2Z2KA

Crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
180
structure length
180
Chain Sequence
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title Structural Plasticity and Enzyme Action: Crystal Structures of Mycobacterium tuberculosis Peptidyl-tRNA Hydrolase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 58
structure length 180
sequence length 180
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 2z2kA00
2Z2KA 3P2JA 4LWQA 3KJZA 4FOTA 4FYJA 4IKOA 3TCKA 1RYMA 4QD3A 3TD2A 2NAFA 4JWKA 3TD6A 2Z2JA 5B6JA 2JRCA 3NEAA 3TCNA 5IMBA 3V2IA 5IKEA 4JY7A 4FOPA 5EKTA 4QBKA 4P7BA 1RYNA 3VJRA 4DHWA 4DJJA 2LGJA 4Z86A 2MJLA 4QAJA 3KK0A 4OLJA 3OFVA 2Z2IA 4JC4A 4FNOA 4ERXA 4ZXPA 1RYBA 4JX9A 5IVPA 4YLYA 2PTHA 4HOYA 4QT4A
chains in the Genus database with same CATH superfamily
5KQMA 3LDGA 3C7AA 2YVUA 2OV4A 1SU7A 1W2HA 2A8YA 5U1PA 4ALLA 1TKBA 4R1MA 3NG1A 5HWSA 1ZIXA 3IE2A 1LK7A 3ZCQA 4BCBA 1UDAA 3GXBA 4DYHA 3BSYA 5LP1A 3CVVA 3MPUA 3TBHA 4EWLA 2GXUA 3ZE8A 4RY2A 5J2UB 1NJ5A 1CUAA 3OFJA 2PSEA 1Q77A 4OH7A 4YFVA 3VC1A 3BFXA 2K7ZA 2IBTA 2CXHA 4LHEA 4CCYB 5C9ZA 4XUGB 4NG5A 4YJ2A 4K9SA 3WNDA 2FZCA 2RHWA 3L04A 1AQUA 1EA5A 5EAIA 4JYAB 1X1QA 5EGSA 1Z6GA 1E9RA 2QUIA 2RCNA 2CUKA 1N0WA 1HSOA 2XVYA 3CO0S 4Y7CA 3S6JA 3PYLA 2VH1A 5HS6A 2P1DA 2V5VA 4CMIB 2G71A 2CXPA 4OLHA 3ZHZA 4XFKA 2OD7A 4M0DA 1VE5A 1T0BA 3PICA 3BSSA 2ZATA 3JYNA 2Q2VA 4E4TA 2X15A 3WL4A 5BWNA 2RBKA 1JKXA 3OLCX 2CK3D 4LXGA 4XIFA 4MR9B 4EVRA 1JILA 5HJEA 5GINE 5LOVF 2AR9A 1HT3A 3FX2A 1B00A 2C2MA 5KYTA 3D1LA 3A05A 3V8EA 5MDHA 2N47A 2NW6A 3H9UA 2X3UA 2QLLA 3K5PA 2DR0A 1IZ9A 1FXUA 3LJKA 1VBMA 1I5RA 1M83A 1RZ3A 2RGEA 3KKKA 3KEOA 5DZSA 3W3AH 3DHEA 2BELA 3H4VA 3CA8A 3T1VA 5DGHA 1HG0A 4PE5B 2DJ5A 2W2XA 3AFMA 2FSPA 3EHDA 3NH6A 4B6OA 3CCCA 2WJAA 1GWNA 3H5RA 4RTPA 3PITA 1D5WA 2HIHA 3DMPA 1RIIA 4E2FA 3I76A 2Q6OA 1FF9A 2I6SA 4UD6A 4HMQA 3TOZA 3WSTA 4KB5A 2QUKA 1ZL0A 2PXCA 2Q5HA 3RLFA 4B3HA 5IC6A 1U8YA 3R9KA 5K20A 2NXCA 1IZ7A 4B6SA 3FYUC 3GBVA 3JYQA 1YNOA 1LF0A 2IPMA 3VKWA 4UPEA 3FOBA 5F3DA 4ZXFA 2VJQA 5HOEA 1MTOA 2EW8A 3NWOA 2DKOA 2VHYA 4TVSA 1U2QA 3ENKA 3KZNA 2E4VA 5CLGA 4EHJA 3ZKWB 4TVBA 1E2GA 3OMXA 3WWEA 2C4VA 1PKXA 2AEMA 2WB4A 3SE7A 2GD2A 4NYIQ 5JZOA 2B36A 4JC8A 1B8UA 2JG3A 1GQYA 2ZJOA 3BZUA 1T29A 1WBJB 1D9ZA 5EP3A 4Q4CA 5DTJA 1R9NA 1U80A 4F3RA 3S4YA 2WAOA 3NHMA 3P71T 4E2XA 4TV9F 3RANA 1ACMA 5A4JA 1BDHA 2H2GA 1LZLA 1I94B 5JHHB 4UUMA 4JJ6A 4BX0A 3OTOB 2ZLBA 1LVGA 1IEWA 1IZYA 3EGCA 3D4PA 4Z4GA 3KD2A 3JAKA 3I28A 4PYOA 1JR3E 2PGOA 3R40A 2C5LA 1MN6A 2JIQA 2W8BA 3IAHA 4FW9A 4I50B 4ND4A 1XV5A 3SZLA 3ZHSA 5HZKA 1TJ5A 2BGJA 3CZCA 1RJDA 5FI0B 4RJTA 1ZAYA 2R97A 1E4EB 1U0FA 1I0ZA 3HDVA 3LYHA 4UFPA 4GYWA 3A8TA 4Q1VA 2HB6A 3FTEA 1Z22A 5TVGA 2XZDA 3EXEB 2PKQO 1Y89A 1U4OA 3F6RA 3HCNA 3LLVA 3UWKA 3K8QA 2FN3A 4DNOA 2W2MA 3TVTA 3QELA 3EMBA 1ZD3A 2CUZA 3DV9A 3CE9A 3KZMA 1KYIA 3DEZA 4MAAA 1DQZA 2UZAA 4OD0A 3HI4A 5E9QA 3E9QA 3VBCA 5HZGA 1XO1A 1Y37A 821PA 4IINA 1N2EA 3OLVA 1GP2A 1GTMA 2X3FA 3K0KA 3W7VA 1GGFA 3OEHD 1PS9A 2PKQP 4NAVA 4G8BA 4HLUC 3PEWA 4KQGA 4MIKA 2W6CX 3TRFA 2AJCA 1UXIA 2RHHA 4KHZA 1CUHA 1KGDA 4NR0A 1S8FA 4P8RA 1NDUA 1ZSYA 2BGIA 2EJVA 3AHDA 4HYQA 4OU5A 3U0BA 1RI3A 4ZO4A 5TLSA 8ABPA 2DFTA 1ZGBA 4XOUA 2F43B 4Q9AA 4DR4B 1I2DA 1RHKA 2PSFA 4IGKA 1INLA 3W4JA 2H1IA 2PUJA 2H1LA 4YQZA 2NU9B 1P1KA 2B4RO 3IHWA 4TMWA 4C2UA 4B3RB 2I2CA 3A6HA 1PQPA 1I51A 5CM9C 3JQAB 4E1VA 1UANA 2WJ6A 2ZUSA 1U7XA 1HORA 1P2UA 2CYCA 4EBBA 4ZIRA 3HUEA 3A4NA 4UW9A 3OX4A 5K7SA 4MTCA 3TD6A 4DMGA 1C3LA 1DIGA 3QVJA 4ZVLA 1NNLA 1NX6A 3L7AA 4Y1RA 3MUEA 3WQBA 4E08A 2ABWA 2PYZA 1MENA 1W8DA 3QLTA 4QU8A 4RZ3A 1DXYA 2RJNA 3WGZA 4AIIA 2ZW9A 3QLVA 1SCUA 3VUEA 5AH0A 3AWDA 4DDUA 3AHJA 4A6PA 3C8ZA 1FU4A 2Q4TA 3O4HA 1T1IA 3T7CA 3VPBA 2JGIA 4KTTE 1BVRA 4RTQA 5F9HA 3ZYCA 1WXWA 4EUHA 5KWJA 4ZVSA 3QMMA 3WWYA 2XKKA 1XU9A 3EAQA 3I32A 1GSOA 4LQLA 5A9TA 3MJTA 1U8XX 4R98A 3WBKA 2AXPA 3DV0A 4WUTA 1ULAA 3GLUA 4YIHA 3H97A 4I1IA 1BCSB 2ETXA 4KRYA 1REQA 2JD0A 4HPWA 2UZ4A 2OUKA 1FZQA 1SKBA 2WT4A 4N6NA 1IK6A 1W30A 1O2DA 2DLDA 5CHYA 4CT0A 4QJ4A 4ZANA 1XEXB 4M1EA 2HQOA 1FJXA 1UDCA 3ITNA 3LBFA 1Z73A 5C52B 2GZRA 2WJYA 5IDXA 2YFYA 3OWOA 1N9KA 5D3QA 4E4RA 3WA6A 1OXUA 4NCNA 3TLCA 1V37A 3OA0A 2BEJA 3HM2A 4ECAA 5FWYA 1GG2A 1EB8A 1L7OA 3T9FA 5INTA 6NULA 2G36A 4ZICA 2CK3A 2F8SA 3GIDA 3EFOA 1Z0IA 4H4EA 1DJOA 1D04A 2IZZA 1K89A 3NWJA 4UBJA 3GRKA 2NZYA 4DKJA 3BORA 2DB3A 1ZJ5A 2P27A 3NHPA 3OLXA 5EWMA 3D4OA 2NP7A 5AM1A 3SX0A 4NBRA 3JQPA 4TKUB 1EWKA 2CLHB 2XVAA 1Q2XA 5THKA 3DDSA 4GVXA 2AVNA 4TM7A 4L9SA 3UWOA 4WVLA 3DHVA 2IS2A 1WZIA 4G9EA 2WVGA 4PTLA 3DD1A 1TAGA 2VPQA 2IPAB 2YS6A 5JY1A 4LOAA 3BCHA 4J1TA 4V1CB 4EB0A 1RXIA 3QKRB 3EY4A 5F4ZA 3WI7A 1MW9X 1GZ7A 2C5EA 3PGJA 2OBXA 1EEHA 3TO5A 2Y1FA 4QOIA 2UUAB 4NOJA 4HAYA 3BB4A 1ECBA 2JGLA 3M9WA 4CMEA 3W2TA 3DG9A 1GZSA 2CXQA 1DRKA 3TZLA 1WB4A 4CEIA 4LY6A 1WKCA 4JT4A 1DINA 2R6CA 2UUPA 1JHDA 1KFJB 3ETDA 1QQ7A 2RE8A 1XMQB 5EYPB 5KPDA 3PUWA 3Q2KA 4MCJA 4BVFA 4C0KA 4D8XA 3NJ4A 4KP7A 1QV9A 4CKCB 1LEHA 2XKJE 1VJ1A 3KSDO 2D5IA 4J49A 4JBYA 4UCXA 4X71A 1E9VA 3KYDA 5F5LA 1Y8ZA 1YCHA 1ZH4A 4A2PA 1H4SA 1R37A 2AZMA 4AS2A 2GPJA 3OETA 3RVSA 5A9SA 4ZYTA 2QTLA 4FCVA 4DMFA 1ABFA 4MRNA 1YE8A 1YHNA 4B8ZA 1R8JA 3I8SA 2ZUVA 4IUYA 4K8RB 4XX1A 4S3MA 1YGPA 3ED5A 1O58A 4OY3A 3SXUB 2VCEA 1JHMA 4CM3A 5IWCA 3TSOA 2DWOA 1DLJA 3U3OA 3LQ1A 4RSHA 1DHTA 2JFUA 4FNMA 4AZSA 1ZZEA 4PYIA 1FUIA 1FU7A 4RFSB 1OGJA 3D54D 2E1PA 3EXFA 4I9GA 5TMDA 3KDSE 3N7UA 1QP4A 3KZXA 4Q7KA 1T3TA 3D64A 1PZNA 3QQPA 5JOQA 4HSGA 4LZAA 3UO8B 1XNHA 1KO7A 2Z2JA 3A9CA 4II2A 4D96A 3RYIB 1RVV1 1W52X 3IP1A 4X1IA 1BDIA 3I5XA 2MINB 3V3KA 3QKSB 4DWWA 1T24A 3CG4A 4G1BA 5IWAB 4QICA 2A0YA 5KQGA 5TXGA 3L8DA 3GVPA 1AMOA 2JCYA 3EJ6A 5ADHA 4HYYA 2V1XA 3CF6R 3HBLA 2IOFK 3T6KA 2FR8A 1PR9A 4K46A 1G6Q1 1XDWA 2GPBA 3H5VA 4BFCA 2YS7A 3BRQA 1P5RA 2IIQA 4N54A 2ZSIA 2ZAOA 4JLJA 4KSBA 2NO5A 2HSJA 4ANFA 4GT1A 3NMUF 1QUFA 5E8JA 4ALMA 2WWTA 2EWWA 4ARBA 4B7CA 4ALNA 4WA7A 2PKCA 3T7JA 4ZAXA 1ZM3A 1CWUA 2CXXA 2FEMA 3GRVA 1MPXA 3LT2A 4P7KA 1KO4A 4V0RA 3NHJA 3QBEA 4JP1A 3DE2X 2J9XB 3C5WP 1MX1A 3EGDA 3C3YA 3ZS9A 3NBZC 1XC7A 1OTHA 1PVVA 2EXXA 1KZHA 5FXMA 5BURA 1A7AA 3O7MA 2VJAA 4CQNA 1IULA 4F3CA 4LGVA 1LDMA 1Z56C 3NBXX 3NIWA 1D6JA 4FOSA 1J2RA 3DGEC 4BAUA 4DLAA 4KN9S 4O2LA 4BXOA 1YBAA 1P2FA 1EFPB 1QX4A 4RQBA 1RJWA 3TIFA 3F5QA 2ZS8A 4JJ7A 3O5AA 3KKNA 4GLLA 5K0TA 3WWZA 4DV2B 4YT2A 1QMGA 3U4AA 4AJLA 2LE0A 4W7IA 1FTSA 3HUDA 3LRPA 1OSNA 1MABB 2VR1A 2OCKA 3JWEA 3LHSA 1UBLS 4V0OA 4ZCSA 4BEBA 1K5PA 4NENB 1YHYA 2GPAA 4UVHA 2IYPA 3CW9A 1P74A 4YECA 1IEQA 1GUAA 2C84A 2X9GA 5AW2A 1VBNA 1RWBA 2W0SA 1WSDA 3DQZA 3VR6A 4HVCA 2EBFX 2HQ1A 5LBTA 1V26A 2HR1A 3AM5A 4HDOB 1RLUA 1RACA 1Y42X 5CG2A 3OTWA 5E4TA 1PTJA 3V00A 5FLXA 2ICAA 2LZ0A 3KQLA 2WINI 3AF4A 3K1AA 1GKYA 1H23A 1RE1A 3KLBA 2Q50A 2HA3A 2FWRA 3I2JA 4PYLA 5JAZA 1GY8A 5IU6A 5JROA 2VHXA 4ESHA 4P82A 4HRXA 5AVQA 4EPXA 4REOA 3RJTA 1HM5A 2V4UA 3ABRB 2H54A 3MT7A 4J1NA 2ACEA 3GFVA 2FZ4A 4XASA 2QZZA 2MSWA 3CY6A 4O08A 4QUAA 3MD9A 4EG5A 1JPUA 1PGNA 2QN9A 3OY7A 1H0HA 1TL7C 3BQNB 3JQRA 4UHJA 4X1YB 3TCXB 4L0QA 3WYDA 5BSFA 4I6JA 2Q4DA 4MHOA 1UXOA 2IYNA 4HEHA 1CT9A 2FX5A 3N0VA 3EMKA 2YC4C 3BRSA 3VOTA 4RGBA 1L6RA 2A9OA 1PD0A 1COWA 1B42A 5KWEA 2I6UA 1M1ZA 4LRSB 1Z83A 3U7HB 2B98A 2YN4A 4PNZA 5IDWA 3FGNA 2JI9A 4TUYF 1YSCA 3IJRA 4BQPA 1KC1A 2V9CA 1CJVC 3AHHA 4UASA 4KGXA 5G02A 1O54A 1T4DA 1VJDA 3UJCA 2ZBPA 4NU0A 4EEXA 4KITB 3EY9A 2RAFA 1ND5A 1L7BA 3MYRA 5LA6F 3HPRA 4EJ2A 1GNPA 5BPHA 1E6MA 3I09A 1FMFA 3ZWMA 1XR3A 3ZXXA 3ABOB 3TX2A 4C5BA 2XIJA 3P5SA 3EZ6A 4LOJA 2QP3A 3N8DA 4C89A 4E7PA 3HKBA 1CIPA 5JYBA 2COEA 3ABZA 1SXJD 4FQ8A 3IKTA 4ZZ1A 3A6LA 3PXGA 3QUBA 2D00A 4JOCA 3T5PA 3E7WA 5H1YA 1FMTA 5D2CA 3U3XA 2AQIA 4IYJA 4PNPA 3T5GA 5DI3A 4U2BA 7AT1A 3KHKA 5M29A 2VHQA 3OMWA 1QV6A 1TDJA 1AUOA 1CEXA 1Q0RA 1TFUA 3L18A 2JIZD 5C53B 4LY9A 1NFFA 2B20A 2XMCA 2HIMA 4AL4A 3RAEC 1NE2A 4FIZA 2ZE7A 4MVXA 3KLOA 2VUTA 3D6UA 3JPYA 2BBTA 3I01A 4FZVA 2JFFA 2GRUA 3EWNA 5TS3A 4C3UA 4S1NA 2PL1A 2PXHA 1AK2A 4RFLA 5JBIA 1NBOA 1F0KA 2EQ5A 2BM8A 3UTDA 2O0JA 1E3TA 1RFGE 1EFLA 2BGRA 1NOIA 2ODTX 1DAHA 3LNTA 4GEKA 3GFOA 4NBUA 5DNUA 4BPBA 4WBNF 2Z8XA 1VGQA 4H0CA 4L4UA 1M2GA 4RMGA 4O29A 4MQFA 4UU7A 4D9MA 4D02A 4RIEA 4C20A 3SKYA 3M6IA 1Y3DE 4LNUA 1Z35A 2EFEB 2WR8A 4JBNA 2KM1A 4E5VA 4QL3A 2GJAA 3KYIB 1TECE 1D0IA 1SHJA 2FRVA 2NWQA 4O4IB 5LLSA 4B7ZA 1MQ8B 3L6DA 5JQGB 1IHDA 4X7MA 2XOKD 3JVIA 4TQAA 1P9WA 1AZWA 2QI9C 3A4MA 4FMDF 3BIWA 3ZNQA 3T9DA 4F2WA 1THZA 2F9MA 1HFJA 3TCNA 3NXSA 4N82A 1F6BA 3HKCA 1IVYA 4RJIA 3CRRA 1B23P 4NEHB 1OILA 4QBKA 4KACA 4REQB 4X41A 1TLLA 1U3UA 1UOEA 4Q3LA 3LO5A 3FYHA 1JFFA 2CE2X 4IIEA 3G13A 3KAJA 4PPFA 2DBZA 2IF0A 4LDNA 4AWXA 1MAVA 4EQ6A 3MGAA 4IFIA 3T61A 3O8BA 5C5EA 4KXYA 4D6XA 2XD4A 3I6QA 4CR6A 4KR9A 1Z5VA 4RS4A 4Q3OA 5EVJA 4EHDA 5HKKA 1UBGA 1VHQA 5JASA 2P91A 5A1TA 4ZO8A 3PKZA 4DDMA 1N5OX 1TVEA 1W9MA 3UPTA 1M2KA 3GLHB 2ZYGA 3F3MA 5BWOA 4ENUA 4TL7A 5DHTA 1F60A 2ALJA 2H18A 2HSEA 1QYVA 3HV2A 4RV9A 2ZT6A 4D0LB 5JD5A 5JNLA 5C4GB 1FX1A 1MNAA 2YJ4A 3E4CA 1N2CB 3OP1A 2ZVDA 4K6HA 3ZEIA 4BL5A 3L05A 3GP5A 3BMQA 1JXOA 2JKZA 1VXRA 1DP4A 2JNWA 1UKAA 3IDQA 4KMMA 3LFUA 4OMCA 4PLWA 3H6HA 1YHZA 3D5EA 1H2YA 3PNBA 3VDNB 3UANA 2KWIA 2YWXA 5T67A 1C9DB 2RHOA 4AY5A 3DDNA 1GG9A 1QE5A 3HJGA 1BQ4A 3ABSB 3NEJA 4RIGA 1W6RA 2BF7A 3AR5A 3P20A 4NI5A 3STXA 4ZZ0A 3O4JA 4KAJA 4M1SA 2A9JA 4PHTA 5BQ3A 1ZAKA 2JAXA 1C41A 1DUIA 3LC0A 5FHRA 1E1RD 3KELA 4DMRA 3GLGE 1OBOA 1AOXA 1GAQA 2GPNA 5DE3A 4GKKB 3VKGA 2YIVX 4P0TA 1E3JA 1QF7A 1XDSA 1NU8A 1OFVA 2BTEA 3V8RA 5D5PA 4NAHA 4YN3A 4H0FA 3W1VA 3LCJA 5GZ3A 2UYCA 1FRFS 2XLCA 3KVYA 2IEZA 2IODA 3WKBA 5L7WA 5AUNB 1C81A 2IP4A 1T5HX 1ZH6A 2PGIA 3GRPA 4UM8B 2CF5A 2ODAA 5HE8A 1TF7A 4AN0A 1PR4A 1MXHA 4DVJA 3ELWA 1HH4A 2C2WA 3LH5A 2BYTA 4DADA 3RVQA 2I0FA 3B1WA 3ER6A 3NEYA 3PFWO 5JSQA 5EHIA 1KWGA 1BS1A 3KQOA 4IH4A 4RENA 4B3IA 4P4GA 1E89A 1W5BA 1CIJA 3GLSA 3PRHA 4HDMA 1ZISA 4KXFB 4RF4A 3CRNA 3T3DA 3EC7A 3KXDA 3DVSX 2NZ2A 3HWSA 1DIRA 4HQOA 3WOVA 4LV6A 3WY9A 5LOVA 1C0KA 2D7DA 3UC9A 1XT6A 3LBAA 1QHFA 5U4XA 2CLLB 2VDOB 2DUJA 5CAEA 5L3SB 2ZRNA 1IHUA 2P9EA 2W90A 3UGTA 4EAAA 3LP6A 4YCLA 5JXWA 3GBSA 4WASA 5BMVF 3LC1O 1SVLA 2OQ2A 3THRA 4X8HA 1KVUA 4R2LA 3I2GA 1FNMA 3OT4A 4J2TA 3G9XA 1K8RA 3JTEA 3JVEA 1DC8A 3N6VA 3QVLA 3OX3A 4XYEA 2ZJYA 2AK2A 3H8WA 3MB5A 3L9WA 5CH3A 1PJRA 1B0AA 2Q7XA 4LA4A 4OYRA 1SA0A 1GTZA 2LIPA 1A96A 1WRBA 1RT9A 2JHAA 2CL7X 2P3LA 2YXEA 2YY5A 3CCFA 4J1QA 3DCJA 4RNCA 5EPEA 2HCRA 2K6GA 5IJAA 5A5EA 1EX1A 4OQMA 2FK8A 3TFQA 2ADOA 2Q07A 2RHJA 3L7IA 5HA5A 4FBMA 3BERA 1AK9A 3SF8B 5AFSA 2JIZA 4LQDA 4CR8A 3OM9A 5HDBB 3MTQA 1JEEA 4D9JA 4B3SB 2B37A 3AR4A 4IQGA 3JQGA 2J5RA 5LL6P 1JA0A 3D02A 2EKQA 5CYPA 3RB8A 3WQHA 4F56A 1T1RA 3HFGA 3F67A 3O26A 1M8FA 1G8MA 5EHQA 3W8RA 3EQ9A 1W7AA 1KJZA 4J76A 4TV9A 5KAPA 1T3ZA 4DMCA 3PR1A 1LK5A 4LECA 4AULA 2D6FA 3KWJA 3K0BA 4TTJA 4WXEA 3TW0A 2BHSA 1ORTA 3BBPA 4C4PA 2F3SA 1SKQA 1JB9A 1AY0A 1Z38A 2G6TA 3KVOA 4GF5A 1X1TA 2CHUA 2ZQYA 4LY3A 4Y0VA 3R77A 4R5HA 5B58T 3CJQA 1QYCA 4I5EA 4DMHA 5B7PA 1Y9AA 1VA5A 2W6MA 1ECPA 1G3RA 3E5HA 3MAAC 4NBVA 1NMSA 3LT0A 1OYOA 3PF8A 4KAFA 4YPFA 2V7UA 3L84A 3CHYA 3MVEA 2VJMA 5DB4A 1SWVA 4IBOA 1P4AA 3E9NA 4MWZA 5FL7D 2O5CA 4Z8YA 1KDVA 1V5EA 4J0KA 2CLKB 1DKUA 4QGGA 1NBMA 1O57A 1V43A 2XDYA 3PF9A 2JVKA 2DWQA 1E64A 3MRVA 5C7IO 1L5OA 3B38A 4BO3A 3MINA 4QD3A 4FFSA 1C2TA 4J1SA 3D4LA 3EUWA 3T3PB 4B85A 2F8TA 1K4MA 5CVUA 3T1NA 1ZOIA 3CNEA 3HU5A 4ND8B 4CEHB 1H1DA 3FFTA 4US0R 5LMUB 4HWKA 1TB4A 3QUSA 1WAMA 2GTHA 1SQFA 3VR2A 3HCPA 2Q21A 2J5XA 3VBEA 2WD9A 3PFNA 3NPMA 1GTG1 1ZW6A 2RGYA 1DCFA 4YRSA 1ORDA 4FFNA 3MT0A 2GK3A 4M55A 2JJ1D 5LZ5A 5KUTA 4L28A 1GL7A 3MTJA 3GEGA 5D3MA 4MRVA 1AHPA 4CMBA 1HLDA 3M82A 2A5LA 2J08A 5D1NA 4DLKA 4DM3A 2BAGA 4DDVA 1FRZA 3UB4A 1ZNZA 2C77A 1UMCA 4DLWA 3DH0A 3LDAA 3S8YA 3S2FA 4TS3A 3M6XA 2VUIB 4QDUA 5JISA 3FNRA 1E1MA 1J1ZA 1YB6A 4I46A 4MSUA 3DF7A 4DKXA 4PG5A 1JJ7A 1PJTA 4J7CA 3DLAA 2HRZA 2X0JA 2Z2YA 8OHMA 3O2NA 4EZIA 4NBNA 4AQYB 2OGSA 1XPRA 3F3KA 2P2ZA 2ODPA 2WTEA 1MB0A 2DOKA 5EUBA 4UQPA 4RANA 2IXTA 3RG8A 4DR2B 3EQ6A 3OZFA 4ND3A 3M6MD 1TM2A 1I5EA 1Z33A 2CNLA 4LPKA 4B7AA 2GFQA 3SMQA 3KWLA 1ISIA 2V96A 1K9VF 3H1BA 3DXYA 4JBWA 4AG6A 5C1DA 2B4AA 2NZWA 3FWPA 4F3KA 1ZR2A 1VRCA 5DBIA 3FBTA 2Q3EA 1QGOA 3ROTA 1NTRA 2CB9A 2ODBA 2BJVA 2YJGA 1JSCA 4BV3A 3E9ZA 2REQA 1XELA 3AP1A 2HSGA 1FDRA 3C4QA 1W4ZA 4RA6A 4WFIA 4CIDA 1BXRA 3GRYA 4YRRA 4KG7A 3ZWKA 3TE6A 3LYAA 3VO1A 2IYXA 1JEQA 4URVR 1QPZA 1A5ZA 1ESMA 3PR2B 1QCYA 1XYGA 2PUHA 4MLCA 3FI0A 1VL8A 1J0EA 1ZI8A 2B83A 4EIWA 4M7WA 3RS0A 1D2CA 2WFMA 3M6WA 2XB2A 3HCDA 3I9MA 2QORA 3DLIA 4RELA 5HM8A 1MZPA 2IP1A 2YZGA 1UKCA 2G07A 4MI1A 3KB8A 4MWSA 2JIRA 4PSKA 3RS8A 3SYNA 3T7RA 1CNMA 2QE7D 4KFSA 4AFNA 4YR9A 4ATNA 4BJ6A 1VJGA 2VQDA 2WU4A 3MWEB 4M8SA 1G41A 4WCVA 1NVAA 1KE2A 2PS0A 1APBA 3CW8X 2J4CA 5GPBA 2R6JA 4M1YA 1QHIA 4HAXA 3QVWA 3RF7A 2GEVA 4PN3A 4OPMA 5C8XA 3AF2A 1PSZA 4WOPA 1WY7A 5NULA 1U63A 4IXWA 1U5BB 2OCYC 3DC2A 4M8KA 5JS2A 4U63A 2CV0A 3EGXA 4RLFA 4ISCA 3NVKI 3IEVA 1F4PA 2ES4A 1PE0A 2PTGA 2VZLA 1NFRA 4ZOAA 3ZDCA 5DNCA 1TEHA 3U3ZA 5CFMA 3RG2A 3II6X 1YQDA 2JFYA 3BB1A 3GEDA 3OECA 3R09A 3JVDA 4URUR 1C1XA 2XX3A 4YCDA 5ER9A 1QVAA 2MYPA 4PPGA 2DQYA 4DA6A 2CDAA 2HGZA 1ACLA 4CL3A 4YUAA 3TQQA 2IH2A 1EGMB 1JW9B 1M2OB 1WOYA 2JHPA 3F74A 3GNQA 1TRKA 2DBVO 4IEEA 1XX6A 1XRLA 5AKYA 5ALUA 4BMOB 4NXMB 3RYHB 2HV9A 3ZNNA 2CZCA 4BBPA 3OSZA 4OB6A 4JASB 1T9DA 3ZJUA 2OB2A 3VPCA 4Q24A 5JS8A 4ZJUA 1QCCA 2EX0A 3OZTA 1QWSA 1DEAA 2Q0SA 4TTQA 5ELLA 5CBPA 2BFDB 1RQXA 4JWTA 4DNXA 5KYUA 1LRJA 1BE8A 3VHQA 3SZRA 4ZN6A 1E6CA 3Q6IA 2QT1A 5BN4B 2R44A 1CBUA 3G2MA 4MVJF 4UE3S 1EQAA 1J1UA 1FEZA 3A11A 4EW3A 3MC1A 1BD4A 5FL7A 4JELA 5IULC 1N4AA 1ZOSA 4DA8A 5C32A 4X91A 2FSHA 3GFPA 4HN4B 2XSZD 2DJIA 4MUBA 4D6PA 4KPYA 3OESA 3Q4GA 1Y63A 4N7BA 2JAPA 1QGZA 4PFQA 3NTQA 3SYRA 5TJ9A 3U60B 3SM9A 2X4GA 1KDZA 4G1VA 1RXEA 3DVAA 2CBZA 1L3CA 2CMFA 3HZHA 4Y2PA 4CVNA 5IJ0A 3OPVA 1QOQB 1FOEB 1KSHA 2CXSA 2P3QA 3OWXA 4IQ0A 1M34A 1PR0A 2W42A 1NXWA 2VUHB 1UMDB 3LOPA 3NHAA 4H1VA 5KHAA 4OGLA 3EODA 4CEJA 4MMYB 2M6SA 3F2VA 3MOSA 4DG8A 3HADA 4FCCA 3VNVA 3M4NA 1E9FA 1UBHS 2D74A 4Y9UA 2RHCA 1BROA 1LH0A 1I2ZA 1T9ZA 2Z5VA 4GI1A 3WYGA 3LM8A 1E1LA 3L3BA 4RV5A 1KQOA 3PBKA 4H4DA 4JYCA 4AVYA 1J5XA 2I4LA 1FCJA 2OVBA 3VI4B 4YX9A 1XF1A 2DFNA 3E3AA 5HMMA 3HGTA 3MWLA 3BWEA 3R6DA 3RQIA 2EBWA 1NT2A 1ZH0A 3NIDB 1XQXA 3LXXA 4Q0MA 3IB3A 3EWIA 1U7PA 3RWBA 2R2AA 4CTJA 1DBSA 4DA0A 1YDMA 4WNYA 1SU6A 4X90A 3P0HA 1TMOA 5AW7A 2YWFA 3H2YA 4BMCA 1WX1A 1VE3A 1WLSA 3HE3A 3OQ6A 4L02A 4PZ0A 3IYLW 1NVGA 3PDJA 1VYHA 4Q3DA 1D6NA 3N2NA 3NBKA 3GUCA 3MJRA 4F93B 5KNDH 1WU8A 1BKYA 5J59A 3T5TA 2BEUB 1ADYA 1HYEA 3B1FA 3HB5X 1VE7A 3E70C 1T6ZA 1WUTA 3B20A 3ND6A 3FNGA 2BFCA 3F98A 1E7WA 4OBEA 5AHKA 1I10A 1WP9A 4LGCA 4ZOCA 1R64A 2VFAA 3KP1A 3TRKA 4TWRA 1F14A 3GRZA 3BJZA 4EJSB 5JNTA 1FW6A 4E5PA 1NVEA 3CZ4A 1OLSA 5K8UA 2IS6A 3NX4A 1FYWA 4AECA 3IDSA 3I05A 4AWAA 3ILSA 1F3LA 2FR1A 3DWFA 3QFSA 4RPKA 5BNTA 2WB2A 3RVOA 2WHPA 3U3KA 1E1DA 1E58A 3N8KA 1J99A 1QYDA 2DFDA 3LQ4A 3NUQA 5E2BA 4YT4A 2D0OB 2NMVA 1R7RA 4DXAA 1M1YB 5A4DA 3V1NA 3O8OA 3TTXA 2R60A 3GPDG 3QVVA 1W44A 1T34A 3B6JA 3PSHA 1V1RA 5J9FA 5LLTA 1G38A 2BRUA 3DXXA 1ZUNB 1OFUX 1P1RA 3INYA 2H63A 5HX7A 2JH9A 4BQEA 2AN9A 2H8GA 3T1YB 1KOJA 2XB6A 2JAHA 4B3DA 2UYHA 3F4BA 3VJLA 5IC4A 2XGOA 3BD7A 1KEEB 2G1UA 4EY5A 2F1HA 3FN4A 5I9BA 1TOAA 1M6HA 2B0CA 4TUYA 1WVGA 3O9ZA 2Q0QA 4B33A 3EPLA 4XIGS 2HQSA 1QE0A 2ATIA 4GUDA 2EQBA 3TLYA 3VH1A 4JEUA 4MNTA 5JWOA 5JU6A 1CP3A 1KVSA 1RWWA 1ULZA 5DPMA 3CUUA 3ZTWA 4IXMA 2NO0A 5FUMA 3NYQA 5LA6A 3SC2A 4MQLA 4M0CA 2J46A 2B4KA 1KZ4A 2J7PD 4IQ4A 5JAIA 1DG3A 3P9RA 1L4BA 4DYVA 1OXMA 2Q3MA 4NNOA 3O91A 5HXAA 4H3HB 1M0TA 1E5DA 1MLDA 1WKVA 4MUEA 5EMMA 3W90A 3WZMA 1NAIA 3F8TA 3L0BA 1NPTO 2ONZA 4QXMA 4XTRA 1RHQA 2WIAA 1M1UA 3FUCA 4EHBA 1KR2A 5CX1A 4YIKA 3T7KA 4XKJA 4E94A 1WPXA 1ZVQA 4DLTA 3EQ8A 4TL8A 5B7NA 3QXHA 3U7EB 5KSYA 2W2KB 3AH8A 4YYEA 3BD6A 4KUEA 2WVAA 3H11A 3E58A 1BWSA 3OCVA 3VFDA 5FQNA 3WS7A 4D7AA 4PYJA 1G16A 2ZJ3A 5KVCA 2Q3JA 1CV2A 2X77A 3EIWA 3FDJA 4P33A 3X2FA 2VN8A 4M9XA 3MWDA 3WJ7A 3R3HA 3DFKA 2OXEA 4MI6A 4TLMB 4S12A 4G5OA 4WE3A 4WBNA 2GJ8A 5IAEA 3VA7A 3ROKA 3ZTTA 3U0VA 1FXSA 1PJZA 1V8DA 2CLFB 5K6AA 5DI9A 4R6XA 3QXGA 4L76A 2H1FA 2RHBA 5DSXA 2XSZA 2FN4A 4K9QA 3N53A 4HL6A 1AB6A 1TMYA 2EV9A 1N4DA 2P8JA 3F6YA 4KQKA 4MUNA 4OX9B 2QTGA 4ZVUA 1Z88A 3MJSA 1W88A 3CUSA 3PWKA 4DLPA 2GD1O 3HXPA 4YV7A 4IKEA 5K03A 2OORA 4RCVA 1T6BY 4OGGA 4ZV7A 3WWCA 4TYNA 1Y5RA 3G2NA 2C3MA 1UFKA 4QAJA 1FJ2A 4FKBA 1WHTB 3OURA 4RNDB 3SVTA 1VMIA 1F2DA 4G97A 3IUJA 2JHCA 4J3FA 5BWMA 1SURA 2P2CA 5CHEA 1YO6A 3RS7A 1GGNA 4PZ9A 1S2OA 1USIA 5CA1B 4CG1A 5G0SA 5I4CA 5LJIA 3DO6A 1R74A 1Z2AA 2F3UA 4JUAA 3MFYA 5FR1A 1SHTX 1NNI1 5J2TF 2NAFA 3H5AA 3OKFA 2WA1A 1I7NA 3ED1A 3H75A 3I9V1 2O52A 4BQSA 2WMYA 2I6FA 1L5YA 2HLHA 5BUQA 5EJAA 2WRZA 4ISBA 2OCAA 4MUMA 3ZU4A 1NI4B 4P38A 1S5PA 4RYDA 4QUKA 5HKAA 3G5AA 2AYYA 1G5HA 1Y1RA 2V6BA 4EVQA 4EYGA 3E48A 2HA5A 5HUHA 3MRSA 5FPTA 3P26A 2D62A 2XE8A 2VHZA 4KIUA 2CNNA 1LK0A 1MCZA 3UK0A 3UXEA 1SOAA 2D5AA 2EZUA 2QUBA 3GJ0A 4K6FA 2Y76A 1QIMA 2FF7A 3EA0A 1JU3A 5B30A 3HCWA 2C4MA 5KS2A 1NVVR 1UJ2A 1P7YA 3H05A 2ZJ4A 2GNOA 3FZNA 3WRVA 1HLPA 1FDTA 3IIKA 4ZGBA 5AO9A 5E8RA 3WLAA 4Q03A 3OQBA 3CZQA 4BKPA 2JLAA 2OG1A 1JAIA 4JCCA 5CLJA 1MUUA 1QZZA 1LWNA 5EIHA 4ALKA 4LYFA 2FCRA 4QQKA 4IAOA 1MB9A 5ECYA 3E3LA 2VTBB 1Y6JA 4M49A 3VR1A 3FVVA 2Z9BA 5DN9A 3DDCA 5BV8A 1WHSA 1BIFA 1XLTA 3DAFA 1RZRD 4UTXA 4Z7QB 1YR2A 3ZWYA 1R6XA 3ER9A 1XEWY 1UFVA 1V2HE 1WXHA 2PH7A 5CK4A 1RS0A 1XVIA 3FOCA 2EJUA 1E2DA 1OWLA 1YWGO 1E62A 2A9KA 2X8LA 1R9MA 3ZK7A 3PC3A 2YVKA 3ANYB 1J23A 3FMVA 3VSEA 2ZTVA 4PVCA 1W96A 5TARA 2CHEA 5I8ZA 3IALA 4M22A 4GM4A 1YZTA 3WHPA 4DNQA 3OWHA 4FFBB 1NW4A 5DP1A 5JXIA 5TPWA 3RI3A 2E87A 2R62A 4ZZIA 2OHGA 2NTYC 2P69A 1QONA 3NT5A 3OPYB 5DM2A 4AJKA 4EO7A 4XCXA 1PT6A 4Y0NA 1XQ9A 2GPTA 4E51A 4F2HA 2QLNA 1DOHA 3GO4A 1L5RA 1A2KC 2XDQB 2XQKA 2C5SA 2ZSEA 4QXQA 5LLDA 1E79D 2BZ1A 5C34B 1XD9A 3NM4A 2IYUA 2F3RA 3SHWA 3DZKA 1WWKA 3MWGA 1DBIA 5BMVA 1DAIA 3NEPX 4RY8A 1NM5C 3ACDA 5E7QA 5FBKA 3GD7A 1V7ZA 2C00A 2J7PA 2NTEA 3FB4A 3C3AA 5EXXA 3WRXC 3NR2A 2VT7A 3EEIA 3A0RB 3ZH9B 3SEQA 2B4TO 3JARB 2OC9A 4MS4A 4EGAA 1NRJB 2AC2A 4F12A 1XFDA 1FVFA 4KMRA 2QQFA 1L0BA 4ZYVA 1NRIA 4QUJA 1G6HA 1EFRA 1BMFA 4L1KA 5EXDA 1HV8A 1P31A 2PWPA 2QJTA 4JJ8A 3GWGA 4ZP1A 1YZHA 4ZOEA 3Q2OA 2QI9F 4IUCS 1PWHA 1F20A 3K92A 1FP2A 2DAPA 2G76A 2GAOA 3OZSA 4FFLA 4Z99A 1K6JA 3STVA 3ZJYA 4C4ZA 2XAAA 5IANA 3CC8A 1WIWA 4ZCTA 1BYUA 2DY1A 5AVKA 4KYVA 2I1LA 3AESB 3HN2A 2CZQA 4GNKA 3SNHA 4FS3A 4F5DA 5AVTA 1Y9DA 3PP8A 1G2OA 1N7HA 1FLAA 3VHRA 3O74A 3ZNPA 1DCMA 3SVLA 1JDBC 1FSSA 2DHEA 1Q0SA 3ORFA 2IE8A 4URXR 4EHHA 1Y6GA 2ZI9A 2JS7A 1LLCA 5FT9A 3R4VA 3VHXA 5ITVA 5DW0A 2CHVA 4BNUA 2CVPA 3DGFC 1L5QA 2NSDA 2ZPTX 3QE0A 2FWNA 1ZWLA 4P34A 4ZRNA 1XGKA 4LBYA 3BTSA 2B7LA 2P6PA 3MTEA 3EB9A 4JMLA 5L4NA 2VPPA 2VYQA 1YZYA 2M32A 3INRA 4GMXA 1OKKD 1DZIA 1U0JA 3IURA 2R7KA 3SI7A 2P3SA 3Q3EA 3R6TA 2Q4EA 3R3VA 3DL4A 1JJVA 3CT4A 4IV0A 2JH3A 4JEIA 4MVJD 5KIAA 1EVZA 1S3GA 1HL7A 4KJZA 3KV1A 3BX1A 2QP9X 1FYFA 3B1KA 3K0FA 4E46A 4ENQA 2GN6A 4QM7A 1IUKA 5B3LA 2R8ZA 4OHCA 3ETLA 1X1BA 4X1KA 3C1AA 1DL5A 3LRTA 3LV8A 4FFDA 3CVWA 3R0ZA 3G9TA 3I72A 3ROMA 4DV7B 3FUXA 2P78A 1Q74A 3PUJA 4D9BA 3I5UA 3TR5A 4CM1A 1M2HA 4D3SA 4LE1A 2QTHA 1C7FA 1W49A 1Y4UA 5BQ5A 3S7TA 1A2OA 4MYCA 2JI6A 1L4UA 2CMHA 4Q7MB 2ZDGA 4D4LA 4O4LB 2FI1A 3WK9A 2CD9A 5LCXA 5B5SA 1PJ3A 2V7EA 2V6JA 3K2IA 3RAFC 1NP3A 1XU4A 2EKDA 3UYKA 3TE7A 2DPXA 2FHPA 4IDDA 4D8WA 3H7AA 3F71A 4MQEB 2RGCA 1RAEA 5B7QA 1W47A 1RPZA 1TTQB 2HU7A 2VQ6A 3JZFA 5JO0A 5B4VA 3KVRA 1UPUA 3URKA 1R16A 3W6OA 5EE0A 3VNUA 1E63A 3U9TA 4FB4A 1LDEA 1L7MA 2C9MA 2XUAA 4AO8A 4F4DA 1JQEA 1JG1A 4R9SA 2VXOA 1G17A 5CCEA 2WU3A 2B1RA 1F06A 3HU1A 3OF5A 3D43A 2HU8A 2RC6A 4YRPA 5GV7A 4UEWA 1EE1A 3RFFA 5F76A 1HEUA 3CMMA 1F7UA 3H3XA 1L7NA 4ZEMA 2A5GA 1Z74A 1V3UA 4TXNA 4G5XA 4AU1A 4MLDA 1CC1S 5FO1A 3O84A 3PCRB 4RL4A 3SBOA 3FTDA 4OCZA 4Z5XA 3IOYA 3ZG6A 1Q83A 4QPDA 1M75A 4DT1B 1PFWA 1TO6A 2OAEA 2W83A 2ZUDA 4NBTA 3ZVKA 1ZI6A 4X84A 4KWHA 1QFJA 3UVEA 1MO4A 4AJNA 4LJYA 4K0KB 1DUSA 4D42A 4KPGA 2V0GA 5JSUA 5DNDA 2NUTA 2YBEA 3O8QB 1E5QA 2IOHA 4BKUA 3EG5A 5B7GA 1JKFA 4MW5A 2Y9MB 1W1UA 2Q28A 4C0XA 1O0CA 1UP4A 4WLUA 2FSVC 4JB3A 1CQZA 5TX7A 3TS1A 5CLIA 4LF8B 1DOZA 3FYUA 4V3CA 1P9OA 2NO1A 2RMKA 3EF3A 3P9XA 4QHSA 3IDFA 2QMYA 2WD8A 3MRXA 5B2ZA 1UZNA 1ZN9A 4KI7A 3VTZA 4AXXA 4EFDA 4J3JA 4QASA 1E60A 1T9GR 2FFHA 2HZ7A 4M1MA 5C81A 1BX1A 5CYOA 1G6OA 1KTVA 3VKFA 4BY9E 5K0CA 1H9AA 5C80A 3G0HA 4QTYA 3IIEA 1L5HA 1EUQA 4I1UA 4RKYA 1F4LA 2GWRA 3O92A 5KNCD 4Y2RA 4XVUA 1MP0A 3M4YA 5K0NA 1AKNA 4G0WA 3LGAA 3EVNA 2VP6A 1YS1X 4RPGA 2JRLA 2VJCA 1TPYA 1Z2OX 2VK1A 3RS4A 3IQGX 5AVZA 4KHPB 3GOQA 2C58A 2FV8A 2O8EB 4M60A 2PRSA 2Q5CA 4MYUA 2CNBA 1CF9A 1YFLA 2ZIXA 4R8KA 4YDQA 2HZBA 2VF2A 2K5UA 3DMTC 2P0EA 3O3CA 2A6PA 1B3BA 3PNMA 5JAUA 2WZCA 4JLOA 1SD1A 1UEIA 5BT8A 4CIAA 1NR5A 1OI3A 5A03A 1E8MA 1NSYA 3BE5A 3A9VA 1E2BA 2QVYX 1DGQA 4Z8XA 1LV7A 4AC9A 4LCEA 3QPAA 3UGJA 2O7SA 4B82A 1A76A 4PBSA 5U9CA 4RTMA 4J9UE 1KYVA 4N76A 4MI9A 2GHIA 2PX2A 2RKBA 4MS3B 2GBIA 1QAMA 1N6RA 2AR0A 1LX7A 2AK3A 2X5XA 3HJUA 4DC9A 1V8PA 5AOCA 2G0NA 3P52A 3ZHUA 1JS1X 3CKYA 4LIPD 5B3KA 3UCFA 4HLQB 3TL6A 5LP6B 1E2PA 3WP1B 1EVJA 2QZJA 2MWMA 2BN4A 3DBRA 4A8TA 1DJNA 4M9UA 1QIHA 2HY7A 3N0XA 2PS1A 2EYUA 2LD4A 3HKDA 4HLUA 4HVAA 2HPZA 1G7CA 2LRHA 4XAQA 3NOOA 5BYJA 5I8WA 5KSWB 1GIAA 1X1SA 3ESAA 3ZLJA 4BE7B 1MA0A 3B13B 2O2ZA 2OBMA 4KWEA 4LGMA 5ULLA 3FKSD 9ATCA 1H3EA 1C3OA 1TVKA 8ATCA 2X8AA 5SICE 4AYXA 1E2EA 2CBGA 1Z13A 1QS0A 3CW2A 1TTHA 1YQUA 4IXDA 1KEUA 3WL5A 5HKLA 3OOYA 3AVOA 3HA2A 4H1WA 2JJ2D 2D1SA 1HK7A 3DOHA 2GTPA 1PSDA 4TTRA 4DCUA 5HS4A 3I30X 1SUDA 4MVJA 2NV2B 1OROA 2R86A 1GNSA 2HXGA 4R9UC 4BNDA 3VVLA 1Z08A 1UODA 1C7ZA 3NOQA 5E4JA 4Q9IA 2NYVA 1W94A 4CMCA 1X1CA 3TLGB 1GXSB 3PJDA 3OJFA 4BP8A 4QYSA 1NMEA 1X3LA 4KWCA 1MZVA 3KUCA 4JB2A 4PRKA 4RETA 3PGA1 4UBOA 1GSHA 3GYGA 4WZBA 3U3JA 1EWQA 5FTMA 2XYRA 3V4VB 4XEUA 4JVNA 4R71A 5JWRA 4JUCA 4BOYA 3JW8A 1X7YB 1X6VA 1OIWA 2PGXA 5H8WA 4PTYA 1M74A 2PLAA 2R47A 3N2EA 3PEUA 2IWRA 4DAEA 1T1JA 3DZIA 3EZ7A 2YWRA 4KQWA 4RY0A 4W9NC 2YFHA 5DCLA 5IYZB 2FSSA 3R24A 2Q6IA 4UHEA 4P53A 2L19A 1T5OA 3ZHCA 2QMOA 4F2GA 1YQEA 1AV6A 3LXRA 3SJCA 2BEVB 1HNZB 3OJLA 1CUJA 4L8VA 4XFDA 5L6LB 5LZ7A 1P80A 3L7JA 5ALHA 4RH1A 4YO7A 1NMXA 3PQFA 1ORRA 4QQ8A 2GRAA 3OLZA 3OTQA 3O47A 2FR0A 2GN9A 3DWIA 2IU4A 2AIRA 2ASVA 3G0DA 4ARIA 1U1GA 4ARUA 1KU0A 3R7LA 3HRIA 4OJYA 3RSGA 4OFXA 3KT3A 4Q5IA 4B5LA 5I45A 3LUJA 5EMJA 4LV8B 4ZRDA 1PNRA 4MDFA 2I3GA 2AD1A 1NT4A 4QUIA 2BUCA 4Q39A 3LA6A 4BZWA 1LXCA 2ZYVX 1H6DA 1QIKA 3QPBA 2YHAA 1ELOA 4ZGWA 1H9CA 1PYOA 1LD3A 3ETJA 5KU7A 5TPZA 3LBIA 1VSVA 1N2OA 2DBYA 4B4VA 4NJMB 1Y9EA 2XLBA 2ZZMA 3AR7A 2C0CA 2W70A 4IIVA 5TMBA 4CG3A 1EWRA 2DHDA 1KS9A 3VZRA 1EG2A 3HB9A 1R3DA 2UU9B 1GADO 5DM1A 5FOXA 2JFOA 2XWSA 5KC8A 1C30A 4C0SA 5BNFA 4OI0A 1LI4A 1R9GA 2C99A 3B1YA 4NBKA 1RAGA 4L6AA 1TD1A 3UMJA 1P1CA 121PA 1JEDA 1PT7A 3H42B 3IBCA 4LGYA 1X0XA 4NYJR 1DV2A 3BQMB 1PYDA 3SYKA 3FMIA 1JU9A 1WSAA 3WMFA 2LR0A 4YRKA 3U44A 4C6TB 1EYZA 1QTIA 2YIJA 3LY9A 3HCFA 5KNCA 4TMZA 2C82A 2ZBFA 3SZUA 4GXTA 1Y4DE 4WJKB 3BIOA 3AI1A 4O5OA 4P86A 2ZRFA 3WKDA 5IT9A 2BFBA 3QXXA 3QUAA 5JR3A 3LHFA 5IS2A 3FCSB 1F8GA 1YI0A 4G07A 1G8SA 4LRQA 1XQYA 1YE5A 2J3KA 3NGXA 4F1KA 2WTAA 2FMHA 1MHTA 1G55A 3LI2A 2GK4A 4QGHA 4PNHA 2GD6A 1GAEO 4M36A 4WCDA 1V95A 2ZYSA 4Q82A 2IT1A 5G41A 4JA0A 1GITA 4KGDA 3ZI0A 1JI3A 4X9XA 2CDRA 1PJ2A 1QVWA 3BE8A 1S4QA 4JBIA 1TEVA 5DWDA 3RIGA 4E1BA 3VAAA 1HWYA 1MHPA 3U1TA 1LRKA 1PJSA 2GZAA 2VJLA 2XQJA 3RTBA 2AG8A 3T4UA 4BO7A 2VTDA 2Y6UA 2BFMA 4IJWA 4YUXA 2XHZA 2FFBA 5AVWA 3EEBA 4BO6A 2JD2A 5H70A 2H5IA 1VL6A 1OIVA 3FOZA 2CE7A 3ONDA 5KNBH 3VJKA 3ZDQA 4UQLA 4RKRA 4BVGA 2D06A 3ZIUA 1ORHA 2QD2A 2V59A 4ZT2A 4PZUA 3FSGD 4EY8A 1JKJB 1U6JA 4TT3A 3H16A 3DZJA 1B8OA 4H15A 3ZD8A 3F1KA 5AK0A 1P91A 1R50A 2D2XA 1V7CA 1QBGA 2YV2A 3RTAA 5IAAA 1P4JA 4H9GA 4LFCB 3WB0A 2QLFA 4E0BA 2JJ2A 4HPXB 2JFZA 2RC5A 5A5GA 1M3SA 3FRIA 4INJA 1CYDA 2JB9A 4XFJA 4E5KA 1GCUA 2F6RA 2I67A 3V8NA 3UMFA 2BFNA 1L8QA 1VPLA 2CN1A 2DSTA 2O3SA 4Z0NA 4OQLA 5EN4A 4NZYA 3SXJA 2FKNA 2HTEA 2H2IA 1Z29A 2XWQA 1WZNA 3HJTA 1EX9A 1SCAA 1XMVA 3HL4A 4GP7A 1GEEA 4XM1A 3ZEAA 4BNVA 4PYNA 1ESCA 2Q7DA 3TB4A 2IS1A 3MUNA 3GL9A 2NVUB 3D6FA 1UAGA 1VP9A 3ESBA 3H04A 3OG9A 1KEKA 1E0SA 1F8YA 2BWJA 3LCVB 1HR0B 1O6ZA 4LC0A 4ZHQB 2BY4A 3KAQA 1D8TA 1I1OA 2FLVA 1H1LA 2J4FA 3KK0A 1ISSA 1QH1B 4FT2A 2YHIA 1BEUB 1TX4B 3CV3A 4U7FA 3TFWA 3WNCA 1EP9A 2WFZA 3RQSA 5GZ1A 3WIBA 3RU7A 1FLNA 3RT9A 3CWCA 4HJXA 4G1MB 2A67A 3BL6A 4D56A 4TS1A 2HXYA 4KZPA 4MRSA 1AGRA 3TUJC 2ZRHA 1NDHA 4YCNA 1BX0A 2D0PB 3DE6X 5J3JA 1P7CA 1CS0A 1RIFA 2DUMA 5FLKA 5BQPA 4PFJA 4BMZA 1C8VB 3TQTA 2AMLA 2XMRA 3ODPA 5J2TA 4EG6A 3AKEA 2O3RA 2LCQA 5E3JA 3HTXA 2EJWA 1C9NA 1V1JA 3HWX1 3PWZA 3K9HA 3RAPR 4Q7JB 4R0MA 1A9SA 4CPDA 1Y4AE 4WFQA 5HRCA 3T3HA 5AW3A 1DPFA 2EW1A 3DOFA 3MFQA 2OQIA 1XWIA 4WOJA 2BONA 4Q9HA 5HJ2A 2R66A 4IIGA 1KJQA 1AZTA 1ONSA 2IYSA 3MAGA 1Z5PA 2VZ0A 3C87A 4G0ZA 1J56A 4Y1GA 5JMPA 1UBUS 5FUXA 1I2MA 3QHQA 4WKBA 3COPA 3NKFA 4Y9DA 3M6LA 2JC3A 4CUZA 1SJ9A 1ZGZA 4XWTA 4F46A 5FHQA 5I9MA 1PNQA 4YQEA 3ZDBA 1WMBA 2FWIA 5HF5A 1HDXA 1N8TA 3D8UA 3TG2A 1O8CA 3MB8A 4OTZA 1FB5A 3T4EA 2W43A 1YAJA 1XJWA 3UW3A 1ENOA 2O2GA 2Y0CA 1JG3A 1XRRA 2X8JB 4L57A 1FQWA 4X5OA 5K8LA 2O3TA 2EEPA 3OCJA 3ECSA 5L95A 3B7PA 1E0KA 1ORWA 3HCBA 3LXUX 3RGWS 4EYEA 1L8XA 5LQAA 3FDZA 2DR3A 2ZRQA 3EYWA 2XUDA 1PQYA 5DGTA 2GUWA 1BJKA 2WBLC 4MA5A 4BU0A 5IJ9A 3NAGA 1DX9A 5JT1A 3IULA 3SHFA 1M67A 3GIWA 4TQUS 1J24A 3TLJA 5CDSA 1P3DA 1SKAA 4K28A 3JS5A 3D1VA 2ZS7A 2OAGA 2ZYDA 2GNPA 2PX0A 2H4YA 3EQ2A 3GAZA 1X87A 4KQHA 4S1WA 4BNHA 3TJZA 5KOHA 3OQNA 2Z5FA 2C5HA 2FZ5A 2FQXA 3KHTA 4XDGA 2WSSD 2LWIA 1P1BA 1A50B 4G1CA 1JWBB 1O95C 4ZO7A 5F5NA 1ZNXA 4EMSA 4OHXA 2IU6A 2JEOA 2OUIA 3QNWA 4YDRA 5K3DA 5HHTA 5BOSA 5I9LA 4GXRA 4JP2A 4ZA2A 5LZ4A 1ZX1A 3DR3A 1NXPA 1Z7YA 2XRYA 3QTBA 1ZJYA 1R8QA 3IHTA 4PLTA 4TSFA 3ZGOA 2PH1A 3AR6A 1WM1A 1ODLA 3HZRA 4XPIB 2H9AA 4K2HA 4ZVMA 4B2PA 4LZWA 5EKUA 1JDTA 2GTIA 4J75A 4XIYA 2GN1A 1N3BA 3WWOA 5KWSA 4EY3A 4LXIA 3AM4A 2XE4A 4Y6RA 2BBWA 5EJFA 4BBAA 5JUWA 2I87A 1JLSA 3ZGVA 4B47A 1Q0QA 1EFUA 5T3YA 1Y3HA 4YAWA 2NACA 3ITDA 4JZYA 3TGPA 1SZJG 2PA0A 3E35A 1PQ4A 4TVOA 5JJIA 3EVBA 4XW2A 1M33A 1QDEA 2QJRA 3SLGA 3P9SA 4YXWD 3N0RA 4FZ3A 5JZ9A 4BRSA 1XZNA 2J9FB 3P19A 1LLDA 3VJMA 4CIBA 3C3XA 1EFDN 1FE8A 1ZCBA 4RD3A 1ZGAA 4QG7A 1Y6ZA 2OHFA 4ZJZA 1RKBA 1FQKA 3WQQA 5ERGB 1GU1A 1I3MA 4NE7A 1I3NA 3HWRA 1NWHA 3RU2A 4H27A 5GIOE 1OVGA 2DM6A 1JH9A 1N5IA 4IILA 1H2HA 3BCRA 3ZY3A 3CH4B 2D2VA 3SQOA 2VF7A 1F2UA 4CQMA 4JNKA 4ZEVA 3KOUA 2XCQA 2PZBA 1E77A 3S44A 3OIFA 2N42A 3DEHA 4N3CA 3P9KA 1XQ1A 2GETA 2YZNA 1OHHD 1IZZA 1U8ZA 1UBOS 4JC4A 2IA5A 4KZKA 3K0AB 4TN5A 5EQTA 2MR6A 2R11A 1XD2B 5TEWA 3CVOA 5F64A 1I4WA 4QXOA 5AW4A 5FBQB 1TK2A 1XQ6A 2JLUA 1IVSA 4P36A 4D9CA 2KMLA 3EVZA 3LO8A 3PGKA 3TWOA 4QLBA 3RRNA 1H6BA 2WKRA 1SWWA 1FNBA 3RJZA 4B3XA 1FDUA 4E7OA 4F71A 4JEMA 3K1YA 4YJKA 1DFIA 1Y0BA 2QTAA 3E84A 4I4TF 1F0NA 2XDWA 1V6SA 1MX5A 3MILA 3OPYI 3OPXA 5CB8A 4GL2A 3QV2A 1IIBA 1F17A 1GPNA 1T25A 1UFRA 2EFGA 3TB6A 3SS8A 4ENTA 2GS9A 3RYFA 1Y33E 4Y9TA 3WGUA 2FFAA 1ZXLA 3HDQA 3Q87B 4R2XA 2ZT5A 3WNBA 2QPTA 3DNFA 3ZDAA 2PZLA 3PI7A 1XQWA 3VX3A 3G49A 4FEGA 3K15A 4O8ZA 4JLKA 5TJHA 3EGOA 1U7UA 3T9CA 2QRNA 1AKTA 3TMAA 2A5FA 4DV1B 2QTBA 5FYDA 5DISB 5H80A 5FOWA 3TIGA 1Q57A 5I7VA 4RDCA 3SDZA 3DZFA 3GFRA 1GR1A 1UADA 4A6XA 3N86A 4GL4A 3RIXA 3FCXA 1O9BA 1JIIA 2VAMA 2FNAA 4GS5A 2REXB 3CUTA 3DW1X 3SM3A 2I3AA 1ZVJA 5DW3A 3S3TA 4CLXA 3GUZA 2J85A 2FWAA 2QL7A 1JPJA 3IAEA 3FD8A 1GZVA 3C7DB 1QORA 3GJRA 1GTRA 4H7IA 3AY0A 4BNTA 5CB6A 1X74A 3FVWA 3R8FA 1J8QA 2JGJA 3L1HA 4C0AC 2CJPA 4LHVA 2DFVA 1UXKA 2IVFA 1MC4A 2QRQA 4BFXA 3ROXA 4BEVA 1FYVA 3U7RA 3IMGA 3LG2A 1NNSA 2GEFA 2JCXA 4I1VA 1B1CA 1B7GO 5CJPA 2HLDA 3GA7A 5AVOA 1PT5A 3KUUA 3VR5D 1HE3A 3MD0A 3RWOA 3ASYA 1IRIA 1DE0A 4M1TA 2VWPA 3IAM6 3SQMA 3PX7A 2ZZKA 4X00A 3LHDA 3OE7A 1PWZA 2XXAB 4HUQA 5I7EA 3O31A 4MUHA 2ZUUA 3E1SA 3NM6B 1W4BA 2Z4RA 3HBNA 1PUIA 5BN5A 1V25A 3BD8A 1JQBA 4K81B 4BE4A 5LDHA 1QC5B 2HSZA 5JNWA 2JGDA 3JATB 3LA8A 2FPUA 4DUZB 3VZSA 4YCCA 3R7FA 3G0GA 5AVXA 3KHSA 5DHSA 4TSKA 5E1OA 1PO7A 2BR5A 5FORA 3U3MA 1VG0B 4BECA 1Q16A 1BVUA 3IKVA 1ND6A 2W00A 3ADOA 4O5AA 2J67A 3UB3A 4M1WA 2QGFA 2FMUA 3CWZA 2OPHA 4TN1A 4OMUA 1WB5A 4D3FA 2BR4A 1GD1O 5FBHA 3BH0A 2BSAA 3BGDA 2WYVA 3MNFA 5LB2A 4B6FA 2HA6A 4BVKA 3RO7A 2QMZA 2CVFA 2IBMA 4UZEA 1ENYA 3QVGB 3SQNA 5KVAA 1OT5A 5HQ3B 1UBTS 4AKSA 4WSOA 1ODCA 1LQTA 2OO3A 4HEA1 4P84A 3AYZB 4QLAA 3UWPA 3T3OA 1U9ZA 3O4FA 2FW6A 2J4DA 3KM0A 3CX3A 1FMJA 4LK3A 5B1IA 2VPTA 4IJKA 2X4IA 2BKUA 3V1LA 2RI0A 3DLHA 1N2IA 5EIBC 4JYZA 1XSEA 1N1GA 2AFHA 2I7DA 3KPUA 4QJ5A 1DTWA 4F85A 4MCAA 1SQGA 4MICA 4X0EA 3FPBA 3VGPA 2GM4A 3RPEA 4CJXA 4YXWA 2WWVD 2WDZA 3GOHA 4TWAA 4OHVA 4LJ8A 1RZVA 3PQDA 4RA9B 1PGOA 2C4HA 3TSWA 2ZM5A 3NBQA 2NP6A 4UM9B 5AW5A 2V3CC 4N5NA 3GA0A 4MW7A 2P65A 5ELXA 1ZXBA 2VTKA 4DV3B 1LS6A 3CZAA 1T3SA 3AILA 3H1FA 3HJFA 2QNIA 2QZSA 2YXLA 4GWGA 2GA9A 5ESRA 4MA0A 4BNMA 4CUKA 3GJSA 3EIFA 4TRMA 2RGUA 4TKVA 1A7JA 3HACA 3G2OA 1RI5A 2AOXA 4A8PA 4BO9A 2PRJA 3A32A 4DLZA 1CF4A 1HE1C 1PZGA 2YJ5A 3N0TA 4RSGA 4WNIA 2FB9A 4TXLA 4DBZA 1E3WB 521PA 3C41J 1D5CA 1CR2A 3TOCA 1BEEA 1X42A 1X1RA 2V9ZA 4I08A 4FR2A 4G4JA 5T5QA 4E1AA 5ED4A 2EF0A 2ZVQX 2IEIA 4K9PA 2WD7A 3OOHA 1G8JA 3UMVA 1YONA 2IKSA 4FMBB 1SHLA 4TSRA 5FADA 4YREA 4QOFA 5EC8A 3G3EA 3RKUA 2QYTA 2DCMA 4HAUA 3VRHA 5KTOA 4Q18A 1U0TA 2DX7A 4W7SA 4J0JA 3FMFA 1J7JA 3E22B 3F6PA 1ZJWA 3PUKA 4NNPA 4OJNA 1I80A 2JVIA 2WF6A 3NTOA 3GLFA 3H86A 5C5CA 3TLBA 2NYUA 4C5CA 1S96A 1Y1LA 1NZDA 1RLIA 4LZOA 4WCFB 4AMUA 2BH2A 4K26A 2X7JA 3T7IA 4JUDX 4A1FA 4AKHA 5ALGA 2B8TA 1FK8A 3TLMA 4N49A 2QL6A 2XMPA 4JX8A 2GA8A 2IYYA 3FPLA 4FX2A 4EATA 5ALDA 2IH4A 4IS2A 4LXXA 4RESA 3MWFA 4KLNA 4M4SA 4Q19A 1K66A 3SJAA 5JYEA 2OSVA 1DWOA 3TIXB 3ICVA 3DKVA 4Y8VA 4JBGA 1GDDA 4X7RA 1OXSC 1P75A 4YJGA 3TIIA 1GG5A 1TUGA 3L1IA 3IAS1 3BJRA 3JQ7B 3LCUA 421PA 2Z1DA 4G9BA 4ZO9A 5K51A 3ZR4B 3T54A 4LHYA 3C45A 4YXFA 5F9FA 3PYXA 1VIVA 3HN6A 5DHQA 2PUWA 5BXQC 2RJOA 2E85A 1RRPA 4OEHA 1UT6A 1XHEA 3ZHBA 1CRLA 1JBKA 3UUEA 4ENVA 4QVIA 1SXQA 4F4CA 2X13A 4JSRA 1VXOA 4BMSA 1CQJA 3CNQS 4LSMA 3PNLA 5D5HA 3R7NA 1SXHA 2QR2A 4BJHB 3TGLA 3W2FA 1JIKA 4G5QA 2OOSA 3IEXA 4UZSA 2Y27A 3WL3A 4PAWA 2DBQA 3UBMA 4YROA 5BSWA 1GSIA 3C6YA 1E20A 3VU1A 1ID8A 4IMPA 1PL0A 1Z7WA 1AN0A 3ZC3A 1SIWA 3VR5A 3UICA 2WPDA 1OB2A 4M6WA 2VYVA 2HK6A 4Y6QA 5BN3B 3G1WA 5BNIA 1MPTA 3AJAA 3C8UA 2BFFB 3EH2A 3IC5A 1FP4A 4JX9A 3OJOA 4IICA 4CLRB 1JDZA 2PWYA 6ADHA 3RBXA 1CDEA 3D3KA 1Z6ZA 3RBAA 4KNVA 4KO2S 3UJAA 1JF8A 4NMLA 4BDTA 1D7OA 4HXYA 3RFVA 2E9SA 4HH0A 3H2IA 3TX6A 4C88A 3KQKA 4XZ3A 2B94A 3LF2A 4RPJA 1Y8QB 4MVJG 3WC4A 3EGIA 4DZTA 1XB2A 3IVAA 3N87A 1ZD2P 1NC3A 1OZHA 3PJEA 3PL5A 4GPD1 4N0EA 4BP3A 3P2KA 4GBED 1V45E 3EDYA 1WUYA 1Z8DA 3GARA 4BO2A 2O7RA 2P6OA 1BN7A 3GUVA 4FUTA 4BTVA 4POOA 3N2KA 3KQUA 1JXQA 4KPEC 4DR5B 1I3KA 1IHYA 3AF0A 3AKCA 4NV0A 2PNJA 2I78A 3JD2A 4B7XA 1N5MA 3D0OA 5FWAA 4QM6A 1XZAA 1PFQA 2VA9A 3ETGA 1L5FA 4S0XA 1E0DA 2RG7A 1WCYA 4M0PA 4X1OA 4E5YA 1TC2A 3GP3A 4U7JA 3OZAA 3LY5A 3D7SA 3QX8A 1I2BA 2P5YA 3IV6A 4ZVKA 5IAGA 3VH3A 2VXYA 4RQUA 1OF1A 4KR6A 2YKGA 3CINA 2D5BA 4K9LA 4EELA 1Q91A 5HOQA 1VJTA 5KJ1A 1E2KA 4MQ5A 1FC0A 2DPLA 4QHTA 2BBSA 3V7FA 5LNK1 2GCNA 3ML1A 2C2HA 1X9GA 4A7PA 4B81A 2XUOA 4IQ8A 5FWNA 1KK3A 1T36B 3EVFA 1KJWA 4BGIA 3DAHA 2ZUBA 4DEYA 1SRQA 1V16B 4O1IA 3TTTA 1RD4A 2P1ZA 3EFBA 2EW2A 2NUBA 3EEYA 2GASA 3EZLA 4XGRA 4B8WA 3ZZ1A 1GU7A 3ESYA 3GROA 4JLVA 1ODKA 3AEQA 1JLMA 3WAGA 5LIRA 2II6A 1SZCA 2Q0HA 2IDZA 1NF9A 1WQ4A 4Q1AA 1T5BA 1R5OA 3CGGA 3K4QA 1YZLA 4IF4A 4YJ3F 5DCYA 5BSMA 3SC3A 1TCVA 4MWCA 1SC3A 4BLVA 2YZMA 1PRYA 4KTVE 3SJ7A 4N65A 4JU8A 3FLMA 5JXHA 4JJIA 4G85A 2VPYA 2ZQ5A 4A73A 4EHFA 1YVUA 1XNRB 3LAWA 2QRVA 3C6ZA 1MJGA 2OBYA 4YWJA 5ICSA 1KAOA 5ILQA 1CQXA 1XZJA 3E7XA 3C3CA 3GQVA 3QU5A 1LI7A 3FHJA 4AY6A 1EK5A 3CPEA 3ZDZB 4DHWA 1URPA 3DVRX 1RKUA 4MVJP 4LOHA 5K09A 3DKKA 3EBPA 3OCUA 5J47A 4HP8A 5KU1A 3KRTA 3K9LA 3KYCB 5IM4F 3H99A 3JAWB 4Z3OA 3E61A 2VDWB 3GJ7A 2WSIA 4JLNA 3JVUA 1FSFA 5CLQA 3S7ZA 3EOZA 3DBOB 3ZDEA 1U9IA 5JIBA 1TCCA 1QGUB 4O4HB 4TVKA 4XVRA 1Z4OA 4MLZA 2VLBA 5TGZA 5F5XA 3OIYA 3NAZA 3W9BA 1K08A 2VTVA 4F72A 1D2RA 1E9EA 1P1IA 3OT1B 1SPXA 1IG3A 1P5ZB 3VYTB 3P45A 4N5LA 2GK6A 5ALSA 5LQSA 4EY4A 3DBLB 2E4ZA 2O06A 3AFIA 5E0KB 1TA0A 3V80A 3X1DA 2QA5A 2ERYA 4G5FA 3M4XA 1XA3A 4J90A 4QO7A 1A9YA 4RC9A 5FWXA 1OH8A 2W6JD 1PLJA 3SLRA 3NHRA 6REQB 2FMFA 2OCIA 4FC6A 4RJKA 4C0HA 4YV0A 3U3RA 4R4JA 3PVZA 3PD7A 4HJRA 4IDAA 4XDZA 2DF8A 3PUYA 1E59A 3A4VA 4R8VA 1DAKA 1OZ0A 1QTNA 4GC9A 1RMQA 1JU4A 1YACA 3IPXA 4TXMA 4LBVA 2DBRA 2PD6A 2ACKA 4N40A 1W4CA 2F4NA 1DTSA 1J06A 1HETA 1KQNA 4KDCA 3RJ9A 3SJZA 2PKWA 1A8SA 1HURA 2CCGA 2VQSA 2QVBA 2WMNB 3QLUA 4HXEB 4FJ1A 4QXRA 2QZ4A 1T0JB 3STYA 1V8FA 5BN1A 5A3SA 4IPTA 3GLGB 1VA4A 2NNLD 3DOOA 2ZJ6A 5K4AA 3K72B 4NJEB 2CJWB 3G7UA 5C3MA 1QCZA 4PC3A 2E5LB 4W5NA 3UZUA 4P3OA 2XCRB 2CGEA 4N9WA 2IEAA 1R4MB 4GZ5A 4MPTA 1ULTA 3R7AA 3RREA 4BB6A 2GBLC 5JJBA 2ZSUA 5DGXA 4TYMA 7REQA 3TN7A 2PHZA 2QNBA 3NS7A 4GGPA 3RU9A 2WIFA 3TAXA 5HFAA 2HA4A 3G8CA 4YO8A 2XEXA 4CFYA 1ORVA 1J2EA 5JCOC 1PHRA 5JVDB 5LZ8A 4LJSA 1D3AA 5ANRB 1BDJA 2XYQA 2XUGA 4QYMA 5AESA 4NTZA 3CLUD 3IE1A 2IXBA 5GQSA 4AZ0B 4JJEA 4YS6A 3X44A 3ET4A 3N2YA 1F2VA 1WNTA 3GPCA 1QHEA 1JSXA 3CKKA 1Q50A 3F78A 4CHTA 4F96A 1Z4LA 2GN2A 3VNQA 1Q1AA 3DBHA 3NP7A 2CL0X 3QFHA 1KSGA 4KR3A 2EAUA 1W5TA 2UVQA 3LTEA 1JX6A 3OO1A 2HX1A 2I2BA 3UJDA 2NSYA 2O0HA 3KUKA 3UWDA 4A03A 3JYHA 1Z25A 2X2OA 3EDMA 3MSCA 4LY0A 1IN7A 2AXNA 4NP6A 1VIYA 2XITA 3KTDA 2I29A 1ONNA 4JU9A 3QJYA 4MQ6A 1RC0A 3AJEA 2ZIWB 2ISSD 1DZ3A 2I1VB 4HSEA 1D1QA 4RGQA 1KIMA 3EAFA 2FEOA 3SNKA 3HMKA 3L7OA 4OXKA 5JFOA 4TV8B 3ZCRA 3JQBC 4DJTA 1FU8A 2EGGA 1IBSA 2H2FA 2O6HA 2GRJA 4U6NA 3TLEA 1A8HA 3ZBPA 5TQ2B 3D2LA 5LU8A 3BGOS 4YV1A 4QREA 4JQYA 5CCDA 1FFXB 4MGEA 3OM0A 2C9OA 3DOJA 3LQYA 3THWA 1AC5A 2O8CB 1MORA 1YU9A 4H3KB 4JJGA 2RH9B 5EZQA 3ZLUA 1IWBB 3UJ3X 1HTTA 3ZWWA 1K97A 4AY2A 3WYNA 1P61B 4UOZA 2V7QA 2BISA 4XOIA 2VXBA 4O4JF 2YICA 1MGOA 1VOTA 3VZCA 2CDCA 3EARA 5HP4A 1N0UA 2R1TA 3I6YA 1UDBA 3DQQA 4ZYXA 3M1AA 3ES9A 1TTTA 2JH8A 5LUAA 1GJRA 4MGKR 2YWBA 1L4KA 2RI6A 4YJHA 1F3OA 1SMKA 1KK2A 3H0EA 4KFUA 4BO5A 4CL2A 5JNRA 3NPAA 3QUCA 4J8PA 1JT2A 2X6QA 1HZZC 2XMGA 3D6MA 2YMMA 3UY4A 4ASUD 4PC7A 4QTUB 4FN4A 2OOKA 1OLXA 4YJ2B 5HRAA 3OZDA 1VSQA 1GRNA 5ALFA 1N2XA 2QN1A 2P4EA 2ZJBA 2DH5A 4JKOA 3KWMA 4RVUA 3WBFA 4DJAA 4RFVA 2JEYA 5GZ6A 2HC9A 2ZJ5A 4J9VA 1DBWA 3ZYZA 2G08A 1UJ4A 2GBPA 1NXOA 1OU4A 1EAMA 3G2QA 3EZYA 3QVXA 5DM0A 3HA3A 5BVHB 2CXUA 2PU5A 4UNRA 4ZTBA 3S1LA 2JAOA 3LPAA 3Q7TA 2BGGA 4HUJA 4XM2A 3ZBUA 1U2TA 4C4OA 2A7XA 3EOBI 4IJMA 4US1R 2IW1A 4G84A 1QQAA 3ZQUA 1BJRE 1RRFA 1Z8FA 4ZYWA 1HC7A 3EZNA 4XPZA 4E12A 2RDMA 4FEEA 3ZQJA 4RDXA 4WA8A 3CNHA 4S0ZA 4ZREA 4A6EA 2F8MA 3DL2A 4EPRA 5EESA 2FSFA 1HXHA 1A98A 1QGED 1UIMA 4W1RA 5HUJA 3LDFA 3LXMA 3GXOA 4OVKA 3V4ZA 5EZYB 4N0QA 3T5AA 1MG5A 1KZ6A 4RS3A 5E38A 1E8DA 2R6AA 3IRVA 2C3YA 4UFOA 1CZKA 5CD1A 1PFKA 3BRWD 4RVNA 2J9RA 2ZB4A 4JLAA 1STOA 2HWWA 3ADKA 5B1DA 3WDLA 3UXHA 3LC2O 4BQIA 4GYJA 1XZQA 3H1AA 4RY9A 2I2DA 3Q7IA 4FNOA 4G0XA 4DMMA 1XA0A 2ZPUA 4ENPA 4JGGA 3TDKA 1JWLA 3OEYA 1B8NA 3E05A 4RJLA 3IDAA 3PKJA 4PLZA 3BJIC 2QTVA 3A36A 2AOWA 2H4ZA 3A9UA 3BDVA 3BMNA 1VMKA 3H83A 4REMA 4X6YA 5DHAA 5G3ZA 1G5RA 2VP0A 3K6JA 2A0WA 2HWYA 2AUTA 3C1OA 1XKTA 2WQ7A 2COUA 3A31A 4LRTB 4I4TA 2QN2A 5FA5A 3IE0A 3FROA 2YOGA 2P3OA 4B17A 4PWZA 4WJZA 1CFJA 3CXUA 2PZGA 3PWSA 2IRWA 2CLDX 1UJCA 5FL3A 3KR0A 4ERNA 2YCBA 5L8VA 2UUOA 1KPHA 3OA2A 5LR6A 1MIOA 5IXSA 3PQEA 1JHQA 1SUPA 3BD9A 1NW8A 4BUZA 4CW7A 2NXJA 3E9EA 1SKUA 5FBWB 4AN1A 1X80A 2XDAA 2CL6X 4MR8B 1WULS 1FDIA 3R75A 4TWIA 3GLHE 3JAKB 4DWOA 4EO9A 2W8BB 1K6MA 1Z4JA 1PWXA 2AH5A 3CH6A 1NHWA 4PANA 1CB0A 1VKRA 1AUPA 2GZ1A 1KRXA 1MW8X 1RCTE 1SUIA 3OIVA 2GB4A 4FE7A 4AZWA 1NOKA 3DDOA 1UBCA 2PGNA 3JD0A 3MT8A 3QGMA 2KPOA 1SD2A 4R0NA 3TTWA 3QELB 4PICA 2PIAA 3AMVA 3Q41A 4J3NA 3IKJA 1BH6A 1P60A 1NW3A 1VE1A 2QY6A 2I9PA 4NL4H 1NQTA 3CEHA 3IMKA 3MERA 1EA7A 5LYYA 1RHUA 4JB0A 4Z51A 1V8ZA 2HDOA 3DTVA 3ON5A 1TUBB 4D3YA 2W4IA 2SECE 3V3TA 2Q5IA 5L3RA 1E96A 1A8IA 2REBA 1II8A 1OXKB 1X19A 1KIAA 4G5YA 4R7GA 5C8YF 2I3ZA 1A5BB 2VJOA 1IN1A 3TL3A 4FBGA 5HCNA 1UWCA 4LSGA 5DTQA 2GBGA 5CDYA 3D6TB 1YJQA 4L6IA 3FG9A 3SJUA 2AJLI 3A1EA 2C7OA 3TQRA 5GWXA 3KTAA 4F6CA 1M7HA 3KZOA 4QBHA 3M6FA 2B2CA 5LXTF 4CRWB 3AF5A 4EB6A 3QF4A 3FDFA 3F5MA 4KWTA 1NM5A 4PPQA 5F23A 3LSYA 5LD2B 3I01M 2MOKA 3FZYA 1LSUA 4O3FA 2CC2A 1C2YA 4ZGGA 1SB9A 3DT8A 3BMOA 2BE9A 1H5UA 1EUCA 3THOA 2XIQA 4J6EA 4FYPA 1W19A 2CVHA 4Y1RB 4R1NA 4NCJA 3UUGA 4CU5A 1AO0A 3ELBA 3T9AA 4ZQFA 2PWZA 1SCUB 2FP4A 2C04A 3ICOA 3IRUA 3K2QA 3AERA 1CQIA 1QAQA 3Q3JB 1C0IA 2AF3C 4O2BF 1RVDA 4RMJA 1XK7A 4WKCA 5DYYA 3TMKA 3CZMA 3N2LA 1FIUA 3ZXYA 5LSAA 2YY6A 3A4LA 4V2UA 2PQ2A 2AMVA 4KE7A 4GDMA 3DV0B 3CR3C 4G4IA 5JADA 3GT7A 4ASUA 2XA2A 4TX1A 2PU7A 4QXAA 4R9RA 2DHRA 3V1TC 1B1AA 4YJFB 4EG1A 3FJ1A 3QYPA 4XTCS 2JANA 2ASEA 3WL8A 4GVPA 1BGWA 2WMDA 2FQQA 3IAFA 1NBWB 3S2EA 2BMAA 2Q6VA 2Y1EA 4FHEA 1JHUA 5G4KA 1KVTA 4DCSA 2KYRA 2PA3A 1K06A 2VP5A 1SR8A 2KSQA 2OC4A 4WLVA 1WV1A 4FMCB 3SEZA 3VQTA 5FWYB 1LWOA 2BFEA 2P2GA 3AUXA 1Q12A 3DXZA 3TH5A 2XECA 3GFQA 4DDKA 5CT8A 3AVVA 3EFOB 3FUUA 3A1FA 3VR6H 4HNAA 3UXMA 4WMLA 1N32B 1DSSG 4TQ9A 1B8VA 2IZ6A 5A0TA 3Q3IA 1Q3KA 1P33A 3EIOA 1ZD1A 3F4KA 4GEGA 5JFGA 4WKGA 3U17A 4P0PB 4LKOA 2H3HA 2PKYX 4QEZA 3RCBA 1V9LA 2V6FA 4GNRA 3MCTA 4AF6A 1N1MA 1SBQA 2HT1A 3A9RA 5IT0A 3QEOA 1GNTA 1U2GC 5EI5A 4GO1A 4FLMA 4L2IA 1G20A 4Y67A 1V9SA 1P4HA 4KXXA 3EIQA 2PMWB 1R6UA 2ADFA 3HYNA 3KQQA 4YLEA 4JROA 3ZDDA 4TMKA 4ROTA 1K4KA 4YLGA 3PLAE 3GN1A 2BLNA 3QLJA 1LGYA 4OG2A 1O77A 3OE1A 1E3LA 1NG1A 2PVPA 4D46A 4HATA 2QE6A 3WV4A 2IHVA 3F5FA 3V7YA 1NP6A 1YE3A 5E9WA 4CEIB 1PP4A 2I8CA 2VNIA 3ZDRA 4URYR 2H2HA 1SG6A 4HTFA 2H29A 1RW4A 4NWIA 1H5NA 2D8MA 4EKDA 1CLEA 4GDFA 3KYDB 3ADCA 4AO7A 1OBCA 3BH7A 2G83A 2JF0A 3MMPA 4C0WA 5L7TA 4X54A 4NECA 3BGWA 1IE3A 5A9SB 3KZVA 2AHRA 2IYEA 2QUHA 3O83A 2ZM6B 2J7KA 4R2JA 1KVQA 5JYDA 5DCUA 3WMXA 3ONWA 4MV8A 1E1CA 4CCSA 4HDNA 2O4UX 3I23A 4DM4A 2WE8A 1Z0FA 4PSAA 2QN8A 3L6RA 1Z6TA 2FFRA 2J0UA 2RGRA 1NKVA 5F33A 3OEEA 3N05A 3QIVA 4MKRA 3YASA 1Z2PX 5E6RA 1JYFA 5SV2A 2NUAB 1YDWA 2WWGA 2ZRAA 2CNDA 3EXFB 3JQAD 5AR1A 3LP8A 5LBIA 1VYTA 5A7FA 1S2GA 3S28A 2WQ6A 5LKAA 1J70A 1F12A 3M49A 1UWVA 3ZDFA 4X1IB 3L7CA 4B71A 4L9RA 1BXGA 2G9NA 4OHWA 3AF3A 3NHKA 3OJWA 4AMZA 3X3HA 3UFBA 1YB4A 1V4BA 1YJAA 5CVCA 2OYRA 2FSVA 1D7AA 3V97A 4LJRA 4NFLA 4WLOA 3V4OA 5BW4A 4RHEA 3M3HA 4CKWA 4UDXX 4H7KA 4U7HA 1QDUA 3X43A 1L7EA 3LKBA 5F7XA 3ZQ6A 5F7ZA 3GZ4A 2ZBEA 1B0ZA 1JLLB 3G1TA 3KVVA 4ND7A 4W63A 5JALA 1GA1A 1CKEA 1L5KA 4LMBA 2EG9A 3N9IA 1NX9A 3D9QX 5J2UA 1R6AA 5IN5A 4XWYA 2G5GX 4C4AA 3KCQA 1BN6A 4CKEB 3KUXA 1G19A 2D4AA 4FLFA 3W34A 2UYQA 2X5KO 1IATA 3HHEA 1TQ8A 2ZP1A 1SEPA 1R8YA 3AFNA 1ISRA 4KQFA 3NGMA 3EMDA 1JG2A 3WGYA 3Q8LA 3E03A 2VOJA 2V45A 3NYRA 1K7SN 1MEJA 2G28A 3V42A 4XYGA 2GQ0A 2OFOA 3RC8A 4CMIA 3EGDB 4EG8A 3CPJB 3D2AA 3W3AD 1P9LA 2HEGA 3LLCA 3M81A 3OQHA 4Z0HO 4EZEA 1FUYB 2CYAA 2FRXA 4HGRA 1G59A 3S8EA 3DMTA 4MR9A 2OLJA 2PRYA 4MV6A 2CMGA 1ESZA 1T91A 3SP1A 1JALA 4IV5A 3VGJA 1EXMA 2D59A 3MG9A 2NPFA 4XWKA 4QYIB 1AE1A 2JCSA 1TGVA 3KQYA 5B64A 4QO8A 4OGWA 2WSYB 5CVVA 1EBFA 1GLNA 2FZWA 5TB5A 1Z6XA 3AEKA 4MRMB 4BP9A 3UG7A 2FKAA 3PL1A 5TS2A 2WHYA 1AHNA 3V7NA 4JR2A 3QVUA 3DKPA 4AP5A 2HNKA 2B2NA 2WNHA 2BEWA 3OEWA 2ZRJA 1JTVA 2RCYA 2YJNA 4D0GA 1GGHA 4WZZA 2GGSA 2OYSA 3I0ZA 1GNRA 1PBNA 3BWXA 3EF1A 2K2QB 3F4LA 4OXNA 4ZO6A 4COOA 4HWSA 2CKDA 2HDHA 4U8HA 3O82A 4HYTA 5LFAA 4YRCA 2BDEA 2G4LA 2X58A 1TE2A 2I2WA 3LWNA 1NMYA 2IDJA 4G0PA 3M1LA 1QIIA 4JFRA 3K1AB 4PO3X 4BMDA 2ZBDA 1TVCA 3KTOA 5D5QA 1L4YA 3AHGA 3RAGA 3S27A 1XOIA 2JJQA 4WX2B 3E3NA 4RE5A 1LNZA 1YH3A 3FCOA 3KKLA 2IPOA 3HJRA 5E7IA 4A0QA 1D1SA 1DEOA 5DRTA 3D6HA 5FEUA 1ACJA 4YJ3A 4TT8A 2AE2A 3OKCA 2MMGA 1UQUA 3IV7A 3VR4A 4M53A 4M8NE 1GT91 5HUQA 1OW3B 4AX4A 1R4ZA 3KJXA 5ALWA 4BFLA 4HG2A 1Q7BA 2PPVA 3F97A 3JQDA 4L7QA 2QLTA 3ZH2A 4UNIA 1Z5GA 1AMNA 1ETUA 5T4BA 4MRRA 1EBUA 4XGIA 1XZKA 3CRMA 3IR6A 2XXJA 2YYYA 4UHFA 2GO7A 5CTAA 5DRYA 4YMHA 3U44B 1YR8A 1UBKS 2I6XA 1JIQA 4W9NA 5IM4A 4FGUA 5JDIA 4JI8B 3DO5A 4ABYA 2WF7A 1Q84A 2IPNA 5CEJA 1WVIA 2CSXA 3HSYA 2BC9A 3OBBA 4DG9A 2QRGA 5CW1A 2P2NA 3HKBB 1XVVA