3UANA

Crystal structure of 3-o-sulfotransferase (3-ost-1) with bound pap and heptasaccharide substrate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
256
Chain Sequence
STQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGLGWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQVLYNHLQKHKPYPPIEDLLMRRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQVDPKLLDKLHEYFHEPNKKFFKLVGRTFDWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 1
publication title Dissecting the substrate recognition of 3-O-sulfotransferase for the biosynthesis of anticoagulant heparin.
pubmed doi rcsb
source organism Mus musculus
total genus 83
structure length 256
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uanA00
4C0SA 1IM2A 1GNQA 2PX0A 3AF4A 3P32A 4PAOA 3DMNA 3KUDA 3GQBA 2P0EA 4UJ3A 2ZQ5A 5D3QA 1RZ3A 1VYUA 4Q1EA 4W7SA 3FMPB 1E2GA 4CF7A 3H84A 3MCAA 4BEBA 4UNRA 2QN6A 1J7KA 2QZ4A 1AS2A 3N70A 2Q9BA 3ZZUA 4CIDA 2LKDA 4MH0R 1K5GA 2GKSA 4BLQA 4HSEA 3ICEA 2ZUCA 4DBLC 1I4DD 2ZSAA 1OT3A 1DAIA 2V8OA 5HCNA 2A3RA 4HDOB 1ESNA 3VR2A 3ZVNA 4D26A 4ASUA 4ZIRA 4JLDA 3U2QA 4QM7A 2VH5R 1QHHA 3FE2A 5KYKA 3I32A 1XX6A 4IFEA 1F2UA 2O8BA 3NBXX 5EXSA 4KODA 2FZLA 2VSXA 1F2TB 1G20E 3NKVA 3Q7PA 1EFUA 3IUYA 5EZ5A 1G1MA 1UBEA 2C8VA 3MGCA 2QT1A 1IONA 1QG4A 1NBME 2ZITA 3BIFA 4PZLA 2ZJBA 3T06B 3TRFA 1Q44A 2OM2A 5J4LA 2J41A 2FH5B 4LPSA 3RDPA 4RZUA 4HAVA 4KFUA 4IOMA 2FZ4A 5TVKA 1G21E 1VMAA 4OI2A 3BK7A 1FPMA 2WWIA 4PO1A 3K0SA 2WM9B 1L8QA 3B9QA 2CBZA 4DB4A 2ZYWX 4HAYA 1NBMD 2ZE8A 2P6NA 1OXVA 2V9PA 3HR8A 2V1UA 2QUZA 1ESMA 3LVQE 4DDTA 2R6AA 1MO6A 1AJEA 3QY0A 2XITA 3VKWA 1YKSA 2AFIE 3U7GA 1VIYA 5EXXA 3OFNA 1XEXA 3MJHA 2OCBA 3TSWA 4NMMA 4LYHA 3AF2A 1UKVY 3LQRA 1RVDA 1JJ7A 3RNLA 1XTRA 4P33A 4JLBA 4A2PA 1VTKA 3MLEA 2XAUA 3QIAA 3CRVA 4PHHA 4V0ME 3ZVLA 1IJFA 1S1CA 1KMHA 4V03A 1X1SA 3WP0A 2PEYA 3EZ7A 4BZXA 1LFDB 2GXQA 4LBWA 1E4VA 3TKLA 4FMCF 2VHCA 3L43A 5KDOA 4TQ9A 1HH4A 4D4MA 5CK4A 2YWEA 3OIUA 4ZDIA 1LB1B 1LW7A 2Z4SA 4X8HA 4BFZA 2OSBA 2XB2A 1XU4A 2C5LA 2XEXA 1UEIA 2QI9C 3B1VA 2YC4C 2ANCA 1XRJA 2MSCB 3CPEA 2YV5A 2CVHA 4IW3B 2OAQ1 5KPDA 2HCBA 4RD4A 4WVFA 3IO3A 4AG6A 4HB0A 3R9XA 3VQTA 1X86B 4NZYA 1OSNA 2W2XA 3NEYA 1G17A 3NEJA 1Z2CA 4A0HA 5B57C 1IN4A 4LYAA 4TLAA 1XJQA 5CIQA 5L3RA 2O0HA 3RSOA 1WMSA 4Q4AA 2NO1A 2OESA 4R9UC 4KLNA 1KDPA 2IF2A 5C2JB 1EFHA 4LHWA 5CYOA 5CYPA 3BB1A 2JJ1D 2ZRIA 3A4LA 3DDCA 4QGGA 2V1XA 1EFRA 4LUCA 1EG7A 3LQQA 1Z0KA 1RJ9B 5TV2A 2ZRDA 5JBQA 3CR7A 4QBFA 1LY1A 1W4AA 2BM0A 3K0AB 4FWIB 4JL5A 1YR8A 3LXXA 2Z83A 4B3FX 4G5RA 5FR2A 1QHSA 2N1BA 2BBSA 3EC1A 1N2CE 1VG1A 4MYCA 4OJKA 5IHPA 2R8RA 4LX0A 1SHKA 3LV8A 4EPXA 2HYIC 2QSYA 4RZ2A 4B74A 2IYUA 3EARA 721PA 4G5QA 4R2HA 3B78A 2IK8A 4URYR 1Y63A 4CEHB 1EWQA 3T1QA 4Q18A 1FUUA 2RGCA 3K0EA 1LV7A 2WMNB 1ZNXA 5CLLA 3U5ZB 1NRJB 4HATA 4A2WA 1AKEA 1FFHA 4PPFA 1FL9A 3GD7A 4B3BA 3SJCA 3PENA 4MGIR 1Z29A 1E4YA 3J81k 4MKFA 4Q47A 3GLGE 2IWHA 2QRNA 4MQBA 3NHAA 4Q19A 1ETUA 2DPXA 1QHNA 2WWWA 5EXTA 3VR3A 1P7CA 3K09A 3K9GA 3MWJA 5JSZB 1CRPA 1GIAA 2WZQA 1WP9A 2QAGB 3FMOB 2B8WA 4NYIQ 4JLKA 5JZVA 1I4LD 3CW2A 2BMEA 3RANA 3F3YA 2V6IA 1NLZA 5C4MA 4XOIA 3RWMB 1G7RA 1II0A 2D2FA 1E0AA 3I72A 2Z0MA 2EWWA 4KCGA 1KNXA 2IHYA 3B85A 4I1VA 3TMKA 2JLYA 1DTSA 1U2RA 3BWDD 3ONWA 1CR2A 2D7DA 1E79D 2FPKA 4KYIB 1OFHA 1Q22A 2FNAA 2PZGA 2WOJA 3AF1A 3I8XA 2PL3A 1R6BX 5FUXA 3GLHE 1JI0A 1Z22A 3IIJA 1Y3AA 3IQWA 4LYJA 2VF8A 4HAWA 4PO8A 2OBMA 3ZYCA 1E9SA 3KKMA 1D6JA 5BYJA 4E09A 5A4JA 3C7KA 4U02A 2KBFA 4XWOA 1XWIA 2ZTSA 2GZDA 4QHSA 4BZQA 3H2YA 5CB6A 1JPJA 1FZQA 1US8A 2GJSA 4NYJQ 1G7SA 5AJXA 3X1YA 3K0CC 2IYVA 4OI4A 1G3MA 1KI8A 3CRMA 2O8EB 1XCGB 4DXAA 4MKHA 2ZETA 5FTJA 1CIPA 3N2EA 5AJVB 4CT5A 5JJKA 4M1YA 3TJZA 2FPLA 2OAP1 4KFTA 4JT4A 3EIHA 2A78A 2VHUA 3KXIA 3WMFA 2GHIA 4RFSA 5B2ZA 2DCUA 4XTCS 1UAAA 4DLYA 4GOXA 4Q9HA 2CLSA 4BFVA 2PMKA 5G3ZA 4ACAA 5IT5A 1NSTA 1J8YF 1SGWA 1XB2A 4MGKR 3IO5A 4ON9A 3SJAA 2OCPA 4QHTA 3ASYA 4OK3A 3PXGA 2J0QA 4QXAA 1XPOA 1U8ZA 4IRUB 3NBYC 3TAHA 3A8TA 4Q1DA 1NMXA 5G53C 1YQTA 1H8EA 3WNCA 2QGNA 1Q3HA 4BFUA 1JXOA 4DB2A 4M21A 3CM0A 1WRBA 3T15A 1P73A 2ZAMA 4V02A 5FR1A 5SZIA 4B44A 3R7WA 1R10A 1CJUC 4D4LA 1P61B 4ZIRB 1HURA 2VPPA 3LXRA 4G3XA 2F1RA 2ZJ2A 5JI3E 2O8BB 3GJ7A 3L2OB 4LPKA 3AQ4A 4Q01A 4KHZA 3CWQA 4PC7A 4Q1AA 5BW8A 4DLTA 3CWZA 3FFAA 3GJ4A 2Q21A 5FOXA 2BM1A 1M34E 3CPJB 2HCJB 4EPYA 5FH9A 4ABYA 1KKMA 5F9FA 2OBLA 4MA4A 3RS5A 4ZI2A 1E0JA 3HYRA 4TMZA 4QL3A 4DSOA 5JFGA 1ZM7A 2RH5A 2FN4A 1G291 1ZYUA 2EFGA 1ZIPA 2GEVA 4Z1MA 1W4CA 2AXPA 3O8BA 1ZP6A 3OHMA 4ZPXA 1FTNA 1GTVA 1KI6A 1Z0IA 4FXPA 1OXTA 1I2DA 3TSZA 2HXSA 3L82B 4W5JA 3DM9B 1CU1A 1C4OA 3ZIAD 4OQMA 3P4XA 4OYHA 1EFRD 1N5LA 2IW3A 1ZM3A 2XNSA 1P9NA 2C04A 2H8KA 1O87A 3EZ6A 3OIYA 5KDLA 4B3CA 5JWOA 2NO6A 4X8OA 1AKYA 1HYQA 4URUR 1S3SA 3WMEA 3MWYW 1XEXB 3QOFA 3GFTA 2GK6A 3ZVMA 1KI3A 1ZJ6A 3WBKA 5IDVA 4RD2A 2FEMA 3WRYC 3NC1C 1KAGA 1RYFA 3FFBA 1JR3A 1C9KA 1LTQA 3VX4A 4YMVA 4I1OA 4F92B 2G1JA 4LK2A 4RD3A 1E2EA 3KKPA 4URWR 1CS4C 1SVIA 1G9XA 4JJKA 1Q0UA 3FKQA 1KMHB 2RHMA 1F60A 4TT3D 3I8SA 3BFVA 2NGRA 3CNLA 4L8GA 5CJ2A 1E1QA 5K8UA 4O25A 3NDPA 2VHQA 2VP2A 3BB3A 2ZPTX 4F4IA 1T9HA 2V54A 4C0KA 1ZCBA 1IN7A 2CCGA 4NE2A 3KQHA 3SOPA 1OB2A 4PAMA 4DDVA 3L0OA 2GETA 2RAPA 5EE0A 4KVAA 2F9LA 2W6IA 1MRNA 3TIFA 3JZAA 1GFIA 1W36C 1E9AA 2ZR7A 3GFOA 4EUNA 2VF7A 4D80A 2HT1A 3W9YA 1R8SA 4DEYA 4FCTA 1Q57A 3OIVA 1ZU5A 2W0SA 3B9PA 4X8LA 3K9LA 2PLRA 1S4QA 1Q1QA 4GOKA 3EPHA 4Q4AB 2GF0A 1KI2A 5J5CA 1NVXQ 3V9PA 1MH1A 2QORA 3LX8A 3FKSA 1KHTA 1TL7C 5HTKA 2YZ2A 2RGXA 1YZUA 3MJRA 1Q12A 3AVUA 1T3LA 3SE0A 1CKEA 2EFHB 5B30A 4Q03A 1AZTA 1A5TA 1E99A 4AK9A 3EXAA 2IXFA 2XSZD 2PLFA 1T3HA 4XD7A 1HT1E 2RGAA 1GL6A 5B58C 5JCZA 3AVVA 2J7PA 1F2TA 1ZNYA 1QDEA 4C9BA 1TQ2A 4LJ5A 3ZDQA 5FOWA 1XMVA 4AYTA 1OW3B 2IYZA 4D0LB 4ZDJA 2JDIA 1N6LA 3BXZA 1OKKA 3Q5EA 2BJWA 4HLQB 4HZUA 3K70B 3DHWC 1AZSC 3X1XA 2WTUA 2BWJA 3QXHA 1AGPA 1VYVA 3ZS9A 1P5ZB 1OHHD 4ZCMA 2ZI7A 2PMDA 1GNPA 4D0GA 3CF6R 4B2LA 5G40A 4PC3A 4DDWA 2J7KA 2L0XA 4NP6A 2IEZA 4QGHA 1ODFA 4YMWA 4JVLA 5CM8B 1G5TA 4KV9A 4F7WA 2ZSBA 4WA7A 4KYUA 1LS1A 5FI0B 1KI1A 4N3NA 1JXMA 1GRQA 4C2UA 1W36B 2V6JA 1NMYA 4LDJA 1KSFX 2QM7A 1MT0A 3EA5A 3HPRA 1AN0A 2R9VA 1AGRA 4D2IA 1AS3A 1RW4A 1P6XA 1VHTA 1TTTA 4CEIA 3DM5A 3SC3A 3UMFA 3CONA 3TH5A 4EPTA 1II8A 3QPWA 3CX7A 1AQUA 5HE9A 2ZSDA 1U8YA 4PSKA 2W6JD 3U61B 3CRQA 3EW9A 4BRWA 4QJ3A 1BH2A 2ZU6A 3VTKA 3WMGA 4KFRA 3MAAC 2PJZA 5GJCA 1ZNWA 3CZPA 3KKOA 4OQXA 1CJTC 2BIFA 3TUIC 1YE8A 4WAUA 4IDQA 3LX5A 3UWOA 2BVNA 4F4JA 3ZH9B 4TMWA 3SDZA 2FGKA 1US8B 2JJ2A 2C98A 2D3WA 5HR5A 1GM5A 2P6RA 1T6NA 3EA0A 2VQSA 4DHEA 1N25A 4PC2A 1EFTA 3AUXA 4KBFA 1G8PA 4I99A 5BN4A 4Z51A 2IYSA 1IHUA 1K6MA 1MO5A 3B5JA 1PLJA 3ND9A 4C0BA 4RJLA 1NJFA 4LJ9A 4M9ZA 2C96A 3TUJC 2QP4A 1NKSA 4RFSB 3TQFA 4OHXA 3F5FA 1KSJA 2ZJZA 1OH6A 1QHGA 1UM8A 2GK7A 4V0KA 2W00A 4Z8YA 3CIOA 1P60A 1TQ6A 1HUQA 1NL3A 1NBMA 4OQFA 1JALA 3CX8A 1JR3D 6Q21A 1G3RA 1RYHA 2P2LA 1X3SA 2GVZC 2C78A 5CLQA 4AY2A 2W2TA 3D31A 1U9IC 4N0EA 2H18A 1PLKA 2CHVA 5P21A 4US2R 4URXR 2CE2X 1EK0A 2NO0A 4Q9IA 2JA1A 1QRAA 1IOZA 5SZKB 3R7WB 1A82A 3SU8A 2QRZA 2IC5A 2BEJA 4A8JA 3W6OA 1MO3A 4CEHA 2F6RA 1GKIA 1G64A 1R0ZA 1TF7A 5DLQC 2IS1A 4ESVA 3QBVA 4AKIA 3R9IA 1UDXA 4Q5IA 4L15A 2XTZA 1OIVA 1CP2A 4H9GA 1Z2AA 1YVDA 1HQYE 4B75A 3TLXA 1Z07A 1W5TA 2CLCX 3BS4A 1KK1A 2C95A 3O8RA 2RGNC 3AGQA 3WHKA 4GZLA 2BCJQ 4DLVA 4AI6A 4A8JC 4V0MA 3ADBA 3TK1A 2RKOA 5DIFA 2IA5A 2ZRLA 2MSDB 1XTIA 1IN5A 1KAOA 1KI6B 4J0QA 5L3SB 2QMUA 3IQXA 1FP6A 2F3TA 2CNWD 2D7CA 3L8YA 3PQCA 3MWKA 1NN0A 4QGFA 5B64A 1IN8A 1SKYE 1XEWY 3ETLA 1M7BA 4JZKA 4YC7A 3UG7A 1I2MA 2FOLA 3VR5A 1BKDR 1E2JA 3DZ8A 4BFSA 1D2EA 1HQCA 2GCPA 2DWOA 1FMLA 4GZMA 1Z6AA 4XSHA 2JJ1A 1IQPA 5FBRB 3FHCB 4B3DA 4YDHB 1ZINA 1GDDA 2QP9X 3E1SA 2CLDX 2JAQA 3W34A 2GNOA 4JBXA 4YQFA 2A9KA 1COWD 2IBMA 3DOEA 2QE7D 4BE7B 1VCNA 1W2GA 3T5GA 3VHLB 1G3IA 1DPFA 2P6UA 2QAJA 3EZFA 4P31A 3QEJA 3ZJYA 4XVUA 2F1IA 3OEED 2R6FA 4TQUS 2O8DA 2MSEB 2IF0A 4PFSA 5UKDA 3MSXA 1BYUA 4L4UA 1KK3A 3QKUA 3BB4A 1OH5A 1CF4A 5FL3A 2R2AA 2ZRFA 4LY6A 2BJVA 2GWHA 5FPKA 1CJKC 2ZI5A 2AR7A 3GJ6A 3H86A 5DHAA 3SHWA 1N6OA 4B48A 1ZVQA 3AKCA 3Q5DA 3QPVA 4A1FA 5JMTA 1ZM4A 2WSSD 3UXMA 2E87A 1E1RD 4IEIA 4JSTA 1RRFA 3IILA 3DMDA 3B1WA 2WPDD 5DYIA 4EPVA 2ZR9A 5FOSA 4BECA 8OHMA 2QM8A 4D6PA 5BWMA 4XTRA 2ZI9A 3WBJA 1XFAA 3K9HA 4GT1A 4Q21A 4BLRA 3BJIC 2GZAA 5AR1A 2WWXA 4NYMR 1BOFA 2Q9CA 3BERA 3KFXA 4US0R 4ZDWA 4BUJA 4B6FA 3GEHA 2DWPA 4LBYA 3CO5A 4E07A 1KZ7B 4Y0VA 3QENA 4JYCA 2WIBA 5AWFC 1U90A 1W7AA 4DLWA 2HYDA 4JLVA 3GEIA 3GLGA 2JASA 3SBEA 2HXYA 2BMFA 3NHBA 1G8FA 2DFNA 1FOEB 2HEIA 3RHFA 3PIRA 3VU9A 1E79A 3SQWA 1M7GA 4KSCA 1P2SA 3FHOA 1PZNA 2N42A 4Q4LA 1T0HB 5L8VA 2JJ2D 5FFMA 2FFHA 3T5DA 1Z6TA 3GMTA 4M9XA 1KTVA 1UDWA 2HF9A 1QVRA 5ANRB 1SHZA 4D25A 2RCNA 2VHJA 4HZUB 4S2EA 4LC0A 3VMFA 1FNMA 5DGXA 2EVWX 3RS2A 1K8RA 2ZRNA 5E3HA 4DLXA 3GJ5A 4NCKA 3NBFA 4LZZA 1CTQA 3GLHA 3WRXC 2AN9A 2K5UA 3BFXA 1S9DA 3U6KA 2KBEA 1IXZA 2ZS8A 4JBYA 2BBOA 4C7OA 2DWQA 4II7A 1ZIOA 1ZCAA 2WKRA 1OF1A 4A36A 3LW7A 3GLFE 2WJJA 4U7DA 3MFYA 4HYYA 5DSZA 2ZUDA 4N1AA 2ECKA 5FOUA 3RS4A 4HAZA 4A6PA 4P4TA 1X8LA 3RSLA 4DVGA 1NVVQ 4FW9A 5TY0A 4TYWA 3QNUA 3HP1A 4CEIB 4K8OA 2P5SA 1LF5A 2EFEB 3B1YA 3PEYA 2OCYC 1II8B 5IK2D 1WE2A 1DELA 3GLIE 3Q9LA 4PZYA 5FUWA 4GDFA 2CDNA 4TSFD 4YLGA 4WIAA 3DKPA 1CLUA 2QMOA 5H1YA 3NH9A 3T12A 1WBDA 4M1MA 1F5NA 3GJ0A 1AA9A 1OIWA 5AJYA 3QXXA 2Q0HA 2IYRA 4GOJA 5DI3B 5IRCD 5FI1B 2UKDA 1OYWA 2BKUA 2IXEA 4JLAA 1GL7A 4QGAA 4ZKDA 2ZAOA 1XD2A 2Z5FA 2BMJA 4W5HA 3SFZA 2WVJA 3G82C 5F9HA 4AKEA 4CDGA 4LWZA 3SBDA 2E1RA 4XWAA 3MD0A 5EP1A 1ZC4A 2OFXA 3EZ9A 2REXB 1WB9A 5JJLA 2R62A 4UQOA 3X1ZA 1SVSA 5A0FA 3CRRA 4TYNA 2P67A 2HF8A 3AKDA 3D8BA 3FWYA 1GOTA 1T8UA 3TSOA 3GPLA 3A4NA 4YMTA 3CKLA 1G8GA 2H7VA 4G0NA 2IS6A 1N5JA 2XNDD 4PPNA 2IYTA 1JQLB 1W0KD 2JEOA 3C41J 3HR7A 4DLUA 2HLDD 4TYPA 3ZIAA 4AKHA 1TU4A 2W83A 2D2EA 4JLNA 1UKZA 2SHKA 1W1WA 2VYFA 4RZXA 2QMHA 2VP4A 1E2FA 3C8UA 3W90A 2O8CA 1KYIA 4RCYA 1SVMA 5FTMA 4PQFA 2GXAA 2ZS7A 2NG1A 5LD2C 1DE0A 3LD9A 1TPZA 4TL8A 4B47A 1YR7A 1ZRHA 2O5VA 2FG5A 3GJ8A 3IPYA 3U6BA 1Z8FA 1M2OB 1GP2A 1VDZA 4A8JB 4LJAA 3NTUA 1GRNA 3WY9A 4IVQA 3AB3A 1OFUX 1T4GA 1S0UA 1ZW6A 3V4FA 4CVNA 4WXPA 4C0HA 4TT3A 1OIXA 1OLOA 2FSFA 2ZRJA 1R7RA 2XOKD 3QKSA 3VAAA 3O8DA 2G77B 1V5WA 4EPRA 1OXUA 4NHOA 5JJIA 3H4MA 1QZXA 3MUFA 2WAYA 4RKFA 1NN3A 3ZD7A 5J4KA 4R98A 4WZ6A 4O3MA 2EWVA 1Z6YA 4FI3C 3VKHA 4B3GA 5JRZA 2PBRA 5HZHA 2NQ2C 4V0NA 2ERYA 2UZIR 3KKQA 1G19A 5E95A 1IY0A 4LGMA 4LBZA 2ODBA 1SZPA 2Z6VA 3CNNA 3E70C 2A5JA 2QTHA 3AF3A 3F0TA 3JVVA 4RSGA 3MG9A 1L2TA 3WYGA 4R7ZA 1W5SA 2IYYA 4ILEA 4QHYA 5BN5A 1J70A 5GADl 3I4LA 4DIDA 3K0CA 1E2IA 2WSMA 3TQCA 5JCPA 1MV5A 3ICQB 2AKYA 2ZSEA 2QPOA 4KI0A 1KOFA 4IEEA 4A15A 3LBHA 3OF5A 4JIMA 5F2EA 5F98A 4F91B 4AWXA 2Z4RA 5HZKA 1PUIA 2YOFA 1G41A 2QPAA 1YZQA 4TMTA 2PCJA 4EKDA 4IKEA 1WBBA 1NY5A 3AVWA 1GITA 5JHGB 2Q3MA 1G6HA 2QG6A 2XSZA 4XVQA 2O8DB 2FJUA 2J9RA 1IY2A 1FTSA 4NONA 2J46A 5H70A 2FPMA 4AG5A 2AWNA 4LJ8A 1XD9A 2QGZA 5EP2A 3AEZA 3PUYA 3KQUA 3AVYA 1PVOA 1GKYA 4QNRA 4XH9B 1GSIA 5AJZA 1RIFA 4A4DA 5J4VA 5KNCA 4C0AC 1BMFA 3B1ZA 1OHHA 1NLYA 1W4BA 4PZZA 3MRSA 2DR3A 2F1HA 2HT6A 1E2PA 2VLIA 3X2SA 3R9WA 1WQ1R 3TR5A 1NSFA 2PEZA 1N0UA 4NDZA 1GUAA 1KO8A 3UMRA 4PTLA 1UPTA 3T34A 2NZ8A 4IDHA 4M9QA 1G7TA 2FV8A 4RY2A 3Q72A 3NG1A 3OESA 4HUQA 4OK6A 4GMDA 4ESHA 5LB4A 2REOA 4MRVA 3QBTA 3FOZA 1WA5A 4BFTA 1QG2A 4HLCA 1X8JA 4LRWA 2G83A 2ZRBA 521PA 2PCLA 2PT5A 2Y8EA 4A2QA 3QG1A 1A4RA 5JHHB 2X1VA 4QBIA 2EU8A 3GLGB 4A9AA 2VL7A 3UWKA 2H92A 3LW8A 3QXCA 1EGAA 1HEIA 1NKTA 2DY1A 4QG7A 5H68A 5K8IA 3VU9B 1XNJA 2AK2A 1S2MA 1BYIA 3CF2A 3BH0A 4TMVA 5DO9A 1G5RA 4CEJB 2W6JA 3L0PA 4AKGA 2ZVPX 1XMSA 3CRW1 2QT0A 4LHZA 3U7FB 1OB5A 4TYQA 4DKXA 4H1UA 4PC1A 4QJ5A 1SVLA 3TUZC 1YZTA 2B21A 4MYUA 1RFLA 3LO5A 4M1KA 1KIMA 4EFMA 3BAFA 4UXIA 5EXPA 1W2HA 2A2ZA 2J5XA 3WYAA 2OT3B 1RRPA 1UEJA 1DADA 1X1RA 2DHRA 3C4JA 5AUOB 4DEXA 1VPLA 3GLHB 4BLTA 4YXWD 1Z47A 2BC9A 5J4HA 5L3SA 3VR1A 1YJ5A 4JSYA 4ACBA 2QQEA 4C7OB 4F93B 2I1QA 2QPTA 5HPYB 4I81A 3SYLA 3THXA 1D8TA 1KY3A 821PA 1W44A 4MYHA 5DISB 3KQLA 1ZC3A 1Z06A 1IXRC 2G9NA 2O0JA 2ZI4A 4FCVA 4PX9A 3EIQA 2E9SA 2J0UA 4PHGA 3KFVA 1A2KC 4M4SA 5EQTA 1PUJA 1UBFA 1CR4A 1EXMA 2GJKA 2NIPA 2ZJAA 4GPTA 2F1JA 1YZNA 3AF0A 4ZCIA 4JL6A 1DAKA 4OI1A 1BIFA 2ZRGA 4FMDB 1T91A 3A36A 1OH8A 5BQ5A 2ZYVX 3CH4B 4NU0A 1N5KA 1ZD9A 1TMKA 2W0MA 3PUVA 1SVOA 2JGNA 2Q3FA 1TQ4A 1Z83A 3LFUA 3CNOA 1G16A 3I5YA 3FMFA 1OXSC 2Q9AA 1U0JA 2OV2A 4PAQA 5F3WB 1FP7A 1MABA 3B13B 1XD2B 2C03A 2KSQA 4UNPA 2PZEA 3TW4A 1J90A 4TTQA 1G8HA 2WWFA 3JZMA 3T35A 4B35A 4G5GA 5KO2A 3CUEF 3QVVA 2AHOA 3A1VA 3IHWA 3ADKA 3NVAA 4M1SA 4L5BA 2P3SA 4B73A 4CW7A 3EPKA 3FGNA 2XZOA 3BH7A 1G7CA 2GAAA 3NWJA 3SEAA 5DE3A 1GNRA 2C9CA 3BRWD 4QKQA 3W3ZB 5E7JA 1D9ZA 2KWIA 5TARA 1KY2A 4JT2A 1DAFA 3UATA 3NDBB 2MMCA 2WKPA 3SI7A 2CJWB 1P2UA 1UJ2A 3EAQA 2CNWA 4QNMA 3TBKA 3B82A 1XXHE 1DEKA 4R71A 4P3YA 1VCIA 4JBWA 4MUAA 2IUUA 5KSYA 2P5TB 1JQJC 4OHVA 2OFOA 5EE1A 2O8CB 1RE0A 3BOSA 2VP0A 4PHTA 3D6TB 3QF4B 1WXQA 1NMZA 3OZXA 3WP1B 4B71A 4FD2A 2CE7A 2EYQA 1E94E 1BO6A 3ZQJA 4DCVA 3W8RA 2YINC 3K1JA 1XZQA 1COWA 2AXNA 2HJVA 4HLDA 2QE7A 1VCOA 4D0NA 4EFNA 4H1VA 1MKYA 3W5JA 4DDUA 5FTLA 3CB4A 1HE8B 2QMEA 1BMFD 3GFPA 3RS3A 2YWHA 1Q21A 3RABA 3OEEA 5JLJA 4BZPA 4JVSB 2G6BA 3CZQA 4UXJA 1W0JD 2A7QA 5AUQA 4A82A 1Z28A 1E9EA 3PR1A 4D4JA 3QKSB 3EPJA 4BRUA 1QF9A 3ZZ0A 4L9WA 4QBHA 3U3RA 3HU3A 5CK5A 2XX3A 3FVQA 4M1OA 1GRRA 1P9RA 2ODEA 3GJ3A 4PQRA 1Z63A 2Z43A 2YOHA 1VG8A 5AUNB 4LV8B 4DCSA 2WJHA 1JB1A 3A37A 3ZS8A 2WSSA 3TGPA 1OPXA 1E1RA 1OV4A 2OZEA 4EJSC 3QQ5A 2WPDA 3MMPA 3U3OA 221PA 5EJEA 1QHIA 3NBZC 4TWZA 2QBYB 1N6RA 4FMDF 4L9SA 1E9FA 3E5HA 5AK0A 4L16A 3M4YA 2ZEJA 2VSFA 2NTYC 4QFMA 1U94A 2R6CA 3FPAA 4Q1CA 3SQXA 4OI0A 3CX6A 2WICA 2A5DA 4EFLA 2JLZA 4BPBA 2G1KA 3B2EA 2BOVA 1M74A 3KJEA 4Q7JB 1E2QA 3DOFA 2ZUBA 1TUEA 1XJ0A 4OL0A 5DI3A 1KMQA 1FX0A 1KDRA 1FW6A 2D62A 3TAUA 3KKNA 3TE6A 4JL8A 5J47A 3LBNA 2IWRA 1SXJE 3R20A 4JLMA 4PPGA 4WZAE 3PUXA 3TW8B 3AGPA 2GZHA 2H17A 4FIDA 4O2LA 5FBWB 1KJYA 1D5CA 4MRNA 4XJXA 3M6AA 2HUPA 1NNEA 1EESA 1NG1A 2IYQA 4D82A 3KL4A 5C46F 4CYMA 1N6KA 1IXSB 5CIWA 2OG2A 2ATVA 1AQYA 1KO1A 2WBLC 1U9IA 1R5OA 3MWLA 1SQ5A 1R2QA 4LJYA 1NI3A 1JECA 5FL7D 3EC2A 3VFDA 3I73A 1T0JB 2GTPA 2F43A 1XCMA 1EX7A 1ZU4A 1QHXA 3B8HA 1UKEA 5FBQB 1XF9A 2P65A 3CH5A 4TN1A 3I92A 2NZJA 2JATA 4R2IA 1YR9A 5KTYA 4HUQB 4NYIR 3W8NA 4PANA 3DL0A 1KDOA 3EPLA 2D74A 4KVGA 2GESA 3TR0A 4F38A 4BEJA 4KAXA 5SZJA 1RRCA 2RGNA 5DN6D 1DAMA 3FMIA 1ZUHA 4MKIA 2O8FA 2YWFA 1VCMA 4Q1FA 5JEEA 4DZZA 2W58A 5IK2A 2R65A 3K8YA 1N3BA 2FFQA 4TZ6A 3AVQA 4XVRA 3RC8A 621PA 2ZJ5A 2FA9A 1T3SA 4TSFA 3X1WA 2ODNA 1KI4A 3C5HA 2J0VA 2ZR0A 4JMPA 2QNRA 5KHOC 3P1JA 2WWHA 3AVXA 1R8QA 4FN5A 3VNVA 3U3JA 5GVSA 1XEWX 3GLIA 3RAPR 3CF0A 4NYJR 4RCZA 3SN6A 2XXAA 3QKRB 3U3MA 5K8TA 2CL0X 4K81B 2FSGA 4MRSA 2JIZD 4QOSA 2FFAA 3REFA 2ZYTX 3CPHA 1NP6A 3ADCA 3X1DA 1E9RA 1YRBA 3ECCA 3B1XA 1UBCA 4ARZA 1VYTA 2FFBA 1YHNA 2CL6X 3BBPA 2CXXA 1Q1ZA 2ZI6A 3THXB 3PV0A 2FX3A 3EIEA 2BDTA 4LV5B 4TYYA 1XP8A 3D7MA 4ZDKA 3B60A 2NPFA 4DCUA 4I4LA 2VTKA 1E32A 2IUTA 2J0UB 2PT7A 3K53A 2HV8A 4NL4H 5GJBA 2XNDA 3KJGA 4EQ6A 5GVRA 3UK6A 2TMKA 4KXFB 1CR1A 1Z6GA 1W0KA 1I4TD 1R5NA 2HLDA 2OXRA 2AD5A 3T1OA 4DRZA 2JLQA 2FU5C 4PPQA 4URZR 1DG1G 2ORIA 3VX3A 4D4KA 3DKVA 5AJWA 5CDFE 1A7JA 1Z6XA 5DHFA 4M22A 4KJZA 3C16C 2FEOA 1E96A 3N2IA 1O3YA 4HLUC 2ATXA 4E5UA 4B33A 2NPIA 2KJQA 1MABB 2WJYA 3RLFA 2A30A 2JJ8A 2QAGC 4LCBA 1DOAA 4M1TA 4Q4HA 4IVRA 2V3CC 1ZUIA 3KUCA 3QKTA 5K8LA 3AM1A 2CHQA 1NVUQ 4V0OA 4NH0A 1CJMA 2R44A 1Z0AA 2XOKA 2ZRCA 5G3YA 1JNYA 1Z0DA 1XDBA 2X2FA 3BH6A 2DB3A 2QTFA 4NBSA 1OYYA 1W47A 4BLOA 3OE7D 1P2VA 4TTPA 4LV6A 3QE0A 4MDEA 4Q9KA 1KSGA 3AKYA 4G5OA 1MO4A 1TADA 2IUSA 5EE3A 2BCGY 1DAHA 4PSAA 1N0VC 2CEAA 4O0MA 2VA8A 1E2LA 1UFQA 4RKEA 4JKYA 1GL9B 4AURA 4U00A 2OXCA 1JEEA 2IYWA 4CRWB 5KPJA 3C15C 3PUZA 4BLPA 1NY6A 2FWRA 5J40A 3AP2A 4C3ZA 5TB5A 4DUGD 4GRAA 1VIAA 4W5WA 4IFBA 4UKDA 3THOA 4MDFA 3BFKA 3U44A 4CEJA 2X77A 2CL7X 3U4QB 2IS4A 4A0GA 1XTKA 4LOAA 4GP7A 1NN1A 3LAWA 1DAEA 1M7HA 2QU8A 4GBMA 4PHFA 1SKYB 1XBTA 4LYFA 3UG6A 4FWTA 4U5XA 2FDCA 2GBLC 2ZRMA 4B2IA 2J3EA 4NKRA 3SS8A 4EJSB 1P72A 1HV8A 3I1FA 1X6VA 3D3QA 2AKAB 3LA6A 4PC6A 3SJBA 4MRRA 2KI5A 3I5XA 2J45A 4Q02A 4BWYA 2CCKA 4MITA 3C5CA 1E3MA 4HB2A 2ZRPA 2IS2A 4JJZA 3T1VA 4HAUA 1HY3A 4PO9A 4BASA 2V7QD 1T5LA 3ND8A 4Q9LA 4IJMA 3CBQA 5CM9C 1P9WA 1R5BA 4NCJA 2IEYA 2ORWA 4TMXA 2OUKA 4V0LA 2WJIA 3LY5A 2ZROA 4LSGA 5LBIA 2BBWA 3QG5A 4KSBA 4OK5A 4B6EA 3SYNA 3SYKA 4DSNA 2H16A 3QF7A 3IDQA 2G0TA 3AH8A 3OEHD 4Q48A 4IOLA 5EP3A 2PZFA 2C9YA 4RVCA 4URVR 4IDOA 5KU1A 1E0SA 3I3SR 5L3VA 4M8NE 2OLJA 2QENA 1DS6A 1KJZA 3KDSE 1TX4B 4B32A 1WDTA 2WV9A 2VEDA 2FSHA 1XMIA 3PEWA 1FX0B 1NIPA 4POAA 1NJGA 2CK3D 5E7MA 2KE5A 4DLRA 1NN5A 4Q7MB 1N6IA 5EZ6B 421PA 1DO2A 4IDPA 5KSPA 3KXLA 5E7IA 4RFVA 2ZE6A 5FBLB 1IY1A 1NF3A 3OAAD 2VO1A 2ZRHA 3KZ1E 4HDCA 1OFTA 4RD1A 2GXUA 3RRNA 3F8TA 2DBYA 1R4AA 5D3MA 1NIJA 1XD8A 2B8TA 2C77A 4YMUA 5JS8A 1L4UA 2BV3A 4QJ4A 2ZXUA 2XGJA 4OHYA 3VHXA 1F6BA 5C18A 1U81A 3VKGA 3UKDA 4LI0A 5FUYA 3CLVA 1XEFA 5HKKD 4YXWA 4UNQA 2F43B 4TLBA 1YZGA 2QP3A 1Z3IX 1FQJA 4FINA 3U60B 3B6EA 2CJWA 1G18A 1DBSA 1Q3TA 4JLJA 3FYHA 2OE2A 2OCAA 3KQNA 5JWHA 3FHTA 1II9A 1G6OA 1XJCA 5KOYA 2QROA 3LDAA 4DLSA 1H8HD 3QF4A 3ZGXA 2BHRA 5BYKA 1KK0A 2AX4A 1N0WA 1JJVA 1E9DA 2ZM5A 3RRZA 1YR6A 1UKYA 1DVRA 1KO4A 3GLFB 2O8FB 3VR6A 3A1UA 2H5EA 3AVPA 2GEDA 4IVPA 1VG0B 1JPNA 1QVAA 2HJGA 3KJIA 1KJWA 3IHLA 4OQLA 1A2BA 4MGYR 3WNBA 1ZD8A 3ASZA 5FOVA 4ERNA 2RB4A 1CR0A 1GVNB 4NPHA 5EUMA 1QBKC 2GILA 3FTQA 1GAJA 2RHDA 3REGA 4B34A 3GLIB 1RKBA 4LBVA 4IOJA 2XXAB 3BORA 1G3UA 4BLSA 5JI2E 3JVUA 5A5GA 1J2JA 3QVUA 4HB4A 1GZSA 1YRAA 3ZQ6A 1GILA 5C4GB 1LS6A 5EE9A 4ARZB 2QBYA 3IIKA 1ZAKA 2PX3A 4UNSA 3LNCA 3PEVA 3TNFA 1ZD1A 3SZRA 4Z8XA 2EQBA 4E22A 2GAOA 1UF9A 1MR3F 1ZNZA 3Q3JB 4M2LA 5JEDA 4JVNA 5IF9A 3RC3A 1HA3A 3B7GA 4EQ6B 2W2VA 4Y0AA 2LWIA 5AUPB 3K70C 3THWA 4KBGA 1TUIA 3EG5A 3QXSA 3S1AA 3O47A 1Z5ZA 4PXAA 3GJXC 4M9SA 2ONJA 4UNNA 2CVFA 1ZBDA 1CEEA 3IGFA 3M1IA 4ASUD 1U98A 2QA5A 2XJ9A 3SJZA 1W49A 2ODWA 1UADA 1XXHA 1AK2A 1E2NA 2GJAA 2YOGA 3DVLA 3KB1A 1VECA 5H8WA 2BBTA 2F7SA 2ZRKA 3K09C 2B6HA 3V4RA 1AIPA 1LVGA 4Q4HB 1L4YA 3C14C 1P4SA 2O0KA 1W0JA 2JLXA 2DFLA 4ZO4A 1AM4D 1DG3A 3SR0A 1W46A 2GVDC 1FUKA 4HDQB 4M0LA 2XZLA 2VHTA 1ELOA 4JLOA 1ZM9A 2Q3HA 2RGEA 1GKUB 2IHBA 3IEUA 3SFVA 1KO5A 3SNHA 3NIBA 4C2TA 2G88A 1Q1EA 3K0FA 2IX3A 2C99A 5ELXA 3UMSA 4TTRA 1FNNA 4N0DA 4Q4JA 3HYTA 5HCIA 4XWKA 2ZU0C 2D4HA 5FBVB 3KJHA 3HJNA 1M6NA 3QEOA 4DT1A 3A1SA 4JVMA 3UANA 1LNZA 1G4AE 3OFND 4TL7A 1L7VC 2ZJ8A 4LHVA 3KX2A 2ZVQX 5FTNA 2CHGA 2VP9A 1ZM2A 4AYXA 4CZ2A 2OO7A 4C4PA 1OH7A 2ZJYA 1MOZA 1D2MA 1SULA 2F9MA 5TDHA 4WXRA 4OHZA 3U44B 3AKEA 1RPZA 2XB4A 3THYA 2AD1A 1Z0FA 1CJVC 4S35A 1Z08A 4PSVA 3TVDA 2RGBA 1HT2E 2DFTA 5DH9A 5JS7A 2JLVA 2QL6A 4YDSA 3R8CA 2YHSA 3HU1A 3U7HB 2ASEA 1E2HA 4GI7A 5LDDC 2A5FA 3DO6A 1XCPA 4PQYA 3E2IA 2RGDA 3AP3A 3QUSA 2ZYUX 2YYZA 3OIWA 3QKRA 3G0HA 4KU4A 5JRJA 1B23P 3A58B 3EASA 4NCHA 1VKJA 1QHHB 1F2UB 5DI9A 2JLUA 1XTSA 1KK2A 4BGDA 5KUTA 1E69A 4DCNA 4K46A 2PH1A 1KSHA 3KTAA 5TMPA 3AVOA 4FMBB 3PUWA 3FDIA 1ZUNB 1SXJA 2ERXA 2JLSA 3W5IA 3LRPA 1PJRA 4US1R 2NO7A 3U7EB 2G3YA 1P2TA 2UVQA 5FL7A 1H65A 2EFCB 1TQDA 2AFHE 4RD0A 2WWYA 2GXSA 4MGZR 3NH6A 3ZZTA 2BKEA 4P32A 3PITA 1M8PA 3Q85A 4ZKEA 2ZANA 4MYTA 4NTZA 4NYMQ 4TZ0A 1NVWQ 4YONB 1Q20A 4W9MC 4A92A 4UJ5A 1SXJC 5L3QA 1KZGB 2J0SA 2C2HA 4LJ4A 2OLKA 4KO8A 5CJPA 2GCOA 5M04A 1N6PA 3A4MA 2C9OA 5DN6A 3WYFA 3RS7A 2VBCA 4TLCA 4LHYA 2VSOA 4HEJA 3RRMA 5JWRA 2OBNA 2O52A 1IJEA 2AL7A 3PVSA 2GCNA 1WF3A 1OE0A 1IN6A 3A1WA 3DPUA 4OHWA 1OFIA 4BFWA 3GEEA 3K70D 3LWNA 2YKGA 2YJTD 4TLEA 5LB2A 1E2MA 4DJTA 3KQKA 5SZHB 4Z54A 1G4UR 5D3MB 1EWRA 4B3XA 2QQ0A 1XTJA 4LJ6A 4OKSA 4P4SA 4HUTA 3QPUA 4MRPA 1HE1C 3BE4A 5LD2B 4IXMA 2J59A 1D9XA 2JIZA 2ORVA 2V4ZA 4C0QC 4KFSA 1F48A 1KKLA 1U99A 2Q6TA 2CMKA 1JAIA 2XJ4A 2QSZA 1KDTA 2VIIA 4C0JA 1S1MA 2NMVA 4TLDA 2ZE5A 4MUBA 2LKCA 3AUYA 3W6NA 3Q8XB 3PG5A 2WJVA 2N46A 2R6GA 2BMDA 1TEVA 1NVVR 1CBUA 1U0LA 5BXQC 2ZS9A 5GJWC 3ADDA 2IT1A 4D81A 4HAXA 2JLWA 2QEQA 3RS0A 1CXZA 2YNMA 1OJLA 3U4QA 2WAXA 1GWNA 4EIWA 1V43A 5KSZA 1RC8A 2F3RA 1TF2A 2JLRA 3I61A 2YC2C 2ZSFA 2D06A 4G5SA 1E0KA 2WHXA 4LHXA 4EJSA 1KGDA 1XTQA 3RYTC 4QBGB 3WHLA 1IAQA 3AV0B 5LPNA 2FGJA 1N6HA 5FPYA 3AP1A 3BD9A 3IKJA 5FUVA 3RVBA 2ZE7A 4P4UA 2DYKA 4DSTA 1CRQA 1LF0A 3IBYA 4DCTA 2IYLD 2J1LA 4IOKA 5CDFA 2GJ9A 5FPTA 4GP6A 4TQAA 1QHYA 2I3BA 1DO0A 3H0KA 4AYWA 2YVUA 1WCV1 4O2RA 4TL6A 4WW0A 2ZJOA 4WZBE 3LH5A 5FTKA 5GJVC 4DWJA 4HZIA 4ZCLA 3IEVA 1TNDA 2JCSA 3K9NA 4AC9A 1T5IA 3GP8A 2OFWA 3IBGA 3OE7A 4G1UC 4HI0E 4Q66C 4A6XA 4CT4B 4F4CA 5KDDA 4TL9A 3M0EA 3PCRB 3O8CA 3ZLJA 1OXXK 2OEPA 4Q00A 1SKQA 3THWB 1H8ED 3T61A 1RRGA 1E2DA 4PR0A 3S1AB 2GDJA 1U8AA 1KI7A 3LBIA 4QRHA 1K5DA 1X8KA 3BC1A 1XMJA 2V55B 3HDTA 3QSYA 2XZPA 3L0IB 4DUGA 2RMKA 4MKGA 2XTNA 2A5GA 4JYBA 4DC9A 1C1YA 1IBRA 1SVWA 1N5IA 1R0XA 4BQSA 1S8FA 3IPXA 2X2EA 4GNKA 4I1UA 1A1VA 3TVTA 2DFKB 3HU2A 1XXHB 2EYUA 4FCWA 4BFXA 4LJ7A 1FMJA 3CR8A 4WOPA 2MMGA 3P26A 4KITB 2NOAA 4Q9JA 1PV4A 1P62B 5KNDA 1BS1A 1R0YA 3VNUA 3N5CA 4EDHA 1EX6A 2WJGA 4M53A 5G41A 3T1TA 1SXJD 2WIAA 3SHFA 3P4YA 4B43A 4A0FA 4OBEA 1KO7A 3L0SA 3LVRE 4M1WA 3RWOA 1ONBA 4XSGA 3WNDA 3QI2A 1TEXA 2I4IA 1YZKA 1J8MF 4P0TA 3BGWA 2A5YB 4RZ3A 2V7QA 3W6PA 4Z1MD 2XTMA 3EWAA 5KNBA 5CITA 2VRWA 2KB0A 5DNYB 1EFCA 3PJRA 1TAGA 3K0FB 1M1YE 5JECA 2GRJA 3A1TA 2H1LA 2FF7A 1E98A 1Q1BA 1JR3E 4Q4JB 4ZI3A 3GCGA 3LLMA 4WBSA 4BFYA 5DYGA 1HTWA 3NXSA 4DT1B 3ZVRA 2EW1A 3IIMA 3GLFA 3H1TA 2ZIAA 1T8TA 2ANBA 4ITRC 4JLPA 3HPQA 1S9HA 3OEHA 2FSIA 3EWSA 2IXGA 3UIEA 3EZ2A 1S3GA 1DAGA 1XZPA 2AWOA 4OJQA 2OILA 4AIIA 4B76A 2OHFA 1PLLA 3THYB 1RJ9A 2GA8A 2HDNB 2RGGA 3I62A 1Z0JA 2B7CA 2QY9A 3K0AA 1W36D 1NLFA 1R0WA 2AK3A 2REBA 3AVTA 3NC0C 1J99A 2CK3A 1TU3A 1SVKA 3P20A 1F3OA 3W3AA 4UXHA 3V00A 1E1QD 2UZ3A 5TXGA 4IHQA 1JAHA 2WMOB 3Q7QA 3HWSA 3QJYA 4KLZA 2R6DA 4E03A 1KI9A 3KXKA 2PJRA 1E2KA 1D2NA 3OAAA 1W48A 1NG9A 2J87A 4LC1A 3G5UA 3QXJA 4IXNA 4QM6A 1AS0A 4AD8A 1TF5A 5C1BA 2VP5A 2YWGA 2W6ID 3KTAB 121PA 1CULC 2WOOA 4A0RA 4B2PA 1SXJB 2I1VB 2ZI3A 2B7BA 1XPUA 1JR6A 1VHLA 4XIGS 4ZV4A 5FOTA 4I1SA 1UBGA 1B0UA 4GMXA 3R8FA 4JKIA 5HKKA 2EFDB 2ZRAA 2CCJA 4TMKA 3WXMA 1N6NA 4HLUA 5EE5B 1XPRA 2H57A 1GG2A 3VR4A 5JSZA 1S96A 2QAGA 3PEUA 3DEFA 3FKSD 4NCIA 1YU9A 4HB3A 1MRSA 1ANKA 3L8ZA 3LLUA 2NO9A 4C0LA 5L3QB 2FE4A 3A6PC 1H8HA 2B92A 3FB4A 4CGZA 4Q7KA 4DIEA 5J4YA 2GCOB 3PFIA 4RD6A 5CB8A 4XD7D 4EAQA 4JS0A 2FMXA 2J7PD 2GJ8A 3U3KA 2X8AA 1YZLA 1FQKA 1JBKA 2IYXA 5EUQB 2JDID 5EP4A 4IDNA 3KB2A 1ZMXA 2BEKA 5FPHA 1OKKD 3UPUA 1E9CA 2G0NA 5HE8A 4GFDA 4GSYA 1E6CA 4NCNA 1DARA 1P75A 4QC2A 4Q1BA 4P4SB 4DLZA 3RRYA 5E4FA 4C30A 1G5PA 1VG9B 3ZD6A 2O8EA 5FPSA 1W4RA 2VP6A 3P27A 3EX7C 4OQNA 1P3JA 1KNQA 2WKQA 4YMSA 4GL2A 2IL1A 4FMCB 2F55A 1U0HC 3DZDA 1G8YA 2ZREA 5BN3A 2WWGA 1JEDA 1E9BA 1G3QA 2ONKA 4EPWA 2GBLA 5KSOA 4X8MA 4Q7LA 2LCFA 2GF9A 4G01B 2GEUA 2QTVB 4DSUA 2X19A
chains in the Genus database with same CATH superfamily
2NUTA 1ZAYA 1FFWA 4PAOA 1E9VA 3GQBA 3N39C 2P0EA 4INAA 4UJ3A 4QQ8A 3CJRA 4YCAA 3VUEA 4ETNA 4Q1EA 1QKJA 1E2GA 1IATA 1U7HA 4JZYA 3G17A 3ZDRA 3ZCPA 1ARZA 4LNHA 2HH9A 4I3GA 2LKDA 1XRLA 2GKSA 2QG4A 3KYDA 1Z0SA 2D8AA 3VH1A 1WDWB 3PYLA 4HSEA 4RLHA 5HJ5A 1VB3A 3PUIA 5BN3A 3ICEA 4ALJA 4MWGA 2PL9A 2WUWE 2ZUTA 2GS9A 3HKBB 3VPSA 1HZZA 3CG4A 5KOHB 2RHGB 4HDOB 1ESNA 1CQJB 3VR2A 4BAGA 1RAHA 4JLDA 2B3TA 4QM7A 1GGFA 1HPLA 1UBRS 2BELA 3PWSA 4MKZA 3DQQA 1T1RA 1JSXA 4TZTA 3WLLA 1D2HA 3HZZA 3PIDA 3TDMA 3C3YA 1F2UA 1PZXA 1ZHFA 2BFDB 4M0CA 2D5BA 3IEKA 1AZLA 4KODA 1G20E 1XHLA 1GTMA 3OM1A 3ONVA 1ODKA 4IQ8A 3RRBA 5EJ6A 5B3KA 1H2XA 4HFRA 4UZFA 3UUEA 1MF7A 2IZ0A 1IONA 1NP7A 3E27A 2VJPA 4I5IA 1HZJA 1USIA 2ZJBA 2HSJA 3GHHA 3T06B 5T5QA 3WWPA 2J41A 2YDXA 3RDPA 4RZUA 4HAVA 4KFUA 2FZ4A 2DPMA 1G21E 4BS9A 3G13A 4OI2A 4BMOB 4FB4A 5ICSA 3D1JA 4FNOA 4U7FA 1V6CA 4PO1A 2I2WA 5JY6A 3RBXA 3FUWA 2HMWA 3F7NA 3GAAA 3NWOA 2VA9A 4ZU1X 1NBMD 2ZE8A 3Q1LA 1OXVA 1A04A 1Z26A 4D8UA 2QUZA 3HWX1 3DBIA 2PQ2A 4M54A 2B5VA 1QVVA 2FUG6 1SMKA 2VUHB 4MYRA 2QVLA 1M0SA 2XITA 1AJEA 1YKSA 2AFIE 5G2OA 4ZVSA 3VKVA 1GZDA 5INTA 2F3UA 4ZJZA 4G89A 3ZZMA 2BL4A 3HUEA 2DTEA 2NSYA 3TSWA 3I53A 3GT4A 5ALGA 4ZAZA 2BEWB 1QQ6A 1VI6A 3CW9A 1VL5A 3M34A 1L7PA 1BSVA 3TG2A 2QR3A 2QN8A 2W2PA 2RKWA 3E22B 2H4FA 5F1OA 3HRIA 3K1AA 4WACA 4PONA 3O1IC 3IERA 4HWKA 4P33A 4CIAA 1PBTA 4FC6A 2XAUA 1H0RA 2B3DA 4BJ1A 3G7NA 2RHOA 3CRVA 4PHHA 1YIDA 4B4KA 5IH3A 5BQFA 3QWAA 3LPNA 2PEYA 1T26A 3RRJA 3WP0A 3W5BA 2GXQA 4QICA 1RVV1 3RBVA 1RMQA 3IA7A 4OLFA 2OGTA 2Y76A 4Q3KA 3VI3B 3VPGA 3WIDA 3ZJ4A 4Y2VA 4AF6A 1M9NA 5CVUA 1HH4A 4D4MA 3DW1X 4IIVA 5CK4A 4DRXA 2GWRA 1FVFA 1LW7A 3QJ5A 5EKTA 3ZN2A 1SXIA 2OSBA 4XARA 2XB2A 1DKUA 4MYSA 2XEXA 3B1VA 4DABA 2MSCB 4CNBA 2AQKA 1FFBA 3NTLA 4AN1A 1WY5A 2YV5A 4PX5A 1QHEA 2V65A 5E9JA 4ZJUA 2IDJA 4OHFA 3DTVD 4AO8A 4E2XA 5MGBA 4ZMBA 4HB0A 5EKSA 3R9XA 1K98A 1QR6A 3IHTA 2IXDA 2JAPA 4IEFB 2P2NA 1TJ3A 5DBGA 1Z8DA 2QRHA 1Z2CA 1Z2OX 3L7OA 5LA6F 1TVCA 1RYDA 3TRIA 4A0HA 3ERCA 2DQKA 1JKJA 4EG0A 1E59A 5JNTA 5H16A 2O0HA 3KYIB 3OZAA 2UYQA 4Q4AA 4L0MA 3LXMA 3W5VA 2IXTA 1KDPA 2IF2A 3QE9Y 1EFHA 3D6AA 3HVJA 3KG2A 3TW6A 4LHWA 4LG1A 3MGGA 3OM9A 4KN5A 4M7OA 5AOCA 2O59A 5IJWA 3A4LA 1NUQA 1KBZA 4QGGA 2V1XA 5KI6A 5B53A 4LUCA 4ARUA 4D5GA 1NONA 2HFKA 2Z3ZA 5JNLA 3EVAA 3LQQA 5F23A 2FRXA 3CR7A 3JD1A 1SCDA 1LY1A 1XYYA 3MQFA 4KIWA 3R77A 3L4SO 4RGQA 1YR8A 5E1MA 3L6UA 3T5BA 3IA2A 4B3FX 4G5RA 5CEJA 4WLEA 5TR9A 3O31A 5IHPA 1LKZA 2E7ZA 4EPXA 2DB3A 3HJFA 2HYIC 2QSYA 5COQA 2IYUA 3EARA 1NYTA 3QLTA 2ZBRA 4J2TA 4R2HA 1CUDA 3B78A 2IK8A 2B1IA 3OJLA 4AO7A 5C8XA 3B3FA 2WWTA 2FLKA 1EWQA 1SOAA 2NVBA 4LXUA 1FUUA 2RGCA 1LV7A 2FPIB 4NE7A 4AZ3A 1E1NA 4XASA 4X1YA 2A58A 1QPGA 4LMPA 1OWPA 2XVXA 3DL2A 3SSNA 4HATA 5HQ3A 1DG9A 4A0QA 4UUNA 5D01A 1RADA 4QUDA 1T3ZA 3W2EA 2XKJE 2XUGA 3D7KA 3O4RA 2WHYA 1FFHA 1DKRA 4WFJA 3PL1A 1GV0A 4G0QA 2NVOA 2BHTA 4YT4A 3I2GA 1C4KA 1F7UA 1E4YA 2JFGA 3EXIA 4MKFA 4Q47A 4EELA 3WGGA 1SU8A 4ZQFA 2IWHA 3UMVA 3GLGE 2QRNA 5FWDA 3PQ3A 3C3KA 3L6RA 4EITA 3AW8A 3S4YA 2RARA 4Q19A 4XOUA 2I29A 5EJ8A 3K09A 3LLSA 1RM0A 4GM0A 3E4CA 3RQIA 1H69A 2EARA 3ADOA 3FB1A 1FQWA 1SU4A 1QQ5A 2J9FB 5C4MA 1RAEA 1XMXA 1G7RA 5GM2A 3RWMB 4CKBA 5KYUB 2QTAA 4MIOA 4ZT5A 1J8QA 1II0A 4HTFB 3SX0A 3VZRA 4AQ7A 5T41A 2O2SA 2QZ9A 2JLYA 1QP8A 2QRVB 1NAIA 4L5YA 1U2RA 3BWDD 1IPEA 3FBWA 1Y1KE 1YB7A 1FK8A 2DULA 1Q22A 3II6X 3W6UA 4DAEA 5FQNA 1U2GA 5C0OE 1JDTA 2H85A 2OTCA 2ZVJA 3GLHE 3L46A 4X54A 4INJA 3HH8A 2I2DA 3EGEA 1Y3AA 3AFNA 1JXQA 4HFNA 4LYJA 2I8AA 3DP7A 2VF8A 1OAOC 2X0NA 5G1OA 4ETIA 3UAGA 1MT3A 1E9SA 1JQAA 1MP0A 3KKMA 2X13A 5CVJA 1NKVA 5F2OA 3PDUA 4P80A 3MJCA 1ECJA 3DUWA 4XQGA 3KC2A 2ZTSA 3FTCA 1PR2A 3G2IA 5CB6A 1E7RA 3H2YA 3R3JA 1FZQA 1US8A 2PSEA 2OHXA 3EA4A 3MPOA 5AJXA 4C88A 1PWYE 3K0CC 2A1TR 2IYVA 1KI8A 2JGLA 4YFYA 4OMUA 4TQGA 5FCDA 4CM8A 2PWBA 2O8EB 2QXYA 5BVGA 2CHUA 4YCDA 3N2EA 1YDWA 4AIRA 4CT5A 4Y1RA 1CUJA 5CFMA 1XA3A 4CLOA 3LUAA 2OAP1 2A3NA 3GH3A 3CLKA 3L7MA 3EIHA 5HF9A 3G2JA 3PQ4A 3RKRA 4TV9F 2GHIA 1QWSA 4C76A 1WLSA 4PLVA 2CDRA 2PMKA 4D9HA 1QKKA 2A4KA 1CS0A 1H2EA 3UJDA 4MGKR 3RC2A 3G2PA 4GBED 1ZVJA 5L45A 4KQCA 1GNTA 2FPRA 2NUTB 1QGZA 4ON9A 2N1MA 3JXEA 2I33A 1RQRA 3EXG2 1IWOA 4R40A 3GQBB 2IP4A 3LPCA 1ODJA 1T25A 5CVDA 5BSUA 2ID4A 1M73E 4ZV7A 4J1QA 4OK3A 5JYEA 2GTHA 4IJ5A 1VE9A 3OOEA 3TAHA 1P0IA 1VIVA 1JHZA 4NDNE 5G53C 2WWVD 3WYAA 3WNCA 5GP1A 4EW3A 3ZWYA 1DDGA 3KYDB 1XN1A 3BXPA 2OZVA 4BO7A 2W42A 3MTEA 4DB2A 4AJ2A 3BCRA 1PJZA 2ZAMA 4EFKA 3V8EA 2G5GX 4UHEA 1R10A 1DQPA 1N78A 3UMJA 4KKVA 2WG2A 1UZUA 3DWGA 1HURA 1JR2A 4RORA 5HIMA 4DS3A 2F1RA 5EA2A 3ILVA 2ZJ2A 2ZIZA 4L5CA 3ZY2A 4I19A 1EUQA 4IHKA 1CY2A 1SPBS 4Z0PA 1HNWB 1UK9A 4K6GA 4BQPA 4KHZA 2CT8A 5AI0A 5EJAA 3I9NA 3V42A 4BNDB 5BW8A 5IAGA 3G88A 3GJ4A 5TT1A 2XUHA 3B9RA 3R41A 2VNHA 3ENZA 4G41A 4CF3A 1W87A 1P81A 4QQNA 4QYTA 4DNXA 1LD3A 3E1GA 1Y8RB 2OHGA 2B37A 4MULA 3C7AA 3HYRA 2GUWA 3GFRA 4QU5A 3RS5A 4F5WA 3NORA 1EPUA 4GR9A 4QL3A 2NYUA 4R8LA 3KSUA 2RH5A 4YK7A 2JD0A 2P4HX 1XU7A 3EQ8A 4ZO9A 4ZEOA 1IJBA 1QVWA 1UOOA 4DM7A 3A6LA 4Z1MA 1M5UA 3O8BA 4RTQA 4ZPXA 2QQ5A 3TRKA 1RWWA 4FXPA 2J4CA 2J3QA 3UOAB 4OBWA 3MTGA 2ESRA 1UAYA 1FYWA 3R2JA 3A1CA 3B52X 2TYSB 1HSZA 4OQMA 4M83A 3P4XA 5KREA 5DBHX 1EUYA 4OYHA 4KUGA 5B4TA 1GYRA 2C04A 2X14A 4TRRA 1FNSA 3F6CA 4MAFA 3WMEA 3ZOKA 3QOFA 4EDFA 2YHIB 2Z2ZA 2RH9B 4XJTA 2JFVA 2XTJA 1CUBA 3Q3HA 4BMYA 5H9VA 1GU0A 4RD2A 3V3KA 2FEMA 1NT2A 2PQ6A 3BDAA 1P8AA 1ODTC 3FFBA 3NC1C 2OO3A 1LTQA 5JZOA 1OC4A 3EVDA 3K1AB 1TAHA 5EIEA 3JQFC 2YZMA 1B1CA 1V6AA 4L8LA 4TWJA 3N2YA 5AK3A 4TKVA 5DNCA 4XEUA 4AN4A 2BM8A 2AOTB 3CXRA 1SVIA 4JJKA 4N12A 3FKQA 5AM3A 4F84A 2NGRA 5CJ2A 3SDSA 2KLBA 3F74A 3WLJA 4PFJA 3D6VA 1A50B 1EQUA 1UH5A 2PS3A 5I7SA 2P75A 1IN7A 3EBLA 3L1UA 4NE2A 4OXYA 5M5BA 4IIUA 1TZJA 5J2UF 3D43A 3CISA 4DDVA 4DRXB 1JS1X 2HRRA 4TUYF 2P9QA 3UFXB 2F9LA 2I3AA 3TIFA 4Q7QA 2OOSA 3BJMA 2YDYA 5GOTA 1C0KA 2BRUC 3UWSA 3PI6A 1B0AA 1L5SA 2R2GA 5IN5A 3W9YA 1SBIA 3H19A 2ZK7A 3CFYA 4IQ4A 3RPEA 1X1AA 4DEYA 3R9XB 1GPH1 2NYVA 3P2KA 2RHJA 3BXEA 5DT2A 1CT9A 1L7RA 3K9LA 5JQGA 1TYCA 4GSLA 3DEAA 3GOHA 1Q1QA 1JKJB 4ZARA 1YUNA 3IV7A 3K8OE 3V7UA 3UB2A 2XQFA 1B8UA 3GPIA 2HC9A 4KFCA 4NMHA 4Q4AB 3EPHA 1OU4A 1U2EA 3F46A 3KYCA 4BO9A 4HPJB 1KI2A 5HKLA 2B4AA 4JI6B 4JR0A 3HVHA 4YEDA 3A3YA 5K2OA 7AT1A 2ZJ0A 4ZEVA 4PICA 5J59A 1GQ2A 2RGXA 4LQCA 1Q12A 3KHKA 4KC0A 5EMLA 1XP5A 1ZQ9A 3OZEA 1NNLA 2VC2B 1E77A 2GN0A 1SG9A 2LD4A 2Q50A 1AZTA 4MVJP 3E9QA 3W8DA 1DEAA 3HCPA 3EXAA 4CQMD 5C1DA 3RVJA 4NOMA 2XSZD 4KWHA 1SBZA 1T3HA 2PLFA 1HT1E 2RGAA 1GL6A 2DPLA 2V6FA 4XD7A 2GZ1A 2J7PA 3S40A 1MW8X 2BMWA 3MLBA 2PUGA 1DIGA 2IIBA 3E84A 4HXFB 3ZDQA 3H16A 4ZDJA 4B4VA 3OJCA 2QXUA 3G8CA 2PX8A 1N6LA 2QD2A 3E5NA 4P5PA 4LGYA 4HLQB 3K70B 2G9UA 2ZJFA 1UOEA 4BL5A 3ZS9A 4X1YB 4X5OA 3HJTA 5NULA 1W93A 4IHAA 4KV7A 5HQ3B 4B2LA 4IINA 2M1ZA 3SXJA 2X6QA 4HC4A 2YWRA 5E2IA 1MIOA 4ZA2A 4NP6A 2PBFA 3T7IA 1MG0A 2IEZA 1THGA 3HJCA 2XCUA 3TRDA 5A5DA 4GC5A 4KV9A 2JD2A 5BQXA 4L9AA 2VTEA 4PYJA 1MU0A 4KYUA 1LS1A 1USWA 1GUDA 1PDOA 1KI1A 3LLVA 4RIHA 2CMGA 1JXMA 4UUBA 1HFWA 1GRQA 1LNSA 2FW9A 2R7KA 4IS3A 4MIYA 3RM3A 3KZVA 3U31A 1CWUA 2QM7A 5TPZA 1G0OA 4L08A 1P6QA 2R9VA 3SIWA 4D99A 4EECA 4D2IA 1RP7A 1P6XA 1I2CA 1VHTA 1AQIA 4OHPA 3C5EA 4CKBB 1W73A 5HILA 5HVNA 3UJCA 4Z99A 4EPTA 4KQ1A 4X91A 3QPWA 3S81A 2OQRA 4NAHA 2A1IA 2Z3VA 3EHDA 2EWMA 1WCIB 5AM2A 5K0GA 5LYJA 3PHJA 4E70A 3UAVA 2XWBF 4LQLA 2GN1A 3Q41A 3CRQA 3EW9A 4PSUA 5I9SA 5K8JB 2ZU6A 3QKWA 4UPVA 4KFRA 5LKAA 3O2QB 4RH3A 5DWQA 3CZPA 1J97A 2V0NA 4EBFA 4HNQA 4CWAA 3L8FA 1CJTC 4ALKA 5FD8A 1YE8A 2J3HA 5CU7A 3E3LA 2NN3C 3LX5A 4Y67A 3UWOA 1ULAA 2G67A 3NTQA 5BQOA 3HFJA 5CYGA 3V8MA 2IOFA 3CHYA 3KL2A 2MSKA 1XQWA 2B1QA 1DPGA 4DIKA 3SDZA 2FGKA 3Q9NA 3RV3A 1US8B 4DDMA 2JJ2A 1U9JA 2D3WA 2ZWPA 3LIIA 3E5RA 4FR2A 3EA0A 4EMBA 2F8TA 4BPRA 4CM8B 1JJAA 1AKTA 1WV0A 3WMRA 1EFTA 3I6ZA 2V58A 1ECFA 4KBFA 5IAEA 5BVGB 2XBMA 4MVJM 4Z51A 2LPMA 2GBPA 4Y1RB 1JT2A 4LDRA 1YWGO 4JXKA 4FT4A 4CLOB 1W75A 5ITWA 2JH9A 1X7YA 3TSYA 4ZT7A 5JVDA 4HXYA 1K8QA 5ALHA 4C6TA 4CQNA 4O0LA 2EIXA 1IK6A 1DIHA 1G4HA 2FRDC 3NT2A 3BL6A 4OHXA 2WFMA 3UWMA 4CHGA 3DO5A 4E5KA 1UWKA 1J25A 1CS0B 2IV3A 4PZUA 2K7FA 2WP0A 3BKWA 3EXHB 4P54A 5K0BA 1T0IA 1LGYA 3GA0A 3IAM1 5HBRA 2V5AA 3CX8A 2IY7A 3UMMA 4HEHA 5BUQA 1RT9A 1T9GS 3P8ZA 3QX9A 2WIFA 4P7JA 1RYBA 2Z2JA 5CLQA 1O54A 2C78A 2J09A 3D31A 1L5GB 3VOBA 1QB7A 3DE2X 2H18A 4O2BA 4US2R 4IJQA 4URXR 4BAZA 3BEOA 1DGQA 3IV6A 2JA1A 3VKHA 2BZ1A 1E2UA 1IOZA 2G06A 1NFFA 5F52A 5EHGA 4IX1A 3KR9A 3B6IA 3QQPA 1TUBA 4B8YA 4I2VA 3GD5A 4RKQA 4X85A 2VJCA 1JN0A 1SC6A 2GOYA 3KZXA 3EYWA 1TF7A 5IAOA 3IB6A 4AKIA 3ONEA 3R9IA 3THRA 3ROZA 1GDTA 2FK8A 1J1ZA 1Z33A 4KDCA 1Z2AA 5DX8A 1HQYE 1NW3A 2Z98A 4B75A 3RTAA 5L9AA 2AG6A 3R3WA 4ZYWA 2BFWA 4XW2A 1BC5A 1U5BA 1S01A 1N9ZA 1DZ3A 1NBEA 2EKPA 1DJQA 3E8XA 3NJ4A 3ODPA 4M1QA 5DTQA 3OZSA 5EMNA 3WHKA 4Q4CA 2D5AA 2O23A 1C30B 4C3UA 1YU6A 4DLVA 3LI2A 4ZAYA 1NJ5A 3OQOA 4AI6A 2GCGA 4YS6A 4Y2YA 2RKOA 2B4RO 2VHZA 3WKEA 3RYHA 1XTIA 1IN5A 1WCXA 1ONPA 1XLUA 2TRSB 5J5VA 3SG0A 3V48A 2I99A 2H00A 4YXFA 1H0SA 1GCOA 5JAHA 1A8PA 1EE1A 1ZI9A 3QHQA 5KOJA 5JSYA 3NGXA 5AQ1A 5B64A 1DINA 3IYLW 1SKYE 1XEWY 3ZWQA 1J7JA 3ETLA 2YXEA 1M7BA 1XQ6A 4YC7A 3UG7A 5BMVF 2V7PA 5T4EA 3UPTA 4EB3A 3VR5A 1NX9A 1GN8A 1H93A 1E6WA 1N1GA 2C4HA 2O9JA 3MWDA 1BKDR 1PKEA 3DZ8A 1HKHA 3IFSA 1D2EA 3ETHA 4LDQA 4YBRA 4BFSA 2P69A 4C22A 1FMLA 5FLYA 5BWBA 5I7EA 3Q8LA 3PNLA 3CLSC 2JJ1A 5CFZA 3SQLA 1GDDA 2NTNA 4MTCA 3E1SA 3U81A 1PKXA 4P2BA 3TZLA 1TD1A 5CFQA 3T5CA 4JBXA 3COZA 2A9KA 1COWD 4TKVB 1QGAA 5B3AA 4EWLA 1PBNA 2QE7D 4X7BA 2WYUA 1UXOA 5EXEA 5TMBA 2JCBA 4BE7B 1E5XA 2P6UA 1M0TA 3C6ZA 2DHQA 3NLLA 3ZJYA 1BHO1 5BT8A 4FSHA 4TQUS 4R5MA 4K9DA 1MGOA 2IF0A 2MSWA 4FU0A 5DMHA 2XDAA 5BWLA 4YP5A 1DQSA 5HIIA 3V2GA 2ZULA 1OH5A 2E4VA 1AB6A 3RVSA 4Z3OA 2ZRFA 1JL3A 1OI4A 3M6FA 3ZWOA 2Y2VA 3FUTA 2GWHA 3PT5A 5EMHA 1T9CA 4AZ0A 2X6RA 1Q0HA 4GC9A 4O4JB 3SHWA 2ONCA 3MC1A 3NGLA 2ZSKA 3QPVA 5H3HA 1J33A 3TL2A 1SBCA 1XK6A 2E87A 4IEIA 4CXMA 5AW8A 5KQGA 1RRFA 3B1WA 2WPDD 4PLWA 5DYIA 1ZBQA 4U4AA 8OHMA 5AW4A 3NBMA 2QM8A 2BFPA 3PJFA 4UHHA 4C7VA 4EA7A 2CYAA 4Q3DA 5AT1A 4H18A 3R7FA 5LMUB 1POWA 1AG9A 3JYPA 4GT1A 4Q21A 3W2IA 5JQGB 2XYRA 2J3JA 1Y1TA 1R0KA 4KVFA 3TB6A 2QN9A 5KX5A 1HBJA 2W4MA 1PZHA 4US0R 1ZH8A 3KYCB 2F3PA 1O57A 3C6KA 3KWMA 4HLNA 3GEHA 4LBYA 4BVAA 1V6SA 2B1RA 3CO5A 3KB6A 1NU6A 2HM7A 2WTBA 3EUFA 3K16A 3R0IA 4M7RA 4OIFA 2IP1A 3QENA 4Y0VA 4LRTB 2NNWB 2WIBA 3KV3O 4RAQA 1EM8A 2HJSA 3ELBA 3DFIA 3JQEA 4JLVA 3GEIA 3JQDA 4NEGA 3SBEA 1XV5A 3QTLA 4B6GA 2BMFA 3BG5A 1MJGA 3KWFA 1P7ZA 5IASA 3QM1A 1G8FA 3AHCA 4R16A 1QO7A 5LP6F 2ZSIA 2HEIA 2POQX 1SFRA 2P9CA 3JWEA 4N4AA 3IEMA 3RHFA 2C9DA 2B4KA 4FYWA 2E37A 2QV0A 2IPNA 2NTVA 1C29B 3EQ9A 4KNWA 4KSCA 1QX4A 3RU2A 5LR6A 1TYDE 3N87A 1SR8A 1TA0A 3GDFA 4Q4LA 3GXOA 2R8BA 3IIIA 3N8GA 2EXXA 1NXVA 1Z6TA 3GMTA 5JTTA 2PL5A 4JI2B 5KBYA 1SHZA 2VHJA 4S2EA 5CLIA 3VMFA 2REQA 1SA0A 3C4QA 4WA8A 4I0WB 5BRJA 1FNMA 4UM9D 5EMKA 1EVKA 1UC9A 1S02A 3HYCA 3IMEA 3IE1A 2IEDA 4OAOA 5E3HA 5IM5A 1VBMA 1V9SA 4KI7A 4DLXA 5B36A 4FP9A 4E1BA 3AEQA 2ZS8A 3ZKWA 2O5EA 2BBOA 3T5TA 2PUJA 4YAEA 1YJAA 2Z2IA 4NBRA 1INLA 4RVFA 2WKRA 1SU7A 4ZV9A 4RDXA 2Q2QA 4RS4A 4QT0A 4EZIA 5C4IA 3FLBA 2ECKA 4TRNA 1ZMOA 3WK9A 3NIWA 4EB6B 4EHNA 2B9EA 3NOVA 1L9XA 4D9KA 3AR4A 4DVGA 1PX2A 4TYWA 4V2IA 1PL6A 1TCAA 5K4AA 3MK31 3PFNA 5DM70 4K8OA 4EMTA 1LF5A 3KXDA 1LBQA 4CKEB 1TZKA 3D8HA 5CDSA 4C4YA 3C6YA 1UFOA 1DELA 4U2CA 1U3UA 1OFUA 2IU3A 4GXQA 3GLIE 1ZW1A 1BMTA 4UARA 5LYJB 1TMGE 4GDFA 1QDUA 4UHDA 2QR2A 2D6FA 4WIAA 1CC1S 3DKPA 3IEXA 2XWSA 1M8GA 4CPDA 1OIWA 2I6TA 1V3TA 4J6EA 5DTEA 4F8JA 3DPIA 3T3GA 3OQMA 3Q4GA 4DG8A 5J3JA 1PFYA 1I2BA 1R8YA 2BKUA 2IXEA 4JLAA 5KHAA 1ODCA 1VI2A 2PTHA 4QGAA 1RI5A 1M76A 2QX9A 5K0SA 4FE3A 4YJDA 1U1CA 1WQ3A 1ZL0A 2ZAOA 4IIJF 3AEXA 5ESXA 4EK9A 2BMJA 5ALUA 3WWOA 3W2TA 2FG6C 2DG2A 3M9XA 9GPBA 3IAS1 2Z8YM 1ZOOA 4KK3A 1U7PA 4YP6A 3ORFA 4OH1A 4AMGA 3SBDA 1BVUA 3WK7A 2JHGA 2WD9A 1U3DA 1WUYA 3F9IA 5DWVA 2ETVA 4CM4A 3IC5A 4G63A 1WB9A 2PSSA 1X7YB 2R62A 5JVDB 4C6TB 3CRRA 4R2LA 2P67A 3N05A 4GWLA 4REOA 1Z0ZA 3MELA 5TMPA 2BMAA 1F8UA 2CHEA 2VBFA 4RA9A 3GC6A 3C1OA 4B2YA 4YMTA 4G2NA 3KLBA 4HVCA 2APJA 2F9FA 3SEFA 3G59A 4NU6A 3OUZA 4PPNA 3FW1A 3ZVLA 1YFZA 5CA0A 4NOKA 1W0KD 3HR7A 1JUDA 4A6DA 1BOOA 4M0PA 5MN5A 3F71A 4JLNA 1UXJA 1W1WA 3LZ6A 3PFWO 4RLFA 4MRMB 4MV6A 2QMHA 2VP4A 1KTIA 3C8UA 4MR7B 1I2ZA 5CIYA 1OBCA 2PPLA 2ZS7A 3VTAA 4O2BB 4YX9A 7GPBA 5LD2C 2E4UA 1YRLA 1TCCA 1KA9H 2NACA 1XPJA 1CQZA 4EZBA 4UC0A 1ZRHA 2FG5A 2PXHA 1ZRMA 2VDOB 3GJ8A 3MCWA 4YP7A 4KRFA 1GP2A 3V6LA 3RIGA 1C1DA 1TUBB 2HAEA 3WY9A 4CTNA 1LZKA 3U5TA 1PFUA 3DEHA 2FN9A 4RDIA 4ZIRA 3H9EO 5LQJA 3J7TA 5CA1A 1G0NA 3FUVA 3FRHA 2UYGA 1MEEA 1H1DA 2A1TS 4BXOA 2QXTA 2Y0BA 4TT3A 1LXCA 4QBKA 2ORED 2A8YA 2WJZB 3L8DA 3HDHA 1E92A 2ZRJA 4UU8A 2XMCA 3COYA 3W5AA 2G77B 2XDWA 4DTIA 1U5BB 1OXUA 1YQEA 2C4KA 3AY3A 3H4MA 4Q4DA 3FKJA 1QZXA 4YRQA 1K7FB 5AM0A 3VKUA 1GA4A 1HLDA 4D3XA 2H8GA 3OQ6A 4WZ6A 3R23A 1DP4A 1GADO 2CDBA 3A32A 3Q9UA 1V8PA 4FI3C 4Q6WA 5TT0A 3RYHB 2HIHA 5JRZA 3FPEA 4YWJA 5DW0A 5E9QA 3LDUA 2QUHA 3GZJA 2NYAA 4LKRA 3MXOA 3W9SA 2MYPA 5E8RA 4HWPA 4TWAA 1G19A 5E95A 1C9JA 3ZGVA 5BSVA 1OAOA 2C9MA 5KOJB 4QXRA 1Y34E 3HB4X 2ODBA 1VPEA 5FBRB 1G5IA 3QBDA 4XIYA 4WVLA 3MG9A 4OHUA 3K05A 4UMEA 4HT3B 2JC3A 3MWDB 4R7ZA 2B4YA 5ESRA 2IYYA 4ILEA 4QHYA 1HDEA 1J70A 1TGVA 1WXFA 3Q0TA 1MVLA 2OHOA 3K0CA 4K9RA 4DIDA 3G7UA 4NAVA 4RK1A 1MV5A 4WJKB 3ICQB 4A15A 2QPOA 1KOFA 1Y3HA 3LBHA 4PY2A 5SY6A 4AMYA 2BPOA 3MBOA 5F98A 5CNIA 1BCSA 2QLJA 5SY4A 2NXWA 3G5TA 2Q41A 4JWTA 2QPAA 4O4IA 2WD7A 1V47A 4EKDA 5A9RA 4LE2A 5L6LB 3AVWA 1GITA 1O4VA 1J20A 2Q3MA 1P77A 1G6HA 4C4AA 2PT9A 3BRCA 3R6GA 1YVUA 2J9RA 2FG7C 3AL0C 1IY2A 3COWA 2PIAA 5DTMA 3VC1A 4AO6A 1I5EA 4MUHA 5U9CA 4OGLA 1C4XA 3FSGA 3RTDA 2GSDA 3VO1A 3VO9A 4UCXA 2QGZA 3PDWA 4QXOA 3JVDA 4RF2A 1BJTA 1XKQA 2XMQA 2D2IA 3PUYA 3RKSA 2I1WA 2WG1A 3FWNA 5KJCA 3WRWA 3SQMA 1FLVA 1LBSA 1SJ9A 4MOWA 5J4VA 5BOSB 4AZ0B 5KNCA 3TNJA 3I0NA 4PE5B 1NLYA 5DM1A 2Q5OA 2GM9A 5B6PA 1EFVA 4Z9BA 5D86A 2AJ8A 4DY4A 4ZCRA 4X9XA 2LW7A 3T54A 3R9WA 1WQ1R 1NSFA 2XUQA 3EAGA 3ZWAA 1JAZA 1KO8A 5GWXA 4L8FA 5GINE 1AUOA 1KOLA 2QTRA 3BBLA 4OG2A 1YMQA 3HXTA 2CB0A 1QMGA 5AW6A 5KX5B 1RHMA 3EMVA 1IY9A 2FV8A 4OJTA 3VH4A 4U2FA 3OESA 4BYMA 3RC9A 4ESHA 1LPSA 5LB4A 1U0BB 2X9QA 1X8JA 4R8MA 2NVUB 4EHIA 1EM8B 3DWEX 2PCLA 5TMDA 1K8XB 4QEZA 5EVJA 4A2QA 2XUDA 2PFKA 2ZBQA 2GYUA 2H92A 1VJ5A 2V8BA 3NATA 3QXCA 4Z9AA 3SNKA 4ZCTA 3OICA 4D56A 1IAVA 1DWQA 1BWRA 1QIDA 2EBHX 1JQ5A 4GWKA 5H68A 5JO0A 1XVUA 1Z75A 5AH0A 4CMGA 4EUKA 3BH0A 3OJFA 3AXSA 1UP6A 2I2FA 4LMRA 4AKGA 4ZANA 2IUFA 5KUTA 4LHZA 3U7FB 3IR5A 4TYQA 4DKXA 1SQSA 4QJ5A 4YT2A 3D5TA 2XYHA 1YZTA 2REQB 1SA0B 3NPAA 1ZSVA 1OXBB 5JC8A 1KHHA 2QTCA 2C4MA 2J67A 4NIMA 4RPCA 1JTEA 4UXIA 4HX9A 5FB3A 4RQUA 2J5XA 3UUGA 4CN8A 1UEJA 1DADA 7ABPA 1X1RA 3OQHA 5I8ZA 2DHRA 2E5FA 1ISMA 2NXEA 3E9YA 1HG0A 3A04A 1AKRA 5COBA 3AEQB 5D1HA 4CEJA 5L3SA 1Y3BE 3ZKWB 3ME5A 3VR1A 4EA8A 1YJ5A 4NJEB 2QQEA 4AZTA 4ZOLA 1C1HA 5B1HA 2ZBGA 1UMDA 1Y42X 821PA 2Y1EA 5FWXA 1W44A 3KQLA 3ZBTA 4RETA 1GQYA 2ZI4A 3CG0A 1U7XA 4M7WA 4HPXB 4PQEA 1ZWKA 4HGOA 4OHRA 2ZYAA 2Y27A 4PX9A 4G0OA 1R4NA 1SVUA 3NETA 1E1KA 1PUJA 3QFCA 3GPBA 2G1UA 2NIPA 3RW9A 3ZU2A 4BUZA 1JKXA 3I12A 4JASB 4AFNA 3NDRA 4ENVA 1HQDA 5H4HA 1ZA1A 2PV7A 1BN7A 1V5EA 4OI1A 4A8HA 5JS1A 1GUFA 4X64B 1Z74A 4L85A 4ECAA 1XCOA 1E0DA 5BQ5A 3E9CA 3FUCA 5BWOA 2PU5A 4CMKA 2Y9PB 2BRUA 1UBTS 3ON5A 4LY0A 4PYRA 2OQ2A 2OBXA 4RGBA 4N5MA 4X00A 3WI7A 3PUVA 2W0MA 1A76A 1NQVA 5C8DA 2M6KA 2Q3FA 4RLQA 1TQ4A 3LFUA 1RXIA 1G16A 1U80A 2I8LA 2RBEA 3WHPA 5EIFA 3FMFA 1OXSC 3AU8A 3EGIA 3EVZA 3FLEA 4L50A 4QTXA 3CVYA 1DUIA 1U0JA 2OV2A 2WM8A 3LM8A 4PAQA 1L3IA 1PFWA 3GL9A 3H5RA 5F3WB 3IR6A 3M6UA 3B13B 1DBQA 1CUEA 4CTJA 1FXWF 4ZZIA 1SCAA 2PZEA 1J90A 2VDQB 3TW4A 3ZTWA 3HVRA 3T35A 3VYRB 5ILOA 3RROA 4G5GA 2QSUA 3CUEF 4WECA 1XCLA 2AVNA 4OREX 5F33A 5A3SA 1L7AA 3UGTA 2Z30A 5DHTA 5GZ3A 4J4TA 4PYIA 4M1SA 3G85A 4L5BA 4CW7A 2A7XA 4CN9A 3EPKA 2GO1A 2Q4EA 2GLUA 4OV6B 3ZCRA 3DZJA 1Y9DA 5LC1A 8ADHA 2P62A 3OMLA 4RVSA 4RA9B 1FFAA 2JHPA 3Q6NA 4ZQGA 2BF4A 3V55A 4RH1A 4H7JA 4LWQA 5E3JA 2XGOA 4H2DA 5JD5A 5HA5A 3UATA 4X97A 1EVLA 2HPHA 4YRPA 4YV0A 5CA0B 2DX7A 3WLSA 1P2UA 3EISA 3EAQA 3OKAA 3VPXA 1QCDA 1R1DA 1OY1A 1VCIA 2VXOA 4JBWA 4N01A 3TTWA 3AU9A 2HO5A 3FLAA 4OHVA 3WO1A 3FTDA 4RPLA 4BNXA 2BEVA 1RE0A 2AR0A 2Y71A 1IPHA 2VP0A 3AJRA 3BOSA 3I2FA 1HDZA 4D8TA 5CB4F 1EZ4A 2P1DA 2PUEA 3N2GA 3T9FA 3WP1B 4MXDA 1JB9A 1R3DA 1KARA 3G9QA 4FD2A 1BO6A 2W90A 5KQLA 1RPNA 3ZQJA 4XVHA 4DCVA 3IPAA 1YJBA 3TLJA 3ZY3A 5K0ZA 1LSSA 3OTQA 4MEBA 4EFNA 1L4LA 3UCXA 2IVZA 4BJ3A 2QMEA 1BMFD 5CA1B 3NALA 1Q21A 1ZMRA 2QRPA 1GNLA 3RHTA 4AZVA 5JLJA 4JVSB 2G6BA 4UXJA 2A9PA 1W0JD 3P9SA 3ROGA 1WMBA 2A7QA 5AUQA 5LOVF 3ROFA 5EJ2A 3EPJA 1Z7GA 3AUAA 4OGWA 1QF9A 1CQIA 1TIPA 4KQ2A 3TIVA 1P74A 2VJNA 1QO9A 3NTOA 3GVCA 3PZRA 1LH0A 4PPYA 3IE2A 1SUWA 2PYIA 4HQ6A 4M1OA 1R64A 3N3AC 4LY3A 1GRRA 1U4NA 5BURA 2ODEA 1N2GA 4MQMA 3NXKA 5K03A 1CEYA 3Q0IA 4LV8B 3ICCA 4R84A 1IZZA 4QLOA 4BWGA 3ZHXA 2WUFA 1OV4A 1E1RA 4IDFA 1KQNA 1GEEA 3KVVA 4KXNA 1GTG1 3RK0A 1OLUA 1Q7TA 3U3OA 1RWQA 4FD3A 5A0VA 1LSJA 3MAJA 1FUYB 2A0YA 1PFQA 4L9SA 4B09A 2UYHA 1LZLA 4YAOA 4O4LF 1PYOA 1W5EA 3ESDA 2QX8A 3I37X 5FTWA 2O7VA 4X7RA 3ESRA 5IJ0A 2NTYC 4QFMA 3O38A 2R6CA 5CAEB 4EA9A 4A16A 2H0RA 4Y6RA 2ECQA 3RFFA 3RJZA 2OHJA 3PWKA 4ZYXA 4OI0A 3CX6A 3HCRA 4H7PA 2QQFA 3W1EA 1PQUA 2A5DA 4ENTA 5ALNA 2JLZA 4BPBA 3GRYA 2G1KA 3I04M 1RQXA 3KJEA 4Q7JB 3C3PA 2Z3WA 1BCSB 2QN2A 4N41A 2B98A 5DI3A 1KMQA 4G86A 2NV2B 2YJ3A 3DQZA 4O4IB 5BSWA 1YONA 2FRDA 2WD7B 2D62A 1FW6A 2F62A 1V3VA 3TE6A 3WK8A 4KX5A 2IWRA 2VPYA 2GHTA 3AY0A 1ZWLA 2A0UA 2QJFA 3E15A 3D6MA