3UANA

Crystal structure of 3-o-sulfotransferase (3-ost-1) with bound pap and heptasaccharide substrate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
256
Chain Sequence
STQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGLGWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQVLYNHLQKHKPYPPIEDLLMRRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQVDPKLLDKLHEYFHEPNKKFFKLVGRTFDWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the substrate recognition of 3-O-sulfotransferase for the biosynthesis of anticoagulant heparin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 1
total genus 83
structure length 256
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uanA00
5BYJA 1W7AA 3AVVA 2QRZA 3AP1A 4XTRA 2J3EA 3CPHA 3QI2A 2J0QA 2BKUA 4LWZA 4F4IA 3VHXA 1DBSA 2DPXA 1MOZA 1Z06A 3TJZA 4MGKR 4JLVA 4PQFA 3P27A 3Q85A 3ZVMA 3NC0C 3PUWA 2YWHA 4RD6A 4AKEA 4S2EA 2FZLA 4LJYA 2LKDA 5JCPA 3LVRE 2EWWA 3B1VA 4TSFD 4KFUA 4OQFA 3K0FA 4NYMR 3FYHA 2A5JA 2WVJA 4JLJA 5EXTA 3RC3A 4DKXA 3AGPA 3CKLA 1NKSA 2IYTA 4UNSA 3X1XA 4DUGD 4OI0A 2YJTD 1JEDA 1G8GA 4Q18A 3EPKA 3NH9A 4WVFA 2Q6TA 3KXLA 1GL7A 1Q57A 4HLUC 4YMSA 3THWB 2RGAA 2XZOA 5SZIA 2A3RA 2HDNB 1E79D 121PA 2P67A 1OXSC 4G0NA 3IIJA 2IHYA 4RFSB 2KB0A 2WOOA 4A92A 3CWQA 3GP8A 1CTQA 2IX3A 4C3ZA 3KUDA 4IKEA 1QBKC 4AIIA 1M8PA 3ZIAD 4CT5A 4DIDA 5C46F 3ZQJA 4Q4AA 4QJ3A 2RB4A 1SVIA 3PVSA 4MGIR 1AZSC 2YC2C 1LW7A 2DFLA 1R8SA 3UIEA 1GG2A 2Z0MA 3CO5A 4PSAA 5HKKA 1OKKD 1RIFA 2NPIA 3WYGA 3GJ5A 4FWTA 1S0UA 1XJ0A 4X8HA 3T1TA 5KDOA 4V03A 2VHQA 2VEDA 1OB2A 2LCFA 3QVVA 4LV5B 4OQLA 3SHWA 4CVNA 2CK3D 4MITA 4CEJA 1J7KA 1G7RA 2ZJ2A 3BXZA 4GP6A 2ZAOA 3PENA 3EA0A 5AJWA 2GVDC 1E2LA 2B7BA 2YWFA 5E7JA 2BOVA 1B23P 1OFUX 2WJJA 3LW8A 1RJ9A 4L9WA 2IF0A 4XD7A 3ADDA 3FPAA 2CVHA 1ZD1A 2J7PA 4L5BA 4GPTA 4D82A 2H17A 5KHOC 4QM7A 2R6DA 3OIWA 4JMPA 1W36D 1XEWX 2GVZC 1W5SA 4TYYA 4Z8XA 2IEZA 3CZQA 3QKUA 4JSTA 4OHXA 2XXAB 3ADCA 5AUOB 1GRRA 2HF8A 2DCUA 3B85A 4A0FA 5KO2A 1RPZA 3BERA 4FW9A 4IDQA 5K8LA 4NCHA 3EG5A 2IWRA 4Q7LA 4TLCA 1S96A 5FUYA 5LDDC 2UZ3A 5FUXA 4EFNA 1E79A 4WA7A 3K53A 1PUJA 3I1FA 2W00A 5FL7A 2QEQA 2C5LA 2QUZA 2AWNA 1Q1ZA 1G5RA 4BLSA 1O87A 4FI3C 3U44A 5L3QB 2ONJA 3Q7QA 2CMKA 1R4AA 5FPYA 1NN3A 1G20E 2F6RA 5M04A 4EPWA 2Q9CA 2RKOA 3S1AA 2A5FA 1FX0B 2GXUA 4TMKA 1GITA 4BEJA 1MO4A 4V0LA 3KB1A 4PHGA 3NBZC 3B9QA 3GLFE 2OCBA 1G41A 2CK3A 3TRFA 4L4UA 4BZQA 5CK4A 3C5CA 4TMWA 5KTYA 4ACAA 4P4TA 1NY5A 1ZUHA 1GIAA 4KITB 1E2GA 1N0VC 4D0LB 5LD2C 4BRWA 1UM8A 1HV8A 2QI9C 1SXJC 2FX3A 1H8ED 1VIYA 2J1LA 1AK2A 4K81B 4E03A 2O8BB 4JLKA 3KTAB 1W1WA 1ZU4A 5E7MA 2OE2A 2ZRNA 5CB8A 5JHGB 3GLGA 1G3MA 3V9PA 2G88A 3T06B 5CIWA 4XIGS 5A4JA 1KI4A 4FCVA 4BRUA 3UKDA 2WM9B 1G3QA 2DFTA 1L8QA 5IT5A 1TQ2A 1G16A 3AF2A 5EE1A 1YE8A 3KJGA 5DH9A 4RKEA 4LBWA 1NRJB 2NZJA 2D4HA 4OK6A 2EFEB 1VCIA 4Q9JA 4M22A 4RZXA 1AA9A 4QBIA 1QG2A 4V0OA 1E69A 3ZQ6A 2CLSA 2O8FB 4IJMA 1OJLA 3KUCA 3W9YA 3BFVA 1U0LA 1M34E 1YHNA 1X86B 3H86A 1PLLA 2CNWD 2NO1A 1UKVY 1G3UA 1QDEA 5J40A 1AKEA 3AKDA 4HLQB 1LV7A 1XTSA 3BB4A 4ZO4A 1HE1C 4BUJA 2NG1A 3EW9A 4UNQA 3RABA 3DZ8A 1TUIA 4RZUA 221PA 2ZE8A 2WIBA 2G0TA 5EP1A 5JEEA 4DDVA 2OESA 4M1KA 2Z6VA 4C7OB 3R9XA 4LC0A 2ZRCA 1R5NA 3W5JA 1JQJC 4HLDA 1CKEA 4AI6A 2DB3A 5KSZA 1PJRA 2W2TA 2FPLA 5JWOA 3ZD7A 5JJIA 4TMXA 1US8A 1CEEA 3SYKA 4RKFA 3EPLA 3QIAA 4NHOA 4JSYA 4ESHA 4DHEA 1GRNA 2ZRMA 3PUXA 1G9XA 1G8HA 4DRZA 2O52A 1JJVA 2A78A 2PLRA 4BFZA 1X3SA 1G8FA 4C7OA 2NO7A 3X1WA 1D8TA 5L8VA 3OEEA 3KKOA 1GSIA 2HYDA 3DDCA 3MUFA 4CT4B 4ESVA 1E96A 3AVWA 1GNPA 3VQTA 1P73A 2IHBA 1NKTA 1MV5A 3FKSD 2NO6A 3FMPB 2PMKA 4PANA 1Z2AA 4AG5A 1II9A 3BGWA 5JS8A 5DHAA 2JIZA 3FGNA 1GM5A 1C9KA 1CRPA 3I73A 3BH6A 4R2HA 4G01B 1N6LA 3CZPA 4CYMA 4KYUA 1HURA 3K0AA 1A1VA 1EX6A 4C0AC 1OB5A 3M6AA 4QL3A 4PC3A 2WKPA 4R7ZA 1CR0A 1DELA 2VHCA 2OXCA 4D4JA 3OEHA 1P2UA 5EE3A 4MRVA 4JLBA 5LPNA 2JJ2A 1F2TA 2ZITA 1J8YF 1KSGA 4D6PA 1RRFA 2ZS9A 1HEIA 1NMXA 3TMKA 1KI2A 2IA5A 4P3YA 3KJEA 4NCJA 1W4AA 4Q66C 1TNDA 5DI9A 2ODWA 2IYYA 4IVQA 3EWSA 1X8LA 5J4KA 3CRMA 2QP3A 2YVUA 2FFHA 3GEHA 4BEBA 2VSOA 4R2IA 3ZZUA 4O2LA 5J4HA 1XPOA 2VP0A 3FFAA 2F1IA 3Q7PA 4RCZA 4BGDA 2CEAA 2FSHA 4G5OA 3MMPA 1RRGA 4ZI3A 2O8EB 2FPMA 4KJZA 4I1OA 4FCTA 1P9RA 4S35A 3K0EA 5BYKA 3GJ6A 2R6CA 5KUTA 1E3MA 4RY2A 1G1MA 2QT1A 1GAJA 3WP1B 4IFEA 4B3CA 3DPUA 2XJ4A 1G7TA 1GKUB 3FHOA 2GHIA 1ZC4A 1IHUA 1P75A 1W36B 3P1JA 4UNNA 1Z83A 2GNOA 3BC1A 1AN0A 4MYTA 5E4FA 2R9VA 1ZNWA 3EASA 1CXZA 5EXSA 1KTVA 3DVLA 3O47A 4NCNA 4KVGA 5TV2A 5F9FA 2OO7A 1E98A 1CJUC 3R9IA 2G6BA 4HDQB 2Z83A 3NBXX 4M53A 4ZDJA 1SXJB 2JLUA 1JECA 1FMLA 2GZHA 2IXGA 3GFTA 4BFYA 4NDZA 2QMUA 1DS6A 2UVQA 3ZYCA 4ILEA 3CRW1 5JFGA 2EW1A 4Z1MD 1XPRA 1TAGA 4W7SA 3A1VA 3BH7A 1G4AE 1A7JA 2EFCB 2FGKA 1R10A 3MWKA 2IYRA 5F2EA 2CL6X 4M2LA 4DSOA 1LFDB 3B2EA 4XSGA 2QPTA 1JAHA 1NIPA 1Y63A 3OHMA 1JALA 1Q1BA 3TUZC 2F9LA 3K0SA 1G5PA 2OCAA 3SN6A 4B35A 2HLDA 5FL7D 4D81A 1GWNA 2GILA 1UAAA 5DN6A 4PAMA 1KK1A 2QQ0A 4H1VA 3IO5A 4TLBA 3VX4A 4E22A 1YR8A 4JLPA 1Z47A 4JL6A 2DR3A 3TW4A 2QPAA 1KY2A 2CCKA 4NU0A 3FFBA 3H0KA 3LWNA 4EKDA 2XTZA 1L4YA 4LUCA 2W6JD 4PPNA 4Q7KA 1GL6A 1ZJ6A 2C95A 2MMGA 3D7MA 2L0XA 1N6RA 4Q1AA 2D74A 2RHDA 1FX0A 3MJHA 1DOAA 4MGYR 1W0JD 1CS4C 4JVLA 5D3MA 4ZKEA 3HWSA 3LX5A 4P33A 1TQ4A 1EFCA 3IILA 3PUVA 3H2YA 4IDNA 4UKDA 5ANRB 2ZRBA 4FMDB 5FL3A 3B78A 3CB4A 4OHYA 3WHKA 5FOSA 4WIAA 4JBYA 1XXHE 3IQXA 3MD0A 2ZJYA 5BXQC 5CM8B 4CW7A 1OH7A 4IOLA 4A15A 1W44A 1T91A 2W58A 1XMJA 4FMDF 5B30A 2CJWB 3LQQA 3FHCB 2V7QD 4OYHA 3AV0B 3GJ4A 2QM7A 4GMXA 1SVLA 2RGNA 1FOEB 4C4PA 4G5RA 4JZKA 2AXNA 2YC4C 1BKDR 1E2DA 4Q4JA 1RRPA 2V6IA 3TAHA 3WRXC 1E0SA 2GCOA 4KODA 3TVTA 2QA5A 2PT5A 4BWYA 5F3WB 2BM0A 1FQJA 4URWR 1Z07A 4TQAA 2XJ9A 5CM9C 1T6NA 4PR0A 1KAOA 3K9LA 2E9SA 1R0ZA 4NCKA 2BMDA 2FV8A 4A6XA 1HQYE 3X1DA 3ZLJA 1I2MA 5CDFA 3U7EB 1CF4A 4LYHA 4P4UA 1NLZA 1E32A 1Z6XA 2R65A 5EE9A 1AM4D 1VTKA 4UXJA 2IEYA 3I62A 2CNWA 3TVDA 2O8CB 1MO3A 1CJTC 4W5JA 1VYTA 2W2XA 5CB6A 3VNVA 1KMHB 1KKLA 2ZI4A 1U2RA 3AGQA 2PT7A 1YZUA 4KFSA 4WZBE 2QGNA 2QTVB 5BQ5A 3OE7D 1PV4A 1EG7A 1NBMD 5HTKA 5AUNB 3AP2A 3SJAA 3L8ZA 3AB3A 2MMCA 3U3RA 4P0TA 4TYQA 1F6BA 1W4BA 2KE5A 3U4QB 4KHZA 2Q3MA 1ZNXA 1IQPA 1TQDA 3QQ5A 4EJSC 1NJGA 2JLWA 1QHYA 1NSTA 2FZ4A 3CF6R 1QHGA 3IDQA 2IS6A 4ZKDA 2NMVA 3NTUA 4QNRA 1AQYA 2E87A 1WF3A 1Z0DA 3E2IA 2QMEA 2ZRGA 3CPJB 4OHVA 1OE0A 4QHSA 3W5IA 4P31A 1KDOA 2OM2A 4L9SA 2QAGA 1ESMA 2BMJA 4JJKA 2ASEA 4HAYA 2XGJA 5FOVA 4Q9KA 3TW8B 2B7CA 1RYHA 5G53C 2QU8A 4ZV4A 2C99A 1ZD9A 1J99A 1XMIA 3CF0A 2XB2A 3KTAA 2WKQA 2ZJ5A 1JB1A 3BB3A 4D4KA 2ZANA 3AKEA 3CX6A 4HB3A 5CIQA 5KSPA 3TR5A 4EQ6A 5KU1A 2VHJA 2X77A 2FF7A 3H4MA 2EFGA 2Z5FA 3IBYA 4MYUA 4ERNA 3LLMA 4EAQA 3FMFA 3RS2A 2IS4A 1NIJA 3SJZA 5BW8A 2CHQA 5FFMA 1TL7C 3VR2A 4IOMA 4PC6A 3QNUA 4Q7JB 4YMVA 1DARA 4DXAA 2X2EA 5DSZA 4DZZA 3GLHA 3QXXA 4RJLA 3RAPR 1VHLA 5EP4A 4C30A 2WSSA 1E2QA 1GP2A 4QGHA 1U81A 1OH6A 2JJ2D 5FBWB 2IW3A 1FUUA 3C14C 4PPQA 3W6OA 2Q9BA 3MWJA 1RJ9B 1KZ7B 4GRAA 2WTUA 3U3MA 4YONB 1N5IA 4C2TA 4JBWA 3ICQB 3DZDA 3PIRA 2C78A 1KO4A 2BMEA 4ZCIA 4Q4AB 4BLTA 1U99A 2O8CA 4XH9B 1WA5A 1EFHA 3R20A 1EXMA 5A5GA 2F43B 3SYLA 2WWYA 1YR9A 2IYWA 1DAIA 1E4VA 4LJ4A 3QOFA 1EESA 1CJMA 1SVMA 2ATVA 1R5BA 4BZXA 1CR1A 1W36C 4Y0VA 4IEIA 1UBCA 4TSFA 3LBIA 5A0FA 2H7VA 1SVSA 3RS4A 2ZU6A 1CRQA 4GZMA 3TSWA 2YV5A 3QUSA 3K1JA 4C0JA 1R0WA 2ZI5A 2QTHA 1IXRC 1DPFA 2DWOA 4WBSA 4HB4A 2VRWA 4PO1A 1XRJA 4PZZA 1E2IA 3PUYA 1T0JB 3DEFA 4IFBA 5DLQC 4X8LA 2RGDA 4QGGA 5IHPA 4GDFA 1GZSA 2UKDA 5KNCA 1U9IC 1BH2A 3GEIA 2EYUA 3UPUA 1UEIA 1CIPA 4GT1A 3H1TA 2V8OA 1GVNB 3OIVA 3IUYA 1WP9A 3WXMA 4LHZA 2YNMA 2QBYB 1Z8FA 3QF7A 4Q1BA 1K5DA 1QVRA 1ANKA 1KI1A 3A1SA 3CNOA 2ORWA 1OXXK 3D3QA 4A1FA 2ZJ8A 1KK3A 1P2TA 2HXSA 2KBFA 2QE7D 2ZPTX 3LQRA 4NBSA 1ZCBA 1ZU5A 1DAFA 1ZM3A 2PEYA 2ZYWX 3ZS9A 1D5CA 3ZZTA 2ZVQX 2OFOA 3THXA 3KQNA 4XWAA 1G5TA 3QEJA 3CR7A 1T3LA 3T15A 4M8NE 1SGWA 4A0RA 2B92A 4DSTA 3WBJA 4DDTA 2VSXA 2W2VA 4TZ6A 2OFXA 2VF7A 3P4XA 4BFWA 1Z08A 1Z63A 2YOFA 5JI3E 2SHKA 1HY3A 3BH0A 2H8KA 1SVOA 1KSHA 3MSXA 4LJAA 1UPTA 5GJWC 3GLGB 2ZQ5A 3K70B 1PVOA 4HAWA 3B60A 2QORA 3F8TA 3GMTA 1XEWY 2C96A 4QHTA 3ZDQA 1OV4A 2VO1A 3HU2A 1BIFA 3A4LA 1GL9B 4G1UC 4MGZR 2VF8A 1AJEA 1IAQA 3QXJA 4LHYA 4W5HA 1YZLA 4FXPA 3NEJA 2V6JA 3LBNA 4OI2A 4JVMA 2GJKA 1WRBA 1FZQA 2QAGC 3OAAA 2IS1A 4A8JA 5EXXA 4V0KA 2Z43A 5B57C 1WCV1 4B3FX 2LKCA 3CLVA 2AR7A 3M4YA 2WWHA 4LJ5A 2GZAA 3LAWA 4D80A 3KL4A 4EPRA 1UBEA 2GK6A 2DFNA 1JPNA 1IN5A 1XDBA 2XTNA 3WMGA 3QKSB 4OHWA 4OQMA 5DIFA 1MO6A 1QF9A 5FR1A 5FR2A 1XJQA 3OIYA 1F5NA 3NC1C 1P9WA 2A5DA 3QY0A 3W6PA 1KJYA 1T0HB 3JVVA 4PZLA 4DCVA 5JSZB 3LDAA 2K5UA 3LO5A 3RS0A 3EZ2A 4US2R 2J0UB 1K8RA 1YZTA 4MDFA 4MYCA 5FBQB 4DLXA 3FKQA 2W83A 3KX2A 2BCJQ 4TT3A 2P5TB 3L0PA 3I92A 4L8GA 2BBWA 4AY2A 4H1UA 2P6RA 2OEPA 4DEXA 1G8PA 2Q21A 5LBIA 1W46A 1D9XA 2QTFA 2ZSEA 1Y3AA 2REOA 4BPBA 1WBBA 2FSFA 1UKZA 2GXSA 4UNPA 4M21A 1YVDA 1XWIA 2G77B 4QBFA 4Q9LA 1T4GA 1YR6A 2RCNA 4HLUA 4JS0A 4NL4H 3L0IB 1H8HA 1NN1A 2PCLA 3WNBA 5GJBA 4JT4A 3HPQA 1SULA 1VPLA 1FQKA 3JZAA 1Z0JA 1I4DD 3BFKA 2PJZA 4MA4A 2AFHE 3BK7A 4O3MA 5JWRA 1OXUA 3F3YA 1UDWA 4FD2A 1KI7A 1VHTA 5ELXA 4PHHA 1G19A 1G64A 3KJHA 1JJ7A 2B8TA 1QVAA 4ZDKA 3JVUA 5BN5A 1P72A 1RZ3A 2A9KA 3HJNA 4HZUA 2VP4A 3LH5A 4MRNA 2GEDA 4TN1A 1GRQA 1IN7A 1QG4A 4PC7A 5D3MB 1KI3A 3CR8A 4O2RA 2XZPA 3ND9A 4HSEA 1SVKA 4L16A 4TQ9A 3RHFA 3GLFB 3W8NA 5CYOA 1G6OA 5KPJA 3A37A 4QHYA 3OE7A 1V5WA 2PBRA 4PFSA 5HE9A 2FEMA 4RD2A 1FNNA 3WBKA 3MAAC 5HPYB 2VBCA 2XTMA 3SS8A 3Q5EA 4TTPA 4YLGA 3UMSA 4A6PA 4NH0A 3Q3JB 4PQRA 4DB2A 3SJCA 4GSYA 3MRSA 3QKSA 1BOFA 5JLJA 4Q4HB 4TL7A 2D7CA 4M9ZA 2YWEA 1NNEA 1UBFA 3MWLA 4KFTA 2WJVA 4US1R 1JR6A 4I4LA 5FBRB 2ZRPA 2RAPA 3RRYA 3P4YA 2WJYA 3FOZA 2F1HA 1GFIA 2VLIA 1J8MF 1N5JA 3ASYA 3WNCA 2GKSA 1KO8A 5FPHA 3EX7C 1A4RA 4DCNA 4G5SA 4BZPA 4BFTA 4ACBA 2EYQA 4QGAA 3KFXA 1D9ZA 3U60B 3NVAA 4KXFB 4OK5A 4MKGA 1ZIOA 1OFHA 5LD2B 3CBQA 3NWJA 4AKIA 4B3XA 4TYWA 3GEEA 4HB2A 4LI0A 2IUTA 4V0ME 1JPJA 3PEWA 5L3SA 3Q72A 5IK2D 3DO6A 3VAAA 1FP7A 1Q3TA 2CCGA 2FNAA 2O0HA 1UJ2A 2Y8EA 5FPTA 5JRZA 4RD3A 1ZD8A 2GXQA 4B76A 1ETUA 4Q19A 1U9IA 3BJIC 2FSIA 3AQ4A 3C16C 3CRRA 4DB4A 2WWIA 3ZIAA 3REFA 1E1QA 2OSBA 2CHVA 1KNQA 3KQHA 3UXMA 2CCJA 3AM1A 2IF2A 5JJKA 3R8CA 2QPOA 1YZNA 3A1TA 1A5TA 4LCBA 1XCMA 1WBDA 2OHFA 1NVWQ 1OFTA 2FFQA 3C7KA 5TXGA 2ZU0C 1N3BA 2VPPA 3B6EA 4EPYA 3HYTA 2OCYC 2J41A 2ZREA 4IDOA 2IYLD 2F43A 3EXAA 3U4QA 4HB0A 3ZD6A 4I81A 4A2PA 1ZRHA 4JYBA 4B32A 1LY1A 1RYFA 3U7HB 1XCGB 3WY9A 2ZR0A 4POAA 3SU8A 3GLIB 2IC5A 2ZRJA 2O0JA 2C8VA 4JIMA 1ELOA 4PC2A 2OFWA 2H5EA 1CLUA 4JVNA 2PZGA 5FUWA 4CIDA 2ZS7A 4RD1A 4TZ0A 1L7VC 3DL0A 3GLHB 5TDHA 3FB4A 1HYQA 3RRZA 2R2AA 2ZRHA 3KFVA 3AVYA 2ZM5A 1WE2A 3GJXC 4EPTA 4PHFA 3QENA 4QXAA 4C0QC 1VG0B 5HCNA 1XMSA 1TF5A 2P65A 4W9MC 1OH5A 3QKRA 1ZUIA 2P0EA 1TPZA 4ZIRB 4TL9A 1K5GA 4PZYA 4B2IA 1FUKA 4BLQA 5E3HA 2YINC 1E9AA 3O8RA 1V43A 2E1RA 2GJ8A 3W3ZB 2D2FA 3BIFA 3I3SR 3U44B 5L3QA 2X1VA 3MWYW 2WKRA 1XD2A 3SQWA 1S1CA 3PITA 2Z4SA 3RWMB 5B58C 4CEIB 4E07A 1JQLB 4I1SA 4Q1FA 1KAGA 4Q02A 1YJ5A 2OBLA 3RS5A 4F4JA 3R9WA 1W4CA 3EIQA 1II8A 1DEKA 1W0JA 2F9MA 3G0HA 4F38A 1N5LA 2HUPA 1VYUA 2FU5C 3MJRA 3FE2A 3TIFA 3TSZA 4DLTA 1NBME 3TH5A 5KSYA 2WPDD 4TLEA 1XTRA 3WRYC 3K9GA 1NG1A 3NIBA 1LB1B 4WOPA 3OEHD 4MKHA 4TMZA 2AN9A 2FPKA 3X1YA 5H1YA 4TYPA 2VSFA 4I99A 1VCNA 2IYUA 2QQEA 3KJIA 3MGCA 3MG9A 1SXJD 2GBLA 3HPRA 5FTNA 2BV3A 2XZLA 3KQUA 2V7QA 4FINA 3PCRB 3HP1A 4MUBA 3V4FA 3KDSE 2WWFA 4V0MA 5EUQB 3IEVA 3U6KA 4B2LA 1OIVA 2B6HA 4FCWA 3E70C 2JASA 1IN4A 3EZ6A 4NYJQ 4HUQA 1I4LD 2KI5A 2KWIA 4MH0R 3C4JA 3PEVA 1GUAA 2ZI6A 1JR3D 4JKYA 5CLLA 4E5UA 3THXB 1U90A 3LXRA 1E1RA 1XEFA 2C98A 3LVQE 4ZPXA 3M1IA 3CUEF 5E95A 2A30A 4NP6A 3T34A 1OPXA 4MKIA 3AF4A 3IIMA 3VR3A 1NVVR 1ZM2A 4F4CA 4IOJA 3ASZA 3D8BA 1FTNA 2O5VA 4QRHA 1VKJA 3LXXA 1XD9A 4BFXA 2H92A 1N6HA 2A2ZA 2WJHA 4HUQB 3SC3A 3LV8A 1L4UA 3K0CC 4JVSB 2R44A 3NBFA 3MFYA 4DCSA 2YZ2A 2QY9A 1EX7A 4A0HA 4R71A 1GTVA 1ESNA 1LTQA 2Q9AA 3O8DA 4QOSA 5K8TA 1XF9A 3KKNA 4A8JB 721PA 2XXAA 3PEUA 4JJZA 2ZSFA 1FFHA 1RVDA 3C5HA 1E0AA 1LF5A 1SKYB 2J9RA 2GBLC 4X8MA 3K70C 2HEIA 1PLKA 4Q1CA 1II8B 4I1UA 4ABYA 2KJQA 3DOFA 3MCAA 1T3HA 2ZYTX 3AVPA 1Z6GA 3FVQA 4TMTA 4B44A 1KDRA 4XTCS 2ZE5A 1R6BX 2BKEA 4CRWB 2VYFA 3KQKA 4FMBB 1OFIA 1DVRA 2J45A 1OSNA 3G82C 4LJ8A 1VECA 4IVPA 3WP0A 3K9NA 1CJKC 5L3SB 3LBHA 5F9HA 4YXWA 1J90A 2ZYVX 4KAXA 1Q1EA 4PO9A 3FKSA 3VU9B 2ODBA 1LS1A 1M1YE 4YC7A 4IXMA 2OBNA 4A82A 1NJFA 5IDVA 1JR3E 1JR3A 1ZIPA 2VP9A 3IHWA 4QKQA 821PA 3E1SA 4PXAA 5AJXA 3NEYA 3THYB 1N6NA 2ORVA 1OIXA 4URYR 1Z3IX 1Q3HA 3UWOA 3EZ9A 4A2WA 2IUUA 5AUPB 3WYFA 1BMFD 4EIWA 1KHTA 1SHKA 2ANBA 3N2IA 4K46A 4HUTA 2IXFA 2WSSD 1LVGA 2Q0HA 5KNDA 3SFVA 3QEOA 1VG1A 4EPXA 4JL5A 5HR5A 3UG6A 1NVVQ 5EZ6B 4RZ3A 2ZEJA 2ZI7A 2RGEA 4W5WA 5H70A 3TQFA 1J2JA 1OT3A 3DMDA 3FWYA 3W6NA 1OYYA 4AKHA 2H1LA 4O25A 2PCJA 4LBVA 2KSQA 1Z6AA 4G3XA 2VHTA 4TWZA 2G1KA 1IY0A 1TUEA 1ZW6A 1D2NA 5CITA 1XTQA 3R7WB 1UEJA 1Z6YA 2CDNA 1NMYA 3GLIA 4LPSA 3UK6A 1N2CE 1BYUA 4HATA 1E9CA 3U3JA 2QRNA 1U94A 1W2HA 4QJ4A 521PA 4WXPA 3GLFA 3TLXA 3TQCA 4YDHB 2G1JA 2ORIA 1XTKA 1HQCA 3AH8A 2JCSA 3BE4A 2ZI3A 4QGFA 4OJQA 1E1QD 1AS3A 1JBKA 1C4OA 5CDFE 3GD7A 3B8HA 2FDCA 3RC8A 2GZDA 1XTJA 1G17A 2OLJA 2GEUA 2ZRFA 3ZS8A 1DAKA 4XWOA 3U6BA 2YKGA 3A8TA 3R8FA 4LPKA 2PH1A 2WSMA 2OXRA 2EFDB 3KQLA 2ZRAA 4JLOA 4Q4JB 1KMHA 3P32A 2GCNA 4AK9A 5L3RA 4YQFA 3CNLA 3U5ZB 4PO8A 2QE7A 3GJ0A 4PSKA 2WICA 4E09A 3Q8XB 4PAOA 2JJ1A 3CW2A 1RC8A 3DHWC 1P6XA 3C41J 5TARA 3BORA 2UZIR 2CE7A 4LJ9A 1E9RA 4WW0A 3T35A 2CBZA 1RW4A 1ZM9A 1DO0A 4AG6A 1NLYA 4AWXA 4ZCMA 3BOSA 2H57A 5J4VA 5C2JB 2FWRA 4WXRA 1MABA 1OHHD 4QNMA 2C9CA 3ADBA 1OHHA 2J0VA 1L2TA 2X2FA 1W49A 4FMCB 4V0NA 4EJSB 5GADl 2O0KA 3QPWA 4TTRA 2FFBA 1OIWA 3I5XA 2QENA 1E6CA 3C8UA 4URZR 5SZJA 1EK0A 3TE6A 3U3KA 2MSCB 2QGZA 2NIPA 1ZMXA 5K8IA 3SFZA 4Z51A 2QAJA 3DM9B 1VCOA 2ZUCA 1BO6A 1GKIA 2OILA 1HA3A 1KJZA 1ODFA 4OL0A 3QKRB 4A4DA 1DAGA 4UXHA 1JXMA 4OJKA 2IL1A 4CEHB 1FMJA 4HAXA 4GI7A 5EXPA 2W6JA 2ZSBA 4WZAE 1XU4A 2ZE7A 1EFTA 1NN5A 3L0OA 4IXNA 1XD2B 1CULC 2O8BA 4PQYA 1A82A 2ZRIA 4XOIA 2J87A 3EC1A 5F98A 3P26A 1ZC3A 3H84A 1Z2CA 2BCGY 1OYWA 2HV8A 1TQ6A 1DE0A 1E94E 1SQ5A 3DMNA 1E2NA 2FN4A 4HDCA 5EZ5A 2FFAA 2V55B 4NZYA 2ZJOA 3VR1A 2HXYA 3VKGA 3M0EA 4M1TA 4Z54A 1HH4A 3CRQA 5HKKD 3K09A 4Z1MA 1KGDA 4D0NA 3BWDD 5J4LA 1P60A 1XBTA 3GLGE 1EGAA 3QJYA 3RNLA 2WZQA 2YHSA 2OT3B 4Q1DA 4B33A 1ZP6A 3UMFA 3TK1A 1M2OB 1KYIA 2V1UA 4EDHA 4QC2A 4G5QA 2JJ8A 3KZ1E 2H16A 1N25A 2QSYA 1R2QA 1OH8A 2J0SA 4II7A 2V4ZA 1TEVA 3ETLA 1KO1A 3EZ7A 1R7RA 2DFKB 1QHNA 4A36A 2PX3A 4Q47A 4BLRA 2BIFA 2J7PD 2WMNB 1G18A 2NTYC 5FOXA 2HYIC 5EE0A 1KDTA 1E1RD 2BJVA 1ZNYA 2ZR9A 5AUQA 4BLPA 2GA8A 2RGXA 3NH6A 3RYTC 2V54A 4PSVA 4Q9IA 1S3GA 1C1YA 5JS7A 3SI7A 1ZUNB 2RHMA 4U5XA 1AIPA 1HT2E 4M1WA 1QHSA 3ZVNA 4D4MA 2DYKA 1DG3A 1OXVA 3RRMA 3RSOA 5CK5A 2VP6A 1Z29A 2XB4A 3AKYA 1UDXA 2X8AA 5C1BA 4QFMA 1MR3F 5C4GB 3AF0A 4UJ3A 8OHMA 1RFLA 3TSOA 3V00A 2OV2A 4JLAA 1G6HA 2QP9X 2QP4A 1T5IA 4UXIA 1P4SA 1YRBA 2NPFA 3CM0A 3OZXA 4ZCLA 4GBMA 4CDGA 1E2FA 1ZVQA 2PL3A 1KJWA 2GETA 1P7CA 2PMDA 4NTZA 2EU8A 3IBGA 4LX0A 3AVUA 1W4RA 4NPHA 2B8WA 1T8UA 1XPUA 4NYIQ 3BFXA 1SVWA 1R8QA 1U0HC 1LF0A 1UKYA 1D2MA 2F1JA 1Q44A 3ND8A 4LBZA 2HF9A 1M74A 5UKDA 2HT1A 2VP2A 4OI1A 4KU4A 3QVUA 2IYSA 4C0HA 2FH5B 2QT0A 3IHLA 1KMQA 4KI0A 3A36A 4MRPA 1XFAA 1JEEA 5KNBA 1JNYA 4EFMA 2C77A 3I5YA 1MRNA 5FOUA 1IOZA 1K6MA 5FOTA 2IYVA 4TLDA 421PA 3LNCA 4IHQA 3VTKA 1ZM4A 2CHGA 2IBMA 4XD7D 3E5HA 4FMCF 2V3CC 2RGBA 1VG9B 1G7CA 3I8XA 4C9BA 1OLOA 4B3BA 1UKEA 1TU4A 4NKRA 4QM6A 4B73A 2WAXA 2GXAA 1ZYUA 4LYAA 1DAHA 5B2ZA 3SHFA 3T5GA 2GDJA 2N42A 2QMOA 4A2QA 2CL7X 1M7GA 2ZUBA 4DLVA 1YKSA 2AD5A 3AVXA 1B0UA 2ZRDA 1XXHA 4PPGA 3EAQA 5LB2A 3X2SA 1M7HA 1NMZA 4DSNA 4FIDA 1T9HA 2N46A 3CWZA 3GJ7A 5EJEA 1DADA 2WOJA 1MRSA 5TMPA 4RFVA 1KI6A 4OI4A 3QPUA 2EFHB 4Q1EA 2A5YB 3I61A 2GESA 3B7GA 1BS1A 3N2EA 3EPHA 1CU1A 4GL2A 1TTTA 2D62A 5FUVA 1UF9A 1E0KA 2GCPA 4DLRA 3DM5A 1LS6A 2HJVA 1E9FA 4XSHA 1WMSA 1G3IA 1N5KA 2GJAA 1E2EA 2WJIA 5LB4A 1SKYE 4CEJB 3SR0A 5JECA 3TUJC 4XVQA 1T8TA 5JI2E 4LHWA 3CRVA 4B74A 3UMRA 5H68A 2WWWA 2OAP1 3BB1A 5CLQA 1JXOA 1SKQA 4P4SA 2DWPA 1WDTA 2J46A 1A2KC 1QRAA 4OHZA 1YZKA 3T1VA 4A9AA 4DC9A 1M7BA 4P32A 2DBYA 2FEOA 4D2IA 4QBGB 3B5JA 4D26A 3K0AB 5TB5A 2GAAA 2OUKA 3IO3A 3A6PC 3DOEA 1IN8A 1FPMA 2AL7A 2WBLC 3THYA 2D7DA 4B6FA 1KIMA 4C0SA 3K0FB 3AF1A 4LHVA 3U7FB 3T61A 4URXR 2JLYA 2W0MA 3EC2A 2AK3A 4NE2A 4EUNA 4P4SB 2X19A 4X8OA 3D31A 3NDPA 4BFUA 4MQBA 4HAUA 4M9QA 2P2LA 2AK2A 1S9HA 3NHBA 1KNXA 1VMAA 1JAIA 3LRPA 3HYRA 1ZNZA 2XX3A 3U3OA 2IT1A 1MT0A 5SZKB 4BE7B 2XITA 5K8UA 1M6NA 5JEDA 1XTIA 5JSZA 3S1AB 1NP6A 3NHAA 2GEVA 3AUXA 3W90A 2P6NA 1CR2A 2ZI9A 5FPKA 4PTLA 2FE4A 1HE8B 1KO5A 2ANCA 2HJGA 2P3SA 2ZJZA 2CXXA 2ONKA 3CH4B 3QKTA 4Q03A 1G291 4DLUA 4KLNA 1F3OA 2REBA 4GMDA 3I4LA 5SZHB 5JBQA 3QF4A 2FJUA 2GAOA 1MABB 4L15A 3OFND 4IW3B 2IYXA 4DLWA 2W0SA 3SNHA 1OXTA 2QL6A 4DCTA 1XP8A 5G3ZA 1P9NA 1NG9A 4D25A 4LC1A 3RS3A 3R7WA 2YYZA 4HYYA 4ZI2A 5P21A 3JZMA 2FOLA 1Z0IA 3QBTA 1XZQA 4QBHA 2ZRKA 2QBYA 3OF5A 5GJVC 2QROA 4XJXA 5EP2A 5FBLB 2OCPA 3PG5A 5HZKA 3VHLB 1NLFA 1T5LA 2AX4A 4LV6A 2F1RA 4TL8A 1F2TB 5D3QA 4ASUA 4U7DA 1EWQA 4PC1A 5L3VA 3HR8A 2ZIAA 2WIAA 4ARZB 4DSUA 2WJGA 4DDUA 3FTQA 1N6PA 3ECCA 4KV9A 5G40A 4F7WA 2EWVA 2WMOB 2WHXA 1E99A 3T1OA 5B64A 4WAUA 1KKMA 4DWJA 4LZZA 2GRJA 1AKYA 1ZBDA 1I2DA 3QXSA 3U7GA 1N0WA 5AR1A 1QHIA 3EA5A 1ZCAA 2F3RA 2J0UA 2OZEA 1VDZA 3QSYA 4KCGA 4FWIB 4D0GA 4NYIR 2YOGA 4IDPA 3VX3A 1G3RA 4YDSA 4ARZA 1TF2A 3U61B 3AVTA 2RGGA 3SBEA 1FL9A 3LD9A 3AKCA 5AWFC 3GLHE 2LWIA 4Q9HA 3FMOB 2F3TA 2P6UA 2A7QA 5DI3B 1GILA 2A5GA 1KO7A 3A1WA 1XEXB 3OFNA 3UWKA 1AGPA 1XX6A 2BEKA 2XSZD 3WMEA 4AURA 4EPVA 2ZXUA 3L0SA 5H8WA 1R5OA 1U8AA 4Q48A 1Q12A 3VU9A 3U2QA 5JRJA 2FG5A 4OQXA 3HU1A 3B82A 2Q3FA 2IK8A 3QF4B 1QHHA 3J81k 4LDJA 1R0XA 1G7SA 1S9DA 4IDHA 2VQSA 3GQBA 3TR0A 2C9YA 4AYWA 2O8FA 4N0DA 4Q4LA 4LV8B 1IY2A 3NDBB 4DDWA 1E2HA 3CNNA 3RWOA 1COWA 1W48A 4N1AA 5JCZA 1D2EA 1COWD 2YOHA 1NI3A 2R62A 1A2BA 3IKJA 4B47A 3GJ8A 4US0R 3ZJYA 3VKWA 2YWGA 4TT3D 4C2UA 4YMWA 3SDZA 1QHHB 1E2KA 4JYCA 2BJWA 1QHXA 3G5UA 3VR6A 1KI6B 3REGA 1SHZA 2JGNA 1KOFA 2CLCX 4F92B 2AFIE 1OKKA 1TMKA 3RSLA 1CBUA 4RFSA 3TGPA 1SZPA 1YZQA 3EIEA 3CIOA 2Q3HA 2D06A 2ERYA 1YZGA 4LGMA 4MUAA 1U8ZA 4OK3A 2R6FA 1YU9A 4BQSA 5C18A 3AF3A 5CJ2A 5E7IA 3TUIC 4BECA 3GFOA 5GVSA 2FSGA 1P61B 2G0NA 4B34A 3PXGA 3T1QA 2BVNA 2ZS8A 3A4MA 5JMTA 1TU3A 3PQCA 3B1ZA 4V02A 4A8JC 2ZYUX 1Z6TA 4TQUS 1W47A 3EARA 2OBMA 1AQUA 1YQTA 4JLMA 2PLFA 2VH5R 1VIAA 1Q22A 1ONBA 1H8EA 1H65A 3AEZA 4MKFA 1EFUA 1KDPA 2HT6A 3NG1A 4LYJA 3CX8A 4DLSA 5IF9A 4KO8A 2ZTSA 1UADA 3T12A 3PR1A 2R6GA 621PA 1VG8A 3DKPA 2JLRA 2BBOA 4K8OA 3ONWA 4GFDA 2D3WA 3BBPA 3NBYC 4HDOB 4RD4A 3ZH9B 4TYNA 3OEED 4N3NA 3RRNA 4B43A 4U02A 4J0QA 2BC9A 4MYHA 2W6ID 4TL6A 6Q21A 2RGCA 2W6IA 2BM1A 3C15C 4C0KA 1WQ1R 4QJ5A 1XMVA 4URUR 5J47A 5DN6D 3LW7A 1DAMA 2JIZD 1IM2A 1F2UA 2WAYA 4GOKA 4ON9A 1DG1G 4GOXA 3LX8A 4LY6A 3W8RA 2VA8A 5KYKA 2JLXA 3RANA 2FA9A 2BBSA 4PAQA 2JDIA 3B1XA 3B9PA 2ZETA 4JLNA 3D6TB 4Y0AA 3VR4A 4QG7A 2JJ1D 1ZINA 1KI8A 4NYMQ 4ZDWA 2H18A 1IJFA 5FOWA 1AS0A 4ZDIA 2QM8A 4Q7MB 2JATA 1P2VA 1E9DA 4AYXA 3Q9LA 2IUSA 2KBEA 1PUIA 2JLQA 2NO0A 4KYIB 3K09C 4CZ2A 5C4MA 5FTLA 1Z0KA 4DT1A 2NO9A 1NN0A 4NYJR 1OW3B 3KKQA 2N1BA 3B1WA 5FTJA 4KBGA 2XOKD 2QMHA 3CH5A 4KVAA 4KSCA 1VCMA 2ODNA 2PX0A 3I72A 4JBXA 1XXHB 4AC9A 2F55A 5IK2A 2XEXA 4WZ6A 4BASA 1P5ZB 1I4TD 1S8FA 2QN6A 3BAFA 1HTWA 5AJVB 3ZVLA 1PLJA 4LJ6A 2MSDB 1KI9A 3IGFA 2IS2A 3FDIA 1XD8A 1GDDA 1SXJE 5FTKA 2GK7A 2J59A 3IEUA 2ZRLA 3PJRA 5J5CA 1Q1QA 1X6VA 4LOAA 1KK0A 3Q5DA 3LY5A 4XVUA 1TEXA 3EPJA 2O8DB 1W2GA 3ZGXA 1II0A 2CLDX 4PHTA 2IYZA 2EQBA 3L43A 3SJBA 2ZJAA 2WV9A 3THWA 1NY6A 4B6EA 2D2EA 3QE0A 2WPDA 3PUZA 3SOPA 1BMFA 2AXPA 4G5GA 4DVGA 2JLZA 4JKIA 1CJVC 2ERXA 4KFRA 2IWHA 3OIUA 1IBRA 4MRRA 3QXHA 2P5SA 1U98A 2CL0X 1MKYA 3LA6A 3SYNA 1G4UR 1UBGA 4MDEA 1KK2A 1SXJA 1EWRA 2VHUA 3HU3A 4A0GA 1U8YA 3LLUA 3MLEA 3QG5A 5DI3A 3VMFA 1XEXA 1E2PA 3AVQA 4LHXA 4C0LA 2PEZA 1Q20A 2AKAB 5CJPA 2OLKA 1UFQA 3UG7A 4Q21A 3EIHA 3VNUA 3O8BA 4LSGA 1FTSA 4D4LA 1GKYA 4ASUD 4RCYA 5TVKA 2C03A 2J5XA 3WMFA 5BN3A 3IPYA 2QG6A 2BDTA 3F0TA 4IEEA 4B3DA 3GCGA 3TBKA 3AUYA 5EQTA 4CF7A 1P2SA 1ZAKA 4CEIA 4OQNA 3VR5A 3GJ3A 2ZSDA 1E0JA 4DT1B 4YMTA 5J4YA 4M9SA 3N70A 1EFRA 1R0YA 2I1QA 2JLVA 1MO5A 1EFRD 2GF0A 3A4NA 2JEOA 3QBVA 4Z8YA 4HEJA 4RD0A 1P62B 2QZ4A 3K9HA 1ZM7A 3CF2A 5JZVA 1AS2A 1JI0A 3LFUA 2ECKA 4C0BA 1F60A 5AJZA 3A58B 4UQOA 2JA1A 3RVBA 1YR7A 2XNDA 4DEYA 1CR4A 1HUQA 3X1ZA 2XNDD 3I32A 4NCIA 1T3SA 2BMFA 5JHHB 3KXKA 2OAQ1 3I8SA 5JJLA 2AWOA 4NONA 2GTPA 2XSZA 1X1RA 4HLCA 2NQ2C 5DNYB 3SZRA 2O8DA 2VP5A 4M4SA 2REXB 5DGXA 1IY1A 2I1VB 2R6AA 2GCOB 3NXSA 2G9NA 1G21E 2C04A 1GNQA 1XNJA 5G41A 4UNRA 4EJSA 3ZZ0A 1NVXQ 2B21A 5KDLA 5FI1B 4KSBA 5GJCA 2RMKA 4O0MA 2QAGB 2PZEA 2ZROA 3KKMA 1X1SA 4EFLA 1BYIA 1TX4B 4OBEA 4ZIRA 2J7KA 5KOYA 2CJWA 1Z28A 3F5FA 5IRCD 5AK0A 1Z5ZA 1NSFA 1N6IA 2ZUDA 1G8YA 3GFPA 5DYGA 1XJCA 2RGNC 4IOKA 1TADA 2RH5A 1RRCA 2NOAA 4XVRA 5HCIA 2AKYA 2GF9A 3OAAD 4LYFA 5DE3A 5EUMA 1WB9A 2IXEA 1E4YA 1N6OA 4M1MA 2G3YA 2I4IA 1S2MA 3ICEA 3ADKA 2CVFA 2JLSA 4BFSA 4BFVA 2CE2X 2WWXA 4AYTA 4HI0E 1IN6A 3NKVA 1DTSA 3VFDA 2FGJA 2C2HA 4TMVA 4HZUB 5DHFA 5KPDA 1DO2A 1NBMA 5TY0A 2F7SA 3L8YA 3THOA 4JL8A 5EP3A 4B2PA 4BLOA 4DJTA 4DLYA 3OESA 1X8JA 2ATXA 3AVOA 4AKGA 4CEHA 1FP6A 3CX7A 3W3AA 3IIKA 1S4QA 1F48A 4UJ5A 3VKHA 4B3GA 2ZVPX 4F91B 4FN5A 4F93B 2MSEB 2IYQA 3V4RA 2JAQA 2PZFA 2BBTA 4ITRC 5KDDA 4Q5IA 1LNZA 2C9OA 5CYPA 1IJEA 3B13B 4NMMA 4N0EA 1VYVA 4PPFA 3TAUA 3AP3A 1KSFX 3BS4A 3SE0A 4URVR 1S1MA 3PFIA 3TNFA 3HDTA 1KZGB 3CPEA 4AD8A 3PEYA 4Q4HA 2OG2A 4KLZA 4PX9A 4KBFA 4JLDA 2ODEA 2Z4RA 2DHRA 4JT2A 1O3YA 1E9SA 2V1XA 1E9EA 4YXWD 3HR7A 2HLDD 1IXSB 1RKBA 4LBYA 2XNSA 4OKSA 3RS7A 3WHLA 4M1OA 2XAUA 3K0CA 4Q01A 1DAEA 1E2JA 1XCPA 3K8YA 3KB2A 2VIIA 4EQ6B 4U00A 4RZ2A 4GZLA 5DYIA 1WXQA 4M1SA 4YMUA 3RDPA 3KXIA 4Q00A 3GPLA 2AD1A 3SEAA 1OF1A 3SBDA 2JDID 3ZVRA 2PJRA 3TKLA 1KY3A 1J70A 5HZHA 3CONA 2DY1A 2TMKA 4LRWA 1US8B 1Z22A 5FPSA 1S3SA 1CP2A 3A1UA 3BD9A 3P20A 4R9UC 1N0UA 4M1YA 4B71A 3WNDA 1N6KA 3DKVA 1Z0FA 5DISB 1Q0UA 5FH9A 1AZTA 4LK2A 5FTMA 5BWMA 3EZFA 2HCJB 4B75A 3PV0A 3UATA 2ZE6A 1FW6A 4DLZA 4HZIA 1NF3A 2G83A 1PZNA 2AHOA 1W5TA 4GP7A 5EE5B 2VL7A 5DO9A 1Q21A 1NL3A 2GJSA 3K70D 3RLFA 1TF7A 1AGRA 5GVRA 1IXZA 2NGRA 3O8CA 3L2OB 4IRUB 2XOKA 4H9GA 1GNRA 4LJ7A 4XWKA 5HE8A 2ZJBA 4RSGA 4MRSA 1E2MA 1X8KA 1XB2A 4HAVA 4R98A 2V9PA 2R8RA 3L82B 1E9BA 2GWHA 2WWGA 3B1YA 1HT1E 4I1VA 2GJ9A 3QXCA 5FI0B 4DUGA 1RE0A 1Z0AA 5JWHA 3IQWA 3UANA 3SQXA 1H8HD 1KSJA 1NVUQ 4CGZA 2HCBA 2ZR7A 1MH1A 3QPVA 1QZXA 4IVRA 2I3BA 1XZPA 1FNMA 1D6JA 4TLAA 4M9XA 4TTQA 4B48A 4RVCA 2BWJA 3BRWD 4HAZA 3FHTA 1GOTA 1YRAA 2VTKA 2ZAMA 3EWAA 3FMIA 1W0KA 1W0KD 3GLIE 5AJYA 4GOJA 1IONA 2ZSAA 3N5CA 3IPXA 4DCUA 2QNRA 5BN4A 3W34A 3QG1A 3T5DA 4M0LA 4DIEA 2NZ8A 5KSOA 2QSZA 4DBLC 2DWQA 5FBVB 2EVWX 1P3JA 1F2UB 3KKPA 3WYAA 1U0JA 2BHRA 2O8EA 2FMXA 5G3YA 2BEJA 4GNKA
chains in the Genus database with same CATH superfamily
3Q0IA 4IMJB 5D6OA 4DQKA 1W7AA 2VJCA 3RVOA 4LC9A 1ZH2A 3OO1A 2J3EA 1YE5A 3DLIA 3OIFA 1EDDA 1JIIA 3PB3A 1FCJA 4PGFA 1U7HA 2O50A 2XOXA 5K0ZA 4DC1A 1E7MA 3RAFC 1MOZA 1Z06A 3TJZA 1ZK3A 4JLVA 3DZCA 4NOMA 4CLOB 3EOAI 3Q85A 3RLIA 1LPSA 2CXUA 2HK6A 3NC0C 2QF7A 1Y1TA 4RD6A 2P4HX 4I4NA 3UAOA 4LJYA 4WY8A 3QP9A 1NONA 1SPBS 1ISRA 1V3TA 2EWWA 2I34A 3B1VA 3INYA 3QWFA 4OQFA 3P7MA 2FSPA 3LOQA 3ROKA 3K0FA 1O0CA 1EK1A 3I5AA 3WADA 1TUBB 1ORTA 1W88A 1KOJA 3E9ZA 4KP7A 3RC3A 3CKLA 4DKXA 3KEMA 4KQ6A 1SK9A 3AF6A 1BXZA 2YJTD 1JEDA 4J0FA 4LECA 1EB8A 1ETHA 1F9EA 5ELLA 3SVZA 3LZ6A 4OPMA 1Y1PA 3RIGA 4S1OA 2GLXA 1L4HA 3DV0A 3UB3A 2XCOA 2MR6A 2RGAA 2GGSA 4O08A 2XODA 5HKLA 1E89A 2HMYB 2PE5A 1XZJA 1R8XA 5LA6F 1MZPA 4L6AA 3NAMA 3CLTD 3Q2IA 1OAOA 4HQOA 4RFSB 1OXSC 4G0NA 3IIJA 5E9QA 3AEQA 1EM6A 2BDUA 2Q4TA 1NHWA 3JQEA 1E9VA 1CNMA 2WM3A 4MUIA 1ESDA 3EH2A 4RTQA 1V0JA 4TS9A 2ONYA 3WNQA 1EH5A 1QBKC 4OOEA 4QWWA 2IX3A 3U5TA 4ZTBA 1M8PA 1X1TA 2VBIA 2WTMA 3ANNA 3QPBA 4JA2A 1H5NA 3N0TA 3STVA 4DIDA 4QJ3A 3IT2A 2WSYB 4OF4A 4JB3A 2IY8A 1AZLA 1LW7A 2RG1A 1FQWA 1NSYA 1SRRA 2O7VA 1GG2A 4OGLA 2Z0MA 3L4BA 4UFNA 4ENPA 1JFVA 4OMFG 3SKYA 5HKKA 5BSEA 1NLMA 4DYVA 16PKA 3IV9A 3GJ5A 1FFXA 1I51A 1IHXA 1XJ0A 3EK2A 1TRHA 3QVTA 2A1TR 4H7FA 4JH0A 4V03A 2A94A 5ETJA 4I5DA 3BIXA 5EESA 4Q4CA 4WBNF 3KSDO 3QV1A 1O97D 1JL3A 2IU6A 3QBJA 4NC9A 5CH8A 3FVVA 3VKUA 3BXZA 2WTNA 1VXRA 2ZAOA 4GP6A 4HQ0A 2BTEA 3EA0A 5AJWA 2GVDC 1E2LA 4R7GA 3U4GA 3DLHA 2BOVA 3LQ2A 3PX7A 1BW9B 1JQAA 2WJJA 3FRIA 4DV0B 2IF0A 1BXRB 3BGOS 4G2TA 4BVEA 4XVHA 1NUSA 2CVHA 3DAFA 3IMKA 4L5BA 5I7SA 4B7AA 2VJBA 5KHOC 2BGWA 3OIWA 1O4WA 1UQUA 5LLSA 1XEWX 2C4WA 1UT6A 2GVZC 2RARA 5AHWA 5LXTF 4BOYA 5K2OA 3NBUA 2O2IA 1OXMA 2XVAA 1WKBA 2Q1WA 3FJYA 1GRRA 1YOVA 2AA3A 2BMWA 2DCUA 1EA5A 1YQEA 3B85A 3FOBA 2ADMA 4A0FA 4FW9A 4QRIA 3AI1A 4PF1A 1S02A 2DUMA 4Q7LA 3DDOA 3RUIA 4I2VA 2K6GA 5BV0A 4Q37A 2UZ3A 2ZYSA 4JI0B 1NWHA 1CDOA 3ST7A 2AI2A 1M67A 1E79A 2QD2A 2R5FA 4QPPA 1NDUA 1PUJA 5FL7A 4EFNA 3H4IA 1OLUA 4MV5A 4BWVA 1SXIA 4FE7A 2AWNA 3ADOA 4IV0A 3TEFA 4CM6A 3ONDA 1X19A 4BLSA 5CXUA 4GMGA 1O96B 4FI3C 5HNKA 1XDWA 3KVRA 2ONJA 3C3WA 3V9AA 3QLUC 1QZZA 3W5SA 4JIGA 2IW1A 2CWWA 2PA0A 3A2KA 3LBFA 4PN3A 4A5SA 2A14A 4PIMA 1UKCA 1NW3A 3PL1A 3VR6D 1GARA 2Q9CA 2O20A 2DT5A 3VJMA 5JYEA 3S1AA 2PIDA 4PCVA 3OOSA 1FX0B 1FVFA 1UAYA 2GXUA 4MI9A 3PC7A 4ER6A 1JIVA 4TMKA 4F2PA 5I7HA 3YASA 4BEJA 2V96A 3KB1A 3ZTWA 2LIVA 1QH1B 4Q3KA 5C1IA 3KHSA 5B37A 4LFCB 4BMCA 3G9TA 2OCBA 1JQKA 3WAJA 1RFGE 1G41A 3TRFA 4FFVA 4BZQA 2VN8A 4JJEA 3G89A 3C5CA 4HR7A 2QZ9A 4Y1GA 2FTKE 1MORA 3ABSB 4UC0A 1GIAA 1VJTA 4XQGA 1B42A 2GD1O 2X1HA 3IE0A 5THXA 3PD1A 2L19A 1HV8A 2A0YA 3ASUA 3BWYA 2HNKA 4H7JA 1JHUA 4RO0A 3KQPA 2FW9A 1DXYA 2DAPA 2HSZA 2J1LA 2H4ZA 1H5UA 2WMDA 3MK31 4P58A 3CH6A 4E03A 3R6WA 3KTAB 3OJXA 1W1WA 3EVCA 5FWYA 4YHHB 2OE2A 5CB8A 2FW7A 4BQEA 1H4VB 1SCBA 5KOHB 1R0LA 2FSVC 2C0CA 3EYWA 4WJKB 5A4JA 3U4DA 1TZKA 2IHVA 3R0IA 2EBFX 1C4KA 2HA3A 5B1DA 2WM9B 3ZW9A 4BRUA 4ZI7B 5JY1A 4HX5A 2HO5A 2NLOA 4TLMB 4Q7EA 2FKAA 4B85A 1G16A 4RSRA 5CA0F 4RTKA 3H1FA 4HX9A 1I8TA 1NRJB 2Y1DA 3B3FA 3IBFA 1C3OA 5A7GA 4ADSG 4CU2A 1SUPA 3M6LA 1QFJA 3UFBA 1VCIA 5FQOA 4DPKA 3OU2A 3FNEA 1HFJA 5AXBA 3WYDA 3B51X 4O4HB 3WK9A 2R6JA 2HWYA 1DEAA 4ZQIA 4QXOA 2O8FB 1Y9JA 4IJMA 4BNZA 2DETA 3AHJA 1GU0A 3BFVA 3KG2A 3LYAA 3NP7A 4WY2A 1SQSA 1M34E 5ER6A 1X86B 3VR0A 4LE0A 3TXXA 2XY4A 1PLLA 4UM7A 4DZRA 3OZGA 2P9ZA 4FZ5A 1OB2A 2NO1A 4NXMB 3OE4A 1ZGBA 2W98A 1G3UA 4ZO4A 4BNTA 4O29A 3K32A 5A4KA 1TM5E 4G6ZA 4HH4A 5DP1A 4RZUA 3VVCA 4DLNA 3O9VA 3DL4A 4LY0A 1TO6A 3R7AA 4JUFA 5HF9A 4DDVA 2E4XA 5BVHA 4C7OB 4LC0A 2O3RA 1K4YA 5E2AA 5U9CA 5GIOE 3CR3C 3H8WA 4MIKA 3W7AA 4HLDA 3RV3A 3NUQA 1QMPA 4QQKA 4RHYA 3KPJA 4Y2TA 3RJ5A 4AI6A 3N3BC 2AFIB 1EQUA 2RGYA 1DT5A 4X9XA 3ZD7A 1W4ZA 1E7RA 1N7IA 3SDSA 3TXYA 3O75A 2YASA 5DTMA 3ZHTA 1CEEA 1XNHA 3SJ7A 3WLFA 4OQZA 4Q15A 4RKFA 3EPLA 3HKCB 4WK6A 3QA3E 3UA4A 3I39X 4DHEA 1WQ3A 3IQEA 1CY2A 4YS6A 4IS2A 4KQHA 3WL5A 3F3MA 1G8HA 4DRZA 4MDHA 1DX4A 1JJVA 1XDZA 2A78A 3KR2A 4BFZA 4H1WA 3D8TA 2YMQA 3UH1A 3N6VA 2NO7A 4FJ0A 1EUDB 1D8TA 2CGEA 3U3ZA 4J29A 2BZ0A 2QNBA 4A03A 4JI2B 1SG0A 3KKOA 3O4RA 5K8JB 2WFMA 3HZHA 3ONNA 3AVWA 1GNPA 2ZSHA 1P73A 3K5PA 2ZVDA 4FGWA 4WHMA 5LZ8A 2FY8A 2YJ6A 3I6YA 1U7UA 1MV5A 3ZCTA 3L4EA 4CUJA 4GBJA 5COQA 3FMPB 4AG5A 4XJTA 1II9A 3FYUA 3BGWA 5JS8A 5IN5A 1LX7A 2JIZA 3FGNA 3L4BC 1P2GA 5DHAA 5TPWB 3ZCRA 1R6DA 5I4IA 1ONPA 2A8YA 2X5JO 1CRPA 2CLOB 1EE9A 4L5IA 4R2HA 5L4LA 2QNIA 4WEOA 4PBSA 1N6LA 3CZPA 2BFEB 1P45A 3LHDA 4KYUA 4I8IA 2YHUA 5KSWB 3K0AA 4IIDA 1OVGA 1A1VA 1T5OA 4QL3A 3NM6B 4QTTB 1CR0A 3FWPA 5U4XA 2W4QA 3U7IA 4D4JA 1W94A 2P4EA 2V6BA 3OEHA 3NFRA 5KNBH 3KBBA 2QZPA 5IWCA 1J8YF 1XTZA 3II6X 1KSGA 1MX1A 4D6PA 4N54A 3T41A 1PZXA 3W7VA 1HEIA 2XUHA 3FZEA 2PLWA 2OHVA 2VJAA 1JFTA 1EBFA 3WK5A 3UVEA 4ZTZB 1R4MA 3S2GA 2X7HA 1K6EA 1SBQA 5DI9A 4DV1B 3SF8A 5T3YA 4ZEOA 1UWVA 3L8CA 4WN9B 1M2KA 4OHOA 3PR2B 5GOZA 4DSZA 4EO4A 4BXOB 4J7XA 3CRMA 2RBGA 4BBZA 5J4KA 4KFCA 1FPQA 2VDWA 3QEMB 5SYMA 1TIPA 4L95C 4R2IA 1XROA 1QO0D 2P2SA 2VP0A 4QSMA 1QANA 2BMAA 2FSHA 4ND7A 1LV8A 4V3BA 4KIWA 2O8EB 4FDVA 4W5OA 2XD4A 3ZKWB 4CF3A 4FCTA 2QM3A 1P9RA 2RHGB 3HCRA 2I6GA 4LQLA 3DBHA 1QLHA 1XT6A 3K0EA 3LA8A 1U2QA 1TVKA 2HA2A 3TLKA 1MJHA 3NUZA 1JH8A 1NBEA 1GAJA 1DXQA 2NTVA 4JB2A 2PM8A 3DPUA 1VI6A 5FB3A 3RVLA 2PX4A 1GKUB 2VNIA 4M8SA 4U7HA 4C43A 5CEEA 3IULA 1IHUA 2EQ5A 3QYJA 4KNVA 1W36B 2OXIA 3WQBA 3BILA 3DFUA 3KO8A 2OORA 3VC7A 4J07A 1QDLB 5HJ2A 3BC1A 2GAIA 5K3OA 4MYTA 5E4FA 3NHWA 2R9VA 1ZNWA 3DYIA 3EASA 3HEMA 3INTA 4O59O 3IEVA 1KTVA 3WOVA 3DVLA 4XOUA 3UW1A 4TVKA 5TNXA 4JP1A 4CV0A 5A02A 5JMWA 4B6JA 1ORWA 3PVZA 1AGXA 3ZE2B 5F9FA 2YNMD 4D79A 1E98A 2P62A 4DNQA 1CYEA 2VI5A 1CJUC 3BN3A 3LHFA 3SQLA 4CLXA 5ALYA 2F4NA 3PGLA 4QLOA 4GMHA 2ZIUB 3F90A 2O1EA 3OLYA 5DKFA 2BT4A 4FOSA 1Y9DA 4G36A 4P84A 1JDSA 5DW0A 1XAGA 3SG0A 1V7PC 1HX7A 1CD5A 1GQOA 2O2SA 4OG2A 1QP0A 4NAUA 2YL2A 4WCFC 3D3WA 4Q6WA 2JI4A 3HADA 4GLBA 1ML3A 4FU0A 5JFGA 1TAGA 5EXPA 2R00C 3D3JA 5JXHA 4MOWA 5DXFA 4UOQA 3EN0A 3IALA 1T2VA 3GCDA 2X9LA 5JU6A 3IH5A 1A7JA 2FGKA 3JALB 1R10A 1GPMA 1NNLA 4DSOA 3L84A 3EXFA 1XLTA 1XHFA 4LI3X 4D3ZA 1OAKA 1OC2A 3WAKA 1NIPA 3OHMA 3TUZC 3PRYA 3M5CA 2DPYA 1WU8A 1GZ4A 1DQYA 2OCAA 2HLDA 1MIHA 2Z4TA 3A28A 3IP9A 4IUBS 5FL7D 2UUBB 3MAGA 4WXHA 2C9ZA 1MC4A 2IUEA 4K28A 3ROMA 1KK1A 3IO5A 3SF8B 1SELA 3N0VA 4E22A 2JFYA 5BRAA 1YR8A 2ZUFA 4JLPA 4WZAA 4UTNA 4DA9A 5HILA 3MGAA 3NXKA 3RK0A 1PJ4A 4L2IA 5IJ9B 2E4VA 3TW4A 1CHNA 3BIWA 1U5CA 3IMGA 2K7ZA 2FPPB 5AW9A 3ZHYA 3GJYA 1FYDA 1VHQA 5EHXA 2VF4X 4C6RA 3QIVA 3R6TA 4OMDA 2YXNA 1L4YA 3P9PA 2J85A 1WXWA 2J3MA 2W6JD 2XUQA 1X7XA 5EIBD 4Q7KA 3GMSA 1ZJ6A 2C95A 2PVSA 5FA6A 5GPBA 3A70A 4DREA 2D74A 3DDWA 3ZNOA 3RVDA 1SA0B 1YMUA 4NEQA 1AGNA 2IZOA 2I1LA 3HWSA 1RYDA 1RLJA 1TQ4A 3P2JA 2D2VA 4BQNA 1GPWB 2JC3A 2P9FA 1R9NA 1JUDA 3UJCA 4BVHA 4TQGA 2HA5A 3WHKA 2BI7A 3HSSA 5AI0A 5FOSA 2CNNA 3OURA 2AYXA 4U2CA 2IU3A 1KQ3A 4ND5A 1GO2A 3OQIA 5KAPA 3D43A 3IQXA 1ZGZA 2VWPA 3EGWA 3MD0A 1J9ZA 4FX2A 5E0OA 4JC0A 1PUXA 1N75A 3D1LA 3ED5A 3B7WA 1YTLA 2JAWA 1XMJA 4FMDF 3OOEA 2E1PA 2FJ0A 3KUKA 5ARDA 1SIWA 5E6RA 3VPDA 1WDKA 3GJ4A 3TNYA 1SVLA 4CE6A 3Q3HA 4XUCA 2PQ2A 4INOA 1CZLA 2QD3A 3NOXA 3O0TA 1FK8A 1PQYA 1XTBA 5AT1A 2YC4C 1H4SA 3LZCA 2PGOA 1U65A 4ZT5A 3O1HB 5DMHA 3TAHA 3WRXC 4OP2A 3CUKA 2QA5A 4RFLA 5F3WB 4AMGA 1Z07A 2PKXA 1K3TA 3NHSA 2XJ9A 4TQAA 2NZUG 2JCBA 2V6FA 2FUNB 2D5LA 3WMXA 3ICWA 5KREA 4GKVA 1RCFA 4XDHA 2Q6VA 4NCKA 2Z30A 2VQFB 2XXBA 1LTKA 4PR3A 1HQYE 3BFJA 3X1DA 2AC2A 2WB2A 1I2MA 4M8IA 2C7QA 3ZLJA 3N39C 4LZOA 1NLZA 1Y3HA 1Z6XA 2H1WA 4R9VA 5EE9A 9LDTA 3D0QA 4UXJA 1RWQA 4MI6A 5E1OA 3I62A 3TVDA 3ZIDA 4PGGA 2W2XA 1NUAA 2JK1A 3UHPA 3VNVA 2IP4A 3ITKA 5D84A 2D0PB 4BL5A 2Q4DA 4UM5A 2QTVB 4C78A 2I91A 5F51A 3WV4A 2W8BA 1XHEA 3AIMA 1NNSA 3OUZA 2PS1A 2QYOA 3L8ZA 1FIUA 5C31A 2MMCA 1MAHA 3K2QA 4P0TA 1KEZA 3VBEA 2KE5A 2FP3A 3I1YA 3NOQA 1ZH6A 2X0RA 2I2AA 3B3QA 3WB9A 2VZ0A 13PKA 1G98A 1ZNXA 4ZVOA 4DVJA 2BHLA 2VKTA 3QQ5A 1JHQA 4FGKA 4EJSC 2AKEA 1NSTA 3N8DA 3CF6R 3MJEA 4R8RA 1V4BA 4UBNA 4QFCA 3CXUA 3LRTA 1X9IA 4ZMBA 2G9QA 4IY1A 2WJAA 3A6GA 3CPJB 2DLNA 4UDYX 4JMLA 4BO5A 3PWKA 1Z36A 5KTPA 3AIIA 1ICIA 1RWKA 2QIPA 3DXFA 1KDOA 2GUWA 4P31A 4ZREA 1VC2A 1XK7A 1C29B 4IMIB 2BMJA 2FN8A 3NUGA 5H4HA 5FHQA 2HJWA 2Q0SA 3S68A 1TM7E 1ZK0A 1BDHA 3HDVA 2XMQA 3Q9NA 3VNAA 1JB1A 3COSA 1W5FA 2ZANA 4BGEA 4PLTA 4D4KA 6PFKA 5G4KB 2Y0BA 5DM4A 4JDPA 2H4WA 4MYUA 3LLMA 4YCMA 4J0CA 3FMFA 3RT1A 1MHPA 5HQ3A 2GCEA 3IMCA 3IQGX 5K3DA 2X41A 4UE2A 3L07A 1YQDA 2NSHA 5IS2A 4OBBA 1TL7C 5IKXA 3P9CA 3VPCA 1W8DA 2FQQA 2I6TA 2J31A 1OGJA 2OECA 3GD5A 3LUHA 4HQFA 1ULTA 1DARA 4PC6A 2X2EA 4H4EA 4PG6A 4DXAA 4KR2A 3HCBA 2BHNA 5JD5A 5A0TA 1EEXB 3D7RA 3WNVA 1T29A 2IYEA 4NPCA 2XA1A 1GP2A 4XB1A 1YIOA 1OH6A 3W4KA 2JFZA 1JLHA 4ZOQI 3U7QA 2JJ2D 4BE4A 4BMVA 3W6OA 3MOGA 3PJEA 4U3JB 1ZUWA 3GRVA 3MWJA 2OKGA 1YFZA 1O9BA 1SBCA 4GRAA 5E8RA 4MQFA 1N9GA 4WI1A 5EAIA 3U3MA 1XGKA 4JBWA 1DC3A 4N7JA 1V8DA 4DJJA 5BSFA 4XWWA 3QITA 3K73O 4Q4AB 1EUCB 4I0WB 4AQDA 4EENA 4XH9B 4K9SA 4DDKA 1F6DA 3TIGA 2F43B 1SBTA 3C3BA 5LYYA 1GQYA 2YUIA 1EINA 1YOVB 3UJHA 4R1SA 5FYQA 5BUQA 2WWYA 2YIMA 3FPKA 4EQZA 4ND6A 1EESA 3MMXA 1UODA 3ORFA 3SKXA 3V33A 2ATVA 2HF7A 2VZ8A 4YP0A 1YJCA 5M3BA 1R5BA 4GC9A 1CR1A 4BZXA 4Y0VA 2OSVA 1B3BA 1QVZA 1UBCA 4JBNA 2C5EA 5IUKC 3SR4A 5LLDA 3FETA 1X42A 1CJCA 4IF6A 1MEJA 1QNFA 4FNOA 2G7ZA 2JVIA 3UF0A 3E81A 1LH0A 2W43A 2CDRA 1RM3A 3K1JA 3NRBA 3WX0A 3KVVA 2OFPA 4JVOA 2GRUA 5J59A 2DWOA 2Q1XA 4WBSA 5CB4A 1Y1KE 1Z82A 2ERCA 2VRWA 4HB4A 3EY4A 2J3IA 1EX1A 1B8OA 3WXBA 4X8LA 1M8KA 2RGDA 3HEBA 1AQIA 3K1AA 3ES9A 4NLLA 1G0OA 4LJLA 3RJ9A 5AFSA 4HFNA 1C7JA 2EYUA 4NWIA 1XG5A 4NQRA 5K2MA 1C9EA 3V6MA 4ZCTA 1CIPA 2V8OA 3T3DA 5D85A 2FP4B 3OIVA 2FPGB 3IUYA 5AVKA 1PTJC 4S0XA 2QMZA 3RTEA 2WINI 4B0OA 4Q1BA 3NT2A 5ERYA 4RE6A 4Y7DA 2ORWA 4G1MB 3NNNA 2MYTA 3VYSB 1E3WA 5EJGA 3SPXA 4BGUA 2P5UA 2KBFA 2ZPTX 3PNOA 1HLPA 4NBSA 1R4MB 5JISA 2FWAA 3D1JA 3D4BA 1WSWA 2GN0A 1QG0A 1VE1A 2ZVQX 1WSDA 3NDRA 4NBVA 1XQ1A 4G0MA 4E7OA 1USGA 1B1AA 3BCSA 2B92A 3K1ZA 4HSGA 1F7VA 1MPXA 1J7JA 5E8JA 2B2NA 1Q7BA 2PFSA 3HBNA 4TV9A 4DA8A 1CETA 2VSXA 3IJ5A 1CT9A 2OFXA 3G2OA 3DBLA 1Z08A 5JI3E 4B79A 1KSHA 4MSUA 1PVOA 3GLGB 2DGDA 3K70B 3AI2A 2QORA 1P1CA 1HOTA 3B60A 3GMTA 3NM4A 5TE9A 1D1PA 2VO1A 5C7LO 1UK9A 1AJEA 1BIFA 1GL9B 3GZNB 3RIXA 1KZ6A 2W8ZA 4EI2A 4CL2A 3M5DA 3NORA 3T0GA 4EKYA 4LYDA 3DGFC 5PGMA 1VSBA 3PZRA 4RETA 4M46A 3ULKA 3EUFA 1CZOA 3I9KA 1WRBA 4GVLA 3FF4A 3OAAA 4E2YA 2COEA 2IS1A 1CDEA 2CWDA 3EGOA 1DTWA 3MIIA 4NV3A 5EXXA 4B3FX 2BGIA 3D3KA 1FFYA 1SIBE 2LKCA 1B8VA 1ZNQO 2P1DA 2YZ7A 3HCFA 3IXQA 3R7SA 4LJ5A 4EPRA 1AXRA 5IDWA 2PV7A 2VCHA 3DWGA 2XTNA 1ADCA 2PGNA 3E7FA 3LKDA 2YWBA 4OHWA 2WZCA 2FMIA 2IXTA 2EBUA 2OWEA 1MO6A 4JU9A 3L7MA 4A2CA 1GAWA 1NC3A 1SD5A 2P2NA 5FLKA 3HFRA 3QY0A 4QASA 3SQDA 1T0HB 2P9EA 3JVVA 5EIWA 4D46A 1IBKB 1FP4B 1YJXA 2Q7XA 3NIGB 4JI4B 4P54A 2QSJA 3VJLA 1LBEA 3EZ2A 3UJ6A 5CB4B 1Y7TA 3FNQA 3AKZA 3HCOA 4BJ1A 4MDFA 4FFWA 2V0NA 3KZCA 3RVRA 3LU1A 3FKQA 2ZP1A 2P5TB 5U4QA 4J0IA 4N3CA 3RJMA 2PXHA 3N05A 5JTTA 4E0BA 2P6RA 1K08A 3N59A 4PYKA 5DPMA 4JI8B 1NMSA 3R9KA 4UNIA 3MMZA 3KOWA 2AMJA 2NYRA 1D9XA 3MS7A 2DBVO 1SZJG 4BV8A 4BPBA 4W9NC 3RADC 1YR2A 1WBBA 1L3CA 1CS0A 8LDHA 3T1HB 1V8PA 3G88A 4UNPA 3UJAA 2GXSA 2G77B 4QBFA 5IT4A 3L41A 3WMWA 4Z9FA 2ZIGA 2EL7A 3L0IB 2NADA 2VDNB 5JPDA 2CJFA 4WA8A 5MGNA 5GJBA 4XYMA 3JAKB 1AU9A 1M2WA 1Z35A 2ZIXA 3MJ4A 4L02A 1TC1A 2F3PA 2PJZA 1R8YA 3NWEA 4EG5A 2AFHE 4N0QA 5A4DA 3EEQA 3FCXA 5GM2A 3GDHA 3MUEA 1NVFA 2JFQA 4KQ2A 4QULA 1RYBA 5ELXA 2OZLA 2FR8A 1BEUB 2B8TA 2JZCA 4EA9A 5I4KA 3V4ZA 2PRYA 1A7AA 2GEDA 3UJBA 3K6SA 1J0DA 1QQ6A 5AOCA 1Y6ZA 1L5ZA 1S8OA 1PR0A 4IZHA 4KAFA 1JR4A 4Q6BA 3RHFA 1KZYC 4YYZA 1OLXA 2ZW9A 3QW4B 5HX7A 2HHCA 3ACBA 4DUYB 5LMNB 1O96A 4QHYA 1IHPA 3N76A 1LLQA 4FGJA 1O08A 2XF8A 3BHIA 3UUFA 3E9YA 2QTNA 2OCGA 1XZMA 3CLUC 5B55A 4KACA 3WBKA 2VBCA 2ZUWA 3UENA 3WA6A 3F3SA 3UMSA 1UBNA 2NUTA 4NH0A 3Q3JB 5EHIA 3A0RB 4DB2A 3ILXA 5KC9A 1DRUA 4TL7A 2YWEA 2AT1A 5E6RB 3UYKA 2WJVA 2PGAA 1Q16A 4XGRA 1JR6A 3AUJB 1OAAA 2RAPA 3WYCA 3FA2A 1PZEA 1GFIA 2HJRA 1D0IA 3I01A 4C7MA 2JAHA 2H8GA 3C1TA 3WNCA 4BBAA 3EX7C 1DLIA 4MWZA 3VVMA 3R7BA 4BFTA 4FOOA 3EVGA 2BY4A 3TDMA 3CLRD 4UHBA 5FORA 3NHMA 1RLMA 1CY8A 3STYA 4QGAA 3KFXA 1D9ZA 5LWQA 1LDNA 4MYRA 4QBKA 4HTFB 4AS3A 3OFSA 4MKGA 5IU6A 2JA2A 3B9RA 4J3NA 2I7XA 3H8JA 1L4MA 1OFHA 5T67A 1ZK4A 3NWJA 4YUVA 2AMVA 4CL8A 1GV1A 2M6KA 4AKIA 2BP7B 1L5QA 3OMWA 2YJ3A 3B6JA 4G8DA 4OQPA 3I9NA 1ZN2A 3NC4A 4V0ME 5JQWA 1JPJA 1UWKA 3RK1A 3SXPA 1IK6A 3Q72A 1RJFA 2JRCA 5IK2D 3QSGA 4BMOB 1U80A 2CCGA 3M5PA 1DXHA 2H0QA 4BO7A 1XCOA 2FNAA 4P82A 4WERA 4N82A 1WUIS 1KFEB 2IV7A 1IIRA 2GXQA 3M6IA 3HRIA 1QU3A 3TQSA 4XGKA 3L18A 5BQ3A 4FBLA 3AQ4A 1CUVA 1ZXLA 4DLBA 3L3BA 4DB4A 5CDHA 4F4DA 3W8DA 1XKQA 2Y27A 3HKDB 4JXJA 4MW4A 3ZTYA 5KWJA 4IS3A 5DK6A 3TLCA 4RSHA 3KQHA 3UXMA 1CFJA 1NX9A 2CCJA 3PFHA 3VU8A 4RWEA 3R8CA 5IZCC 4Z0PA 3VR5H 1M34A 1EXNA 1YZNA 1P1BA 5HUQA 2IEBA 1BVHA 3A1TA 4LCBA 2UVDA 4CKBB 5ALQA 3W9BA 5C8YB 3HRHA 1OFTA 1KETA 5TXGA 1N3BA 2VPPA 1RAFA 3B6EA 1NQOA 1WSBA 2BHSA 3H3XA 4PYJA 4REOA 1E1MA 1QAMA 4HT3B 1TLFA 3VYTB 1J23A 5AKJA 3VZBA 1XYVA 2XUDA 4NE9A 3HB0A 4RHTA 3W5UA 4I81A 3K3PA 1IRXA 4MWOA 4AY5A 1RCUA 3KSUA 4UE3S 5EJIA 4H27A 3FLMA 2JB9A 2QVYX 3TWOA 3C97A 4GVPA 3GLIB 1UP6A 3SU8A 4RTRA 1U1DA 1X7WB 3FNBA 3F47A 5FO0A 2HHHB 2DQZA 5BOSB 2H5EA 5DGDA 4ZCPA 5CFNA 2CB0A 2PMFA 3I0ZA 2AHRA 3COYA 3MWDB 2C57A 2ZS7A 4GZ3A 3K4PA 2PWYA 2ODQA 5TDHA 3RUDA 2AXEA 4D3YA 3UGKA 3KFVA 2M98A 1G5IA 2ZRHA 4B84A 3AVYA 2LPMA 1K3FA 4QEZA 4D4HA 3OZUA 1A04A 1M0SA 4PHFA 5DTIA 4YDRA 2Q7DA 4KKXB 1DCFA 3PQDA 1B2LA 4O4IB 4I5EA 2DR2A 4OA8A 1ZUIA 2P0EA 2W71A 4UBLA 1J1ZA 4PZYA 2IEAA 3EGIA 3OOHA 4HTFA 4FPXA 4O1MA 3A6HA 3V7UA 1AMNA 2G40A 1GGNA 3RVSA 2RAFA 2XCUA 1E9AA 2YINC 3GC6A 4IRMA 4JKOA 1NLUA 1V43A 2GJ8A 1YIAA 4UMVA 3O8RA 4WL0A 2D2FA 3I3SR 1TZJA 3BDVA 1J49A 1UDBA 3H16A 4RPIA 5L3QA 2QLNA 4UPVA 1XD2A 3NIWA 3CJQA 5IAEA 5B58C 1HDYA 3HKBA 1JFLA 4E07A 1J33A 2F00A 5BPHA 2CKMA 1A8UA 2VUUA 4OSEA 1S3IA 2C2MA 3JARB 1THTA 3OJLA 4KSYA 4ZU3A 1II8A 3CIFA 1FMCA 1DEKA 1W0JA 4LWOA 4MTCA 3ZEAA 5EFZA 4BN4A 5KMGA 1RJWA 4TS4A 2ZT5A 4JU8A 3TR6A 5JARA 2HUPA 4KH1A 3AHHA 3TSZA 1GA4A 1NBME 3SD7A 3QRWA 1KERA 3G0BA 4ITUA 2OD7A 3WRYC 4EY5A 3RYCB 3SICE 1N77A 1N36B 1ZGHA 4M9UA 1Y6JA 5JRDS 3NIBA 4GE0A 3QLEA 2R79A 2P91A 4MKHA 4WOPA 1SXHA 1YBFA 1N57A 2AN9A 1MAUA 2PQ0A 1Z75A 4P2GA 4UEWA 5H1YA 1AH2A 4I99A 1VCNA 2IYUA 2V6MA 5A04A 1SXJD 3BHMA 3HPRA 3PNPA 2YIDA 3NBKA 4HLNA 4CPDA 4EHHA 5HYVA 3N7TA 1D3AA 2V7QA 2LTAA 2ECQA 3I30X 4FINA 4EY4A 1AF4A 2JI9A 3V4FA 3DAPA 2WWFA 3WL8A 3PC4A 1SQ6A 4OKIA 3TQTA 2CJYA 4MWDA 4D5EA 3CVUA 2VATA 2G5CA 4J3JA 4MVJD 1U8UA 2G36A 5DNVA 4NYJQ 4MQ6A 1RXUA 3MOSA 3U9SA 1NT2A 3C4JA 3ZY4A 4JJ4A 4Z1OA 3NJ8A 2OWDA 4H7HA 1KWKA 3LHSA 3THXB 1JKJB 3HL0A 3LXRA 4NARA 1KDZA 1NJ8A 2CYAA 3BXFA 3CU5A 3L1VA 4J75A 3CUEF 3AOGA 1L5KA 2ZYIA 4ZT3A 2A30A 1ZESA 1TLTA 4NEGA 1N8KA 5LP1A 3BG5A 1MJ5A 3RYFA 4JJIA 4QT0A 3AF4A 3IIMA 4HG2A 1N78A 3E27A 3VR3A 1A4UA 3MTAA 4BLVA 4F4CA 3PC8C 3ASZA 3AHEA 4GYWA 4XIJA 4HDNB 4I1PA 3EISA 3QA9A 3DMHA 3O74A 3JPYA 4KZKA 2H92A 1N6HA 2WJHA 3E9MA 3Q7EA 4HUQB 2EDCA 2M32A 4X85A 4CM8B 5FJJA 2CL5A 3OF2A 3LUKA 1T3ZA 1HEUA 1VLHA 3FSGA 4MVXA 4EHIA 3R7FA 4DCSA 1K8YB 4N41A 4TV8A 3B6KA 1PJQA 3I01M 4UHHA 3GYBA 1UXOA 2C4VA 2PRKA 2WE8A 1GTVA 1ESNA 1Q7CA 4YGYA 2LIPA 3AT1A 4QOSA 2ACKA 4TWBA 1WL8A 4A8JB 3PEUA 4PN7A 2ZSFA 2V3WA 4GD3Q 1V11A 4PX3A 3O7WA 1ZVMA 4AJ9A 1LF5A 1T0BA 3TL2A 5D2CA 4X20B 2HEIA 3WKEA 2CJPA 4BMNA 1II8B 4AZSA 3J80A 2YDYA 3DOFA 3MCAA 3TRDA 5TQ0B 3FVQA 1U1CA 2XPCA 3V3KA 1KDRA 1LDBA 5CT8A 2FPUA 3GFSA 2ZBDA 4FYYA 2HMAA 5JYDA 3DR5A 2GWRA 2J45A 2P8JA 1VECA 4IVPA 2R3SA 1SC6A 1WVMA 1UJNA 4UEQA 3WK8A 2R7KA 2OBBA 2ZYVX 3GT7A 2FETA 3O1LA 1O77A 3N8GA 4KAXA 5A3SA 3UMYA 2HC9A 3FKSA 3T3MB 4NXNB 2ODBA 4RLFA 1M1YE 2HMWA 2V0GA 2WD7B 5A6SB 4DXDA 4DR2B 4IXMA 3RU9A 2CLEB 3FDXA 1NJFA 3ACCA 3FMVA 3OJCA 1ZIPA 4JC4A 4WOKA 3UT6A 3F8SA 4PXAA 2GN9A 1VI2A 5DM2A 2NWQA 4Q12A 1KZ4A 1YRHA 2AX3A 4WZBB 4H4CA 2IUUA 3W8EA 2QRMA 3L8DA 3DOJA 3KYCB 1TIBA 4YPVA 1N1EA 1SJ9A 1XV5A 1BMFD 3W77A 2ANBA 3SSNA 3NR2A 1OI4A 2B1JA 4GH5A 2FHPA 1NVAA 3KT0A 2IXFA 4QQFA 4EY3A 2Q0HA 5JS6A 3SFVA 4PTYA 5HR5A 5KNDA 1VL1A 2PKRA 4JL5A 3H9GA 4UQLA 2Q2QA 4D98A 4NG5A 2R7MA 4W5WA 3MT9A 1VMIA 4MB0A 3TLZA 5BNIA 3GZTB 1JH9A 2WU4A 4YAUA 2FPIB 1TKBA 1D0VA 4AKHA 4YP7A 4Y2JA 4LBVA 2X8LA 3WQHA 2MT9A 2JVJA 5JCJD 3MAJA 1ZHFA 2VHTA 4G3XA 4L22A 1WEHA 1JG3A 2I33A 3WB0A 5EJ9A 3OQPA 5BW4A 1BA3A 3R24A 1ZW6A 4YREA 2VCYA 3R7WB 1Z6YA 2CDNA 3PHGA 3R23A 5DOVA 1ABEA 3UK6A 1MQAA 1XDUA 4BKUA 3QVGB 1BYUA 2Y1KA 1E9CA 1F20A 3NALA 3U3JA 1JSLA 1C8KA 2QRNA 5GP1A 3AUUA 1CY1A 3D6FA 4Y1EA 2R7AA 4L5AA 1G59A 1RMTA 2AJLI 5ALPA 3TLXA 4N48A 2PX5A 1D0SA 2VDWB 3QEMA 3SC6A 5KTTA 2QW0X 3SZGA 4LGCA 1U2ZA 4GRDA 2JCSA 2P11A 1PT6A 5KYWB 4FWBA 4RPLA 4NSNA 1RXVA 3H7IA 4S1WA 4FDTA 2GBGA 4Y6RA 1PG2A 1Q77A 4OJQA 2MOKA 5J1SB 4OD0A 2YWCA 2FDCA 4PYIA 3GD7A 3RC8A 1I7DA 2CHUA 3KS9A 1OBHA 5SICE 1QH1A 3ZS8A 3R40A 4OTZA 4V1CA 1TA9A 1JHYA 4RA6A 1CC1S 1VGVA 3KP1A 3L05A 4OIFA 2OXRA 4RKWA 2O19A 2ZRAA 1BKSB 1CY4A 4D6XA 4HN9A 4B83A 5AHOA 1AV6A 2C84A 5AOAA 3INNA 1NNUA 2GCNA 4AK9A 3H11A 3K6KA 2AOTB 1J2TA 4O1IA 4ZT2A 5L3RA 1GQ2A 4ZCRA 1VBNA 3RHZA 4FNAA 3HP7A 2GHTA 2QE7A 3HV0A 1ORRA 4EGQA 2WICA 1ENZA 2C7OA 4CLRB 2JJ1A 4UPDA 2GB4A 1A8PA 2PH3A 4UFOA 2Z58A 3VRHA 4LRYA 3AONB 4E32A 1QE0A 4FKZA 1XRPA 5GV8A 1MB2A 1NYRA 2FR1A 3GOHA 4EHLA 4H7IA 1QFYA 1L9XA 3T35A 4PZ9A 1DOHA 5FT9A 3E7XA 4AG6A 3ZHZA 4ZQGA 1GPNA 1TKCA 1MABA 5LP6B 5DF1A 3COJA 1H3EA 1T1SA 5IW8A 3A0UA 3WBFA 2X2FA 5HHTA 5JJBA 2ZUUA 2WIKA 3BTOA 3EIWA 3QBEA 4XQ0A 5GADl 2O0KA 4FFDA