1FSPA

Nmr solution structure of bacillus subtilis spo0f protein, 20 structures
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution NMR structure and backbone dynamics of the Bacillus subtilis response regulator, Spo0F: implications for phosphorylation and molecular recognition.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Response regulator
molecule keywords STAGE 0 SPORULATION PROTEIN F
total genus 24
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1997-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fspA00
4PEVA 1YS7A 4H3HB 3OMWA 4DN6A 1RXEA 4KMRA 3E61A 2FQWA 1FFSA 3I5AA 4LX8A 4UHKA 1K66A 4YLEA 4EYOA 5HM6A 1DBQA 1XHFA 3TB6A 4OLBA 3HVRA 3CHYA 5DGCA 3OLWA 3QLUC 5E3JA 4NICA 1XHEA 3A0UA 2R25B 3GRCA 1NXOA 4N47A 5DTEA 3KSMA 2PAFA 2QXYA 4W5OA 1RZRA 3F7NA 5C5EA 3IDOA 4LZLA 3N0XA 4N76A 1NY5A 4G0XA 3QELA 4GPAA 5TQJA 1ZH4A 1DCKA 1QPZA 1MIHA 3LUDA 1E2BA 3MMNA 4ETIA 4YV7A 2NUBA 5JNRA 1Z13A 4Z4IA 1VRVA 3HK2A 2JB9A 2XDYA 1ZDMA 3LKBA 5JNWA 5B3JA 4RY9A 1WETA 3OO0A 1KRXA 3MM4A 1TVMA 1USGA 4MR7B 5CHYA 4NCBA 3GBVA 1U2PA 2FEKA 5D2CA 3D02A 3ILHA 4GNRA 4F3TA 4Z4HA 2IPAB 4ZYLA 1GCGA 4P98A 4O1IA 4LDZA 2O20A 2VUIB 1KRWA 3TD9A 2QVCA 5T3YA 1JFSA 4Q7EA 2IDMA 2MSWA 2ZWMA 1JF8A 2A9RA 3DLBA 1GCAA 4LRQA 1EAYA 3HJFA 5TPWB 5IEJA 2JCGA 2PL1A 4EYGA 4RDCA 4MRMA 1EWVA 5CNIA 3C6QA 2ID9A 4MRMB 4W5RA 1SD5A 1U8TA 4MR8B 1Z12A 3N6VA 3D8UA 3H5IA 3NBMA 2L18A 3H6GA 5KQMA 3LUGA 1OXKB 1A0OA 4KVFA 3H5VA 1ZGZA 3SG0A 2GBPA 3KTOA 2PUGA 1JWLA 3OM1A 5JS2A 2H0AA 4MQFB 1JFTA 3NHZA 4HYEA 4UHJA 5BR1A 5DKFA 4W5NA 4FE4A 4ETMA 3OLVA 3EQ2A 1E6LA 5TPWA 4MR7A 1JHZA 3HUTA 4Z4FA 3TX6A 5IUJC 2FVYA 1Z26A 1SXIA 3IP5A 3A3KA 3GBPA 4G0OA 3OLXA 1DC7A 5FWYA 5IUNC 4ML3A 3Q41A 1W9HA 2WY2D 3HDGA 1YK0A 2JVKA 4EY3A 2PUFA 4N41A 2PKXA 1MVOA 5CNMA 1OXBB 3FMVA 4NCAA 3KYIB 4LDAA 3NNDA 2MYPA 2GWRA 3O75A 3T6KA 3UUGA 5JS1A 2RDMA 4JAVC 3JVIA 4MR9B 1DRJA 1BDJA 3SNKA 4EYKA 3Q15C 2NZUG 3UKJA 1C4WA 3URMA 2CWDA 2LP4Y 1UDRA 3I42A 1MAVA 4EVQA 2A9OA 3O2SB 1PUXA 1JBEA 3EODA 4RXMA 4HNSA 1ISRA 4D74A 5TQ0B 4PZ0A 5FBKA 4IF4A 5KQLA 4G0PA 4CBVA 4N0PA 2A9PA 2MYUA 3RVNA 4JB2A 3HZHA 4XLTA 2WJAA 3KCNA 1L5YA 4RK4A 3O74A 4RXTA 2N9UA 3Q7RA 2HPHA 3KJXA 2LUOA 2LBPA 2B4AA 3LUKA 4Z4CA 5IC5A 3IPCA 2M98A 4TLLB 5GQSA 1ISSA 1QKKA 1T34A 2FXIA 4Y9TA 3ROTA 1D1PA 2LPMA 1E6MA 5FWXA 3T38A 5FWXB 4MQFA 2TMYA 1APBA 3K4HA 4G0QA 1DP4A 1J56A 3L6UA 4QICA 2WWVD 3C3MA 3EAFA 3RVMA 3R0JA 3I09A 1AB5A 2P9HA 3RVRA 5ABPA 4W5QA 3DGFC 3O2JA 2JBAA 3KHTA 5EWMA 4F12A 4RU1A 3UK0A 1D5WA 3BRQA 1I3CA 3CG4A 4RK1A 2OQRA 4LE0A 2JVIA 4RZSA 1QO0A 1CEYA 3H5LA 2FQYA 2QVGA 3QELB 3QLTA 4RV5A 3CRNA 2QR3A 3QK7A 4OG2A 4RK5A 3QEMB 4EGSA 2R48A 4YCSA 3SAJA 4OLAA 5TPZD 2QU7A 1Z15A 3A0RB 4O1HA 1CHNA 3CFYA 3O2QB 2E4ZA 4RK6A 3MQ4A 4KZKA 2R4QA 1HEYA 3G85A 2GKGA 3FDFA 3NNNA 3NNSA 3LOPA 4Q6BA 2IOYA 6CHYA 4Q6WA 1LK0A 1TM2A 3Q7TA 4O5AA 4TMYA 3FFWA 1NXPA 3DZDA 1TJYA 2PLNA 4TN5A 1SXGA 8ABPA 4JASB 4PE5B 3SQNA 4EVSA 3HEBA 2ZAYA 3LTEA 2HJ9A 2HQBA 4RXUA 3EJWA 4RY0A 3H1FA 4YP9A 3KLNA 1DJMA 4RSMA 2E4XA 1ZHHA 3IP9A 3CZ5A 1LJUA 3T8YA 4Z4EA 4PYRA 1A2OA 1YMUA 3EULA 1ZAYA 4WUTA 5IBQA 4TLMB 1D1QA 1SXHA 1JYFA 1NXTA 3F6PA 3EDCA 1JX6A 3CNBA 2NT4A 3O1HB 3RQIA 1ZVVA 4Z4GA 1FSPA 1XWWA 5HKOA 4G97A 1P6QA 2E4VA 3RH0A 2FLKA 3C3WA 4EUKA 1QP4A 4F06A 4ZMSA 1A04A 1TMYA 2FMIA 2MSLA 3F6CA 4XASA 3O1IC 2FMKA 2VK2A 3GT7A 3BREA 4KREA 3IP6A 3HDVA 3DLHA 1PHRA 4IMIB 1FFWA 2FN8A 3FFXA 2IKSA 2JK1A 3KLOA 3RVQA 2FLWA 3HM9A 1BVHA 3GL9A 3BILA 1P8AA 4E7OA 4L85A 2PUAA 1ABEA 4KFCA 1EWKA 2X7XA 5FWYB 5GOTA 5IUKC 5HSGA 3G1WA 2KYRA 1YVUA 2QSJA 1RNLA 1YIOA 2IPLA 5DLEA 3EQZA 3OQOA 4LE1A 2AYZA 2JVJA 4YGXB 3RVLA 2FMHA 1RPJA 3CZCA 1W25A 1U2QA 4OBBA 3RVSA 4MS3B 3H5TA 3IPAA 3FGZA 2F8SA 2IPMA 4RK7A 4H3KB 4JP1A 5IX8A 3HUUA 7ABPA 3LUAA 1ZN2A 3MIZA 4EYQA 5T7BA 2VYCA 1QQAA 5TPZA 4D6XA 2HSGA 2J48A 3QX8A 2E4YA 4NV3A 1JYEA 5EWJA 3H1GA 4WZZA 2M1ZA 4XXHA 5EWLA 4KV7A 2YHAA 1H9CA 3FFTA 3GYBA 2F8TA 1DCFA 2WB4A 1GUBA 3TMYA 4RKQA 1Z2EA 4IGAA 4EVRA 2L17A 2FTKE 4KQ9A 4RS3A 4RY8A 2NZVG 1VLZA 4KPYA 4MLDA 4H60A 3GV0A 3Q9SA 4WWHA 3RVJA 2PMCA 2IPNA 1BDHA 1Z17A 1QMPA 3N0RA 3W9SA 5TQ0A 1NATA 3CG0A 2PJUA 4DQDA 4MQEA 4QYMA 4MQEB 4OATA 3BBLA 3CTPA 4JA2A 9ABPA 5KQGA 3T95A 2CHEA 4MS4B 2FMFA 1DZ3A 2HQRA 3C97A 3KKEA 2FEWB 4F11A 3QX9A 4Z9AA 3E3MA 4D6YA 4YR7A 1JFVA 1JLKA 1FFGA 1JL3A 2FQXA 3OM0A 4MS1B 5C5CA 1ZGGA 1M5UA 3A10A 3DGEC 3OLYA 2L2QA 3LUJA 5I4CA 2RJOA 4YWHA 2FN9A 3F73A 1ZH2A 3OLZA 4KNYA 1IIBA 1URPA 3H5OA 5BRAA 5JNTA 4Z0NA 4QYWA 3O1JC 2PE5A 2LIVA 3OO1A 3SM9A 2JBAB 2PUCA 3JVDA 4RWEA 4MLCA 3QLVC 4PICA 3TO5A 3OMXA 1BAPA 2ID7A 1NXWA 3GA5A 6ABPA 3SY8A 4S05A 3HSYA 4W5TA 3I45A 1U0SY 1Z2DA 2FW0A 2FSPA 1M5TA 4DADA 2B1JA 1CYEA 2BGGA 1D4ZA 3MA0A 5KWSA 2QZJA 5EWJB 1YS6A 4XAQA 1B00A 2W42A 1VPWA 2AYXA 2WJWA 4OTZA 4MYRA 3JY6A 4HNQA 1DCMA 1RXIA 1QO0D 1ABFA 4YS6A 4MR8A 3LMKA 1TLFA 4MGEA 1JDNA 3QEKA 3EGCA 1EHCA 4N0QA 5KC9A 5TE9A 1FQWA 1Z18A 1GLGA 2DRIA 4MAAA 2E4UA 4YO7A 4NQRA 2MYTA 5B3JC 3KYJB 3LUCA 1VKRA 4HNRA 4QPJC 2CD7A 3KG2A 5DCLA 4MPTA 2L19A 4IMJB 3HO1A 5KI6A 4FE7A 1NXSA 1U04A 1ZY2A 3CLKA 2I6FA 5JNUA 1RZRD 1NXVA 1DC8A 2NT3A 5KC8A 1PEAA 4MS4A 2QV0A 1Y1LA 3N0WA 1PEYA 3N8IA 5FBHA 4Z99A 1JDPA 2HQOA 3MYYA 1NTRA 3BRSA 3HV2A 3H5WA 3LKVA 5TQ2A 3MF4A 5BRJA 4S04A 1DRKA 2JRLA 1E6KA 3QLVA 3VNBA 2MYNA 5ED4A 1PNRA 3ROFA 1F4VA 2GI4A 3CS3A 1EWTA 4L4UA 3QLUA 3M6MD 1K68A 2A9QA 1LBIA 3HCWA 2PUEA 4IILA 1P6UA 1GUDA 2GX6A 3CU5A 1Z25A 2RGYA 3H1EA 3M9XA 4Z9BA 2IYNA 1KMIY 4RKRA 1QP7A 4MS1A 3OQNA 4E7PA 4RK0A 3RVKA 1R8JA 4N03A 1M2FA 4F8JA 1BA2A 4KRFA 3Q7SA 4G0MA 4LE2A 2FKAA 3GWGA 5F64A 3L49A 4ZJPA 3NHMA 2RJNA 3DBIA 3O21A 1YK1A 5BQ3A 4KK4A 5JNVA 1EFAA 1P2FA 4XARA 1BDIA 3QEMA 3H75A 3C3KA 1DBWA 3B2NA 4M88A 3K9CA 2E4WA 2WRZA 1DBPA 4JB0A 5CNJA 5KQPA 4P1ZA 3HXMA 1L5ZA 3JS5A 4MS3A 3JTEA 5IEBA 1MB0A 2QW1A 5IULC 1LJLA 5TQ2B 4G0ZA 1QNLA 3P9YA 4WXMA 3S99A 5EWMB 4KK3A 4ZPJA 4ETNA 3M9WA 1KGSA 1DG9A 3HS3A 1JH9A 3N75A 1ZESA 3IP7A 1PNTA 5EWLB 2FEPA 1Z16A 3LFTA 2H3HA 1SRRA 1YMVA 3VNAA 4WXEA 1C0EA 4IRXA 4JOQA 3OQMA 3LUFA 1D2AA 4FB4A 4KQCA 1F51E 3JPYA 2Q5CA 5HQJA 2R47A 3RVOA 1NXXA 3CKMA 3ILYA 2OENG 1AB6A 2WMYA 3N53A 2PUDA 3RVPA 1QP0A 3KS9A 2PUBA 2MSKA 1USIA 4WT7A 5PNTA 2CHFA 3LUHA 1USKA 3JPWA 1ZITA 4XFKA 1YTUA 4G86A 5CNKA 1M2EA 1QQBA 2P4UA 2PL9A 5JNSA 2VUHB 3H6HA 4ZMRA 2V0NA 4G0YA 2YHBA 1S8NA 1LBHA 4MR9A 4YRZA 1MB3A 4B09A
chains in the Genus database with same CATH superfamily
5AK3A 3MS7A 3K0AA 2C2HA 1C1DA 3BZWA 1E2IA 3HMQA 3PNPA 2TECE 5I9SA 5KO2A 3HFJA 2GK4A 3OT5A 4YCCA 3CLTD 2FQWA 4QYSA 3Q6IA 5CD9A 1DMRA 3PC7A 4BTEA 4J0QA 3VC2A 3RS3A 3ZHRA 2A5LA 1EFPB 3BKWA 3GUYA 3OIGA 4GT1A 4JY7A 5J58A 3GRCA 4DEYA 3SJAA 3A1DA 3HJTA 1LI4A 1QHNA 5K2MA 2XBMA 4B4VA 3D81A 5HIMA 1R0WA 1DZIA 1Y8QA 2D2VA 4IDPA 4DR1B 5TMPA 1OOEA 4YAKA 2PMWB 4L07A 4G0XA 4GPAA 4LISA 2EBWA 1YR9A 5L4LA 3OKAA 3PQ8A 2A0KA 4YV7A 3B1YA 4V0ME 4B2YA 1CKEA 1FFDA 3BHIA 3FN4A 3QBVA 4M37A 4Y9RA 1ZUWA 4EJSB 3EMBA 2WVJA 1FNSA 4U7JA 3T3DA 1F2TA 4ZVQA 1UXIA 3I2HA 4A1OA 3DZHA 1WETA 2D2EA 3FSRA 3MM4A 2A5FA 3MSCA 1Q0RA 1U8EA 1ZONA 5EXDA 5CDFA 3A6EA 2XUJA 1MAWA 1YSCA 1IZYA 3FF1A 1DFIA 1NVBA 1TQ6A 2J7KA 2Z6VA 1GN9A 4EF4A 4EYSA 2ZP1A 4Z4HA 5LQAA 2K5UA 3FBWA 1KQPA 2IVZA 1OPRA 4NULA 2G83A 2VF2A 4QWMA 4AY4A 1CQIB 5JAQA 2QRUA 3JQFA 2Q5OA 3FNIA 4AZTA 1I7PA 1Y6QA 1HE8B 5J2UB 1PEDA 2H2AA 1L3CA 4FNAA 5LXTF 4A3SA 1DOZA 2I2FA 2F8MA 1JF8A 3L0PA 4ZOLB 2P67A 1QH1A 1GCAA 3NCTA 2X5OA 3K0CA 3EDRA 3K05A 2AE1A 4G67A 5C53B 4YA6A 3C6QA 5HRCA 2Q6LA 1PAUA 1E3JA 1LVHA 1QLWA 3ZHOA 1A5ZA 4MR8B 2NOAA 4KGDA 2YXBA 5KQMA 4LV5B 3BC1A 4O3MA 1ADFA 4Z8YA 1Z62A 5FA5A 5TC4A 3IEIA 2FP4B 2Z5FA 4UNQA 3TQIA 4V1CB 5JOQA 3S55A 1EXMA 2H0AA 3TZBA 3W2FA 3M89A 2J09A 1VL5A 3QBJA 3H3XA 5FWAA 3OBBA 2G4CA 3RS8A 2C00A 4RVOA 4FE4A 5IU6A 1RQ2A 7MHTA 2FVXA 2R00A 4TZ0A 2D0OB 1VI2A 4OAPA 1Y34E 3I12A 1ATIA 3HUTA 3ITDA 3OC6A 2C4KA 3PC8A 3CW9A 4K9KA 5HJ5A 3C74A 4KAJA 5IUJC 1P44A 3GFPA 2NYAA 1G6OA 1K9SA 1M8JA 3CXUA 2BMJA 3P9KA 2G1AA 4PQYA 3VYSB 2X14A 1G6HA 4G0OA 3BGSA 1KSGA 3VV2A 1QYWA 1FU4A 3L6EA 4M60A 1A77A 1U5AA 3L06A 1FCJA 3EMKA 4UMEA 1A1SA 2C2OA 2HHCA 2WF7A 4UCFA 4XPIA 2C4VA 4BY9E 2W5UA 2BZSA 3HDGA 3IALA 4FDUA 3TDNA 5KINB 1R10A 1SZJG 3U17A 1J2EA 5FTKA 2AL7A 3EH1A 2GVZC 1LRJA 5HKKD 4KDFA 4XOIA 3F97A 5I7HA 1CZUA 2PNJA 3OEHA 6NULA 4FXOA 3THWB 4MGYR 3N6RA 5DVZA 1VL0A 1XMPA 1P9RA 1DRJA 3DMRA 4GI7A 1KYTA 4JVMA 4CU5A 1XLTC 1C1DB 4UBOA 5LDDC 1IPFA 4LJSA 5KYTA 1CFJA 5BVHB 5FWNA 5BSWA 3VOTA 1N2HA 2AFRA 2LZ0A 2W0SA 1Q3KA 5E2BA 3M3PA 4G25A 3AF6A 1EE1A 2EIHA 2QN6A 5JWOA 3NVAA 1M1UA 3RRMA 5BV2P 2Q8NA 4XLTA 3VZBA 1KMQA 3KVRA 2KLHA 3DULA 5DI9A 3V7UA 2XIQA 2QRNA 2WJAA 4X61A 4DE5A 3M4YA 1CNMA 2XA2A 1Q84A 3JQDA 1T2FA 5JG7A 1G5HA 4ZYUA 1QTNA 1G3IA 1MIOB 2GDJA 4UJ5A 4DNPA 4G36A 5IRCD 1U9ZA 4RESA 1PG5A 4JVLA 1PFWA 4LTMA 5H0IA 2D0PB 2O1WA 1MZVA 4LBVA 4NE9A 3I1JA 4IDCA 1QKKA 1KARA 5TGTA 5A2GA 6REQB 3U13A 3DP7A 2NSLA 1V7PC 4YCDA 1TYEB 1XFAA 1E4VA 2F67A 3RAGA 4BOYA 4HSEA 2JHCA 2O2ZA 1V5EA 3EIXA 1CR2A 3HFGA 4YJ2F 5B64A 2NO1A 2XOEA 1Z5WA 1SVMA 2BEJA 1NXQA 3I09A 4JUDX 3LLMA 1VIAA 1FE8A 1N6KA 3IMFA 4IIEA 3VQTA 1TTPB 2YVKA 2ZW9A 3VOBA 1JDTA 3INRA 3D43A 1WR8A 2R8BA 4ER3A 3R6WA 1QGUB 4FUQA 4M55A 1C41A 1AKMA 1ZK1A 1S9DA 5KSZA 4CKWB 4AKGA 4M9XA 1IXYA 2OXFA 5I8PA 3EZFA 3BFXA 1U0RA 3QEMB 2R4TA 3S4YA 3H8VA 4HG2A 1OFTA 3UMBA 4AG5A 2BJWA 4BO0A 4OLAA 2D00A 2ADFA 2V3CC 3I9NA 1BS9A 1QKJA 2X5KO 1ZM2A 3SC3A 3OX3A 4V3BA 1N6RA 4R3UC 5IN5A 3OEED 5BW8A 1SBYA 4RA6B 4JSYA 2JGNA 3OKCA 2WSMA 3BBPA 4Q66C 1H3NA 2RBKA 5JEDA 3K1TA 1L4BA 4LI0A 3ZWDA 4XRRA 4RETA 1UWCA 4ZAXA 1VECA 3PZBA 1V1JA 2NZYA 1ORHA 2DQYA 5AXBA 5H4GA 5LSAA 3RIGA 4FNGA 2UU9B 1Z33A 3KK0A 2PKEA 3ZCTA 4C6RA 1T2UA 4HNHA 3FXAA 4F1WA 3SQNA 1BHSA 4Q02A 3AUAA 3FHOA 3NMUF 3ZE2B 1U8CB 5A0FA 4EI2A 3GVPA 2IS4A 2DWQA 2Q0XA 3S68A 4IV5A 3AFNA 3AW9A 1SVOA 2QLTA 2A9KA 4DXAA 1Q0PA 4BNTA 5IJ0B 2ZBQA 3VSBA 1JLMA 4CL3A 1NZFA 1UPXA 2MHCA 3ITNA 3NTXA 4ZVPA 5A3VA 4E08A 4LY6A 2RHWA 1JYFA 2CJXA 1IHUA 2RHGB 3VR3D 4ASUD 4CV0A 3B6EA 2B4KA 1FNNA 4Z7QB 2AOTA 2GJSA 3WGLA 3L0OA 3DAPA 4BMYA 5C8YB 3D5TA 5HKOA 1YVPA 1OASA 3BSSA 2DB3A 2AC7A 1VB5A 1FP7A 1IHXA 1PK8A 2VRNA 3R5JA 3U4IA 2GEJA 1JJVA 2INGX 1TCUA 3BIXA 4LYFA 4KIFA 2JRCA 3SXJA 4CQMD 4ZT4A 4QPZA 4FOLA 3M3DA 4ZVVA 3QWBA 3T5DA 4EZEA 1JDUA 1OV6A 3E2IA 1RLTA 4BO3A 1SZPA 4PO9A 5DI3B 2BR5A 4CKWA 3ET5A 4UMVA 3GLHB 5AVKA 4KFCA 4GICA 2BOVA 3CNQS 1NN1A 1T43A 1FX1A 2Z8YM 2GZAA 2WIJA 3K09A 1S9HA 1MDBA 3OJXA 3A04A 3V34A 3EK2A 1JU4A 2FPUA 2I5PO 1TU0A 1IBSA 3IVMA 4FYPA 1VXOA 2FPPA 4FMDB 3EY4A 3V8PA 2CWWA 3RVSA 4G5OA 1L5MA 1LI7A 5CG1A 1GZ3A 2C07A 3LWBA 3P2JA 3ZI0A 2J3LA 2OO5A 4R2MA 4U2GA 2O23A 3MUFA 5ERGB 4AMGA 4DCGA 2CJFA 4H3KB 3LZ6A 4NARA 3DOUA 4QECA 3AUKA 3I2IA 3IKLA 2V58A 4QAJA 4BFTA 3OJCA 3I0NA 3R5SA 1OE0A 1U7HA 5A5VA 3SMQA 4BFSA 1G1MA 1HYHA 1QVZA 4ZZ2A 3DOIA 3JD4A 1R5OA 3IULA 3OC0A 4NU0A 3ESRA 3O26A 1F17A 2V9PA 2Z09A 3GARA 3OCYA 5AKZA 3WVNA 4RKQA 4DWJA 3W5IA 4UQLA 1Q7EA 2GCPA 2QL9A 1L7MA 2EARA 2QMEA 3RO7A 1JSZA 2HV9A 3Q2OA 3K71B 1NVGA 3ZEIA 2JI7A 3DPUA 4MDFA 3G2KA 5C1OA 4Q4AB 1KIMA 1N0UA 2X4DA 2YZMA 3CPSA 1CUYA 2C31A 3H42B 3PHBE 2IPNA 4HDRA 1HSZA 2EOAA 2F2TA 4PLVA 2FA9A 1J2UA 2RH4A 4MQEB 1XU7A 4YAOA 1X3SA 5KCZA 1NP6A 3AZPA 3IE2A 1Z0DA 2QY9A 4HQ6A 9ATCA 5MFZA 3QX9A 3DMPA 3ROGA 1OGJA 3IDAA 3QKSA 3E3MA 1VKNA 5ECDA 1JLKA 4YAGA 1GM5A 1OGYA 1ZGGA 3O82A 4B8ZA 4B3GA 4OMDA 1R4NA 1SHZA 2NU7B 2Y1KA 3RV4A 3HJAA 2V0GA 5JFOA 4KYIB 4BQFA 2C03A 3F73A 4K5QA 5E7IA 2JKYA 2CJWB 2DVMA 2RCYA 3TZKA 3U19A 3U1TA 4B4DA 3AI3A 3AJEA 2I2WA 3SBXA 1XJ0A 3UXMA 4EJSC 4ZAYA 4ALMA 4ZICA 3B53X 4JENA 2HA6A 3ISJA 3AKDA 2IYTA 4WACA 4W5WA 5F5NA 4IUDS 5AVOA 3WGVA 3W8EA 4NE7A 1DVRA 1TIKA 2ZG6A 3QVXA 4K81B 5B1IA 5ALDA 4OJYA 4F4UA 5EOVA 4W63A 4FHEA 1FOEB 4D3XA 2ZTVA 4NU6A 5CPFA 2XR1A 1SCBA 5FI3A 3CO5A 4X7MA 1LDEA 4NBUA 2DCMA 3AGPA 2ZPAA 3A4NA 3TXAA 3HJNA 1T6BY 4LSWA 2B1JA 4W1QA 2VP3A 1R1DA 2CSUA 3BICA 4QDXA 1DCTA 2QBYB 1LW7A 1S1MA 1T4BA 2A0WA 1YHYA 4Z2AA 5CXSA 6Q21A 3MGBA 2A0XA 4M36A 4XE5A 3L7KA 4IDDA 4R16A 1ISFA 4YAIA 1JXAA 3QEKA 2JJMA 1C7EA 2GTHA 3UHJA 4EG4A 1SZCA 3ZY3A 4Z49A 1IHPA 3R4VA 4AJOA 4U2FA 4PAQA 1ZG3A 2ZKLA 1FDTA 3PQ4A 3H5NA 3QX7A 4RTPA 4G89A 2NN3C 3L1HA 1UXHA 2IOFA 4RDHA 3V8QA 1U8AA 1FLVA 4FE7A 4ZO7A 1YOVB 4IS3A 4WJLA 2GEBA 1GTMA 1NXVA 1Q20A 2EFGA 3PGKA 1DWUA 2VJPA 5DHSA 2OFFA 4X1OA 5FR1A 1IHDA 5KC8A 4FHDA 1ESZA 5M2QA 3N8IA 1JQ5A 3OZCA 1G19A 3MYYA 4LSGA 3JQCA 1VYVA 2JD1A 2JCBA 3LPCA 3ZE8A 3LKVA 4AJLA 1WBBA 1SGWA 1NSYA 5TQ2A 4OFBA 1J2RA 5FBLB 1DKUA 1PNRA 2NO9A 3BG5A 4B76A 1F7VA 2I6XA 1CFZA 4G8JA 3V8MA 5K8VA 2DLDA 4Q1CA 4ZEMA 1VLMA 3OZFA 2BFCA 3KEQA 2ZJFA 3DTNA 1E2GA 3U4DA 3GMTA 2CVOA 2CJYA 2IIVA 4DYVA 4ALJA 1YNOA 3A7EA 2XW6A 3CVOA 4ZYWA 1E5XA 1M8GA 4OXNA 5BVGB 1T2VA 2D3TA 1KFJB 1GPH1 2ZJ8A 4RM2A 2J3DA 4MI3A 2P90A 4AECA 1E7SA 1T9KA 4K7JA 1L1RA 4RFVA 1X9HA 1QRRA 2JKVA 4KRFA 2YWFA 1BCRB 2I2CA 2J7PD 4G41A 4Q4AA 2FKAA 2NAPA 3EPKA 2PHZA 2P9FA 3NQ41 2L42A 4M1QA 3UW3A 3B1JA 2F3SA 3JQ9A 3ZV5A 2I4IA 1JEAA 2M32A 1U2SA 3WL3A 5CDYA 2VATA 3IPYA 1YO6A 2X8JA 5CCXA 5ALOA 2WRZA 4DHEA 3SKVA 1TT5B 3GLKA 4C0JA 4E1VA 1PFYA 1L5ZA 3LCCA 3I6BA 2YS7A 3I5XA 5BV7A 1OSNA 1K2WA 1N6PA 1E1LA 3H5RA 1OA1A 2PZEA 5E6SB 1DG9A 4XGKA 2RGDA 2BFCB 3EVGA 4DCTA 4YYZA 3Q1KA 3R8XA 4AY5A 2IU3A 4M8IA 1SOVA 1YB1A 1L2TA 4WXHA 5DHTA 3TIFA 4XJVA 3TJRA 2J7PA 3HWX1 4ZI2A 4LNUA 4O59O 1ZUNB 2G88A 3ML1A 4YHBA 4XYGA 2CBGA 1Q7RA 3Q40A 1LTHR 1XD2A 2E7ZA 3MD9A 3IQEA 1KAMA 3ACCA 3K3PA 3PC4A 4I50B 1GAWA 4BLVA 4LJ9A 4NNPA 1IB6A 3GNSA 3VGPA 1KPHA 1LLQA 4OXYA 1FU7A 4FYJA 2D8AA 4MUMA 5ED0A 3L6OO 4WT7A 1PN3A 2JBWA 3BPSA 3OZDA 3B60A 5ALGA 3PHLA 3JPWA 4PYNA 3FZNA 1JKIA 4CEHA 3GC6A 4HQOA 2QAGC 1W5AA 4NABA 2O5EA 4PC1A 1E2HA 4Y7DA 5AW0A 4M9RA 3VNVA 1Y3IA 2PBFA 2VUHB 3FYSA 1YJCA 1YR2A 2GRAA 3G2IA 3Q8XB 4MR9A 4R05A 1H5NA 1SBNE 2WT4A 1XRMA 1T1IA 2HFJA 1YS7A 1KR2A 3BH7A 4LZZA 4RDXA 2Q29A 1JHQA 2P68A 3WGQA 1R0RE 4BNGA 1JFFA 1MX5A 1SG6A 5J1SB 2AB0A 3HO6A 3DEHA 4WNYA 5CTJA 2W6ID 4UHKA 4PLZA 4UVEA 1T3LA 2B34A 2VDOB 3BWYA 2HMTA 4H6VA 2IV7A 4RJTA 1W5FA 4CR6A 5KUTA 5LZ2A 3AUTA 2XCUA 3ND8A 5GV7A 1HNNA 2B78A 4WY8A 1FJGB 3AEZA 1G8PA 3HDHA 2PPVA 5DTEA 2NO6A 2Q6VA 1VG8A 3HMKA 3IX7A 4FEYA 2PQ2A 2I6GA 3F7NA 3MVEA 1ONNA 2ASEA 3DE2X 3DUFB 2V4MA 4BX0A 4P4SB 1P9LA 1YI1A 5K3BA 4ZOEA 5BWNA 1I0IA 4NPCA 1NY5A 4HH4A 4RM3A 4WLEA 4CQLA 2F4NA 5JAMA 4GM4A 1C8VB 1AZWA 3C15C 1MIHA 3GLUA 1D9XA 4I1UA 3ONEA 3MMNA 4JUBA 4OHXA 3GCDA 4YJHB 5EQDA 4R9RA 1IZ0A 3QI2A 1VDZA 2JJ1A 3C4QA 4C22A 3JQ6A 4C4SA 1UP4A 3C6XA 4TYNA 4F92B 1VSQA 1SG0A 3SEAA 3NGXA 1T1SA 2YHSA 1KRXA 2RGRA 2Z98A 2DH5A 3PPYA 4IKEA 2J3JA 4OHMA 3UGKA 2WQ7A 3ZWBA 4BYMA 4PXSA 2R9VA 4HGPA 3QW4B 3SK0A 2AJBA 4ZYLA 4GLFA 3E6AA 2R65A 2XUKA 4WGGA 5CW1A 3A31A 1TZMA 5EUMA 3VH3A 5JROA 1KRWA 2V5AA 4M6WA 3EC1A 2UYCA 1NNLA 1Z6GA 3P45A 4IXNA 4X20A 1QFZA 2RHDA 3I6MA 1Z4LA 2O2HA 5IAEA 5JMPA 4ARZB 3DEAA 3ORYA 1IL0A 1BO6A 4OCZA 4NC9A 4OIMA 5TPWB 2P5TB 2ZDQA 2OBXA 1X80A 2JCGA 1MAUA 2CYAA 5LCXA 4A91A 4F9GA 2ODPA 4XVCA 3CPJB 4YP1A 3R7FA 1S7GA 3DBRA 3HUFA 3LBFA 2NYRA 4JJGA 3W4JA 4BMSA 2PX6A 1U98A 3A6DA 5CDFE 4XLLA 3TE6A 3W5BA 2EXXA 1GEEA 1YQQA 2QTVB 2XNCA 1X0XA 3HKEB 3YASA 4BN4A 5F7OA 1R0ZA 3CKYA 4YRLA 5DOVA 3IBTA 3B38A 2JIRA 2PT5A 1O5TA 2ZTUA 4LVOA 4P3XA 1DQSA 1UZLA 1ZGZA 2KX7A 3I30X 5AH0A 2I7XA 4URFA 2QSYA 5JS2A 4WZBB 1GXSB 1SC9A 2AD1A 5AJWA 1LDYA 3VYUB 8OHMA 3DVLA 4HAOA 1G21A 3A26A 1WPQA 1O94D 2GAOA 3P9XA 3PDWA 4GBJA 1IK4A 5D1HA 3IT1A 2LIPA 1TMGE 3OHPA 2VI5A 2YMPA 1WLSA 3ENKA 5TEVA 1EZZA 1BQ4A 3KWLA 3S6JA 1OT3A 2JJQA 3DP9A 4RTNA 3L8EA 2YWCA 3KQLA 2H07A 1FYDA 2WJGA 4V0RA 1X14A 2JFYA 5IZCC 4N3BA 5DGTA 2RAFA 1M8KA 4EJMA 4IO0A 4C20A 4HSGA 4TQUS 3BRWD 4E30A 2JHPA 3Q9UA 4G4GA 3VU3A 1IWOA 3HBJA 3U3JA 3EZ7A 2P5UA 4M9SA 4O8ZA 5AVRA 2C29D 3GH3A 4XCXA 1OXSC 1UMCB 4KPUB 1L5SA 2NADA 2VTDA 3A6HA 3PQFA 4UDNA 3WMEA 3KTAB 5HS6A 3RODA 4WA8A 3TQCA 1YDEA 4YK7A 3VPCA 1NBMD 3ZZTA 4AN0A 1H2XA 4KQWA 5F5XA 3TNJA 4UDXX 5TDHA 4U3JB 5FPSA 3T3GA 2HR1A 4FDLA 5CM9C 4YUYA 1OREA 2ILVA 4GNKA 4U39A 3FOBA 5IKMA 1ABBA 4GEGA 1ECLA 4HAVA 4QPPA 4AK9A 3NC0C 2CC2A 3EB9A 4CLRB 621PA 2JAUA 5C35A 4L5AA 2BZ1A 3GLIB 4TQ9A 3WLAA 2J3KA 4B48A 4BFXA 4HX5A 1MV5A 4OO3A 1USWA 2WD7A 1T26A 4RBNA 5ITZA 1Z88A 3PTLA 2N9UA 2FZLA 2Z3WA 3LFUA 4IIGA 3ZDCA 4P32A 1VHJA 4L16A 4RA6A 2R1VB 1M2GA 1B43A 2G06A 5ETJA 1GZ6A 1Z73A 8GPBA 2QPTA 5GQSA 1MH9A 1ISSA 3GRFA 2H7CA 2P75A 4UE3S 5KNCA 2YV2A 1D1PA 4YREA 3D6JA 1QIKA 4A27A 2Q6OA 1ZQ1A 3X1DA 1DP4A 2X4LA 3RS9A 1L5GB 3EDOA 4FNMA 4QSMA 1LF0A 4Q18A 4KBGA 2MR6A 1U3DA 3QZUA 2BI8A 1EK6A 3K8OE 4HZIA 3DWGA 1XA4A 1Z6AA 2IK8A 2C7GA 2P5SA 2RGUA 1TU4A 4LMAA 3UAVA 3KPYA 5IJ0A 3BXGA 2XTAA 1U1GA 4HWOA 2ZDHA 2QD4A 1NVMB 1D2MA 2Z2KA 4P8RA 4QDJA 4W9RA 3SDZA 2BN4A 3WSWA 1PL8A 1WCIB 4RPKA 2DEUA 2D4AA 1GOTA 3FR8A 3NG1A 3OURA 4BQNA 3HBFA 3L7MA 3VAZA 4AX8A 3LLUA 1MQ9A 4X8OA 5H68A 4TV8A 2SBTA 3FPAA 4FOSA 3VM6A 3ZV7A 3DBHB 4IH1A 4PG5A 2DOKA 2PA3A 3COVA 3FYHA 4D0LB 1A9XA 2V98A 5EHXA 4QGAA 1T36A 1TUEA 3BZBA 2QZPA 3AI7A 1I4WA 1TZKA 1WTAA 2VHWA 4JCCA 1VLVA 4IUYA 1Z5NA 4UEQA 4WA7A 4JI5B 4J07A 2WAXA 4MDYA 4X3OA 3X0DA 4ZYYA 1DKLA 4XTCS 5LQUA 2Q4EA 2HA7A 3FDFA 4LF5B 2PFKA 5EUQB 3SLGA 1FFEA 2IOYA 3PVSA 4V0SA 3ZH2A 5TSDA 3HR8A 3EEQA 3WNDA 2GZDA 1U7DA 3L8GA 4XX0B 2ISCA 1N7JA 1N9GB 2H63A 5H80A 4DIDA 2QRVB 4IXMA 3SZGA 4QASA 3FFWA 5DX1A 3EAGA 3DE1X 1LY1A 3EWSA 1V5WA 3ABIA 3MS4A 1U2DA 3AGQA 1F0KA 3CB2A 3TYXA 1ENPA 1CT9A 1DXOA 2FNAA 2W98A 4TKVB 7GPBA 4HAWA 3DE6X 1RTKA 2IP4A 1XDBA 3IQZA 4WUVA 4EA9A 4CI0B 3G5UA 4WHMA 2ZS9A 4PYIA 5T4BA 4RGQA 3SZMA 5TT1A 5AIBA 2Q0HA 1X39A 3DWEX 4KE6A 1L8LA 4U6SA 3THSA 1GUFA 5CJ2A 1ATZA 3N2GA 1UXOA 3CGWA 1PSWA 1TRHA 2QZSA 4MQ6A 1CDZA 2W00A 3SIRA 2DSTA 3VKVA 3ZDZB 2CDBA 4BHTA 2F1RA 1GZDA 3ESAA 4IIDA 4A8PA 2I9PA 4DV2B 3M4XA 4EZBA 3AJAA 2VQFB 2B9EA 2BISA 4ZFNA 4DR4B 4M98A 3HKCB 3ROZA 1NN0A 3AG5A 4WW0A 4FOOA 5I9TA 1K98A 1KS2A 1NYQA 3AIKA 2A1TS 3UPTA 4R8RA 1RYMA 4QU9A 1JI0A 1TC1A 4TZKA 5EE3A 3KYBA 2IY7A 2X7XA 1AUQA 1NR7A 2V65A 1NVXQ 2QF7A 4MWZA 3KWMA 5K0ZA 3HJUA 5EXTA 1AY0A 1RNLA 3NP9A 3G5MA 1P5RA 3BXPA 2V0CA 2XBUA 3MILA 1ZYUA 4FLMA 1NMXA 1M66A 1K7FB 4HP8A 5FAKA 3EH2A 2AMVA 4IIXA 1AOXA 2FETA 2AGVA 4MS3B 1QB7A 1EGQA 5LD2C 2Y6UA 1Z82A 3D5EA 3V2HA 2F8SA 4X6YA 1IZZA 4II7A 5AKXA 1ZJWA 3KEOA 3EFOA 3IDQA 1K6MA 3WKBA 4E6PA 3UANA 1F4LA 4H1HA 3VR4A 3MTBA 1YMQA 2TYSB 2LRHA 2EC5A 3PKZA 2FK8A 1QB8A 2X13A 2PBLA 4EJ2A 2FX2A 3A9UA 2NU6A 2Y1CA 1QC5B 1TQHA 2PGIA 1WB5A 1ZGJA 1NBOA 3MWGA 4KV7A 4XXHA 2O8FA 2TS1A 1H1TA 1VGVA 1LPOA 4L4XA 4OI4A 2GUWA 2PMFA 1WP9A 3HB0A 4G9BA 3SR0A 1P18A 4PNZA 4P5EA 2L17A 4JJ7A 4LDNA 4KPGA 1BH6A 4KQ9A 4XIFA 5AKKA 1AGYA 2PGNA 3ANLA 4C7MA 4ESEA 1JA1A 1AV6A 3QWHA 5ITWA 1WVMA 1NJ1A 3MLBA 4CUZA 2Q5FA 5FXMA 5FX2A 1QRTA 3R9XB 5JHGB 1SHTX 3AR8A 2QGFA 5DLPA 1OZHA 3PPVA 4MKGA 3RRFA 1M10A 2EEPA 2GN9A 4J4TA 3UPDA 3L18A 4KBFA 3UT5B 3QMWA 4I19A 1UDCA 3RYHA 2K7ZA 3VYTB 5JWRA 1FA9A 1T6YA 4CM6A 5BXQC 1JJ7A 2YIMA 1G3QA 1ULAA 2GCIA 5CLIA 2QZ9A 4PYQA 1X8KA 1LQ2A 1P9WA 3UC9A 3SU8A 3WJ1A 2QN2A 4NZPA 3SICE 4Y6LA 4PANA 3VTZA 1QTRA 4B6PA 4H7HA 5E3IA 3PFKA 2FN9A 3IUEA 5LQMA 4OMFG 1K5GA 3IC5A 3UUWA 5AK4A 2RHTA 1CIVA 1Q1EA 4BWVA 2CNKA 2ODTX 3PQ2A 2ZIXB 2BFAA 3E23A 4KLNA 5AICA 3C14C 3QVGB 3WMXA 2XCRB 1GTSA 3NBFA 2XQFA 1X15A 1DIGA 3J81A 1RSZA 2C2BA 3WB2A 3HNOA 4JJFA 3SM9A 4UHFA 4IIJB 1VE3A 3FUTA 3HB9A 1WWKA 4YC7A 3TO5A 3JQBA 4AM8A 1IOWA 1SOAA 2BKEA 2PZKA 4QQNA 1FRNA 5LWQA 2J6HA 5LMCA 2H2WA 1OYOA 3UK6A 2NACA 1P0IA 3DE3X 1XI2A 1M1XB 4HUTA 1YRQA 1I7QB 5IG2A 1CB7A 4JBWA 4XDGA 4CYMA 4EARA 3UHAA 3RTBA 2X4GA 1HZJA 3QOWA 7REQA 4MYRA 1CUGA 3JY6A 2GFQA 3R7BA 4DIFA 4I55A 4TKLA 3LRXA 3UJ6A 2NLOA 1KOFA 2PXXA 5FOWA 1LPNA 1TD1A 5KYVA 421PA 3HY3A 3GJTA 3KDSE 2I54A 3KXKA 1W47A 2R7LA 4E2ZA 4G5FA 3VFDA 1NKSA 2ZUEA 3BE5A 4EPTA 1Q91A 1YI0A 3DO6A 1JPVA 5BOSA 1T4DA 2BEVA 2OL4A 5FJJA 4D96A 3Q4GA 4IMJB 3P8ZA 1MJFA 3LT1A 1TAHA 3LW7A 1SUWA 1U04A 3GFBA 4G5YA 2PRZA 3R7AA 3OZ7A 4UHEA 1QH9A 4S1NA 3PJRA 5JJCA 2V3VA 1F0PA 3IOYA 2Y6VA 2C1EA 2NWQA 1JDPA 3L9XA 4L3OA 2HPZA 5JC1A 1QIDA 3OQBA 4PBRA 3NEYA 4JBNA 3K1AB 5ALHA 3WQHA 1OI7A 4LYAA 4UM8B 4BC0A 5IT4A 1F6DA 2WWGA 1MGPA 4E07A 4D9EA 4MXDA 2ZRAA 2RKOA 4BO5A 2DWCA 2XDWA 2ZRCA 3DOJA 4QGHA 1DI0A 1ZJ4A 1YR8A 4OIFA 3I52A 4ND4A 1LBIA 4NLLA 1HTWA 1PJZA 3HG7A 3K94A 4N7BA 3ZWCA 2PUEA 4TYYA 2IYQA 2O8BA 3SHVA 2BGKA 5KBYA 1WEHA 3DCJA 2IELA 2CFSA 1E3EA 2FK7A 3FYTA 3OUUA 5LL6P 2UVPB 2O19A 3RARA 3OQNA 4HWSA 4B0PA 3KSUA 1RD4A 3L7LA 1RABA 4JQSA 4LXXA 2CVQA 3JZDA 1CUDA 1HORA 1NLYA 3WAJA 5EINA 2CNWD 4I9HA 1K8YB 3GWGA 4M38A 5F64A 4M0LA 4ENTA 2P7IA 3E4CA 1P5FA 3RKSA 5BUSA 2GVDC 2C4NA 2WA2A 1JILA 2P9YA 3S8MA 4BV2A 1EFAA 4TLDA 1JHDA 2F1IA 3H75A 3C3KA 2JFGA 1DUIA 3WTBA 5C18A 3U48A 2O9JA 2GS9A 1UPCA 1KH1A 4KO1S 4YEDA 1P74A 1DEHA 4DKJA 1T8WA 2NTVA 3KQOA 3QQ5A 4E3WA 1M6WA 4ZJZA 4OYLA 1U7ZA 3K2IA 3PI6A 4GMXA 2GPYA 1VYUA 1LWOA 3COSA 2Q6TA 1CUBA 3QOYA 4MWTA 4YMTA 1KU6A 3TG2A 3FHCB 2CBZA 4J49A 4HBGA 1ORWA 5EJGA 3TOVA 3FMOB 2VHJA 4ZJYA 4NBKA 5WRFA 4JFAA 2Q2WA 3NHYA 3SS9X 1Q0HA 3A1CA 4WNCA 2GHRA 3LX6A 2WF5A 3G79A 3HBNA 4NPHA 3WGTA 1E63A 3WJ2A 3ZWQA 1XZCA 6GPBA 2O59A 3TEJA 3JD0A 4C4OA 3HGMA 3COPA 4JI7B 5I8ZA 3CNEA 1KI4A 2PO7A 1JHOA 3KB8A 4HDAA 4Q5IA 3MXOA 1J0DA 2PUBA 3CZ9A 3D7NA 3TZCA 3HYTA 2BSXA 5J23A 4O4HA 1TEHA 1USKA 5KTYA 1KHHA 2HO4A 2X6TA 4TMVA 1WQ1R 2WW8A 4K6MA 4CG1A 1EDBA 1CDOA 2Q9CA 3H6HA 1YL6A 3GGDA 4RZUA 3DDNA 2P8JA 2BR4A 4G0YA 3AF5A 4KHPB 5FF9A 1GYPA 1ZD2P 2HMUA 3DD1A 3HJHA 3LI2A 4RSHA 1R4MA 5ECWA 3QU9A 4FX5A 2B94A 1DO2A 3WGIA 3HA5A 5JVDB 1XPOA 4MV6A 5G0TA 2Q1TA 5J1TB 4LX8A 1DT5A 3CH6A 1K66A 3BORA 4PZEA 4HAZA 2AMFA 3OZTA 5LA6B 1SK8A 4PPFA 2RB4A 2J0EA 1Y6JA 1E2KA 2VT6A 1P1BA 4ALLA 5DBOA 4M0FA 3REQA 5IZCA 5DM2A 1CUXA 2GSWA 4LZLA 3L0CA 5BSUA 5ALRA 2G09A 4N76A 2XGJA 2AJTA 4RADA 1H2YA 2FZVA 4WECA 3ZCQA 1KXZA 1Q11A 3OP1A 3CZAA 4RA9A 1WMDA 1Z13A 4RF5A 5DYYA 3T4PA 3N2KB 2EGUA 1E9SA 3ZK7A 1QIIA 3ZD8A 2BBOA 2XDQA 2VC2B 1R3DA 4ZOBA 1I2ZA 1DMSA 3PNMA 3QY9A 5LP6F 5ARCA 2WICA 1THZA 1RJEA 4AN1A 4F4JA 1FTYA 3ILHA 4FCCA 5CFPA 5M7EA 4YMUA 3LBAA 5AHKA 4EGAA 1WF3A 1IZ9A 2NQTA 2PZ8A 2YQ5A 1E5VA 3R77A 4J1SA 4COKA 3OCWA 3WV5A 4OHUA 4Q1EA 4B8YA 3ZGXA 3VAYA 2VHQA 3LA8A 4ID3A 1E99A 4QFCA 2O48X 2I22A 5JR3A 5CRIA 3UW1A 1U99A 2ZE7A 1DQZA 1W5BA 1YBVA 4N5DA 3ZD6A 4J76A 4KCGA 1OZFA 3QYPA 2MTBA 4Q47A 3GDGA 2DFDA 4JELA 1ODSA 1KYVA 4YY3B 4BYGA 3RBZA 2WM8A 2C9OA 2JW5A 3DLCA 3QLJA 2CLSA 3ZZ0A 2FW8A 3AEXA 1TZCA 2Q9UA 1FFCA 2O7RA 2E5WA 5KWEA 3FD8A 4XVQA 5A06A 1OXKB 4J0HA 1NNUA 4NZNA 1HLFA 1I51A 2YIJA 1PJRA 1M6NA 1U5BB 4KVFA 1ESEA 5JMTA 1XNGA 2EWWA 2VUTA 3LWNA 4IDQA 2FJUA 4RKYA 1I7DA 1KQ3A 1EVZA 1THGA 3MJ4A 1E8NA 4HYEA 4OXRA 5EKXA 4BJHB 4EEKA 1NMEA 1SC4A 4KGZA 4RCYA 2PMDA 3Q6NA 4X1IA 4O2BB 3W06A 2OWDA 1L4FA 4LHXA 4JNKA 3KFXA 1Z26A 1ULUA 2ZUBA 3IP5A 4BFLA 3UJNA 1C8BA 1Z0ZA 5A4KA 1A9RA 4PTLA 1Z4QA 1ULBA 3W5VA 4JLJA 1UJMA 3L7IA 3MWFA 4NCNA 4MYUA 4WY5A 4TWAA 5A5EA 3H4TA 4TXJA 3D6MA 2WUDA 3UATA 4II3A 1O97D 4QYIB 1Z2PX 2HQ1A 3USCS 1UKEA 1EUZA 3A1EA 1DSSG 3FMVA 3K30A 4JLNA 2VHXA 5EE0A 2J46A 3K6KA 1OI3A 3G8AA 3KYIB 1F2DA 1L8QA 1WUKS 4LCJA 2J3HA 4LHZA 5F1YA 4ZV7A 4EKDA 3CMMA 1JG6A 2RGBA 2J9XB 4Q21A 2RDMA 1GZSA 2VH1A 2ORED 4JAVC 4NNOA 3IMKA 1NBEA 4ZQEA 4ZT7A 1OCEA 4P3PA 4IHKA 4NZMA 3BIFA 4P92A 4ISBA 3AUJB 3RSOA 3AYZB 3T3MB 5K6AC 3MG9A 3BB1A 1JFFB 1L7OA 2AMJA 4ZAZA 1WNTA 2OFPA 3DQZA 4M86A 3OX4A 4O8CA 1BTOA 1I3NA 1U1FA 4J90A 4W7HA 4YBZA 4FBLA 1NMZA 4JEHA 5J4LA 4AUKA 2REQB 5G53C 5A02A 1OI4A 2VNIA 2JCYA 2ZRLA 5JBNA 5KJFA 2XYGA 2AC2A 2CKDA 2VK1A 3R3XA 1IJEA 1OX4B 4TL7A 2DT5A 5P8WA 3Q8MA 3T52A 1HL7A 4BGIA 2QUKA 3K9HA 3OZSA 1GRQA 1SCDA 2OO5C 3QWAA 3DF9A 4I50A 1B6RA 1A9YA 2WJIA 3PPWA 4AX4A 2HPHA 4QVIA 2H8GA 4KGVA 3H99A 4MVJM 1JDZA 4L76A 5KHAA 2YQZA 5IC5A 3PXXA 1X1RA 2PFSA 3G9TA 1D0SA 4O2BF 1N9KA 1QM5A 4RMIA 5EIWA 5KYWA 4L5IA 4MUAA 1VKHA 3CRW1 1FBNA 3UWOA 1RBMA 2JI4A 4OQLA 1WPGA 3ETGA 1IY1A 2I3GA 1HR0B 3CF4G 5DMXA 1ANKA 1TJPB 4F6RB 4EMUA 2FMTA 3ZGYA 3F7TA 1ADJA 5EPEA 3PJDA 1EIWA 2EKBA 2A9FA 2GM5A 2P2YA 4IG4A 1EB8A 1WA5A 5LU8A 4Z86A 5I7EA 1DAFA 3V1TC 1PFUA 2FQ1A 1B4DA 4RHFA 3CPEA 1QVRA 1YCDA 3I4FA 5DTIA 1CULC 3QY0A 1G18A 4Z9YA 2QMOA 1GPJA 3PZRA 3N05A 1ZU5A 5KVAA 2FPLA 4HFMA 2A84A 2Q7XA 3EA4A 2GZ3A 2BTQA 1Q92A 3V3TA 2DHRA 3IAM1 1G20E 5KYYA 1RM5A 1KK1A 5TT0A 2XYPA 5HEKA 1SVIA 2PKQP 2W2XA 2CFCA 1Q22A 5JS6A 1TU3A 4ZO8A 1DL5A 4IICA 2G9RA 3N2GB 2HDNB 3QBDA 1BW9A 3M6IA 1WCXA 3QFSA 5GJCA 3AP2A 2NV0A 3M81A 4GMDA 4A92A 4JASB 1KO8A 4PE5B 2GHQA 3NB0A 4UFNA 4LYDA 2PN1A 3IAHA 4KRYA 1M73E 2HQBA 1JKXA 2H48A 4MV3A 121PA 5DE3A 4PSUA 1P62B 2V6IA 2WC1A 4W4TA 4KI7A 1RXCA 4BVGA 3KZXA 2JI6A 4M1SA 1DG1G 1FTSA 2IUYA 1FXUA 4GPD1 1FUKA 2A3NA 4N9QA 4X7PA 2H16A 5MN4A 4KQMA 3IUNA 2OCBA 3H8SA 2G82A 3O7WA 1ORVA 3JD1A 1C81A 3P96A 1TKBA 1IY9A 3TTXA 1YGPA 2AFIE 1Y4SA 3D54D 4ZMSA 2OOSA 1KAEA 3NZEA 1A2KC 3GEDA 1IBMB 1PJLA 2B4TO 2AH5A 2P9BA 3BYZA 4MPDA 4I81A 1TMOA 3GRUA 3NORA 4LXIA 2BFPA 3PK0A 4IMIB 4Q34A 2JFXA 2R66A 3HKEA 4J0GA 2QIOA 4WCVA 2CXSA 3TRFA 5GVSA 4BGEA 5D8DA 1JG1A 3CW2A 3FI0A 3OQHA 3ZHTA 2O5VA 2ZJ3A 2ALJA 5BWCA 1PZFA 1GGVA 3KZKA 2EBFX 3DONA 3NGMA 4IHAA 4KLRA 3RYIB 5KNBH 1SEVA 1L4NA 1KI6A 5AOCA 3R9IA 3T9AA 3V2GA 4HWPA 4MVJG 4YGYA 1MB4A 4PZDA 1XL0A 2V7UA 3RTAA 4G0VA 1ADGA 1Y3CE 4XM1A 2XSZA 2UUPA 4BMXA 5ILOA 2I4RA 2WF9A 3AVOA 4EMSA 2GEKA 2NZXA 2AWNA 3KEFA 3MJHA 4QXPA 4RK7A 2IYOA 2R1VA 4S12A 4CKXA 4YP0A 2OBNA 3TR0A 3M0EA 3O8CA 2YJTD 1NVEA 3WJAA 2DKFA 1F5NA 3H2ZA 3EVTA 5J2TF 4WD3A 5TPZA 1UJBA 4UTNA 4K03A 1WDWB 2OFXA 1DB3A 1PW7A 2PKYX 3GNLA 2I7TA 3NBKA 4NMHA 1V7QA 2FWMX 4MGKR 5COBA 4HPWA 5IT9A 4P7FA 2MINA 2WFLB 5SV2A 5BNZA 2IDZA 1AKRA 3HJRA 4XQCA 5BW6B 4BO1A 5E6RB 1G5TA 2ZR0A 3MJVA 3IVCA 3RUEA 1T4GA 2J87A 3KOMA 4NYIQ 3A1UA 5DCWA 4B74A 1BMFD 4Y2UA 5IXYA 1UADA 2H1SA 1FS6A 1Y1PA 3CCCA 3LUBA 4W5JA 2AJ8A 2B7CA 5EXSA 2GF9A 4F56A 4KB5A 4NYMR 1MMFB 1VLZA 4DXDA 5AHRA 5IBCA 1COZA 4X94A 4X92A 4NYJQ 1SMKA 5AM1A 1QMPA 1YTLA 3DTYA 1ECCA 2MT9A 1ZBDA 1MNQA 1U6JA 4U7GA 5IKXA 1JAZA 3BBLA 3BDVA 4NU8X 4UUAA 3KJGA 4OOFA 4D9HA 3GLIA 3OEEA 3ZJ4A 1VJ0A 1ZD4A 3ZHCA 2C7QA 1T29A 2WE7A 4LCEA 2BTOA 3H9JA 1JFVA 2CGEA 4C4RA 2IF0A 4OHVA 3X1YA 3BX1A 1Z6XA 1HV8A 3P52A 3OLYA 5BWLA 1CUEA 2YYSA 1U2ZA 2XOKA 4YWHA 1U2TA 5C2JB 4KN9S 3OZIA 2NO5A 3DYVA 3E0XA 4QE3A 4R1PA 1GSOA 1Z8NA 3W5CA 3GJ0A 2R00C 1NQAO 1B8PA 2IXFA 4PZCA 1V8FA 1VLJA 3HDQA 3TOSA 3D1LA 3DEZA 3MWLA 4YRCA 1UPAA 2FPWA 3DV0A 2JLSA 2CDRA 4LDJA 1ZNZA 3MTGA 1ZUNA 2HT6A 1PL0A 2PUCA 2UDPA 1R50A 3TLYA 3F4BA 2BFDA 3I9V6 4OA8A 3RI3A 4D9IA 2XTMA 3KOWA 5TX7A 4UTVA 4ND5A 1BAPA 1U8FO 4EW3A 3UWKA 2Y8EA 3UFXB 2QSUA 2RC6A 3L41A 2ZIZA 4R3NA 3LK6A 2FSPA 1SG9A 4MA5A 4ZDKA 3ZJ5A 5ERYA 2CLCX 1XVUA 5FEMA 5JD3A 4EDHA 2ZIGA 2HMWA 1TRKA 1U4SA 3GCXA 2OV3A 2Q45A 3IBGA 1B00A 4QUGA 5FDFA 1YVDA 2MSNA 5JO0A 2IL1A 5JWHA 1NP7A 1CCWA 1NR5A 3DTTA 4K9NA 1E7YA 4CF4A 1TUIA 1O03A 1E3TA 1YZUA 2H29A 2IU4A 2QX9A 1BYIA 2WG1A 3F5QA 3NT5A 5DSTA 4B75A 4QARA 5A9SB 5KC9A 1RPZA 2XZLA 1N3IA 1PWEA 1SCNE 3ZN2A 2AJLI 2WPDA 1ZSNA 3HHPA 2O7QA 2EEZA 1A3CA 3VH1A 2IPOA 2Q3BA 1JT2A 3TM4A 1CJMA 3FYUA 3KYJB 5B37A 3DE7X 2VZLA 3EQ9A 1DJLA 4MVJF 1XQYA 4C06A 4IDBA 1U4OA 1H2AS 4CDRA 1BFUA 1QKIA 2EG9A 1NQTA 5ALNA 3T0FA 3RC3A 4B3JA 1G20B 1Z83A 3NJRA 4YAEA 3C1UA 2EGGA 2X42A 3GAZA 3IVRA 5FV7A 5CG2A 3QPUA 4DIMA 1ZJ5A 3GP8A 5ILGA 5JDIA 2WYUA 3DV9A 1HY3A 3L8DA 4LYGA 5AOVA 4CLOA 4EMTA 1PX2A 1V0JA 3LYUA 3M49A 4IMPA 3FHTA 2KE5A 1N9ZA 5HIKA 1W4LA 2ATVA 2PIAA 4Z3OA 4JEMA 4NHOA 3M6MD 4UQPA 4AMBA 1J1ZA 3HCWA 1JZSA 1V2HE 2JAQA 4MWEA 1N4AA 4CTKA 1SB9A 2CCJA 2Q21A 3MJSA 4KQHA 3ZV6A 2JIZA 2Z8ZA 5CAEA 5JYDA 1U63A 1ICEA 1UOPA 1T4CA 2AQHA 1P29A 2NUPA 2ZUUA 5JXIA 4PIVA 2CHGA 1NUSA 4O4JB 2ID8A 4FFBA 1QX3A 4UNSA 5BOVA 5JPIA 2MSEB 3GJQA 4X8HA 1QYCA 5CTAA 3TDKA 3ULKA 2FJPA 3DLAA 3RM3A 4BB0A 3CONA 2J5QA 4M9ZA 1B0ZA 1XVAA 2IY9A 3SEQA 1XEXB 1TCBA 2XT0A 1H2HA 3I2FA 2M1XA 4MKZA 4U2DA 2BFOA 4F6LA 2ESRA 4BLPA 1KQNA 2JGJA 1F3OA 4R1NA 4BP9A 1XLWA 3QWFA 5JNVA 3P32A 4F8EA 3U5ZB 1MX9A 4ND7A 3QEMA 3AV3A 4CIXA 1AN0A 4R2HA 4GGOA 3KOYA 1IQ0A 4N48A 3HHEA 2AZTA 2NIPA 4FIZA 5A9RA 1DX9A 1E98A 4BZXA 2VJBA 5KQPA 2R68A 1ONBA 2V7BA 1ZRMA 4XJSA 5M3BA 1C3EA 3NC1C 3AF0A 3UCEA 2CL6X 2QN7A 4BMCA 4EG1A 5IH7A 4B5LA 3KCQA 2VP4A 3NO4A 3P9YA 2P79A 3FNQA 5LZ9A 4F84A 1KVRA 1QUEA 4JA0A 4LMPA 4QUAA 2HLHA 1T1JA 1GU7A 3T0GA 5IKEA 3HS3A 4YRGA 2B2XA 1E6CA 2QTLA 3A14A 2RK4A 2V7EA 4YJ3B 3U4AA 4ZKDA 1PUIA 2UXCB 3ZS9A 2H2IA 3AEQA 1Q1QA 5DT9A 1DFGA 1L5OA 3M6WA 3QU2A 4K9RA 3AY3A 4PLTA 4PXYA 1ILWA 1U3UA 3R24A 3K15A 5JY6A 3MSXA 4KVGA 2W71A 5CPBA 2NPIA 2EP8A 3BWXA 2GN4A 3JQRA 4KQCA 2EHDA 3VO8A 3K4QA 4ZO9A 1GZ5A 2W7TA 4Z9XA 3ZHXA 1JSXA 4FNOA 2EP5A 4G5RA 3TIIA 1RRPA 3DM9B 4IJQA 2COKA 2ZDGA 3KS9A 4QBHA 1N8TA 5FA8A 5ULLA 4CT0A 1Q12A 1DQNA 1GR0A 5K3SA 3OZGA 3PDJA 4CNBA 4B31A 4HLUC 4RFSB 1PGOA 2Z56A 3ESDA 1PV2A 2HZ7A 3CEHA 4W9MC 2EZ9A 2NNLD 1LPBB 3GEMA 4PQEA 3PE3A 5FEUA 1QQBA 3DOHA 5EEGA 2WKSA 2BDUA 4BMNA 2W9XA 4L50A 4MLZA 3UAXA 3ZHZA 4RCVA 1QU2A 3GVIA 1G8AA 5L45A 4P93A 2P3LA 1YZYA 4GKKB 1QCZA 1TAGA 2JATA 3LC7O 1W36B 2OTCA 2PV7A 1XRRA 4EB6B 3BDAA 5IJZA 4I9FA 3P5BA 1CR6A 4YLEA 4XWWA 4RF2A 2W6JD 4JGGA 5DYIA 3CHYA 2YW2A 1N2OA 3TOCA 3VU1A 4UULA 5JZMA 1CRZA 5AK5A 4X6UA 1J9EA 2Q1SA 1ECJA 4NICA 4XGQA 2R25B 1YQDA 2XVMA 3A6JA 3TUJC 2VBGA 3HZOA 4AJNA 4FWTA 1SIOA 1HK7A 3B3QA 2XGMA 1SQ6A 1PZEA 1MAHA 2FE4A 1LK5A 1XZMA 2COUA 4QOIA 1A9PA 4NZYA 2ZYGA 3EXHC 4I55F 4DMKA 4UNNA 1HE2A 4B2LA 1DHRA 2PMBA 3EQ8A 3QELA 3DCNA 3HCCA 3R4CA 4BE9A 4UU0A 3W2IA 5EIXA 1DCKA 2G6BA 3LUDA 3MRSA 1N2IA 4A7PA 1PQYA 4ETIA 1LDMA 3TG8A 3QF4B 4JHLA 4RL6A 2Z1NA 3N59A 3R20A 4F91B 1J2TA 4A03A 1UR5A 4ZCMA 4B7XA 2X1HA 3OAAD 2HMVA 2VK4A 4TXMA 1KQFA 4B0OA 5BV8A 1ISMA 1DFHA 2QRPA 4N7JA 5DM4A 5FV4A 3PD0A 1LV8A 2J9RA 1USGA 1W4AA 3IXQA 1IJFA 2C9MA 2JL1A 3IESA 3PQ3A 2WSSD 4IKOA 4ARUA 1HEIA 2IIBA 1UDAA 2WNHA 3EFEA 4OP1A 3G5TA 3K9QO 4NZOA 3ZK9A 4CGYA 3AIIA 2I78A 3D6UA 3FDZA 5AJTA 2O20A 1Z6PA 3PDCA 3ASYA 4UBLA 1SKAA 1ND5A 3FPHA 4H7FA 1N3BA 1RWXA 2XA9A 3EGXB 3PJEA 1IEQA 1DTSA 1K75A 4GVXA 1C9YA 1M1ZA 1F20A 1YBFA 1MH1A 3P0FA 3C98A 2IUUA 1H6DA 3ND7A 5ARBA 3DLBA 5FO1A 2IZ5A 4FMCF 5T57A 2YBDA 1OD6A 3M5WA 1JHVA 3T5CA 2G3YA 4BNFA 3S1SA 4HGYA 4EUEA 4QTZA 1HNZB 2PT7A 1ZIXA 1EGMB 2YMMA 4MRMA 5DHPA 2V5VA 5FD8A 3E9EA 1NJFA 3Q9NA 4P3NA 3MPOA 4NDNE 1JLSA 1T13A 4YALA 3NBMA 3O8QB 4H7JA 5CBKA 3W5AA 4HQLA 2HJVA 2OFOA 3LNTA 4MV7A 3OTOB 3QKRA 1PT6A 2RHRA 1A0OA 5C4IA 3PS9A 4BP1A 1MJNA 5C8YF 4L4ZA 1D1TA 2EBUA 2PUGA 2VQ3A 2C98A 2XF2A 2WHEA 4FN4A 3R0XA 1GYQA 4UNRA 4C0BA 5B6IA 4UHJA 3A2NA 5B1SA 1UT8A 2X19A 5SY9A 1IIRA 3KTDA 2YASA 3MGAA 5HK8A 1E6LA 3PYLA 4MR7A 5FQNA 2OD7A 4FXPA 3G8YA 3CZQA 1DC5A 3VNUA 3PFHA 1K4MA 4NMWA 2DH6A 3V55A 4FYKA 4JI6B 4PHTA 1X86B 4RORA 4TGLA 3WGGA 2YX1A 4N6OA 1U3TA 2GCGA 5KTOA 4YMVA 5AHXA 5HJ2A 4D8WA 2VHCA 3QYAA 2JVKA 3LE8A 4HXYA 3T54A 3KLBA 1GV0A 5CNMA 4QEZA 1U1CA 2VNAA 4Z51A 4KW7A 3JYHA 5K6RA 4RQBA 3SFZA 4AZSA 1U3GA 1M0SA 2G9VA 2PRSA 2QLLA 3UUGA 1N8SA 5JS1A 1E1NA 1Y37A 3SEZA 4F21A 2DSNA 5G1NA 1F5SA 1P1HA 3GRYA 1XYYA 1GFSA 1U0OC 4MJ3A 2C9YA 2D59A 3K5PA 4J1TA 1XTUA 1UDRA 1MAVA 1GU0A 2JFZA 1PUXA 4M1OA 1RQNA 2WYIA 3ZVLA 2MMCA 1NGSA 1Z4MA 4L5JA 5G4KB 1E3WB 3DB2A 5HZGA 2LD4A 3E7DA 2HB6A 4DZRA 3V4RA 1MT3A 3Q9LA 4PC6A 3F9IA 4G0PA 3V1YA 1GT91 4X3PA 3CR3C 2Y1LA 1KAOA 2OG1A 4WK2B 4CBVA 4CW7A 5J3JA 1CG6A 2WWHA 5LXTB 1ZQ9A 5JAPA 1HNWB 1EZ4A 3O83A 2C7BA 5EC8A 4K0RA 1BSVA 4FTWA 3RS7A 4F6RA 4Q39A 3G9XA 4WOPA 5CFRA 3M6XA 3RSGA 3EG9B 2L0XA 1PL6A 5EAIA 1ZM4A 1X1QA 3OOYA 1EG2A 3OI7A 4AZ3B 2P69A 2AHOA 2FXIA 2O3UA 1EZ1A 1R4AA 2C58A 2XWSA 3L4BC 4JXXA 2UZ3A 3C4JA 3O9ZA 5CT8A 3TR6A 3RIEA 4KXXA 4D3YA 1N7IA 1L1EA 3G7NA 5F98A 4IGKA 2W4IA 3PYXA 1N5OX 3PWZA 2P9HA 4FOTA 3EFBA 4DT1A 5MGBA 3O2JA 5EWMA 1PK7A 1N1DA 4NRDA 3DOFA 2N0SA 1SQSA 2ZYDA 1C0IA 3V1KA 1WDTA 3CEPB 1YFZA 2A2ZA 2AOUB 3RQSA 2VYVA 2XWQA 2PZFA 1GG2A 1AHNA 1OLSB 1W19A 3MB8A 3UYLA 3W8DA 3ZTYA 6YASA 1QO0A 1GTVA 1A50B 4UZEA 2ZJ6A 2HHAA 3FGOA 1OVGA 3G6KA 1O54A 4OG2A 3FBGA 1S4MA 1JHAA 3MFQA 1IRIA 3OPYB 1J39A 1EQUA 3RSZA 2GXUA 1EUDB 3NM4A 3L01A 4DQXA 4RQUA 4XGNA 4DY4A 2A8YA 4FJ2A 4A4DA 3MELA 2NO0A 1OB5A 1JSCA 1MABB 3IERA 4YRRA 1CE8A 3D2LA 2G67A 1YDFA 3JZAA 3QKTA 2REOA 1IOVA 1RQ7A 1JQBA 4ILEA 4G37A 1BE6A 1T35A 2AR9A 4DLVA 1ZNQO 1XAGA 3BH0A 4G8DA 3ZNNA 4YYEA 1M34B 4XDZA 2B8EA 1KH2A 1O0CA 1E2UA 1K6IA 3VHXB 4AT1A 1KO7A 2VF8A 2OLEA 3CUTA 5JNLA 2CNOA 5ICGA 5I3CA 4V39A 2I6UA 3IA7A 2XODA 1PWXA 4MJLA 1NASA 4EVSA 3BS4A 1DOHA 2DULA 2YXPX 1XQVA 2Q3FA 2JG3A 4FHGA 1KH3A 3LT5A 1QCDA 1JE1A 4NXMB 2ZKIA 3ABRB 4LRYA 3CZ5A 4WLNA 5E0KB 1NF9A 1QF7A 3LO8A 4AURA 1O1YA 3VPHA 3EULA 3DO8A 4XJTA 4J1NA 3QEOA 1QG4A 1ZLXA 2FZ5A 2Z5VA 2MIIA 4Z0TA 4TVOA 1PQPA 4GPEA 1UZNA 3C7CB 1AGRA 1NY6A 2F3QA 3SC4A 1FUIA 3Q5DA 3KHKA 3O1IC 4PYMA 1PT5A 5I7WA 2ZRQA 1TFRA 4EY6A 1O9GA 1CUHA 3VMFA 3KPWA 5AOBA 4YP5A 4R71A 2EW8A 4EITA 4EUHA 5JLAA 2BMAA 1XMSA 3OBIA 2JK1A 3CB4A 4I2VA 3RVQA 4AKTA 1B23P 2XYHA 1H6BA 3E7FA 2CLKB 3HP1A 1GPDG 4GQAA 4J6EA 3DAFA 2H7YA 1ABEA 4ZEWA 2HRBA 1UQRA 4OB7A 3BL5A 5IUKC 1KO1A 2GZMA 3M70A 3REFA 3VZRA 2O57A 3FKSD 5JTTA 1VSBA 3MLEA 1ZO8A 2ZR7A 4XEUA 1S7CA 1T9GS 4MWGA 1YJ5A 2I4NA 5BN3B 5HM8A 4TWJA 4TKUA 1ZCAA 3L6RA 821PA 1GG5A 1Z0KA 3WQQA 3MGCA 4GRDA 4PSVA 3UUFA 4MYCA 3UM9A 1PF7E 3KQWA 2OUIA 4JBXA 1GIAA 1P61B 3LP6A 1NI4A 2H5IA 2P77A 3ZLTA 4ZK6A 3DEFA 1NNEA 2C4UA 3LUAA 3HRIA 4CWAA 4YACA 1U5BA 3GLSA 2GD1O 4KRXA 3ICEA 1YCHA 4TLBA 5DULA 3D1JA 1RXSA 2VBIA 1JZTA 4XD7A 3KD2A 1T2AA 1E1RA 5BR4A 2JLVA 3B12A 3IKTA 4UCQA 2YJ5A 1PIWA 3E48A 2P4SA 1QR2A 1ZOLA 3PIIA 1XMVA 5IJXA 4L9AA 4RL4A 3GDOA 1UKZA 2LKCA 1A8IA 1BEZA 5A4JA 4Q3NA 2HWUA 1AH2A 4MLDA 4ARCA 1MIOA 1Z2AA 2J4CA 3D8BA 4HDNA 3RVJA 3SWWA 2V7TA 2YXLA 1EFRD 1IM2A 3AR7A 3KAPA 1UEXC 4ITRC 4UHHA 4KWTA 4XKJA 3TQOA 4CM9D 4DJEC 4Q1FA 4DQDA 4OATA 5D51S 1PLKA 3OOSA 2V9ZA 2IW3A 3I5YA 2BKLA 3QVJA 2PXCA 1FTNA 4H3VA 4Q4HB 3WGMA 2GN0A 2RHCA 3IYLW 1LLFA 3Q87B 4UNPA 4DLNA 3P0HA 4F11A 4UFPA 4DR2B 5AW7A 1DEAA 3I9OA 1ZK4A 1UKCA 5G02A 2QWXA 3VZCA 4GAEA 4MS1B 1FS5A 4I4TF 2J0VA 2L2QA 3I4LA 4P6VF 1T6XA 4LC9A 4QDZA 2X5XA 3RU2A 2ZSFA 3PRHA 3S2YA 3AHJA 2OCGA 3HZRA 1J8YF 4AD8A 4KNYA 4J16C 1N4DA 1X7ZA 3DDSA 4CUJA 5JNTA 3LWDA 2DY1A 4XYLA 4ZI7F 2XI4A 1UMDA 1HYGA 1IY0A 2R8ZA 2YZ7A 3ZDXB 1JI3A 3C2QA 1P1KA 5K3AA 1K5PA 4C0LA 4MLCA 3QLVC 4O02B 4KWCA 4HS4A 1ORTA 3H8WA 3DR5A 2IUTA 1Z8HA 1COWA 2IRWA 2E18A 1NXWA 3LDHA 4JT2A 5F76A 3U5TA 1NDHA 4W5TA 1RC8A 2Q1YA 1U0SY 4DADA 1AHHA 2C4MA 1U0BB 1GL3A 5A5DA 4OGWA 2V5UA 4EPYA 4EL0A 4B46A 2DM6A 5LQKA 2W42A 5DB4A 3W3AA 4HGZA 2OESA 2AYXA 4Z9FA 4WBNB 1EUQA 1ZEMA 5DCUA 4GMKA 4GG1A 3ETNA 1L1QA 3KHUA 2G1KA 1XRNA 4MR8A 5GOZA 1Z0SA 1SBTA 1RRKA 1E8DA 2BE7A 2Q0QA 4MGEA 4FLEA 4RV4A 1X92A 3NM5A 1E79A 2Z2IA 4RVDA 4WNAA 3SKYA 4ZO4A 3T1VA 3TBFA 4IO1A 1T24A 4IAOA 2JHFA 2HK6A 3EYAA 4JYBA 4EHKA 3LP8A 5KWIA 1O6GA 1HA3A 2XB6A 5JTUA 4WINA 3UAWA 5IYZA 3RANA 1UPTA 2XNKA 1RBQA 4MPTA 3MMPA 1RR6A 2C2MA 1NXSA 2DWOA 3CLKA 5JZOA 1ZHFA 1M0WA 1HFKA 1G2PA 3C5VA 3IR6A 5MN5A 4X62B 3QFTA 3P4XA 2IIQA 3D0KA 1CY4A 1ZPDA 4JLVA 3L4KA 4Z99A 2HFKA 3NRCA 2MMGA 1NTRA 1GADO 1UUFA 3AVVA 2DFTA 2DUWA 2Q3HA 1Q1BA 4WFQA 4RZHA 1YL5A 5D01A 4B4OA 4YRAA 4I5IA 2Q27A 4MB2A 5FYQA 4BPRA 2RGEA 3LIIA 5C0OE 4BVEA 2ODEA 3HN6A 1QWOA 3OSUA 4L15A 1M6HA 1YHZA 3RTGA 1RJWA 4WQMA 3G2NA 5KNDD 3ZLJA 4Z2YA 1KSJA 3AXTA 4RF4A 1WZ2A 2ORVA 2RGYA 2R1UA 4JC4A 2A1UB 5LP6A 1SXQA 1O95A 3CH5A 1G8YA 1VCIA 1FNMA 3PL1A 1JIIA 4GOKA 5KJ1A 3KM0A 2GH1A 2CLFB 5GJWC 4YRSA 5AI9A 3HA3A 1I3LA 4UPEA 1IXSB 1IMJA 2XXAA 1A1VA 4P2BA 4ECAA 2G1UA 1P9NA 2Y68A 1QV9A 4IFTA 4Z1MA 1LSJA 2RJNA 3CEMA 2B1QA 2D5LA 4GDFA 1KAHA 3G23A 1MT0A 5JHHB 3EZXA 1HLDA 3PD7A 3M1IA 2QYHA 1DHTA 4QATA 4BWFB 1FYWA 1ID1A 4GR9A 3WRYC 1KMHB 1GL6A 3UXYA 1Z2OX 4GDMA 1U3CA 3UHPA 1EQAA 1U0FA 4P1ZA 5TS3A 3JS5A 1FLNA 2VZEA 4B3FX 1E61A 2C3UA 3LBHA 1PDOA 2LWIA 3QFCA 1HL3A 1PR2A 1TECE 4G0ZA 4P7GA 4U6QA 4WXMA 3QEAZ 3ESQA 5EWMB 4F9EA 1QHYA 4J3JA 2FRDA 1KGSA 3PC8C 4CM3A 2R5FA 3EHEA 3GFVA 3WL5A 1IUKA 2I87A 2VDKB 2WTBA 1KY3A 4FT4A 4O63O 3RDPA 4A8JB 3Q85A 4Y7CA 3LFTA 1QRSA 2C2GA 4BNVA 3DZ8A 2IZOA 3IDFA 1PR4A 2FUCA 4L3VA 3IIMA 1U0TA 1NW8A 3JAWB 4IOKA 5ENVA 3KIPA 3NASA 4JYZA 2P0EA 2QVBA 5CA0A 3TLJA 3ES9A 3IDZA 1HDGO 3PUJA 3ZOKA 1A9QA 1GPKA 3ICVA 2P65A 2VJDA 3CXRA 3DR3A 1FTQA 2BEVB 2IYXA 3DXYA 4Y9DA 3U7IA 1U0JA 3TIGA 4MCHA 3UJHA 4YJFA 4G1BA 1QP0A 1NLZA 1UPUA 1Y7TA 1TMKA 4W99A 4MB6A 2BUCA 2K87A 1A8QA 2CFIA 1X38A 2V6MA 2CFTA 1ZLYA 1W1WA 4D45A 3A2MA 1DWQA 5FNVF 1NN3A 1CUAA 1LPPA 3AKEA 1IUPA 2O2IA 4GHWA 4NEHB 2IOQA 3QX3A 4J0JA 5DXFA 3IOEA 2DQ4A 1AUOA 1S8NA 3HP4A 3IAEA 3QJ5A 4PQRA 1I4TD 3VR2A 3ROQA 4AF8A 4ZIRB 5JD4A 1E4EA 1FRZA 1II8B 1SO8A 4I1SA 4JJKA 1OBCA 4N40A 2EFCB 1ZCJA 4CQMB 4BX8A 4CCYA 5JAZA 1HLPA 2JFHA 5DWQA 4LXTA 2Q2OA 3SHQA 1CJSA 5H4HA 3UHFA 2V1UA 1FFAA 4JIGA 1A5AB 3WL7A 3DD5A 1PP4A 4CVNA 1NFFA 1D4OA 4WX2B 4LHEA 2PD6A 4F2WA 4ZU3A 3KSMA 5BNFA 4DDKA 3G9UA 2OXEA 1YQGA 3LVQE 2Z6UA 1LSOA 3EXEA 1KZ9A 3KB1A 3PR2B 2ZE5A 1Q2UA 4JBHA 2HX1A 3TQHA 1GAJA 4YUVA 2R7NA 3V97A 2UYOA 3N0XA 1J25A 1KVTA 3KJNA 4MKFA 1DELA 3EJ6A 1KO4A 1VJCA 5FOQA 4R7TA 1ZR4A 1M2NA 1JE0A 1P7PA 3B9RA 4ES6A 3RE1A 3IVAA 3O8NA 1H3FA 1U0EA 2VKTA 4IWYA 5P21A 4PPQA 1HURA 1TA9A 2FCRA 4FBMA 4HQNA 4TXNA 3HXTA 1V37A 4BGUA 4QQKA 4UM9D 5B3JA 4GP9A 4QXRA 3FOWA 4V0LA 5CHYA 1M1NA 3CGGA 3JSXA 2NUPB 2G17A 4C7KA 1O77A 1L5VA 1SBCA 2OBYA 2CNWA 5E7QA 5EKUA 3GZJA 1VMKA 3AOGA 1C14A 1E2PA 3TUIC 1P60A 3OZBA 1M2OB 4LDZA 4D9KA 3LJKA 4KSBA 4F1JA 2VZ8A 1L7DA 2LGJA 2QVCA 2YWJA 3JTMA 3AUFA 1IMOA 4TT8A 3VTAA 2B25A 1GNSA 4YMGA 4E32A 1J22A 1ML4A 4JLWA 5TVGA 2A9RA 1YFJA 3TFWA 1ZZGA 4WOJA 1YB7A 2WFZA 3PIRA 1J2JA 3G2PA 1N2CA 1JIKA 1VRCA 3BCUA 1A76A 3DCIA 3LF2A 3LLVA 4CKZA 2YVUA 3QG1A 5E1OA 2G08A 1VA4A 1CUWA 2F90A 2GZHA 3AHGA 2VPPA 3MD0A 4MRMB 2GWHA 2WD7B 3ZCUA 5ITZB 1FS4A 1QORA 3D59A 3GIDA 2QDKA 3O8QA 3DOEA 3H6GA 5CLHA 4DRXA 2VP5A 5IVKA 4ZQGA 3ER9A 2BEWB 2ODNA 2C77A 3SG0A 4D98A 3O4RA 5D3KA 5CB0A 3MB5A 1RT9A 2O05A 4MRRA 2QX8A 3QMMA 4MQFB 1JFTA 3MEQA 1YZNA 1KJWA 4BBPA 1H9CA 3KE9A 5FI0B 3LA6A 3P0JA 4H4CA 2C7PA 4PC7A 2FMUA 4BX9A 1PVDA 2K6GA 3QXHA 1RHKA 4OUDA 1C7FA 3UMSA 4X71A 1AV7A 4Q19A 3HFRA 3T9BA 3WDKA 4IH9A 3ZY6A 1U1EA 2W11A 4HGOA 1W44A 4LJ4A 4PNPA 3WKEA 4V24A 5LC1A 2H1LA 1OBFO 1UF9A 4I6GA 4Z53A 2Y27A 1JR3A 1HE1C 1NKVA 3MT0A 3WO1A 5FWYA 2F48A 5EP2A 4L28A 5B2EA 3DOOA 1MHTA 1YK0A 1OHHD 5LYJA 1EYZA 1YJQA 4ALNA 3BOSA 4KQEA 1A7UA 4C0QC 4R8VA 1KNXA 3H16A 2HF8A 4Y1EA 2FSHA 3HKBA 5C8XA 3K92A 1JPJA 3EUAA 1MRNA 2Q3MA 4GRIA 1SB8A 5AK0A 1E66A 1BE1A 1IFXA 3FTQA 3FZGA 3QHAA 4GOOD 4MW4A 4HATA 4Y2XA 1P7VA 3DO5A 4ZAWA 4CMCA 1T8SA 2CUZA 1L7XA 3WRXC 1R2QA 1TCCA 1A4RA 4HB4A 4GR5A 1OBVA 2GASA 3GJ6A 3HC7A 3PSHA 1ZWKA 4JLUA 5EEHA 3OTQA 1Z75A 3RRZA 5T4EA 3M1YA 2PRJA 2A0UA 2Y1WA 2I1WA 4V3CA 5KQLA 1TGYA 3BXOA 1BS2A 2AR7A 4MV5A 2PH1A 1QANA 3VKUA 3AVQA 2JC3A 3FNRA 5JSHA 2IPXA 2JAPA 2W8ZA 3OD5A 4N8DA 5FNZA 4ZYTA 4ZANA 1GKIA 1KL7A 1MR3F 2PD3A 2QMHA 3I8OA 1N6LA 3ELBA 2O8DA 3UAGA 1WMAA 1MPTA 2ZLBA 3EZ2A 3TVDA 2VF4X 2P62A 3NYIA 3R3VA 5AI5A 1M2VA 1CUJA 1QK5A 4Y2HA 4EKEA 5KYXB 1WKVA 2MSCB 2RGCA 3GK3A 4YTEA 1ZMOA 4TLLB 3FNHA 4F0JA 2NO7A 2XB8A 3NH6A 4PNEA 4DDHA 4PAMA 4J0IA 3BM5A 3WZMA 3A9CA 3WG9A 4AP9A 4MEBA 4TLAA 4C4XA 1OUMA 4EWLA 2FSGA 1VKJA 2H4FA 1V2GA 2PS1A 1A9OA 3MLAA 3PUYA 2KS6A 5A7HA 3ZVKA 3IKJA 3LYHA 4YDSA 4LKOA 3EAFA 2EFJA 1WV1A 3RVRA 4CU2A 1YZQA 3FHLA 1P77A 5F3DA 3WFZA 1PJ2A 4EHHA 2CZGA 3SS7X 1YRAA 5F2KA 4BRZA 1S89A 4R9NA 3E58A 2QTGA 4I4CA 1DBRA 5CU7A 3IVGA 4X1KB 3IAAA 2GHIA 1OMOA 1P0FA 2ZYUX 3TLZA 1TUBA 3W6ZA 2G04A 3T1NA 5BQOA 2A0FA 3FROA 4YJHA 1BKSB 3D7KA 3E9MA 3I76A 5EE9A 5IC6A 4KVZA 3FFAA 2E37A 5IVDA 1UWVA 5TGDA 1P1FA 5L6MB 4B3HA 2C3YA 1OW3B 4MK4A 2GERA 1LBQA 2ILTA 3RS0A 5U4XA 3VR5D 3W6PA 4Z1OA 4RZXA 4ARVA 1U7TA 1B0UA 2CE7A 2FJ0A 4Y6OA 4CEIA 3LOPA 1RI3A 4LF6B 4IIUA 2FZ4A 3M83A 2Z1DA 4WLOA 2EKQA 3VPFA 2NUAB 2XCQA 5FI5A 4M0CA 5C1PA 3ST7A 1BD3A 1TJYA 1UBFA 4RW0A 4EKYA 1SM4A 3BTVA 2A1UA 4U9UA 3CRZA 1R6XA 2ZAYA 3BZUA 2GBFA 1Z8FA 2JFQA 3G59A 1T4CB 3S5JA 3EJWA 2OSVA 4HWTA 5T8KC 4FSDA 4JP8A 1VJ5A 4URZR 2IBTA 2O2YA 2QU8A 2RIPA 3A1VA 3PP8A 5IWAB 1M1YE 1YMUA 3FFBA 4BVAA 1ZINA 3GAMA 4NNJA 5LDGA 3B2EA 3GJ5A 4D4KA 3P4YA 1Q1ZA 1RJFA 2WOJA 4KDCA 4UTZA 4KFSA 4KE8A 2DGDA 3UA4A 3BFKA 3ZU6A 3DAHA 4B7ZA 5TLSA 1EDDA 3PUXA 2XEXA 5JMOA 1JXMA 5H3HA 4E5YA 1POWA 3MJEA 3PGLA 4KNWA 1VA5A 4E2XA 2H2HA 4NMXB 4G0WA 1W4ZA 1ACMA 2IYLD 4YMIA 3E82A 5BRNA 4HOYA 3R09A 4F7DA 1SHUX 5A6SA 2VJKA 5H3LA 4JR0A 2VK2A 1USUA 4EHIA 4F85A 4XQEA 3FNFA 2EKZA 3A1WA 3OIUA 3P9ZA 2P6MA 6PFKA 5A9SA 1G8JA 5I45A 1J1IA 1AKNA 3T5TA 1R9JA 3PPIA 3U60B 3TZHA 1OWNA 1X9IA 2ZSIA 2C20A 1GLVA 1TIPA 3DEYX 3OIWA 1I0ZA 3TLAA 3O2NA 4BWGA 2RK3A 2J0QA 3KT3A 2ONJA 3CJTA 4PG4A 4JKOA 3SI7A 1SPXA 1Z35A