4PYJA

Human apo-comt, single domain swap
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
208
Chain Sequence
DTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 208
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pyjA01
3ER8A 4FT2A 2YUIA 4V0RA 2K4MA 1KYZA 3CJRA 4DCMA 4EKIA 5KQRA 3HCEA 3C3YA 2ADMA 5CIYA 3EEOA 3TPZA 4GF5A 3SGLA 1TW3A 3AXSA 5T67A 2UYOA 2XYQA 3B89A 4GBED 5KVAA 2ORED 5HOQA 3PLAE 3B5IA 3KR0A 3C3PA 2XVAA 2E5WA 4CKEA 3GCZA 3HTXA 2BR3A 2C7RA 5EKXA 2G72A 5EHGA 3BUSA 4YV0A 5D1HA 1KP9A 2AR0A 1UFKA 3B7PA 1Q0TA 2YR0A 2YTZA 3DOUA 2V7EA 3HM2A 2PKWA 5FCDA 3M6VA 2AOWA 3KQMA 5EEHA 2BZGA 4M37A 3GGDA 5FQOA 3THSA 1R8XA 4DCGA 1NW7A 2P1DA 2Z6UA 2CWWA 2QY6A 1WXXA 4PGHA 4H0NA 4QQNA 3RODA 1N7JA 2AZTA 1WG8A 2ZWVA 3HCBA 2IDKA 2FK7A 3DTNA 5E1MA 3I53A 5E2BA 5ICCA 3MB5A 3LL7A 4RTJA 4AZVA 1QAQA 4FR0A 2IFTA 4C06A 1G6Q1 1XDUA 5K0CA 3LX6A 5DRTA 3VC1A 3VYWA 4E2WA 2ZIGA 1U2ZA 10MHA 1ZG3A 3FTFA 5CD1A 1KHHA 2GA9A 3KQVA 1L3CA 2PXXA 4KDRA 4NECA 2BM8A 2OB2A 3KKZA 5E1BA 4AZTA 1JG4A 3CC8A 3ELYA 1F3LA 3DP7A 2P7IA 3FPEA 5LQKA 4Z2YA 4KDCA 5DXAA 5BP7A 2PT9A 2P3OA 3GNLA 1ZKDA 1YZHA 3O7WA 2HR1A 3UJCA 4GOMD 3LDGA 2NXCA 2P40A 1TPYA 2IPXA 3GWZA 2UYCA 2IH5A 2YQZA 1UWVA 2OY0A 4RV9A 3LHDA 3EVCA 5HIMA 1D2HA 4OX9Y 4FS8A 1VL5A 1KYWA 3CJTA 3UJ6A 3KR1A 3R6TA 5FA5A 3DXYA 3EEYA 3CVOA 4GOND 3PFHA 4LECA 4ISCA 2IIPA 3NWEA 2VS1A 3OU2A 2IDJA 4GQBA 2AN4A 4HTFB 4QTTB 2XYVA 5E1DA 5E8RA 2HWKA 5HIIA 3AXTA 3BWYA 3UZUA 2ZBPA 3B3GA 3KQTA 3MTEA 3V8VA 3EVGA 3ELUA 1NV8A 2Y1WA 2ZLBA 4G56A 2ZVJA 4E2ZA 1PJZA 3FTDA 5DPMA 1NBIA 1P39A 2C7QA 1RJGA 1QAOA 2CL5A 3A7EA 4EVIA 2EG5A 3G88A 2GLUA 4PGGA 2IBTA 3UJ7A 5BXYA 3BGDA 3MTIA 2NYUA 1XCJA 4IV0A 4QVKA 4YV2A 4C05A 4BLVA 3IEIA 3KPWA 4GOOD 4YUZA 3KQSA 4RTKA 4KRGA 1EJ0A 1KR5A 4XUCA 3DMGA 5FWAA 1SKMA 3BGVA 3F4KA 3MCZA 2PY6A 5EZQA 3TLJA 3E8SA 3X0DA 2JJQA 4E31A 2V74B 3UJAA 5DM2A 1V39A 4XUDA 2B9EA 2BM9A 2OXTA 2ONYA 2JH8A 3EGIA 1SG9A 5F2KA 4RWZA 4BP1A 4YUWA 3Q87B 2YXLA 5T6BA 4HH4A 2P7HA 3K0BA 4L7VA 3UJ9A 3HA3A 1M0EA 4WXHA 3SSMA 3FTEA 3EVAA 1SQFA 3PX3A 5K0EA 3KU1A 5EMLA 4ER5A 2ZIEA 1EJ6A 1RI1A 3CGGA 3NWBA 1X1CA 3TKAA 2PSSA 4K6MA 4ER0A 2HMYB 5LQNA 4A6EA 4KWCA 1M6EX 1JQ3A 2HV9A 4DMGA 3FUWA 4R6XA 3UJBA 1ZGJA 3SR4A 4OA5A 4M7RA 9MHTA 3O31A 2PX4A 4EKGA 5K0GA 3E7PA 3CCFA 2JHPA 4OQDA 3LDFA 5FHQA 2PWPA 1X19A 2ZCJA 4R8SA 4XUEA 3M6XA 3GO4A 1KXZA 5EIFA 3P9CA 2NP7A 3OZRA 3P2IA 4QDJA 3DLIA 1EIZA 1BKYA 5FWDA 3OFKA 4FZVA 5BW4A 3JWIA 1QAMA 5DWQA 2OO3A 3IYLW 5E9WA 2G70A 2Z6QA 3HA5A 2PLWA 3GRYA 3VSEA 3LSTA 4YUVA 5K01A 3P2KA 4KIGA 2O0LA 4GEKA 3KQYA 3BKWA 4HSGA 3SSOA 5EEGA 5EIWA 3P71T 3TM5A 1VP9A 3ELWA 3EVZA 3EVEA 4X63A 1JG1A 3FTCA 7MHTA 5K0BA 3LBYA 4RTRA 3P9IA 4BLUA 2FRXA 4YUXA 5DTMA 3NW9A 4R6WA 3HCAA 4MTLA 2F8LA 5ICGA 5LQCA 1X1BA 2P3QA 4QPPA 3I5UA 4E2YA 1DCTA 1T43A 2NXEA 5EMKA 2O57A 5CVUA 2JG3A 2ZW9A 2VDVE 4X61A 3MAGA 2PV0A 3WSTA 5K0JA 2XBMA 4E2XA 2ESRA 2HTEA 1IM8A 2ERCA 2AOTB 5E1OA 3LECA 2P3LA 2JHAA 4HGZA 2OB1A 2AOUA 4C03A 4RVGA 1INLA 4F84A 1RI2A 3ID6C 2PBFA 3GJYA 3ER9A 4QDKA 4X1OA 4Y2HA 4RTPA 3FZGA 3KPUA 3HA7A 3MCTA 5HIJA 5K0FA 5IKMA 4YUYA 1DL5A 5EG5A 2Q41A 4PYOA 1NW6A 4R8RA 2UYHA 4KVZA 4RVFA 2PX2A 1NE2A 2H00A 5K0LA 3DMHA 2GH1A 3KQWA 3HNRA 2H1RA 3LKZA 3M4XA 2QRVA 4X41A 5K09A 3DXZA 1WZNA 1HNNA 1ZHFA 3OPNA 3H2BA 4PNEA 3EPPA 2AN5A 2I62A 3MQ2A 1G8SA 3DULA 3NJRA 3UA4A 4PINA 5IH3A 4EK9A 3I58A 4AUKA 3SMQA 4C4AA 3TRKA 3FRHA 3G5TA 5KS2A 1NW3A 1N7IA 4A6DA 3LBFA 2R3SA 5ERGB 2UZ4A 4HRAA 1X1AA 4JXJA 3E05A 3G2PA 2YXDA 2PX5A 1R74A 1L3IA 3KPVA 3MGGA 5GM1A 3UWPA 5C1IA 2EJTA 2OBFA 5GIPE 1QZZA 1Q0SA 4GC9A 3PX2A 1H1DA 3HEMA 2C7OA 5DSTA 2ZULA 4CXMA 1VLMA 2QYOA 4RVDA 2GS9A 3SX0A 5LQUA 2P41A 1WS6A 3UJDA 2B78A 1FP2A 4R05A 5DX1A 1N2XA 4F85A 4RTQA 5HEKA 1X1DA 5LSAA 4PYKA 5B1SA 3JWJA 2AOVA 3GXOA 3HVHA 1SQGA 3AY0A 4Y30A 3LDUA 3Q7EA 3RIEA 3BXOA 3NDIA 3TR6A 4KIFA 1NBHA 4PIPA 2Y1XA 2O05A 3FYCA 4KW7A 1L3BA 2EJUA 3OZSA 5EKUA 3AWIA 4QVGA 2H11A 5EHIA 3CBGA 4BY9E 3DR5A 2AVDA 5M5BA 5CCXA 5KQSA 3ERCA 2OKCA 4EMSA 2XYRA 3GIWA 4PONA 2AN3A 2O06A 4E30A 3L8DA 3A27A 4B17A 5HIKA 2CKDA 5KYGA 3O4FA 4CTJA 2WA2A 3PS9A 4PYLA 4WVLA 5LR6A 1KPIA 3KQQA 3R24A 5FA8A 2QE6A 1FBNA 2B2CA 3P2EA 3SXJA 5GM2A 3BWBA 4PCLA 1R00A 3SM3A 3VC2A 1SVUA 2ZBRA 4EQZA 3EVDA 1XTPA 1RI4A 3HP7A 3OCJA 5EC8A 5EGSA 1AQIA 3KPJA 5FHRA 5FUBA 3UFBA 3DMFA 3SVZA 4DQ0A 3DXXA 3BGIA 3NMUF 3K6RA 3GRUA 3B3FA 5DX8A 1QYRA 3G8AA 4ZTBA 3PFGA 2FHPA 1G38A 5LQRA 4RSRA 3FPFA 4E32A 1L1EA 5FADA 4ATNA 4UOEA 3FPGA 3TM4A 5GWXA 1P91A 3BWCA 4FGZA 3BZBA 1R8YA 3FUUA 4CWAA 2Z6AA 3R9XB 1FJXA 1RI5A 4O29A 5DT2A 5T64A 1R18A 4HC4A 4CKBA 1WXWA 5CUQA 5BW5A 4IKPA 4AX8A 3BT7A 3FYDA 4CKCA 4AZSA 4POOA 3GRZA 3I64A 2HNKA 2PXCA 5K05A 1JQEA 1YUBA 4M36A 2ZZKA 3DUWA 5EVJA 2ZZNA 1B42A 1SUSA 2VP3A 3D2LA 5E2AA 1JQDA 1WY7A 3C0KA 3KR9A 3G8BA 1KPGA 2UYQA 2ZWAA 4HGYA 3UA3A 1O9GA 3EGVA 2CMGA 5C9ZA 5F2NA 3DH0A 1BHJA 3A4TA 5LQJA 1VBFA 5EOVA 5E9JA 4RTLA 2DULA 1MHTA 2BR5A 1YB2A 3EMBA 4P7JA 4YV1A 1JSZA 3OU7A 3FUTA 3AJDA 4ER6A 2IGTA 2WK1A 2PJDA 1YF3A 1KIAA 1AF7A 2QRVB 1BC5A 1G8AA 2PX8A 1QANA 3FRIA 3OU6A 1VPTA 3KPYA 3TFWA 3LGAA 3QOWA 4C07A 1D2GA 4FT4A 1NT2A 3E23A 5G02A 4GUAA 5HFJA 5DRYA 1VIDA 4OBXA 2FPOA 5EZSA 3FPJA 5DM0A 1MJFA 5DSXA 4DZRA 2BR4A 3P9KA 3QV2A 3M33A 1AQJA 5FULA 5HILA 3KHKA 3KQOA 1NV9A 3FPHA 2AVNA 1FPQA 3FUVA 4DA4A 4U7PB 5LQAA 4BLWA 1IXKA 1ZGAA 3GDHA 1XDZA 2ONZA 1UIRA 1XDSA 2FCAA 5EQJB 3A7DA 2P35A 3T7TA 4C08A 4IV8A 5EPEA 2AS0A 3HCDA 1M6YA 2VDWA 3P97A 3LKDA 3JWHA 1Z3CA 3TOSA 1AV6A 1F38A 4MWZA 1VQ1A 2KW5A 4U7TB 1ZQ9A 2GB4A 2PGXA 2FYTA 5E8JA 5FQNA 1P1BA 3SSNA 4E33A 2AOXA 3HCFA 2XVMA 5DM1A 2G1PA 2B25A 4PYQA 3NVMB 1VE3A 1G55A 4P7KA 2OYRA 4QQKA 5E9QA 5K0NA 4DF3A 4RTOA 5F2OA 2PT6A 3TMAA 3OZTA 5FTWA 1JTFA 5JR3A 4BP3A 5P8WA 4PWYA 3HVIA 4QTUB 4P7FA 4P7GA 5CM2Z 3ORHA 3CJQA 2BH2A 3FUXA 4DKJA 3PVCA 2VDUE 3M6WA 3THRA 4C04A 5U4XA 3C6MA 1YFLA 3ANXA 4MQ4A 3LCUA 5ICFA 1O9HA 3UJ8A 2PVCA 1JTEA 5CVDA 4E70A 5GIOE 3GRRA 2AOTA 5EMJA 3T7SA 3G89A 2G8NA 1I1NA 1JR4A 2OZVA 3P8ZA 4YMGA 4YMHA 2B3TA 2I6GA 3LCCA 3PB3A 4PYNA 2ZIFA 5GP1A 4RTNA 5DLYA 2DPMA 3KQPA 5DM4A 3OE4A 3MHTA 2WA1A 1RJDA 3EGEA 4OQEA 3EMDA 4PYMA 5CCBA 4V0QA 3M70A 1I4WA 1VP3A 1D2CA 2ZBQA 2GAFA 1IY9A 5C0OE 1YFJA 2IH4A 1XJ5A 1XCLA 2PXAA 3TKYA 2O07A 3KR2A 3A26A 3PT9A 4PCAA 4QPNA 2C7PA 3BWMA 4ER7A 3OFJA 2ZSUA 4GC5A 1R6AA 5HZMA 2EFJA 1XXLA 4PYIA 2YX1A 1TW2A 3M6UA 3A25A 3TQSA 3NVKI 2NP6A 2NXJA 3GRVA 5K8VA 2A14A 2I9KA 1EQAA 3G2QA 3IHTA 3HVJA 4ER3A 1EAMA 3UBTA 4RVHA 4F86A 3P9NA 3V97A 5DXJA 4RYLA 5JUWA 3NTVA 3I9FA 5CVVA 2JHCA 3PTAA 1NW5A 5ICEA 3REOA 2PWYA 2FK8A 2ZZMA 2NNWB 3MERA 5K03A 3NDJA 1Y8CA 3HCCA 2OPBA 1SUIA 3BKXA 3G5LA 3OE5A 4GOLD 3U81A 2N47A 4AZWA 4OA8A 1OR8A 1JG2A 2QM3A 2IBSA 5MHTA 2VZ9A 1O54A 4MHTA 3EVBA 4PIMA 1FP1D 5D1NA 5DX0A 5GOZA 4HTFA 1KPHA 3LPMA 1BOOA 4DM3A 4M38A 1JG3A 2YVLA 2IH2A 2R6ZA 3HVKA 4IWNA 4FP9A 4LWOA 5GINE 1PRYA 1NW8A 3ME5A 3B3JA 4FSDA 2CMHA 4MIKA 3JWGA 4XCXA 1EG2A 4PYJA 2IP2A 2AOUB 4FSXA 2LD4A 1DUSA 3T7RA 3EVFA 1NKVA 3T0IA 1ORIA 1RI3A 3R3HA 3RW9A 1ORHA 2EX4A 5EMMA 2P8JA 3GU3A 2I7CA 4RTSA 2YXEA 3DLCA 3G2MA 3IV6A 8MHTA 1I9GA 4RX1A 5DTRA 1P1CA 4CTKA 1RJEA 5CVEA 2GPYA 1RJFA 4LWPA 4RTMA 4HG2A 5DTQA 4LG1A 3S68A 3C6KA 1JSXA 3R0QA 3G7UA 4X60A 1YZ3A 3QOXA 2G71A 3ELDA 1HMYA 5CVJA 5H02A 2NXNA 1G60A 1L9KA 3LCVB 2ZTHA 3CKKA 2ZFUA 3G2OA 4OBWA 1XVAA 2JH9A 4P58A
chains in the Genus database with same CATH superfamily
1N6NA 2AD1A 2OV3A 3RBVA 1V5EA 3PNPA 4P54A 1FPMA 4L73A 1NJSA 4QHYA 2NTJA 1G3QA 2IOQA 3AP2A 1QOQB 3ZVLA 5GJBA 3D9QX 1S8FA 1X8LA 4FZ5A 3TSYA 4BVKA 5DYYA 5BURA 1GTL1 4FJ0A 5B7GA 5DFAA 4QU5A 3QVGB 5M7EA 4YQFA 4HNUA 5M3BA 2RH8A 3MCUA 3C6XA 1A4XA 4CQLA 5JQGF 1E2EA 2Q28A 3BCUA 2HZBA 2O48X 3HACA 1UFKA 3VPGA 5KHLB 4MS4A 1TZBA 4Z9XA 1Q0TA 2QAIA 2C31A 1T34A 3AM4A 4FC7A 5B1HA 2D3WA 5L4NA 2PFKA 5TV2A 3PUZA 5ABPA 1NW7A 1JMKC 1L4HA 3CSSA 3IOMA 3AQ4A 4LOHA 3FX2A 1A9XA 2D54A 3HSSA 1RTKA 2W6CX 4D4KA 5IC4A 3HQ4O 2FEWB 4QT0A 1Q77A 1KI6B 2FTKE 3O8CA 4BEVA 3NAGA 1GCGA 3W2GA 1OIVA 3G8CA 3CIFA 1KTVA 2VYNA 2D13A 2VEOA 3D2BA 4ZK6A 4B32A 2FF7A 2OB2A 1KVRA 1SIOA 3TJZA 3CC8A 2ATEA 3HNOA 4GHWA 1YJXA 2FJPA 4ZVOA 4QNNA 5IAEA 1SG0A 1VZ3A 1JEQA 1SC9A 2HH9A 4IXTA 2HR1A 2O8FA 1A1SA 1JHUA 3K5PA 2VBCA 3ZIUA 3GUVA 4UARA 3COWA 4M86A 4I4IA 3WQRA 4Q18A 4J4TA 3MJCA 1XZIA 4BJ6A 3QXHA 2QGZA 3H3FA 2XUZA 4MVJI 3PEYA 2ZSJA 5E6UB 4DV0B 3LKVA 2WVGA 3HXLA 4D41A 4E6PA 3ZHZA 1UKZA 3CY6A 5H1YA 1BDMA 1G63A 4GWKA 2GESA 1BFUA 4TTTS 3E2IA 4MP8A 1LA2A 2Z4RA 3D43A 2HA7A 2M1XA 1KWGA 1GNVA 1L1QA 2IOFA 2EX1A 3UZUA 3AXTA 4A8JA 1KQFA 3TUZC 3ZQKA 5TQVA 2QP9X 4I6GA 4KO2S 4YYEA 3RAGA 3Q85A 4YK7A 3KOUA 3LF1A 3G49A 4LSWA 1MQ8B 3H2HA 2DBZA 4G56A 5H70A 5B7NA 3STYA 3EZYA 5M2QA 3D8SA 1Z26A 2J5QA 2RAFA 1I4OA 2I9PA 2C96A 4R71A 3H8VA 3ZLJA 4RE5A 4X8LA 2J6BA 1MCZA 3GT7A 4JQOA 4M99A 3LY7A 3VNRA 3DE0X 4QJ4A 1F0PA 3ZTTA 3CRMA 2X5NA 1E3WA 4QULA 3TOXA 4PRKA 5DE3A 3DM9B 3K5WA 4R7TA 3WKBA 1DV2A 1QC5B 4YIKA 3DD1A 3ZGZA 1B23P 4L5BA 2RH4A 2QTGA 4QGBA 2VPXA 3ESCA 4BVBA 5J4KA 3X1ZA 3AB7A 2EFDB 1X7XB 1WB9A 1SAYA 2FUKA 2WU1A 4Q9JA 1U9CA 3L7MA 5D51S 3F7TA 3FB1A 5T3UA 4EFKA 4X95A 1TKBA 3UJ9A 4H7JA 4O25A 2FGKA 3LUGA 3FYUB 4WXHA 1SUCA 4XPZA 3U7QB 4KPUB 1C2TA 2OC9A 2O3UA 4WLNA 4U8HA 4R41A 1M2JA 4OUDB 3F90A 4IO0A 5AJZA 4YP1A 4Q3DA 1KK3A 1M6EX 2FU5C 2H59A 4NSNA 4QUJA 3SDBA 1D09A 1DAGA 5JXIA 3I2KA 3PR3A 2PX4A 2V9PA 3LKBA 3G82C 2HLDA 2QTLA 3AV3A 3E81A 4CF7A 1G0OA 1GSAA 1TD9A 2GD0A 3A70A 3T4EA 1UKVY 4U9IS 3W7AA 3GLHE 3C1OA 2WSBA 2VVTA 3MK31 2XRYA 4BGEA 4IJUA 1YR9A 4INOA 1YCFA 4HDMA 1OH7A 2PL5A 3EX7C 3PFIA 1OX5A 4YUVA 1BDHA 3L43A 2VJMB 4KIGA 2ADFA 2Z58A 3LQFA 3V00A 3AHJA 5U4QA 1VKOA 3ZCUA 1G64A 1JV2B 1YS4A 2X9QA 3TM5A 2VXOA 2CF6A 3EVEA 3GEBA 4JI5B 2XGSA 2ARKA 3O91A 4NABA 3NT5A 2MIIA 2P9CA 4PNHA 2GEDA 2XVYA 4RMJA 5CA0A 3K0EA 4RIGA 3NVDA 5JWHA 4BMYA 5A02A 4MW2A 1D8TA 1OA1A 3TAXA 4KP7A 3T54A 4IR7A 4S1VA 4UNPA 3PA8A 3ET4A 2VDVE 4H18A 4HBGA 5CVUA 2ERXA 3MAGA 5LZ8A 3TH5A 2PV0A 4WHMA 3WGOA 1KBQA 4MQ6A 3FJOA 4QZVA 4DMCA 1AKRA 5BW4A 2XB6A 3DTVA 1RTTA 3MWEA 3UWMA 3KKMA 2AEJA 3HBNA 4IVNA 1J7KA 4EFMA 1W96A 2ETVA 2NUTB 1KI3A 5DT9A 4TRMA 1EJBA 3KOMA 4EBBA 2FX2A 4GUDA 4K03A 1OVMA 1RKBA 1HUQA 2HX1A 2OMEA 2YYSA 5CA1B 3USZA 2K2WA 4TRNA 2MR5A 3H86A 3UO8B 2Y0BA 3TW8B 3TXAA 4ETNA 1BXZA 5BMVB 1USUA 1Y4DE 4KQXA 1XCGB 4ZQEA 5JATA 4S1NA 2JGLA 1Y5RA 2ZKIA 1FF9A 3OECA 1U1EA 2XZTA 5K09A 1P9LA 1A04A 2VXBA 1JKIA 1L4FA 1EVEA 1DIGA 2AN5A 2P4UA 2PPVA 2DWOA 2QUJA 5C4MA 5CA1F 2QZ9A 3I58A 4O6VA 5KTMA 3U5ZB 2PD3A 1ONSA 1GL3A 4EY8A 5BYKA 2PZKA 3FI9A 2VDRB 1OXUA 4H4CA 1ZVVA 1NJ1A 4KMMA 5DI3B 3RLIA 4DHEA 1CCWA 1LV7A 2EQAA 3H5VA 4QEZA 2AC2A 4BCCA 1IUNA 1JDJA 1MT3A 1L3IA 2PIDA 3KYIB 4I2NA 4OKIA 4E4YA 2HCFA 3OAAD 4K3UA 4QUIA 5D5PA 1JFVA 1KMNA 4KYTA 1Y1PA 3SEQA 1L5HB 3RYIA 3Q5DA 1V8OA 4GI1A 3AG5A 3QWAA 2EFCB 1WS6A 2I6XA 3Q3CA 4G4GA 4YQZA 3VU0A 5DN9A 4OQQA 4FKMA 4DV6B 3GDGA 4BB6A 2G07A 1CY7A 2X3UA 1CX9B 3ROGA 3WLKX 1SXPA 3KXKA 3IBCA 1AGXA 4RZ2A 4BNNA 1JQJC 1TO6A 1JKXA 1A8HA 1ZD2P 3OFSA 2RC6A 1UKYA 2A1UA 3B7WA 3DMTA 2SHKA 4UEKA 3UC9A 1B7GO 3GRKA 4INZA 3RWOA 1I0IA 1QKJA 4MVJD 4MHSA 2W93A 4QDXA 3KZXA 3AWIA 5C1DA 2CFRA 2P9YA 2BH9A 4BVFA 4CM9A 2IPAB 2FR8C 4H31A 2WZQA 1BNCA 3DQQA 3FFXA 4QUGA 4A6PA 4EHJA 4DFDA 4E30A 3ICQB 2CUTA 2XYGA 2FXIA 2CVPA 4BFXA 1ZP6A 4N3AA 1ZUIA 3SG0A 5LR6A 1RHMA 4NDZA 2V7GA 5EP2A 4LY9A 2JDID 1WP4A 4XOIA 1CLUA 4ENSA 4RFSA 3MQFA 1FFSA 4Z4GA 3S2IA 3EVDA 1RI4A 1Z5ZA 1TKAA 2YDXA 4RPGA 2QM7A 1AC5A 2CVZA 2N1BA 1DUVG 4I1YA 4CMAA 1PYGA 2UUPA 1KH3A 3EISA 3NXSA 3WIEA 2HYIC 2J32A 4PZEA 3FSGA 2HWYA 2ZR8A 4JJIA 1XKTA 3FRJA 3G8AA 3DAOA 5A9TA 3L49A 5LXTB 3ZW9A 1VRCA 4L5JA 4OX9B 3ZBUA 3FPFA 3KKNA 3GN1A 5ELXA 1BVHA 3V4PB 1QUEA 1DBQA 4C5AA 1V9CA 2G1JA 4N5DA 4DV3B 4Y1RA 4C0XA 3WOVA 3L77A 3HFRA 2QN7A 3GBSA 1GPUA 2VOEA 4Q9KA 3H8WA 5DBOA 1I7PA 1BE0A 4JHLA 2JGKA 4QYWA 4Y7DA 4B5KA 5LXTF 3HCRA 2QRNA 3ZBQA 4KQ2A 3AB3A 2BKVA 2D4AA 4FMDB 5EXEA 3W4KA 4XWOA 4QDOA 3GC6A 4WWHA 2EKLA 3AUUA 2KB0A 3KWJA 1L4UA 4WBSA 5JLJA 1M54A 1M10A 3OPYB 1I3MA 4ZU1X 3HL4A 1RJ9A 3D4BA 4MQUA 4BKPA 3R7FA 4ACBA 4JA0A 4TVKA 4BB5A 4C3OB 3W04A 3F5MA 5AW8A 2FWRA 1GP2A 1K4MA 1T4GA 2W48A 2PL3A 3TLCA 4O2LA 4HYTA 3H9JA 1YQUA 4RADA 1H0HA 4UM7A 2IGTA 3T5DA 3PQCA 4FMDF 2IV2X 5FOVA 1U7OA 3OU6A 1U2RA 1YDEA 1MJHA 3RABA 4IDNA 4DSUA 2AL7A 4UVEA 1PEKE 4H2DA 2DWQA 2DB3A 4WEQA 3V8QA 1ZEMA 2FSGA 3FJYA 3K6JA 4XAQA 4KQHA 5DSXA 4DNXA 2Y77A 5EJFA 4DCVA 1GEEA 3HU3A 1H05A 1UF9A 1X13A 2BN4A 4JL6A 5CTJA 4GDMA 5ERYA 1YUNA 4GLJA 1XWFA 4QJBA 3CUKA 5DMHA 2VG8A 4U7PB 3A2KA 3WB9A 4HWPA 1QRRA 4WESA 3T9DA 2V45A 3FWZA 1YCGA 3LYLA 3GBVA 3A1NA 2WJGA 4EYKA 5EQTA 4C3UA 4WY8A 1UPFA 3AB8A 5JXJA 1QDUA 3S2ZA 2I2BA 3UT6A 1AV6A 2CVFA 1KEPA 1PJRA 4IYJA 4Q16A 3B38A 2Z2KA 3DVAA 4H3KB 5E0OA 3VPSA 3ZVRA 1PJLA 3AVXA 1IMOA 3JALA 2XUOA 5FEUA 1K7FB 4NJEA 3KQKA 1IN4A 2PBZA 3NBQA 2F1OA 5I4CA 2FPKA 5TQ2B 4QBFA 3TBHA 2FEXA 3RAJA 3DL0A 1R10A 4IOJA 4RH3A 4ND6A 5SYMA 3S29A 2Z3WA 2YS6A 2WTAA 3OTQA 4Q3BA 5JD4A 4QDUA 5A4MS 4JUDX 4NMLA 1EAYA 1KGSA 3JSAA 3PSAA 1F2VA 4Z0NA 2CNBA 5A4IS 3EAFA 1KC1A 5BQ5A 1QFZA 3H9CA 4JU9A 2Q5IA 3TTXA 1JPNA 4OHKA 1A50B 3ZE9A 1ITZA 4BNLA 3AM5A 4WXPA 3V4RA 1PT7A 2G8NA 4K9KA 1XGKA 5H59A 2V7BA 1DAKA 1RXCA 2EZ4A 3PYLA 4JROA 5G53C 4DLZA 2C5BA 3K0AA 1F2UA 3S40A 2ZUEA 5DLYA 1X14A 1WNFA 2DPMA 3TQIA 3VJKA 5B53A 3B7GA 1ID1A 4OQEA 2LWIA 3OX4A 3CA8A 3BFKA 2IXFA 1DQNA 3VYUB 1I4WA 3ORQA 4QWMA 1FSSA 2LDBA 4Q9AA 1E3MA 1W1UA 4OHCA 4L5YA 1LPPA 1ZCJA 4LE1A 1L5NA 3H42B 2J8ZA 1L8QA 3H1TA 4XR9A 1RYHA 4YCSA 1SD5A 1FJGB 3JQAB 3KJNA 5AJXA 5JMPA 3U4CA 3SKXA 3LQ2A 3W2TA 4F8YA 2JJMA 4MJLA 3K70C 1FVOA 4NTZA 3IR7A 1OLSB 1TW2A 3OIYA 1PNRA 2PRYA 1NJ6A 5AHOA 1NULA 1XZ8A 1YA4A 4HLQB 5BQXA 3M5CA 4N9QA 4HEHA 3LWNA 4DUZB 1ZCAA 1LBQA 3CTPA 1QCCA 4J2TA 4X8OA 4CM4A 5KC9A 1JN0A 4AO7A 3WJ2A 4G0QA 1FDIA 5JUWA 3MOSA 3NETA 1GZ4A 1T2UA 1XLTC 5CVVA 4R2HA 5HFAA 2Z08A 3WMRA 3GEPA 4RETA 1KERA 4Q4JB 1TIBA 4Z8YA 1P1HA 2Q5LA 1LKZA 4IZHA 2JW5A 1SUIA 2WUEA 4OIFA 3T3MB 2N47A 5FWXA 2DCMA 3EXG2 4QA9A 1BS9A 1J8FA 1N1MA 1QYXA 5C8YB 4CKWA 2IBSA 5BN4B 3FHTA 2X2PA 2W6ZA 2XUPA 3B6KA 3KHTA 1ZWKA 2OVFA 3ZDEA 3ZU5A 5C4IA 2D2FA 2BTQB 3DNFA 3GFVA 5J2TA 1W36B 1BS1A 4AY4A 4NCHA 1VYTA 2QN3A 1Y7TA 5GINE 3CF2A 4Z0TA 4M0EA 3TL3A 1ZR4A 2IP2A 3AVQA 1QVWA 1KDPA 3GLUA 5C8YF 2QR2A 1SCAA 3AONB 3KJXA 3S2UA 3RIHA 5AMXA 4ASUD 4BATA 3KQHA 3T0IA 1N9GB 1NLFA 1FS5A 4XQ0A 2DX7A 3D8HA 3VZQA 1S9HA 2CCKA 4JC0A 1UKEA 3MWJA 1K3UB 3PU6A 2ZYTX 4AJLA 5JC8A 4TLLB 4CMEC 1REQB 2FPGB 5EP1A 2W6IA 2AKAB 2I65A 1RJEA 1Z0IA 1IBSA 2K5UA 4H3HB 4DCTA 4ZFNA 3QEMA 4RTMA 4HH3C 1BW9B 2AG1A 2ZE5A 1SU6A 1FBTA 4OI1A 3HBAA 4MKXA 8GPBA 5G2OA 4MRAA 2ZREA 3PHGA 3V2IA 4CEJB 1KRXA 2YHBA 2HF8A 1N5IA 1NUPA 5J4HA 2FFBA 2NXNA 3LCVB 5TQ0B 3Q3HA 4C5BA 2H16A 2QXUA 3DMPA 1WUJS 3EHEA 4R1SA 5AKEA 1H66A 2OCLA 3GFOA 1TJ5A 4NE2A 3RIGA 2JS7A 3PR2B 3HN6A 3QE0A 3IUMA 1E32A 1ZBDA 3JRWA 4XYEA 4F1JA 2R85A 2W2TA 2WJIA 3CUYA 4CRWB 2HWXA 4CI0B 5AVXA 5B57C 2JKZA 3W3AH 5BWCA 2BFOA 5JISA 3I5XA 1WSAA 1L5FA 1YBVA 5FOSA 1DT5A 1DCKA 4CU2A 4CKEA 5LZ9A 4D45A 3BILA 3EMKA 4IGEA 3U1BA 1E3DA 1XCOA 4BJ5A 4FR2A 1VHJA 3ITKA 4ACAA 4RHYA 4CWAA 3HXMA 4B6OA 1XU4A 3DOUA 2BCGY 4JC4A 2PKWA 1R4NA 1RQ7A 3DQPA 4MUJA 4NYMR 1MRSA 2AOWA 1Z29A 4MPTA 3CLUD 4UEOA 4A10A 3LXRA 2H0AA 3O4RA 3S0JA 4E5NA 2IHUA 4H0NA 3U3DA 3CEHA 1Z4PX 2WM8A 1M2VA 4IH9A 4KACA 4WLUA 4F5DA 1GD1O 4ZJPA 1U4OA 1P0QA 1NUUA 1AQ6A 2JK1A 2FMKA 2O8DA 1I13A 4ENPA 3OVMA 2QZ4A 2IIVA 1RAGA 1U2QA 1R4ZA 3IEVA 3LT0A 4D4GA 1H5NA 2WFZA 2XRFA 3CPSA 1NLMA 1KOJA 2J31A 1KRWA 4GECA 3JQFC 3VVCA 1TEZA 1F9AA 2Q3BA 4B6EA 1EB8A 4PX9A 1LQ2A 3SIXA 1UIMA 5ELLA 1T9KA 3UJCA 5L53A 4DIOA 4OQLA 2UYCA 2GXUA 1NU6A 5JYCA 1RXIA 3OC6A 3HXQA 3M1AA 1ECJA 1XKLA 4P2GA 4U0JA 4CIDA 3FVTA 1EP9A 3ZOKA 2X0FA 2X0KA 1WPQA 3ZWNA 1GN8A 1NFQA 1Q1EA 4JVNA 2PQ6A 3DEZA 5YASA 1EUZA 3DXYA 4RELA 1IBMB 1WXHA 4ZYTA 4UU7A 3ZWAA 2X0NA 2PUHA 1QLHA 4OH1A 3OU2A 3DEYX 4FINA 3W5SA 4FFLA 5IYZA 1M6NA 3KKKA 4HUJA 4PIVA 3AHGA 2WM9B 4QD3A 1FU8A 2VF5X 3T7CA 1NSYA 1SOMA 3EVGA 2ZTSA 4TS3A 3SOPA 2XF8A 3AHIA 5AHXA 4WJLA 4AQ7A 3TQTA 4E2ZA 2EFHB 4B3BA 1FNBA 2XUJA 3DDWA 5KOIA 3GLFA 1RJGA 1KK0A 4P0TA 1A69A 3PWKA 5FRDA 1QNFA 3ZZTA 3QLJA 5F12A 2JFNA 1HKHA 4X62B 5AKKA 4EEKA 5B58C 2XF2A 4G0YA 6CHYA 3AKDA 2R0QC 1KDYA 2I99A 3INRA 2Y6UA 4FGWA 5LQDA 1QHHB 3QWHA 2CMFA 4RKRA 4K9QA 4POAA 1LUAA 2E55A 4Z4IA 3IILA 5FUXA 4MS1A 3BFVA 4KQFA 4BWYA 2OC4A 3JAKB 1S8OA 4S1PA 4LNUA 5KCZA 2GF9A 1P0PA 1WSDA 5HKKA 1KMHA 3CHYA 4EH1A 3K1TA 1U2EA 2XCLA 4H6XA 4J0HA 5H83A 4M22A 4KZKA 5F2KA 3N59A 2QI9C 4P1ZA 3EXIA 4AL4A 1V71A 4FPXA 3N8NA 3CH4B 3DV0B 4RVUA 4YREA 1M67A 4ER5A 3ZYCA 3OF3A 5ALLA 4EEXA 1NQTA 3TLEA 1ND6A 2BZSA 2PSSA 5GJCA 5CFOA 1ES9A 2X2EA 3BSSA 4KO4S 2ASEA 1U6JA 4I1SA 4LGVA 2ZRBA 1O1YA 1E9BA 1H2YA 1WPRA 1XZAA 1JB1A 4EGAA 3CCFA 3OPQA 1L8AA 3I1FA 4HXYA 5FHQA 1GQ2A 2D0DA 1RQGA 3DMYA 4N65A 4ADSG 4PQYA 1IQUA 3OOHA 4GP7A 2VDWB 1EIZA 4MKRA 3LXXA 4JOCA 2WOOA 1QZUA 4XLZA 4OB8A 1JE0A 3EPHA 1NBEA 2C78A 3EZ7A 3ZEAA 1SOWA 2F3UA 2SNIE 4EDHA 4Y1EA 2DEUA 4KGZA 2C83A 4DYVA 4TMYA 1YU6A 4UBIA 1BD3A 3F3YA 5AKZA 3DBOB 4BWGA 4QHSA 4F97A 1Q21A 3A1TA 1SEPA 1NXOA 2DBQA 1Z82A 1Z68A 4L8GA 3TNDA 4BVEA 7MHTA 1WUYA 1ZUD1 1RP1A 3WSVA 4OHXA 2GXSA 4UUAA 3MXTA 1DC3A 3CW9A 4R6WA 4EENA 2E4XA 4QICA 2P3QA 3OTOB 4N39A 3NIFB 3ZWMA 4XE5A 3KQLA 1RRCA 2NXEA 2LIVA 2JG3A 2BDEA 4X61A 4NZMA 1I6MA 1PFQA 4YCLA 1SPXA 2J6HA 5K0JA 1Z25A 2H31A 1QIHA 4EUFA 5CEEA 2ABWA 4AZ0B 1JAHA 3L8HA 3ZWVA 3JQ9A 3J7TA 4PV7A 5FTNA 2ZUCA 1DC5A 4RVGA 5EIEA 2C4WA 1QYCA 2PXHA 3LQQA 5FLEX 2B94A 3H9UA 4RTPA 1ID8A 4FGSA 3GR6A 2PFSA 5SY6A 1WLSA 1W4ZA 3SHTA 5KQPA 4J0IA 1E3LA 3HCNA 4Y6QA 4BRWA 2RGDA 1IK6A 2I3GA 2YFHA 4MR7A 5FPHA 4LFBB 1DJPA 2LCFA 3TD6A 5U1PA 2C58A 1XDBA 4OEHA 4DT1B 2P5UA 3ROTA 3TCNA 4IDFA 1WUIS 2VJLA 2G77B 4P33A 1WZNA 3PHJA 2C8JA 1AT1A 3DB1A 1G20A 1SXJD 3JAWA 2WU8A 3EPPA 3LNCA 1T36A 1T1GA 3AUKA 3AW8A 2GWRA 4G1BA 4GR9A 3UA4A 4BKUA 1ISSA 3ZIDA 3HK2A 1RWQA 4GGOA 1L7NA 1DI0A 3I5AA 2JL1A 5JXGA 4CDGA 3QNMA 3ASVA 2NADA 5HE9A 3LC2O 2QTTA 1LPMA 3KPVA 1NF3A 5AXAA 3M2TA 4X7BA 4MW4A 2OEPA 1P2BA 1UMCB 2IXEA 2ZYGA 3LYHA 4JLOA 4WMLA 2IE0A 3BD7A 2ZULA 4IFIA 1GG8A 3OZUA 2V7XA 1ZKMA 3Q1LA 4IIXA 1BYIA 1V5GA 2Z5GA 1JPUA 3FROA 2BW0A 4YO7A 1G5IA 1J20A 4CM8B 3HDQA 1SA0A 1TAHA 2JRLA 1P6QA 4YRKA 4ZCIA 2BUBA 4FYWA 3IVAA 1BIFA 1H85A 4HWSA 5DGIA 2FW0A 4ZXPA 2IPLA 3IOYA 2YRFA 4I8DA 4ZVKA 2Q2OA 3TR6A 4EUEA 5F7OA 1OTXA 2FUG6 4PIPA 5F4BA 4HB2A 2QTHA 2PKEA 1QM5A 5IK2D 2JGMA 1IZ8A 4JJAA 5EPOA 1H2FA 1ULTA 1C4KA 5KQSA 4KQ1A 4PONA 5AESA 5BV1A 1KP3A 1IN8A 1CUWA 2WTXA 1IPHA 1C3XA 1Z5OA 4E5DA 3RQSA 4C01A 2YBEA 5HIKA 4GRDA 2I2DA 2PR7A 4IHJB 3RRJA 3STVA 4PYLA 3WZLA 5INTA 1VMKA 2LUOA 2G9QA 3EW7A 5EWMA 3ETDA 1WKCA 1JJFA 2RHCA 3QKSA 4JLPA 3FCOA 2A0XA 4I1OA 1RWWA 4K87A 4OTZA 4CLRB 2NU8B 1AM4D 1UBLS 1XEXB 2Y1KA 3OCJA 4J3JA 2I3AA 3UFBA 1X1EA 3EUWA 4FYKA 3AF3A 3KV3O 2NAFA 5K45A 2AW5A 2QLFA 3EIWA 3IEKA 2Q6LA 1N33B 3T94A 3F9CA 2ZS9A 2ZRKA 3OM1A 1UEIA 4IHJF 4X00A 3CQ9A 3AVPA 3A2NA 4YXWD 4A15A 5IM4A 4G01B 2E4YA 3G5UA 5BN5B 5K3FB 3D0RA 2PZMA 3N2YA 2GAOA 1NLUA 2JLCA 2GXQA 1SCBA 2JI4A 3A1FA 2ZDQA 4ALIA 1UBTS 2GPSA 1ZIOA 3DKVA 1GCAA 1CZHA 3VYVA 3HKEB 4RJTA 4MX8A 4NP6A 1IEQA 3GFRA 5F7JA 4CKBA 2YZNA 5AQEA 2JLWA 1GNTA 2XE7A 4XYLA 4X0EA 3TGLA 4ZOAA 3L0PA 1OWNA 2EJWA 2F67A 1K8YB 4OLHA 1V43A 2XDQB 1ZI9A 4J0FA 3D2CA 3ND8A 2G9RA 4I4LA 4KSBA 1JQDA 4MIOA 1IEXA 1XUOA 1IYZA 1Y5MA 3AUYA 1H6DA 3OD5A 3Q40A 5HKOA 4YJHA 1BWRA 4V1CA 4J16A 5SY9A 5F2NA 1HE2A 2MT9A 3BL6A 5E9JA 4BAUA 1A2KC 4UBJA 1N6LA 5IDWA 4JN6B 3SVLA 2Q5QA 3DZDA 1C5KA 2ZJAA 3DE1X 4B2IA 3UG7A 1SZCA 1AHNA 3LBNA 2C4VA 1O89A 5IJWA 5CAEB 1AF7A 1V35A 2JIPA 1UMDB 3CMCO 3CUEF 1BC5A 3HY4A 1LNZA 4GMGA 4K46A 3AF2A 4MYSA 2WMOB 3AF0A 2E7ZA 3G6KA 1OAKA 5LQMA 4FT4A 1NDHA 1JI0A 3V3TA 1Z6TA 3NPAA 5HX7A 2O8CB 4QGHA 4Y8VA 5BXQC 1KJJA 2H48A 3VR1A 5HF6A 5EFZA 4DZRA 1WW8A 1LB1B 1IPEA 3C4QA 3SBOA 3FHOA 4LISA 3EZLA 4N5MA 3F4BA 2JFVA 4RZ3A 3BXEA 5H68A 1UZMA 5HILA 1QP7A 2D5AA 1Z16A 3CO5A 2RGUA 4ZYYA 4CEHA 3VTZA 1TAQA 3CZMA 1IHUA 3PSHA 1IXKA 1PJBA 3T7TA 1XDSA 2BM1A 1WABA 1LWOA 2DR3A 3UAYA 3I2YX 1QQ6A 1R3DA 5HIAA 4FEEA 1DBSA 3HCDA 2YIJA 4KMSA 1M6YA 1OPRA 5GONF 4ALJA 3AINA 2Q4DA 2YASA 3A1UA 3S27A 4JYPA 1LRLA 2ZI6A 3AK4A 3HKDB 4GMKA 4D9NA 3SBXA 3W1EA 2Z2XA 2YY7A 4AMBA 1ORWA 4MKHA 2Q8PA 5DM1A 4BGDA 2BOVA 1RRKA 1T1SA 1PIWA 4BKRA 1DVRA 5PNTA 2B9VA 1XTSA 5EKDA 3GP8A 1Z4OA 4QXQA 3BRQA 2G5GX 4CYMA 4TYNA 1IG0A 4MUKA 3IBSA 4HVAA 2X7XA 3PFCA 2Z3ZA 1ZIYA 3D3WB 4KPFC 3BIWA 1PR0A 5JSZA 4JEHA 2W2VA 3ORHA 4CPDA 4DKJA 3RGWS 1DAPA 1PBNA 4P5DA 2ZIVB 1UQUA 3ZZMA 2RB5A 3FDJA 2V9ZA 4MWBA 4RD0A 3UWKA 4EQ6A 4B7XA 5LOVB 2VXYA 1XMIA 2XAAA 4YT5A 4HDRA 3FDXA 3SDSA 3VNQA 2JPDA 4ZC8A 1JWBB 2ZRDA 4LDPA 3UK1A 4E22A 1LSUA 4CM5A 5CT5A 4YMHA 1GNPA 3DDOA 4R1PA 4U6SA 4EITA 1OBHA 1FNNA 1Z6QA 5JPIA 1LDGA 4DZTA 5MGNA 4HAVA 2PN1A 3I01M 4L3VA 4UHCA 3BF8A 5DYWA 2WNSA 3MGAA 1IBKB 1ISIA 1GFSA 2HDOA 1D2CA 1GOTA 5ALXA 2YXNA 4Y2UA 3SQDA 4Z2AA 5LOVF 1POXA 1R0BA 2NOAA 1WVGA 4K6FA 3UJ3X 1E6LA 1NOKA 2XV1A 2QPTA 1QVVA 1J1IA 2OTCA 3H5RA 1R37A 3PD7A 4Q37A 3A2LA 4DYHA 1ZHHA 2CZGA 3WRVA 1M34A 1DB3A 2O2YA 1NJGA 3B85A 3AEZA 4P86A 2X15A 1AB5A 4PFJA 1TZCA 4MCIA 1Q5PA 1RRPA 2BTOA 4XVRA 3IHTA 4Q7EA 3VX3A 4FE4A 2NZVG 4B3GA 4DL9A 1KO8A 4PM4A 4FYVA 5FFMA 4NATA 2Z83A 1CQIB 4R8MA 5J5CA 3WV5A 1JMVA 5T4BA 1J0DA 5ALTA 5KTNA 4BNTA 3O1HB 4U4AA 2ANCA 1ZD1A 2BIFA 3HI4A 3W2HA 4AG5A 1RE1A 3L40A 3GVIA 3NH6A 4JT2A 2BSXA 4GOLD 4F45A 2NU7A 1QDEA 1OR8A 4A8JC 3WK5A 3HSKA 4C43A 4E46A 2I22A 1WIWA 4HQ0A 3TLGB 4WA8A 4AF7A 2J7PD 3CPHA 5DEOA 5CLFA 4UC0A 1Z3IX 2VHVA 1QR2A 2ZB2A 5GOZA 2G1AA 2G04A 4GO1A 4BFCA 1CQJB 2P2NA 3EXEB 4KWIA 2HQ1A 3DZFA 1C0LA 1KAEA 3G1TA 4EPRA 1Z6PA 4G1EB 1CYDA 3ETHA 4LDNA 5EJEA 1AD2A 3Q2IA 5F9HA 3H7AA 4J1NA 1DUSA 2C2MA 1BVYF 3E84A 2ID9A 3T7RA 4CODB 4A0SA 1E9FA 2ZTVA 3DUFB 2XOKD 3E0XA 4FLMA 1WF3A 3LUJA 2NO4A 5LUAA 5BYJA 2NQ2C 2RMKA 3TSWA 4BFYA 4D3FA 4OY3A 2GK4A 1YR8A 5DOVA 5LLDA 4HWOA 5A5EA 3OUUA 3GPBA 4GKVA 1RHJA 1I4LD 1UAYA 3E82A 3QJGA 2ZUFA 2AG6A 1KZ4A 2DMRA 3LW7A 3QENA 1X15A 2CLIB 2JKVA 4G65A 4YNBA 1X0XA 2E4ZA 2ENWA 4KQJA 5ER6A 1FS4A 2H0RA 3U3JA 4KPEC 1RMYA 4FFRA 1AQYA 1JDUA 3WLHA 3KUXA 3EBOA 1B6TA 4H0CA 2HIAA 3FVVA 4MDFA 3OSUA 2FHSA 1X7HA 1BDIA 2MSDB 2AQKA 1COZA 2BF4A 2OQRA 3WIUA 4G8BA 3E9RA 4P58A 1N0UA 3WKDA 5KYWB 4FT2A 2YUIA 1XRMA 3SC4A 2Z43A 1D0VA 4G86A 1K1EA 3IIMA 1MV5A 1Y1SA 2GBFA 3GZJA 3O8QA 3QFCA 3DGFC 1P1JA 4OK5A 4Y2QA 4K26A 4BC1A 2XT0A 3DAYA 5EXTA 2QXTA 1WL8A 2AW3A 3B6JA 5T67A 4EABA 3KVYA 1L5OA 2JEOA 1U0FA 4X6YA 1GTRA 2D4HA 3R3XA 1FJHA 1U7WA 3HGMA 4PBTA 3FNIA 4IQGA 4MUGA 1OI4A 4W7IA 4ZT7A 5HS6A 2QJTA 3GJQA 4OU4A 2NV0A 3B2NA 4I55B 2YR0A 4PFSA 2RKBA 3VH3A 2V7EA 1TD1A 4U7JA 3T1TA 5AVTA 2HLNA 1OE0A 5FQOA 1DIOB 2Y1LA 4HEJA 1L7PA 1Q7GA 1P2GA 3JATA 4O8CA 4QWWA 4JENA 1PL0A 4UKDA 4BE7B 4D02A 2PUDA 4DBZA 4DDUA 3E3NA 2AA3A 4RHXA 4UZFA 3VFDA 4IINA 4EKEA 4BNKA 2DF8A 3DTNA 2OCXA 3R3UA 4AUEA 5TPWB 3GLSA 3AFMA 1QAQA 3TI9A 4KV7A 4UBKA 1SBNE 3OIUA 4LC1A 5C81A 3GPCA 3V8NA 4E2WA 3DL4A 3KSRA 4HAOA 4KREA 2ZGVA 5ITWA 3LQKA 4I66A 5LM3A 4DHWA 3GVHA 5AUPB 2DPXA 3ZD7A 2FXVA 3T99A 4Y9UA 4TRRA 2JGDB 1OU4A 3UANA 4WBNB 1U7PA 1YL7A 3EGXA 2QYSA 1E18A 1ZKDA 1HFKA 5CITA 3GLRA 2R62A 1FVFA 3WJ7A 3D6JA 3AH8A 2WYIA 1NQXA 1BU5A 2LV8A 4Q9NA 3BRWD 1B6GA 5I48A 5I6DA 4FS8A 2FQYA 3WAGA 2WWWA 4Y6LA 4BLQA 1FMLA 5D7NA 3OFVA 1RCTE 4WBNF 2GZ2A 3PFHA 1LTHR 3IMEA 3E3LA 4JV5B 1VHDA 1QZ3A 3D6UA 3NC1C 1DNPA 2I1QA 3PGXA 4JBGA 4PXAA 4RCYA 3QPBA 5AM1A 1JVNA 3TMYA 1W4CA 2GJKA 3VZRA 3MMSA 5B4VA 5LMCA 2YCBA 1UBFA 3U4AA 4Q7QA 1OJLA 5G1NA 3BA1A 5KNBA 5BN3B 3RVSA 4KJZA 4KXUA 2NUBA 4N1AA 1YKSA 4LXTA 4ZO9A 5EJIA 4IDOA 5ESXA 4CUJA 2L2QA 2Y99A 1EBFA 3BGDA 3K8YA 5JCOA 1CTQA 3K8ZA 3N2KB 4BGIA 5KYTA 2ZTMA 4LGYA 2JJ1D 3EA5A 3NTLA 1PGNA 3OZBA 1P2SA 4XUCA 3V6MA 4MROA 1EX9A 2AF3C 4C7BA 4EJSA 2DYKA 2C3PA 1XJ0A 4KFUA 3GJRA 3UJNA 5D3QA 3O2NA 3VPAA 3DMTC 3WGNA 1QO0D 3UPDA 3JXEA 3KZOA 4ZEMA 4OQXA 4MLPA 1KMIY 4X3CA 4P4SB 4J1SA 3RTAA 2GUGA 1M2WA 3MS7A 1ML4A 4R3WA 5IPFA 4JVMA 3C97A 3LAWA 4JI4B 3H1PA 4C7KA 4J94A 2VWQA 3UAXA 3KU1A 1HFJA 2EKDA 3F73A 3ZX4A 4R16A 2OSBA 5EERA 2XNSA 3MZ0A 2XEDA 4QXOA 4YP0A 2R66A 5JMOA 3HVUA 3W6ZA 2HV9A 4R0MA 1PSZA 3RS9A 2VR1A 2QA5A 4ZMRA 5IFLA 1U3CA 1UT6A 2BFEA 5DEIA 1L0BA 2PA3A 1XZBA 3TLKA 1YZTA 3N75A 3E7PA 1K98A 3UK7A 3LDFA 3LLMA 3QQPA 2J1LA 4MEAA 2JFZA 2YHIB 3M6XA 1N75A 1U3DA 3MGBA 1XEFA 1AE1A 1XZJA 5JANA 1KQOA 1VBMA 1QAMA 3CH6A 3SYLA 4CMJA 4PQGA 2OQIA 4UREA 2LPMA 3PUWA 4WSOA 2Z3VA 3OTGA 4ZI7B 1IM5A 3WVNA 5K01A 2EP7A 4YB8A 2JFUA 2R65A 2XA1A 1V7ZA 4D0NA 3N2EA 3G5MA 3EASA 4GBMA 1SMKA 2WEKA 4UFOA 2A6PA 3NHPA 2GM4A 4AC9A 3QNUA 2EERA 3D6FA 4NYIR 4DXAA 2VJBA 4REMA 4DDWA 3PVSA 1CQPA 2CUNA 2E5FA 4IV5A 3NW9A 1PNTA 4MTLA 1HNWB 3I28A 3QU4A 1JBEA 4HVCA 4ZI7F 1R12A 3WLQA 4L16A 4BLSA 1T43A 3SZ3A 5AW1A 3EEQA 4MDYA 2XNDD 1AIPA 1GZ5A 3SZRA 2X1VA 1BGWA 4YRBA 1WW3A 2HWWA 2GTIA 4I5EA 3GN2A 5TEWA 2QN6A 3M83A 3DEIA 4HYQA 5FOTA 4ZVSA 1WV1A 4L27A 4Q12A 2WAYA 4NICA 4C22A 1WMBA 2BEUB 2OMKA 1EG7A 1D03A 3FOWA 3MJHA 3TL6A 4P93A 3ER9A 4ML3A 1Z2OX 3FZGA 2AFHB 2NGRA 3MCTA 1KEVA 1OZHA 4Y0VA 4Z86A 5JS6A 1X2EA 1QG0A 2XT6A 1WB4A 1JLSA 3DS8A 5GMOA 2WDPA 1DDGA 3T9BA 2F9FA 2Q41A 3BG5A 2UZIR 2P2DA 3OY2A 3M1LA 3PCXA 4OI4A 5CH8A 4LF8B 1X8XA 1YR1A 3MUFA 4P92A 2H1RA 3LKZA 4C1BA 3M4XA 3AHHA 3RSFA 1SC3A 1HNNA 1I4EB 4H59A 3RYFB 2C4HA 4RPJA 5K4AA 2R1UA 2RJOA 1I5EA 2PYIA 3DULA 5COBA 4F06A 1RD4A 4HQRA 5ALRA 3FB4A 2VJQA 1ACLA 4UHFA 4PG8A 4Z4CA 1ZH6A 1HSZA 5JH7A 1KFCB 3OY7A 2LW7A 4OB7A 2UZ4A 2GPNA 3DOCA 3IDFA 2ZUTA 2JAHA 3I1IA 3E05A 5L51A 2YJ3A 4UW9A 1GZVA 3VZBA 5J47A 4NBVA 2B4TO 1U1GA 2OVBA 3KXDA 1UCFA 4FEAA 2PBRA 4PSUA 3SX0A 1DADA 3OTHA 4DA8A 3U09A 1DDOA 2WT9A 2ONCA 1G20E 3IVXA 3KEOA 4X20A 4E11A 4F85A 1Y80A 2BGMA 2XCUA 1E9RA 3CCCA 4KQEA 2IOFK 1SQGA 3MS4A 2BEWB 5CDFE 1J0CA 1QYDA 4UEWA 2NO9A 1TA0A 2OQVA 4KIFA 2WINI 2IY8A 1WD7A 5G4LA 3RF6A 1SCUA 4DR4B 5A0VA 4AY2A 5KC8A 3AF4A 3AFOA 1H8HA 1XU9A 4RVNA 5L3SA 2DVMA 2OYSA 5EHIA 4I5IA 3DTYA 1X9HA 4FCTA 2IU0A 3DYIA 4CETA 1SVIA 4IXDA 2QD4A 5C80A 4BU1A 1H4TA 2J0EA 4J3NA 5FP0A 1YVUA 2QD5A 1K5DA 2WYOA 1J8VA 3C6ZA 1MQAA 1IY2A 1PUIA 1RMQA 1ZSVA 1Z8FA 3KQQA 1E59A 1MKYA 4EF4A 2X9VA 1PD1A 1TYAE 4MV8A 5GM2A 2NPOA 1K5HA 3KKOA 3KVNA 3SP1A 4XM2A 4ESHA 1J23A 2KLBA 1GAJA 4D4IA 4PS1A 3NIGB 2JRCA 3VOTA 1HE5A 5KAPA 2Z2YA 5KUTA 4L57A 2YWDA 2PH3A 4P3YA 2Q3LA 4J76A 2G80A 3SK0A 3ZGYA 1W48A 3MWYW 1UK7A 2ODEA 3RO7A 4Y6GB 5GADl 4NULA 4R2XA 3RD5A 4INJA 1I5OA 4OH7A 1P9WA 3MMPA 4TXHA 1W0JA 1XRSB 2IHYA 4LNAA 4PG6A 3I12A 3BN3A 1HBJA 3B36A 2VP0A 1KZHA 2H9AA 1G38A 3M4ZA 4FS3A 4RSRA 3Q0IA 1U7TA 1FX1A 1Z56C 4QQRA 4V39A 4ATNA 4TL8A 5K8IA 3H0EA 16PKA 1Y82A 1A9YA 4GWLA 2RSLA 1HQCA 4KGVA 3MBKA 1BYUA 2Q4TA 1E1YA 4OP2A 4WVFA 5DT2A 3RM3A 5CUQA 2G6TA 3OOWA 4BNZA 1DG3A 2J0SA 2VRWA 1X3SA 2WF8A 3SQWA 1X42A 2GARA 2PZEA 3LTNC 5K05A 4EI8A 3ZOZA 4AF6A 3EOAI 4HMOA 4EPTA 1SUSA 2QVXX 2RHDA 1D7AA 5CTAA 1MP0A 2OV1A 1DPFA 1TU0A 4Z49A 5I5EA 2UXDB 1WLYA 3RUHA 3EGVA 4JLBA 5ECDA 4PG7A 3UF0A 2PU7A 3LO8A 1E69A 1PZHA 2BI4A 3AEKA 3DR3A 1R7RA 1CQZA 2J4CA 2HXSA 3G79A 5B37A 1MHTA 1L7XA 3WJ1A 4GT1A 1FUIA 3UM9A 3AJDA 3KQNA 2DSNA 3IQIX 3GI1A 2B8WA 1VGQA 3BZWA 1EXDA 2O0KA 2ACVA 3JYQA 2G5CA 4YCBA 1KDOA 1T3TA 4HWKA 3LGAA 3I9OA 3P2YA 1JDVA 3NAQA 2W6PA 3ILXA 3UHAA 3I37X 3W5JA 2XUKA 2ZSEA 3NWPA 3KKPA 5EUQB 5DRYA 5GAJA 1Y6JA 5J23A 2PE5A 2IXBA 3KAKA 2K7ZA 3K70B 4G07A 1LU9A 2CJFA 1BXRB 5D5QA 5A5GA 1BZYA 4PZLA 4QTXA 2HU5A 4QDZA 4LYGA 3QH4A 5I7AA 1QU2A 3PT5A 2IS1A 1TLTA 3K0CA 3NQ41 1NYTA 3MFYA 1NW9B 1DU4A 1HH4A 1ODKA 2JVIA 4XXHA 3ZNOA 4TROA 1O94A 5LN1A 3EPJA 4D0LB 4B87A 2QL6A 1EU1A 3VM6A 3QVKA 4FZJA 5LA6B 2JIBA 5BWLA 2G0TA 2YOGA 1AUVA 3F3KA 1YWGO 4OBBA 1ND5A 3F46A 4CT5A 4JQCA 3VOAA 1O0CA 1P1BA 2P67A 1AKVA 2XVMA 3T4UA 4DA0A 3IQHX 1ZH8A 1PDWA 4JB0A 4DB2A 2EWVA 1WULS 2FEAA 4TS1A 3G0IA 4TZTA 3WWYA 3OQNA 1RZRA 4IQ4A 5LA6F 4G5XA 3OOSA 4GXTA 3QPCA 3V9PA 5IMBA 2YJZA 5CK5A 2GTHA 5IM5A 4P80A 2XYHA 1B0ZA 5ADUS 1BEUB 1I2CA 1OH8A 3FF1A 2QX8A 3PYMA 4G26A 2HMUA 2ZBVA 2H1HA 2G76A 3BH6A 1UM9B 1II8A 2VDUE 3M6WA 1TTTA 3PXUA 1A97A 2LCIA 3BZUA 1UT5A 3C6MA 1P18A 4G37A 4XRRA 3GLGB 2AEMA 3UJ8A 3I01A 1EWQA 3HR7A 2WKSA 1NHWA 2ZI7A 3AVYA 4BCBA 2XTAA 2AV6A 3I39X 3E5HA 3MSXA 1A8UA 3AR8A 2JJ2A 2P5SA 4AT1A 1TQ6A 3R5SA 1ZRNA 1TYZA 3MJVA 5AJUA 2OZLB 1G0NA 3MHTA 3C14C 4S1TA 1P29A 4J0DA 3PX7A 2GOYA 1NVXQ 1ZN8A 1C3EA 4NY1A 2P2GA 4L4YA 1A8QA 1ZLYA 1ISJA 3O95A 4JYBA 1YFJA 2PS0A 2VZLA 4M8KA 3SS7X 3KR2A 3TPFA 1E2HA 4YJ2F 4MDEA 4B9EA 1N3IA 4BMVA 2AFRA 4KNWA 3BBLA 4J7AA 4O4HB 1SIBE 4UNSA 4K05A 2ACKA 1IH8A 3C6YA 4YP6A 3HP4A 4COOA 2NP6A 9LDBA 2CLDX 2I9KA 1EQAA 1XEWX 1PK9A 2A9FA 3LVQE 3MTQA 1IWBB 3COZA 3GMDA 3OURA 2ZR0A 2X0JA 3CPJB 4MVJH 3C5WP 2H2AA 4OCZA 3INGA 1M76A 4I9HA 2ODBA 4R1MA 3MTJA 1XT6A 3ZUPA 1CT9A 3VYTB 4B6RA 5LDDC 1XZEA 2ID4A 2G9NA 2IS4A 3U3MA 4JAVC 4KKVA 3DKKA 1M34E 4J7CA 3RC7A 1WV0A 2LKCA 4AM8A 1MC4A 2C2BA 2VZ9A 1GUZA 2JGEA 4JBLA 5ITZA 1L9XA 1UPXA 2TMDA 5FBKA 1Q22A 4IRXA 4PHTA 5G40A 3KETA 1GFZA 5H9VA 4KR3A 1VA5A 1MVLA 2O3RA 3FETA 4XPIB 4M38A 4EBFA 3SE7A 3EAQA 3IAM1 1FLVA 1OAOA 3BL8A 3AZOA 3SJUA 1EHIA 4UTRA 3FMVA 4RY2A 3TG8A 4QHTA 4GXRA 2DU8A 4PYJA 5JVDB 2AOUB 3JYOA 4FSXA 4NMMA 1V11A 2C61A 3EVFA 2Q27A 2BFNA 4II2A 4WK0B 5IWCA 4WT7A 3FPBA 3ZGXA 1BOFA 2Z2JA 3CX8A 3QG5A 2D1TA 4DC0A 4EHNA 2QBYB 1SBQA 4RZQA 5AUQA 1P61B 4XX0B 3UHFA 5J2UA 1TCCA 4LRTB 3S1AA 2FVXA 4EG8A 4BMDA 1K06A 3PXBA 3E03A 4XGNA 2VCEA 3W3AA 3LNTA 1DT3A 4F5WA 1EK1A 1HDEA 1E2JA 3FR7A 1EDEA 5F1YA 1W88A 4BEJA 2EGUA 1P7YA 4Y2YA 4MA5A 2Y68A 4J3FA 5E7QA 3HJFA 3COVA 2H52A 2UXCB 3PNVA 3EXG1 3V1LA 1J97A 2AE1A 2VF2A 1YI0A 1ZOOA 5CJPA 4HPXB 4KWEA 3SVTA 4P3XA 2CJWA 5K8LA 4YY3B 4C7OB 2QMOA 2ZYUX 1UOOA 3A3OA 3I5MA 5NULA 4NCBA 3DBVO 2G36A 3M4NA 3RFVA 3EZ9A 3DHWC 2J9ZB 2TMKA 4WA7A 1DJNA 2JA2A 4X5OA 1QGDA 4AQYB 2VZ0A 2EHJA 1FMJA 3OIWA 1EXWA 1W35A 1XWIA 3HCEA 3AEXA 2AMLA 2QX4A 3LIPA 4ZICA 1Y1LA 1F8YA 2QJWA 4IIDA 1BRMA 2ZETA 4XQ9A 4XFDA 3LY9A 4K9OA 3IDAA 4XM1A 5COAA 2V6MA 4M2LA 1E1QA 1P2FA 3P1JA 4HNAA 4D81A 1PEAA 2YBDA 1IZ7A 3LHSA 5AT1A 1KP9A 1L5SA 5KDLA 3TCKA 1D6MA 2RONA 3GUZA 3DNPA 3NM6B 2ZJ7A 4G85A 4IWYA 4HNTA 4PLVA 3WO0A 2E89A 4RULA 1DE0A 3HM2A 2QMHA 3N53A 2PKQO 1K68A 1LI4A 1WDKA 4GRAA 4Z9BA 2P1DA 1T0BA 3KYCB 5F5NA 4BBAA 1Q11A 2RBEA 1TJ4A 3REFA 2WFAA 2WYHA 1Z0UA 4M1OA 1KI9A 1ZJWA 3A6GA 3LOUA 3MT9A 4GM0A 1Z6GA 1A9SA 2FEMA 3MB5A 3FMGA 1JFFB 2Y27A 4RNCA 1TJ3A 4EZIA 4XGQA 3EF0A 4YRQA 1SKYE 2Z56A 4P0QB 4MKZA 3VYWA 3JQ9C 2ZIGA 4IXWA 4MO2A 3WXMA 4DA6A 3R8FA 1FFHA 1KHHA 5K4GA 3KQVA 3TD2A 7REQB 1NNEA 5ED4A 5JNLA 5L6LB 1R88A 2W4MA 1QHSA 4ZYWA 1G19A 2QI9F 3B82A 2O0HA 2O3QA 2OR3A 2QK4A 2P79A 3EOBI 3PFNA 1AXRA 4L2IA 1C4OA 2EP5A 1BHSA 3UV7A 3LDGA 4CMIA 1VXOA 4G36A 3GWZA 4G5SA 3UV6A 1PV4A 4NVRA 4OXYA 1ZK3A 3CVYA 4RQBA 4AMVA 3FDFA 3FGNA 1CZNA 1OBOA 4GZLA 1PFGA 1G8JA 3PXAA 4Y2TA 4D6XA 1SHLA 4B4UA 4YRGA 3ZHQA 1GSIA 1HK7A 1G7TA 1ZIXA 3IIJA 1OBFO 3QYAA 3WL6A 4KGXA 3DBHB 5FA5A 1KL7A 5G4KB 2JD0A 3Q7PA 2NZ2A 1NNI1 1O3YA 4ISCA 1PJSA 3VKHA 4UM5A 3N7UA 1UC9A 2R2GA 3V97A 1ZUWA 3WYNA 3CPEA 5JC1A 4IKOA 3RV4A 3GOHA 5KQGA 3CS3A 4LAFA 3HU2A 1OI7A 2BL4A 5KMGA 4WI1A 2QRUA 4DDKA 3A8TA 4D56A 5FWYA 2PD4A 1R8JA 3GMTA 4P5EA 2ZYRA 5K3SA 3T5MA 4D8VA 4MXDA 2JVJA 4EAQA 1U90A 1UJNA 1YGYA 2I3ZA 1U8EA 2C88A 2VWPA 2GHIA 1JEOA 3QKRB 2VUSA 5IBRA 1UDAA 1SFRA 3UQZA 2HO5A 5BV2P 2UUCB 4HFRA 2CYBA 2SCUA 5EZYB 3UMJA 5JROA 2IVFA 2LZ0A 2NUAA 2OV2A 5C7OO 1QG4A 4JOBA 3TK1A 3MAAC 1EJ0A 1NHGA 5L3VA 2QLBA 1A7UA 2GNOA 3O90A 4KG7A 5HKBA 1P19A 1KIMA 5CFRA 3MT0A 1HT3A 2NQTA 3BHMA 3B9BA 1UK6A 2PS3A 1D1QA 1M2OB 5K3BA 3SCZA 3PC3A 2X5XA 3DSRA 4F7WA 4RMGA 1KYVA 2OAGA 1RABA 4TPKA 4UE3S 3FI0A 5EZYF 3W79A 1IJEA 5CYGA 2I34A 2FFRA 1QP4A 2FPUA 4AN1A 1MDBA 1CDOA 5A9SA 3BD8A 1U0GA 1IRXA 1DTWA 1NOIA 3I76A 3QY9A 4YJ3A 4UTZA 4U6QA 1I3OA 1H1LA 3PXCX 1Y5NA 3ROFA 4LF6B 4D80A 1Y98A 2NVBA 4CL8A 3I5YA 1ZJYA 3VMMA 2ZUWA 9MHTA 3WGMA 1LI7A 2DLDA 3ZDRA 1E20A 5I7EA 2GN6A 2JHPA 3NB0A 3PUJA 4H7PA 3RT1A 3ZGOA 4US2R 1PKEA 4JLVA 1AQUA 3VAZA 4F6RA 2QZSA 2X1MA 2GLXA 3K05A 1EFVA 2VSOA 4D3YA 1GTMA 1IOWA 2HN9A 1WBDA 1NMXA 3EG5A 1WMAA 5E9WA 4UTPA 1MAWA 1UBEA 3H9QA 3S1LA 2Z6QA 2GVZC 2Y2VA 3UT5A 1ZK2A 3L6DA 1CRZA 3FM9A 4DTCA 4UVHA 2G7MC 2CNWD 3HCOA 1NOJA 3MF4A 4QOFA 3EZ2A 4DR3B 3Q72A 1JHXA 4HVTA 1G9SA 2CXQA 2K2QB 1WEKA 2ONKA 3RWBA 5I7WA 2X4GA 2IP1A 1EX7A 2VYVA 4OJMX 3WLSA 4EF6A 2Y71A 5CYOA 1P8AA 2P3SA 3U7RA 3ZJUA 2PEZA 3HCAA 5DBFA 4M9XA 2W6ID 2WU0A 4OFWA 2GM9A 2CB9A 3WGLA 4GMXA 2O57A 2JBHA 1M7HA 1H2AS 2H4YA 3KT3A 2Q5EA 4GXQA 3QHAA 1QV9A 1KYTA 1P0CA 3O2JA 4X65B 2YFYA 3AETB 1G3UA 1P62B 2DP4E 4D0RA 2W6MA 5JNTA 2UUOA 2OB1A 1U0OC 1Q7TA 4J16C 4P5PA 1LPSA 5DSZA 2GMWA 4C4YA 2GFQA 2PBFA 1NXQA 2P9GA 4Y2HA 2ODAA 3HDTA 3KPUA 1TRHA 1HX7A 1H8ED 2A9RA 2F43A 1RQNA 1LWNA 1XKXA 4WNIA 2AR9A 3EWNA 1SHTX 3ACBA 3MTAA 2BFFB 1J5PA 1VECA 4ZHQA 5EG5A 2NO0A 1T4CA 2AYXA 2O5CA 3C3XA 1HNZB 2H00A 2QV0A 2XWBF 1LDBA 2PNJA 1T4BA 6REQA 3FNQA 1K6MA 2W11A 3N1UA 1IAVA 3HWSA 1ZOLA 2REQA 3JYLA 2ODWA 3A6PC 1JECA 1JHRA 5IH3A 1D2RA 1EK5A 5EZ5A 1CUJA 1PR5A 2PZFA 2H8KA 1AMOA 3ZLTA 2PZ8A 4M0MA 4QATA 1DQRA 1FYVA 1XMPA 2VDQB 4RDHA 3ZX5A 4AX4A 4C4OA 4D8WA 1JZTA 2CCGA 3WWDA 4A73A 1YL6A 2PTGA 3UB4A 4YRNA 3Q5EA 3E5MA 1I7QB 4R54A 1GDTA 3EEFA 1R74A 1TYCA 1C7RA 1VLHA 4NFLA 4UPEA 5A9RA 1MPXA 2X58A 2C7OA 1T8YA 4G5HA 4CTKA 4CXMA 1EP3B 2QYOA 7YASA 2ZBDA 3UJDA 7ADHA 3DZHA 1JAIA 5EMNA 1O5OA 3WHPA 1JIVA 1H3NA 5BSRA 4CIYA 1NR7A 5JRZA 1NE7A 3B53X 2IWRA 3DDNA 4D46A 3EAGA 4TV8A 2AOVA 3HVHA 3B52X 3OMWA 1QOZA 2GFHA 3BDIA 1BEEA 3IEUA 3MWFA 1JYSA 1RYEA 3WYEA 2GXAA 4KX5A 5DGTA 4DB4A 3M9WA 1Z0AA 2TYSB 2ZATA 1XAIA 3O9VA 3L4JA 4N76A 1H65A 4AFNA 1CIPA 2CL6X 4QVGA 5HRCA 1E4EA 2WZDA 1P2VA 3WNCA 2D0IA 5M5BA 2GZ1A 3RBAA 1GTJ1 1T5TA 2Q9BA 3JSXA 1F1BA 2X8JA 3AOGA 4JP3A 3WLIA 1MG5A 2CKDA 1PV2A 4G0ZA 3ANMA 3G0DA 3QIVA 2D74A 4XWYA 4Q66C 1E7MA 2NVUB 4E7OA 4C4TA 1QF6A 1I0ZA 1Y37A 1EIWA 1N6HA 1V1RB 2EZ8A 1LY1A 1ONPA 4QRHA 3KPJA 4OKSA 1CS0B 2IUSA 2DLCX 2CVOA 3PQFA 2IUYA 3F5DA 2FCRA 2XWJI 2QM0A 5FH9A 4HLDA 2LE0A 4Q3CA 2GGSA 5DX8A 2W9XA 4ZRNA 1QQ7A 2ZE8A 1R9GA 2H1FA 1MR3F 2Q2QA 1TIKA 3P2JA 1KNQA 3K20A 3R5JA 4G6ZA 1WOYA 3A4VA 2BKEA 2QT1A 4RY0A 1F0YA 1LK7A 3FPGA 5IDYA 5DP2A 2O8EA 4L6AA 2JIRA 2AG8A 5DTIA 3QBVA 5T57A 5TARA 1CFZA 1P9RA 1OYOA 2JFHA 2Y93A 4MTCA 5GGYA 2I6QA 1UP6A 3VC7A 1NGSA 1G5TA 3GIDA 1HEYA 1RC0A 3CONA 3NHFA 4CKYA 1NYLA 3MIZA 4FHFA 1NNSA 2DECA 2ZDGA 1KS9A 1CFJA 3NGXA 3O21A 1F1JA 2SKEA 3BRSA 4MS4B 3OZGA 4MGZR 3WGGA 1T9AA 4M36A 2ZZNA 2GZHA 2FDRA 3C1TA 4PAMA 5LIRA 1CF4A 2O2HA 2Q8QA 2CXSA 4CKXA 1EVQA 2QTRA 5AK3A 1E7YA 1O9GA 1UKBA 2DFPA 2RIRA 1A9XB 4YCDA 4YRCA 1L8LA 2ZS8A 5C9ZA 3KEFA 4N7BA 4P83A 2DT5A 2XWPA 4RTLA 3O73A 1T9DA 1YB2A 3EMBA 4Y2RA 4F0JA 1PJTA 2QVZX 4ZEVA 3HZOA 1BSVA 2VHQA 3KDSE 2HAEA 2ZIUB 4C88A 1I6WA 3LWZA 1U2DC 4LHYA 4QJ5A 3KPYA 2F3TA 3TFWA 2O0MA 4R2MA 5HFNA 4EVQA 1V8BA 4IJ5A 3C4JA 3MD9A 3FNHA 2D0OB 4BAGA 1JEQB 2O8FB 2FETA 3FKSD 5DM0A 8ADHA 2PCLA 3B1WA 3NHJA 4NU8X 3AR4A 3QE2A 5HF9A 1IRIA 1P7PA 1T5OA 4NCAA 5BPHA 2CY0A 1XMOB 1MO2A 4D8YA 1LX6A 2AVNA 3OICA 1FPQA 1I2ZA 4G8CA 4L76A 4MPDA 3IUEA 3IXLA 5LQAA 1I94B 4D6PA 2ZYAA 3PKJA 3T7JA 1C1YA 1KHTA 1Y6FA 5F3DA 1OVGA 1T15A 4G67A 4M49A 3HRHA 3HG7A 3T7DA 3MIIA 3V55A 3F74A 2FE4A 3K0KA 5IDQA 4RZXA 3ZJYA 4A8JB 3A9RA 3BSFA 3ZDFA 1KBZA 2BV3A 1VRVA 4TOIA 4XVQA 5ENDA 2HRZA 4XFJA 2AZMA 2DPHA 4B9AA 4B7AA 5E9QA 4D9HA 1GZ6A 1NXPA 5L3RA 1ZA2A 2OXIA 2PMFA 1FQOA 1TYEB 3WAKA 3SQMA 1N5RA 3RIYA 1FJ2A 4US0R 1DIAA 1UKCA 2R4QA 1B8NA 1X9IA 4XFKA 5ICCA 1EZ4A 4R0VA 4FX5A 4P7GA 5BQOA 4QUDA 2OENG 1GCIA 5JCPA 5TMPA 1YKFA 2X0IA 2GD1O 2PYDA 1C30A 5DNDA 3X43A 4HADA 1E3WB 4ZOBA 2QUAA 1IQRA 1FP4A 1ECCA 3DPIA 3QTTA 1G8MA 1N6KA 4ZVMA 2PJZA 4UPDA 2J30A 2PVCA 2FWMX 2VNAA 1HG0A 2B6NA 2RHRA 1JSLA 2HJHA 4D9FA 3KB1A 3D4PA 2I6TA 5K5EA 1YQXA 2W2LA 3K16A 4FGUA 1RYYA 1FRZA 4LBWA 1WEHA 1S6YA 4BOYA 2VHTA 4I5FA 5J40A 3D6HA 2BYTA 1WXDA 2AYZA 3LCMA 1W30A 2EJCA 5K1ZA 5I9SA 3V8RA 3ZY2A 3RYCB 4MVJM 2IH4A 1XJ5A 3H6KA 5AR1A 2J08A 4NK5A 4AG6A 2GZDA 6GPBA 3CF4A 3JQBA 4EP1A 1W0KA 4FW8A 4EUHA 4EECA 2RGGA 1CY2A 4BLTA 2ZSUA 2JZNA 3ZZNA 3G9XA 4PRYA 4UUPA 2CW5A 5I7OA 2C07A 1W6RA 4PN3A 1L5WA 3FPSA 5P21A 3B1XA 2PD6A 4IHKA 3HVJA 4UM9B 2HHHB 1O95C 4HDMB 3ENWA 2CSXA 1JR2A 1U7HA 2FF5A 2H65A 3P9NA 5FV4A 2CZCA 4Z1MA 2A1IA 3J81A 3NHBA 4RM3A 3IQEA 1J39A 1GCOA 3B9QA 4HAZA 4Z1OA 5FNVA 3LT4A 1Z4NA 3MERA 3D7LA 2Z2IA 4QDTA 2YMPA 3H2ZA 3U81A 1XSEA 4Q3LA 2QUBA 3QX8A 2BMWA 4FYIA 3K9BA 5CA0B 1FP7A 2CHGA 1U3VA 2KE5A 3GVXA 1FP1D 1G3RA 3RIMA 1NAHA 1D04A 1N1EA 1GPJA 4RYDA 1P5HA 1EFHA 1NNUA 4M6WA 2I87A 5JAMA 1VSVA 1GPNA 5JOQA 2UZ1A 2QQGA 3N7TA 3RARA 2VK8A 2X6TA 2DUWA 3NHYA 2IEDA 5JCOC 2DBVO 3C3WA 4IZIA 4CM3A 3DTVB 3MWEB 5IKPA 1IL0A 3VH1A 5CA0F 4E13A 2BVNA 5ALEA 4PW0A 4EJSC 5KTTA 3FFTA 4LN1A 5HBRA 3R3HA 2EX4A 2I3DA 2XUHA 2P8JA 2G83A 3GBPA 3RFFA 3VZCA 1NATA 5KX5F 3O7MA 3O93A 1E9CA 1U4NA 4DC9A 5H8WA 3HV0A 6ADHA 4EUNA 1G6HA 1JR3D 1L5VA 5ECGC 4J6EA 1XMQB 3KEGA 2GPYA 2P4HX 2RD2A 1C1XA 1NIJA 2G9ZA 4DLYA 1YZ3A 3QOXA 3QXCA 4MW0A 3X2SA 4QTYA 3TTSA 3AR7A 2QMQA 5CB4B 3DE4X 5KJ1A 2X41A 2QPAA 3GCWA 3QRWA 2MSKA 3FR8A 4PHGA 2A67A 4HAWA 2CGEA 3AQIA 4U5XA 4ZT3A 4OBWA 3JZAA 5A3RA 3CXUA 2O7QA 2WB4A 3B78A 5I4BA 2ZP1A 5DN6D 3T3GA 4V0RA 3AO0B 3C7CB 2AUMA 3T1QA 4Q4AA 4AK9A 2WAOA 3J80A 2RHGB 2JJ8A 4EKIA 3OOJA 1E79A 3RSHA 4OFZA 4NU0A 3CRZA 5CB4F 4GF5A 2BUAA 3WK4A 4Y9DA 4JA2A 2QY9A 3ER6A 4LA4A 5A6SB 3DPSA 3BDVA 5KEIA 1Y4ZA 2V7VA 3MS2A 4NPAA 5A4DA 3QA3E 2WI8A 1M7GA 2QRJA 2YTZA 3CR8A 1YR6A 3TMKA 2XEXA 5IZ4A 2YRXA 3KQMA 1MW9X 3R0IA 3GGDA 3NEJA 4PLGA 5LYJA 1R8XA 4TTIA 3R9IA 1W94A 4JT9A 1SUFA 4PZCA 4ZQIA 4MI9A 1K5PA 1SZDA 1GVHA 5GGXA 5EESA 2IY9A 5E3JA 1J9ZA 4CCAA 1UZAA 2WPDD 3E1GA 4FGKA 4KKXB 5FUMA 5E4YA 3FD8A 3I53A 4H7EA 5AHKA 1QB7A 2OK8A 3RFTA 3ZE2B 5B12A 1M0WA 2XZDA 1TAUA 1FDOA 5BR7A 2GEJA 1G1AA 1V7CA 3TDKA 1G4UR 4I81A 5ARDA 3LOPA 4GKAA 5AKIA 4RFSB 5FBQB 1KSJA 3FPEA 1R5JA 3N3BC 1TFUA 1EPUA 1Z0FA 1OFGA 3AL2A 1RKUA 3FYTA 3KU4A 4LBVA 4NOMA 2IBMA 4IYRA 1Z07A 4R2JA 5LP6F 1DMSA 2P40A 2RH9B 1QGYA 3CEMA 1Q7RA 1G5RA 3GF4A 3RANA 5JI3E 4YASA 5BUCA 1PJ4A 2MYTA 4RIIA 1W87A 4C76A 2H1OA 5L95A 4Z9AA 1R8QA 4PAGA 4JUAA 2FPSA 1BKSB 1KEEA 2UZ0A 1V5IA 3CFYA 3I32A 5F5XA 5I7UA 4KAJA 3CTMA 2IDJA 1GY8A 1KDTA 4WZBE 2XYVA 3IO3A 1Z7EA 3BWYA 4QYIA 4Y1RB 2R751 1Z75A 4B6JA 1QFXA 3VDQA 2EATA 3MCAA 5K3AA 4AG3A 4DIEA 1DWQA 2B8JA 5CK4A 2BFMA 3WMFA 1QG2A 5BRJA 5U9CA 5FF9A 4D96A 4LRSB 1GEGA 1LPNA 1ZD4A 4AWBA 4ENQA 3DEHA 5G0TA 5KSOA 1QAOA 4D4MA 1MPTA 1M2FA 3HYCA 4KGDA 3DCJA 1GPKA 4PGGA 4ZQBA 1TAGA 1RJ9B 2BMDA 3IUNA 3R23A 2NNLD 3LGSA 4N4AA 1ZOPA 2LRHA 2RI6A 3FPAA 4C05A 4V0OA 4TYWA 3IEIA 2QVCA 1RWVA 3I73A 3DOIA 4OP1A 1NVDA 2Y1EA 5BOSA 4RTKA 1X7ZB 3NCTA 4JS0A 3ANNA 3DVRX 2P2LA 2DFNA 4D42A 1CUCA 4CVNA 3U19A 4UQLA 4LXIA 4Z3OA 1FNCA 2WF9A 2Z5FA 5DB4A 1KH2A 1NN1A 2RH5A 4HZGA 5DOZA 3V1TC 3DQZA 5JZ9A 2FVYA 1XA0A 3QIAA 4I6JA 2XCQA 4DLNA 1DKMA 2HLHA 4YUWA 1YD7A 4TN1A 4N0PA 2PRKA 1KAHA 4RJIA 1H5UA 3YASA 4GQIA 5ISMA 1QTQA 2I71A 4NFYA 1FSPA 1ZSNA 2C3OA 1NN3A 3FHLA 2EJVA 3EIEA 1BKDR 3TLZA 3C3DA 3IAXA 4AJNA 2V97A 3GCDA 1XJQA 3L8FA 4DCJA 1EFRD 1YRLA 4TSRA 5BRNA 2BMVA 3D3EA 2QORA 2XTZA 3B12A 4M87A 5CNKA 5ALZA 1IBRA 1AK2A 2BDUA 2A1TS 2QX6A 2ZITA 4FC6A 1X19A 1GUBA 1R4MA 3ANSA 4YFVA 1AKNA 1ODCA 3L0YA 4TVOA 3S81A 3DHNA 1Z2EA 2ZAYA 3U3OA 1YVPA 3VPCA 2WP0A 1NVVQ 3QWBA 3IYLW 4UMDA 5LD2C 4JUCA 4C0BA 1V2GA 4R3UC 2EIXA 4H3SA 2RAUA 4UEJA 4XVHA 5HNKA 2P4QA 4HB0A 3GG9A 3JALB 3TW6A 3BKWA 2WBLC 2ODNA 3Q6MA 3SSOA 4NJEB 4I36A 3HKCA 4I8IA 4FJ1A 4KBYA 3ACDA 4YQEA 1YHNA 1J2JA 4QRDA 4UTVA 4LJ6A 4R1TA 5JAQA 3BJRA 2XCTB 3N9IA 3ZC3A 4P35A 4I9GA 5ALGA 4C7MA 4JITA 4RTRA 4WD3A 3VVBA 4R9VA 4LXYA 3IP9A 2V5UA 4YBRA 4P6VF 5ICGA 3O83A 2EXXA 1OLXA 1X1BA 3U9SA 3F6BX 3H4VA 3R9XA 1WKVA 1U2GA 4JJ4A 4DQUA 3SU8A 4FFOA 3WLFA 2I7TA 4JY7A 4TKUA 4IEEA 1RPJA 3OZFA 4E2XA 1SB8A 3ZDCA 1IM8A 2ERCA 3LRTA 4ARZA 2E18A 4R9SA 4BP8A 2X42A 3SR3A 3E9NA 1UMBA 3D5QA 4YALA 3K0AB 1F2UB 1V8FA 1W5SA 3HN7A 2FI1A 5ER9A 4ZT4A 3PFBA 3WLRA 1B8VA 1T8SA 1VL2A 1W2GA 4QBKA 3C8HA 1GZ3A 2C29D 3TS1A 2WP8J 4L0QA 2R6R1 3IKVA 4OF4A 3ZCVA 1M1YA 1VHWA 2ERYA 1J0EA 3VNBA 4ITRC 5B1YA 4E5KA 3QBTA 1LW7A 3K5HA 3T0FA 5KZMB 1C8LA 1SUWA 4XA8A 5EXXA 4E5PA 5FBVB 3K1JA 3SKVA 3WLTA 3V9AA 3F1KA 2BFWA 2UVDA 5CIWA 4L4RA 1E5LA 4F3RA 2XE8A 2EKBA 2V3WA 2A30A 3OO1A 4X41A 2QRVA 4PC7A 2FSUA 3MAJA 4O0MA 4DDVA