3UANA

Crystal structure of 3-o-sulfotransferase (3-ost-1) with bound pap and heptasaccharide substrate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
256
Chain Sequence
b'STQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGLGWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQVLYNHLQKHKPYPPIEDLLMRRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQVDPKLLDKLHEYFHEPNKKFFKLVGRTFDWH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 1
publication title Dissecting the substrate recognition of 3-O-sulfotransferase for the biosynthesis of anticoagulant heparin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 83
structure length 256
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uanA00
3VMFA 3PR1A 1A7JA 3IQWA 1KO7A 3ADBA 2QRNA 1M74A 3HU1A 4JS0A 1VHTA 5DISB 3PCRB 2BMDA 5HE8A 4G5OA 5TB5A 4GSYA 5FPHA 2QQ0A 1N6KA 1UJ2A 4RD3A 2W58A 2I1QA 2D7DA 1W0KA 2MMCA 3AVOA 2Q0HA 2ZTSA 2Q9BA 4OQFA 1Z0KA 5L3QB 1NSTA 2W00A 5JS7A 1CU1A 3BAFA 4S35A 4G3XA 3W5JA 4LJAA 3LWNA 3ZQJA 3B85A 1NVWQ 1XD2B 4NBSA 5CITA 2QZ4A 1KJZA 2OBNA 1WRBA 3VQTA 5DIFA 3A4MA 2FX3A 4RD1A 3DZ8A 4QBGB 2NO7A 2FGKA 1T9HA 721PA 1BKDR 1Q1ZA 3SZRA 2XITA 3X1XA 2QSZA 5HCNA 2IYZA 4LX0A 2Z4RA 4FCVA 3IHLA 2QAGB 3FHOA 5CK4A 3PITA 4GOKA 4RVCA 4GL2A 1DAHA 4JZKA 4Z8XA 4O0MA 1EFRD 1GKUB 4MDFA 4B35A 1OH5A 1X8KA 5F3WB 2F3RA 4R71A 4DB4A 3A4LA 1FP7A 4FMCF 2ZS8A 4ZKDA 4DSUA 2VHUA 5LD2C 3B1XA 3QVVA 3K9GA 3PUWA 3K0AB 1E2FA 4PO8A 2IUSA 2JASA 2O8BA 3GJXC 2ZJ5A 1E0SA 1P2VA 2YVUA 1XTRA 4MUAA 1OXXK 2BKUA 4TTRA 5C1BA 3ZH9B 5FTLA 2OBLA 3BH0A 3IQXA 1E2GA 3CH4B 3KXLA 3U7EB 2HLDA 4B2LA 3QXCA 2O8DB 1KSJA 3RS7A 2YYZA 1TEXA 1WMSA 2F43A 1Q57A 2NIPA 2O8EA 1N25A 3IGFA 1KY2A 1KTVA 4PSKA 2VP5A 2C98A 3B1VA 4C9BA 5FPKA 2L0XA 4NZYA 4GP7A 2IYYA 4ERNA 2QGZA 4NCJA 4DDTA 1PZNA 2DR3A 2QNRA 2CVHA 4IVRA 4GP6A 2V55B 2FFHA 3B9PA 1BH2A 3QF4A 1OH6A 1FMJA 4BEBA 4IEEA 2BWJA 1G8YA 2VTKA 4JVNA 4LRWA 3V4RA 4V03A 3MD0A 1KI8A 1FQJA 3K8YA 2A2ZA 5FOVA 1UBGA 4JVSB 3QBTA 4PZYA 5FL3A 4CF7A 2FWRA 3HPRA 4Q18A 5HPYB 2PX3A 1XEXB 5KSPA 2OCBA 4C0JA 3UKDA 3B2EA 3SBDA 5H8WA 2VHCA 5IT5A 2WMOB 3A37A 3EA5A 2BEJA 3LBNA 4O2LA 1X86B 2REXB 4A92A 4WZ6A 4JYCA 3PJRA 5H1YA 1VDZA 5FPTA 5HE9A 5HKKD 1ANKA 3KKOA 4XVQA 3BORA 2WICA 2ZI3A 1Q3TA 4QBHA 4U00A 3FWYA 1E0AA 2JCSA 1TTTA 1CKEA 1NKSA 2D4HA 1KO5A 5TXGA 4GZMA 1KK3A 4KXFB 1S4QA 3RYTC 1X6VA 2C9CA 3FGNA 4JKYA 1UKEA 1P72A 1LS6A 1E3MA 4YMTA 1CP2A 4B48A 2ZSFA 2REBA 4FD2A 2CDNA 1PUIA 4MYUA 4DLVA 4UNQA 1D9XA 3BC1A 1YZUA 2ATXA 4Q03A 4WA7A 1W7AA 1TADA 5JEDA 1KDOA 2ZSEA 1E9SA 3EG5A 5FTKA 2GHIA 4IDQA 2IL1A 4QL3A 2J0VA 1P9NA 2ZSAA 5EE3A 3CKLA 1E9AA 4DVGA 1U9IA 3HWSA 5CLQA 1OYWA 4P32A 2E1RA 1X1RA 2QAGA 1GSIA 3GEEA 1RRCA 3SI7A 4C30A 4Q47A 4LK2A 4BLRA 2C78A 3CRQA 3HP1A 3FFBA 1IN6A 1TEVA 1R2QA 4DEYA 4Q7LA 2JGNA 4LYFA 4IOMA 5LB2A 3UIEA 2IC5A 3RWMB 2RGNA 4B44A 3K0AA 5KOYA 1GKYA 2PZEA 1Z3IX 4AKIA 1EWQA 1Q21A 1XJQA 2WBLC 4NKRA 3GPLA 2FEOA 4RZUA 1XNJA 5FBVB 3H2YA 1NMYA 2XZPA 4XSGA 2DYKA 2JIZD 1NN3A 3MRSA 4YMSA 2C77A 4XIGS 4YC7A 4ASUA 3BIFA 5KO2A 1NRJB 2W2XA 1G21E 2N42A 4M8NE 4Q9HA 2ZRHA 1PLLA 1L7VC 1NF3A 1T8TA 2BJWA 5JWRA 3I72A 2VP6A 3AVTA 1KGDA 2UKDA 1E9EA 1U90A 3Q8XB 4NCIA 2YOGA 4NHOA 2N46A 4PHGA 4TL6A 3B13B 3UXMA 2GF0A 3I73A 1DADA 1TX4B 2CMKA 1SZPA 2FEMA 4UNSA 4RCZA 5GJCA 4A2PA 3I92A 4ZI2A 4A0FA 4CEIB 1XTSA 1XU4A 2QE7D 3FDIA 4D6PA 4JYBA 2G9NA 4WBSA 1N6NA 1E99A 1SVMA 2H57A 1NNEA 4AIIA 5CDFE 3C5HA 3GQBA 3S1AB 4DLSA 1H65A 1G19A 1ZNYA 5KUTA 1MABB 4NCHA 1UAAA 2GESA 1ZBDA 2ZETA 2ZUBA 3LFUA 5FUVA 3A6PC 4P4UA 5DI9A 4NTZA 2AKAB 3MWLA 2UZ3A 3Q85A 4JL6A 3KQNA 1AZSC 3AP3A 4NMMA 1ONBA 3P26A 3IKJA 1XEXA 3TUIC 2QAGC 2NO1A 3EPHA 3CO5A 5GJBA 1J99A 2WJIA 3Q3JB 1OJLA 1LS1A 5FI1B 4YMWA 3TLXA 4B3CA 1J7KA 2XTMA 3NBFA 3U3RA 2Q9CA 4DZZA 4X8LA 2WPDA 4M1TA 3WHLA 1OPXA 4NYMR 1C9KA 4Q1FA 3K0SA 3BE4A 3LQRA 3SU8A 4NYMQ 5SZKB 1P2TA 3O8RA 1XXHB 2YZ2A 3LRPA 3NXSA 1CR2A 5D3QA 1KI4A 4ESVA 1BYUA 3A4NA 3WBJA 4B2PA 4W5WA 2XB4A 2ZU0C 3LY5A 3FKSA 4EPVA 2DBYA 4QKQA 1N5LA 4K46A 4OK5A 1U8ZA 4LHXA 1AJEA 2XZOA 4D80A 2QEQA 4A4DA 5FBRB 1ZIPA 2R2AA 1DARA 2NG1A 1G7TA 3FFAA 4TMTA 2GZAA 1G8PA 1LF0A 2GNOA 1DOAA 3THOA 1VYTA 2QAJA 3AVUA 1G16A 1ZD9A 1KNQA 4AG6A 4BLQA 4X8HA 2GEDA 1DBSA 4PPGA 3UWOA 3TGPA 3AVYA 1EFUA 1G4AE 4QJ4A 4G01B 4PANA 3WNCA 1S1CA 2VRWA 2QROA 1WBBA 4Q1AA 1OH8A 3ECCA 3RDPA 2ONJA 4HI0E 4DKXA 4HAWA 1MOZA 1SVSA 2W6JA 2ZREA 3VR6A 4PPQA 1P60A 2PZGA 1DS6A 3GJ6A 1SHZA 1A2KC 4M1WA 2OXCA 4H1UA 5JCPA 1IY1A 2ANCA 2GAAA 4OK3A 1Y63A 4QFMA 3QXXA 2B8WA 3THYA 1XCPA 2SHKA 4JVLA 1AS0A 2CJWB 2ZE5A 3B8HA 4Q66C 1S3GA 4XD7A 2PEYA 4MGKR 3QSYA 1S9HA 1F5NA 1U0JA 3BB3A 5J5CA 1YZQA 3KQLA 3I62A 1GRQA 2P6RA 5JWOA 3OHMA 4BFYA 3CPHA 3LBIA 4KVAA 1R6BX 3GD7A 2YOFA 4JBYA 2BEKA 3NC1C 2OO7A 4I1SA 1D2NA 4CEJB 3HJNA 3TIFA 5FH9A 2ZRFA 1SVWA 4JLMA 2GXUA 2VO1A 2H1LA 3Q7PA 1ZAKA 4HDQB 1TNDA 4JT4A 2OLJA 3HYRA 4JL5A 1OIWA 3U3MA 2NGRA 4FWTA 4TYNA 3ICQB 1CTQA 1GG2A 3HDTA 3RNLA 3ZIAD 2R6DA 4CEIA 3GP8A 2GEVA 2O0KA 1G5PA 4DUGA 3AM1A 1Z06A 4CT5A 1FL9A 2IYSA 3DVLA 2BDTA 5M04A 4LC0A 4C2UA 4K81B 1B23P 1OFUX 3WNDA 1M7BA 2XTZA 1E79A 3RABA 2G1JA 1EK0A 1R8SA 1CJTC 1W4CA 4IDPA 2WWYA 5FTNA 3CF0A 3W3ZB 5JRJA 3HYTA 2XZLA 1P9RA 2LCFA 1GL6A 2FF7A 3BB4A 4TL9A 1U81A 1MRNA 2LKDA 4EPTA 4LJ9A 2IUUA 1Z5ZA 3WYGA 3U60B 1M7HA 2ZS7A 2ZRMA 3B1WA 1Q1BA 1FTSA 4IEIA 4BZXA 4URZR 3NEJA 3GJ5A 5DSZA 1HYQA 5DNYB 1V5WA 821PA 1KZGB 1TUEA 1EWRA 3C41J 1RE0A 3B9QA 3Q72A 4EJSA 2HF8A 3PG5A 3U6KA 1DVRA 4K8OA 1KI1A 3MWJA 4ZDWA 3RHFA 3K70C 2NO6A 1IONA 2YOHA 2QU8A 4KFRA 4LJ4A 1JBKA 4L15A 4GFDA 2C8VA 5CIQA 5KHOC 1J70A 4ZCLA 5HTKA 2IEZA 2VA8A 4IFEA 1OFIA 3E5HA 1KI3A 1JXOA 1N6OA 2WWWA 5J4HA 4UXIA 1OYYA 1GL7A 1KI2A 3LXXA 4HB2A 4II7A 4PAMA 1VIAA 3UG6A 3VNUA 1IAQA 1S8FA 4OI0A 2ZVQX 1AZTA 3ADDA 4Q21A 2OUKA 4UNRA 4MGYR 1IQPA 1UADA 4UQOA 3W6OA 2H16A 4OHVA 4ZIRA 2RGBA 5EP1A 3OEHA 5EP4A 2IYWA 3KQUA 2W83A 3TQFA 2FSGA 4CZ2A 2BVNA 2G83A 2Q9AA 1W0JD 4DDWA 4HSEA 1E9FA 4P3YA 3ZD6A 2UZIR 1VKJA 1RFLA 2CLSA 4B3DA 4A8JA 2CNWA 4ZDKA 4AC9A 2RGAA 4ZKEA 4Z51A 2IYVA 1R0WA 1W5TA 2W2VA 4AD8A 2V6JA 1P5ZB 5AUPB 2VP2A 3OIWA 3SYKA 1AS2A 5ELXA 4HLDA 2ZE6A 2CHQA 3EC1A 4GMDA 2XX3A 4LBZA 5J40A 3W90A 3MGCA 2DPXA 5C18A 2JAQA 1DPFA 1ZUIA 4ASUD 4EAQA 1A2BA 4KLNA 3AVQA 1TQDA 4EFLA 1HURA 2FDCA 2F3TA 2OV2A 1TF2A 3IIMA 3EZ6A 5SZHB 2NO9A 3GLHB 4URXR 3D8BA 4DT1A 5JECA 5BQ5A 3KQKA 2FOLA 4A15A 3N5CA 3I4LA 1NVXQ 1P62B 1Z08A 4TYPA 1KIMA 1YVDA 1SKQA 4M0LA 5IK2A 2VEDA 2GKSA 3EWSA 3GLGB 2CE2X 4TSFA 5EXSA 5JRZA 1ZW6A 2FPMA 1N0UA 2ZSBA 1S0UA 3U61B 3L8YA 3GFOA 1SGWA 1NVUQ 1XZQA 4HUQB 4FMCB 2HYIC 1NBMD 1XPUA 4OHYA 1Z2CA 2PCLA 2WWFA 2WWIA 4QBIA 2WHXA 1N5JA 3W9YA 1W36B 2OSBA 4AYXA 2C04A 2BKEA 4ITRC 4WZBE 5E3HA 3QPUA 2JLSA 4RY2A 4W5JA 1W5SA 5JWHA 4A36A 2WOOA 2FZLA 3IPYA 5HR5A 3BJIC 4V0NA 3TSWA 4OQNA 1CIPA 1NSFA 2JLXA 3BERA 2D2FA 1YHNA 2QTHA 1HT2E 2BCGY 2WIBA 4MGZR 4F91B 4KU4A 3TW8B 1O3YA 1ZVQA 1B0UA 4LWZA 1G1MA 2E9SA 4RD0A 1GNQA 3Q5DA 3AF2A 2A5YB 5GJWC 5TY0A 4MYCA 2QORA 1VYVA 2GK7A 3F3YA 2JLUA 1JAIA 2FG5A 4Q9KA 1MT0A 1ZU4A 3D7MA 1WDTA 5SZJA 1COWA 2BJVA 4IDNA 3IEUA 3P4XA 3EIQA 4I99A 3WMEA 5UKDA 1G291 2YWHA 5DE3A 1G5RA 1XB2A 3CWZA 3FKSD 2C9YA 5EXTA 2IYLD 4OHWA 2G77B 4M22A 4N0EA 4TT3A 2HV8A 5DH9A 2PT7A 3I3SR 2QI9C 3H84A 1HUQA 5FR1A 2G3YA 4UNPA 3TRFA 4MA4A 2AWNA 3R9WA 1K5GA 1WQ1R 1XTJA 5C46F 2QP4A 1QG4A 3U3OA 2CVFA 1GAJA 4P4SA 3RRNA 1BYIA 1SVIA 1ZU5A 2QPOA 1XPOA 1JAHA 1W47A 2XTNA 4X8MA 3W34A 3SJBA 2A3RA 1E2PA 2Y8EA 4IDHA 4LJYA 1TMKA 2W6JD 4I1UA 1E1QD 1KO1A 5SZIA 4HDOB 3ZJYA 3AGPA 1RVDA 1QHXA 1II8A 3AP2A 3CIOA 3VKWA 4PC1A 1AKEA 3H1TA 2EYQA 1R10A 2UVQA 1QHSA 4AI6A 4XD7D 2PCJA 1RYFA 2ZVPX 5TDHA 2P65A 4AWXA 1Q44A 3GFTA 4JL8A 2JDID 1P7CA 2B8TA 2J45A 2GTPA 4DLXA 4PZZA 4XTRA 2HCBA 1ZCBA 1Y3AA 4NCKA 5JHHB 4NE2A 1YRBA 5BN4A 1NN0A 2JATA 4LZZA 3GJ8A 3GLIB 2R9VA 1DAGA 3QKTA 4OKSA 4PPNA 2NQ2C 2R6GA 2YWEA 3GLHA 2KE5A 3EC2A 1GRNA 4Q4JB 4AG5A 2XOKA 3DMDA 2RCNA 3O47A 1HE8B 2RHMA 1G7SA 3KUDA 1XJ0A 4WXRA 2ZYTX 3ND8A 4FXPA 1ETUA 4DUGD 2Q3FA 4JLJA 1QHYA 2WSMA 3LLUA 1N5IA 1NLFA 4TLAA 2QGNA 3RS3A 5AJYA 2QP3A 2V3CC 3CX6A 2IS2A 2QP9X 2V4ZA 4YXWA 1E79D 4B6FA 3D3QA 1MH1A 2AHOA 3NTUA 3H0KA 1NN1A 3TK1A 2EFDB 1QG2A 2Q21A 2RGEA 2LKCA 2HEIA 2V7QA 3KB1A 4Q48A 3WXMA 3EZ7A 3A58B 2X8AA 2F6RA 5FOTA 4TMWA 1F6BA 2ORWA 4LJ7A 1GWNA 2IA5A 4P33A 2A5FA 4B32A 1HQCA 1VCOA 2GCOA 4PAOA 3LX5A 1G6HA 2QBYB 3QOFA 4B74A 4MUBA 1L8QA 2HUPA 3OE7A 3W6NA 3TR0A 4B33A 1XMSA 1UDWA 3I1FA 4HDCA 5EE1A 1RRPA 2Z43A 4Q4HB 5JLJA 5KDDA 5A4JA 2WSSA 2V54A 3KXIA 3X2SA 4B3BA 4BECA 4UJ5A 2XB2A 1E1RD 3KKNA 4EKDA 4I4LA 1Z0AA 3VU9B 3R8FA 3WMFA 2V8OA 3PUYA 1H8HD 1TQ2A 4RD6A 1S9DA 1MO5A 1G4UR 1YR8A 2VF7A 2ZYUX 3QBVA 3U3JA 5HZHA 4GBMA 4D0GA 1E9RA 5JCZA 1CJMA 1Z6AA 2F1IA 4JLOA 4LI0A 5E7JA 5B30A 2C9OA 1TU3A 4P0TA 5FUWA 3J81k 4R9UC 5FOWA 2R62A 1VG0B 1X8JA 5A0FA 1HQYE 4DXAA 2FSHA 4C3ZA 1KAGA 3QKSB 3LLMA 2PLRA 3OEHD 4WOPA 3KFVA 1G3MA 3T5DA 4G1UC 1SKYB 4JJZA 3TR5A 3G0HA 5HZKA 4US0R 4BFVA 4KO8A 1W36C 2DFTA 3LD9A 2OT3B 5FOUA 3THWB 3LQQA 3VKGA 2DFKB 3B5JA 1OHHD 1GITA 3ZVMA 3SJAA 3NC0C 1GOTA 4DIDA 2AK3A 3X1YA 4A6XA 4O3MA 3R20A 4Z8YA 2ZJBA 1FTNA 4BQSA 4QM7A 1M34E 3IHWA 1ZD1A 2ZRLA 1GL9B 3JVVA 2VSOA 5DI3B 1P2UA 3UG7A 3U7FB 2JLWA 2V6IA 4NYJR 3SOPA 3OAAD 1T91A 3MSXA 1KKMA 1RYHA 2PMKA 2VL7A 3OIUA 1JJ7A 4NYJQ 4F92B 5KSOA 3GLIA 1N6IA 2ZM5A 1E2IA 4IXNA 4CIDA 2R65A 3LX8A 4RJLA 4LOAA 2ERXA 2IF0A 4M1KA 2VP0A 4HZIA 4N3NA 3U7GA 1FFHA 1P73A 3OZXA 1RIFA 2J59A 2XXAB 4TN1A 2HXYA 5IK2D 3ASZA 2JLQA 4BRUA 5F2EA 5FOSA 1IHUA 4TSFD 3SEAA 2BC9A 1D2EA 4XWOA 1U0HC 1NY5A 4PC6A 3SHWA 2OESA 1YJ5A 3EW9A 4IVPA 3VX4A 4Q4LA 4IDOA 1GRRA 2GETA 2IS4A 3UPUA 2FFAA 1WXQA 4LYAA 5BW8A 4YDSA 5G41A 2ZIAA 2J5XA 2W6ID 5L3QA 5G53C 2OCYC 3TVDA 3OFNA 4DLRA 2A78A 1QHHB 4C7OB 1PVOA 2EW1A 4Q1CA 2IYUA 2PT5A 4BRWA 4M1OA 1XD2A 2VP9A 4RZ3A 5JJKA 2D7CA 4HLQB 1ZM2A 3G5UA 1ZD8A 4TL8A 1G8GA 1ZM7A 4TL7A 3R8CA 4ZDIA 4XTCS 4ABYA 3RSOA 1E2HA 4BASA 1CF4A 1N0WA 2TMKA 2XSZA 3NWJA 3ZDQA 1JNYA 1A5TA 2JLVA 1OFHA 3IO5A 2J7PD 1T3LA 1YKSA 2ODWA 3DMNA 4LHVA 3DPUA 4A2WA 1LV7A 1W4AA 1EXMA 2FU5C 2QUZA 4UNNA 2FMXA 2HF9A 4LGMA 3TW4A 4BFTA 4B6EA 3CB4A 5DHAA 1XTKA 3BOSA 1N2CE 1O87A 3VR4A 2QG6A 2KBEA 2WKRA 1T0HB 3K70D 4JLDA 1U0LA 1TF5A 1UFQA 4LUCA 1OH7A 3L0PA 5FBLB 1AGRA 3OF5A 2QT1A 4RD4A 3M0EA 5CB6A 3AV0B 2GXQA 4ACBA 2PH1A 3QG5A 5C2JB 4W9MC 3BBPA 3AKDA 2KWIA 5D3MB 1GUAA 1DAKA 1AQUA 2P5SA 2ZRJA 4KHZA 2CK3D 4D4KA 2XNDA 3QKSA 1KOFA 1R4AA 1GNPA 3CF6R 3CR7A 2FPLA 1QHGA 2IHYA 2I4IA 2RGDA 1D6JA 5G3YA 2QY9A 2CE7A 3G82C 4TZ6A 2O8DA 2V1XA 2ZR9A 3ZVLA 2Z6VA 5IF9A 1T3SA 4M4SA 5KPDA 1JALA 1EFTA 1XCGB 4Q1DA 2F55A 1MO3A 3L0SA 1PV4A 2BIFA 3E70C 4BGDA 2RB4A 3CUEF 1G7CA 1GP2A 2W0SA 4PQFA 1ZP6A 5CJPA 4NONA 2WKQA 3AKYA 3RRMA 4C2TA 1K5DA 4A0GA 1MO4A 4FMDF 4OI4A 5B64A 4TYYA 1KMHB 4A82A 4G5SA 4PAQA 5EE9A 5EQTA 4V02A 4QHYA 1Z63A 5EP2A 1FNMA 4MQBA 2EQBA 4DDUA 2HT1A 5CM9C 5J4LA 1R5BA 3GLHE 4CEHB 5JEEA 1SXJB 2J46A 2VHTA 4O2RA 2GXSA 1DO2A 2PEZA 3CWQA 2XXAA 1DG3A 4IKEA 2Q3HA 3IIKA 1DAIA 1D8TA 3EIEA 1CRPA 1C1YA 3UATA 4QGAA 2IYTA 3CX7A 2QT0A 4L4UA 2BBSA 3RC3A 4URYR 3BH7A 5DLQC 3T5GA 4D81A 3CR8A 1ZNZA 5CIWA 4KITB 1AGPA 5L3VA 1E9DA 2O8FB 1FX0B 3SQXA 5FOXA 4Q00A 3O8BA 5G3ZA 1JR3A 2AXNA 3QEOA 4YXWD 2VSXA 4DHEA 4B76A 4US2R 4W7SA 2RAPA 5E95A 3QJYA 1CRQA 1W0KD 3FHTA 4LJ8A 4F4IA 1YZLA 2QMHA 2ZRAA 4PR0A 1W2HA 2GBLA 3OIYA 4LSGA 5AJXA 1QHHA 3QF7A 4L9WA 1I4TD 1NY6A 1WP9A 1U2RA 3NHBA 4M53A 5AR1A 1N5KA 4L5BA 4LJ6A 4O25A 1Q0UA 2ODBA 2EWWA 4KFSA 2FA9A 3ZGXA 4Q5IA 5BXQC 1GDDA 1JXMA 3F0TA 4YDHB 5EUMA 3CNNA 2R6CA 1H8EA 3A1SA 3PIRA 2CLDX 4UKDA 1E2LA 2JLRA 4B34A 2F1RA 2GRJA 1EFHA 2F7SA 3OE7D 3QPWA 4R2HA 4D4MA 1OW3B 1HT1E 3K1JA 2D62A 2ZJOA 421PA 2NTYC 1JPJA 2CCGA 3ICEA 2C95A 4DLYA 2WSSD 3KZ1E 3HR8A 2IEYA 4J0QA 5FUYA 5JFGA 3UWKA 1IN5A 3BGWA 2O0JA 4V0KA 3BH6A 2OXRA 4DCNA 5KYKA 3SC3A 5BN3A 2QMEA 3ADKA 4GOXA 1EX7A 3WRXC 1XDBA 3HU2A 3R7WB 4AKHA 2AN9A 1QHNA 2DWOA 3K0FB 2MMGA 3WP1B 1XCMA 3B6EA 4C4PA 2IS1A 3UMFA 1ZUNB 1WE2A 1FP6A 1KAOA 3L2OB 3QY0A 5D3MA 4Y0VA 1ZM3A 2JEOA 4HAZA 3SS8A 8OHMA 2NZJA 4M2LA 4JBWA 2HDNB 3QKUA 3ZVNA 4TYWA 1KKLA 3B1ZA 1DO0A 5DN6A 3P20A 4DEXA 2AFHE 3PEVA 1WB9A 3EXAA 2CXXA 2J41A 2VSFA 5FR2A 4CRWB 3PEYA 3K9NA 4EUNA 4LBWA 2HLDD 3QXSA 4EPRA 3A36A 3PENA 1L4UA 3TKLA 4F38A 4Q9LA 2O8CB 3NBZC 4NL4H 1CLUA 4KCGA 4JLNA 1TU4A 2IX3A 4ESHA 4NCNA 1MKYA 1OV4A 2GBLC 3AQ4A 2WIAA 2GCPA 4BFSA 2PLFA 3LNCA 3U3KA 4MKIA 3FHCB 5B2ZA 1XD8A 2H7VA 1KK0A 1NLYA 4NYIR 5FL7A 1XTIA 4M9SA 4KAXA 1NIPA 4NYIQ 4PC7A 3S1AA 1KMHA 3WYAA 4AKEA 1R0ZA 2VF8A 2FFBA 3N2EA 1MABA 4N0DA 4PTLA 1E2MA 5H68A 5KSYA 4DLUA 3PUZA 4KVGA 1CEEA 4DCUA 4URVR 2CHGA 4TLCA 3GLIE 1QBKC 2WV9A 2P6UA 5B58C 4EPXA 2IS6A 1ZINA 4LC1A 4TQAA 4JLBA 4BEJA 3DKPA 4IOKA 4IRUB 3NG1A 4RD2A 1E6CA 1XZPA 2EFCB 2OFOA 1AA9A 2OZEA 3W8NA 1NIJA 3C15C 1FZQA 2ORVA 3THXB 3FMIA 4QHSA 1ZIOA 2V1UA 2LWIA 4JJKA 1Z6TA 4LV8B 4BE7B 3P1JA 3RS4A 4GNKA 1TF7A 1XXHA 2YC2C 2EYUA 3GEIA 2C99A 1EGAA 5L3SB 3UMRA 1T3HA 4WVFA 3ZZ0A 2EFGA 4KI0A 1E0JA 1P2SA 4EPYA 2PMDA 3OIVA 2QMOA 3CLVA 3OFND 4PO9A 2ZR7A 2P6NA 3MWKA 4M1SA 2J9RA 4Z54A 5JJLA 4ZPXA 2FPKA 5KSZA 3KFXA 3U7HB 1Z83A 5JSZB 2HCJB 3X1ZA 4POAA 4C0SA 2GEUA 3TNFA 3SJCA 2H5EA 4GT1A 4D0NA 3RC8A 1OXSC 4Z1MA 3ZVRA 3T1TA 2GA8A 1N6LA 1OIXA 4YONB 2RHDA 3L8ZA 1C4OA 1Q3HA 3K9HA 4G5RA 5DHFA 2HYDA 4HZUB 1F2TB 5K8IA 2NPIA 2YHSA 2ASEA 3MAAC 3A1WA 2W2TA 1P9WA 1FNNA 3DHWC 2B92A 3DL0A 3EASA 3GLFB 3MWYW 2CJWA 3K0FA 5C4MA 2QA5A 2XEXA 4KYIB 4LCBA 1SXJC 1ZJ6A 4RSGA 4TLDA 2ECKA 5EE0A 2KBFA 1UEIA 3BRWD 3JVUA 3QVUA 2A5GA 3TAUA 4KSBA 2B7CA 2ZI7A 4HLUC 3QNUA 1MRSA 4HEJA 1XRJA 1R0YA 2AX4A 1F2UB 4CEJA 2VBCA 1SKYE 1G3QA 4B2IA 4PZLA 5JZVA 4DLZA 1DAEA 1LB1B 5TVKA 2BV3A 4MKGA 3LVQE 4DJTA 3I8XA 1KK2A 1WF3A 1I4LD 4XJXA 1AIPA 2EVWX 5K8TA 2WWXA 4LV5B 4L9SA 4PHFA 2GVZC 2ZPTX 4D4JA 3AUYA 3NH6A 3AF0A 5AJWA 4LBYA 1JEDA 2F9LA 2QL6A 1CBUA 2G0NA 4JT2A 4Q7KA 5KNBA 4DC9A 3I61A 1OE0A 2QM8A 4C0LA 4JLPA 1R5NA 5ANRB 5J47A 3SR0A 5TARA 1Z47A 1MR3F 1E9BA 3VR1A 3QPVA 2J0UB 4LYHA 5EZ6B 1FW6A 2F9MA 1HY3A 4GRAA 4PPFA 2DCUA 4KFUA 6Q21A 1Z0IA 2G6BA 4MDEA 3OEEA 3AVXA 3KXKA 5E4FA 5EXXA 3A1VA 3LA6A 1QRAA 4MRNA 3TUZC 1ZYUA 4XVUA 4A1FA 2FE4A 2P0EA 1XMJA 5HKKA 2ZI6A 1KSFX 2QPAA 1OFTA 2D06A 3IBGA 2J7KA 2XJ4A 3VHLB 2WPDD 3GCGA 1S1MA 1DAFA 1LNZA 4Q1BA 3VHXA 3DDCA 3FB4A 5CJ2A 3T15A 3SYLA 5L3SA 1N6PA 2FFQA 3CX8A 4C0QC 3VX3A 2CCKA 1JR3E 3WP0A 2AXPA 2IBMA 2HJGA 3DM9B 1Z6GA 4M21A 2JJ2A 2J0SA 3KJHA 3WNBA 4JLAA 2AD1A 1JQJC 1HEIA 2FV8A 1FPMA 3TSOA 1N0VC 4U02A 3T61A 3AH8A 5JSZA 4GZLA 5K8UA 1E2EA 2AR7A 1F60A 2C5LA 1IY0A 2OHFA 3PVSA 4LHWA 4E03A 5J4VA 2RGCA 4MKHA 2DWPA 1Z28A 1H8ED 1OB5A 4Q7MB 4TTQA 5GVRA 3KX2A 2EWVA 3BXZA 4Q1EA 4XSHA 5TV2A 4AK9A 4KBGA 3GEHA 1DG1G 3BK7A 1ZMXA 3AKEA 1E69A 1XMVA 1E98A 3B82A 1NP6A 3SQWA 1YZNA 2CBZA 4CYMA 1NMZA 2ZE7A 1XD9A 4EPWA 1F3OA 4B75A 1T5IA 2VH5R 621PA 2GJAA 5CYOA 3GLFA 3AKCA 5CB8A 4F7WA 4QGHA 4AY2A 2GAOA 4XOIA 3EA0A 3L0OA 4V0MA 1QVAA 1IOZA 3WYFA 1SVKA 1UF9A 2IWHA 4CW7A 2ZRPA 4QGGA 3M4YA 3MFYA 2JIZA 3AUXA 4KJZA 1ZC3A 2IW3A 1AM4D 2A5DA 4DSOA 2QSYA 4YMVA 5KTYA 3FOZA 3GJ0A 4I1OA 3GJ3A 2X2FA 5BN5A 5J4KA 1KYIA 1CS4C 1QZXA 1QVRA 1V43A 1LTQA 4JSYA 2OLKA 4LPSA 2OG2A 4TQUS 4DLWA 1R7RA 3GJ7A 1X8LA 4F93B 1GIAA 3KJIA 3NBYC 4HAVA 4TZ0A 2O8EB 3QI2A 3PEWA 1UBEA 3HPQA 2QE7A 1Z0JA 4HYYA 2RGGA 3EZ9A 4M9QA 5CM8B 2FGJA 2ONKA 4EIWA 1LY1A 4BFWA 4RFSB 1X3SA 4IOJA 3GLGA 1E0KA 4A0RA 1NI3A 1E96A 1FOEB 1KNXA 521PA 1UPTA 2GF9A 1ZM9A 3QF4B 3OESA 1KJYA 1JJVA 5FL7D 5LPNA 121PA 3I32A 4D25A 3H4MA 1E32A 4RKFA 1OXTA 1JEEA 4QJ3A 4HUQA 2OE2A 1G8HA 4PC2A 3K0CC 1P61B 1BMFA 2A9KA 1G3UA 3WHKA 5CYPA 1N6RA 2JA1A 1M2OB 2GJKA 4QOSA 2ZU6A 3RS0A 3A1TA 2EFEB 4OYHA 1NG1A 2ZS9A 4LBVA 3C16C 2NPFA 3NKVA 4M9ZA 2GJ8A 1SXJE 2BHRA 2GCNA 2VIIA 1WA5A 3HU3A 3ND9A 4XH9B 1ELOA 2ZJYA 4P4TA 3LVRE 3MG9A 2CCJA 2IXFA 4BFUA 4URUR 2DY1A 1Z22A 2XAUA 2IXGA 4WIAA 2RH5A 4IXMA 3VR3A 1LFDB 4AURA 4DWJA 1FMLA 4Q9IA 4PQYA 4TLBA 1XXHE 4XWAA 5F98A 3DO6A 5EXPA 1M6NA 1L2TA 4GPTA 1VPLA 4B3XA 4E22A 3L0IB 2FSFA 4PC3A 4FMDB 3KB2A 1E2QA 2XGJA 4KYUA 3D31A 3TBKA 4RFVA 3W5IA 1RC8A 3U2QA 1W48A 2ZRIA 2RGXA 2QTVB 2ODEA 2OFWA 1JB1A 3CNLA 3QIAA 2WWGA 3K9LA 4CGZA 4S2EA 5IDVA 3AGQA 3ASYA 4HAUA 1U98A 4TTPA 4Q7JB 4Z1MD 3DM5A 1VG8A 2IXEA 2B6HA 3AVVA 1KK1A 2GVDC 3TUJC 1NLZA 4BFZA 3TE6A 1XEWX 3NEYA 5CLLA 3SHFA 5KPJA 1R0XA 2VPPA 1G18A 3NBXX 3ONWA 1XPRA 2ZYWX 2J3EA 2VHQA 3AVPA 1GNRA 4FCTA 1OT3A 2ZAOA 2VYFA 1R5OA 1VG1A 4LDJA 2CNWD 4OJKA 4E5UA 4FMBB 1YR7A 1U99A 4LV6A 1KO8A 4H9GA 3U4QB 3Q9LA 1U8YA 2GJ9A 3DOEA 2PJRA 1AS3A 2WWHA 2X77A 1DAMA 2QMUA 2ZANA 2V9PA 4FW9A 1KSGA 1KY3A 2DFLA 3D6TB 3NDPA 3B7GA 1W46A 2HXSA 2H17A 1VCIA 1OF1A 2R6FA 2AL7A 4FWIB 3X1DA 5AUOB 4N1AA 1CR0A 4Q02A 2ZRCA 3QUSA 5KDLA 4QC2A 3FTQA 4PQRA 1EESA 3ZIAA 2B21A 1G6OA 3BFKA 4TMVA 3LW7A 4Q4JA 1UEJA 3CRMA 4RZ2A 5GVSA 2WJVA 5AUNB 4RFSA 2QQEA 1VIYA 4C0KA 2GWHA 1KMQA 1SQ5A 1M8PA 1W1WA 4A0HA 1VCMA 3QEJA 4EFNA 1A4RA 1S96A 2YJTD 2ZUDA 4ON9A 1QF9A 4UXHA 3EPJA 1XMIA 5JBQA 3VNVA 2AK2A 4B47A 1DTSA 3EPKA 3N70A 2BOVA 3F8TA 4ZDJA 2BBTA 3Q7QA 3CW2A 2NMVA 5EP3A 1YZGA 2FSIA 3UANA 4C0HA 4BZPA 4QRHA 3IUYA 1G7RA 4MYTA 3WMGA 1ZNWA 3MCAA 2IT1A 1Q20A 3OEED 1Q12A 4BLOA 1Z29A 5GJVC 1RPZA 1FUUA 1J2JA 5BYKA 2MSDB 1G3RA 4MGIR 4V0LA 5F9FA 3BWDD 1YR9A 2QBYA 3H86A 3L82B 5AJZA 1CJVC 3QQ5A 4PHHA 4G5QA 2YC4C 3F5FA 4DB2A 2KB0A 4JKIA 1OXVA 2FH5B 2WJYA 3DKVA 4Q4HA 3VFDA 5E7IA 1COWD 4U5XA 2ZRDA 1J8YF 4FN5A 5C4GB 1NN5A 4OK6A 5EJEA 1MO6A 2H18A 4M1YA 3TJZA 4TMZA 1XEWY 2OCPA 4D26A 3R9IA 2ZYVX 3DOFA 4MYHA 3VU9A 2JJ2D 4LHZA 5L3RA 2D74A 3CPEA 5KDOA 1CXZA 2OBMA 5AK0A 3QG1A 4TT3D 4DSNA 1IBRA 2JJ8A 1CULC 5KNDA 3SYNA 1VMAA 3R9XA 2GZHA 2ZJ8A 1T4GA 3TAHA 1IXSB 4DCTA 2CHVA 5JJIA 4B3GA 2GK6A 4CDGA 3CRW1 1ESNA 3EZ2A 2W0MA 1OB2A 1G5TA 4QGFA 4QG7A 3KKQA 1IXZA 3W6PA 1NVVR 2A5JA 1W0JA 2N1BA 4HAXA 2YINC 3LDAA 3T1QA 4M9XA 1NVVQ 2OFXA 1IN8A 5FBQB 3QXJA 3EWAA 3MLEA 2MSCB 4KSCA 3N2IA 5JI3E 3THYB 2P2LA 2Z4SA 3CRRA 1LF5A 4OQMA 1VG9B 3THWA 3ZQ6A 3JZAA 1UDXA 3GLFE 2Q3MA 4HATA 4KODA 3U4QA 4Q01A 1P6XA 3KTAB 4V0ME 3PXGA 2G0TA 3MJHA 1I2DA 1E94E 1RJ9B 4I1VA 4JIMA 2ZEJA 5JMTA 5B57C 4KBFA 2DB3A 1RZ3A 2WZQA 1BOFA 5DI3A 3SJZA 2PJZA 5AWFC 4JSTA 1NJFA 1HTWA 5EE5B 221PA 5G40A 1VYUA 2G88A 2FJUA 1UKZA 3ZZTA 1WCV1 4RCYA 2WJGA 4A2QA 1BO6A 4BPBA 3FE2A 5DYGA 5A5GA 1AKYA 4BLTA 1MV5A 2BM0A 3ZD7A 3CZPA 2Z5FA 3QXHA 3LW8A 2PZFA 3QENA 1G8FA 4IVQA 4P31A 3SNHA 2XOKD 2NO0A 2KSQA 2CL7X 4KLZA 1Z6YA 3KDSE 1JR6A 4U7DA 2XJ9A 5EZ5A 4ILEA 2GXAA 4IOLA 3GLGE 3QE0A 2B7BA 3GMTA 2OAQ1 1KDTA 1NBMA 1GKIA 1E2JA 3MUFA 4PXAA 2ZAMA 1TUIA 2R8RA 4NU0A 5F9HA 1US8B 3O8CA 1IM2A 1T0JB 3CF2A 3M6AA 2BBOA 1K6MA 1X1SA 5FBWB 1BMFD 1U9IC 1W36D 2DFNA 1P4SA 5JI2E 3AF3A 5FTMA 2NOAA 1Z0FA 3LV8A 3MJRA 1JPNA 2ZE8A 2CEAA 4IW3B 4WXPA 2BMJA 4ARZB 2KJQA 2V7QD 4D0LB 1IJEA 4C7OA 4US1R 2A30A 2J0QA 5IRCD 3CH5A 4A9AA 4EDHA 2RGNC 4B43A 4EJSB 2JJ1A 2WJJA 5LB4A 3CONA 1YR6A 2ZRNA 2ZI4A 4TMKA 1NL3A 1XJCA 5FTJA 4MRSA 4WZAE 3V00A 1YZTA 2AD5A 2ZRGA 3CZQA 3PV0A 3VKHA 1RKBA 1Z6XA 2HT6A 2OEPA 4GOJA 1CR1A 2D2EA 4YQFA 3VTKA 1JECA 3DZDA 2BCJQ 1G41A 4IFBA 1PUJA 2K5UA 2DWQA 2CL0X 4Q4AB 4D4LA 2IWRA 5AUQA 3I5XA 1IY2A 1I4DD 3FPAA 5TMPA 3REGA 2QM7A 4RKEA 1OLOA 3L43A 3QKRB 3Q5EA 1NKTA 2IHBA 1KI6B 2I1VB 1HE1C 4DIEA 4JBXA 2ZXUA 5BYJA 2ZJAA 4OQLA 1J90A 1A1VA 1II9A 4ZIRB 1OKKA 1JI0A 2YWGA 1T6NA 1GZSA 1NJGA 1YRAA 1PLKA 4QNRA 3E1SA 1TAGA 2OAP1 3NH9A 3B78A 2C96A 1E1QA 4WW0A 4A8JB 4XVRA 1GM5A 1KDPA 4FINA 1HA3A 4NPHA 2AKYA 4QM6A 4DCSA 3AP1A 2R44A 2YWFA 1A82A 4G5GA 2Z83A 3KTAA 5LBIA 3GJ4A 1RJ9A 1QHIA 4UJ3A 2X19A 2JDIA 2X2EA 1P75A 2Z0MA 4NDZA 5EUQB 4B73A 3ZLJA 1G9XA 1FQKA 3IILA 3TQCA 3FVQA 3C5CA 4DSTA 4HB3A 1TL7C 1VCNA 3LAWA 3K09A 3CNOA 5LDDC 3EARA 4IJMA 4X8OA 1G64A 2PL3A 1YU9A 2ERYA 2WAYA 1KI7A 2WAXA 2P67A 4EQ6B 2FN4A 3ETLA 1GILA 4GMXA 3RSLA 1Z2AA 4MRVA 1GTVA 5E7MA 4DRZA 4CT4B 1N6HA 3PQCA 4DT1B 3T35A 2REOA 3IEVA 2GJSA 4CEHA 1G17A 5HCIA 1SXJA 4PSAA 4Q9JA 3U6BA 4TLEA 1E9CA 3ZS8A 1W44A 3C8UA 1U8AA 4R2IA 3SFVA 4HLUA 1VHLA 3IBYA 2H92A 4QBFA 2X1VA 1HV8A 4PFSA 2JLZA 1YZKA 1IN7A 1RRGA 1US8A 2QENA 5FUXA 1DEKA 2IYQA 4XWKA 2O8FA 1FX0A 4D2IA 4BLSA 3P4YA 2EU8A 2VLIA 4KV9A 4TWZA 2ZI9A 2C2HA 2IF2A 3MMPA 4LY6A 2QRZA 1ZM4A 2OM2A 1KHTA 3WRYC 4FIDA 3PEUA 1D5CA 4ARZA 3V4FA 3SDZA 5JHGB 2F1JA 3E2IA 2ATVA 4AYWA 4ZO4A 3T06B 4NP6A 1Z07A 5GADl 4L8GA 3LH5A 1E4YA 1JQLB 2H8KA 1XTQA 3LO5A 4FCWA 4E09A 1DELA 5DYIA 1ESMA 2D3WA 1Z0DA 4MH0R 3X1WA 4AKGA 3RRZA 4LHYA 2XSZD 2QN6A 2ZR0A 2VQSA 1W4RA 1VECA 3RS5A 3U44B 4D82A 4JMPA 1KDRA 5AJVB 1E1RA 1IXRC 2NZ8A 4CVNA 3SBEA 3NIBA 1XFAA 1H8HA 3WBKA 1DE0A 3K09C 3LXRA 3RVBA 1KZ7B 1M1YE 4F4CA 1EFRA 2E87A 3ZS9A 3K70B 4Q4AA 4OBEA 1SVLA 3KKPA 4MKFA 4BWYA 4C0AC 3CBQA 3B60A 1KO4A 1OIVA 1SULA 3QKRA 1CJUC 1J8MF 1II0A 1KI6A 1QDEA 3R7WA 1GVNB 4B71A 3EAQA 1EX6A 4OI1A 3T12A 3VAAA 1LW7A 1IJFA 1E2DA 3LBHA 1P3JA 2RMKA 1UBCA 3BS4A 3T34A 2ANBA 1ZRHA 3TMKA 4DCVA 4TQ9A 4P4SB 3AF1A 2HJVA 2BMEA 1OXUA 3TSZA 4PHTA 3UK6A 2ORIA 3BFVA 3W3AA 3V9PA 1KI9A 1UM8A 2XNDD 2O0HA 3RRYA 1Z8FA 3P32A 4BLPA 3NDBB 3CPJB 2Q6TA 4UXJA 2O5VA 1UBFA 4GDFA 1S3SA 3PFIA 4ZCIA 2IYXA 4YLGA 1KSHA 5P21A 1OHHA 2PBRA 2GILA 1II8B 4EFMA 3AB3A 2O8CA 1HH4A 4HAYA 1XX6A 3T1VA 5K8LA 4E07A 3SN6A 3I8SA 3FMOB 4W5HA 3VR5A 1SHKA 2ZUCA 3JZMA 2PX0A 2ZITA 4HUTA 3ZZUA 2IUTA 2FZ4A 4BZQA 3EIHA 3OAAA 4OI2A 3DEFA 3K0EA 2ZJ2A 2YV5A 1BS1A 1E2KA 3KJEA 4Y0AA 4MITA 1W49A 1R8QA 4EJSC 4EQ6A 4Q19A 3FYHA 3CRVA 3A1UA 3EZFA 1XEFA 4QJ5A 4B3FX 1Q22A 3PUXA 3IDQA 2JLYA 3K53A 1XF9A 1XP8A 5LD2B 3KJGA 3P27A 1IN4A 1XBTA 1LVGA 1TPZA 1SVOA 2WOJA 4YMUA 3BD9A 4AYTA 2WTUA 4LJ5A 1AN0A 1ODFA 4A6PA 2GZDA 4BUJA 3THXA 4L16A 4G0NA 5H70A 4HB0A 1G20E 1RW4A 2GDJA 2WVJA 2VHJA 3AVWA 4M1MA 3ZYCA 1N3BA 4MRRA 4RZXA 1NBME 3NHAA 1PLJA 3RLFA 2G1KA 2W6IA 1TQ4A 3M1IA 1G3IA 2ZRBA 2ZI5A 1JR3D 2MSEB 4KFTA 5DGXA 4PX9A 3C7KA 3C14C 2ZSDA 2J1LA 4LPKA 2YKGA 4OQXA 2I3BA 3IO3A 5FPYA 1E2NA 4DBLC 1AQYA 3T1OA 3KL4A 2C03A 4PSVA 3VR2A 4A8JC 2ZRKA 2IYRA 3IPXA 2OCAA 5IHPA 2R6AA 4PO1A 5DO9A 2P5TB 3UMSA 3KKMA 2GCOB 2IK8A 3O8DA 3EPLA 4HLCA 3KUCA 4GI7A 1I2MA 1D2MA 2J7PA 2ODNA 4ZV4A 2JJ1D 5FI0B 3K0CA 1ZUHA 4ZI3A 4LYJA 1CJKC 2BMFA 3U44A 1TQ6A 1WBDA 2F1HA 2EFHB 1OSNA 3KQHA 2WKPA 1T8UA 4HZUA 3NVAA 1F2TA 4QNMA 3B1YA 4JLKA 3RWOA 1M7GA 3GFPA 2ZROA 4DDVA 1BIFA 1GFIA 4HB4A 3FMFA 1FUKA 4OJQA 1U94A 4I81A 1NG9A 4MRPA 1Q1QA 2YNMA 4IHQA 3WY9A 1K8RA 1S2MA 4TYQA 1ZC4A 2O8BB 2CK3A 2CLCX 3AF4A 4JVMA 3RANA 1F48A 3CM0A 1L4YA 1ZNXA 2ZJZA 1NMXA 4V0OA 2O52A 4DLTA 4ZCMA 1OKKD 5KNCA 1W2GA 3RAPR 4WAUA 1VTKA 1UKVY 5DN6D 3SE0A 1YE8A 2A7QA 1F2UA 3IIJA 2WM9B 2XNSA 3AEZA 4R98A 4URWR 3SFZA 2KI5A 3FMPB 2F43B 4C0BA 3EX7C 1RRFA 2QTFA 3TVTA 5BWMA 1PJRA 2FNAA 2J87A 1CR4A 1KJWA 2DHRA 1EFCA 2ZQ5A 3A8TA 1D9ZA 3U5ZB 2WJHA 3I5YA 5CDFA 3HR7A 5J4YA 4JLVA 3TH5A 4ACAA 4OL0A 2WMNB 1XWIA 5L8VA 1W4BA 5JS8A 4QXAA 3ADCA 4TMXA 4BFXA 4F4JA 2AFIE 4QHTA 5FFMA 3RS2A 1T5LA 4OHZA 3REFA 4R7ZA 2QPTA 2AWOA 4NH0A 2BBWA 2P3SA 1E4VA 1Q1EA 2J0UA 3W8RA 3FKQA 3PUVA 3C4JA 5CK5A 4FI3C 1UKYA 5FPSA 3BB1A 1AK2A 5KU1A 2RKOA 4H1VA 1YQTA 1EG7A 2VP4A 4OHXA 2BM1A 2CL6X 2OILA 1SXJD 1ZCAA 3BFXA
chains in the Genus database with same CATH superfamily
1U8TA 1RYYA 3LM8A 5JBNA 2V3WA 1EK6A 2QRNA 1YF3A 1M74A 5JXJA 1VHTA 5DISB 1VE6A 3U13A 4QSHA 4G5OA 4QBKA 2JHFA 4QJIA 5FPHA 5BR8B 3QW4B 4LDRA 4WZAA 3UV3A 2CXRA 1AQ6A 4RD3A 4D98A 3E9YA 2BI8A 3DHYA 2I1QA 2MMCA 2UAGA 2IHVA 2Q0HA 3AVOA 1BQ4A 2AI1A 2WJPA 2Q9BA 1WVGA 1MORA 3DSRA 4OQFA 2PKQP 3SPXA 2LIVA 1FQWA 1M2VA 1NYQA 3T7RA 1U2GA 2LZ0A 4Z5XA 3UHJA 3BAFA 4TUYA 2IHNA 3PPIA 4FINA 2Z6QA 1XU9A 1WVIA 3V8PA 3I30X 3D3WA 2I4MA 2CD9A 2AZXA 4BFLA 5DLYA 1XD2B 4RY0A 1VBKA 3BM5A 3DZFA 3L8HA 5CITA 5IJ0B 3G2PA 1IVSA 4YV7A 2P2DA 2OXEA 5DIFA 2FX3A 4M1ZA 3STTA 1Z0SA 3DAGA 4QBGB 2NO7A 1BRMA 4OOFA 1T9HA 3OX2A 4GPAA 2XMPA 4JX8A 4P1ZA 1BKDR 4GKJB 1GXSA 3X1XA 1LX7A 1NOJA 2JZNA 2IYZA 2HQBA 4ENTA 5LYJB 2FPIA 3AUJB 2O2SA 4GPEA 4P3PA 4XQGA 3JX9A 4A5SA 3K6JA 5F5NA 3NATA 4QWWA 4NFYA 8LDHA 4KQCA 2IIQA 1N33B 2O9JA 6CHYA 1HNZB 2FSVA 5FWXA 4CV0A 1HE5A 1UL1X 3OTOB 4N6NA 5DPMA 3V46A 5A02A 1E7WA 2CYAA 2D1FA 2H5LA 4MVJG 4O0MA 5AHOA 2VPYA 4L4RA 3WSWA 1OH5A 5ALXA 1AKQA 4Q3AA 3QVKA 1W85A 2AJTA 2X8BA 1Y1KE 3K9GA 1S5PA 1ZWLA 3RVSA 3OZSA 3NQ41 4EUSA 3PUWA 2H9YA 4FBGA 2JASA 4MTCA 2BGUA 5CVUA 4F2HA 2BN4A 3B6KA 1JVNA 4MUAA 1CJCA 1UBSB 2HKIA 2FRVA 4YAUA 3PXCX 2AI2A 4FGWA 4MQFB 2YWJA 5AVOA 2XVZA 2EDAA 1T8RA 1Z39A 3FCCA 1LZLA 3FGZA 3CH4B 3W8FA 3HFRA 1X87A 2VJMB 4MV5A 1IDOA 2HLDA 5A4IS 4B2LA 3ZIDA 3IAXA 4NOMA 3Q8MA 1OD6A 4IMPA 2YYZA 3N0VA 1WMSA 2F43A 5KYYB 2IHJA 4P5EA 1LEHA 4AZ0B 4QFBA 4FEEA 4RK0A 1C4XA 1N25A 4V1CB 1T9BA 1KY2A 1EX9A 1KORA 5EMKA 2JK1A 2J9ZB 1EAMA 2A88A 5BSHA 4MVCA 4RDXA 1A76A 2C98A 3V4VB 3OU7A 4NZYA 2IYYA 4ERNA 4XRGA 5FLKA 2QNRA 3VR5D 1O03A 3FR7A 3B9PA 3DNFA 3H4TA 3KRTA 2QVCA 4HVAA 4BEBA 4P5DA 1JS1X 4IXDA 4JVNA 3MD0A 3GUHA 1O7JA 5BOVA 1FQJA 1YZ3A 3K8YA 4K03A 2Z95A 3HY6A 4JBGA 2ACKA 3HB0A 2XWPA 1F8UA 1JQEA 1V7ZA 3UMCA 1KMCA 1FDUA 3I0MA 4E70A 4DR3B 3QBTA 3R0ZA 1TZ2A 1DG9A 4KZPA 5FL3A 4G65A 4D9GA 3G0OA 3TIGA 3SKXA 1NSYA 2X7JA 2XMCA 2WKSA 1OFUA 3CLRD 5C52B 3UKDA 3C3JA 5FWNA 2Z04A 1GZ3A 3A37A 1QCDA 4HK4A 4L85A 2VK4A 2BEJA 4S1PA 5EMNA 1CETA 2EKPA 4QOGA 4V0RA 3H6HA 3V55A 4A92A 5JALA 2A0KA 2O2JA 5B1EA 1VDZA 5ITSA 4UTRA 2FQYA 4JOSA 5HE9A 4BB9A 3DW3X 2VR1A 2WICA 2VOJA 3OWHA 3WQSB 2ZBRA 3K72B 4DYVA 5SZJA 3N0WA 1KS9A 2IODA 1DCMA 3GVHA 1E0AA 1NT4A 4RGBA 1UT6A 4B40A 3AV3A 1BD3A 3RRBA 1UDCA 2YFYA 3QJ5A 4FQ8A 4L5YA 5BSMA 1TE2A 5HMLA 1PFUA 1L5ZA 2JAUA 1UOOA 3RYTC 3FGNA 3KLOA 4RIIA 3IB6A 1UKEA 3EDOA 5I7RA 3GAMA 1WMEA 3I37X 1ZSYA 3V7FA 1NDUA 2PSJA 2CDNA 2AZTA 2GD2A 1XI2A 2YRXA 1C1DA 4H7IA 5U1PA 4DLVA 1D9XA 3ORYA 4KXUA 4FNMA 3TTYA 2ATXA 4Q03A 4EYQA 4EM6A 3M1AA 3ILVA 5HBGA 4ZRNA 3DMTC 3DVAB 3WGKA 1OGJA 4CU5A 3I45A 2IP2A 3M82A 1REQA 5AVXA 4UPDA 1FSFA 2ZSAA 4W5TA 1SBZA 3CKLA 1UC5B 1RS0A 3JASB 4OKNA 1N2JA 3GEEA 1GSIA 1Q0PA 3AXSA 3HL4A 1KFBB 3KT8A 4C30A 4HX5A 5C1DA 4BLRA 3CRQA 1IN6A 2WLSA 1QAOA 1R2QA 3OE4A 4ZZ2A 4Q7LA 1RWOA 4LYFA 1NXSA 3C3WA 2P2YA 3H83A 4NR0A 4YASA 3OWOA 4ZT5A 3TLGB 3R3WA 1CNEA 5FPQA 2QQFA 4BVBA 2OR3A 2W8ZA 2YICA 4B44A 1EM8B 4PNZA 1LLDA 3M6UA 4MIOA 4JT8A 2YFKA 3ZH2A 3DWEX 2H06A 1Z3IX 4AKIA 2FW6A 1WUHS 1XJQA 2ZBEA 2WBLC 4GBED 4L8LA 4UUQA 3TR6A 2FEOA 2NO4A 1ZKMA 1XNJA 3PQ6A 5FBVB 1NMYA 1FS6A 2Q3CA 3IR5A 5AHRA 3B51X 3TEMA 4O4JA 1C30A 3UICA 3QBJA 4YC7A 2XEDA 1K9VF 3BIFA 4MUYA 1F38A 1NRJB 5GINE 4Z4GA 1QF6A 2W2XA 1G21E 3D4BA 2IXBA 3NP7A 4DM7A 3K1ZA 1L7VC 1NF3A 3QLUA 2BJWA 3EIFA 4IUYA 3EJWA 5JWRA 2JGDA 2CD7A 2WT9A 1S6YA 1G2OA 1U90A 3I2IA 4M6WA 2YOGA 3Q7TA 3HCBA 4NHOA 4Z0HO 4ZJUA 4OD0A 3IAUA 4Z7OB 3I73A 3TGLA 4KYVA 2IYFA 2FEMA 5GJCA 4D4IA 1D04A 3FDZB 4JGGA 3R9KA 4CE6A 4D3SA 1JLLA 3H1GA 3QVWA 1O2DA 1XU4A 2QE7D 2WVAA 1C9NA 3MERA 1IHOA 1P5FA 1SVUA 4FFRA 5E8RA 5EZSA 3ZWPA 2A1UA 1R0KA 1X1BA 4WBSA 4RMIA 3TLAA 1SVMA 2D5AA 4REQB 3WA6A 2J3MA 3G9QA 4UCWA 4AIIA 4YJFB 3SHTA 4RVDA 1CUJA 2W42A 1J0BA 1U2EA 1LKZA 1H85A 3GQBA 1KYTA 2GZ1A 2YXEA 4TVOA 1QRUA 2DWUA 3SWWA 1O0BA 1OXKB 1G19A 4E1BA 2P1ZA 5KUTA 3OFJA 4NCHA 1UBJS 2ZETA 2NSDA 1VB3A 3UFBA 1LA2A 2IHTA 3T54A 3JVIA 3OIFA 4MP6A 2AKAB 4OB7A 3U9TA 4E5VA 1TJ4A 1MP0A 3L6DA 3E1GA 3ZGOA 1AZSC 3PL5A 1BDIA 3AP3A 4NMMA 1JKJB 1POXA 3P26A 3VNVA 2NZXA 3MBIA 4UHHA 2OC4A 2QAGC 1QF7A 3HV0A 3JQ9C 3PIIA 4TGLA 2EW2A 5L51A 1Z5WA 3TI9A 2BKVA 1J99A 4A7PA 1HG0A 4DMUB 5F7XA 3RJZA 4N47A 5FPSA 3P9YA 1ONPA 4W1SA 1ONSA 2XUKA 5KAPA 2XTMA 5E9JA 1FE8A 2BHTA 4FKMA 3WHLA 4XKJA 4XM0A 4Q3CA 1OPXA 4FIZA 5FCDA 2WYHA 1QTQA 1LSOA 4RSRA 4Z9BA 4YMSA 2X9QA 4W4TA 4OQ4A 5EWJB 5LU8A 2YL2A 1FFCA 3QQPA 2YZ2A 3QVLA 4AUNA 3NXSA 5D3QA 3JCZA 1BYUA 3JQ8B 2XUHA 3A4NA 3WBJA 2UXDB 3UB2A 3OX4A 4QT0A 3LY5A 3HCRA 4W5RA 1M5TA 4I50B 4JP5A 1T9DA 4EPVA 3E7PA 1ACLA 2WU3A 5EE3A 2F3UA 4G0PA 1GSOA 3CZ9A 3IAHA 3AU9A 3JSXA 1ZWKA 3FPBA 3ND5A 4QQFA 1VJ1A 5DGHA 4JWTA 3L18A 1DWQA 4WK2B 5KI6A 4D80A 1IPHA 2H52A 3IHTA 5JJCA 1ZIPA 2OORC 2NG1A 1YBHA 2R2AA 4NPAA 4Y6QA 3R7DA 1GT6A 1NW6A 3LF2A 5CCEA 1DOAA 1P0FA 1VYTA 2EIHA 2QAJA 3VDNB 4XGKA 3JQ7A 3QKWA 3TEFA 4AG6A 1PQPA 2VCHA 4D97A 2HRRA 1H0HA 4RGQA 2C07A 1DBSA 2MYNA 3AETA 1Y5MA 3ISVA 1YIOA 3E9DA 3AVYA 1JUDA 2YTZA 3RJMA 1YT5A 3B5IA 4RS3A 3WNCA 2VRWA 1R9GA 2QROA 3RDPA 2ZUEA 3S68A 5DYNA 4HAWA 3AUSA 3N0XA 3WRYA 2R00C 4H4DA 4DKXA 3CNBA 4FQ7A 3GJ6A 4PPQA 3TOZA 5L6LB 1SHZA 1BVHA 3GJRA 2MSNA 5G4KA 3EGEA 4GOMD 4WSOA 4B46A 2WF8A 1K5HA 5DHPA 2GAAA 1PFQA 3QWBA 1NXVA 2P90A 3THYA 2EBFX 1SC3A 2H4WA 2JI6A 2OK8A 1BCSB 3BULA 3P96A 3T3GA 3G2LA 2QY6A 5IAEA 2PEYA 3GRYA 5T4BA 5BV2P 1S9HA 1U0JA 2I55A 3BB3A 4L5CA 4WERA 4YJKA 5CT9A 4L6AA 5J5CA 3BDIA 3I62A 5JPIA 2G71A 3FD8A 3KVNA 3NHPA 5D3ZA 4Z99A 2YJ5A 4YLYA 1BEZA 1Y8QA 3VSBA 4S12A 3MD9A 3IT3A 1FCJA 1K3TA 4ZVVA 1C7JA 4YREA 4WFQA 1A8SA 1FU8A 2NNWB 2OO7A 3D6VA 4I1SA 3OCJA 4A26A 4HH1A 2BT4A 3TIFA 3WO1A 5FH9A 2BFCA 1SVWA 4JLMA 5AW1A 5BOSB 2VO1A 2EFJA 2H1LA 3Q7PA 2DPLA 4ZREA 1ZAKA 4HDQB 4Q93A 4JT4A 3K9FC 1ZVVA 1XKLA 2D3TA 1FFGA 1SCJA 2GT1A 5D84A 4J0HA 3RFUA 3HDTA 3MEQA 3VI3B 3ZIAD 1NBEA 3U26A 1E3QA 4R1TA 2HOQA 4BY9E 4XEHA 1L4FA 1WKBA 4TS3A 4IMJB 4QYMA 4RJKA 4ZT6A 4DUGA 2Q45A 4PQGA 3ZJ4A 2IYSA 1EMDA 3D2AA 3WA7A 1KDYA 5M04A 4LC0A 3UN1A 2FW8A 1OFUX 4WK0B 3INYA 4MP3A 5F3RA 2ZKLA 3WNDA 1OR8A 4CKCB 1PWEA 1GEEA 2UYCA 2Y1CA 3ELBA 1R8SA 1RJDA 4XB6B 2ZZMA 3T7TA 3DFFA 1P1KA 3HWX1 3EGCA 3ESBA 4L73A 4HGRA 5CX1A 4PS0A 1NBAA 1AHIA 1UQTA 2VCEA 1YZFA 2QRMA 2J33A 3NWEA 3BCHA 3SX4A 4EVSA 4UFOA 5KWIA 5EFOA 4BGEA 4TL9A 1MRNA 4HL6A 1SQSA 1VB5A 3L7CA 1Q7BA 3QYPA 4JCCA 4XYLA 1Z35A 4Y9DA 4KRXA 4HF7A 4UUMA 3FG9A 3TOXA 5LP6A 1UBHS 3IE2A 2NSLA 5LLTA 3TECE 5AK6A 4RVFA 1TVEA 2FWMX 2II6A 1W1UA 4G4SP 3JW8A 3ZBTA 5DNYB 3RSSA 4DMGA 1XLTA 4W1RA 4MJXA 2WIFA 2PD3A 2X3FA 1CZUA 1T29A 3LUKA 3SMVA 1EGQA 1RE0A 3B9QA 4INPA 1N5RA 1YCGA 2AW5A 3GHHA 2AOUB 4LY0A 1QH0A 1T0BA 3OZ7A 4NJOA 4BXOA 1Y81A 2Y1LA 3OJEA 5THQA 3EODA 2FMTA 2O07A 3P8ZA 2O2IA 1M0WA 4ZDWA 2X40A 3RHFA 2NO6A 5CAEA 5JO0A 2QU8A 4TKMA 4EKNB 1FFXB 5LMCA 2WP8J 2YV4A 5HF9A 1JBKA 2BR3A 2JIOA 1KETA 2C8VA 4HQOA 1DRVA 2A4KA 4YK7A 3EAFA 1QYRA 1ZH4A 4WBNF 2VA8A 2ZWPA 3QU2A 4EY4A 4JJEA 1MENA 1SC9A 2I5PO 2D54A 1V9LA 3OOHA 4IJVA 4YDRA 4K6OA 3L0DA 4PFKA 4RPIA 4X60A 3U81A 5J4HA 1KI2A 4BPRA 4MUGA 1D8AA 1EUDB 2C2MA 2IGTA 5J2UB 1IAQA 1S8FA 3O3OB 1F9AA 4KGXA 4K9SA 1D6SA 5K3FA 4QYIA 1C0IA 5D00A 3ADDA 4Q21A 1P7PA 2VC2B 4DBVO 3L5KA 5C8VA 3MYYA 4JJ6A 4IYRA 4MGYR 4N6OA 5HDBB 3W6OA 4ECAA 1YKFA 2X8LA 4OHVA 2XWSA 4XVHA 5GWXA 2R8OA 1BD4A 1GRVA 3JD2A 1SC6A 5EP4A 2YJ6A 4UHJA 4XQEA 3JPYA 4IVNA 5A62A 3TQFA 1A7KA 4CZ2A 2P3OA 5EERA 2G83A 3MGAA 2GRAA 4DDWA 4KQ6A 5JI2E 2EX0A 3UJCA 3P9NA 1E9FA 2YS6A 5C1OA 1L7QA 3G2MA 4JJ7A 4H6VA 2G1AA 2JFGA 2RGAA 2OFFA 3L7BA 4Z51A 5IULC 4GVLA 1W5TA 4C0XA 2HHHB 1P5ZB 2X3UA 4QFDA 3TI7A 3OIWA 2X5NA 3K4PA 2VUUA 2WFZA 1T15A 3KP1A 3P0RA 3Q2IA 4IIUA 1I5OA 5MDHA 1U4SA 2CHQA 1M34A 3JQDA 2DUMA 3DULA 4O4HA 3RB8A 1IHDA 3L40A 5FORA 1BMTA 5J2TA 1L4GA 4FE7A 2AOTB 2Z8ZA 4GVPA 5DNAA 2BFDB 2HJRA 4FT4A 4AKTA 3OJXA 3CLUD 4OFZA 2AB0A 3MBKA 4OBWA 4EAQA 1V5IA 1SCUB 1WXFA 4FR0A 3HDVA 4M0CA 3URKA 3WQRA 1OMOA 1HURA 2JEYA 2F3TA 3HCWA 3IIMA 4EF6A 4NICA 5CJJA 5CTAA 4O2BB 5SZHB 3V8NA 2NO9A 1U9ZA 1BE1A 3HCDA 5MGBA 3IBFA 4DT1A 5JECA 2IXAA 3NAGA 2V98A 4ENWA 1R9NA 1XMPA 2QZ9A 1NVXQ 5IASA 1A1SA 4KN6A 1YVDA 3JZIA 2EFYA 4L76A 2VEDA 3WGUA 5LOVB 2A9OA 3JYNA 5G0UA 3GLGB 3FOFC 3DMRA 1ZW6A 2ETVA 2PVCA 3UZUA 2FW0A 1S0UA 1Y9ZA 3U61B 4IV5A 1K7CA 3ZHYA 3SX2A 2IOYA 3GFOA 1UBLS 3HC7A 2X5XA 3JAWB 4JJGA 3HJFA 3L06A 3MMXA 4FMCB 1XPUA 3DUFB 3L6RA 1THZA 1Z2CA 2PCLA 4O2AF 4QBIA 3RV3A 2IUEA 1N5JA 4C4XA 4E46A 1CUIA 1W36B 1QGAA 2OSBA 2C04A 2CLOB 4ITRC 2A0WA 5GONF 3QPUA 1S2OA 1NBWB 4W5JA 3DEAA 5JWHA 3BTVA 2P9FA 4H3KB 3SR4A 1BGVA 1M0TA 3HI6A 4KDEA 2OZLA 5HR5A 3BJIC 2CL5A 1IK6A 2W90A 1JKFA 1NMEA 1RCFA 3LT5A 1JDTA 4OGKA 1U9CA 3V34A 3ZDZB 3M2PA 3BERA 2D2FA 1YHNA 2QTHA 3IQEA 1HT2E 1MUUA 1XALA 1IHYA 1RYBA 4B87A 3TRHA 4PGMA 3KPVA 3NYWA 4XDGA 3TW8B 1YB6A 3EXEA 2H2GA 3GZNA 4FSXA 4B6RA 3BSSA 1IB6A 3M4ZA 5IJAA 5KAMA 1SPXA 2ZTVA 1VYVA 1DUVG 2JLUA 3RTAA 2C5FA 1COWA 4G2NA 1YL5A 3CTPA 3MLAA 3UW3A 2ACVA 1YDEA 3N2GB 4GQAA 2WIDA 4WV3A 5J9FA 2I6QA 2Z9BA 2FOIA 3IUSA 3NT2A 2V58A 2YWHA 1GTSA 4F1JA 2XZTA 1V5GA 3FVRA 3R5FA 1HE2A 3CWZA 3IVCA 2RK6A 4PNPA 3ER9A 3BSYA 3OQVA 3HMQA 1N1MA 1KL7A 1QJ4A 2JFQA 3FZGA 1I10A 2G77B 2GNPA 1CK4A 4M22A 4N0EA 4TT3A 3BMOA 2NTEA 1WLYA 4AW9A 4JNKA 1EI9A 1T34A 3JQPA 2DZDA 5KS2A 4G5HA 4EG0A 4YCMA 1BW9B 1AUVA 1JSLA 2C84A 5JQGF 5HXAA 1NWCA 4MGEA 4DC0A 3FGOA 3TRFA 4B7AA 2RI0A 3A9WA 4N03A 3JR7A 3WGLA 5JW6A 3U3OA 4IZOA 3UAOA 5CPBA 1S2LA 3JRNA 1JVSA 2CW5A 3QUAA 1T5BA 1BYIA 2DUWA 4U7WA 3VOSA 1ZU5A 2NSYA 1ONOA 1JAHA 1FUEA 4Y1RA 1W47A 2XTNA 3WIBA 5EIAA 2ZUVA 1Q19A 4BMNA 1BHSA 5ITVA 2XH8A 2AMLA 4UE2A 3PHLA 5CVCA 5DJ5A 2Y8EA 3C74A 3SJBA 4IDHA 3UJ8A 1OUMA 1TMKA 2WMDA 1BU5A 2WFMA 1G8MA 3JYLA 4I1UA 4OJNA 4R9SA 5JE8A 4E5DA 2BF4A 1KO1A 1WCIA 2OAGA 2Y2VA 2PTHA 2XYVA 3AGPA 3OX1A 4LRUA 1MB0A 3EVDA 3AP2A 4BB0A 3FHLA 4CLEA 2W2NA 4RTNA 2ZWMA 3OTGA 1EBFA 5C9ZA 5KU7A 2EYQA 3O94A 1U2TA 3T4XA 3EA4A 3YASA 4DHWA 3HTXA 4Z4EA 4AI6A 1QPGA 5IC5A 1KMIY 1RYFA 2CB0A 4QATA 3I9JA 3O9VA 4GU5A 2P65A 2HIMA 1UK6A 3GA5A 4BO2A 1EG2A 1BS2A 2JDID 1P7CA 2B8TA 1U28A 2GTPA 2PVSA 4GM1A 4PZZA 4U3JA 4XTRA 3ZHRA 1Y3AA 4AMZA 4J2HA 4OHKA 3S29A 1YRBA 3EVCA 1M6WA 4N3GA 4N65A 1NN0A 4Z4HA 4OLFA 1NI4A 1XZJA 2W6CX 4LZZA 5E3IA 4P4NA 2R9VA 4ZC1A 1N2HA 1QLHA 1FFBA 3EPRA 2IYNA 2NQ2C 2R6GA 3B3QA 1HYHA 3GLHA 4WUVA 1A77A 1LK5A 1CG6A 3FPJA 2DQ4A 2BEWB 4CMIA 2PKWA 4CJXA 1LLFA 2A9QA 4Q4JB 3GV0A 3ZX4A 4EHJA 1TKRA 3OIDA 4N4AA 4PLGA 2RCNA 2QXYA 1HE8B 4AG5A 4QJBA 5TEWA 1G7SA 1M73E 2XMSA 4HFRA 4U2KA 3VDXA 3DTVA 1MOQA 3GAFA 3PNSA 4JITA 4NU8X 3ND8A 5I47A 4RTMA 1XDSA 3IVRA 3S2EA 5ILGA 3NJRA 4JJIA 1U0SY 2WSMA 3NLLA 5MF6A 1N5IA 4KQJA 4PYRA 2PBZA 2G1UA 4TLAA 4LMBA 1ITZA 2ZJFA 3B6ZA 2VDWB 3M3PA 1XKTA 3RKUA 5BR4A 5BVHB 1VFPA 1EYZA 4YXWA 2C7OA 3N07A 4B6FA 3D3QA 5B4VA 2AHOA 1BVRA 3NTUA 4OGFA 3H0KA 4OA5A 1NN1A 3EFOA 4MHTA 4INZA 2IZZA 1E3JA 5CHYA 4ZYZA 2Q21A 4B3TB 1TW3A 3DGFC 1TRHA 2VXCA 3MRVA 3S2UA 3ZWDA 4H6XA 4BCBA 3VZSA 5JPCA 3RJ5A 4IJUA 4G36A 5FD8A 1JU4A 2ORWA 1OVGA 2OD2A 4HOYA 4XX1A 4P93A 4AY4A 1TZMA 4PAOA 4TTTS 4B8ZA 4BEWA 3LX5A 1NULA 2ZIFA 3HKCA 3L0CA 2QBYB 2Y66A 3QOFA 3T52A 4COKA 1AO0A 2P9QA 2JGRA 4LTDA 5E6RB 1LSJA 2RIRA 9ABPA 1UDWA 1NVDA 2RHBA 1GKLA 4MPTA 1NR1A 1EVKA 5EIBC 4Q4HB 1EHYA 1UPUA 3MAGA 4H1HA 5JD3A 1L5NA 1HLDA 2LIPA 3KXIA 3IOMA 3TOVA 4A0SA 2ZSJA 4IKPA 1QTIA 3GAAA 2H4JA 5EWMB 4E94A 4M87A 3D7KA 1GCIA 1P8JA 3GIDA 1Z0AA 1I1QB 4LRXA 4XFJA 5EC8A 3WMFA 4K40A 3K31A 3ZKAA 4LRQA 4C07A 3ZCUA 2VF7A 4S2UA 1Y7IA 4D9CA 2VPIA 3AHIA 3ZDBA 2ZFUA 5GZ3A 3IAS6 2ETXA 5HK8A 2B1RA 4ETMA 1PQYA 4JLOA 4FGKA 3G2HA 5E7JA 2WTBA 4N76A 1VLLA 3NNSA 3DAOA 4OCZA 1P3DA 1TCBA 3DC7A 1DUIA 1EWYA 3N28A 5DWQA 5A0FA 3M70A 4TTJA 2JC3A 2V7BA 3G68A 4O3FA 2BGKA 5ER6A 2ATIA 4LF8B 5TQJA 1IHXA 1ENPA 3QWFA 3F3KA 2VA9A 4ALNA 5HZKA 2E4VA 5FTWA 3GVIA 4HNTA 4US0R 4D9JA 1TYDE 3OU6A 2JH9A 2DFTA 5D3KA 2JIPA 4ZYXA 2J09A 4TWBA 4D02A 4FYIA 1FNBA 3LFHA 5F51A 3LQQA 3VKGA 3PTAA 1BKYA 1OX5A 1PZXA 4YACA 1OHHD 1UMCA 3RREA 4Y9SA 4YRGA 5IKPA 2XCTB 3ZVMA 4JN6B 2FR8C 3FPKA 1NHGA 3D4OA 1G2QA 1XC7A 1KY4A 3LCVB 1ULZA 2HMWA 1PRYA 3QWAA 3QU7A 3FCYA 1SBYA 4Z8YA 2EZ4A 1N2IA 3VC1A 2ZJBA 1FTNA 1P4GA 4BQSA 1M34E 1K7YA 3BE5A 4XJTA 4XYMA 1GL9B 5FDFA 4QOHA 1NX9A 3MUNA 3WAJA 2IIPA 2XVXA 3OAAD 4NZPA 3U0BA 1W6RA 1YRLA 1T91A 2FMKA 2XMQA 2ZBPA 3G8AA 4MYRA 5DM0A 4AVYA 1JJ7A 4E0BA 4YR9A 3CZ5A 4QXOA 4ZYLA 1CSEE 4D44A 2Q4DA 3EQ6A 1KVQA 5GMOA 5AOBA 3L6UA 4QOJA 2NT4A 1QGUB 4BLVA 4M1KA 3MINA 4AZSA 1EVLA 1U7XA 3A31A 3U7GA 1FFHA 1YVPA 3CH7A 3RSFA 1PFWA 1T6ZA 2ONYA 2J59A 2W6PA 2XXAB 1Y34E 3M4JA 2HXYA 1RWXA 3KZXA 5AK3A 1DI0A 1PT9A 2R7KA 3U3DA 2IQIA 4Y2UA 3I9V6 3DCIA 4BDSA 2GNAA 4YCAA 3FHTA 3WL8A 2XHZA 2Z57A 3B1JA 4CGYA 4GKVA 4NEGA 1AY0A 1YJ5A 4RBNA 3HJRA 2ZSIA 3SYTA 3VX4A 2K87A 3DLPX 3NMUF 2PGOA 1LSUA 2WILA 1E61A 1NNLA 2W48A 1RQNA 2VAWA 1WXQA 4FHEA 4LYAA 4PLVA 4X93A 2GKGA 5DTJA 1SRQA 2F3QA 3TVDA 2KLHA 3KUUA 2DLCX 3PPWA 4BS9A 4RLHA 5K5EA 5K3SA 5CXQA 2I0FA 2EW1A 1W88A 4Q1CA 2PT5A 4C7OB 1VLMA 2YW9A 3AFOA 1C3OA 3HRKA 5E2AA 4F21A 2WE8A 3EVFA 3KJFA 4M49A 3DZJA 1G8GA 5FBKA 2OGTA 3RSOA 1DFHA 4NF2A 3TF5A 3OZFA 2I76A 2TMKA 2XSZA 2AC7A 4YBZA 3ZXXA 1AHNA 2O2HA 2YQZA 1A5TA 3F90A 3LQ4A 1VL2A 2CNNA 5DWVA 4REOA 3SC2A 1A9YA 4WJZA 1ODKA 3EQZA 1PGNA 1YKSA 4H16A 4QLAA 4V0SA 2E82A 3R6LA 4UDOA 3LA8A 1M75A 1DBRA 3SICE 1C0PA 4UNNA 1W73A 5D8DA 1JBQA 5TS3A 1KIFA 3MJTA 3EEIA 4AN4A 4MB2A 1XTKA 4K6FA 3MK31 4N7BA 2NVUB 2ZSHA 3RSZA 1WZUA 2QG6A 2WKRA 1HL7A 1UFVA 4LUCA 4AAYA 2EEPA 4S1TA 5BN3B 1OH7A 4O5OA 4EHNA 3QK7A 5EJ7A 2ZXFA 3IPLA 4P3OA 2O5CA 4KWEA 3A3YA 2W8BB 3GHYA 4ACBA 1EFVB 3KFLA 4I66A 2BMVA 3M89A 2R11A 2YNMD 1VPEA 5D3MB 5C80A 1DAKA 2UYHA 2QZPA 1GLVA 1NTOA 1JHAA 2YIVX 4RTJA 3EXHA 5DZSA 1EAYA 5MHTA 2CK3D 4D4KA 1KOFA 3BIJA 5CFMA 5C1IA 1JTVA 2ZCUA 3CF6R 4ALIA 2Q5QA 4D5GA 3FOEC 1JVBA 2IHYA 3U3ZA 2H0QA 4TRNA 2QDXA 2TMDA 2QY9A 2IBTA 1CX9B 2Y0BA 2ZR9A 2VHZA 4DQDA 3AIMA 2QGFA 1XCGB 1EFTA 2VKTA 3K6RA 2V4UA 5I7HA 2F55A 5FNZA 1VPVA 1YB5A 3L0SA 4G86A 1PR0A 4DRYA 3C98A 3COSA 2HWUA 1PV4A 4BGDA 5LQAA 2RB4A 1P0CA 3NPMA 4DLBA 1VPDA 2C2YA 5C81A 5A4AA 2BGGA 1G7CA 9LDTA 4RF2A 2BCEA 3O4RA 3UOWA 1R4NB 2G7MC 2YV2A 3KLNA 3VO1A 4C2TA 2Y77A 3KEQA 4WLEA 1KYVA 1SD1A 3PYXA 4A0GA 3OQHA 2WU0A 3DKRA 5JQGA 4A82A 4MVJD 2MHCA 4OO3A 4JOBA 5EE9A 1ZDMA 1ZMRA 4V02A 4FS8A 4F86A 1FK8A 1TM3E 1Z5OA 2D00A 1XRMA 1DTWA 3PFWO 3MYRA 2Q0XA 4MQBA 4UAVA 4DDUA 3G59A 3T3OA 3U4AA 4LNUB 3T3DA 2A58A 3FM9A 2VK2A 1E3TA 4RDCA 1K3UB 1K06A 3UOAB 3GLHE 2B1GA 2J46A 1FVFA 2D1QA 1EFKA 2VHTA 3RT1A 3UCXA 4EK9A 4J4HA 5ICMA 1YSCA 1UCFA 4L8FA 5ALOA 3O3CA 4HDKB 4F3NA 5LU9A 3EIEA 3RADC 3WGTA 3WWOA 1PKEA 4F5ZA 2JARA 2QT0A 3DOJA 5K0LA 1E62A 1C14A 2GN4A 4PS1A 5F1YA 5TE9A 3BH7A 1VL5A 5DLQC 1EUQA 2FX2A 4PG5A 1KZHA 2O8FB 4PAGA 1T8SA 2BTQB 4P81A 5EHXA 1QDLB 1OVMA 2XQFA 4Q00A 2XCRB 4FUTA 3KG2A 4H3HB 2CHFA 5F7ZA 4COOA 1Z4PX 3ZJUA 2PKCA 1C80A 1CRQA 2QX4A 1W0KD 2Q6LA 3EF1A 3HA3A 3Q6IA 4LJ8A 5COAA 2QMHA 2FR0A 4F4IA 1JX6A 2GBLA 3RK0A 4NZNA 2NZ2A 2BSXA 1I3KA 1YBAA 2X0RA 3C3BA 1NY6A 1DV2A 2FPSA 3DZGA 4FE4A 1NVKA 1YB2A 4M53A 4PGGA 4DY6A 2GHQA 4DV6B 1TK2A 1L5WA 1UMBA 1NJSA 1ICIA 1YB4A 1GDDA 1JXMA 3F0TA 2G9VA 3E22A 4YDHB 4Y6RA 4A10A 4DLKA 3G02A 3KB8A 3UWMA 4QUEA 3DG9A 4ARCA 2CLDX 2GHTA 4J16A 3PZRA 2Z3VA 4DXHA 4KWIA 5AKGA 3NNNA 3OE7D 1YS6A 3H9BA 4D4MA 1GPYA 1OZHA 1T10A 1HT1E 421PA 3OSZA 4RV5A 2NTYC 1Z18A 4ZTUB 3KTOA 1HQKA 2I4OA 3PD0A 4JEHA 1JSXA 4KLRA 3ICEA 2YMMA 1M54A 3KZ1E 3HR8A 3IP5A 2IEYA 2GK3A 3A9CA 1SHUX 3ENKA 4TWAA 4X00A 5FUYA 1T4BA 3BGWA 1DHRA 2QD3A 3R77A 4G0QA 1T4CA 4YN3A 3BH6A 4QODA 3CX3A 4DRXB 1DJNA 2J5RA 4ZO8A 2WWVD 4H2DA 3WWDA 3A7DA 5CB4F 5AKXA 5I7WA 1CZLA 2HBRA 4GOXA 3D1JA 1FMTA 2X4GA 1OZAA 2VDUE 4RYLA 1B0PA 1NXQA 5A71A 5JMWA 2DWOA 3K0FB 2BF7A 5EPEA 3AU8A 4MJ3A 4Z9AA 4KOEC 1CQJA 3WP1B 1WE2A 3L1UA 1Q0SA 1G98A 1KAOA 1R4ZA 3QY0A 5FUBA 1WPQA 2XB9A 2HJSA 4XXHA 1I3MA 2JBAB 4LEIA 2QLJA 5IZCC 4RLSA 4TTVA 3ZVNA 2TMYA 3RIXA 3ZXYA 4GMGA 1YS9A 3UIEA 3T1YB 3TSAA 3H2BA 5LP1A 4DEXA 4IIHA 3PEVA 5EGNA 16PKA 1IH8A 2A5LA 3LX6A 2EIXA 4G6ZA 3LRXA 5A3SA 4OAOA 1H6CA 4KR0A 5J5VA 3UW1A 4I1PA 4RA9B 4XGQA 3SIXA 3K9NA 3PEYA 4GKKB 4N54A 3PU6A 1XTZA 4EUNA 3O1JC 5CNIA 4MEAA 1SKBA 2AFVA 2QJOA 3PENA 2O7SA 2P5UA 3S5UA 4F38A 2PRKA 5FLYA 1P9OA 3NBZC 4NL4H 3DZCA 2HRZA 4MS4A 3E81A 4NCNA 3GB9A 1OV4A 1R27A 2EGHA 2QRUA 3I6MA 3CMMA 3FYCA 2PLFA 4WBNA 1HXHA 3TB6A 5EIXA 1ISJA 4QUIA 3V2HA 2A4MA 1R88A 3OOEA 3QM1A 2CZCA 4NYIR 1T1GA 2XHEA 1Y1RA 4G07A 4M9SA 2ENUA 4J2OA 3ZTTA 1NVAA 2Q3LA 2W6QA 3IDFA 3D7RA 3NO4A 1NUTA 2FG6C 1E2MA 5KSYA 1VI6A 1WM1A 2IXTA 2DTEA 4DLUA 1CEEA 2Q3JA 4DCUA 1MQSA 1W34A 5D7BA 5AVJA 2RH8A 4HPXB 4BP1A 3TQRA 4CDRA 1DX9A 1VE3A 2WV9A 1R0LA 1THTA 4EPXA 1WZCA 1TAQA 4KR2A 1ZINA 4LC1A 4UBOA 4JLBA 4JYZA 1QRTA 1O8BA 2WJ4A 2NXNA 4INJA 2AGVA 4ENRA 4ESEA 3HY3A 1KYQA 1RWPA 1USGA 1Z16A 2HBYA 2EFCB 1PTJA 1U2DC 3GT0A 1U6JA 3UGKA 3VSAA 3NFRA 4EYOA 5C8ZA 1M8JA 1RC1A 2X8WA 2VHEA 4JJ8A 4KH0A 1ZIOA 1Z5PA 1N2GA 1PK9A 5EYPA 2GMWA 1R3DA 1DKOA 1FDTA 4LDPA 3P1JA 5TNXA 1EA5A 3DE1X 3R3VA 1BMQA 2XRFA 1XXHA 1B26A 1RXIA 2ESRA 3GEIA 3I5AA 4E88A 1T3HA 2E4YA 4QTXA 3RTBA 1E0JA 1P2SA 1ZICA 1AKTA 3PNOA 4Y7CA 3U0VA 3HN7A 2QMOA 3CLVA 2BY4A 3MMSA 4PO9A 4GE3A 4NDAA 1KJNA 3CLSC 1QYCA 1UDAA 1EZ1A 3BXGA 4Z54A 1T6BY 4QASA 2V6FA 5IC4A 5JJLA 1P80A 3KFXA 3ICOA 3ZPXA 4H7KA 4U9HS 5HF6A 4E2YA 2CLKB 4C0SA 1W93A 2GEUA 1ENYA 4C43A 3AM3A 3EEOA 2JFXA 1LH0A 2B9EA 1S2DA 1OXSC 1PR1A 2GCGA 3HADA 4GT1A 4KXWA 3AHJA 4HH4A 2GA8A 4BU1A 4FX5A 1OIXA 4E5NA 1LC3A 2RHDA 3KZMA 2G25A 4PRLA 1YVUA 5DHFA 5C53B 2R0QC 5HA5A 2QRJA 5KTKA 1K89A 2BRUC 5HHTA 2HYDA 4IY1A 1XJWA 4HZUB 3PTZA 1RAFA 1ZISA 2CVQA 2O50A 5K8IA 3UWDA 3IP3A 4MW1A 2G70A 2YHSA 2ASEA 3C7CB 3FDJA 3MAAC 3PPXA 4U9UA 1M2KA 1HI9A 1IXKA 4O2AA 3KWLA 4PFQA 3T6KA 3DHWC 2B92A 4BMPB