2Z2KA

Crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
180
structure length
180
Chain Sequence
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structural Plasticity and Enzyme Action: Crystal Structures of Mycobacterium tuberculosis Peptidyl-tRNA Hydrolase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 58
structure length 180
sequence length 180
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 2z2kA00
4LWQA 4YLYA 2NAFA 2JRCA 4JWKA 5IKEA 3OFVA 4FOTA 1RYBA 3TD2A 3NEAA 5EKTA 4FNOA 3TCKA 4QBKA 4DJJA 4DHWA 4JY7A 3V2IA 4QD3A 4QAJA 3KK0A 4JC4A 2Z2KA 4FYJA 4Z86A 2LGJA 3TD6A 4JX9A 4ERXA 4HOYA 4QT4A 2PTHA 1RYMA 4P7BA 5IMBA 3P2JA 4OLJA 4FOPA 1RYNA 5IVPA 5B6JA 2MJLA 3KJZA 4IKOA 4ZXPA 3TCNA 3VJRA 2Z2JA 2Z2IA
chains in the Genus database with same CATH superfamily
1YH3A 4PCUA 5B2EA 4TS4A 3AFHA 1P29A 2UYOA 1RJ9B 3PNLA 5BUQA 2GVDC 5TIIA 1B1AA 1NNSA 4E07A 3K1AB 3C5EA 3GEBA 3KXLA 3LY9A 1YOVB 1WMBA 4BBJA 4J1TC 1CLEA 2VSNA 5CPBA 3RBXA 3BRWA 3IAM6 4DAOA 1JJ7A 1W0KA 1UC8A 3STTA 2JBWA 4FGLA 4EGSA 1YL6A 1C9YA 1KO7A 1PD1A 1TTQB 3LWDA 3HCWA 3Q6IA 5H8WA 1FMFA 4WT7A 2MTBA 2PD4A 1L5FA 2Y1CA 4NJMA 4ZQHA 4OL0A 2PZMA 3KELA 2NQTA 4A6XA 5HFJA 3SIWA 2M6RA 3P5BA 3K9LA 1GA4A 2QD5A 3UMRA 3ZWKA 4YCLA 5EWMA 3UJ9A 4HAIA 5IYZB 1DEHA 4GS5A 1RZ3A 1ODKA 4HWTA 1R50A 1OFUX 5AKGA 1JEOA 3A1EA 1CVRA 3TTTA 3WA6A 4EFDA 3V5NA 3BMCA 1OI4A 4RKEA 1QHFA 3OPYA 3USZA 4XLTA 3F49S 1JWAB 3R5HA 1MC5A 3KV3O 4XAQA 1DCMA 3C3CA 3HYTA 4WVLA 5DGDA 2RCNA 3GN2A 1IRXA 1EVKA 2Q6KA 1P2UA 4LDPA 4BLVA 1N57A 5BMOA 1C8LA 3WBKA 3WNVA 4ASUD 3EVDA 2QP4A 1MOPA 4C3ZA 4BLPA 3MTBA 1ZN7A 5LBUA 1IDOA 3CW9A 4ZT2A 2P2GA 1R4NB 4INOA 5LZ7A 4B74A 2BSQA 3UENA 3KJGA 4RXUA 5G4KB 2JEYA 1RWWA 4I4TB 1EU1A 1NC3A 1XCMA 1NQ5A 4CIWA 3TJMA 5L3SB 5EZ6B 1QIFA 2LTAA 1OH5A 5EQTA 1W30A 1ZPDA 2SECE 3WB1A 3HYCA 3EEYA 4L16A 2IY9A 3PF8A 3UZUA 1P7PA 4ZGWA 1UBMS 2GJ4A 4FDMA 3T7DA 2VJBA 1QXSA 2IPLA 1DELA 1G21B 2V7WA 5CCBA 1BTOA 1EWTA 2QRNA 4LOLA 1T2AA 4QUDA 3L0SA 5CNJA 5ALIA 1Q21A 4DIKA 4KREA 2WFMA 3SZGA 3L07A 5IX8A 1PKXA 4LYEA 5JV5A 3BH6A 5DASA 1ZZEA 4TMXA 3G0DA 1IUKA 3OIWA 3QFSA 3V8MA 2K2WA 3AVOA 1BN6A 3GFTA 1SQ5A 4CTOA 4E5SA 2VPZA 2O5CA 3NBKA 4AG5A 2QZ4A 2QMEA 3HN7A 3EWNA 3HR4A 4US0R 5KEIA 1KZ9A 1GZUA 3PBKA 2NZWA 4WKOA 3O9ZA 3AFMA 2IV7A 1QQTA 4D74A 4KE9A 2LKDA 2B7LA 2PKYX 3O8NA 2HMAA 4Y9DA 3WMGA 4DY6A 3HA3A 1K27A 4QFDA 4TXMA 1UK7A 1TZJA 2B98A 2Q29A 3IAUA 4KNVA 3JQAB 3OETA 4RF3A 3HXMA 1FJ2A 2R1UA 3OPYI 4QXRA 1ZM9A 1H66A 4OBEA 4MW5A 4WQMA 1W5AA 2VYVA 3PUWA 1TYCA 3VXKA 3H2ZA 1KQOA 1ORRA 1Z45A 2C4NA 2BTQB 4BQIA 1M7GA 1XP8A 3H9UA 5CDFE 2GWRA 2FEAA 3I04A 1YNSA 3W8EA 1X7YA 4Q34A 4BZXA 5ES4B 5KYXA 4RPLA 2ZIZA 1Z4NA 1N5LA 2OV6A 3NJ8A 2PDAA 3RC3A 5C51B 5KNLA 1ZUHA 1IEXA 3HSSA 4M4SA 4ZJZA 3KXPA 4NBSA 2DBQA 4NMLA 3GXBA 1M1XB 4V0MA 3PI6A 4X66B 2IH4A 3LCUA 2VDWB 3OOHA 4OJYA 3DEJA 5K7SA 2IYXA 3N0RA 3RVOA 4F3NA 3CQ9A 5FCDA 2HF2A 3BKWA 3HUDA 1P1HA 1ZMOA 3N70A 4QAJA 1IJEA 2C95A 5FB3A 2R6CA 4HEHA 3VISA 3G7SA 4KKXB 1CQJB 4FHZA 1MO4A 1YU6A 2AOWA 2AX3A 1J1UA 1NE7A 4LS3A 2JVIA 3G5TA 3KOUA 4G0MA 1CIVA 3FSGA 4BE7B 3DFFA 1M0EA 2PY6A 3LYAA 2FP4B 1AH2A 4BNMA 1W4LA 4EMTA 1OI3A 3QLUA 5C1DA 1LQ2A 3EXEA 4DLUA 1ZUD1 3DHYA 3INGA 1JIKA 1B23P 3WGHA 3DL7A 3V1NA 3R7NA 1VLVA 1SHLA 1Y5RA 3HKCA 2X6RA 3NEAA 3AF1A 4LSZA 3GNLA 2G4LA 1QYDA 1U7TA 3W34A 3ZBUA 1BCSB 4AJOA 3C1OA 2GN1A 3R3ZA 4INAA 3UJDA 3ZBTA 5I3ZA 1T26A 2FWRA 2HU5A 3QU5A 3Q3CA 4UAVA 3KB1A 5C1IA 4RY9A 1S2DA 1BX1A 2QLTA 5CYFA 1E32A 4Q47A 4D5GA 5K4GA 1NWCA 5J4VA 4O4IF 4UAJA 2G8NA 5DCLA 2JBAA 4RX1A 3T35A 4D1YA 4HZGA 1PR1A 4F11A 5LDDC 2ZROA 2LZ0A 4GWKA 5L8VA 4JA2A 4L0MA 1H94A 4JEMA 3OMWA 1ONNA 3KFVA 2ZSFA 3KZMA 4PC1A 1FTSA 3S7ZA 5CP8A 3V9AA 1ZCZA 1E2MA 4OGGA 3RVKA 1KMMA 5KX5B 4KQEA 2C88A 2I1QA 1T2CA 2ZSAA 1AKNA 2GPTA 2Q3FA 2UDPA 2W2OA 5A9RA 1NASA 3DHEA 3JQFC 3ZGNA 2RIPA 2I34A 4U2GA 3I6BA 4FT4A 1PBNA 2WFLA 3T3GA 3RYCA 3B51X 5GOZA 2PK3A 1W9HA 2QVYX 1VPVA 3RLFA 4E31A 4MW6A 3PDIB 4HWGA 4RZUA 2XJ9A 3K1ZA 1GG9A 4BKPA 4QBTA 1LRJA 4URFA 3D7RA 4MVYA 4RGQA 5HPYB 1Z47A 3RIXA 2R8EA 4JGGA 3TBFA 5FOQA 2G9NA 1RYZA 3W5UA 4XIJA 2P27A 3T4XA 3CMMA 1V2GA 2O7NA 13PKA 4FYPA 1WU7A 4ZAGA 3GH3A 2W9XA 5DM1A 4YRPA 5JJIA 1E6MA 1Z0SA 2P7HA 1FS6A 1RD4A 1TECE 4O2BF 5ESWA 4C1BA 2I3BA 1BWSA 2JFGA 3QOXA 3AO0B 1EVEA 4PAWA 1XQVA 1T5LA 3EIOA 1E5QA 1HTBA 3TGWA 4C0KA 3D1LA 3QVKA 3OWXA 3DZBA 4KXNA 5HS4A 5IS2A 1FVFA 2ZJ7A 5B3AA 1T2VA 1X1RA 4FQ7A 1NXQA 3R7WB 5HUQA 1R74A 4NMXB 2G1PA 4GDFA 3I5XA 3ZGZA 3WL8A 3JV7A 4E5YA 5JG7A 1VJRA 1FRVA 1N4AA 1SQ6A 1S7GA 2J9FB 3OLQA 4KN8A 4KYTA 3TRKA 4UQLA 3JQBA 4WBNB 4QOJA 1TTPB 4PZ0A 4XI9A 4F2HA 4XYLA 2PGLA 3E23A 3PDJA 4LISA 4NL4H 1A8UA 2C8JA 4KDCA 5E1BA 1YZUA 3S7TA 1OV4A 2HO5A 2CHQA 4Q05A 5K0BA 3PICA 4I8IA 3DLCA 1CERA 2FR1A 5JNTA 3B9RA 3K0BA 1SBIA 3GD7A 4FFOA 3SF0A 3OM1A 1CXZA 4D3FA 4YUVA 3RCBA 3ROMA 3UXHA 1E60A 3H5RA 2BC9A 2PIAA 5TS3A 2A0YA 3D0KA 4MW0A 1CZHA 2PJDA 3GZ4A 1T1RA 3R5JA 5JO0A 2PUBA 1HMPA 4Y8VA 4A8PA 1I1OA 3QE2A 4E2YA 3MJDA 2QN1A 1H9BA 2CN1A 1EAYA 1YWGO 4M2LA 4AIRA 4DG5A 5CT4A 2F9LA 4BX2A 2K6GA 3HDQA 3G3EA 3O8LA 3KL4A 4TLCA 1Z0AA 5EE5B 2OC4A 4P32A 5EMMA 5LU9A 3HL0A 4GZMA 3PL5A 2GBPA 4MHSA 4DC1A 4U8GA 1QLJA 4NOMA 1F7VA 1GCUA 3DR5A 3ZV3A 4DR6B 4WH0A 2ZXUA 3BHNA 2E5LB 1GLNA 2O8CA 2RHCA 3ANLA 3QE3A 4E15A 4AB1A 5I9IA 2WHXA 1TZCA 3DTVA 3M5DA 1GPAA 3SHQA 5F52A 3IE0A 1N6NA 5E7IA 5CA0F 2F4VB 1KC1A 2GAAA 3SSNA 4M7WA 2PL5A 4AJEA 4EB8A 2Y67A 3EVFA 5UKDA 2CE2X 3KKKA 4LWOA 2A0KA 3IMEA 5AO9A 4WZBA 4QKQA 1ZR4A 4IGFA 3W6ZA 3NATA 3C6BA 3VPXA 4KQ6A 3HACA 1KE2A 2WQ6A 4MUIA 1TKCA 1X2BA 2VF8A 2VJMB 1OLSB 5BWOA 1T6XA 3QPDA 3DG9A 1K4MA 1XX6A 3VR3A 2SKCA 2C9DA 3EUEA 1T3LA 2FF5A 5C37A 3I39X 3TW8B 1LFAA 3CM0A 3KHUA 1RYDA 3CCCA 3QNUA 2FEKA 3G2PA 4F93B 2XT9A 5LJIA 3ACDA 4QTZA 2HLNA 1W4ZA 4A73A 1J7KA 4CKXA 1ORHA 2YVUA 4ER7A 3HNPA 1DC3A 1XVVA 1W9MA 2A7XA 4U0JA 5K3CA 1M6VA 2ZZKA 2CF5A 2YJ3A 4V0KA 4XGRA 1S8NA 1DOHA 1NOJA 1UMBA 1XKXA 4IJ5A 4KQFA 4ZAWA 5B36A 3E3LA 4D96A 1KY3A 1CUWA 3JATB 2DYKA 2H65A 4PLTA 3GLIA 1PK9A 2I55A 3H6HA 5FYQA 5J5CA 3SHVA 4JOSA 2R6JA 1KEZA 1XL1A 4FI3C 1VMKA 4GUAA 4YRDA 5JAQA 3DWIA 3WIOA 4DJDC 4MMZB 1WSAA 3HR8A 3VR2D 2YY6A 2X1VA 2EJCA 1GNTA 4MIKA 4CU5A 3MAJA 5LUAA 4DDMA 1TF2A 1QZTA 1HOXA 2ECFA 1IULA 1EBBA 4RE5A 4Q1VA 3BT7A 1J0DA 1JPVA 4L50A 5HSGA 3IV7A 3DM5A 1XRPA 4DCJA 2FW6A 2W2TA 3B1XA 4DMFA 2ZDGA 3LIPA 2IDJA 1KIAA 1U2TA 3ETDA 1BOFA 4FFLA 4PHGA 3SX0A 3TQIA 5JCXA 3CRVA 5TVGA 2FN7A 3CLUC 4RNCA 1DKQA 2NIPA 1XYVA 4NICA 2F9FA 4Y2XA 5ESDA 4B44A 1XPOA 3AVXA 4HGZA 1H2AS 4H17A 1SAYA 4DC0A 1T8PA 4YV2A 4WGGA 2JCSA 3FHCB 1YFLA 1GITA 4M99A 4KLNA 1I7QB 1KJQA 1P0PA 1YBFA 3GAMA 3ACCA 4KSCA 2GARA 5SICE 5ABPA 5AK4A 3DPIA 3HLTA 1P44A 3DAFA 3IV9A 4EZBA 2E0IA 1XU4A 3ZS9A 1CRWG 1ACMA 2B5OA 3LUKA 2Q4TA 2VNAA 2WIJA 4Y2HA 3X3HA 1OC2A 4OJNA 4ZK6A 5KMGB 3TUZC 2Q0XA 4Y6OA 3TUIC 3ELBA 2OZVA 2BFDA 3FTCA 5ICMA 3MT8A 2YXPX 2FN9A 1KJYA 3FDJA 3ZK7A 4U4AA 3OFKA 3CLSC 3KKZA 2IYZA 2FZEA 4CEJA 1DBVO 3D4IA 1H2ZA 1TVKA 1Z0KA 1HE3A 4UMFA 3SVZA 4MVJA 1KMHB 4K2AA 2F4NA 4YJ3F 1B6GA 1G63A 2AJDA 1Q7GA 3KK0A 3OSUA 4Q03A 1MZPA 1UPXA 1KU6A 5K6RA 1ZWLA 1ODFA 1ODSA 3IBCA 2WJ4A 3MVEA 2OWDA 4B80A 2FFAA 1N9ZA 3CC8A 2B21A 1K3TA 3KPWA 4JLSA 4UEKA 4WHMA 3HS3A 4CV2A 5HK8A 3FPEA 1WXEA 3GMTA 1ENYA 3BRSA 2YH2A 3NT5A 1FP6A 1H4VB 1KYYA 4H0FA 3L6OO 4IYJA 2XMPA 4V39A 1L7OA 4R31A 1N7IA 1N0VC 1WF3A 1JXAA 4BO8A 4MUYA 5B64A 4TROA 1CDZA 1VCNA 1FTWA 1XC7A 2QGNA 3CKKA 4H2DA 3UQZA 1V3QE 4BYMA 3FDFA 4CTJA 5DCUA 3DOHA 1OSNA 3KYBA 3V1UA 4G1CA 4CLDA 4BB9A 2PANA 1NXPA 4UBKA 2EQ5A 2WSSA 4KXFB 1N3LA 5J9FA 2R79A 4JJ7A 4UARA 3TRJA 1I2ZA 3BK7A 4HVLA 1J8DA 4MUXA 3DW1X 3I8OA 3B12A 3F67A 3GZNB 4PS0A 3RPEA 5FOWA 1U6KA 1DJQA 1YK0A 3ELYA 4M98A 4ARAA 4QYXA 1UIMA 1DBIA 5IK2A 3AIKA 1NWHA 4ZDKA 1G0NA 4I8XA 2VDRB 4IZIA 3Q9UA 1EJ2A 3PFFA 1G5PA 1QBGA 2QT0A 5LN1A 1AS2A 3BMOA 1W29A 3HB0A 3REQB 4B3BA 4DLPA 1GPJA 4BVHA 3IJPA 2A5LA 1ADBA 2BFPA 2I4MA 3QHQA 4P80A 1YRBA 2SCUB 5HFNA 3SFZA 2INGX 2V97A 3ER8A 4HFJA 4IVPA 1X7WB 3AUKA 1JKMA 3UXYA 1PEYA 2CDAA 3BGDA 4TL6A 1HZZA 3VKVA 1T5BA 1ZMBA 4QELA 1W73A 4R1NA 5ITVA 3JQ9A 1L7NA 4MVJI 4DUZB 1P1BA 3CRNA 1XZCA 5B5SA 1T24A 1NHGA 1Z5GA 4BAUA 5HJ7A 3IQIX 3WE7A 5CPFA 3G9XA 5AKKA 2CNOA 3M7IA 3TL3A 2CSUA 5BUZA 5ALOA 1CUIA 2WABA 1DDIA 3A4TA 3KQYA 3LQRA 1PZMA 4Y6GB 5JD5A 5KU7A 4D4HA 5IJAA 2V0GA 5BT9A 2I2XB 3Q98A 2GUGA 4II3A 4YCCA 1NIPA 3VDMA 3LY8A 3DR3A 4CTKA 3FDZA 3DMGA 1KR2A 2G17A 2RB4A 4ZQEA 2M32A 4EFNA 4J03A 1F8YA 2P6MA 3DMYA 5AXBA 3GBPA 1TD9A 3Q5EA 2YKGA 1KAHA 1KF0A 1GTZA 2JDID 4JLOA 4U7PB 1QYVA 4YBZA 2I78A 2IUYA 2Y71A 2A94A 4M0FA 4OXYA 3K1AA 2YS7A 4WBXC 3ZXSA 1YOVA 1PR5A 4ZTBA 2JD2A 5JAPA 5ELLA 1BD4A 2PKXA 1KSGA 1FFYA 4TYNA 4MV8A 1L1EA 1TVCA 1GA6A 3IEUA 4ZP1A 1D03A 5AXAA 5HEKA 4BGDA 1EFHA 1TMGE 1CEEA 1V7CA 4BVJA 4CG1A 1GOTA 3L0DA 4I9UA 4EX6A 4YRKA 4DCSA 1OZGA 4XVUA 4R2WA 2IZZA 121PA 4EA6A 1YZVA 4Z3DA 1HNXB 2WYWA 1YR8A 2PA0A 3SR0A 3AERB 5IYZA 5JS8A 2PSSA 4F5WA 1CYEA 3FUTA 5LD2C 2VP9A 5AM3A 2SNIE 4EITA 2NADA 1PG0A 1RJWA 5IDVA 3KQHA 4MEJA 4X24A 3TMKA 1PQYA 4AKHA 5KNCA 3L0BA 5ALUA 2DERA 2EFEB 3DUFB 1NUSA 3GYGA 4AULA 4RIHA 4CFZA 1FA9A 4BDTA 2H00A 3WSTA 3HVHA 5A4AA 4KITB 1UWLA 4OJKA 3FNRA 3EBLA 2PD6A 1W36B 2DT8A 1U8CB 3FRHA 4WN9B 5BURA 5GADl 4S1OA 4BNVA 1R4NA 3A9WA 5BSFA 1GDTA 1E63A 3CPHA 3LVRE 3EGDB 5JOQA 3LHFA 1BVUA 1I3KA 4I4TA 2IOYA 4ND8B 4YMUA 2ZJFA 1SXGA 1XDGA 4JNCA 4WSOA 5T6MA 5TF4A 2HW8A 4EI8A 5L3SA 1A4UA 2IY8A 3PFBA 5EA2A 1NW7A 3A4MA 2E9SA 5CM8B 1RMQA 3ICWA 2DCUA 3ICVA 5F2OA 1YD7A 1D8TA 2EVWX 2XOKA 3ZDEA 1W5FA 1OWPA 3R09A 5GINE 3LVQE 3ZX5A 3I76A 1G21A 3O1IC 1NM5A 2W7TA 2J5KA 2FX2A 3SHFA 1H2EA 4TL7A 3T5TA 4ETMA 2JHPA 4YPOA 3U6BA 4HNRA 1ELOA 3ZQ6A 5KHOC 1E2DA 4JBNA 4A36A 4HLUC 3QVGB 4C04A 3E61A 9MHTA 1XMSA 2EX0A 3K5IA 4MS3B 2NT3A 4G8DA 4OSEA 2I33A 3DKKA 1CBUA 3EQ2A 1FTYA 5H68A 2YWRA 4HAZA 5D1NA 3F97A 2PUTA 1N1MA 3TVDA 3SGLA 2Z2YA 4Z4CA 5KTOA 1QCDA 4C4SA 2IYRA 1I1NA 3HG7A 4XYEA 4X1OA 2VLIA 1RHQA 3KT3A 3PPIA 4OU5A 4Q1DA 3IXLA 4KPGA 1A8SA 1SXJB 4B17A 4CXMA 4Z4QA 4LY6A 4OHCA 3JQAA 1GL9B 5HKOA 1JI0A 1XJQA 3RSOA 1B15A 4D3DA 3FXAA 2C3OA 5FUWA 1S9DA 2FE1A 1XLUA 2Q62A 3EN0A 3IAHA 2IU0A 3TTVA 3U62A 2J07A 4PNPA 3UKOA 4MYDA 2BTQA 4O4HF 3BSSA 3P7MA 1DXOA 2O7RA 4G01B 4M9UA 4IIDA 4ZCSA 3ZCSA 3LLMA 4MPPA 5I7HA 5ERXA 3NHAA 5K6AA 5BR1A 2A1TS 3ANNA 3GFOA 4EZEA 2FQQA 4A26A 1OVGA 5JYCA 1KTVA 2VDWA 3B3GA 3BRWD 4LVUA 3FOZA 1G6HA 1W0KD 2QGZA 1WR8A 2VT2A 1L3CA 3GRKA 4BTLA 5JFOA 3FUUA 2P0AA 5HP4A 1BA3A 3TNYA 3EMVA 4B4OA 3CEAA 1GRVA 1R27A 3F2VA 1BE1A 1CQJA 2AW5A 2Q5FA 4PVCA 3FVRA 3I04M 3NEJA 2J45A 1QV6A 2NO6A 2WKSA 2V5VA 3KPJA 5B3JA 1LKZA 2JANA 3P2YA 3BHIA 4CDMA 3PQ5A 1YQTA 1TU0A 1E9FA 1F48A 3GZJA 2CWDA 1DVRA 2Z2JA 5DBGA 3WKAA 2PYDA 4P81A 3HKBA 1XU9A 2X7HA 2BUCA 1MP0A 1LBTA 4BCDA 1JSLA 4FZ3A 4M9CA 3T5BA 2NZ2A 1G6KA 1BCSA 3BYZA 3KR0A 4AZTA 4BV8A 3PCRB 3ZXYA 1VE1A 2OK8A 2P9TA 2GDJA 2VT6A 2YWDA 5LQJA 2W8BA 3ML1A 1UXKA 4ABTA 4BGIA 1CW2B 1DC5A 1IB0A 2GAFA 2WJIA 4QYTA 3E3OA 2MMGA 1UQRA 3PKIA 2GFIA 2QUIA 2VA9A 3EGWA 2ZITA 3O4GA 1DZ3A 4DIDA 2CXRA 5EVCA 3ROGA 1YC5A 3LX6A 3IEXA 2NZVG 2ZWPA 1NR5A 2PWBA 2GD6A 3W6OA 4TWJA 3RLIA 5G4LA 2IE0A 1DKRA 3KSMA 2HCRA 1DX4A 1HFWA 1ULAA 2H9YA 3NAGA 4FYHA 3ROFA 3FIJA 4A0RA 5JSUA 1VE3A 2Q1UA 3BDVA 1TYEB 4LF5B 4EGAA 1M2OB 5KX5A 3RJ9A 2Q2QA 2ZIEA 3GARA 1C4WA 2W70A 3VR4A 4COKA 4DGQA 1G4AE 1OC4A 2HSEA 2XOEA 3RTEA 3SQXA 2PU5A 4YP0A 1DGQA 2DPMA 1K7SN 3O38A 2HT6A 1BFKA 4KE7A 4NCKA 1V4BA 1WVGA 4P92A 4NFYA 1XMPA 1Y5MA 2Z09A 3W3AA 5JANA 2XCRB 1P7VA 1NFQA 1RR6A 2C78A 1P91A 2O1XA 3TPCA 4ZJYA 3PYLA 5BQPA 1W5EA 2O2IA 3COYA 5A5VA 2FQYA 1DKOA 2KSQA 4FMDB 4HBZA 3TYXA 3A6HA 1AHIA 4QSMA 3CR3C 3LRPA 3N2EA 2ZVDA 3ABOB 3DYVA 1Z29A 3UMFA 5IFKA 3TECE 1N5KA 2C7RA 3CMCO 4KJXA 5DIZA 2VTEA 4CFYA 3VR6H 3R7DA 4KIJA 4NBRA 1SURA 1E7MA 2Q1YA 2VYVD 5EUCA 2AG5A 3NETA 1KI8A 1MGPA 2PQMA 1FZQA 2A3NA 2JHCA 2X23A 3MM4A 1XZHA 1P8JA 1P1JA 3S1SA 4YIHA 4A27A 4P35A 4OJMX 1Z6XA 1JJAA 3R7WA 5F1PA 1RIIA 4PCVA 1IN7A 1ZL0A 1KGDA 1ZSYA 3ROTA 3U19A 3AKCA 3EGIA 3HFSA 3QWHA 4LQ4A 3CWZA 4MUKA 4LF8B 1LCIA 1GNPA 3Q7SA 5TMBA 1S3IA 1RTKA 2J9FA 3I4FA 3HP1A 4X6UA 4C0BA 4WBNA 1PWXA 5DH9A 1HQYE 3KOMA 3MTGA 3V00A 1E4EB 1UKBA 3GLIE 1THTA 5D3ZA 4HFMA 5DBEX 5A4DA 4TMWA 4JY7A 4Q7JB 1NQTA 2O8EB 1J0EA 1NBOA 1J21A 1Y9JA 2Q2WA 4WOPA 2DUUA 4Y9UA 5FR1A 1Z63A 1U04A 4IOMA 4XEHA 3S1LA 1J1IA 2G9VA 1TQHA 2VPPA 3FSGD 3HWSA 4GSLA 3BIWA 1XRQA 1T9HA 1POWA 5J4LA 4RPCA 5I9BA 5GIOE 4REQB 4ZZ0A 2UU9B 3GGOA 3VVLA 3NVKI 4BNZA 2Q1SA 3OZWA 1IAVA 4MJXA 3N6VA 1I0IA 1OY1A 3HEAA 4DJFC 4XIFA 3T41A 1US8B 2WJ3A 1SULA 1CZLA 2Q9AA 3A2LA 3QW4B 3CN9A 4U6QA 1LFDB 4XUCA 3SS7X 2YWXA 4A0HA 4HS9A 3WQHA 1V4NA 3NIWA 4B45A 3IUQA 2DBYA 2D00A 2WUWE 1Z7WA 5D7NA 4JOBA 1GPWB 4PN3A 3PJEA 2QJFA 1RXYA 1B0PA 3LZDA 3ZQ4A 2GN8A 4XDGA 2E87A 5BV7A 1XI2A 5BRJA 5IVKA 2Z56A 2FCAA 2YYAA 4MGEA 3C16C 3I45A 5L95A 2RH8A 4YEDA 3CTPA 4ZGGA 2Q4BA 2FN8A 2SKEA 3W4KA 2Y9MB 5JBIA 3AYXB 1KI4A 4B6SA 1AQNA 4UUQA 5JZBA 2QR2A 3O1JC 1XLTC 3LDHA 1JKJB 1A9QA 1U2ZA 2H5LA 2PYZA 2GZ1A 1D2EA 3S2IA 5ALQA 3T3MB 4WOCA 2PGAA 2ZREA 4BKRA 5KKNB 2GJSA 2I91A 1EGHA 3TRDA 1J97A 4R2MA 5JW6A 2I54A 3I3OA 2HA0A 2C29D 4FGZA 1II8B 3DS8A 4BN4A 2NV6A 1MQ8B 4E5NA 2VJMA 1KJJA 1OLSA 4QOHA 4UUOA 2OQ2A 3CGWA 5DM60 2Q5QA 2P9JA 3EAFA 1ZD4A 3IOBA 4OO3A 2ZDQA 3TW8A 4JBLA 5FH9A 1IOZA 1L7PA 2XGOA 2FMHA 3CUYA 1YIOA 1NDQA 2O07A 2ZRHA 3OWOA 4KI0A 3QUQA 1LWNA 1OXVA 1EZZA 1PJ3A 5BN4B 3WX0A 5F5XA 4BX3A 3UB4A 1V47A 5JWOA 2QAGB 1GSOA 3A0RB 3L7BA 4MTCA 3MWYW 5EMJA 1Z26A 2VUIB 5A62A 5IP5A 2V7EA 3MQ2A 5H59A 4DCTA 2GGSA 4FU0A 3D2LA 3HB7A 2YNMC 2DT5A 3VYUB 2FLKA 5CH3A 4D56A 1D0IA 4CDGA 1BROA 4FN5A 3JATA 2VNHA 4UUPA 1FYFA 2HJRA 4QC2A 3TR5A 1HE8B 2OXCA 4JLUA 4GP9A 3UYKA 4KP7A 1ZI6A 2JGAA 1U02A 3PNKA 2KLBA 1F5SA 1GZDA 1IM2A 1N7JA 4R3UC 2BCEA 2JLUA 1QK3A 4R9UC 2WF5A 2AHOA 2CFCA 5BOSB 3TSOA 5FIUA 3U1TA 2ZTHA 1CHDA 4LRSB 2Q0QA 2BH2A 1B8VA 1AZLA 1BAPA 1WRBA 3FOBA 1VHJA 2HU2A 1C2YA 4PTYA 2RB5A 1WBJB 1SHZA 4HRYA 3CT6A 1FYVA 4LZLA 2BDUA 3PUKA 2NP6A 5BR8B 4GXQA 3AWDA 4G4SO 1JFSA 1RI5A 2D5CA 3NHFA 4R81A 5COAA 3I12A 1PJLA 4PGAA 5HIIA 1V43A 3HLYA 1N77A 2C3UA 4MSUA 4KB5A 2B8TA 3MQFA 1Z15A 3PEYA 2Z6UA 1L3IA 2EBWA 2HHAA 1JILA 3HEBA 6NULA 3X1WA 2CMDA 2IYTA 2ZW9A 2CXPA 3V4VB 3ISVA 4I1VA 3AL0C 1PS9A 1EKXA 1S4QA 5HDQA 1AGPA 3QUTA 3NEPX 4JMLA 4C3VA 1V5FA 4H1HA 5KMGA 1P7CA 3FMPB 5BYJA 4OQPA 4WKPA 5HM6A 4FR5A 5ALMA 3UAYA 1JIIA 5TS2A 4IPTA 1ZIPA 4QQ8A 2CV0A 1GM5A 4KRYA 3U48A 4H1VA 1Y7PA 2HPVA 4KVFA 4LK3A 4W8GA 2DWUA 3AEXA 3P19A 1VA4A 1NLYA 3DTVD 1LZKA 3QEKA 3VBCA 4X1KB 1SB9A 1W25A 3GEDA 4O3FA 3MMXA 3VPHA 3U56A 3ZNQA 3INRA 2NUTB 1M6EX 2ATXA 1MPXA 3OEHA 1NATA 2E48A 5I5GA 1KVRA 4ZYXA 3E3NA 5LC1A 2G5PA 3HADA 4GVXA 3R9IA 3MCAA 3F3KA 3MMNA 4XB1A 3NHYA 2PV7A 4Q9IA 1ECPA 3SSMA 1A96A 1EG2A 2H1RA 2H85A 2OGZA 1DUSA 2PX8A 3ESXA 4HAVA 5KCZA 5CNMA 1N6HA 5U1PA 1J49A 5E1DA 1CUJA 3ZDZB 3VR3D 4YAIA 1T5DX 2XD4A 3WK7A 2QLLA 3TDMA 4JKYA 4ILKA 5AW8A 4ZVQA 5FI5A 3IALA 1XQ1A 4GZLA 2QP9X 3SXUB 1U4NA 4X97A 4ZOEA 2ZVJA 4FEGA 1K7XB 2WUGA 2EJBA 1UBSB 4QECA 4D9MA 3GZNA 4ECAA 3OCUA 5DTIA 4CIVA 4F84A 3GN1A 3NTLA 4MKGA 1DNPA 5A06A 3V8BA 4RS3A 4OMUA 2X22A 1WSWA 1XZIA 3LXXA 2KM1A 3D4PA 4ZODA 5FA5A 3R8FA 1EXDA 1QNFA 4W63A 5B2ZA 3MJHA 1GQRA 2VHZA 2P35A 3VPCA 1N5OX 1I13A 1PX0A 3G1WA 4RVDA 3REQA 4BNIA 4AJKA 3W77A 2VJOA 4HR7A 4L02A 2SCUA 4XASA 2GN0A 3WHLA 1CUDA 2OGTA 3FPKA 1X7WA 3QWFA 3V3TA 4YB8A 1GPUA 4AXXA 2HX1A 2VUTA 4O02B 3RVBA 1GNLA 1W34A 1KYIA 2H31A 4RDCA 3BBLA 2PMKA 3G8BA 2A5FA 3BD6A 4EY3A 1ZCBA 3UMMA 3WL3A 1KRXA 1GAJA 2GA8A 5BRNA 1Y1RA 3LYUA 2WY2D 3MINB 1M8JA 1E58A 1UP6A 4LJAA 3TZ6A 4AUNA 1W52X 1OUMA 1P1FA 3DXYA 5JCJA 3UGTA 4CR6A 1UDWA 1NF9A 2FMFA 4LYHA 2MU1A 1FMLA 4DVGA 3JARB 4S1VA 2H8KA 3HYLA 1NV9A 2C1EA 4G1BA 4HUJA 5FRDA 5M3BA 2EP8A 5AK0A 1NQWA 3FUXA 1DAGA 4XYBA 3SE0A 4BWFB 1L6RA 1DKNA 1S8AA 4J0FA 4DCVA 4R8SA 4PNZA 4I6JA 3LPNA 3UMSA 3JCZA 4YMWA 1KIFA 5J2UB 3VO2A 3ZDDA 1QSGA 4BN0A 1NHWA 4UBLA 3GRZA 3GEGA 2KBFA 4FCTA 2X8AA 4C6RA 3ZVNA 3LWZA 4YLGA 4YRRA 1BXZA 3CIOA 3G2NA 2GAOA 2VQDA 5HOQA 1FDTA 3ZWYA 1GQOA 1Q1EA 4LTDA 3VSBA 2DULA 5F33A 4K8OA 5IULC 1A2OA 1PW5A 2V3WA 3CB2A 3GNSA 4FIZA 2X2FA 2MSLA 2R1TB 3NPMA 4OKNA 4PFJA 3WWYA 2R84A 1RWOA 4BX9A 1W5SA 2V8BA 5CEEA 2AXPA 2WBLC 4CF4A 2GKSA 5F5LA 4QTXA 3D5EA 2X0FA 4DV0B 4MVJD 4TWIA 1IZ9A 2QMOA 3K0SA 4UM9D 4AVYA 3AERA 4FB4A 1R0XA 4NBVA 4ZEMA 4KBYA 4NE7A 5C53B 3EZLA 4EHBA 4A8JB 1DO0A 2VBGA 2ZRDA 1Q44A 3D0QA 5DN9A 4MQ6A 2BFMA 2Q3EA 3DUFA 3NVDA 1Z2PX 5K0LA 2IBSA 2R751 5B6IA 5F76A 3L1IA 3LUBA 4RLSA 1F9AA 3FKQA 4XWAA 2R5FA 4M1WA 3WGMA 5BY2A 2WB2A 1ZGAA 3WRYA 1XAGA 4J16C 2OZPA 4BTEA 2JFHA 4R54A 3RYIB 4WN9A 4UU1A 4JYZA 1OW3B 2NO9A 1F9EA 1YQGA 2ZIWB 2PUDA 2WSSD 2ZI4A 3EGDA 1QFZA 1V5WA 4ND8A 3KIPA 3PVSA 4RMIA 3U9TA 2I6XA 2XRYA 3ZLVA 2C4HA 2DR0A 3SJAA 3GROA 1W1UA 2B69A 3GP3A 4OBBA 4QAQA 1KU0A 5C1OA 4FGSA 5IK2D 1WW3A 5ER6A 4XR4A 1D09A 1ZIYA 1LY1A 2ZJOA 4AYWA 5JIBA 5A71A 1PR9A 3DGEC 2CMFA 1JAIA 2FZLA 1D6MA 3VU3A 2VDOB 3F8TA 3GLFB 4IHJB 5FLKA 4X92A 1PAUA 1CEQA 3QWIA 4AZ0B 4TLAA 3TRFA 7MHTA 4NI5A 2JHGA 3QVGA 1PJ8A 2JKYA 4XYGA 4M1SA 4GXRA 4MS3A 3TQFA 5DB4A 3JR7A 1U3FA 5BMVF 1SEPA 2JEZA 2Z9BA 2AFRA 3KHKA 5LLSA 5L6MB 1Q1GA 4ARBA 1QTRA 4W7HA 5CLQA 5EE1A 2Q50A 1OLUB 4WXHA 1BS9A 3RT1A 4AF7A 4EUFA 1T29A 1YKSA 1KA9H 1NMXA 2XQJA 4I1RA 1SXJA 4D8UA 2DHEA 1OOEA 4DBLC 1A8IA 4TVSA 3D4BA 4E2WA 1R0WA 1QP8A 4EYKA 1PTKA 2X0KA 4W9MC 2O7SA 5F9HA 1BZYA 4JUFA 5D3KA 4TTSA 5IXYA 4FC7A 2LCFA 4NFHA 5JECA 2BE9A 2FZWA 5IVPA 1VLHA 2H1FA 1OGYA 5DWDA 1AUXA 2QU7A 1XZFA 2OBLA 2F48A 3U0BA 2ZFUA 1U31A 2TMGA 2PX3A 4MV0A 2CVPA 4BIMA 2ZBDA 4BU1A 2ZJ3A 3H84A 3G8YA 1OFIA 1DIOB 4EGCB 5KHAA 2NG1A 2QX4A 1DCKA 1E0DA 2OLKA 2GVNA 2ADOA 2WV9A 2KWIA 1H0HA 1UJ5A 1U9JA 3LHSA 3PGVA 5T41A 5HRAA 3HTXA 1DJMA 4EWLA 4BO5A 2OSVA 5T67A 2DHDA 2X19A 2WILA 3OKFA 1QIIA 5LSAA 3WRWA 5LNK6 1BYIA 1HE5A 2ZSHA 3EXFB 2VUUA 4ZO8A 1LPNA 2VVTA 5FA8A 2CEKA 2WJYA 3AJDA 1U98A 4DQUA 4RJ2A 1SUPA 1SWVA 3HWRA 3WOVA 4D45A 4HDAA 2WF6A 5HQTA 5JSZB 1KRHA 1XRJA 1ZKMA 3GT7A 3P8ZA 2QNRA 3NTXA 3D8RA 1SUAA 5IC5A 4Q1AA 2IHNA 4B3RB 3PUVA 4W1QA 1EA7A 2Y1FA 3O8OA 4JUCA 3FLMA 3KQTA 4DA4A 4UOQA 4H4DA 4E70A 2BBOA 1VL0A 4Y6LA 3I5AA 4DKXA 4HNUA 5KNCD 1JHXA 1MEEA 1ZD3A 3P9XA 4RELA 5LA6B 3WGKA 4YUWA 3DZHA 4OF4A 3Q8XB 1EP3B 3IT3A 1H42A 2QZSA 3IJEB 3RSQA 1OBFO 4DXDA 4FOOA 3L46A 4JX9A 1I01A 1TKBA 1P1KA 2FW1A 1RBMA 1SKBA 2WVJA 4DV7B 5CLLA 5I7VA 2I2DA 2IYPA 4EHKA 2ZCJA 4UMVA 2WMYA 3IP7A 5G0SA 3KYJB 5A7HA 1TJPB 2QL6A 2CXSA 3EISA 3SNKA 1HLFA 2IE8A 2A58A 1L5MA 1N7GA 1SD2A 1VSTA 1D1QA 4FFPA 4NSNA 4UPVA 4P0TA 2ISQA 1XRNA 1Z7EA 3HJHA 1LNZA 2Z5LA 1HXHA 5LQDA 4C7JA 4L5YA 2EHJA 3RVSA 2QR5A 4E2ZA 1NRIA 4YNBA 1JHDA 2FETA 2WF8A 4HAOA 4DDHA 4MMYB 4C6HA 1WUHS 2VCEA 1JEYB 1DIHA 5FYDA 2XOKD 3F98A 3RBVA 1M2OA 4L4XA 1JPUA 1R0YA 4II7A 2F3RA 1GG8A 1ZHFA 1M1YE 2PGJA 2XGGA 3C8DA 3IO5A 1X15A 4M6WB 4R0VA 3UFXB 3SKXA 2PX5A 3I6MA 5KBYA 3C85A 3KZNA 4FZVA 5I7EA 1F2VA 1TU3A 1Q92A 3MGGA 3OFNA 2OYRA 3HUTA 4C78A 3NALA 4EEXA 2RGRA 2R6GA 3R20A 2LKCA 3C3MA 4IH9A 2YCLA 3B70A 3UH0A 5BP7A 4QLOA 4HB2A 3QX8A 3BGOS 2UAGA 4HDCA 4JQSA 1ND5A 3IAXA 2FG7C 4PZAA 4L3VA 4L0DA 2O9JA 3DH0A 4FGKA 1QQAA 1AE1A 1TJYA 2PTGA 1MC8A 1FFDA 2OFOA 4EI7A 1GAWA 3NBZC 1TZ2A 1ZNYA 8GPBA 4LJ8A 2V6IA 3JQAD 4NQRA 3TDKA 5HHTA 4ARUA 4LGCA 4FZJA 1FRZA 1L8XA 4GLBA 4QDJA 1KJNA 2QW1A 2AZXA 1HLDA 3EDYA 3AETB 2GBCA 2OT3B 4CBVA 3AZPA 1HF3A 1WLSA 2FDRA 3UHFA 1MQAA 3HJFA 3QA3E 1RRKA 3IQXA 4O29A 5D84A 3H1BA 1K98A 2AW3A 3GQVA 1N8SA 2V55B 1WXXA 4HAXA 3W2FA 4DTCA 5FWAA 3A3OA 1B8OA 3HVIA 3KOOA 5DK6A 1YFZA 4ZU1X 5LMUB 3W6PA 3SBOA 1ZM7A 3OJFA 3WTBA 3DNFA 4YPFA 1C3EA 1E4EA 2VWGA 4F3KA 2BHNA 3N0XA 1FFEA 2J6CA 3PR2B 1UAYA 1E5XA 4QLBA 2PPLA 3L2OB 3RRXA 2YJ5A 4MW2A 1ZIXA 4QYWA 1L7QA 1M6HA 2GZMA 5ESRA 3ME5A 1HOTA 2IWRA 4G2TA 4W8OA 2BEJA 4BQOA 5L9AA 4W7SA 3W9YA 2BCJQ 5DKFA 4DFDA 2TRSB 4WPGA 4REQA 3M4JA 2OXTA 2JJYA 2ZVPX 2JZNA 4NNOA 5EKSA 3ZD8A 4YJ2F 1N9GA 4A82A 5L3VA 4HH4A 2O52A 3HQ4O 1US8A 3S70A 1G2PA 5LYJA 1QOQB 2ZPAA 5HUHA 4A2PA 3WA7A 2VPTA 3ILYA 3R0XA 1QJ4A 2NTEA 1KJIA 3UXMA 4Z5XA 4CKYA 2CMKA 1UZNA 4JJAA 3WB0A 2B4KA 3LL4A 2D5LA 2JNWA 3EGCA 3DZDA 2FSVC 1NE2A 2OD2A 2WWWA 4HQKA 4WAUA 3T3PB 3BH0A 1ENZA 4J76A 1T2UA 1Y7HA 1T2DA 4RZ3A 2IY7A 3GRUA 1YZQA 5K0TA 2CHVA 2QQGA 1QRUA 2P3SA 4Y2QA 5EMKA 1RYMA 3M4ZA 3NX4A 5C5CA 1GR0A 3EARA 2WE8A 3CISA 3PXBA 1EVZA 4L4UA 3U26A 1MHPA 3UHPA 1KR5A 1JKJA 1R6BX 1L1FA 4LYYA 1CQPA 5I48A 3DMRA 5E9JA 5F77A 3W2IA 4LFBB 1VPEA 1A9PA 4MV4A 1WXDA 1IBRA 1QGAA 2QT9A 2VN8A 2W6OA 4HNQA 1YULA 4UNSA 3A9VA 2YUIA 4XQ9A 5ANRB 2EWWA 3VR4D 3MJSA 1II8A 1K7FB 4XDZA 2WF9A 4L08A 3WB9A 2GA9A 2JGKA 2NNLD 3SC6A 4CEHB 4MRNA 3KT8A 3FNQA 3UJHA 5LQAA 1JSXA 1M74A 1YHZA 4REOA 3WLJA 4DIFA 3VTAA 5LDHA 2CXTA 1NBEA 4J4TA 2FVXA 1D1SA 1DC6A 1JKFA 1GKUB 1LVUA 2H4HA 2YOHA 5G0WA 3W3AD 4E5VA 4KWEA 3ISTA 1ADYA 2H3EA 5BN4A 2EP5A 1IYZA 2FPGB 3GD5A 4WLOA 2ZB3A 4FLMA 1IIBA 2QAGA 4DF3A 1I4TD 1Z4LA 2QM0A 5T6BA 1Y6GA 3X1ZA 1FZTA 2HZBA 2EBHX 3BJMA 5K20A 1DKLA 1VP3A 1W46A 4ARSA 3PC4A 2EL9A 2XQGA 3CKMA 4IW3B 2VPYA 5DM0A 4BATA 3H87A 1M1NB 4BV9A 5LZ5A 3SSAA 2O2ZA 1EAMA 3B3QA 3LUDA 3FCSB 4IKPA 5GQSA 2OPHA 3WNZA 1WW8A 2ZE5A 3T12A 2ZRAA 1LRKA 2DBRA 2YDXA 1VYHA 3C4QA 5DNDA 3WVNA 4EQ6B 1T15A 4ETWA 1NLZA 3QNWA 4Y2TA 2BE7A 1H2YA 1TKRA 2J6BA 2YZMA 1T10A 3DV2A 4LFCB 3LD9A 5ILOA 4XARA 1EESA 4B4KA 1G42A 1WUTA 3MJEA 3HVJA 2IH5A 4F45A 3E8SA 2YHAA 1QNLA 4ZT3A 5AVUA 1P77A 4E09A 3I05A 3I2HA 3GJ6A 1IN4A 4MV9A 4Y0VA 4Z9FA 2Q2VA 3P0FA 4JB3A 3JRWA 2ZULA 3A26A 4HJXA 3SLRA 1FSPA 4J6EA 5IJWA 1CJTC 3AF2A 3TB6A 2HCBA 4P22A 3IQDB 5F3DA 4U3JB 5KOYA 5DTRA 4B87A 3HI4A 4CN9A 2XCUA 2NUBA 4BXOB 4HXGA 1HT1E 3Q0TA 3TX6A 4NC9A 3PUXA 1WDTA 2ZSBA 1P2BA 4XWOA 3HABA 2Q3LA 1YDGA 5IT5A 5JMWA 2GYYA 1U7XA 1UBKS 4PX2A 4MVJG 5CLHA 5HW0A 3HUUA 3VYVA 5CFRA 5EJ7A 2YVAA 5E6RB 1ONBA 4LNHA 1J8YF 1P6QA 4FEAA 4XIGS 2F55A 4GPBA 1H23A 1YJXA 2BONA 2H5IA 5HBRA 2NV0A 3BWXA 4TKMA 1BX0A 1KEUA 4ZVTA 2JZCA 4JP1A 1NI5A 4YDHB 2C9YA 1GTMA 4DYDA 1IU9A 5FOTA 1RC0A 1IVNA 4EJ2A 4K81B 1U7DA 5JZVA 2R0QC 2I2WA 3DAGA 1NLMA 3WKDA 1Z7BA 4NE2A 4Z1MA 1PEAA 1PQWA 3GEIA 4PCAA 4C21A 1E3EA 3GPCA 5TQ2B 3AV3A 3NV9A 3QXCA 5ERYA 2YV1A 3GUZA 2M6SA 4Y9RA 2D8MA 2WUVA 5DSTA 1SC3A 3MQ4A 3QHPA 4ZI5A 3RARA 3RKUA 4O4LB 1WZCA 2HJWA 3A28A 3WYAA 5IJ0B 1G20A 3OESA 3ABIA 4MR7B 2JIMA 3RG8A 1KOJA 3HGMA 2JH3A 4FONA 1T9BA 3RS0A 5BVHB 3ORQA 1II0A 4OQZA 3GCZA 3OICA 1AB6A 2WU3A 5CJ2A 4RTMA 3DE5X 1ZG3A 4J0HA 4BGVA 2YMLA 2H1CA 4RENA 3N74A 3SXUA 1O89A 1UOOA 3T95A 1SKYE 1YL5A 3KJEA 4RE6A 4C43A 1QTQA 2J3KA 5JJLA 2DTXA 5K3AA 4B1FA 2BI8A 4CI0B 1P0MA 4KTTE 4MCJA 4S0ZA 4UZSA 1MAUA 1M8KA 1AU9A 3MUFA 4YECA 3ZQUA 1G3QA 1D4ZA 1DT3A 3AP1A 4F5YA 4GLLA 2FF7A 5LWHA 1U2DA 4HH0A 2I80A 1QWOA 3AM3A 4TV9F 3PFCA 5ALHA 4I9GA 4AC9A 2JLXA 2YRXA 3T7SA 3ZE6A 3TM5A 4Q4HB 4MEAA 2JI4A 4I08A 2PE5A 1MB0A 3HP7A 1A1VA 2V6JA 2JGMA 4P33A 2PWZA 4EHHA 2LCIA 4RTQA 1YR1A 2AJLI 2J4FA 3BTSA 3P4UA 4FGUA 1Q20A 2QMUA 2WUFA 3EUAA 4QU8A 3SOPA 3CVXA 1G38A 1TGYA 2P4UA 4RHTA 3G2QA 2TECE 3Q87B 3TRIA 3OHPA 1NY6A 1VB3A 3E18A 5LIPA 2LVBA 2ZQZA 3DJFA 1TA0A 3LV8A 3NYRA 4Y67A 5IDYA 4RVUA 521PA 3IERA 5JVDB 4I46A 3PQ3A 1YQQA 1OLXB 1UOQA 1NPYA 5FNVF 3TPZA 4HQ0A 2RHOA 4NNPA 2OQVA 3VDQA 4MP3A 2H1IA 1KFEB 1R6VA 2HCTA 3WO0A 3MINA 3FFBA 4MLPA 5IDWA 4RULA 3MAGA 1NONA 1E1RA 1UJMA 4H59A 4FKMA 2C9CA 5CT9A 2RAPA 5DNWA 3TTXA 3W8RA 5IF3A 3IP5A 2GZ3A 3JARA 4WNCA 4L8WB 2P68A 4RQAA 2B4YA 2NM0A 4UAUA 4TGLA 1LBEA 3EFBA 1JH9A 4UASA 4NESA 1YR3A 5AVWA 3AUSA 4ALJA 4B34A 1QGED 3I6YA 4OG2A 4PQEA 5FPTA 1MOQA 5FBVB 2CLLB 1FS5A 3LCMA 5E4FA 5J2UA 4B7CA 3VUFA 1A5SB 2IK8A 5EKUA 2VHCA 3BWBA 3CINA 3UKDA 1L1RA 3C0KA 1E8MA 1I14A 1NW9B 1S1MA 4PXSA 2AXEA 2I65A 3FN4A 4GOOD 3JVDA 4MQBA 5EEHA 3DBRB 1GLGA 4S2EA 3V48A 1N1EA 2VUHB 3IX7A 2DR3A 1ABEA 2DKOA 3LIIA 1JBQA 2BGJA 4URWR 3NBFA 4JEHA 4LQDA 3IKMB 1EBFA 2V7TA 2DLDA 4OV6B 2JATA 1Z74A 3IS3A 2R1TA 2JIQA 1V2HE 1YKFA 1O54A 2VL7A 4G1MB 3G7UA 1R0KA 4KQWA 4KQMA 3S55A 1V1JA 2Q5JA 5LYYA 4EKDA 2VKQA 2ZZMA 4PLZA 3M2PA 3E9QA 4FUTA 4DZRA 3OEHD 3U60B 1YA8A 3F71A 3C5VA 2VXYA 4NHEA 1YBHA 3C3DA 3F9IA 1RRFA 4A8JA 5DSZA 3ZLBA 1SC6A 1WV0A 3K09A 5CURA 3U4DA 1M9NA 4UJ3A 3EDOA 5CBPB 1XDBA 3PEUA 4FOSA 3U09A 1V11B 1RQXA 5FOSA 2NQ2C 4IXWA 2NZYA 2FW7A 2QLNA 2QPTA 3HMQA 3KBOA 3ZH9B 4IJMA 2RK6A 3DXZA 2V7GA 4L95C 3RYIA 4BKOA 1CQIB 2FNAA 2G7ZA 1JG7A 3KEOA 1ZUNB 2AV6A 2VDNB 4OHVA 4KOEC 5C0OE 3TAXA 4QGAA 4F9EA 3HU1A 3VAAA 1P3Y1 2YN4A 5DCYA 4WUVA 2VCYA 1FLDA 3IOCA 3RYFB 4EKGA 3KQPA 3AVYA 1GZ5A 1WLYA 2P6NA 1U9IA 1IJKA 5JT1A 3W5HA 5B3JC 3M83A 5EHNA 1YUNA 4EPTA 4BB6A 4HMOA 3ICPA 1MD9A 3ILXA 1VTKA 1MRNA 3E7XA 3IRUA 3JYOA 1EP9A 5HGJA 3RANA 1BRTA 3K92A 2LUOA 2OV3A 2WWXA 1RLOA 1D9ZA 2WHRA 1JTVA 5B4TA 2AVDA 1RQPA 2ZYGA 3BIOA 3KLMX 2RKOA 4IHJA 4MWTA 4XIYA 2PZEA 2W2XA 4AZ0A 4EG8A 4Q39A 4XFDA 2PKWA 3H5IA 4FS3A 4KHZA 4R7ZA 4KFCA 3RVQA 4PSCA 1J24A 1LK7A 3RS2A 4ATNA 4EGQA 4IF4A 4M49A 3JTEA 3OJWA 2O8EA 1SVLA 3RH0A 3NYIA 2E18A 2WYOA 4KQJA 3U7RA 4F6CA 4OJQA 1MENA 3HYSA 1ZBDA 1R2QA 3BCRA 1BIFA 1B26A 5HIKA 2XB6A 5LUBA 4YYEA 2JLWA 1H6BA 2VP4A 3C6YA 1WDLA 2HCFA 3DOCA 4IMIB 3ZJVA 4V24A 3DL2A 2W5UA 3O83A 5GZ1A 1HFEL 2AOXA 1IWBB 1SCAA 2BZSA 2D2FA 4ZQFA 3RW9A 2B0JA 3P45A 4E2XA 3AZQA 3H9QA 4L3WA 5JCJD 3NIFB 4NU6A 2C0QA 3BL8A 3QBJA 5K45A 3HPQA 3Q0IA 2HB6A 4JP2A 1I9CA 2BIFA 3JQRA 2C5EA 1W0CA 2XUGA 1KMCA 3GWGA 4PYKA 3UNXA 4DWVA 4QOEA 1ZGJA 3VI3B 1L4HA 4QHSA 2ZIXB 3V80A 4OU4A 3W78A 5MN6A 5E1MA 2Q8NA 2EJWA 2GN6A 4AY6A 3Q3EA 3UTDA 3O26A 2X4GA 4U7TB 2E4AA 3LG2A 4XX1A 5EXPA 2P9GA 4PZ9A 4WXPA 4JI8B 2XDYA 3TR0A 4MIYA 1MJ5A 2AEEA 2OTCA 4X93A 2XVMA 4YMLA 2UUBB 1G8YA 2WDPA 2O4UX 4MV7A 4MCIA 1N6OA 1QE3A 3EXFA 2CXHA 3C3PA 3CX6A 4QWMA 4XPIB 3WK5A 1E2EA 3AKEA 1ZVVA 2WTUA 1U4OA 3WYEA 4WWHA 5FV7A 5JSZA 4G23A 5HCUA 1YS1X 3DGFC 3DEZA 2R66A 3ND8A 4KOAA 1DADA 2I2BA 2IA5A 2R1VB 5ALDA 4B76A 1PUIA 4A6PA 2AC7A 3MZ0A 1TFRA 1ZHHA 4MVJF 5IC6A 3M1IA 3PGKA 1XQ9A 1VDZA 4DLNA 2OZEA 3U3MA 4GOJA 5THKA 5LA6A 3VFDA 4YWHA 1EVJA 3N87A 1J09A 4FLFA 4XW2A 2Y0PA 3H13A 3L8HA 5TDHA 3EVEA 2GILA 3GR6A 5DYTA 3RAEC 2XGMA 4KC0A 2RGBA 3OQMA 4OHXA 4DCMA 1F14A 3JY6A 3MIZA 2PBLA 5CVVA 4EG3A 1X8XA 1W36D 3DBOB 1W85B 1O6ZA 1ODJA 4C2AA 3RJMA 1UZUA 4XLLA 2EJUA 4PNHA 5J4YA 3ICOA 2GBIA 1HLPA 4BNLA 1JLHA 2F59A 4AO8A 2QSZA 4IICA 1QM5A 4D8VA 4KO4S 2FKAA 3G5MA 2Y2UA 1RJDA 2DHRA 3QOFA 4J9UE 2WWIA 2ZTSA 4P3NA 4YLYA 2HR1A 4OXIA 2GX6A 1VKOA 1R7RA 1OFVA 3LOQA 5IASA 1DWUA 1EK6A 1JXMA 1FL9A 1KWKA 4NCHA 3BXOA 1FNSA 4PX5A 1KQGA 1VQ1A 2C96A 2GJAA 2ZSEA 3OKPA 5JYEA 2CUKA 3KKLA 2IS4A 4E46A 5AD1A 5KDLA 5I7WA 2YV4A 1P8AA 1VG8A 4M6WA 2QN7A 1M67A 3UFXA 4H0NA 4EG7A 2WWVD 1Z6ZA 3GB9A 4PSVA 5BXQC 2REQB 4H7EA 3ZY2A 2P1ZA 3CO0S 3PXUA 1LSUA 2C99A 2V7BA 1MW8X 1E9DA 4TWZA 1WBDA 3Q3HA 1C0EA 1SK9A 5E9QA 4ZOAA 1UAAA 4AS3A 5A02A 4TMZA 1ODTC 3OTQA 2Q5LA 5H3HA 2GF2A 4YP6A 1Z4PX 5KUTA 3S68A 5I51A 1GT91 1LPAB 3JZIA 3VX4A 2WKPA 4KHPB 3IIIA 4TV8B 4C7MA 2OMEA 1QIEA 3V55A 1QS0B 1WPGA 4ID3A 1SXJD 1FFGA 3NEYA 1E3JA 2EZ9A 1Y9AA 1NR7A 4QQRA 3IULA 1M1UA 2BMAA 3OEEA 4ERXA 5F35A 3U39A 1MB4A 1Q0SA 2G6BA 3PX7A 3AETA 3DV0B 4WKGA 3E5MA 3PEVA 1V9SA 1W2WB 2ATCA 1K8ZB 1U3WA 3FFWA 2VF2A 2ZUTA 5ALXA 1Z8NA 2IEYA 2A9VA 3D4LA 3TD9A 3TUJC 2QXYA 2ISSD 3FNEA 3LYLA 3ENQA 5K3SA 4YGYA 1O87A 1BX3A 5IVHA 2AMVA 2JI6A 4TVOA 3ZV4A 4EBFA 4OXRA 2BTOA 3WGTA 1BD3A 2VHQA 1JQLB 1ISPA 4W99A 2VQSA 4BQFA 5FBRB 2HWWA 1MKYA 3MD9A 3MGBA 4NDNE 3DEHA 3TOVA 1VL6A 1SOWA 1RBQA 4XH9B 5GMOA 3R5KA 1QLHA 2HNKA 1OIXA 1NVUQ 2G9RA 3AEUB 3IURA 1FYXA 3PNYA 2IVZA 4Z0PA 4S1PA 4OHYA 3TZLA 2GEBA 3FUCA 5H4HA 3MXOA 4M9RA 4ZVNA 3LDUA 1EEHA 4D0RA 4ER5A 4G0YA 5CNIA 2GK3A 3CA8A 4MW1A 3S27A 4AX8A 4MWSA 5DX1A 4G0QA 5KNDA 1USIA 5IYZF 3NFRA 1NLUA 3OQBA 5C7OO 3L7NA 3GFRA 5D3QA 4AJJA 4DMHA 4IH1A 5KNBA 2R7LA 3SSOA 4HS4A 3ABRB 4B5KA 3Q2OA 1EJ6A 1JI3A 2C0CA 2HMWA 3BFKA 3H6KA 3CTMA 4G9BA 2JZOA 1KDVA 3RD5A 3SHOA 3W3ZB 2ZSUA 3RVRA 4IUBS 2AXQA 1CETA 2X5KO 3W2EA 3WFJA 1LSOA 1QF7A 4QQKA 4CKZA 1YA4A 2B8NA 2VF5X 3FY4A 2ZOSA 4IIXA 4N82A 4UAGA 5HWSA 1E9CA 4P9NA 1JT9A 1Q1AA 1CDDA 6REQB 4M21A 4ARZB 3N2NA 4F6LA 1NGSA 2RHWA 1NP3A 5C32A 5AQ1A 2RH5A 2FH5B 2HK6A 1R8JA 3ODGA 1SZCA 2XRMA 3DCIA 3SHTA 1C8VB 2VJNA 4LDQA 3WO1A 4YRBA 2QPLA 3LHDA 1O7JA 3OEYA 4HXYA 2RGXA 4I4TF 3ZHUA 3JALB 5G41A 2BKAA 3NWEA 2C31A 4JLDA 5L3QB 2GSDA 3CE6A 5BOSA 5CCDA 1AKUA 3K9WA 3CUTA 3P1JA 5EHQA 5GAJA 2IW1A 4CEHA 2LRHA 4ZAZA 3F6PA 3JYNA 4BLTA 4WA7A 1NIJA 3P4YA 4OY3A 4BFXA 5IDXA 3OFND 4XPZA 4CMKA 4D6XA 2W2VA 4TRRA 1NMQA 4X0EA 4AU1A 3M9LA 1Z5WA 5JCPA 2HV9A 2JAPA 2AB0A 2FR0A 2H6EA 3A14A 2TSYB 4IIHA 4PPQA 5KTTA 3GFPA 4ETNA 1D6SA 1RYNA 2FPGA 3TR6A 2RAUA 5AOVA 4PC7A 2BRUC 1C3OB 1NBIA 2OC9A 2ONKA 2OAEA 1ECLA 3DMFA 1G20E 5FUBA 3U3DA 4PN7A 2OBMA 2ZWIA 1UXIA 2WI8A 2LP4Y 2HK7A 2Q21A 2ZR9A 1QLWA 1VG0B 1RZVA 1SG9A 4ENTA 3CZ5A 1T2EA 3Q88A 1JWLA 1M1NA 3NIBA 4FBGA 4OBWA 4B3CA 4A2CA 4DM4A 1LC3A 5FX2A 1JKXA 3ZIAA 3JYQA 4HF7A 4KXLA 1Y1SA 3H9BA 1E9AA 3KG2A 1V8PA 1EJBA 2ID9A 4D43A 4FDAA 4BNJA 4ZI3A 1XF1A 2FQXA 1T4GA 3G23A 4EQ6A 1DXYA 1NU6A 5D8DA 3PGA1 3SEZA 2PUAA 4P6VF 2C42A 1DHTA 3G8DA 2OP0A 1RQ7A 5F1OA 5C35A 2GK4A 2IS6A 3GLRA 3TGPA 4KAJA 4RACA 1MH1A 2X8BA 3K6KA 4ZQBA 1G3RA 3A1WA 1QIGA 2EGGA 5DU2A 5JXGA 3OCJA 4MWZA 1PFWA 3LX4A 4BFSA 1N8TA 3BX1A 2PX2A 4EJSB 5IKEA 3L0IB 3NB0A 4LDJA 1MOSA 2QIOA 4OAOA 5HF9A 1JHVA 3UK0A 5EKTA 1LI4A 1UPAA 1PWZA 2E3JA 2Y1WA 4ILEA 2UZIR 1A72A 4IUYA 4K9DA 4QPPA 1E2NA 2C7GA 1SVIA 4M76B 2MSEB 2IQ5A 2VQ3A 1KDTA 4ALNA 3NV7A 4O4JF 2OBFA 3RUFA 5JDCC 1KAOA 3BXXA 3OX1A 2AK3A 1BDBA 4U3JA 3E5NA 4PLYA 1WXFA 3PD7A 1X9HA 4JCCA 4JJGA 4Q5IA 3ZJ5A 4U5QA 5LQNA 2HHHB 5IXJA 4BXOA 1CRLA 3FPBA 3MJRA 4UTNA 3U80A 2OCGA 2W0SA 2ZIVB 5J40A 4ER6A 1DAOA 2AI3A 1NF3A 2GD0A 2PU7A 4PGHA 5DX8A 2E6KA 5E6RA 3E81A 3NBQA 1YTLA 3NRBA 4GR4A 3PRKE 5K8VA 4HDKB 2YY7A 2XGSA 3ZGOA 2UYYA 4DB2A 3G5UA 4EUEA 3L0PA 3KJHA 4TYQA 5EOVA 4DDVA 2CHGA 2EF1A 1W35A 3SD7A 3IDOA 2QX9A 2ONYA 3CZAA 3DVQX 4JX8A 4WACA 4MV1A 4J3NA 3L4BA 4R1UA 4CKBB 1ZP6A 2OFXA 3KE8A 3N2LA 4Z4GA 3UIEA 3LPMA 5JUWA 4AXBA 5TQ2A 5EJ5A 3CSSA 4G4JA 5CDYA 2M9MA 2ZT7A 4GLJA 1XMOB 2YBEA 1X0XA 4UFOA 1FU7A 3WMRA 2G6TA 4JR0A 4CMEA 1U3UA 3LT1A 4O4LA 4W9NA 2Q3CA 2GF9A 1JSCA 2C84A 2E2WA 5TEVA 2FX3A 2P2DA 4MR7A 3MLEA 3K6RA 1RQRA 1MXHA 1RLMA 2AJ8A 1VCOA 1YOBA 1VA5A 2AI2A 1RYBA 2CW5A 2ZUVA 3BWVA 3H0EA 1QIJA 5K4AA 1CB7A 2B35A 2P9HA 3EA0A 4OLHA 2GZHA 5BVHA 1BRMA 1Y8CA 4IHAA 2D1TA 5EE9A 5F51A 3MGCA 1A71A 1U5CA 3L7LA 4M8IA 4IMPA 1JHQA 4EO9A 4BBZA 1K5GA 1X1QA 2CFRA 4I81A 4MUFA 2O59A 4I3FA 1TCBA 1VFPA 5AM5A 1XBTA 5LMCA 4RGYA 4AQ7A 2DFPA 5IZCA 2JAWA 2X41A 2ISCA 2I22A 3VU1A 3EVZA 5ERGB 1S3FA 4TOIA 5KOHB 2PXAA 3ANSA 4G4IA 3IESA 2EGUA 2CGEA 3QZUA 3VGJA 3WI7A 2Q7XA 2EDCA 1EG7A 4BGUA 1L4EA 1LI7A 2FAXA 2FPPB 2EFCB 2XWQA 1PN3A 3QNMA 3NIGB 4Q4HA 5DXFA 3OIGA 4J0CA 5DX0A 2YMMA 4D02A 1E9VA 3DLIA 4KVZA 4F3YA 3CWCA 5EHIA 5KOJB 3WRXA 5HIMA 1AJEA 1KJWA 1J33A 1USUA 2FJ0A 1PF7E 4LVOA 1TUBA 5DSXA 3S2EA 1AO0A 2JFQA 2GHTA 1TKAA 2GYWA 4LTMA 1XU7A 4G09A 4MW7A 3D8HA 5JVDA 2NACA 2WQ7A 1OLXA 2CT8A 4GL4A 5DTJA 3SJUA 3HY3A 3S81A 4PRYA 2A88A 3O4IA 5DMHA 2VHWA 4UNNA 3ZQJA 1CCWA 3NUQA 3IUBA 5CGQB 1EB8A 5TEWA 5EIXA 1UJNA 3EQ8A 1L5WA 4D2IA 1GCAA 2F3UA 2O0HA 3MCTA 2NO4A 3IVAA 1ESMA 3TW6A 4FK8A 4UFNA 2CLHB 1ID1A 1SRQA 1MUUA 3JVIA 2WSMA 1QOZA 2J30A 2EQBA 2EFGA 1IMOA 3HB4X 3ZDBA 1NVXQ 4CMBA 3IIKA 3LQ1A 4RY2A 4PZUA 1L4KA 4GW3A 1OIWA 1XEAA 3TLJA 3N8HA 1MJHA 2G71A 3VZCA 1GYPA 1NMSA 4CGYA 2C8KA 5BOVA 2CHEA 1FNDA 3DMPA 1ECFA 2R7MA 4EKNB 3QF4B 3TFQA 3DBRA 3SQOA 1NVTA 4KIWA 4BNDB 3P26A 1R8XA 2Q9CA 1U8ZA 2IHTA 2WEKA 2QN2A 3PQDA 1IY2A 4DMGA 2IPNA 3FJYA 3ZZMA 4UFPA 1NJFA 2Z8ZA 1E1QA 3FTEA 3ASVA 3L05A 3ZWXA 3TSZA 3SDZA 3DF9A 1FFWA 2PUHA 4NYMQ 5AVOA 3A1TA 4AN1A 5L40A 5JS2A 3P5SA 2ZIFA 1IZYA 4Z1MD 5JAMA 4FYMA 1QC5B 2AEFA 4RZIA 2ZM5A 2WMOB 3KFLA 3GT4A 2V1UA 1Y9EA 1KKUA 1LS1A 1ZINA 2G1AA 2GD2A 5IANA 2J59A 4HQNA 1RHUA 1TA9A 3OCYA 4M1QA 1L5HB 2PZKA 1JIVA 4TTVA 4Y2UA 4BMVA 5JATA 4GX5A 4QBHA 3WV4A 3O3OB 1V11A 3MIIA 3ORRA 4TMTA 3QKRB 1XTVA 1EK0A 4KO8A 5JSFA 5LIRA 4IEFB 4JC5A 4AJLA 1RAHA 3WGQA 1CQIA 1MIHA 1JFVA 1WE2A 2X42A 2V0CA 1ZUNA 3GUYA 5DTMA 1KY4A 1IIRA 1ZW1A 5IBPA 5DLPA 1QTIA 2FWIA 5BVGA 2RK4A 1JA9A 3ZWPA 1CIPA 2M2IA 1J7JA 1E3TA 4LY3A 3HV2A 4NYJQ 5DK4A 2QZ9A 3RYFA 3T3HA 3X1MA 3KETA 1N32B 2HO4A 2LD4A 2C5FA 1E0KA 2HF8A 5EXSA 4F5EA 4B3IA 4HBGA 4BB5A 3KO8A 2FZ4A 5EVJA 2DZDA 4LDZA 4YC7A 3U7HB 1GT6A 2OB2A 3HJUA 4X9XA 2PXXA 3ZE9A 1A2BA 1YJ5A 1P9RA 2MDTA 1XWIA 5DTQA 2PHZA 1EUYA 3L4SO 4K2HA 4QNMA 3P20A 2QVZX 3PJDA 4PC3A 5CG2A 3CUSA 4JELA 5AJTA 2QNIA 4DT1B 1BCRB 1HYEA 1Y7TA 4PAMA 4TLMB 3ZI0A 1EDDA 3BHJA 3JZMA 4D9BA 5AW6A 5JDIC 5L6LB 2GNPA 3O21A 3IPLA 4QUGA 4N0EA 4TWBA 3BEDA 2E4VA 4BNKA 3CFYA 3KVOA 3HCAA 1PT5A 3DE3X 4M36A 4XVQA 3TAHA 2QY9A 2C82A 5K4HA 5ALGA 5ALYA 1BKSB 3RF7A 1YB7A 3EVNA 2YZNA 3TCXB 4DABA 2QLMA 2WMDA 1SBZA 1GL6A 4PANA 1SK8A 4Z8XA 4ENVA 3NVMB 5CXQA 2ADMA 1N36B 3TEJA 1GEGA 3BJEA 3GJ4A 1E1RD 2HAEA 2KB0A 3KYCB 4MYCA 1IHYA 2C57A 2XQIA 1DARA 2AG0A 3G0IA 4RWZA 4YS6A 2BP7B 2Z3WA 1KIMA 4E33A 1KEEB 3BZUA 4A7PA 1M6NA 1E4VA 3D6HA 4F5ZA 3PHGA 1L8AA 2ZSIA 3T1VA 1H22A 5CRIA 2E1PA 2ZIXA 3SKYA 2B78A 2VJYA 3MERA 5HQ3B 2H4XA 3D4OA 4ON9A 4RXTA 3OY7A 3SC2A 3RRMA 4OB6A 4CM9A 5BUCA 4MITA 1E3WB 2XUPA 3I1YA 3QELB 2HA6A 4PVDA 1PNQA 4H16A 4XLZA 2VXOA 2Q2OA 2Y93A 5SY9A 3LQYA 3Q3VA 5DV9A 1T3TA 2IS1A 1KPGA 1NRJB 1T4CB 1CY8A 5IT0A 1ECGA 3LQKA 3NO4A 5I4CA 2ZSKA 1EFUA 2FPIB 4GMHA 4HLQB 4R51A 4QIHA 3COPA 4F7DA 1WAMA 5D2CA 4OXQA 4XPIA 3M49A 1J42A 1M6YA 4EMSA 3ZY5A 1M1ZA 4N3BA 2RARA 2IEZA 2PS3A 3U40A 5JAUA 1IPHA 5MFPA 2ZIGA 3AY7A 4WD3A 5D01A 4EMBA 1Z06A 3S8YA 4HTFB 1E96A 4S05A 1BGXT 2X0RA 1QVZA 2FFHA 2R1VA 1E9RA 5GVRA 5JEEA 1W44A 1WY7A 3GNTA 4RLHA 3UWOA 1MABB 4QJIA 4ZU6X 3PIRA 1YB4A 3TLXA 5DBHX 4LPSA 1E69A 1C7ZA 1JU4A 1AV7A 3VHRA 3ZHSA 5IT9A 3KU4A 1VRCA 5HK9A 1PR2A 1QG0A 1X80B 3F8SA 2EFYA 1Q84A 4DC9A 2GETA 2JH8A 5DNVA 3ZW9A 1F17A 4Y2RA 1W85A 3C7CB 3LRXA 4F92B 1Y42X 2P75A 3BA1A 3FAKA 4GH5A 5CTJA 3JX9A 4OHFA 4ZV9A 3I2GA 5HJEA 3HU5A 4WY2A 4YRMA 2XIQA 5DLDA 4AS1A 1Q1QA 1JVBA 2BHTA 4KLCA 3OFVA 2C7OA 2ODEA 5TPWB 1JVNA 1SQ0A 4A0SA 4PO1A 2ZUSA 3CWQA 4X62B 4RGBA 5KNCH 1EXNA 3FPSA 4X94A 3I1FA 3GGSA 5CDHA 5FOXA 3F7TA 3IMGA 3NANA 4YIKA 4K1LA 2X2OA 4MPTA 1F6DA 4K46A 2H4JA 4NHOA 4X45A 3UG6A 2FDCA 5M2QA 4EIWA 1X38A 2G04A 1JTEA 3D3JA 4FHCA 3FVQA 4FR0A 3PIDA 2PZLA 3TIVA 3EEOA 2FXIA 3IBFA 3H0KA 2XUJA 4MYHA 2VHVA 4KFTA 1NVAA 5K2MA 2VP2A 1T6YA 2WOOA 2XITA 2ZR8A 1GYRA 1XD8A 4E0BA 1V9CA 3AI1A 1NN0A 1QCCA 2M1ZA 4C4AA 3CEJA 4CMAA 3CPSA 4DUGA 1I3LA 1UADA 4TV8A 1CJSA 3EXHC 4LHWA 1DIGA 1ONOA 2J0VA 2Y6UA 3IUNA 1QS0A 3FCEA 4R69A 4XQEA 1RQGA 5C9ZA 4R16A 4FS8A 2V0NA 4GZ3A 4CM4B 4LE0A 4YT5A 3STWA 4QASA 1D0VA 2JAQA 3M4NA 3ECAA 3B8EA 4TYPA 2IYWA 3DV0A 3ES9A 1HT3A 3RKSA 4FYWA 4LJ9A 3EH1A 2I03A 3SOZA 4NP6A 3ZVRA 2VJDA 3AF6A 3U4QB 2WAAA 4X6LA 2HQBA 1JSRA 3Q8KA 5ARCA 5I9TA 1XMXA 2GO1A 1FPMA 4QG7A 3UCXA 4MVCA 1KI1A 3QW2A 4GRDA 4XUGB 5COBA 1GGJA 3ILSA 2JARA 1D4AA 3VZPA 3W7VA 3A9RA 4UPDA 3RAPR 3IKVA 3HBFA 4NABA 1IVSA 4LDRA 5EWJA 3WGUA 3LQQA 5EE0A 4WI1A 1F7UA 3ICEA 3K9NA 1H1LB 3X2SA 1L9KA 3I5MA 1YS7A 3WDKA 3JYPA 1V7PC 4BNYA 4DCOA 5KVCA 2VT3A 3AEUA 1UCFA 2IKQA 5FBWB 2FJPA 4A91A 4MWEA 4Z9BA 3QVMA 2RGDA 3KSDO 4A2WA 2D7DA 1OWMA 1UKCA 1W94A 3NORA 3GQBB 5ICEA 2RGNC 2JHAA 1RLIA 2VK1A 2WTEA 3LGAA 2ETXA 1I2BA 3PQ8A 2HQOA 4KLZA 4D98A 1FUEA 1BE6A 3E05A 4ZI7F 4U5XA 2X8WA 3GG2A 3VZRA 4Z99A 4EF6A 4GOLD 3IKJA 5F78A 3HWWA 3NRJA 4KGXA 1UBHS 1MTZA 3JQPA 3WDLA 2G82A 4DCPA 1GRCA 3NCTA 1UK6A 4HPWA 4PSAA 3NH9A 2PH1A 4XQCA 3VH1A 4WEOA 3RUCA 3GPBA 4BASA 2XRZA 4BO0A 2OD9A 2DWOA 1BDJA 2ONZA 2XWSA 2Z58A 4NZZA 2AFHE 4H7FA 2GPWA 1S2LA 3V8PA 4U2KA 2BMFA 1M2HA 2AN9A 2D06A 3JQ7B 5F4ZA 4DCNA 3BK1A 3TLZA 6REQA 3E9YA 1FDUA 3FLBA 3H2YA 3IBTA 4KPUA 5FOVA 3WDSA 1AY0A 2KPOA 2WVHA 4CKCA 1EQ2A 1NQXA 3NHBA 4TKUB 4UBJA 5C7YA 1Z08A 2D6FA 3NG1A 2BFNA 2FFBA 1K97A 2V1XA 2C2MA 3OCWA 1T13A 3JALA 2PQ6A 3CLTD 4MULA 1KRWA 2AHRA 3PLRA 1B6TA 3U9SA 2NT4A 4GZ6A 1TIBA 5L3QA 2ZRJA 2JGEA 2WAXA 3OY2A 3SVLA 1DQSA 1G3UA 4HEA1 3G2IA 2H0QA 4XOUA 4E51A 4L07A 4NU8X 2HC9A 2AKAB 5H4GA 3ASZA 2OFPA 3LM8A 3RS7A 3D64A 3AVUA 3K2IA 1M33A 4HDSB 5AIAA 2PBFA 2WWHA 3IKTA 1LSJA 2WNSA 4O0MA 4OLJA 2G3YA 4AMGA 1W6UA 1BQ3A 4ZV7A 3UW3A 3H16A 4DZTA 2H9IA 3DVSX 1SQSA 3HXKA 3PFGA 4JGBA 4M53A 4LNUA 2PD3A 3SYLA 3TW4A 2QBYB 2XCLA 1C3OA 2O2HA 1QH9A 4RAQA 3SFVA 1TEHA 2PRZA 4PYLA 2FOXA 2HJGA 4E7PA 1PD0A 3FTNA 3GY0A 3OQ6A 2UV8A 4NZYA 4Q9DA 1NQUA 3PKZA 4N5DA 4TQAA 2WM2A 3B48A 4WJLA 4HNTA 1XT6A 1FIUA 4AN4A 1BWRA 2C4VA 5JJCA 3OEED 3REOA 2H4ZA 4CIDA 3T9DA 1TUGA 3SMVA 3L4KA 1Q50A 5C7LO 1L7AA 2C2ZA 2WIFA 4XFJA 2IYUA 2H0RA 2B2XA 2IP1A 2QD3A 3F90A 2HUNA 1NW8A 4G4SP 1V95A 3B1WA 1AG9A 1IM8A 4Z9YA 1A2QA 1JLMA 3UMJA 3ZBPA 4KW7A 5B1IA 3RC2A 3OTOB 3R74A 2FSGA 1QKJA 1Y0BA 3S40A 5BSGA 4LDNA 3PQFA 2Z4SA 2YFKA 2VNJA 4AYXA 5JNSA 2FWBA 1VXOA 2I1LA 4EJSA 3OWHA 2WOJA 1RI4A 1O8CA 1UQUA 3PFNA 4KVGA 4XXHA 4REMA 4CV1A 4W1RA 4ABYA 6GPBA 3MGAA 5FA6A 1ZIOA 1NUUA 4O8ZA 5IT4A 4YUYA 3QUSA 5HBGA 4QULA 4I1SA 1E7SA 2HXYA 3MT7A 2QTAA 5K3BA 2PH7A 4HMQA 4IO1A 2F3SA 2PT5A 5C4MA 2YVLA 1TI7A 1YAHA 5EG5A 4EAAA 3TXYA 2EX4A 2D0DA 5KNDD 2D1YA 3EB9A 3FJOA 3JQGB 2B20A 3B38A 1NTOA 4IEIA 4BX0A 5KNBD 1JEQB 2WYUA 4E08A 1R6TA 5AHXA 2WM8A 1XHFA 4HDKA 4KAAA 4WKBA 1D4OA 5CMLA 1L5RA 2WD9A 2RHTA 3BPSA 3EAGA 3LO8A 4W6QA 1E2KA 4EG6A 1BXGB 2MIIA 3K2BA 4TL9A 1TM4E 5DGXA 4EPVA 3U3JA 4GNRA 1F2TB 4LKOA 3ZCRA 4LAFA 1A3CA 1RXEA 3C6MA 4Q3NA 4QEKA 1P33A 4CKBA 3W5SA 4HL6A 3M5WA 4K03A 3PLAE 1N2SA 4J1TA 3QYFA 4BVFA 1EFLA 2JA2A 1PDOA 2Q27A 4HFNA 1AQYA 4PXAA 5BW5A 1JN0A 4XD2A 3WDMA 4YCSA 1SG6A 1E6EA 3OQ1A 3DZ8A 3PV0A 4LWQA 3WLAA 3QRWA 4BLWA 5CVTA 5KTYA 1QJCA 2CNDA 5DW3A 4HNAB 3FOFC 4Y0AA 5HE9A 1TPYA 4Q7EA 1HDCA 5BYKA 1E3IA 1ZK1A 4S3MA 1A5TA 3ABSB 2CXUA 4ZCPA 4UTPA 3T3NA 5CR9A 1NI4B 1LX6A 1B8UA 3MRSA 1YT5A 4IFEA 5IC4A 4KUEA 5BSHA 3UJPA 4L4ZA 1V1RB 3ITEA 4EW2A 3OD5A 3AESB 3FUVA 5TXGA 2FHSA 4YBRA 3RBAA 1AK1A 4HSEA 3T0GA 1T8WA 4CYMA 5K0ZA 3R44A 4C7KA 4CETA 4QEZA 4F6RA 1K7EB 1O4VA 5F23A 5B57C 4NV1A 3JZDA 1GV1A 1VCHA 1VLLA 2G63A 1B93A 2I71A 3D3EA 3EZ6A 4P54A 4QNRA 2HK8A 1FU8A 4FMDF 5DEOA 2WU8A 3UGJA 4ARIA 2FOIA 3I9NA 5BSEA 1G66A 1XPJA 1I4OA 3G89A 3B3JA 3ZIAD 2X58A 4DM7A 3OZVA 1UODA 4PZLA 1ACLA 1G9XA 4EO7A 4A8TA 4HWPA 2J0QA 2PMBA 5KOJA 1KY5A 3UUGA 4BECA 3IUEA 3TZCA 1VCIA 1DX6A 1E92A 1Q12A 3B60A 1FXUA 2OCXA 1UBEA 1B2RA 1KP2A 4N4AA 2C2GA 1DQNA 3EWSA 3AU8A 4X6XA 4G5GA 2NSHA 3OZAA 2GR9A 3QX7A 2JLBA 3L1JA 4ALKA 2F90A 2JVKA 4MR9B 3LLSA 3ZVMA 4EZIA 4BN5A 4G36A 3G0HA 4BBAA 5AK5A 3VSEA 1FJHA 4NARA 1TW2A 1GZ7A 1K6IA 3BE5A 3RUPA 5EL0A 3V1LA 2JJMA 4JVNA 5EJGA 3S8EA 2W37A 4MUMA 2PVCA 4EEKA 4TXJA 2VH1A 3QKWA 2ZTVA 1R12A 1L7EA 1PIWA 2ZBQA 4WZ6A 3W9BA 4DWOA 4C87A 3O9MA 2YQZA 1KK1A 5CTAA 1EDBA 3BICA 2CBGA 3U5ZB 1N2CE 4RK6A 1UK9A 1G8MA 1TQ6A 4J2TA 4QUAA 2YQ4A 1SVNA 1JLLB 1GAXA 5FTLA 2QZPA 4D9CA 1TLFA 1NW5A 1S8OA 3NDJA 1S2NA 2A9KA 3N75A 1IEQA 4HQLA 3QF4A 4IOKA 3UTCA 5LYJF 3H97A 4MOWA 3PXCX 3TIGA 3WICA 1EK5A 1HR0B 4Q1BA 2FR8C 2O0KA 2PUGA 2HIHA 1QF9A 2EJTA 3KJFA 2XE7A 1QGOA 3QFHA 1XQ6A 2B7BA 3BJZA 1DKMA 4BVAA 3EZFA 1CUGA 1OZHA 4TZ0A 4GMDA 2RHHA 4FYJA 2D1QA 4KGVA 1DFGA 1P73A 1QC5A 2B83A 2JAXA 1M5UA 4HDMB 4KQ9A 1HQKA 5G1NA 3KCQA 2OGWA 3FH0A 4LYAA 4Q02A 4HN9A 3PEEA 1M10A 1RM4A 2AFIE 5AVYA 4KMMA 3ERCA 2HD4A 3IEIA 3P9NA 4KPEC 1CZOA 2WM3A 1DQRA 1K8QA 2OV8A 3A2NA 3DC7A 3OTHA 4JQOA 1ZL2A 4FGWA 2CVHA 3LGSA 4H3KB 1KVSA 1I2MA 1MNQA 1REQB 4OAQA 4MROA 5IJZA 3HH8A 4F38A 4QJ4A 3TAUA 3IT1A 1SBHA 1YJCA 2GTHA 1GFSA 3M34A 1JNXX 3GRFA 4UXIA 4KPFC 3MEQA 2P1RA 3GGJA 4UNIA 2EXXA 3GEMA 2XDWA 1VOTA 4BRSA 4QGSA 2N42A 2A33A 1ORWA 4MUEA 1E2UA 3T5GA 1P7WA 1WMAA 4PWYA 3UY4A 3DEFA 3DLPX 5A7GA 1ZAYA 4ARCA 4GVPA 4LJ4A 3FVTA 4E5DA 3AWIA 3AL3A 5BW8A 3CZQA 3AY3A 3QEOA 3T15A 5A4IS 3UBMA 1D2HA 1FNNA 1QU3A 3M2TA 2KJQA 4LC1A 3FFXA 1LWOA 4DT1A 4JEUA 1BCRA 4RPJA 3V8RA 3THXB 2ZS9A 1Q1NA 3CT4A 2OD7A 3G0OA 3T3DA 4DE5A 2HSGA 2O2SA 3G0BA 1DBRA 4DMCA 1LW7A 1FSGA 2W6QA 4UVEA 1I7LA 4J2HA 3ZW8A 5TJHA 2WW8A 2P8JA 1VLJA 4RPIA 1KXZA 1IY0A 4J0QA 3WP1B 1DMRA 3JQQA 1XMVA 3SQNA 3RNLA 3WMEA 5AH0A 3TO5A 3VV3A 5JZOA 8ATCA 3D8UA 1IFXA 2IYQA 3JQFA 1KH1A 4Z8YA 2KQUA 1KVTA 3DD5A 3KVVA 1JNYA 3S2FA 1H85A 4EY4A 1C4XA 2PZGA 3VOAA 2ZQYA 5I9LA 1KEEA 3T52A 1G9SA 3I34X 3RIEA 3IO3A 2IEIA 2A4MA 1B8NA 1OU0A 1I33A 3DM9B 4D5EA 1OYWA 4UE3S 3G9UA 4LHZA 4XVRA 3SZRA 2WVGA 3UXEA 4QDXA 3OJCA 4AY3A 3UFBA 2DUNA 3LU1A 5HKAA 2HJHA 1E3WA 4ZO7A 1PR3A 3QELA 3K72B 3QQPA 4MH0R 1PYGA 1U1GA 4OP1A 1C0LA 2P4QA 1QK5A 1DAKA 1BJKA 1T4CA 3LHIA 3GO4A 3S2SA 3T1OA 2W2MA 4CUJA 4QJ5A 3QYPA 1XKTA 2R65A 2FPIA