4PYJA

Human apo-comt, single domain swap
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
208
Chain Sequence
DTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 63
structure length 208
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pyjA01
4IV8A 1TW2A 3ELUA 5DM4A 3FPGA 1NW8A 1EQAA 1OR8A 1VBFA 3UJAA 3IHTA 2Y1WA 1L3IA 2H11A 4P58A 3GGDA 5DM0A 3G89A 1L3BA 1L1EA 3KR1A 4R6XA 3THSA 5HOQA 4E70A 3SSMA 5GIPE 3G2PA 4R6WA 2PWPA 2ZWAA 3MGGA 3TKYA 1DUSA 2AOWA 5BW4A 3DLCA 4HC4A 5HILA 1B42A 3TOSA 3VC1A 3ELYA 2ZULA 2GA9A 3LL7A 5EZQA 1ZQ9A 5EMMA 3M6XA 1INLA 2PX5A 3REOA 3ORHA 2N47A 4QDJA 2ERCA 3C6KA 3GRRA 5K0EA 2F8LA 1XDUA 2P8JA 3EVGA 2QY6A 2CWWA 2PKWA 4OQDA 5E2BA 1Q0SA 1QYRA 3AY0A 3KPVA 4EKGA 4RTPA 1KXZA 5ICCA 4WXHA 4U7TB 4YUWA 5DTMA 1JG1A 3SGLA 4Y30A 3FRIA 3ER8A 3AWIA 4NECA 1KIAA 5CD1A 3KR9A 3DMHA 2P40A 3BXOA 1YFJA 5EMKA 3OPNA 3BKWA 2OKCA 5P8WA 5U4XA 3DUWA 4CTKA 4E30A 3X0DA 4YV1A 4YUYA 3A25A 5FCDA 4YMGA 3EPPA 2EJTA 3KQPA 5FHQA 1RJGA 1VP3A 3IYLW 4AZWA 3P97A 2UYOA 4XUEA 3UWPA 5DSTA 4RVDA 2I62A 3NVMB 4FR0A 3SR4A 1L9KA 3KPWA 3VYWA 1BOOA 4RTKA 3G5TA 3BT7A 1EJ0A 4PYMA 4LG1A 1N7IA 3TKAA 2YR0A 2PJDA 1VLMA 5B1SA 1YUBA 1IXKA 2FK7A 5T6BA 2JHCA 4AX8A 3LSTA 2AOXA 4GQBA 4IKPA 3AJDA 3GJYA 3KPJA 5F2OA 5E9QA 1FBNA 2PT9A 4L7VA 4PIPA 2A14A 1R00A 1M6YA 5GIOE 2I6GA 2ONZA 5HIJA 2O05A 2OPBA 3UBTA 1Y8CA 3B7PA 2G8NA 3B3JA 4FT4A 5DXAA 5JR3A 4C03A 1YF3A 3K6RA 3BGIA 2Z6AA 3M33A 3DTNA 3I9FA 3KQWA 3HVHA 3FPFA 3EEYA 1H1DA 1JG4A 3L8DA 2YXLA 4RTRA 3LDUA 3KKZA 2YX1A 4EVIA 3TQSA 1BHJA 4MIKA 3EMBA 5DX1A 5K03A 2R3SA 4GF5A 1XDZA 3G5LA 1JG3A 3GRYA 4ATNA 4DKJA 3JWHA 2VZ9A 4RWZA 2O07A 3CGGA 4Y2HA 5DX8A 3FTEA 3KQSA 3Q87B 1ZKDA 1DL5A 3MCTA 5HIKA 5GINE 1VE3A 4OBXA 5E9JA 2FYTA 4OA5A 4GC9A 2P7IA 3ME5A 4MQ4A 1G8SA 2OZVA 1QAMA 4C06A 4RTQA 3MERA 4QQKA 3FUTA 1P1BA 2ZSUA 2NP7A 1RJDA 3SX0A 3UA3A 2IPXA 3CBGA 5LQNA 1Z3CA 4M37A 2ZZMA 5T67A 1KPHA 4GC5A 1UIRA 3A27A 1N7JA 3OU2A 3V97A 2PT6A 2QRVA 4PWYA 3A4TA 4DM3A 2H00A 1XTPA 5GM2A 1PRYA 1QANA 1I4WA 3HA5A 3LCUA 1SG9A 3GRZA 4ISCA 3MTIA 5C1IA 4KWCA 2IH2A 5E1DA 3TM4A 3HCCA 3JWJA 2PY6A 2YXDA 2Z6UA 3LHDA 4M36A 1RI2A 1SUIA 2JH9A 3NDJA 3P71T 4KW7A 3VC2A 1G38A 3HA3A 3FUUA 3G7UA 4HSGA 2C7OA 4O29A 5FHRA 2PSSA 3OE5A 5K0BA 4BP1A 1NE2A 2PX2A 3UFBA 3CCFA 5CVVA 1R8YA 2GAFA 5E8JA 4P7FA 4GOLD 2UYHA 5C9ZA 3EGEA 3FTDA 4QTUB 2FHPA 2OY0A 2OXTA 2O06A 5DM1A 3HCFA 3H2BA 1G8AA 4KIFA 9MHTA 4HRAA 3BWCA 4KVZA 5JUWA 3C0KA 2ORED 3EVEA 3KQQA 3BKXA 3HCBA 2HV9A 1X19A 4F84A 2NXNA 4PCAA 3KQYA 2JJQA 3T0IA 2EJUA 3CVOA 4QVKA 5FA5A 3UJ7A 1VIDA 3O7WA 1XDSA 2NXJA 2PXAA 3PX2A 4GBED 1JTFA 5K09A 2AN3A 4RVHA 4XUCA 3EEOA 4C08A 2G1PA 4PYKA 5DT2A 2QE6A 3LX6A 1WZNA 2P3OA 3OE4A 5CVEA 3UA4A 3T7SA 4RYLA 5FQNA 4F85A 3P8ZA 2B2CA 5EHIA 1KYZA 1I1NA 2OBFA 2FPOA 3OZSA 3FZGA 5CUQA 3P2IA 4LECA 4QVGA 3MAGA 3KR2A 4UOEA 3KU1A 3QV2A 3HVIA 3SSOA 5HEKA 4BLWA 3KQVA 3FUVA 3P9KA 5LQRA 4OX9Y 1BKYA 2CKDA 2BR3A 3PX3A 5DTRA 2FCAA 1NW6A 1AQIA 3EVAA 1NBHA 4FGZA 5LQAA 1M0EA 2YTZA 3P2EA 1FP1D 2ZZKA 5HIMA 4GEKA 3MCZA 2G70A 1EAMA 4GOND 1WG8A 4YUVA 3SSNA 3OFJA 2B78A 3DMGA 3MTEA 4AZVA 5K8VA 3HNRA 3M6VA 1G55A 3WSTA 1XCJA 4YUZA 2PBFA 3PS9A 1MJFA 3R3HA 5FUBA 2OYRA 1FPQA 4RVGA 1KR5A 4U7PB 2CL5A 3UJCA 3P9CA 1FJXA 3R9XB 2BM9A 3EVBA 3FPHA 5CVDA 4M38A 4IV0A 2XYVA 2AVNA 3CJTA 2C7PA 1YZ3A 3NMUF 4E2YA 1XVAA 2XVAA 2UYQA 5C0OE 3PLAE 1YFLA 4XCXA 5DTQA 5E1BA 2Y1XA 3BWBA 4QPPA 4YV0A 2OB2A 3CJRA 5FQOA 2IFTA 3O31A 2AR0A 3FPJA 1N2XA 3IV6A 4KIGA 2P35A 3S68A 5LR6A 3NTVA 4HH4A 4ZTBA 4CKBA 5K0CA 3OCJA 1D2CA 3KQOA 5ICFA 1DCTA 2DULA 1IY9A 2PVCA 2UZ4A 2ESRA 1T43A 3ELWA 3QOXA 4H0NA 4DCGA 3EGIA 3LCVB 3A26A 3BUSA 1X1DA 5LQCA 2AN4A 3K0BA 4KDCA 5EC8A 5HIIA 4K6MA 5CCBA 2BR5A 2IGTA 2YUIA 3HCEA 1QZZA 3BGVA 4AZTA 3EVDA 1JTEA 4FP9A 2K4MA 1JSXA 4DZRA 2EG5A 4BLVA 3TM5A 4QDKA 4PNEA 3PFGA 3B89A 3M70A 4E2ZA 3EMDA 2ZVJA 2NXEA 4RVFA 1ORHA 2O57A 5T64A 3T7TA 3LDGA 2ZW9A 3OU7A 2GLUA 2OO3A 3GDHA 5CVUA 5DM2A 4PYLA 4C05A 1P91A 4RTLA 7MHTA 1RJFA 5HFJA 3R6TA 2WA1A 5DX0A 4EKIA 2I7CA 4LWPA 3LGAA 5GOZA 3IEIA 2AN5A 4Z2YA 5BW5A 2EX4A 3MB5A 5EHGA 4P7GA 1ZGJA 3P2KA 2AS0A 2AOTB 3THRA 5M5BA 4PYQA 3EGVA 5KQSA 2XBMA 3FTCA 5GP1A 5E8RA 4HG2A 3HA7A 1R74A 4AZSA 4MWZA 3MQ2A 3R24A 3G88A 1KHHA 3P9NA 4QPNA 4R8SA 5E1MA 4E2WA 3ID6C 4ER0A 1SUSA 3B5IA 1O54A 3PB3A 1KP9A 3HVKA 4C07A 2PLWA 3NWBA 3LBYA 3KPYA 1RJEA 1RI4A 2IP2A 3GXOA 3V8VA 3BWMA 3LKDA 5IH3A 1R6AA 4FSDA 3GCZA 2AVDA 5K01A 3C6MA 1NV9A 3FYDA 4DQ0A 3PFHA 4HTFB 4R05A 2ZBQA 4WVLA 5ICEA 3ERCA 4XUDA 5LQUA 3DOUA 3UZUA 3HP7A 2P3QA 3LECA 3I5UA 3JWGA 2QRVB 5EQJB 3T7RA 4PCLA 5F2NA 5E9WA 2ZTHA 3E05A 3OFKA 5E2AA 4PYNA 2P1DA 2PV0A 4YUXA 1X1AA 2WK1A 3GU3A 2ZLBA 5HZMA 1R18A 1NW3A 2ADMA 4QQNA 1MHTA 1ZGAA 3LDFA 1AF7A 3EVCA 3DR5A 5CM2Z 4E32A 3DXXA 1D2HA 3GNLA 4DMGA 2OB1A 5KQRA 3FYCA 4RTNA 1FP2A 2PXXA 4QTTB 4HTFA 3G8BA 4ER6A 2GH1A 4KRGA 2ZZNA 5EIFA 5MHTA 3LKZA 1VL5A 2GS9A 2IIPA 2YVLA 4MTLA 5FA8A 3TPZA 3P9IA 3OU6A 5EGSA 4BLUA 4ER5A 1I9GA 3G2MA 3KQTA 1KYWA 2PGXA 1QAOA 2WA2A 4ER3A 5G02A 2QYOA 2BZGA 2YQZA 4C4AA 2HWKA 4R8RA 4AUKA 1P39A 4LWOA 4PONA 2BH2A 3LPMA 2AOVA 3SVZA 4OA8A 5DXJA 1UWVA 1SQGA 2NXCA 3ANXA 3UJBA 4POOA 1JQDA 5KVAA 2AOUA 4RTOA 4JXJA 5EMJA 3DXYA 3GIWA 3O4FA 3EVFA 2PWYA 2XVMA 5D1HA 3E8SA 4CTJA 1NT2A 2Z6QA 3KHKA 3A7DA 5DRYA 3JWIA 5FADA 5D1NA 3EVZA 2ZIEA 4FS8A 4V0RA 2ZBPA 3FUWA 5EKXA 3DP7A 8MHTA 4V0QA 1F3LA 3BZBA 4FZVA 4PYIA 2P7HA 2G72A 2XYRA 4X1OA 5EVJA 4CXMA 1WXXA 4PGHA 3NW9A 1R8XA 3KR0A 2P41A 1VQ1A 1XJ5A 2IBSA 2AOUB 3SXJA 3TLJA 5K0GA 4HGZA 5CIYA 5CVJA 2LD4A 5H02A 1HNNA 2NP6A 4X60A 4RTMA 5EKUA 5EMLA 1JG2A 4OQEA 2IDKA 3KQMA 3FUXA 5FTWA 4E33A 3G2OA 2FRXA 2VS1A 4CWAA 3PTAA 1Q0TA 3LBFA 4PYOA 3C3YA 1P1CA 4G56A 4GUAA 3DLIA 5DLYA 1XCLA 5DPMA 3QOWA 4EMSA 3HCAA 2Q41A 3NVKI 3G8AA 4FSXA 3BGDA 5BXYA 2KW5A 1SVUA 1X1BA 5EG5A 3UJ6A 2GB4A 5CCXA 3ER9A 3HEMA 3FRHA 2VDVE 3G2QA 2QM3A 2I9KA 2JH8A 3DXZA 1G60A 1QAQA 3DULA 3ELDA 3U81A 1AV6A 4PINA 4IWNA 2JHAA 1SQFA 5K0FA 5BP7A 1JR4A 1WY7A 2G71A 1WS6A 2ZIGA 3B3GA 5KYGA 2O0LA 2YXEA 4X41A 3Q7EA 3DMFA 2R6ZA 2B9EA 2VDUE 2IH5A 5EIWA 3CKKA 3E7PA 4RTJA 3M4XA 5EEGA 2B25A 2ZIFA 3OZTA 1SKMA 4MHTA 2FK8A 5K0NA 2BR4A 3PT9A 1NV8A 2C7QA 2HR1A 4CKEA 1ZHFA 3RW9A 5EOVA 1KPIA 4FT2A 3SMQA 3HM2A 1RI5A 4M7RA 4C04A 4F86A 5ICGA 2IDJA 3M6UA 1X1CA 3TFWA 5ERGB 4B17A 3TRKA 4RTSA 2B3TA 3GWZA 1XXLA 4PYJA 4BY9E 5K0JA 2VDWA 4X61A 5F2KA 5KS2A 3B3FA 3DH0A 5K05A 2ZFUA 4PGGA 4P7KA 3M6WA 1AQJA 4X63A 3FPEA 5DRTA 4DCMA 2ONYA 4DF3A 3UJDA 1YZHA 1PJZA 1IM8A 3HVJA 3R0QA 1ZG3A 2CMGA 3E23A 5DSXA 2DPMA 3AXSA 2JHPA 5DWQA 3UJ8A 5LQKA 2C7RA 4GOMD 3KPUA 1EJ6A 1ORIA 5FWAA 3MHTA 2HMYB 3NWEA 1UFKA 1O9GA 2PX8A 3TR6A 4CKCA 2P3LA 2BM8A 3I53A 3LCCA 3VSEA 1JSZA 1WXWA 4EK9A 3OZRA 4ER7A 2IH4A 1KPGA 1U2ZA 2HTEA 3HTXA 3NJRA 3RODA 3GRUA 1V39A 1JQ3A 2GPYA 4A6DA 1RI3A 5K0LA 5GWXA 3GRVA 1RI1A 1YB2A 3PVCA 1EIZA 2JG3A 10MHA 4RV9A 1BC5A 5FWDA 5LSAA 4HGYA 4P7JA 2PX4A 4RSRA 1F38A 2AOTA 4E31A 5EZSA 2H1RA 1NBIA 1NKVA 2HNKA 3A7EA 3NDIA 5GM1A 2PXCA 2V7EA 4DA4A 3D2LA 4KDRA 1NW5A 3SM3A 2ZBRA 1NW7A 2V74B 1VPTA 2ZCJA 1HMYA 5E1OA 1L3CA 3HCDA 4RX1A 3GO4A 4E2XA 1M6EX 4YMHA 2E5WA 4YV2A 3I64A 2IBTA 1G6Q1 5EPEA 2ZWVA 1VP9A 1EG2A 4GOOD 3F4KA 2AZTA 3I58A 5EEHA 3RIEA 5LQJA 4PIMA 4EQZA 1TW3A 4A6EA 2UYCA 2EFJA 2NYUA 1JQEA 2NNWB 4OBWA 3BWYA 3C3PA 3TMAA 1D2GA 3FTFA 3CC8A 3AXTA 5FULA 5IKMA 1O9HA 4BP3A 3CJQA 3UJ9A 2CMHA 1TPYA 2XYQA 2VP3A
chains in the Genus database with same CATH superfamily
4HDRA 1TW2A 4MICA 3ZDXB 4B44A 2CD7A 4F9FA 1HX7A 1FQKA 1F6BA 2NO5A 1FS6A 2O2HA 1SCKA 5FBLB 1J90A 2NV6A 3JWEA 3DO6A 3U0VA 4KHPB 2GN4A 4DC9A 4UCWA 2JASA 1YQTA 3HB7A 5J1TB 3IRUA 2C2BA 4LXIA 1QHIA 4M2LA 5MFZA 3N39C 3W6NA 3N2YA 1P2UA 5BW4A 5CB0A 4CKZA 1KIMA 4CEHB 4WOCA 4O3FA 4R1TA 4YJHA 3IOYA 3OHSX 3VTAA 1ZA2A 3R6WA 4GOXA 2DWCA 1T8PA 1V7ZA 3JW8A 5ADUS 3ORHA 4XJSA 4V1CB 2IT1A 1M2OB 2Z98A 3KJZA 4FZJA 1PR3A 5GADl 4A0HA 2GM5A 3LZDA 1DEOA 1XXHB 3C3XA 2KB0A 3A6GA 1LY1A 2NO4A 2AE2A 1PFUA 1JLLB 1I2CA 3ROGA 3WL8A 2PLRA 4RF2A 4EMBA 1C2YA 1ORDA 1C9KA 3ECSA 2MSLA 2P2SA 1M74A 3V80A 5C3MA 3H2JA 4FINA 4GD3Q 4AM8A 5A4JA 2OPHA 1KIAA 5M04A 1JR3A 1MH1A 3A1SA 1X94A 3HS3A 4LDAA 3N2NA 1Q0ZA 3BXOA 3QIAA 4HGNA 1TIPA 3GLGA 2Z2ZA 4JJEA 2VATA 3CZ4A 3KG2A 1SUDA 1E2DA 2YBEA 3WLLA 3I2GA 5FCDA 5LN1A 1P7WA 2WZQA 1NKSA 2GJ4A 3IYLW 4AZWA 5JALA 1SVNA 3AY7A 3ECAA 1MX1A 2FX5A 2X0KA 3P97A 3Q9UA 4JUCA 2R6GA 2PRZA 4K3UA 4X00A 3CLTC 1RBYA 3W4KA 4RD6A 4YRGA 3W7AA 1DOAA 3ETNA 4D8UA 3UANA 5LLSA 2RHRA 3WGZA 2C7VA 2KYRA 4RL6A 1YIOA 3ZD6A 4PHHA 4O1IA 3LSTA 4LMPA 2GVNA 3ZLBA 2CXHA 1DIRA 3FPAA 4OF4A 1KSHA 4C3VA 4KHZA 5TQVA 1CUBA 2NQ2C 4DM7A 3F3MA 4UOQA 4R41A 1NRXA 1XXHE 2GHRA 2IYXA 4TVOA 2XZPA 1Z5WA 4TLBA 4DADA 3VVMA 2AIRA 1VYTA 3K6RA 3H0EA 3SEQA 1BKDR 5IVDA 1OV4A 1O8CA 3I76A 4LVCA 4EW2A 4IS3A 4P3YA 3L9XA 4WXRA 4ENSA 1HFJA 2QPLA 1I80A 3B5JA 3NT2A 3PD7A 4JMLA 3MQFA 4Y2PA 3N86A 1KR2A 5ALYA 3VX3A 3ZU4A 1NJ1A 5DLDA 4DCSA 3CMCO 4L9SA 5CDUA 3RB8A 4GMGA 1XKLA 3D2BA 1VPLA 3BFKA 2WSYB 3UWOA 1TFUA 1AKMA 4YXWA 1FQWA 1TCBA 2DTXA 1TYCA 3Q7PA 4R2MA 1CV2A 4QYIA 3TE6A 5IXSA 2X0IA 2YNMA 3T3HA 4HD8A 3Q87B 4L85A 6Q21A 3FTEA 3H65A 3LT0A 2A1TR 2YVAA 4UFNA 1DAMA 3H75A 4I2VA 1OOEA 1TQHA 1WXFA 2IS4A 2ZAGA 1LKZA 1UWCA 2R44A 4OSEA 4C06A 4QU0A 1FTSA 3W9YA 4X8MA 5EJAA 2IXTA 2J9XB 4DXDA 4LY3A 5BMVA 2Q9UA 2ODWA 4YRAA 1R5JA 4FMDF 4H6XA 1X74A 3GUHA 1G5QA 3SKXA 1S4MA 4ZOBA 4DQLA 4J0CA 4UAGA 3M1AA 1VE1A 1XMIA 1I4WA 4NS1A 4YJGA 4LRQA 5JBNA 3MTIA 3I83A 3MGCA 4NBUA 2HU7A 2X0FA 3MD9A 2F55A 1A98A 1KO8A 4N5HX 3TM4A 3JWJA 3LVRE 3PE6A 4NR0A 3BEDA 5HKLA 1OHHA 1RI2A 1SUIA 1VKHA 1ACJA 3M5CA 5EY5B 3VZDA 4YRIA 4B5KA 2ZDHA 4BUZA 3AF6A 5CA0B 3C1TA 1DKUA 1XYVA 2PUVA 1AKTA 2JLRA 5BUSA 3EWSA 1PK9A 1CNEA 3IX7A 5A02A 1BHO1 5JHGB 1AGXA 2D00A 2HZ7A 2XOKA 5AVOA 4B0PA 1FQJA 1UMCB 2JGLA 4B6OA 4BKMA 4EG4A 1LPNA 5C9ZA 2UYHA 5DM1A 3CR3C 4COKA 3BC1A 1T4CA 2QP9X 1E6MA 3C6QA 1I3MA 3FLMA 5CNMA 1V37A 2ORED 4DRXA 2C4MA 1JFFA 2AJLI 4LYYA 2ARKA 3AYXB 4HLUC 3PUYA 2OQIA 3N8HA 5FA5A 4OHUA 4A91A 1JTFA 1S3GA 2EKDA 2OV2A 1LSSA 2Y1KA 3NC1C 4EHBA 4BEWA 3P9XA 1LTKA 1CZHA 1L7EA 2SKCA 4ICIA 5EIBD 2BF7A 4XLZA 4L07A 4N7JA 5AW0A 4ZAZA 4J94A 4F85A 3DPUA 2J32A 1YC2A 3TLGB 2WSSD 3K8QA 1U1GA 4NNOA 5CA1A 4MP8A 2EW8A 3HVIA 1E59A 2QN7A 3SFTA 1KDTA 1ZSNA 3G0DA 1S2OA 2XYHA 4DWJA 3OURA 4LVUA 4EBFA 3GN2A 1NBHA 3I9OA 4XM1A 1REQA 3INYA 2YTZA 4I1UA 2ACEA 1DWOA 2FY8A 3BIWA 5ALLA 1BGWA 4MV9A 2IW1A 5HBGA 3RVKA 3S7ZA 1E3WA 4KZPA 5CT4A 3W77A 2GM3A 3OZWA 3ADDA 2Y77A 4Q4HA 4MR9B 3ZJYA 3WQSB 4BNGA 3M6VA 2OHGA 2R5NA 4PWZA 1ECCA 3PHJA 1ZOPA 2OHOA 5FNZA 5FUBA 4ZVOA 3KO8A 4JU8A 4F04A 1D5WA 2VSFA 5KWSA 4BFVA 4U7PB 4IM7A 1LZKA 4P83A 2EV9A 4U2EA 3HFGA 3KYJB 4AJ2A 1NY5A 2CFIA 2IYRA 3K5WA 4NAVA 2XF8A 4X91A 1RZRD 1XZFA 3FPSA 2XVAA 3BREA 1UT8A 2JZCA 4OUDA 4ASUD 1SJ9A 3CJRA 2EKBA 3QELB 4XW2A 3L0IB 2AR0A 1QO0D 3LVFO 3S28A 4DDHA 3UUEA 1I3CA 2XUZA 3AKYA 4YCJA 4LQ4A 3OCJA 2FEXA 4JNCA 4Q48A 3V2GA 4I4IA 4D5GA 2W70A 5KSPA 3EEFA 3IESA 3EGIA 2TS1A 2DWOA 2ZRIA 4KFSA 3GFVA 4H1TA 5KTYA 3UMFA 3ROXA 1OU4A 1SQ6A 3BJRA 4GMFA 2W2NA 4KDCA 1TVKB 3LPAA 2VJYA 5IJ9B 2H31A 4BO3A 4H3HB 4FP9A 4Y2UA 1L7NA 2DTDA 3BBLA 3ZD8A 1UMBB 4BKUA 3AHHA 3I72A 3FI0A 1YZVA 3E6AA 4M1OA 1CSEE 1G3UA 1ODLA 1XCPA 5TMDA 4CFYA 5BNTA 1GWNA 1PLJA 1U9JA 4JLPA 4WJKB 1Y8QA 2O57A 4EI2A 3AR3A 3KJQA 1SNYA 3HU3A 3P2MA 2ETVA 3W2GA 3BAZA 3OU7A 4J3JA 1JLSA 3CZ9A 4YMIA 3WAKA 5DM2A 3IAM1 4BGDA 2H5LA 4LSMA 2ZUBA 3M4YA 2ET6A 3UICA 4BV9A 4LJKA 3WYNA 2EBHX 1FBTA 3IEIA 3NKLA 3WLQA 1GPAA 2FF7A 4D79A 1E3SA 5AKYA 1X1TA 1EP3B 5DK4A 3TUIC 3WK8A 4M1TA 3CE9A 4H1WA 1N0HA 2J5BA 3RRJA 1Z4OA 5T4EA 3X1KA 2F3TA 1OZGA 5AQEA 5LUAA 1NNEA 3HLKA 3JX9A 3TUJC 3NU1A 4QPNA 4QZVA 5K20A 3RAJA 1CFJA 2FFHA 5KWIA 4HN2A 2ZSFA 1S8AA 2FWBA 4GXQA 1O54A 5FUVA 1FMTA 1GU0A 3AVYA 1E9AA 3PL1A 3FHLA 4IHJB 3DF7A 3FM9A 3E9DA 3L0CA 4FSDA 2OILA 4JLWA 3UQYS 3CA8A 1FOEB 3LOUA 3R6LA 2PR7A 1RM4A 1T0UA 1E1QA 3H5NA 3WLRA 1YJ8A 3ESQA 2OAEA 2XE6A 4AULA 3UK2A 3NIFB 1EFAA 1O4VA 1CRZA 2B7CA 1Z8DA 3E15A 3KAJA 2VWGA 2XWBF 1YZTA 3LP8A 3GBPA 1DAEA 4MUFA 4QHSA 4R2XA 1U3FA 3AF1A 4RHFA 3VYVA 3X1XA 3HBMA 4CT5A 1U7DA 5E9WA 4DRZA 4MINA 1YV9A 1DV1A 2V6IA 3LWBA 3WO1A 2HDHA 4EVSA 2FX3A 4PSAA 2IXDA 2V0NA 1H3FA 2WJZB 2ZT5A 4RD1A 2N9UA 3KKLA 3PLNA 2OQVA 3BTUA 3HR8A 3EDOA 4TVSA 1CCWA 1NNSA 3BIXA 1HDXA 2BISA 2D0DA 4TQAA 1GSOA 1JIKA 4WA8A 3T35A 2GH1A 3GFFA 2XH8A 4HNAA 1OASA 4C7OA 3C2QA 1C3OA 2QMOA 2W6ID 3LKBA 1V7CA 2KSQA 3EC7A 3VYSB 4F46A 3I39X 2A67A 2ZB3A 1G2QA 1QTNA 2O50A 4ER5A 4K2AA 1EDDA 1ZZGA 2VHTA 3K0AB 4TROA 4GSYA 4B71A 5JHHB 1RZVA 4BLPA 1NQAO 1PZGA 1JU4A 1SA0A 1T9GS 3C4QA 4R8RA 4DT1A 2CHUA 3EHEA 3MMNA 2XUGA 1E9CA 5HQTA 2RB5A 3TF5A 2PUEA 4KR7A 3D3NA 3IDSA 4NVRA 3TH5A 5IJWA 2ZDQA 4B6JA 4FBLA 4CT4B 2JA2A 2YJ5A 5IPFA 3L4SO 2OOSA 3LX5A 2GHIA 3C39A 5L53A 2WJHA 2EP8A 2XTMA 4RW0A 4LPSA 4OKNA 2VNKA 1KEPA 1U5BB 3ZXIA 3A3OA 3RUPA 4KR6A 5G0SA 4ECEA 5KNDA 1MVNA 2X5KO 5AKZA 3HJGA 3RI3A 2R87A 1BCSB 2YWJA 4O8CA 5L3QB 4RXUA 5ILGA 1KQPA 1S7GA 1HT3A 3D02A 1PGPA 4HAUA 2P41A 4J2OA 4O4LA 1U8ZA 2HU8A 1IPFA 4LQLA 1EEXB 1JKJB 2B30A 3EUEA 3ZBPA 1J99A 1LWOA 1YB5A 3T95A 1V1RA 4JOQA 1DKNA 2SCUA 3A6JA 3U37A 4CI0B 1H1TA 5AM3A 1MB0A 2E5FA 1IH8A 2H7YA 4E33A 4YYZA 1A9XB 2LUOA 3A3KA 3DEKA 3STVA 5A0TA 3KV1A 3ICQB 4AX4A 2QZ9A 2WZCA 1CNFA 3FYHA 2HC9A 4DLUA 1N2BA 4RPKA 2AD1A 3QF4A 1N3LA 4TSKA 3ZH2A 3D5QA 4IH1A 3JQCA 3T5GA 4BQRA 2QBYB 4OQMA 2EZ8A 3CF4G 2XDYA 1F0PA 4JEUA 1D2AA 1I8TA 4UAUA 3WYFA 2IF2A 4QOJA 2IHTA 2ZIGA 2O0LA 4NCKA 3BA1A 4JBWA 3TQRA 4ZVNA 3S81A 1NA5A 4EECA 3TL2A 3EPKA 4QYWA 3WB9A 1W88B 1WNFA 3I05A 3L93A 1ZYUA 4GMHA 4RDXA 1GM5A 3M4XA 5TVGA 5KVVA 4PPYA 2J46A 4TXNA 1X87A 2NM0A 1LNQA 1I7LA 2DYKA 3GFOA 4D92A 1JIJA 1TVEA 1HI9A 3PDJA 2DHRA 2P6NA 3OESA 2PZKA 3Q3IA 4Z4FA 2XTJA 3EZ6A 3RW9A 1GZUA 3MELA 221PA 4FT2A 4OK3A 3ZS8A 2CNKA 1E3IA 5SY9A 5A1TA 1BU5A 4V2UA 5DFAA 5JVDB 1PL0A 2XV1A 5EP3A 4XIFA 3O8NA 2NVBA 3KL2A 4LV5B 3ZK8A 4CM8B 4NLLA 2WD7A 2CJFA 4HQOA 4M6WB 3BH7A 3BH6A 3U48A 3CRMA 5F3DA 3L7AA 2UZ1A 1U65A 3NONA 4L78A 1ACLA 4G0MA 4AZ3A 4PZCA 4B4OA 4F6CA 4U6SA 4LF9B 3OKPA 3IUYA 3TJRA 3T15A 1EUCB 2O5RA 1QO0A 2WD8A 4PHCA 4RZUA 3E23A 3TTWA 3U7RA 3EQZA 5JLJA 2FLVA 2PMEA 1AUQA 4BKRA 2H4ZA 3O91A 3EIQA 3OMXA 2C7RA 2GGSA 5D87A 2FUG6 2O2YA 1CE8B 1EVYA 1U2TA 2QLJA 1HQCA 1CRWG 3LY5A 4FSHA 4ZOEA 4ZT7A 3ZIUA 4BO2A 1WABA 2ODEA 1FS5A 2JFQA 3FBWA 1X7XB 1E2KA 4CMJA 4ZEVA 1RJWA 1N6LA 2AKAB 2DQKA 1F0NA 5L4SA 5H70A 3UT6A 3W5CA 4R8LA 4QGHA 1EDEA 2JS7A 1Y7PA 1MORA 2WUGA 2CLCX 1ZD4A 1M6WA 1ZN8A 3C7AA 4OGGA 4BV2A 4BO1A 3K71B 2GX6A 1T24A 4LGYA 3EJ6A 2BTQB 5CA0F 1TM5E 2VP4A 3WNBA 5T5QA 1WF3A 2AFVA 1U2GC 2H1RA 1RZ3A 1UDBA 3O1LA 2GCOB 1NBIA 2CFTA 3PFKA 4LYHA 3VR2D 3A1VA 1D8TA 4A8JA 1ODJA 4R8MA 3OZVA 1VRWA 3TIIA 3OQMA 5REQA 2IUTA 1ZCJA 3AV0B 3HCOA 3TXYA 2V5UA 5B6IA 3S8EA 2AF3C 4A2WA 4KUGA 4DZTA 3N0RA 4NTZA 4KIJA 1W6RA 3JD3A 1DRVA 4WZAA 4F0JA 4JLBA 3U4QB 4C30A 2XMZA 3EODA 1N2IA 4P92A 5AK4A 2PGLA 2NAFA 1VKOA 3ESZA 4WKGA 2I2WA 3F8WA 4HI0E 3VDRA 3M49A 4F5WA 4ZVMA 4B6RA 3BEOA 3R20A 4OQNA 4ZI7F 4NX2A 1L5MA 4DIFA 3AF2A 2ASEA 1J33A 2RAUA 3R2JA 4B2LA 4Q82A 3CJQA 4KXFB 2AEMA 2XYQA 3OOJA 4IV8A 4FDVA 2MDTA 1W1IA 1TZKA 2J3EA 4FEYA 5K01A 3DHEA 1CF4A 1L1EA 3ZHUA 1VGVA 4QUBA 1IN5A 2NWQA 3H4IA 1K5HA 1U0OC 5ALWA 3ZWAA 4EUFA 2J6CA 1HBJA 2OHFA 1GUZA 4NK4A 1DUSA 3LG2A 1IQRA 2RDMA 2MSCB 4D4GA 4Z99A 4XIYA 2R96A 3F3KA 4L5CA 3H1AA 3AR5A 4HZUB 4XPIA 3WLPA 4EPXA 3I5YA 2F4VB 4LOIA 1IPEA 1QGOA 3QPBA 2C29D 4X85A 4J7UA 2A1UA 3EXIB 3G1TA 1WDLA 2CE2X 2WIBA 4X20B 3R7SA 2KI5A 2JI4A 2CDAA 2QPTA 2QY6A 2CWWA 5AVSA 3ZU5A 1D0VA 1LUAA 4H4CA 4B6FA 3SS7X 1FK8A 3O3OB 3KE8A 4QU8A 2ZT6A 3CNNA 3DKIA 2HMVA 3QY0A 4RJTA 5DTMA 4Q9DA 2VJBA 1CR6A 3C5EA 1C3JA 2XY4A 3ER8A 1N78A 1KTVA 4TLAA 3PSHA 4P31A 4Q9HA 1JHDA 4D3DA 1U80A 3CLSC 3VAYA 1KJ8A 3A4MA 3R5XA 3G13A 3YASA 3OPNA 1J06A 4NP6A 1DFIA 1CG6A 1WW2A 3I8XA 1YAHA 2OWEA 4G0QA 1MIHA 5KBYA 4OD0A 1M8GA 4YV1A 2NU8A 4XFDA 4ZT6A 3M34A 3KQPA 1PZHA 4UHJA 2A5YB 1VKNA 2V98A 3F5FA 3IEMA 1IY0A 5FEMA 4XJTA 1E2QA 4BLOA 4F8JA 4PTLA 4MQMA 1ZC3A 2I2AA 3CH4B 3H5RA 3ZLUA 4HWGA 1PWHA 1H5QA 2XKAA 4L16A 3V6MA 3MCAA 4WT7A 4P0TA 2R751 4DVGA 1TEHA 2DHCA 2WYWA 1D2EA 4BQFA 3GX1A 2BJVA 2VJMB 2YDXA 2IZZA 2HA4A 1REQB 2G77B 2O6HA 1KK1A 2XA1A 4KQGA 3B6KA 4C78A 4ENQA 5BQ3A 1QC5B 1UPBA 5A2GA 3ZV4A 4MQFB 1E1QD 1Z39A 2VXOA 4N0PA 4QU9A 3WGJA 3FHTA 4BYMA 5I9NA 3NHMA 1QGYA 1XHLA 2FPXA 2F9FA 3BGIA 1HG1A 2GNOA 3DZFA 5CT5A 4R71A 5CFRA 2P9JA 1N5DA 2VHUA 2ZBUA 2VK2A 3ZDZB 1BE8A 1Z45A 4WAUA 1QTIA 5LLTA 2Z8YM 1VZ3A 3I1YA 4PAMA 1M7GA 2E4ZA 2ID9A 3F90A 4GU5A 2XDWA 4HMOA 3CFYA 2VPPA 5JPCA 2G1JA 1WP9A 3JWHA 2BPOA 1ZK3A 4RWZA 2C54A 1T1IA 2D0OB 3QP9A 4DA6A 3MT7A 4MB2A 3EGDA 3ROEA 1NZFA 5K4HA 4MIOA 3DQZA 1VPEA 3RRMA 4D8YA 3CW2A 4LTMA 2P7IA 3JAWA 2B94A 3HCRA 3DLBA 4UUOA 2KBFA 3LLCA 5BSUA 2QLMA 2ZI3A 4X1KA 1ZIDA 3DVLA 3H9BA 1EFVA 5HKKD 4UBMA 3M5WA 3VZQA 3UA3A 1O97C 2ZCVA 3B8HA 2N1BA 3I52A 4PO8A 3OLYA 3AQ4A 2HSZA 3TQTA 2IYQA 1E2NA 4II2A 2UDPA 2Y8EA 2Y1OA 2GZ3A 2ZI5A 3OPQA 4RLQA 4TWZA 2OA0A 3RUHA 3ZOKA 5HE8A 2E0IA 2ZAMA 4Q39A 3ABSB 4YN3A 1QHNA 1VI2A 1GEGA 4HADA 1P1FA 1PDOA 2HM7A 3DAOA 5ALNA 5KVQA 4BNUA 2O2DA 5D5QA 3U4QA 2O14A 2FQQA 3HUEA 4EHLA 1C2TA 5AM0A 1AT1A 2OXRA 3WGQA 3VC2A 3NEJA 3GCDA 3S8MA 5DMHA 3G7UA 4HSGA 2JARA 4O29A 1G8FA 5KNDD 3NHZA 4G5GA 3OTOB 4XE5A 3AX6A 1XTJA 2PX2A 1NYRA 4LMBA 4NJMB 4RORA 3FMPB 3B2NA 1GN9A 3OZAA 2IYEA 2GN2A 4IMIB 4OBEA 1Z5VA 4QTUB 4BQOA 5BQFA 4NXMB 1NZDA 3K9HA 4REOA 2OXTA 1UZMA 3EZ9A 1G8AA 4TTSA 2I4RA 3ZE8A 2D3WA 3BWCA 3GC6A 3IT3A 3QFHA 4R54A 5T41A 4BDTA 2CV0A 3HMQA 1E79D 3X1ZA 2Q4BA 5IT9A 2YMPA 1W8IA 5HG0A 3O7WA 2VF5X 4GBED 3TW4A 3IP7A 5HK9A 3AI3A 3E5NA 1F6WA 1ZKMA 2E89A 1ADYA 2WWWA 2JLBA 3OIFA 4ILKA 1P44A 4PYKA 3RSQA 5CVEA 1Z0IA 2O1EA 4QQRA 4FFNA 2UZ1B 1T3GA 1T9HA 1WMDA 3CKMA 1MAWA 1Q2UA 3CUSA 1JECA 2NXWA 1KYZA 2FN7A 3C4JA 2C83A 3TFOA 2YWFA 4W8HA 1GT6A 2J1LA 5J59A 1KQNA 3KQHA 4XQ9A 5HEKA 3AB7A 5LZ4A 2CVFA 3L8FA 5D86A 4YONB 4L8WB 5B37A 4BFLA 2JJ1D 3GLFE 1I7QB 1KJIA 4JB8A 2H2AA 1QPBA 2G5TA 4ZQFA 5HQJA 3K1JA 4HVLA 4FOOA 2XZLA 4R0MA 1DSSG 4EARA 5J4KA 3WSVA 1KZ4A 4CQLB 5J2UF 3VAAA 2OK7A 4LVOA 5E9AA 1UXGA 3NOOA 4U63A 1IQ0A 1EFUA 3HDGA 2E4UA 4RSGA 2NUAA 4HLNA 3RT7A 4NRDA 3S55A 4MQLA 1PZNA 1ESZA 4XYBA 5KC9A 3SI7A 1CLEA 3QI2A 2EF1A 3B1FA 3IT1A 3ILVA 3G2KA 1PJ2A 2MT9A 3VHQA 2NADA 3PLAE 3T7DA 3GLGE 4TT8A 4YGXB 2WNSA 2K7FA 1M5RA 3BMCA 3NVAA 3E1GA 2C31A 4PQEA 3HUDA 1JGTA 5BWBA 1G20A 1FTGA 3IJPA 5E4FA 1W0KD 4MLPA 5DHAA 5KKCA 3CLUD 4XLLA 3I6BA 3V7FA 1TCAA 2PVCA 5EA2A 1PR9A 1TGVA 4H0NA 3FJ1A 5AJZA 4ENVA 1VJRA 3HBLA 3RRZA 1O8BA 4ZOLF 2DB3A 1X1DA 5U4QA 1S1CA 2EFGA 4LHXA 2OHIA 2YMLA 2G08A 2PS3A 1B8PA 4HDMB 4LWZA 1O6ZA 2IGTA 4WNAA 3ROTA 2HH9A 3NAQA 3ZE6A 3RSOA 2R6R1 1G8KA 5AM1A 2RGAA 4OTZA 2IYAA 3GT3A 3AP2A 1U8YA 4B74A 3GK3A 2QTAA 4XWWA 5TT1A 2F67A 1TUIA 1QGUB 3BCRA 1KP3A 3IQZA 5J2TA 1JEYA 2OSBA 3SD7A 3IPXA 2GLUA 1NLUA 3KK0A 5T8KA 3GGGA 2QLTA 4JFRA 2NU6B 4RFLA 3LDAA 3R77A 4E4RA 4YAGA 2P6RA 1CQJB 4FFOA 1KI4A 4TTAA 4MR7B 4D74A 3MS4A 2EWMA 2IYUA 2XXAB 1D6SA 2XGOA 2D2VA 3DHVA 3KWLA 2QR3A 3MILA 3PA6A 3PEVA 2QUJA 3TBKA 2P0EA 5FB3A 2PYZA 5LZ5A 4JU9A 2NGRA 1C0KA 3QRWA 1T3LA 2YDYA 4RIHA 5EHGA 4Q4AA 3O2NA 4L4XA 4AY2A 3VM6A 2JAPA 2O8NA 2RHWA 4PZDA 4C7KA 3HUFA 2RGCA 2VSQA 3FWYA 1BXRB 5IDVA 1ULTA 4M98A 1NUSA 2ZWIA 3WKEA 4PZ0A 1L5HA 3ZE1B 4CDRA 5BWNA 6LDHA 3QSGA 2HO5A 2BH9A 1SY7A 1V48A 5L7TA 4MVXA 2WQ7A 2VPQA 2HV8A 3AHJA 2Y0BA 4I46A 4JSYA 1T6BY 4ECAA 3K30A 3OP4A 4RY8A 1USUA 3SJBA 4OXXA 2IIVA 4RKRA 4LXXA 5A7HA 3SX2A 2BDTA 2NO1A 3B6EA 1FDVA 3VR6D 1UAGA 3FOEC 1X9HA 5TXGA 2IY8A 2DP4E 3IE0A 3PZBA 1YUMA 2WD9A 2FZ5A 4C22A 1O0BA 2WF5A 5DP1A 3EQ6A 1O0SA 4IWYA 3TVYA 5C8DA 5ER6A 5AVTA 4XUDA 4BGVA 3FSGD 2RGXA 1OX4B 1ULBA 3EGDB 3ESXA 1XKTA 4QASA 4X7BA 5JO0A 3JWGA 3OFSA 1GYQA 3E05A 1GKLA 1IXRC 3OQVA 5JROA 2VQSA 4PYNA 2V54A 5DHPA 3VTFA 3PQ2A 3WICA 2ZUDA 1E99A 1XI2A 3E9RA 1N25A 1MCZA 1BE6A 3DMDA 3DMTA 3H8WA 4X1KB 3RC1A 1U31A 3I92A 1Q15A 1I01A 3O38A 4LXQA 4O2BF 4AJNA 4AZ3B 2KWIA 4F97A 1P2VA 2QD1A 4WN3A 1TEXA 3G23A 1QVWA 3GARA 1YE3A 3WRXA 3ZWDA 1MC5A 1ZVKA 1P9LA 4U7FA 4WBNF 4ER6A 4O25A 4LYAA 1V7PC 4XB2A 2QJRA 2G28A 3H6GA 1SXQA 4D8XA 4IIDA 2H7XA 1W73A 2EQAA 2I4IA 2X3FA 2H2FA 3GJ6A 3VDMA 3LKZA 3IJ5A 5KNLA 1RWMA 3EBPA 4NYJQ 5FA8A 3C3JA 3OU6A 3P9IA 1B8NA 5HKKA 1H2HA 2VJOA 4GAEA 3UJHA 2H52A 3TW0A 2BIFA 1MC1A 1JDSA 1H05A 2IELA 3ZVLA 3L77A 3CZ5A 5DXJA 4CIAA 2AQKA 2LW7A 2PNFA 3UXYA 3RSCA 3OCUA 3T1YB 5GGYA 1W48A 2B2XA 1PEYA 3NBKA 3WP1B 3EVFA 2PAAA 1SHTX 2PGDA 1NSYA 2HQRA 2HSDA 5D1HA 3LZCA 1ZD3A 3OY2A 3ABZA 5CB4A 5KINB 5E6SA 2RARA 5F7ZA 4R8VA 4HB4A 3TAUA 1XRQA 3K0SA 3C5VA 1FMCA 1N9GB 3G6KA 5CNJA 1W1WA 2EWWA 2P68A 2WHEA 3QE9Y 5T4FA 4YB8A 4HH0A 2V45A 2ILVA 3S99A 5ER9A 3PQ4A 3TZEA 2QT9A 4FLEA 3ZGNA 4FKBA 3IQGX 4YRSA 3TOXA 4DA7A 2YV2A 1CUXA 5EWMB 4R3WA 4CM7A 4PN3A 3LVQE 3ZHOA 4F3KA 1LLFA 2ZJ8A 4GM0A 1UBEA 4TSFA 3K2EA 1QQTA 2VWPA 2ZIVB 1WCWA 4JP2A 3HPQA 3UCXA 3B48A 5ALPA 3D8BA 3QENA 3LUDA 4UD6A 3W5SA 1KQOA 2OXCA 1JT2A 2YUTA 3IE2A 4ZXPA 2H1OA 4G56A 5DP2A 2DF8A 3HCAA 2GBLC 2Q41A 3OLVA 3VYTB 5C7LO 5HQ3B 4HUQB 1FNNA 1RKQA 3HKCB 3U4CA 1ES9A 1QV9A 3D3EA 3TW8B 3THWB 3HEMA 5I7SA 2H0AA 5KDDA 1A1VA 2JFUA 1KJQA 4LJYA 3U81A 4UEQA 5A6SA 2XOXA 3WP0A 5K0FA 1VMIA 1XTBA 2R00A 1XDGA 3BMQA 3FTNA 4A0RA 3OCXA 3H19A 2YXEA 3AV3A 1HDYA 4HNSA 4XVQA 1B43A 1E6LA 1W87A 4EUKA 3ZKWB 4E5NA 1YH3A 1PT7A 3KJIA 5EIWA 4Z3DA 1WTAA 2B34A 4F56A 2AHOA 5EEGA 2JGRA 1N5JA 1SM4A 2O7RA 2QTZA 3OZTA 1T5HX 1RQLA 2XKBA 4HQLA 2GOYA 1LSJA 1EK2A 1US8A 4H17A 5IZCC 5DDIP 3D0OA 4W63A 1QIDA 3WR5A 2BW0A 1HYEA 1SRQA 4C04A 4XWKA 1LFDB 5JFTA 4YJFA 4XZ3A 2XHEA 4IPTA 2HK6A 1CY1A 3C6ZA 3JQQA 1WSWA 2I78A 1XQYA 4IVQA 1UC5B 4R1SA 2O7NA 1T8YA 1AHPA 1MZPA 1Z38A 1RQGA 5ALKA 2NSJA 2PTGA 3KALA 4AJJA 3W7VA 2H59A 1PJZA 5L3SA 1HYGA 4GWKA 1FSSA 4ZANA 5CEEA 3KJHA 2XWQA 1ZU5A 3U44B 2YFYA 3THXB 4LJ7A 2CMGA 3FF1A 5HS6A 5D5PA 1SULA 1EX9A 2MOKA 4DSTA 2G8LA 2H1IA 4WX2B 3RIXA 5LYJF 1D6NA 2FPGA 3L7JA 3ZXXA 5JD6A 3JZMA 3MHTA 1W4AA 1E3TA 4PCUA 3OJEA 1DKPA 3SWWA 4BN5A 1JSZA 4PRYA 4CVNA 1OWOA 3C98A 2HTEA 3N2ZB 4PE5B 4CM9A 4FI3F 4IFEA 2FX2A 3PQFA 4K2HA 1IOVA 2PK3A 3R40A 4ZVRA 4YNBA 5EWJB 4JI7B 2BBTA 1WCIB 1QVZA 4ND4A 1HRKA 1XK6A 1ZITA 5H3CA 1T8RA 1W76A 2MR6A 3IB3A 1AKEA 3DCIA 2JG3A 2CHQA 1Q6ZA 3P2YA 5LPNA 4XGKA 4LOHA 1YASA 1J2JA 2R6JA 5B58T 1WD5A 4Q3NA 5EL0A 2SBTA 4JOCA 2IWRA 3KQKA 1GUBA 1V16A 2ID8A 4H18A 5GM1A 2PXCA 4DXHA 5IKPA 3CLRD 2PQ0A 1TAGA 4XWAA 1R10A 1IONA 4NZOA 2C82A 2A0YA 1FU7A 2J3KA 1E60A 3SDSA 4CU2A 5CLJA 4NEGA 1Y1TA 2CN1A 2FSVC 4GWGA 1AXGA 3U40A 3H2YA 4OHFA 3KOOA 1BVRA 1CZKA 3VR5H 2Q6IA 2DUMA 1YK1A 4W1QA 4A6XA 4OQPA 1VG1A 1YQEA 2CJPA 2WF9A 3IKMB 5I01A 1VMDA 2M6KA 3TLZA 4JOSA 4EFKA 2EYQA 3D6VA 3RJ9A 3O4GA 4N5DA 4KK3A 2WF8A 3EW9A 3FBTA 4ON9A 3EE6A 3AFGA 3T3NA 1G8PA 1Q0UA 1Z73A 4J75A 3FOAA 5DM4A 4O4JB 1Q19A 1NTRA 1VBFA 2XA9A 3CTPA 3GV0A 3KDSE 1G59A 1DPFA 1GG9A 3B78A 1L3BA 1TM4E 4J0JA 4PFSA 1RXEA 4UEJA 3C8MA 3CT4A 4EB6B 3HYTA 3TLKA 3T1NA 4PS1A 1PEDA 5LWHA 2OAQ1 5J1SB 2AQIA 4GO1A 2DQSA 4HFRA 2G06A 2C2YA 1QJCA 1VM6A 1SXGA 5IKXA 1XJQA 3TSCA 1Z0ZA 1GRVA 1RAGA 3N28A 4UUMA 1TZMA 3PRJA 2Q28A 4EG0A 5JZ9A 1AKNA 3ZHSA 4C5AA 1J49A 1FUKA 4RD0A 1W36D 5G1OA 5F7XA 4EPWA 3GHYA 3SK0A 1E0SA 5BV1A 4MB6A 4LF7B 1KK0A 4BJ1A 1H9AA 3RS4A 3T6KA 2GBIA 3KBBA 4CMBA 4CNBA 1XMSA 2VN8A 2W37A 4M0PA 1KJNA 3R7BA 3R76A 1GL9B 1U0BB 2V6BA 1OBCA 5G0TA 1OWMA 3LO8A 521PA 4CIDA 3CLVA 1HTBA 5THXA 4RK6A 1WTCA 3VNBA 2NZ2A 1NM5A 5JH7B 4EHFA 5INTA 4OYHA 3CM0A 3AR6A 1DX4A 4BMOB 2B1JA 1H3EA 2IE0A 4D25A 3EAQA 3KQLA 2AN1A 2I4MA 2I62A 3V1UA 1H2RS 4YT2A 3U4DA 4PNPA 3V8EA 3G5TA 1RC1A 4UDYX 5FORA 1QYVA 421PA 1IWPB 1UBSB 2DM6A 2EF0A 3ZJ4A 4ZJYA 2WIAA 2HL6A 5F2EA 2HKIA 3I1JA 3FKSD 4IUCS 1IXKA 4IX9A 1EFLA 2D1QA 3ACBA 4AX8A 4DIOA 1M8FA 2VHJA 2XTNA 3PFBA 4IKPA 4D9NA 1ZHOA 1JFTA 1YS9A 2RD2A 3AYZB 2IS2A 2FW6A 2CJYA 1JIUA 4GH5A 2DFDA 2FWMX 4I9FA 3ZCRA 1CHNA 2E6UX 2WY2D 2AUNA 1UANA 1WHTB 2BCJQ 4TSFD 3KXKA 2B99A 1AA9A 1CF9A 4UBLA 1QX4A 2E9SA 4YDSA 5JATA 1OGIA 1Z2OX 3AEKB 3GDGA 3M4JA 4FN5A 2AN9A 2XTZA 1I0IA 1YVRA 1QIEA 5HYVA 4RK4A 3AUAA 3Q9LA 3H4TA 3FCYA 4NIMA 4O8ZA 4YRQA 2HUNA 1WSBA 2VSXA 3ZZMA 3LWNA 4ATNA 3ADKA 5TPZD 2JLWA 2EZTA 1R2QA 1R9GA 5AK6A 2FU5C 3H1PA 1QWOA 4QU5A 2DBZA 2FPLA 4YMSA 3EDMA 2HA2A 3HKDA 4UPDA 5GINE 1C1YA 1C41A 3GAAA 4QOFA 7REQA 3L6RA 3A6PC 2ZQYA 3HB4X 4FCCA 3GGCA 2WM9B 1G8SA 5DGHA 1YA4A 2CHGA 2HREA 2V96A 4YJ3F 1QLJA 3E7WA 3PNSA 4M9CA 4UW9A 2Q4RA 4J4HA 2ZSUA 3IIMA 5TJ9A 4D82A 2FVXA 3CBGA 4HDMA 3AUUA 1BHQ1 1Y3IA 2OZKA 4TGLA 1BMQA 1KPHA 4EI7A 5KNBH 3U5ZB 1N7JA 3DNFA 3LWDA 5HKAA 5JOQA 2BFWA 1ZM7A 2GAJA 4HGRA 2IEZA 2QI9F 3H1TA 4FW9A 1XTPA 4DEVA 4DWVA 4BXOA 1QANA 1GU1A 3QE2A 3B13B 1EXVA 3SZ3A 4KCGA 3CUTA 1MX9A 4OHPA 2L18A 2WWYA 4RHTA 4OFXA 3OX4A 5A5FA 4LJLA 1IUPA 3V4PB 3MG9A 4BNHA 1EU1A 3IDOA 3PF9A 4MR7A 4PC1A 4ZYWA 5JAOA 3ZJTA 1P29A 1ZUHA 1Z08A 2Q5IA 1PL7A 3KHUA 5FLXA 3EFOB 1YVEI 4WECA 5CT8A 5IAEA 3TINA 3UFBA 1JILA 5IVKA 2ZAYA 1SD2A 2WWRA 2IIQA 1WU7A 5E8JA 5EZ5A 5H1YA 2QUHA 1SUFA 4ND8B 4U5QA 5D6OA 1YUNA 2Z04A 3VBCA 1FJGB 3DW1X 3GCGA 4CI9A 4Z4CA 2WIFA 1X3LA 1RLIA 2QX7A 4BFXA 4EZBA 5J4LA 4PCAA 4YMWA 2JJQA 3UWMA 2H48A 3EGXB 3CVOA 4IMJB 1CY4A 4X95A 3QYPA 2ANCA 4GT1A 3UW1A 3JYHA 2AN3A 3KSUA 2FFQA 2I67A 3QHQA 4LOAA 3VKVA 2W2PA 5IM4A 4LBYA 2CZGA 1VECA 2VHXA 1JEDA 3R09A 3MIIA 3OLWA 1CIPA 1N2SA 3W5HA 5DBFA 4WACA 2QQEA 3ZCUA 5EUBA 5BRAA 3T94A 1XA3A 1CF2O 5AVJA 2HWXA 2RAFA 2O5VA 3KR2A 3EG9B 1F8YA 4TWIA 5G0WA 3R0ZA 3ZK7A 2C3YA 1BEUB 1U7HA 1AUOA 3HH8A 3PXUA 2FRDC 1B73A 3HY3A 5GZ3A 2RKWA 1MT0A 2BR3A 3RVQA 1NW6A 1UEIA 3TRFA 3B1YA 1Q16A 2YWGA 4PQFA 2VK4A 3VUEA 4C2AA 1FFWA 1K8QA 3RTBA 3TLAA 1AK1A 4EG8A 3OM0A 5DU2A 3IMKA 1ZNYA 2PUJA 4LSWA 1DIBA 2AMFA 1G19A 2F3RA 2ZZKA 3SZLA 4GEKA 5E7JA 3GMTA 3MCZA 1EAMA 1X0VA 2XNKA 3B1XA 1WETA 4IDPA 1YJAA 4Z4GA 2F1RA 3KFLA 5BXQC 3EW7A 1R0ZA 4FS3A 3V4OA 2VP9A 4AG6A 2BUAA 1XT6A 3PS9A 5TMBA 3EC2A 4QUEA 4JEHA 1EAYA 1U1CA 3P0RA 2BHRA 4BRZA 1MDBA 4XRRA 4B3RB 3FPHA 1EGMB 5F98A 3C3MA 4QX6A 3GPCA 4IV0A 1IN1A 3OM8A 3PFIA 5E3HA 4JV5B 4LV6A 3L7CA 1HEUA 5DTQA 3K8YA 2XUAA 3KIPA 4OJMX 2VNJA 2OTCA 4PZLA 4YGYA 4I5GA 2CCGA 4Z0NA 1PJQA 3NCTA 1BXZA 1U3GA 5AK3A 4BNJA 2XE8A 4CKBA 4DPMA 1XRSB 4IYRA 3J7TA 1PJLA 5A3RA 1IY9A 2QLFA 2JCGA 4BNLA 1PWYE 4ML3A 3HFRA 1WHTA 1JH9A 3TX6A 3C3EA 1W0CA 2F48A 1UXHA 3DLAA 4EG5A 2J08A 2C9MA 3FCCA 4GHWA 1UZLA 3BWVA 3QXJA 4B8WA 1PVVA 5B1HA 4ND1A 3QW2A 1QZZA 2PD6A 4ZYYA 4KZKA 1XTZA 3V4ZA 1AO0A 1NBAA 2WU3A 4BLVA 1L5FA 3TW6A 2V9CA 2F43B 2IPNA 2VWQA 4LDJA 3O0DA 2H0QA 2H4FA 2ZRPA 1S8OA 1J56A 4FYHA 1IVYA 4WEOA 5T64A 2FSPA 4ZU6X 4B79A 4C6HA 1W35A 3WWOA 1M2VA 1LF0A 2Y76A 1Y9JA 2GZ1A 1T15A 2OO3A 2W2MA 2AGVA 5T4BA 7MHTA 3A6KA 1WW8A 1JVNA 2Y92A 2X8BA 5LXTF 5DIFA 4W9MC 1O87A 1KOFA 1X39A 4Y9TA 5FPKA 4QFMA 4XR4A 4YRNA 3TGWA 4QG3A 3E81A 3C3CA 4AL4A 4CDNA 1Q74A 4NCNA 4HB0A 2DR3A 4C89A 2XBMA 4UPEA 1IE3A 3AVOA 1Z6AA 3WC4A 3ECCA 4IHKA 5LZ2A 2QVZX 4XEUA 1GARA 4JUIA 4DY4A 2FLWA 4EABA 4RVUA 1TQ4A 3SIRA 3ZTTA 1NXSA 3IT2A 1HDIA 1OVGA 3ZBQA 3AFHA 3NWBA 4OYRA 1B8VA 4FR2A 2C2OA 2Z58A 3JQ9C 3CEPB 3O4VA 4DNQA 3HKEA 2AVDA 1XEWX 1SBHA 1NV9A 3ZZ1A 1MJNA 1CUSA 2NVOA 2B4YA 1JIIA 5CDYA 2JLZA 3GT4A 4D2IA 4LX0A 3VU0A 2IHNA 4XQCA 4A73A 4ESVA 4TRJA 5ICEA 4AMZA 2AWNA 3SYRA 5AJUA 4UBKA 4OXYA 3T1VA 1TNDA 3A36A 2W6NA 2DPXA 3L8CA 4DLSA 5FL3A 3ENWA 3T5TA 2Z4RA 3H2KA 3E2PA 3ZHZA 1CZNA 4GVPA 2IYSA 5KHOC 5BNFA 1X1AA 2FJ0A 1PX0A 1MX5A 2Z1DA 2ZRCA 3I42A 3HXOA 1R18A 3FHCB 3LSYA 1N6NA 4NE7A 4RV4A 3D1VA 3MT9A 4A0SA 3WIDA 3DXXA 4KYIB 3TO5A 2WKQA 4M21A 4NZZA 8GPBA 1PBTA 5A4DA 4BWGA 3BD6A 5A9RA 3OIUA 4DNFA 2MHCA 4R1QA 1AS3A 3RRBA 1L5KA 4JC8A 2ZZNA 3MRSA 1O6FA 3HI4A 1GP2A 4N7RA 4ZGBA 1T9CA 1V9LA 2QRJA 5CFZA 1DB3A 4S05A 1QYDA 3PWKA 4R69A 4C43A 1ZD8A 2PE5A 1KU0A 3SQNA 4DILA 4EEKA 1ECGA 1SELA 3O74A 1N8SA 5CX1A 2ZRNA 1E66A 2FQXA 2CVQA 4RPHA 4WK4B 3AJEA 4XIJA 5CH5A 3T7IA 2PL5A 4NJEB 1NXWA 5FI0B 3ZDRA 2XEXA 3GCXA 4RH3A 3U1TA 3RRYA 1CDZA 4REQB 3EFOA 1QIJA 5LCXA 3AOGA 1JQDA 1L4NA 4KPFC 1W0JD 2Z5VA 3NPAA 4Y9SA 4GKVA 2QT1A 1PHRA 8ABPA 4M1EA 4GKBA 3AR4A 3CVJA 1C8VB 1G64A 4GQIA 4IS2A 3STUA 1LH0A 4I08A 1EB9A 3TDMA 4DUPA 3HJBA 2OM2A 3FKSA 2HMUA 1MT3A 2R8ZA 2K87A 3R41A 2J87A 4HPWA 1J6UA 4PRLA 4U9HS 2CLIB 1HF3A 3TX2A 3U9LA 2XB2A 3ZHBA 3V2UA 1U0NA 2UYGA 3N8DA 2C5LA 5DNVA 4ZAGA 2QW0X 3RM3A 4YRBA 1JIVA 3QE0A 1QYCA 2CVHA 3H97A 4A2CA 3OT1B 4YRRA 1V35A 1HO3A 4Z9AA 1N57A 1T2VA 4HQKA 2Z43A 4FEGA 2IP1A 2OCGA 2R25B 3CBQA 1EZ1A 1NRWA 1JQ5A 4TS4A 3DWIA 4B73A 1VCIA 3AEZA 5JV5A 2XMCA 4XCVA 2JCXA 1Q50A 3SZUA 3FUXA 4I4TF 4D6YA 1EVIA 3FNFA 4YLEA 4YAIA 3PTAA 4PW0A 2RH4A 4ARZA 2QZ4A 3QOWA 5HBRA 1R27A 3H1BA 3PNMA 3Q7TA 5FFNA 3T3GA 5C1BA 3HY4A 5CDGA 3COJA 2OBLA 2YKGA 4FQ5A 1G60A 3DL4A 3DZHA 3I2FA 1H0RA 3QNUA 3SF0A 3C48A 2JHAA 2GXUA 1T5OA 1AD2A 1V9SA 4IDHA 1XKXA 4RPJA 2Q1UA 2CXRA 4ARSA 4EFNA 1F3OA 4IXNA 1VHJA 1EESA 3KDPA 1Y3FE 1XWIA 1U94A 2IYFA 5ELLA 3QM1A 3DMFA 1O95C 1DXYA 2W2XA 4IDNA 1BDHA 3BFPA 4O08A 3AVPA 4R40A 4UHEA 5F21A 1G41A 1SKMA 3VZRA 3ADOA 1RWNA 5KYYB 2IPLA 2HHJA 3WB0A 2IXFA 3OTHA 4RDIA 5A5DA 1RQRA 4YACA 7MDHA 4N4AA 2ZB4A 1CJVC 4CIVA 4DMCA 5L4LA 3CY6A 1KPIA 2RBEA 3CNLA 3H5IA 3ET5A 3Q8XB 4JA0A 4OL9A 4QDZA 3RYIB 1RQ7A 4F86A 2VDQB 1X1CA 2IZ6A 1QGED 5AT1A 2GHQA 2E4VA 1PDVA 1DLIA 1RW4A 3DTVA 3BRWD 4KXMA 1FLAA 3B3AA 1NVUQ 1D1PA 3ENZA 3QXCA 3DMRA 4IIGA 5F2KA 4HY3A 2OWDA 4FD3A 3Q3HA 1EK5A 4RPIA 1JEQB 1ZH2A 3W2IA 3QXGA 2NTYC 4FB5A 4BKOA 4H3SA 1YL6A 1Z2DA 3IAFA 5TR9A 3T9DA 5AVYA 1MC4A 4D98A 4J29A 1NG1A 4YCSA 2A9JA 1JHPA 4CUZA 2D8AA 1HRDA 2CVZA 4KBYA 3U16A 3MTDA 3PGJA 3R0VA 4GOMD 5HW0A 3WIEA 3CUEF 2HSJA 3TJZA 2XZDA 4MIYA 1Z5UA 1O97D 2CLSA 2X4DA 1L7DA 3SJCA 2GPTA 5K5EA 4J1SA 4F4HA 5F5LA 4CE6A 2AXEA 2WR8A 3E22A 3TZHA 1IDOA 1FFGA 1NFRA 2EBUA 1F7VA 3I62A 1NQTA 3C1AA 1C0IA 3PXDA 4F71A 2W83A 3A28A 4FGJA 2VIIA 1I0ZA 4OHMA 3X1JA 1YCGA 5AUOB 1NBMD 3PNPA 4RSRA 4YO7A 2YJTD 3F9RA 1EJ2A 2BFEB 1MDFA 4MXDA 1T6YA 4M0KA 2F1HA 3MIZA 1NMQA 4Q3LA 3WGUA 3GMSA 3GLQA 1YRAA 2OL4A 1NW5A 2QXYA 2NZXA 4KFUA 4WKNA 4ZRDA 1BEEA 4W5OA 3M1YA 3U62A 2IU0A 2J67A 1GAWA 2PEZA 3TI7A 4AKHA 1JAYA 3ESYA 1AC5A 2W7TA 1AZLA 2Q6VA 5AJTA 3VI4B 3PQCA 1L6RA 4R8KA 4HAWA 2JI9A 1U3DA 2X2FA 1LS1A 5T4HA 3SS8A 4S35A 3MOSA 1E1YA 5CA1F 3FCOA 1RWPA 4N0DA 1N9ZA 1J70A 2OD7A 1OMOA 2EKLA 3C8ZA 4L28A 5KX5A 4JYAB 3UO8B 3BWYA 5SY6A 1CK4A 5BN4A 2WSIA 1WXDA 2WMNB 3ODPA 3U39A 1PWEA 5KMGB 2D2XA 3Q0IA 1J1IA 3WBFA 5BN3B 2VP3A 3L07A 3OQNA 3M5PA 2VP5A 3S6JA 1KKLA 1EQAA 1V5FA 1W2GA 4LE0A 4GYJA 3K7EA 1M1YA 2Y66A 3HFSA 4RA6B 1FLNA 2WKPA 4QYSA 1GLNA 5AI5A 1U8CB 1HMPA 3L79A 1Z82A 2NV2B 1E1NA 2EW1A 4B8YA 1Z4NA 3DLCA 1HLFA 3D6FA 4LVNA 4JKOA 3K9NA 1QUEA 5TDHA 4W5JA 1Y3HA 2ZOSA 3GLIB 1OU0A 3H16A 3W5VA 1I4DD 2X4LA 4K6FA 5SZHB 1WXIA 3ETLA 4KWHA 1IBLB 2IQIA 2IW3A 1OIWA 2WE8A 5JCJD 2PKWA 2R1VA 1W44A 3OFND 4TV8B 3FVQA 4UPVA 4L3OA 3NTXA 1G2OA 3WKCA 1X1SA 3N5KA 1JE0A 2VBFA 4GPAA 1UM9B 4KN5A 1TT5A 5HUHA 3KUCA 4LXYA 1FMLA 2NZYA 2VK1A 4OGLA 4W82A 3PUVA 4BTVA 3KR9A 3DV2A 4M0DA 1OB5A 3LUFA 1A8SA 2O9JA 3EGCA 2ZYAA 1ODTC 2FA9A 1ND5A 5P8WA 5F1KA 1SPBS 4V1CA 3DOFA 1YB4A 1W5AA 1JIQA 3EN0A 2RE8A 5EJGA 3DD5A 5EVCA 2CFOA 1W4ZA 1GTG1 1HEIA 5BMVF 2ECKA 1Y5RA 3GJ8A 4TXHA 4QXOA 1H9BA 2OGSA 2BGUA 2H3EA 1SOWA 1XZBA 5J4YA 3SU8A 1QU2A 1CRQA 1USGA 4OPMA 4WXYB 1FTQA 2ZYIA 3L8ZA 4WNAB 1RHUA 1EBBA 4JJIA 2XLCA 4KFCA 1QB7A 1TXGA 3LUAA 4TLLB 2JKVA 5LVAA 3HXPA 5BOSA 3E03A 4FPXA 4DBLC 2QX6A 1ZCAA 4HYYA 4GQBA 3VHXB 5LB2A 4E12A 3OTGA 3PNOA 4ENUA 5BSVA 1WMEA 4BOYA 5J40A 5J2TB 3RVRA 1UINA 5DGTA 4ESHA 2J7PD 5KJCA 3P5SA 5D84A 5F1OA 3QVLA 4TMXA 3L0DA 2H1LA 1PT5A 2ZXEA 5JYCA 3UBTA 3MM4A 4BMVA 1IFXA 4BZXA 3WLIA 3CVYA 2OQ2A 4UNIA 4D8WA 1FSPA 1FFDA 2Q3FA 4TTPA 4OI1A 3FPFA 4NYMQ 4UUQA 3EWAA 4JQCA 5BYAA 3PR1A 2J9GA 5AVRA 2FSSA 5JAUA 2FSVA 3NHRA 1BOFA 4LYEA 2HW8A 5C1PA 2CEAA 2D7CA 3NYIA 4BRSA 3V7NA 3WGVA 1BHJA 3QTTA 3WL7A 2RHHA 3ZNOA 4KH0A 2AUMA 3LLVA 1EP1B 5IABA 5K8TA 1YVPA 3WLJA 3JAKB 4MX8A 2X13A 3A9RA 2KMLA 3QIVA 2FN8A 2YWHA 3N7TA 4H35A 2W9XA 4RKFA 3DCJA 3AJAA 1XZHA 2AK2A 1NZJA 3MCWA 4V2IA 3RTEA 3SC6A 4TYQA 3SHQA 4KAFA 4OA5A 4WHMA 5E9JA 1QHGA 3HYLA 3UV3A 1WQ4A 4WFKA 2P62A 3QPCA 1FXUA 1XP8A 2QLLA 4ZA2A 3NHJA 3KEFA 4LZZA 3L4EA 3E70C 4NPCA 2H4JA 1W581 2ZUSA 3N2KB 1D0IA 3QU4A 4FFWA 4RJIA 2FOXA 2M1ZA 3SX0A 4MEAA 2P2CA 3ZDAA 2C04A 2RI0A 3KTAB 2ZS8A 1WV0A 3ZZ0A 2YFQA 4ZCIA 5EMHA 3V97A 4PWYA 3DTTA 4DCOA 3AG6A 1RC8A 5F23A 2UYYA 4ISCA 4KWCA 4E11A 1C30B 2PZLA 5P21A 3OETA 1R4MA 2REOA 3TKLA 3HCCA 3TUZC 1MP0A 3DFKA 1BIFA 1RM5A 2YXDA 5F12A 3WMFA 3DTVD 4CETA 1VHLA 1L4KA 1A9YA 5CT6A 3OTIA 1ZD1A 1UJMA 5JJLA 2L82A 2XI4A 5JYEA 2YOHA 5K0BA 3Q88A 1Q92A 4RC9A 4OMFG 5ETJA 1FC0A 2WFLB 4F3NA 5LP6B 3ZUGA 1XNJA 3HYCA 3KXIA 2A3RA 2GAFA 4RWEA 5C5EA 2HADA 2EEPA 3K3PA 5AKJA 2O06A 3E3NA 1PJSA 3MS7A 1R0LA 4GSLA 4PVDA 2JRLA 1BNCA 3EEBA 3N0VA 1B93A 4MRMB 4O2RA 4J0DA 2HV9A 4FYJA 4X8LA 3H99A 4RJLA 3URMA 3ZCXA 3P4UA 3OF3A 1HH4A 1XDSA 1W0KA 1TVCA 2VF7A 3PX2A 3UH0A 3ZGLA 4D43A 4KV7A 4BNWA 4RHCA 5K3SA 3UC9A 2PH5A 3UGQA 4K8OA 3ZDBA 3UA4A 1S3IA 5CG2A 2XNCA 4UU1A 4NCHA 1EFDN 1YONA 1X7GA 5AD1A 2GN1A 4XAQA 1VG0B 4LHYA 2D4AA 3P2IA 3RREA 1Z4MA 4KQIA 1AN9A 3QUQA 4GGMX 1V11A 2XITA 2C5HA 1SCAA 3D6NB 3NM5A 1YB6A 4I1PA 4NZ9A 5HF8A 3A3NA 5IXJA 4HX9A 4UNRA 5DN9A 5AESA 1E9RA 1RKXA 2P2LA 4W6ZA 3DMPA 2ZK7A 3A14A 2PLAA 3K0FA 4QOGA 1IJFA 1KZ7B 4XR9A 4F7DA 2XXJA 3GLGB 2PGJA 4HSEA 2PZ8A 3REQA 3RARA 2QR5A 2RHOA 5A4FS 3SPXA 3MUNA 2X2PA 3PUHA 4GOND 4ZD6A 2FN4A 5JMOA 4RPLA 1ZGBA 2B78A 3AESB 3DMGA 1DQRA 5KYUB 4HO1X 1XF9A 1G55A 2AG0A 3GZ4A 2JAWA 4TRMA 2G4LA 1MJFA 16PKA 3AP1A 3BJIC 3R3HA 5TGZA 3UJCA 4ARIA 1KFBB 2D5LA 1EVJA 3RS8A 4RF3A 3FCSB 3BWEA 4YAUA 1UQTA 2F17A 2GN9A 2QP3A 2YZMA 3ADPA 1A5SB 4IIEA 4Y67A 5D85A 4EY6A 3OQJA 2BE7A 5IHXA 1M1ZA 2OLKA 2O8DB 3BWDD 4RQUA 2JKZA 1XEXB 3AHDA 1GKYA 1XCGB 2Y1XA 3AR7A 3IB6A 3KVOA 1YL5A 3ZW9A 3GRKA 1P60A 5LXTB 4E5PA 1XZQA 3I12A 2K7ZA 3DDOA 5AOCA 4Q7LA 3JZIA 4C4PA 3KQOA 2WIGA 3LPDA 2EQBA 3E82A 4ZDJA 2JAOA 3JU3A 4CMIA 1XX6A 1SOMA 3FMFA 4B4UA 4YLYA 5K8JB 1EFVB 4YX9A 1RTKA 1BXGB 2UZAA 1KVRA 1S2IA 3MGBA 4AZTA 4DV7B 1JJIA 3T4UA 2Q62A 1IY8A 1DAHA 3QHPA 2B4RO 3A0RB 4M7OA 1TCUA 4IDQA 2QM7A 3FYUA 3PFGA 4YRKA 2I7VA 3MTJA 2NG1A 3O8QB 3H9QA 4NV3A 4OU4A 3OIWA 3JQAA 3UKDA 2DR2A 1E3QA 1J42A 1EFTA 2HMAA 1OXKB 4G36A 2CXNA 1CR2A 1CVLA 4ZXFA 4ZI5A 1RQ2A 5J9FA 2EOAA 4PF1A 3WAJA 2EJWA 2EXXA 2FVYA 1PNOA 1Y1QA 3KHSA 1RYZA 3UT5B 4DAEA 5BV0A 1E77A 5DX0A 1NLFA 1WD7A 4WN9B 5IEJA 3H7IA 2RFLA 2W6IA 3D59A 4WESB 2RC6A 3D8NA 4IJKA 1RRPA 3G7SA 4JUFA 4TRRA 5EXXA 3NANA 4N39A 5CDFA 4PYQA 2YJ6A 1ISMA 1VCNA 5JQGB 3DL7A 2AW3A 2GRAA 3O7MA 1YR9A 2H85A 2GDJA 1GCUA 3ICEA 1QK5A 4EL0A 2W6JA 2AKEA 4IP0A 4RM3A 2MR5A 4MI6A 5F1PA 4F2PA 4CF3A 3N8IA 4D0LB 3RYFB 3QKSA 1RJEA 3X1WA 2VHYA 1LI7A 2RGWA 4C0HA 5YASA 3DOOA 1NP6A 2YJ4A 4CF5A 1BVHA 4NNPA 1BH2A 2R62A 1L7VC 1ZD9A 2R7AA 3SNHA 2ZVDA 1H4TA 4ZQHA 4ALLA 2VDLB 3N76A 5BN5A 4HDSA 3I5UA 3CS3A 3BXPA 3IDZA 1E2JA 2QRVB 1MJHA 4F2DA 2DPYA 1RWWA 1A50B 3H8JA 1WVMA 4EMTA 5HP4A 4ZMBA 4S04A 1AY0A 1T2FA 2HIGA 1WXGA 3UAZA 4LRSB 4CV2A 1QLHA 2ZKLA 4ITRC 3GU3A 2YWDA 1QE5A 4MGKR 4FHEA 3K2IA 4RHEA 3EVCA 3M2TA 4QELA 4NABA 5K8UA 5I47A 2QE7D 2LIPA 5H81A 1WHSA 2QUBA 4WOJA 1OE0A 1C8BA 2M2IA 1II9A 4C6RA 1ISHA 2Z2XA 5B36A 3UPTA 4CGYA 1XPRA 2VQDA 4QHYA 5EIFA 4AWAA 2GCGA 2QNBA 5CW2A 4KTTE 4CTNA 4CF7A 3TPZA 2YVLA 2ORVA 4MTLA 4RUKA 2WIDA 3GLHB 3VOSA 4XJVA 721PA 2IX3A 1P9OA 2Z1NA 3GAMA 3HKDB 1FX0A 3ZY6A 2GR9A 1XTVA 2BZGA 1V25A 3A6HA 4PONA 4DHEA 2ZJAA 2F3SA 4YP9A 1MAUA 1O4WA 3LFHA 2IHBA 1Z88A 2J4CA 5FBVB 3MSCA 1YAJA 5JBQA 5EP1A 4JSTA 1D0SA 4WERA 5HGXA 2J5RA 3W78A 2IUSA 3UPDA 1SCBA 2OFPA 4NYJR 3C70A 3VH2A 2Q99A 2ZSJA 2HF7A 2C4TA 3UG6A 3GLKA 2Z8YA 2XT9A 3R7DA 4FX5A 1P72A 4Q01A 3D7MA 3M82A 3ZHTA 8MHTA 3QTBA 3S5UA 3I28A 4WKPA 1S8NA 4ZDIA 4I1SA 2V7BA 1YDWA 4JL8A 2P78A 4UQPA 4MPRA 3CKLA 3AR8A 2IBSA 2PQ2A 4NI5A 1E6EA 2YASA 3TLJA 1QGUA 1YK0A 1JEYB 3ESAA 2ISCA 5LXTA 1RD4A 5B1IA 4A15A 4B3DA 1DJPA 3ED1A 4JGGA 3FHJA 4HDKA 3RHSA 3ZV5A 3KQMA 1NYLA 1E96A 3E4CA 5AW3A 2FRXA 4CWAA 2IOFK 3OECA 5FO1A 1T1GA 1XDWA 2ISQA 3PVSA 4J16A 4CLOA 4IEIA 1NMEA 5JNRA 3R7NA 5KYVA 2HCFA 3WGHA 2HEIA 5CCXA 4ALNA 2JBAA 1OPRA 4GUDA 4KQ6A 1NFQA 1P5ZB 2R6DA 3MWYW 1Y89A 5LYYA 3E3AA 5LL6P 1JE1A 2D7DA 2XVZA 1X7ZB 1TYDE 4L9AA 5IUJC 4UZSA 4CM9D 3UV7A 3RC7A 5GGXA 3IKLA 2VNAA 4ZT4A 1JA1A 1C9EA 1I4LD 1WY7A 4FVTA 4RD3A 3JQ9A 3GBSA 4FDTA 4TZKA 1LPOA 1TC2A 3TSWA 4HDNB 3VPBA 3VZPA 4YY3B 1ZNWA 4MR8A 2EJBA 3JQBA 4P54A 2BD0A 4DDTA 1SXJE 1G5RA 1Y6JA 2P9BA 2PS1A 2ETXA 3HBNA 4M0LA 1WEKA 4CL8A 1N33B 5IRCD 1Z0JA 2FK8A 5I8WA 3BE4A 2FEKA 4M46A 3KV3O 1G5PA 1JNXX 4QDXA 3ICPA 3PG5A 4HRVA 4IIFA 4L8FA 1M0TA 3HABA 2C59A 5AH0A 3SIXA 3SSAA 4X7MA 4M7RA 3AUXA 5KQMA 2P1ZA 3UTCA 3O75A 3FNIA 2NZUG 5BSEA 1E9BA 5FP0A 5LC1A 5ESRA 4EVQA 1OHHD 1DEAA 2RK3A 4HS9A 4MCHA 2WIJA 4BNMA 4YJ2A 3ONFA 1MO2A 1Z6QA 1D2RA 3EHDA 2OZPA 4P7KA 4UTVA 1GUAA 3T9CA 3UK6A 4R01A 2VL7A 1XG5A 3D7NA 4DLKA 4QWWA 4BQEA 2O8DA 4MWSA 1D8AA 1VB5A 4DWWA 3JR3A 1Y6FA 5HF6A 4WPGA 1X0XA 1PF7E 4B0OA 4ZHQA 2JHGA 2ZRMA 3DR3A 2V5VA 2A9VA 2R7NA 3LHFA 4LJAA 2R65A 4IJVA 4L0DA 5HM6A 4BXOB 1AQNA 3A32A 4D6XA 4O2AB 4O2BA 3LAWA 4G97A 1SHJA 1SOUA 1VJ1A 3E2MA 1NXQA 3QU2A 4HDSB 3RNLA 1RPJA 3UG7A 3UK0A 4ER7A 4I36A 3FNQA 3WOHA 1ZIXA 4RY9A 4NZNA 4KV9A 4PHGA 4D99A 2DY0A 2LBPA 2V7GA 1B14A 3MFQA 4DL9A 1YB2A 3BE5A 2I4OA 5ALIA 1BC5A 1T1SA 4GNKA 3WKDA 1XF1A 2AOTA 3KP1A 1UKCA 2NX2A 3UHFA 5JIBA 1XMOB 2Q9CA 3E48A 5SZKB 3VR4A 4ZI3A 3RVDA 3IBYA 2F64A 3FMOB 1L4YA 4LBZA 4G8CA 2R48A 1NF9A 2XUOA 5I9TA 5A71A 1KVQA 5GAJA 1SZJG 5A6VA 3M4ZA 3TWOA 2R7KA 4NFYA 3EOBI 3GFTA 4TM8A 7AT1A 3IALA 3SYNA 4DR7B 2WPDA 3CF6R 4JC0A 1KS2A 2MSWA 3I64A 4MAFA 2ZB7A 4WK6A 3LW7A 3I58A 4LRXA 4MJLA 3WRVA 3C6YA 6REQA 5LQJA 3MUFA 2Y1GA 2YCLA 3AIOA 4BAGA 2JJ2D 4EATA 1X8LA 5F76A 1RLMA 3LP6A 4MW4A 4E94A 1H3NA 3TBHA 1T0HB 1ZZEA 3E9QA 4IJMA 5JCOC 1RYBA 1M6VB 2XUKA 1OLUA 3UJ9A 1XPUA 1WDMA 3SQMA 4DG8A 3OSZA 3U1BA 2QTBA 4D26A 4K1XA 3I01M 4Q4JA 3IUEA 4JVOA 4L1KA 1KWKA 3OH8A 5IFKA 2O52A 3U7JA 5JJBA 1W85B 3K0EA 3L41A 1RLJA 1Z5ZA 5GIPE 1ZVQA 4MTCA 1H42A 3PLRA 5COBA 5J47A 4YIKA 3Q6NA 1WX1A 3WL3A 3NTQA 4W9RA 1B42A 3DPSA 3TOSA 4EJFA 1BROA 1RPZA 3G9XA 3GN1A 3KYCA 4C7OB 3IHKA 3BSYA 5HOEA 1O03A 5KI6A 4P4LA 1GPDG 5KUTA 4NFSA 5K0EA 4PGFA 1EP9A 2ASVA 1P6XA 4XA8A 3USCS 1EGHA 1JDBC 2ZBEA 5KU1A 2NMVA 1KKUA 1QDUA 1J0DA 5C53B 4RDHA 2LCFA 1SA0B 5ICCA 4C3UA 2UXBB 2Q3HA 1OQAA 2Y0PA 3NBZC 2QLBA 4RY2A 3ST7A 1O96A 3PFFA 5ESWA 1IN6A 1U11A 2E18A 2RH5A 2QPOA 4YWHA 4MWGA 3TD6A 1DOHA 4BU1A 2P40A 4KP7A 4N3BA 1PW5A 1P4SA 5D00A 5C4GB 1HFKA 5C3UA 3NNDA 4WZBE 3BKWA 4QTYA 4XIGS 1Z07A 2Z6VA 5EHXA 3IR5A 2BP7A 4RIIA 1G291 3X0DA 2ZYSA 4BX3A 4JVMA 3EPPA 4GG1A 3MAAC 4KQFA 2IDMA 3Q1KA 3ELBA 4L0QA 3MTGA 4QGAA 1ZLYA 4AURA 2AZ4A 5K6RA 3ZUPA 5CB8A 3VYWA 2DBVO 3OOSA 4I8IA 2BHTA 4FJ0A 4RENA 4EYEA 3BMXA 3BT7A 1QSGA 1A8PA 4NHOA 4XEHA 2IHUA 5J2UA 5BORA 1G2PA 1LK0A 1OZAA 2PJDA 3L7NA 3ZCPA 5EP2A 5BUQA 2WYUA 1MV8A 1WL8A 4RM2A 4X6YA 2PZEA 2AV6A 1AK2A 3QUTA 5KPJA 4CBVA 1LW6E 3WA6A 1JX6A 1XVIA 2A14A 3L06A 4QEZA 3THOA 5JNLA 1OX5A 1RMTA 2ZB2A 3KDAA 4IVRA 4KIWA 1N8TA 1NUAA 3NJ4A 4GI2A 5HIJA 1Y8CA 2BGTA 4DLZA 1YF3A 4F2WA 3T5MA 3SQXA 3SYMA 1QHXA 3M33A 1E5XA 2C94A 2VQ3A 1EP2B 1N2CB 3DTNA 3DZGA 3HVHA 3KQWA 4YI3A 4BV3A 3EEYA 1GPUA 4PC7A 3L8DA 2QUIA 1ZR4A 1N1MA 4NU5A 1JKXA 1IEWA 4PBTA 2WT8A 3LCJA 4MIKA 4HDNA 1YHNA 3QI7A 4I5EA 1K75A 4JITA 4R5MA 3WSWA 3ZQ4A 1JG3A 3GRYA 2VJMA 1AKVA 1W88A 4RD4A 5CLGA 4BMYA 2RBKA 4Y2HA 3GJ7A 5AW1A 3KE9A 5FEUA 2PPLA 1WQ3A 2BFCA 2W2QA 2X1MA 2H0RA 3UV6A 4P22A 2WKSA 1W9MA 1G42A 1RWXA 1ZUWA 3DPIA 2PX3A 3NUZA 2QV7A 4GC9A 2X8LA 2NSDA 2B2NA 3BD8A 3K32A 4B4WA 2ABWA 4F7WA 2I9PA 4M1WA 1QAMA 3SJZA 4AXXA 1UODA 2V7UA 1A8UA 1YQUA 2EZ9A 3CW9A 4DSUA 1Y5NA 2ZYWX 1FXSA 1L4LA 2G9NA 4ITUA 1HL7A 2OMKA 2HIHA 2F7SA 1QIGA 1JR2A 2HTFA 3O8BA 3A2NA 1ZS9A 4FNMA 4KBGA 4RJ2A 6AT1A 1KGDA 5KPDA 1GR1A 1UADA 3G82C 4YAWA 2IOFA 1UJ4A 2HRQA 2WWIA 5K4AA 1XXHA 2B7LA 5JMWA 4IIUA 3RTGA 1PJRA 4Q3OA 3ZXUB 1PR5A 3AHIA 2QTVA 4IIJA 5E1DA 3X2SA 4MV8A 3SP1A 2PY6A 2X23A 1WB9A 3N7UA 1UBLS 1BH6A 1PYOA 2JH9A 2ZTMA 2G3YA 3GEMA 4KMOA 4MQEA 3J7AC 3UT5A 1Z0SA 3OE5A 2XCQA 1CUHA 3OM1A 1U9CA 3OBIA 5IF3A 3HM9A 2I55A 1B6RA 1L4UA 1N2GA 5G40A 2DWQA 4I81A 2ZIUB 1PSZA 3ZU2A 5JXHA 1CDDA 5EHNA 5LOVB 1VGQA 5MN5A 3K70C 3SKVA 2EDCA 1P2DA 3L2OB 4BP9A 1Y9ZA 1EIWA 1RPAA 2QQFA 1SOAA 2WTMA 4OMCA 1GGEA 2O20A 1SCIA 3GPBA 4QGBA 5CD9A 1RRFA 1EX7A 1EHIA 3HCWA 2