3UANA

Crystal structure of 3-o-sulfotransferase (3-ost-1) with bound pap and heptasaccharide substrate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
256
Chain Sequence
STQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGLGWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQVLYNHLQKHKPYPPIEDLLMRRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQVDPKLLDKLHEYFHEPNKKFFKLVGRTFDWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 1
publication title Dissecting the substrate recognition of 3-O-sulfotransferase for the biosynthesis of anticoagulant heparin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 83
structure length 256
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uanA00
1TQ6A 4C7OB 2CK3A 1DG3A 1UKVY 2GXAA 4BFUA 4A0FA 1HV8A 1KHTA 1NBMA 5J40A 2FPLA 1M7GA 4G5SA 3ZD7A 2ZJAA 1OIXA 1L2TA 4NBSA 1ANKA 1D5CA 1GITA 3D3QA 3FPAA 4FMCF 1S4QA 4HLCA 4QGGA 3GLGA 4FW9A 4LJ9A 3VU9A 1T4GA 2CNWD 4ZCMA 5L3SA 4TSFD 4TYNA 3W6PA 2ZITA 1P2TA 3AQ4A 3OIWA 3SS8A 1NKTA 3BH7A 3QBVA 2JIZD 1COWA 2WWFA 1XB2A 2WKQA 3RAPR 3QVVA 2QMHA 4RD3A 4DKXA 2W2VA 5KYKA 2ZEJA 4Y0VA 4XVUA 4BFSA 1Z6YA 1YZGA 4M21A 1AIPA 2QI9C 2ZRJA 1SXJB 4NCHA 3N70A 4RSGA 4ZI2A 4A0GA 1TQ2A 4NL4H 1T6NA 1Z6AA 4FWIB 3TKLA 1I4LD 5C18A 4C0SA 1PLKA 4GL2A 3CPHA 4M9QA 4DCUA 1W2GA 4PQFA 2YWHA 3DEFA 1NNEA 3SR0A 3QG1A 1FX0A 3OE7A 4PC6A 1D9XA 2O8EB 4DSNA 2EFDB 3NHBA 5J4KA 1UJ2A 1UPTA 3ZGXA 1OT3A 3SFZA 2VSXA 4P4SB 1OB5A 1VECA 2MMGA 4A6XA 4OHWA 1KSHA 1E79D 4PQYA 1E3MA 3N2IA 1R10A 1PUIA 4JVMA 3RWOA 1C4OA 1NRJB 1S3SA 2AD5A 2A3RA 4Q9LA 2MSCB 3H0KA 3PUYA 4JYCA 1NVVQ 4URZR 3GLIA 5FTLA 2QP9X 1MV5A 2CL7X 3PUXA 2F3RA 5FPKA 3ICEA 3T5DA 3AGPA 3KJEA 1EFCA 3B85A 2RGBA 3UXMA 2VEDA 2N1BA 1QRAA 5DNYB 4HYYA 4DCSA 4MKFA 3LX8A 5CYPA 3BB4A 2PEZA 3QQ5A 4M8NE 2YOFA 1K5DA 3VHLB 4Q9IA 1HUQA 1DG1G 1YQTA 4IDNA 421PA 2GJSA 2NMVA 1YR8A 3A4LA 1G8HA 3CZPA 121PA 3DPUA 1ZMXA 4YLGA 4DBLC 1A7JA 1EFRA 2C9CA 2BJWA 4LI0A 3GP8A 1XTQA 3VR1A 1N0WA 1NVXQ 2DHRA 3ZQ6A 2TMKA 3WBJA 4I99A 4M4SA 1SVOA 4C7OA 1P7CA 4C0QC 1UBFA 3PCRB 5JJLA 4IVPA 3ZIAD 4HSEA 4ZDJA 2O52A 1OIWA 4ZDWA 2H92A 2GK7A 4D80A 3KUCA 1CR4A 1VG8A 2GZDA 3KQHA 5EZ5A 4BEBA 1D6JA 3CWZA 1GDDA 3T12A 1D2MA 1J7KA 3GFOA 3KKOA 3IKJA 1W0JD 1FW6A 3X1XA 2WAYA 3K1JA 3SEAA 2ZREA 4ZO4A 4AD8A 3TVDA 1HURA 2QE7A 1WQ1R 2H57A 3EPJA 1GNPA 1Q57A 1ZNXA 4QJ4A 4ARZB 1NBME 2OLJA 3KTAA 3NXSA 3NWJA 4GSYA 5DGXA 4BLOA 4GP6A 2B21A 1SKYE 2QMOA 4WZ6A 3LDAA 3GLGE 1VDZA 1TMKA 4Q19A 5JMTA 3PIRA 2RGDA 3K70D 1DAFA 3KZ1E 4WXPA 4URYR 2X1VA 1E0AA 3CKLA 2BCGY 3E5HA 4P33A 2PH1A 3TK1A 3IHLA 3HU1A 3THOA 5FPTA 2W0MA 2HEIA 2R8RA 2NG1A 2V55B 5KSYA 1E0SA 4Q7JB 4XVQA 4Z8YA 2HF9A 4HLDA 3QEOA 1P73A 4X8OA 5J4HA 1UAAA 1RJ9B 3PEVA 2A7QA 5KDLA 3JVVA 1OB2A 2ZR9A 4Y0AA 3CNLA 3TR0A 2MMCA 2C03A 4CEHB 3AVOA 3AVQA 1ZP6A 3MG9A 4GFDA 2XTZA 2J87A 4BLQA 2OCPA 1AA9A 3QF4B 3SN6A 3CRVA 3PXGA 3ZS8A 4II7A 2BEJA 1CXZA 4XD7A 1E99A 5HE9A 5L8VA 1JR3A 1QHYA 2WWIA 1Z29A 4MRSA 3I5XA 1XPRA 3C5HA 3MJHA 4B2IA 2QGNA 1CR2A 1E9AA 1N6NA 2BMFA 1FL9A 3QG5A 4BFTA 3CUEF 2D3WA 4F4CA 2ZE6A 1E2JA 3G82C 5EE5B 3W8NA 3IO3A 1Z2AA 2VP9A 4A8JB 5DN6D 2IS1A 2Q9CA 2CBZA 1A5TA 4M1SA 4FMDF 4WOPA 1GP2A 1R8QA 3NEJA 3QF7A 1R5NA 3GLIE 1W4RA 5HCIA 5B58C 4OQFA 2GJAA 2IXGA 2UZIR 3QKSB 2W6JA 4M1OA 5AUOB 2WWYA 4X8LA 4AC9A 2NZ8A 1YJ5A 2VPPA 3KKNA 3CRRA 1NLFA 5EP2A 2DFTA 1ETUA 1QZXA 2A9KA 3ECCA 2Z4RA 1IY2A 3EXAA 5H70A 2OXRA 2R9VA 5EXSA 2Q9BA 2QEQA 4F4IA 1G8PA 1HQCA 4QM7A 3N5CA 4RD6A 1OE0A 1ZJ6A 2VSFA 3PUZA 3SOPA 3WNDA 2WHXA 3BJIC 3THYB 1N2CE 1W4CA 2R6GA 1OXXK 4JZKA 1XCPA 3ND9A 2GVDC 3PFIA 3CX8A 4QOSA 4B2PA 1E2DA 1VHTA 1CJTC 1S9DA 2JDIA 4B6EA 1XPOA 3DOEA 5B57C 1CEEA 1H8ED 3ADBA 2V7QD 2ZJ5A 4DVGA 4LBVA 1UADA 4Q4LA 2ZI6A 4E5UA 1KDRA 5JEEA 5JHHB 5JJKA 1NLYA 3D8BA 5JI3E 2A5JA 3GJ0A 3PR1A 1N6HA 1DAIA 2HT6A 3VR4A 2ZJYA 2ZRFA 2JJ1A 1LS1A 3LVRE 1KDPA 3EIEA 1NJFA 4QBHA 2IWHA 1KI1A 1S8FA 3KJGA 4OK5A 5FBQB 2C98A 3K0AB 3IIKA 4HAYA 3SHFA 1CIPA 1N3BA 4R2IA 5E3HA 4HB2A 1TAGA 4DLXA 1CF4A 4CEJB 4NYIR 3OIYA 1LS6A 1HEIA 4F93B 4HB4A 4V02A 4QHSA 2GBLC 5KSOA 3X2SA 3TSWA 2C5LA 1FTNA 2YINC 3DMDA 3UMFA 1KI8A 2W0SA 2A5YB 5CLQA 3LO5A 1ZM7A 2ZJ8A 3DVLA 4KFTA 3QI2A 5UKDA 2WIBA 4G5GA 4PPNA 3QY0A 5TV2A 3FKQA 3K09C 4HZUB 1XJ0A 2C9YA 4TMXA 5DI3A 5CB8A 5A4JA 2WVJA 4IXMA 3KDSE 4MRRA 4D0LB 4LYFA 1SXJE 2IUTA 2ZE7A 2MSDB 2OBLA 2YVUA 5FBWB 2XX3A 1KMQA 1Q3TA 4BLTA 1KK2A 3WBKA 1JQJC 1KTVA 3GEIA 4BZXA 2BBTA 5DLQC 3AUYA 5FUXA 1R8SA 1OH5A 2RB4A 3BXZA 1P6XA 3FE2A 1OLOA 3KB2A 3I62A 4C4PA 2WZQA 4OQLA 4Z1MA 4DEXA 4TT3A 1BMFA 5F98A 2CK3D 4M1TA 1HTWA 3HYRA 1NBMD 4O25A 4WW0A 1WBDA 3U6BA 4OHZA 1N5LA 2ZSDA 3AVYA 4JLVA 4LCBA 1JAIA 5G41A 3SJAA 3RANA 2IYQA 1UBGA 2GCNA 4FCVA 1KI4A 4P32A 2YKGA 2H7VA 1QDEA 4W5WA 1JR3E 1FOEB 4GPTA 2O8CA 4DSOA 5E95A 2HT1A 2FE4A 2NO9A 4XSGA 4DJTA 2VP0A 1COWD 1R6BX 5CK4A 3C14C 5EQTA 1M7BA 3M4YA 4M0LA 2BIFA 1TQDA 2FSIA 1MT0A 3BRWD 3THYA 3RS4A 3L0OA 1QHSA 5EE0A 5FPHA 2XB2A 3BOSA 1GSIA 4C30A 3QNUA 4MKHA 4F7WA 3W3AA 3WYAA 3NHAA 1E0JA 4QHTA 4AY2A 3OE7D 4JSYA 4DHEA 4U7DA 1AS2A 4LJYA 2VP6A 1OHHA 4UQOA 4PO1A 3O47A 2QAGB 4M1MA 3O8BA 2CCJA 2F9LA 2VH5R 2NIPA 4EFNA 2J0SA 1NIPA 2B7BA 2ZU6A 2OG2A 1WA5A 221PA 2ZVPX 2ZXUA 5FTKA 3I1FA 1N6IA 1GNRA 1G5RA 1Q21A 1YR7A 4DIDA 2ZM5A 2JLXA 1P2VA 3SBDA 4DDVA 3KQUA 2UZ3A 2AWNA 3RABA 3AB3A 4RVCA 5FR2A 1XWIA 1T9HA 2EQBA 1ZW6A 1X3SA 3LH5A 2WJVA 3Q72A 1HQYE 1DOAA 1KKMA 1R5BA 4UNPA 4EPWA 3CH4B 2Q0HA 1U81A 1CR1A 2W2TA 3R7WA 3CF6R 4ERNA 4B73A 2AN9A 3QKRB 2XSZD 4PHHA 4HZUA 3SFVA 1GZSA 1TUEA 3B78A 5DI9A 5IK2D 4C0KA 2EWWA 2JLYA 1XD8A 3RRZA 1QHNA 2ZSEA 2KSQA 2FFBA 3QUSA 4DUGD 2L0XA 1R5OA 3LLMA 3BH6A 1U90A 1KJZA 2GKSA 4MDFA 4TZ6A 4CT4B 5H68A 1EFRD 2ZIAA 5KNBA 3SU8A 1NY5A 1S2MA 4NDZA 4G5OA 4Q4HB 1ZCBA 2Q3FA 3Q3JB 4TL6A 621PA 3K09A 2OCYC 3IEVA 2O8BB 1RVDA 5B2ZA 1E1RD 1Z2CA 2IYTA 1E94E 2QY9A 3Q5DA 3AP3A 1W36D 3RWMB 3U7GA 1G6HA 2V54A 3I8SA 3OEEA 3TUJC 5AR1A 5B64A 3PEWA 3FHCB 3I92A 1N6KA 4WZAE 3QOFA 3VR2A 4FWTA 1XEXA 2F1IA 1LTQA 1A4RA 3QPUA 1W44A 2Q3HA 2AD1A 2R6CA 2WWXA 1JPJA 1NI3A 2AWOA 2PZFA 4F91B 4EQ6A 3DL0A 2IHBA 2ZUDA 2CDNA 1E2KA 5FOTA 3NH6A 5JCZA 4KBFA 2D62A 1JBKA 3EPLA 1N5JA 1IJEA 2QE7D 3W6OA 3TVTA 1G21E 3L43A 3AVUA 1G16A 1NVVR 2OLKA 1SXJD 3A37A 2RAPA 3A58B 4PAOA 1P72A 3AP1A 2XB4A 5IHPA 2PJZA 4ZIRA 2P5TB 5AUPB 4UKDA 2QQ0A 3CLVA 4QHYA 1CS4C 2XTNA 4MYHA 2ZI5A 3B6EA 3BGWA 1KY2A 4JVLA 2CVFA 1LVGA 2GJKA 1JXOA 3FYHA 2OSBA 3RS5A 3SZRA 3BIFA 3B1XA 3U3JA 2C78A 3B1YA 1G9XA 4TLDA 3BORA 1U0LA 2RH5A 5AK0A 4WBSA 1AZTA 1KYIA 1J2JA 3CBQA 3GEHA 2JLZA 3KUDA 1OSNA 4IDQA 4KSCA 1E2LA 2FPMA 5CIQA 2GEUA 1ZBDA 2V9PA 3R8CA 4Q00A 3ASZA 1AS0A 1SKYB 1TQ4A 2QM8A 4AK9A 3U2QA 5DISB 2IHYA 1B0UA 1OXVA 4B71A 3K9GA 4CRWB 1JALA 4RFVA 4S35A 5L3SB 4BQSA 4XD7D 4U02A 5G3YA 1JR3D 2E87A 2D74A 3IPYA 2P67A 4JIMA 4LV8B 5CDFA 2ASEA 3MWKA 4E09A 4RJLA 1OYYA 3AM1A 2AKAB 3U44A 2DFLA 5CB6A 3EZ2A 5GADl 4B3FX 3TQCA 1WMSA 2VP2A 5EP4A 1E2FA 4I4LA 2LKCA 2RHMA 3EW9A 2FSGA 2IUUA 1PLJA 4JYBA 4FI3C 2YOHA 2J0QA 2OBNA 2QM7A 4PZLA 4F38A 3I32A 4MKGA 2GVZC 1VCNA 4C0HA 2WM9B 3AVXA 2W6JD 1QG4A 5LD2C 2Y8EA 2AK2A 2BM1A 3CM0A 3ZVNA 3TUIC 5AWFC 1Y3AA 1M8PA 4KXFB 3C7KA 3IUYA 2Z0MA 4URWR 3QVUA 1FX0B 2ZRLA 4DWJA 2OV2A 4BUJA 4JBWA 1CJKC 4CDGA 4GZMA 3U3RA 1XNJA 1Q44A 2ZYUX 2OESA 3CH5A 5GJCA 3T06B 2G1JA 2OUKA 1TTTA 4QBGB 1WCV1 2D2EA 2R6DA 3KXKA 2B7CA 1NMZA 3WNBA 4FN5A 4DEYA 3TJZA 4G5RA 2XXAA 3RYTC 2IWRA 1NVUQ 1U99A 1YZLA 4LZZA 1NLZA 2JDID 3X1YA 4BWYA 1Z22A 1Z0DA 2Z6VA 3H4MA 3LW7A 3THWA 2HF8A 4PZYA 3MGCA 1JEDA 4J0QA 5JZVA 2ZRIA 2J7PA 1JXMA 4E22A 1XMIA 2F9MA 4U00A 2JJ1D 3AGQA 3OESA 4B34A 2P6RA 1N0UA 1ZC4A 1DAHA 1OFUX 2ZANA 4B43A 3NTUA 1YZQA 2O8FA 1G18A 2H1LA 4B48A 1VIYA 3A6PC 3F8TA 4HB3A 5D3QA 1GL6A 3TH5A 2GHIA 4WA7A 2XJ4A 4K8OA 1K8RA 2DWOA 4OHYA 1X8JA 3VMFA 2P2LA 2QL6A 5G53C 3CF0A 4EAQA 3C15C 3P26A 1W4BA 3AKCA 1HE1C 1W2HA 3FMIA 3QIAA 5P21A 3JZMA 4MRVA 2ZROA 4MA4A 2HUPA 3KXIA 4TMZA 4NYJQ 3WHLA 2FFQA 4JLAA 4UXJA 3TW4A 4A36A 3FKSA 1PZNA 3SDZA 2HYIC 4M1YA 4LHWA 4M9XA 2B92A 3KKQA 4BRWA 2NTYC 5TDHA 1KI2A 1ZCAA 3IIJA 1KI6A 4IEEA 3ASYA 4IXNA 1W36B 3KXLA 2LCFA 2EYUA 2PBRA 4TQUS 1J70A 3UKDA 1RC8A 3T1OA 1II0A 1MH1A 4Q1EA 4YC7A 5LPNA 3CO5A 1HA3A 3E2IA 1MO5A 1Z8FA 2C04A 2YJTD 3L2OB 3EZ9A 3SHWA 5JECA 2OCAA 5DO9A 4Q66C 4GI7A 4NCJA 2FF7A 4PANA 3RLFA 1YZKA 4Q4JA 2GCOA 4JJKA 1BIFA 4AYTA 4NYMQ 1PJRA 1XMJA 4JS0A 1GKIA 1Q12A 2REBA 1DS6A 3NC0C 3C41J 4D2IA 4Z1MD 1E4VA 1BMFD 4BGDA 2VA8A 2BBOA 3UANA 1GNQA 4K46A 3KTAB 2ERXA 2P0EA 3CX7A 1AJEA 4XTRA 5FUYA 3HJNA 4TWZA 1FP7A 4H9GA 4MQBA 4DCTA 4FXPA 3RNLA 1UKEA 2GCPA 3SYKA 3U3OA 4RZ2A 1KIMA 4HLQB 5KSZA 4B76A 1N5IA 1ZNZA 3K9NA 2R6AA 2MSEB 2NGRA 3I3SR 4XSHA 4YMSA 4PR0A 5E7JA 4Q03A 5CDFE 3REFA 2RMKA 2OE2A 3MJRA 3EAQA 1R2QA 1W48A 1Q1EA 1GIAA 1IBRA 2B8WA 2Q3MA 4R71A 1N6OA 1UM8A 1KI3A 5TB5A 1FPMA 2PL3A 3CRMA 1KAOA 3HWSA 3MWYW 1E0KA 4PSKA 4EJSC 2QN6A 1FMJA 4NP6A 4OJKA 3DM5A 1U94A 1OXSC 2D06A 2ZRAA 2ODBA 1G20E 4IDHA 4MUAA 2OFOA 5EJEA 3K0EA 5TXGA 2FA9A 3SYNA 1DAEA 2EFHB 2R62A 4LC1A 2ZS9A 1LF0A 2FGKA 4B74A 3B9QA 5K8TA 1YZUA 2WICA 1XMVA 2Z5FA 3TAHA 1NSTA 2RKOA 2GRJA 1NG9A 2R65A 1OHHD 2GTPA 4UJ3A 4TTRA 4GT1A 3UG7A 4GDFA 1CRQA 2ZI3A 3GJ6A 1XCMA 1U8YA 2FZ4A 2R2AA 3PVSA 4TTQA 1R0YA 4WVFA 4US2R 5K8UA 3Q85A 2KI5A 2IYWA 4YONB 5FBLB 4KHZA 1MABA 3K9HA 1KSJA 4DCVA 2QTVB 3KKPA 4HI0E 4RCZA 3GPLA 1G8YA 1Z5ZA 1S0UA 1VYVA 3IBYA 2FEMA 4OQNA 5KNCA 4POAA 1GRQA 2FG5A 4KJZA 3ZLJA 1F3OA 1J8MF 4DB4A 1T5IA 4UXIA 4MUBA 2RCNA 4LBWA 1RPZA 4LWZA 5H1YA 4KODA 3VQTA 2FOLA 1RIFA 2CLSA 3A36A 2FSFA 2CEAA 2QP4A 4GBMA 2CL0X 1P2SA 2EFCB 4BPBA 2EFEB 1NMXA 1OXTA 4GMDA 3I61A 1S9HA 1D2NA 2IX3A 1X8LA 3U60B 4LOAA 3G5UA 3VNUA 2QRNA 4B3BA 3MMPA 3ADKA 5FOXA 2ODEA 3HPRA 2ONJA 3SJCA 4PZZA 3UATA 1MO3A 2EVWX 5C4MA 4N0DA 4QNMA 3V4FA 2IS2A 1MO4A 4P31A 4DLVA 1AK2A 3RRYA 1G8GA 1I4TD 3B7GA 3SBEA 4LJ7A 1I4DD 2OCBA 4LJAA 1N6RA 4TQ9A 1CR0A 1T3SA 4HDOB 5FPSA 4IHQA 3OEED 5DHAA 1D2EA 4BFVA 4C0AC 3BAFA 1F2UB 4R7ZA 3DO6A 3B60A 4AURA 2F1RA 1EK0A 4EPTA 4V0LA 3I4LA 1IN8A 2CE7A 2YV5A 4Q4AA 4RD0A 3ICQB 1QHHA 1Z28A 5CIWA 2G77B 2HDNB 1VCIA 3KFXA 3PUWA 1ESMA 5GJWC 1TU4A 2ZUCA 4TQAA 3QPVA 3UPUA 1U9IC 2BWJA 4KO8A 1EFUA 3GJ7A 3BFKA 3EA5A 5DI3B 2ONKA 1HYQA 1W0KA 4A2QA 1EFHA 1II9A 2BEKA 1IHUA 4OHXA 4LGMA 1R0ZA 2J0UB 4LBZA 2D2FA 3QE0A 4O2LA 3QJYA 1XEWX 2GWHA 5K8IA 3T1QA 3CIOA 1WDTA 4RY2A 2KE5A 1OXUA 1EX7A 1P9RA 3CNOA 1XTJA 1DAKA 1VG0B 2OXCA 4G5QA 1KI7A 2FSHA 2JAQA 4I81A 821PA 3WMFA 4O2RA 3MWJA 4URVR 3OAAA 3BFXA 3U7EB 2FNAA 3UIEA 1M74A 1HT1E 4KAXA 4L9SA 2D4HA 1U0JA 4BLRA 3ZDQA 1IN5A 1KO4A 3GLHA 1IQPA 4B75A 4JL6A 2AR7A 1XJCA 2DYKA 2WBLC 4DLWA 4TL8A 2IYUA 2RHDA 3LBHA 1E4YA 2Q6TA 1GILA 1DO2A 3OFNA 2WOOA 2O8CB 5G40A 2HXYA 1NN1A 2QZ4A 3DZDA 1SVWA 1OH8A 1UEIA 5LDDC 3U4QA 2J59A 3IO5A 4OI1A 4JT4A 1SVSA 3NC1C 4ITRC 4QGFA 4I1VA 3RRMA 3TSOA 5DIFA 4GZLA 2PX0A 1JNYA 3V4RA 2WJHA 1UFQA 2DFKB 2FEOA 3FMPB 1Z08A 3W90A 2A2ZA 3TR5A 2HCBA 2X77A 4PHFA 3CW2A 5D3MA 4DB2A 3DMNA 5SZIA 3ZZ0A 4M22A 2V4ZA 4QGAA 2GZAA 1HH4A 1TF5A 3TMKA 3DZ8A 5ELXA 1RFLA 1H8HA 1VCMA 3AV0B 4Z54A 3VFDA 4EPVA 2F1HA 3GJ8A 4W5HA 1OJLA 3IILA 4JLKA 2XAUA 6Q21A 1GAJA 1MOZA 1XXHA 3EASA 2ZJBA 2PCJA 3ZS9A 5CM9C 1KO8A 1XTRA 2ZE8A 3SI7A 1GRRA 4RZXA 1EWRA 2CCGA 3M6AA 1GM5A 3ZZTA 1P3JA 3OIUA 3BB3A 5JRZA 4RD4A 1G8FA 4DLZA 4W9MC 5L3VA 1F2UA 4JLBA 2ZRGA 4AWXA 1ZNYA 1EX6A 4PC3A 4Q9JA 1IY0A 1O87A 4A82A 2A5DA 1OFHA 1T8UA 2RGGA 2XOKA 3GFPA 3RC3A 2GETA 3EWAA 1MO6A 2J7PD 3P4XA 3TRFA 4EFLA 3SC3A 1YRBA 3W3ZB 1E2QA 3AKDA 3R7WB 1P9WA 1XEWY 4IOMA 4TMTA 1DAGA 4PXAA 2C96A 4C3ZA 3P27A 1UDWA 4JSTA 4F92B 1EXMA 1VYTA 2GNOA 5HCNA 2BMDA 2J0UA 2ZI7A 4P4UA 5EXXA 1XTIA 4H1UA 4LK2A 4KBGA 3B8HA 5F3WB 1AKYA 4JLJA 2QQEA 1LNZA 1XDBA 2UKDA 4R9UC 2CLCX 4GOXA 3FKSD 1AZSC 1TX4B 3EC2A 4JLDA 5KSPA 1WP9A 1OIVA 3VR3A 4QBFA 1U8ZA 4UXHA 2H18A 3ZJYA 4IDOA 1Q0UA 1ZD1A 4DCNA 1KK3A 1XD2A 2C2HA 4LSGA 1L4YA 1IN4A 2VYFA 1GL9B 1GFIA 3S1AA 4CIDA 4ABYA 1ZUHA 1AN0A 3THXA 5B30A 1WRBA 1SVIA 3SQWA 1XEXB 1NVWQ 1AKEA 1BKDR 3E1SA 3K70C 3A1TA 2EFGA 1SHKA 1T5LA 2ANCA 2XJ9A 2YOGA 3DDCA 3HR8A 4EQ6B 2OZEA 4KYUA 4BFZA 3IPXA 1GKUB 4R2HA 1NIJA 5EP1A 4ACBA 1XMSA 4B44A 4C0BA 3HU2A 3RS7A 1OH7A 3VNVA 4QJ3A 2YHSA 4HZIA 3WXMA 3SJBA 1FNNA 3W8RA 2IC5A 1FNMA 2AL7A 1ZM2A 1Q1BA 4MRPA 3PENA 4Q7LA 4ZPXA 3QENA 3BS4A 4DIEA 3H1TA 4C9BA 2QP3A 2BKEA 1DPFA 2Z4SA 4ZIRB 3O8DA 5JS7A 3EC1A 5CM8B 4HUTA 4V0MA 2PZGA 2JLVA 2RGCA 3MCAA 4Q9KA 4NMMA 3ADCA 4DLRA 1J8YF 4GNKA 2IT1A 2O0JA 1E2NA 2X19A 1G5TA 3NEYA 1XPUA 1Z0FA 4HAXA 4KITB 3SNHA 2J0VA 2QBYA 2QORA 1RKBA 1MRNA 2WWHA 5FH9A 3REGA 2DY1A 4L9WA 1E1QA 4PX9A 2PEYA 2HJGA 3MRSA 3BC1A 1NN5A 1WF3A 1T0JB 2QAJA 2QAGC 2BHRA 2F43A 3FVQA 2ZRKA 2VP4A 2ZJZA 1KGDA 3T5GA 1DBSA 2CHGA 3VTKA 1P4SA 4IEIA 3A1VA 1BOFA 2OBMA 3JZAA 3QKUA 4GOJA 1AGRA 4FMCB 4LV5B 4NYJR 5L3RA 5JWOA 1X1SA 3KQLA 3FDIA 3BERA 4HUQA 2J5XA 2W00A 2WMOB 3PITA 4PTLA 2YYZA 4IOKA 2BMJA 4NONA 4UJ5A 2ODNA 1G4AE 1XXHE 4BECA 2W6IA 3FFAA 3L0PA 4ACAA 3U44B 1P75A 3FHOA 1QVAA 2PZEA 3IQWA 4TLAA 3UWKA 3ZVRA 1C9KA 3FWYA 2H16A 2OEPA 1BS1A 1E2EA 4M2LA 3PG5A 2GBLA 1RE0A 4DSUA 2J3EA 4IVRA 2YWEA 3WP0A 4NYMR 4FD2A 4IKEA 1U8AA 1GKYA 1WE2A 1M34E 5J4LA 1ELOA 2QRZA 2WV9A 3AVPA 3BFVA 3RVBA 4B33A 4AKHA 1XZPA 1SGWA 3DKVA 3EA0A 1SQ5A 3D6TB 4LHYA 4HB0A 1F2TA 3PV0A 4XTCS 5J4YA 1TL7C 1XP8A 1QHGA 4L8GA 1Z0KA 4IDPA 3A4NA 1Z6GA 4NPHA 4JLNA 4FCWA 4MDEA 2BKUA 3LA6A 3I73A 5JWHA 3BB1A 5BW8A 5F9FA 2XXAB 4HAVA 1UBCA 2NO7A 2ZETA 1XD9A 3L0IB 4YXWA 3A8TA 2FU5C 5DHFA 5FBVB 3THWB 1W7AA 3T61A 2N46A 4A2PA 3H84A 2XZLA 2VBCA 1KDOA 4BE7B 1KK1A 2O0KA 2PCLA 3CZQA 4TYQA 4AG6A 4YQFA 4X8MA 3A1UA 3NH9A 2I3BA 2ZU0C 1Q1ZA 1G7SA 2X2EA 5TARA 4A4DA 3WNCA 2HYDA 4EFMA 3KQKA 4BZQA 4KFSA 2O8FB 1G17A 2REXB 3UWOA 3Q7QA 4Q1CA 4C0LA 3GLFB 4IFEA 4CEIA 1N0VC 1A82A 3H2YA 5EXPA 2ZI4A 4ZKEA 1G4UR 4B35A 2GDJA 2P6UA 4HLUC 3OEHA 4TMKA 4PPFA 5KTYA 1FMLA 4RZUA 4LC0A 2GK6A 4OI0A 3THXB 4WZBE 2GXSA 3LX5A 1DELA 2FX3A 3RS2A 5JRJA 3BBPA 4P4TA 1RYFA 1LB1B 3CPJB 3FB4A 1Z6TA 2VHUA 3F0TA 3TQFA 5L3QA 4KU4A 1W0KD 4L15A 1KI6B 1G7TA 1PUJA 1Z0AA 2JCSA 5A5GA 1CLUA 1L8QA 4UNSA 1BYUA 1QF9A 3TUZC 4DLTA 4JLOA 1R0XA 4US0R 1IY1A 1KSFX 2QSYA 5FTNA 4V0ME 1TADA 2C77A 1ZRHA 1ZM9A 2GF9A 1G1MA 4YMTA 3GJ5A 2Q21A 3K0FA 4A6PA 2QT0A 2B6HA 4IVQA 2DPXA 4Q4JB 1MR3F 2DWQA 1TEVA 2EU8A 2GCOB 4RD2A 5TVKA 3TBKA 5EXTA 2BVNA 3OIVA 5FOWA 5J47A 3VX3A 3FHTA 3OAAD 1B23P 4D25A 2BBWA 3NIBA 3U7HB 4LHXA 4D4MA 3B5JA 1R7RA 4V0OA 4QRHA 5BYJA 3UMSA 4TLEA 5KUTA 2XEXA 3I72A 4RKEA 1Z3IX 3TAUA 1VTKA 1ZUNB 4AKGA 4I1OA 3OFND 1E2GA 1QHIA 4N0EA 1E6CA 2VO1A 2F55A 4KYIB 5JFGA 2B8TA 2XZPA 4NE2A 4P0TA 3NBZC 1KJWA 1ZUIA 4RD1A 2ZYVX 4HATA 1EFTA 2PLFA 4B3DA 1KK0A 3IEUA 4L4UA 3ZZUA 2PX3A 4D4LA 1X1RA 5LD2B 4LPSA 4JBXA 4ZDIA 1ZC3A 2DWPA 3L8YA 1SZPA 2RGXA 4YMUA 2V7QA 4IOLA 4KV9A 1E9EA 4FMBB 1KKLA 2FN4A 5AJVB 1KMHA 3EPHA 1VCOA 4PFSA 4UNQA 2VHTA 1YR9A 1E9BA 3LVQE 4MRNA 3R9XA 3RS0A 1S96A 2ZRDA 4QFMA 1PV4A 4Q18A 2JLRA 1CJVC 5C2JB 3ETLA 3GD7A 1G6OA 1QHXA 4I1UA 1YZNA 2KBFA 4KFRA 2NPFA 4MGKR 3O8CA 1UEJA 1OKKA 1L4UA 1SVMA 2EW1A 3GLFA 2OILA 4WXRA 5HE8A 4FMDB 2SHKA 2FFAA 2QMUA 3OZXA 8OHMA 2ZVQX 1F5NA 4DDWA 2JLWA 2XITA 3TW8B 3BE4A 5EP3A 4JBYA 4JMPA 1MABB 2Z83A 5EUMA 3KQNA 4BFXA 1II8A 3D31A 3U7FB 5F2EA 3AEZA 3X1ZA 2GJ8A 1ZAKA 2XOKD 5AUQA 1Q22A 4BEJA 3P20A 2WJYA 1KOFA 1R0WA 4WAUA 4CVNA 4XIGS 2ZRPA 2O5VA 1XBTA 4AKIA 5GJBA 3EARA 4PPGA 4OBEA 3U3MA 4D82A 2YWGA 1CRPA 3T34A 1S3GA 1DEKA 2G9NA 1W36C 2VQSA 2J41A 2G0TA 4LV6A 4RFSA 1LF5A 2WWGA 1OPXA 3TGPA 2XZOA 1ONBA 1FP6A 1KZGB 4I1SA 3CF2A 2ECKA 4LPKA 4DT1B 1QBKC 3A1WA 2BMEA 2VF7A 1PVOA 2H17A 1CULC 4A92A 1N6PA 2J1LA 1VMAA 3LD9A 3EZ6A 5FI1B 3U3KA 5EE9A 5J4VA 3K0SA 2WKRA 3KKMA 4OQXA 1XJQA 1YRAA 1X6VA 1ZD8A 2DBYA 2HLDA 2A5GA 4TT3D 5GVSA 1JPNA 2ZS7A 4Q02A 1E9CA 2WKPA 5FOUA 4E03A 1ZYUA 4NCKA 1US8A 3W9YA 2VTKA 1YKSA 4EIWA 2IS6A 4PAQA 1MRSA 1OH6A 1NJGA 1SXJC 4OHVA 4LRWA 2E1RA 3ADDA 2Z43A 3QEJA 1S1MA 2IYVA 3C5CA 3LV8A 1P61B 1PLLA 2GA8A 1E2MA 5CLLA 1K5GA 3WRYC 3AP2A 4Q4AB 2AFIE 1QHHB 1P60A 2NO0A 3A4MA 1E2HA 3Q5EA 3AF3A 4XWKA 2J7KA 2VP5A 2EYQA 1F48A 3AF4A 2C9OA 1T3LA 3P1JA 1F6BA 4D4JA 3PJRA 4TMWA 2CJWA 4R98A 2REOA 4YDSA 1VG1A 3KFVA 2WJJA 2NQ2C 5GVRA 1VIAA 1G64A 2JLUA 1AQYA 4JT2A 4TN1A 2ZI9A 5HZHA 4LY6A 4DZZA 1NMYA 4TL7A 4XWAA 1G291 2Q9AA 3LXRA 3HPQA 4OI4A 1BO6A 1E1QD 3T1VA 4EJSB 5E7MA 2G3YA 2JJ8A 1P62B 3RSOA 4HDQB 4LDJA 3JVUA 4OYHA 3K0CC 4NCNA 4LHZA 3RHFA 5FTMA 3VR5A 3IBGA 2JASA 1W46A 5LB4A 3GLHB 2CCKA 4BRUA 5FL7A 4ON9A 2V1XA 4F4JA 5JLJA 3B1ZA 2ATVA 2VHQA 4RZ3A 3NVAA 5JSZA 2OHFA 2RGEA 2VHJA 4PHTA 1NN0A 3I8XA 1ZM4A 4M1KA 3TNFA 4K81B 2JLSA 3WRXC 3MAAC 4TZ0A 1G7CA 1C1YA 3U4QB 3PEYA 2N42A 2F6RA 3UMRA 4PSAA 4TYYA 3IDQA 2XSZA 5AJYA 4V03A 2FV8A 5FTJA 2KBEA 5IK2A 4JL8A 2W6ID 3WP1B 4ZV4A 1YZTA 1KAGA 2BOVA 2V6JA 3GFTA 5HZKA 4DUGA 4S2EA 3M1IA 5SZKB 3GLFE 3GJ4A 4US1R 2V3CC 4PQRA 1P5ZB 4Q9HA 1DE0A 5D3MB 1FQKA 1M1YE 3L0SA 4OL0A 3LW8A 5IT5A 4GMXA 1G3MA 1DAMA 3U61B 2WSSA 3C16C 3U6KA 3U5ZB 3LNCA 4PSVA 4DT1A 4P3YA 2ZS8A 3HR7A 1T8TA 1SVLA 2PLRA 4QJ5A 3H86A 2P5SA 2QMEA 1E1RA 4PO9A 2WMNB 1JJVA 4NKRA 4DXAA 4HAUA 3RSLA 2F3TA 3V9PA 2JJ2A 1W4AA 2XGJA 1XXHB 1YU9A 4ESHA 1YE8A 4CYMA 3SQXA 2PT5A 1A2BA 5HKKA 1NSFA 4JLMA 4ASUA 4M9SA 1CP2A 1Z6XA 2FZLA 4Q47A 2GXUA 1SHZA 3GJXC 4MGZR 4QXAA 3GJ3A 3R9WA 4GP7A 4LX0A 3EPKA 2IYLD 2BBSA 721PA 4YXWD 1ZIOA 2RGAA 3VKWA 1XFAA 4ZDKA 5C46F 2QTHA 1IAQA 1NL3A 1Y63A 1TPZA 4PC2A 2LKDA 4JJZA 3IIMA 3SYLA 5IDVA 3QXJA 1FUUA 5BXQC 2QUZA 2H5EA 2ORVA 4G01B 3AVTA 2WIAA 3DOFA 3AUXA 3FMFA 3ND8A 3VX4A 4ESVA 3LFUA 1SXJA 3EZ7A 2CLDX 4Q7KA 4KVAA 4CF7A 1T3HA 2J45A 4LBYA 2JATA 3HYTA 1NF3A 2KB0A 1M2OB 1SVKA 4IJMA 2FDCA 4BFYA 4DLYA 3OEHD 3GCGA 2WWWA 4MITA 5ANRB 4OJQA 3WMEA 1SKQA 3QXCA 4D0NA 1A1VA 2VHCA 4EKDA 5JJIA 5LBIA 3LWNA 1DO0A 1NN3A 1W47A 4Q01A 1Z06A 4C2TA 2I4IA 2HV8A 2IA5A 5M04A 2O8EA 5FI0B 3J81k 1E9DA 2FPKA 2PJRA 5GJVC 1RW4A 5J5CA 3IHWA 2OM2A 5AJXA 4EJSA 4P4SA 2IUSA 3LY5A 3K9LA 5E7IA 2QPOA 2ODWA 5JCPA 2G83A 4HAWA 1GWNA 4EUNA 1E69A 4A8JC 1XD2B 4BLPA 3D7MA 3MSXA 3S1AB 4N3NA 1DVRA 2G1KA 4AG5A 1FZQA 4TYWA 1P9NA 3M0EA 2OAP1 5EZ6B 1J99A 4ILEA 4DDUA 1IONA 3P4YA 2YZ2A 4Q48A 3F3YA 3B9PA 2ZRNA 4W7SA 4D26A 1UF9A 2DCUA 1JB1A 3ZVLA 2C8VA 4JL5A 2WPDA 3K0CA 4IRUB 5HPYB 3MWLA 1TEXA 1JI0A 1GL7A 2BV3A 2P65A 4EPXA 2ZPTX 2X2FA 5TY0A 1DADA 1UDXA 3Q9LA 2CHVA 3EX7C 1ZU5A 5AJZA 5CJ2A 1YHNA 4B3CA 2ZAOA 1S1CA 1AM4D 2D7CA 3K8YA 1Z47A 5CJPA 1XF9A 4Q1FA 4XH9B 1UKYA 2IEZA 3QXXA 1A2KC 2A30A 4RKFA 1K6MA 4KLZA 1KZ7B 3T15A 4UNRA 4QGHA 4NU0A 1KNXA 3FTQA 3B2EA 2QBYB 1E2IA 2AHOA 2VF8A 521PA 2ZRCA 2IYXA 3L82B 3RC8A 5DE3A 1W1WA 2ZRHA 1OYWA 1AQUA 3NDBB 2F43B 3C8UA 4FIDA 5FPYA 2LWIA 1ODFA 4B2LA 3FFBA 5KOYA 1QG2A 4A2WA 3LLUA 4YMVA 1X8KA 1N5KA 2W58A 4QG7A 3KL4A 2QSZA 1N25A 4KCGA 4AIIA 4XOIA 2XNDA 2FMXA 3MFYA 3CR8A 3B82A 3QPWA 5F9HA 2GILA 1E32A 1W49A 4IFBA 2BDTA 1J90A 1EG7A 1RRPA 4HUQB 2ZYWX 2R6FA 4BASA 1P2UA 4TYPA 4U5XA 2ZTSA 2JEOA 2G88A 4QC2A 1IN7A 5AUNB 3ZD6A 4UNNA 2D7DA 4XJXA 4ARZA 1G41A 2GEVA 3CWQA 2QU8A 1M6NA 2JGNA 1TF2A 1OKKD 2VIIA 1XTSA 2PT7A 1YR6A 5FOSA 2IYSA 1IJFA 3TE6A 3B1WA 3TLXA 1Z0JA 2C99A 2VLIA 4V0NA 3DHWC 4LYAA 2CE2X 2IYZA 4E07A 2IK8A 5AJWA 4OKSA 2E9SA 4WIAA 1HE8B 2QA5A 3EIQA 3UK6A 5BYKA 3AF2A 2AK3A 1XZQA 3GEEA 1U9IA 3B1VA 4N1AA 4YMWA 1NKSA 2ERYA 4AYWA 2ATXA 4PAMA 1CJMA 1RJ9A 1F2TB 3BH0A 4QKQA 3WHKA 1V5WA 4CEHA 4B32A 3ONWA 5IRCD 3Q8XB 1G3IA 1D8TA 1E98A 3ZQJA 5CK5A 5BN5A 2CVHA 4JLPA 2QT1A 1IM2A 3QF4A 5EE3A 1IXZA 1RRCA 1G3QA 4LYHA 1IN6A 2CNWA 4DC9A 4A15A 4TSFA 2IEYA 1E9SA 2BCJQ 2CL6X 4JKIA 5JI2E 1T0HB 2IXFA 1G5PA 2JIZA 3TIFA 5H8WA 1I2MA 4QBIA 2ZRMA 5CYOA 3HP1A 3QSYA 4G3XA 4A8JA 2GF0A 3QKTA 2VSOA 2HLDD 4NCIA 3LRPA 2V1UA 3LAWA 3AVVA 1JR6A 4QM6A 3MUFA 4QNRA 1ESNA 3EWSA 3CPEA 5DSZA 4FCTA 2G6BA 4CEIB 3GLHE 2FGJA 3K70B 1XU4A 3QXSA 2HXSA 3QKSA 2QNRA 2FH5B 1EESA 1HT2E 1KNQA 2W2XA 2AXPA 4A0HA 2FFHA 3T35A 3PUVA 3HDTA 4NZYA 4L16A 2H8KA 1JAHA 2JLQA 4LYJA 2IS4A 3T1TA 2G0NA 1ZINA 4PC7A 2CMKA 1WXQA 1G7RA 1LV7A 2QG6A 4MYTA 4Q5IA 2ZE5A 4JVNA 5KHOC 1AS3A 1CJUC 3FGNA 2W83A 1E79A 2V6IA 5L3QB 1OW3B 5JBQA 2OT3B 3UG6A 4L5BA 4LJ6A 5LB2A 2WAXA 4G0NA 4XVRA 2BJVA 2IF2A 4LJ8A 5C4GB 4DLSA 5HR5A 1VYUA 4D6PA 1TF7A 3KX2A 4LHVA 5A0FA 5C1BA 1O3YA 1KO7A 3K0FB 1F60A 1E2PA 2NO6A 1KO1A 1OFTA 4IW3B 2GESA 3BK7A 5TMPA 1D9ZA 2IL1A 4Z8XA 1YVDA 1TUIA 2QROA 4HDCA 1E9FA 1NY6A 2ANBA 1U0HC 3IGFA 5CITA 1EGAA 2ZJ2A 5FFMA 5K8LA 2UVQA 1W5TA 2DR3A 3K0AA 1Q3HA 3MD0A 5FOVA 2GAOA 5BQ5A 2VRWA 4BFWA 4CEJA 3B13B 1N6LA 4LJ4A 4M9ZA 1KSGA 3VKGA 1T91A 5FL7D 5KU1A 2IXEA 4V0KA 2QPAA 4MKIA 3CRW1 1Z0IA 3LXXA 3WYGA 2F1JA 3MLEA 3PEUA 4TLCA 2GJ9A 3AKYA 1OFIA 3FMOB 3TSZA 4D0GA 5IF9A 4A1FA 3G0HA 3AF1A 2GAAA 3CONA 2NOAA 2ZR0A 3CRQA 2WSMA 3NDPA 1RZ3A 1XEFA 1ZVQA 1G19A 3ZIAA 4B47A 2RGNC 2GEDA 3V00A 3WYFA 3P32A 3LBNA 3K53A 4EPRA 1ZU4A 4Q21A 2HJVA 2A5FA 3C4JA 1Q1QA 3RS3A 5BN4A 4NH0A 1FQJA 3N2EA 5EE1A 2WSSD 2O8DB 2OAQ1 4HAZA 1W0JA 5DH9A 2YNMA 1U98A 4TL9A 5EUQB 1HY3A 1KMHB 2ZR7A 3F5FA 5DYGA 5BN3A 3OHMA 4ZKDA 4W5JA 4ZI3A 1AGPA 2J9RA 2VL7A 4A0RA 2ZAMA 1UBEA 2BM0A 1XTKA 4JKYA 1E96A 2JJ2D 2ZYTX 1KO5A 5JWRA 4MGIR 1GUAA 2NO1A 1RRFA 4Q7MB 2GXQA 1FUKA 5HKKD 1KI9A 2ZRBA 2A78A 4PC1A 4ASUD 3W6NA 2XNSA 4EPYA 1SULA 5SZJA 3KJIA 4M1WA 4MGYR 1M7HA 1XCGB 4C2UA 1I2DA 4OQMA 1OV4A 5FUWA 4KSBA 3LQQA 3VR6A 4B6FA 2PMKA 4EDHA 2ZSAA 4URXR 1DTSA 1KDTA 4TMVA 1II8B 1VPLA 3AF0A 5FL3A 1LFDB 5KPJA 1V43A 4O0MA 4Q1AA 1IOZA 3EG5A 2DB3A 3A1SA 3DKPA 3RRNA 4Z51A 1LY1A 5KDOA 3R20A 2FJUA 4DRZA 1TNDA 1IXSB 2WOJA 4TTPA 3W34A 3R8FA 1CTQA 1IXRC 1X86B 2EWVA 2JA1A 4H1VA 1VG9B 4KLNA 1OF1A 3BWDD 4RFSB 2X8AA 4PHGA 5FR1A 1UKZA 5G3ZA 2DFNA 4B3GA 1Z83A 2R44A 2FWRA 4PPQA 4NYIQ 1TU3A 2XTMA 1QVRA 3Q7PA 1BH2A 3EZFA 2YC2C 3I5YA 3VKHA 2P6NA 5E4FA 1W5SA 3LBIA 2AKYA 1WB9A 2HCJB 2F7SA 3NG1A 4X8HA 3NBXX 3AVWA 2QTFA 4OK3A 2QAGA 2AX4A 2ORIA 5DN6A 1Z63A 2OFXA 4MH0R 3CX6A 4ZCLA 2WTUA 1JQLB 4FINA 1VHLA 4LJ5A 3CR7A 4CGZA 3KJHA 3QBTA 3O8RA 1JJ7A 3GLGB 1US8B 4AYXA 4AI6A 1FFHA 1Z07A 4OI2A 4OK6A 1G3UA 3VU9B 1L7VC 5KNDA 4MYCA 4AKEA 2AXNA 2OO7A 1NG1A 3NBYC 1U2RA 4D4KA 4ZCIA 2V8OA 2IYYA 1ZNWA 2YWFA 2IYRA 4IOJA 1GOTA 4PO8A 4QL3A 5SZHB 4DDTA 2ZQ5A 4Q1DA 4YDHB 2WPDD 2IBMA 3PQCA 4HEJA 3CB4A 3BD9A 2NPIA 3QKRA 3GQBA 5KPDA 2GZHA 2I1QA 1FTSA 4LUCA 4NTZA 1NP6A 2BC9A 1RRGA 3OF5A 3LQRA 3X1DA 2CJWB 2O0HA 3SE0A 1BYIA 2IW3A 2P3SA 2YC4C 3DM9B 3E70C 4CW7A 3ZVMA 2KWIA 2WJGA 3W5IA 1H8EA 2PMDA 3IQXA 4C0JA 1EWQA 2AFHE 2O8DA 1RYHA 2CXXA 4Q4HA 4KI0A 2O8BA 4URUR 1H8HD 1VKJA 3HU3A 1XRJA 1R4AA 2RGNA 2J46A 4D81A 1G3RA 2ZJOA 2WJIA 3FOZA 2K5UA 2OFWA 4A9AA 4JVSB 2QENA 3QXHA 2C95A 4Q1BA 1JEEA 3ZH9B 5KO2A 5FBRB 1DARA 3WMGA 4M53A 1GRNA 2KJQA 3AKEA 3KB1A 4RCYA 3ZYCA 5JHGB 1Q20A 5BWMA 3GLIB 1ZM3A 2ORWA 2IF0A 4CZ2A 1H65A 3NBFA 4MYUA 4XWOA 2XNDD 4DSTA 3NKVA 2ZUBA 4GOKA 2CHQA 3L8ZA 5JSZB 4G1UC 1CU1A 3WY9A 5FUVA 4BLSA 4CT5A 4DLUA 3EIHA 1MKYA 3CNNA 1JECA 5JEDA 1KJYA 4KVGA 3AH8A 3GMTA 4BZPA 1WBBA 4GRAA 3SJZA 4KFUA 3VHXA 5KDDA 2QPTA 4HLUA 1ZIPA 3VAAA 4O3MA 5JS8A 1GG2A 2I1VB 1GVNB 1ZD9A 4B3XA 3RDPA 1GTVA 1E9RA 5DYIA 3X1WA 2ZSBA 3R9IA 1LW7A 5HTKA 4TLBA 2ZSFA 1CBUA 3W5JA 1XX6A 2QGZA 1KY3A 1CKEA 2NZJA 4NHOA
chains in the Genus database with same CATH superfamily
4H18A 2IE0A 4C7OB 1H23A 2CK3A 3AONB 4LOJA 2H4YA 5GPBA 3CZRA 1J39A 2YN2A 4I7EA 5ALTA 4A0FA 1KHTA 1B15A 5J40A 1M7GA 4G5SA 3CX4A 4UC0A 2ZJAA 1C7JA 3PSHA 3RSCA 1MOPA 4ZJYA 1D5CA 3D3QA 3IP1A 3PGMA 3OPYA 1S4QA 4QGGA 4XB2A 1JLSA 3GGDA 2XQJA 1Y7TA 3FI0A 1ODKA 1ZZGA 4JZYA 2UYOA 5A4MS 3GP5A 2CNWD 2C97A 3GGCA 3P8ZA 3UICA 4TYNA 4AN4A 3MOSA 2IYFA 5CXUA 4MZDA 2ZITA 5KVQA 1Z5OA 2OV1A 2QTRA 3ZDCA 1KFCB 1RR6A 3GBSA 1DCTA 1COWA 2WWFA 3P9PA 1K0UA 1F3LA 1V11B 1VXRA 4RD3A 2W2VA 3W6UA 3EEIA 3EGWA 4MR7A 5AM5A 3VZQA 2R8XA 4UDYX 1E1CA 2QM0A 1XK6A 3BA6A 4A1OA 1FW8A 1SXJB 4NCHA 4RPHA 5CXSA 1H2RS 3SX2A 3L6EA 4WKOA 1WZIA 1TQ2A 1ZSYA 1QG0A 1SZJG 2QTNA 1A9QA 3CVXA 3EIFA 4M9QA 2FDXA 3EFBA 4DCUA 3N3AC 3HWWA 3GLTA 3P9SA 1F8XA 2FLKA 3DEFA 2PU5A 4LVOA 2HIMA 4M0PA 2AYXA 1NNEA 1Q1AA 4NOJA 4PC6A 2Q5IA 1I5EA 2EFDB 5KJ1A 1OAAA 3WFJA 4U7HA 3K0BA 2PKWA 1OT3A 3FDFA 4MKZA 4PYOA 3PUKA 1VECA 3K71B 1OB5A 3TN7A 3LWZA 4A6XA 5THKA 2PS9A 5CA0B 4PIMA 3NHSA 1U8FO 4M1QA 2NU9A 4FSXA 3RYIB 3RWOA 2J3QA 1SU8A 4K6OA 4YRDA 2Q3DA 5K3FB 4AO7A 5AVZA 3TKAA 4JYCA 4URZR 1ZHOA 1C9MA 4MA0A 2NM0A 3NGLA 4WLOA 3PNQA 2VDPB 3RSFA 2CL7X 2I6UA 4YIKA 1A77A 1ZH4A 1Y1RA 1RHQA 2AYZA 3H5TA 1L5ZA 3UXMA 2VEDA 5DNYB 3DFZA 4DCSA 4KMMA 4CTJA 2N1MA 4AXBA 1KXZA 4L8YA 3RC1A 2G17A 5FWXA 3MW8A 3QX3A 1B8UA 3BB4A 1NXWA 2QRLA 3RCBA 4BZZA 1I7QB 2WABA 1HUQA 4HNQA 2UXDB 1UZUA 2JGEA 2GJSA 1E5LA 3CKMA 3H5NA 4ZVUA 2BMAA 4MQ5A 3TCKA 3AERA 4Y2VA 3DPUA 1ZMXA 4YLGA 5DZSA 3V46A 4DBLC 4JYPA 3FAKA 3DONA 1C7ZA 4IF4A 4LI0A 3EGDB 4B7ZA 3GP8A 1XTQA 2QTMA 1N0WA 3RK0A 4YNBA 1J2YA 2DHRA 3H11B 2PUWA 2FX2A 4MV5A 2G72A 3JYLA 4LTDA 3ZC3A 4DRXB 4PAWA 2RCYA 1M33A 1SVOA 1ZL0A 4WBNA 4C7OA 2ATCA 1ZSNA 1UINA 4C0QC 4TWAA 5CFLA 4BAGA 5TE9A 1WBJB 4K9MA 2C57A 2LBPA 2Q7OE 3NFRA 4HSEA 2XUKA 4IS3A 4RDHA 2EKBA 1OIWA 2O52A 3E7FA 2H92A 4JJ7A 4ZAWA 1X7DA 1I7SB 4D80A 1ZQ9A 5ARDA 3VBCA 1S7CA 1P7YA 3SFTA 4OX9B 2XRMA 2ZUVA 4RANA 1TM5E 2QY6A 5EZ5A 4AX4A 1D2MA 4GYKA 2AR0A 4X6YA 3K1ZA 4FXOA 4HWGA 1DBWA 4NZZA 3IKJA 1W0JD 2JFOA 3PPWA 1SIWA 3CZCA 4MPTA 1FW6A 3X1XA 1VL0A 5T67A 4GH5A 3A9TA 4EGAA 4AD8A 4ZO4A 1UK7A 1V11A 2VYQA 1ICIA 2D0PB 2O48X 1QFSA 5JTTA 2H57A 3TJMA 1XCBA 2IOHA 4JB0A 4K6KA 4QJ4A 1K1EA 1ZNXA 3OECA 2OO5C 2P9JA 3ET5A 2GYUA 1D1TA 3NXSA 5LZ4A 4GP6A 1E3IA 4O4JB 3LHFA 1V6SA 2O2CA 2QMOA 1FLVA 2X23A 4NH4A 4RH0A 3ZZ1A 2QYTA 1RXYA 2OCXA 3H5IA 1FU7A 1YA4A 3PIRA 4MQLA 3U62A 5JMTA 3H0CA 3PEEA 4UAJA 1DIOB 2SNIE 4K40A 4KXLA 4URYR 1PJ2A 2X1VA 3WRYA 1PFQA 2CN1A 1INLA 1WXHA 1FMFA 3E3NA 2Y9PB 4MEBA 4P33A 1NGSA 2RFLA 5K3AA 3P9IA 3MJ4A 2QLJA 3IHLA 4YMIA 3ZI4A 3N07A 3Q3VA 4N01A 2KM1A 3HXQA 2Q5LA 1V1JA 3W5CA 2R7MA 2V55B 1M54A 1E0SA 4XVQA 4CLDA 1P3Y1 2YX1A 3KCQA 4X8OA 1UAAA 2IDJA 5ER9A 5KDLA 4E5MA 1SB9A 1TIKA 1WD5A 4GICA 4OIMA 1OX6A 2C84A 4Y0AA 1SXIA 3W1WA 1JE1A 3T4EA 2MMCA 1KR2A 3LLVA 4CEHB 4UEQA 2QD4A 3AVQA 5LQDA 4OM8A 4WADA 5JSFA 5LZ9A 5BN5B 2OCPA 3A4YA 3BDIA 3HYCA 1OZ0A 1ZVJA 3ED5A 3LIIA 5ECDA 2HJHA 3LPLA 1QJCA 1TFUA 3P0HA 4HTFB 3PXGA 2PUFA 3USZA 1KXJA 1RKQA 3K1YA 4EI7A 5KX5F 3FYTA 1SPXA 3SX0A 4PGFA 1A69A 2JS7A 1LRJA 4L4XA 5ULLA 4LJKA 4UMVA 5JWRA 1N6NA 2MINB 3REQB 1KJ9A 4AJHA 4C6RA 4CKCB 3E8XA 1GT6A 3CLSD 4BFTA 3CUEF 4I4CA 1H1TA 5G4KA 2ZE6A 3RSHA 2PGXA 3G82C 1I2BA 1ZD4A 5EE5B 1Z2AA 1L6RA 2ODPA 3ZR4B 2J3KA 2CBZA 4OM7A 4XQGA 3Q2IA 3C3JA 1A5TA 2XY4A 4QLOA 1RPAA 3V7NA 3OKAA 4FMDF 4WOPA 3ZLTA 3C6MA 1GP2A 3FSEA 3NEJA 3R0JA 2WT8A 4BKPA 3OA0A 1MC8A 5HX7A 1O5TA 2DC1A 3NORA 4Z1OA 4OQFA 2JBHA 2GJAA 3L7YA 4NBWA 1OAOC 3ETNA 1TCCA 2NZ8A 2VPPA 3DT9A 2RK3A 3W9SA 1ETUA 3ECCA 3VTAA 3GCWA 3H11A 3GEBA 3PPXA 1EMDA 3PNPA 4QULA 5FA5A 1M9NA 3NVMB 5H70A 5KNBH 4O3FA 1UWVA 1CUGA 4U2DA 5EXSA 4EW6A 3IVRA 1G8PA 3RVDA 1T8YA 1G42A 1X1BA 3HBMA 3N5CA 3RAEC 4HX5A 1Q16A 2HC9A 5BSKA 2D1YA 5IAKA 4E4TA 1YWGO 3BJIC 4R8LA 4UVIA 4YX9A 1YNOA 2R6GA 3WSVA 5KYWB 2Z4TA 3THYB 1OXXK 3GT3A 3CR3C 1KEEA 4ENSA 1VJGA 1E2DA 1X42A 2JDIA 1YCDA 2VJPA 4B6EA 3DOEA 1MJGA 1H8ED 3RTAA 1GSOA 3N1UA 4Q4LA 1UADA 2ZI6A 1M2GA 1KDRA 4Y1GA 1NLYA 4RETA 3UGTA 4Z53A 2I78A 2ODQA 3B48A 3VR4A 1DKUA 2ZJYA 4P54A 3VC7A 1Y6GA 3EIEA 2WZBA 4PZDA 1VLHA 1S8FA 2PUHA 4OAQA 2EGUA 3WQBA 4U7JA 1XWWA 2X0DA 4I9UA 4F3NA 5CVEA 1M75A 2EBUA 1L7NA 2D00A 2FEPA 3DKIA 3GFQA 2A0UA 2GN8A 4FZVA 4HYTA 4R2IA 3V2GA 4HB2A 5I8WA 4W5TA 3WB1A 1YB4A 2Q3CA 2Q8QA 3ZV5A 3REOA 4YYEA 1ZK1A 4DWOA 2VVTA 2V59A 2R6HA 2BISA 3JQ7A 1DHTA 4LOKA 2JRCA 1CQJA 3UMFA 1KI8A 2WZCA 3B5EA 3DBRB 3I5UA 4QPZA 1WUKS 5CLQA 3DVLA 4B4VA 3QI2A 3OZVA 1O77A 2VPIA 3C6YA 2B99A 4PPNA 3FKQA 1OFUA 4IY1A 4TMXA 1SXPA 3F97A 2Z57A 3EGIA 3DFMA 2IOFK 4RK6A 4F60A 4YCMA 3DUWA 1CJBA 1SXJE 1YHYA 2AVDA 2ZE7A 3IP7A 4IUDS 4LYFA 5FBWB 2FWPA 4ALNA 2JLAA 1KK2A 3WBKA 1C8KA 2QVXX 3VDRA 2R5NA 2PGIA 4G0VA 1KTVA 2YZKA 4E2WA 2WIKA 1TVKA 5BN4B 1SHJA 1OWMA 1IIBA 5KMGB 3HJGA 2RB4A 3AR7A 3ER6A 1H9CA 3SF8A 5DXAA 4TKUA 2JEZA 3BSFA 1YVPA 1QYVA 1PS9A 1OLUB 3OPXA 2Z3ZA 4FONA 5ALQA 5DW0A 4CKCA 5FV4A 2UU9B 3I62A 1JDZA 5CNKA 2D1SA 1SN7A 1Y5RA 2RGUA 3HRHA 4OQLA 4ISCA 4QUEA 1BMFA 2QX8A 2CK3D 3AIIA 4TT3A 3UWMA 2B9VA 3PQDA 3OQIA 5PGMA 3L79A 4M1TA 5EIEA 1IY8A 5DYNA 2RONA 4O25A 4WW0A 1WBDA 4XPIB 3U6BA 1LZKA 4TX1A 1N5LA 4OHZA 4AQYB 4OA5A 1MDFA 1O6GA 4U4AA 4OA8A 4JCOA 3AHDA 4RACA 2H1VA 2WNHA 4MW1A 1ZOPA 2Y9MB 2FYTA 1E1NA 4LCBA 4EEZA 2GUGA 2XMBA 3O73A 3PTLA 1UJ4A 2XQGA 1Q74A 1ZY2A 2HMVA 2IYQA 3NYWA 4JXKA 1KI4A 4P7BA 4O4LA 1X7HA 1QDEA 1U2ZA 4C89A 1WP4A 4HSGA 3SS9X 2O8CA 3JQEA 3NIWA 1T5OA 1JYFA 2NO9A 1VL2A 2R4UA 3SHTA 1AKUA 5E7QA 4RXMA 1S6YA 3T7DA 1PL6A 5MDHA 2H4FA 2O3RA 2I54A 3PNVA 2GHRA 1COWD 5FKJA 3W77A 2NTJA 3GGSA 5CDHA 3DFFA 1N2ZA 3HCPA 4YJ2A 2YZGA 2NXCA 3HUEA 4WUVA 3IDFA 4RUKA 1VZ2A 2BHSA 1HR0B 4LRSB 3RFUA 1NXTA 1PR2A 1PG5A 1HFEL 3CVVA 4CG0A 4N6NA 1PG0A 3WGOA 4L5CA 2GBIA 1U5CA 2V7TA 3IBCA 3O3NB 1I1HA 1J2UA 1XXLA 4FDTA 3THYA 1XDUA 1V8ZA 1DAOA 1TU0A 2VN8A 3UJ8A 4GMGA 4LI3X 3N8GA 2GLXA 5CU7A 4RGYA 5KTOA 1TI7A 3VAZA 4MKHA 1NPDA 3W3AA 1PT5A 2FY8A 2DFDA 5EHQA 3WL7A 2OM6A 3NHAA 1AUPA 4QHTA 3HZHA 2AOXA 3LUDA 4NOLA 3TRKA 4LJYA 4FE7A 1EI9A 2X42A 3DAYA 3MB8A 3NJ8A 4AT1A 3BWCA 4M1MA 3O8BA 3TW0A 2VH5R 2JAWA 4ARUA 4EG4A 2BLLA 2ZU6A 1LWOA 3U19A 3DGFC 2RH4A 2K87A 3LT4A 2ZXUA 5FTKA 5F1OA 2ZM6B 4O4IB 1N7IA 3RIMA 1Q21A 1IEQA 1T5BA 4DIDA 2VTBB 3DD5A 3SBDA 5HA5A 4JT8A 3KETA 2UZ3A 3T38A 3CUUA 2AWNA 1M67A 4F4FA 5CT5A 4I5DA 4M60A 5FR2A 4ZEVA 4G1VA 3OBIA 2J9YB 2EQBA 4EG3A 4WFJA 3DB2A 5KREA 3I45A 1SK9A 2WJVA 1HQYE 1DOAA 1KKMA 2HV9A 3KSMA 2Q0HA 1B76A 1KR5A 3CF6R 4B73A 2AN9A 1DKRA 1MXFA 5B4VA 1RRVA 4OMFG 1H4TA 5DI9A 3HYNA 3L41A 4Q3EA 4YHBA 2OK8A 3O6VA 4C0KA 1QHNA 3CW9A 3ZTTA 6ABPA 2GEJA 4PQEA 2FFBA 3LP5A 3QUSA 1QO9A 5ERXA 4B3RB 1G20B 1GZVA 1ULUA 1WMDA 1TFRA 2HSGA 2O50A 3BH6A 3INNA 3KDAA 5EL0A 4WL0A 2C61A 4Q15A 1SCNE 2M98A 3QEKA 1M5RA 3KOWA 3WQHA 1WXXA 1QMGA 1NY5A 2Y99A 1S2MA 2DUJA 3E18A 4NDZA 1ZCBA 1TM4E 4Q4HB 4CTOA 4TL6A 2O8BB 3NYQA 4QYXA 3VRHA 3GV0A 1VIDA 5B2ZA 5DFAA 1E1RD 3FVRA 1OLUA 1Q7CA 1ZMBA 1CZKA 5IM4A 3T7CA 2RI6A 1YRQA 4NAVA 5K2MA 3AUUA 4IIBA 4W9NC 2B8EA 4F9TA 3CE9A 5I7RA 5H83A 1GGHA 1RXVA 2F90A 1GG8A 1VFPA 2W22A 4R1LA 4E11A 1W36D 5FEUA 4QYMA 3FR8A 3IPAA 5B64A 1F5SA 4ZTUB 2HD4A 4KHPB 3FHCB 3I2IA 3QNMA 3I92A 1N6KA 5D84A 3QOFA 3EJ6A 3VR2A 4FWTA 2PPLA 1D1PA 4JD5A 4NJEA 4G4SO 4RMGA 3BSWA 2Y0EA 4U6SA 4N5HX 1JPJA 1NI3A 4GWLA 1DTWB 1KKUA 3GF4A 4EAAA 2QZZA 3RVRA 2J0EA 1PG2A 5K8VA 4NY1A 1L5GB 4FJ2A 3EPLA 2VQEB 4NMWA 4FU0A 4RPJA 1DG9A 1IJEA 1QH9A 2HW8A 1SUDA 4Y6SA 3OZTA 3TVTA 4BX0A 2X1HA 3U09A 5JRDS 2OFPA 3EK2A 1SXJD 1SXQA 3A58B 3OMWA 2W2KB 1OXKB 1P72A 3ELWA 2GZ1A 1T8RA 2P5TB 4UKDA 1JIVA 1SQGA 2V7PA 3FDZA 4GYYA 4XDZA 5A4IS 3QFHA 3PQ7A 3B6EA 3RFCA 3BGWA 1KY2A 4N54A 4JVLA 2BP7B 2C4NA 2I91A 2PLAA 3CGGA 1U7OA 1VL1A 4YLYA 3B51X 3FYHA 4ZOEA 2AZTA 3B1XA 4V1CI 1HDXA 3ILSA 1J8VA 3KZCA 4JASB 2X3YA 1G9XA 1OGYA 4TLDA 4TUYF 1XELA 1P29A 4NRDA 2OPHA 4DMUB 2O6LA 3MHPA 1J2JA 1SUPA 2O3SA 1E60A 1OSNA 2FCRA 1TUBB 2PGJA 4Y9UA 3A6FA 4DMKA 2CJPA 3GT0A 4OSOA 4D44A 5IWAB 2O5CA 1TRHA 4RVNA 4AVYA 4OGFA 4AK9A 1SKYB 2QM8A 3C1UA 1CVIA 2ZRQA 3CCFA 1PZFA 4X3PA 5CXXA 4BNNA 3U2QA 1U0BB 2H7YA 5DISB 1OXVA 3GFGA 3TOVA 1I80A 1SBTA 3K9GA 5I7OA 4CKWB 4D9BA 4S35A 2BUAA 2Z5LA 4EKEA 4JI0B 3CEAA 1KFKB 2QQGA 1XLUA 3FD8A 3UT5A 1L4BA 1G59A 4YK7A 2P67A 4LV8B 1HTTA 2A59A 2B2XA 4WFKA 3ZCXA 3KQPA 4ZYUA 4LFCB 2CJXA 4YT2A 4HQLA 4KL8S 3SPXA 4L2IA 2DFLA 1M83A 3L8HA 4DR3B 3UMCA 3MSCA 5GADl 1BFKA 3DXYA 5F7ZA 5EP4A 1E2FA 1KRHA 3CXRA 2N47A 3D3NA 2LKCA 2DPGA 2RHMA 3FSRA 4RYLA 4BQRA 4RA9A 2FSGA 4RK1A 1UXIA 3MIIA 1J9ZA 2PXXA 4FI3C 4R1PA 4OXQA 2QM7A 2AE1A 2B6NA 4PZLA 4AN0A 3I32A 2GVZC 2R2GA 1VPDA 4M87A 1LV8A 2CNNA 1KQPA 1BOOA 2OB2A 5AWFC 4YI5A 1Y3AA 1M8PA 4O1HA 3C7KA 4URWR 3KK0A 3HYSA 3HN2A 1JDPA 4PRZA 2Y2UA 1G66A 2ZRLA 4DWJA 2OV2A 2G1PA 2HF2A 4JBWA 4ZODA 4GOMD 4GU5A 3GO4A 3I05A 2OESA 3F47A 3CH5A 1OTXA 5E9QA 3T06B 4I1PA 1MXHA 3C6QA 2OUKA 1TTTA 4QBGB 1WCV1 2OBFA 2HHLA 2VPWA 2V5UA 3NYRA 5FYDA 1KVSA 2XUZA 4YRTA 2HPAA 1T8WA 4PLPA 2BFNA 3RKUA 2GI4A 1PGJA 3WNBA 1QH8B 4GX2A 3TJZA 3RYTC 3Q3CA 2VATA 4ZEXA 5E6RB 3X1YA 2JDID 1TMOA 5EFOA 4OIFA 1Z0DA 3G2NA 3H4MA 3WLFA 3I58A 3RRFA 5JZVA 5CLIA 1LI5A 1R4MA 1UZMA 1JXMA 2J7PA 1X74A 4FIZA 4E22A 4R40A 1V3UA 4KIGA 5FBKA 2XYHA 3VR4D 5C8ZA 3QFFA 3HVKA 5CRIA 1RWPA 4LNAA 3TXXA 4J3NA 1HKUA 4KE8A 1N0UA 3L9WA 1DAHA 3B6IA 1T25A 2CUKA 4INPA 2IIVA 3C43A 4I3GA 2EZUA 5HDBB 3Q8LA 1YBAA 2H1LA 3N3BC 3FPEA 1VIYA 2IQIA 3HR4A 1OC4A 3G79A 4MWDA 3WL5A 1U5BB 1N77A 4JBLA 2YWCA 3ELUA 2I4LA 1M1YA 4PXYA 2OQIA 2W2KA 3GDFA 2DWOA 5K6AA 1BC5A 1Z7YA 1X8JA 3U7JA 2Z2XA 4OJYA 3M83A 3NPMA 3C15C 3LC2O 4LA4A 2QTTA 2QR3A 3QWAA 3T3MB 3AKCA 4XR9A 3VPHA 1W2HA 1LH0A 3QIAA 2VNKA 2W98A 3JZMA 2IX9A 2A1TS 3IVGA 4TS1A 3THXA 2DQYA 4JLAA 1P45A 2BP7A 5CIYA 3LQ1A 3SDZA 1EK6A 1PZNA 4KXVA 2HYIC 4BVGA 3M9LA 2AW3A 4XB1A 2QWXA 3CVJA 3OTIA 5COQA 3TQRA 2WUVA 2QTLA 3JY6A 2NTYC 4FHGA 3O4IA 2ZXEA 1TUBA 3LGAA 4IXNA 4P2GA 1TE2A 4XA8A 3KXLA 5C35A 2Q2NA 5DHSA 4KQ6A 3MUOA 1ZI9A 2OCKA 4TQUS 1CE8B 1K7EB 2PYDA 4M8KA 1II0A 1H6CA 1MH1A 4YC7A 1W59A 1EP1B 4KN5A 2YRFA 3ZHXA 3V8QA 5BSRA 2I9PA 3L2OB 1ZK3A 2INGX 3H3JA 3CUYA 4JGIA 4EG8A 1XDZA 4EATA 4X62B 1LDGA 1N0HA 3LLCA 3GRCA 2XYRA 4PANA 3ONDA 4QXQA 4E12A 1YZKA 4BHTA 4MYRA 5E6UA 3WJ2A 2ZUSA 3TMYA 1PJRA 4JS0A 3VO9A 5MN4A 5DW3A 1Q12A 2REBA 5F1YA 4DN6A 2C2ZA 3B9RA 3C41J 3NC0C 2G9UA 3GCZA 2H4ZA 1BMFD 3QWBA 1QQBA 2X9QA 4L9AA 2WMYA 4XUGB 4BLWA 1HZZC 3LA8A 4Y1RB 1Z0UA 1E3LA 1SXGA 1X7YA 1P7PA 2VYVA 2YQZA 1K8XB 5FUYA 5LFAA 1DX6A 2YVKA 3HVIA 1Y6FA 1AF4A 5JQWA 1KZ9A 4GWGA 3RNLA 4HRYA 2R00A 2QV0A 1FYXA 2OKGA 4RZ2A 4C5AA 3CSSA 4KQ2A 4HLQB 4LGYA 5DP1A 3DLTA 4IG4A 1GEEA 1WEHA 5C4IA 1UBRS 2BT4A 1UBSB 2R6AA 3N2LA 4UHEA 4XSHA 4YMSA 1JMYA 3P52A 4LW8A 3Q10A 4Q03A 1DEXA 3WJ7A 4XJVA 1TKAA 1Y7HA 5I3ZA 4DCGA 3EAQA 1L3BA 2EP7A 3N6XA 1GIAA 2B8WA 4L76A 3ER8A 4X9XA 2Q3EA 3IMKA 1KI3A 2E5LB 3FCYA 1H1LB 5COAA 2PL3A 3A4IA 3TL3A 3OQ6A 3MWYW 4P83A 1E0KA 4PSKA 2QN6A 1FMJA 2FZ5A 2PZAA 4OJKA 4B3HA 1OXSC 2MYTA 3MM4A 3QUTA 4J7XA 3RVSA 3VVMA 2ODBA 1G20E 4ZICA 4CKZA 5KHLB 3ONEA 4RA6B 4UOQA 3JPWA 3ERCA 2C1EA 1V8FA 2VHEA 5JVDA 4I6JA 1GR0A 3B12A 3PNBA 2ZATA 1T1JA 4FB4A 5JNVA 3DGEC 3FNRA 3P97A 4P93A 4X20A 2VPXA 3WL6A 4J0HA 3SCZA 4GECA 4DJFC 3ND7A 3SAJA 3W3AD 5HXAA 1J5EB 1C7QA 1FNCA 5JJKA 4NECA 1M2NA 1N1GA 1XMVA 4K6MA 1NSTA 4LXGA 2RKOA 2SBTA 4ZAFA 4Z5XA 5ALWA 3WDSA 1WX1A 1NF2A 4TTRA 1QLWA 3AI1A 4GT1A 3AHGA 1WXWA 5TQ0B 3GJ6A 1XCMA 3I2YX 3PTAA 3V42A 5F5LA 3ER9A 3TDNA 2LRHA 3K32A 3T5TA 1SC9A 2KI5A 4AUNA 6REQA 2WU1A 3GCXA 4AJ2A 4ALKA 4AUMA 3O8QB 1MABA 2QPLA 4LVNA 4XDGA 1KSJA 2XDWA 2AN5A 2W7TA 3P0FA 4ZOAA 1EX1A 5KTMA 2PA0A 3QPBA 3ZJ4A 4JXZA 1VYVA 5KNCA 3IBYA 2PR2A 1FYEA 4QO7A 4POAA 4XWYA 2FG5A 1F3OA 3B36A 3A06A 3MCTA 3RF6A 3RM3A 4MUBA 2FOIA 2DWUA 2RCNA 3GLSA 4TLLB 4ZOLF 3HU5A 4I9GA 2B4RO 4MAMA 1RPZA 3LWBA 1F8GA 4KODA 3IP6A 1NW6A 2DFVA 4R69A 2FSFA 3UT0A 4BO8A 1JQDA 1QKIA 2CL0X 5IUNC 2ON6A 2FK7A 1L4MA 4GMDA 3OEYA 1QIGA 1RBYA 1S9HA 1V5EA 4BNHA 1J0EA 3ZUPA 4QJIA 4TYMA 4EHAA 1U9ZA 3VNUA 4B3BA 4CIWA 5H3HA 3MMPA 1OBVA 2YV1A 5I01A 1U0RA 3SJCA 1NX9A 4PZZA 1MGPA 3NOXA 1YNSA 2EVWX 5C4MA 2NUAB 2Q4RA 1JBQA 4IHJB 2IS2A 1J1IA 4YS6A 3UAZA 4DLVA 3NAQA 1AK2A 4YRPA 3RRYA 3SBEA 3UJHA 4LJ7A 2YXNA 4R3WA 2AC2A 3KYDB 2A92A 4LJAA 3CU5A 4MW2A 4TV9B 3MC1A 5AHXA 4M55A 4XCVA 5FQOA 2FW0A 1S4MA 2VDVE 2O8VA 3CMCO 1W30A 2AIRA 3A26A 3IP3A 4G23A 4E5SA 4H3SA 2GTIA 4UHDA 4I08A 3BAFA 4TTVA 1F2UB 3BSSA 4R7ZA 3VR2D 5KKAA 4AURA 5CVTA 1EK0A 4K0KB 2Z5VA 1QIIA 4QYSA 1WY7A 3DFUA 3PT5A 4Q4AA 4L73A 2Y05A 3IDAA 3S0JA 2HDNB 1VCIA 2JFQA 3OT4A 4XCQA 3RTCA 5JZMA 3BRCA 3UJNA 1TU4A 2QS9A 1M6VA 2QTZA 4NC9A 1EJ2A 5IM5A 2H51A 3WDLA 2RE8A 3UPUA 1Z12A 5LXTF 5G02A 1E2BA 1RXCA 4FI3F 1MAHA 2C4WA 3EA5A 3F74A 5JS1A 1RI5A 1II9A 3HCAA 4OHXA 1JR2A 1NBOA 3BWYA 4EY4A 2FMHA 3AESA 5HKKD 1KQGA 4L6CA 2PANA 1KF0A 3SQDA 3EWNA 3WBBA 1FYFA 1AQLA 4ZD6A 3Q8KA 3QJYA 4ME6A 3QA9A 1XEWX 4P3KA 4Q93A 4B4DA 1F12A 4MUKA 2GWHA 3T1QA 1WDTA 2PFKA 4Z3KA 1XDWA 5COBA 3EH2A 5JAMA 1A98A 2OXCA 3GROA 3WLEA 3YASA 1KI7A 3O9MA 3KBBA 4I81A 2IV2X 3KKLA 4NHEA 1F4VA 4GYJA 5TQ2A 1E4OA 4O2RA 4AY3A 3DEZA 3MWJA 3ZDYB 4PYIA 3GDOA 3VNBA 5A0VA 3PGVA 1B1AA 1UT6A 4Y2QA 1YUNA 3HJAA 4KAXA 3GDGA 1SPBS 3SG0A 4DR6B 2EJCA 1MIHA 4FNMA 3R3SA 4B6RA 1WV0A 5DXJA 1YMQA 4B75A 1B93A 4YV1A 5CFQA 3T4PA 4X65B 1GZ6A 2WBLC 5NLLA 1OZFA 3DG9A 4J9UE 2IYUA 3LBHA 2AN1A 2VR1A 1E4YA 2Q6TA 3NCTA 5TF4A 3WLIA 4X93A 2QZ9A 5JDCA 1GILA 3EVDA 2Y6VA 5HOEA 3PBKA 1N5DA 2WOOA 3WQRA 4J0DA 4NBRA 3DZDA 1NN1A 2VDWA 1OH8A 2BEVB 1UEIA 1QR6A 2Q4DA 2EDAA 1CB7A 2J59A 3TIVA 4OAPA 1NW9B 4MR8A 4ZYWA 8ADHA 3IO5A 2EZ8A 3I6IA 1V5FA 1JKFA 4ITRC 4QGFA 8AT1A 4DYHA 5GM2A 1PV2A 2OD2A 4YGXB 1JXAA 3V4RA 2WJHA 1UFQA 3GGOA 1TO6A 1QPBA 1Z2OX 3DAHA 2B82A 3DF7A 3LY8A 4HNAA 4JEUA 3RK1A 3W90A 2A2ZA 4BMZA 2X77A 4EYQA 2PTHA 5ALHA 1XCOA 4CF3A 3LUHA 5ESXA 5SZIA 3ZZ0A 3PQ4A 1P80A 3IR7A 4M22A 4CL0A 1O94A 4KN9S 2A9JA 4MOWA 3E8MA 4ZZ1A 1TF5A 2AOUA 3VV2A 5LMUB 2WQZA 4C05A 3DZ8A 1B8PA 2FR8C 3GJSA 1DRUA 1H8HA 3AV0B 4B09A 4KXYA 3RUEA 3VFDA 4EP1A 3GJ8A 4F5WA 4FDAA 1DXOA 5A4DA 2ZWVA 3ITEA 2XE7A 2HBYA 1TXGA 1HK7A 3ORHA 2XAUA 1Y3FE 3IP5A 4JLKA 1Q15A 1GAJA 4C2AA 4WECA 1MOZA 1XXHA 2CD7A 4C1BA 1JT2A 3LY9A 2HGZA 3LK7A 4YP1A 3KPJA 3KYDA 5CM9C 1JDVA 4TRJA 3D6MA 1FFCA 4N76A 4DQVA 1EZZA 1UDAA 4EG1A 1M6YA 3MLBA 3D3WB 1JQ5A 2PUVA 3DNMA 3HP4A 3N87A 4DC1A 2ZOSA 2AG0A 2ZBEA 3A0UA 1G8FA 3NWEA 4UZFA 1GDTA 2OSVA 1F2UA 1DXYA 4JLBA 4CMHA 2LDBA 4LGCA 3VPBA 1JVNA 1X7ZB 1XVVA 2X9LA 3VOAA 1C3OB 1O87A 2BRUA 2CNKA 3F2VA 4AX8A 3A14A 5DM60 1D6NA 2F62A 3A1NA 3DKRA 1OFHA 5KI6A 3WK4A 4C3VA 3EWAA 5L4NA 2J7PD 2AG1A 3V1KA 5HRCA 1DJQA 2WZDA 3AKDA 1P9WA 4IOMA 3R7WB 3ROXA 1DAGA 4R6XA 3W0LB 1NBHA 4PXAA 5BWOA 4F96A 3BK2A 3PJDA 3TTWA 1W6RA 3KWJA 4EHNA 4XFKA 3F49S 4WY2A 1J07A 3DE2X 4L85A 5ALSA 1IQUA 1I36A 1WUYA 3PC8A 1KH3A 1RYNA 2F17A 3PFWO 4RDXA 3OFJA 1WU8A 4LK2A 1ZWKA 3BIWA 1E8MA 3IE0A 4CM9D 4YJ3F 3JQCA 4ESEA 1WHTA 3SYRA 5C8YB 2H3EA 1KQFA 5LKRA 2W42A 4FBGA 5KOHA 1LNZA 4M88A 2PT9A 1ZKDA 1VGRA 2UKDA 4YRSA 1K6JA 1BGWA 2J09A 2P90A 3N0WA 4R9UC 4RAOA 4EKYA 4GOXA 1AZSC 1RAAA 2R1TA 4RTJA 4PCVA 1WP9A 4BN5A 4D9GA 2CBGA 1ONOA 4RULA 1U8ZA 4MCIA 2H18A 4MLZA 4UXHA 3ZV7A 4IDOA 4OBXA 4UMDA 1Z8DA 2E21A 3M70A 4KR9A 3E7DA 3NJRA 1XD2A 2GRAA 3I30X 4RVUA 2BKXA 1AKTA 1L4YA 3BEOA 1NVAA 4CIDA 2Q07A 3H5OA 4ZTBA 3ENKA 3BFPA 4X95A 5T64A 4EB3A 3QE9Y 3U7QA 1QGUB 1C3EA 3EMKA 1AKEA 1VSQA 1U28C 1QYDA 4BXOA 3U49A 3L4SO 3KZKA 4U9IS 3HDVA 3K70C 4ZZ3A 1SHKA 2FW7A 2NUPA 3WZ2A 2XJ9A 3DDCA 3HR8A 1EEHA 4NICA 2OZEA 4PX5A 4BFZA 4EQ6B 4LFBB 5DRYA 1Y8RB 3CUVA 1XMSA 1JV2B 2OVBA 3IPRA 3VNVA 2IW1A 2YHSA 2RSLA 4HZIA 3CVOA 4RMNA 2HWKA 4HPWA 1YL6A 1FNNA 3FFWA 4IEFB 2IC5A 3N2KB 4G8DA 3W8RA 3QWHA 2XR1A 2AL7A 4Z0HO 4P53A 5IG2A 1Q1BA 3B7PA 2EKPA 1KA9H 4DIEA 3JQBC 2A7XA 3VTZA 4C9BA 2VYVD 1NURA 5JZSA 1VMEA 3IYLW 3UCEA 2BH2A 2M9MA 1GUBA 4ZIRB 5IPFA 5JS7A 1E7WA 4DDKA 1FRVA 2RC6A 2XRFA 3NEAA 8GPBA 5K09A 4R3UC 2RGCA 3TLKA 2JLVA 1L1RA 2AKEA 3ADCA 4IXDA 4X7PA 1DJLA 2EFYA 4GNKA 4D56A 4QDTA 5KVSA 2R0QC 1Z0ZA 3DP9A 1PP4A 2QBYA 3CPSA 2QORA 1F8UA 1R3UA 3HWX1 1GUDA 3L6BA 4R0NA 5J23A 2HJGA 2OHJA 1JJBA 1JQBA 1RWOA 3BC1A 3FM9A 4QDKA 1Z33A 3CLSC 1WF3A 1UBTS 2BTQB 4P4LA 1YXMA 4QYIA 1KDVA 1PR3A 1B3RA 1XQ9A 3BQNB 3FVQA 2ZYGA 4XQ9A 2UYCA 1H94A 4PZUA 1EDDA 3H19A 3GLQA 3PHGA 4BMSA 2ZJZA 3SHQA 1BWSA 1KGDA 3T5GA 3HJBA 3GFSA 4IEIA 3WJAA 4IH1A 3A1VA 1BOFA 1D4AA 3E8SA 4LHSA 1JGTA 4GOJA 2IU0A 4BPRA 4LV5B 2FRXA 4NYJR 4ID9A 1U0EA 1VLQA 3NHJA 4Z99A 1HORA 1UKCA 3BIXA 3FDIA 3BERA 3SJ7A 2QXTA 4CCSA 5B55A 2UUAB 2J5XA 1HDZA 5JU6A 4P84A 5CCDA 2W00A 1O9GA 4HNHA 4PTLA 3FPBA 4IOKA 2BMJA 2ZJ3A 1TCBA 2ZZMA 3NBMA 2QYOA 2R25B 3CLHA 2ZXFA 4HNGA 1XXHE 3V2UA 4ACAA 3U44B 1P75A 3FHOA 1QVAA 2PZEA 3AB7A 1JH8A 3IQWA 3EIOA 3O95A 3UWKA 2GN1A 1EEXB 1YFKA 3DNFA 4UPVA 4WOBA 1VRWA 2OEPA 5F9MA 1USGA 2VAWA 3N2NA 3PD0A 5HILA 1W19A 4IVRA 1OV6A 5ED4A 2PD3A 1C8LA 3TNYA 2NVBA 4WD3A 2ONCA 4Y30A 4UUAA 1JEAA 3I0ZA 2V65A 1MW8X 1GZ5A 2QRZA 2VS1A 1LPMA 3AVPA 5F7JA 5AM4A 3RVBA 4MHTA 4U7FA 1SGWA 1TRKA 1XALA 5EAIA 4N5NA 4GE3A 5KNCD 2NZUG 3ESXA 3IAXA 1PSZA 1HLGA 3RV3A 5TJ9A 2HR1A 5B5SA 2HM7A 2PZBA 4KTTE 4XTCS 3EAGA 3LE8A 3RK4A 1XP8A 1QHGA 4LDQA 3ZW8A 1RLJA 1RXSA 1KYXA 2M6KA 3VSCA 4AS2A 4G85A 5BOSA 1BHO1 2VNAA 3PYMA 4DY4A 4QFBA 2BKUA 5IXYA 4HXGA 2Q4BA 4GUAA 3L4KA 4G41A 2ZQZA 3U4CA 2WYIA 1R0SA 4C0XA 1TYCA 1ODSA 3R77A 1UBCA 2NO7A 4GVXA 4YXWA 2ZUTA 1YKFA 2YTZA 3ZLBA 4BAZA 1GQQA 2FU5C 3A8TA 5FBVB 5L4LA 5JARA 1CEYA 2N46A 3VOSA 1EA7A 1EIZA 3IOCA 3EQ9A 2XZLA 1VMKA 2JBAB 2E18A 2HMWA 4BE7B 3B9BA 1PT8A 4QBKA 1GUYA 4AG6A 5FWDA 4X64B 2B1RA 2RHRA 1YR1A 3A1UA 4FGZA 4N40A 4KQWA 4WCDA 5C0OE 2QUIA 4A4DA 2R66A 3WNCA 3N2ZB 3WIEA 3WKEA 4EUFA 1A2OA 4UM7A 1MX1A 2O8FB 1EH5A 4CTMA 1D1SA 5J2UA 4C0LA 4IFEA 1A82A 1XJ5A 3H2YA 4MGHA 3DZCA 1GTJ1 4R2MA