2FPIA

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
304
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
total genus 106
structure length 304
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpiA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fpiA01
5JNLA 2O3QA 5EN4A 4U5QA 1U4SA 3I4CA 1ZKMA 3H2ZA 4L0QA 3WGZA 4WOKA 4HY3A 3RAJA 3BMNB 3CPSA 4XJTA 3QY9A 3NEPX 1XR3A 5CPFA 3MJVA 1I3MA 3GF4A 3EHEA 4DYDA 2R00C 3K73O 4CR6A 2X8LA 4HX5A 5TC4A 4DL9A 1GZ6A 3WGGA 1GL3A 1WWKA 2BLLA 1JWAB 3ANLA 5HM8A 5JYDA 5GZ6A 4M89A 1K6JA 4EJ0A 2Y1FA 3K8ZA 4NMHA 1GZ4A 1ENYA 3U4CA 1KY4A 1RM3A 1DPGA 4JP2A 2X0JA 3T4EA 4M54A 3D3WA 4PLWA 4WLNA 1JKFA 2Y66A 4GBJA 2D5CA 2E49A 1OI7A 1DIHA 4ONEA 1WZEA 2V7PA 3HQ4O 3LC2O 2GNAA 1PU2A 3OJFA 4PLFA 3BAZA 3H9QA 4R51A 3VVBA 1LSOA 1U7TA 3E5RA 2WE7A 3ZWNA 2WWRA 2O3JA 2VYNA 1JAXA 1I24A 4LW8A 5ICMA 3L77A 1ULUA 1SB9A 2WD7B 4CQMB 1DRWA 3H9UA 1DIBA 3CUKA 1HLPA 1AUPA 1GCOA 1V6AA 4GLOA 1IY8A 1PQPA 2HJRA 3NJ4A 2UDPA 1SOVA 3TL3A 4FB5A 5A03A 3GEDA 2QW8A 4FOSA 4KDEA 1XYGA 4QTZA 2XXJA 5CEJA 1PS8A 4BNTA 1H6DA 1JQBA 3W6UA 2Q1SA 3GUCA 4XDZA 3TQHA 2FMUA 1U3WA 3KV3O 3RBZA 4O1MA 1O6ZA 4QECA 4AJLA 1LDYA 4L4RA 1P45A 3D5TA 1EK6A 2CD9A 4JBHA 5DCUA 4GVXA 5FWNA 1UAYA 1JKJA 3ADPA 3DBRB 4XRRA 5DDIP 2O3RA 5TJHA 3RKRA 3U3XA 1CIVA 3B6ZA 3C3XA 3E6AA 5JMWA 4QEDA 1AE1A 4IS2A 2IYOA 4I9UA 1I2ZA 4W9NC 4DLLA 1E5LA 1H9BA 2GERA 3U09A 1YL5A 5THKA 3UW3A 2QHXA 4OSPA 3K2EA 2WD8A 3M2PA 4E2WA 4Z0HO 4BS9A 3PHJA 4HWKA 2Y1EA 1DFHA 2BKAA 1HDRA 1U5AA 1T1RA 4RJTA 1CYDA 1N7HA 2FSVA 2Y99A 1B8UA 2P9EA 3EUWA 4OHUA 1LC3A 4HUJA 3ASVA 4NFHA 4MVJM 1DRVA 1B26A 2OHXA 3UFXB 3WTBA 4AJ2A 1LLDA 1EQUA 4S3MA 3QVOA 4ALLA 4NJMB 1N9GB 1WMAA 4BO3A 5JCJD 4RQTA 1HTBA 5AXAA 1WW8A 3TZHA 4XGNA 2ZATA 2G82A 2RHCA 4JJGA 3OQBA 4EYEA 3AUTA 3V2GA 1HYHA 4EEZA 1GQYA 2GRAA 5EMHA 3K5PA 3VC7A 1QYVA 1LRKA 1U3TA 2I9PA 3QLJA 4YAKA 1U5CA 1P77A 1Z45A 2ZB4A 4BIIA 5K9ZA 2DVMA 2P5UA 2SCUB 3FNFA 1PJ3A 2TMDA 1ISMA 1Y9EA 4HP8A 4ND2A 1NQOA 4O63O 3NT2A 3ZDFA 3E1KA 2OOSA 3NT5A 3DR3A 1A71A 2AE2A 4NQZA 1T2DA 1R4NA 2B4TO 1KIFA 1MFPA 5F1PA 4A7PA 1U8XX 1O95A 1E1LA 1QRRA 4E6PA 1KC3A 2Y0DA 1EBFA 4EI2A 1HRDA 4ZU3A 1HZZA 1YB1A 4NBRA 1ZK0A 4GKVA 5G0WA 4CQLA 1C0PA 3ZNNA 4B8ZA 1IYZA 4CMAA 2DBRA 1WPQA 4BNIA 1R12A 2X9VA 3DAFA 2W90A 2GYYA 1N7GA 3FTNA 3HZZA 1C0IA 2WSBA 3QV1A 1J0XO 1NVGA 3KEQA 1PSDA 3ROQA 4OOEA 4BNUA 2ZTLA 1KY5A 2Y67A 4YAIA 4A26A 3GRKA 4WCFC 1E77A 2DTEA 1D3AA 1BVRA 1UXKA 1O89A 3F9IA 4D79A 1C1DA 2IYPA 1MG5A 3BMOA 3MJCA 3ZV6A 1BXKA 3GNTA 1LLQA 1T2EA 2XXBA 4ID9A 5B12A 2Y0CA 2DUUA 2EWMA 3WBBA 3Q0EA 3LZ6A 4HFMA 4E2XA 4BQRA 5BSFA 1HDYA 2EGGA 4H15A 1NAIA 2QQ5A 3IP1A 5DZSA 4NK5A 1PGJA 2VHZA 4RVDA 5DOVA 1F14A 3L4SO 4WNCA 3GT0A 2D0IA 5T67A 2DBQA 4EGFA 1WDLA 4J6FA 1XU7A 1ZSNA 4QUKA 3TNLA 2NU8B 1I3KA 4LVCA 3VKUA 3F3SA 3M1LA 1DC6A 1YXMA 3G1TA 3O4RA 4QQRA 1C0LA 3VH4A 2O3TA 3WJ7A 3RROA 2J5RA 3VPSA 1E1KA 2FR0A 2GF2A 2JFHA 3IJRA 3ZHYA 1YGYA 2FR1A 1C3VA 4XX0B 3EVTA 3K6JA 4AJEA 2AG5A 3L4BC 2HMVA 4YT4A 1F8FA 2HMSA 4FCCA 4D0RA 2FP4A 4RPLA 2NU6B 2AA3A 1TT5B 1ONNA 5CPBA 4XR9A 1LX6A 1HE2A 2X58A 3SVTA 5EPOA 2O4CA 1D1TA 3CZRA 4QO8A 2ZTUA 1GPDG 3H4VA 3DMTC 4BO0A 2PZLA 1NFRA 3RWBA 1J6UA 2B5WA 3MCVA 2AW5A 1F12A 2H63A 5COQA 3C1OA 4BNVA 2DLDA 1FXSA 1YO6A 2BD0A 4PLPA 3FNGA 4LCJA 4NBVA 3ABIA 3NTOA 3KXDA 3PJGA 3H3FA 1NQAO 2O7SA 2POQX 1ZIDA 2WMDA 4EUFA 1ID1A 1ORRA 4YDRA 1XG5A 3C7CB 5C37A 3D5QA 1OC4A 3RJ9A 1LDEA 1LDGA 4RLSA 3V1TC 4H3VA 3A06A 1DLIA 1QKIA 1KVRA 3AW9A 4CLOA 4U6QA 3SBOA 5G4KA 1I2BA 5I8WA 3B1FA 3MWDA 2VRBA 2ZB3A 4YJHA 1D4FA 1PGQA 1X0XA 2Z1NA 3PI7A 4QXMA 1AXGA 3GEMA 2WTBA 1GV1A 4YJFB 3ZZNA 1ZUD1 1YJ8A 2CSUA 2O50A 1JAYA 2QYTA 3AUUA 4J43A 4N18A 4E0BA 2X1HA 2P4HX 5DOZA 2GZ2A 4P8RA 1W4ZA 3ZH2A 2IEBA 4R1TA 1XQ6A 3OQ6A 3A9WA 5A3JA 4LISA 4I8XA 2HKIA 3QSGA 2VHVA 3JQ9A 5EQFA 2A94A 5L9AA 5KVQA 2OFPA 4BMVA 1VKOA 1DLJA 1HYGA 4Y8VA 4JK3A 1CWUA 1T1SA 3E8XA 3CMMA 1N92A 3VOSA 2VCYA 4E12A 5BQFA 3RD5A 2GPTA 8ADHA 4C7JA 4WLEA 3AUSA 1RYDA 3GVXA 1RM5A 3OHSX 3GRPA 3JQGB 1FK8A 1NXQA 5GZ1A 3MEQA 3FPLA 3K2BA 1NTOA 4OH1A 4MVJG 4F6CA 4RZHA 5H83A 1HL3A 1E0DA 3I83A 4LMRA 4NNJA 1P1IA 4ND1A 1AGNA 5IZCA 4BKRA 4PG5A 3V2HA 2WJPA 4TKLA 1UZLA 4CJXA 1IHYA 3I3OA 4ALJA 5T64A 3BMNA 3QVTA 3ZHXA 1YRLA 2HSDA 1IZ9A 5EL0A 3OFSA 3DBHB 3O8QB 3CEAA 3EZYA 3TOZA 2IZ0A 4D0SA 5L53A 4A10A 3AI2A 3O38A 4JJIA 3L6OO 4BUCA 1E7WA 4FOOA 4MVJF 4J9VA 2C5AA 3VVCA 1B15A 4WCDA 4D3FA 1HDGO 1MP0A 4GQAA 1HE4A 4PLHA 3C1TA 2NWQA 1NR1A 2RH4A 3ZHZA 1O94A 3AFNA 3GMSA 4DUPA 4CLRB 3PK0A 1WXDA 2CMDA 5FFFA 4BO8A 1DXYA 1VL8A 3RJ5A 3UVEA 3ZWMA 3FNHA 5HS6A 2VTDA 1RYEA 4NG5A 4N5MA 4WJZA 5JE8A 1A7AA 3ZV3A 2PNFA 3JQBC 3LT4A 4CQMA 2WD7A 3E82A 2ZYGA 2CZCA 4BB6A 1BG6A 1EK5A 3NYWA 1K5HA 1L7EA 3TWOA 4YTEA 3B20A 1NPDA 1EFKA 1XKQA 5DP1A 3QWFA 1ZH8A 5A04A 2OXIA 4CV2A 1VSUA 2ZKLA 5A3VA 1OC2A 2FZWA 4II2A 5JLAA 3HNPA 1GPJA 4MVJI 4CM4B 5AXDA 4ZN6A 1D7OA 1MFZA 2Q45A 2X0NA 1P9LA 2I6TA 2WE8A 3GH3A 4DTIA 3ROMA 3KETA 2NM0A 4KUEA 4MDHA 2I65A 1WLYA 3WYEA 5I7SA 4DLBA 2PLAA 3FNEA 3HSKA 4Y6SA 3ONFA 4KWIA 3DBRA 3GZ4A 2JCXA 3KM0A 4IZHA 2VZ8A 4I9HA 3X2FA 3NUGA 4Q3CA 3DEYX 1P1KA 2YW9A 4GI2A 1ADBA 1LDMA 1H5QA 1ZK2A 5AVOA 4R41A 3UCFA 4J0EA 1HZJA 1YBAA 4ALMA 4OKIA 3WICA 4CUJA 1N8KA 3KYCB 4W99A 1T26A 4RPGA 4E5PA 3RKUA 3MTJA 3A4VA 5I9LA 4Q3NA 4DVJA 4YRBA 3INGA 4YVFA 4JGBA 4UVDA 5JC1A 4IGEA 4Z0TA 1I3LA 2I3GA 4WLOA 4DMMA 4EUEA 1BTOA 2JFFA 1PJCA 1P1HA 2C54A 2WM3A 4UREA 3IDSA 1BMDA 4PG6A 3UFXA 1KVTA 3A28A 4EEXA 4AJKA 4DQVA 1E6WA 5C7IO 1MC5A 2AHRA 1NFFA 2IRWA 1VL0A 1N9GA 2NV6A 4NJMA 2BMAA 4CM8B 4CV3A 5ER6A 1X13A 2PR2A 2AEFA 3IUSA 4BO1A 1DIRA 1XWFA 2WYVA 3I5MA 1UP6A 1KETA 4XJSA 4J1QA 1I30A 4CM5A 1H93A 2X9NA 1U28A 2SCUA 2YUTA 3S2EA 4ZQEA 1I0ZA 4RDIA 2FSSA 2OBNA 3JYQA 3HDQA 2Q46A 2Y93A 1JTVA 1CERA 3KLPX 4I5DA 4YA6A 1VL6A 4BNMA 1IHXA 2VOEA 4D42A 1HXHA 4R5MA 1PGOA 3H2SA 3JD1A 5I8ZA 4XR4A 3RBXA 4D46A 4BNHA 3HJAA 5JSFA 2GUGA 1IOLA 4PG8A 4PIVA 4CLDA 3RUHA 2DFVA 3B1KA 1PJ4A 2GN6A 2BHLA 2W4QA 3GVIA 4NDNE 3ZWWA 1VC2A 1GDHA 5AOVA 4CMEC 1LI4A 3BHJA 4GSKA 3EK2A 2GZ3A 1OBFO 3F4BA 3PYMA 3NRCA 2PV7A 2PZMA 1EDOA 4IDGA 4WOJA 3OETA 3SX2A 4L9RA 2E4AA 4DYVA 5A4DA 1M2WA 1O0SA 4RO0A 2CVQA 3WIEA 5L7YA 1BDBA 5A5EA 4I9NA 1UXJA 2D5AA 3PEFA 1V9LA 4N7RA 1SNYA 1QYCA 1Q0QA 3U49A 4Q39A 3NAQA 4Y6PA 4EZBA 2UV8A 3SC6A 3FF4A 3BZUA 5HTOA 2NU8A 3GFBA 1M6WA 3JQFC 1L7DA 1DSSG 5FI5A 1SEPA 1LTHR 2VUSA 2VWQA 2CY0A 4CQMD 3HHPA 4DC0A 1ZXLA 4I5FA 4B7UA 4XX0A 1QR6A 1NBOA 3AU8A 2Q50A 3LQFA 1VJTA 3NKLA 2RAFA 1K3TA 4Y67A 3RU7A 1Y8RB 2Y68A 3AI3A 4B4OA 2NU6A 3RVDA 1TT5A 3V5NA 5HS4A 1VJ0A 1I2CA 3Q6IA 3BTSA 1Y5MA 3FI9A 2BGLA 4ALIA 1M76A 1JA9A 4CM3A 2HK8A 1R0KA 3CIFA 1DAPA 3CXRA 4R54A 5DCWA 2Q99A 3VZPA 4DMLA 3OIDA 4NHEA 3PRJA 4YPOA 4PLGA 2NQ8A 1DIGA 2X7HA 2ZTMA 4URFA 4J0FA 1BRMA 3LC7O 4XDYA 5BSEA 1A4UA 1I01A 4KUGA 4J7UA 3WNVA 1R16A 3Q3CA 2XPCA 1S7CA 4CLEA 3WIDA 5U4QA 3RUAA 1SMKA 5KOIA 1EUDB 1NP3A 4HKTA 4OQZA 2GO1A 2EHDA 2ZCVA 1NWCA 3ONEA 3M6IA 3ULKA 2BFAA 4R1UA 3U4HA 3HN2A 5JXWA 4RVSA 4XYBA 2PGJA 1KC1A 4UAGA 2VHYA 4I5EA 4D44A 3MOIA 4WGGA 4IUYA 4XYLA 3AFMA 3GHHA 3O03A 3DQPA 3INRA 1GFSA 3H5AA 1IPEA 3NDJA 4FFMA 4MKZA 1KVSA 3WOHA 3MJSA 4UUMA 3OJLA 3CH6A 1VPDA 1OAAA 4LSWA 5IXSA 2ZQZA 3Q1LA 1E3LA 4IJVA 1RM0A 3H9GA 5DNAA 2BELA 3Q2KA 5KKAA 3S2FA 4BGIA 3GN2A 4YJFA 3RFTA 4CMIA 3LK7A 1CDOA 3ETEA 4BGVA 5KNLA 3R3JA 5JFOA 4LSMA 3GY0A 4ND5A 3OJ0A 5G2OA 1YVEI 4OIMA 1NNUA 5JDIA 1TI7A 1XDWA 4FIZA 2QRLA 4KDFA 1GCUA 1Q7CA 4YAGA 4L4XA 1NHWA 4FW8A 1QSGA 2CF5A 1LSSA 5JAMA 1GV0A 1SB8A 2HJSA 4I1IA 4J49A 3DWFA 4ILKA 2J3IA 3DHEA 4CMBA 5L3ZA 1PQUA 3DZJA 3WDSA 2AE1A 1V8BA 2Y1DA 1ZMTA 1UXIA 5BSGA 4BB5A 4JXKA 1T2CA 1ADFA 1ISIA 2JFGA 4XQ9A 4FC7A 2YYYA 3I6IA 2BI8A 1JDJA 3PHLA 1LU9A 3AY7A 3DFUA 4BNLA 3RC1A 4CR7A 4DIFA 2HDHA 5JDCA 4E5NA 3JQGA 3FRJA 2Z1MA 2JHFA 2W2LA 3I9MA 4IBOA 4AICA 4IQ0A 3PQDA 5EESA 5CEEA 3I9OA 5EERA 1PR3A 5F1KA 3MTGA 5JPIA 2JD0A 5T57A 4O0LA 2NVBA 5A05A 1GEEA 1CJCA 3PFWO 3ZWPA 1S6YA 5A06A 1PQWA 1LDNA 4DXHA 4YWJA 4CMIB 3PGXA 3DBHA 3O8QA 5DN9A 3GK3A 1ADCA 3TFOA 2GGSA 4NBWA 3QA9A 4OYRA 4R1SA 4ESOA 4TKMA 4NH4A 3WGIA 4OXYA 4PG7A 2NTNA 3KVOA 4ZJUA 4FSHA 4G65A 2PGLA 4QO7A 5JW6A 1LUAA 3GDOA 3HUDA 1E92A 4I08A 1X0VA 1IE3A 2GSDA 4II3A 3N7UA 1MA0A 3JQAB 2NLOA 1DC3A 3D4NA 4CLRA 4KMSA 2I66A 3EY4A 1QMGA 3F6YA 4WNIA 5GMOA 3Q9UA 1E1NA 3LLSA 3PJFA 3JQ6A 4W7IA 4Y98A 4KOAA 3PIDA 3AOEA 1E6UA 3ZU3A 2GD1O 5CDGA 1B14A 3TRIA 4W82A 3W1VA 4NR0A 2Y1CA 5BNIA 4D3SA 4FQ8A 1P1JA 4BNNA 3JQDA 4XD2A 1EVIA 3COSA 4TQGA 3IOYA 1X14A 3RCBA 4R3WA 4X54A 4IDCA 1I8TA 1PZFA 1ZSYA 2IEDA 4U0KA 3H6KA 2B4QA 3OEYA 3DZGA 4GPD1 4CM4A 4Q3DA 3ANNA 4AJ1A 4D45A 1H2HA 3A1NA 3JD0A 3HFSA 2EERA 4B4VA 4B4UA 4WKGA 2FR8A 1NM5A 4L73A 4QFDA 1B3RA 5K0ZA 2PH3A 5G0TA 3PJDA 3UH1A 1MLDA 1XU9A 2C82A 2E82A 3HN7A 2PZKA 2PZJA 2VN8A 3K9QO 4Q3EA 2DBVO 4BKQA 3LC1O 5TSDA 1U7HA 4Z9YA 4BGUA 4GLLA 3NJ8A 2DPHA 4E5MA 1UZMA 3ZI0A 4HV4A 5HBRA 1MV8A 2D3TA 5A9TA 2ZB7A 3KYCA 4U8GA 3S2IA 1SBYA 3C85A 3W8EA 4MVJP 3U62A 4C4OA 2DTDA 1FDVA 5HA5A 2PH5A 3HB4X 4B4WA 5L4LA 2XF8A 4YAEA 4BO5A 4ZA2A 1P0FA 1KEPA 1KYQA 4NK4A 3RC2A 2OMEA 3LT0A 4ZRNA 4UUNA 1E7QA 4RL6A 2Q49A 2O4UX 3ZW9A 4P4NA 3KYDB 5F3RA 2FOIA 3PWSA 5C5IA 3ZV4A 4TWRA 1B8VA 2EP7A 3WSVA 3D64A 4H7PA 4CM8A 3NTQA 3WWZA 4YBZA 3GN1A 4GVLA 3QWAA 2GR9A 1GUYA 1HT0A 1AHHA 1R0SA 5K6AA 5JO0A 2O2YA 2X86A 2YHIB 4OOFA 1WAMA 2OP0A 3JQCA 3RI3A 2I67A 1IULA 1E7RA 1QYDA 1EE2A 3BMCB 2YFHA 1WZIA 3Q11A 2IZZA 4HNGA 3WGHA 5HRUA 4FR5A 3ST7A 1X15A 4OO3A 5BSHA 2O23A 2X23A 3TZKA 2FPGB 3U5TA 2VYND 4R4JA 4PVCA 3BHMA 2GN9A 4NJOA 1U3VA 2ZCUA 3LVFO 2YY7A 1DOHA 4NU5A 5JAIA 3PHIA 4WCFB 2VTEA 2P91A 3NV9A 3PHGA 3IL2A 3PHHA 1ZK3A 4WPGA 4ZGWA 1NPYA 1ZMOA 4Y6RA 3DBLB 1SZJG 2BFOA 1ZEMA 1YB4A 2IXBA 2Q4EA 3OM9A 4PVDA 1OZAA 1P0CA 4K9DA 2J3JA 4UVHA 3PVZA 4YJGB 1E7SA 3UUWA 3PLNA 4IDBA 3UICA 2GASA 3RFVA 3WX0A 3TZCA 3FHLA 2YDYA 4BNYA 1UZNA 3WS7A 1Y1PA 3WTCA 2BGKA 3F5QA 3JD2A 2EJWA 3WGYA 1HWYA 5FF9A 3I9NA 1QLJA 5B4UA 2QRJA 1HSOA 3IMFA 1EFLA 3U4DA 5KJ1A 1QORA 2P4QA 4CODB 1ZW1A 1TVEA 5JBIA 1PJLA 3DONA 1LQUA 4UEOA 4EDFA 3AM3A 5ER9A 1X1EA 4CV1A 1MB4A 2VUUA 3JQ7B 4YYZA 2Q1TA 1B2LA 2HMTA 3GGPA 4XIYA 2D59A 3GHYA 3OP4A 4J1SA 1RKXA 3KB6A 4WEQA 4E2YA 3RUFA 1AHIA 4N5NA 1LNQA 1MGOA 4WASA 1W8DA 3AOGA 1Y8RA 1H0KA 5KJ6A 1Z74A 1A4IA 3DAGA 1K2WA 5TQVA 5JC8A 3LYLA 4PRLA 1NHGA 3G1UA 1GYPA 3FSRA 3PJEA 5IXYA 2YV3A 4GX5A 4NBTA 3ZWYA 3D0OA 1PL7A 1PEDA 3GG2A 1JN0A 3KYBA 3P2OA 2FY8A 4IDFA 5TT1A 1FF9A 1Z75A 3W6ZA 1YB5A 2BFPA 3ZU4A 3QWIA 3OSUA 2I99A 4R5HA 2VHWA 3E9QA 2B83A 3VH2A 5A9RA 1FDTA 2QX7A 2G1UA 2YQ5A 3I9KA 3QJ5A 3DOJA 3LF2A 1YL6A 1UAGA 2PFGA 4K6FA 3E03A 4P4GA 1DRUA 4DREA 1EUDA 4IZIA 4ZQFA 1Q0LA 2PKQP 4IQGA 1JLLB 2BH9A 4WECA 1UDCA 2EJVA 2EKPA 1ONPA 4XQEA 3VZQA 2VNAA 5KVSA 5AYVA 1F0YA 4CM9A 4JBGA 1DO8A 5HWSA 1A5ZA 4MVJH 1EE9A 2HMWA 4BKPA 1VSVA 3EC7A 1ADGA 3VPHA 3DHYA 4MPDA 1PL6A 1Z6ZA 3WB9A 2EW2A 2QIOA 3D3WB 3U4IA 1YONA 3KHUA 4JNKA 2X22A 1EBUA 4BMNA 1M66A 3DBVO 2Q4BA 3WQRA 4UVIA 4RZIA 1E3WB 3SEFA 4BQPA 5AQ1A 3D1LA 2ZK7A 4OMUA 4R9SA 4XGKA 2RBEA 1QYWA 4HNHA 5TIIA 4FDAA 5CHEA 3GGOA 1Q0HA 3I1JA 4PLZA 2ZJ1A 1ZK4A 3EVNA 3QWBA 4IS3A 4FFOA 2A4KA 4KP7A 2FHSA 4UULA 5L40A 2DM6A 1KEWA 5TX7A 4LRSB 2GN4A 3NGLA 3PWZA 4NI5A 3O9ZA 2VWHA 4JN6B 1G0OA 3VHRA 3SC4A 1Z73A 2TMGA 1GUFA 5T8KA 4TVOA 4L76A 4U7WA 4DPLA 3QW2A 4XYGA 3PXXA 4DPMA 5ICSA 1ZVMA 3GPIA 4XRGA 5IFLA 3GMDA 3HDHA 4QFCA 3QE3A 3GOHA 4IIVA 1WP4A 4LRTB 2NUAB 3FBTA 1PGNA 5JCXA 1P1RA 2PWZA 5CDUA 2VZ9A 1QLHA 1FDWA 4KWHA 2O3UA 4CMKA 4ZICA 1NPTO 1E3IA 2JHGA 5I7EA 4B3IA 2OORA 5U1PA 2Y1GA 5G0SA 1BW9B 4BNGA 4IIUA 2R00A 5MDHA 3EYWA 4EITA 4AJPA 2B37A 4P4LA 4RF5A 3BTUA 3JD3A 3INTA 3O26A 3GC6A 1BSVA 1V3UA 3GNQA 1X1TA 1IB6A 2QZ9A 3DHNA 2PD6A 3F5SA 4J1NA 1DFIA 3OQ1A 3FBGA 2FRDA 4NU6A 2VHXA 1SAYA 1PWXA 1R4MB 1E3EA 2NNLD 3ZGYA 2BF7A 2HK9A 4DBZA 1MXHA 4J4HA 5G4LA 1PGPA 1YQDA 5IG2A 5CG1A 5KVVA 4J7CA 4TMFA 4F6LA 2LDXA 4CUZA 3KZVA 4MVJA 2EF1A 5C7LO 3JQAA 4RVFA 4FGSA 2FPIB 1H9AA 2UUOA 4ZQBA 2ET6A 1NASA 4OM8A 1P74A 4IDEA 2CVZA 2GDZA 4IMPA 1PL8A 4R9RA 4QT0A 4BNZA 2H9IA 3MWEB 4Z3DA 1DC4A 5KJEA 4RPKA 3TOXA 3ON5A 3MJ4A 3ZWCA 1ZJYA 2Q2QA 3I9LA 2UUPA 1QV7A 5IAAA 4FBGA 2WDZA 1A7KA 1F06A 2AQ8A 5JAZA 6ADHA 2E48A 5ADHA 4PZEA 4CLHA 5J23A 5KKCA 3ONDA 2HLPA 4OAQA 2VNSA 3VPFA 3KRTA 1Y8QB 4PCVA 3ZCXA 5TNXA 3MJTA 4YXFA 3L07A 4EW6A 4L75A 2EGHA 4XYMA 3MJEA 2JAHA 4W9NA 1KVUA 2ZJ0A 4E5YA 3MOGA 3WYBA 5GZ3A 2PY6A 3UCEA 1EVJA 2V65A 1N2SA 3HADA 2J5KA 4OL9A 3ICCA 1VE9A 4LN1A 3BHIA 4E31A 3ZW8A 4B3JA 2PGDA 3KUXA 1PJTA 2QG4A 4NFSA 3NT4A 1E3JA 4A0SA 4GX2A 1GZ3A 3UCXA 1A9ZA 3WQSB 1A27A 3AJRA 5FYDA 3V8BA 3DOOA 3FWZA 4CPDA 4Q3BA 2P5YA 2UVDA 2X4GA 3L6EA 3LU1A 3OECA 2HMUA 1J49A 4G81A 5IF3A 1LSUA 4J16A 1GD1O 3QHAA 2H6EA 3T4XA 4B7CA 1TT7A 3F47A 1M67A 1ZJZA 3ZU2A 2NTVA 1HSZA 1Y81A 2NQTA 4IPTA 3BMQB 1NYTA 3KYDA 3ZWVA 2CNBA 1U3UA 4DQXA 3ROKA 2EP5A 4I5GA 1NQTA 4BO6A 1ZFNA 3HB5X 4FFPA 4MINA 4BNFA 4YRDA 1U1IA 5A1TA 2HCTA 3ZWXA 2V6BA 2WYWA 2CDBA 2YHIA 2FPPB 5T5QA 4BV8A 2HO5A 1YS4A 4K28A 3G0OA 1UXHA 3DAPA 3JYNA 4RVUA 2NTJA 3GGGA 1E7YA 3ETDA 2AQKA 1KERA 1EUCB 1XGKA 3BMCA 4Z0PA 3RIHA 7MDHA 4G5HA 3WMWA 1C1XB 3KBOA 4OQYA 4CM7A 3PTZA 4LVUA 4Z9XA 5H81A 4J3FA 2FPGA 4CL3A 1KOLA 2J5QA 2CVOA 4TRRA 1LBEA 3EMKA 4GL4A 4XEHA 1LSJA 3VTFA 4NBUA 4WCFA 1B0AA 5FEUA 3VZRA 3E9NA 4MIOA 2EKLA 4IM7A 2JD2A 4W4TA 3JQ9C 5IDXA 2HQ1A 3AI1A 2C0CA 4LGVA 4ROSA 3WGTA 4AJ4A 3DBLA 3OA2A 4YCAA 1EUZA 2VWGA 3K30A 3D4PA 1WNTA 3UGKA 3WGOA 4AJJA 3RBVA 5EQDA 3K31A 5IN5A 2V6FA 1Q7BA 4YJGA 5THQA 1I36A 4NIMA 1YBMA 1FMCA 4DBVO 2RHRA 3JQEA 4C7KA 1Q7GA 2P68A 1PS9A 4NZ9A 2YV2A 2JKVA 5L4NA 2I3AA 2B0JA 3ZV5A 1VLLA 3DZIA 3JCZA 4B7XA 3GFGA 4BO4A 4FJ2A 4CMHA 4U6SA 4LMPA 3I6QA 4GH5A 2WYUA 1EQ2A 1WDMA 5L45A 3JV7A 2NVUB 2HK7A 5TT0A 3GDFA 3ANMA 4MVJD 3LT2A 3W4JA 3VH3A 3JQAD 1LJ8A 1DHRA 3RSHA 1FDSA 5IZCC 3LF1A 4YAJA 2W2KB 4CMCA 5JCJA 1MUUA 5L7WA 3OIGA 3W4IA 1P33A 1T2FA 5KIAA 4YB8A 1R6DA 3JQ7A 3CMCO 3L4BA 3I9JA 4FFRA 2GCGA 1HE5A 5JY6A 1HEUA 3OJOA 4L8VA 1H6BA 3VPGA 3RUCA 2YHUA 4H16A 4MKXA 4XB2A 1O8CA 1E3SA 1YOVB 3DOCA 1X7HA 4E5KA 2ZQYA 5CDYA 4J2HA 4MIYA 4D41A 4IDAA 2DPGA 2Q2VA 4FPXA 4IXTA 4P22A 4U0JA 4Y9DA 2C59A 1J5PA 4W6ZA 2EW8A 5F5NA 1ENPA 4MP3A 4TSKA 3DMTA 3Q9NA 4KZPA 2BFMA 1HETA 3QVXA 2Y1OA 1W6UA 4Z9FA 1N1EA 5COBA 4UEKA 4YQYA 4ND3A 5JAQA 5T8KC 5A5FA 5C3MA 1MC4A 4JJFA 5ITWA 2ZTVA 1JW9B 1TB4A 3OMLA 4ZRMA 5AXBA 3WG9A 1K6IA 5JO9A 1CQIB 1A72A 1TXGA 3H8VA 3PYXA 4XQGA 1B3BA 3DZHA 4XZ3A 1ISGA 5DCYA 3STHA 5CDTA 4O6VA 4M8SA 3DTYA 4IY1A 1WVGA 1ISJA 1DFGA 3GPDG 3RFXA 3S55A 2FZEA 4W7HA 1JLLA 3GQVA 4O5OA 3G49A 4RDHA 4RLHA 4XQCA 4AJNA 3DZFA 4YT8A 1D8AA 1PX0A 4JCOA 2LDBA 1AXEA 4HFRA 5IJZA 3DB2A 1XLTA 1P3DA 3ENNA 4N5LA 4XB1A 3H7AA 3EZLA 3QIVA 1KBZA 5F21A 1BVUA 5TGDA 4DC1A 4FFNA 5B1YA 3B70A 1OMOA 4FN4A 4IQ8A 5KTKA 2C2YA 4RVHA 4FJ0A 4ZVVA 4MVJE 1LRJA 3OF2A 4NPCA 4BO9A 5ILGA 3PWKA 2J3KA 4B8WA 3AK4A 7ADHA 2JD1A 4ITUA 4L4SA 1R66A 5U9CA 4LK3A 4PLCA 3HDYA 1E3WA 3OICA 5L95A 1YL7A 4BL5A 2H5LA 3H5RA 4UUOA 5JMPA 1G0NA 3TZ6A 5A9SB 1EZ4A 2R6JA 3IIEA 3Q2IA 4BO7A 2DAPA 2CDAA 4M55A 4E30A 3VDRA 3B1JA 2EXXA 3D3EA 4FGWA 5I9MA 4B79A 5G0VA 1F17A 4FFLA 4YEDA 3P19A 2NU9B 1P1FA 3PLRA 3C7DB 3ZWBA 4BNJA 2HAEA 1K89A 3TSCA 4MKRA 3NGXA 3FPCA 1V0JA 4MOWA 3ROPA 3ZNPA 4L74A 1LC0A 1PR9A 5A02A 4AG3A 3I23A 1ZCJA 4PGFA 3WSWA 2NUAA 4XCVA 3JQ8B 4J90A 1R0LA 5KWEA 2VYVA 3PZRA 5EJ2A 1QG6A 1Y5RA 2R2GA 1I3NA 1YQGA 1BW9A 2D2IA 3NDIA 4DLAA 2XOXA 1UUFA 4K26A 3WXBA 1CQJB 1T2AA 3ZN2A 3CKYA 1IL0A 1RM4A 3ITKA 2EIHA 3PYLA 3ZU5A 4PZCA 1ZNQO 6LDHA 4XKJA 3UOGA 1SEVA 3FN4A 4YT5A 4BOYA 1M75A 3H9EO 1R4MA 3D4OA 3FTPA 2NACA 3FR8A 2VRCA 5L4SA 1W73A 3F1LA 4LCEA 1L1FA 2YV1A 1O9BA 1HDOA 4BNWA 4BO2A 1D1SA 1NX6A 4TRNA 2VOJA 3VPXA 3JQBA 4ZQGA 3C24A 1HLDA 1NFQA 2FPIA 2AQHA 3L9WA 3OIFA 2J8ZA 1ISHA 4OSOA 5B37A 1E5QA 1HDXA 5IN4A 2O7QA 1Q2XA 2X5JO 3IS3A 5C7OO 5ILOA 2C7GA 2Y05A 1BWSA 4YJDA 1VRWA 3MWEA 2Q1UA 2X5KO 1YE3A 3ORFA 4TROA 4RV9A 3UXYA 1EVYA 2P9CA 4KTTE 3TFQA 1U9JA 3SLGA 1QXSA 3PFFA 5IDWA 1X7GA 2CFCA 1DHTA 1NWHA 3AM5A 1GYRA 2IODA 3AY6A 4A2CA 4CM1A 1UH5A 4MJLA 1SCUB 3GZNB 5AXCA 3C8MA 2X9GA 2Z5LA 1W0CA 1DC5A 3ASUA 4GAEA 1Y8QA 1NR7A 1R15A 5IDYA 1UXGA 3H9JA 2OUIA 4J4TA 3W8DA 4A27A 4K1LA 4GSLA 5CAEB 3D7LA 1YH3A 2X5OA 1QYXA 2BGMA 4F3YA 5B4VA 1HDCA 4GKBA 3ENKA 3L0DA 3OBBA 3I52A 5CEFA 1XIVA 2X0RA 3FD8A 4ZD6A 1GYQA 2V6GA 3VZSA 1G1AA 5TS3A 4EJMA 2NU7B 1SC6A 3DDNA 2OP1A 4DIOA 1ZEJA 2PTGA 4J4BA 4E3ZA 1HKUA 2DFDA 1MG0A 2W2LD 1BDMA 2JJYA 5CP8A 4E4YA 3TN7A 2DT5A 3QWHA 3R6DA 1PJQA 4BV9A 2IZ1A 3DFZA 4YACA 4AJHA 2B4RO 2VQ3A 4E33A 1ZSVA 2VT3A 1T25A 3BTVA 2BI7A 4GWKA 2VUTA 4R3NA 4ALNA 1N5DA 1EMDA 4GGOA 3PP8A 3JYLA 3KEOA 1U2GA 1B7GO 3BMQA 3WR5A 1PWZA 4A03A 1FJHA 2CUKA 1EVZA 3V2UA 4DWVA 1B16A 1KVQA 3F46A 4GMGA 5KCZA 5LCXA 5ENDA 3G17A 1ZXBA 1JVBA 2EV9A 5L51A 3UF0A 4ALKA 3DXFA 2OGUA 5BNTA 1X7DA 2IXAA 3CE6A 4RF2A 4JLWA 2FPPA 3T7EA 1LEHA 5LDHA 4AVYA 3M2TA 3JD4A 3TF5A 4BVAA 1EUCA 1H94A 3AY3A 3GR6A 2C2XA 3DC2A 3N74A 3QRWA 2WEKA 1ONOA 5CDSA 1C1XA 4BGEA 1Q1NA 4F46A 5MGBA 1VI2A 1UJMA 2AMFA 3VKVA 4DIBA 2PK3A 4JBIA 4TZKA 1IZ0A 4DA9A 4K6CA 3NX4A 2VYVD 2D4AA 3JTMA 4HXYA 1VKNA 5JDIC 2Z95A 1BXGB 2HU2A 3EAGA 3MZ0A 1ISFA 1VM6A 1XELA 4CMEA 1GU7A 3V1UA 4DQUA 4D43A 4OXNA 3ICPA 4HFJA 4RVGA 5ES3A 3IJPA 2VT2A 2W8ZA 3ZNQA 4FS3A 2NADA 5BT9A 3BTOA 3G79A 5IDQA 1E6EA 4G2NA 4RGBA 2O3SA 4RPJA 4B3HA 3RU9A 3LDHA 1YBVA 4BNKA 3BIOA 4TVBA 4AJIA 3IUPA 2ZB8A 3CZMA 5TLSA 1N1GA 2VRCD 2RH8A 3TJRA 4RCVA 1TLTA 5L7TA 4J9UE 4OJNA 4P38A 3WJAA 2CF6A 3EGOA 5JDCC 3KSUA 2E37A 2NVUA 3P2YA 4WE3A 4EBFA 2AG8A 2AEJA 3JQFA 4DGSA 4MO2A 4E21A 2PKQO 4Q3AA 1Z7BA 1JVSA 3RC7A 1ZK1A 4IJWA 1CEQA 1PJBA 1LDBA 4JX8A 3X2EA 4FJ1A 2W2KA 1DEHA 3FR7A 1GQQA 2JCVA 3OA0A 1QP8A 2AQIA 3FCOA 5BR7A 4GX0A 2C5EA 4EUHA 3ZWOA 1XEAA 1GTMA 1PTJA 1T24A 3A14A 1HE3A 4J1TA 5T6BA 1FDUA 3PPIA 1U2DA 3GVPA 4WUVA 1LA2A 3ADOA 1BHSA 3IKVA 1LXCA 4CMGA 3WBFA 3PQEA 2A35A 3PIIA 1KEUA 2ZYAA 2B69A 1YOVA 2C29D 3PDJA 2HRBA 2JL1A 3GUYA 5KVCA 3KOUA 3FWNA 2HRZA 4A73A 4Z3KA 1DDOA 2DTXA 3K96A 3GA0A 2B5VA 3AM4A 4S1VA 4YT2A 3TDKA 4XGIA 3M1AA 4JROA 4IJUA 3SLKA 1HDZA 3WYCA 3JYOA 3AOEC 2DUWA 2JAPA 1CQIA 4DPKA 4RF4A 2ZIZA 1H6AA 2NSDA 2Q2WA 4UVEA 2G17A 4E13A 2EEZA 5DULA 4R16A 4OKNA 4MP8A 4UVGA 1ENOA 2P2SA 4BKUA 3VTZA 1RJWA 5EIOA 3GAZA 3C1AA 3U0BA 2DQ4A 4M87A 3WMXA 1ENZA 2UAGA 3OH8A 2PD4A 1LLUA 3N58A 4R68A 2QYSA 4PFJA 1JKJB 4RQUA 1GADO 2JCYA 3RQSA 2AXQA 1Z7EA 4GX1A 2H1SA 3RUDA 4NFYA 1GY8A 1UR5A 2CDCA 4CLXA 3QVWA 3GLQA 1DB3A 3HE3A 3DZKA 1EEHA 1B8PA 3F1KA 1CRWG 1R37A 1C0KA 3V1YA 1LQTA 4PZDA 4M86A 4ND4A 9LDTA 4YRAA 2C07A 1E1MA 1U8FO 4KQWA 4ZHSA 1C14A 3U9LA 2GN8A 1DJQA 3T7CA 1A9YA 5A9SA 4IXWA 3KSDO 4WK6A 1M6HA 1O5IA 3TZQA 5DT9A 3BYZA 4IINA 1PZHA 1V35A 4UEJA 4XIJA 3H5NA 4JQCA 1XA0A 1Z82A 3SXPA 4PLVA 1DBVO 1TA4A 5B4TA 1LRLA 2NU9A 2X6TA 2AEMA 5KJFA 4RORA 1J4AA 3UAGA 5DP2A 3P5SA 4TRMA 4CL8A 2ILTA 3GEGA 4BMSA 4XA8A 1Y6JA 3W4KA 1E7MA 3F4LA 5JYEA 3DZBA 2ZYDA 3JYPA 3RC9A 2P9GA 3VAZA 1YDEA 1JWBB 1P31A 3JQ8A 1WMBA 1ARZA 1ZZEA 4PLTA 1K6XA 5K6AC 3CTMA 3ZHBA 3LSYA 3JSAA 1I33A 5TRTA 4HBGA 4O59O 1U4OA 4Z6KA 5LDGA 1R4NB 5FI3A 3RASA 1IUKA 3BXXA 3UN1A 3W8FA 5G0UA 1T4BA 2DKNA 1CQJA 1NVTA 2GLXA 4OGWA 1TEHA 4OXKA 3R1IA 1BGVA 4CQLB 4GWGA 4D3DA 5GY7A 4GGPA 1GEGA 1SOWA 4R1NA 4PRKA 1HYEA 4BNXA 1KEVA 3EDMA 3RUIA 3WGQA 4KQXA 2YQ4A 1XHLA 4ZQHA 3S8MA 5IZ4A 1GAEO 3DTTA 2VWPA 1V3TA 1NQ5A 3C7AA 3EW7A 5DBFA 1WDKA 2B36A 3QQPA 1V3VA 1H2BA 4JIGA 2C20A 2F00A 4EJ6A 2IDZA 2QZZA 4QX6A 2W98A 3L9XA 3IAHA 3KTDA 3LT1A 3E48A 1C1DB 2O48X 4CM6A 2VZ0A 4TRJA 3BMOB 1Y9AA 1EDZA 2O2SA 5I7VA 5TF4A 1UP7A 3TL2A 1ML3A 4CM9D 2J6IA 3S1LA 1YQXA 1DJNA 2D8AA 3ITDA 2Q1WA 3OEWA 4WLFA 1IPFA 1GR0A 5I9NA 1I32A 2OL4A 5ITVA 3CSDA 3R0IA 4F45A 3UHAA 4XWYA 3WFJA 2PA3A 1UP4A 2FN7A 5DBIA 4YQZA 4CUKA 2YDXA 2G0TA 3HG7A 3R3SA 1K0UA 3NDRA 2V6MA 3GG9A 3PZBA 3QP9A 1ZBQA 3TPCA 5DBGA 3WNQA 1JKIA 2DU8A 3DMYA 3DO5A 1YWGO 2OBYA 4GMFA 4IDDA 1SCUA 3GZNA 2G5CA 2UYYA 4WLVA 1P44A 5F5LA 2FP4B 1MX3A 2G76A 1DAOA 4N54A 3VDQA 5CAEA 1I10A 1AN9A 4RF3A 4A5OA 3E5MA 1LLCA 3PGJA 3WFIA 4E32A 2Q3EA 8LDHA 1VJ1A 1CETA 1RPNA 2GZ1A 1Y7TA 4IMRA 2YZ7A 3E18A 3ZNOA 4IJKA 3K92A 1DIAA 4BHTA 4INAA 1ZO8A 3WWYA 2NU7A 3IKTA 1I5RA 4IGFA 2OZPA 3HWRA 3KO8A 1H6CA 4J2OA 2XAAA 2C7VA 2BRUA 2J3HA 4CMJA 4D7AA 4E2ZA 3PQFA 1KS9A 3SJ7A 3KLMX 2IE0A 4JP3A 3WLFA 4R01A 1GUZA 3ETGA 4MP6A 1F8GA 2I76A 4FC6A 5DF1A 3SJUA 3WQQA 4CR8A 3LLVA 1XCBA 5LC1A 2F1KA 4HFNA 4DRYA 4WLUA 5H82A 1PJSA 1YDWA 1GQ2A 1UDAA 1YKFA 4XYEA 3HDJA 2DC1A 2Y0EA 3IP3A 3NTRA 5ENVA 4AFNA 1JU9A 1UDBA 3GDGA 1HF3A 9LDBA 2FWMX 5KJCA 3AU9A 4CLOB 2EG9A 3P7MA 5G4KB 1G6KA 2PKRA 2A9FA 3MWDB 3I4FA 3L6DA 2B35A 4YJHB 5CG2A 1NAHA 4MIEA 3CINA 1PZGA 2YFQA 4HADA 1QV6A 3IQDB 4TZTA 3HFGA 1NVMB 2I5PO 2NVWA 2EKQA 4UUPA 3WLEA 3RUEA 5CFZA 5COAA 5BNFA 1RWBA 1T4DA 3IC5A 4FD3A 4PG4A 1OFGA 4KUHA 4M1QA 4YR9A 1SO8A 5F1OA 1PS0A 1PJ2A 3H65A 1PIWA 3AWDA 3E9MA 4RPHA 5I7FA 2RCYA 1CF2O 2YJZA 1ULSA 4CV0A 2E6UX 4QSMA 5TJ9A 2X0IA 3H3JA 3DL2A 1BXGA 1XSEA 1BXZA 1YJQA 4AL4A 5JS6A 3BA1A 3GAFA 3GNSA 4Q9NA 1PZEA 1SPXA 4R69A 3QVSA 3VH1A 3GVHA 4WEOA 2D1YA 2OO5A 1OOEA 2QRKA 4M49A 3GVCA 3S2GA 3G3EA 2RIRA 4J91A 4J7XA 4PLYA 4AJOA 2HUNA 5EINA 3PDUA 1MXFA 3UKOA 3ZWAA 2DBZA 2PD3A 1XQ1A 4PN3A 5JY1A 3KSZO 3AUAA 4KTVE 4BKOA 3OJEA 2A92A
chains in the Genus database with same CATH superfamily
2QS9A 1W0JA 3VGPA 3I4CA 1WMDA 1ZKMA 4L0QA 3CYFA 4FP9A 2EZUA 4W5QA 2QQ0A 2AOUB 3CRVA 3QY9A 1SCIA 4GNKA 5CPFA 2YXDA 3L92A 1FLVA 2ZAMA 4ZI2A 3EHEA 1PT5A 5C8DA 4OFBA 1HORA 2R00C 4NENB 2RD2A 3IQIX 2XYQA 2X8LA 3X1WA 2CCGA 4KXVA 4QBFA 3WGGA 1GL3A 2BLLA 2W2MA 1A0OA 1OA0A 3ANLA 4JJ4A 4UM8B 2OBFA 5HM8A 3DE6X 1T9BA 4M89A 3DO8A 3BCSA 4NMHA 1FFGA 1IK6A 1GZ4A 5LZ4A 3U4CA 3B85A 1KY4A 4U02A 3RWOA 1KK2A 1DCFA 3T4EA 1T5HX 2MR6A 1HR0B 3EUAA 1ECJA 3QTBA 4D4LA 3K1AB 4GI1A 3UV6A 4QOJA 3PRHA 2D5CA 1YS9A 4HF7A 4PLFA 3WV5A 1WZEA 3I58A 5JNTA 3W8NA 2YWJA 3ZBPA 4INPA 3LHIA 2DT8A 2I0FA 5K99A 2BHSA 3W2FA 4I5IA 1SOUA 5KPDA 5KYVA 3UANA 2H9AA 3EXAA 4YV7A 4OTZA 1Z68A 4C0SA 1Q19A 5ICMA 2WD7B 1D6MA 1DRWA 5DLDA 5GAJA 1DIBA 3KK0A 5FJIA 2PR7A 2O20A 2ZETA 4IH4A 4GLOA 2HJRA 4BU0A 2FW1A 3VU1A 5P21A 4NMLA 3OX2A 4WN9B 1P4SA 2PV0A 4EPVA 4HLUA 4IYJA 1E2NA 4O4LA 4H59A 2WTNA 5K51A 1RWMA 1B0PA 4K8RB 4PS1A 1P4AA 3B5IA 4Z4FA 3A3NA 5CEJA 3F3MA 1Z25A 1FBTA 1FMJA 2J7KA 1FUUA 3S5JA 4BNTA 3W6UA 2Q1SA 5H3LA 1I4DD 4LZOA 3WWOA 2FMUA 4QKQA 1EFUA 1X94A 2QN8A 3CUWA 3KV3O 1U3DA 4QGGA 4C4SA 2J3MA 5FBKA 4AJLA 4B84A 3STUA 4Q1FA 1P45A 3K0KA 4JBHA 3NWJA 5TF0A 2IH5A 3IUYA 5FWNA 4D3XA 4KG7A 2ZBRA 4AUEA 2QPOA 2B7CA 3T4PA 4XRRA 3U3XA 1EXVA 1YI1A 4XIIA 3B6ZA 3NW9A 4F2HA 3PDHA 4R0VA 3E6AA 2NZWA 3AFOA 3KQYA 4OLFA 4QEDA 1AE1A 4IS2A 4XXHA 3Q10A 5U4XA 4GYKA 4DLLA 1WSBA 2J08A 4W9NC 3TFWA 4ZZ0A 1AOXA 3U09A 2NZVG 4C04A 2QHXA 2ERCA 4OQ4A 1VKRA 4MAMA 3M2PA 4E2WA 5K3EA 4A6EA 2H2IA 4JU9A 5IDVA 1PLKA 3RHSA 5LIPA 1XNQB 1OIXA 1CYDA 2OUKA 4HDCA 3WL3A 4DOMA 1B8UA 3L5KA 4E5UA 4OHUA 4B81A 1JYEA 3ASVA 4JB2A 4NFHA 1RXIA 2ZT6A 3NRJA 1J8FA 1M6VA 4MVJM 2QP4A 1TADA 3MNFA 4J6EA 3G2OA 1OIWA 1X7ZA 2KJQA 2OHXA 3O0DA 3OZDA 4G1MB 1B76A 1LLDA 5EHNA 5F4ZA 1EQUA 1Y3AA 2ZRLA 4Q48A 4XWKA 4AF8A 1Z7GA 3AHIA 4BDTA 1N9GB 2GEJA 2L18A 4JC0A 5AXAA 3LW7A 1SGWA 2NUBA 2WABA 4Q16A 3GCGA 3QKIA 4XGNA 4XAQA 4GEKA 4Y2PA 2RHCA 4PXYA 5J5CA 3OQBA 3RHFA 3AUTA 3W77A 5AM4A 5CFPA 5JSZB 1XTBA 3IAEA 2GRAA 1F1BA 4S05A 2JZCA 1N2XA 4FKMA 2WQZA 2P3OA 3VC7A 1KSHA 1LRKA 2NQ2C 5FI0B 1U8UA 1GVNB 2GM9A 1U5CA 3E58A 3QX7A 2JIOA 4BIIA 5FOXA 2P5UA 3DCYA 2SCUB 3BJEA 3FNFA 3FOAA 3SZ3A 5LQCA 1UKYA 1ISMA 4OB8A 1CFZA 5J2UA 4ZVKA 3ZDFA 3KJFA 1AUVA 2RC6A 3NT5A 4NF2A 3DR3A 3FFAA 4NQZA 1R0YA 1R4NA 3CRRA 1MFPA 4BJ1A 5F1PA 2C78A 1E1LA 2IGTA 1QRRA 4RELA 4E6PA 1KC3A 4RTPA 4P5EA 3WLLA 2P2LA 3GYGA 5KTMA 2C4VA 3IAM1 3IERA 4B2IA 2K7FA 2NUTB 4ZKEA 5B2ZA 5REQB 4NBRA 4YAUA 1XMSA 3I6ZA 4CQLA 1C0PA 1FQJA 1PHRA 1U98A 4CIAA 1PFWA 2JASA 1TKAA 1I13A 5TVGA 1DWUA 2C4TA 2CLHB 1UT6A 2CK3A 3Q0TA 2GYYA 1N7GA 1C0IA 2WSBA 1E8MA 1Q15A 3TKYA 1JQJC 3THWA 1ZESA 1PKXA 4G25A 1M7GA 5FPPA 1LVHA 2XVMA 5HZHA 3UOAB 3EVEA 2VG8A 4HNRA 4WCFC 1FU4A 1W4BA 5K8JB 5BN3A 1TVKA 3AL0C 2I2BA 3IMKA 2JI7A 1RHJA 1Y6QA 3CLTD 1PBTA 4MW2A 4WDQA 1BVRA 2XUPA 1RMQA 5KINB 5FPSA 1RHKA 4ZYUA 3WVNA 4UUBA 1UKAA 1WY7A 4OG2A 3ZIUA 1BXKA 1LLQA 2XXBA 5BN4A 4ID9A 4GLBA 1EGAA 1U0OC 3HRIA 4B2LA 2AOWA 4N3AA 4WKBA 3W5DA 2EWMA 3CLUC 1ULAA 1X8XA 3LZ6A 2OFFA 4DXDA 2HHJA 2R7MA 1NJ6A 1HDYA 2EGGA 1OI2A 1YR3A 2C2GA 4HAYA 4YPVA 4AWBA 1PFKA 4FKBA 1KSJA 2IYYA 1ZRSA 1XLWA 3GT0A 4NYIR 4EFKA 1KWKA 3Q3IA 3ZZ0A 2I4TA 1CUZA 2HBZA 3H2KA 1WMSA 1QRSA 1JEOA 2NU8B 5EIAA 5I3ZA 4IF6A 1GGEA 2XCOA 3DVRX 2Q41A 4OQDA 4GVPA 4RS3A 5A4JA 1JTEA 4MULA 2TYSB 1LPAB 3VH4A 1C0LA 5IBRA 4YO7A 2I4LA 2FR0A 2J6HA 2Q3FA 3IQZA 4IHKA 2GF2A 2WFLB 3IJRA 5M5BA 1YGYA 3EISA 1DUSA 4I7EA 3PNKA 4KFTA 5DTQA 2XTMA 5DX8A 1MX1A 2VJNA 3K6JA 3VHLB 1X9GA 3COYA 4YT4A 5DLYA 1D1PA 1YMUA 3PC8A 1L5YA 4JNCA 4K9PA 2AA3A 4TMKA 1IN8A 4RFSB 4QGAA 5D85A 5JVDA 3JZFA 3I8XA 1DMSA 3R0QA 1I7PA 1E6LA 4QRIA 1ZM7A 2P65A 4MPRA 4A0HA 4KRYA 1T0IA 1HI9A 2QPLA 1HE2A 3Q5GA 3SJBA 1BMQA 2NSHA 3LI2A 4ZEXA 4EI8A 1XV5A 3HMKA 4RIEA 1D1TA 3CZRA 3F7TA 4HC4A 2O2IA 2ZTUA 2FQXA 2QGZA 4BY9E 1FP2A 1GPDG 3H4VA 4ZFNA 4UDNA 4C7OB 2V7XA 2XBLA 2B5WA 3KAPA 3RWBA 5FA8A 5JJLA 3I3SR 5E6SA 3C1OA 1IN7A 1U7DA 2EZ8A 2EX4A 4FOTA 4NEGA 1M34B 2XQJA 3DMPA 1PZNA 2ODBA 1HKHA 3FNGA 4LCJA 4QFBA 3NTOA 2EJUA 3KXDA 1YE5A 3PJGA 3ZZ1A 3A6KA 2VK2A 3AKCA 1X7WB 4LJ9A 1QK4A 5HJ7A 5EHGA 1ZIDA 4BQOA 2ZRQA 3W9SA 3FTFA 1QUEA 4WAUA 1ID1A 1FVOA 2OHGA 3NBXX 2VDKB 4OHPA 1XZDA 3E7FA 1T36A 1LDEA 1LDGA 2XYGA 4FWBA 4F72A 5C52B 1SD2A 3CISA 4JOCA 4G24A 1DLIA 1XHFA 1QKIA 1XLTC 1Z5UA 3E7WA 1KVRA 3N2IA 3F9RA 3QUTA 3GJ4A 4HX9A 4H7JA 4O2LA 2HJ9A 2XWSA 3HR4A 3L6BA 4K05A 4OHFA 4Q7LA 1F0PA 3B1FA 2QNRA 4MV1A 5G4KA 2OSBA 4E4TA 3AVTA 1D4FA 3H2BA 2IDKA 1X0XA 2Z1NA 3PI7A 1HFKA 1HURA 4QXMA 1U65A 3ED5A 1YRHA 5ECGC 4ZAFA 3VHXB 3PDIB 2QN1A 1VYUA 5IVKA 4ZHQA 2CSUA 1U0RA 2O50A 4KQCA 4RKRA 2MIIA 3AUUA 4J43A 2AN9A 5DNVA 2ZBDA 4JQYA 1CEEA 1GUAA 3ZK7A 4B5KA 4JC5A 2QJRA 4P8RA 1CR2A 3ZH2A 1TF2A 4I8XA 4EZIA 3I09A 4UASA 2CHUA 3SE7A 4CEJB 1OU4A 2HKIA 2VHVA 2CEKA 3JQ9A 3PIRA 1MPTA 4M1OA 4R2LA 4QM7A 5DBOA 3BWBA 3A8TA 5KVQA 4PSUA 2WG2A 2OFPA 4QYIA 4GR5A 4R7GA 4BMVA 1DLJA 1VL1A 1I3OA 2B1QA 2GWHA 2JRLA 2VF7A 3LLCA 4TV9A 3QENA 4Y8VA 3TQTA 2XCUA 1I4WA 3HB0A 1Z2EA 3R3XA 4YCMA 5F5XA 3ZCQA 1JGTA 4NXMB 3G2JA 2R5WA 2FCRA 4ND7A 3LPDA 4EMSA 3VSBA 3VNQA 1V9CA 3B1WA 3EG5A 4YECA 1L8OA 1WU7A 3KAKA 8ADHA 1SG0A 4WLEA 1EM8B 3IRUA 4OL0A 3FZQA 4KL8S 3OHSX 2C1XA 2GZRA 1V71A 2NMVA 4AN1A 5EMNA 2PX8A 4GPAA 5DI9A 5EJ4A 1NXQA 1P4HA 1V7ZA 5CJPA 3UPDA 3H17A 1W4LA 1UPFA 3K2BA 1NTOA 2BR5A 3MEQA 2QE6A 4HI0E 4MVJG 4QPJC 4Z99A 4TT3D 4RADA 3GA5A 1E0DA 1QZ3A 3KDPA 4LMRA 1P1IA 1GA1A 4DT1A 1ZUNB 5FTNA 5A3RA 3LY9A 1AGNA 1S2DA 3H5OA 4U7PB 4BKRA 3NOXA 1W5AA 1J23A 3IEMA 3V2HA 1BMFA 1MR3F 1MT3A 1NXWA 1FOEB 2AYZA 2FV8A 3FSJX 4O1HA 2JLCA 5G40A 3SXUA 4CJXA 1RADA 1TD9A 3I3OA 4ALJA 1QG4A 4ESHA 5KHLB 4M99A 4QBHA 4IDQA 1SRQA 4DQLA 5CYGA 1IZ9A 1P9WA 2V6IA 2XD4A 5JR3A 3CEAA 2XB4A 4DMRA 3LJKA 5LYJA 2H2AA 3BFKA 4FK8A 4ZVRA 3BWXA 4I3HA 1T5IA 4RULA 4Q4JB 5JI2E 3OD5A 4BUCA 1RWKA 5T41A 4Y18A 1PT8A 2VPYA 3HA3A 1JLMA 3ESXA 4N6NA 1WTAA 3C87A 3ZWDA 1HDGO 1C0EA 1MP0A 2AYYA 1GG9A 1TJPB 2ECFA 4KB5A 4WIAA 2NWQA 1C7ZA 1C4KA 1GZUA 1QO7A 2RH4A 3T3DA 1A5AB 4DV3B 3AFNA 4CLRB 4PU0A 1WXDA 4HDQB 4I3FA 2CMDA 1VSQA 5FFFA 3TKLA 1F7VA 3B1YA 5DTIA 3WGMA 1DXYA 1VL8A 2QZSA 1BKSB 2WHEA 4BCBA 2IBTA 4NNOA 1ZM9A 3UVEA 1W5TA 1JECA 2M2IA 4NG5A 5AVUA 2A30A 3U4GA 4KLCA 5JE8A 4CXMA 1JF8A 1VPLA 4CQMA 3CCFA 1UM9A 1BJRE 1IY2A 2CZCA 3ED1A 1II0A 1OZGA 1MVLA 4HAOA 3QY0A 3B20A 5JWOA 1U2PA 3VR1A 1EFKA 2FOXA 4XUEA 2CYAA 1G7RA 2TMYA 5DP1A 3QW4B 4IFTA 1X38A 4RBNA 2OXIA 1SWVA 2KWIA 4LA4A 2AMVA 4QUHA 5BWCA 5JLAA 1RP7A 2JA1A 3HNPA 1GPJA 2VSXA 1F2UA 1BX3A 1U3CA 3FYUB 5FRDA 3UXMA 3EEOA 4KDCA 5KHOC 1OFUA 5JJKA 2A0FA 3RT9A 1D7OA 1XXLA 2AZDA 2HRQA 2Q45A 3NAMA 4J3JA 4H17A 4EL5A 5I45A 5BQ5A 4EF6A 3KETA 1T9GS 1XJQA 5IJ0B 3ROMA 2LIPA 2NM0A 4MLCA 2C4WA 4YP7A 3HJFA 4YS6A 4I66A 3OWHA 4PYNA 3U1TA 1IUPA 5JSQA 3O93A 3T7CA 1P72A 3HSKA 2QL6A 3KOYA 3HCRA 4Y6SA 1PK9A 3WLOA 2X3YA 2ZWVA 1P17A 1SR8A 4MVXA 5FQNA 2GJAA 1VLVA 3R5HA 1M2EA 1U63A 1RHRA 2VZ8A 4GOKA 4I14A 4IZHA 3NUGA 2M6KA 2J7PA 1OTHA 2YNMD 1ZP6A 3QA3E 4Q3CA 5FDFA 4PRZA 1MO4A 5F98A 1M2HA 1ADBA 2ZAOA 1H5QA 4OFZA 1A4RA 3DYIA 3BFVA 3TE7A 4BCDA 4JITA 2QD3A 3EPRA 1P2VA 2WIJA 5C1IA 2DHCA 4BVFA 1M33A 2LD4A 1R6AA 2CFTA 5CUQA 5F2NA 1T26A 3Q40A 5IYZF 2ROQA 3Q7IA 3O74A 4Q3NA 1WDWB 1ML4A 1U90A 3LCJA 2B20A 3ZEIA 1RWWA 4YRBA 4Z7NB 1WW2A 4Z0TA 1P81A 2ODEA 4F71A 1I7DA 1L6IA 1U5BB 5FPQA 4BLRA 3UMBA 3OSZA 4DMMA 4WL0A 1KI9A 1NJ1A 3QKTA 4ZVMA 2BJHA 1AY0A 1W9HA 3IDSA 1L6RA 3UFXA 2AC4A 5LZ2A 2OV4A 2GBLC 2BFNA 1N3YA 1XOIA 2AHRA 1UKCA 1D2NA 2OEPA 4NJMA 1AS0A 4OAOA 4GU5A 5KTRA 3QPVA 4LGCA 4KODA 4CM8B 1XDBA 4QQNA 3U48A 2PLRA 1WXIA 2AEFA 4DYHA 1UPBA 3B51X 3I5MA 3ZHRA 3OT4A 1UP6A 2UU9B 2CHGA 4KQ9A 3GFSA 4J1QA 3GJYA 4FZ3A 2CLEB 3BWEA 3OCVA 4MW1A 4OEHA 4ZO8A 5GJWC 3KQNA 3OQOA 1PEYA 1BQ3A 1CZNA 1JG7A 1MD9A 1U28A 1KMQA 1A9OA 2CFSA 2X9NA 4RVOA 1KGDA 3DOUA 3S2EA 1KBQA 3I2JA 4JUIA 4MCAA 3UJ6A 1JJ7A 2QAGC 4D81A 1BS1A 2NT4A 3E70C 2WU8A 3OPYA 3ROEA 3JYQA 3NHAA 3OY7A 3T94A 4YRGA 5L3SA 2GUWA 2HJHA 1CERA 3K8YA 3KLPX 4YA6A 1ZHOA 2OCIA 2CLFB 2WLSA 1C8LA 3IQFA 3EFBA 4AZ3B 5HF9A 2B2XA 2P6OA 3JD1A 3CT4A 4FD2A 1CLEA 4XR4A 5I8ZA 4C7KA 5LM3A 2JLZA 2QLBA 2HWKA 4BNHA 4YCNA 2GUGA 3N7TA 5SZIA 1IOLA 2J85A 2QTTA 3N9IA 4PG8A 4ZEMA 4PIVA 3N2NA 5F76A 2YHBA 2ATCA 5ALOA 3WZMA 4FEYA 3VR4A 2GN6A 1X3SA 4KQGA 3I8OA 1E60A 1ELOA 1LS1A 1KQGA 2GPSA 3C6QA 4AJ9A 4P34A 3FMPB 4REQB 1ZITA 4HN9A 1HGXA 1KZ1A 2WF5A 4N3GA 3SEQA 3VC2A 1EESA 2VJYA 4YCBA 3OZIA 3EK2A 2XKBA 4MV5A 2NXCA 1U2EA 2W5UA 2YNMC 2YY5A 3UA4A 1AQJA 3RLFA 2PZMA 1ZUIA 3ASYA 3CRW1 1OYWA 2OFXA 1MQ8B 1NT2A 3ELBA 3HVUA 2IZOA 3OETA 2CLLB 1I5EA 2I80A 3ES9A 2HIGA 2CVQA 3LPCA 3R3UA 4TL9A 3TBKA 5B3JC 4FGUA 1QC5B 2VBIA 1YR7A 4KYTA 1BO6A 5AP9A 1WUYA 2GN1A 2D62A 5I7UA 4Q39A 4BMYA 1AIPA 3MJDA 2IYTA 3MQFA 3RS0A 2UV8A 1RYBA 2FX2A 2LKDA 4XJXA 3H05A 3SC6A 4NONA 4YY3B 1VTKA 3ZUGA 1J5EB 4MI6A 1XAHA 1Z33A 4RV4A 3IBCA 1Y3FE 5K0JA 2I7DA 1L7DA 4M9CA 1YOBA 2E55A 4X1KA 1H05A 1DIOB 3Q98A 3JWIA 4CU5A 2IZ5A 2ON6A 4EL0A 4Z4EA 4TTVA 4HDKB 4RK0A 4CQMD 3HHPA 1JMVA 4I2VA 1NP7A 1XEFA 3B2NA 1N5JA 3GWGA 4IVNA 3TAUA 1N2EA 3Q7RA 4E2FA 4LJ8A 4Q05A 1QR6A 4Y67A 1AS2A 2Q50A 3U7IA 4ABTA 3EEFA 3TOCA 3RU7A 1Y8RB 3DFIA 1QK3A 3AI3A 4QGBA 3HKCA 4GYYA 1RCTE 4PNPA 4B4OA 4KSCA 2ZYUX 3SN6A 4ENUA 2C5FA 2FHPA 3GPLA 1B0ZA 2NSLA 1QH8B 2CGEA 2HGSA 3EIXA 1O58A 1E4EB 1PYGA 3V5NA 4YR7A 5FPKA 2XJ9A 2VSNA 1UFVA 5K4HA 1Y5MA 4OYYA 1JA9A 3SXJA 5JQWA 1FZQA 4F5EA 4B9EA 3Q7EA 2DFKB 1PWEA 3DCJA 3MRTA 1R0KA 4RENA 4C4ZA 2ZR0A 2B2NA 1DAPA 2CJYA 4YMUA 5LQDA 1GTRA 2PS3A 4ZZ1A 2MSNA 3FH0A 3KQOA 3VZPA 5EWJA 4NHEA 3PRJA 3W79A 2EJTA 4MYTA 5GVRA 2X7HA 2ZTMA 4IJ6A 4XDYA 4WZAB 7MHTA 1I01A 2VHEA 3ZX5A 1S7CA 3AYXB 1QDUA 2KX7A 5U4QA 1EWYA 3ZXUB 1BJKA 3BAFA 2ZYIA 4P58A 4HKTA 2QTZA 1NWCA 2VC2B 1JKXA 1OTXA 4YP0A 4ZVPA 1XDGA 3W1EA 3EVCA 2FW7A 1I9GA 1NR5A 1XVUA 2JANA 4JYAB 2R7NA 4XYBA 2IYEA 1PX2A 1US8A 2YC4C 3BD9A 3KJEA 4I5EA 4D44A 4ZTBA 5LPNA 4XCXA 2V96A 1G38A 1JIIA 1JU3A 2BE7A 1E1YA 3AFMA 4Z53A 5JG7A 3S0JA 2RGCA 4Q3LA 3BA6A 5TXGA 1KVSA 4C1NA 3MJSA 1CUAA 2N9UA 2Q6KA 3EUEA 1M7BA 1D2MA 1VPDA 2WHYA 3KG2A 3KSAC 2ZQZA 3H5VA 3NKFA 5BO5A 3W2GA 3IMEA 4IJVA 3IRVA 1RM0A 2BELA 3ABSB 5TPWA 2NP6A 2J4FA 2D2EA 1BS2A 2VJOA 1BJTA 3MVEA 3GX1A 4PANA 3N0TA 2EKZA 2Y2UA 1CDOA 4BGVA 1KZ6A 1JXOA 1MRSA 4OXXA 4MNTA 4TLMB 5G2OA 3SMQA 2WBLC 3BERA 3D81A 1LJLA 4K3UA 4OIMA 1ONBA 1A8UA 3OZVA 1UMDA 3G23A 1IQRA 5CW1A 2RI6A 2QRLA 1GCUA 4O2AA 1M2JA 4YAGA 1JKMA 2IYVA 5E2AA 1UOQA 2CF5A 1BD3A 1MEEA 1XL0A 2PSSA 1GV0A 3DEKA 4OHKA 2HJSA 4J49A 2A8YA 2RJ3A 3EOBI 4ILKA 1SXJE 1HDIA 2D2VA 2ZTSA 4BCCA 1SUBA 5JXIA 1V8BA 2FN9A 5T7BA 2Y1DA 5KHAA 4XCQA 1VHJA 2FW8A 3OWXA 4KXYA 1OZHA 2I1VB 2HDNB 4JXKA 1Z6PA 1T2CA 2BL4A 1ISRA 3TRHA 4UHCA 1WLSA 3A25A 2J9RA 3DWIA 2R8XA 4ICIA 2GZDA 4GZLA 1Q17A 1YSCA 2C2OA 2FW6A 1JDJA 3PHLA 5KPJA 3JWGA 4WSOA 1LU9A 2ACKA 2ZJ6A 3DFUA 2FFAA 4CR7A 1KAOA 2F4VB 1USIA 4GMXA 3FRJA 4EX6A 4EA8A 3DNPA 3LY7A 5CVUA 2W2LA 4QPNA 4AICA 4DQDA 4EW2A 3OCJA 1E98A 3V3KA 2H0QA 2ZTHA 5JPIA 1GA4A 4ZDWA 3FZNA 5T57A 3HVJA 5KQLA 1GEEA 2QTLA 1KEEA 3OHPA 3A4LA 3PFWO 1E9VA 3FVVA 3QEBZ 3ZWPA 2FEMA 4G9BA 5A06A 4DXHA 2QGFA 4CMIB 3S27A 3L6UA 3KEMA 4I9FA 3DBHA 1ILEA 1IDN1 4A82A 1X7XB 4DIUA 2GGSA 1EB8A 4NBWA 3QA9A 2NSJA 1GQOA 1K6MA 1O5OA 3IESA 4R1SA 5FIUA 3RS5A 4G0XA 4NBLA 4RXMA 3I45A 2HWUA 2JBAA 4RZSA 2SKDA 4WBNF 1AN0A 3N5CA 1GUDA 1QUFA 3FJYA 1J06A 1S9DA 3KR9A 4G65A 1RWOA 4QO7A 5JW6A 1LUAA 5HZGA 3M6AA 3F97A 5H7XA 3UFBA 4CI9A 3BSFA 2ZRHA 3KP1A 5CTAA 3WGVA 5LDDC 4LQ4A 4RA6A 4JEHA 3JQAB 1DC3A 2H2HA 1E4VA 3A2LA 5ICEA 3QXHA 2ZANA 3R24A 2I66A 1QMGA 2QUAA 1P0QA 2D1TA 2ZYSA 7YASA 1IB0A 2R6R1 3OPMA 1U02A 1YFKA 4M22A 4D8XA 3AV0B 1EJBA 3SC2A 3JQ6A 4H1WA 4NG4A 5I8PA 2GXSA 1IUNA 1E1DA 1GLGA 4PR3A 1VDMA 5EUCA 1YRBA 4NR0A 4IKOA 3K0EA 2YMMA 4N76A 3TEFA 1C80A 2XT6A 5JWRA 4BNNA 4UNIA 1UJBA 2K7ZA 4GM1A 4M3NA 4FZVA 3COSA 3OOHA 3HM9A 4YUVA 3EWAA 4I50A 3FLAA 1ODSA 3IOYA 3PPVA 5CK4A 5B6IA 4JAVC 1I8TA 3BIXA 1G20B 4U0KA 1DBWA 4FLFA 1II8A 3LKVA 3H6KA 4HS9A 3UJNA 4YQEA 3OKFA 1W36D 5AW2A 1U6KA 4CM4A 5I7RA 2VVTA 5E0KB 1XMXA 3HA2A 2QBYA 2WVAA 1ICEA 3KR0A 4DJFC 3L0CA 3O8LA 4TL6A 4D45A 4IDNA 1H2HA 1SJ9A 2AOTA 2XYVA 3U3KA 3CJQA 3RVLA 4B4VA 1C7IA 4UHBA 5KQGA 3UMGA 1FDRA 1L8XA 4Y2UA 4E5DA 3B8HA 3SF0A 4D9GA 3WAGA 1M2VB 5HKKA 1NUAA 1BFDA 4Q3EA 1D4AA 3DULA 5E95A 1X87A 2DBVO 2GXUA 5C5EA 4G1BA 4NAHA 1DX9A 1IEVA 4G5GA 4P84A 3R40A 5TSDA 1U7HA 1NSFA 3C98A 4US2R 5HXAA 3NJ8A 2XCLA 4E5MA 9MHTA 1UZMA 3QKSA 3TDMA 3GJ5A 5ESRA 3ZI0A 4HV4A 5HOQA 2AD1A 3V4RA 2BEWB 4RK7A 4ZXFA 1CJTC 1G9XA 4O4HF 3KYCA 2GFHA 1GSOA 1ZD1A 1LTQA 2H4HA 3HB7A 3S2IA 4LF8B 1DAGA 3W8EA 3D0QA 1F4PA 5DU2A 5EJ8A 3B7GA 2B3TA 4C0XA 4GXQA 1SOMA 1GFWA 1FDVA 5E4TA 1HQDA 3TPZA 3CEMA 3E9RA 3HB4X 4C08A 4RMHA 1JEAA 1N2CE 4PGGA 5DNCA 1CZOA 4MYSA 1KEPA 4Q15A 2X19A 2BRUC 1RI5A 2OMEA 3OBIA 2ZE7A 4IMIB 4Q4DA 4ZVQA 5HKOA 5I6DA 5IYZB 1ADJA 1L9KA 4FHCA 2AF4C 1F6WA 3RKSA 1BGXT 4P4NA 1LVGA 1RXWA 3PWSA 5AICA 4G8DA 1QH9A 1A98A 1B8VA 2QW0X 4H7PA 2IHNA 3D43A 1GLVA 5BWBA 3M8KA 2FUEA 3RVSA 1QVZA 2WSLA 3R7LA 3R8CA 3QWAA 1MB3A 2GR9A 5LB2A 3TS1A 2ZLBA 5K6AA 1GM5A 2DFPA 2YL2A 5BUCA 1TFUA 2O2YA 2JLAA 4IL5A 3ZI4A 2R5NA 1WAMA 3KHSA 1GGNA 1S9HA 4V0ME 3PV0A 3BBPA 3O6VA 3SY8A 3GLGA 1JQEA 4F04A 1W30A 1AGXA 4RTNA 2I67A 3CX8A 1IULA 1E7RA 5IM4F 2VPWA 1N2HA 2CL7X 3ABZA 3WK9A 1RRCA 4DQ0A 1OXTA 2ZIEA 5JAUA 2WIGA 2A5GA 5A4FS 5EJ9A 3WGHA 3IGFA 4BX3A 3LGAA 3PB3A 5CX4A 1RHMA 1QTQA 2DQSA 2X23A 3WLJA 2BMVA 3TZKA 5JT1A 3LHKA 3KLOA 1PDVA 1QOZA 2B8EA 2J9FB 2GOYA 4PVCA 4ZAVA 2XUDA 3DAHA 2IPXA 3ZR4B 4DSAA 4NJOA 5A62A 2QF7A 4F4FA 2F3PA 5J1TB 4YV2A 4QPCA 3DOIA 3IAXA 3BGSA 1JWLA 5JAIA 2YY7A 3BVPA 1JR4A 2B5OA 1HNWB 4L5IA 3B5JA 2ZDHA 3IL2A 1ZK3A 1JHQA 3H75A 1CX9B 4P9NA 2IEIA 4TYNA 3A6EA 3RK1A 3QPBA 1ZMOA 4AY4A 1TMYA 4HDMB 1SZJG 1M2NA 1W88A 2GZHA 1ZEMA 1YB4A 3GLSA 3DCIA 3QKRB 3W3AA 3OM9A 4D82A 4ZPJA 4R40A 2ATEA 2CLCX 4K9DA 1P0CA 2HDWA 3GUHA 3N2GB 3OQIB 4N01A 2G5PA 4YJGB 4U2GA 1UBGA 3WV4A 4B17A 4YV0A 5K7SA 1H2AS 1HNNA 4JB0A 1FTNA 5K0NA 5J4HA 1J8DA 1ZN8A 4LBVA 3FHLA 1SKAA 2KQUA 4DLKA 3HI4A 4EZEA 4UNRA 4RD0A 3TR0A 4LJRA 4BFXA 1W5SA 1YUMA 1T6BY 2I55A 5C2JB 5FV7A 2ARKA 1O6CA 1HSOA 1O96A 2QLMA 3SM9A 1V37A 4AZSA 4M1EA 5DHPA 3CZPA 1QORA 3U4DA 1W2HA 1ZW1A 1TVEA 4ME6A 5EVCA 3H86A 1KJJA 2HI0A 2PMCA 1XRLA 3I1FA 3U9SA 5FADA 5DN6A 3A6LA 1UDWA 1D0VA 5ER9A 3O8NA 1X1EA 2XKKA 4AKTA 2VUUA 4L9WA 3P0IA 5LU9A 1KO4A 2ODAA 3ORRA 4JLOA 4YYZA 1B2LA 4XTRA 4JKIA 2E9SA 3H6GA 1YS7A 4N3CA 3PE4A 4X8MA 3P1JA 5H4HA 2JLXA 2O8FA 3LFTA 3KB6A 4E2YA 3OUZA 5KTTA 1NQWA 2K4MA 2VNIA 1MGOA 2H29A 5D8DA 4NV0A 1U1EA 2WWFA 2GPWA 4DCSA 2FDCA 3LV8A 5AIBA 1Z08A 3NIBA 4H1TA 1A4IA 2C2KA 1YJCA 1GAJA 2YJ3A 2WWIA 3TLJA 1G17A 4RESA 5IK2A 3BDIA 4XX1A 5BYJA 2HHCA 3H99A 1NL3A 4MV0A 3AR6A 5D7BA 1KWGA 1J39A 4JR0A 3QYJA 1A4XA 2JAOA 1NHGA 3DAOA 3G1UA 3ILXA 4BFWA 3FSRA 3PJEA 3HYSA 5SZKB 5IXYA 3D0OA 1PL7A 1PEDA 3GG2A 2RIPA 4JT8A 4WJLA 4AMUA 1A04A 1OLSB 3KYBA 2HF9A 1NI4A 2PX5A 3C6BA 1FF9A 1JDBB 3CKMA 2HV8A 3K05A 2FSGA 5DM1A 3ZU4A 4QIHA 3OSUA 3Q5EA 3KJIA 2EFHB 2QTVA 2YRFA 4TS1A 3E9QA 4LXXA 3VH2A 3KIPA 3BCUA 2VDPB 3E9ZA 1UJCA 1YL6A 3AETB 4RKQA 4GPIB 5G3ZA 2I1QA 1DRUA 1YQEA 5T6MA 4DREA 1EUDA 3DFKA 4OXIA 4KE9A 2BH9A 1RZRA 3DLTA 3DV9A 1KXJA 2BFDB 1RRGA 4LHXA 2EJVA 5EXEA 2KE5A 4DCVA 3DMHA 1MX5A 3L8YA 1FYXA 3ANXA 1QGAA 2VNAA 1LD3A 1MIHA 1Q1AA 2DMRA 5AYVA 2PSEA 4Z2YA 2QUJA 4JBGA 3UAOA 4HTFB 5C81A 4G9GA 4LIPD 2G1AA 2MINA 1UF9A 2HMWA 3L18A 2ATXA 5DKFA 4BKPA 4F1KA 4L7QA 1TAQA 1CY7A 1QTIA 2YXPX 3DHYA 2QNBA 5KTNA 3FB4A 1YZVA 2EW2A 2MSLA 1GPAA 1Z4NA 1S2GA 2QVLA 1EVEA 1YONA 3D3WB 3KHUA 2X22A 2IUFA 2CNKA 4JNKA 4MUKA 5SICE 4BMNA 2GK6A 2Q4BA 3H19A 1T15A 3ZLUA 4ZAXA 1E3WB 4O33A 4A4DA 4BQPA 3G9UA 4RIHA 3QYAA 3HLYA 1W85B 4C7BA 5ALQA 2AFIA 5K0FA 5KYWB 3PPXA 3AF6A 4XGKA 1O3YA 2EFEB 1MB9A 3RAPR 4HAIA 4DDHA 4TYQA 2O0LA 5AH0A 3R77A 5A5DA 2AD5A 5DHUA 2A58A 3ZE1B 1KI3A 2RSLA 3G2IA 3HCOA 2LIVA 1Q0HA 4HQOA 2ZJ1A 1W48A 1AB6A 1N8NA 2E4VA 1OREA 1L3BA 3EVNA 4IS3A 5EI5A 5K3BA 1V8FA 2FHSA 2H59A 4H6PA 5L40A 4MI3A 2WWWA 4EVIA 4G01B 3D6VA 4LRSB 4ADSG 1DO2A 2GN4A 1G4UR 1YZNA 3KFVA 4I1SA 1SXIA 5AVJA 5BVGB 1OHHA 2EW1A 3UJ7A 4LECA 3PWZA 2YWRA 4G9EA 4DCJA 3H8WA 2VWHA 4ZODA 3T1NA 3GLKA 4EA6A 2F3SA 1DXOA 1ECLA 1TYZA 3TTSA 4R3UC 5A5VA 1Z73A 2P4EA 1V1JA 2FFBA 3AR9A 3EZNA 4H1HA 5AWFC 2PL3A 3R3VA 5T8KA 4TVOA 5EE9A 4UM5A 2IUTA 4XYGA 3UWSA 3ZEAA 1ZVMA 1NZFA 1MAHA 5IFLA 3LRPA 3MMXA 1NI5A 4K3VA 5BR8B 4LJ5A 4DZRA 2P9HA 3N76A 5TQJA 1JNYA 2VDWB 3QZUA 2VSOA 4X44A 2NUAB 4HNVA 4PQGA 1J8MF 4RE6A 4DMGA 5CDUA 3TG2A 3GRYA 4EKGA 3CO0S 1L5HB 2O3UA 3E7DA 4ZICA 1NPTO 1E3IA 3C5CA 3L49A 5AK0A 6REQA 4B3IA 3CJRA 3EF0A 3FYTA 2QZJA 4PX2A 3H84A 4JHXA 2VYCA 2Y1GA 5ERGB 1U7PA 2YV4A 1ULZA 3RRYA 1GRVA 3ZD9A 3W3AD 2OFWA 2CKMA 1ZJ4A 5MDHA 1D6SA 4GMHA 4ARBA 3GO4A 5HFJA 1V5IA 1WS6A 4P4LA 4D4IA 3RLIA 3OLZA 3INTA 3A9UA 3GNQA 4ER7A 2QZ9A 3L06A 3F5SA 2HBYA 3EXFA 3HXKA 3IT0A 4YRRA 1V4VA 2Q9CA 2YWCA 4NU6A 3IPCA 2VHXA 5MN6A 1NBAA 1OYOA 3FHTA 3W5IA 1UPUA 1Q84A 2NNLD 2HK9A 4MCJA 1IXYA 1PDOA 1LPBB 3MCTA 4F4CA 5K1ZA 2O1SA 1PGPA 1YS6A 2OV8A 2VHUA 1C9EA 2Z9CA 1M2KA 3BQMB 4IWNA 3OF3A 4X8OA 5AJVB 5CG1A 2J4DA 4MWTA 3I9V1 4QTXA 4CUZA 1AA9A 3DMGA 3V34A 5BN1A 3KZVA 3N3BC 4MVJA 5FO0A 2EF1A 4F9GA 3TVYA 2XNDA 4MUNA 3B6JA 2O54A 2DY1A 2E4UA 3CNEA 1H9AA 4IO0A 4CT5A 5IF9A 2JI6A 5IJ9B 4Y1EA 5C32A 1P4GA 1NASA 2VAWA 5B58C 2QUBA 1JDSA 2H4WA 2PWYA 1P74A 5NLLA 3SSMA 5LOVA 2GDZA 5IJXA 2WKRA 4R9RA 4XUCA 4D4JA 5G1OA 2BFFB 3E9YA 3KU1A 2R751 4IFIA 4A0QA 1SBZA 4F56A 4IRMA 3ESDA 2F67A 2OM6A 3Q3GE 1DC4A 5D3QA 5KJEA 2PLFA 3TOXA 2CMKA 3KVNA 3MJ4A 4HDSA 5EWMB 5JU6A 5IK2D 2BEKA 4YRLA 1V16A 1X1CA 1OLOA 1QV7A 2UUPA 3IIJA 1UEJA 4B6GA 2HRRA 1WULS 1M6NA 4CEHA 2ETVA 1TYCA 2QT0A 4DWJA 1V8DA 2LE0A 1ZN9A 1TAUA 3ET4A 4F3RA 4RZ3A 4CLHA 2VSQA 4ZTZB 2I6GA 4XQ0A 5KKCA 3A6DA 4KBFA 2QK4A 2HLPA 5IEJA 4JUAA 3SHOA 3VPFA 4IIGA 4QUDA 3KRTA 5HUQA 1K9SA 3EA5A 2EBWA 2ZWIA 5TNXA 3MJTA 4DDVA 4ZXPA 3N8DA 1JJBA 1T3TA 3L07A 5FTMA 4KPEC 1QH1A 4XYMA 4QFMA 1M2OA 5E0OA 5DYTA 4WUTA 3O2JA 3AXTA 2IXTA 3MJEA 2JAHA 4B1FA 1KVUA 2ZP1A 5HW0A 4TLCA 3UCEA 4LF4B 3PSHA 3DLAA 4HH0A 5CMLA 3IVAA 1GZVA 1QZTA 1F51E 1N2SA 1OXSC 2GNOA 2V65A 2VRNA 3L8GA 4RJ2A 1TLFA 3EN0A 5JH7B 3K70B 1XRQA 3BHIA 3HU1A 4FILA 4KFRA 2OYRA 4A6DA 3ZW8A 3U3DA 2ZIWB 4NAVA 3DKVA 3MAJA 1PJTA 4NQRA 4PC3A 4OJQA 4V0KA 4PHCA 5ED0A 4MS4B 5EPEA 4M9RA 1RQ7A 2YJTD 5C46F 4GX2A 4LG1A 4BDSA 1JEQA 4WFKA 1WBJB 1Q12A 3F8TA 2X2EA 2OCYC 4GECA 2IV7A 1I1HA 4QDZA 4EFMA 3BH7A 1XO1A 4GPBA 1FS6A 4KWEA 1EP3B 2P5YA 1D2HA 4IHAA 3LU1A 1Z29A 3O8OA 3ESRA 4LYJA 1J49A 4G81A 4O4HB 5GJCA 3W5UA 5IF3A 2Q3LA 1GD1O 4HH4A 4K9SA 2H6EA 5LB4A 3PR1A 2V03A 4R6XA 1T5SA 2GPBA 4EG3A 3DDZX 1M67A 3NB0A 4TM8A 1ZJZA 3HEMA 2QSUA 3R7WB 3UXHA 3ITEA 2NQTA 1EX9A 1CVIA 2HW8A 4YHBA 3ZWVA 3OTOB 2VT6A 3FNBA 1U3UA 3ZJYA 4OQXA 3UK7A 4DQXA 4F4JA 3L7OA 3AEKA 4BO6A 1ZFNA 3N8HA 3E23A 3VVLA 5B2EA 1AQYA 3GCDA 2HB6A 1K98A 4GYJA 4L50A 4PYOA 1CPYA 4QM6A 4KLNA 2B7LA 5L3RA 3KXLA 4NYMQ 2XUQA 1XDZA 2YHIA 4G85A 3HPQA 1OHHD 1FNNA 1M0TA 5EKUA 2HO5A 5T5QA 5BT8A 1UXHA 1XRRA 4M8IA 4BLTA 5JNVA 1N5KA 3DAPA 3BX1A 2I87A