1FSPA

Nmr solution structure of bacillus subtilis spo0f protein, 20 structures
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution NMR structure and backbone dynamics of the Bacillus subtilis response regulator, Spo0F: implications for phosphorylation and molecular recognition.
pubmed doi rcsb
molecule keywords STAGE 0 SPORULATION PROTEIN F
molecule tags Response regulator
source organism Bacillus subtilis
total genus 24
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1997-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fspA00
2VUHB 2MSLA 4N41A 2JRLA 1M2FA 1QP7A 1YMVA 1SXIA 4OLBA 1QKKA 1ZESA 1ABFA 4WXMA 3KKEA 4Z9AA 4RS3A 1SXHA 4JA2A 4D6XA 1JYEA 3I42A 2FMIA 2FW0A 3DBIA 4JAVC 3ROFA 2R25B 4E7OA 3OLXA 3G1WA 3N8IA 3UUGA 1NTRA 2TMYA 4KPYA 2OQRA 4Z99A 1P8AA 2I6FA 5KQGA 3W9SA 5DKFA 1TM2A 4RK0A 3A0RB 3T38A 4MS4B 3HDVA 5DGCA 2WB4A 5T3YA 3TD9A 1RZRD 3Q7RA 4KV7A 4O5AA 2E4ZA 3F6PA 1AB6A 1USIA 2FTKE 2E4XA 4LX8A 5BRJA 5GQSA 2PUBA 5KQLA 2QV0A 1EFAA 2IPLA 4UHKA 2HQRA 3RVMA 1PUXA 4NV3A 4Z4HA 2N9UA 2VK2A 5TQ0A 1OXKB 4ETNA 3QLVC 3DGFC 4RK5A 3GWGA 1DBPA 3Q15C 3HDGA 4KK4A 4RK4A 2V0NA 3NNNA 3EAFA 1FFSA 3A0UA 3L49A 4NICA 1TVMA 1ZH2A 5GOTA 2FQXA 4Z4EA 2CWDA 2GX6A 7ABPA 1SXGA 2MSKA 4TN5A 2MYNA 1D5WA 3FDFA 2PL9A 3JVDA 4G97A 4KREA 1D4ZA 1YS7A 4MR7A 3DLHA 3CS3A 1YMUA 3MQ4A 4RK1A 5FWYB 4ZJPA 1U04A 2R48A 3DLBA 3H1FA 1PEAA 2LUOA 1A2OA 4G0OA 4YCSA 1SRRA 3HJFA 2CHFA 3FFWA 1QO0D 2B1JA 3HEBA 1BDJA 1Z18A 2MSWA 1KMIY 2FEKA 3Q9SA 4H3HB 3LKVA 4ETMA 3N0WA 2IPNA 2R47A 2FEPA 2MYPA 2FQWA 2RJOA 1DJMA 3SAJA 1MB3A 2PMCA 4UHJA 2P4UA 1SD5A 3H6GA 3NNSA 4OTZA 1ZDMA 3BBLA 4YS6A 5FBHA 1Y1LA 2IPAB 4N03A 4E7PA 3IPAA 3MYYA 3H75A 3KSMA 3OQNA 3F6CA 2R4QA 2FMFA 1LJUA 2DRIA 1YIOA 3KHTA 3JY6A 4MS4A 4MR8A 4PYRA 1QP0A 3FMVA 3B2NA 2FMKA 4KMRA 1NXWA 5KC9A 4LZLA 1CEYA 4JP1A 5E3JA 4MRMA 1MB0A 4RXMA 2IPMA 3CZCA 3LUHA 1EAYA 4LRQA 2WWVD 3C3MA 3H1GA 3C6QA 3LUDA 4YRZA 1BDIA 3D02A 3DZDA 3LUCA 3IPCA 4Y9TA 4YLEA 4QYMA 4EYOA 4JOQA 4Z4IA 1P6UA 1DRJA 3HO1A 4W5QA 4WUTA 4KZKA 5EWJA 2ZAYA 5B3JA 1S8NA 4LE0A 3VNAA 2Q5CA 5EWLA 3MIZA 1FSPA 3H5OA 2IDMA 3IP6A 4MPTA 4MR9A 1YS6A 3O2SB 3OQMA 2LBPA 4F11A 3RVLA 2FXIA 4RXTA 2CHEA 1ZN2A 4MR7B 4EVQA 4F8JA 1AB5A 1A04A 4H60A 2O20A 4RDCA 3QX9A 3CG0A 3C3WA 4MYRA 1K68A 2FEWB 4MS1B 1YK0A 3QLUA 4KQCA 4XASA 5IBQA 5JNTA 1CYEA 3FGZA 1M5UA 1PNTA 2NUBA 2XDYA 1BVHA 5KQPA 2F8TA 1Z26A 5JNSA 3RH0A 4CBVA 5TPZD 3OM0A 3MA0A 1YVUA 1U2QA 2VYCA 4L85A 1ZAYA 4P98A 5FBKA 3URMA 4JASB 3NHMA 2NT4A 3EGCA 4ZPJA 6CHYA 1QQAA 3EULA 3DGEC 1TJYA 3NBMA 4XXHA 3HK2A 3EQ2A 4GPAA 1W25A 2FKAA 1WETA 5JS1A 4NCAA 3CFYA 4ML3A 4DADA 2PE5A 4L4UA 4TLLB 2NZUG 1DBWA 5CNJA 4RSMA 4N47A 5JNUA 4M88A 4PZ0A 4N0QA 3RVKA 2E4VA 4MR8B 2W42A 4NCBA 1PNRA 3BREA 4XAQA 2JCGA 3E3MA 2JVJA 4RZSA 2PLNA 1U0SY 1XWWA 4MRMB 2ID9A 2FN9A 5F64A 1H9CA 1JH9A 5EWMA 4D74A 3HV2A 3N75A 4F12A 1JBEA 4YP9A 3IP7A 5HM6A 1NATA 1U2PA 3CRNA 2JBAA 3O1HB 1DC7A 3A3KA 1YK1A 1USGA 1Z12A 3IP9A 3H5IA 4S05A 1NXVA 3QLTA 2PUFA 1EWKA 1BAPA 3NNDA 2PL1A 5EWJB 1NY5A 2QR3A 2WRZA 4Q6BA 2LPMA 3HM9A 4DN6A 3BRSA 1E6LA 4G0PA 2QSJA 5EWLB 1E6MA 4EYQA 3KYIB 3O2JA 4MR9B 3I45A 5JNRA 2HJ9A 3OMWA 2L2QA 5IUJC 2A9RA 3I5AA 2PUEA 1BA2A 4OBBA 4MS1A 4RU1A 1E6KA 3OLYA 2E4YA 3KJXA 1KRXA 2GWRA 2JB9A 3CU5A 3O1IC 4G0ZA 3F73A 1ISRA 2GI4A 3QELB 4YV7A 5C5CA 4FE7A 2OENG 1FQWA 4Z9BA 1OXBB 5DCLA 5BRAA 2PUDA 3QEKA 4KK3A 1DP4A 4QICA 4Z4FA 1ZVVA 5DLEA 1DCKA 2PUGA 5KI6A 1TLFA 2FN8A 2FVYA 1JDPA 1J56A 3LUFA 5TE9A 5ED4A 1RNLA 1I3CA 3CLKA 1P2FA 3EDCA 1C0EA 1LBIA 4MS3B 2L17A 3I09A 2VUIB 3SY8A 4HNRA 1DCMA 3KLOA 3GRCA 3T6KA 4LDZA 3GYBA 3G85A 4YGXB 3LUAA 3RVOA 1ZITA 2LP4Y 3K9CA 1A0OA 3BILA 3MF4A 4RY9A 3KTOA 1CHNA 5IX8A 3HXMA 5EWMB 4RK7A 4EGSA 2PUAA 1Z25A 3OO0A 1JWLA 5ABPA 2JBAB 4IRXA 4RKRA 1FFWA 1GUBA 3N53A 1ZH4A 3QX8A 4LE1A 3QK7A 1JHZA 3H1EA 3HVRA 1DBQA 4OG2A 2LIVA 9ABPA 3CHYA 2YHAA 5FWXA 1NXPA 3T8YA 3Q7TA 2IOYA 4ZYLA 3SQNA 1UDRA 2GKGA 3SG0A 2JVIA 1USKA 2YHBA 3P9YA 1APBA 2FLWA 2B4AA 4YO7A 3OLZA 5B3JC 3OQOA 1ZGGA 3KLNA 2GBPA 5IEJA 2BGGA 2RGYA 1Z15A 5DTEA 2IKSA 2PKXA 1PHRA 2QVCA 3L6UA 3GL9A 3NHZA 4XARA 1ISSA 5T7BA 3O2QB 3E61A 4FE4A 3QELA 5TPWA 3UKJA 1L5YA 5BR1A 3OLWA 5KQMA 2MYTA 3H5VA 4QYWA 3QLUC 3M9WA 1DG9A 4O1IA 4QPJC 4EVRA 1EWVA 4KRFA 3H5TA 5JS2A 1ZHHA 3EODA 2WY2D 1M2EA 1HEYA 3MM4A 3HUUA 4KVFA 1JF8A 4XLTA 3QEMA 1RXIA 5TQJA 5IEBA 4YR7A 4F06A 2P9HA 1PEYA 3CZ5A 2FMHA 3GT7A 2PJUA 3IP5A 5IC5A 2JK1A 4MS3A 5CNIA 2ID7A 4PEVA 3TO5A 5KC8A 1FFGA 3H5LA 4ZMRA 4RY0A 1MVOA 3CTPA 3RVPA 2X7XA 4IF4A 4F3TA 4DQDA 4HYEA 2FSPA 2H3HA 1VLZA 3H6HA 2QXYA 3RVQA 3C3KA 2HPHA 3LKBA 3RVJA 4P1ZA 1P6QA 2KYRA 1JFVA 4EYKA 4B09A 3HCWA 1LBHA 1EHCA 4LDAA 1JLKA 1MAVA 3EQZA 1VPWA 3CKMA 1MIHA 1XHFA 4GNRA 4WWHA 4D6YA 3RVSA 1VKRA 3A10A 4Q6WA 3CG4A 3ILHA 3HZHA 5PNTA 4ETIA 1BDHA 3LMKA 3D8UA 2WMYA 4EYGA 1L5ZA 1LJLA 3K4HA 2J48A 3KG2A 3LUJA 3C97A 1DZ3A 4WXEA 5IUKC 4TLMB 5TQ2A 8ABPA 2QVGA 5I4CA 2A9OA 3GA5A 4MAAA 4JB0A 4OLAA 3QLVA 4Q7EA 1D2AA 4RK6A 4RV5A 5FWXB 2FQYA 1RXEA 3LTEA 4YWHA 3GBPA 2AYZA 2HQBA 3R0JA 1JDNA 3Q41A 4N76A 4G0QA 1NXOA 1K66A 1Z17A 1QO0A 4N0PA 1D1PA 2E4UA 1Z16A 5JNWA 1GLGA 2H0AA 3ILYA 4G0MA 3OLVA 1NXXA 4IGAA 3OMXA 2QU7A 1ABEA 3OM1A 4G0XA 1GCGA 4IMJB 1JFSA 1QQBA 4WT7A 4Z4CA 5D2CA 1DCFA 1R8JA 4O1HA 4MQFA 5TPWB 2A9QA 3LUKA 1KRWA 1GCAA 1D1QA 3LUGA 2RDMA 1Z2DA 4EVSA 3GBVA 1C4WA 4JB2A 4MLCA 4XFKA 4W5NA 3RVNA 4MQEB 3KCNA 3QEMB 3UK0A 1LK0A 4EUKA 1TMYA 3N6VA 1F4VA 3BRQA 3VNBA 3TX6A 4RXUA 1KGSA 3LOPA 1JX6A 2FLKA 2M98A 3Q7SA 4MGEA 5CNMA 1JYFA 1DRKA 2L18A 4KNYA 2QW1A 3HUTA 1DC8A 4WZZA 1VRVA 3SNKA 3JVIA 4W5TA 3IDOA 4RY8A 4S04A 2RJNA 1U8TA 4RKQA 4MLDA 3O75A 1EWTA 3JPYA 2F8SA 2AYXA 1W9HA 2A9PA 3HS3A 3JTEA 3F7NA 1M5TA 5CNKA 5HKOA 1E2BA 1IIBA 2JVKA 5IULC 4IMIB 1Z13A 3GV0A 4OATA 5C5EA 2PAFA 2NT3A 3MMNA 1QP4A 4W5OA 1T34A 1JL3A 3H5WA 4PICA 4ZMSA 5KWSA 4IILA 3O1JC 3M6MD 4NQRA 5CHYA 1Z2EA 5TQ2B 2ZWMA 4G86A 3N0XA 2WJAA 2HQOA 3T95A 1QPZA 1XHEA 3S99A 1NXTA 3JS5A 3TMYA 1YTUA 3M9XA 1RPJA 4EY3A 4H3KB 4KFCA 4Z4GA 3HSYA 4HNSA 5HSGA 4KQ9A 6ABPA 4Z0NA 2HSGA 5TQ0B 5BQ3A 3JPWA 2PUCA 1F51E 4FB4A 1B00A 3LFTA 3CNBA 5TPZA 1ZGZA 3O21A 2E4WA 3FFTA 3SM9A 1JFTA 3FFXA 2CD7A 4MQFB 3RVRA 2M1ZA 1URPA 3O74A 4TMYA 1ZY2A 2QZJA 3N0RA 4LE2A 4G0YA 5IUNC 2IYNA 3TB6A 1QNLA 4MQEA 3RQIA 1NXSA 5FWYA 3OO1A 5HQJA 1GUDA 4PE5B 2WJWA 3KS9A 3KYJB 4HNQA 4W5RA 5JNVA 3EJWA 2L19A 2MYUA 3ROTA 2NZVG 4RWEA 1QMPA 1RZRA
chains in the Genus database with same CATH superfamily
1XVAA 1N8TA 2CHVA 4KHZA 4DLSA 2RD2A 2B1QA 4G2TA 3O8CA 4KMMA 3LC7O 4IJVA 1LRLA 1KYTA 1RPNA 2IS1A 3KT8A 3PC4A 2CXSA 2FW1A 2GXQA 2O8NA 2UAGA 1AA6A 3AL0C 2FP3A 4MYSA 1W59A 2JPDA 4BNNA 1X92A 4XQ0A 3GDFA 5ER9A 2WIBA 4Z9YA 3EW7A 3C5WP 3USCS 4UCFA 1EXMA 3GJ7A 2FMIA 3U3ZA 3VX3A 2YOGA 3V9AA 1OIWA 1TAHA 2VXCA 1MJGM 3G1WA 3RTGA 5LPNA 1QHYA 2J85A 4WZAA 2J6CA 2C4KA 2QTVA 2CL6X 3IXQA 3PQEA 4HB3A 4J8PA 3JQEA 3AEKA 3LVBA 2G8LA 3HDVA 1DEHA 4CTOA 4J7AA 1T1EA 2JRCA 4LXXA 4MRSA 2E4ZA 3I5XA 2CN1A 1IZ7A 3C3AA 4KIFA 2Y27A 4XDZA 4CMEA 1OF1A 3W7AA 1U4SA 1UXJA 3PNOA 1IUPA 2C3PA 4U2BA 3C8HA 4RV4A 4F9TA 5F4ZA 1OASA 2O2XA 3RVMA 1BX0A 4NV3A 3WMRA 3NXSA 1MUUA 2O2HA 5A5DA 1M1ZA 3OUZA 2YDYA 3A27A 4KITB 4EG1A 5HUJA 3HDGA 2W4QA 4RORA 1FFCA 4R01A 5BT8A 3H18A 2NZJA 1IBKB 2B37A 2W83A 4LY6A 1E99A 4IIYA 7ABPA 1F12A 5K3FA 4ZDJA 2G1UA 4PINA 4CLEA 3MCWA 7MDHA 1E3MA 1OWPA 2EG5A 4KREA 1KI7A 1MDBA 2FQQA 4BIIA 4DCOA 1PWHA 3C24A 4WFJA 2WWGA 4LDPA 1G8PA 4AKTA 3OZEA 3IELA 1A71A 2HL6A 4PRLA 4FYWA 3WLAA 5JQGF 2GF0A 4CF6A 3L7AA 2WFLB 3NIFB 1MT0A 1UMKA 4LF9B 1JU9A 4L4ZA 1KIMA 2HCTA 3GAMA 3D4NA 3DLBA 1U11A 1TYCA 4O4LA 3P9IA 2FWAA 1L7QA 1W0KA 2CBXA 2GN8A 2V7BA 4GBJA 4NPAA 5CFOA 4CLRA 2G08A 1SVMA 1SUCA 3KLBA 4XA8A 2PBLA 4A26A 2GCEA 3L5KA 2P4UA 2QRNA 1SD5A 5EUMA 1JQ5A 1WU8A 4H7DA 2XKBA 3U7JA 3WDMA 1XZJA 4DUGD 2W00A 5FBHA 2BY4A 1H2WA 4HPJB 3AFGA 1G3MA 4R2JA 1IOWA 3PC7A 1AG9A 1G63A 4IO0A 1SB9A 4MA5A 1KI6A 1E9DA 1R4AA 4PLWA 4KGZA 4XD7D 3D6TB 4AX4A 3HADA 1OSNA 4PYRA 1HC7A 5H82A 1FLAA 3P9CA 3L02A 5JT1A 1NXWA 1RAEA 1TZMA 2OCYC 4UE3S 3TJRA 3V8NA 4CF5A 4DR2B 4H7PA 3EF1A 2CHUA 4OUDB 3WNQA 3ZI0A 3PHBE 2GETA 1OB5A 4UE6A 2PKEA 1E6WA 1VI6A 4QD3A 4R9SA 3E0XA 4PXSA 3T7RA 4XWKA 5TIIA 2XKKA 1XDGA 4EA6A 3EX7C 3M6UA 4LRQA 1EVZA 2VH2A 2XMRA 5C37A 1L7NA 4AS2A 3TBKA 1IOLA 1IHUA 3SICE 3GA7A 2F48A 2XZDA 4YLEA 5KQSA 2A9KA 4I19A 2XTAA 1Y0BA 4G8DA 3Q10A 3V4SA 5TY0A 2V5VA 5K3AA 1OFVA 3BK7A 5JFTA 2DEUA 3RS4A 4PPFA 1ECGA 1GPMA 3R6DA 1S8NA 3D4IA 3UMRA 5EJIA 3EG5A 4I4TA 5BSRA 3TLZA 5LQNA 3GEBA 1U2DC 1O95C 1ORRA 1WXHA 2UUCB 3K6RA 2BC9A 1A04A 1KMHB 4JLWA 2FYTA 3BCRA 1SK9A 1XEWY 1IPFA 1KI9A 2P2SA 3GH3A 3L43A 1XTUA 4V1CB 4JXXA 3QITA 4BRUA 4CGYA 4OQQA 3FOZA 2KHZA 2NUBA 4ISCA 3IBTA 3NV9A 1JQ3A 1DX9A 1YDWA 2XT6A 2EFGA 4IFEA 4NJEB 3SOPA 5BNFA 1QRUA 4NNOA 3QOXA 3NATA 4D3DA 1ULBA 3BMXA 3X2SA 5DE3A 1JSRA 2ZYRA 2C9CA 1LW7A 5IKXA 4IOJA 1DX6A 3B2QA 4Z53A 1OC2A 2Z4TA 1TA9A 3I9JA 2R1TB 3HFJA 3OWHA 4EO4A 1GPAA 3D4PA 3A26A 1Q17A 1VHLA 4P3KA 3REQB 1D7OA 2G67A 1XCLA 4EWLA 1AXEA 4BXOB 1P61B 2PL5A 2LCIA 5E95A 4I08A 4YRAA 2EARA 3IOBA 1ODJA 4IL5A 1V43A 3GFTA 5JNUA 1DNPA 4N0QA 1XCMA 2OC4A 4HS9A 2FU5C 3BWYA 1QX4A 2FUNB 4MR8B 4E33A 2O06A 1QVVA 1W2GA 4BFCA 5BW8A 2F3TA 5GIOE 3ZS9A 1Y4SA 4EUHA 3DOJA 3NAMA 4J2OA 2FZEA 4CUJA 3H9QA 2RHRA 3DF7A 4J1TA 5FTWA 4J3NA 3VVBA 3O8DA 1UP6A 3SBXA 2AKEA 3QXXA 4MIEA 1FUKA 2ISQA 4N5MA 4OI2A 4F12A 2ZZMA 3ANSA 5CA0A 3SZLA 3ES9A 1U2PA 3F46A 1O0CA 3E82A 2JLCA 3FB4A 4V3BA 1G3QA 2C2GA 3IP9A 4IO1A 5KZMB 1UL1X 2Z6QA 3QVSA 4G9BA 1C7ZA 1Y5NA 3HKBA 2H7XA 3O84A 3B7GA 2IU0A 3ISJA 3QLTA 5HCUA 2LDXA 3JALA 4K46A 1TK2A 1UWVA 1PR6A 3CLUD 4UNRA 1NE7A 2QR3A 2QRJA 1JFRA 4J1NA 4LFBB 1GR1A 5CITA 1KH2A 4K9QA 4GE0A 3DTVB 5CT5A 3OX3A 4NMWA 4AJ9A 3E58A 4WBSA 5DJ5A 3IO3A 3TDMA 3K6SA 1LNZA 3BXZA 1C29B 5F7ZA 2HWUA 1L5FA 2I8LA 2RCNA 1B74A 3G79A 3BICA 3QNWA 1NJ5A 5I5GA 4F92B 1V7PC 5KKAA 4M1KA 2AG1A 2GI4A 1Q95A 3QTLA 2RGUA 3PWZA 3E3AA 1LLDA 3ZW7A 2QUIA 3ZGZA 4D98A 2XNDA 5BRAA 2PUDA 1WEKA 3QEKA 2PRSA 4C7VA 5F98A 2V9ZA 3VV2A 5HFAA 5HQ3B 4QM6A 2VHCA 3E70C 1Z0UA 2WP8J 3LT1A 1KSHA 5B3AA 4D96A 3GHHA 3HYLA 3PNBA 2BP7A 3P2YA 4FX5A 5I6DA 3JQFA 1M8GA 1HPLA 1I3CA 5IBPA 4A73A 3QV1A 3ZW9A 4NESA 1H0HA 4ZCIA 1IZ9A 4G8JA 1WY7A 3EA4A 4DRXA 4ZEVA 5ISMA 5DX8A 4XYLA 3KLOA 4PGAA 4ZKEA 1NNI1 5THXA 4DZZA 4OGKA 5LD2B 1TEZA 3MTDA 4B32A 4EEXA 2VI5A 3JQ9A 4XGIA 5FV4A 5K8UA 3BHMA 1HYQA 1I2AA 4FK8A 1U7ZA 4LIPD 1NUTA 1O0SA 4H7JA 3CTMA 4UVHA 2RK6A 3MJRA 3FWNA 1GIAA 3WLIA 3BSSA 4IQ4A 1OAKA 3CIFA 1KS9A 5C8ZA 2JFWA 1B8UA 4JA0A 3N6RA 4JC0A 4ZVQA 4HZGA 1UEJA 4FFBA 1XA0A 4MRPA 3J81k 4DEYA 2JAHA 4RIGA 3ZYCA 2NVOA 1OREA 1ZH4A 1FYVA 4I1PA 4IZ6A 4N8SA 4LE1A 3QK7A 3VU9B 4C21A 4JLNA 5CP8A 3A11A 4U9IS 2QN1A 4X95A 1QKIA 4NC9A 1HT3A 2IXTA 3YASA 1YO6A 2CV0A 4IOLA 1IJFA 1PVDA 2I87A 4IIJB 4XQGA 2YZ7A 1K6JA 1UDRA 4QU8A 1X80A 4C3OB 2FX5A 4PF1A 1S2MA 2AOTB 2D7CA 1ZLYA 2ZSBA 5JO9A 4UFPA 5EFZA 2D1RA 2F59A 4I3FA 1MH1A 5KDLA 5IEJA 4BVJA 3FTNA 4NJOA 5DHAA 5FFNA 1PJLA 5CVUA 1K27A 621PA 1U98A 2C98A 2PS1A 2M2IA 4LHZA 1UXGA 5FLXA 1BOOA 4HDNB 4L76A 5HE8A 4XW2A 1AKTA 1EP1B 2WOOA 3OOWA 5CBPB 2ZR0A 5JR3A 4DAEA 3C41J 4CW7A 1RXVA 3E27A 3H5VA 4K1XA 1GL7A 3RWBA 3QPCA 2WG1A 3I01M 3V6MA 1FB5A 3EODA 2Q1UA 3DEIA 1WVMA 2EIHA 1XOIA 3V9PA 5LJLA 4I5DA 4M2LA 1MAUA 1M9NA 1SHLA 5TQJA 5LIRA 1BHQ1 3GT7A 3TECE 1G291 3AMVA 3BFKA 3ORSA 4OP2A 4K6CA 4AMUA 4LSWA 3G88A 1GQ2A 5AI6A 2BGTA 2EFEB 1I36A 1WRBA 4CL0A 1PSWA 3L4BA 1VIDA 3FF1A 2VZ9A 2Q7XA 5HNKA 1XDZA 4BNFA 4XUEA 1P2DA 2R6AA 4B3JA 1C9JA 1N6IA 3LBNA 1BE0A 2OXFA 2RJ3A 4FJ2A 3ZD7A 4QOEA 3PUIA 4G4IA 3CSDA 1G20A 4GQBA 4QFCA 1XU9A 2IEGA 2OK7A 5DNWA 3SMVA 1R37A 4P83A 4HAWA 4E70A 3ILHA 4MPPA 4ALIA 3LLUA 5C8VA 2HMVA 4E7OA 1EBBA 2BMEA 1T2UA 1QGYA 1IQUA 4PNHA 3C16C 4UEKA 1W76A 3FPGA 4V0MA 2NZ8A 3SKXA 1IZ8A 4BLQA 1D2MA 1MO6A 1ZOLA 4MOWA 4GVXA 4CHTA 3AKZA 1F8XA 1GZ7A 3HXPA 3RW9A 4NHOA 3TRIA 4BP9A 4DDKA 1SPXA 4DREA 1W87A 1UFQA 2JK0A 1J42A 1JHXA 3D0OA 3L8CA 2XBUA 4GWLA 3GXBA 3RC8A 4C4XA 2EKLA 5KMGA 2GLTA 2GK3A 2I6GA 2VOJA 3GRPA 3EPLA 1N9GA 4C78A 4HF7A 3U4HA 3LYLA 4E5UA 5JY1A 4CQLA 1VYHA 3O7WA 2BIFA 2ZQ5A 1NXXA 1YS9A 2VYVA 1SKBA 3IHKA 1W36D 1CBUA 2X0IA 4IWYA 1NX9A 2BFWA 3R3SA 1U2TA 2J9FB 4PQEA 1O94A 4EHNA 3ZU2A 1J8QA 5HIAA 3B5EA 3F2IA 1UANA 1PFGA 2D2XA 1TQDA 1LX7A 2H1HA 1X1RA 2OK8A 3LGXA 1J20A 1X0VA 2RDMA 4N9WA 1PYGA 1I1NA 2DQSA 4R1PA 1JQDA 4Z49A 2IZ0A 1TA4A 1WDWB 3KB2A 3QVWA 2NSYA 3IQWA 1CZOA 4WGFA 2BEWA 3T4PA 3RUIA 3EQ9A 1CDOA 1GG2A 2F8MA 5EIBC 3WHKA 3ZD6A 1R6UA 2BF7A 2XA1A 1XTVA 3FKSA 1S2NA 2M6LA 2WTMA 3U7EB 5IAAA 4EHKA 4URZR 1R6BX 3JQGA 4CHGA 1UAYA 4DV6B 3B5JA 5AH0A 4B6RA 3OZXA 4RABA 2JGJA 1VP3A 2N1MA 4S04A 1HZZA 2CSXA 4KR7A 1RZVA 2A0UA 4K6MA 5L3SA 2AI3A 4X97A 4R2XA 4LFCB 4GDFA 3KE9A 4BQNA 1OWMA 2FOIA 1PCXA 3BS4A 3IEVA 5IT9A 3QHPA 4BFXA 4BQQA 3TQTA 3F78A 1VJTA 1C7EA 1I10A 1Z13A 3GV0A 1Z38A 4UUMA 4KE7A 3V6LA 4RGBA 3PNPA 4WHMA 5E6UA 5LUBA 4ERNA 2O4CA 2I6XA 2OZEA 4KW7A 2EYQA 4UEWA 4W5OA 1VA5A 2FX2A 1U8XX 4UM8B 2B83A 3M6MD 2IYXA 2JFNA 1M1YE 4NQRA 2C42A 2FWPA 4MGHA 1HMPA 1C1XA 2PJDA 4Y6QA 4CV3A 2HQSA 5AUOB 5BVGA 5HR5A 3D6UA 4KDRA 2ANCA 3KQSA 5LLSA 1NBAA 1QPZA 5IJ9A 4PGMA 2Q1XA 1UFRA 1N34B 4FHCA 5A0TA 4PX9A 1SCDA 2BBWA 3LVFO 4B3TB 3SZUA 3BSYA 4QBIA 4EX7A 1OHHD 2H59A 4HDKA 4MIYA 3OOHA 4KBGA 4PAGA 1ADYA 4MV5A 1E2UA 3UJ6A 5HOEA 1XKLA 3PGVA 5K4GA 6ABPA 2J7KA 2PMKA 3PVCA 1RAGA 3QVVA 5LQSA 2DQZA 2LTAA 2WZBA 3W5SA 4C0KA 1RAFA 1V16B 1Y7LA 3HABA 1OLXB 1YONA 1ZGZA 4Q1EA 3G8DA 2HA0A 1QIMA 1Y9AA 1GR0A 4EG5A 3VOTA 3KU1A 2ZIAA 3DLPX 4OXYA 1Q0HA 2JI6A 5DMHA 4ZTBA 3CUEF 3G59A 3TUIC 3TZHA 6REQA 2Q3DA 4H15A 4BO0A 1KFEB 4HQ0A 4WCVA 3R0XA 4MQEA 1G5IA 3SK0A 3D5QA 4A0RA 3K15A 1GUDA 2N1BA 3H6KA 3UVEA 1RE1A 4KXQA 5H3HA 1DO2A 5HCIA 2QE7D 2VZEA 3AEZA 3UK1A 3BDAA 3HJNA 1YULA 3RYFA 5B7NA 1XMSA 3CUVA 3ZHBA 2AUNA 4PX3A 2EKZA 3E22A 4ARZA 3I52A 2VDMB 2DE0X 4QPPA 2FWIA 1WDTA 4WOKA 1KARA 3A6LA 2I4RA 3ZE6A 5IJXA 4ZYTA 3ITKA 4KN6A 1BEZA 2A58A 1T1GA 3NWEA 1ZESA 2I2WA 3UWDA 2CD9A 1DIOB 2CXHA 2GHTA 3BG5A 3INYA 2JLAA 3IHWA 4HX9A 3MLEA 4UOQA 5IDXA 1NV9A 1RAAA 1YZGA 2FGJA 5AOAA 4LYAA 3GA0A 1PFUA 2B0JA 1UWCA 2EZ9A 4RGYA 4EJSA 2P9TA 2J4FA 4RTQA 4Z99A 1JKIA 2MR5A 2HSDA 1E7SA 2CJFA 2AGVA 2MJLA 4UNPA 3NFRA 3G5MA 3EK2A 1EJ6A 4TTQA 4WOPA 5EXDA 4DLAA 4AB1A 4QFDA 1L4KA 3OJFA 3RVDA 1ZS9A 4PZPA 3UJ7A 4C29A 1JA1A 4O5AA 3VDMA 4F1WA 4PIMA 5EA2A 1DPFA 3VPBA 4EARA 5HJ2A 5KQLA 3AI7A 1PV2A 1AK1A 2NU7B 3PQ5A 1EFAA 1BO6A 1M74A 4ID3A 4LJLA 3I9V1 3K9FC 1B76A 1H0SA 1ORTA 1XCJA 4M98A 5BQ5A 3EXFA 3KQOA 2VK2A 1DIGA 2E82A 2EF0A 4LDRA 1XDDA 1K0UA 5DI3A 4ETNA 2JJMA 3TFWA 3GNSA 2P9YA 1FRFS 3PNQA 3GPIA 3ECSA 5KSYA 4PPQA 3A6KA 3L49A 1Y5LA 3IX7A 4I1RA 3I34X 4D9IA 3B89A 1C50A 3FSGD 5E6SB 3ZD8A 1M0TA 1N5JA 2HJVA 1F3LA 4XSHA 4FMDB 2J9ZB 4MW0A 4AT1A 4EHFA 1JV2B 1K63A 3W2TA 2WIKA 2XTNA 4RIFA 5K51A 3WL6A 3LQFA 3O91A 3DBLA 1GNVA 2EX0A 4PGFA 4AMBA 2QAGB 2O1WA 4RK1A 1AKWA 3CF2A 4ZZ1A 2G9ZA 1UPBA 2IGBA 1QGDA 2G5GX 2NO1A 1PEAA 4DLYA 1N6LA 2FKNA 1M33A 2H0QA 3COVA 5MFZA 1H0RA 2B1JA 3GCDA 5EUBA 4M9ZA 1OOEA 1KJNA 1CR6A 3DFIA 4EP1A 2FEKA 5A2QA 1A9XB 4EPXA 3D7MA 2IPNA 1T8YA 2EBWA 5BOVA 3Q8KA 4NZYA 2YBDA 1CUBA 2FQWA 1XF9A 3A32A 2H18A 3OTGA 1R0LA 5FPYA 4P9NA 1XA4A 4CKXA 5B7GA 3X1DA 2SKDA 2OVFA 3I39X 4QJ4A 3RV3A 2W6JA 3H6GA 1G38A 3ANNA 5F1PA 2MSEB 1XN1A 5A5VA 3GLGA 3N5KA 3TQOA 4BAGA 2O1XA 5DVZA 1GDTA 5A3JA 1Y1LA 1YR9A 1U65A 2VPZA 2IHVA 3LD9A 4YRKA 3WYAA 1NJGA 5A1JA 3EFOB 5AM4A 3NYRA 4LZOA 3JY6A 3OE4A 3E6AA 4FMCF 4PPYA 4QTYA 2BHRA 2OV3A 2Y1WA 1I0ZA 2QVBA 3DAPA 3B2NA 4ZZIA 1JNXX 2PNFA 5GZ3A 4KHPB 4I4NA 3RR2A 1WXFA 1Q0SA 1T9KA 3RTDA 2EWVA 4LZLA 4AJ1A 4RZ3A 2J59A 4D0RA 3MOSA 4EKEA 1SBQA 2W8BA 1SB8A 3WGVA 4L51A 4A6PA 3GRZA 2GS9A 3G0OA 2CLIB 3LUHA 3GP8A 5EJ9A 4O29A 3FHCB 5LFAA 4CG0A 2NACA 3K32A 3N3AC 1XAHA 1SUDA 2LR0A 2W11A 1U1IA 1B6TA 3GPDG 4JOQA 4QUJA 4YAEA 2AMJA 2WKQA 1TCAA 3L4EA 3VISA 3B6JA 1ZICA 5CH3A 4D45A 4KWHA 2VRCA 4GDMA 4WESA 1E2NA 1EFHA 4YCNA 5DGIA 3FNIA 1XQ9A 3IKLA 3PYLA 1DAOA 4M0UA 2ZAIA 3COPA 4RKYA 2G9VA 3BE5A 1J7JA 2ERYA 2PUHA 3AWDA 3WLOA 1ZN2A 4EVQA 3PUZA 1C8LA 1E3DA 3PPXA 4E30A 3RHSA 1SH7A 4F1JA 3ZHUA 1U6KA 3P96A 3UIEA 4MS1B 3TMKA 1XLWA 2C94A 3KWLA 1CRPA 4MKRA 1V48A 2AZMA 5E4YA 4UUQA 2XR1A 2BMVA 2HCFA 2QZ9A 4GMDA 4JR2A 4A8JA 4IIDA 1IPHA 1UBCA 1ZGBA 4LOJA 2VO1A 1O96A 5IC6A 4CBVA 3K0CC 3DE6X 2IYVA 2AUMA 3MW8A 1WW8A 2W2QA 5JQGB 4QL3A 1TMOA 4O2AF 1VL8A 3BHIA 2I91A 4AJHA 4DA9A 1ZNXA 1LZLA 1XA3A 4IFIA 1XRRA 1NKSA 1A9SA 5AJYA 4ZPJA 3MCTA 3F47A 3ROQA 4CIDA 1AUPA 3GOHA 3L7LA 3QPDA 4R1LA 3IC5A 1S2DA 3N9IA 3ZQKA 3SC3A 2AQKA 3AOGA 3Q1KA 2FN4A 4P7GA 5ERYA 2Q7DA 4F84A 2F3PA 2CNWD 2J7PA 2RB4A 4NBRA 3FUXA 3GRVA 1T4CB 2BTEA 1NVGA 1FSFA 1BU5A 2ZJ7A 3NJ8A 4ZYUA 3UK2A 1E5QA 3FTQA 4XAQA 2NV2B 2CJXA 1TF2A 3LDHA 1YL7A 2X5JO 2Z3VA 3C6MA 3K2IA 1Z0FA 4JDUA 3VAYA 4B83A 4WX2B 2VF4X 2VHJA 4TL6A 5DHSA 1Q3TA 2AW5A 2VSQA 1ZU5A 3JARB 1KEWA 1NATA 5I7EA 1YIAA 2WA1A 4OIFA 1CUEA 3A4VA 1N7JA 3QBEA 4MLPA 2OV6A 4JOCA 3RV4A 4N5DA 1VMEA 1U0RA 2FUEA 2XOKA 3NGMA 5AW7A 3AEQB 4N0DA 1KZGB 5AM0A 1ST2A 4QUBA 4DCPA 1ZZEA 1WUTA 3GUVA 3ADCA 1P0IA 2NU9A 2ZT6A 2C83A 2RGRA 3MBOA 3D3EA 3C4VA 5EXXA 5SYNA 3TPCA 3IE1A 2IY7A 3E9MA 1KOLA 4CIYA 4LZAA 3UPDA 4GPD1 1JJBA 3G5UA 3GI1A 1J22A 1PNQA 2B36A 3E1GA 3NDRA 4C1NA 1R18A 2NQTA 3L6BA 2WPDD 4MGIR 1HG1A 2ZETA 1KRXA 1UKBA 2HMYB 2D5IA 5FWAA 2C9ZA 4Y98A 4ZZ2A 3FPLA 4R2IA 3ZU6A 2G17A 4D9BA 2BFOA 5T6BA 5K0TA 4H7HA 1QE5A 3S2SA 4OKIA 3WYFA 1JNYA 1T24A 2B9VA 4HLNA 3KPYA 3H65A 3ZBPA 4MJ7A 4IXTA 3LT4A 4CKWA 3C1OA 2PEZA 2HRZA 4TVKA 5L45A 3OTOB 1A82A 1Q3HA 2VWQA 4QATA 1VZ3A 1SXJA 1M1YB 2OBMA 4IV8A 4UDXX 5COBA 2WDZA 5SYAA 3LQKA 3TINA 3TLKA 1UKEA 3HA7A 1C3VA 4LWQA 2HWWA 2FN8A 4MWCA 2ZIVB 1EXWA 1PU2A 5KBYA 4Z51A 1F9EA 1WD5A 2VATA 2VNHA 3P4UA 1AMNA 5DX0A 3H0KA 3W8EA 3D54D 2RGDA 1V4BA 3F90A 4WKGA 4F3CA 2IYWA 3KKKA 3LC0A 4KI7A 2FR0A 3VPHA 1DCMA 1AHNA 2BEUA 2Z9DA 3IS3A 2F17A 2PUWA 1EZ4A 5MN4A 1UDBA 3NG1A 4X3OA 1WMDA 4XFDA 3V7YA 4N9QA 1IRIA 4R1NA 4RY9A 4D4LA 2QORA 3IDSA 1I3MA 4KXVA 4Q4AA 5C9ZA 1II8A 1KQPA 2Q2NA 5DGXA 2QENA 4EGCB 1TL7C 1H8HA 1UQRA 3R5KA 2HU2A 2O8CA 3RI3A 3EEYA 1TECE 4H16A 3O0TA 2WSBA 4IUDS 1YBMA 4NG4A 3VYWA 1NYRA 2IH4A 3WFZA 2E5LB 1PF7E 2J31A 3SFZA 2Z5LA 4HGNA 2H29A 3IKTA 2XLCA 1SBYA 3ACCA 4Q7LA 5G3ZA 5EYPA 5AMXA 4KYUA 1JHRA 2VHXA 4JGIA 4RVOA 4R2LA 4L57A 5HPYB 1MX5A 3B7WA 2NO4A 3T7CA 2GHQA 3IBFA 3KRTA 5F7OA 3CKLA 1LSUA 1X7YA 2JASA 3FYHA 3VR1A 2GBPA 1QNFA 5DTEA 5KDDA 1LS1A 3OE7A 4AS1A 1V39A 5DTMA 1Q1EA 2I7VA 4Y3UA 4UTVA 2CF5A 1HQCA 5JCOA 3LXUX 4UTNA 2DGDA 5FAXA 3E61A 3NONA 5HF8A 5JH7A 1ZC4A 4B7AA 1NJ2A 2J09A 1L5YA 1P2BA 3DE5X 4L3VA 2PGDA 3QFTA 2FF5A 2MYTA 1SVLA 3MVEA 1WXEA 4KQFA 5L6MB 5EJ8A 1TM1E 4U1RA 5ARCA 3GGJA 4KDCA 2H0RA 2VLIA 4LGYA 1X74A 2XIQA 2YJZA 1OFTA 2VAWA 4RAOA 3IV7A 5FORA 4TKUA 1QLJA 4FC6A 4UHFA 3IVGA 5ECGC 5LP6F 5A7GA 2ONZA 1N9KA 1PEYA 1JLSA 1V96A 2FMHA 3N7UA 5AXAA 1V7ZA 2D0IA 3QWHA 1F6WA 4FNOA 1RMYA 2YS6A 3OU7A 4Q4LA 5CDUA 3ECAA 1E1RD 1FP4B 3BL8A 3DPIA 3OIYA 4YUAA 5KC8A 4RY0A 3CTPA 2HRBA 4X44A 4XIFA 4ZQIA 1G9TA 4RHUA 2Q29A 1VSUA 5ADHA 3GJ6A 2AXPA 4L4YA 3W04A 3P4XA 1YZNA 3KVRA 4J1QA 4CV2A 4D81A 3NX4A 1XZNA 1EX1A 1IUKA 1HI9A 3M33A 3UAGA 2OZLA 1D4FA 3IXLA 3C3PA 3L92A 1KZ4A 2YYSA 5C1DA 2XUFA 4C07A 1QG0A 1DEKA 1JMVA 1ZLXA 4G37A 3LCMA 4XVRA 4FKZA 4EG3A 4IY1A 3UWOA 5K05A 3A10A 1VXOA 2BGNA 3SS9X 3CNNA 5LQRA 3PFGA 1MQSA 4HFMA 4B3DA 1SUAA 3V1YA 1WDMA 1G6HA 1P5FA 3GVPA 4NMMA 2XH8A 3WTCA 1P29A 3NI2A 2X1LA 3I9V6 5T8KA 4P5PA 4JB0A 3OJOA 1GUZA 4EA9A 3H1TA 3KTDA 3OY2A 4JD5A 4CTJA 4GXQA 4ZOQI 1P9OA 4CLHA 1YT5A 3EW9A 1EKXA 4F5WA 2Y1LA 2XVZA 1AQYA 3G7SA 4CM8A 2F43A 1YUNA 2X14A 2O2DA 1ULUA 4Y2RA 2E4UA 4DTCA 1PJ8A 4IXNA 2JA1A 3CH6A 3G5TA 4JLKA 3A70A 5ULLA 2ZRDA 2QU7A 3EXIB 4EI8A 1T6BY 1IXZA 2WF7A 2R8OA 4K5QA 1N5DA 4OHVA 3HQ4O 3HKCA 2JIRA 4OJQA 1KJYA 2QQEA 4A7PA 4ECEA 4J2TA 1LSOA 3LUGA 2VAVA 2YJTD 3VNUA 3OIVA 4BNDB 2O3RA 2DPMA 3D7SA 5EZQA 4XFKA 1HTTA 2HQ1A 2A8YA 4XWTA 3A1VA 3E4DA 3EIXA 3TW8B 3ADDA 1WXWA 1XRQA 1F4VA 1FTNA 1WPGA 2FFBA 3KD2A 4NBTA 4BL5A 5KJCA 2GT1A 2ZBDA 3M8KA 1L4YA 4L8WB 5JZVA 3Q7SA 4IWXA 2GLXA 5CNMA 3VYVA 1BIFA 4OQFA 5B2ZA 2I3BA 4HL6A 3BKXA 5ALKA 5BNIA 1WZCA 2JFOA 5JAIA 1X2EA 2L18A 4UBMA 4KQMA 5CVTA 3BJMA 4QDOA 1OA0A 5TGZA 3W3AH 1B1CA 2D3TA 1SG9A 2BI8A 3EIUA 2BVNA 3C1UA 2Z2ZA 3I5UA 4QDTA 2VF2A 4BCBA 5C52B 4A27A 1ULHA 4Y7CA 3MGBA 3PC8C 3V33A 2WU0A 4C0SA 1HFJA 1QH8B 2JGFA 4MVJH 3R9WA 2FZ5A 5CXXA 3SJ7A 5KS2A 4NULA 3VPXA 1SOWA 2Z8YM 2Q0XA 4QVKA 1JSLA 1OX4A 2PQ2A 2FGKA 2IF2A 4RKFA 1J4AA 3LP5A 4RF3A 3K0KA 4CKZA 4RM2A 1WZEA 2NO9A 3OP4A 4NV1A 3VQTA 3EQ7A 4H9GA 2LD4A 2YYZA 2MMGA 5REQB 2FP4A 3CE9A 3BQ9A 3RKSA 1GKIA 4QIHA 4CG1A 4US2R 4Q4JB 2W58A 1KI3A 5LWHA 1CY7A 3O4FA 4WEQA 3UENA 5BPHA 3SCZA 1GGMA 5JFOA 4JWKA 4PAWA 1JG2A 1FJHA 5GONF 5LOVA 3BK1A 2QQFA 3ELWA 3L8HA 4DJEC 4C2UA 1O87A 3JPWA 4WNIA 5JYBA 1Z33A 2PUCA 5K0GA 1DSSG 2BI4A 5ALJA 2PSSA 5T4BA 5EIEA 1XVLA 4BLUA 3AF4A 2AW3A 1ZD1A 2V65A 3I05A 3NOOA 2FPKA 4Z7JA 2VTBB 3CM0A 5ARBA 2WWTA 3BHNA 1CJTC 1RU3A 1CWUA 4BKRA 3B82A 2REBA 5IUNC 2H4WA 1VPLA 2RONA 1G6Q1 3KT6A 4IS3A 4AROA 1U81A 2B4RO 1T5BA 4GS5A 4M36A 1E3IA 2CUTA 5CAEB 1MJNA 2ETVA 3PXEA 4MX8A 1MC1A 1O89A 4DSUA 4XIIA 4EBFA 4D3XA 2QROA 3LT2A 1VHQA 3NH9A 4GR9A 1AC5A 1QMPA 2VDOB 5CH8A 5IWAB 2PANA 3K1AB 3WLJA 1MHTA 3ZGOA 2P9FA 2J1LA 1E7MA 4HGQA 1T5IA 3VAZA 4U7FA 3FY4A 4KXLA 1SY7A 4U2DA 4B75A 4GPTA 2YOFA 4EMUA 2ZGVA 3GOQA 4R68A 2JIOA 1AT1A 2HWXA 5IMBA 1QO9A 2TYSB 1H5QA 2IY9A 4D4IA 1KI4A 3KVYA 3K96A 2VPIA 1MEJA 2J3MA 2ZPAA 3F9IA 4FGJA 3F98A 3ROFA 5C81A 3EXEA 4ONEA 1HUQA 1NUUA 4TSFD 5KNBH 2AL7A 1SZJG 2RH5A 2I6FA 5AVQA 4J1TC 4DV2B 1I32A 1B42A 4QPZA 1GUYA 5AI4A 4PBSA 3ZR4B 3HCOA 1MW9X 4AMZA 3ADBA 4K0RA 1F8GA 4EL0A 2XT0A 5BRJA 1H85A 4CQJA 3AR2A 3NBUA 3OCJA 2FLVA 2ILTA 4V0LA 5CPFA 5DLDA 2VC2B 1TCBA 3NWJA 4Y6LA 4ZOLF 1KXJA 3WYBA 2GAOA 1J5PA 2HQRA 1ENZA 2QL5A 3PFFA 3ZY6A 4Z5XA 1QR2A 4G4SP 2B69A 3RD5A 3QLVC 4HLCA 3H0CA 3D4LA 5ALQA 5BVHA 1UOOA 4DY4A 1E32A 1R00A 3TSWA 4WBNF 1WLYA 3NNNA 1THMA 1EP2B 2VP9A 2ZIFA 3U3JA 2I9KA 1J7KA 5H0IA 1JDSA 3HHPA 4HB4A 2TSYB 4L07A 4LJ9A 2YWXA 3B85A 3B48A 2X7HA 2CE2X 3CWCA 1P1FA 4D8UA 1EGHA 1I3LA 1XVIA 5C0OE 2DY1A 5F5LA 3KQLA 2QRLA 1K6MA 2ZITA 2NUPB 1E9FA 2YR0A 1LDBA 3K70C 3KV1A 2FB9A 3PLRA 4BQRA 5L7WA 3RLFA 1A96A 1VJCA 2C57A 1T25A 3NDPA 4ZT5A 4OA5A 4CCWA 2C2MA 4UMEA 3UXYA 2AQIA 5EI5A 2X6QA 4P4LA 2H6EA 1MJGA 3OT1A 4K8RB 4KNWA 4PXAA 5JDCA 3TOVA 5HJEA 2EJTA 1U0LA 2NYAA 4PSDA 3BEOA 3BMOA 1OE0A 1X0XA 2Y2VA 3WKBA 4BWGA 4C6TA 5JS8A 3LY9A 2FEPA 1JHYA 4P4UA 1VI5A 2ZE6A 1Z7YA 4PQFA 4UHJA 1FFBA 4Q7QA 5HDQA 4B1FA 4EITA 3G8CA 3L0SA 4I8IA 5J4LA 1RRKA 3IEMA 2FDXA 3IJ5A 2O0LA 2CFOA 3H9JA 1LC3A 2C8LA 2OZPA 2B7CA 1THGA 2AFHA 1HL3A 2P0YA 5DHTA 5F9FA 3SKVA 3U3KA 4D26A 3CINA 1OZGA 5HRCA 2VN8A 3A3OA 3HCPA 1CJVC 1OVMA 1RM5A 5G53C 1GFWA 3AVYA 3H99A 4GNKA 3VGPA 2GR9A 1KI1A 4JJIA 4B7XA 2HF8A 3GD5A 1U0FA 5B57C 3H5RA 3QIVA 2JAQA 3CNQS 3DP7A 3FMVA 1CHDA 2P9ZA 3HA2A 1MO2A 3VI3B 3WDKA 3FNEA 1OWLA 4E5VA 5LZ2A 3L05A 4UDNA 1RD4A 4ND8A 1KDRA 2F67A 2X9QA 3DNMA 5E3JA 2IWHA 4RIHA 1MB0A 5LA6A 3L5OA 4HWSA 4IHJA 4NARA 3C1AA 5HOQA 4PN3A 1RZUA 3JYQA 3ZJYA 2QTCA 2R8PA 4O4HA 2W2XA 1F0YA 1PK8A 1FS5A 3RRXA 4GRDA 5EMKA 4Q82A 4IJKA 5CBKA 2HJRA 3DZDA 4FZVA 4EYOA 2OGWA 4N8DA 3TUZC 5BQPA 1YE5A 3Q6NA 2WYOA 2I29A 1N1DA 2NSLA 3EZXA 1DRVA 4K0KB 5FPTA 4KZKA 4A0QA 3DVLA 4QQNA 1ZN9A 4O2BA 1WF6A 1B6RA 5CCEA 2G71A 2XCRB 2PQMA 3JQ8A 4HR7A 3RS0A 4DNXA 3VVCA 4M99A 1AA9A 2LV8A 1E9CA 4NOLA 4ESEA 3DBOB 4H1WA 4RVNA 5I47A 1CS0A 3KOZA 4RJKA 5IU6A 4RTJA 3D6NB 4GYYA 2V7XA 3FPSA 3CZ9A 4PYOA 3B52X 4JYPA 2REOA 4ARAA 5A3SA 3EASA 1BE1A 3QLEA 2PGLA 1ZAKA 5DM0A 1Q0QA 3JQ7A 2PWAA 2VJYA 1F2UA 3Q5GA 4A16A 1TX4B 4LOLA 5CMLA 5TPZD 1TJ4A 3TW4A 2NSHA 2HU7A 2N3ZA 3B70A 1NUAA 2V54A 1DUVG 1E2GA 2GA9A 1JHPA 4WZZA 4L85A 1DO8A 4GF5A 2P77A 3CT4A 1A77A 2J87A 2ZRPA 4ND3A 1B0ZA 4JASB 5DISB 3OPXA 2GCOB 1P9RA 3NTRA 6CHYA 3PYXA 1FW6A 1FRVA 1Z36A 3H3XA 2AOUB 2GAIA 1RW4A 4UVEA 3SU8A 1HX7A 1OGJA 2ZSHA 5EN4A 1Z47A 2GK7A 3JASB 1XTSA 4XWGA 3LH5A 1BXRA 2YCBA 3WIEA 3L6CA 4B6EA 5A7FA 1ENOA 1U7OA 4U8HA 3QFCA 4PZ0A 2GGSA 3AESA 3PENA 1ZJJA 3M7IA 5DP1A 1J97A 5IZCA 2OZKA 1QOQB 3NTUA 4QDJA 2J08A 1CULC 5EJAA 1AXRA 4OQNA 3GJ5A 4EFLA 1Y8QA 1XWWA 4GP7A 5CT8A 3U40A 1LBQA 1UBSB 4XUCA 2OGTA 2BD0A 1EEHA 3CEAA 2PKCA 4FMCB 2YY7A 4UHCA 4YMTA 2DQKA 2VSXA 4JT8A 4UM9D 3O83A 2BYTA 1M0EA 4DT1A 1USGA 3T94A 3P9SA 4G89A 4AY4A 5C80A 2HXSA 3LOQA 1FRNA 1JHMA 2E1PA 1XPJA 4DWVA 2WM3A 2EKPA 1BS2A 2QPLA 3FRIA 4MMXB 4PBTA 5DT9A 1OC4A 4P53A 2XUPA 1PRYA 1ZXBA 5JCJD 1RKVA 2LPMA 1CLUA 4GMFA 1QBKC 4AJEA 4DN6A 1BX3A 2O07A 3GGPA 3PKJA 2QV7A 5IK2A 2BGUA 1JAZA 3O2JA 1BRMA 2VAPA 2WG0A 2WT9A 4YTEA 4CLXA 3KOUA 3S7TA 2IXEA 2EIXA 2JGEA 1C0LA 1J70A 2R00C 2VNKA 3K8ZA 3S1AA 3TSOA 5LKRA 4YHHB 1RWBA 3SGLA 1RLUA 4MVYA 2O8EB 2PX6A 1QIHA 3EC1A 1Y5IA 1CV2A 3LWNA 2P3OA 3OZRA 2FR8C 2WT8A 1E77A 4MQ4A 3QPUA 3IAUA 4NE7A 1TIBA 4A8PA 4DNFA 3DL4A 3LU1A 4MWTA 4XVUA 5C5CA 1YR3A 3T1YB 4CEHB 1QAOA 2OENG 4GBED 4QRDA 4E13A 1D1TA 5KU7A 5HUHA 1OXBB 3HSKA 1AD2A 2EU8A 5ALPA 3GDHA 4B3FX 2J3JA 1ZVVA 5LQJA 1KZ1A 2I6QA 3ZCQA 3AF2A 1OBOA 1E9AA 3JD4A 3CW2A 3N86A 2GPSA 2W2VA 4C14A 1RTKA 4BNWA 2VPTA 1I7PA 2EVWX 4DBVO 1XMVA 4HAIA 4O2AB 2ZSDA 1M10A 3NIBA 3TOCA 4FDMA 4ZOAA 2RKOA 1E58A 2BTQB 2WSSD 2X77A 1W0JD 4DW8A 2WMDA 1N57A 2QL6A 3O9MA 1PYOA 1ZEMA 2ENUA 3GYBA 3LPAA 4WLEA 1HTBA 2NAFA 5A6SB 4NXMB 1GFSA 1ZITA 1WV1A 3EVGA 4EFDA 2NZYA 1BA3A 1X38A 3HXMA 2O1SA 4ZHQA 4IGIA 4ES6A 5IDVA 1ODLA 1N2CA 3W6UA 2QMYA 1W35A 2QD3A 1NN0A 4RKRA 4E22A 1Q0TA 4Q3LA 5HFJA 4WN9A 2EJUA 2OQIA 3NB0A 4N18A 1LXCA 3MS7A 1DAGA 4Q3CA 4NYIQ 5JRZA 3IAAA 4FSDA 4OG2A 3Q0TA 2XXBA 3G5LA 1U8FO 2FJ0A 3LC1O 5FWXA 2QTBA 3LOUA 1GYQA 3A4TA 5K45A 2E18A 3DOUA 1SCJA 4W4TA 5CD9A 3P2JA 4BNJA 6YASA 5JAMA 3AHCA 3Q8MA 4D43A 2V45A 1Z6ZA 5DNYB 1D1SA 4MWEA 1CJBA 4BVKA 2P2DA 1CUSA 2IKSA 2CNDA 1R9NA 3I2HA 2PD4A 2Q3MA 3P5SA 4CKEA 5KNCA 4LYJA 4TTPA 2J3DA 4LNHA 4FT4A 2ECOA 3QEBZ 2FWJA 5BR1A 3SVTA 4I1SA 2H17A 3OU6A 3TXYA 4REOA 3HM2A 3ON5A 4ZYVA 2NW6A 1X70A 4HH1A 1KAQA 2OCGA 2E5FA 3CEJA 3SOZA 4C7XA 2ZRCA 3ZTTA 4UBKA 5IFLA 1SGWA 1T26A 1Q11A 4OLFA 3ZWDA 5DV9A 3WGLA 2QN7A 3E35A 3ISVA 1E2LA 1X1BA 2PJUA 3EN0A 3IAM1 2FRDA 1WZUA 2BE7A 2R68A 3R09A 4XYBA 1Y37A 4J16A 4MS3A 3AUFA 4F5YA 2I8CA 2JHFA 1Y1RA 3R1IA 3NV7A 1DKNA 5H5JA 4DQDA 2XEDA 2SICE 1RT9A 1ZVMA 3R6LA 2FK8A 2H3HA 3G7NA 3HUEA 3IAXA 4HN2A 5HILA 3U44A 2DMRA 4GLFA 4Q21A 3P9NA 5TVGA 4CMIB 1KY5A 3AFHA 2BFCB 2J32A 4N3NA 4BMXA 5HWSA 3L77A 4F9EA 2ZE8A 3K1ZA 1O6ZA 4EPVA 5KAMA 1PJBA 3HY3A 2XNHA 2BKXA 4UNIA 3DPSA 1DLJA 2A9FA 2FUKA 2UDPA 5F4BA 1BDHA 2WWRA 2ZRLA 3ZIDA 4RELA 1C14A 3IOEA 4BMCA 3TOXA 3K5HA 5EQTA 3C97A 2R7NA 3QMWA 1Z0SA 2AVDA 1XEXA 4MEAA 2IZOA 3MJ4A 4TLMB 4Y6RA 3V8MA 3W3AA 4ZICA 1S4QA 2CYBA 1D4OA 3J80A 4FOTA 4E0BA 1AQUA 1M2OB 1OROA 2C92A 1FDRA 2IUYA 3FPAA 2DTEA 1MRZA 2FSGA 3CRRA 4HADA 1AIPA 1P7CA 3A4IA 3T5PA 4AO7A 3QF4A 2ZBRA 1VMIA 2WLTA 4FOSA 1GKUB 3AUYA 3BFPA 4HQRA 1I4WA 5E9WA 1D6SA 1QPGA 1R0KA 3A1DA 2OCBA 2IVZA 4HDAA 3PF8A 4N49A 2B4TO 4HMOA 3ODPA 4I7EA 1XWIA 2QL7A 1DHTA 3NHYA 5EC8A 4Z7OB 1A9QA 4B3BA 1IG3A 5KHAA 2VSYA 1SRQA 1M3SA 2VDWA 2GJAA 4WT7A 3MJTA 4Z4CA 5TPWB 1HE1C 4AULA 3H1AA 2BRUA 1HDGO 5AHWA 5IJ0B 1VPVA 3CR8A 2I66A 4JKIA 1KRWA 4G8CA 3VKFA 4EVSA 4JQSA 3U17A 5IABA 1JXQA 3EH1A 2YJNA 4CQNA 1ZMTA 2R8ZA 5BSFA 3Q88A 3EOBI 1LK0A 4KUEA 5KJFA 4J6EA 1HNWB 1KGSA 5H80A 1Z0AA 1NZFA 3LX5A 1V7QA 3DE3X 4JGGA 1X19A 2VJDA 2AC7A 3NOVA 3OURA 3WBFA 1MAAA 4KYTA 2NX2A 2VUTA 1ONBA 2A35A 2C3UA 2JI7A 1WXIA 2Z2KA 4LQLA 4R40A 2ZT8A 3FUUA 4RX1A 3PL1A 4LNAA 1NW6A 1ODCA 2XODA 3AKCA 2QTMA 3B20A 4GPBA 5KPJA 3D8TA 2CFSA 1XKQA 4ZO6A 3KQUA 1EWTA 2H63A 2PMFA 1E3EA 2WV7A 4PGGA 1U02A 1U8AA 4LZWA 1TAUA 1IN1A 1U5BB 1AO0A 1IZZA 4ZC1A 1QYXA 2D1TA 3IT0A 3U56A 4IDBA 2ZB8A 3LXMA 1DDOA 1Q7CA 4EUNA 4TL8A 3WV5A 5JD5A 2RG1A 1G5HA 1X9HA 4PONA 3D8NA 1G8KA 1L4LA 1P75A 2Q6TA 4FQ7A 4NPHA 1FXWA 3IAS1 1QP4A 4RJTA 1JKXA 3OPMA 3HHEA 4C4RA 5CHYA 4C4OA 3A6ZA 3BD9A 1MNAA 4YQEA 2IA5A 1XCGB 5DEIA 3KQKA 1Z7BA 2QPTA 3MPUA 3WL7A 2O6LA 1P0QA 1MABB 1OZAA 3FGPA 2Q49A 2IYPA 2XXJA 3SJBA 3GFGA 5HSGA 5I4IA 4KQ9A 1SCIA 2HA3A 3DLTA 4Z0NA 4JJFA 1ONNA 2B82A 4Y2YA 3PVZA 4YJFA 3CXRA 4IG4A 1R5JA 4I4TF 5ELMA 4ZVUA 3D59A 5TQ0B 3T0GA 4C0QC 4R51A 2ZJ5A 4BPRA 1L7AA 4HLDA 5DO9A 4UTZA 4X8LA 2FAXA 1A88A 1P1CA 2FJPA 3MILA 3GUZA 3PVSA 4PO1A 5IJAA 3FFXA 2NUAB 3UK6A 1FE8A 1UAAA 4X0EA 3HB0A 4EFNA 1VLVA 4UNSA 5AJUA 3TKYA 5J43A 1H8EA 3OM8A 3N0RA 3EPRA 4UU1A 3S2GA 4EG0A 1NW8A 3HJBA 5CYGA 3KXDA 3MOIA 1J23A 1CQIA 5E38A 1RLJA 3RS5A 5FPKA 4NOMA 5MHTA 2CFIA 2OR3A 1MKYA 1D6NA 4HUQB 4W82A 3QTBA 2G63A 4W63A 4H77A 1CD5A 2X5OA 3M6WA 2QVZX 1QAQA 1XP5A 3EIWA 4RCVA 1N4AA 1AKUA 4W1RA 4I5GA 2UVPA 4TYYA 1YV9A 2CCKA 2P40A 1NQXA 1Y9DA 2HK6A 5FOVA 2I7XA 4WXMA 4AC9A 2FHSA 1H23A 5C8XA 3NAZA 2YWCA 4RACA 1BYIA 5IJZA 3BL5A 2PSDA 3RODA 4KR6A 2ADOA 3HB5X 4PYMA 4XE5A 4D6XA 1C2TA 3P2IA 1VBMA 5LQCA 3P1JA 1GQOA 1X7ZA 5B58C 2YFQA 1Q7EA 2OQRA 2WM9B 4BJ3A 1P8AA 3EA0A 3W9SA 1GZDA 3V1TC 5G4KB 1Z28A 3P9ZA 1K2WA 4CI0B 4CTKA 1E1LA 3F2VA 4EHBA 4A2PA 2NV6A 3C6BA 1RPAA 4IFBA 5AM2A 4HRAA 1PHPA 3EXAA 4LV8B 5E2BA 2AB0A 3TJZA 1XRPA 1TLLA 4BEBA 3C39A 3ZJTA 3NUGA 3OTQA 2PWYA 1KJIA 1V95A 3CYFA 1Z6YA 3BBPA 4BLWA 2B6NA 2JA2A 1JA0A 4LYGA 1QB8A 2YVAA 3P9PA 2WYWA 2PZ8A 1JAIA 1E4OA 1VHWA 3UF0A 4BO7A 4DLTA 4EKNB 3KXIA 1UT8A 2GPJA 3FIJA 2ODPA 3IQFA 2GM9A 4HNAB 2DCMA 2OPHA 4C0HA 3OJEA 2EJVA 1E3WB 3L0YA 3Q98A 4K9NA 1L0BA 2IE0A 1E8NA 1Q0LA 3EAFA 4GECA 4WKPA 4A9AA 4OA8A 3I0NA 1AHPA 1T9HA 3KIPA 4WECA 4DWWA 2DTXA 3UB3A 1P0FA 1HV8A 1E18A 2OCIA 4ZOEA 4Z6KA 1C3XA 1Y8ZA 1CY6A 3U1BA 2KQUA 5LMZA 3FD8A 4CV1A 3ZCRA 1E64A 2YJ4A 4AN4A 3BPSA 2XMSA 1R2QA 3KXKA 1YQTA 1WR8A 2R1UA 5EL0A 4EO9A 3ELUA 5KYGA 2RBKA 5ANRB 1M76A 3JQDA 1REQB 1USWA 2XGGA 4IJQA 3TF5A 1DARA 2P2YA 2Q3JA 1HYBA 3Q6IA 1KMHA 1QYCA 3FLEA 3R23A 1LI7A 4HJRA 3LX8A 2QLFA 3K35A 4D2IA 5KQRA 2XA2A 4X20A 1SXJC 3UG7A 2Z57A 2ZBQA 3ABRB 3DEAA 3AM3A 5AJZA 1WZNA 2ZROA 2G77B 4EZEA 1Z3IX 1RWWA 4IIUA 1QFJA 3GAAA 1DVRA 4M1WA 2Z5GA 3QXJA 3FF4A 3T9AA 4IKEA 5K3BA 3RT9A 4YRMA 2X23A 1FP6A 2ZEJA 2Q8NA 4DMCA 2ID4A 2VDKB 1EIWA 2FPIB 4BXOA 2CL7X 1VKJA 2BEKA 2C2HA 4B3MB 4PCUA 1ZI6A 3H4MA 4WK6A 1G9XA 3L3BA 3MTJA 4XSGA 2IPAB 3RAPR 4LYFA 4POOA 3EQ8A 3WY9A 5HQTA 1GRVA 1EBUA 1SBNE 4DA7A 4JI1B 3L9XA 3PHIA 3G17A 1LK5A 4UHBA 3VBCA 4D4GA 4UW9A 1PTJA 3ONWA 4MH0R 4MR8A 1POWA 2C0PA 5DASA 3PJDA 3UHJA 4C7MA 4Q12A 3R7SA 5E0OA 3PYMA 1CUIA 1U28C 3RJ5A 1O8BA 2RIPA 3BD6A 3C7AA 4Q9DA 5FUMA 2OCLA 1PGQA 3L2OB 4PZYA 1HDYA 2Q5IA 1QKJA 2WV9A 1WPXA 4WRRA 3SSNA 1TA0A 4YMUA 4ZYWA 1CY8A 1XVVA 4Q48A 5IBRA 4LHXA 1ZKMA 1SC4A 3AOEC 4KXMA 3UZUA 1QH0A 1KO4A 4CEIA 2JHGA 2J41A 4FFDA 4GX5A 4BU0A 3WZMA 1J9EA 4JQOA 1Y1KE 2EGGA 2QX9A 3HKDB 4X84A 4ZOLB 1O6BA 2OBNA 1JLHA 1LNQA 3MWEB 3QX3A 4LE0A 4BU1A 5JU6A 4AJPA 3AFOA 4WKNA 5DDIP 3EEQA 3H5OA 4PN7A 2FF7A 5JCOC 5AIAA 1VMAA 1IQPA 1XRJA 1LH0A 2RHDA 1GA1A 2ZJ1A 1V6SA 4B7CA 1WE2A 4HH3C 2AN1A 2ZRMA 2D5CA 5JYCA 4F4JA 4J1SA 1JHUA 1QWOA 2QJTA 4QEDA 5DCUA 1OLSB 4RIEA 1EZZA 3ZNNA 1GN8A 1FPQA 4HEA1 4UBNA 1UPUA 3FNQA 2H3EA 4IR7A 3MCZA 2ZIXB 3BN3A 3PA8A 4MDFA 1E1NA 1KGDA 4FONA 5EXEA 4FI3C 5BSHA 1X1SA 2OCAA 2Q2WA 2FSFA 3MUOA 3IR7A 5HP4A 1NPDA 1DWOA 2GCPA 2QPAA 1NRXA 2WZCA 3DOFA 4CM5A 1U2QA 2COKA 1PX2A 2H16A 2PRJA 2DFKB 3IAM6 3JYOA 4URUR 4B44A 1SBTA 4F9GA 3PEYA 3TOZA 3V34A 4BAZA 1G8FA 2EKBA 2M9MA 3LGSA 4GOMD 1GY8A 5I5EA 1QQAA 2NPFA 4K9LA 4ER6A 1W25A 2EBUA 4LGCA 4QBFA 4QLBA 5CDYA 4YRPA 1KNXA 3RLIA 4I36A 3I6IA 3L40A 3QY0A 5DRYA 5EERA 4L5BA 3SQOA 3SLGA 1VE6A 2C5AA 2P7IA 3AETB 5DK6A 5LMCA 3ICOA 2ZJYA 4Y2PA 1VCOA 1G3IA 5AHRA 1QIGA 1Z0JA 3FN4A 1N5IA 3ORQA 4KX5A 2F4NA 5F64A 4XDGA 3G2OA 1I2DA 4TXLA 5HIMA 3WRYA 3VUEA 1SVSA 2OO7A 3B60A 4YMWA 4AZ3A 1Z75A 4FD3A 2OHGA 4IQGA 1CQZA 1FFAA 2Y1OA 4H17A 5D3KA 5BUZA 2P0AA 4UFOA 2RMKA 4LZNA 3EF0A 1U94A 4O0LA 4K9DA 3VKVA 2PT9A 2HRCA 1I7LA 2WQZA 2ZXUA 3SEQA 3AY3A 3OESA 3BJZA 2CUKA 3QVTA 1CR1A 1V5WA 4NZOA 4P58A 5DYNA 5K99A 1OH6A 3ZKAA 5JAPA 1BAPA 1NY5A 1FZQA 2W98A 5EJ6A 4Q6BA 4IIJA 2W4MA 2C0QA 3W6PA 4TV8B 1N7GA 4C3UA 1WJGA 5JBIA 2OB2A 4US1R 3JQAA 2AOTA 6GPBA 2J4DA 4BKQA 4P5DA 5IUJC 3QYAA 5FUQA 4LHYA 5IDWA 5M2QA 3U60B 1IFXA 2JGKA 3WNCA 2JLVA 2DPHA 4GGPA 4TRRA 3WHLA 3M3HA 2FZKA 4LSZA 1GOTA 1OYVA 2P6UA 2QPOA 5C34B 4DVJA 3O8RA 2D06A 5E9JA 1L5SA 4FLMA 1WDLA 3D0QA 5ARDA 5KYNA 3AHJA 4GBGA 4BGDA 5ITZA 3OZBA 4UQLA 3L9WA 3DB1A 1EFTA 4YAOA 2P4SA 4XJXA 3ZIAD 1KO7A 1TUIA 2NN3C 1EA7A 4FGLA 4Y0AA 3TRJA 4Z4FA 5EP4A 1QC5A 3BEDA 1KORA 1N6RA 4CF7A 3HFSA 3ONEA 2VKQA 3IOYA 3ZGXA 2Y1EA 4EB6B 5DTRA 1UMBB 2NVBA 5DMXA 4ZVTA 3SXUA 4ALJA 2B6HA 5LXTB 5AOVA 2CUNA 1ZPDA 2C95A 1T5LA 3JD3A 1SZCA 1TKCA 2ZBFA 2BDUA 4CCYB 4V39A 1JDVA 2OOSA 1TTTA 4EDFA 4I55F 3OECA 1U9IC 3GT3A 2Y1XA 4XJTA 4R05A 1FP1D 4BDSA 1J8DA 1X7WB 4ZCPA 4DVGA 4C20A 3QXGA 1PLJA 1W0KD 2CNLA 3E23A 3ER8A 2G1KA 3HCNA 1CHNA 1NQWA 2QX6A 5IX8A 5JYDA 5TT1A 3D1LA 3WYNA 5DPMA 1CF4A 1FP7A 3FMFA 4LQCA 3QKRB 3RS3A 4GMKA 3V97A 4LVOA 4KQIA 4CGZA 3UH0A 2XAUA 1GGNA 1DG1G 1WU7A 3OZ7A 3PWKA 5D3MB 5KVAA 2J3KA 4TQAA 2G83A 4GKAA 4Q7JB 3EYAA 2Y9MB 3QX8A 1P73A 2PR2A 4TT8A 1P7WA 4DMUB 3CPHA 4G01B 4MRAA 3STYA 5FTKA 3RSCA 5F2NA 4J49A 1FQJA 4V03A 4KQ6A 4EY7A 3BIWA 3HE3A 3TS1A 1J8FA 1HY3A 2NOAA 1JKMA 1T0HB 2NVUB 4MUGA 3ELDA 2YHBA 1BVYF 1SZDA 3ONVA 4IBOA 3T15A 1FLNA 1TK9A 3I4LA 3ZVRA 3BWBA 4RPCA 1P31A 4E11A 2ZBGA 4C0BA 2ZJ8A 3KLNA 4F4FA 1J24A 4P4SB 3B1VA 3EIHA 2RGXA 4P6VF 2A94A 1IY1A 4D9EA 5ALEA 2PZEA 1L1EA 1ZISA 4K88A 4M60A 1Z68A 3NHZA 5TVKA 1CZKA 2JJQA 1KH1A 3TQFA 3RFTA 2WU8A 1W29A 3O47A 2UZ1B 3H86A 4LOAA 2O7RA 4NMXB 3VSBA 2QT0A 3BX1A 1F7VA 1EGAA 1E8DA 2FW8A 5KQMA 2I8AA 1FNNA 2A0FA 1U99A 1R9JA 3E53A 4RVCA 4YQYA 1OFIA 2J8ZA 3HDQA 1AH2A 2R65A 1YQWA 4OJKA 5JQWA 4ZD6A 1L9XA 5GGXA 2OQ2A 5ED0A 2RGNC 3WQBA 1LNSA 1SM4A 1WULS 5DTIA 3MYRA 1YMQA 2BBTA 4ROTA 1VJGA 4RZIA 1S0UA 4R5HA 4WLFA 3M2TA 3TEFA 4D41A 2UUAB 4CCAA 2GEJA 5FX2A 4CKBB 5LCXA 5C35A 2FPRA 2RSLA 5A9TA 1CUCA 3WISA 1RRGA 2OVBA 1TKRA 3H42B 1YCGA 4F46A 3WVNA 3GG9A 5E4FA 2R8RA 3D2AA 4ASUA 1N78A 3F6SA 3U26A 1GNLA 3DBVO 5KJ1A 2HTEA 1SKYB 1SD2A 2AI1A 4MRRA 4XDYA 5I9BA 5BSWA 1AS0A 3I83A 4U3JB 2IY8A 3KUKA 1UF9A 3HCWA 2ZYDA 2IDZA 3FNGA 1XZLA 4HRVA 5EMHA 3AJRA 3Q8WA 5AVJA 5LDDC 4Q37A 1HMYA 1UBLS 1YZKA 2QTGA 3B6KA 4LXYA 5JSZA 2AEJA 3CKMA 1P5ZB 4CDNA 5BNTA 3HMKA 3K6KA 2C1EA 1S3SA 3PP8A 1LY1A 4QSHA 2FN7A 5PNTA 1OLUB 3V2HA 5JMTA 5A3RA 3K0SA 1XPOA 4C08A 2CJWB 3VR5H 4EYGA 2F00A 2XYQA 3VPDA 2W6OA 4Q15A 4GBMA 4CMCA 4DV1B 1PX0A 2WWWA 1DZ3A 5IUKC 6NULA 4B45A 5I4CA 3GGCA 5GOZA 4ED9A 1K0FA 4O4IF 3GA5A 2ZYUX 2Y67A 3DUWA 4M0MA 5GPBA 1JTFA 4YCLA 2R1VB 3BKWA 3FH0A 4NECA 4DV3B 1BN7A 2QM0A 4G5FA 1XMQB 3AY7A 2ZS7A 4F0JA 1E2JA 1H69A 3QVGB 4HGYA 3F9RA 5I51A 4MO2A 2YV1A 3DA8A 1G7RA 2GN6A 1H65A 2NYUA 3MK31 2I1QA 1E4EB 1WCXA 1YUMA 3A3PA 4H4DA 5JAUA 2VDUE 3TIIA 4O3FA 5LMNB 1TLTA 4GUAA 2AFIB 1ABEA 1VE3A 4M7RA 4B71A 1N6KA 4ITRC 1K92A 5B6JA 3KJHA 1NIPA 3ITEA 3A6JA 1VE5A 4DL9A 3GUHA 2AMVA 1SQSA 2ZPUA 4LDQA 1Z4IA 2H1RA 4XB1A 1WTCA 4IXDA 3I61A 4UTOA 5DSTA 5IKMA 1NZDA 1YA4A 3DXZA 3IE2A 4YRLA 4XFJA 4YCCA 4JOBA 3ZE9A 2FSHA 3QEMB 4ZVLA 3BRQA 1RM4A 4RXUA 2R6JA 2QW0X 2VL7A 3OBBA 2D00A 2C8KA 3NIDB 4PZ9A 2Q45A 3LBAA 1IL0A 1BWQA 1IEVA 3K3PA 1WB9A 1U6JA 4Y67A 1KAEA 4KNYA 1O77A 1DC8A 2B2CA 2NTVA 1YFJA 3G9XA 1OAAA 2IEBA 2IUUA 3WLRA 3IDOA 4W5TA 3K70D 5BP7A 5I9SA 2AHOA 1LSJA 3MS4A 5CURA 3A7DA 4CMBA 4DR7B 1RDFA 1MBZA 4D8TA 3ZLVA 5B5SA 2VXBA 4W9NA 2XNDD 4JHLA 4BVLA 1YR7A 4ZJUA 1QM5A 2OPBA 2Q1YA 4I1UA 4JNKA 1EDDA 4F3KA 2B5VA 2AYYA 2P1DA 4FVTA 3ZDEA 4EUEA 4YR9A 1XT6A 3ZGLA 2GYYA 4W7HA 4WZAB 3GCWA 5C5EA 1A8UA 1XZQA 5DHUA 5JEDA 1V3QE 2AE1A 4TQUS 5I7OA 3LVQE 1X7XA 3OEYA 2DZDA 2XMBA 3L0DA 1RYFA 1UAGA 1L5LA 3SYMA 1Y3DE 4JHXA 5HIKA 1XDBA 2ZDHA 3UCEA 5E1DA 2CYCA 1D07A 1JTEA 4R83A 4B6JA 2Z8XA 2GRJA 2Z9BA 3TMYA 2B0CA 1ZL0A 3M9XA 1RPJA 3NOQA 1JJFA 1ZGJA 3NO4A 2NO0A 5EP3A 5H9WA 3STWA 1FL9A 3MWJA 3G49A 4AK9A 4DCTA 3G1TA 3O4RA 1T8UA 2EBFX 2JHCA 3MINA 4IAOA 4IH9A 3GXOA 3RYIA 1LS6A 1D7AA 1A72A 4QGSA 3DFKA 4UBJA 3EARA 4OHFA 5DM4A 1QRAA 1AGXA 1W8DA 3QWIA 3E9CA 4GOND 5KJEA 3TIFA 3V8EA 5JZMA 5KSWB 1M54A 4FLFA 3SM9A 2YVLA 1KO8A 2IYZA 3S27A 3T4UA 3RARA 5CDHA 1RQXA 3VO2A 3FUCA 4BB6A 2RC6A 4RTLA 1BQ3A 1C1HA 1XG5A 3TB6A 5GWXA 1PS8A 4H4CA 2ZBPA 1LRJA 2FWBA 3UICA 2VEDA 4HEA6 2N0SA 3OO1A 1BD3A 4MQUA 5FTJA 3VC2A 4DMLA 2DUJA 4V0ME 4P08A 5I8PA 1OWOA 1JEYB 3WL8A 3O03A 4KSCA 3EJWA 2L19A 2HTFA 3WIVA 3WK7A 4D57A 1V26A 1W34A 1XJ5A 4F6RA 2HHHB 4OHYA 1AZSC 1AUOA 2HNBA 2IEZA 3W7VA 3ILSA 1R6XA 1DTWA 3R8CA 5HS4A 2VUHB 2O14A 1OX5A 1RRVA 3MLAA 3OHPA 5GJCA 1A9XA 3PIIA 2V59A 5EQDA 3RYCA 3DT8A 4BGEA 3A2MA 3DW3X 1D8TA 1QVZA 4AYWA 4TWIA 1CRQA 1AF7A 4CLRB 1ESMA 2YUIA 1NPTO 3ZNOA 2PA3A 1HG0A 2QNIA 3TZBA 2VRNA 2O3JA 3VR3A 2VVTA 2RAFA 3PJRA 2R25B 3UV6A 3INTA 3MQ2A 4RJ2A 1TCCA 3CUYA 4BAUA 3NHJA 2A7QA 3EFOA 3NBFA 1KEVA 2EW1A 4S35A 3DWGA 5AW9A 4MW6A 3QW4B 1AKNA 5KTTA 2QG6A 3W1WA 3Q11A 4MNTA 3E1KA 1TCUA 4KV7A 4B8YA 5A9RA 2VOEA 4DARA 1JBKA 1G64A 1N5MA 1NBHA 1QHFA 2BMFA 3IPRA 3WWYA 3VKGA 3O95A 3IIKA 4NFSA 4QJIA 2X2PA 4D3YA 3LRTA 4IXWA 5HF6A 4Y2JA 1NP7A 1N6PA 2MSDB 5I8ZA 2G04A 5KKNB 1TD9A 1WXGA 4PXYA 2GA8A 3BC1A 5DXFA 2PXHA 3S7ZA 5BYAA 2XSZD 3BB3A 2GD1O 3NVMB 4MHSA 2O0KA 3VU0A 2W71A 2TRSB 4IUBS 1TB4A 1QUEA 3VKWA 1ID1A 4G25A 1A9YA 3ENVA 3FAKA 2AXEA 1NT2A 2I54A 3MTGA 1D5WA 5D01A 3IDFA 5KWEA 2ZZNA 5B7QA 3IQGX 4PY2A 4I4TB 1V8DA 3UHPA 1CVIA 1KQOA 1YB7A 3H9UA 1QZTA 3CS3A 2P6NA 3DYBA 3R3YA 4P93A 3SMQA 4ZJPA 1F17A 3K9BA 1BXGA 4Q9JA 2DHCA 4X8MA 5BYKA 5I01A 3OCXA 1B7GO 4DLXA 4RTRA 2QIPA 4JSYA 4PBRA 1A98A 2WUDA 3IESA 1U1DA 4LHEA 4TZKA 3HEBA 3TZ6A 2XYGA 4BE9A 3HJFA 5I9NA 1FUIA 4BJHB 3NHAA 4CN9A 3SC2B 1ZOOA 2WVGA 3EXHB 2J46A 3NLLA 4W1SA 4PU0A 1U0BB 1FQOA 2GBLA 2VH1A 2EHJA 4YJDA 1IVYA 4OK6A 2PMCA 1FW8A 4NFLA 4KIJA 1CR0A 2EKDA 1LX6A 2X7JA 4JEIA 3W34A 4DB4A 5HZHA 1VKNA 1KP9A 2CB0A 1K98A 4FEYA 4QDZA 1E9EA 2H5EA 1YC5A 3JRWA 4DS3A 4QFMA 2Y4NA 4PTLA 4KO1S 4B3RB 4KN8A 4BGUA 1YIOA 1FVXA 3UW3A 3FKSD 1DDGA 3CONA 3NEYA 5FT9A 5EXPA 1H1LA 3O94A 1PYDA 2DT5A 3F8WA 3GIWA 3K2EA 3OPQA 1IM5A 1BN6A 4FOOA 4JLUA 4KUHA 3ROZA 3T1NA 3W5CA 3OZSA 3R20A 4Q39A 1QGED 3KXLA 4M21A 4RXMA 4XUDA 1E0DA 4Z0TA 2DVMA 2CXUA 2IFTA 3UHOA 4N01A 1US8A 2E4AA 3JARA 3RM3A 4AY2A 1G59A 2ZYTX 1KEPA 3FUTA 2CSUA 2OHVA 4X92A 5KVQA 5FF9A 4JCCA 4KAFA 4X7PA 1NJ1A 2JD2A 5CA0B 2GRUA 2HSZA 1Z8HA 3PDWA 4L0DA 5DHFA 3MSXA 3DW1X 2GNOA 3CPSA 3V32A 4ZRDA 1LA2A 1OT5A 1XXLA 4URWR 3HKBB 3CSSA 2EJCA 4DBLC 4F04A 4E2XA 3SHWA 3JALB 1UC4B 2ZWOA 2Q5CA 3DHYA 4HAOA 3VC3A 3HO6A 1Z5GA 3FSEA 1HDIA 4Q19A 3O2SB 5C4IA 2XUDA 3TLCA 1SCAA 2H4HA 3K5WA 1EUCA 4R1MA 2FFRA 5AI8A 4G1CA 1WA5A 4AUMA 1B6SA 1QVRA 1UBFA 3I64A 4Q3NA 3TVYA 1IONA 4MYRA 3RRNA 3K6SB 4MI6A 4A6DA 1KZ6A 3E8MA 4HZUB 4K9SA 1CPYA 4G0WA 4DCGA 4RTNA 2OAP1 1KOJA 2DFVA 4ER3A 1YOVB 3FFAA 8ADHA 4MIKA 2O2GA 1K4MA 3CMMA 3TCXB 1FNDA 2JLUA 4MRNA 3OTHA 2CLSA 1PWZA 3EPPA 5FOXA 1KEEA 3IR5A 2QLLA 3UQYS 3V5NA 4FQ8A 4OU5A 1E5TA 1R15A 2SKCA 2BOVA 3MRVA 4TM7A 1FVHA 3JWEA 3VDXA 4NAVA 2IBSA 4F4HA 2XGOA 4XXHA 4U2FA 2BP7B 1M6NA 1MH9A 2I7DA 1AKVA 3ICEA 3H97A 3M4NA 4JFRA 1DBRA 2GPWA 5BQXA 3F7OA 4L4UA 4EJMA 1NW5A 1ZW6A 2Q5JA 3QUQA 1RWNA 4UU8A 1DE0A 4DRXB 1GLNA 2Y0PA 3Q7PA 4JP3A 3CBGA 1NF8A 1TMGE 4E4YA 4CIWA 1GQQA 3HUFA 4MYDA 2OAQ1 2PX8A 2Q27A 3EZ6A 1ML3A 3MAAC 4NQZA 4RVDA 4NCBA 2GD6A 1TF5A 2PDAA 5K8CA 1AK9A 3BF7A 3JAWA 2ZTSA 1UC9A 3QFHA 1WXDA 3UBTA 4TMKA 4DSZA 3EA5A 2A0YA 2C54A 3THRA 4JJEA 4GYKA 4EI9A 4DWOA 3EWIA 5TF0A 3PUKA 2PWPA 4KX3A 4NEHB 4TKZA 4X64B 3CF6R 3DH0A 5IHPA 2P75A 3A3YA 4K3UA 1FPMA 2H4ZA 4NMLA 4Y6PA 4YCMA 3R3XA 1ZRHA 4BASA 5L7TA 1PD1A 1W93A 2DU8A 2X0RA 1I7QB 2DLDA 5JEEA 2OCPA 1WHTB 3ZDAA 5I7RA 1YZUA 3PX2A 1WPQA 4NZPA 5G02A 3HM9A 1Y98A 2PD6A 5LUAA 1JAYA 3DOEA 4BP3A 1LI4A 3KYIB 2VP5A 2XE4A 3DKKA 2Y76A 1X80B 1NONA 2L2QA 1DC6A 2NXJA 1YS2X 2Z4RA 5FOQA 4BLVA 1L6RA 2HMTA 3U3XA 5EMLA 5G2OA 4OBBA 1FC0A 3DZJA 4OAPA 3AP3A 3RRBA 3UJHA 1VLHA 3WI7A 2AA3A 1H4QA 1MB2A 4MJLA 1KFKB 1AKMA 5FXMA 2VQSA 4U0KA 4ILKA 3GRKA 4G0ZA 3GH1A 3ZC3A 3ROEA 4PZDA 3ZHOA 1CKEA 1N2IA 2Z98A 5SZJA 1O2DA 1EFLA 1UZNA 4FE7A 3QVMA 4TMZA 4MSUA 2GB4A 4O33A 3QKTA 4Z9BA 4TYQA 1EX9A 1NNLA 2YRXA 4JJKA 2WU4A 4DA0A 5C1OA 4N3GA 3TTUA 2O7NA 1NJ6A 1EHIA 4LDJA 3T35A 3K1JA 3TTXA 1GQRA 5KI6A 4ZAZA 2C7PA 1M6HA 1ACLA 1PL7A 4GG1A 4KQJA 5T3UA 421PA 1O9HA 2YNMA 5K6AA 1A8IA 1LV7A 5BPFA 1FP4A 1P2FA 4B3XA 3GDOA 4OAQA 4R6WA 3DDZX 3OQ1A 4GRAA 4CUKA 2R6FA 3I3SR 3EXG2 3LWZA 2OM2A 5CDSA 5CK4A 2ATEA 4JUIA 4O8CA 5FCDA 4FXPA 1MPXA 1VGVA 4YJ2A 2V9CA 3QMVA 5IN5A 1KBQA 1H2AS 5L4SA 4BX8A 4JBLA 5HMLA 3O82A 5EQJB 1VYUA 3DL0A 5I45A 4PHHA 3U7QA 5AXCA 1T8RA 3V1UA 4ZQCB 4AWBA 1FMJA 1WXQA 2KSQA 3FPJA 3MMSA 5EE5B 2NQ2C 3MF4A 2F9FA 1V8OA 3KTOA 4WEOA 3ZWWA 3UAOA 1BCSA