1USIA

L-leucine-binding protein with phenylalanine bound
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
345
structure length
345
Chain Sequence
DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords LEUCINE-SPECIFIC BINDING PROTEIN
publication title X-Ray Structures of the Leucine-Binding Protein Illustrate Conformational Changes and the Basis of Ligand Specificity
pubmed doi rcsb
source organism Escherichia coli
total genus 133
structure length 345
sequence length 345
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usiA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usiA01
5FWXB 3I09A 2FQWA 3DGEC 3G85A 3EJWA 3RVOA 2PLNA 2VUIB 3O2QB 3LUAA 1EHCA 1DCFA 3CG4A 4YGXB 1Z2DA 2JB9A 5JS2A 4KK3A 3O21A 2A9OA 1LBHA 4ZMRA 2OQRA 3RVKA 1B00A 4LX8A 3MF4A 1TJYA 2ZAYA 4WUTA 2JBAB 2P9HA 3BRQA 5DKFA 1UDRA 3MIZA 1FFSA 3LUHA 3NHZA 2QVGA 4ETIA 1XWWA 4LE1A 4MR8A 3QELB 3I42A 1GLGA 5IC5A 4ML3A 4WXMA 1EAYA 1NXOA 1XHFA 1YTUA 2H0AA 3IP9A 1SXGA 3A3KA 4WWHA 3H6GA 2HJ9A 1FQWA 3R0JA 3H5WA 3JVIA 3C3MA 2LUOA 5KQMA 4Z9AA 4EYKA 1A04A 3H1EA 3E3MA 3LOPA 3CFYA 3MYYA 1W25A 4NCAA 1BVHA 3FMVA 5T7BA 1DRKA 2QV0A 3N6VA 2VK2A 3K9CA 4TLLB 4KREA 5HSGA 4HYEA 3RQIA 3K4HA 1MAVA 2E4ZA 4KQCA 1MVOA 1QO0D 1J56A 1JX6A 1ZESA 4WT7A 5B3JC 3GWGA 5C5CA 1DCKA 2J48A 3TD9A 2IPMA 4WXEA 4GPAA 4RY9A 5FBHA 5TPWA 1DC8A 1Z18A 4E7OA 5E3JA 3QLVC 4W5QA 3ILYA 1TM2A 2IDMA 1Z12A 5EWJB 4MQEA 5IBQA 3D02A 3MA0A 1T34A 4KPYA 3IDOA 2PUGA 5IULC 1RZRA 3LTEA 3URMA 2WJWA 2JRLA 3LKBA 3NNSA 2FMIA 1DG9A 4KZKA 4S05A 1QP0A 4RSMA 3D8UA 2PKXA 4N76A 4DADA 1CYEA 2JVIA 3KKEA 4ZJPA 1YMUA 5HQJA 3N53A 1JBEA 1Z13A 1EWKA 2A9QA 2ID9A 1F51E 2L2QA 3LUDA 4IRXA 4G86A 3JY6A 3HSYA 4JA2A 4RK5A 3UUGA 4S04A 2TMYA 1FFWA 3T6KA 3TMYA 4H3KB 4EVQA 1PNTA 2ZWMA 4XFKA 7ABPA 4JAVC 2CWDA 1JL3A 2CHEA 5CNIA 4OLAA 1Z26A 4JB0A 4KRFA 1JFSA 4Z4GA 2CHFA 3MM4A 3HDGA 1L5ZA 4LE0A 5IUJC 3SG0A 4NCBA 3NBMA 4IMIB 4OLBA 3HEBA 3OO1A 1H9CA 1Z15A 1HEYA 4MGEA 3KYJB 5EWLA 1QP7A 3O1IC 5TQ0A 4KQ9A 2E4VA 3C3KA 4Z4IA 2FVYA 3E61A 3KLNA 4N03A 4YRZA 3NNDA 4EVSA 3H1GA 4RDCA 4YS6A 3H5VA 3OO0A 4F3TA 4RU1A 4XXHA 6CHYA 2WWVD 1W9HA 1SXHA 4P1ZA 3F7NA 2PUDA 1DCMA 1OXBB 4G0ZA 2HPHA 5FWYB 2HSGA 4YP9A 3RH0A 1DP4A 1C4WA 3JS5A 2LBPA 4JB2A 4LDZA 4MQFB 5TQ2B 2IKSA 4H60A 4NV3A 1GCAA 3C97A 3HVRA 2WRZA 1DBQA 2WB4A 1A0OA 2JCGA 3ROFA 2MYPA 3HS3A 4JP1A 2VYCA 1E6KA 2PL1A 3QX9A 4KVFA 1URPA 1P8AA 3KSMA 4MS4B 1U2QA 3T38A 1ZGZA 2E4WA 4RV5A 4MR7B 1ABEA 1BDHA 4ZMSA 1NXXA 3A0RB 3EODA 4ZPJA 3TB6A 4L4UA 3T95A 1NATA 2B1JA 1R8JA 1DBPA 3Q41A 4Z4EA 3HUTA 5KC8A 1MB0A 1CEYA 4LDAA 3CG0A 4MPTA 5DCLA 2WMYA 3F6PA 5IEBA 4MRMA 4WZZA 1ISSA 3Q7SA 3BBLA 4F06A 3I5AA 2RDMA 4RXMA 4MR9B 2LIVA 3LKVA 4IILA 1DC7A 3IP7A 3SQNA 5TPZA 2CD7A 3OM1A 1M5UA 3CNBA 2A9PA 4RKRA 4W5TA 4F12A 1USKA 4H3HB 3Q9SA 3CZ5A 3GL9A 1JDPA 4Z0NA 4OG2A 2LP4Y 3FFXA 1GUBA 3MQ4A 5C5EA 1Z17A 5CNMA 3RVJA 4IF4A 4MS3A 2P4UA 4OTZA 4G0QA 1D2AA 4RWEA 3MMNA 3VNAA 4W5OA 1GCGA 2VUHB 2WJAA 1PEAA 1ZGGA 4Z99A 4EUKA 2F8TA 1LJLA 4YWHA 5PNTA 4EYOA 1NXWA 1TMYA 1NTRA 5JNVA 1QP4A 3LMKA 3QEMB 1YK1A 1BDIA 3RVRA 1K68A 3HV2A 5BQ3A 4N0PA 1EWTA 2PUBA 1JHZA 1ZAYA 1RPJA 4D6YA 1AB5A 3S99A 3M9XA 3CKMA 3EULA 4YR7A 2QSJA 1SRRA 2FW0A 3OM0A 4KV7A 1ZH2A 1FSPA 1D1PA 1MIHA 1M2EA 1P2FA 1YK0A 2FKAA 3CZCA 3JVDA 3JPWA 5EWMA 2L17A 3QK7A 1A2OA 4W5RA 2JK1A 3FFWA 3LUKA 5BRJA 3OQNA 3OLXA 5IX8A 2OENG 2FXIA 4ZYLA 2M1ZA 3RVQA 2R4QA 4MS1B 3N0RA 2AYZA 3KJXA 4PEVA 5IEJA 4GNRA 3H5OA 2QR3A 3DLHA 3EQZA 2QVCA 5CNKA 2WY2D 2E4YA 3CHYA 1ZHHA 1RZRD 4M88A 1YS7A 3CU5A 4Q6BA 2FSPA 3IPAA 2FQYA 2MSLA 3IPCA 4UHKA 3GYBA 4TMYA 5JNSA 3HJFA 5IUNC 3M9WA 2NZUG 4N47A 5T3YA 4D74A 3GRCA 3EGCA 2HQBA 1JLKA 4KFCA 3GBVA 3Q15C 4UHJA 1DBWA 1U04A 3DZDA 3B2NA 1E6LA 2W42A 3EQ2A 4Q7EA 4LZLA 3QEKA 4G97A 5BR1A 1Z25A 1KGSA 2L18A 2FN9A 4O1HA 5JNTA 4RK1A 3N0WA 8ABPA 4F8JA 3G1WA 3L49A 4OATA 2JBAA 2R25B 3N8IA 4JASB 1ZN2A 4MR8B 1PUXA 3SNKA 4MAAA 4DQDA 1MB3A 1DJMA 2QZJA 1VLZA 1P6UA 1BA2A 4FB4A 1D5WA 3QELA 3Q7RA 4RKQA 2PUFA 5DLEA 1VKRA 4MLDA 4Q6WA 4QYMA 1E2BA 3F6CA 1VRVA 2R48A 2IPNA 2FLKA 2QXYA 3CLKA 2JVKA 2PAFA 5KQGA 1U8TA 3FFTA 1QPZA 2FTKE 4CBVA 2AYXA 2Q5CA 1U2PA 2RGYA 3N75A 4Y9TA 1PEYA 3A0UA 3HK2A 3LUGA 1RXEA 3ROTA 1KMIY 3GT7A 3RVSA 1F4VA 3IP5A 5GQSA 3QLTA 2E4UA 3KTOA 1USIA 3CS3A 3ILHA 3JTEA 4G0MA 1SD5A 5F64A 1K66A 4PICA 3LFTA 3BREA 5TPWB 5HKOA 4L85A 4XARA 5KQPA 5KC9A 4YCSA 5ED4A 4MQEB 4RK0A 4N0QA 2H3HA 2MSKA 1S8NA 1PHRA 4RY8A 2YHBA 5EWJA 2MSWA 2FEKA 4TLMB 4IMJB 3KHTA 2GX6A 2FLWA 3QLUC 2NUBA 3A10A 3C3WA 1TLFA 1AB6A 1LBIA 3TO5A 4LE2A 3HXMA 1YIOA 4EVRA 1XHEA 3LUCA 3EAFA 3RVMA 4F11A 4N41A 4O5AA 5TQJA 1NXSA 2RJOA 9ABPA 1EWVA 1QQBA 4KMRA 3O75A 3O1HB 3N0XA 2PUEA 3HCWA 3H75A 4Z4CA 3KS9A 3DGFC 1NXVA 5JNRA 1LJUA 5TPZD 2FEWB 1YS6A 4Z9BA 4MYRA 3IP6A 1D4ZA 3JPYA 4FE4A 1JYEA 1QQAA 4OBBA 3OLZA 6ABPA 1IIBA 4ETMA 1M2FA 5EWLB 3C6QA 4EYGA 3KYIB 1Z2EA 5B3JA 4NQRA 5TQ0B 1CHNA 2N9UA 2QU7A 4HNSA 2GKGA 2IYNA 2GBPA 1QNLA 3HM9A 3SAJA 1YVUA 4DN6A 2ID7A 2MYUA 3O2JA 3OLWA 2MYNA 3F73A 3QLVA 4LRQA 4IGAA 4XAQA 1P6QA 2PUCA 4KNYA 3KLOA 3H5TA 1SXIA 3EDCA 2IOYA 1NY5A 5CHYA 3SM9A 3UK0A 5FWYA 1RXIA 1QO0A 2HQOA 2YHAA 4D6XA 4MQFA 3CTPA 5ABPA 4HNQA 3GBPA 3NNNA 5TQ2A 1TVMA 2B4AA 2XDYA 3KG2A 1ZITA 5KWSA 3OMXA 3GA5A 4G0OA 1VPWA 1M5TA 4PE5B 2F8SA 4Z4FA 1BDJA 1FFGA 1U0SY 2R47A 2JVJA 2GI4A 4XASA 1JDNA 1E6MA 1ISRA 1USGA 4MS4A 1WETA 4RXTA 4YV7A 5GOTA 4MR7A 4O1IA 1Z16A 4W5NA 4XLTA 2X7XA 5FWXA 5KI6A 3O74A 1RNLA 3L6UA 4G0PA 4MRMB 1QKKA 2GWRA 3BILA 1ZH4A 4MLCA 3I45A 1I3CA 3RVNA 2HQRA 2M98A 1JYFA 4RK7A 3T8YA 4PYRA 4NICA 2FMKA 3P9YA 1ZY2A 4MR9A 4QPJC 4ETNA 4JOQA 4PZ0A 4RS3A 5DTEA 3W9SA 4EYQA 2A9RA 5HM6A 3UKJA 4E7PA 2FN8A 3SY8A 4YLEA 3DBIA 3O1JC 5KQLA 2FQXA 2I6FA 4MS3B 3VNBA 5JNWA 1YMVA 1DRJA 3Q7TA 3CRNA 4G0YA 3DLBA 2NT4A 4B09A 1JWLA 1ZDMA 1APBA 3KCNA 5CNJA 5I4CA 3HO1A 2FMHA 3NHMA 4KK4A 5TE9A 3RVLA 4HNRA 2NZVG 3OMWA 2PUAA 3H1FA 4G0XA 2KYRA 2PL9A 1JFTA 3OLVA 3LUJA 4RZSA 3HDVA 2NT3A 5JNUA 2PJUA 1C0EA 3QEMA 3OQOA 4RY0A 2IPAB 2V0NA 4RK6A 2L19A 1NXTA 3H5LA 2O20A 5EWMB 2E4XA 3QX8A 2MYTA 1KRXA 1D1QA 1KRWA 3OLYA 4TN5A 4FE7A 3FGZA 3QLUA 4RXUA 2PMCA 2QW1A 3O2SB 5D2CA 5FBKA 3LUFA 3RVPA 1ABFA 2DRIA 1Y1LA 1DZ3A 3H5IA 3OQMA 1ZVVA 4YO7A 4EGSA 4MS1A 3FDFA 3HUUA 5BRAA 1OXKB 1L5YA 1BAPA 3TX6A 1JH9A 3GV0A 2BGGA 1LK0A 4RK4A 2IPLA 1PNRA 3HZHA 2RJNA 4EY3A 4Z4HA 4P98A 1EFAA 2FMFA 1NXPA 1GUDA 3BRSA 2FEPA 5JS1A 1QMPA 4QYWA 5IUKC 3M6MD 3H6HA 4QICA 2PE5A 5DGCA 1JF8A 2LPMA 1JFVA
chains in the Genus database with same CATH superfamily
5IBPA 1O95C 4DIFA 3P9SA 1LLUA 3H86A 3M6LA 1EX7A 3K92A 4KGZA 4TQGA 3I2KA 4I7EA 5HYVA 1XMOB 1ZVJA 2O7QA 3LX8A 4XJXA 5I4KA 4X1KB 2WQ7A 3G5AA 2PJZA 3QG5A 4YHHB 4GRAA 4S3MA 3QOWA 4REQA 4ZMRA 4B1FA 5B7NA 1HL3A 1J2YA 2VNJA 1O03A 3E2PA 4DWVA 3WGIA 3Q8XB 1Q95A 4HP8A 4X1IB 3P9IA 2JBAB 3INNA 3FMFA 4YDQA 1JG6A 3PQCA 4FGZA 3MELA 1T25A 3HGQA 1T3HA 1XF1A 4LE1A 1WEHA 3KEGA 3E3OA 2NX2A 3HRKA 1DEXA 5ALLA 5AICA 2OE2A 2ODBA 4ENQA 3FUVA 4XUDA 1OXSC 1QHIA 3C5WP 3EIOA 2C2MA 3GCDA 1FQWA 3RODA 1VL2A 1GZ4A 1XRQA 1V3TA 4JQYA 5EXDA 3PNBA 4EOGA 3LOUA 2FQQA 3EYWA 4PC3A 2P9CA 1LF5A 2XUGA 4PO1A 3U5TA 3ZJTA 2O5RA 1M1NA 4G36A 1JQEA 5JZBA 4AJLA 3E9ZA 1XN1A 4JCCA 1U99A 4CCAA 1U9ZA 3S7TA 5DF1A 3WYFA 2PKQO 4UPVA 4E07A 1NYTA 3CCFA 4WT7A 2BGNA 2ZE8A 1RPAA 2IUTA 3ELUA 1Z6XA 3G2HA 4LYDA 4MWBA 9ATCA 4FOPA 2WHXA 5C53B 1YJCA 3IIJA 4J4BA 4MCAA 4NK4A 5FA6A 2R96A 2VTDA 3G23A 5JJLA 1SCIA 2YIMA 5D00A 3K8QA 3UPTA 2XRFA 4ZK6A 2FWAA 1RLUA 4ZVLA 4DLTA 3IJEB 1XLTC 2GO1A 2HNBA 4U2DA 1RRGA 1LJ8A 1ZVQA 2NTEA 3FJ1A 4XLLA 2ZT7A 5CU7A 4YCMA 2CSXA 4MLPA 1ICIA 1NV9A 3DONA 5E9AA 2BFWA 1T5DX 1W88A 2PZJA 3T3EA 2GUGA 1AX9A 1E5VA 1SBQA 3GQVA 2HRDA 1QP0A 4JL6A 2JNWA 5HTOA 4DR4B 3EMBA 1SCDA 3LT4A 2I8CA 4LCBA 4NZPA 2JJ2A 3K35A 1E1LA 3KKEA 2HA7A 5A9TA 2CVOA 5HQJA 4D9BA 4EHBA 3PWSA 1JBEA 2L2QA 1ZIPA 3AUSA 3MB5A 4TYQA 4JI2B 2ZIAA 1L1FA 1WHSA 4X8OA 3F71A 5EGNA 1N6RA 3AF1A 4NLLA 1PNTA 2EG9A 1KZ7B 3DM9B 4TLAA 3ZLUA 2ACWA 1U2DC 2GN1A 4LHXA 3TRHA 3PEYA 4UXIA 4BEJA 4YMLA 5LQKA 1DO2A 4UD6A 4U7WA 5IASA 2C2ZA 2VHYA 2JFNA 2YINC 1MDBA 1L5ZA 2VPIA 1M1YA 5DBHX 2ETVA 3LCMA 1N8KA 1TADA 1U0RA 1E61A 1KZ6A 1EZZA 5AUNB 3CR7A 4J9VA 1DMSA 1KQFA 1XP5A 2PTGA 4DYDA 1YNOA 5AESA 3NHLA 3HBFA 2HM7A 4UVGA 1TXGA 1UBKS 4FOLA 5K8LA 3PGA1 1AJEA 3D5QA 4H3SA 3ZK9A 5JAUA 4OK5A 1J2UA 4W7IA 2FRXA 4XXHA 5HRUA 3I6BA 1W9HA 2D7JA 1ESDA 2WYVA 2XCIA 1KVUA 3ZGLA 3OQIB 5A04A 1R9JA 1GGVA 3NX4A 5JTUA 1O7JA 3DVSX 1QHHB 4RZ3A 4TV9A 3R5TA 2DLCX 2YMLA 4X3CA 3TWOA 4R0VA 2ACEA 2DSTA 1H0KA 4ALIA 1R4MB 2O3TA 1DBRA 1FP7A 1ODKA 4JP1A 2O2CA 1RYNA 4BQEA 5JS7A 1URPA 4LYJA 4XJVA 2FB9A 1ZKDA 3ST7A 1PT7A 2V4ZA 1MXHA 4TQ9A 1GKKA 4MS4B 1QVRA 3TZCA 1ZICA 5JCJD 3OEWA 5EJ5A 3E2IA 3E15A 3IR6A 4EO7A 3KQOA 2OZLA 2AE2A 1NXXA 3AEZA 1FW8A 5KNDA 2C5HA 2HSJA 2A5DA 4PO9A 4OHOA 3VKWA 3GLGE 2FPWA 4YUYA 4MXDA 4GG1A 5KNCH 5MN5A 4XR4A 5I7UA 5A03A 3ZBUA 2RG1A 1KP3A 3KJIA 2I4OA 1ZOIA 3DBHA 2G70A 4ZVUA 2JCVA 3H0EA 3A9CA 1QIGA 4YRJA 2WSIA 4PYOA 2P2SA 1HV8A 2V0CA 2MSDB 3NUQA 5BT9A 1H1TA 1OBFO 3IA7A 3ZU2A 4A3SA 4AICA 4EG4A 4P53A 2IBSA 3BRWA 1K1EA 4TXNA 3EDRA 2R6JA 1NQTA 4RHTA 3DTNA 3P5BA 4N5MA 1RCUA 2FZEA 1W19A 1ESMA 2AQIA 2I6TA 2WTNA 3JQFA 1R6XA 4WK6A 1QCZA 4DR5B 1NF9A 4HS9A 1PQPA 3GNQA 3CEHA 1JNXX 1QLWA 4UUQA 5CNMA 4BRWA 4X64B 4DJTA 1GZHB 1E9VA 3C3JA 4Q3DA 4AAYA 3RC8A 3MMNA 1DKRA 1NVEA 2W2LA 3AEKA 4OAQA 4YJ3B 2VUHB 4DJJA 3M0EA 2JD1A 1DKNA 3PUWA 5HW0A 4EGFA 1CE8A 4AVYA 1Y4DE 5KKNB 4HUQB 4FIZA 1UC5B 2GNOA 3JWHA 4WKBA 5I7EA 4HH4A 1T0HB 1EVKA 4XSVA 4EUEA 2Y27A 1GA4A 3PDIA 1MA0A 3PJFA 3OE5A 1JHZA 1YONA 1ILEA 1RPJA 5ILOA 4AROA 8AT1A 3RHTA 3DEKA 3C5CA 3A7EA 1SCJA 1VL6A 4BO4A 3BE8A 3W8RA 3ECCA 1RSZA 2VP0A 3G7SA 5EWMA 2ZKIA 4J1TA 3FHOA 5FUVA 3SPXA 4DTCA 3H05A 1UPUA 1IB6A 1KEEB 1COWD 1RRVA 1RU3A 3QKTA 1N0UA 2NACA 4LWZA 1E3DA 1ZRSA 2OSVA 3H1TA 4URFA 4UAUA 3TLEA 2GXAA 2ZSFA 4BX8A 1IQRA 4AY4A 3KRTA 3QBEA 3IGFA 4G25A 1UMCA 2VYVD 1CR0A 3I2HA 4IIYA 4PEVA 3ZV4A 4E22A 1IRXA 1DAEA 3AOEA 5K4AA 3S4YA 3ESBA 2LCFA 2QR3A 3EW7A 2WKQA 2FFBA 5EJ2A 4FILA 2QVCA 2YC2C 2DFPA 4FGKA 2RB4A 3DFKA 1WTCA 3UQZA 3QKRB 3OQ1A 1YS7A 3CWQA 2AK3A 3UM9A 5KOHA 3UQYS 1QG4A 2DULA 3GVXA 2D74A 4KTTE 3S2UA 1IBMB 3TZLA 3UJ3X 4BE4A 2REOA 2FE4A 2XMZA 4HPXB 1ZOPA 3A25A 5G1NA 3UMRA 7REQA 1Q57A 4IIEA 3ROQA 1C9YA 2HRBA 3IT1A 3TKYA 4CIVA 2UYQA 4RF2A 1KBQA 1Q3HA 3DYVA 1WO8A 4LZLA 1U9JA 2XZPA 2XNDA 2B4RO 4H7KA 4ZGBA 1IC6A 2NVUA 1AKYA 1YUBA 4S35A 3MJSA 3VAZA 2MSNA 2WIKA 2V4UA 1PZGA 4BN4A 4U7HA 3F97A 4KIGA 4F8JA 5I9IA 4YXFA 1SQ5A 2VPTA 1RKUA 4DM4A 2B78A 4LG1A 1YNSA 4LA4A 3A4IA 4MR8B 3WAGA 4IDFA 3S1AA 1OFIA 3WHPA 2CXXA 2OQIA 3C3EA 2HMUA 2ZJ4A 3TECE 1K3UB 4XIGS 5CFQA 3HCCA 3O8NA 4E5VA 1GZ7A 3VZPA 3A27A 1FC0A 3W2TA 1T2FA 4FBGA 3SZMA 1B6GA 3G8CA 4FFNA 3VR3D 4Z8YA 5DPMA 2RH4A 2CZGA 1P7CA 3WWPA 2FF7A 1UMDB 1BU5A 2VRBA 3H13A 4JUBA 3GYGA 1DEKA 4KYUA 4OHCA 5A6SB 2J33A 5I7HA 5U9CA 2XKJE 4GOJA 1YCGA 2O5CA 3N75A 1XHLA 4RE6A 2HF7A 2IU6A 2BLNA 3CV3A 1Y8ZA 1X77A 2B9VA 2AOTA 1USIA 4LJ6A 2ZS9A 4XD7D 4B3CA 4C7XA 4TKLA 3S2SA 3FN4A 4BNLA 2H2WA 3SJBA 4BVGA 1E3QA 3K4QA 1WS6A 3OFJA 3PFHA 1W6UA 5JV5A 2WIDA 2WJIA 1YV9A 5KC9A 2IHVA 1UBFA 3SCZA 1A9XA 3PICA 3NBYC 5HR5A 4H1TA 4MQEB 4ZODA 3WAKA 2P8SA 1K89A 1PS0A 2G5TA 2VHEA 1HFWA 5HK9A 1H4TA 4IMJB 3BKWA 1XP8A 2AQHA 2FSHA 2B2CA 1E58A 2QXUA 3K9GA 1F3LA 1UZUA 1TLFA 3K8ZA 4MIOA 3T9DA 4BKUA 1ND5A 3AQ4A 2FPGB 1G5PA 5GJCA 1ZISA 1GARA 3E22A 3EEOA 3O4RA 1E99A 5DRTA 3IQZA 4H0FA 2XRYA 3LX5A 4P08A 1QCYA 1WTAA 2JIOA 2QRJA 1ECLA 5DXFA 5EXXA 2B7CA 3CKLA 2FWJA 2JCYA 5A2GA 3HY3A 3ENVA 1YS6A 4OI1A 2AN5A 3L8FA 1FRQA 1A95A 2PGDA 1ZAKA 4BTLA 3BD8A 1A5AB 1DJOA 1Z9BA 4R68A 3MLEA 1NMXA 1GIAA 3LA8A 3ZI4A 4C0JA 4YAJA 4R2JA 5K7SA 2ZE6A 4DR3B 2H59A 1U2GC 4GLLA 1S3FA 1J6UA 3JATB 1WLSA 2J46A 4X92A 4HN2A 3HDHA 3HXKA 3MMXA 3RUHA 3U4CA 3L18A 3NH9A 3NT5A 1R9NA 3GMSA 3OHPA 1GFIA 3WNQA 4DNPA 5KVCA 4NOJA 1QONA 3QY9A 1KI1A 1WXFA 4MB2A 4E32A 4B3FX 1TK3A 3P1JA 2BM8A 5B53A 1XAIA 3WLEA 1YZLA 2O0HA 1ESNA 1ZA1A 4LRQA 4O4IF 4OI4A 5ALMA 4L1KA 2ZM6B 1IN8A 1O9GA 4CVNA 3FH0A 5AHXA 5JASA 1O54A 1S89A 3LPMA 1YR7A 4BMDA 5KNBH 1MOZA 1E7MA 1RXIA 3OCVA 1VYUA 5FI5A 4Q1EA 2Z30A 2J5KA 2R2AA 3L7AA 1QR6A 1NW6A 1PG5A 4Y9UA 2NQTA 4GF5A 1T3TA 4RD0A 5ALDA 1IDOA 1RACA 3HJHA 4ISBA 4OXIA 5AXBA 5KDDA 1JE1A 1LWOA 3ICWA 4XIIA 2DFLA 4V0LA 3SVLA 4Z4FA 2GM5A 3IHWA 4HTFA 3PC7A 4LBWA 3QV2A 4HNVA 4NH0A 5GOTA 3VNQA 3U81A 3EH2A 5EJ4A 4TS1A 5AVKA 3RTBA 3PPWA 3PC8C 3U40A 3B1FA 4UBLA 3DOUA 1V2GA 4WMLA 5C80A 1HLFA 3OI7A 2OHXA 4I99A 5DB4A 4LNUB 2JFXA 4FXPA 2E7ZA 5E6UB 2XQJA 5AOAA 4H31A 3PXDA 1O08A 4A6XA 1X1CA 2ZLBA 4JBGA 4HXFB 4CM4B 4N5IX 4O63O 1ADJA 4IDHA 1HQYE 5CW2A 3HKCB 4O4IB 4AL4A 5AOBA 1J97A 1EUDB 5FWDA 3CIFA 2IFTA 3EPJA 4EFKA 4BNIA 2RHJA 1C80A 1J90A 3UA3A 4BX2A 3T9CA 3TL2A 1YL6A 1ODSA 1GTL1 1YMVA 3A6JA 3D6TB 3CLTD 2Q2NA 3MC1A 1ISFA 3BMOA 2PUWA 3IVCA 5KTPA 4YT8A 1BOOA 2PBFA 2X4GA 3AF4A 3CO0S 4QPPA 3U62A 1C7ZA 2ORIA 1OVGA 5SZIA 3NOVA 3OE1A 4B75A 1HE3A 4L0CA 1ENZA 1ZU5A 4MCJA 4EEXA 4BV3A 1JG1A 4E51A 1V3VA 2NZXA 3A2KA 2OT3B 3SSAA 2IYEA 1C0EA 1ULTA 4ZDWA 5F9HA 3KELA 4B45A 1U7ZA 5KSWB 2CJWA 3OZDA 4NAUA 4EJFA 1D2CA 4J1SA 3P2IA 4MAMA 4FR2A 1VZ3A 1P3DA 1QGOA 3ONFA 3TG8A 1I1NA 4DRZA 1DKQA 4AKSA 2Z6UA 3V00A 2CF6A 3NVMB 3ESAA 1FFDA 1VIYA 4DBZA 5IC4A 3DC7A 2VHWA 3LO8A 4NZYA 5IMSA 2ZUWA 7ADHA 1EGHA 2CNWA 5B57C 1LDMA 1OYYA 1MFZA 2CN1A 2G83A 2ZXEA 3L4EA 4R3UC 4C03A 2BHTA 2J8ZA 2Q8PA 1PJSA 3D2LA 2CB9A 2OXRA 2HHLA 4FZ3A 1N6HA 4GW3A 2GJ8A 2GXQA 4IVNA 5A0VA 5B7PA 3HLYA 2X0FA 5E9JA 1RM0A 3CX8A 1H05A 2EHJA 4E08A 1D2MA 4DDTA 1VLHA 1XRSB 5JPCA 3H4IA 1VL8A 5KQRA 2FMFA 3EA4A 1RWBA 2FEPA 1PLJA 1XYVA 1A50B 1FP2A 3OQ6A 4IJMA 5JDCC 4DPLA 1QLHA 2WLSA 2IZ6A 5K3CA 4L7VA 3FGOA 3ORHA 1XJQA 5ERYA 4GT1A 2RONA 3QF4B 3V5NA 1A7UA 2FQWA 3DGEC 1Z22A 4AKHA 3G85A 2FVXA 4QDJA 5AMXA 1MPTA 3PYLA 3SKXA 3TLBA 3ZWQA 1FXWF 1Z7GA 3VUEA 2F48A 2QSZA 2DJ5A 3T7DA 1HT3A 1E0SA 2Y0PA 3GLHB 4ZVPA 3ZDCA 3S55A 4KB5A 4OQ4A 1E3SA 5F2NA 3EXHA 3EA0A 4WUTA 3ZN2A 1NHGA 2HB6A 3K09A 5FLXA 3C3CA 4L08A 3W6OA 1EIZA 3LUHA 2J4CA 1ZH8A 5IHXA 4WLEA 2QG6A 1W4BA 3GJ7A 4WV3A 3RASA 4AO7A 2BFCB 4LOJA 1JKMA 1P1HA 3DMPA 3QYAA 4Z3DA 1FP1D 1VLMA 3ROPA 4EZEA 3NJRA 2JKZA 1A69A 2CYCA 2N3ZA 3QVXA 4LPKA 4L22A 3ZHUA 3DTVD 5CIWA 3P97A 3VUFA 4YACA 3RWOA 4JOCA 4TMKA 2IH2A 2IT1A 3L92A 5FD8A 5IARA 4RCYA 3TUZC 2YJNA 4XUEA 3ML1A 3FOZA 1WLYA 3BCHA 4B79A 1W44A 4EA9A 1U4OA 5JFOA 1Y3CE 3GWZA 3LOPA 4TVKA 1TZJA 3WGHA 5J3JA 2JLXA 3Q40A 4BJ1A 3N8GA 1RHJA 2BMJA 2XOKA 3ER6A 1ADCA 2QV0A 2QTVA 3Q8KA 2XNCA 1FNBA 1TW3A 3WLRA 3CB2A 5EHGA 3GFQA 5T4HA 3TAHA 3A37A 3S2EA 1J9EA 3HLTA 2VQ6A 3OCWA 1EESA 2ST1A 4YRIA 3CCCA 1SC1A 1VLVA 2GEJA 5FBZA 2QLNA 2J48A 4PQFA 4AN0A 5HMMA 1DIOB 1EM8B 2H4ZA 4ENTA 4B6SA 3G82C 4Q1DA 2J0SA 2OBLA 2LV8A 4WDQA 1VL1A 4QT0A 4RIHA 1DOZA 2B8JA 2VT3A 5CA0A 4AG3A 3U19A 1BWPA 2C58A 1NL3A 3QPAA 1JHOA 4Z1OA 4BBZA 3SBXA 5FX2A 2JHCA 1EQUA 5JSQA 2R97A 1XO1A 3FLEA 1UAYA 3ILSA 1Z56C 2E5FA 4V0ME 2WR8A 2CLIB 3UGKA 3I9NA 4ZT7A 2HO4A 4GXQA 4XRRA 4CQMB 4CKBA 1W8IA 2Q1XA 2X0EA 3S7ZA 3UJBA 1G8YA 4AWAA 2LGJA 3F5MA 3TL3A 4KPFC 2PKXA 4DADA 4U9UA 3WYBA 1EQ2A 1PT6A 5FTMA 2WTUA 4XB2A 2UUBB 1ZD8A 2P9FA 4XM0A 1R0CA 1HDXA 2FLVA 1I3LA 4IW3B 3W7AA 3ESQA 1R6DA 3F1LA 3GB9A 1V95A 3JQ8A 3ET5A 2I2BA 5AI0A 1A2QA 4NAVA 2NYVA 2LRHA 1P2UA 2VUTA 3N6RA 1DRUA 4FXOA 1EJBA 1N2CB 1YA4A 1Z6QA 3LE8A 4HAUA 4LY6A 4XDZA 4YAOA 1JFSA 4O3FA 2ZGVA 4FSHA 3KT0A 4QUGA 1V16A 4UARA 4ZGGA 4MPJA 5EMNA 4KODA 2JI7A 1J8QA 2NG1A 3HEBA 2Q4OA 1TOAA 4EMUA 3NAZA 1HEYA 5JH7A 2VBGA 1FEZA 1AKWA 3WJ7A 3MAGA 4RTRA 1ZR4A 3SR4A 1L8XA 4RW0A 3H6KA 5CMLA 1UPXA 3A6DA 3UFXB 1LDYA 1HETA 2EDCA 3BJRA 1NSFA 4EVSA 5DM0A 2PLAA 3STHA 4EW2A 2RHWA 3EZYA 3OOHA 1NBWB 5KNCD 2E9SA 3V2HA 3WQBA 2NSLA 1XQXA 4IQGA 1JR3E 3AHDA 2XE8A 5JR3A 3DD1A 1ONSA 3GQBB 2V7EA 1X6VA 2IKSA 4GSLA 1YULA 2XIJA 3RRMA 4ZYTA 2ZUDA 1A8PA 2OP0A 2R6DA 2VWQA 3E8XA 3G2QA 1FBNA 4CQLA 5K8VA 1JQBA 2IF2A 2IHYA 3JQGB 4NBNA 3ZGYA 1W5AA 3CUTA 1ZD4A 5HDBB 1W52X 1WXHA 4G1EB 5DHFA 4IF6A 1XU4A 5HGXA 3AUTA 3UGJA 2ZREA 5J4HA 2RGUA 1T8WA 3SP1A 10MHA 2YJ5A 3O84A 4D99A 4DMHA 5BOVA 3P27A 4C9BA 3NOOA 2CGEA 3T95A 4L4UA 3K32A 4P5PA 4AJPA 1GWNA 2B1JA 5KVQA 3DFIA 3TQSA 1X80A 3T7EA 3NTLA 4WL0A 5KX5A 3D4IA 4FKZA 4F56A 4HWGA 2I8LA 3G2OA 4KO1S 4G09A 4LDAA 2XWPA 3AERB 3LZCA 3VSEA 4F06A 3AHJA 4E5NA 1PLLA 2AN3A 5BQXA 3FROA 1E2DA 4QHYA 3ICOA 1Y7IA 5B2ZA 2DPYA 2GYUA 2PIAA 2K2QB 3P9NA 4IZOA 4OL9A 1R64A 4PX5A 5E6SB 1QF7A 2A9PA 4S1OA 1J8YF 5DEIA 3HXQA 3K4PA 5BQ5A 1UJ5A 5JYEA 1YACA 4E14A 4OG2A 5LQRA 4M54A 1U8YA 4Q3EA 5A71A 3TRFA 3K05A 4BRUA 4MGHA 4LRSB 3ACDA 3A9SA 4ZO9A 5JE8A 3SVZA 4B6QA 2RHRA 1K6MA 4CT0A 1BCRB 2R1TA 1NNSA 2XOEA 1GCGA 2QRVB 3ON5A 3GD5A 4R2XA 2GEFA 5ALKA 5EIBC 3VXKA 3AVTA 3BDVA 4PX9A 2WWFA 3E48A 4QPNA 3W79A 3KFVA 1JEYA 2C5EA 4X7MA 3R7FA 3U3KA 5C8ZA 4FEYA 2GCGA 3C74A 5JNVA 1YIAA 2NXCA 3P4YA 1F2UA 3AHEA 1FFAA 1U81A 1C0LA 3O9ZA 3KB2A 4OOFA 1OI4A 4R0NA 1N7IA 3A9UA 1EG2A 1G6HA 3F5SA 4N6NA 3R6DA 3INRA 1IOZA 1F60A 3SXUA 4M9SA 2O6LA 2PVPA 4RZHA 1E4VA 2JCXA 4LZAA 3UWMA 1R4ZA 2GVDC 1MH9A 2QTCA 1JZQA 1OA1A 3GR6A 4RQBA 3WKBA 2NV6A 4UUAA 4NKRA 4XPZA 1QIIA 1ZOOA 1QVWA 4JI6B 4RHXA 1U7TA 4RBNA 5K0CA 1H2FA 3ZZMA 2JFQA 2CMGA 2GERA 5TVKA 3LUKA 3BVPA 4X45A 1SELA 2F9MA 3OLXA 3RS7A 3VYTB 2G6TA 2YNMC 2EG5A 4CHGA 4HEA6 1A1SA 1QX3A 4RIIA 5K0FA 1JSXA 4BMCA 2HJRA 3HA7A 2FKNA 2PA3A 3QOYA 4P5EA 4FI3F 5LQJA 3KJXA 3OZWA 1WDWB 3FSJX 1ULHA 4C88A 1UK8A 5FJIA 1NRIA 1W87A 3FLBA 2YIDA 3HR7A 2WZCA 3EQZA 2CDCA 3GGDA 4K0RA 5IF9A 3EIUA 3CHYA 1ZXLA 4GX1A 2SCUB 4A5OA 3M1AA 2PRYA 3D3QA 3FYDA 4HYTA 3T34A 4C08A 4KW7A 1G8PA 3EXG2 2J3JA 1EWYA 2VH1A 2AKYA 5T3YA 4NXNB 3Q2KA 1Q77A 3GARA 4YP5A 1WRBA 1ZIXA 3UMVA 1UZMA 1NUPA 2GK7A 5FUWA 2PMWB 1OLUA 3COWA 3MCZA 4J0KA 3WTCA 3ZY5A 3ELWA 1Z4NA 3WP1B 2EJUA 3KJHA 2Y99A 3U7JA 3ADCA 4NDZA 1AQNA 1UC8A 2NADA 3KQSA 5C31A 3V4RA 3SZGA 2HPVA 3LS2A 2VYQA 1FYEA 3CF2A 4KTVE 2DJIA 1OKKD 4QUDA 3U39A 3GLFE 4F2PA 2Z43A 4H3VA 4U8GA 1FRNA 3LH5A 4CFYA 5FUMA 4RNDB 4JASB 3M81A 3WWZA 1Y1SA 3QE2A 1W5FA 4UBKA 3ZJUA 3TEMA 1BXGA 2C1ZA 3DBRB 4GLFA 3PB3A 4AECA 4QWWA 5EC8A 4EY8A 2ZR9A 4IIXA 4PBSA 2NTYC 4MW7A 2V9PA 2F1JA 1BHO1 3OMLA 4BGVA 5C8YA 4PO3X 2Q49A 5E3IA 1TKAA 3G0HA 4QDXA 1RADA 4FGUA 3FPAA 3IJPA 4G26A 4BC0A 3ICEA 3BSSA 3WGKA 2XZDA 3SS7X 1Z4QA 5JOQA 5CT4A 3LVFO 1OXTA 3NASA 2XMGA 1B2LA 3VPXA 2EJWA 1Q7BA 4W6QA 1GV1A 1KQ3A 1W0KA 3DOOA 4ENWA 1U8FO 1RJWA 1SZDA 5FRDA 3G49A 4U0KA 3IAHA 4H6XA 3RCBA 3WICA 5IAEA 1XWIA 2X7JA 3LCJA 1O6FA 4GVLA 3FOCA 1IJKA 1E1YA 4K9SA 1A4IA 4D9MA 5FL3A 1Z7BA 4FFBB 2YVAA 1PQYA 1UEJA 3FCCA 3GP3A 3CF4A 3QXGA 4MUEA 5E7MA 5HKLA 2Z2ZA 2ODAA 3T7JA 1Z6PA 4EI7A 4YCSA 5LYJB 3VR4H 2H2FA 1PKEA 2I6GA 2XT6A 1KOJA 1XR3A 3H9UA 3PUHA 1S8NA 2ZJ0A 2VKTA 4EELA 1SK8A 1M54A 3EF3A 3R5KA 4JBIA 4WHMA 5EWJA 5HF6A 1NQXA 3COZA 3ROGA 2R8RA 3A10A 3CBGA 1LBQA 2ZIUB 2VIIA 1Q83A 3QH4A 1OFTA 4LE2A 1CZLA 4LJ9A 4BMVA 3SWWA 2ENUA 3LUCA 2OCDA 4I1YA 4BQIA 1P7YA 1E7YA 4Q9IA 2PK3A 1O8CA 3BXOA 1K92A 2P1ZA 4L9AA 4LMBA 1QQBA 4YGYA 1IUOA 2ZUVA 3RS8A 3ENZA 5H5JA 2X22A 3DA8A 4DG5A 5JANA 2KQUA 3LWZA 3MWFA 1FJHA 3R5SA 3G0CA 4FT4A 4GI1A 5JLAA 2A57A 1WUHS 4RF5A 5JNRA 3TSZA 3R6GA 4YMIA 3VH1A 3B60A 4E5PA 4U2BA 1VIVA 1Y3BE 5WRFA 3CVVA 2WYHA 3O9VA 1C8KA 1W2WB 3N8DA 2EW1A 2PPLA 1YDEA 1BW9A 2B8EA 2ZBQA 3NGXA 3UK7A 1V1RA 3BSYA 4Y2RA 1RZVA 4KPEC 1I80A 2P0AA 4URHA 4I1UA 3SBEA 1SHLA 2FE1A 3I9FA 4Y2UA 3HJNA 2VUUA 1A88A 2PS1A 4R6WA 1QYVA 1KAGA 2R44A 1E3MA 4D57A 4NQZA 5F7JA 1WJGA 3HB4X 3R3WA 3TNFA 5JZVA 2ZKLA 1NNUA 3FFAA 1Q0LA 1GD1O 2I54A 5KKCA 2C7RA 2VK1A 5I9TA 3BL6A 1T2DA 2QRZA 4RNCA 4EB6B 5IPFA 3K9FC 1GTJ1 3IOYA 1IUPA 4L5CA 1I6MA 1WXIA 4IGAA 3RIHA 3RUFA 2KHZA 3PG5A 5A9SA 1V8BA 4DC0A 1GQRA 5D8DA 3CJTA 2C5GA 3WFJA 3HN6A 3VPGA 3FOAA 2BF4A 4URXR 3DEYX 5KSOA 3EDYA 3KU1A 4KAXA 1NJ1A 1XZ8A 3UWKA 4B40A 4FQ7A 4L16A 3B6IA 3H9BA 2DOKA 1ZITA 1VSVA 5TV2A 3R2JA 2F43B 2F8MA 2YYSA 1FP4B 1DRVA 1ODFA 1K5DA 1W1WA 1X7XB 1DWQA 3CPSA 2YBEA 3HR4A 2GYYA 1YE8A 2QM0A 1PJ2A 3PNMA 2GHTA 2M2IA 2R47A 3KKLA 4PSUA 2NVWA 5I9BA 4DJFC 5HK8A 3LBAA 2KI5A 3G7NA 4GKBA 1N57A 1BNCA 4XDHA 5AVXA 5HQ3B 3VJKA 5A2QA 3TIVA 1ZZEA 2XYHA 5T3UA 4AYWA 4A8HA 1D0IA 3BQMB 4EATA 3CSUA 3UHAA 2Q9UA 2CL0X 2VNSA 2FG6C 3Q0EA 2IDJA 2FA9A 1SMKA 3LL4A 3EOBI 3CNLA 3KYDA 1XZKA 4J0DA 2BBWA 3IBTA 4X44A 3KZMA 4ZVKA 1UQTA 3S44A 1FXUA 5HMLA 4L9WA 1OFVA 4N48A 1BOFA 1Z8NA 4OB6A 5T64A 4PYRA 1PK7A 1NUQA 1R12A 4ETNA 2ZUEA 5TDHA 4IO1A 4EYQA 4D9NA 1NNI1 2L69A 1VRCA 121PA 3WRVA 4S1TA 1N9GB 2QR5A 4E7PA 2ZEJA 1YQTA 5KQLA 2HHHB 1NQWA 1Z0KA 2H1VA 2XB9A 4YDHB 5K1ZA 3WQRA 4RTJA 5B6JA 4F97A 5KYUB 5JCPA 2PPVA 3B51X 3ZUGA 5TEWA 2PS0A 3KCNA 1VSBA 3IIEA 3OECA 4X84A 1DX6A 1RR6A 2ZAGA 4YHBA 5E4YA 4NHEA 2WSBA 1ZGBA 1QFSA 4NIMA 2X1VA 4QUKA 3BHNA 1SJ9A 5SY6A 1YCHA 5CLLA 1W46A 3ZNOA 4UVHA 4U5XA 4PXSA 5BNWA 1IUKA 4BOYA 1JDVA 4PAQA 5BPHA 2GPTA 3HB7A 4OXQA 1ML3A 2R3SA 3B89A 4MJXA 4QYTA 5BSGA 2HCJB 1YXMA 1P5JA 1LRJA 2GGSA 3CISA 3FDZB 3OFSA 1LSUA 4RK6A 5AKKA 5DP2A 4RMIA 2Q6KA 2CK3D 2X15A 2ISSD 3GLVA 4MYSA 3BOSA 2G06A 2E4XA 3U48A 2XUQA 2Q6IA 2VTKA 4WAUA 4GPZA 3NPAA 3NVDA 4PQYA 5HF8A 3UMSA 3JZAA 1D9XA 3BEOA 3FGZA 3ZVRA 3K9QO 1SU8A 2BFDA 4OQNA 5I6DA 2O8FA 1GVNB 1R10A 3GG9A 4BEWA 2HAEA 4L5IA 4QTXA 1LNZA 2PU5A 3U49A 2HYIC 5JCJA 5EKUA 2HIHA 5J5AA 1NVDA 3U7RA 2PR7A 1NG9A 1J07A 3GLKA 3UB2A 1XKQA 1SZPA 4ZYWA 2P5TB 4HPJB 1GCUA 2X8AA 2OILA 2PEYA 1SCKA 1WDTA 2BEKA 2FPPB 3AILA 3BRSA 4MIYA 5DEOA 5ERXA 3X1JA 4JYZA 3TFWA 1DC5A 2VJAA 1FSFA 2B6NA 2Q9CA 3B6EA 4ZC1A 1LTHR 1BA3A 1Z4JA 4HDKA 4Q9KA 1DQPA 1E1CB 1E9BA 2PO5A 2XJ4A 3KPWA 3NC0C 4DL9A 2Z6VA 2ZDQA 3R75A 2I4IA 2FJUA 2VUIB 3ICPA 4PX3A 4U9HS 2QX9A 3UT5B 1FDSA 2HW8A 1KZ1A 3CURA 4UHDA 1JIVA 5GM2A 3ZCSA 4Y30A 1JIKA 2EL7A 3SIPA 5JS2A 3AFGA 3HO6A 3Q5DA 3RVKA 5I9MA 3UMBA 4I6JA 2X9GA 4EY7A 3ZH9B 3LG2A 3VVBA 1VIAA 2IXDA 1JNYA 2PWBA 3E4DA 3KT3A 5JPDA 2HIGA 2GUWA 3FKSA 3MIZA 2XYQA 2ERXA 4JC5A 3VAYA 5JU6A 2YTZA 3JXEA 1JV2B 1B0PA 2AOUB 2Q50A 2XNHA 5DX1A 3PUVA 4AO6A 2WU4A 5K01A 2K7ZA 4ND7A 5ECGC 1Y5MA 1Y82A 1YJXA 4NRDA 5I7VA 3BMOB 5JAMA 2CUKA 2Q27A 2DHQA 2IYXA 3OCXA 4LOHA 1S96A 2ZTHA 1DARA 3BFPA 2POCA 4K28A 1H2YA 2JAOA 3ANLA 3TLGA 3TW8B 5BNIA 2Q62A 4JXXA 3BT7A 2NZJA 3KEMA 4HB4A 3IJ5A 3PXCX 4RFVA 1MC1A 3BH6A 4YECA 4F5EA 2B1GA 3GZJA 1PF7E 1W25A 2GB4A 2OV3A 3D81A 4MW0A 5F7XA 1HH4A 1MDFA 3M1IA 1OU4A 1RABA 2ZJ1A 5IW8A 2XADA 4H1HA 3S5JA 3FYCA 3N6VA 2VK2A 3LL7A 4BCBA 5KREA 1GU7A 3FF1A 3NALA 3AC0A 5HSGA 1GKUB 4HAOA 1UWLA 5E1BA 4TTQA 1JX6A 2Y76A 1J22A 1COWA 3MT8A 1EUCB 3G0DA 3RU2A 4KXNA 2EFDB 2QAGB 4K7JA 1JEAA 3DJFA 1GFWA 1KZ4A 4H7DA 1C3OB 2Z2IA 2IV7A 2C9DA 3GJZA 4A73A 4C5CA 5BMVF 2VYVA 3M70A 3VU8A 3WYNA 2H2AA 1NVUQ 3PVZA 1R0YA 1FW6A 1CPYA 3HPQA 1BRTA 1DG1G 4RLSA 3MJ4A 2AOXA 5BXYA 2C4HA 4HQ0A 3AG5A 3IODA 3N28A 2FR8C 2QN7A 4PFSA 3WAJA 3WA7A 4PHGA 1Y9ZA 3HLKA 1IZYA 3ZEAA 4I81A 1HDIA 1P29A 3IXMA 3N2NA 4I9NA 3KJEA 2ZJBA 2FEOA 4A6PA 1IULA 1OF1A 1OTXA 5SICE 1K8YB 3AVQA 3H2HA 3HPRA 3IP8A 2XNKA 3N6XA 3LDAA 1QRAA 4B4OA 5LD2C 2ZUFA 1O96B 3ITNA 3FIUA 2IE8A 2VA9A 2W2KA 3DEFA 2NU8B 1YMUA 4AZ0A 5K3OA 2V45A 1VG9B 3C4JA 4QPZA 1C1YA 1SC9A 1GLVA 4I55F 1VJ5A 1V11B 4FKBA 3JY6A 2QMHA 4KGXA 2P1RA 3ZWWA 5LWQA 1Q7EA 1V96A 4J6EA 4RJKA 1C3VA 3T6KA 1ZOSA 2XW6A 2HOQA 1EP2B 2WZDA 2FMXA 1R0KA 2YYAA 3KR9A 2CL7X 2ZBUA 2ZSJA 4NCXA 1CFZA 1ZK3A 4ZVVA 3SBDA 4BMSA 4HNGA 1FDVA 1PW7A 4Z4GA 1DEAA 1MQSA 3BN3A 4X0EA 4TTIA 2C2HA 5CXSA 4RVUA 1XZFA 1EB9A 1K3TA 4MVJM 4CR6A 2Z04A 5BMVB 2V6GA 3UWPA 4OLBA 4GKAA 1N5KA 5GMOA 2G3YA 3G9UA 3O1IC 3CLVA 5AW2A 4R3WA 3C6MA 1V8FA 3DMFA 2GN2A 4V02A 2O2XA 3AFOA 3D6JA 1M73E 5DHTA 5IVIA 3IEMA 1ONOA 3AMVA 4URZR 4YCBA 3VR3A 4HFRA 1G6KA 3CUVA 5IG2A 1X92A 2HSZA 3GJ5A 3H5VA 1TZBA 2J9RA 3W5DA 2PRIA 2Q5LA 4DZTA 4F6RA 5BRNA 3OX3A 4G5FA 3M2PA 4FDVA 2GN9A 2IXAA 4XX0A 3UOAB 4U5QA 2O8CA 3HBLA 4YP9A 2ATEA 1U8XX 3ECSA 1OV6A 1V0JA 3CW8X 5BRJA 2A9JA 3GMTA 2I5PO 4B4DA 4I55B 4XD7A 2RCYA 3O31A 1ZJZA 3QTLA 4F72A 4CETA 1FDRA 1Z38A 1NU6A 1FL9A 1FRFS 2JCGA 3ZX5A 1I7SB 2G9UA 2MYPA 1XKXA 2VZ8A 1OLSA 1E6KA 2HK7A 2ZBRA 4HK4A 3SLKA 5LCXA 2EBHX 3KR0A 2M6LA 4MUFA 1XCOA 1QGUB 4HYYA 4BKQA 1UFRA 3Q9NA 4RHUA 4HBZA 4H6VA 3MOGA 1LPSA 3RLFA 1V7CA 5FIUA 5C1OA 5JH7F 3P2JA 2VTBA 1G5QA 5LDHA 2RHGB 2ZI9A 4TKUA 4POOA 5JZSA 2P9ZA 4E09A 5CAEB 2IC5A 3QPDA 4MWSA 5BWLA 3OUZA 2DPHA 5D5QA 3Q41A 1UXGA 2W0MA 2ZRJA 3THXB 3I6YA 5KC8A 2QVZX 3DFMA 4UZFA 2BZ0A 5E7IA 5L3ZA 3VTZA 5IEBA 1IHOA 4RTMA 4UW9A 3N5CA 1TF2A 1VXRA 2JRCA 3Q7SA 1JALA 3STUA 3T7CA 1CJKC 1G2QA 3H9QA 3X1ZA 4CTKA 1KOLA 3PFKA 1TT5A 1V1MA 2G36A 3OX4A 4P7FA 3OOJA 4AO8A 4HADA 1JHUA 1HDOA 1DTEA 1FFHA 1W1UA 4QBGB 4DZZA 1WSBA 1PG0A 5ENZA 1SUPA 3FPCA 3UV3A 3WV4A 4DTIA 2F3PA 3MSCA 4DVGA 2H6EA 1NAIA 2ZWIA 2HDNB 3ZGVA 3R9IA 2HH9A 1JAZA 2C4TA 1GOTA 3RC7A 3KKZA 3ZC3A 3TOVA 1NVVQ 3BB4A 5CA1F 1EA5A 1P74A 4ZVSA 3PJRA 3CKKA 4I50F 3R1IA 1SUFA 1WXDA 2NO5A 2QL5A 4M21A 4MB6A 3WYAA 5B7GA 2F8TA 4YRKA 1P9LA 4UOZA 5JH7B 5K6AC 4L3WA 1PYOA 1SOAA 1Y80A 3GVCA 4LHYA 1ZIDA 3HV2A 2J3DA 4MZDA 3SZLA 3V1MA 2WM3A 4D8WA 4CLRA 2Y1EA 4CLEA 1OHHD 4KUHA 3WS7A 1JMVA 2GYWA 1C50A 2IP1A 1FYFA 4LRWA 2RHCA 1U9CA 2GD1O 4L50A 3HZOA 4E1BA 4YUZA 4FHFA 4BASA 4AULA 3BM5A 4YRAA 4V3BA 4XYLA 1KO4A 1Y3FE 2MOKA 2P77A 3IPYA 5EIAA 4UAGA 5CR9A 3A1EA 3ZY2A 3U4IA 3BD9A 1KJYA 5A5FA 5IX8A 5HNKA 1SVOA 2JAXA 3HDQA 1T3ZA 3HI6A 4KC0A 4U4AA 5P21A 5FKJA 1QQ6A 1DFGA 3FFBA 3JD0A 4DS3A 1KJZA 1EMDA 1XRRA 2GD2A 5IJWA 2Q1UA 5CT6A 2V7XA 1Z39A 2NTNA 1IBRA 2R00C 3O7MA 1MCZA 3OJ0A 4B81A 4PYJA 5CA1B 2B69A 5CXQA 5AJHA 2CWWA 1SIOA 3CU5A 3VA7A 4EB3A 4I50B 5DH9A 3NP9A 3S3TA 2YW2A 1QIJA 2A5YB 4BWGA 1EPUA 4US1R 4JX9A 5C51B 2NZUG 4GECA 4CM1A 4DEYA 3NFYA 1JP7A 3KALA 1OR8A 2I2DA 5GJVC 4UULA 4B32A 4KFCA 1SCQA 3ETLA 1XVUA 2W22A 3DZDA 1UBSB 1YU6A 1DAKA 1QPGA 3W2HA 4DPMA 1USUA 3B3FA 1WXXA 3A6HA 2APJA 3NV9A 4EZBA 5AM3A 1ONNA 2W48A 4AP5A 5JD3A 4EKGA 1Q1AA 5ITWA 2OM6A 1KZHA 3WTBA 2XDWA 1Y7TA 4BZWA 1Y1PA 3UUWA 2VPWA 4FHZA 3EEQA 3C3YA 2AF3C 5FF9A 1BE1A 5BYJA 2GTPA 1O5TA 5JW6A 4CKEB 3AKDA 4DQDA 3HSSA 4M0PA 4N6GA 5HCUA 2O2EA 3NC4A 4NCJA 4P80A 4RA9A 5L51A 5TVGA 3VR4D 4TKVA 4KRXA 1SVIA 5ALRA 1JKIA 4X20B 3V4FA 5I7SA 1N2HA 5DLEA 3VR5H 4TXHA 5CLGA 3IBGA 1LI4A 4C5BA 4C76A 3HKBB 3A6FA 1DL5A 4UNRA 3KSRA 4PLCA 1KFBB 5K0NA 1TEZA 2H1SA 3MILA 4K9LA 2BCEA 2FLKA 2F3UA 4IS2A 1QYXA 4WOJA 3AHIA 3L7MA 4G84A 3SLRA 4KLZA 3JAKA 4PSDA 2AYXA 4Z49A 3U7FB 1KO8A 2IYZA 1A77A 1RQPA 2P2ZA 4XYEA 3VQTA 2EV9A 5ESRA 1PEYA 3A0UA 1F7UA 3LV8A 4NDNE 3LUBA 2H4JA 4D5GA 1ZBQA 2H4YA 2QQ5A 1BQEA 1AN0A 1R6VA 1TJ5A 1GG5A 2RB5A 3L6RA 4XWGA 2JGFA 1IZ8A 3L7OA 2HA5A 4O59O 1N7HA 3MCAA 3O95A 3JVEA 3R3UA 2HF8A 3CZ9A 3DDSA 5CCXA 1C7JA 3WYDA 1YFZA 1V4BA 1Y5LA 4XARA 1O95A 4QDOA 5B2EA 5HXAA 3B1KA 1QLJA 5ED4A 4LHZA 1CY2A 3W4JA 3H84A 5KTNA 1U5CA 2GPAA 2JH3A 2C29D 1PR2A 1SZCA 4FQ8A 1O87A 5LZ2A 3TDKA 4US0R 4EEZA 1J7KA 2VJPA 1OLXB 1TL7C 2FLWA 4L6CA 5CLIA 1E6EA 4B5KA 5L7WA 2QROA 4M83A 1DT3A 2BGRA 3TJRA 2V7PA 5B1YA 4QOSA 4HDAA 1Z35A 2RBEA 1IEWA 4MVJA 2EKDA 3INTA 1EUZA 1N2SA 4K5QA 1VIDA 3TZKA 4KMRA 5CPBA 3I8XA 3GNSA 1EK2A 2BN4A 1V8OA 4IHJA 5EESA 2PD6A 4IXWA 1AV6A 1RTKA 3RBXA 3S68A 4J7UA 2BCGY 1MORA 4GGOA 5K9ZA 1U3UA 4RF4A 4S2EA 4GDFA 2BI8A 3IP6A 4L2IA 4PR0A 4UEOA 1J20A 5TMPA 1UWVA 2V97A 2XE7A 4RVGA 2VDRB 3K6SB 2VQEB 2VFAA 5NLLA 4DZRA 1G2OA 4PPQA 1FTYA 3D0KA 4TWIA 2GEKA 3RSQA 3EVFA 1UM9A 3PDWA 2ZRMA 3ACBA 1P0IA 1XL0A 2UUAB 1FFYA 1FUIA 5EIWA 5F3RA 3DTVA 3GGPA 1CHNA 3JQ9C 4BLVA 4Y7CA 4MV9A 4WQMA 3KYCA 4KR0A 2JFBA 4M1OA 4NS4A 4D0RA 3E9QA 2VF8A 4YRGA 2DC1A 3C3XA 3IB6A 3KQTA 2QE6A 3O2JA 3DMTC 2VNKA 3HV0A 8MHTA 2OGZA 2WSMA 3L4BA 4EHIA 1HDEA 4O4JF 3V6LA 4JJIA 1LSSA 1REQA 4L51A 3L7BA 2PXHA 2H9YA 3LQRA 5EVJA 3ZJ4A 1A8HA 4QU5A 5MN4A 2V7TA 1IBLB 2B4AA 2Q21A 2IIPA 1EE9A 1VKJA 2HUPA 3FWKA 3H2BA 3M1LA 4G4IA 4XYGA 1FFXB 4C4TA 2SKDA 4YV1A 2ZXUA 2NYUA 1TEVA 4A8JC 4F38A 1P2SA 5FNVA 4NZ9A 1CUIA 1OC4A 3B7GA 2V6JA 1L5OA 3CO5A 3R9XB 4H7EA 2ZSDA 4JP5A 4M9QA 5BY2A 3FBGA 2CJXA 3B5JA 1G20A 1QJCA 1SBYA 3CEJA 3L8YA 1AXRA 3LT2A 4RHEA 1CUDA 1ST2A 2IEYA 3RUPA 2F90A 2GRJA 4LZPA 4U00A 5REQB 1CUSA 3S29A 1MG5A 3MJDA 2GDZA 3LBIA 3O74A 1DU4A 2PHZA 4QSHA 4B3IA 4OUKX 5M29A 3JQQA 1QKKA 1Z6GA 4FFOA 5TARA 1ZH4A 4MLCA 5C4IA 2WWRA 3D6NB 4KWHA 5ICEA 4KQHA 2AUNA 1RLMA 1FYVA 1RWKA 4OAPA 1R88A 4KR6A 5HKAA 4ZQCB 1JVNA 3P9YA 4O4JB 3DBLB 5B3AA 1B7GO 4KH0A 2WW8A 4KFUA 3SJZA 1X13A 2FFRA 3L05A 4NMLA 3BGWA 3BK7A 5FEUA 4ETWA 4YAFA 3R3JA 4RVOA 4DV6B 3SY8A 3OTIA 4B44A 1Z06A 1JDZA 4H7JA 4HZUB 2CY0A 2GZ2A 2QN1A 2VDUE 2W6QA 5FB3A 3H65A 5IM5A 3RT1A 4A0FA 4ZT2A 1RCFA 2PZ8A 1Y8QB 5H0IA 3AB7A 1CV2A 4L3OA 5EP1A 2VTEA 2X8JA 3HO1A 4X6YA 5CDTA 1X1QA 4O0MA 3EEIA 4TM8A 4Q1FA 4WZBB 5JSFA 2NZVG 3OP4A 3H1FA 2O1EA 1SRQA 5EQDA 3D6VA 1YA6A 4IIJF 4D56A 4RZSA 4ENPA 3A26A 2EX4A 4OMUA 3KNZA 1CUYA 1HYBA 2M9MA 3CLHA 5JNUA 3PHBE 3W3AD 4HFMA 1J24A 2GKSA 1X7DA 2D3TA 2CT8A 2JLWA 2CXRA 3K0FA 4JZKA 1CQWA 3R3ZA 4NE9A 4Q48A 3W5AA 1NVMB 3FZNA 1S0UA 1YS9A 2P68A 4DEVA 3EPRA 1FDIA 2G4CA 1N34B 3IUNA 2VO1A 1EJ2A 2HDOA 3EQ8A 3FR8A 3H99A 4M9XA 4BV2A 2CJFA 3SZ3A 4XVCA 4NJMB 3C6KA 5J4VA 1I2BA 3CF4G 2PMCA 4WVFA 5FBKA 4IGFA 1QCCA 5J58A 2B82A 3ZIUA 2B37A 4WSOA 1A8QA 1T6YA 4MDYA 3TOSA 1XRPA 3ROZA 2Z3ZA 4EMTA 2BEVA 2JAQA 2OAP1 1ZUNB 2J4DA 3EBPA 4YMGA 3TMKA 4DLKA 5CYGA 4QRDA 4R31A 1ODTC 4LYHA 1CJMA 3K73O 3DQZA 4MGYR 1M2KA 5IS2A 2HBYA 3WIOA 1KS9A 4TTPA 4QYWA 1VHLA 3RAFC 1NYQA 3NTVA 4IIJB 4KNVA 5DGCA 3RF6A 2GJSA 2J7KA 5GP1A 1P3JA 3H16A 3HVJA 3EXFB 3AY0A 2A1IA 2PLFA 3H1AA 3HBNA 3CG4A 4MA5A 3DZBA 4Y2HA 1Q19A 2OCAA 3IE0A 3SC3A 1K4MA 2I22A 1B73A 3ESZA 4XPIA 5IYZA 2XE6A 3QVLA 3H04A 2J3IA 1GNLA 2WV9A 1DAPA 1CUHA 3P9XA 2OCKA 4P83A 3ZU5A 1OFUA 2J6BA 2AG5A 3LC7O 2DT8A 2MU1A 3AP2A 5EJAA 1KEVA 1PYDA 3GRVA 2CFOA 3TLMA 2IBTA 2AG0A 1WD5A 4N3BA 4ZU1X 3GUZA 2IYOA 4N39A 1YKFA 3EK2A 5DOZA 2EZ4A 3WMRA 1GLGA 1MABA 4WXMA 3CKYA 1JR3D 3ZNQA 1E32A 2H0AA 2PUVA 2ATIA 3A3KA 3PQ4A 4WWHA 4ZU3A 3TD6A 1G7CA 2F8LA 2P79A 3DB1A 3GLHE 3QG1A 4FHEA 1T3LA 1A04A 2C07A 3H1EA 4CDGA 1P4JA 1QZZA 3DHYA 3GJ3A 4J1QA 3ZVLA 4B4WA 1GHTA 4JI8B 1NBHA 1V6AA 4PWYA 2AV6A 5AQ1A 5ALPA 1TC1A 4TV8F 2MINA 821PA 4OUDA 3AGQA 4Q15A 3V80A 2XVMA 3W4IA 3MWEB 3U3MA 3PSHA 3FPHA 1UZAA 3WIVA 1ZSNA 4GWGA 4HDRA 1WHTB 3RYHA 1G19A 2GTIA 4U39A 3WLMA 5L4NA 3PBKA 4QULA 2IPMA 1GPKA 4KRGA 3SSOA 3PNKA 2E0IA 1GPBA 1EFLA 2Q0QA 1S5PA 1Z18A 3VR1A 1NVBA 2WPNA 3OKFA 2O8DB 1FFCA 2RC5A 4Y98A 4XVUA 4CM9A 2VBCA 3QBVA 1KI6A 5IBQA 3D02A 3MA0A 1MX5A 5C8XA 4D9HA 4KPYA 3IDOA 3JCZA 1RE0A 2OZVA 2NAPA 1SVNA 1ZVKA 2Q2VA 1TO2E 4KXXA 1Y6GA 1PRYA 3REQB 5FI1B 4N82A 5CFNA 2IP2A 3KAQA 2B5WA 4J8PA 1YE3A 3DNMA 4D4LA 1DAOA 4B2YA 2QBYB 4YFYA 4L9SA 2ZIXA 1RPNA 1HYGA 1ZM3A 3ZLBA 3QKSB 1ZL0A 3T94A 4H27A 4N0DA 3MWKA 3O4GA 4GX5A 4N76A 3E5NA 4QEDA 2O0JA 2BR4A 4JBYA 1RBMA 5JJKA 1P8JA 3MWGA 3VO8A 4UM9B 3WRXC 4TV8B 3L1HA 4EVQA 4K6GA 1Y5NA 3AB3A 2H3EA 5FR1A 2X5NA 2EP7A 4FTWA 4RD3A 3VU3A 3EZGA 1OKKA 3G0OA 4F5ZA 1XNRB 1OJLA 4OGGA 5A4AA 3I5YA 3L77A 1PUJA 1PD1A 1MENA 1DAGA 1RS0A 3I64A 3HA2A 1QHNA 5ALUA 5IUJC 3RT7A 4GX2A 1JQAA 4ND8A 4OBXA 5CD9A 3F9IA 4TYWA 3PNOA 1K88A 1QTIA 2BFPA 1NSYA 5EPUA 5ICCA 1IN6A 1PI3A 2Q3JA 1SCUB 2WJ3A 3D8SA 4MW9A 2A35A 1GL6A 1TAGA 3HACA 4TL7A 3I9V6 1C30B 4ESEA 2HJHA 3C3KA 3KDSE 3TQQA 3KLNA 5E1MA 1XLUA 1GLNA 1TKCA 1M34A 4JI4B 2GJAA 3EOAI 3L8DA 4AJHA 1N2CE 3E7DA 1ARZA 2F9FA 3BHIA 3CLUD 2XCUA 4RU1A 4KFTA 2C3PA 3OCCA 2I2CA 2WWVD 4LOIA 4OJYA 1JTVA 4A10A 4J16C 3SXPA 5ALGA 5C0OE 3DQQA 3AIMA 5CVEA 1JG2A 1J2TA 3QWIA 5K8IA 2HR1A 3DMDA 1QU2A 1G3IA 1S1CA 4PS1A 2EJVA 4G5GA 4XR9A 3WWDA 3LOQA 4K6HA 4IJ6A 5GADl 4XLZA 4OX9Y 2P3SA 5JWRA 4LHWA 4M8LA 1VMIA 1RJFA 3L6CA 4UMFA 4V24A 5F23A 4A8PA 4ZAYA 2YW9A 2UZ1A 1R6BX 3CNEA 3WWYA 3NS7A 4B33A 3L1IA 2KB0A 3ZHXA 4YAGA 2OLEA 4I4CA 4PZ9A 1P8AA 3G8YA 1NYRA 3UVEA 4HRAA 3EIFA 2P75A 3T38A 5IKEA 2CXUA 4MR7B 4GMFA 3E03A 3FPEA 3ZWMA 4PX2A 3COJA 4EKDA 4Z7QB 1IJEA 2B20A 3JYPA 4RPCA 5IRCD 3OIVA 1VGRA 2C78A 2EARA 3DHVA 1D1SA 3HBMA 4AZWA 2QP3A 3H2ZA 4C6SA 5IDVA 1HTWA 4M0CA 1NMEA 4QVKA 3RTCA 4UNSA 5DN9A 3DC2A 2LKCA 4ZCLA 1FNCA 4PTLA 1I0ZA 3QX7A 2IKQA 3AQIA 3T3OA 3FJOA 4DHEA 4KDRA 1DJNA 1JKJB 2CUNA 3JRXA 3I1YA 1YUMA 3DFZA 1L7OA 5DW3A 3TOZA 2AYYA 2ANBA 1IN1A 1WD7A 3MINA 2QN9A 3D7KA 3RTEA 5BPFA 1KERA 3EIEA 2Z0MA 3C3AA 4AWBA 3NATA 4IDGA 1X42A 3GT4A 4Q7QA 1WMEA 3KQLA 1NQOA 4JBNA 4YNBA 5BV0A 5JHGB 1UL1X 5K03A 2JGDA 3ZW8A 1ZGGA 2C5AA 4GC5A 3B8EA 3TPCA 5KBYA 2PJRA 5PNTA 5FAXA 4WBXC 1GL9B 3W0LB 3E3NA 1L7EA 4OLFA 3V8PA 3P9ZA 1E3JA 1TMGE 4U2CA 5IJ9A 2B98A 3W90A 1RXUA 1BDIA 3G1TA 4Z1MA 4HSEA 4XIFA 4KCGA 2FW6A 1MRNA 2CCJA 2XGOA 1F2DA 2JFGA 1EE1A 1H0SA 4P86A 1XDSA 2IE0A 2XVZA 4RGBA 3L7IA 1PL8A 2FKAA 3JVDA 2QY6A 3QK7A 2O8CB 3L1VA 4AX8A 4PZCA 3M5WA 1EK1A 3GDGA 3QFFA 4RQUA 5F76A 3SF8B 3ZQUA 5CJJA 1KSGA 3PEUA 4QNNA 3UF0A 3ANNA 3UHJA 5K6RA 4RVDA 4ZVMA 1U0NA 2BJHA 4U9IS 1Z68A 3Q5EA 4DXAA 4ERNA 1RZ3A 4M1TA 3H5OA 1QK5A 4NI5A 2WJHA 1T4BA 3ZU4A 4MHTA 2E4YA 1IU9A 2IVZA 2P91A 2XWQA 3PQ7A 2E49A 2EGHA 1C0KA 5E0OA 3T3HA 4CM7A 4WN9A 4X94A 5TXGA 3IQGX 3HU2A 1TU0A 4TMYA 2VTBB 3H5AA 4B8ZA 3AW8A 2B34A 2EP8A 3M9WA 3KKMA 3K0AB 2BYTA 2P90A 2BGTA 3T61A 3WGGA 1T2CA 2HQBA 4C7OA 1G63A 1C9NA 1DQRA 1FMLA 1HURA 2AJLI 4IJVA 5AW1A 1RWQA 1UKZA 2HMYB 4PFKA 5KWVA 4OGWA 4QPDA 2W42A 5J2TA 2WYWA 1T0IA 4G97A 4MWZA 5BR1A 2ACKA 3KQVA 1Z25A 3KZOA 4UCQA 2SICE 3B9PA 4B35A 1X1RA 2YKGA 1CJCA 4JN6B 3FCSB 3NHPA 2D5BA 4EGJA 3N0WA 4QASA 2BFBB 1N6OA 3FVWA 2EJTA 3WVNA 3MOIA 1U11A 1JZTA 2Q3DA 2PXCA 3FDIA 4HDSB 2BI7A 5IT9A 3BWXA 3EDOA 3F6EX 3SMQA 3WSTA 1Q2UA 1YFJA 2A94A 4NL4H 4G5SA 1SXJB 5KYYB 3IEVA 2JF0A 1CF4A 4FYKA 5E8RA 2RGWA 3QSGA 3AYZB 2NZWA 4IAOA 2WILA 3KOOA 4QL3A 2VQFB 1S7GA 1THTA 1ZCJA 2I80A 3MJTA 3AI2A 4JY7A 3CXUA 4PGGA 4RIFA 1DWOA 2WIBA 1SN7A 3BFVA 3H19A 4MUGA 1T2EA 3I01M 4Y6PA 2CK3A 4IRUB 5DNWA 2B99A 2PKCA 1SQSA 2Y1GA 4MV7A 2H52A 3B85A 4QYIA 4U3JA 1KZYC 1HT2E 1W34A 2KW5A 3B6MA 2OLKA 3ENNA 3GXBA 4OKIA 4C43A 1ZNQO 2NXWA 3TLCA 3E4CA 4TVBA 5KHLB 1Z5GA 3B7PA 1E2QA 1K2VN 3X44A 4OQQA 1ZG3A 4C6RA 1P0PA 1IVNA 1RI3A 3OZSA 4BNNA 1CXZA 1YOVA 3AVVA 1UJCA 1VG0B 3LPCA 4JLKA 4NENA 1X7YA 3TL6A 1P62B 1K0UA 2MSKA 5AIBA 1RLTA 3CBQA 3EXIA 4NZZA 1PHRA 1QG6A 1TDJA 3WADA 2L42A 3OZBA 1ILWA 3TLZA 1B4DA 4JVSB 3SFZA 1MOPA 5CCBA 2ZQZA 1IVYA 3IULA 1GPNA 4WFQA 3C3WA 3HQ4O 4DJ5X 5GIPE 1GPYA 3PEFA 1U0HC 2NU7A 3VX3A 3JQAB 1BE6A 1TYZA 4MYUA 4XWAA 3TTVA 2ZRGA 1CUVA 4N5LA 5I8ZA 4TZ0A 1WZUA 2PKYX 1U1IA 1N2EA 1T6BY 3E35A 3JQ7A 3RW9A 5ADHA 4PXAA 1C3XA 2BKLA 3EIHA 4WLOA 4D9GA 4Z4CA 5CT8A 5JMWA 2BE9A 1T5TA 4QE3A 2WV7A 2XIQA 1Z2NX 1SG6A 2YOHA 4TYMA 5TPZD 3AIOA 3TLKA 2YQZA 3VX4A 2ZQYA 4XCQA 3OE7A 4YRTA 5DI3B 3RB8A 4PHCA 4ES6A 4LRXA 4MJLA 2PY6A 3JPYA 3WE7A 5JXIA 3NWJA 3TJZA 4B6PA 1JYEA 3D7MA 1K63A 2EGUA 1CUEA 1X39A 3FWNA 4J94A 4MNTA 2OMEA 4B7CA 3KX2A 4CKYA 4ZYYA 4B3TB 3PIDA 3TEFA 4AFNA 2IHTA 4LGVA 4KVAA 3H42B 2A4KA 2FW9A 4UBIA 1JSLA 4M7RA 4LYGA 1ORRA 3BS4A 1A7JA 3GEMA 2TRSB 2XYGA 2WIFA 2N9UA 3VSDA 3KZ1E 1B16A 1IE3A 1ZJ6A 2Q6LA 2GOYA 5AJYA 4A27A 3Q11A 1Z4MA 3ZGNA 2IYFA 3KSBC 2DLDA 3F4LA 2Q4TA 3O03A 3NP7A 4TWJA 4BAZA 3KFLA 4AJ2A 4C78A 2XD9A 4WFKA 1LZLA 1PFGA 1X9GA 5K3FA 1M2NA 1AKTA 3W5BA 3H4VA 2AN4A 4TSRA 2PUCA 2YC4C 1NI5A 1P0MA 5EEHA 3W5SA 5LDDC 1YZFA 3EFBA 3TCNA 3X43A 4ADSG 3IQIX 4MWEA 1Y3DE 4IHJF 5B2FA 4RTLA 1HO3A 3UAZA 3OOEA 2HQOA 5FADA 3MTJA 2YQ5A 2P3LA 1B15A 1TVMA 3QOXA 3GLGA 1P1CA 2XDYA 3C8UA 3KG2A 4LYAA 5IHPA 2N1MA 1Q7TA 1TO1E 4MDHA 1ECPA 3QZUA 4IXDA 3SR3A 4UPEA 5KOJB 1IY2A 4LYEA 1KQNA 4ALNA 4FYPA 2H2GA 3V4SA 1G8KA 2F1KA 2I6XA 2YWGA 3U16A 5CBKA 2P7IA 5K0JA 3IVGA 4YDSA 4KPUA 3EXAA 5LOVF 2O52A 2XOXA 3M6UA 2UZ3A 1DOHA 3I12A 1CC1S 2YV2A 1L4KA 5AK4A 4K9DA 2FSVA 2PVCA 1L7DA 4K6CA 3G6WA 2ZRBA 4BFSA 4BO7A 4ILKA 3OCZA 3JYHA 1JAIA 1QFYA 2Q3FA 3BCRA 3BILA 4NNJA 2ZYWX 3MGKA 4N5DA 1I3CA 3BK1A 3FUWA 4B8YA 3G2NA 1O6BA 1OVMA 5BR4A 1R6UA 4K8RB 4P92A 2HA2A 3VYVA 4G81A 1Y1KE 1GNRA 5FL7D 5TGDA 4RSHA 1W5TA 4FFSA 4IHJB 4CCYA 4LQLA 5B58C 3UMYA 4E21A 3OETA 1VLJA 2K5UA 3K1ZA 3DBIA 2NU9B 4GS5A 4HRVA 4RVCA 1BWSA 1HMPA 5FOQA 4JQOA 4ACBA 4LTDA 2NOAA 5TNXA 3HBJA 4X60A 2CL6X 4KQGA 4O6VA 2E5LB 3NB0A 3W1WA 1KJJA 1A7KA 1S2MA 1Q74A 1W94A 4KQKA 4RPLA 3DO6A 2Z1MA 1YRBA 2XUFA 1WNFA 3O92A 1BMDA 1OWMA 3Q12A 4JBLA 2BHNA 4OGFA 1G59A 1L3CA 5LOVB 1UODA 1NQAO 4LEIA 3RYIA 3R5XA 3MIIA 3VH2A 3OFNA 3AETB 4M8SA 2X41A 2NUAA 1W73A 2NT3A 3BB1A 1QAMA 3QEMA 4FIDA 2DF8A 4MUIA 4QUIA 4WH0A 5BV8A 1YHNA 3FZGA 2GARA 2OVBA 1YRLA 3IBYA 4YIKA 4FGSA 4JELA 2A58A 4XH9B 3TNYA 4X6UA 2PCLA 3FSEA 1TK9A 4UEJA 2O20A 1PNQA 2V1XA 1GEGA 5B30A 4EQZA 4ZZIA 1YHYA 3N39C 1D1QA 3AHCA 1IXRC 3P52A 2A0WA 3MAJA 3LGAA 3UA4A 2H11A 1A4RA 2B1IA 3QKWA 1QE3A 3WL5A 5B5SA 1WZ2A 3OTOB 1J2JA 2XQFA 2X0RA 4UTPA 3CMMA 4BZPA 3SICE 3P20A 1U3GA 1JXAA 4KUGA 4MS1A 3SYTA 2GVZC 2YS7A 3INYA 4CCSA 5HS6A 1GAQA 3AKEA 3GEBA 3KSZO 3L0DA 5JRJA 4OJNA 2OK7A 3S5UA 4D4KA 4K9QA 1EFRD 3ILXA 3M6AA 3EZXA 4M7OA 5FFMA 2BTEA 4EL0A 4Z4HA 2YXEA 3HJBA 3E5HA 4IKPA 3ORYA 1UZNA 1XNJA 2HN9A 3U9LA 4CW7A 1L5LA 1G20B 3EXG1 2EXXA 3ZCQA 1KFJB 2GN8A 2GAFA 3KUXA 4MVJG 4BVKA 3IVRA 1QYDA 2VJQA 3LQ1A 2GAJA 1U5BA 4Z9XA 1FYXA 4PYMA 4YN3A 1FU7A 5IM4F 4KO8A 2DETA 2GHIA 3RVOA 1IMJA 1NKSA 3O4HA 4L15A 3PQ3A 2HCBA 4W1PA 4ZOLA 1I4TD 5C2JB 2IHBA 4OKSA 4UBMA 1FVHA 5F1OA 4A03A 3S40A 3PZRA 2HNKA 4KN6A 3COSA 4W8OA 3ZIDA 4MTCA 4YCCA 1N0IA 2P9HA 2FDCA 2O3JA 4ALMA 4BHTA 4H0NA 5BSWA 3P0FA 3I01A 4FPXA 3JD2A 1CU1A 2BISA 3DOEA 3LU1A 4IVQA 3NHYA 5KEIA 1MNQA 2NM0A 4WADA 1IYZA 3CINA 1AMUA 1K3FA 1CD5A 1RI5A 5ALEA 2JLYA 2IZZA 2R1VA 3BMQB 4EI8A 1FY2A 2OCLA 1NLZA 2CVHA 3DE4X 3M4YA 1A9TA 4GR4A 3RDPA 2FWBA 2XEDA 2PD4A 1OHHA 4QOIA 3STXA 1IOLA 3K8YA 4P35A 2W7TA 3KKOA 2A0UA 3UJAA 5IAJA 4X7BA 3KVOA 3DE2X 2HL6A 4E5UA 4RLFA 1X87A 1G9SA 4MQLA 4BO9A 2D62A 3RAEC 2WWXA 1QO0D 4CF5A 1SNYA 4EKYA 1H0RA 4I3FA 4JI7B 4LV8B 4BMOB 2W2QA 4RPIA 1GRVA 3EJ6A 3OIWA 4WXEA 2CLFB 1CQIB 4RY9A 1YKSA 1UT6A 4GICA 1IHPA 3CCBA 4P82A 5HVNA 3MWDB 4WD3A 2V6MA 4AURA 4N3NA 3S2GA 3OLQA 4J7AA 1P9NA 1FNMA 2Q4BA 3AEUB 3EZ9A 1WKCA 2GKOA 3HXPA 3SHQA 4GRDA 3KQHA 4HDNA 1KSJA 2X9QA 3QA3E 5CVDA 5FLKA 1HZZC 5JPIA 4H08A 2NYAA 1MOSA 3DCJA 3NPMA 3CX6A 1HI9A 1XX6A 1GILA 3AESB 3SXJA 4CQNA 4QFBA 2YXPX 2Z57A 4BLPA 1G4HA 3D8UA 1XTTA 4CTOA 4ENSA 2B8NA 2EX0A 3T12A 1XQ6A 1UMBA 1ZD5A 2BGKA 2CLKB 2OQ2A 3ET4A 3LLSA 5SY9A 4C7VA 2FWNA 4IRXA 1Z13A 2DBQA 3HY4A 5LZ7A 1F51E 3VSAA 3X1YA 5TY0A 2GK4A 4RPHA 3A6KA 2IOQA 5ARDA 5GVRA 2AC2A 4QM6A 4KDEA 1LD3A 4AZTA 4AUKA 3HU5A 3UENA 4DA8A 3M9LA 3AEQA 3T3IA 2W37A 2REXB 4JBXA 4X8HA 3VM6A 4E03A 1RYHA 1JKXA 4LE0A 1T1IA 2B25A 3U60B 2X6RA 1TQDA 1WVIA 1XD8A 2LXNA 2O3UA 2SNIE 2X42A 5G4KB 5ITVA 2QX4A 3PV0A 3L8CA 4MGEA 4Q4JA 3BDAA 5F2KA 1MG0A 2DVMA 4WLNA 1NJ2A 2GCEA 4KQ9A 3I61A 1POWA 1II8B 1JBQA 1I3MA 3A3PA 2XUHA 3M6IA 5DT9A 1PV4A 1OBOA 5M04A 1WBBA 5HFAA 4AG5A 4Q3BA 3MWJA 2D1RA 1QVVA 3FTQA 3FYUA 2WA1A 2AS0A 2G1KA 4FZRA 1BS9A 4XCXA 3FKJA 1RMYA 1PDWA 2YOGA 3IQEA 4P1ZA 2PV7A 1TMKA 1AKRA 3PE6A 4TUYF 5DVZA 4F71A 4HWRA 1KETA 4LXXA 4TTSA 4Y2XA 2HPHA 1ZMRA 1K7EB 4QTUB 3RU9A 16PKA 2LBPA 4X93A 3DXYA 2W6CX 1U4NA 4LFBB 4H60A 4IDCA 3RAJA 4U8HA 1EXWA 3C97A 4OUDB 5EI5A 3W5VA 3ZIAD 1X1EA 1CR2A 4DCSA 2XQKA 2YZ2A 4BJ6A 2NUTB 2AHOA 3I58A 1M2VA 1I7NA 2C9YA 3PCRB 3ROFA 4GE3A 2CLSA 2PFGA 1WWKA 2VYCA 4IDPA 5IK2D 3A1FA 4G07A 4KFSA 3NBKA 4Q02A 3UAWA 3GJ6A 4DYVA 3ZXXA 1Q0TA 3O4VA 5DTIA 4ASUA 3LK7A 1BDHA 2YZMA 4OYHA 4MMZB 2XUOA 3BZWA 4XGKA 1BGVA 2ASEA 5CT5A 2OXTA 4WNYA 1K4YA 3QFSA 4UVEA 1XLVA 3F6YA 4I4TA 2IIVA 1QH1A 2YRFA 3D9QX 5JXGA 3K0KA 3EEBA 4LNAA 3KP1A 5M34A 2PWZA 3PPYA 1QIKA 2B4QA 3JW8A 3ZWKA 3HNRA 3BWYA 2OCPA 2RKOA 4MRNA 5LQUA 4KAFA 1ORHA 3IAUA 3JYOA 4JJGA 2C8VA 4JKIA 4QG7A 4N40A 3LKVA 1SPBS 2JBWA 4TUYB 1XVVA 3K70C 1F8FA 1IEXA 4O4LA 3V8NA 1H2HA 4FUTA 4QEKA 2QNBA 3GL9A 3FI9A 1R9MA 4UAVA 1R16A 2LP4Y 1GUBA 4LZWA 4EJ2A 4W4TA 3TB4A 5H3CA 4QLBA 2Z2JA 4G0QA 1L8QA 5TT0A 2YHIB 1N2OA 2P9JA 5E4JA 1I10A 1GYPA 1UXIA 3Q88A 3QU2A 4J4TA 2D54A 3FIJA 4IIFA 4S1VA 4KXUA 3THOA 2Z83A 2YV4A 3IESA 1BKYA 2RG7A 2WAAA 4YWHA 1YB5A 3I9OA 3W8EA 2H16A 2W2XA 2OV8A 4WGGA 2QI9C 4HWOA 5KNDH 1DPGA 4FWTA 3EF1A 3F90A 4DWWA 2XTAA 3KZVA 4YRDA 1WCXA 4BX0A 2RARA 2BV3A 1R3UA 2UUOA 2VHVA 1NW9B 2YVLA 3OOWA 5T6BA 2VA8A 2A3RA 3VHLB 1PNOA 3BMCB 5U4QA 3BWCA 4DM3A 1P2FA 5BWCA 2G40A 3JAWA 4NE2A 4F3NA 3P9KA 1V5EA 3L7LA 4BUZA 1BEEA 1CP2A 3FFWA 3K6JA 5TSDA 3OQNA 1USVA 1FX0A 4TMWA 3LDHA 4X97A 4GBMA 1WCIB 3HR8A 1UJMA 1SUIA 1U1CA 1O89A 3DDHA 3DEHA 4JB3A 4PPFA 4QWMA 1UFVA 4RC9A 4F1WA 3ELDA 4UHCA 1L5HA 4EUFA 2XMRA 3ITEA 4AK9A 1AMOA 1TEHA 4I5IA 3PHGA 1JKFA 4PIVA 1B0UA 3REGA 4EW3A 3E9CA 3HHEA 1Q7CA 2X8LA 5IUNC 1I33A 3C0KA 5DYYA 2J5BA 4FP9A 5DK4A 1IM5A 3C8HA 5CYOA 1XD2B 3EGIA 4KL8S 3B2NA 1ZYUA 4KLAA 4B9EA 4ZCSA 3T9FA 1SBHA 3KB8A 1X1AA 1RW4A 3R23A 3QEKA 1AXGA 5LP6C 2R5NA 3GROA 4DG8A 2X77A 3LLCA 1DHRA 4EPWA 4JT8A 1SIBE 4PO8A 1F9AA 1PVVA 3D31A 3GDHA 5EL0A 2ORYA 3VHQA 4XGNA 2QTBA