1USIA

L-leucine-binding protein with phenylalanine bound
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
345
structure length
345
Chain Sequence
DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of the Leucine-Binding Protein Illustrate Conformational Changes and the Basis of Ligand Specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords LEUCINE-SPECIFIC BINDING PROTEIN
total genus 133
structure length 345
sequence length 345
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usiA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usiA01
3HUUA 2CHFA 5IX8A 3E61A 4RY0A 1M2FA 4LX8A 2B4AA 4RU1A 1MIHA 3G85A 3BBLA 1FQWA 2ZAYA 1U2QA 1RXIA 3R0JA 4KK3A 4DQDA 1A2OA 3O2SB 1EWVA 2IKSA 2JRLA 3QEMB 3SAJA 5DLEA 1TVMA 3OM1A 4YGXB 3H6GA 5GOTA 4MQEA 1KRXA 4LRQA 3RH0A 4KQ9A 1PUXA 1I3CA 4XLTA 3T95A 1JL3A 1DCFA 1USGA 5TQ0B 3OQMA 1R8JA 4MR8B 1AB6A 4QICA 2PMCA 2A9QA 3C6QA 2R4QA 3A3KA 4GPAA 2W42A 1SXHA 3A10A 3G1WA 3GBPA 2L18A 1EFAA 1WETA 2V0NA 1DCMA 3EJWA 3TO5A 5JNTA 1D1PA 3OLWA 4YLEA 1T34A 4D6XA 3TX6A 6ABPA 2E4YA 1U8TA 2FLWA 2FQXA 3O21A 3RVQA 2L17A 3OQOA 3KS9A 3A0UA 2E4WA 4JB2A 4TMYA 4ZMSA 2A9OA 5TPWB 4YCSA 2AYZA 3KCNA 4JB0A 4W5QA 4ETNA 4IMJB 2TMYA 3OLZA 3KSMA 4YP9A 1NTRA 5TQJA 1JYEA 3FMVA 3CU5A 3IDOA 2QZJA 1DBQA 1Z26A 3H75A 2IPMA 1NY5A 3KHTA 1NXXA 4JP1A 3MM4A 3QLUA 4MR9B 1H9CA 1YK1A 2IYNA 1LJLA 3HS3A 1Z25A 3IP6A 4N0QA 4Z4IA 5JNRA 3CNBA 3CS3A 4MLDA 1VPWA 3TD9A 3CRNA 4MAAA 3JVDA 2A9RA 3BILA 4KREA 1ISRA 2WJAA 4Z9BA 1RZRA 9ABPA 1LBHA 2PKXA 4MR8A 1NATA 3O74A 4NCAA 4KFCA 3CZ5A 4P1ZA 3SQNA 2E4ZA 3HXMA 1QP7A 1KMIY 2PL1A 2CHEA 3N53A 6CHYA 2PUEA 4NCBA 4KNYA 1GUDA 3IP5A 3L49A 4RXTA 5JS1A 2N9UA 1CHNA 2RJNA 2JBAA 2L19A 4LE2A 1CYEA 1P8AA 3A0RB 3FDFA 2WJWA 1JFTA 2PUDA 3LOPA 1BDIA 1YTUA 2LPMA 3EULA 3GA5A 3IP7A 4PICA 4F06A 3HK2A 5IUJC 2LBPA 1ZAYA 1JHZA 1RZRD 2GBPA 2FN9A 4S04A 1L5ZA 2H0AA 1E6KA 1DBWA 3GV0A 4YRZA 4H3HB 4MS1A 2FXIA 4O5AA 1TMYA 4EYKA 3CHYA 2HQBA 3OLXA 1EHCA 3N0RA 1KGSA 1YVUA 4H3KB 3T38A 1P6QA 2PJUA 1FFGA 1PEAA 4MQEB 1QKKA 1XWWA 3EQ2A 1ZITA 3H5LA 3LUFA 5CHYA 4YO7A 2E4UA 3KYIB 3SG0A 4RK5A 2MSWA 3C97A 3E3MA 3DGEC 5CNJA 2WY2D 3HZHA 2PL9A 2VYCA 4Y9TA 2BGGA 4E7PA 5TE9A 1M5UA 3N75A 1E2BA 3QLVA 5HSGA 4FE7A 1QMPA 4UHJA 4Z0NA 5FWXA 4N41A 1URPA 3QELA 5C5CA 4RXMA 3LTEA 1JX6A 1Z16A 4HYEA 2FVYA 5TPZD 3H1EA 1OXKB 4NQRA 3KLNA 1DZ3A 1FFWA 3VNAA 5FWYA 3NNNA 4FB4A 1YS6A 3M9XA 4G0QA 4N76A 2PLNA 3CG4A 3KTOA 2QXYA 1NXOA 4H60A 3DBIA 1KRWA 3HDVA 3M9WA 5KC8A 3LUHA 3URMA 1DBPA 1ABFA 3C3KA 1NXVA 3HV2A 3I09A 5EWMA 1JFSA 2PUGA 2X7XA 3F7NA 4LE0A 4EYOA 1USIA 1NXWA 2J48A 1NXPA 3O75A 2HPHA 5CNIA 5BRAA 3ILHA 5TPWA 2PUBA 5CNKA 3GRCA 3IPAA 3HVRA 2GWRA 1MAVA 3H1FA 3NNSA 4IGAA 1YIOA 4N47A 1ZH4A 2B1JA 2LUOA 3LUCA 4WZZA 3RVSA 4EVQA 1VLZA 3N0WA 4TN5A 4WUTA 5EWLB 1QO0D 3H5IA 2FQYA 1SRRA 1ZGGA 2MYTA 5BR1A 3BRQA 1B00A 3GT7A 1FFSA 2E4VA 3H5OA 3F6PA 2WRZA 3O1JC 4JA2A 4F3TA 4RK1A 1USKA 4Z4GA 3QX9A 1DRJA 4MR7A 3OLYA 4WXMA 1OXBB 3C3WA 3RQIA 1VRVA 2IPNA 4KV7A 1SXIA 1XHEA 5DTEA 5D2CA 3KLOA 2KYRA 2GI4A 1M5TA 3RVRA 3HM9A 1D1QA 2PAFA 2QSJA 3Q41A 3JVIA 3B2NA 5DGCA 4EGSA 3JY6A 3QK7A 3T8YA 5KI6A 4YWHA 1BDJA 1UDRA 1APBA 1P2FA 3RVOA 3EGCA 4KVFA 2F8TA 1DC8A 1RPJA 2I6FA 4ML3A 4ZJPA 2F8SA 3JPWA 3H5VA 5B3JC 3QLTA 3OMWA 2FEWB 3QLUC 2FMFA 4MR7B 4EUKA 3HUTA 2Q5CA 3I45A 3ROFA 3TMYA 1LBIA 2VUHB 1JDNA 4NV3A 3EAFA 2JB9A 2FEPA 5HKOA 1ZGZA 1NXTA 1MB3A 2MYNA 3QEKA 4MS3A 3LFTA 2VUIB 4ZMRA 2DRIA 1JFVA 2ZWMA 4OTZA 3L6UA 4EYGA 3DLBA 3D02A 3OM0A 4G0ZA 1S8NA 4RV5A 3OMXA 5FBKA 1Z18A 1EWTA 2NZUG 3KKEA 3Q7TA 3N6VA 4KRFA 5KQGA 1BA2A 3O2QB 5ED4A 2R47A 3RVLA 4RSMA 1E6MA 4O1IA 2MYUA 3K4HA 1Z13A 3SNKA 5BRJA 5JNVA 4HNSA 4PE5B 3CLKA 3KJXA 3EQZA 4KK4A 1TLFA 3CFYA 3O2JA 4XFKA 2GKGA 1DP4A 2CWDA 3FFXA 4ZYLA 3N8IA 8ABPA 4LE1A 2MSLA 2NUBA 3Q9SA 3UKJA 3FFTA 3OQNA 1A0OA 3FFWA 3TB6A 2ID7A 4W5NA 4MR9A 2GX6A 4IMIB 1A04A 1Z2DA 2CD7A 2IOYA 1EAYA 5FWXB 5IEJA 4Z4EA 1BDHA 1AB5A 1DRKA 3EODA 4QPJC 4G0OA 4MQFA 3CTPA 3GWGA 5GQSA 4OLAA 3UUGA 3H5TA 5JNWA 4GNRA 2IPAB 3H6HA 1EWKA 4G97A 2HSGA 1MB0A 3JPYA 2O20A 3HDGA 3N0XA 4G0PA 3JTEA 4RKRA 4G0XA 4QYWA 4Z9AA 4YR7A 2FW0A 4ZPJA 2P4UA 4PZ0A 1YK0A 2LIVA 4HNQA 2JVKA 3I5AA 3LUKA 4MS3B 4N03A 4XAQA 4Z4HA 3LKVA 3QEMA 4W5TA 1ABEA 2WMYA 3NHMA 5F64A 1W9HA 4DN6A 2RJOA 3OLVA 4G86A 3M6MD 5EWJA 3RVJA 1Z15A 3S99A 4UHKA 1BVHA 1GCGA 1F4VA 4YS6A 5KQLA 4RK7A 1D5WA 3CZCA 5IC5A 5HM6A 3W9SA 5KQMA 3CKMA 3VNBA 1QP0A 2QVGA 4OG2A 3NNDA 4XARA 4Q6WA 5JNUA 3BRSA 4RXUA 1ZY2A 4RY9A 5FBHA 3UK0A 1K68A 1GLGA 2RDMA 2QW1A 1ZESA 1DCKA 2NT3A 1J56A 4OBBA 2OENG 4LZLA 3LUGA 5TPZA 4MGEA 4F11A 2MYPA 3LUAA 4EYQA 2P9HA 4ETIA 4G0MA 4MLCA 4RDCA 2VK2A 1FSPA 3Q15C 5IEBA 1Y1LA 1LJUA 3P9YA 1MVOA 4IF4A 4RK4A 4D74A 2FEKA 3KYJB 1Z12A 3H5WA 1QQBA 3GBVA 2RGYA 2HJ9A 2JVJA 4MS4B 4MQFB 3RVMA 1SD5A 3KG2A 3RVKA 2PUAA 1U2PA 4L4UA 2M98A 3MF4A 5JNSA 4EVRA 1M2EA 1JYFA 1K66A 1RNLA 2R25B 4FE4A 2A9PA 1QNLA 4KMRA 4RS3A 3I42A 4EY3A 1PNTA 7ABPA 3OO0A 2JVIA 3MA0A 3LMKA 3CG0A 4TLLB 4JOQA 1L5YA 2PE5A 1QP4A 4WT7A 4DADA 3JS5A 2M1ZA 2FMHA 3DGFC 3GL9A 5JS2A 4RZSA 2LP4Y 4Q6BA 3HCWA 5IUKC 2QU7A 4Q7EA 4MRMA 4RKQA 4WWHA 1CEYA 4IILA 2R48A 2WB4A 1JF8A 3MMNA 3O1IC 1LK0A 4LDAA 5E3JA 3K9CA 3F73A 3LKBA 2PUCA 1GUBA 5CNMA 4Z4FA 1JBEA 1NXSA 3RVPA 1JDPA 3Q7RA 1DJMA 1D4ZA 3NHZA 1Z17A 1IIBA 2HQOA 4ETMA 2FTKE 1ZH2A 4XASA 3F6CA 1QO0A 5PNTA 5I4CA 2PUFA 2YHAA 2FSPA 1XHFA 3SM9A 2FN8A 3DLHA 4JASB 3IPCA 5EWMB 4Z4CA 1ZN2A 4OLBA 4XXHA 1JWLA 4RK6A 4W5RA 1DC7A 5BQ3A 1F51E 4LDZA 5TQ2B 2MSKA 1C4WA 1VKRA 3QX8A 5KC9A 4S05A 2FQWA 5TQ0A 3EDCA 2OQRA 3LUDA 1ZVVA 4PEVA 4O1HA 5TQ2A 5FWYB 5DKFA 2HQRA 4MS4A 2JK1A 3LUJA 3MQ4A 3OO1A 2AYXA 2ID9A 3NBMA 3QELB 2FMKA 2QR3A 4G0YA 4IRXA 2L2QA 3HEBA 1RXEA 2XDYA 1JH9A 2FMIA 2YHBA 4EVSA 4F8JA 4F12A 4M88A 3H1GA 4MPTA 3DZDA 1YS7A 4PYRA 5T3YA 3RVNA 4Z99A 2H3HA 3HO1A 3FGZA 3Q7SA 4W5OA 4HNRA 1YMUA 4RY8A 4CBVA 4MRMB 4QYMA 1HEYA 4KQCA 4OATA 4N0PA 4KZKA 4RWEA 1U04A 2JBAB 2NT4A 4JAVC 4L85A 3BREA 2IPLA 3O1HB 1ZDMA 5HQJA 1BAPA 5C5EA 1SXGA 3HSYA 3GYBA 3ROTA 3T6KA 1ISSA 5KQPA 1PNRA 4KPYA 2JCGA 2NZVG 2FLKA 2FKAA 5KWSA 5EWLA 3SY8A 2QVCA 3MYYA 3ILYA 3QLVC 5IBQA 4TLMB 1D2AA 1P6UA 1E6LA 3HJFA 2WWVD 4MYRA 1PHRA 1QQAA 2IDMA 4MS1B 3D8UA 1DG9A 5IULC 1W25A 1C0EA 3IP9A 1QPZA 4NICA 1U0SY 1TM2A 4P98A 1PEYA 5T7BA 5DCLA 4B09A 5EWJB 5B3JA 4E7OA 4YV7A 5IUNC 1GCAA 4D6YA 5ABPA 3MIZA 4WXEA 1YMVA 2E4XA 4RK0A 2QV0A 1ZHHA 1JLKA 3C3MA 1Z2EA 1TJYA
chains in the Genus database with same CATH superfamily
2H1HA 4GX0A 2J7PA 2VSNA 3E61A 4W1RA 4LX8A 4QDOA 1TZCA 4BB6A 4E46A 3J7AC 5MF6A 4P08A 1ES9A 4HRAA 4OI0A 3BXXA 1SWWA 4M89A 4DQDA 3B20A 5DBIA 1D2EA 3G17A 2QD3A 2IKSA 2MINB 2VXOA 4KWTA 4B8YA 4DMGA 1K6XA 2Q1YA 2HCBA 1QSGA 1JJ7A 1Q21A 4KN9S 2GJ8A 1SQFA 4LRQA 4TTIA 4CM8A 1FSGA 2ZJ3A 4YJFA 3TIVA 3AEZA 3VPGA 1F6BA 1PUXA 1ZMBA 4J07A 1Q20A 4RFVA 3T95A 3QHAA 5B57C 2DR2A 1SCJA 4JBNA 4Y1RB 4F97A 3WYBA 5ENZA 4LHEA 2WTMA 4PC6A 4YRIA 2CL5A 4KQIA 2LCIA 2V3VA 5E4YA 2QD1A 4TTRA 2PGOA 2AK3A 2BCEA 3T7TA 4BJ1A 4AJJA 5JASA 3ZJTA 3A6EA 4OKIA 3U1BA 3I01M 1GZVA 1RWPA 5AJWA 4ON9A 3CQ9A 3KX2A 4DSAA 4DA6A 3NC4A 4UARA 1PJ8A 3BGWA 3W2TA 3U3JA 1YV9A 2XCRB 1I2AA 1DXHA 1YR6A 5CLQA 2ACEA 5ULLA 3ZXIA 3HYCA 1DRVA 1Z7BA 1V9CA 2ZR9A 3WWEA 4NBSA 5J4HA 3TLKA 3UB3A 3C5VA 5FUBA 1XQXA 2AOXA 1O57A 1XMPA 2W2TA 2ESRA 3A3YA 3NR2A 4R0MA 1R4NB 4A0RA 2TRSB 3WL6A 2FH5B 1CS0A 2CLHB 4DWVA 3EZXA 2VH2A 3KUCA 4NESA 3VR4D 3ZZ0A 4GOKA 3C7KA 2O57A 2P5YA 4TLDA 3ZY2A 1N5KA 4WOBA 1JTEA 1T4DA 1NY5A 2HLNA 1T3GA 5EIWA 3VU9B 2H7VA 4MR9B 1H9CA 2ZPTX 3I39X 4QAJA 1PQWA 1WVIA 5AD1A 5EZYA 4PC2A 2WJYA 1T43A 4CF6A 4ZGGA 4R0VA 1TKBA 5FBWB 1VG9B 1KP3A 2WU8A 3OG9A 4MXDA 3NYWA 4YRPA 5LQSA 2A9RA 1T9ZA 2VPZA 4FYKA 4E22A 4P5EA 5TT1A 3SXUA 1CK4A 1W5BA 4QYSA 4X44A 4FDAA 5F9MA 4MV6A 4G5GA 3AHGA 3D6AA 5HIJA 5AM2A 4D3YA 2XECA 3FCSB 5DI9A 1Z62A 4BX9A 4DA0A 4C3OB 5KX5B 4F91B 2W2QA 3UWDA 4MZDA 5LQAA 3T5TA 4BO6A 4DDMA 1NN1A 1JFLA 2PPLA 3CZ4A 4X6XA 1NHWA 1W94A 3RSQA 3V00A 3LX6A 4YDSA 4CEJA 1U28A 2LE0A 2XXJA 4R1LA 1N1DA 4YQFA 1S7GA 4BYMA 4R8SA 5LQKA 2I55A 4FYWA 1NW9B 3CIFA 4HCJA 3ZQ6A 4TKZA 4YUVA 1LSOA 1TFRA 1OFGA 1PLKA 5DYNA 2XCUA 2WLTA 4BEJA 4EJSC 3F46A 4OJKA 2RGBA 3P4XA 4KUGA 2XB4A 3IUJA 5KNDA 2YXBA 2BN4A 4C76A 5EZYF 5IDWA 3WL5A 4YT5A 3HKCA 1RLOA 1GTZA 2VJCA 4FPXA 2WHRA 1KGSA 1GGMA 3B2EA 2GBCA 3D5QA 4TWIA 5GGYA 5BVGA 2XYGA 4CFZA 3IRUA 3M49A 3OZWA 4MUIA 5E0KB 2ZBEA 2CJWB 5TSDA 3ZHUA 3SQXA 4NYIR 2BEVA 4PLFA 2ZPAA 4M38A 4CEJB 4J1SA 4GYWA 3OICA 2EWMA 4X1IA 1IXSB 1NW6A 2ZQ5A 4Y9TA 3LOQA 4HFJA 1N2CA 4TSKA 4WXHA 3TRDA 3KYBA 3WLOA 5BXYA 1E2BA 5JCXA 2B1IA 3QLVA 1G20A 4FE7A 1V16B 2OV8A 4FOPA 1JR3A 3KQNA 2JH8A 4DC1A 2Q21A 1WSAA 2G76A 3GRFA 4QDTA 2H9IA 2WPDD 3HHEA 5CA0B 3H1EA 3OZXA 3T52A 2VDPB 4AYTA 4IDEA 3KLNA 4RBNA 3FF1A 5AJUA 4BBPA 2PRIA 1R6AA 5FI3A 3WIUA 1ZBDA 4IXWA 2XOXA 5KINB 1JZTA 2BGTA 4X7MA 3EFBA 4C78A 1N5MA 4JI5B 4EELA 5BV1A 2YHSA 3R77A 4AZ0B 4LYGA 3C4VA 4CMEA 3H3FA 3GFBA 1PTJA 1C1DB 3KHSA 4Q3AA 3RAJA 2HOQA 5EFZA 1EDBA 2J0VA 3I09A 1W5FA 4PGFA 3RRNA 4CIAA 1KTIA 4LQ4A 621PA 4TKUB 3PGKA 5B3AA 2VNIA 4FC7A 5GV7A 3TBFA 2IE8A 5BRAA 4CM9D 2HI0A 1LBEA 1I7PA 1E0SA 3BXFA 4K28A 3THRA 3ZLVA 4DLNA 3IPAA 3Q12A 3KSAC 1PLJA 1XT6A 3KDPA 2YC2C 2JLXA 4JXXA 1P74A 1Y7LA 1TYCA 2OFPA 2RI0A 3OPVA 3SN6A 4DLTA 4KLNA 4EVQA 4FBGA 5IH7A 3MGCA 2IS1A 4DXAA 1LLFA 1MT3A 1X7GA 1JALA 1Y4DE 1GPH1 4IOKA 1HH4A 3T94A 1II8A 1PSZA 3OCYA 2XNKA 4JFRA 1T0PA 1LBTA 2AN1A 2VWPA 4MI1A 2Z6AA 1WNFA 5GGXA 1QB7A 3F6PA 4HZGA 2BI4A 4WOKA 2ZCJA 4GQBA 1USKA 4BUCA 3RT1A 4BCDA 5FUVA 1J7JA 1DTWB 3ZIDA 4QTXA 5CFLA 5AW2A 2IGTA 4WSOA 3FSEA 3RS2A 4EKYA 1ZSVA 3G2PA 4EMSA 3EIHA 2NU6A 3EIXA 3FM9A 4R8RA 1FUUA 1XTTA 3E8SA 3H5NA 3A7EA 1HZZC 2A0XA 3OZDA 4MITA 4B6OA 1NP6A 3AHHA 1NMZA 3N8HA 2ZR8A 1ICEA 3IEUA 1WX1A 1IZYA 5BN4B 4EGSA 1N2JA 3TLXA 4YT8A 4XSVA 6LDHA 2Q3BA 5KJ6A 2IBTA 2FSIA 1J21A 1TO1E 3P0FA 2PJRA 1RHRA 5L7YA 4UZFA 1ADJA 1U7TA 4DIFA 3LK7A 1VYTA 2J87A 4EH1A 4J2OA 1BEUB 4KRGA 1XZKA 4DCCA 1CUXA 1R16A 1LC0A 5EZYB 5AM5A 3BA6A 4I1IA 2GK3A 1L5LA 3WIEA 3UXMA 3TLAA 3PKJA 2AI1A 1ZAKA 2DHEA 2ZTLA 3NOXA 3VU1A 4CMEC 3KB8A 3YASA 4CF5A 5ES3A 3IV6A 2ZWPA 1U4SA 1UJCA 5DHAA 1SCIA 2XMBA 1WMAA 3M33A 3G13A 5TMDA 5J47A 2R6AA 3CH7A 3LY8A 2VF7A 2YJTD 2IKQA 5D7BA 3EZFA 2NZJA 3DZGA 3UMSA 5DTQA 3DKIA 2X14A 1YS9A 2BCJQ 4AJ1A 1ULTA 4JI3B 3SKVA 5D5HA 1S8NA 1NFQA 1O96A 3HJRA 3KHKA 4ZTZB 1Z18A 1SWVA 2VZ0A 3SSOA 4C4TA 1M2NA 4Y6SA 2XCTB 5JXHA 4UDOA 1QV7A 4Y2QA 4LOLA 3O2QB 1EX9A 4NE7A 4B46A 4RC9A 3BF8A 4YJ2F 1WY7A 3LC0A 5EMLA 2NTNA 2VAVA 3EE6A 4L15A 1D9XA 3HYNA 3VGJA 2BC9A 4C4RA 1ENYA 4HYYA 4H1TA 1PFGA 4JIMA 4RTLA 5JNVA 5LYJB 4QUHA 4O8CA 1U3CA 3M3PA 4XYBA 5C1OA 4JCOA 3T3OA 2CMDA 4TWAA 2EZ4A 4IIXA 4XFKA 4Y6PA 3H42B 3PDJA 3ROKA 4DM7A 1OWNA 4KQ6A 2YCLA 4PRKA 5LJIA 4DIDA 4KR2A 2A9KA 4Y3UA 3UMYA 3FLAA 4YRAA 4QFCA 2JFZA 3NM5A 4YALA 4DWJA 1KY2A 2KMLA 1AG9A 1I0ZA 3AESA 4IVRA 4R9VA 4E6EA 2B5OA 1KDVA 3TDNA 3RBVA 2ID8A 4AZWA 4DDUA 2IVZA 2GX6A 3E84A 3IV7A 4B4WA 5B3KA 1H5QA 4JUFA 1DLJA 2YMQA 4FILA 1HKUA 4LUCA 2G6TA 1XSEA 2BEUA 4ESEA 5A03A 1GPJA 3JWIA 3ABSB 3QFRA 3S55A 2BEKA 1YKGA 3H4VA 4K6OA 5JUWA 2BHSA 1XVVA 2FSVC 1N77A 4RPJA 4YVFA 5C53B 1OLUB 1E32A 4YB8A 5CT5A 1R0ZA 4BCCA 5JNWA 5FFFA 3HNRA 3O8LA 4MO9A 4UXIA 4X91A 4RM2A 4DIEA 4QYWA 1CP2A 1VBKA 2V6MA 1QFSA 3IUYA 1F0PA 4M1SA 2EJVA 5FL7A 2J7PD 3NHRA 3G9XA 3F4LA 4QPNA 3RU7A 1XTQA 5BMVB 2QTMA 2JARA 2FQ1A 1Z4MA 3GC6A 4OFZA 3MS2A 3RW9A 3QEMA 4BMVA 1X1AA 4FCCA 4FS3A 5ILGA 4LJ9A 4IXTA 5CA1F 1F14A 5LA6A 3NLLA 2AFHE 3TQQA 3OX3A 5KJCA 4BL5A 1E0KA 2WJGA 3CPSA 1FDOA 3LWZA 3IESA 1EA5A 4GMFA 3PUHA 4OQMA 3K6SB 4BAUA 4C0WA 1F4VA 1ZN8A 1JAXA 2QTNA 3PEEA 4OHKA 4MAMA 3U0BA 3WL8A 1YR8A 4B9EA 4DG9A 2YVLA 2WM3A 5BV7A 2YVQA 5LQCA 2YUIA 1GEEA 3VYTB 3W1EA 3EMDA 1K27A 1T36A 2ZSIA 3SP1A 3HXLA 2DVMA 2EHJA 2QVGA 4M3NA 2Z6VA 1P9RA 1UFOA 3OFNA 1G0NA 3BQNB 4LX0A 2VSFA 2RMKA 3OX4A 4H4CA 1PS0A 4XM2A 1MJNA 5DT2A 3FBWA 5DX8A 1PT9A 1G8JA 4K05A 1XD9A 3CB4A 1D6JA 1GLVA 3DTYA 4QYIB 3T0FA 3VTFA 3PDIB 4JQYA 1I30A 3QW4B 4GXNA 4RV4A 4EJSB 1S4QA 1GQOA 1CY4A 1GVNB 3VZRA 5TLSA 3Q8MA 1W0KA 4OB7A 1KJQA 1B1AA 3INNA 3SD7A 3TYXA 4ABYA 4HJRA 1E7MA 3LT0A 3NIWA 5IEBA 1R4MA 4N7JA 1PWEA 3OJEA 3OPNA 4FW8A 2V7WA 3BA1A 3MJ4A 3WE7A 1AN9A 2FUG1 2YYYA 1T9AA 4MS4B 4WZAE 3ND8A 4AJOA 1MXFA 1Q11A 2FPIB 2ZB4A 5FHRA 4YMHA 2OCKA 3CGGA 1E9FA 2QYHA 3LQ4A 2XOEA 4BRZA 4LIPD 1IM5A 3QE4A 2H2DA 4XIIA 1T0JB 3AL0C 1W19A 1ZM3A 2XUFA 4P9NA 4REQA 3PYLA 1U3FA 1ONOA 2ZVDA 1W5AA 2ZCVA 3DLIA 3K7EA 1Q0ZA 4LZNA 3C24A 4PR0A 4RESA 4JLSA 4X41A 4WBXC 4R1MA 3LA8A 1T3HA 4LYJA 1BIFA 4MICA 1S8OA 3OQBA 4L4RA 5HBGA 3OF2A 1TMGE 3T99A 1G55A 1T0BA 3A6FA 3GK3A 5E2IA 4EFDA 5C8YB 5AVUA 4DV3B 2P3LA 2O2HA 5HR5A 3NGLA 2O3RA 1RQNA 4JX9A 3VSBA 3AL2A 3AY7A 4Q6BA 1LPSA 5FPQA 3H2YA 4D4LA 1A8HA 4OM8A 3A1WA 3ADPA 3DXXA 3E6AA 4JXZA 1X1SA 1OTHA 3H2ZA 1JSLA 1KAOA 1PNOA 4J3JA 4L22A 4BP9A 3V1LA 2C7RA 1I80A 1U2EA 3GCGA 3E53A 3PL5A 3E0XA 3KOZA 1JJVA 4LYAA 3KWJA 4AKSA 3A9RA 3Q7RA 3K6JA 5DLYA 3AVUA 2C83A 4DBLE 1G5TA 4IEEA 3VNRA 4LRTB 1J5XA 3BE5A 1QO0A 3ONNA 5CG1A 4FFRA 3ESDA 1XHFA 3M6LA 3NMUF 1XTVA 1O9BA 4Z8XA 3I0MA 3TR5A 1R6DA 3V8RA 3BXGA 4B6JA 3IPCA 4D3SA 4LFAB 4IR7A 2FW9A 2R11A 2XE8A 4LDZA 4HFNA 3ZV6A 4HDNB 2NYUA 2JRCA 1Z2NX 3PI6A 2HAEA 1XROA 3F9RA 2P91A 4M7WA 3ASYA 3PC6A 5EMNA 1CJTC 1FZQA 3H2KA 1CT9A 4QPDA 4RKEA 1HNXB 4HQ6A 2P1ZA 3CVJA 4B3SB 1OB2A 2XCIA 2C96A 4DCNA 3KVYA 2GZRA 4KX5A 4CIYA 1E2PA 3QELB 2FMKA 3PJRA 1JDUA 1E1DA 4WV3A 5AT1A 5H5JA 4PZUA 1HM5A 4J1TC 4EHIA 1RXEA 2EJWA 2QSZA 4XYEA 5AYVA 1C0PA 4P86A 3ABQB 3QPBA 1BE6A 4TT8A 1VJCA 3V7FA 3ED5A 3KLBA 3OOHA 1HGXA 4UUOA 1E64A 3W34A 1QQTA 3W6NA 5AP9A 2HYIC 1XDSA 4QLAA 1I2DA 1C3VA 4J3FA 2EHDA 4MPTA 3R5XA 1M73E 5F23A 1NMQA 1BWRA 2VKTA 4K9LA 3B6ZA 3S3TA 4Y9SA 2P2GA 5C3UA 4XCXA 5KWIA 5CYGA 1L1QA 3KAQA 4PNEA 4J4BA 4WJZA 4XWGA 1M8GA 3WMEA 2VHJA 1HYHA 4WZAB 1U2GA 1E3SA 5JVDF 5I7AA 2NT4A 4X8MA 3ADCA 1R0RE 5BN1A 1ULZA 3HJCA 1CS4C 1Z5ZA 3HSYA 2B6HA 1LLDA 2G5GX 2PXCA 4CCYB 5C5EA 4LSGA 1IWOA 1U7XA 2RGNC 5BPFA 1VLQA 1BS2A 4I1OA 1VKJA 5B55A 1GR0A 2JI6A 1D2AA 2A3RA 3NIDB 2H5LA 2GNAA 3E1GA 3KBOA 4JV5B 2VYND 3MG9A 4IKPA 3W9UA 5BVHA 1BS1A 3EUFA 2Q5QA 1P4RA 1W96A 1LW7A 5LDGA 4TZ0A 1P5RA 2PEYA 4PZDA 3WGTA 1RTKA 3THYB 2ZK7A 3EW7A 1JHPA 1OC2A 4OHFA 2VBGA 4W5WA 1HQYE 1QFJA 4ZI7A 2OUKA 4RIHA 5CAEA 3UWOA 1QYXA 1G9SA 3FUTA 3HCEA 4YUWA 5K2MA 5JRJA 1MIHA 2GZAA 1XF9A 4I5EA 3WQRA 4DA8A 3BBLA 5IVPA 5JCPA 3IO5A 4DMMA 3DOOA 4LV8B 4HYQA 1G42A 1RXIA 1GHTA 3FSJX 3K2BA 5EXXA 4N40A 4YLYA 3A3OA 2RKOA 3IEKA 2QPOA 4M86A 3L3BA 2I66A 1RHUA 2OV2A 1PJQA 3ISVA 4JUDX 4TSRA 5KBYA 3OZAA 2ZJAA 4LBZA 5H3HA 4CEHB 1V4VA 5JQGB 3W5DA 5IS2A 1RI2A 2O8DA 2AZTA 2WNIA 3R5HA 2JFPA 4JLMA 4L57A 2WF7A 2A2ZA 4O33A 1UBTS 4GI1A 3FWNA 1KXZA 1A69A 3GF4A 1NLYA 3KZNA 4BNHA 3L77A 2DWUA 2GN4A 3ZLTA 4D9GA 5LPNA 2I4NA 2JIZA 2NO4A 3B8HA 4M21A 2BHNA 1OJLA 1X8JA 3OLWA 3LT2A 4P92A 3C7DB 4TN1A 2XA2A 2E4YA 3EBLA 3PJDA 4YLEA 3J80A 2W9XA 2I9KA 1QUFA 2H3EA 4E1AA 1U2GC 3VO2A 1T5IA 4URFA 2BJWA 3LAWA 1FYWA 4ZMSA 521PA 5TPWB 3KETA 1FRZA 3SZOA 3FI9A 2GRJA 4ZO6A 1QCDA 1YCHA 1P1HA 1YBHA 3IOEA 4M54A 3WB1A 1FC0A 1FTWA 1Q7CA 3UBMA 3RRZA 1DKLA 4ALIA 2NO5A 3ZY6A 4KP7A 5TY0A 4UJ5A 1Z26A 4ZCIA 1JTVA 2NSYA 3SF8A 5G4KA 4U7DA 4AP6A 2ROQA 3FHLA 1WVMA 5DBFA 4ZJYA 2BRUA 2ZUEA 1N2XA 3A1DA 3SFZA 2RONA 3NS7A 4J91A 2OGWA 1MX5A 4YRRA 4MDEA 4CR6A 3FTEA 2I1QA 1G6Q1 1V1MB 3N8GA 5HOEA 2EWVA 4AF8A 3L6RA 4Z7NB 4DQLA 4KREA 1K97A 2WJAA 1O95D 1W6UA 1R0WA 3C16C 3OE7D 4MYTA 4C04A 1WP9A 4WKCA 1O0SA 2O7NA 1EVKA 1U9YA 3R2JA 1QC5A 4R41A 3E8XA 4B6RA 4K6CA 2AA3A 1EP3B 1P2SA 3CY6A 3NHAA 3HYSA 1CYEA 3SZUA 3VUEA 4IIFA 2W37A 4TOIA 3L8EA 5C4GB 4A03A 3KJGA 1DL5A 1FFEA 1PR2A 3I9LA 5EP1A 3TSOA 2I3BA 5JBNA 4KCGA 4NJOA 1E2DA 3V8EA 4IJ6A 1VDZA 4DV4B 1ZQ9A 3R5KA 4IIYA 1SUFA 5BOSB 1RZRD 1JU9A 4JI7B 2W11A 4LV5B 1UDXA 2C2XA 2FN9A 1LU9A 4M0MA 1G5PA 2V45A 2X86A 3HP7A 1E6KA 3SX4A 5KQSA 4YRZA 2CDAA 4NX2A 5JYEA 4UJ3A 3VNVA 1P3JA 2FJPA 4GECA 4R69A 3T38A 1X7DA 2C98A 2PJUA 5JS7A 2OXEA 2P77A 2BFMA 1UWCA 1QZTA 3KLPX 3TCXB 4GF5A 4QE3A 3JAWA 4Q1DA 2B1RA 2GN8A 3I6ZA 2X0KA 3C1TA 2QW0X 4Z2AA 2ODNA 1RT9A 1TUGA 1QOPB 4WFKA 5KUTA 4PIPA 2FX2A 4L9AA 1ST3A 4ZV9A 1P81A 3PG5A 2XW6A 1SA0A 3H65A 1CNFA 1M6NA 4G01B 4W5JA 4X1YA 5FWXA 3WHIA 4A8JC 4RXMA 3IT2A 4DR3B 3A2MA 3WGOA 1L7NA 1N6KA 4GGPA 4DCMA 1RW4A 2OZLA 5EOVA 4XQ9A 2AXNA 2YZMA 2YN4A 5EC8A 3PGVA 3AFOA 4HUQB 1V5WA 4EHNA 3T34A 3WKCA 4LJ6A 4TKVB 1K2VN 3QPVA 2FPIA 3BWCA 4KE7A 4FFOA 2C5SA 4W1PA 1CF9A 1S9DA 1ENPA 1SY7A 4MK4A 2ERXA 3KKOA 5JZVA 2P8SA 3SDSA 4II3A 4UTZA 3COZA 3QNMA 1WB5A 2VG8A 1KRWA 2XCQA 2PUHA 4ANFA 2XRFA 2FFAA 4QUDA 1QIJA 2ZRGA 1OZGA 1J25A 2FLVA 1JG7A 3P9CA 1JDVA 2FJ0A 4I4CA 1X1QA 2G5CA 1L5RA 4BJ5A 3W3AH 5THQA 1ZICA 4ZDJA 2I2WA 4GPZA 2J48A 5CEEA 1AKRA 4CL0A 4O4JF 3PFWO 2PT7A 2WQ7A 4LWOA 2DPYA 1RTTA 2VQFB 4HQ0A 1GNLA 4NATA 5ALEA 3HL4A 4TMTA 3ESCA 5E95A 5JDIC 1MAVA 1NKTA 3H1FA 3AILA 3CLSC 3L7MA 2EOAA 3CXRA 4BX3A 4JK3A 2IIBA 2YXEA 2BT4A 3CV3A 5M34A 2M9MA 3S7ZA 3N07A 2W2NA 1I01A 3LT1A 3IXMA 5IJXA 4D4GA 3OURA 1FXUA 3FUXA 3S2GA 1KWKA 3CUEF 3Q98A 5HS6A 3KKQA 1DFHA 3RJZA 4NWIA 1NJGA 3VTKA 5J4YA 3AVYA 1M1XB 1OAKA 1L4MA 2GN0A 2VYFA 3LL4A 4ES6A 5AOVA 5HRCA 1UPTA 1MG0A 4HMOA 4HQKA 2ADFA 4AX4A 3FOFC 3CLSD 3ETEA 3GT3A 3Q3JB 2H8KA 4X8OA 3AM3A 5B4TA 4CQMB 2B2CA 2GI4A 2WR8A 4R1SA 4QOJA 5F7OA 1KJIA 5EIOA 4CLOA 3IAS6 3TUJC 4P82A 3S2IA 3QH4A 2RHMA 4BNWA 4ZT4A 2AR9A 2OGTA 3IE0A 2BUAA 3HO6A 3IBTA 3DZCA 3QK7A 1GL6A 2ZJFA 1KR2A 4QQKA 3RUHA 2G6BA 2REBA 3MXOA 3PXCX 4RKYA 2IWRA 4AM8A 1FOEB 2RC5A 1DAFA 1O94A 3TSCA 4IX9A 1GSAA 2ABWA 4XR9A 4BZQA 5B3JC 5K3SA 3I8OA 3BSSA 3HUTA 4Y2SA 1DQSA 3AVWA 1P0IA 4LMBA 4HWOA 2C94A 3RYIB 1UOOA 2QRHA 5ECYA 1VA5A 4I4TB 3IT0A 3TNYA 4GRDA 4DJTA 4EITA 3MT9A 1EFRD 1O94D 5LKAA 3ZJUA 2WP0A 3L1UA 5CXSA 3W5IA 3FB1A 2VZ9A 1PJAA 2N1BA 4L5JA 4P3OA 1Z63A 4FFNA 3F5FA 3FIJA 3P45A 4X85A 5BWBA 4C4AA 5FWNA 3KR0A 4OLFA 4RV5A 3U4QA 5FBKA 1HL3A 2ODPA 2XD9A 4IDNA 5FI0B 4Q4JA 1XKXA 1IFXA 2DPXA 5ALRA 2O05A 4KRFA 4G36A 3BYZA 4TMXA 5DTMA 1Z3IX 1ZX1A 2XI4A 4K9DA 3V1YA 1UT6A 1GRVA 2LV8A 3M81A 4HADA 2C5GA 4Q03A 4TXNA 3VX3A 1PT7A 1Z13A 1PL7A 1ACMA 1C1DA 2BKAA 4DLWA 3QITA 5E1BA 3U4IA 1WMEA 5L3QA 1G21B 2KPOA 2FG5A 4OK6A 4PE5B 2F6RA 2L69A 3ELDA 3HWRA 1VL1A 4FWIB 3HWSA 3ESXA 4LDNA 4LAFA 1BGXT 4OXNA 2WLSA 4O4LF 5DV9A 2VDUE 2VPPA 4FFDA 3W77A 4CVNA 1UPCA 1SRQA 1LX7A 3GEDA 3MILA 2XJ4A 1RYYA 2X0NA 3OIVA 4RAOA 1Z4QA 3HCCA 4TKMA 3QYFA 1DS6A 2AG6A 4W5NA 4QHYA 4URWR 5J1SB 3WGIA 3BB4A 5SZKB 4G09A 3LQ1A 3L0CA 3JQ8B 1QV6A 3KQTA 5G3ZA 3UHFA 3V34A 4AWBA 2A67A 1X9HA 1N6OA 2QA5A 1B41A 3JWJA 8LDHA 3I12A 1FDTA 1CS0B 1U2ZA 2ZIWB 2ZWOA 1YB7A 4QPJC 1T9GS 3UGTA 4B6EA 1EVJA 2G0NA 4JGBA 5JJIA 1UOQA 4Q9JA 1L7MA 1REQB 3FMFA 4WOJA 4RIFA 3I6MA 4PYKA 3TOCA 5IXSA 2OHFA 5AKXA 4N9QA 3C5WP 4PZ0A 2IS4A 2AJBA 5DNCA 2QUKA 4JLJA 1N57A 2QORA 1DVRA 2EBFX 4ZVTA 1O89A 4HZUB 1O0BA 4ILEA 4JBYA 3TQFA 1U63A 3C1OA 4ND7A 4ZCSA 1SQ6A 3R3WA 3HJAA 3DDHA 2WMYA 2PR2A 3DBRA 3UATA 4K9NA 1M2OA 1NG1A 1JKXA 3I2HA 3R0QA 1UZLA 2YW9A 1BFKA 1Z15A 4U2DA 1IUNA 3DD1A 3D9QX 1CZOA 5TT0A 1MA0A 1VL8A 4OYHA 5SYAA 5JWHA 1Q0RA 4KVGA 2WWXA 2JJ1D 4MQ5A 5HOQA 1CZRA 5AI4A 1ENZA 5IZCA 4WJKB 1YVDA 1TKRA 1NYQA 2ZBDA 2EBUA 1QZZA 1QIFA 4U3JB 3HKDB 2XTJA 3D3NA 1EUCB 2CK3A 1MNQA 2VPIA 2GZ3A 3L8CA 1UMCA 1QGED 3A1NA 3UVEA 2O23A 1ZNXA 2BDEA 1LJ8A 2YBEA 4HDCA 1AS2A 3PNQA 4OBBA 5HA5A 1DAIA 2ZBPA 3LQQA 1HDCA 2A84A 2OZVA 4K1LA 3U4DA 4RD6A 4E07A 1VKZA 2WAYA 4U7WA 4E5VA 3BD6A 1NUHA 3RBAA 1EGVB 3ZVRA 4G5OA 1K6IA 5IARA 5GADl 4QUKA 2ZVJA 1PFWA 3T4PA 4DQ0A 2YDYA 3A70A 3LLCA 4B3MB 1GZUA 1LLCA 1XZ8A 5KYUB 4J6EA 1WXQA 4NFYA 4X6UA 3BFVA 1IM2A 4RH0A 1AGPA 2PVPA 2XNDD 1XZAA 1QG4A 2ZT6A 4PGMA 5KOJA 1V5FA 2JI8A 2BUCA 4Y0NA 1ZU4A 4ZOAA 4BRWA 2AD5A 2EZTA 3DL2A 4R7ZA 2F9FA 3ROZA 3I42A 4CETA 1Z39A 1ZJ4A 3MTDA 4TYYA 4YBRA 2X1HA 2JVIA 1M0SA 1ZG3A 3AESB 4GXRA 1RWOA 1DO2A 4RD0A 1T9BA 4BQRA 4WKNA 1MO2A 3MUEA 1ZP6A 1WXDA 5DXAA 3TBKA 1JIUA 1GEGA 4R8VA 1RHKA 1O5OA 2H4JA 4YV2A 3GL9A 1SZJG 2W2KB 4ZCLA 4L0QA 1JHVA 3MAAC 1H2EA 2G36A 2X7JA 2EP5A 1V3VA 2WKRA 1P5ZB 4GWLA 5AKHA 3URMA 2FP3A 1WG8A 3ZCRA 4ALKA 4YCMA 5DHTA 3QUTA 5E3JA 5F52A 1TUBB 5AHOA 6NULA 2WSSA 5H8WA 3RVPA 5DX0A 1JDPA 3R5FA 4CCYA 2YC4C 3OEYA 4FGZA 3U3DA 5KEIA 1X7YB 2C8VA 2ZJ7A 4X95A 4DZRA 2GEBA 1Q0QA 2AFHB 4G1UC 2FEAA 1I4WA 4WHMA 1I4LD 1QQ7A 1RWXA 3R3VA 3MRVA 5I48A 4JJAA 1XCMA 3OM8A 5BR7A 2AOTA 1AMUA 2XUJA 1UXGA 3JYLA 1H66A 5IJZA 2XTZA 5KB3A 4TMFA 1UBUS 1UWKA 1C9MA 4IIDA 4D42A 4QT0A 5TQ2B 1C4WA 2Z57A 4E1VA 5TDHA 2HRZA 2QG9A 3K2IA 1EESA 1XTSA 2QP4A 3CYFA 2B92A 2QSUA 2Q3CA 1O6FA 3TLEA 1MAAA 2YWCA 1KE2A 2RGAA 4P35A 4RNCA 4GAEA 2QRLA 4Q7MB 4W9NA 4D8YA 2RG7A 4PAQA 4PR3A 3RS8A 2X4LA 1JHQA 3V4ZA 3MJFA 2DYKA 1SULA 2LWIA 4JP2A 1XF1A 1N2HA 2DBQA 3OO1A 1TC2A 2J3LA 2Z4SA 5HF6A 2HMWA 3H83A 3RRMA 2O6HA 6REQB 1ZMXA 2BAGA 1U6IA 5BO5A 3BXOA 1USUA 3EY9A 3V48A 4UVDA 4YCCA 2UZ4A 1Z4LA 3PT9A 2YHBA 3KQOA 4CKBB 2Y8EA 4X5OA 5LD2B 3N1UA 5EESA 1T2EA 3AI2A 3GPBA 2VP2A 3QWHA 2O0HA 3QWAA 3O8NA 4JBXA 4P84A 4QREA 2HO5A 2CY0A 4C5BA 1XZLA 3VJKA 1GPYA 2CJFA 3ZGZA 4LTNA 2O5EA 4K9PA 1S96A 4XVCA 1A4RA 1DC3A 4LECA 1FUKA 4IFTA 1Q0HA 1BD3A 1IL0A 3MRTA 4UQOA 4YRJA 4DLLA 5KWVA 1YR9A 1CP3A 3KJIA 2WU1A 3IO3A 2J8ZA 3TDKA 4KLAA 5BSWA 3DEFA 3U7QB 2AX3A 3TQTA 1Z6ZA 1CJVC 1K5DA 1LFAA 1YZYA 1QOQB 2FMUA 5KYVA 1YB2A 3CRZA 1XZIA 3E3LA 1IHYA 3I58A 1ANKA 1WEKA 2NZVG 4LTDA 5LBIA 5EG5A 1IY2A 4G24A 5B1YA 2QNIA 4N7MA 5IBQA 1P6UA 1PL8A 3IDAA 5ALYA 2WIDA 3OH8A 2I2FA 4MYRA 5FJIA 5JI2E 2J5KA 4HLDA 2FRXA 1XELA 1JKJA 1CNEA 2ZB2A 3HDTA 2DLNA 3N0VA 3NEPX 3ZHTA 4B84A 5F2EA 3IILA 1TT7A 4NICA 4DRXA 2YV1A 4EP1A 1MJHA 2NQ8A 5LNK6 3JW8A 1H0RA 3QXCA 1XNGA 4JU8A 2QAGA 1MHPA 4UDNA 2I65A 1KZGB 4Y98A 4ENRA 5LQNA 1H6AA 4PF1A 2D4AA 2G88A 3FFXA 1GARA 3JV7A 2DFVA 3SS8A 2O3TA 4AECA 1N8TA 1I3OA 3KZMA 5K7SA 4RY0A 2IP4A 3I2JA 4GP7A 4JQOA 4LCJA 3TXXA 1U8AA 3ZY3A 1VHQA 2QM3A 2WTXA 1YMQA 3L4SO 4WINA 1IHXA 2KJQA 5EMJA 3ROXA 1XU7A 2BSXA 5EYPA 2JGIA 3TSYA 2BHTA 2XNSA 3MUNA 1UK6A 2YV2A 3K30A 2BW0A 4MQLA 4F7DA 3FHJA 2FEOA 2GNPA 5FNVA 1HNZB 3NEJA 1ECPA 2BFEB 4B74A 2YZNA 4NBKA 1RBZA 3KPYA 5ICSA 3AEQB 3OAAD 2JATA 2E89A 1E2EA 1UDCA 4AG3A 4JB8A 5CX1A 3MWFA 1Z08A 4MIYA 5JXWA 1H22A 3C6KA 2A35A 3EZ2A 4J7CA 4KMMA 2YWGA 4IJQA 3GD7A 3SKYA 4CCSA 3TO5A 5HZKA 1D1PA 2TSYB 4JA0A 4C0HA 2RFLA 1GPDG 4D0GA 1E9VA 2IHJA 2ZS7A 4NEGA 2X13A 3AG5A 1KSJA 2I87A 3QOXA 3WL7A 4GGMX 4JB2A 3PQ8A 5LM3A 1QRSA 2QBYA 1T0UA 2H31A 2P0EA 5A4IS 4ETNA 4FQ7A 1SB9A 3M1AA 3MT8A 2DM6A 1PTKA 3LX5A 4ZVPA 1NTRA 1QJ4A 4IH9A 4EY5A 2B4YA 1O6ZA 2JIZD 1UBJS 1NOIA 3J81k 2HRBA 3MN1A 3K31A 3TNLA 4R8KA 5J59A 5IZ4A 2A1UA 5A5DA 2CLDX 1OX4B 2JJ2A 5C1DA 1DAEA 2HRRA 3H75A 3QP9A 3KHTA 2Q1TA 4TQGA 1NXXA 5LDDC 1C80A 1D6NA 1FMLA 2IYVA 1BOOA 2C4UA 1XEWX 1SVNA 1VYVA 2PGLA 2WI8A 3LCJA 4H7DA 4N5HX 2COEA 2OAP1 3AZOA 1TQHA 3UG6A 2BFCB 1HLFA 2GVDC 1YA6A 1SC4A 3O8OA 5TC4A 2YVAA 4KMOA 5IC4A 3CA8A 4X61A 2EXXA 3N2LA 3T1TA 9ABPA 1N78A 2JCSA 5DGTA 3AP2A 3KAJA 5L9AA 1E6UA 1G7SA 1UWVA 2E4ZA 2Q3FA 1QXSA 4JT2A 4N8EA 2OCDA 1AQ6A 2BMWA 5HF5A 2PUEA 3V7UA 2V8BA 5C9ZA 3LDHA 4J0DA 3CCFA 5DCWA 2GPSA 4KPUA 3TNJA 1IU9A 2IIQA 2Z2ZA 3LHKA 2EFYA 2FWMX 1UKEA 3BN3A 4HLUC 4IEFB 4NMWA 4GXQA 3ZHXA 2PGIA 1Z0SA 1IEQA 3HU5A 3LOPA 4F06A 1HLGA 3KWLA 3MEQA 3QE9Y 1M1NA 3DOHA 3AF5A 1WO8A 3OCXA 3CONA 3KM0A 1ZIYA 2RIPA 3EZNA 1K6EA 2C84A 3DE6X 4M6WA 4RA6A 3UWKA 4EW6A 2YXPX 3IEMA 5CB4F 4L9RA 3PWZA 4QFBA 4C0SA 1GTRA 3VHQA 3RSOA 1L0BA 4GQIA 2Z9CA 2ZUUA 3IHTA 2HQBA 1HMYA 1SUEA 2ZIVB 1MH1A 2GOYA 2VSXA 2BR3A 3G02A 3SIRA 5BUSA 3KR2A 1GCIA 1FFGA 3H1TA 3P9KA 5TF0A 4D2IA 3H8SA 3N8KA 2I2CA 2XNDA 2CSUA 2Q07A 2Q6VA 2SKCA 2WZBA 3DDCA 4XWTA 3SG0A 5JTUA 3I61A 4O25A 1AXRA 4HVLA 2HMAA 5G1OA 1QH8A 2O3SA 3AC0A 3IKJA 3SQMA 3A6LA 5JD4A 1JA0A 1F7VA 4IJKA 4A2CA 3G8CA 1SC6A 2XB2A 4BNXA 2V74B 2PRZA 2GMWA 2E48A 3A28A 3SVTA 2OYCA 1VLMA 1URPA 3KBBA 4Q01A 3V7YA 5GM1A 3A2LA 3DDOA 3F8TA 1RCUA 3UMJA 1RWBA 1XEWY 1R6TA 4GI2A 3BKWA 5TPZD 3CT4A 4QEKA 1ZC3A 2OG2A 1QAOA 2C2WA 3WBKA 2C97A 2XT9A 3NNNA 1R5JA 3CNEA 2UV8A 5ALUA 3E7PA 2BWJA 4AUMA 4F3RA 4Z3KA 1Z33A 3DWFA 2GXSA 4QQFA 4JI8B 4MIOA 4EX7A 3LP5A 3ZQ4A 2B8NA 3DBIA 2BFBA 1W581 1ZHFA 2ZQYA 3HDVA 5BW5A 1AN0A 3KZXA 4M2LA 3IJ5A 5KX5A 1Z5UA 1CQIA 4ZOLB 2ZFUA 1L1FA 3IEVA 2BIFA 1BQ4A 3ABZA 1FYVA 2G06A 2ZITA 3KHUA 2DH6A 3NU1A 5KOJB 4LE0A 3VDQA 4CKZA 2Y6UA 5ARBA 2YVUA 3PXDA 4AQDA 1NXWA 1NW4A 2HT1A 2H4FA 4N3NA 1ODKA 1MQ8B 3DVRX 4YROA 3SLGA 4J4HA 4JH0A 1Q95A 5CNIA 4CLEA 1NLFA 3FJYA 3SE0A 4EK9A 2ZRDA 3ZHBA 1O77A 3U3ZA 4YT2A 1H0HA 3CF0A 2FPPA 1A77A 5DNWA 2C9YA 3FWPA 3L7NA 4W8GA 1QH1A 2VOJA 1Z68A 1XL0A 1RPNA 4F4IA 1QO0D 3LTNC 1OI3A 1SRRA 4GM4A 2HNKA 5CT8A 2YL2A 3A04A 1PV2A 4LXTA 1W4ZA 4F3NA 2R85A 3Q5GA 2RAUA 2ENWA 1B4DA 5AVRA 3KOOA 3HI6A 4YAKA 3EWAA 4DGQA 1I2ZA 4MWCA 4RVCA 5C18A 2JG3A 1F7UA 4KFTA 4KXUA 2D1FA 1D2NA 1MDBA 1J2UA 3IPYA 3N2YA 3GR6A 5ALKA 3WK5A 2NSDA 1QR2A 2AFHA 1ZI6A 1CLEA 2WKSA 3GVXA 2I6GA 4KU4A 5GAJA 2YS6A 2H92A 3ZCTA 5AW4A 3VXKA 3UPUA 1WUKS 2X9QA 1IPEA 1T8SA 1E2HA 1V26A 2AHOA 2C9CA 2QSJA 2W6IA 1WD5A 2WT4A 2YV5A 3WB0A 3WLJA 4A91A 1AHIA 1SIWA 6ADHA 1TD9A 3T3GA 2IS6A 3GGPA 3SZRA 4R5MA 3H2BA 1IQ0A 2IEZA 3EGCA 3OX1A 2FFQA 1T1EA 5TEWA 3DYIA 1YE8A 1UJ2A 2O0LA 2OVBA 1U2RA 3JPWA 4FHEA 3D2LA 3QLTA 5HKLA 3VJLA 2IW1A 4F3KA 3KOMA 1JNXX 7REQA 4BZZA 3ANSA 1J8VA 4MARA 3ZJYA 1QS0B 2QRMA 3GAFA 2DETA 2DQYA 3RKSA 1O08A 1AGRA 3WDSA 1LBIA 1QOZA 2GSWA 3ZNQA 4X63A 1W1UA 1J0EA 2BMFA 1KAQA 2WJ3A 4YCDA 1AQJA 4KXNA 3IQXA 3E5RA 3I3OA 1KC3A 3LFTA 3KE9A 2ZWMA 1OA0A 4TZ6A 3ULKA 2HGZA 1YIDA 3D02A 5C8XA 3HUFA 1QJCA 3MTJA 4EDHA 2ECFA 3F96A 4JJFA 3FNQA 4CQLA 3RIGA 3BB3A 3C5HA 3PC8A 4Q3BA 2IT1A 1Z56C 3GUZA 4AJEA 1JIKA 3OJWA 5F2NA 5F77A 3QV1A 5JZMA 4HQFA 5DWDA 3W78A 2J33A 2G67A 4JITA 4X9XA 2AEFA 5MDHA 1Q77A 2X9LA 4IIJA 3KJXA 1Z37A 3QHPA 3RUPA 4KK4A 4UNRA 5BWCA 1NU8A 1UMCB 1UEXC 2IELA 2TMDA 1HA3A 1EIWA 2D06A 3B5JA 4ALLA 1ORHA 1OYVA 3UQZA 5H0IA 4JKOA 4E70A 3BGVA 1LPNA 2YJ3A 3GIDA 3UK1A 3CWZA 5CVCA 3M3DA 1SFRA 4C43A 3Q8LA 1T1JA 3AHJA 3LBHA 1QFYA 1XXLA 5GINE 3MCUA 1XTJA 1CUGA 1JEOA 2YFYA 3WS7A 2Q4BA 2J4FA 3RRBA 4G0VA 3RJ9A 3KV1A 5FL7D 1UP7A 4Z4EA 3DDWA 1EJBA 4K88A 3WNBA 5K0BA 4NR0A 3MCVA 4CQLB 3REQB 5G40A 2INGX 3W7VA 4I55F 5KO2A 2FHSA 5KOYA 5GQSA 4UQLA 3UUGA 2QMOA 4CPDA 4IIHA 2IYPA 3COJA 3GEMA 3EEYA 1EWKA 3RK0A 3QEBZ 5FLKA 1XK6A 2GASA 1RKVA 2J07A 3HDGA 1SVOA 3A32A 3OCCA 4G4GA 1D4FA 4F84A 4V0OA 1POXA 5JIBA 4YR7A 3GP8A 2QRUA 1V8OA 3BMNA 5EHNA 4XAQA 1CB0A 1GRNA 3DBRB 2QN1A 4EJ2A 3A4TA 3AG6A 3LKVA 4CLDA 3NPMA 2B7BA 1XA3A 3GJ6A 3G8YA 5CLGA 4YRBA 2QNRA 3M6AA 4B40A 3C6ZA 4O2AB 4YCJA 4FLFA 4QUJA 4XRGA 3S99A 1JEQA 1FXSA 1G8YA 2QL9A 4X94A 4NS1A 1NR1A 5LMZA 2PL5A 5H3LA 3UMFA 5IVDA 3LSTA 4I3GA 2V7UA 3K16A 1Y8CA 3M4YA 4BASA 2VA8A 1KWGA 4ZT5A 4CODB 5I7UA 1Z4JA 2GO1A 1SD2A 2VRNA 4PO1A 4F04A 5G3YA 2X23A 5JNUA 2X6QA 3AUUA 1QU3A 5AVTA 3EIEA 5KYUA 1K68A 3HG7A 3HYTA 2HXSA 3QVLA 4R83A 3O1LA 1Q1BA 2VTBA 1J56A 4JJIA 2A5DA 4LZLA 1XUOA 1E79A 2ZYWX 1GL9B 3LUGA 2Q3DA 3NTUA 5EZSA 3OQ1A 2JZCA 1KEVA 1UT8A 3QKRA 3D81A 3FA2A 4EYQA 1P4AA 2FCAA 2SBTA 3DTNA 1E4YA 3IOCA 4YRQA 3B12A 3ENWA 3HRHA 1WBBA 3IC5A 1R9GA 4IRMA 2IK8A 3T3DA 1L5MA 3QFCA 5EIXA 3A6PC 3R9WA 5DSTA 1W2HA 3FPHA 4DRZA 3IPRA 3DZ8A 1V9SA 4OM7A 3PNYA 2R2AA 3B6IA 3IB6A 4CM6A 4PBSA 3S2SA 5GJVC 4BGUA 2HSWA 1J23A 1ACLA 4MUJA 3UXYA 3OX2A 1NJ8A 2DPHA 1ZNQO 4JSTA 5CD1A 4L4ZA 1VP3A 3N3AC 3HKEA 1PDWA 1BS9A 4K86A 2A9PA 1H4VB 5FAKA 3T7AA 4FWTA 5AXCA 3H0EA 3IOBA 3DO8A 4TS3A 1HDOA 3UCXA 1X86B 4F3CA 3JQQA 1JKIA 2B83A 3PPWA 3I1JA 4UEJA 5ERGB 3L2OB 2GEVA 3JU3A 4WXPA 3DO6A 2P9EA 1QP4A 1VRCA 2M1ZA 1JKMA 4X1KA 3RI3A 1YOVB 4P0PB 3FI0A 1ZCAA 4BNGA 2OLKA 1ZA1A 4HUQA 1G8FA 1OGYA 4AN1A 6YASA 4PVDA 2ZU0C 4H6VA 4PO3X 4WDRA 2IRWA 3BWYA 3K9CA 3RV4A 2ORYA 3LKBA 3GJXC 1KDZA 1BXZA 2H11A 2HV8A 2WFZA 1REQA 5FUYA 3QE2A 3VFDA 1WDLA 3OQVA 1JHYA 1D4ZA 1I14A 1IIBA 1XMIA 1UBRS 3EOBI 3GRZA 2XA9A 4UATA 5GZ6A 4B4VA 4M9RA 4QJ3A 3H6KA 4TVOA 3S2UA 3EW9A 1KFJB 1H94A 3FDXA 4DVGA 2V97A 1J0CA 1Y8RA 5C7IO 4TWBA 4YBZA 2B7LA 2CN1A 4ZO4A 3GOHA 3H9CA 4J4TA 1ZIOA 2IU6A 2G8LA 2UZ1B 2XQKA 1Y3DE 4XKJA 3GZNB 4CM9A 5CA1B 1F06A 4D45A 2FPMA 1D4AA 1SGWA 3RYFA 2GN2A 3U13A 5IAGA 2Q7XA 5L4LA 1EYZA 1V45E 5JISA 3LUDA 3C3EA 4UVIA 1YQEA 1ZO8A 1QAQA 1JT2A 3WK6A 5C81A 3EUWA 1JEDA 4MEAA 1YJCA 1G16A 4KGXA 4MS4A 3CNOA 3NOVA 4EX6A 2VDRB 3MD9A 1JJAA 4TQ9A 4QPPA 3GWZA 4TRMA 2EX0A 1ATIA 2P65A 4H3VA 2IZ6A 2OQIA 3WICA 4XGKA 2C2KA 4ZQHA 2YMPA 1XWFA 3I3SR 2QUBA 2IIPA 3QU7A 3LIIA 2WP8J 1AKUA 3UQYS 2C61A 1PVDA 4ZVUA 4DAEA 4LRYA 5JH7A 1R37A 2PUTA 3LYLA 1JR3D 2BFPA 2OV4A 2ZIGA 3P0IA 3QF4B 3VR0A 2ZYSA 3O2NA 1V11B 1MX3A 4J8PA 3NORA 4Z99A 2PKWA 721PA 1XEXB 4K1XA 2JJ8A 4XM0A 2EKQA 1HEYA 3K96A 4EFMA 5E7QA 1ZM2A 5FOQA 5DWVA 4L85A 1DOZA 2ECKA 1Y81A 2VP3A 2J85A 3Q88A 4TM8A 3CWQA 5T3UA 1HDIA 2NUAB 2PGXA 2JGJA 3TSAA 4B43A 2BSQA 4M8IA 1FS6A 1OKKA 3KVRA 3NTVA 4IGKA 2MSNA 4KPYA 3FPGA 1GCOA 4K8RB 4MI3A 3WFIA 3BMNB 1WW8A 4F45A 4AC9A 4EFLA 1Q92A 5EHZA 2W22A 1A9RA 4LA4A 3HJFA 3F49S 1VSBA 2AFIE 3ENVA 3RAPR 4UBKA 5HJ5A 3M34A 2RHTA 2PRJA 3WADA 5C5IA 2C9ZA 4A16A 4I8XA 3OHSX 3VHLB 2M6KA 2WICA 1HMPA 2VAMA 2WAAA 4UULA 3D8SA 5KNCA 1VG0B 2G3YA 2W6NA 2ZKIA 1CLUA 2NX2A 1YZKA 2QV0A 3GMDA 4IQGA 5FQOA 5AK6A 3UJAA 1E5QA 2DWCA 2GD2A 3C3MA 4ALJA 2V6IA 3LC2O 3QYJA 2Y71A 2H18A 3TLGB 2JFBA 1JHXA 1KEWA 1QORA 2R1TB 2BFDA 3ZDXB 1W44A 5L3SB 2KW5A 1IG3A 1AGXA 1Y4ZA 1R7RA 2AUNA 1DJPA 2YJGA 1XRNA 4G8DA 5F9FA 2MHCA 4TPKA 1S8AA 2RGRA 4YGXB 5LQUA 4PINA 5FXMA 4LY9A 1GD1O 1L7AA 1LLUA 4MWZA 3X1WA 2J3QA 1KS2A 2ZUBA 3DA8A 4BFYA 2X0IA 4RZ3A 1RAEA 1JR2A 2DSTA 3IE1A 1K9VF 4PQEA 2BL4A 1SHKA 4Y6OA 2I2BA 5CB4B 2E7ZA 1USGA 3CX6A 1NX6A 2HJHA 3OQMA 3RFXA 3RC9A 3MJHA 4CIVA 1JIQA 3D1VA 3L1KA 3RS4A 3ECAA 3AW9A 2W70A 4D0RA 2BGKA 2RGCA 5TGTA 5IDQA 4ND5A 5CGZA 2B4TO 1X3LA 3V8VA 1E59A 1OBCA 2WSLA 1G18A 4KXVA 2OXIA 2PFKA 2Y05A 3H0KA 2X9VA 1FX0B 4OGGA 1NI5A 3FMPB 3W8FA 5BV8A 2H5JA 1A7AA 3FHTA 3T12A 3QTLA 3SQDA 5DHPA 3UA3A 2NO7A 4RDIA 5EGNA 4D99A 1NMXA 4ZICA 1TEHA 5TJ9A 1ODSA 3GGCA 3PEFA 5EPUA 4BZPA 4YPOA 4AJ9A 3U5ZB 1CQZA 4FHZA 5EMMA 2W8BA 5EN4A 1UBCA 2J32A 3B9RA 1X7XA 4DSUA 1NUAA 4F96A 4P7BA 4RGVA 4RD3A 1DSSG 2QZJA 3G82C 3OLQA 2YYZA 1YOVA 4IIJB 3RKRA 4Q4CA 5BYBA 4JP1A 3QI2A 1WU8A 3WGGA 5I7OA 1CV2A 2D2FA 1V6AA 4NNPA 2ZTSA 2FP4A 5H68A 2DKOA 3HBFA 2JFYA 1OYWA 2HC9A 3IP6A 3QKSB 4FBLA 4XOIA 4ZAZA 1AHHA 2J31A 1OXUA 5M7EA 3CUKA 5CURA 3MWEB 1ZUNB 1T4CA 3HQ4O 1VE5A 5K0TA 1T2UA 1W52X 4YX9A 3ACDA 4B3BA 1Y34E 4I4IA 4GX5A 1NXQA 4RYLA 3AUJB 4JWKA 5JROA 1C7ZA 2PKXA 1T9DA 4ISBA 1WMFA 4B9AA 4QASA 3X2FA 1PEKE 1HNNA 2MINA 3UNXA 5A3RA 3COSA 4KXFB 1YB6A 3O84A 4J0IA 4JEMA 3D0QA 4TVBA 2PA3A 3KO8A 4KO2S 3F9CA 4ZOLA 3SXUB 4QLOA 4ZYUA 4EL5A 3KJFA 4RIEA 5AJYA 3L4JA 1LVHA 2ZBUA 1CUZA 3IHKA 4WK2B 2N9UA 4Z9YA 3ZWOA 3ZX4A 3JALB 2C58A 3K4PA 2WJWA 1MFPA 2VJPA 4ENSA 1IVNA 5FPKA 4IGFA 5FLXA 2DG2A 3ZEAA 3I64A 1J4AA 1TRKA 1JHZA 1KH2A 1Z28A 3NV9A 4FFWA 5GPBA 5KHLB 2Y9MB 1V11A 1E5DA 3LGAA 3IJPA 3VZBA 3SHWA 5IM4A 2GA8A 4UU8A 2FZEA 4DA9A 1QZ3A 3G88A 2VJBA 1JI0A 3CX4A 2QI9F 3R3HA 2QX9A 3U81A 1EHCA 1IBKB 4Z53A 3T5MA 4PYNA 1GKUB 5CVTA 4LMAA 3I83A 5A7GA 5CUQA 1N4DA 4G65A 1PEAA 1ESNA 1RXVA 4ED9A 2VH1A 2VZLA 1PWZA 4CHGA 2JLBA 4X93A 4BWVA 3D6NB 4C07A 1ZNYA 1UJ6A 1CTQA 4UHFA 4BFXA 4ZV7A 5KTSA 1WCIB 1WBDA 2PL9A 3ITEA 4ADSG 1PUIA 1W49A 2QLFA 3QVUA 1W48A 2BLNA 3RS9A 1Y3CE 2HQSA 2XB9A 1P0CA 5CFPA 3JQ9C 1NLZA 3LQRA 3WHLA 1SCUB 2R1VA 4I6EA 1QK4A 3QELA 4RO0A 2Z9DA 1MAUA 3ZNOA 2DQ4A 5LXTB 1A27A 4UM7A 1CVRA 2BPOA 4IDOA 3GUCA 2FX3A 1OHHD 2W4QA 4TS9A 4D5EA 3NTLA 4MW7A 5MHTA 4PHTA 1PDOA 4EAAA 1U8EA 1GFWA 2BE9A 1P1BA 1K5PA 1BE0A 3R6TA 3F67A 3I2YX 4GLBA 4LEIA 4ZOLF 5SYNA 3RIYA 3V2HA 4AS1A 4GEKA 3ET4A 3FKSA 3INTA 4BN5A 2IXAA 1JQLB 3JQPA 3ZKWA 4CDMA 3NEAA 5H9WA 2ZXFA 2QUIA 2YY7A 4W63A 3RWBA 1NA5A 2EX4A 4OQLA 3RSGA 4HPWA 4OSOA 1JFSA 2GYWA 3L18A 3OP1A 4BTLA 1CEYA 4J7AA 2JFGA 4AXBA 5EE1A 3AFNA 1Z6QA 4LOHA 3C1UA 1G60A 3WL4A 2GF2A 1GU1A 2IU4A 4R1PA 1IWBB 4M8KA 1Y5IA 4EF5A 1NQXA 1DWQA 2OWEA 4HAWA 3NCTA 2GWRA 2BFCA 4UNPA 5A6SA 4OP1A 1QH0A 3BHMA 1OIWA 3ANYB 1POWA 1WQ1R 4PG5A 1RJWA 2EARA 3PQ4A 1P5FA 1GPMA 3TUIC 3EYAA 2ZP1A 2IA5A 2Y0PA 3AB8A 3DMTC 1NJSA 2CNLA 4HF7A 3VR3A 1A1VA 5I4CA 3PT5A 1AS3A 1I7SB 1QTQA 1LXCA 4TX1A 5EUQB 2X0JA 3SQLA 3C4QA 2AF4C 1OT5A 3E9MA 1GQQA 2WWGA 1SBNE 4Z4GA 4NG5A 2PZEA 3OZEA 4ZI7B 1C3JA 4LXUA 4O2BB 1YRHA 1FLAA 2V96A 1ORIA 1Z29A 2NV2B 5JSQA 1P2DA 4DL9A 1G4UR 2C7BA 1DB3A 1EGMB 3GZ4A 4CDRA 1E5VA 3A4NA 4KWIA 1G8SA 4CR7A 2VNKA 2HIGA 1Z8FA 5KDLA 1HF3A 3T8YA 5KMGA 1J90A 1WL8A 5G4LA 2OHXA 4GR4A 2R86A 2C04A 1G5IA 4OHBA 2V59A 4CI9A 4K3VA 4DR5B 3LPLA 2B0CA 5FUMA 2EGGA 3P19A 3M2TA 3I45A 3IULA 2NZ8A 1ZL2A 1PK9A 4GBED 1CR6A 4X71A 4W9RA 2IOFA 3QMMA 4OHYA 3LOUA 3NJRA 4WZAA 3FDZA 4EB3A 3SC2A 1EK0A 2XMCA 3EBPA 4B6SA 1FS5A 1Z7WA 1ISGA 2F48A 2MYNA 2O52A 2DRIA 4D9BA 1QGDA 4ER7A 2Y4NA 2PK3A 3PX3A 1AKNA 3R40A 2L42A 3M6FA 1HT1E 5D1NA 4UTRA 5L40A 1XWIA 4WBSA 4X3PA 4DHEA 2HJWA 3EIUA 3IIMA 3VDRA 4NV0A 2ZSHA 1R0LA 3EF1A 1X1CA 1DEAA 3C70A 3K3PA 3NWBA 4PO9A 2P2LA 3VDNB 3A4MA 2XE7A 2FX5A 3MD0A 4RWZA 5J40A 1U8FO 3RK4A 3RFTA 1W46A 1GNSA 3HMKA 3SS7X 3BC1A 2O3UA 4PLGA 3T4XA 1N1GA 1ZM7A 2H1WA 1SOWA 1PW5A 1K7CA 3WBFA 1L4LA 1TF7A 2VNHA 4JYAB 3NW9A 3NV7A 3TPCA 1QGUB 5K9ZA 1L7EA 5A02A 2NUBA 4YAFA 3ND7A 2F4VB 4JL6A 4IVPA 5AK3A 3IP3A 4UW9A 4UEOA 4PAMA 2XUKA 4EHDA 4MPDA 2VA9A 3FFWA 1U5AA 4RLSA 1U5BA 1YRAA 2FA9A 1IHUA 3HVJA 1O97C 1E99A 2WSSD 3R8CA 4M8SA 2JAHA 4MB6A 3VTZA 4CTKA 4BJ6A 1HQCA 2EQAA 2FFHA 4ZYVA 3EGIA 4K81B 4KQGA 5ALSA 4PLWA 1G8HA 2A7QA 4MQFA 4BN0A 2ZI4A 2RH9B 4KTTE 4B2LA 2OE2A 2ZUVA 3TQCA 4G97A 5SY9A 5J4VA 3AIIA 3SPXA 2VDOB 5CFOA 2O20A 4AZ3A 3B48A 5BSRA 2H2HA 1YI1A 3JTEA 1F9AA 2WIFA 3F90A 4Z9AA 4ZPJA 3O38A 2V0CA 3NUQA 4EOGA 2F1JA 1SH7A 3NIGB 3AT1A 3NVMB 4HNQA 3GRRA 4JFAA 1MVLA 4M9UA 5AVVA 2QM0A 4FUTA 4MMZB 3FCUB 3KT0A 5GJWC 2X8WA 3K05A 1UBEA 1Y80A 3B1YA 1DQZA 1PZNA 2BOVA 3HVKA 4G89A 4IW3B 2OM2A 3AR6A 1ABEA 3FAKA 4Y2PA 1W9HA 4W9MC 3I1YA 2G7MC 2CEAA 2D2XA 3HMQA 1EH5A 4LV6A 4BATA 1N8SA 4IHJB 1BVHA 1GCGA 3AVOA 4ZA2A 1MORA 4EG6A 1Q50A 1IK4A 2P4QA 5JAOA 2PCJA 4OYRA 2BGMA 1K0UA 4GX1A 3SIXA 4L8GA 1ISHA 1JV2B 2J0QA 4XARA 1U0BB 4GBMA 4ZEXA 1Q12A 3K32A 4AY3A 3NX4A 1RXUA 4RY9A 1G3MA 1KQPA 2NU9A 3TJMA 4AJNA 3TG8A 1YHZA 3BMQA 1R6XA 1UQUA 1E8MA 1Y7HA 3PCRB 4Q0MA 4B1FA 2CK3D 4GP6A 3WNCA 2QVYX 1NW7A 2WMOB 4LRUA 4QU9A 4BNFA 3CH5A 3UMMA 4F4CA 2VNAA 4C6SA 1I4TD 2O54A 5DSXA 3ZWQA 2WD7A 4TV8A 3LV8A 2K5UA 2QN3A 3LY7A 5H83A 3QPWA 4PQYA 1TQDA 3OTQA 4G9BA 3PI7A 4Y30A 2DT5A 4IS2A 4ZU3A 1HZZA 5P21A 3RS7A 1YQWA 4RK4A 4INOA 1J0XO 2FEMA 4KLCA 1BX3A 4UNIA 5F7JA 3GBVA 3HKBB 1TKAA 3OZRA 3ESAA 4MJ3A 4B35A 4BZXA 2CXHA 2N75A 2KWIA 5GP1A 4OGKA 1ZM4A 1E79D 4RF2A 3WMRA 3DYVA 5JNSA 4PGHA 5KTPA 5HQ3A 3GQBA 5AI6A 3DPUA 5FPTA 4O2BA 3E2MA 3BGSA 1LGYA 3KQYA 3OWOA 4JR0A 4MV0A 1JVSA 4WIAA 1WZNA 2E37A 5H3CA 2LDBA 2ZULA 3AQIA 3I01A 1GYRA 5BSFA 4CKBA 2CVPA 4OHRA 4K6KA 3LS2A 2B82A 1SHUX 1UWLA 2EFGA 2B3TA 4AJHA 2ETXA 2P0AA 5I3CA 1FNDA 2CKMA 1PL6A 2R7MA 5FOSA 2HNAA 2R6GA 2I8LA 1I33A 3E2PA 4G9GA 3QUBA 2JAUA 4V02A 1GO2A 1U7ZA 1VE9A 3PC7A 4G1CA 1X3SA 4PC3A 4CWAA 2XZLA 1TADA 5CCEA 4D81A 3JQAA 5DEOA 5JQWA 1H8EA 3IBCA 3MMNA 2IF0A 4EY6A 1A71A 2XOKD 3LY9A 3B1ZA 2UZIR 2NU7B 2WYOA 1NXSA 1HYBA 3CW8X 4GZ5A 3CEMA 3PUZA 1TUEA 3RSHA 1K7XB 5SICE 4OIMA 2HQOA 4E32A 2AZDA 3B78A 3IOYA 3ZU2A 3K5PA 4HNTA 1SVMA 1B93A 4M49A 4P5DA 1L5OA 1TUIA 3FB4A 5ENDA 1FXWA 2H63A 3AFHA 3IAS1 4AWXA 2F3SA 4QBFA 1BC5A 3GLSA 3MWDB 5BNZA 1N34B 3STTA 3GJZA 4NYJR 1R6UA 2JCYA 3JQAB 4C87A 5LOVF 1YR2A 1ADFA 2QD2A 3QX8A 1NE2A 4CNBA 5K6AC 4Q3LA 3D8NA 2CW5A 3Q0TA 4FYYA 4AJLA 2RK4A 1T35A 3I5YA 3MQFA 4NHEA 3T06B 4FDVA 3LH5A 1PJRA 1Z4NA 2VUTA 4J1QA 2FUKA 4RCVA 1TYAE 4C6RA 1T5SA 1XLWA 2FV8A 3IBFA 1CB7A 1MOZA 3FOCA 2GZHA 4MCIA 4JELA 3ZDDA 1WAMA 4JD5A 3JARB 4OCZA 3KQQA 4O4HF 2WF9A 1P4HA 1ZVJA 2YW2A 4G81A 5JAQA 3SIWA 3G6WA 1ULSA 2XVMA 3NCHA 4BWFB 3JD4A 1M76A 5KCZA 4DBLC 4BX2A 3IUPA 1S4MA 4IDPA 3DDNA 2HGSA 2QRPA 4Z0PA 5JMPA 1CERA 3TX2A 1H5NA 2XUPA 1VSTA 5CDUA 4IIEA 1QGYA 2JAOA 2H7CA 5ALFA 4EYSA 3EISA 2C1EA 3H1GA 2H9YA 3ELYA 4N8DA 3U62A 2QR2A 1KYYA 1IH8A 4ZU6X 1CDEA 5CDHA 4Q1FA 4LYFA 4RQUA 3DTVA 4WY2A 3RVNA 1JR3E 5KYYA 3TI9A 3P1JA 1XRQA 3UJCA 2Q3EA 3CX3A 2VHXA 1YMUA 3E0QA 4DABA 4L73A 4CBVA 2P6MA 2P6NA 3KJZA 1YRQA 4HNVA 2VDKB 3TK1A 4G8JA 4W99A 3ANLA 3G0BA 5HK8A 1RQPA 2IPLA 4NBVA 2X0EA 1ZDMA 2X5XA 1ZWLA 1EDZA 1SXGA 1CPYA 2Q4OA 2XQGA 3AEXA 2X40A 3ROPA 2AT1A 2QX6A 3CZPA 5FUXA 4IIJF 2VJOA 2JI4A 4XIJA 3RSLA 4KDFA 2AOUA 1DUIA 3MYYA 4DUGD 3LPDA 4MTCA 4Q3NA 4H7JA 3OOYA 1OMOA 3PSAA 4YP0A 1QQAA 1YCFA 3SLRA 1ESZA 3WYAA 3O9MA 3NT2A 1NVBA 2RCNA 2PKCA 2WT8A 1T1IA 4RACA 1N4AA 1D2CA 1VOTA 1I24A 2DQZA 2W2VA 1S3FA 3IUQA 4ND1A 1Y4AE 4P98A 2NADA 5EE3A 1C9DB 3ZU5A 3OBBA 1Z9BA 3JAKB 4LK3A 2P2YA 3DPSA 1JLSA 1UODA 4YCNA 5KVQA 3WA7A 2XMRA 2A8YA 4BTVA 4PQFA 4I4TA 1Z5PA 4LZAA 1TJYA 5FLEX 3HUUA 4FQ8A 4D02A 3BH0A 2IH5A 5EJEA 1B6RA 5LBTA 4D8UA 1H1LA 2JIPA 3D4BA 1VLJA 2GFHA 2B4AA 2EFCB 3LL7A 4X7PA 1JHAA 1I32A 4EG0A 3MUOA 1QHFA 2VCYA 3G8BA 2GFIA 2O9JA 4RJKA 4XLZA 3NBFA 5DLEA 1U7WA 4A8TA 5CDSA 5JFOA 4N5LA 1KRXA 3CWCA 2XNCA 4X90A 3P9PA 1DFIA 4MGHA 3V8MA 3MINA 1AGNA 3O83A 2IZOA 4BEBA 3GLGE 1TEVA 3A2KA 1FS4A 4B85A 1ISJA 1QPGA 2WIBA 3KC2A 1HK7A 1H4TA 3P97A 4MA0A 5HILA 4OQ4A 4WNAA 3K6SA 3JQGA 3BEDA 2XSZD 2G9RA 4B3GA 1AUOA 2HM7A 5T64A 2GTPA 3AMVA 2UXBB 2LCQA 3UICA 3WGNA 4UAUA 3HJGA 1ULAA 1TJ3A 3HY6A 3AERA 4OP2A 3P0JA 5IT4A 2Q27A 4U2KA 1QM5A 1UZAA 1W8IA 4II7A 4DCVA 3BMOA 3L0DA 1Y9EA 3TEJA 2CUTA 4BNDB 4J16A 1GKLA 1Z0AA 2NO9A 3PNSA 4QOEA 3D54D 3DC2A 4YCSA 5C0OE 4JB0A 3VR6D 3IMKA 5IPFA 1N3LA 3KDSE 3PKIA 1KQ3A 2GHIA 4I2VA 1SHLA 2BZGA 1SCQA 5KYTA 2UDPA 1ADYA 1QH8B 3D6JA 2O8BB 3UYLA 2BI7A 3CSDA 1FW6A 3GB9A 3KKZA 4UOZA 5G53C 2LDXA 4NCKA 2G5TA 4HTFA 4LI0A 4QTTB 3T7KA 5FD8A 2EP7A 4ZDWA 4M9ZA 4BZWA 4MPPA 4QDZA 1US8A 5JNRA 1Z8DA 3LC1O 2IV2X 2QENA 2ZSAA 1WSBA 4IMPA 1A97A 4S0XA 1RYZA 2BF7A 2XRYA 2VDJA 5HS4A 3DMHA 1P6XA 1XZGA 2A7XA 1DBSA 1ZK3A 3JSXA 4ZREA 3TM5A 1Q16A 2ZJ2A 5GONB 2K6GA 2FPKA 2ZIAA 2B20A 3QU5A 4XGIA 2JASA 1EQUA 4EAQA 4M83A 4W9NC 1YJBA 1ZL0A 4F6RB 1TTTA 2Z1NA 1QVVA 2PBRA 1PP4A 4UD6A 2VHYA 3H5RA 3T9FA 1KZ7B 3DEHA 4JKIA 1PSWA 1Q57A 1Y1QA 3NAQA 1CHNA 1F12A 4LE2A 1ZK2A 3NP9A 5AW8A 3A0RB 1QYCA 3NUGA 3UT0A 1TE2A 2BYTA 4NCXA 5BYAA 2PS9A 3MPUA 1NRXA 3GPCA 4M9QA 5EPOA 1ZAYA 4QTYA 5IJ0B 3GFPA 2GBPA 3ZPXA 4I7EA 3I6QA 3FBTA 1N9ZA 1INLA 3QG5A 1RIIA 1Z74A 2QTAA 1X42A 2ACKA 3UV6A 3VR6H 4DW8A 3AONB 3FLBA 1UFRA 3KCQA 4NTZA 4EA8A 1EM8B 3R7FA 2Q0SA 5JU6A 4P3PA 1ZA2A 1COZA 2DMRA 3C8DA 3SOZA 4EI8A 3GLFE 2X2FA 3MLEA 3F6SA 1QGAA 3ICWA 4MRAA 1F5SA 4EG5A 2WHYA 3B7WA 3BL6A 4L7VA 3D4LA 1SCDA 3L0SA 4BJHB 1FCJA 1YCDA 4HNAA 3GJSA 1NNUA 4BO8A 2GD0A 3MWLA 3IKTA 1G4AE 1ETUA 1ZRHA 221PA 2OOKA 3MYRA 5AVOA 3S2ZA 1M5RA 3I0ZA 5CYPA 3GLVA 1ZJZA 3OCZA 4IUDS 1A7UA 4JJKA 4X24A 1QMPA 3TTTA 3TGLA 5BV2P 3A1FA 1OWMA 1L6RA 1GQSA 1JX6A 1YAJA 3A37A 2QLTA 3L0IB 5ENVA 2ZROA 3EVEA 4RZHA 4U8HA 1JEYB 1OXKB 4Q16A 2AMVA 2PLFA 3FCYA 5E1MA 3MCAA 1F1JA 1QR6A 3CG4A 3WMXA 1P4JA 2X8BA 4OYLA 1L8OA 2GPJA 3RVLA 3NALA 4UM5A 3NP7A 1UMKA 3QWFA 4FFSA 1UZMA 3IB3A 3HDJA 2WQ6A 4I8IA 1ZSNA 3PHJA 3QEOA 4JBWA 4UEKA 3ES9A 4ARAA 3AHDA 3LFUA 1N5RA 1N36B 3UBTA 2QP3A 1PJ4A 2PGAA 2R6HA 3E4DA 4J2HA 5M3BA 3ZZTA 2SKDA 1JMVA 2ANBA 3M3HA 4RTRA 3JAKA 1WXWA 4EYOA 1USIA 2J9FB 1JFFA 1ZW6A 4U2CA 3R0ZA 4EVIA 4HSGA 1VBMA 1XDGA 2YIVX 3FYDA 4EZEA 3K9FC 1NZFA 5E9AA 1R3DA 3H19A 2JEYA 1ECJA 3CKKA 2Q8NA 3Q8XB 2COUA 5A4DA 4A82A 4LY3A 1Q7EA 1TTQB 3GN1A 3S6JA 5HNKA 2BKXA 1SU6A 4XGRA 1BGVA 3N0WA 3ND5A 3UT5A 4NU8X 1R4ZA 4NDAA 1L9XA 1WB6A 2CBXA 3FUCA 1ODFA 1VCMA 1PYDA 2G71A 1JDTA 3BRQA 3GXBA 1B00A 3OEHD 3QPCA 4FX2A 2EV9A 4ZVSA 5ICFA 3O93A 4RVSA 4DEYA 4MDYA 2PANA 3S68A 4KIJA 2ZVQX 4JA2A 3EPKA 1O3YA 1UANA 2HX1A 3N6RA 3B3FA 2IOHA 3CLTC 4KE8A 3EVCA 3OLYA 5AJXA 4II2A 4B80A 1VRVA 1SXIA 4LJSA 2CVFA 1K7SN 3DVAA 4DMHA 4D82A 1YS2X 3CH4B 1XBTA 3KLOA 4Q47A 3MJVA 1KDPA 1NVDA 1M5TA 1WZCA 4ZJUA 1IXKA 3VYVA 2WJZB 3G2IA 4GLFA 4P81A 1KI6A 2DWQA 3JATA 2JL1A 1KZHA 3L4BA 3TQSA 4H2DA 3P4UA 3HGTA 2NUTA 4WJLA 1JJIA 2GTIA 2PZMA 2IS2A 2WM9B 2AQIA 4TLEA 3KD3A 5DXFA 2D0PB 4EM6A 1DC8A 2F8SA 2BRUC 3U7QA 3KXPA 3PUWA 3DDSA 2FMFA 1DTWA 1V71A 5FNVF 4UAGA 2H16A 1TZJA 4CT5A 1JECA 1XPJA 3ZW9A 2YUTA 4OJTA 2QQGA 4AROA 2OR3A 2B4QA 2QW8A 2VSYA 3B1KA 4N3AA 5H9VA 4EF4A 3PENA 2VUHB 4ZCPA 5JW6A 2QTBA 1KU6A 1F8YA 1S0UA 1DG3A 3AEUB 5LZ8A 3UGJA 1OILA 1ZR4A 1N5IA 5JSHA 3PBKA 3BORA 4NZNA 1MZPA 5EJ2A 2SCUA 3QU4A 4MS3A 5KTKA 2PGJA 4UPEA 3NUZA 2W2MA 1JQEA 4H08A 2NAFA 3DCNA 3HBNA 3RYCA 3O4VA 3WY9A 2X5NA 2Y4OA 2FG6C 3N2GA 3WZMA 4L8LA 1QYRA 1YRBA 1BXRB 3DXZA 3LZDA 5L3VA 3K70C 2Q3HA 5HK9A 3U19A 4WN3A 4N01A 3RIHA 1ZJ5A 1S2LA