4PYJA

Human apo-comt, single domain swap
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
208
Chain Sequence
DTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 208
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pyjA01
5E9WA 4RWZA 3FYDA 4C05A 5EMMA 3KU1A 5ICEA 4RTQA 4OBXA 2VP3A 1RI2A 3MAGA 2QYOA 1G8AA 1RJEA 5GIPE 3GRZA 4HH4A 5K0CA 5F2KA 4CTJA 1JSZA 4CKCA 4KDCA 2PY6A 2N47A 2NXEA 1YFLA 4RVHA 2G72A 2NXCA 3ELWA 2FHPA 3LKDA 1MJFA 3P2KA 3DOUA 3LDGA 2Y1XA 3KPUA 2OO3A 4PGGA 4U7PB 1NW3A 5DSTA 3ER8A 4E33A 3OCJA 1PRYA 3G5TA 3SR4A 5CCXA 2B9EA 3KQQA 3UA3A 4ER5A 4HGZA 4QTTB 2ONYA 3E23A 5IH3A 5JUWA 4Y2HA 2ERCA 1QANA 3EVGA 3G7UA 2G1PA 3CGGA 4FT4A 4GOND 3PLAE 3HVJA 2NXNA 5K0JA 2PX8A 5FUBA 3LGAA 1VP3A 3B89A 4CKBA 5LQJA 5E1BA 4PYLA 4M37A 2P8JA 3GRYA 2VDWA 1AF7A 2FPOA 2JJQA 1WXWA 1KXZA 5B1SA 4PYNA 3DP7A 3TQSA 1JG3A 3R24A 4R05A 1EJ0A 1IM8A 2A14A 1AV6A 1IY9A 3LDUA 4A6EA 4LECA 4YUYA 5DM2A 3FUUA 3BKWA 2BH2A 3DR5A 3BGDA 3GGDA 5E9QA 3QV2A 5E2AA 1QAMA 1KHHA 3G5LA 3UJ6A 1RJFA 3ANXA 3IHTA 4C4AA 5HIIA 3AWIA 2PT6A 3NWBA 2ZIEA 4M7RA 1NV8A 2PBFA 2WA1A 2YTZA 2DULA 3EVEA 3SSOA 5F2NA 4FGZA 3BWMA 2HMYB 5EC8A 4U7TB 4GEKA 1AQJA 3ELUA 2C7RA 5GOZA 1NV9A 3KPWA 3QOWA 4OA5A 5HIMA 5FTWA 2IFTA 3BWBA 4AZVA 4YMGA 5K05A 1XDZA 2B2CA 3VYWA 1QYRA 4GC9A 3DLCA 4G56A 3UZUA 3UWPA 5CIYA 3M6WA 3P9CA 2ADMA 1O54A 3LECA 4WXHA 3TPZA 4DCGA 5C9ZA 5DRTA 4OBWA 3FYCA 3V97A 4R8RA 2B78A 3BGIA 3KQYA 4HSGA 1P39A 1ZGAA 2CWWA 2AOUB 4Z2YA 5ICFA 3B3JA 4EMSA 4GOOD 1QAOA 4RTRA 3EMDA 4GOLD 1G60A 3LKZA 2BR5A 4PYKA 4X1OA 3DXYA 4AX8A 3EEOA 1HNNA 2XYRA 1SG9A 5HEKA 3BKXA 2CMHA 1XCJA 3REOA 1NBHA 3JWHA 5K03A 3MB5A 4C06A 2ZFUA 4AZTA 3SX0A 4EK9A 2HTEA 3MQ2A 3P97A 5E1DA 5FA8A 3HNRA 3SM3A 2NP7A 2BM9A 2IP2A 2ORED 5GM2A 3FTDA 3L8DA 3BUSA 5HOQA 1ZKDA 2C7OA 1JG2A 1N2XA 1VL5A 3EVDA 3NTVA 1YZ3A 3KPYA 4E2WA 4XUDA 5EMLA 3BGVA 3KQMA 2ESRA 3PX2A 4PGHA 4C08A 4E2YA 4AZWA 3T0IA 1NKVA 1F3LA 1SQFA 2O0LA 3G89A 4ZTBA 1RI1A 2JHAA 5H02A 5DWQA 4P7GA 4POOA 4RVGA 5HFJA 3VSEA 3GRUA 2R3SA 3FRIA 2O06A 3T7SA 1R00A 3HTXA 5GP1A 2OKCA 1P91A 3B5IA 1N7IA 4PWYA 1VBFA 5G02A 2ZZNA 2Z6AA 5EG5A 3PTAA 3UJAA 2ZIFA 2GAFA 2I62A 2PXCA 2CL5A 3GJYA 3H2BA 1EG2A 1XDSA 4M38A 4FS8A 4QPPA 2P3OA 5ICCA 5DXAA 4IWNA 3BXOA 3RODA 5GIOE 4DMGA 2AOTA 4QVKA 1SUIA 3D2LA 3UA4A 4PNEA 4LWPA 2P40A 2G70A 4GBED 3NVMB 2AOUA 1R74A 5EOVA 4YV2A 5BW5A 5GINE 3R9XB 3M70A 4AUKA 2AOVA 2ZZMA 1TW2A 4CWAA 5LQCA 3JWIA 2ZULA 3BWYA 4PIPA 1DCTA 5HIJA 4EKIA 3OZSA 3MTIA 2EJUA 3DMGA 3OE4A 2UYHA 1SUSA 3CCFA 5DSXA 2OPBA 2AVDA 3CJQA 1KPIA 5EKUA 5EZSA 3ORHA 3OU2A 3UJCA 3C3YA 4F84A 2GS9A 4QQNA 1X1AA 3TRKA 4DZRA 5IKMA 1BOOA 4Y30A 1NE2A 3TM5A 2QM3A 2XVAA 5LQAA 1INLA 2WA2A 5FHRA 3ID6C 1ORIA 3HCEA 3LL7A 5D1HA 2ZLBA 3HEMA 1NW6A 2I9KA 3P71T 1ZQ9A 1X1BA 3CJTA 2O07A 4KW7A 3MCTA 10MHA 3NJRA 3I53A 2ZWAA 4R6WA 3A4TA 3FTEA 3LCUA 4MQ4A 3EGVA 3A26A 3EVBA 3FTCA 3Q87B 2HV9A 3R3HA 4ISCA 4LWOA 4RV9A 4F86A 4MWZA 4BLWA 2YR0A 2PLWA 2XYVA 3CVOA 1L3CA 3B3GA 5FHQA 1M6EX 4PCAA 5FADA 5BW4A 2UYQA 3G88A 4OA8A 3LX6A 2O57A 4C07A 1G38A 3FUXA 1O9HA 5EIFA 2ZSUA 3KR9A 2LD4A 5EIWA 3P8ZA 4RX1A 5ICGA 1WG8A 3FPJA 2IDKA 4L7VA 3EVAA 1SQGA 5E1OA 5HILA 3EVCA 3ER9A 3MGGA 1M0EA 1YB2A 1RJDA 3SSNA 5E8RA 3HVKA 4PCLA 3EVFA 1YFJA 2QY6A 1JTEA 1VPTA 3P9NA 5EVJA 3FPEA 3O31A 4RTPA 2EFJA 1YUBA 2ZZKA 2B25A 3KR2A 1XJ5A 4HTFB 4EVIA 2FK8A 4RTLA 3NWEA 1H1DA 3KHKA 3BT7A 5EMKA 3KQWA 4RVFA 4IKPA 1X19A 5K0GA 5DM1A 1JQDA 3M4XA 4B17A 4V0RA 2BZGA 4RSRA 3V8VA 2Y1WA 4YV0A 4R8SA 4EKGA 2OYRA 5HIKA 2I7CA 3KQOA 1BC5A 3B3FA 3EVZA 3AJDA 4R6XA 5DTRA 4FSDA 4UOEA 3KQVA 4NECA 2V7EA 3E8SA 1VP9A 1ZG3A 2OB2A 3HA3A 2PGXA 2ZW9A 4X60A 1FP1D 1ORHA 5FCDA 1L3BA 1XTPA 2AOTB 2R6ZA 3FPHA 1X1DA 2PT9A 1XXLA 3CKKA 5CCBA 3G2OA 3GXOA 4KRGA 1RJGA 3DTNA 3HCBA 3THSA 2KW5A 2IBTA 5KQRA 5CUQA 2NXJA 3FPFA 4QPNA 4BY9E 3EEYA 2XVMA 2C7QA 3TKAA 1L3IA 3HM2A 3I64A 4GQBA 4X61A 1FPQA 2ZTHA 4X63A 2PJDA 3AXSA 3GU3A 3JWJA 4DCMA 3EPPA 1FP2A 2PVCA 2ZVJA 3O7WA 5CVUA 2WK1A 4QDKA 2JHCA 5KYGA 4RTJA 4DKJA 1G55A 5EHGA 3O4FA 4RTNA 1EJ6A 4RTKA 1HMYA 3OZTA 5EKXA 3UJ7A 3FUTA 2YVLA 1R6AA 2NNWB 3PB3A 3LBYA 3HCCA 2IPXA 3CJRA 1UFKA 1VLMA 2C7PA 3TM4A 3UJDA 4RTSA 3HCDA 1I9GA 3KPJA 2G71A 4EQZA 3FZGA 4QTUB 1G6Q1 1Y8CA 3SGLA 2IDJA 2CKDA 4HTFA 3OE5A 4OX9Y 1P1CA 3LCCA 5K01A 2HR1A 2OZVA 1XCLA 2AR0A 3E05A 3HVIA 3LSTA 2H00A 4PINA 4P58A 3G2PA 5C0OE 3K0BA 5BP7A 1NT2A 2FCAA 2YXLA 3CC8A 1TW3A 2BM8A 3PFHA 1YZHA 3TR6A 2ZCJA 3SMQA 3OU7A 2BR4A 1UIRA 3WSTA 3DXZA 3KKZA 3LHDA 1KPGA 2P41A 3LCVB 3TOSA 3UJ8A 1X1CA 4GUAA 3FUVA 1KIAA 3PVCA 2G8NA 4RTMA 2AOWA 2H11A 1U2ZA 2YUIA 5DX1A 1B42A 4E2XA 2ZBPA 3P9KA 4PYIA 3OPNA 5ERGB 5F2OA 5FQNA 5BXYA 4E2ZA 4ER3A 4XUCA 3I58A 4FP9A 1V39A 3Q7EA 4DM3A 1FBNA 3HCAA 2GH1A 1EQAA 2GB4A 3IEIA 1YF3A 1Q0TA 3ERCA 5EHIA 5D1NA 3KR1A 3TKYA 1KYZA 3G8BA 2FRXA 5K0EA 1WXXA 2IH5A 5MHTA 4E32A 3DUWA 2ZWVA 1ZGJA 1FJXA 8MHTA 3OU6A 4E30A 3HVHA 3TFWA 4YUZA 2P3LA 2PXXA 3GCZA 3HP7A 4HGYA 5EEGA 1KPHA 5E8JA 1D2GA 3MERA 5EQJB 3EGIA 1D2HA 5DM0A 5K8VA 4ER6A 4YUXA 3TMAA 3M6VA 5K09A 2UZ4A 2PWPA 3OZRA 1TPYA 3G2MA 2PX5A 1DL5A 1SKMA 4DQ0A 5DRYA 4KDRA 4CKEA 2UYOA 2ZBQA 4MTLA 3I9FA 2NP6A 2E5WA 2B3TA 2AVNA 3GNLA 4ER7A 3E7PA 5K0FA 2YQZA 3PFGA 2IBSA 5U4XA 1QAQA 3LPMA 4C03A 3PS9A 3DMHA 4PIMA 3A7DA 5KS2A 4XCXA 2HNKA 1Z3CA 2YXEA 4JXJA 5FWAA 2JHPA 5LQKA 5EMJA 4PONA 3P9IA 3X0DA 3C0KA 3GRVA 3PT9A 3KQTA 4OQEA 5DM4A 5FWDA 3B7PA 9MHTA 2QE6A 4HRAA 3GWZA 4P7KA 1NBIA 5FA5A 2UYCA 3UJBA 3THRA 4BLVA 1ZHFA 2K4MA 2VS1A 3I5UA 2P3QA 2VDVE 3SSMA 4RVDA 1F38A 2JH8A 2JH9A 3GRRA 4BLUA 3UFBA 4CTKA 1PJZA 4WVLA 1BHJA 3KQSA 3ELYA 5C1IA 2EX4A 2GLUA 4KVZA 2IH2A 2Z6QA 2P35A 1JQEA 1RI3A 3A25A 1AQIA 3DLIA 1I1NA 5K0LA 3KPVA 4FR0A 1JG1A 3PX3A 5K0NA 4ER0A 1R8XA 5LQUA 2ZBRA 4QDJA 1XDUA 5T6BA 1NW5A 4X41A 4QQKA 4AZSA 3AXTA 5KVAA 2PKWA 3GO4A 1UWVA 3A27A 1QZZA 1O9GA 3VC1A 1SVUA 4A6DA 4DA4A 4M36A 1WS6A 1L9KA 2HWKA 4RTOA 2IIPA 2P7HA 3DMFA 3HA5A 1N7JA 4HC4A 4OQDA 3HA7A 5CM2Z 4F85A 5CVDA 4YUVA 5GM1A 2PSSA 4H0NA 4FSXA 5EEHA 1L1EA 2PV0A 3KQPA 3VC2A 4FZVA 4YUWA 2OB1A 3IV6A 3BZBA 4HG2A 4MIKA 2QRVB 3KR0A 3LBFA 4P7JA 3UBTA 1Q0SA 2CMGA 2IGTA 1WZNA 2IH4A 3UJ9A 5LQNA 1JSXA 1JTFA 5EGSA 3M33A 3M6UA 1I4WA 2AN3A 3U81A 2AN4A 1D2CA 5JR3A 3IYLW 3DH0A 5E9JA 5T64A 3DXXA 4DF3A 3DULA 4QVGA 2FK7A 2DPMA 3FPGA 3LDFA 2VZ9A 3SVZA 4CXMA 2Z6UA 5P8WA 1EAMA 3GDHA 3JWGA 3K6RA 2AN5A 3ME5A 4ATNA 4YV1A 4BP1A 2PXAA 5CVEA 4KWCA 1VIDA 2F8LA 1WY7A 2OBFA 3A7EA 4E31A 3C6KA 1VQ1A 1KR5A 1NW8A 2PX4A 2PX2A 1OR8A 3MCZA 2YXDA 5HZMA 5DT2A 2AS0A 3EMBA 2XYQA 4E70A 1RI5A 2OY0A 3NW9A 3FRHA 3RIEA 5DTQA 2GPYA 1RI4A 2NYUA 4O29A 3FUWA 2P1DA 3NMUF 1M6YA 5CVJA 2YX1A 4KIFA 2JG3A 1DUSA 1KYWA 3NDJA 3S68A 3G2QA 3R0QA 2V74B 1R8YA 4IV0A 2Q41A 1IXKA 5KQSA 5CD1A 5DTMA 3F4KA 3M6XA 4P7FA 3P2IA 4GOMD 5FULA 5LQRA 4PYOA 5E1MA 4PYMA 3TLJA 5LR6A 5LSAA 2ONZA 1R18A 4FT2A 4YMHA 4PYQA 5DPMA 3FTFA 2FYTA 2PWYA 2P7IA 3MTEA 5M5BA 3BWCA 4C04A 1P1BA 3EGEA 2ZIGA 1XVAA 3OFJA 5DLYA 2QRVA 3GIWA 3R6TA 4RYLA 1MHTA 4K6MA 1NW7A 2EG5A 2OXTA 2GA9A 1EIZA 5DXJA 3C6MA 4V0QA 3RW9A 2XBMA 4MHTA 1T43A 5T67A 2AZTA 1JR4A 4BP3A 3T7TA 2H1RA 5FQOA 3SXJA 5EZQA 5DX0A 3MHTA 3QOXA 5EPEA 3C3PA 3ELDA 3OFKA 2VDUE 5DX8A 2I6GA 1JG4A 2EJTA 4LG1A 5CVVA 3NVKI 1VE3A 5K0BA 2BR3A 3P2EA 4GC5A 7MHTA 5GWXA 4GF5A 1G8SA 1KP9A 4IV8A 4KIGA 3T7RA 1JQ3A 2AOXA 5E2BA 3HCFA 4XUEA 2O05A 3AY0A 1BKYA 3NDIA 4PYJA 3G8AA 3CBGA
chains in the Genus database with same CATH superfamily
1KZ1A 3SC6A 1CDEA 1YULA 5LB2A 4CEIA 4FGUA 2R6AA 2VF2A 3K4HA 1CB0A 1PNVA 3VAYA 3HR4A 3PQ5A 4G4GA 4GUDA 1WQ3A 3TTWA 4ZXFA 3FAKA 2Y99A 1CZRA 3D3WB 3FFXA 2FUKA 2QYOA 2HLHA 2J5KA 1PSWA 2EFDB 2MYNA 3T3IA 5E3JA 3RREA 3I42A 3BCSA 1G291 5EWMB 2AG6A 4MYTA 4R3NA 1IZ9A 4N65A 4J1SA 3B9RA 4UHKA 5EIXA 1W4LA 5EQDA 3ZJUA 4PNZA 5EP4A 1U1DA 4EB3A 1RPZA 3GCWA 1JU3A 2ODQA 3DL7A 5FRDA 4U8HA 4NK5A 3G9ZA 2WJYA 3LKDA 5B4VA 2ZJ2A 1IN4A 3K15A 1ZGZA 2RFLA 4U00A 5ED0A 3K4PA 2X6TA 4D9HA 3UA3A 2VPIA 2FN3A 1E7MA 3GOQA 4ER5A 4YRJA 4IF6A 4P6VF 1RWBA 5ADWA 3JVIA 1E3TA 3D6NB 2GI4A 3U31A 1NOKA 2YHIB 2B0JA 4C7JA 3K2QA 4HOYA 3GFFA 1K5DA 5EZ6B 2VYVA 2DHCA 3G1TA 4B8YA 5B58C 2WVHA 1Q19A 2BHNA 2SICE 5EN4A 821PA 4GPTA 3C97A 1E79D 3I6QA 1E2GA 3TQRA 1JJBA 2YWXA 1O97D 3PNOA 3GFQA 3E8XA 1BRTA 2YOGA 4QUEA 2I6UA 3P94A 1YQGA 5REQA 4A16A 3DQQA 1U0RA 1CW2B 2A9KA 1NVEA 4YAFA 5FOVA 4URVR 3WGQA 3X2EA 1CUFA 4O8ZA 3ZWYA 4PQYA 1NASA 3LDUA 3FXAA 4DBVO 4MO2A 5LDDC 1GA6A 4R5MA 4YUYA 1QU3A 1WPRA 2QRLA 4K40A 2VLIA 3OMWA 3BGDA 3AFIA 3FR7A 3RIXA 1ABBA 2H1WA 4QUHA 1EG7A 2Q99A 3D6JA 3EQ2A 3RBZA 3AZOA 2J9FB 3IHLA 3IHTA 1IG0A 4AF8A 3HDJA 5HJ7A 2JI8A 2WIKA 4EO7A 4XFDA 2JBHA 4OHZA 4FGZA 1XKTA 3TIFA 3IB6A 2HO4A 4HLDA 1XG5A 5BUCA 2WWHA 1H85A 1Q12A 2PG3A 2Z3VA 5GOZA 4W8GA 4FIZA 4NU0A 2FEXA 2CXHA 2GBGA 1WSWA 1D2AA 2HIMA 3I72A 3HU3A 5B6IA 1LRJA 2ZI9A 4X8OA 1E2HA 3QP9A 4FOPA 2WFLB 3COVA 3QTBA 1SXJA 3HYTA 4G0QA 1O97C 1QCZA 3IPRA 1U7XA 2B78A 1I0ZA 3N0VA 4BL5A 2DTDA 2IYLD 3D6VA 4BNMA 4JBLA 4PZEA 3B3JA 2JFUA 1L4LA 5ICFA 4DBZA 1Y48E 4ZMRA 4Q6BA 4X91A 1MGOA 4AX8A 2PKXA 2EJBA 4MV5A 3UATA 1SKUA 3WLMA 5ALGA 1CE8B 2BFFB 5HEKA 5E6SB 2CMHA 1H6BA 4CJXA 4KQ6A 5K03A 5JE8A 4AI6A 4EPWA 1H22A 4C4ZA 3OKCA 4NZ9A 4OXKA 1TT7A 4MWCA 4EK9A 1ZL0A 2CZCA 3IERA 3VFDA 3VOTA 5C4IA 3HNRA 3CM0A 5DTJA 1UIMA 1RBZA 3HBFA 5CFOA 1QZTA 4TZKA 3JALB 1WWKA 1HNXB 1EXWA 1E9FA 1WHTB 3CXRA 4MPJA 2Z3ZA 4JGGA 4PFKA 4RY8A 5HKKD 1IN8A 4YMSA 4EQ6A 1AUPA 2Q3JA 2R6R1 4XUDA 5MFPA 1N36B 5C4MA 5D01A 3TGWA 1NVKA 9GPBA 1KI9A 2Q2WA 4WBSA 1BGWA 1CUCA 2FZLA 4WCDA 1RI1A 2EERA 3QITA 1UKYA 4P7GA 1ORRA 5T4FA 1WQ4A 1NVWQ 1RCFA 4RMNA 4X92A 3JQCA 2O06A 3FY4A 3PWZA 2GTHA 4BKPA 2AG5A 2OCPA 3BE8A 4EP1A 2GZRA 2XSZA 3MLEA 2GD2A 2GZHA 2D4HA 2B1RA 4ZO6A 3ZNPA 3D3QA 3T9EA 4L5CA 3LLVA 4LF7B 4Y2QA 2X6QA 4O4JA 2Q6KA 5BV1A 5ALZA 4XR9A 3PU6A 1M2EA 5KDLA 1GTSA 3OOWA 2XMZA 1U28C 3O73A 2ORVA 3DKPA 1W4CA 1Q5PA 3LHSA 4IFBA 4JBIA 4WLFA 4UVIA 3OBBA 4MLZA 3UA4A 1JJFA 1OD6A 3P96A 1OB5A 4S1WA 3QNUA 1NY6A 2WB2A 4J0EA 5EE5B 5SV2A 5JQGF 1ULUA 1XZGA 1WB9A 4TLAA 4R0MA 5F3RA 4N3NA 3ZHRA 3A3PA 1XK7A 3K09A 1KNXA 4PCVA 4KPFC 5I3CA 2PX3A 2QRZA 3D4OA 5AHKA 2HBZA 1XTKA 1XVLA 2QUAA 1OU0A 1GO2A 5D6NA 3I9V6 4AN1A 4M8LA 1VLQA 2EEZA 2FQXA 2OORC 2WVGA 1C8VB 4EMTA 4Y9TA 1SEPA 2JD1A 3ECCA 1SU6A 9LDTA 2QL6A 3ID6C 4BBAA 3V2UA 3H4IA 5A02A 1QHHB 2ZU6A 4MJ3A 3P71T 5G0VA 4CLRB 1JDSA 3ECAA 4DC9A 2JIQA 2ZUDA 1EB8A 4M1ZA 1X7ZA 1Y98A 2HV9A 3L92A 2O54A 2BFEA 4KQCA 4D3ZA 5KOHA 2FWRA 1XMSA 5JROA 3D0KA 3FTQA 4TYPA 2PUHA 2XITA 1IAQA 4IZ6A 2Q6OA 1FFXA 4RETA 2RAPA 4NCAA 2CLMB 2VPTA 3RRMA 4DJ5X 1DC3A 3NEPX 4MGZR 2I3DA 4DLTA 3SKXA 4M0CA 1R7RA 2CNKA 5EIFA 3HEAA 2MU1A 3KR9A 2XNCA 3HACA 2A5DA 2LD4A 4ZVOA 1II8B 1SBHA 3B12A 2JNWA 4AULA 5AXCA 4YRIA 1ZRHA 1CUJA 2PZJA 3D5TA 4QBHA 2C4UA 4FVTA 2ZWIA 1PR1A 3QF7A 3GEBA 3O9VA 1UBOS 1TZCA 4CLHA 5JAOA 1YDHA 2BLNA 4RIIA 4ESEA 3ZXXA 1JXOA 1ZITA 1YBFA 1IHUA 3AR4A 1JALA 3R77A 4LDPA 3EDMA 3FETA 3GRKA 3LA8A 4LGVA 5AR1A 3ANTA 3PC8A 3IVAA 5K3EA 3ET4A 5BV2P 1U0TA 3DKKA 3K6SB 5TS2A 3ZNOA 1MIHA 3GP5A 5BSTA 2OYRA 3QPDA 3DHWC 3KQOA 4F45A 3LQKA 1Z33A 4A82A 4AJNA 4Z6KA 3OESA 1HDIA 5JSFA 5DLPA 4IEEA 1B16A 4XB6B 3N0XA 4X45A 2XZOA 5H7XA 4GRIA 3OQIB 4AMGA 2VHXA 3W9BA 1BG6A 2WP8J 1E3SA 2FKNA 1WX1A 5JNVA 3CRRA 1W4BA 1ZXLA 2M98A 2ZBEA 3DTNA 4HNAA 3UUWA 2VDMB 4EGCB 5I9LA 3PFBA 3PYMA 5CUQA 1WKBA 4WBNA 4QPNA 4BPBA 5JZMA 1GAJA 2XVMA 4DUYB 1PHRA 4G8JA 2C7QA 2GKSA 5JJKA 3QXHA 3JWJA 4OQMA 4RF4A 3EQ9A 5BQ5A 3TI9A 3PEFA 3DFKA 2D62A 1SJ9A 2WZBA 3FFWA 3TIVA 3I9NA 3ZD9A 2FVYA 2IU4A 1C50A 1F48A 1PFYA 5F73A 2RSLA 1DFGA 4JQSA 3M6AA 4NL4H 1QGUB 4I1PA 3EEQA 5TEVA 4BMOB 3F6YA 1IZ7A 2Q5EA 1VLMA 2EU8A 1L5MA 2G71A 3BJIC 2PZGA 3KHTA 1Y8CA 4QUKA 1B0ZA 2XF8A 2PO7A 2E5LB 2QNIA 4MI3A 3MT0A 1O6CA 4YPVA 3AVXA 3LCCA 4EAQA 3OPMA 3F73A 1GPMA 2VZ0A 4Q3LA 4JP2A 1JMYA 1NG1A 1IJKA 3NIDB 5TRTA 3H4VA 2PQ6A 1RM3A 5BSHA 1GTVA 1ZUWA 4ZOLF 2Y0PA 3FB4A 3PYLA 4HDKB 2JCBA 4RF2A 4B85A 1SVMA 3T1TA 2EJVA 1FUIA 2JVIA 4C6RA 1EDEA 2YN0A 2ATIA 3DYBA 2YINC 2JFYA 3W4KA 1EX9A 3VR6D 2C5HA 3IXMA 1UEIA 2GRUA 5BXYA 3HWWA 1GT91 4QU0A 2VDLB 5KYWA 5K9ZA 2Q2NA 4YMTA 1W94A 1FBNA 1PUJA 2OG1A 4QJ3A 1BE8A 4QLAA 3IH5A 5EXPA 4ZEMA 5AVRA 2FTKE 3Q6NA 3CHYA 4JK3A 4ZXPA 3VPSA 2FRXA 1Q1ZA 3HEBA 2FLVA 1T2AA 3NI2A 1JKJA 2VAVA 2R86A 2RHGB 2VPPA 4I55B 1QHEA 3OU6A 3CX3A 1U3CA 1GTL1 1C7FA 1V71A 2ODTX 3HMQA 3HV2A 5B1SA 3TFWA 2HQSA 2P6PA 4CZ2A 2VH5R 3MERA 4YRAA 5A4AA 4ZMSA 2PLRA 1J2TA 4IDOA 2PKQP 3RQIA 1A5BB 3QOYA 2DWUA 4OB8A 2D2IA 4OCZA 3SR3A 5E6RA 4KRXA 1Y4AE 2CJXA 2QWXA 3C3DA 1XZQA 1ZK3A 4L3VA 3KWJA 4MTLA 1DUIA 1DMRA 1X15A 2V7TA 2B3TA 4TN5A 3EZ9A 4K2HA 3W5HA 3LPMA 3WICA 3MK31 2Q4OA 4O8CA 2H7VA 2COKA 2VUUA 2Y76A 2G9QA 2BGLA 4MULA 2H2AA 2AWOA 3IUYA 4U8GA 5U4QA 4BCBA 4D44A 4DY4A 4ENRA 2Y1LA 4OQEA 1Z4MA 4MMYB 4RAOA 4D0GA 1N0VC 3IAUA 2ZUWA 1NHWA 4KIWA 2FOXA 1YRWA 1PVVA 4I66A 5FKJA 2VS1A 2W0SA 4UVGA 2VOJA 3PQ8A 1TC2A 4CTKA 4AB1A 3N8HA 1KR2A 3RVMA 1I01A 5BVGB 3CY6A 2E4UA 1EVYA 1X42A 2H54A 2QV0A 2WV9A 4L4YA 4NCKA 4NV3A 4MYSA 4V02A 5D3ZA 2Q50A 2WLTA 3COJA 1C8KA 2Q8QA 2VBGA 4X8MA 1TK2A 2P91A 1I2AA 3V7UA 2P3SA 1S2GA 5DU2A 3RRFA 3RTAA 4C0HA 4NFYA 3QEKA 3SEAA 2VF8A 2RK6A 1JIQA 1A3CA 2ZBRA 4KHZA 4MWEA 3LQ1A 3JZMA 1S2IA 4OKIA 3FE2A 4E94A 4QQKA 1TI7A 4LFCB 1FFAA 1NG9A 2O5VA 2VEDA 4F97A 4Q3KA 2IL1A 2IIPA 2ZUTA 1XCOA 4MQFB 3QQPA 4TSFA 3VVCA 5C7LO 2QTVB 5EEHA 3AY7A 3FDJA 4RZXA 2I1QA 1SKBA 3URKA 1GCOA 1RYZA 4Q0MA 3KR0A 3W9YA 2XGGA 2RD2A 3RASA 3K9FC 4HUQB 2AFIE 1G1MA 2IZ1A 3WMGA 4ALLA 4X1IA 5T4BA 3S99A 5GADl 4FN5A 2Q7OE 1BGXT 3NC4A 1EFLA 1JJAA 2R2GA 4FYXA 3HJGA 3A3NA 3H2ZA 3MAJA 1W4AA 1ZOPA 1V8OA 2UUBB 3DULA 1M0WA 1QE5A 2F62A 3WE7A 5HUJA 2QI9F 1PNOA 5EE0A 5IBRA 3FPGA 2VZ9A 4CM5A 1TE2A 4DC1A 5P8WA 3TDNA 3Q3JB 4ZZ3A 1FW8A 2XA9A 2P78A 1UANA 2CXQA 3OX4A 1QGAA 5CAEB 4KWCA 4D74A 5CNJA 3A6FA 1EDDA 3CLTD 3JQAD 3P0IA 4E31A 2WFAA 3UAYA 5DW3A 1OYYA 4GQIA 2Z04A 3KKQA 3NFYA 2XW6A 2GETA 3GH3A 4IH1A 4IIXA 4LVNA 3RIEA 2R8XA 2XGSA 1GGFA 1F4LA 4B4DA 1MMFB 1YQDA 1ZUNB 2P6OA 5JT1A 3NMUF 4LSMA 1KRHA 1MV5A 1WXDA 2KPOA 2QT1A 4RCZA 3AETB 5CVJA 3LYUA 2GN8A 3TIXB 4MUKA 1Q83A 3TMYA 2OM6A 2RIRA 2WUGA 5HXAA 3G13A 3UFXA 1Y1RA 5LQRA 4H7FA 4Q5IA 5BWOA 2QUKA 1MZVA 3D6HA 2IWHA 5LR6A 5JMOA 3BCUA 1FQWA 2G06A 3GDOA 2GK4A 4X64B 3KVNA 1G18A 3AFHA 2W6NA 3FFBA 5KTPA 1R8QA 1N6LA 4PN7A 4LJYA 2WZCA 5L3ZA 2I0FA 3NDBB 3CH7A 1DBRA 1NF8A 3QX9A 2IY8A 4HL6A 4ZD6A 3WLKX 1EIZA 2C1ZA 2ZROA 5DXJA 1NQ5A 2ZETA 1I2BA 1IBSA 2YJTD 3IAS1 2X4DA 2PRIA 4JHLA 4TL9A 4Y6OA 5DZSA 4F4JA 2AFRA 4I8IA 2GYVA 3BVPA 3WLIA 5BUQA 5C37A 2F43A 1GGMA 1ZD3A 3LGSA 3EDRA 2G6BA 4WV3A 3VSAA 1W9HA 2OV4A 1PR5A 3QOXA 4GSLA 4LJSA 4REQB 3OBIA 4WNAB 5HGJA 1JG4A 2JEZA 2BGNA 3FPLA 3C3XA 1U8AA 1JKXA 1ZAKA 3ITDA 1P0IA 3Q7QA 4KMSA 4YJGA 5DYTA 3PDIB 1OC4A 1QTQA 4B3GA 5DW0A 2NU8A 5KPJA 1E1QD 2BDEA 1OXMA 3ES9A 2JGFA 1NUUA 2YXPX 2ADOA 3AHIA 3CW9A 2BP7A 3HCPA 4QWMA 2Z6UA 1DKPA 1QPBA 3RUFA 1ESEA 1TEHA 5E4FA 4JB0A 2H92A 1DKMA 4N0PA 4DLLA 1JHRA 3FWHA 2JHGA 3KEQA 1DO2A 2XTMA 4PQGA 1FFWA 4IQ8A 1KDVA 3QELB 2XPCA 1XQ6A 5I9SA 1BSVA 4ZDIA 1B0PA 1OI2A 4NOLA 2G63A 3EIHA 3GT3A 4DLZA 3GFRA 2YIMA 2I6XA 1F1BA 2YYYA 2I2DA 2YIDA 3FF4A 2HF9A 4KDCA 1AM4D 2O8BA 1J8MF 2I3AA 1I24A 2EKQA 5ALSA 4KRFA 1YQXA 3LLMA 1K08A 2REOA 3QMVA 2ATVA 2D8MA 4IL5A 4RZUA 4C21A 2VHEA 3HZZA 4A8TA 2P6UA 3LDGA 4LX8A 3KPUA 4EA8A 2C92A 4OGKA 1V5IA 1C81A 1BS1A 4GPEA 2PWAA 4TMWA 4FMBB 3Q3IA 3GLIB 4G5OA 2XT9A 1EEHA 3FTNA 1Z4KA 3E23A 5K99A 2WF5A 2IUTA 4DZZA 3PC3A 3QSGA 1PWZA 4KOAA 4UEKA 4QGAA 4FCWA 1YCHA 4PV7A 2XD4A 4GVPA 5FUBA 3RFXA 4CMIA 5KO2A 1D0VA 1UK9A 4G8CA 1Q2XA 4X00A 3RU3A 1T2NA 1RE0A 2NM0A 4FOLA 4LZZA 1PU2A 3GV0A 1V9LA 3CEPB 5DO9A 5DMHA 3GRYA 2HQOA 2FR8A 3WGIA 2JKZA 2FPSA 3DLBA 2CKMA 5TS3A 4C76A 4X7BA 2V5VA 5KUTA 2JGMA 3V1NA 3H9QA 1LY1A 4N8SA 1Z0UA 4AWBA 3V4PB 3R24A 2JLBA 1E2NA 1TMOA 2FZCA 4Q4AA 3C8UA 1O4VA 4QNNA 5C5IA 4A6EA 1G0OA 1R8SA 3NKVA 4GZ3A 4KYUA 2A1TR 4LECA 1P0CA 4IEIA 2GRJA 4RXMA 3HLTA 3ONEA 5AJUA 1D5CA 4C5BA 1GYPA 3WZ2A 1O7JA 4ESHA 3SXPA 2HXYA 1HE3A 2UXDB 3L0PA 4RY2A 3GG9A 2JAOA 1CY4A 1J2YA 1JKFA 2HLNA 3RC3A 3K70D 4F1JA 2WV7A 1GNRA 1ZMOA 3AILA 1BJTA 1NV8A 3MN1A 4M7RA 1ORWA 4RPKA 4QZVA 2DFTA 2EKLA 3KWMA 5FJJA 2A9OA 4OHBA 2W71A 2C7RA 5FLKA 4U0JA 3WWYA 4UCFA 5LUAA 1NV9A 2N9UA 3SD7A 1S8FA 4HWPA 2J9YB 1AO3A 3K2IA 1WL8A 2QT9A 3HDYA 4JI6B 2CNWD 2WHPA 2GHRA 3H2JA 3S81A 1WU7A 3GLHA 3D0RA 3HC7A 2XNHA 4PSKA 3LECA 2D3TA 2XV1A 3N28A 3PQFA 5NULA 2H9IA 4EGSA 1F2DA 4O6VA 3ZU2A 1VDZA 2C5FA 3QVSA 2ZANA 1FU7A 4OXIA 4UU8A 2AOUB 3G8CA 3KJXA 3MXOA 4KBGA 4Z2YA 3EG9A 5C8YA 2C7BA 1NZDA 1Z83A 2WMOB 3U9TA 3G2KA 5CGZA 2AR7A 3UMVA 3ZV4A 3BFJA 3E2MA 2YWBA 2ZJ3A 4ABYA 3SYKA 3PZBA 2C61A 3REOA 5CITA 3O7MA 3GRPA 5AVOA 1OGIA 1WZ2A 3GLGB 2GASA 5HCIA 3DMTA 3UXMA 5AVUA 2AN9A 2JH3A 2QD5A 3TJMA 3KQUA 1MABA 2IP2A 3KYJB 1R0LA 2DFVA 2QTGA 4U2BA 5K2MA 1LU9A 2V0GA 4TKVB 2HHJA 1SN7A 1U7PA 2I1VB 5JPDA 3K70C 5IVHA 3DLAA 4M0MA 3PX2A 1O8BA 3EFBA 1M8KA 1Y9DA 2BYTA 2GESA 3BREA 2AMJA 1NKVA 5H02A 3LBAA 3BDVA 4NAHA 1J99A 4GR5A 1G9TA 4KUEA 2R3SA 4BQQA 3A1WA 1OLUA 3GJ7A 4BV9A 3AF6A 2C95A 4E15A 3GJTA 2ZSBA 3H8VA 4HDMA 4JR2A 1VL1A 3IPXA 2FWMX 1KOLA 1KO5A 2AKAB 3UJHA 1TCAA 3DTYA 4RHXA 3QI7A 2AJTA 3CB4A 4WKPA 3VO8A 5ALMA 3VV3A 5FBVB 4MS4A 1W44A 3GJYA 1FDTA 1SOUA 2GVZC 3L7AA 3R6DA 2G80A 4W7HA 3O1HB 5DXAA 1Z6AA 2ZR8A 3RODA 2QYTA 4QT0A 5DT9A 2CD7A 1KETA 4M86A 2WUVA 1AK9A 2R8BA 5DH9A 3V4SA 2P40A 5BSRA 1MORA 3AJAA 1TYEB 3AP2A 2ZTMA 4XRRA 4B9AA 4LTDA 2GGSA 3TRDA 5CYGA 4QVIA 2ACKA 4O4JF 1KORA 3USCS 2ZSDA 4EHNA 1DCTA 1U4SA 1G5FA 2CL0X 3AU8A 1W48A 3QVGB 4AW9A 4WCFA 5K3OA 1DKRA 3CCFA 2H7CA 2JHFA 5FOTA 1R88A 3TNYA 1U1EA 4BQEA 5JECA 3K53A 3C3YA 5FUMA 2PKCA 4DZRA 3O83A 2FPMA 5IKMA 4F9EA 1RM4A 3CPEA 1JHUA 2ANBA 2KE5A 1W5TA 1WCYA 3Q6MA 3R23A 4M8NE 4A8PA 1U2SA 4Y6GB 1FQKA 4EZEA 1NW6A 4BNIA 2RJ3A 1C0KA 2XEXA 2Z8ZA 1NZJA 1D04A 3KV3O 5EQTA 1XTZA 3MD9A 4R9NA 1WSBA 4RACA 2EZUA 2PLNA 4FTWA 1SURA 3JAWA 5D7BA 5E2IA 3ZCVA 2D2VA 2X2PA 3IUSA 1RP7A 3PWTA 1WMFA 4FYHA 4BLWA 1YDGA 1JHQA 5BRJA 2FZVA 1NPYA 2F3QA 3R8CA 4AO6A 3F7MA 5TB5A 1IDOA 1IG3A 1UC5B 3OD1A 5MN4A 4ES6A 5FNVB 4LNAA 3L84A 2OHFA 3PDWA 4FDAA 1ZD1A 1LF0A 3O82A 3GLRA 1OZFA 1K8ZB 1WV0A 4LHEA 4JV5B 1FRFS 4TXLA 1LPAB 1M0TA 2QSJA 4BMZA 1C5KA 3DEZA 1CRWG 4BX9A 2EF1A 1Z7WA 1SC6A 2YOHA 3H11B 4QYMA 1XWWA 1PWXA 4Z54A 2O8FB 1F17A 3QTLA 2PA0A 2XUJA 5ECYA 1OVMA 1GHTA 4J7AA 2ZZKA 4BNYA 1XJ5A 5L7TA 4M89A 1UFQA 3D43A 5COAA 2RG7A 1CUZA 2HA4A 5IT4A 1A8SA 1WTAA 2WAYA 4YCJA 4XFJA 3VZSA 1W4RA 1JQDA 3M4XA 4ILEA 2EZ8A 1IJEA 2G9UA 4D8VA 5BPHA 1VI2A 5L95A 4O2AB 1SBCA 2H17A 2ZJ1A 3K35A 2AHRA 2ASEA 5L3VA 1ZNWA 5CRIA 2ZB7A 2YQ4A 5DTRA 3UGQA 4UTOA 4IILA 4U2CA 5HTKA 4G0ZA 1UKCA 1XC7A 1ESMA 2AWNA 5DNDA 3U3KA 3H9CA 4N18A 1QFJA 4KNYA 1ZD4A 1XTPA 3EQ8A 2BEKA 3VR2A 4Q1EA 2FDRA 3PWKA 1WF6A 1V16B 4UJ3A 1Y3DE 1P5JA 1BVUA 3KXKA 2A1UB 5FYQA 2HJSA 5EWLA 3T3EA 1QRRA 1NR5A 2YZMA 4RJ2A 5KYUA 4CMCA 1JILA 4EZBA 2PUAA 1MEEA 3DE4X 4CODB 5C3MA 5C46F 5I9NA 4QDTA 4YQYA 3FYUA 4R5HA 5SICE 3O8DA 5FBLB 5CTAA 4MVJH 5J4KA 1BQ3A 1JKIA 1PGPA 4V24A 1FK8A 2WU0A 1K3FA 2YS7A 2QJRA 5LLSA 3ND5A 3ADCA 5KTNA 1QO7A 2CHGA 1NMZA 2DY1A 3DJFA 1QRAA 3V4ZA 3QWAA 1SUBA 1CNFA 1HYGA 3IAFA 3EXEB 4WBNF 4IRMA 3RFFA 4ENVA 3MCUA 2ZE7A 1A4XA 1AHHA 2L69A 2OGSA 2C7PA 5H70A 2VAMA 4DIMA 1KOJA 5CXQA 3OIUA 3SBDA 5FIUA 3IL2A 3NEAA 1A1SA 2KI5A 3TEMA 2W6PA 3CLSD 4QLBA 2CLKB 4QQRA 1H2AS 3LSTA 2BTOA 4P58A 3W2TA 1PS8A 3O74A 4MRRA 1NURA 4CUJA 2WNSA 4CI9A 1IN5A 4U1RA 2PIDA 2ZKIA 3EYAA 4OD0A 4TVSA 1Q0TA 1QDEA 1OA1A 3GN2A 3LCVB 1Z07A 3FUVA 2QLMA 2FJUA 3KOYA 4KH1A 5DX1A 1A5TA 2JLCA 4X3PA 4PYIA 4K9DA 3R7WB 3QY9A 4IJVA 1XTRA 5TC4A 5JCZA 1F14A 2BM0A 1UUFA 2Q3MA 3LHFA 4KE6A 2GH1A 1USGA 1JSCA 3IEIA 1YOVA 4K86A 3ROTA 4E1BA 5D1NA 5J4VA 4ZOBA 5LU9A 3M7IA 3VR3D 1XA4A 4MAMA 4KQGA 1SK8A 5GQSA 2CMKA 2ZJYA 3BE4A 1P5RA 4N01A 1XEFA 1SC3A 1GQRA 4ND4A 1U3UA 4R1SA 5KOJB 1Y42X 4MITA 1EVZA 2CE2X 1QQBA 4JLAA 3DM9B 4QOIA 4MDFA 4XEHA 3IBYA 5IAKA 3OOHA 2RHRA 2W2PA 2CFIA 2ZRHA 2CL6X 3DO8A 3TMAA 1EU1A 1N6PA 3INRA 5BV7A 3O2JA 4D92A 1JIXA 1SKMA 2XKKA 4YCBA 3BCHA 4CKEA 3AKDA 1K4YA 4J0HA 3NORA 2OTCA 3CLSC 3JQEA 4QODA 4YQZA 6AT1A 4TROA 2NP6A 2E5WA 4BX3A 3MLAA 4JHXA 2O7VA 1X3SA 1M8JA 1NI4B 3T5GA 1MVLA 3MZ0A 4BO9A 3RYIB 2HLPA 2IK8A 3JXEA 2HYIC 4XCXA 3T9CA 2O2JA 2A3NA 3W3AH 5KEIA 2QVBA 1GPLA 1A95A 1P0PA 3HJCA 5E7JA 1S9DA 2WVAA 4M2LA 4TMTA 1U5BB 1PZMA 1ESNA 1V11B 2DQZA 1VE5A 2HGZA 3ADKA 5KTYA 4GKKB 1Y6RA 2FY8A 3N3BC 1NQAO 3I8SA 4MRSA 8ABPA 3LL4A 1KKLA 3KSUA 4LQDA 4YWHA 3TJZA 3CVVA 4CDRA 1MO3A 2PO5A 4BLUA 3UFBA 3CSSA 4RPIA 2DLCX 4NK4A 1SVSA 1ZC4A 4IOLA 1PLLA 2GLUA 3QH4A 1GNQA 3OIVA 5FOSA 1WULS 3JD3A 4A4DA 1D9ZA 1RXUA 2YZNA 3RVNA 4AU1A 4DJTA 4WUTA 5C7YA 2B5OA 3KP1A 4D3DA 3DOFA 1NM5A 1IOVA 3PX3A 5KTOA 2VJNA 5LXTB 2VXCA 1TFRA 4PXSA 5BUSA 3CURA 2CXPA 5EZYB 3FDZA 5ALRA 4PX9A 1UWVA 3EPHA 2PD6A 1Y9ZA 1WM1A 4MVJM 1J06A 1FU8A 2H4FA 2P7HA 1G66A 3EHEA 1DP4A 2XWQA 2VZEA 4G8DA 4Q9LA 4F3KA 1UJCA 1PL8A 3ONVA 1RLTA 1U4NA 3A1FA 5JZOA 4AJIA 4F7DA 4NHOA 1E8NA 1HF3A 4J0JA 4BFTA 3ICEA 2QUZA 4QQ8A 1PZFA 2C0PA 3A3OA 4XLTA 2VBFA 3U7GA 4PU0A 1QF7A 5EGSA 1T8YA 4XEUA 3WHKA 4C0SA 3OLWA 3ZPXA 1M7GA 4BWVA 1KTVA 1SUWA 3PUXA 4QHTA 1M5RA 1NNI1 2VJMA 3EQZA 3FNHA 1P33A 4DUPA 2FWAA 4XWAA 1A69A 1O89A 3SVZA 4CXMA 3C3KA 3L9XA 2O6LA 1OWMA 2AN5A 3CO5A 3DTTA 1P8AA 1O94A 4YV1A 4XYLA 4POAA 4TLBA 1E64A 1TAHA 1VIDA 3DHVA 2RGCA 1XELA 1ZX1A 3G82C 4ALMA 4BVBA 4JI4B 4DFDA 4J1TC 3PFNA 3FOCA 1S0UA 3N2IA 1E3QA 3F6CA 1NQOA 3OM0A 2V9ZA 1T2FA 4Z9BA 2AS0A 3H3XA 5IJ9B 4KLCA 4JFRA 2KMLA 4G0XA 4BEBA 4DIBA 1VJDA 3EXHA 2YMMA 3M9XA 3DT9A 4OQYA 5DTQA 3JQFA 4A0FA 5JBNA 2TMKA 4M4SA 3EARA 3QX7A 1NJ2A 2JGIA 1RPNA 4TMZA 5AKKA 3VHXB 3L4KA 1ZK0A 2YX1A 3NDJA 4TMXA 1S02A 2X77A 3KZXA 1QLJA 4WFJA 5JDCC 4CKCB 1T2EA 2O0HA 1QZ3A 1YRAA 2I8LA 3AHGA 4R0VA 5BT8A 4I8DA 4YMUA 2OCXA 3DWIA 2Y9PB 2GNAA 2YFYA 1IEQA 1R50A 3E6AA 3GPDG 5CT6A 1V96A 3AUUA 4E7PA 4RK6A 1OXBB 2EGHA 1BE6A 1UAGA 3BIFA 3V1KA 5ALVA 5C7IO 1S1CA 1AURA 5KTMA 1LBQA 4HLQB 3EGEA 4D56A 4JNCA 4RFVA 5EWJB 5BR1A 1V2HE 4IKEA 4TOIA 4WNIA 2R97A 1OTXA 1HYHA 4I4NA 4MB6A 4UE3S 4ABTA 2WJHA 1GEEA 3M5WA 2AJCA 4LJKA 3ZW7A 4KX5A 4M60A 3CH6A 4TXHA 2AZTA 3WOVA 1W85B 3T7TA 3FHCB 4BO4A 4DSTA 3E3NA 3WYAA 3BOSA 3O2SB 2ZJFA 4TGLA 2AI2A 3R0IA 4M1SA 4EKYA 5D3KA 2QYSA 3NVKI 1XVUA 1E1KA 2BR3A 2P65A 2QX6A 2FMHA 3EBPA 4MUYA 1A77A 1L5ZA 2IIQA 2WYWA 3AL3A 3DDCA 1C7RA 1XLTA 2V5UA 1IB0A 4ZZ0A 2IEGA 1N2IA 4XWKA 1Z0KA 3ZQJA 3B9PA 1HGXA 2O05A 4JR1A 4BE7B 1JBQA 3NDIA 2Q5HA 1JPNA 1ZM7A 1IIRA 2N75A 5CVTA 4MUXA 5G1OA 2V6IA 3QHPA 3T4XA 5JC1A 1V1RA 4TXJA 2IOQA 1YV9A 1LW6E 3GD7A 3DDNA 1U8EA 1D1SA 1OX5A 4QXPA 2H3EA 1VM6A 2X4IA 5IJXA 5GIPE 2MDTA 2AF3C 2P4SA 1DWQA 3FOEC 1XRJA 4YROA 1GRVA 4DVJA 5A03A 1SEVA 5JY6A 3OTHA 1C8BA 5TARA 1EP1B 1GGJA 1V47A 1U98A 4PG5A 4PO1A 3QKRA 4EJSA 2WNHA 1W46A 2F3PA 2UUOA 3EW7A 1T2UA 1UC8A 3W1EA 4D8TA 5JMPA 2H2GA 1T3LA 4Q93A 3WK8A 1PAUA 2OBBA 1CUEA 4IMRA 4JQOA 5FOWA 2ZRCA 1A04A 2HRDA 3HUUA 3P9RA 4MRNA 1GTG1 2QM0A 5CCXA 2OKGA 3LVBA 1S3GA 1CUIA 4CN8A 1A8QA 2ZVQX 1VJ0A 5DDIP 2BFOA 1XD9A 2PUVA 4O0MA 4MWOA 1C1DA 2W37A 3CGGA 1VRCA 2JI4A 3N7AA 2E4ZA 4XB1A 3TX2A 1Y9JA 5IFLA 1ODLA 5JALA 2GCOA 2OQIA 3B3QA 3WHLA 1L4FA 2BEVA 3QW4B 4UHFA 3OTOB 3B1KA 1Y1TA 2DWQA 3TL2A 4IBOA 3CUWA 1OIVA 4BC0A 4HTAA 4M1TA 4UHJA 4UMVA 4ENPA 3D4IA 4PQFA 4ZQIA 5AKGA 1X6VA 2DAPA 4IJKA 3LWDA 3M4JA 2I2WA 3DP7A 4LXXA 2F1RA 4IZHA 4Q1FA 5AM1A 2BAGA 4AZ3A 1TMGE 1ABEA 4LYAA 3ETNA 1EFKA 4R05A 4PR3A 4XKJA 1I7NA 5DGCA 1G41A 1K8RA 4CG2A 1TRHA 4F8YA 4UEQA 2CK3D 1LVHA 2YHUA 1P74A 4PAWA 4WLUA 4XVCA 4UBMA 5AM2A 5G3YA 1BXZA 2VP5A 1SXJD 3MQFA 3MD0A 1XU7A 3ANXA 2HK6A 2PZMA 1CVRA 4DG9A 1BX1A 3CGWA 2C94A 1XVTA 4XGKA 1KEVA 1MOPA 1PEDA 4UU7A 5CJ2A 1KDYA 1VTKA 3ENQA 2AF4C 1PDWA 2VRBA 3GX1A 3ILSA 4LE1A 4Q03A 4U7WA 3HKBB 5TE9A 1GZDA 3WBBA 3WQSB 5G0UA 3BWMA 1KAOA 2HMYB 3I1YA 3GJ6A 3UC9A 4B32A 4Z4EA 4GKJB 3QOWA 1HTBA 3G5UA 2J67A 4WZAA 4EY3A 3HYNA 4LK3A 1LW7A 4LSGA 2CXRA 2I54A 1XI2A 1W8DA 1Q7RA 4LPKA 1MEOA 2AZ4A 6Q21A 1M1NB 5JCJD 3KJFA 1MQSA 2X5KO 3ZV6A 3TPZA 5E2BA 3JQ9C 2HF2A 5DN6D 2H4YA 1P39A 5AJWA 2PPVA 3QVWA 5AIBA 5KC9A 3WBFA 1H2ZA 1AD2A 1QAOA 2Z2XA 3WWOA 1BDBA 3UHAA 2XA1A 5ABPA 1N5IA 3PEVA 1U94A 4LS3A 4P7BA 4Q6WA 5CB6A 2I91A 1XUOA 2OCKA 2PEYA 4JLDA 1VL2A 2W2MA 4M1EA 4BVEA 2TMDA 2FN4A 4G2TA 3SIXA 1E7WA 3WBJA 3GT4A 2WE7A 3D0OA 1SXJC 3IIEA 1PO7A 1WKVA 4YO8A 4EUFA 3QLVC 5C8YF 5CB8A 1N2XA 5FPQA 2MINA 4MYCA 5GAJA 2YRFA 3OJXA 1M1UA 5FUVA 3ABSB 4CKZA 1CY0A 4C0KA 1RP1A 4MQMA 5A4JA 3QUQA 1LBIA 2CC2A 4A92A 1JPUA 3LM8A 4CM4B 3KKOA 3DVLA 2IHUA 5BRAA 1JNYA 3T52A 1KVSA 2II6A 1H94A 2FXIA 1YZFA 5CFMA 4YREA 2EP7A 2FPPA 1F6WA 1QGED 2HJRA 3L7LA 4A2QA 4B4OA 3LC7O 1WETA 4U9UA 3VYTB 1DB3A 2CL5A 4Q3OA 2OQRA 3C4VA 1OUMA 5ICCA 3FAZA 4LK2A 4XIIA 1M1YB 4NBSA 5EYPB 1IPFA 1G42A 3PHCA 2WTMA 3EFOA 2V8OA 1NBEA 4YP0A 4RKFA 3M4YA 1LS1A 3I1JA 3E9ZA 1RM0A 2R6DA 4AZ0A 4KVGA 4EM6A 4MV3A 1NW4A 2EGGA 2W2KB 3VPDA 3QLEA 3IGFA 3RABA 2NV2B 3SHWA 4YT4A 3LC0A 1WEHA 1M6VB 2ZP1A 3ZHYA 1QG4A 4U7HA 4ZHQB 3KJGA 3PNYA 1OAAA 4GR9A 2MOKA 2OPBA 1FS4A 1FFGA 4H18A 4NZYA 4WADA 1W2HA 3DXFA 3E03A 4XD7A 4V1CA 3SE7A 4NJOA 4G4IA 5D1HA 1OZHA 3V1MA 1I7LA 1Y3IA 2QS9A 3HEMA 4QOFA 4N3AA 3RT7A 1ZQ9A 1CJCA 1X14A 2ZT7A 3OUZA 1OYVA 2H1FA 2W5UA 2OA0A 4ZGGA 3NJRA 1RNLA 3OY7A 1H8HA 1LTKA 4TL6A 3VM6A 1KOGA 2AXPA 1FMTA 5G3ZA 3U2QA 4BRUA 3DBRA 4JI5B 5LMNB 1FYDA 4KVFA 4D25A 2TYSB 2ZR0A 4PG6A 1IWBB 4QGGA 4C3OB 4FKBA 4UZSA 1XEXA 4ASUA 5BQ3A 1M6EX 5K45A 4FZ5A 4TKZA 1NZFA 1VSVA 2QVGA 3BBPA 4H7DA 5CXSA 3TJRA 3V3KA 2DKNA 2YMLA 1DIAA 2QMYA 4CU5A 2BI4A 1LD3A 2QR3A 3D2BA 4B40A 2WW8A 4PZCA 4Y18A 2R25B 3FPJA 5DCUA 1TA9A 5WRFA 3X1JA 4CMAA 5E1OA 1X0VA 2FW7A 3M2PA 5C8XA 1FA9A 1ZFNA 1KEZA 4Q7MB 4GXTA 1OLSB 2BEUA 2Q5OA 2HSEA 2G88A 3PSAA 4MO9A 1QSGA 3T35A 4CL3A 4EUEA 3GELA 4FGSA 3FPEA 1DAIA 4WY5A 5DI9A 4FDTA 1EUQA 1ZS9A 2A0XA 3CT4A 4BGIA 1MQ9A 4PAMA 1XEWY 5ALLA 4JUAA 1VG0B 1YRBA 3LGXA 1Y3CE 2JKYA 4BP9A 2Z2KA 2ZIUB 4KQKA 1YAJA 3GVPA 3IAXA 1BU5A 1QORA 3PUWA 4UPEA 4DR3B 3L8MA 3BK1A 1KEWA 2F8SA 3RAJA 4PF1A 2PMBA 2WOOA 1P0MA 2QN1A 4WWHA 3OMXA 1HL3A 5CT9A 4LJLA 5AW5A 3OQBA 5JI3E 1QIFA 1G5PA 2C2YA 4GWKA 4KN9S 3E8SA 2F6RA 4KG7A 4FFPA 4MCAA 4NECA 4KFSA 3ZX5A 1E8DA 5CA0F 2D7DA 3AIIA 4HH1A 3FSJX 5D8DA 3U7IA 1NSFA 3CE9A 4E3ZA 3NBMA 2FMUA 2FWIA 2Q1WA 2WDPA 1J6UA 4B3XA 1NBOA 3VHQA 5FEUA 3RYCA 2CLFB 2YH2A 3WK9A 3MYRA 4D6YA 5KVQA 4LHYA 4BNWA 3TL3A 4CU2A 3LWBA 1FW6A 2DFKB 4NMLA 4Q3DA 3PHLA 1YJBA 4CM8B 4CEJA 3EEYA 3THYB 2RARA 5E0KB 3MMPA 1G8PA 3LUBA 4MX8A 4TTRA 4WH0A 2HH9A 3MTBA 4RM2A 3AXSA 3FCCA 4Q4HA 4HJRA 3WGYA 2A5GA 1L5RA 1A9RA 2OD9A 2Z8XA 5CHYA 1DEOA 1G55A 2ZYTX 5JY1A 5KYNA 3HJTA 2FB9A 2HA3A 1UBUS 4WZZA 5AXDA 2H1SA 4F93B 4JEUA 4Y7DA 3MFYA 4FBLA 2RMKA 4O33A 4L22A 4H0CA 2QBYA 3C39A 1KMQA 1OAKA 1VRVA 4GWLA 4XPIA 4NOMA 4UZFA 2IUUA 2ICAA 3R09A 3DKIA 1NE7A 4HNVA 5IC5A 1Y6ZA 3B9QA 1R5BA 1PQYA 4AY4A 1EAYA 1GZ5A 4BGEA 1U5AA 2NOAA 4MPDA 1G8FA 2GJAA 3AG5A 3EISA 3L6EA 3QPWA 4G84A 4ZODA 5GJCA 3K9GA 4XYEA 4Z0NA 4JYZA 3F46A 3CINA 1HT1E 2JLQA 3OU7A 4RA6A 4WI1A 5M7EA 3FSEA 4OQNA 3REGA 1UIRA 2Y9MB 1MH9A 3IJ5A 3LHDA 2XYPA 3TOSA 2JPDA 2GN6A 2LTAA 2XVXA 1CUUA 1X1CA 4X61A 3REQB 3PVCA 3ZIUA 4DNXA 3VKHA 1U2ZA 3A6DA 5DHRA 5ERGB 4KZPA 1K6XA 3EUWA 1JECA 3PC2A 2MSKA 2O2SA 3MXTA 4NATA 4E2ZA 4ZYXA 1B43A 3STXA 3ZVKA 4RULA 4PPNA 4L9RA 1P2BA 3D5QA 4M8SA 5TPZD 1H3EA 1Z5WA 2P4EA 4G9GA 4G0UA 1GQOA 3OFNA 3E9CA 4X1KB 2WHQA 2HKIA 4LY6A 3CLRD 2PU5A 3URMA 4MUNA 2EV9A 4DAOA 1FVHA 3PCTA 5DCWA 1LSJA 5EMNA 1R5OA 1JE1A 3WRYC 3ZU5A 4OV6B 2AQ8A 4NNOA 4B74A 5EEGA 1XJCA 3HKDA 5EVCA 1KPHA 3MTGA 5HIAA 2C3OA 4CFZA 1PQUA 2VPZA 2W6ZA 1WNTA 1HQKA 3AUKA 5JASA 1I8TA 3QVKA 4W5JA 2PX6A 1VRWA 3OA2A 2UYGA 4TS9A 5AUNB 5IWCA 2NTJA 3WVNA 1H9BA 4MHOA 4OQLA 4MUIA 2HSDA 4LZOA 3S28A 4EX7A 1AA6A 4V0OA 1Z08A 4KPEC 1SPBS 3DOJA 5A9SB 1ACMA 4D43A 4D41A 2GCPA 5K3DA 2X15A 5FNZA 4AF6A 1NXSA 3QXGA 4KQ1A 4EKNB 4Z7QB 2TRSB 4V2UA 4ZGBA 3D3JA 1IY1A 4FFWA 1P5FA 1DQRA 1V7QA 4N6OA 4YP6A 3P9IA 3L0SA 2FI1A 3NXKA 5FWDA 1YZQA 3B7PA 3MJDA 2R7AA 4D79A 4P08A 3CG0A 3TTTA 4BNUA 4MV1A 1U9JA 3ICVA 1JRLA 2HPAA 2X8JA 4MPRA 1GZSA 3KO8A 1NHGA 1RZ3A 1O0SA 1SCAA 4F6LA 1QGOA 3UUGA 2AI3A 5JSUA 1IBMB 4ZAWA 3TLAA 2Y6VA 5C81A 1VFPA 2BF4A 4NY1A 5DBGA 2A33A 1Q7CA 3U7RA 1PJBA 3OUTA 1CETA 1I2ZA 4NJEA 4EEZA 1YMUA 5JWRA 3T99A 3CLRC 5DNYB 3NFRA 1J5EB 1EWVA 1M2GA 1IQUA 2W6IA 3A3KA 4WXYB 1SCNE 2ZBVA 5CNMA 1FFDA 4FC6A 3U39A 2XUKA 4ER0A 5T7BA 3FPAA 2CV1A 3K70B 3TTSA 2HSZA 2G7MC 2FSFA 3H84A 1YHNA 1ORTA 2WG0A 4YHHB 5JAQA 3IMEA 1VXOA 4NWIA 3GDWA 1IHOA 4BLRA 2D13A 1UDBA 1I32A 3L82B 1UC4B 4HC4A 1KFEB 2F17A 4YUVA 3L3BA 3DM5A 2B94A 2LCQA 3CRQA 2ZRFA 2O8NA 2WAXA 4H4EA 1QFXA 2YWJA 1BA3A 1UDWA 3DE6X 1BEZA 2VNSA 2WJ3A 4BO0A 3FNGA 4B35A 1R9MA 4LRSB 4N5NA 1C30B 3A1CA 3R74A 3TBHA 4YRKA 4GEGA 2VCHA 3T5CA 5D84A 4KQWA 4B7ZA 221PA 5K51A 3ZE7A 1P1JA 3ZDCA 1QH1B 4I50A 1E6WA 3CUYA 1EK6A 4NYIQ 1S3IA 4LPSA 1WMDA 1YMQA 2GCEA 3VNSA 4DRXA 3F97A 3N5CA 1J1UA 3SR0A 2BMVA 2EWWA 4ZYWA 5LP1A 1G8JA 4IS3A 1LF5A 5KNBH 2OP1A 3HY4A 4WOJA 2AK2A 4PHHA 1JT2A 1LCIA 3EIWA 4EDFA 3W8NA 2QXYA 4AECA 2PXAA 1O6BA 4JJAA 2PUDA 1PX2A 1GQYA 1QH8A 1RMQA 2QQ0A 2ZJ0A 4CLOA 2GUGA 1NVMB 4K1XA 1N2SA 2WICA 1VQ1A 1RJ9A 2W2LA 1Z4QA 3X1YA 1NX6A 1QZXA 3W04A 3BXPA 3WGMA 1M34E 1UMDB 3AEQB 4Q3NA 3C7TA 4MXDA 3ISTA 4IP0A 3STHA 1ZCJA 1UZUA 1WB6A 4I8XA 4X62B 4B3TB 4DUGA 1U0SY 4TRMA 4A5OA 3RS0A 3LUDA 4O29A 5JV5A 2HO5A 4XQ9A 4II3A 3C1UA 5KDOA 3A4MA 3L6BA 5JSKA 4I6EA 3EZ6A 3WLLA 1DUSA 3HGMA 3O8NA 4MS3A 5KQSA 1T4MA 5DBOA 2Q41A 1A76A 2P9BA 3ZGLA 2H07A 5HRUA 3E3MA 1L7NA 1NFFA 2W4IA 4R69A 2VH2A 2O8FA 1AIPA 3FCAA 3I92A 2FEKA 2GKGA 2WMNB 3UMMA 2FLWA 3ONWA 1H2YA 3WAKA 2C59A 5JH7B 1ADCA 1XMVA 5EY5B 1OZGA 1IOWA 5DB4A 3ETEA 4FHFA 1NC3A 3MIIA 3MGCA 3E61A 4P0TA 4DW8A 2PUTA 3RLFA 4M98A 3UT5B 3VMMA 1L5OA 5CEJA 3KV1A 1UJBA 3ILYA 3GBSA 4BP3A 3S3TA 2H1RA 1E32A 4BX0A 5A9RA 3L06A 3OEED 3ZGXA 3JR3A 1ISMA 1TECE 4U2GA 4EG3A 2G4CA 1N75A 1Y4SA 1SC4A 3A4LA 3KOMA 2PD4A 4C01A 2C96A 4V2IA 2ACEA 2XMPA 2CHUA 4DVGA 3EOBI 3G5AA 1Y9AA 2A9JA 4U3JA 3T7RA 4H7IA 4IHAA 1ISGA 4MGKR 4RMJA 1L6RA 3IAHA 4I5IA 3FG9A 4KDEA 3PLNA 4K9QA 5COQA 5H3CA 1NKTA 4YAKA 3RSOA 1NUHA 4QX6A 2CWDA 1VYTA 2BBSA 2ZJZA 4OVKA 3HE3A 4HEQA 3H97A 3K0FB 4EY6A 5KWEA 1LWOA 3OM1A 2H2FA 1LBHA 1G5RA 1ZJZA 3PNSA 4YI5A 5HKOA 3KZ1E 5ICEA 2Y0DA 4HFRA 4H6WA 4A0SA 5LVAA 2HW8A 3V9AA 2ZJ8A 3GJRA 1DPGA 2I4TA 1OV6A 4CMBA 4RGQA 1G8AA 4FNOA 1RHQA 4OP1A 2IYWA 2CVPA 5AKYA 1W8IA 1P9RA 4LI0A 4LJRA 1E1NA 4ZVKA 5TX7A 4CIWA 5B37A 1EGMB 2C29D 3BIWA 4HZUB 3UEOA 1JQJC 2B21A 4LKOA 2XUIA 4BDTA 2G0AA 3NTLA 1UK7A 3BZWA 1FNMA 1K3UB 2NQ2C 2WJJA 2HF8A 4XGQA 5DTIA 1YC2A 1Z39A 2XMGA 4WY2A 5DSTA 3USZA 2LR0A 4EJFA 4LFAB 421PA 1FDSA 4F2PA 2QRJA 1XKLA 1YI8A 3HK2A 2OE2A 4I1VA 4TT3A 3SC2A 3WB9A 4CL8A 3ZHSA 5JVDA 1DC7A 4M6WB 4CCYB 5JTUA 4TTSA 2BFBB 1PDOA 2Y1CA 2GZSA 3D59A 3F71A 3R5TA 4FT4A 4MUAA 4Y1RB 5HCUA 4E46A 2WVJA 4BXOB 4B84A 1T8WA 2BGGA 4RZSA 1PFUA 4NENB 3G9TA 2VJDA 3JZAA 2O2IA 4N48A 2OHIA 1V6AA 2O52A 2R47A 2JZNA 3EGWA 1DS6A 4IXTA 4RIEA 4CKBA 4F5WA 4ZYVA 2BI8A 2B1IA 3F6PA 3WLNA 2W90A 1K7FB 1VE7A 1X8JA 3SS9X 2ZYAA 4PSCA 1LSSA 4XVHA 5K0ZA 3GGGA 4Q18A 4U9IS 1A50B 1WF3A 3CE6A 3QNMA 1N2GA 1ADYA 5BN1A 3SQLA 2FZWA 4UEWA 4YX9A 2Q5IA 2DZDA 2I55A 3NG1A 3K0HA 1O3YA 1QHSA 4QASA 2AQIA 4ZWNA 3TO5A 5A5FA 3OICA 5B1DA 1C3OB 3D3WA 3FNQA 5AKEA 4DXAA 1B4DA 2P9HA 4E5MA 4WZBE 1H6DA 4AN4A 3CRVA 5JS8A 1SKYE 5EWMA 3A8TA 3W8RA 1T9AA 1EKXA 3QNWA 4Q9HA 2YJ5A 4OJNA 4E4RA 1PYOA 3FF1A 4ONEA 2I4RA 3THWB 1I9CA 3BL6A 1KQFA 4X44A 1HE8B 5CDGA 5HIMA 2WM2A 4MROA 5EJ4A 1ISSA 5E3IA 4WK6A 1I7SB 1XWFA 2GHIA 4DCUA 4F0JA 3QUAA 1E4EB 3IKMB 3GYGA 1JE0A 3LFUA 1B74A 5G1PA 4HQNA 2OLKA 1I4LD 3M6WA 3PUVA 3NM6B 3S4YA 2NO1A 5AUQA 2YHIA 4MV4A 4YLGA 1E98A 4MW4A 4C3VA 4XIFA 4TQ9A 1I94B 3UYKA 1LS6A 4HD8A 3GUCA 2YIJA 2XCLA 4L8WB 2RGWA 5J2UB 4CL2A 3EMDA 1PLKA 3L1UA 4R2XA 1BZYA 2QQ5A 1NUTA 4DADA 2IODA 2Q8NA 3DL4A 1K98A 4YDSA 2ZQYA 3MB5A 4MUJA 3IEKA 4PZ0A 4D3XA 3PDJA 2HTEA 5FA8A 3WIVA 3PC4A 4WNYA 1AUQA 2C2GA 3LD9A 1ODJA 2VQ6A 5IVIA 1GWNA 3IPAA 1XLUA 4OGLA 4ZFNA 3NR2A 4CLEA 2C8KA 3KPYA 3R76A 4E5KA 5BMVB 2JAQA 1MQ8B 3C48A 2NAFA 4EB6B 4QXRA 2J9FA 1F3LA 5DBHX 3T0IA 2PPLA 5I01A 2DH5A 1R0XA 1TXGA 1U1IA 2C9DA 2IYYA 2JDIA 2PBRA 3FJYA 3KKEA 1XYYA 3QE4A 1P62B 1EGQA 2AYXA 3TVTA 4EPRA 1TUIA 1U7TA 3A2MA 4ZMBA 5CDFA 3C3AA 1OFGA 3PDUA 2YNMA 1ZONA 2VNJA 4R1OA 1JFTA 5KZMB 4BVAA 3RE1A 2OGZA 3SF8B 5KJEA 3DW1X 4HEA1 3RTBA 3WRVA 2PUFA 4DMKA 2ZIFA 2GAFA 1NTRA 3AOEA 3JQQA 1ZHOA 1JPJA 3LRTA 5FHRA 4E1AA 4JLVA 3TQFA 2WFLA 4XUGB 5ALFA 1A9QA 4GR4A 1WSAA 4LWPA 3IJPA 3L1JA 5JNRA 4GBED 2OEPA 1Z0JA 3I05A 2DY0A 4RV4A 2BZ1A 3MELA 4ZJUA 2AOVA 2NW6A 2PBLA 3A0UA 4RJIA 4UTNA 4CMHA 2O23A 1TZBA 1VMEA 1W0JA 1CE8A 1XA3A 3ZIAD 1FQJA 5E6SA 4DA7A 2EQBA 3QLUC 5FUWA 3V00A 3L1HA 3SOPA 4OL0A 3ONFA 4B7UA 1T3SA 3RUIA 4EG4A 3ACDA 4NCXA 3RCBA 4F84A 1GTRA 2PMEA 5K8JB 1YONA 5LQAA 3JALA 1QUFA 1CRQA 1WHTA 3OE7A 2KLHA 3E70C 4A73A 3TECE 2WQ7A 4A2CA 5CXXA 1PVOA 4ENUA 2X0IA 4F12A 4WESB 3EJ6A 1DRWA 4MQ4A 4JBHA 3R3HA 1DQNA 5ALEA 4RM3A 2NPFA 3RKUA 1YT5A 3S5UA 1RXYA 4WCFC 2CLIB 3HGTA 4BATA 1E9RA 1GL3A 4TV9F 2V6FA 1L5HA 1XE3A 1A5SB 2VP4A 3ZDEA 2GEFA 1RD4A 4TWRA 2GR9A 4DV1B 3UN1A 1DXHA 4PQRA 4RCVA 1KJJA 1E99A 2JGRA 2JRLA 3BL5A 3LI2A 3P5SA 1O9HA 2C00A 3LZ6A 3IULA 3TZCA 4C78A 5AYVA 5L8VA 4BUZA 1ECJA 1MV8A 1N33B 1B6SA 1EUYA 5CPFA 4MPTA 3HS3A 3OJOA 4GE0A 3ZY5A 1PEAA 2FRDA 2WJ4A 2G25A 3IVXA 3A6PC 1QHIA 3G0DA 1AKMA 4PO9A 3G85A 1CUSA 4KMMA 3U19A 2VAXA 2H5IA 1EA7A 3QA3E 1UKZA 3IUJA 1Q1GA 1A8UA 1JAHA 1T2DA 4W1PA 2EFJA 3VPFA 4BZZA 3VR2D 5CPBA 5HUHA 4LZAA 3ZD7A 2J3KA 3PXGA 1GCIA 4NCIA 1T26A 4TUYB 1HT3A 1Y7HA 3B2EA 3OIFA 4DIKA 5ILQA 3AEYA 5DM1A 3KKPA 3KZCA 5THQA 3SC3A 1OZAA 2YWDA 3RM3A 1KBZA 5CLFA 2IS4A 3O92A 3DE1X 2IP4A 4I1IA 4RHTA 1VP9A 1SXJE 3M83A 1II9A 1QHHA 3BILA 3FIJA 5IF9A 1GKKA 2VL7A 4GZ5A 4CLRA 2VUHB 3D4BA 4P4UA 2HSWA 5TVGA 1L4GA 5GGXA 5IN4A 1VB5A 4QJIA 3NVDA 1THTA 3S0JA 1EI9A 3W2HA 5LNK6 1NVGA 1NC1A 2IZZA 3D6UA 3S2IA 2KW5A 2C5GA 2C5LA 4EYQA 2ZXUA 2PUGA 3IDQA 2D5IA 4N76A 5KTTA 3TI7A 2C2XA 2M6RA 4AIRA 5K3CA 4DQXA 5KNCH 4YN3A 5IHXA 2ZTHA 5E7MA 3THXB 2PJDA 3NAZA 3GGSA 3HCWA 5CVUA 2JHCA 1L5YA 1PR4A 1T9GS 1II8A 1ST3A 4M9SA 4P4SB 3DD1A 4URXR 1Y3BE 3N8GA 3PTLA 2PH1A 5EKXA 3K30A 3UJ7A 3OJFA 2NNWB 3QENA 1IY2A 4WLVA 1WP9A 2X76A 4GM4A 1B2RA 4Z8YA 1HLDA 1OVGA 1VSUA 4C5AA 3PGXA 5F7OA 4MRPA 4RE6A 2IYQA 4FGKA 2CCKA 2H8GA 4BVKA 4OKNA 3OQPA 3KSDO 4AAYA 1FTYA 4PINA 1WZIA 3A31A 1PQWA 5IM5A 4LOJA 3VSBA 3WFIA 2CJWB 2G04A 4P92A 4BQPA 3LV8A 3LS2A 1Q3TA 1BHQ1 2FSPA 3OM9A 3K6SA 3GAAA 3U4DA 4CIYA 2LPMA 1WO8A 1L4NA 1I7PA 1GZ3A 2BR4A 5FPHA 5SZKB 4DQUA 4LQ4A 3AB8A 4LJ7A 1D0SA 2GEKA 1LB1B 2X13A 3UH0A 3WWEA 4E2XA 1GAWA 2XRYA 1Z7BA 1FXUA 2VBIA 2YUIA 4H3SA 4LOKA 1K8YB 5FQNA 5JBIA 1SK9A 2E1PA 1IBLB 2HLDA 3OQIA 4PZDA 5BWNA 5IMSA 2DQKA 2J0UB 2Y93A 3D8HA 4R8MA 4ZV7A 1J8QA 3AWDA 1IDN1 4B5KA 2J41A 2RGRA 4AKSA 1BWQA 2BT4A 2EFCB 3KLOA 2GARA 4RPLA 2KWIA 2Y1KA 4G5SA 1BN7A 1RADA 5AVVA 3IEVA 1EWRA 4IMIB 5BWBA 1ZR4A 4XIGS 5IK2A 5A4FS 4BU1A 5DM0A 4MR8B 4HDQB 4E4YA 4M22A 1CF4A 4BVGA 2UZ4A 3D5EA 4AQDA 1HQCA 2A9QA 4EL0A 2BHRA 3MCWA 2OHVA 3CUVA 1WEKA 3O6VA 5HR5A 2O3RA 1VSQA 1QGUA 2UAGA 2Y92A 4WA7A 4D9BA 4DMRA 4UQLA 2MSEB 1TYAE 2ONKA 1I4OA 4L0DA 2AVNA 4QFMA 3VZCA 1G64A 3KAPA 4ZP1A 1PFWA 3AB3A 5U4XA 1XYVA 1XZAA 3PICA 4F3TA 4OLHA 2QNRA 4FGJA 2R62A 1I2DA 4D8YA 4K6FA 4RENA 1GV1A 2LBPA 4D0RA 5AW0A 3LHKA 1VPLA 4KPGA 2IU0A 4F5ZA 1EWQA 3KYDB 3V1LA 2AMYA 2DLNA 3R3VA 1Y4ZA 2OCYC 4YPOA 2UYCA 4CM1A 1ZHFA 2K4MA 4HDKA 1M66A 4A91A 4QKQA 3RAGA 4QM7A 1UXGA 5B53A 3DJYA 4FDUA 3KQSA 1YDFA 4AP5A 3UTDA 3ELYA 5L6MB 4P8RA 4J3NA 1H9AA 2DUMA 3EOAI 4PHFA 2Z6QA 4MVJD 2ZU0C 2ON6A 2WSYB 2C1XA 2ZSIA 3N8KA 1Q95A 4PZAA 4EHHA 1EK0A 2YY7A 1Q57A 4INJA 4BJ5A 4JH0A 1M73E 1SHTX 4AZSA 1Y4UA 1WUYA 3Q40A 4BGDA 1BMFA 4I55A 3RAPR 5L3SB 4NKRA 2BRUA 2XDAA 2Z9BA 4B6OA 4Z9AA 4WFQA 5DGTA 5B58T 3PKJA 1J90A 4ZI5A 3EZGA 1O94D 3LUPA 5KNCA 3NNNA 3OTIA 2YVUA 4HG2A 1W76A 4I46A 1XJQA 1ZW1A 2QRVB 3LBFA 3B36A 3PQCA 3UMRA 3DNMA 4PZUA 3VKUA 4B6SA 2IGTA 4US0R 5AW9A 4BNHA 4D8XA 4DR2B 1T9KA 4YCMA 3KSMA 1QJCA 1S96A 4LJ5A 5EXDA 621PA 1LA2A 4X94A 4FYWA 3STUA 1HEYA 1I4WA 1OGYA 2WJAA 3AX6A 3LFHA 3UWDA 3D4PA 3V8RA 3MCVA 4G0YA 5JR3A 1W6RA 2OV6A 3DXXA 5T64A 3ITNA 2BF7A 2JI7A 2HMVA 2XZTA 3AIMA 1K7YA 4JYPA 3UXHA 3LDFA 4YYEA 2BKVA 3IQWA 3QOFA 4U5XA 3H04A 1YASA 2WI8A 5DWDA 4DRYA 4EAAA 4ATNA 3AVUA 1SVOA 1CXZA 3KUKA 4FC7A 2J48A 4WLOA 1AA9A 4D4IA 2HCJB 3A7EA 4I50F 3UMFA 5CLLA 1CWUA 2JASA 1ZINA 4NTZA 5BVGA 4QOGA 3PJDA 1RKUA 3WZMA 1UJ2A 2V97A 4P2GA 4BFLA 1TM5E 4FWBA 1C2TA 1XEAA 4IZIA 3V46A 4P31A 2PWBA 5ICMA 2WZDA 4L6IA 2I7VA 1YSCA 5F52A 3NW9A 1LDEA 2GZ1A 3O75A 4LC1A 4O59O 3EQ6A 1CYEA 4XJTA 1T3GA 1X3LA 3RS3A 4DV4B 2R8RA 1Z7GA 2H5LA 3NHPA 3C24A 4KIFA 5BNZA 1O94C 4W1RA 6YASA 1TO2E 3G2QA 3OPVA 1H1LB 1XFAA 4DMCA 1K1EA 3PNBA 1TM2A 3A6JA 4Y2JA 4P32A 4X9XA 4NCHA 2XE7A 2JI9A 3T1YB 2QTVA 1R18A 4FT2A 3ZGOA 3W3AD 4E51A 1P8JA 1JG6A 3LUKA 3F98A 4MSUA 3N5KA 4C04A 2ZIGA 3OZDA 2VPXA 1LUAA 2LNDA 2HA2A 4LYYA 2ZSJA 3RSZA 4C89A 1R2QA 4HUQA 5C18A 3FCYA 2UUCB 4GBJA 2GPWA 3GCGA 1RMYA 1Q7EA 4JEIA 3KTAA 4MHTA 3NGMA 4L6AA 4B81A 1H2WA 3IB3A 3OZGA 4N6GA 5DX0A 1U6IA 5EE1A 5AUPB 3PA6A 2ODNA 1AF4A 1NLUA 3BTVA 1P5HA 3ASUA 2EDCA 3A06A 1QIMA 1R6TA 1VE3A 2XTZA 1SD2A 2JK1A 1XNRB 1UXHA 4KXUA 5I5GA 4ARAA 5CAEA 4FHZA 5DIFA 1CDDA 4HGQA 4TPKA 3K1ZA 1RCUA 1JIJA 1U1FA 1W5SA 3CZMA 4OG2A 1SCJA 3I3OA 5A7GA 4IW3B 2GRAA 1AOXA 2HJVA 2Q9UA 4H7JA 4ZQGA 5DV9A 3UY4A 3V2HA 3X1WA 2GNOA 3LWZA 4Y1EA 5MFZA 3NH6A 2ZDGA 4FK8A 1JR6A 3GWGA 1G9SA 2X1VA 3WDSA 1Z5VA 2CBGA 2UUAB 1AGPA 5CFNA 3AETA 1BFKA 5BSUA 3PGMA 3RS2A 4RMHA 4Q9KA 3AI2A 4DNQA 5K20A 3C6XA 2IY9A 3QE9Y 3DO6A 4FINA 4NX2A 1I2MA 1MOQA 4TXNA 3NOXA 2FPIB 2QQEA 2QZPA 4INPA 2FOLA 1CJTC 2OO3A 1NSYA 1Z56C 1N2OA 3DZDA 4JC8A 3W90A 4INAA 3UNXA 1ULBA 3G0BA 4HB0A 1FXSA 1IZZA 1NW9B 1V3QE 3MMSA 4I99A 2YC4C 1T10A 3C8HA 3Q6IA 3KQLA 1W0KA 3TNLA 3ZK7A 4JYMA 4W5NA 4IJ6A 4AS2A 5TQ2A 2ZI5A 4UNIA 2CDRA 2ERCA 3BERA 1JR3D 1L4EA 1F8FA 1UQRA 1A8PA 1V2GA 3JSXA 4RGBA 4RZ3A 1ADBA 3AW8A 1ODKA 1QCCA 3M1IA 3PLAE 4QNMA 5A3SA 4F5EA 1WVIA 1V48A 3L8HA 4WNAA 4REQA 5CHEA 2K7ZA 4Y9RA 5CMLA 5DI3B 2IZ7A 1PG5A 3E7DA 2ZRKA 4PC7A 3TMKA 4XVUA 2OHOA 4RLSA 3PDIA 4ESVA 3IE0A 1WNFA 3L7IA 2QX9A 3MWYW 2F00A 4RS4A 1XTIA 2V98A 5TGDA 3WLHA 5JVDF 2VQFB 2CZGA 3T3DA 4Q1DA 4ZVRA 2ODBA 3DWFA 3BHNA 1P9WA 1RHRA 2MWMA 2RB5A 2Z1NA 2QEQA 2A59A 3RWBA 5DIZA 2Z83A 3VR5A 4OOFA 4BMVA 2VF5X 2Z43A 5AM4A 4B3FX 1IM8A 3ABIA 4XLZA 4UUBA 5IZ4A 3KKMA 1EFRA 1DJOA 2O3JA 1NLMA 3B8HA 1P2UA 1TX4B 2QAGC 3BA6A 3H87A 3KIPA 4M0FA 2J8ZA 2COUA 4HB4A 4IVPA 1T0PA 3GGDA 2FVXA 3OLZA 4NYJQ 3QELA 2BHLA 4FMCF 4HUTA 4FJ1A 3NOVA 4D0LB 2I67A 3F78A 4X24A 1UP7A 2G7ZA 3RYHB 4UUPA 4L08A 2G5PA 5HIIA 4UUAA 4PX3A 1JHXA 3EBLA 3LBHA 4H1VA 1JUDA 2FG5A 2DULA 2XQGA 2JBWA 3SSOA 2DECA 1RFGE 1XD2B 3DBHB 3WGJA 4CIVA 3HUDA 4ZYLA 2EFYA 1DLJA 2GMWA 4D82A 3KVYA 3U3MA 1GCGA 2G6TA 3QV1A 3ZH9B 4Z7JA 1XZDA 3GLIA 1G4HA 4MLPA 1E4OA 3A11A 1SGWA 4ZT2A 2QR5A 2W2XA 3WQHA 1EBFA 3N05A 2ECOA 1YR9A 1ZXXA 3IR5A 3T9BA 1A71A 2CMFA 2JANA 4FSHA 4D99A 4UBNA 2Q45A 3KQYA 4OK6A 3RTDA 4C43A 4CF4A 2AXQA 3JASB 5GZ6A 3TZKA 2WIDA 4P84A 4LV5B 4ND2A 2A5JA 2VFAA 4RYDA 3RGGA 3ZNNA 1NONA 2WJ6A 4TT8A 5FV7A 4EZIA 1YVUA 4ZU3A 2Q0QA 1IC6A 3OEWA 2A84A 3CSUA 4ARZB 1WCIB 5G40A 4RAQA 3SN6A 2YN2A 1YACA 4IIYA 1U0BB 5BO5A 1V5WA 3ROEA 4DV3B 1GUYA 5ESDA 3SM3A 2WC1A 3HL4A 1FP7A 2I2CA 1RU3A 4COOA 4KQJA 4F21A 1ZKDA 4DLBA 2G5TA 4E2WA 3NTVA 4AP9A 1ES9A 3T3OA 4JOSA 4MKGA 1XTQA 3JVEA 3KEMA 3PFCA 3EGOA 3ST7A 4KAFA 5B2ZA 1VYVA 2ZRIA 3A9CA 4XM2A 4PBTA 3WRWA 1H2FA 1SQFA 3IPCA 3P19A 4GOJA 1J9GA 4IMPA 1IN7A 1Z5ZA 4RMIA 1XKXA 3PIIA 5KHLB 1E7RA 2JAUA 4HDRB 1LXCA 4Y9DA 1UMBB 1KMHB 1Q0LA 3L0DA 4QJ5A 5ENDA 2XMQA 5I7SA 2RH4A 2P0AA 5K8IA 1FSGA 4EITA 5IUNC 2OKCA 1U3DA 1K5PA 2R00A 2Q07A 2HUNA 3B5IA 3I6IA 3ILHA 5DNCA 1H8ED 1SM4A 2MCFA 1T35A 2W42A 4Z53A 3UJAA 3AONB 3YASA 5K8LA 3DW3X 5AHXA 1TVMA 3AHCA 1RQNA 4DCCA 1HZZC 1NJ1A 1HDCA 4LHWA 1WPXA 3ZCUA 5JANA 1KQPA 3SQWA 1OV4A 1TK9A 4YRFA 3BZUA 1NNUA 1QV7A 3CZQA 3EXIB 4Z5XA 4V0MA 5IDXA 2H4WA 4D26A 3PDHA 5KTKA 2J6CA 3E0QA 3P0RA 2FWBA 3QRWA 2AOUA 3IALA 1P4SA 4LDZA 1MRNA 2VF4X 1JA9A 3HBLA 2Y6UA 1EFAA 5LQCA 3KL2A 3JWIA 3N70A 5H81A 3T7IA 2XZLA 3L7CA 2FP3A 4ASUD 3NHRA 4CW7A 5B1EA 3SOZA 1F6DA 3U7QB 2ORIA 1KFKB 2C2ZA 5H59A 1VBKA 5EZSA 5J23A 3ZWKA 4FFNA 3GLGA 3SYRA 5I7OA 3M3PA 1Z37A 4KIJA 2BMWA