2FPIA

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
304
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 106
structure length 304
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpiA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fpiA01
5CP8A 1E3SA 4QSMA 1DB3A 3LC7O 2Z1MA 3RUHA 3PHGA 3UCFA 3EVNA 2Q2WA 4J4HA 4RGBA 4D0RA 2GR9A 2GNAA 2X5OA 4C7KA 1Z74A 3KM0A 1VKOA 2HRZA 4GLOA 2J3IA 3ZU3A 1UXHA 4XRRA 5A9SB 4MIEA 4I5FA 2WEKA 4BNVA 4CQLB 1PR3A 9LDBA 2SCUA 4ZN6A 4MIYA 5DOZA 2AG8A 5KTKA 1PS9A 2X58A 1Q0LA 1H6CA 2QYSA 5TQVA 3CEAA 3I9KA 4IDDA 2NACA 3JQFA 1ZK2A 3PIDA 3EGOA 4J0FA 1HSZA 2DUWA 3LC2O 2V65A 3NYWA 1G0OA 2IZZA 3DMTC 1SEPA 3MJEA 1QKIA 2A94A 2XPCA 1E3IA 4CQMD 3D64A 1UZLA 1RM0A 2BGLA 4CL3A 1X7DA 1PJ2A 2DTXA 2FSSA 2GLXA 4GL4A 1WVGA 1BWSA 2I3AA 3F9IA 1XEAA 4FN4A 5ILGA 3VC7A 4ZQHA 1NASA 3ZWXA 4YT8A 2IZ0A 3ONFA 3VH3A 2O3SA 1ZXBA 3O03A 4PCVA 4CPDA 3U4IA 4L0QA 3Q2KA 3R0IA 5I9NA 1KVSA 4G65A 2WYUA 1F14A 2VRCA 1I36A 1MXHA 3G3EA 4E13A 3ZDFA 3UFXB 1QYWA 4DQXA 3DB2A 5EINA 1ENYA 1ADGA 3H7AA 4YWJA 2IYPA 5KJFA 3PZRA 5GMOA 2GASA 2ZTLA 4CMCA 1U5AA 4IDBA 2AA3A 4XWYA 1Y7TA 2YHIA 3ONEA 5L95A 2OGUA 4RV9A 2LDXA 1HDYA 3H9UA 4E33A 2YY7A 3ZNQA 4JK3A 3FPLA 4P4GA 5F1KA 5BNFA 4HV4A 3FWZA 3SEFA 1D1TA 1W8DA 1E7YA 2C29D 1IE3A 1HRDA 5JLAA 2P2SA 3ADOA 4FW8A 1ONOA 2ZYGA 3D3WA 4EW6A 3MJVA 1BXGA 4IJKA 1OC4A 4O0LA 1BGVA 4R54A 2VUTA 4JQCA 3SJUA 4J7XA 2Y66A 4MP8A 2DBRA 2F1KA 2J5KA 5T64A 1EK5A 1I33A 1U8FO 2GGSA 3OQ6A 4Y6PA 3DBRA 4OXYA 1SNYA 1ISMA 2ZJ1A 3B1KA 3VPFA 5JO0A 4W9NC 4E31A 1X13A 2ET6A 4WLNA 4TQGA 1R0KA 1ULSA 3RU7A 1YXMA 2VHWA 4II2A 3OMLA 3U49A 2VOEA 3D1LA 1QYXA 4P4LA 4PLHA 2Y67A 5IXYA 3BIOA 4BO5A 3MJSA 2GCGA 4RORA 4TZTA 1ISFA 2C7GA 1A4UA 1CF2O 4IIUA 3GHYA 2QRJA 1RM3A 4M89A 1CQIB 2Z95A 2NVUA 4NH4A 4TRJA 4BNZA 4CM9D 2EWMA 3LK7A 4K28A 1M6HA 3DONA 5EMHA 3E03A 4PLVA 4FFNA 1T1SA 2YYYA 4DMMA 2V6MA 1HXHA 3TWOA 2OBYA 3MCVA 3GC6A 2X86A 5I9MA 5ITVA 1WW8A 3HSKA 4E2XA 2DU8A 5U4QA 2P9GA 5ITWA 1V35A 5KVVA 4QO8A 1NM5A 2BFAA 4HNGA 4TVBA 3PRJA 3ONDA 4M86A 4BQRA 1SEVA 3LT0A 2G76A 4CUZA 4Z6KA 5A9SA 4CQLA 2RIRA 3SC6A 8LDHA 4GI2A 3U3XA 2ZJ0A 4J1NA 4CM8A 2FR1A 1PJ3A 5KJCA 5G0SA 2Y0DA 3WWYA 1T1RA 1RJWA 5AVOA 4AJJA 4NFYA 1H2BA 2ZYDA 3FHLA 4NR0A 3W4KA 1GPDG 1DPGA 2VOJA 2FZEA 4YQZA 3EDMA 3D4OA 1WWKA 1B26A 3OIDA 5A06A 5I8WA 4IQGA 3OHSX 3WJAA 5TJ9A 3NV9A 4UVHA 4IY1A 4YAGA 3H5AA 3FNFA 4KDFA 2IXBA 4B3IA 4IMRA 1YL5A 1SO8A 3FCOA 4DMLA 5BSEA 1LC3A 1MG5A 4HFRA 4OXKA 3ROKA 1WDLA 3JQ9A 3OETA 3CSDA 3QJ5A 4J7UA 5JMPA 3MJTA 1JAXA 5ICSA 1QXSA 3FSRA 1TEHA 3COSA 2UVDA 5GY7A 4ZQEA 2CNBA 3P7MA 4RL6A 4KUHA 2ZKLA 2OORA 1TI7A 3CUKA 1NTOA 3OJ0A 4CLOB 3DFZA 3S8MA 1I24A 4XA8A 1VJ0A 1Z73A 1S7CA 4IDGA 3P19A 3GEDA 1K5HA 4PLYA 3NGLA 4CMIA 2VZ0A 1DRWA 3OJOA 4PIVA 2DFDA 2VWHA 4RO0A 3GUYA 1EUCA 1E3WB 4MVJH 4ZQGA 1PWZA 3UFXA 4GBJA 4BL5A 2P9EA 1LUAA 4EUHA 4Q3BA 1MA0A 4OJNA 6LDHA 5T6BA 2PKQP 1PJ4A 3PPIA 4M1QA 1RPNA 2I3GA 3ZH2A 4H7PA 2X8LA 2YDXA 1NHWA 3MOIA 3NX4A 4XR4A 4AJ4A 2E6UX 5B4VA 1LQTA 3K9QO 2C2XA 1IZ9A 5HBRA 2P5YA 3WLEA 4NNJA 2O3UA 4NFHA 1EMDA 3RBXA 4JBGA 4OHUA 3DMTA 3V8BA 3JQAB 5CAEB 4XYMA 2D59A 3I1JA 4J9UE 3RUFA 2FSVA 4OMUA 1SPXA 2HU2A 3AM3A 2ZTVA 3IP1A 1H5QA 4CMEC 4CJXA 2Y1OA 3GFGA 4N5MA 3SXPA 3VZQA 2HJRA 3GF4A 1YL7A 1WXDA 1TT5A 1DBVO 3JYPA 2C5EA 3KYCB 3WBFA 4YPOA 1T2FA 2NU7B 3RD5A 1P77A 4J2OA 2R6JA 3NDIA 2EP7A 3WFJA 5IDXA 5L7WA 1YVEI 1R6DA 2ZYAA 1XWFA 1HE4A 4FJ0A 2J8ZA 1W6UA 2EG9A 3RBZA 1EFKA 3DL2A 1DXYA 4NBRA 4D3SA 4WPGA 3LYLA 4EBFA 5IDYA 3WSWA 1KEVA 2JCXA 4FPXA 3K2EA 4IM7A 1I3LA 1JVSA 2E48A 3L9XA 4OOEA 4WJZA 2HSDA 5IZCC 3VH4A 1CQIA 3UHAA 1WPQA 4IQ0A 1ONNA 5L53A 1A9YA 4YT4A 5TLSA 4KDEA 5ENVA 1YRLA 4Y6RA 4B4VA 4LVUA 4YA6A 1IZ0A 2DLDA 1J49A 3GNQA 4FC6A 5IXSA 4G81A 2BI8A 4M54A 4ZQFA 3H5RA 1U5CA 3HNPA 5K0ZA 4NJMB 5KIAA 2OZPA 1C1DA 3S55A 2JHGA 1Z7EA 3EZYA 1Q7GA 2ZTUA 1T25A 3TDKA 2FWMX 4IJUA 3RSHA 3K30A 1ZEMA 3ZWAA 5T57A 1PGJA 3ZV4A 1FF9A 4BNNA 1IOLA 3ZWPA 1HT0A 4Y6SA 1WNTA 2Q1SA 2J3JA 3EHEA 5JBIA 4W9NA 4IMPA 3V1TC 2VWGA 5A03A 2PZKA 4B4UA 4BNFA 1U9JA 1DC4A 2IZ1A 1GTMA 1N7HA 3O8QB 1K2WA 3PK0A 1PTJA 3W8EA 1ZBQA 4WCFC 1S6YA 1KVTA 2QZZA 4MKXA 3O38A 3WGIA 4JBHA 1LLQA 4JROA 3HFGA 4CM6A 2HK8A 5GZ1A 1D3AA 1N1EA 2QG4A 3PYLA 1YGYA 5BSGA 4U8GA 1H9BA 1YONA 1RYDA 4Z0HO 1E7QA 2J5QA 3PGXA 3V2HA 1ZK4A 4EGFA 3HN2A 4C4OA 1DAPA 1PJBA 1ZFNA 5COQA 1GEEA 1I32A 1QMGA 1NWHA 1I2ZA 4ZGWA 3JQBC 1VM6A 4ZHSA 1HEUA 1YJQA 2I76A 2IDZA 3KLMX 5LCXA 3WICA 2Y0CA 3HWRA 4RCVA 4K9DA 3ZZNA 7ADHA 1P74A 3JD3A 4CLOA 1E1MA 2A4KA 2O23A 4PLZA 1UP6A 3WIEA 4YVFA 3WQRA 5C7IO 1KS9A 4OM8A 3LU1A 4XB2A 5IFLA 4LRSB 4MP3A 3QWFA 1E3WA 2CVOA 4JP3A 3PHIA 3SLKA 4D7AA 4RPJA 3E9MA 4QECA 2EW2A 2HQ1A 1MXFA 4FQ8A 1T4DA 3PHJA 3QVSA 4IS3A 2VWPA 5F1PA 4GMGA 3BMQB 1A7KA 3H2ZA 4URFA 5A05A 5CEFA 4CM1A 5L4SA 3C3XA 1PQPA 4DRYA 2OP1A 1J6UA 2PD6A 4A26A 2X22A 3OJLA 5EPOA 3RI3A 2PWZA 2WMDA 5DDIP 3F5QA 4EJ0A 2PD4A 2A35A 4HKTA 5CAEA 2R2GA 1I0ZA 2BFMA 5CDGA 3X2FA 2P9CA 4OYRA 4UVDA 3ADPA 5JAZA 1E92A 3H2SA 4WOKA 2V6GA 1EDZA 4GGPA 3MWDB 3RWBA 5DCWA 4QTZA 3VH2A 4CLEA 2O2YA 5ENDA 4UEKA 3P2OA 1HE5A 4D43A 1A9ZA 1N5DA 1EDOA 4FC7A 2D0IA 4P38A 4OGWA 4E21A 5B1YA 2NU8B 1T4BA 2NU7A 3R1IA 3SVTA 1PR9A 1VJTA 2DC1A 3KLPX 2HK7A 5I7FA 4YYZA 3UICA 5JAMA 3CZMA 3JD1A 2YW9A 1FMCA 1ORRA 3QE3A 3BMOB 5FI5A 3DTYA 4GX1A 1HDOA 3KSZO 2GSDA 1K6IA 2Y99A 2AQ8A 4OQYA 4JNKA 1AE1A 4JX8A 2FOIA 3AY6A 1M76A 5KJ1A 5AXDA 1XQ6A 1PJQA 3H6KA 4GLLA 1GADO 2XOXA 1WMAA 3G0OA 1P33A 3PFWO 3B1FA 1JKJB 3I6IA 3K2BA 4IZHA 1Q0HA 3RUCA 4Q3NA 1IYZA 4DQUA 2IEDA 2PKQO 3OECA 4I9UA 1HE2A 3BMCB 4FB5A 2POQX 3NKLA 2NADA 3TZHA 1OZAA 3LQFA 1GCOA 4CMEA 4NU6A 3PIIA 4J1SA 4NJMA 4TSKA 1OFGA 3L6OO 4IDEA 1EUZA 4YCAA 3OP4A 4LSWA 2JD2A 4H16A 1BSVA 1MP0A 3OJFA 3S2GA 4D46A 1H6BA 2SCUB 2AQIA 2WYWA 4CR7A 1CQJA 2JL1A 1P0FA 3HFSA 3R3JA 1E6UA 4GGOA 1E5QA 1T26A 2UUPA 4EEXA 1B15A 4CUJA 1T2CA 4J3FA 4GVLA 3OSUA 1UAGA 2AE1A 3DOCA 3GPDG 3N7UA 3T4XA 3O8QA 1QV6A 4NQZA 1NQAO 1DO8A 5EESA 4LK3A 4M49A 1ZXLA 2JCYA 4NFSA 4U0JA 5IZCA 1Z75A 3R3SA 1NWCA 4YT2A 4Z0TA 3PYMA 2VT3A 1V3UA 2HRBA 4IUYA 1PS8A 4OH1A 3V1UA 3LVFO 4GSLA 4W82A 1GV1A 3NDRA 2TMDA 3PQDA 3DAFA 4FGWA 4FOOA 3VVCA 4UAGA 1CEQA 1UAYA 3VZSA 3IS3A 1DSSG 3K96A 3TF5A 3ZWVA 3JYQA 3A9WA 2FR8A 1LDNA 4MVJG 4KOAA 4NBVA 4X54A 5JCXA 2VYNA 2FN7A 3GLQA 1MG0A 3GPIA 3LF2A 4IBOA 5JC1A 1JQBA 2W2LD 2X23A 5JFOA 2OMEA 1J0XO 5ADHA 1T24A 4LRTB 4DPKA 4RVDA 3ON5A 3QVTA 1Y5RA 3RKUA 2C07A 3EAGA 2Y1FA 3UCXA 2YHIB 4LISA 1F06A 1XU7A 4QEDA 5LC1A 2GPTA 3JQ8A 3H9JA 1SC6A 4WOJA 4FFPA 4MKRA 4WCFA 4XGKA 4KMSA 1LQUA 1DAOA 3VPSA 4ZVVA 3BHIA 4Y67A 1VPDA 4DL9A 1XQ1A 4EDFA 1PZHA 3WTCA 3QWIA 3WB9A 3H5NA 4AL4A 1E3JA 3BMNA 4AJEA 3S2FA 5L4NA 4FBGA 3S1LA 3PDJA 4ALMA 1BXGB 4DQVA 3BYZA 4E4YA 4E5NA 1YBMA 1IB6A 2DT5A 5BNIA 1RM4A 1KC1A 1OC2A 3GDOA 3JQBA 3MWDA 3E18A 3N58A 5TGDA 4E5MA 1YE3A 5G0UA 2BI7A 3DBRB 4ID9A 2UV8A 1YKFA 4F6LA 2Y1DA 3DXFA 4INAA 5JNLA 2NU8A 2O3QA 2X1HA 2OFPA 2XAAA 3DFUA 4YB8A 5CG2A 4ND4A 3VDQA 2H6EA 3V2UA 4JGBA 1LLUA 3DAPA 4J2HA 4J9VA 2NU9A 1SZJG 2AQKA 5KCZA 4E5KA 2PY6A 3L9WA 5DP1A 4N5NA 3NJ4A 3LT4A 4FD3A 2C2YA 1CIVA 3WQQA 2Y1EA 2V6FA 3QQPA 1ISGA 1ZIDA 3H3FA 3WGGA 3MWEA 2ZK7A 1JKJA 3RUAA 3F6YA 4XDZA 1VC2A 3BMCA 4TRMA 1BRMA 3BHJA 5CPFA 3KO8A 1VSVA 4MVJM 4XIJA 3TZKA 2PKRA 2ZB8A 1KC3A 4DC0A 3BXXA 1TXGA 4FFLA 3VKUA 5B4TA 3G79A 2VTEA 1N2SA 4G2NA 2WTBA 3GNTA 2VRCD 1W73A 3W8FA 2Q50A 5IN5A 3KXDA 3KYBA 3AI1A 3L0DA 3PJDA 4CM8B 3E6AA 3AUAA 4OSOA 3GMSA 3WFIA 1OBFO 1A7AA 1HZJA 2QRLA 1T2AA 3VPGA 3FBTA 5I7EA 4XX0B 4AG3A 5IZ4A 1KY4A 2PR2A 3AY7A 5T67A 1UJMA 3C85A 4BGIA 4A27A 3U9LA 5BSHA 3TRIA 4B79A 1QLHA 3B70A 1H93A 1LNQA 4Z9XA 2E82A 4ZRMA 1NNUA 1E1LA 4BO2A 1QG6A 2XXBA 2CSUA 1ONPA 4BGUA 4LMRA 3ZHYA 2HMTA 4NK5A 4BVAA 1HSOA 5DBFA 2HK9A 3AUUA 4BMSA 4RF4A 5JXWA 3ANMA 4A5OA 4B7UA 3KV3O 1DC6A 1PJCA 3CKYA 4ALLA 1U4SA 3VPXA 1P9LA 1VRWA 1UH5A 4BKRA 2HMSA 4CLRB 2NTNA 4YDRA 1C0LA 5A3JA 3DZKA 1KYQA 4JIGA 4CMIB 4D79A 3AU9A 2CFCA 3UGKA 1DC3A 1EUCB 5IAAA 3I9MA 2DFVA 4IXWA 1E0DA 2NNLD 2GO1A 2BLLA 5BR7A 3ZV3A 1L7EA 3I4CA 1D8AA 4OSPA 3QW2A 1MLDA 4WEOA 4J49A 1LU9A 3M2PA 4CMHA 5I7VA 3T7CA 4DREA 5COAA 1LDMA 3IMFA 5BNTA 2PTGA 3PI7A 3LC1O 4MP6A 4UEOA 5JDCC 4HP8A 1PZFA 5EERA 4L73A 4YBZA 1N1GA 3WS7A 4CLDA 3QIVA 5KOIA 3OIGA 4FCCA 1M2WA 3DC2A 3WIDA 4M8SA 3DMYA 1PL6A 2AE2A 3F47A 5G0WA 3OIFA 2VCYA 1R15A 3AWDA 2EGGA 1LSUA 4AJPA 2DBVO 5DN9A 1PL8A 3IIEA 1TT5B 4J0EA 4R41A 3ZN2A 4PLCA 3WNVA 4GAEA 3E8XA 1VJ1A 5JY1A 3UUWA 1M75A 4IDFA 3WMWA 3PZBA 3VOSA 5F3RA 4BO9A 3GN1A 3K5PA 3H3JA 1GUZA 2GZ3A 3GAZA 3IJRA 1A27A 3LZ6A 5U9CA 3KYDA 1A5ZA 4Y9DA 2EERA 3L77A 3TOZA 1QRRA 2Q45A 1HDGO 4BQPA 4RVSA 3DDNA 1WDMA 5KKAA 5DOVA 4G5HA 2AEJA 4QQRA 2JFGA 4Q3DA 2R00C 5CG1A 1YQXA 2DTDA 4UUOA 4NBUA 3M1AA 2VZ8A 1B3BA 1JW9B 1I10A 4E30A 1HLDA 3PWZA 4OIMA 2W4QA 1X0VA 2EXXA 4RLSA 4XGNA 3DHNA 4RVUA 1XIVA 4IGFA 3JQEA 4J43A 1NAIA 4BNUA 3RJ5A 1C1DB 2RH8A 1YWGO 2A9FA 1LJ8A 3GZ4A 3HB5X 3GVHA 3ORFA 4NJOA 5AXAA 5GZ3A 3OQBA 1EBUA 3E9QA 3RVDA 4K26A 2X0RA 5C5IA 1ZEJA 4HFMA 4F45A 1BVRA 1R66A 1E7WA 3IUPA 1ZNQO 2OXIA 4HBGA 1DRUA 4HXYA 2RAFA 1JVBA 2DUUA 1NX6A 2VUUA 3D3EA 2AHRA 2PZJA 1GQYA 5ER6A 3SJ7A 4XX0A 3PHHA 4TRNA 5H81A 2JHFA 3UXYA 1K3TA 1NPDA 2NV6A 2VT2A 2Y1CA 1XHLA 3TZCA 4JP2A 4BNMA 5B4UA 1EQ2A 4HFJA 2D1YA 3GDFA 2DQ4A 1PEDA 3S2IA 4CR8A 2EJWA 2YFQA 2G17A 2RH4A 3AI3A 1E7MA 2C0CA 3QWBA 2WE7A 3W6ZA 3OF2A 2X0NA 1LDYA 3CXRA 2B69A 2YV3A 4MVJF 3JYNA 4QXMA 4XDYA 3VDRA 3ITKA 4BKUA 2VYVA 4LN1A 2BGKA 2HMUA 4YRBA 5A1TA 1ADBA 4N7RA 3U4CA 3FF4A 2Q1UA 2QQ5A 2J3KA 2OUIA 2Z1NA 3CTMA 3GVPA 3PDUA 1XCBA 2VN8A 2C54A 2X9GA 3AM4A 1QYDA 3Q1LA 3LLSA 3BAZA 3OA2A 1EVYA 2OO5A 1ZJZA 4CLRA 3I83A 1ZSVA 3O4RA 4YTEA 4IQ8A 3JYOA 4ND5A 4XYLA 1OOEA 4NBTA 4PG5A 4D0SA 1HL3A 2VRBA 1FDTA 2I67A 2RHCA 2EKPA 3ST7A 3FRJA 1X14A 1ISJA 3T4EA 3VTFA 1SBYA 1PU2A 1ZVMA 2RHRA 3GDGA 1HWYA 4W4TA 1BG6A 5HWSA 5JDIC 5A04A 2Q1TA 4HUJA 1VE9A 5MDHA 4D45A 2OHXA 4MVJI 1K6XA 4WUVA 4XB1A 1ULUA 2YV1A 4Z3DA 4RPHA 3UVEA 3QY9A 1X0XA 1Y6JA 2AW5A 3FWNA 3ICPA 4L75A 3PGJA 1NVMB 4BKQA 1C0KA 4HNHA 3RQSA 5C7LO 2C20A 4ZU3A 3PFFA 1F17A 3RC2A 2BD0A 1PIWA 2HMVA 5DBIA 2X5KO 4B3JA 2I9PA 4BNGA 4AJLA 2O4CA 1ZJYA 3ZHBA 1EQUA 4OOFA 4BB6A 3I52A 3GK3A 3A14A 4U7WA 5L3ZA 3WWZA 5CEJA 4IDCA 4RQUA 4DLLA 4DIOA 1GR0A 1LDGA 1TVEA 4NI5A 3T7EA 3GVIA 7MDHA 1R4NB 2VWQA 3OICA 2Y05A 4IS2A 4HWKA 3L4BC 5DCYA 5KVCA 3BTSA 1LSJA 1XYGA 3LF1A 1OAAA 3L6DA 2QX7A 3WGTA 1LDBA 1ZH8A 5HM8A 5F21A 1FDWA 2CF6A 3M6IA 1DIHA 4O6VA 3ENNA 5THKA 4CMJA 3PJEA 4XZ3A 3TQHA 2PGJA 1EVIA 1MFPA 1YBVA 5JPIA 3RFTA 3NT4A 4CMKA 4Y98A 3PXXA 3RROA 2BMAA 3QV1A 1EEHA 1Y8RB 4DBZA 4B4OA 2GYYA 4LMPA 2WYVA 3D5QA 3IOYA 1HYEA 4BO7A 3L4SO 1ZSYA 2QYTA 4N54A 5JDCA 3NT5A 2PNFA 3V1YA 3FPCA 1HF3A 3K6JA 4Q39A 4XYBA 4XQCA 4AVYA 1EZ4A 3RIHA 1SB8A 3GR6A 3WJ7A 4R4JA 4PG7A 3AUSA 3IP3A 4FDAA 4NPCA 2EJVA 3W1VA 3EY4A 1ARZA 2HCTA 4GX2A 5CDUA 3KSUA 3TL2A 1H0KA 1CQJB 5JYDA 4BGVA 1B14A 1BXZA 3WTBA 1LSSA 3U09A 3FR8A 2O7QA 4NU5A 3FN4A 5CDTA 2D4AA 1O95A 3DZGA 1PS0A 4RPKA 4EUEA 2GN4A 4EJ6A 1AN9A 4ILKA 4CM7A 3KZVA 3F4BA 3U0BA 4D42A 3QSGA 5AXBA 4MJLA 4AJNA 3WYCA 3QWAA 4FFOA 2DTEA 1U8XX 1QLJA 2CUKA 2BKAA 3JQAD 2R00A 3WGYA 5G4LA 3CPSA 3H9GA 5TSDA 4A10A 4E2YA 1NHGA 1N9GB 4PG8A 3E9NA 2IE0A 1BMDA 1DHTA 3Q9NA 3ASUA 4CLXA 1NYTA 4LGVA 4PRLA 1YDWA 4A73A 2BF7A 1ZZEA 3OJEA 4LVCA 3ETDA 1LRLA 3F5SA 3DZBA 3EK2A 1OI7A 5DT9A 3CIFA 4D41A 2NLOA 4PGFA 3WSVA 1HLPA 3KEQA 3L07A 3NAQA 3OBBA 4MVJP 4R3NA 1HYHA 3ZWBA 4DLAA 3EVTA 1LTHR 1K6JA 1B7GO 1GEGA 4ND3A 4NBWA 3MTJA 4J4TA 3SBOA 2CVZA 4B3HA 3DHYA 2DBQA 4R5MA 2WWRA 3QHAA 4XR9A 2CDAA 2NVWA 3AY3A 3JQ8B 3MZ0A 3ZCXA 4BNHA 2AMFA 4MPDA 4KTVE 4R5HA 3STHA 1VI2A 5CEEA 1E5LA 1P31A 2FPIA 4WCFB 3UN1A 3OEWA 5JYEA 1C0PA 2NTJA 3MJCA 4MVJA 1DEHA 2P68A 1HETA 1UDCA 1VL8A 3BMNB 2AEFA 4R1NA 2PK3A 1KERA 1DIRA 3AJRA 5TJHA 1HTBA 4M55A 2Q3EA 1EK6A 2YQ5A 4UVEA 1PJTA 5T5QA 4F3YA 3ETEA 3JV7A 4J91A 4W7HA 5TS3A 1ZK3A 1V9LA 1JLLA 3F3SA 1X7HA 4W7IA 4CODB 3JTMA 5L4LA 1GZ6A 1V3TA 3PQFA 1WDKA 1R4NA 3KTDA 3RAJA 2BFPA 3WXBA 1FK8A 4ZJUA 2OL4A 3O26A 1E6EA 4R3WA 4O59O 4YACA 5AOVA 2NU9B 1IPFA 1P1HA 4XEHA 3ROPA 2P5UA 5CPBA 2HKIA 3WG9A 1LRKA 4TKLA 2BH9A 1WP4A 3CMCO 4WLFA 5JDIA 3PLRA 4QUKA 1Y5MA 3ZU5A 1YS4A 2AXQA 4L4SA 5JSFA 3OH8A 2B5WA 1ML3A 1PSDA 3MWEB 1UXGA 1MX3A 3JQDA 3N74A 1Y8RA 5L40A 2B35A 3ZWWA 4CM4A 4GWKA 1UZNA 4BUCA 4FJ1A 1QSGA 3GG9A 4MO2A 4F6CA 3WNQA 4ZICA 4IIVA 1ISIA 2PZLA 3GRPA 3QVWA 2NU6A 2B83A 4KQWA 5U1PA 3FTNA 1SCUB 1AXGA 4TRRA 2D3TA 2Q2QA 5KVSA 2VYND 1M67A 3A28A 3WGOA 2EKLA 1QP8A 4CV1A 5JCJA 1I5RA 3DOOA 4XCVA 5LDGA 1IL0A 3OEYA 4K1LA 5JMWA 3L4BA 1MFZA 5B37A 3TFQA 3UAGA 3H9EO 4RDHA 2Y1GA 2WE8A 1GU7A 3KEOA 2NSDA 2RCYA 4IGEA 4F46A 3ICCA 1WAMA 4I5DA 1DJNA 4YJFB 1EVZA 1N92A 5DULA 5IF3A 1RYEA 1Z7BA 4J90A 2O48X 2FP4B 4Z9YA 4UUPA 3UH1A 3PVZA 1DOHA 1P44A 4BV8A 1N9GA 2VNSA 4NK4A 3GVXA 2J3HA 3TZ6A 2VUSA 2X4GA 4RZIA 4I5EA 4WE3A 3WMXA 3V2GA 1F0YA 3WDSA 3IC5A 4ONEA 4AJOA 4BHTA 5FWNA 3TPCA 4BV9A 2O7SA 2HJSA 2VQ3A 3HHPA 1ZO8A 4QO7A 4XIYA 4BKOA 2EW8A 4H15A 4J4BA 4R16A 3UKOA 1KVQA 3ZW8A 2JAHA 3TNLA 3DO5A 1B8PA 3PTZA 5L7YA 1E6WA 1E3LA 4CV0A 2HAEA 2GD1O 3C1AA 5DP2A 5AYVA 1KEPA 1NFFA 1F8GA 1JKIA 1XSEA 1XELA 3I6QA 3Q9UA 3DWFA 4L9RA 1LXCA 2EHDA 2IEBA 1UXIA 5AXCA 1NVGA 1AUPA 3HG7A 4BMVA 4DPMA 3E48A 3B6ZA 3ZWNA 4TVOA 4BO4A 1QORA 5G4KB 3HE3A 1QR6A 2CMDA 2NUAA 3ITDA 4NMHA 3KVOA 3M2TA 4D3DA 1DFHA 1E77A 3EZLA 3K73O 4J1QA 4I5GA 4L76A 5IJZA 3GUCA 4C7JA 3RASA 1TLTA 3Q6IA 1PX0A 1CWUA 2I66A 4E32A 4Q3EA 5HRUA 4CMBA 4YR9A 2YUTA 2NQTA 1KY5A 5TT1A 3LT2A 1HDCA 1FDVA 1B0AA 3TFOA 1R16A 1ZMTA 3PLNA 4BKPA 3NRCA 1ZK0A 3U4DA 2X7HA 3C7CB 5HS4A 2X0JA 1HKUA 5DF1A 1EVJA 4MINA 1GYPA 2JJYA 3IDSA 1IULA 4JN6B 3ZNPA 3GAFA 1L1FA 3PP8A 3GEGA 4CQMB 5J23A 1PGQA 4ZQBA 4AJIA 4P22A 4WEQA 1RKXA 1ZW1A 2FR0A 1IUKA 2VTDA 3KYDB 4I9NA 4A0SA 1NR1A 3HZZA 2J5RA 4N18A 4OO3A 4DTIA 5KKCA 4BNJA 3AW9A 2O3TA 2V7PA 5JW6A 3HUDA 4R1TA 1YH3A 4ALJA 1GZ4A 2B37A 3KB6A 1E1NA 1ZUD1 3F1LA 3KHUA 1P3DA 3D4PA 3VH1A 1ENZA 4R1SA 3JD2A 1UZMA 3GMDA 1U3UA 5L9AA 3FD8A 3LT1A 1V0JA 3RU9A 3GHHA 1RWBA 2JAPA 4I8XA 2Q46A 5COBA 1I2BA 4WGGA 1CJCA 3FBGA 4OKIA 5KJEA 4NHEA 2PA3A 1SCUA 3QRWA 3WX0A 3JD4A 4PN3A 2QHXA 1K0UA 2P4HX 1EUDB 1GY8A 4XYGA 3U62A 4DBVO 3NJ8A 1GUYA 3OQ1A 2CY0A 2Y68A 3AFMA 4BGEA 5A5FA 4CL8A 3U5TA 4WLVA 3Q3CA 2V6BA 1OMOA 1UDBA 4CM3A 6ADHA 3GY0A 2FPGB 3TSCA 1Q1NA 5C37A 4U6QA 3E5MA 3NTOA 3W8DA 1DLJA 1GPJA 1NPTO 4KWHA 4Q3CA 4QT0A 1YL6A 5TC4A 4BOYA 1MB4A 1NR7A 4AJ1A 4YJFA 1E1KA 2B4QA 2F00A 5A5EA 2CF5A 2QW8A 4BNIA 2FP4A 4IXTA 5F1OA 4LCEA 3S2EA 1R0LA 3TN7A 1LLDA 4ROSA 1LEHA 5G2OA 5BT9A 1NQTA 3EMKA 1I3KA 1N8KA 1H94A 1GAEO 1Q0QA 1UR5A 2Q49A 1PQWA 2Q4EA 2VZ9A 2WD7B 2A92A 4YEDA 1LBEA 4RQTA 1G6KA 1EE2A 1Y9AA 1KBZA 4ZD6A 3QWHA 1I3NA 3QP9A 1ZK1A 4PFJA 2X0IA 4OKNA 5FI3A 1DDOA 3GZNA 1BDMA 4YJDA 1JN0A 5ER9A 4I08A 4YJHB 1B8UA 3GT0A 1P1KA 3X2EA 1UP4A 2CDBA 3C7DB 3Q11A 2FRDA 1Z45A 3AUTA 4YAEA 3ETGA 1E7RA 3AFNA 4QFDA 1P1RA 4WNIA 2Q2VA 3DAGA 3GOHA 4EZBA 3I9NA 4Y8VA 2XXJA 4PG4A 5G4KA 3Q2IA 1ADFA 2X9NA 2JFFA 1F12A 4DYDA 1UP7A 3F46A 1R4MB 3DBHB 1Y8QB 3GRKA 3WGHA 2H5LA 4W6ZA 1O0SA 5I9LA 3DZIA 2CDCA 3VPHA 1M6WA 4GSKA 2DKNA 1C1XB 4KTTE 3I5MA 3GH3A 1X1EA 4BNTA 3B20A 4U0KA 1MC5A 2H9IA 3C1TA 4E12A 3GG2A 4RJTA 5I7SA 2G5CA 3H8VA 1Q2XA 3PQEA 1U4OA 3D4NA 2C7VA 3ENKA 3ROQA 2C5AA 4UVIA 2X6TA 4RVFA 4RVHA 4CQMA 1DLIA 3AU8A 4TKMA 3LSYA 4BNXA 1T2EA 3ZWCA 1NFQA 1PL7A 4IZIA 5KNLA 4XRGA 4YJGB 2NQ8A 4PRKA 5DBGA 4R69A 2ZCVA 3VHRA 4DWVA 1DFIA 3EYWA 3G1UA 5GZ6A 4BNLA 1CYDA 2UDPA 4P4NA 1P1IA 2HMWA 4PG6A 3ZWMA 1MUUA 5L51A 1FJHA 1NBOA 4HY3A 1E3EA 3A4VA 3ULKA 3WQSB 3PHLA 1U7HA 4AJHA 4DXHA 4XJSA 2W2KB 1I3MA 3AM5A 2O3JA 1KETA 1KIFA 1YQDA 2YZ7A 2IODA 3EW7A 2G1UA 4GKVA 2VYVD 2CVQA 1SMKA 3BTVA 2XF8A 4OL9A 1JAYA 4XKJA 1VL0A 3KRTA 1HE3A 2TMGA 3FNEA 4O5OA 2G0TA 5DNAA 1GL3A 3A06A 5EN4A 4WNCA 4BO1A 4S1VA 1BDBA 1X7GA 4Z3KA 5K6AC 2OP0A 5H82A 1EUDA 1LA2A 2IRWA 4FGSA 3NEPX 5AQ1A 2ZB4A 3IAHA 3FTPA 2JFHA 2E37A 5MGBA 4XQ9A 2UYYA 2Y93A 2H1SA 1J4AA 4K6CA 4JJIA 3ZHXA 5A4DA 4UVGA 5ILOA 1NAHA 3I23A 4IJWA 2FPGA 1FXSA 1RM5A 4BMNA 4W99A 1DJQA 1HZZA 4GMFA 1YDEA 1LRJA 4YQYA 4PLPA 1H9AA 2BRUA 1ID1A 3RFXA 4PLTA 2J6IA 4PZCA 4E2ZA 3AI2A 4NG5A 1A4IA 3KBOA 3IKTA 3NUGA 3TL3A 3CZRA 2Z5LA 2JD1A 1P1JA 5EQFA 1QYVA 3UCEA 2O4UX 1DIAA 4UUMA 3M1LA 2GDZA 4PLFA 3DHEA 3GNSA 4BNKA 2E49A 1C14A 1M66A 2D5AA 2QIOA 4RF3A 4UREA 4MDHA 5A9TA 3RKRA 3VVBA 1GCUA 4EUFA 2WD7A 3SC4A 2VHZA 1U1IA 1C0IA 2YJZA 1LC0A 4M87A 1EFLA 4LSMA 3E5RA 3OFSA 5EL0A 1QYCA 4DA9A 1HDZA 1BVUA 3V5NA 4A03A 4FIZA 1XKQA 3ANNA 5G0VA 3LLVA 4YJHA 2PGLA 3BZUA 1D4FA 4CM9A 3RC7A 5H83A 5THQA 2B4TO 4DLBA 2GRAA 1IY8A 4BS9A 2W98A 2I5PO 3QA9A 1C3VA 1IHYA 3DR3A 4JXKA 2VNAA 1YB1A 3GA0A 2WM3A 2EP5A 3KUXA 1P1FA 3RC9A 3UW3A 3ZWYA 2FPIB 4R9RA 3WGQA 4WCDA 2PZMA 3CH6A 2CD9A 3K31A 4Z0PA 4ZA2A 1R4MA 4NIMA 3DBHA 1U3TA 4PLGA 4BNWA 1Y8QA 2D8AA 4BO0A 5FFFA 4FR5A 5FYDA 4EEZA 2Q1WA 1SOVA 4ND1A 3DBLB 3I9OA 1C1XA 4HFNA 1TA4A 3PJFA 5KJ6A 2UUOA 4DIBA 4EJMA 1PQUA 5IN4A 1KEUA 3W4JA 1JLLB 3WR5A 4J7CA 4CM5A 3RUIA 4R51A 4DYVA 3JD0A 1BW9B 4CMAA 3I9JA 4ESOA 4ITUA 4HADA 5TRTA 3F4LA 3RUEA 4CMGA 5EIOA 3JQ7B 1I2CA 2ZQZA 3O9ZA 2Y0EA 2P91A 4FSHA 4JLWA 1NVTA 3H65A 1Q7CA 1R37A 1EBFA 4YRDA 5HA5A 4YJGA 3VTZA 4BB5A 1O5IA 1JWBB 5KVQA 4YAJA 1I8TA 1D7OA 5L45A 3INGA 1XGKA 1I01A 2YV2A 2QRKA 5JC8A 1JA9A 4GX5A 1PJLA 1JWAB 4E5PA 4RPGA 4GKBA 5ES3A 2X5JO 4CM4B 2W2KA 4TROA 5CFZA 1UUFA 3AOEC 2YQ4A 4YT5A 5FF9A 4DC1A 2VHYA 5DCUA 2YHUA 1O9BA 3VZPA 5DZSA 4CUKA 1B16A 2EEZA 2DVMA 4XQEA 2B0JA 2NU6B 5L7TA 4RZHA 2WD8A 3PEFA 3TOXA 4JCOA 1IPEA 5JO9A 3EC7A 4GWGA 2B36A 1ZCJA 3BHMA 2HDHA 5IDWA 1CERA 3GGOA 3JQCA 3NGXA 3R6DA 2G82A 4CR6A 1G0NA 3E82A 2ZATA 1LDEA 3I9LA 4FJ2A 4EYEA 1YQGA 2ZTMA 1GUFA 5IDQA 1GFSA 2QZ9A 1P0CA 2HO5A 2PV7A 3MTGA 4FFMA 4R9SA 5K9ZA 3UF0A 4WECA 2ILTA 4TZKA 5C7OO 4RPLA 1O94A 3CMMA 5TNXA 2ZB7A 4K6FA 3FNHA 4MVJD 4RF5A 3RFVA 1O8CA 1UDAA 1PGOA 3TZQA 4WASA 1Z6ZA 3QVOA 5T8KC 4CLHA 1ZSNA 3TJRA 3IJPA 4KP7A 4U6SA 3PWKA 2RBEA 3DZJA 1B8VA 3HDJA 2X9VA 1KEWA 1VL6A 4DVJA 2OBNA 1AHHA 1AHIA 1GZ3A 1X15A 1XU9A 2GF2A 4FFRA 4GQAA 4B8WA 4EITA 3GEMA 1Y9EA 5B12A 5TIIA 5C3MA 4J1TA 1PWXA 1JTVA 1F8FA 2I99A 4PZDA 1YB5A 4II3A 3RUDA 1SB9A 1UXKA 1L7DA 4D3FA 1MC4A 1XDWA 4PVCA 2ZB3A 4XD2A 2PFGA 2DM6A 3HADA 5K6AA 1PZGA 4I9HA 4MIOA 4E2WA 3WLFA 3I3OA 3IUSA 3QVXA 3NDJA 4OXNA 3G17A 5FEUA 3HJAA 3WYBA 1LLCA 1GYQA 3ZU2A 1YJ8A 1DIGA 4MOWA 8ADHA 2P4QA 4BO3A 2IXAA 3OA0A 2PH5A 3KSDO 4YAKA 3ZHZA 4AICA 4UULA 3G49A 5TX7A 3NTRA 2NUAB 4RVGA 4EI2A 5ICMA 3QLJA 2GN9A 1CDOA 4QFCA 4R68A 4IPTA 3D5TA 1R12A 1V3VA 4IINA 4BO6A 1Q7BA 2WSBA 1YBAA 1GQ2A 2FPPB 1A72A 3INTA 2AG5A 2BGMA 4YXFA 5F5NA 3DBLA 3RCBA 3DQPA 3I4FA 3GFBA 4WLOA 3KOUA 1ISHA 2EIHA 4OAQA 3IQDB 3C1OA 4NDNE 4B7XA 9LDTA 3L6EA 2FZWA 4B8ZA 2YFHA 3NT2A 4GH5A 1LX6A 2Q4BA 4KWIA 5JCJD 5IG2A 1YOVB 5JAIA 1BW9A 1H6DA 3JQ6A 4GX0A 1ADCA 2JCVA 2NVBA 1I30A 4KZPA 4H3VA 3JQAA 3HB4X 3JQ7A 1XA0A 3ZGYA 5CDSA 2IYOA 3BTUA 3JQGB 5A3VA 2DBZA 3D0OA 3RC1A 1BTOA 5JAQA 3H4VA 1HDRA 2CZCA 5BSFA 3DBVO 2ZCUA 4DPLA 2UAGA 2C59A 3P2YA 3ZNNA 5TF4A 1DRVA 4YAIA 2DPHA 1HYGA 1KVUA 3KYCA 1O6ZA 2D5CA 1NPYA 2HUNA 3G1TA 2YDYA 4I1IA 2C82A 4MVJE 2JKVA 3JCZA 4UEJA 3JQFC 1TB4A 3W4IA 1E7SA 1NXQA 3FR7A 3GVCA 3GN2A 2GN8A 1R0SA 3IL2A 1WMBA 3VKVA 2GZ1A 1DFGA 1K89A 1JU9A 1CRWG 1BXKA 4JJGA 5HS6A 1WZIA 2B5VA 4BNYA 3CINA 1WZEA 3ASVA 2I65A 4FS3A 4Z9FA 4DIFA 1DHRA 1J5PA 2AQHA 3DOJA 3EUWA 4Q9NA 3RJ9A 5G0TA 2PD3A 5F5LA 3ABIA 2BHLA 1AGNA 2EF1A 2GN6A 4MKZA 4PLWA 3K92A 1UXJA 4R1UA 1U3WA 2PH3A 3GGPA 4E6PA 1B2LA 1X1TA 3UOGA 1D1SA 1DC5A 1KOLA 2ZIZA 3PWSA 1SOWA 3SLGA 1GYRA 4J16A 3ZV5A 1TT7A 1U7TA 4N5LA 1U2GA 3ANLA 2ZQYA 2NWQA 4CV2A 2BFOA 4NZ9A 2DPGA 4YRAA 4KUGA 5CDYA 2EV9A 3Q0EA 4O1MA 4DUPA 4XJTA 3K8ZA 2VHVA 1LI4A 4E0BA 3CE6A 1EE9A 1GDHA 4AFNA 1KVRA 2FHSA 2WDZA 2PLAA 2Q99A 3IKVA 3AOEA 4L4RA 1W4ZA 5JE8A 5A9RA 1G1AA 1ZMOA 2W90A 3LDHA 1QV7A 1P45A 4A7PA 1XLTA 3GZNB 3H9QA 1JKFA 4IJVA 2WJPA 3RBVA 3WGZA 3MJ4A 4DGSA 4WLUA 4RDIA 1XR3A 1N7GA 3JYLA 4ZRNA 4L8VA 1U28A 1GQQA 4JJFA 5I8ZA 5JY6A 1PZEA 1ZKMA 3C7AA 3OM9A 1H2HA 2EGHA 1PJSA 4TWRA 3B1JA 2FY8A 1V8BA 3C8MA 3ZV6A 1H6AA 4L4XA 3HN7A 4R01A 1NFRA 4ALIA 3MOGA 3PJGA 4IDAA 4XYEA 2AEMA 1JDJA 1U2DA 2H63A 4FOSA 1VSUA 4Q3AA 3A1NA 3U4HA 3WOHA 4GVXA 4D44A 4LCJA 1B3RA 4HX5A 3BA1A 3NTQA 1AXEA 1XG5A 2FPPA 5T8KA 1LSOA 4BIIA 3D7LA 4PZEA 1V6AA 1GD1O 2O3RA 1VLLA 4KQXA 3SX2A 3WBBA 2HLPA 3PYXA 5A02A 5KWEA 4O63O 1ENOA 2GERA 1ENPA 1W0CA 3HDHA 2EKQA 1FDSA 1YB4A 1U3VA 2PGDA 3BMQA 3P5SA 1PGNA 3ZNOA 1DIBA 2OOSA 1VKNA 3HDYA 4XGIA 3ROMA 1MV8A 4P8RA 1PGPA 1YOVA 4ALKA 4A2CA 3VAZA 2E4AA 4E3ZA 1MGOA 4AJKA 3F1KA 1O89A 5BQFA 4KUEA 3D3WB 5EQDA 2I6TA 3JQGA 4L74A 4WLEA 2W8ZA 4S3MA 1Z82A 1WLYA 1SAYA 3DZFA 4ND2A 3FI9A 4J6FA 4QX6A 4TMFA 4U5QA 1YO6A 2D2IA 3DZHA 2B4RO 1BHSA 2GUGA 2LDBA 2FMUA 3GGGA 4UUNA 4WK6A 1GV0A 4XQGA 3AOGA 2VHXA 3ZU4A 1NP3A 3WYEA 3W6UA 1CETA 1T2DA 5CHEA 5TT0A 2NM0A 2DAPA 4BO8A 4CV3A 4RLHA 3ZWOA 5JS6A 4OQZA 3HDQA 1NQ5A 2W2LA 1IHXA 3JSAA 2GZ2A 2BELA 2O2SA 4E5YA 1NQOA 4GPD1 3AK4A 3HQ4O 4B4WA 3E1KA 3BMOA 3INRA 3DEYX 4RF2A 5LDHA 2JD0A 3FNGA 4JBIA 4B7CA 2NTVA 1FDUA 4PVDA 3BTOA 3C24A 4LW8A 3DTTA 4AJ2A 2NVUB 1A71A 3GQVA 2O50A 5EJ2A 5HTOA 1Y81A 4ALNA 1HDXA 4WKGA 3VZRA 3KETA 3ZW9A 1Y1PA 3ZI0A 3JQ9C 3MEQA
chains in the Genus database with same CATH superfamily
2O8NA 5IK2D 3M6VA 1SXQA 2GTPA 2ZI6A 2W8BB 1H0RA 3IXQA 1JR6A 3QIAA 2F59A 4PCLA 4Y2SA 3EGWA 3H3XA 2JIMA 1GOTA 4RGVA 3IVRA 2OORC 3UCFA 3ZGLA 4B85A 4RTNA 1NJSA 1ZGBA 2GR9A 2NMVA 1J42A 2X5OA 3KWLA 4P2BA 5REQA 2HRZA 3ZS8A 4QDUA 3B6MA 1Z2NX 4HO1X 3A6JA 3QELA 1OFIA 3PNVA 4XRRA 3VR5H 3L92A 5HQTA 1TL7C 4BNVA 1PR3A 3Q88A 2SCUA 4ZN6A 2GD6A 5DOZA 1C8LA 1R0XA 4N3NA 4P54A 1UM9A 3V7WA 3W8NA 4RHYA 2HOQA 4GEKA 2X58A 1ZR4A 1H6CA 1ST3A 1SUWA 1TW3A 5AKZA 4Z0NA 2IBSA 4KXNA 3NASA 2HEGA 3CEAA 3I9KA 4KQGA 1ORTA 1RYMA 3LUCA 3FDXA 3WLJA 1GCIA 2OB2A 4JEHA 1W25A 4ZXPA 5K4AA 3EGOA 2E5FA 2XMSA 1UPUA 3R5SA 4GI7A 1V2GA 4HR7A 1MHTA 5HGJA 1T5IA 4YROA 1D2CA 3IOMA 2V65A 2XQIA 5CH8A 1T4CB 2IZZA 1T3SA 1VL1A 4ZHQB 3P27A 4JR0A 4EG8A 1N5LA 1Z06A 1E3IA 3IAM6 3JXEA 3D64A 3AVXA 1JLHA 1Q0UA 1F1JA 1J25A 1RM0A 3MD0A 2B6HA 1NI3A 3RYFA 1DUVG 2X4LA 3RH0A 1PJ2A 1UEXC 1QG0A 1TJYA 3LY7A 5DGHA 3J81A 2WJJA 1JFSA 4TKUB 2IPLA 4ZI7F 4AD8A 3KHKA 3Q5DA 3ZHQA 4JXJA 3ZWXA 2IZ0A 3VH3A 4B87A 2JA2A 1V4NA 2GK4A 4WRRA 3TXAA 4G65A 3KV1A 4I14A 3I92A 1F14A 3RRYA 4DNPA 3GUZA 1VJDA 1FRQA 5TARA 1NDQA 3CF0A 1KI1A 3HV0A 4Q7LA 4DQXA 4E13A 3UBTA 3FDZB 2X3YA 3ZDZB 4F71A 3PZRA 5HGXA 4UMDA 1X7ZA 1VLVA 2ZTLA 2QSUA 3QVKA 1RPTA 1U5AA 2I2AA 3E8SA 1J0DA 1BD4A 2O2JA 4IDBA 4QA9A 3FPEA 2ZI5A 3T7JA 5JRZA 4K87A 3BH6A 1MVNA 5TDHA 1YUMA 2G28A 2HQSA 3DMNA 4BUZA 4RV9A 3U3MA 3EGCA 1QKKA 3QLVC 4ZAVA 5LQDA 4MYUA 2B8WA 3IPXA 4KGVA 4JK3A 3ZNQA 1T3HA 3NC4A 5F2EA 2PT7A 2GAOA 3SEFA 4AM8A 4HV4A 3FPSA 1XEXB 2EQBA 1IE3A 2O20A 2ECOA 2VJPA 2WJAA 3OPNA 2PUHA 1HRDA 1PJRA 3QOFA 4WZBB 2VQFB 3ZI7A 1SXHA 4QWMA 2YZNA 3HRKA 2Z8YA 2Q5OA 1MPTA 2ZYGA 2J3QA 2D1FA 3MJVA 4Q4JB 1BXGA 2ATXA 4O0LA 4R54A 1ZM9A 5EIEA 4LPSA 4JQCA 4D57A 5DI9A 1CJUC 4F2WA 1L7AA 3ELUA 2Y66A 3A1SA 2DBRA 5ANRB 5A5GA 2J5KA 5T64A 1EK5A 1U8FO 1XVTA 5AWFC 3WGNA 3L0CA 1EFRA 1MO6A 4JSTA 1XZHA 2CFTA 2Y2VA 2OPBA 3I1IA 1V26A 2YJ6A 1YFKA 4OXYA 5JXIA 4UTOA 3ZHUA 4DBLE 2ISSD 1QOPB 3E8MA 1J24A 4HYEA 5CLLA 2DPYA 3HJUA 2QM0A 5DM70 2P7HA 3BQ9A 1BJKA 2ET6A 2P78A 3WKDA 3SIXA 3P9CA 2PO7A 4IWNA 3U7QB 1ULSA 3WNDA 4PNZA 5DIZA 4II2A 3OMLA 3UOAB 3CC8A 2YXLA 3DH0A 1USIA 4LNUB 3BULA 1QYXA 4HTFB 1AK1A 1PTJC 1R0YA 3IAEA 3IE1A 4JFAA 2BGGA 2A1IA 4BO5A 1P0MA 1A5SB 2O2EA 4RORA 4TZTA 3TQOA 3S8EA 1XMIA 3LX4A 4HSGA 4YNBA 2VSYA 3MQFA 3P5BA 3GHYA 4IIUA 2UXCB 1E8NA 4YRLA 2PX2A 4WQMA 1EFHA 2NVUA 4DLKA 2CV0A 1E8MA 4TRJA 3H19A 2PX0A 3C43A 3OI7A 3QMPA 2EWMA 4N7BA 4R0MA 3LK7A 5HX7A 2ONYA 1BZYA 1UBNA 4O4HF 2XWBF 4JFRA 1ZESA 2RC5A 1ZICA 3D0KA 4OHCA 4GHWA 1D09A 4PLVA 2YV5A 3CUEF 2V6MA 1HXHA 2W8BA 5FA5A 2RFLA 3MCVA 4OXIA 4UBJA 2X86A 1BWRA 2GBIA 3DXXA 1E9BA 1ZL2A 5I9MA 4E2XA 4EB3A 3OM8A 5AO9A 4US1R 5EJ4A 4CT4B 5M2QA 2DU8A 1XO1A 4NCAA 4Q37A 2H16A 4Q4AA 4HNGA 1AQNA 1RXYA 4MB2A 3ONDA 2ZIAA 4JA0A 4RZ2A 1WHSB 1NVKA 3I6BA 2R7AA 4FKZA 5I4KA 1U99A 1ZGZA 3OU6A 8LDHA 1O6GA 4FHZA 2ZJ5A 4GI2A 1SUPA 2QRPA 3UBMA 3LIPA 2P62A 2ZJ4A 3NIFB 4FX5A 2IWRA 4X62B 3KE9A 5G0SA 2P27A 2Y0DA 3WWYA 3PUVA 1RJWA 5AVOA 4AJJA 1YZFA 1U1GA 4CFSA 5I51A 3OCXA 2BLNA 3NHFA 4NFYA 5IVHA 3A3YA 2ZRFA 3T0GA 2AJDA 1X87A 4GC9A 3R7DA 3Q3HA 1ZNYA 2QMZA 2C9YA 2FZEA 1XPRA 1UIMA 2FVYA 3D4OA 3CW8X 3TAXA 5EE1A 3HWX1 2YN0A 3KOMA 4IQGA 3NG1A 4EECA 2ORYA 5TJ9A 5ARDA 2IYEA 2MSCB 4GT1A 4P08A 1PUXA 3FNFA 2IXBA 1Z83A 1I7NA 1PW5A 3EBLA 1T13A 3G2OA 4IMRA 4ZHQA 1QGUB 3FCOA 2CXNA 3U3OA 2G83A 4RHXA 2OBFA 1LC3A 1Q1AA 4MRSA 3NPAA 2F3RA 2QVCA 1DQSA 4OXKA 3JQ9A 3OETA 3CSDA 3QJ5A 4KXWA 5EG5A 1OXXK 2FU5C 3NVAA 3CX3A 3QPAA 1JAXA 4MPPA 5ICSA 4HNAB 4P4UA 3CS3A 3FSRA 2WPDD 1TEHA 4R8VA 4NZPA 1YQQA 2UVDA 3LCVB 4JXXA 1XRNA 4ON9A 4PBSA 4KUHA 3RRBA 5AKGA 1UPCA 2OTCA 3CUKA 1NTOA 3X1DA 4FYKA 1L5MA 2NNWB 4DB2A 1I24A 3I64A 4KXXA 1Z73A 4XA8A 2QLFA 3UJCA 5HJEA 3IEVA 3EMBA 3EIEA 4OGGA 1K5HA 1XEWY 1P72A 2HC9A 2OFFA 4CBVA 4EAQA 3DLBA 2J0UA 4F5WA 4OLHA 3GJ0A 3CBQA 4I99A 4IFBA 3OJOA 4TMVA 2DFDA 1IZ7A 1IY0A 1SULA 1T4MA 2VWHA 4LZNA 2EC5A 1EUCA 1G55A 1KIMA 1KTVA 1WMSA 3DT8A 4JOBA 2RHWA 5CYFA 4BMCA 4EGQA 1TA9A 4EUHA 2PBRA 1DWOA 4MMYB 4DC9A 3LDAA 4K46A 4P33A 1R9MA 2PKQP 1S96A 5A0FA 1IDN1 3X1XA 1XMSA 2YRWA 1RPNA 4LGCA 1TVMA 2Q4DA 1YACA 2YDXA 4MKHA 1NHWA 3LBHA 4AJ4A 2CNOA 3P9XA 4ECEA 2RHBA 1L7OA 1VHQA 4NYJR 2B21A 3S28A 5ESDA 2DUNA 3JRXA 3K05A 4LHSA 1IZ9A 2VT7A 3GQBA 1F51E 1G20B 2P5YA 1P7VA 3WLEA 3BG5A 4JS0A 4TLDA 3OY2A 4Q4HB 1RXIA 1EMDA 4WESB 3ILVA 4TTIA 1XEXA 2G1KA 3DMTA 2XMRA 3TRDA 3V8BA 2D59A 3I1JA 4KQ9A 4XYMA 1X9HA 3QUBA 4MWZA 1KEEB 2CFSA 2AWOA 3A6LA 2ZB2A 1Q22A 4OMUA 1SPXA 1IK4A 4OHWA 2H0RA 2CVHA 3M6MD 1ZJJA 1R1DA 4DM4A 1IM5A 3VR6A 3GFGA 4N5MA 4ARZB 1F7UA 2O8EB 1YKGA 1WY7A 5IRCD 1S89A 3MBOA 3WA6A 3HUTA 5CURA 3CGGA 5JQGF 1G5HA 3R3VA 1QE3A 2GYUA 1MAVA 1LI5A 1TQ4A 3KYCB 3TIGA 2CL6X 1T2FA 1CQZA 4IAOA 1XLVA 4J2OA 3DMRA 4WWHA 2CCJA 4S1WA 3OTOB 3DFIA 4HRAA 5L7WA 4UC0A 3O3OB 4I1VA 2P6MA 3U7QA 4Y2VA 1N5RA 1IMJA 5BYAA 3RS2A 3ABOB 4LNUA 1Y1RA 1SBHA 1D2AA 2V5VA 2O8CB 4HTFA 4MWOA 4D02A 3WZ2A 2CGEA 1RRKA 2EOAA 4IMJB 5D3MB 1QF6A 3OX4A 2R66A 4WPGA 4EBFA 3PUHA 1DEKA 4R1SA 4ZQIA 3K2EA 3A10A 4TYQA 1JVSA 1U1CA 3L9XA 4OOEA 2P3LA 1XOIA 4WJZA 2HSDA 4LJLA 3VH4A 3UHAA 1FZQA 4JVLA 1WPQA 4IQ0A 3U61B 2ZYTX 2WAOA 4N8EA 5TLSA 5ENVA 4Y6RA 1D2HA 3LXUX 3NS7A 4B4VA 1DE0A 5KVAA 1IZ0A 2DLDA 3K3PA 3B1VA 1J49A 4WZBE 3NBUA 1KKMA 2VXOA 2R5NA 3OLVA 4FC6A 3V4FA 2BI8A 4IRUB 3KVRA 4Y2RA 5BWBA 2V3CC 4RK5A 4MWBA 2X0KA 3HNPA 2C9OA 4MGIR 4NJMB 5KIAA 4XCXA 3M4NA 3B2NA 1DWPA 2BEUB 1C1DA 1EP9A 5FUBA 2Z8YM 3EGDB 2OYSA 3EZYA 4DCPA 2FR8C 4Q9HA 1PV2A 1OX5A 1T25A 2MYTA 2TSYB 3CWCA 4UM9B 1YFJA 2LV8A 1ZEMA 1WHSA 1ZW6A 3AHJA 5T57A 3ZV4A 4BLVA 1FF9A 2YIVX 2AB0A 3BC1A 2GJKA 3BL8A 3G02A 1IOLA 3ODGA 2QP3A 4X6LA 1D6SA 4YGXB 3ZWPA 4D0GA 4Y6SA 1BGWA 1VG0B 1TO1E 3OZDA 2H5EA 3EHEA 4BRSA 2DXIA 4BN5A 4F97A 1HTTA 4HS9A 5FBWB 1Z07A 1GKYA 2VWGA 4GP9A 5D86A 4B4UA 5CJ2A 1ZAYA 1DC4A 2OHIA 3GLVA 5JCOC 3L84A 5T4BA 3O8QB 4IJMA 1KZGB 2PRYA 2OKCA 4C30A 4G67A 1BHJA 4JBYA 4OLAA 3BWVA 1KVTA 3IT3A 4MKXA 5ALOA 4NC9A 3B89A 3T7KA 1RMQA 2O2GA 2PQ6A 1JBEA 4NMXB 1V16B 2QG4A 3H84A 1Y34E 1GNLA 2MMCA 4WCVA 4NFLA 5BSGA 1YONA 2QZSA 4Z0HO 1KI4A 3MILA 1M2HA 3DVRX 1IUPA 2J6BA 3V2HA 5JS7A 1MCZA 4PICA 1FNBA 2BI4A 2ZOSA 3OTHA 1QCDA 3HN2A 4C4OA 1DAPA 1PJBA 3FFWA 4BZWA 2H7VA 1GEEA 1SRRA 4ISCA 4HGNA 4HNAA 5EHZA 5JTTA 1SUFA 5HMLA 4JGIA 1HEUA 1J7JA 1P4SA 3CJRA 4YJKA 1AS3A 3VZCA 2Q3LA 3AF1A 4MUKA 2JF0A 2Y0CA 3A4TA 1NMYA 1NJ8A 3RG2A 3ZZNA 5A6VA 2ATIA 7ADHA 1EXDA 1T5DX 3V8QA 5EE5B 2BMWA 3WIEA 4BLWA 5AFSA 2ZM5A 3BIFA 3FETA 4XFKA 3MYRA 2CHGA 1SVLA 2DR2A 2E21A 3CRMA 4UOEA 4LRSB 1HEYA 1IN7A 2GSWA 4KXLA 1FRZA 2JIRA 3NDPA 3PHIA 2VRNA 5CT5A 4J0JA 5J4HA 3CISA 3IVCA 4H6WA 1B00A 1MXFA 1Y0BA 2R6GA 1T4DA 1XNHA 3QVSA 4IS3A 2VYFA 2QMUA 2OAEA 3IIKA 1YMUA 3O0DA 3PX2A 4GMGA 4URFA 4OP3A 5FO1A 4YMUA 5A05A 5CEFA 4CM1A 1WULS 4UMFA 1XAJA 3TW4A 4DRYA 2HT1A 1A4XA 1Z7YA 4KRGA 1GUAA 3KQMA 3ESXA 3ZLTA 1WM1A 5LQCA 5EPOA 2NPOA 1G20A 3ZS9A 2IHBA 3UH0A 1K63A 2PD4A 3A1CA 3E5NA 3F71A 3GP5A 4V39A 2R2GA 2VPIA 4XUDA 2B2XA 2JGRA 1U9IA 2XDAA 5CDGA 2JLWA 1KEEA 1Y6GA 3PQCA 3LCJA 1V6CA 2JVIA 4JY7A 1VYUA 3H2BA 6REQA 3MJHA 3TK1A 2A0XA 4KE6A 1CRPA 3UWDA 4LF9B 4NOKA 1P0PA 2E55A 3KQNA 2G4VA 2V6GA 2WIJA 3W77A 3RWBA 3MWDB 3VH2A 4X6XA 4QTZA 2A3RA 4R05A 5DCWA 4ARZA 2O8EA 4UEKA 5J43A 2P5TB 4D43A 1T6XA 2N1MA 2CXOA 4ESVA 3NWPA 2Z98A 3QPVA 4PWYA 2EZ9A 4TTJA 5IKOA 2NU8B 1T4BA 1USWA 4ZCPA 1JHQA 4Q05A 1IXYA 1IVYA 2FHPA 2NO4A 3T5CA 4DIDA 4FXOA 2BW0A 2E9SA 3NOOA 4QLBA 3H87A 1G9XA 3JD1A 1C9EA 1OFHA 2QXTA 3CNOA 3ZZ0A 4M0EA 3N59A 3BWDD 1Z0ZA 1UBKS 3DTYA 2O8CA 2I4MA 1RCUA 1Z0JA 4RCYA 1XAGA 4YO8A 1G42A 2EKZA 2GHRA 4YCSA 3VOTA 3PNBA 1K6IA 3CLRD 2YZKA 5FUYA 4EFKA 1KH1A 5KJ1A 3TVTA 1M76A 5GOTA 2DERA 4EF6A 1X9GA 2L18A 1WKBA 4LHYA 1G60A 1E79D 1JHPA 1XQ6A 2A3NA 5J9FA 5UKDA 4F5ZA 4TX1A 4B6OA 1WMAA 3G0OA 4DLZA 2QROA 3B1FA 3HCBA 2YC4C 1JPJA 3I6IA 3K9BA 4YFYA 5BMVF 1M6YA 2PKQO 4Z2AA 1HE2A 3BMCB 4FB5A 4G5QA 1KA9H 5C4MA 1OBVA 2V54A 4MW9A 4RKRA 4HDNB 4DA7A 3B78A 2JFOA 4Q1DA 3EA5A 2M98A 3R9XA 1II8A 2A14A 3BE4A 4A6EA 4F56A 4NJMA 5D7BA 4XVUA 5F7OA 4QUBA 1V8ZA 1VZ3A 4TKZA 3EGDA 4YCAA 2GDJA 2C1XA 2JATA 3HCPA 5K51A 2WSYB 4LSWA 1BSVA 2VDVE 4AKEA 4ZK6A 4JI8B 4F3KA 3T4PA 1K7SN 5FAXA 2WYWA 1YVRA 1L9XA 5IBQA 4CR7A 4AKIA 3PQ7A 4G5SA 2QD2A 4GGOA 1Y5NA 3T6KA 3U7FB 3CKMA 3QI2A 1QK4A 3C3BA 4I55B 1P3JA 4MYDA 1B15A 4WL0A 2ZJFA 5EKSA 5HK8A 4JI1B 2GAFA 5AOAA 4J3FA 5I9BA 3I28A 3KZ1E 3OSUA 2B25A 4GVLA 4OJMX 1NN5A 1NLFA 1FX1A 3T4XA 1KI6A 3W9UA 1VPEA 3KEFA 3LYHA 5A71A 3O8QA 1QV6A 3FTFA 1ZGCA 3VM6A 1QJ4A 2J9FA 2P65A 4EHJA 2FZ4A 4NQZA 2OXRA 1NQAO 1NE2A 5EESA 5FL7D 2WWXA 5DK6A 1E18A 4KFRA 3ZXSA 5JHHB 4B76A 5LLTA 5IBRA 4NFSA 4DDMA 1V16A 5IZCA 4D9KA 1Z75A 1L7PA 4P36A 4M0KA 3AERB 3EGEA 1WPXA 3TQFA 1DARA 1XZMA 2C03A 2FFRA 4Z0TA 2IQ5A 2R8BA 2P9YA 1TC1A 2PPVA 3HEBA 4IVNA 3DCIA 3LKZA 3VO9A 4OH1A 1ZX1A 1I2MA 1OIVA 3GD7A 4BBPA 2DP4E 3TQRA 3K9WA 4W82A 1GV1A 4CYMA 3JQPA 3TKAA 3DAFA 4FGWA 3FAZA 3VVCA 1UOQA 3SVLA 3PD1A 1VIVA 1UAYA 4POAA 1QANA 2ODEA 3IS3A 3I9V6 1TKCA 3DMFA 2VDKB 3C74A 3FJOA 2KHZA 3QMMA 1IZYA 4YMIA 3AHHA 4MVJG 4YCJA 2QU7A 5JCXA 1UJ4A 2BFCB 3A4YA 3RFUA 2FN7A 2RHGB 1P3Y1 2E5LB 2C00A 1A5AB 1MG0A 3AFOA 4PC3A 4IBOA 5JC1A 1VRVA 1BCSB 4ZO7A 1W49A 1DG3A 2ZWVA 4AG6A 1C3EA 1HE8B 1AMNA 2J0QA 1MIHA 1T24A 2FN9A 4DPKA 2YJTD 1K8XB 1Y5RA 2QTLA 1EGAA 2FSGA 2HPVA 3EAGA 4KAJA 3BWXA 2YHIB 4LISA 4QEDA 4RFSB 3SK0A 1K1EA 1UBUS 3HV2A 5G41A 4WCFA 1AGPA 4B3GA 4QOFA 4REOA 4BEJA 4EI9A 3T7SA 4X3CA 2GN2A 3H5TA 2PSFA 4KL8S 5HJ7A 1VYHA 5EPUA 2NOAA 3BMNA 2V3VA 1KJIA 1U7ZA 5KQSA 3K5HA 3BMXA 3S1LA 3PDJA 3IFSA 3QU9A 2XYQA 3WGUA 3MFYA 1YBMA 1MENA 3EIFA 2DT5A 4CN8A 3WY9A 1EESA 5JJ5A 1RM4A 1Y80A 3CM0A 5F78A 2PX6A 3B12A 3GDOA 5FTJA 3WFZA 3MWDA 1P5HA 1YR7A 1U8AA 3OX3A 5HDBB 4DDVA 2ID4A 1Z33A 4FI3C 4F6LA 2Y1DA 3C87A 3DXFA 3L41A 4M0LA 3TO5A 3PI6A 3RVQA 2WABA 2NU8A 4CIXA 4KQFA 2X1HA 3ADBA 2OFPA 3A1UA 4OJYA 4MDEA 5IMBA 4ND4A 3I05A 4GBED 3VDQA 3UHPA 4UM5A 3U1BA 1FTSA 4JGBA 3LVRE 4QPPA 1NDHA 4OXXA 5A0VA 4FI3F 2NU9A 4RK4A 4TOIA 1WP9A 3WLRA 5KCZA 3U60B 1S8FA 2IY9A 5C8YB 3J81k 5E7MA 5HEKA 1FVHA 4DIUA 3SEAA 5K2OA 3DZCA 1Y3IA 4NCIA 1WB6A 3B1WA 3RBAA 3L4EA 4IDNA 4FD3A 2M2IA 1N2GA 2XMBA 3S2UA 3WQQA 1NZDA 2V45A 1IK6A 2H8GA 4Y2UA 3S8YA 3QV2A 4G5OA 1M1NB 2KE5A 1OXVA 4GS5A 2CLIB 1W85B 3JW8A 3QOYA 5K8JB 3H3FA 1Y6RA 3W8RA 4V24A 3WGGA 2ZK7A 3ZEAA 2H7XA 3JQRA 2XB2A 4KSYA 2RI1A 1Z8HA 3EW9A 3BMCA 5FDFA 3CO0S 4TRMA 1BRMA 3BHJA 5CPFA 4NH0A 1FBTA 3I04A 5CNIA 4HDNA 1XVLA 4A0FA 3KQKA 4BEVA 1ECLA 1S2IA 4DLPA 1WQ1R 3BXXA 4O2AF 5B4TA 1CW2B 3G79A 3I76A 2VTEA 1A8IA 3NVKI 1HX7A 2AUTA 3B3QA 2WTBA 4G2NA 4M9QA 4FEEA 3GNTA 4QXRA 4BYGA 4CU2A 2AYXA 2XWQA 2YY5A 3KK0A 1BU5A 1KAQA 3CZAA 1O03A 1WD7A 3KT3A 1KFEB 4FDUA 3CV3A 3WP1B 4W5QA 1NVFA 3UWSA 2QXUA 3V1MA 4MR8B 1L5SA 1X70A 3E6AA 3V4ZA 3AKEA 3H5LA 1RWQA 4CM8B 3DL7A 2FRVA 1T8TA 3L40A 5DW3A 4I55A 2GILA 2ECQA 3AEYA 4IRXA 4MUMA 2HRQA 3VPGA 2I3ZA 3IHTA 3ITNA 5KYYA 5CIQA 1MEJA 1V6SA 4OBWA 3TLXA 2PSEA 4EZEA 3OO1A 1XL0A 2IT1A 3OLWA 2ZROA 4XX0B 1VLQA 2P2YA 3AY7A 3C85A 1RWPA 2VDNB 5CGZA 3UJAA 3U9LA 4JDUA 4MMZB 3Q7EA 5AKHA 4B79A 1QLHA 1B23P 1H93A 3HACA 2G07A 1DP4A 1VL5A 1WSDA 3PNQA 3W90A 2PKXA 3FMGA 1QCCA 1NNUA 3BORA 3CKLA 3S3TA 1N8TA 2VP5A 1X7WB 4D9FA 1VTKA 4CLOA 3AERA 2XXBA 5SV2A 2XKJE 4Q7KA 1OFUX 2IYWA 3Q0TA 4AQ7A 1L5QA 4QVKA 2CSUA 4DDUA 5MF6A 3GRFA 2HMTA 1PYDA 1CUBA 1P62B 1Z3IX 2J4CA 1XWWA 2INGX 5IJ0B 4GM0A 2FZCA 3I72A 4N82A 3EZ6A 1NI5A 2ZI7A 4X91A 4BMSA 5JXWA 3ANMA 4A5OA 1QYIA 1V37A 1V96A 3AUJB 2N9UA 4HYTA 3HA5A 1U4SA 2HREA 1MO3A 1O77A 3EVGA 4P9NA 3WHKA 4F06A 4TS1A 1VRWA 4ENVA 4MHTA 1UH5A 2QE6A 4HAOA 3OHMA 5BYBA 3LWZA 4OGKA 2AUMA 5TY0A 5LMCA 5KPDA 3HUUA 2IPXA 2BFCA 3T1QA 3NI2A 4D8YA 3CVUA 2P40A 3K09C 4Y1EA 2GNPA 2XMCA 1JGTA 1ZUNA 4J75A 1TD1A 1BCSA 2A59A 1E0DA 1CY7A 1QPZA 3VJKA 2PZBA 1XK7A 3D4BA 4CNBA 2GO1A 1TPZA 1MHPA 5K0GA 3K9HA 4X7RA 4YWHA 2VXCA 1FY2A 2FSPA 4PPYA 4C4XA 1TU3A 2CV2A 4WK0B 1JQ5A 3CWZA 4D6PA 5KAPA 4OJKA 5J4KA 1VE3A 2ACKA 2J9ZB 1WY5A 2AN1A 2J7KA 1LU9A 3M2PA 4CMHA 4DREA 1NW3A 4Z7QB 4ZMBA 2PTGA 3PI7A 4MLDA 3WL7A 3ESCA 1GPH1 3AVQA 4TN5A 4HP8A 5JDCC 2OM2A 1PZFA 5EERA 1N1GA 1R0ZA 4M46A 5G53C 1T9BA 3ZHTA 3QIVA 3LW7A 1SUBA 1OY1A 2V7WA 3MG9A 4D0NA 4YRMA 2PUWA 1M2WA 3BDIA 3DC2A 3A31A 1WA5A 5LQRA 1F2TA 2NV2B 3OBIA 5EMMA 1GL7A 1VKHA 2AE2A 2BN4A 3FCAA 1QG2A 1E2JA 1KPIA 2HA5A 3NOQA 1HNNA 2EGGA 3OIFA 4AJPA 5K7SA 2GLTA 1C8BA 3PE4A 5DN9A 3WL3A 4URUR 5K2MA 2XQFA 4KLAA 4R41A 4GAEA 3R23A 5M3BA 3QVGB 3UG7A 4MAFA 3GLIB 1JG3A 3LI2A 2VJKA 3TCNA 3RRFA 1M75A 3EG9A 4O4JF 5GADl 4JLAA 1GUZA 3GAZA 3GMTA 5LBUA 2GEUA 3RE1A 1ZNXA 1Y3FE 3A0RB 3IUYA 3JARB 3WL8A 3JAMA 4IG4A 3GLHB 2IV2X 4D4HA 3GFRA 2A5FA 1QRRA 3EE6A 4PZZA 4F2PA 2Q29A 3PQ3A 2I7TA 5F23A 3K9CA 3F5DA 4G5HA 2AEJA 2QTVB 3H8SA 1T5HX 2JFGA 3P9YA 4Q3DA 3WMGA 1U2EA 4JASB 5ALVA 1J06A 5IBCA 4ZVOA 4BMXA 1FRVA 1M1NA 1PBTA 2XV1A 3ZK7A 4LOHA 4UUOA 4NBUA 1XAHA 2P1RA 3KB1A 1B3BA 1JW9B 2PLRA 4E30A 4GE0A 2BMFA 3WQHA 2GAJA 5DM2A 4BWYA 1SCDA 2DR3A 4OLFA 2FQXA 4L3VA 4XGNA 4BDTA 1CYEA 2AH5A 1WUIS 3TIVA 3VYUB 1KO8A 4J43A 5KEIA 1TO2E 2V5AA 1QKJA 1RW4A 3G9TA 2RH8A 3RRZA 1OXMA 1YWGO 3ETNA 3HB5X 1CDZA 4LWZA 1PT7A 2C8JA 2CK3A 5DHUA 5BURA 4IICA 3AZQA 3QFFA 5ILQA 3OQBA 4D9CA 1O5OA 1RZRA 5CDHA 3RVDA 1RHMA 4UCQA 3VR4D 4L51A 4B46A 4B43A 2ADOA 5AT1A 4U7FA 1BGXT 1XZGA 2FEWB 3O7MA 4L27A 4MR8A 1R66A 1STOA 1SCAA 1E7WA 1F5SA 4CIDA 5SYMA 1USKA 1PLKA 1DRUA 4B9EA 1LCIA 1I1NA 1RTKA 3AQIA 1OFTA 3AQ4A 2VP3A 3F9RA 5AJWA 2PEZA 5M29A 3PNOA 3L7DA 4LCBA 1GQYA 3PHHA 2YHBA 1ZH2A 4XX0A 1K0FA 4URVR 1SVWA 3OZAA 3ADKA 5IAJA 2AC2A 3WV5A 5JH7F 4FYXA 4Z3OA 2J4FA 2NV6A 1PR0A 4O4HB 4AB1A 1WOMA 5B4UA 3TR6A 3JPYA 1FYFA 4HFJA 4G0WA 1N8SA 2D1YA 3IMKA 4WGFA 3GDFA 2DQ4A 5FBVB 1K88A 3S2IA 4OHVA 4QFBA 3TRJA 4QBFA 2JANA 2WAMA 3PEUA 3W6ZA 1YDHA 2X0NA 3CNBA 3O8DA 2I03A 2JASA 4ZYVA 4D4LA 3VR6D 2XR1A 2YV3A 2C0PA 2IOYA 3I3SR 4XDYA 4EDHA 1WBBA 4UBNA 1HNWB 4BKUA 2VYVA 5IAEA 4YRBA 3NUZA 2Z6QA 3E9DA 3EQ9A 1RXCA 3I04M 3P2EA 3CTMA 4ZARA 4JBLA 4UJ5A 1YULA 4FQ7A 4RZXA 2ODWA 2NZWA 1QYDA 2QRHA 1PDWA 2XMQA 4UHCA 2OO5A 2H65A 4N8DA 4RGYA 4MZDA 4BVJA 1QRTA 4X66B 4ND5A 4PG5A 1DMSA 1SHKA 1JHAA 1HL3A 1N5JA 2R68A 4LXUA 4BXOA 2RHCA 2Y77A 2AXPA 2PKWA 1ISJA 3T4EA 4YN3A 1CZOA 3T15A 4ACAA 1LS1A 3DT6A 4WA8A 2FEAA 3HXOA 2ZXUA 3ZJYA 4A36A 5HWSA 4W5HA 1BG6A 4YP0A 5GM2A 5JDIC 1LTQA 1OWOA 4KO2S 4G4IA 2Q1TA 5A04A 4GICA 2YY6A 1PK8A 5MDHA 3UXMA 4D45A 1AKYA 1T0IA 2NIPA 4PW0A 3WGLA 3G2MA 1E9FA 3Q7QA 3BGOS 1K6XA 1XCPA 3IODA 3N0VA 3DHWC 5FLKA 1Q0TA 4PCUA 3R9WA 3SHWA 4F3CA 4C7BA 3LQ2A 4RPHA 1PJ8A 1H2YA 1UBHS 1UJCA 3KFLA 3BS4A 3PGJA 2Q6KA 3BT7A 1NVMB 1E1YA 1C0KA 4TTTS 1W8IA 3M6UA 4UE2A 2HJWA 3PFFA 4MHSA 2BGTA 3T7DA 3URMA 2R8XA 3RC2A 4AROA 4LJ6A 4OA5A 5EE3A 2PUAA 4BNGA 1JG7A 1YGPA 3D1VA 3VC1A 3T0IA 4DDTA 1EQUA 1FUIA 4OOFA 5E4JA 1BMTA 3H8WA 4BB6A 5IHPA 1TYEB 2JI6A 2P3QA 4U7WA 3WLPA 1GT91 1Y98A 3EXEB 5CB4A 2WD9A 4IDCA 5EJ7A 4NDZA 3DVSX 1TVEA 4URYR 3JASB 5HE9A 3TPZA 4DIOA 5DSZA 4RVOA 7MDHA 1SXJC 3VNVA 4JJ8A 1R4NB 3QK7A 2B6NA 4HWKA 2Y9MB 2XWPA 3S99A 2XZPA 3UW1A 3GLIA 2HTEA 5DCYA 4GRDA 4HZUB 1FU7A 4HQKA 5FPQA 5JG7A 4RIFA 1XYGA 4RKWA 4ARUA 2F1JA 2PM8A 3LF1A 4G1VA 5EVJA 1V11A 5F4BA 4AUMA 2EU8A 4CCWA 1CUGA 5C3UA 3WGTA 1UDWA 1ZJ5A 3JARA 4JLNA 4B6QA 3LPNA 2BT4A 3F6RA 3VU8A 4W5OA 1FDWA 3KE8A 3QNUA 1IU9A 5HCIA 1GGHA 3UNXA 2IVZA 1ZMBA 1AGRA 2QTVA 2PBLA 1G59A 1UT6A 4BVFA 1E2KA 1EVIA 2QGNA 2Z2JA 5E7JA 2BZ1A 4GGMX 5JT1A 4EARA 3LRTA 3RROA 4B8YA 3G88A 1EEHA 1SKQA 2WWHA 3DE6X 1RQLA 3PC7A 5SZJA 1DXHA 3I8OA 1R6VA 5LA6F 4PYKA 4BO7A 1EHIA 4N54A 4YRFA 3NT5A 2ZJAA 5K0SA 1KU0A 1TZKA 3FPCA 4XYBA 4KRYA 3DDCA 3TW0A 4BP8A 5JQGB 4AVYA 3Q0IA 4AMZA 4LWOA 2OV2A 4WXMA 4R4JA 1EG2A 3UMVA 3AUSA 5CB0A 4L5YA 1GRRA 4TXMA 4FDAA 2EJVA 3SNHA 3EY4A 3W1VA 3AP2A 4OFZA 4FBLA 1H0KA 2NTYC 3FPHA 4OHFA 3LBIA 4ZP1A 1P17A 3CYFA 1GGKA 1ZHOA 3KXLA 1Z2OX 5CVEA 4Z2YA 5L6LB 1WKCA 2X1MA 4NOJA 5FR1A 3A9UA 3FR8A 1CB0A 4MLZA 3U1TA 1PS0A 2XZOA 5FXMA 4C0BA 3NXSA 1E1CB 2WK1A 1J2TA 1DKUA 2O2HA 5A6SB 4EJ6A 4ILKA 2XCRB 4R8RA 4X3PA 3WRVA 3H86A 2DX7A 4D42A 4DA6A 4YP1A 3GLHE 5AXBA 2AKEA 5E2IA 1DKNA 1L6RA 3EZGA 3H9BA 4MJLA 4DLUA 2QVBA 4NP6A 1B1AA 1ECPA 2QPOA 4KFTA 2DTEA 3MA0A 5HMMA 1U8XX 3UJ8A 1NZJA 3V3KA 4E08A 3A8TA 1AIPA 4RD2A 3UYKA 3H11B 2BKUA 3MUOA 4L4YA 5J5AA 4DSOA 1TM1E 1P5FA 3HTXA 4D8UA 2IFTA 5MN4A 3CU5A 1QX4A 2IE0A 4U2CA 5IC6A 4MYTA 2R79A 3NOXA 2WUWE 5K0CA 3W0LB 1Y6FA 4Q5IA 1Q21A 5IUJC 2CHQA 3P1JA 2IX3A 1ZOSA 1EKXA 1WW2A 3WJ2A 1OI7A 4TV9B 3QVVA 4I46A 3WLMA 4PN7A 4YXWA 4TZ6A 3PUWA 4XLZA 3WSVA 1TYDE 3KEQA 1KSGA 1JHMA 4R3NA 1HYHA 2YNMD 3W1EA 4P1ZA 3ZWBA 4F5YA 2XTAA 5FJJA 4GVPA 4MCJA 4Q3LA 4KN9S 3WNBA 3K35A 4ME6A 3A58B 3OOYA 3CLKA 5IULC 3DHYA 3FFXA 3A05A 1CVIA 1PTKA 2D2EA 2KW5A 4JP8A 3V97A 4Z4IA 1T5SA 3R41A 4YMWA 2HJ9A 3FRIA 3COZA 4UDYX 2CDAA 2V7GA 2YMQA 4S2EA 2AI3A 1S2NA 2DLNA 4Y3UA 1KKUA 3ZCXA 1KI7A 4R5HA 2YASA 1P31A 3UN1A 1TZBA 2WUEA 2ZQ5A 1WHTA 4V0QA 2Q9UA 4FDLA 1PT5A 1VI6A 2P68A 1EXVA 2FMXA 1NC1A 3WV4A 1DBWA 1KAHA 3O1JC 2Q2OA 3UB4A 3V6MA 4D4KA 4ZDKA 5TJHA 1EK6A 4EY4A 5AVJA 5FPSA 4WZAB 3U5ZB 4F3YA 5LYYA 3ETEA 4GPIB 4UM9D 4IMIB 4RJLA 4V0RA 2E4UA 3LP5A 2JLVA 1V9LA 1JLLA 1R9JA 4JT4A 4KHPB 1SM4A 1O3YA 5EP4A 1A8SA 4NNOA 5K20A 3K0FB 3QXHA 1R4NA 3KTDA 3M8KA 3L0IB 4DCVA 1SQGA 2OBLA 4QPDA 1U63A 2V0GA 3WXBA 3OURA 4QGHA 3DL4A 3WISA 4HZUA 1FK8A 2OL4A 3CT6A 3O26A 1WE2A 4D9NA 3SI7A 1NQXA 4GYJA 2ZT7A 3CW9A 5BW8A 1XJQA 3DLIA 4W9RA 3ROPA 3KKLA 2P5UA 4MV3A 4QYWA 1N1MA 3SOPA 4Q7MB 3L6BA 2FW8A 3UUFA 2E4WA 4B84A 1RQGA 2FPRA 4AY2A 5FWXB 4PQGA 3VVLA 1T0PA 4EENA 3K9GA 4J0DA 3KLOA 1WMEA 3B6JA 4MX8A 3ANXA 3KS9A 2BKEA 2B5WA 3K1JA 3HFRA 3E5HA 1SVMA 3MWEB 3P20A 3K20A 5AYVA 2B35A 3ZWWA 1E62A 4JGGA 3HM9A 4MO2A 2GJAA 2HDOA 1P6QA 2JB9A 2SECE 4YJ3F 4OBEA 2DKFA 3WNQA 4I8DA 4ECAA 5BSTA 3EZ2A 4IIVA 1ISIA 4Q34A 5A4JA 2W93A 4B3CA 3GUUA 2B83A 3HYTA 3ETHA 3F3YA 4LOKA 4QJ4A 4H3SA 1SCUB 1EAYA 1NMQA 1ICIA 1OYOA 4K7JA 4TMXA 3V48A 4HLUC 1NBAA 1M67A 1DDIA 5B5SA 3ML1A 2EKLA 5H16A 2FCRA 2VAWA 5BNZA 4IUBS 5HF6A 3TW6A 2C1EA 4FYVA 3IJEB 5LDGA 3EGXA 1IL0A 5F52A 5B1DA 1T9AA 4BLTA 1YI1A 3MERA 1PK9A 1YS7A 4U7GA 1E1CA 2H85A 2ZJZA 5CU7A 4V0MA 3ZDYB 3A3KA 4K6KA 2C83A 4KXVA 2XQKA 4IHJF 4AP6A 3PC3A 1G291 3RNLA 3MM4A 1F6DA 4YPVA 5JPDA 3HXMA 5FR2A 5H7XA 2WHYA 5HJ2A 3R7WA 4Y9SA 2ZPUA 1WAMA 1M0TA 4I5DA 1DJNA 2QD1A 3UQZA 1EVZA 3E1SA 1GVNB 2GVNA 2VJYA 3GI1A 3NTUA 3ZBQA 3N2GB 3UXHA 3WHPA 4AX8A 2WAXA 2HBZA 2P9HA 4RPIA 4YRCA 3H11A 2QG6A 2Z43A 1KH2A 3DKKA 3SX0A 2R8YA 1TCBA 5K6TA 5EZ5A 3GJ5A 3MAJA 5ERGB 4G1FA 2W2OA 1IAVA 4NAVA 2OV8A 1U2RA 1AZSC 2J3HA 2IITA 2VUSA 2XCQA 3DCJA 3QBDA 3G68A 2X9QA 1DKQA 4WE3A 5SY9A 4HLNA 2CXPA 4PHCA 3M5WA 4K05A 1F0YA 2ZKIA 4CI9A 4BN0A 3EG5A 3QLUC 2O7SA 1ZO8A 4N40A 2YIJA 2XECA 4TV9A 1FCJA 2EW8A 4H15A 1V8OA 4NL4H 4EYSA 5KTTA 1YRYE 1UOPA 1Y5IA 3IPRA 4ENSA 4P0QB 1EH5A 3HEAA 5L7YA 4BGDA 5C32A 5LD2C 4BB9A 2IPOA 3AVOA 4G1UC 1E3LA 5FWYB 1RWNA 2HAEA 4R1MA 2JKYA 2GLUA 5DP2A 1RKUA 1KEPA 4L9RA 3FUTA 2C2WA 2IUYA 4CPDA 5E0KB 2IEBA 5B7QA 1MKYA 1YC5A 4ZI3A 5IAOA 2HY7A 5GJVC 2FWIA 2GYWA 3R5FA 3ADDA 1KY3A 1I2DA 2EJCA 2JLSA 4TVOA 4AYXA 4C0AC 2L42A 2VSN