5RA 2R68A 2LCIA 3N0XA 3WLSA 2B2CA 5L40A 1SG9A 4PW0A 4TTRA 4E5NA 3H5AA 2VTDA 3QIAA 5I9MA 1NUUA 4TZ0A 5L3RA 3LUAA 2G6BA 2C1ZA 3LVQE 1SVKA 1II0A 3AYZB 4L85A 4U8HA 3TTSA 4ENVA 1KMNA 1L5KA 5C35A 2BWJA 3C1UA 1JDPA 4K9QA 4EEKA 2X15A 4K86A 1N2HA 3G8YA 2H2GA 4PZ9A 2WM3A 5DT2A 1CJUC 2AOTB 2QAGC 1T8RA 3UV7A 4X66B 2NQTA 3H1PA 4S1WA 1ACLA 4JX8A 2A9QA 2CMFA 1EWRA 3H11B 1K8ZB 3ZU6A 1YK1A 3BTVA 1UC5B 2WAMA 3BERA 2WKQA 3GIWA 4YJKA 4KGXA 1CSEE 1XZAA 5IJ9B 2VSQA 3GO4A 5K45A 5M5BA 2R6AA 2PKYX 4GPIB 4HGQA 3AM4A 1WWKA 3Q3EA 2HO5A 3DDUA 3LV8A 3Q98A 4W1PA 3TM5A 3LBFA 1KORA 3CF0A 4OHWA 3EMVA 3AX6A 1N5RA 1SG6A 5KYUB 3S8MA 4AYWA 3BKXA 4ETWA 1JHDA 4ZCLA 1GN9A 2VAPA 1J70A 3F8SA 5EIBD 3AG6A 4AD8A 1K6MA 1O96A 5M3BA 1FSSA 5A9SB 5IS2A 5IFLA 1L1EA 3COYA 1EX6A 3VJKA 1LJ8A 1F8YA 3O8BA 4K9MA 1QHIA 4YRLA 3CWQA 4KXFB 5F73A 2D06A 2ZYUX 2D59A 4QUHA 3TEMA 4CFZA 3R6LA 3R6GA 2CEKA 2EHDA 4LWQA 1SKMA 1Y9AA 4XUEA 5BSWA 3WQQA 2PRJA 3A58B 4PHHA 2ZPUA 1M2WA 2VPWA 3IKTA 1FYVA 1NJGA 1YR1A 5DCWA 4IZIA 1WDLA 4TSRA 1EA5A 1XT6A 4O25A 4YECA 1DC4A 2PWZA 2V4ZA 4MKRA 3CG4A 3K70B 4R6WA 5KSPA 2WHYA 4S35A 5JD4A 2W6IA 1I4EB 4DR2B 2ZRDA 1ID8A 1P3Y1 1LNSA 3OECA 1GQYA 1RRGA 3BDIA 3R20A 4HEHA 3SY8A 3EISA 2VIIA 3S2UA 4I1PA 5E9QA 1EFVB 3C14C 2QN2A 3VGJA 3RSFA 3HU5A 4G1BA 2CL7X 4PO9A 1XK7A 3H9JA 1YJQA 4LBWA 5AKLA 4DIMA 3F6EX 4QT4A 2W2OA 4DDVA 2EZUA 1ODSA 5I9BA 3FCOA 5F2KA 1TYBE 2P2SA 1ZJ5A 4KQIA 3THYB 4IUYA 4INOA 3F98A 1JDZA 5EJMA 5EHXA 2C88A 2V97A 3ESBA 3D64A 2FSVC 2JBWA 2B30A 4G5FA 5HE8A 4ZQFA 2HOQA 4BVHA 2EX1A 4EMUA 5KU1A 4E15A 5EEGA 2FMFA 3BJRA 1MP0A 3HXKA 4GSLA 5AD1A 3WWEA 4Z9AA 3OKFA 1CRZA 1OLOA 3K0KA 1ZUNA 1L7VC 1DIBA 1IHXA 1C3XA 2J67A 3RUCA 3EGXA 4NBSA 5K0FA 4YAEA 2BGIA 2H17A 5CLJA 4ABTA 5HCIA 3L6RA 4DPLA 5BMOA 1TYZA 5HKKD 1GPAA 1QNLA 2ZJ2A 2IE8A 4BO2A 4MWBA 2Z2KA 1U2GA 3E3OA 4PTLA 2IYPA 3VR4H 4C9BA 4XIGS 4JLJA 4E31A 2Q5QA 3LS2A 3AFIA 2FQWA 4H7PA 3GARA 2OSVA 4TN5A 3BJMA 1DWPA 2I80A 2P2GA 1ISRA 2PAAA 1IJFA 2XUJA 1C9JA 1RXCA 4K6OA 2QP4A 3TVDA 1YFJA 1P7WA 1N0VC 4U7WA 1TU3A 4EYSA 1SUCA 3BX1A 5C4MA 4X8OA 4WFKA 2C42A 5TSDA 1YVPA 2OO7A 2A9OA 1W2HA 3PZRA 6Q21A 3SLGA 2XTMA 1BMQA 1O54A 2JASA 3X3HA 3GT0A 3VAYA 1JV2B 2PVCA 5A3QA 1YQDA 4LWPA 1H9BA 1F60A 2UAGA 3AGQA 4POAA 1W94A 2DBYA 4EX7A 1C3VA 1RU3A 2A1UB 4N54A 2A9VA 1H94A 3EQZA 1WOMA 3H3JA 4ND7A 2V7BA 2QHXA 1S5PA 2DM6A 2XNCA 4ENRA 1R2QA 4DCJA 3N2YA 5JAZA 5A6SB 4KXNA 4GYYA 1PBNA 2REQA 3ICQB 1E5TA 4N47A 3H9GA 3HJAA 4UEKA 1UKEA 4G2NA 4NH0A 4C0KA 4YQFA 1FFHA 4PC1A 1EG2A 2Q3JA 3INRA 1X1CA 4BQRA 4XB1A 4XPIA 4RMJA 5J4YA 1XP8A 4CTMA 4CCYA 2R85A 2BGKA 3H3XA 4HDRA 1HV8A 3HXLA 1DE0A 3F0TA 1IJBA 2VJAA 3ZJUA 4D2IA 3FDZB 4N5LA 3GFQA 4ZCTA 2OO5C 3OJLA 5SYNA 4BZPA 2OBNA 4BFZA 1PW5A 2EKBA 2IHZA 2IU3A 4P3PA 4EJ0A 3AHDA 5LZ5A 2VHXA 4IVNA 2WWRA 4FWIB 3OY7A 4IPTA 3CSSA 4O2BB 3LUDA 4JJZA 1TO1E 1OIVA 4OKIA 3BIXA 4FOLA 4FE4A 3FBGA 4CMEC 3TW8B 2HF8A 5FP0A 4QUKA 3KSRA 4YP5A 3G1TA 1QRDA 3O84A 4D8UA 1PV4A 3R0IA 1RXYA 1ZH0A 3H97A 1W5BA 2ODPA 3QMPA 5AVOA 3HYNA 5KVVA 2QUBA 1CJBA 4TTIA 1VKZA 1IJKA 4F3KA 2Q5FA 2QT1A 2RHLA 1WABA 1OFUA 1SPBS 3JRXA 5ECYA 3C3BA 3NC1C 3G9XA 4QZVA 3SJ7A 1Y8ZA 4PNZA 4X9XA 1JQBA 4MROA 4I8DA 3NEJA 1MT3A 1P7VA 1N9KA 3LQ1A 2BFOA 3F6CA 4PX3A 2JKYA 4KH0A 5F3WB 1O95A 1KYWA 5MDHA 2VAWA 2WHRA 5FL7D 3EXHB 5LWHA 2ZS7A 1BKSB 3BWYA 2J33A 1HDOA 2WU8A 4G0XA 1U0BB 2R96A 3QK7A 4BIIA 4EYEA 1ZMRA 3NHJA 3QRWA 5CLLA 1CQPA 3ROKA 1T9AA 2HJHA 4MMXB 8ATCA 4UBNA 5JASA 1DNPA 4HT3B 3M49A 2IHKA 2XR1A 5BT8A 1JKMA 1PJ2A 3H5RA 3WL6A 621PA 2OBXA 5I7EA 2HSZA 2PRIA 2XNDD 4MX8A 3ZCSA 2Q8PA 5KKNB 3B85A 3LKDA 1LX6A 3DOIA 2ZR8A 4BN5A 2AKEA 4B3TB 4CN9A 3RU9A 2EKLA 1C1XA 3UMJA 3T61A 1ZRSA 5J43A 1YGYA 3WIOA 2MSNA 2I4MA 4WJKB 3W8NA 4LYHA 4ZEMA 4U9HS 5GVRA 4RK0A 4BV9A 3QPUA 1YQUA 1VL2A 5GM2A 1Z8DA 1DG1G 1NI4A 2C5EA 2OG2A 3DJYA 3JAWB 4YGYA 1BA3A 4LJLA 1LVUA 1I2CA 2BMEA 5E95A 3OEWA 5H82A 5K3FB 5CFQA 1G4AE 2OVFA 4C1BA 4CN8A 1Q83A 4UNIA 4JI8B 2GPNA 2W2NA 3DE5X 3GLUA 2V5UA 2CJXA 1OIXA 5B3JA 5FBLB 4XGKA 1DJOA 4FDMA 5JC8A 2ECOA 1ZBQA 3I0MA 4D3ZA 1T5HX 1Y7PA 2CXSA 3JYOA 4HB0A 2I55A 3PPIA 3DAHA 1VBNA 3A05A 5FWXB 2B25A 2BRUA 4RVCA 4CWAA 1EAYA 5FI1B 5G4KA 1I2MA 4AMVA 4TYYA 1G3QA 1OTXA 4TQUS 4LF4B 1DO0A 1N0HA 4KN5A 1CUGA 1NJ5A 2WNHA 3A7DA 3W2IA 3ZY5A 1WTAA 1QOZA 2QIPA 4KO3S 2QLBA 2FJ0A 3E8XA 2Y3IA 3GJ7A 3RRJA 5LQUA 1UMBB 1SXHA 4TVOA 3UUGA 1LPOA 2XITA 1A9PA 1EHYA 4QYIA 2HJWA 4CKCB 1LPAB 3F73A 4EGCB 4F60A 3AY3A 3K53A 1QRTA 1L8OA 2LRHA 1OVGA 2H65A 2YOFA 3I58A 4GLLA 2JANA 4ZVSA 3N0VA 1PGNA 1QCDA 2J7KA 2QUAA 4EFLA 3IBGA 4TXMA 4KACA 1RXSA 2WVHA 4NOKA 2IUEA 2RFLA 3HJNA 4DBLC 3JATA 5GADl 3NBQA 3ADBA 2ZRCA 5FF9A 3LIPA 3ZCXA 2ZRAA 2ZIGA 3K09A 4QTYA 3VAZA 5DI9A 4C5CA 1MUUA 1T4DA 2ATEA 1OZGA 2XQGA 2E21A 3BZBA 3FZEA 3L1VA 4HKTA 1BU8A 3ABSB 2RAFA 4NYMQ 3F6BX 2AC4A 1A8SA 4JU8A 5J23A 3L7AA 1GFZA 1N3YA 4FYXA 5DI3B 2FAXA 4RZXA 4US2R 1UPCA 1ORHA 4FT4A 4H0CA 3H9EO 4NQRA 4C4AA 1GGNA 1XJ5A 1QXSA 2PWBA 1Z0SA 1UBEA 3DBHA 1M7BA 4XGRA 2A1TR 2B7LA 4RTRA 4ZEWA 1U65A 1W4LA 4XGQA 4OTZA 2PR7A 2QPLA 3ZVKA 1UINA 2O0KA 2YJNA 1TTTA 2Z1NA 3O90A 1IXRC 1HPLA 2FZEA 2WU1A 4TVKA 4EG3A 2AI3A 1T8YA 1GNVA 1Z0UA 1APBA 3E5HA 1VTKA 1BMFA 1E3DA 3WHIA 2BIFA 2H1SA 1V96A 3QE9Y 1SU7A 3TCKA 2IBTA 1F8GA 1KZ7B 1IUOA 3D5QA 2MSKA 2REBA 1VGRA 2C4UA 2PDAA 4LTDA 5J5CA 4W99A 2BSXA 2H9YA 2ID9A 2VBCA 2YXNA 3KKKA 1PU2A 3OU2A 3UT5A 4H35A 4D98A 4B3GA 1KAHA 3TSAA 1QFYA 3KSUA 1A8QA 3RKRA 2J6IA 3RW9A 1QOQB 1YB2A 2GEVA 2H6EA 3SKVA 1CZOA 1MVLA 1TCCA 2A9JA 1BWPA 5C0OE 3TLKA 3NP9A 4B2PA 3CW2A 2I7XA 4IHJB 3W9BA 2QVLA 3FX2A 5D2CA 3VJRA 3U4CA 1ZGCA 4MLZA 2O2XA 3R0ZA 5IC6A 1QV7A 3NB0A 1XDBA 4KO2S 4GF5A 4Q4AB 4XYBA 1JA9A 3PVZA 1KO1A 1UJCA 5DNUA 4AF8A 3VH2A 5IP5A 3LBAA 1EPUA 1G8JA 3G5MA 1U04A 1XTTA 3EPKA 3NW9A 4ZI2A 3OQ6A 2G1JA 3KD3A 3OTQA 3ICWA 4C7VA 5KQMA 3NAQA 4XRGA 1Z4LA 2HL6A 1OAOC 3RT1A 3N0RA 3STHA 4DIKA 2XODA 1ZH2A 2R8PA 5BR1A 4KWIA 4O3MA 1U8XX 2F3QA 1HXHA 4ITRC 4KQ6A 1QE3A 1A82A 1CEXA 1P7YA 3TZEA 4ZEVA 4BX9A 4IZOA 3V4OA 3E23A 1F4PA 2VQ3A 3CZRA 3DZ8A 3MD0A 4F4IA 4FZVA 4RHCA 5SZKB 3MF4A 2QRPA 3MRSA 1XNQB 5IJWA 1G8YA 4I9UA 1PK9A 4PONA 5EXEA 4UAGA 1CTQA 1SU8A 1EGHA 1U8ZA 1T5BA 1VKNA 2VYNA 3B52X 3GH1A 4LDRA 3VR5H 2DGDA 3SN6A 2UUPA 1YDWA 1ZNXA 3CG0A 3MCVA 4DLRA 3HU3A 2CHEA 1P4RA 2DUUA 1D5WA 3KV3O 3UIEA 2FRDC 4ZO8A 2C8JA 4UUAA 2PGAA 2B1JA 5BNIA 1GOTA 1Y80A 4R1QA 1G6HA 1T9CA 5IYZF 3T4PA 4UM8B 4EMBA 1PZNA 1TKAA 4L4XA 1SZPA 4HNAB 1TFRA 1P1BA 3JD0A 3TLGB 4EMSA 4UEQA 1EQAA 3TZKA 1KSHA 2IKQA 1GZ3A 3ZLTA 5IABA 4ALNA 3DR3A 3HWSA 2O2DA 4YUAA 1H2HA 3T15A 3W77A 2A4KA 1ML4A 5A4MS 1EK6A 3JWJA 4NFSA 3EVBA 2XUFA 4QUDA 4HQFA 2EQBA 1UKYA 5ILOA 2G5PA 4FFMA 2WJIA 1VG1A 4E7OA 1KY2A 4MI3A 3P52A 2QN1A 2JFVA 2PYIA 1LGYA 3GUZA 5CM8B 2YIDA 1GPWB 4RO0A 4C88A 4DA7A 1RBQA 5K6RA 1JHPA 3NC0C 1HLDA 4BYGA 1AUQA 4M0CA 4M1EA 2X6QA 2X22A 2JHFA 5LR6A 3RVLA 4F2DA 1T2CA 3JYPA 5A2QA 1Q22A 2H2HA 2WG2A 3IJRA 1GKIA 3ELUA 3WK8A 2WD7A 3FWZA 4Q3OA 4E5PA 1MVOA 2AN9A 2B21A 3OAAD 4KPGA 4NCIA 3MT7A 4X1YB 4F6RB 3VV2A 2ZI5A 3LVBA 3W0LB 5ALTA 4JR1A 2O0JA 3GGGA 1QWSA 2P9GA 1ZHFA 3H0CA 3QFHA 2EF0A 4NJMA 2RJ3A 3IS3A 3CHYA 2HIAA 1M2EA 3S40A 3SHWA 2VI5A 3GFTA 3NLLA 1R8JA 4GPZA 3VPCA 1GARA 1UZAA 2XGMA 4BQSA 4G65A 5FBVB 2A5YB 1E1QD 4DMHA 4CKWA 1Q1EA 2WR8A 3O0DA 1NXTA 5ECGC 1UQRA 3DH0A 1HNZB 1LBTA 4QSHA 1GJRA 3KKOA 4L4SA 2HHAA 4MQLA 2RCNA 3K0AB 4I4TA 3VBCA 1WB4A 3JTEA 4WOKA 1RWXA 1AQIA 3CJQA 2IJGX 2PBLA 3SQLA 3H83A 4P84A 4DIOA 1QFZA 1RWVA 4ZAZA 4HQLA 1OIWA 4WINA 4YPVA 1B6TA 4OXRA 1GAWA 5C1IA 4BTLA 5C8VA 1TOAA 1W2GA 1O8CA 1ZUD1 4OREX 3PJRA 5F5LA 3C6ZA 3LLCA 1XZNA 2Q9CA 1MU0A 1M5RA 1MAVA 4QVIA 5TT1A 5K2OA 4PIVA 4QT0A 2GZ1A 3HFSA 3RSSA 4AJJA 1ZGHA 2NNWB 3LRPA 2QPAA 2J85A 1C1DA 4ZO9A 1PX2A 4MUMA 1UDCA 2MSDB 1NQ5A 3AESA 1IUKA 4OH1A 4BO0A 3G8DA 2P40A 5JNWA 5KC8A 1H8HD 3WO1A 4DMFA 3SZUA 1C3OB 2GX6A 2HH9A 3L7YA 1NVDA 1K7XB 2YRXA 1T26A 5AM0A 3DONA 4MW9A 2ZAGA 5LQAA 1NBOA 3DFIA 2QG9A 5DIFA 1KRWA 2QN6A 1FMFA 4Z8XA 1PFWA 3A4IA 2O19A 4ECEA 1U2ZA 5DP1A 4EENA 3DLHA 1D0VA 4UTRA 3WYEA 1KXZA 1XF9A 3CUEF 3G23A 4G37A 4J16C 1M33A 4QX6A 3E03A 2QTBA 4KYIB 3EQ2A 3GLHA 2JJYA 1F2TB 3BFJA 3GL9A 3OWOA 1W4ZA 2HX1A 1XWFA 3CVUA 3EEIA 4FEEA 4N0EA 4OPMA 2DQSA 4Z53A 1GT91 1RCTE 2GNPA 4MHSA 4YEDA 2QGFA 4JQYA 2VDNB 1WZCA 2GZAA 4JB3A 4O1IA 4PYRA 1K66A 4P54A 1U0FA 1WKCA 3SBXA 3UOAB 4C6TA 4DCPA 2EGGA 4BZQA 1RAAA 2NSDA 3K0HA 1CU1A 4RSMA 4DWJA 5D7NA 1BU5A 1YZNA 2ZBFA 5DO9A 1G20E 1NYRA 2HRRA 3TKAA 3HXQA 1DHRA 2ZATA 4CYMA 4MLCA 3TEJA 3VDQA 1L5LA 2ACKA 4RLHA 3LDHA 4PZCA 4J0FA 4E33A 4ZMBA 5ABPA 3DMTC 1CE8A 1WOYA 3DLCA 5AVUA 3C8HA 1W88A 1UFOA 4FOTA 1FBTA 5AR1A 1Z12A 2GD2A 3FNIA 2I33A 1DMRA 1GZHB 3C3EA 1J4AA 1FA9A 4IXTA 1C7RA 5AK4A 5ESDA 3GLIE 4UNNA 3RR2A 1DXYA 3B51X 3T3NA 1EINA 4NOMA 3GPCA 1SWVA 5DXAA 1NP3A 1AO0A 2CNKA 4OD0A 2ARKA 2WJHA 3VZSA 3DMGA 5BN3A 4C06A 1SA0A 2ZQYA 4IGKA 3P2MA 2L42A 2FG5A 4IIVA 4BB9A 4G84A 4EL0A 4O2AA 1CERA 4XASA 4AXXA 1N6RA 1OTHA 2HRQA 4M87A 2AWOA 3BORA 2OAGA 3DZGA 4H0FA 2OG1A 3MWDB 3PXAA 1KZGB 1WKVA 4RLFA 3B48A 4PAWA 3W5JA 1SUIA 4JQOA 3U3JA 2VOEA 2Q7OE 3L40A 4ZDIA 1A2KC 1U99A 4MVJM 1V1JA 5IAEA 5T7BA 4PLHA 3G49A 3TNDA 3EULA 3EIWA 2H4XA 3OQJA 3G89A 2CLSA 4PSUA 4JVMA 1ZMTA 4RXTA 3CLUC 3WKCA 3SYKA 5ADVA 3F96A 3JQ9A 3O4RA 2J32A 3TLMA 4AQDA 2ZI6A 3U7FB 1V3UA 1HT2E 4MJLA 3QWBA 4XH9B 1E5DA 2O8DB 4IIDA 1X1AA 3LW7A 1DMSA 1F2UA 1S3GA 1T4BA 1ZSVA 3OCJA 2CXNA 3EFOB 3PUZA 4YAJA 4QTTB 3UJHA 2Z56A 2GD0A 4G8CA 2CLEB 1VL6A 3FROA 2V3VA 1E6CA 1XTBA 1WDKA 3T3OA 4HWTA 1B6RA 1GD1O 1ZN9A 4FGJA 4LJ5A 3ZTWA 2ZTUA 4DQKA 4CV3A 2WB2A 2A84A 4UDYX 4B3JA 3ZDDA 1GZ6A 4PRYA 5MN6A 4FYJA 4N76A 2GNOA 1VLJA 2BJVA 2GT1A 1F1JA 2O1XA 4N9QA 4Z99A 5EHQA 3EW9A 5K51A 3O4GA 1LY1A 2AEEA 1C9YA 2AR0A 4JOBA 2ZSJA 4FDTA 1AGPA 4IDPA 1P0IA 1XTVA 4OQDA 1T1IA 1DKMA 1SXJD 1KI7A 1J7KA 2GHIA 3FCUB 3MJSA 1SUDA 3NWOA 4UHCA 1GTL1 3FMVA 5B6PA 4OMFG 2UZIR 2W2QA 4DYHA 2C20A 4QXOA 3W7AA 3TLZA 1A9XB 5JCJD 2I71A 1KEKA 2PUGA 2OY0A 5KQRA 1W7AA 2RGCA 4YRTA 1TK3A 1XN4A 2AX3A 5JD3A 4OX9Y 1U4SA 4WLUA 4GVLA 5MFPA 2LDBA 3QBEA 1NUAA 3EXIB 3P9CA 4DILA 3HDVA 5K6TA 2D74A 5GV7A 5ALNA 3WP0A 2HIHA 2GBLA 1M1UA 3QUSA 3GI1A 3IURA 3SDZA 1DC6A 3VI4B 5J4LA 1U98A 4DMKA 3JARA 1PW7A 1SKQA 1WBJB 2GB4A 2YYZA 4FXOA 5HJ2A 3T3DA 3U19A 2XECA 1F48A 3OFKA 4RW0A 1FS5A 2IWHA 4DQUA 1G8FA 4NCBA 2FE1A 1E2BA 3C41J 1QFJA 3WBFA 2QUJA 3UJ7A 4CI0B 1FLVA 3H5OA 4URVR 2IYUA 3OPMA 1GTG1 2O59A 2B99A 4QC2A 3BZWA 5HUQA 4B4UA 2VH1A 2FX5A 3GXOA 5BURA 3FGNA 1EDEA 1EVQA 1FF9A 3AV3A 1RLMA 4Z0HO 4AMUA 2QAIA 6PFKA 1Y1KE 1D6SA 3N3BC 1NNUA 3M8KA 1YTUA 1V5FA 2O52A 4Y18A 2ORVA 3I2IA 4EB0A 3NV9A 5JCOA 4CLOB 2I2FA 3F71A 4X64B 2IYWA 4YXWD 3K35A 4KIFA 2AXNA 2HBZA 2X1HA 3JQRA 2DE0X 2Z9BA 2DQ4A 3QG5A 1YCHA 2VA9A 4LNUA 3UV6A 2J0UA 3BTOA 4D8WA 4YUXA 1YZFA 3LC1O 1P0MA 3ADDA 1BS1A 1JKIA 1GRVA 1T3TA 2NSYA 1H05A 3BGSA 4QEDA 1F3OA 1G2QA 4DR7B 1L0BA 2GTHA 3I12A 3NS7A 2WJ3A 3LQQA 5LFAA 2F8TA 5JVDB 4M0KA 3I92A 2H7VA 5EJ2A 1P5RA 1DI0A 4JJAA 1VPEA 4N39A 4HVTA 1U9CA 1TEZA 2J59A 5AK0A 2ODTX 2DOKA 4LF7B 2QYOA 3G79A 1YA6A 1WAMA 5ALRA 2WP8J 2OCPA 5DNWA 1D03A 1JDNA 3BULA 3DDZX 5DLYA 3E15A 4J2TA 4ACBA 4YAGA 2AG1A 3VO1A 4QLAA 2QMUA 4JQZA 4YPOA 3JZDA 1OROA 5A0VA 5HMMA 1YIOA 4FS8A 4DE5A 3NWEA 4LY9A 1JHXA 1NVMB 5EJAA 3TG2A 3IUQA 1NW5A 2PT6A 3HGMA 4FHFA 3WGGA 2WUEA 4Y2PA 3ZYCA 3IOCA 1EM6A 1R3DA 4ZZ0A 3FNRA 2P1RA 2FEPA 1BGXT 4FOPA 2I9KA 1XDZA 2R1TA 3FWYA 3OA0A 2VLBA 1QAOA 3R3ZA 4H6XA 1PFQA 3KR0A 4PFJA 4BRWA 4POOA 3A6FA 3I5MA 1L5WA 2XNHA 4PTYA 1A04A 4I6JA 2QYTA 1A0OA 3KJFA 1IQ0A 1U7DA 3PIIA 4GGMX 3ZCQA 1A7AA 3K0EA 1SCUA 1NW7A 1FJXA 4RD3A 3UAYA 1M8PA 1QJ4A 1E59A 1W4BA 1CBUA 2CYCA 2LKCA 2X9LA 4GL4A 5E3IA 1SCJA 1T1SA 1IZ8A 3IP1A 1X3LA 2G0NA 3RKSA 3SXJA 3D2AA 1G1MA 1M9NA 1PNTA 1IVYA 1QH9A 4H08A 4NESA 3CR8A 4UCXA 4OJTA 4UDXX 1SD1A 5IAKA 4ZGBA 2V5AA 5JR3A 3FJ1A 3BSSA 4GOND 2RKWA 4IIGA 3TNYA 1FRZA 4QULA 1T1JA 2DZDA 3M81A 2ZRPA 2H48A 4WOJA 2UXCB 3GLQA 4CM6A 3N1UA 1GQQA 1IUNA 2Y0CA 5CITA 1VBFA 3OF2A 4HZIA 2OLJA 1CY6A 4DVJA 1FB5A 2FWMX 2H4HA 1JKXA 1GFWA 4JJIA 1ISIA 2W37A 4HD8A 1MBZA 4JLMA 1QCZA 3DXZA 2QLMA 3NM4A 4JI0B 1G41A 4U4AA 3I1IA 1RJEA 5EGSA 1UK7A 3INNA 2V7GA 1SJ9A 1V16A 1WDTA 2G77B 4QXPA 1RXVA 4FI3C 3KOMA 4MR7A 4F93B 3BXOA 1H5QA 2MYTA 2P78A 2QN8A 4X7MA 3TOZA 5FTKA 1NQUA 4GOLD 1BE1A 1GPNA 4IXWA 3KYCB 4U2DA 2WIJA 4ZVQA 2Y0DA 2BFEB 3ZTYA 4WBXC 2ENUA 4Z1OA 1IM8A 2Y68A 1LTHR 1EFCA 1F6WA 3PC8C 1L5YA 3V34A 4GYWA 1QHSA 4ZIRA 1JWLA 1GIAA 2JIPA 5L3QA 1U9YA 3AB7A 3HO8A 1X7WA 1P0QA 1M2OA 1QK4A 3Q7RA 1FX0B 3FJYA 1R8SA 1QS0B 1YTLA 1YWGO 3AILA 4MA0A 4UMVA 3IUYA 3R7LA 2O5VA 3TQTA 2G72A 3IUJA 1L7PA 1TC2A 1UK8A 4NY1A 4DDTA 1MJGM 1IONA 2CSUA 4PNPA 4RY0A 3TQRA 3HA5A 1HY3A 4HEA6 3URKA 4I66A 4ESOA 4M1MA 1IC6A 2V6GA 4QU9A 1P2BA 3CGWA 1S8FA 2VRWA 4KYTA 2PEYA 4WW0A 3T41A 3WLQA 2GHQA 5KOYA 3LGSA 4FC7A 4ZHQA 2N75A 1FP2A 4E51A 4U2FA 4UNSA 4CMHA 1QC5A 2A0KA 2BCJQ 3N9IA 3CJRA 2GZSA 3V00A 1GITA 1IYZA 1MAUA 2JBHA 4RE6A 1O57A 3NUGA 3QV1A 1EUQA 1GG9A 2A86A 4RGQA 3BMQA 2HSWA 1RMQA 1VL0A 1WMDA 4EX6A 4Q3DA 4TX1A 2ZYDA 3JVDA 1B8VA 4TPKA 4FFBA 4HUJA 4B6JA 4IIYA 1BD4A 2HMUA 1WDMA 2Y0BA 4RF5A 3VO8A 2RK6A 5H68A 3C87A 3PD7A 4CMCA 5KZMB 3VKFA 1B74A 4AO6A 3A6LA 3D1JA 4PR0A 4W7IA 4D43A 1EIWA 1IHDA 1C80A 4MW1A 1ZCBA 4HJRA 1HDXA 4MWSA 4OAQA 3USES 2W8ZA 3GGCA 1NVGA 3CX7A 1M67A 2RI1A 1QYRA 2J5RA 1CZHA 4RSHA 1KO5A 4X91A 3UMBA 4YR9A 5CXUA 4UUPA 4B79A 1ZVQA 4U2CA 3VXKA 1ZIDA 4X8LA 1Z83A 2AE2A 2IFTA 5KNDA 3AEUB 1LDNA 1U2GC 1E6KA 1V3QE 3I01A 3K4QA 4PWYA 1SQ5A 5CB4F 1GG5A 3RSQA 1Y1RA 3X2EA 2VR1A 1JDVA 3KPJA 2JAHA 4Q1CA 1WXHA 1MG5A 1S2GA 4KNWA 4V1CB 2YXEA 4XIFA 1K9SA 2ZBDA 2QRZA 2H85A 3PPWA 1XQVA 1U7TA 4K81B 4OK3A 3OLYA 1JKFA 2I8LA 1ZO8A 4ILKA 4NENA 4UARA 5EUMA 4XWWA 2ZBGA 3ZWKA 5IRCD 2F3RA 5DBGA 1BD3A 4KQXA 3Q5EA 2WJZB 3FI0A 4D92A 2RD2A 2ZUTA 2P8SA 4OXKA 1LSJA 2FZCA 4YAUA 4C2AA 1KARA 1QPBA 4G0PA 1W35A 2HF7A 3DQPA 1CUDA 2B8TA 4IINA 3ZV4A 4DV4B 3EIFA 4OVKA 4IFEA 3H5LA 6YASA 4I5DA 2PKRA 1EMDA 1W49A 2YRWA 3P7MA 3V48A 1HDEA 3IH5A 1EB9A 4BKQA 1MENA 1XZGA 1MO3A 1Z5PA 2DHDA 3LIIA 2FLWA 2BEWA 4QDOA 2JL1A 3D2CA 4PX5A 5ENDA 4DKXA 1W8IA 1CEQA 1MO5A 1V6CA 1YS7A 2PRYA 3J7AC 4JEMA 2BFCA 1Y7TA 3BE6A 2EDCA 4BFUA 5JTTA 3RG8A 3RBZA 2KWIA 3JQAA 4C4ZA 2XE7A 2YMMA 3WG9A 1SULA 4LDZA 3P9XA 1Y8QB 3FMOB 4FQ5A 4CLEA 3I05A 1Y1QA 2YUTA 3ESDA 4E5UA 1C7JA 4C05A 2CZGA 3AERB 3QPAA 5IJAA 3SYLA 1MX3A 3S70A 3KKEA 1SVLA 1OX6A 3PIDA 4EBBA 1LPPA 2ZBPA 4DWOA 1NURA 3PWSA 3OQMA 2DT8A 1U0OC 5G1OA 3RLFA 3MS4A 4JJGA 5CJJA 3QW4B 5F2EA 1ETUA 1MC8A 3BFXA 1WRBA 2P5SA 3IB3A 3K92A 1RKBA 4NHOA 3THRA 3WBBA 4A5OA 5K3OA 1QHHB 2QP3A 1RHUA 1UZUA 4XXHA 1RPJA 1YQTA 1IN5A 2CXXA 4R8KA 3I9FA 1ZQ1A 1JG7A 4AKIA 1Q14A 1U7UA 5BW8A 2RKOA 4BMCA 3ND9A 3IFSA 3F6RA 4NV3A 4W82A 3UCXA 4D4LA 1E8MA 1GRCA 3O9VA 1KDPA 1WHTA 4E08A 5EJ6A 4JOCA 2F8MA 1JEEA 1Q77A 2L2QA 2OTCA 1TYAE 5CT6A 5TGTA 1UBTS 3TSOA 4EHAA 5CCEA 4C7BA 2G7ZA 2ONYA 4MDHA 2XRFA 3IEUA 3NASA 1OFIA 2YXPX 1JR2A 2A67A 3DCNA 3SS7X 1XZMA 1PKEA 3AVOA 3M89A 4IP0A 4JCOA 1VPWA 1E3LA 2VXBA 3BGDA 4PSAA 2VTBB 1IEVA 1XMSA 3HJBA 3KS9A 4B3IA 1GZUA 1Z5NA 3DEAA 4YS6A 4IDDA 2ZYTX 5C7LO 2O5EA 1J56A 2BR5A 5LL6P 4JP8A 3D3WA 1KEPA 1OD6A 4WZBE 1EE9A 5KBYA 4WKOA 1NRWA 1SHUX 1UT8A 3LZDA 4KR3A 4JBWA 3N8IA 5BYBA 4EI7A 5EJ7A 4NONA 3A4VA 5K8LA 3EGDA 3WWCA 2YIVX 3LTNC 5BUQA 2PCLA 4Q9HA 1EQ2A 3DOEA 3DQQA 3HUUA 2V96A 4F97A 4XIYA 4RTJA 2B1GA 3NX4A 3MUOA 3NALA 1TNDA 1HDRA 2AFVA 3K9NA 4ZODA 5ARDA 1JFFA 2D3WA 2EAUA 3WL5A 4UTZA 1GCOA 1EGVB 3T0FA 1E61A 1KOFA 2FPXA 2Y9MB 2BFFB 4TL6A 3W5VA 2YFKA 1PTJA 3BE4A 5SY9A 3B1YA 3KKMA 4M7PA 5B3JC 4N03A 4FFLA 4R8VA 2NZVG 1X0XA 2VZ8A 3L7IA 1ZQ9A 2P90A 3E7DA 2PGJA 2O5CA 4K9LA 5CVDA 1KDOA 4MVJD 2GLXA 3TPFA 4FNGA 2BRUC 4WERA 1FBNA 3EIOA 1B0UA 2VPXA 2GS9A 4OO3A 3ROEA 3V8VA 4J1TA 5E6RA 2IH5A 5IU6A 4C7XA 1KQPA 5GONA 4U63A 4JJ4A 3EZGA 1BDMA 2EW2A 2M1XA 4W8OA 3GXBA 4Y6LA 4N7BA 2XUKA 3P0EA 3EQ6A 1YVRA 1ONBA 3I52A 4L8LA 1TAGA 3Q0IA 3HVJA 5BW4A 4QA9A 4E22A 1R6TA 2HLNA 3TKYA 3N2KA 1H9CA 5BQFA 4I50A 4QD3A 3ZBTA 2JDID 3A1EA 4Z4GA 2YWJA 1O0BA 1DDOA 1EWYA 5FOWA 1VSBA 2V6IA 5BYKA 3P94A 3LT4A 3TW6A 3X1XA 1E3EA 1HDGO 2F1IA 5I8PA 3SVLA 4EY6A 1DARA 3CPSA 2X3YA 3ZZ0A 4DV6B 1M7GA 2EGUA 1Y9DA 2XCLA 2J6CA 4NBWA 1JJAA 4R40A 4CUJA 5AVVA 4G0WA 2VP6A 1ZSYA 3AZPA 4LSZA 4NOJA 1NX9A 121PA 5CTAA 3UJPA 5KS2A 1XZJA 4HQKA 2H2DA 2UUBB 3EYAA 3LQKA 4LY0A 3X1YA 2H2IA 3IQGX 1SQSA 2PPLA 4KCGA 2HJ9A 2JEZA 4G9GA 3R74A 1ZIPA 2VQDA 4QDZA 1GLVA 1EVJA 2YDYA 1ZUWA 3WQSB 3RADC 3HN6A 1H2WA 4HAOA 3E4CA 3PR1A 4CM9D 1T6ZA 2C2WA 3E61A 4RA9A 5ETJA 5FA6A 3CNEA 4JKOA 5JBIA 1P33A 1GWNA 4B40A 3B6MA 5E9WA 4QEZA 4H27A 1DG3A 1GPYA 1COZA 1T8SA 4UHHA 2X1VA 3ZCTA 4WQMA 4XWYA 3WLOA 2NN3C 2QNIA 1QO0A 2J4FA 3FYDA 3EBPA 3N6RA 4LOIA 4BQIA 4TV9B 2RK4A 3DO8A 2DFNA 5EP3A 2XCUA 5JC1A 4GI3A 5BWBA 2WD9A 3F6YA 1Z4QA 3MK31 4ON9A 1TW2A 1CJTC 1VM6A 2NSHA 2RHBA 3DTVB 1ND5A 1G64A 1XU4A 3PQ6A 4CMBA 2F4NA 2O1SA 4FIZA 4WOPA 2PUCA 3LAWA 4KODA 3NQ41 1HEYA 4GI1A 3PDIA 1V8PA 1Z0FA 2FWPA 3KVVA 3QWFA 3IBFA 3A6EA 3QMWA 4FYYA 1G60A 3ZWDA 3O26A 5IH7A 2PX4A 2J4CA 3MJHA 5JU6A 2ILVA 4OQFA 1VKRA 3R7BA 2MYPA 1L7RA 5A4IS 3N05A 2PZJA 4Y1RB 5FPKA 3EVZA 1XVAA 4G5RA 5FPHA 1SRRA 1JPUA 1U1FA 2H3EA 2WYUA 2JIBA 1ZGJA 2NU7B 5AW2A 5IUNC 5ALQA 4BNZA 2AMYA 1GQ2A 3PNYA 5I9LA 5FFFA 2X4GA 1LNZA 4WFIA 4JBLA 5UKDA 3MGCA 3O2NA 2A9RA 4M9XA 2XQKA 2OILA 2PAFA 4QBFA 3TTVA 1M5UA 3SK0A 4DRXB 1B14A 5IKPA 1FMJA 2VJBA 2PUVA 4O4HB 3IT0A 4Q19A 2O9JA 2OBYA 3NHKA 3T9DA 4H18A 5BWNA 4WKNA 3K0BA 3DBRA 2BSQA 5B7NA 2QBYB 1TT5A 2WDPA 2XLBA 3ED5A 4ARZB 1SIOA 3ELYA 2OBMA 1R4MA 4C87A 5KNCH 4N18A 2PH5A 3T1QA 2WJ6A 1FDIA 5TPWB 3G2LA 3LUPA 1TO6A 2FEKA 3GT7A 3ETDA 5IBPA 4HO1X 1Z6YA 3E82A 7ADHA 4N3NA 2YJ6A 4KN9S 4PYMA 2OV1A 4MW6A 2G09A 3HA7A 1NGSA 3K6SA 2R4UA 2ZYIA 3CVOA 3EWNA 2CV2A 1V7ZA 2HEIA 2EFGA 2QY9A 2RAUA 2WVJA 3B6IA 1QTIA 3G9TA 4K6MA 4RPJA 4WPGA 4J0GA 3TEFA 1L7XA 1P7CA 1HL3A 3VYTB 3STXA 4DR5B 4QYMA 3C7CB 4LRXA 2J3MA 1T0IA 3AO0B 1XHFA 4LBZA 1ZXBA 2CYAA 1L2TA 3ASYA 5HK8A 4PGMA 5JAOA 3NRBA 2PT5A 2IK8A 1D1PA 4A2PA 2EW1A 2OHGA 3VC1A 3I9LA 5E7JA 4MV3A 1QQ6A 1QTQA 1E1DA 5K0EA 1UOOA 3ZXSA 4TT3D 4PCVA 3AVVA 3IDOA 2H57A 2HDWA 3DLBA 2V7QD 1Z8HA 3PWZA 4J0JA 2OHVA 2B8JA 2FMTA 5EPEA 1AUOA 4EZEA 3RRNA 1QORA 2I6SA 1J99A 1SVSA 3IQXA 3ZDCA 3NDRA 3U4QB 3P1JA 1E2EA 2Z8XA 1U81A 3JZFA 4R71A 4GLFA 4OYYA 5LSAA 4YB8A 4QFBA 2WI8A 2OHHA 3A11A 5IN4A 3X1JA 4RPGA 3ILHA 3T3IA 1B0PA 3BXFA 1F2DA 3A3PA 1A8PA 4MVWA 5DYIA 4B5LA 4R1MA 3JAKB 1VJGA 3BIOA 1Y3DE 1EFPA 1FQJA 1U5BA 2HA3A 3O31A 5DP2A 5KTKA 3GVPA 1E6MA 3HEMA 5HA5A 2PMBA 2PK3A 1Y7IA 3VMMA 2B8EA 3CH6A 2KHZA 4LMRA 1ZH6A 3HCFA 4XDHA 3VU1A 1PZEA 3WLRA 4BNDA 5B6JA 5FUWA 5DXFA 1O96B 1CJSA 4B3MB 3ACDA 1ZJ4A 4Y9DA 1NVVQ 1GCIA 4P3YA 3WIVA 2PKQO 1F20A 4CL8A 4MWDA 1ZOOA 3WWYA 5EGNA 4TMFA 2YBEA 3FFXA 4H17A 4F9FA 1OXVA 2XUIA 3W2HA 5J47A 1R7RA 2WTUA 1GA4A 2PMWB 2G04A 2QA5A 1JUDA 2QJFA 2V6JA 4XJTA 3HVUA 2Q3FA 2PIAA 3FZQA 2CJYA 4CG1A 3S8YA 4UUMA 5KNLA 1IHOA 1N1DA 2EFDB 4M36A 6AT1A 2WT8A 5ES4B 1YF3A 1WNTA