1OC2A

The structure of nadh in the dtdp-d-glucose dehydratase (rmlb) enzyme
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
346
structure length
346
Chain Sequence
QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DTDP-GLUCOSE 4,6-DEHYDRATASE
publication title The Structure of Nadh in the Enzyme Dtdp-D-Glucose Dehydratase (Rmlb)
pubmed doi rcsb
source organism Streptococcus suis
total genus 144
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oc2A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1oc2A02
3A1NA 3PYLA 3AUAA 4E12A 4OKNA 5EIOA 1LI4A 4DPLA 5J23A 2VUTA 1UUFA 3ROKA 4J0EA 3SC4A 4RLHA 1A9ZA 3DDNA 4JJGA 3ZU2A 1DB3A 4D42A 1GQYA 4E4YA 2AW5A 4CM9D 4D46A 2PKQO 2UUPA 3QW2A 3GZNB 4EGFA 4GKBA 2WYUA 1MLDA 2VT2A 1PIWA 3GDFA 2VZ8A 3RUAA 3MTJA 4NR0A 3WWYA 1Q7CA 1HF3A 4DPKA 1HETA 2UV8A 1ZCJA 4FBGA 5DZSA 2ET6A 1VM6A 4D3DA 4EDFA 1Q0QA 4HNHA 4ZRMA 1B2LA 3U49A 2J3HA 3DOCA 3RC9A 3GRPA 2CSUA 1Z73A 4D3FA 1D3AA 4ND4A 4J6FA 4BKQA 3Q2IA 1KEUA 2WE7A 3E18A 3VDRA 1RPNA 3WLFA 1B3BA 2BRUA 4J3FA 1A71A 4HY3A 4NG5A 1I33A 4II3A 1VL8A 2AEMA 1N1EA 3E9MA 3ZV6A 4YAJA 1I32A 3ZHXA 3IKVA 3VHRA 5IG2A 4RCVA 4D0RA 3L77A 1LC3A 3JQBA 3AU8A 1I3LA 2VTEA 4L8VA 4MVJA 1G1AA 3CXRA 3TNLA 3U4HA 1Y7TA 3DB2A 2I66A 2I99A 2VYND 3M2PA 1YWGO 3HDJA 3Q6IA 4PG8A 1P74A 3L6OO 3SLGA 5TJHA 5JSFA 4WLFA 2HLPA 2AEJA 1PGOA 4RZHA 1YQGA 3QRWA 4RVHA 1NQTA 4WNIA 4XQEA 4ZRNA 4QFCA 4YA6A 4IXTA 3L4BC 1UAGA 5L7YA 4OM8A 4YJHB 2EF1A 4PZCA 4XDYA 3VVBA 3MEQA 4GL4A 2RH4A 4PLGA 3AY6A 3TOZA 3ZWCA 5GMOA 4R69A 5U1PA 2X0RA 4YT5A 4FFNA 3L0DA 4YCAA 5JDCA 3ZWXA 3F1KA 1QMGA 2JD1A 2DQ4A 3COSA 3QWBA 2E82A 4IZIA 1NHWA 1VJ1A 1PJ4A 1BSVA 4QO8A 3I9MA 3KEOA 3PZBA 3Q9UA 3JTMA 1UDCA 3PDUA 3MJSA 5A03A 5MGBA 2FSSA 2Q2VA 2Q45A 1LDMA 1XELA 3B1JA 1DIGA 1ML3A 3MWEB 3PWSA 5GZ1A 4NK4A 4Z0HO 5ER9A 5BSHA 4JX8A 1CEQA 5ICSA 2G17A 2Y99A 4DMMA 3HUDA 1H6CA 2CF6A 3GEGA 4OL9A 1QYCA 5A02A 5FI5A 4BQPA 3GQVA 4J90A 1ONOA 1NAIA 3ZHYA 1WDKA 3LYLA 3GA0A 1PSDA 2CFCA 5C37A 2AG8A 1H0KA 4MINA 1HDRA 1MFPA 4MIOA 4XRRA 2ILTA 1NFFA 3OSUA 4AJ1A 1JN0A 1HLPA 1KVQA 1OMOA 3I23A 4I5DA 2C54A 3QV1A 4GGOA 2QRJA 3KHUA 1XLTA 1OBFO 3CE6A 5AYVA 3CZMA 3KLMX 1A7AA 1XR3A 3OH8A 1ZK4A 3HHPA 3MTGA 1N1GA 3W4JA 5I7EA 1KVUA 4UUOA 4AJJA 4N7RA 1KERA 4XX0A 4XGIA 1ONPA 4X54A 1BVUA 4MKZA 5L45A 2FWMX 3HB4X 1SEPA 1JKIA 4DC1A 5B4VA 2P5UA 4WUVA 2E4AA 4J49A 4BGEA 5C7OO 1M6HA 4BNYA 5IF3A 4WLOA 2BLLA 2Z1NA 4QXMA 1UP6A 4O59O 1DFGA 3GFGA 3FCOA 1DFHA 3ZWWA 2PKRA 1R4MB 1W4ZA 1NFQA 3JQAD 1RM0A 3H6KA 3BMOB 4L4XA 4CM1A 4OSPA 2GSDA 5I9LA 1BDBA 4M8SA 4CQMD 1GADO 1FDWA 1T2EA 1ULSA 3HZZA 1EUDA 2HK9A 3LT0A 4J1QA 5DT9A 4Z9YA 2A4KA 1VSUA 3K2EA 3EW7A 3QVWA 4WLNA 3KV3O 2IYOA 1HDYA 3F3SA 1EVJA 4YRBA 1DSSG 2OUIA 1U7HA 1BXGB 1P45A 2DTDA 4R1TA 3HFGA 3IDSA 4CV2A 4DWVA 1U3UA 3TOXA 3NJ8A 3SXPA 3C3XA 4II2A 4E21A 2Y1CA 4Q3EA 3I52A 1U4SA 3B70A 3C1AA 3PRJA 5CG1A 4R4JA 3BYZA 3D7LA 4JIGA 4A27A 3PK0A 4Q39A 2X9NA 1PL8A 2YHUA 2YV2A 2ZQZA 5U4QA 3ZWOA 3S2FA 3ZNNA 4HFMA 4MJLA 5I7FA 3CH6A 3ZN2A 1VL0A 4PLZA 4INAA 1PTJA 4KWIA 2EG9A 2Y05A 4LCJA 3OETA 1LBEA 1DHRA 1NVMB 3Q2KA 4YYZA 3LC7O 4BVAA 5B12A 2VNAA 1DRVA 2NQTA 3RBVA 3TN7A 1HE2A 1P1KA 4IJUA 2X23A 2E48A 3NDRA 2VWGA 1U8XX 3PDJA 2BHLA 4IQGA 1U5AA 2TMDA 1IB6A 1HYHA 3ABIA 4HADA 4BO9A 1NYTA 5L51A 2I65A 3AFNA 4DRYA 5HTOA 3VKUA 1EEHA 2O4UX 3L07A 5KVSA 3WGOA 3GN1A 2NU9A 3E6AA 4CLRA 4JNKA 4EJ6A 3F46A 2R6JA 1ULUA 2BGLA 1PR9A 5IDWA 1A4IA 2FPIA 1QORA 3KO8A 4RPHA 1EK5A 2UUOA 1E3LA 3H9UA 3PTZA 3QVOA 1EQ2A 4J1SA 3NKLA 4MP8A 5IZCC 2P4HX 2AEFA 3E5RA 3PQEA 1M2WA 3OQ6A 4LSWA 4A0SA 4KQWA 4NBTA 1X15A 4YRAA 1QR6A 1JAYA 1DRUA 1PS8A 5G4KA 3ZU3A 4RF3A 3AOGA 3U0BA 1PS0A 1MG5A 1V0JA 1ZEMA 2IRWA 3JD2A 4R3NA 5G2OA 1PGPA 1QYWA 1ZXBA 1ONNA 4QSMA 1HTBA 1UZMA 4C7JA 2O7SA 2C20A 1Z82A 3JQ7A 3MWDB 2P68A 1GAEO 1C1DB 3IP3A 1P1RA 1R4NB 3AW9A 2W98A 2C7GA 1DDOA 3PGJA 4CLHA 2GR9A 3PGXA 2X1HA 4PN3A 3DFUA 1LJ8A 5ER6A 3JQ8B 2OHXA 2QZ9A 5JCJA 5I7VA 4XGNA 5T8KA 1ZK1A 4RV9A 4XR4A 1Y1PA 1PQWA 4PZEA 4J43A 5CDGA 2ZB7A 3AM5A 4RF4A 4I9UA 1DIBA 4G81A 3QWIA 3U9LA 3WDSA 2GNAA 5BSEA 1SPXA 3WICA 3B20A 2ZTVA 4CR8A 2DFVA 2EGGA 3LDHA 5JY1A 4MVJM 4QQRA 4UVGA 1JVSA 3VPGA 5H83A 3WLEA 2VRCA 4BO2A 2OORA 3FPLA 4W82A 2NTJA 5HA5A 1J6UA 2I5PO 3GVHA 4NU5A 1G0OA 4CMIB 1AXEA 1Y81A 4M87A 2J3KA 3I9OA 4BNZA 3W4KA 5I8WA 1T24A 4YJDA 1NPTO 4MDHA 4O6VA 4WKGA 5CDUA 3A28A 5TC4A 4OSOA 4ITUA 5JO9A 1OAAA 4C4OA 1N92A 3FNHA 5CP8A 4E5NA 3QWHA 4D0SA 3PIDA 4J7UA 4BNNA 2HQ1A 2Y66A 3BMQB 3D5TA 1ENZA 1BXZA 4N18A 4IQ0A 2FN7A 5DN9A 1EVIA 3GAZA 3U3XA 4MOWA 4PVCA 1PU2A 3A4VA 4M86A 1NR7A 2VQ3A 1KOLA 1LLCA 3T4EA 5KVCA 4NBRA 4NJMA 1ISFA 3GGGA 4B3HA 2PK3A 2C59A 3GFBA 1WP4A 3A9WA 3DBHB 5G0TA 3AUSA 4HP8A 4XYGA 3WQSB 4GVXA 4RPGA 3LF2A 1DC4A 1U9JA 3AK4A 3T4XA 4ZQGA 2AA3A 4UUMA 3RUDA 4PLFA 1JWAB 1PR3A 1KYQA 3TZ6A 2BD0A 4TRNA 3E03A 3QWAA 2NV6A 2V6FA 3IL2A 4NBWA 2OBNA 3RFTA 4CMJA 1T2AA 1LDEA 4AJPA 4MVJF 1NQOA 1PJQA 3JQGA 2J8ZA 4K1LA 4H16A 4Z0TA 4AJNA 4MO2A 3WYCA 4CM8A 1DAOA 3QP9A 4Z9FA 4NH4A 1MXFA 3PQDA 1B14A 4OOEA 2VWQA 4HKTA 4UUPA 3O4RA 4TSKA 4WPGA 2X6TA 2W4QA 4P38A 3D0OA 3I9LA 4XR9A 1MXHA 1HDZA 4IS2A 1L7EA 4GSKA 4B4VA 3RQSA 1B15A 5IZCA 3D4PA 1GTMA 3EMKA 1NPYA 2Y0CA 2DTEA 2QRLA 4U0JA 4G65A 4MP6A 2D1YA 1I0ZA 2CVQA 4IDGA 1HL3A 4IQ8A 4YJGA 2YJZA 1LC0A 1FMCA 4B3JA 1CRWG 4R51A 3W6ZA 1Y9AA 4KTVE 3E8XA 5KCZA 1NX6A 3QVXA 3AM4A 1YB4A 4Y8VA 3UKOA 3CSDA 3JQ6A 4CLRB 5DOVA 1EFKA 5JDIC 4CM4A 4R01A 3ZU5A 2ZQYA 3ETDA 2J5KA 4IMPA 2B5WA 4FC7A 4XCVA 1E7MA 5EQDA 2H1SA 3O8QA 4H15A 3FSRA 3SX2A 3V1TC 5FFFA 1SAYA 3V8BA 2OOSA 4GLOA 1FDTA 3EDMA 4KWHA 2BF7A 1YOVA 2BELA 3G3EA 3K9QO 3KOUA 3ZI0A 1Y8RB 2EKQA 1GUZA 4ZQEA 1YQDA 4EUFA 5G4KB 4Q3AA 3E9NA 2QG4A 2NACA 4R1UA 4TQGA 1P77A 2ZIZA 5A3VA 3UGKA 2J5QA 2Y1GA 4PLPA 2Q99A 1EDZA 4KUGA 5BT9A 2QQ5A 4TKLA 2IEDA 3KYCA 5JO0A 1V6AA 3HADA 3PJDA 1CWUA 1EK6A 3OJEA 4F3YA 4CM7A 1LLDA 1EE2A 3VH2A 3WSVA 4CUZA 1ENOA 2D5AA 3WOHA 1ARZA 3GPDG 4G5HA 4RVDA 4CMBA 2O3TA 2R00C 3I6IA 3WIDA 3I4FA 5EERA 2QYSA 4E33A 4GI2A 5L7WA 3UOGA 2FR1A 5DNAA 1O94A 4RF2A 1N5DA 1U1IA 4N5MA 3CINA 5TS3A 4EEXA 3WGIA 1TB4A 3DR3A 5BQFA 2HUNA 1L7DA 1DIHA 2FY8A 1L1FA 1MX3A 2OP0A 3ZWYA 1B8VA 1AGNA 1LDBA 1LSSA 2BFMA 1HWYA 1VJTA 4JN6B 4WOJA 4CJXA 3DEYX 4E5MA 3GPIA 4LGVA 2DU8A 4ALNA 3EVTA 5A5FA 4J4HA 3IMFA 3LT2A 4DIBA 5GY7A 1GV0A 2G1UA 2HCTA 2WD7B 2H5LA 3JQ9A 2ZYGA 4O0LA 4WCFA 3WG9A 1E3WB 2PR2A 3KVOA 3L6DA 4H3VA 5JAIA 5ILOA 2DFDA 1S6YA 3PXXA 2PZJA 3S1LA 1A9YA 1QLJA 5F5LA 2EGHA 1I01A 1Z6ZA 4MVJP 4ONEA 1JLLA 4TRJA 2JAPA 4U6SA 2B37A 4NNJA 4DA9A 5FI3A 2O3QA 5CDTA 1PJ2A 1YXMA 2WYVA 5DP1A 3C24A 4QX6A 5H81A 2ZB4A 3VPSA 4A26A 1X0XA 2O2SA 3AJRA 3OHSX 3KM0A 5L95A 4R1SA 4FR5A 3H5AA 4WCDA 3ST7A 5CG2A 5IN4A 2Z95A 5KKCA 1UXKA 4DVJA 1P0CA 3SJUA 2Q1WA 4DXHA 2PTGA 3H9GA 1EUCA 1JA9A 4UVDA 3GT0A 4IJVA 4CQLA 4DGSA 3FRJA 2GERA 2X9GA 3VZPA 4FDAA 4DC0A 2O3UA 1SOVA 4YRDA 2OMEA 1LSOA 4LN1A 1E5QA 4BNMA 5JAMA 3F9IA 2J3JA 3UVEA 1GYRA 5FYDA 3ADOA 4W9NC 2Y0DA 4RVFA 1LX6A 2O3SA 4B8WA 3D3WA 4YJFB 4CL3A 2VHYA 1SBYA 3C8MA 3DMTA 2O3JA 3LC2O 1B3RA 3FNGA 5G0VA 2WM3A 4PG7A 3GGOA 1ENPA 2HK7A 2D4AA 3KRTA 3OMLA 7MDHA 2W2LA 5HS4A 3D3EA 3FTPA 3WGQA 3I1JA 4UVEA 3M1AA 4XQCA 4CM8B 2EIHA 5G0UA 2XXBA 3P5SA 1DC6A 3KB6A 1WWKA 1PS9A 1YJ8A 4J1NA 1B8PA 4N5NA 2YHIA 4PRKA 1OOEA 1LXCA 2CVZA 2Y1FA 5DP2A 4EYEA 2VNSA 3TZKA 2LDBA 1TT5B 2PGLA 1EE9A 2Q1TA 2X9VA 2DBQA 2O3RA 3LT4A 4CV0A 2W2KA 5IDXA 3PWZA 4HWKA 5DBGA 2AQIA 1LA2A 4R41A 5IDYA 1HT0A 4FB5A 1RYEA 5L4SA 2Y1EA 3W8FA 3AFMA 3IJPA 4TZTA 2IXAA 3PQFA 4GVLA 2C82A 2CDCA 2GZ2A 4OXKA 1ZK2A 1I36A 2Q49A 2YQ4A 3DBRA 4IDBA 5B37A 4L0QA 4GX2A 4PLVA 4YR9A 4TWRA 3OA0A 4ESOA 2NU6A 3O26A 3RVDA 3NUGA 1H5QA 4IM7A 4JJFA 3ROMA 3S2IA 3GG2A 2HO5A 1BMDA 2I3GA 4CM4B 1WZEA 3O9ZA 3O8QB 4WASA 1DLIA 1NVGA 2EKPA 1R0KA 1ISHA 3EZLA 3QSGA 1WLYA 2HRZA 1MA0A 3F6YA 4JQCA 3EAGA 1YOVB 1JW9B 2PGDA 4IMRA 3ZWAA 4EUEA 1SCUA 3VKVA 1NHGA 2CDAA 4BNLA 2PD6A 3W8EA 2EHDA 3DZBA 3BTVA 5TX7A 4BO5A 1A4UA 2DTXA 3B1FA 3ZWBA 3GEMA 3FBTA 3KYCB 1ZUD1 3O03A 4I1IA 4IIVA 2G82A 3IUPA 4BO6A 3WNQA 4OGWA 1UP7A 3I5MA 4PG6A 3TZCA 2IDZA 2JFFA 4F46A 4BV9A 1DLJA 5KKAA 5L7TA 4NHEA 5DCUA 2Y93A 1X13A 4ND2A 3OEYA 3DZJA 3TSCA 2CF5A 3RKUA 1R15A 2VHZA 1H6AA 4AJ4A 4A7PA 2V65A 3HDQA 1LQTA 1MV8A 2GUGA 1E1KA 2E37A 3FHLA 1O6ZA 5F1KA 4PLYA 3GMSA 5LC1A 4CMCA 1PWXA 3KETA 4GAEA 3RUCA 1ZSNA 2JHFA 3VZSA 2AG5A 3LC1O 4RDIA 4NQZA 4U5QA 4KDFA 5EESA 1K2WA 1LLQA 5JCJD 4M55A 3K73O 4XYEA 3R0IA 4WCFB 3WMXA 1UJMA 3O38A 5JYEA 2AQ8A 1Q7BA 5EPOA 3IJRA 2FZEA 3PHGA 3DOOA 1YH3A 2EV9A 2Y1DA 4O5OA 2WMDA 2NLOA 1AE1A 5BNTA 3MJVA 1YKFA 2PD4A 1YJQA 2ZTMA 3OIFA 1T4BA 4CLOA 1HYEA 1R66A 2JAHA 1ZEJA 1C3VA 3DMYA 3V2UA 1UZLA 4WECA 1T1SA 1I8TA 1XQ6A 3I3OA 4YVFA 3HQ4O 3LQFA 1TA4A 1EMDA 3FTNA 2A92A 3WXBA 3D1LA 4BS9A 1PZFA 5G0WA 2XOXA 4BKUA 1KVTA 1IULA 1KS9A 3ETGA 4BNFA 3ADPA 1NP3A 4HFRA 2AHRA 3BMCA 3DZGA 1SOWA 3BXXA 2DKNA 2QW8A 1ADBA 4GWGA 5JMPA 1QLHA 1FDVA 2P9EA 4CQLB 3GVPA 3AI1A 1UXIA 5EN4A 4YPOA 3WQRA 4BKRA 1P1FA 5IJZA 1H94A 1QYXA 4H7PA 4Z0PA 4CLXA 3FD8A 2FHSA 4RZIA 4ZVVA 3DAGA 1Y8QA 3RC1A 4DUPA 1K3TA 3PFWO 1IOLA 3RUEA 3BTUA 4RQTA 2P4QA 2YFQA 4MVJH 3RU9A 1I3MA 5KTKA 3L9XA 3BHJA 3ENNA 1E6UA 2V6BA 4ZGWA 1ISIA 5FWNA 1AHIA 2PNFA 4BL5A 4HX5A 4CV3A 1LDGA 3RBXA 3K8ZA 3HFSA 3FBGA 3VTFA 3E82A 4WLEA 1FXSA 1W8DA 1X0VA 2BI8A 4R9SA 2YHIB 3OM9A 3QLJA 3RI3A 1UH5A 4OXNA 2AE1A 3GG9A 1SZJG 3P2OA 3WGGA 3VH1A 4YQZA 3DZHA 2IE0A 1Q0HA 1TVEA 2W2KB 4D44A 4ND5A 3UH1A 1KETA 1U3TA 3C7CB 1B16A 1M75A 1WAMA 4QTZA 1U5CA 4WK6A 3PHHA 3D4NA 4FC6A 3BIOA 4RLSA 2B35A 2H9IA 5L9AA 3WIEA 5DBIA 5DCWA 1PQUA 2VOEA 3DBRB 5T67A 1DRWA 2JD2A 1LU9A 3NTRA 3LT1A 1O8CA 3E1KA 2IEBA 3WWZA 4BKOA 5K6AC 4AJEA 3F1LA 4OYRA 4QO7A 3WFJA 2GDZA 4OQYA 5CHEA 1LEHA 5JBIA 3V1UA 1G6KA 4XIYA 1PJCA 2P9CA 4DYVA 1LSJA 2QIOA 1ISMA 3U4CA 4IIUA 3X2FA 1F0YA 3WGZA 2EJVA 5CAEA 4L9RA 2GN9A 3GVXA 1U8FO 4L75A 2C7VA 3OIGA 4L73A 2NQ8A 3NDIA 5JC1A 1Y6JA 1UDBA 3H3FA 4ALIA 3L4BA 3EYWA 4G2NA 2X0IA 2PH3A 4AJIA 4BNJA 1SEVA 3AU9A 4JXKA 3I9NA 3CMCO 3EUWA 4TZKA 1HDXA 3SC6A 4TKMA 1IL0A 2RIRA 3JYNA 3MOGA 4BNHA 3WR5A 1GZ3A 3D64A 4NBVA 3RWBA 1LDYA 1O95A 2NWQA 4PVDA 4IJWA 3JQCA 5CDSA 2OP1A 1T25A 2H63A 3PLNA 2Y68A 2GN8A 4TVBA 1GZ6A 2YDXA 4GMGA 3KYBA 5TF4A 5JS6A 3WB9A 4CM9A 4JBHA 3EC7A 1MP0A 2PKQP 1N9GA 3I4CA 3GDOA 1A27A 2FZWA 4NIMA 1LNQA 3UF0A 3DXFA 3DHYA 4PLHA 4PRLA 1ZMOA 4IDDA 1F14A 4NMHA 5DOZA 1FDUA 3UFXA 4BO0A 2C29D 5A05A 1WVGA 5KVQA 3ICPA 1X7HA 3ITDA 3TL3A 3GNQA 1TI7A 3MCVA 4CMGA 4E2WA 2ZKLA 4CUJA 1WDLA 5JFOA 2DUWA 1PJSA 2DC1A 3DZKA 2HSDA 3LVFO 4PIVA 5AQ1A 2ZJ0A 4D79A 2XXJA 3STHA 2C0CA 1B8UA 1R0LA 1XKQA 2Q1SA 4ZJUA 2OGUA 1YB5A 1WPQA 2UVDA 4GSLA 1ZJZA 3OP4A 3B1KA 4EW6A 2POQX 1ID1A 3WYBA 4D45A 4E5KA 5CEEA 4KDEA 2ZCVA 3IKTA 2XF8A 4CLOB 2JCVA 1PZEA 4KOAA 5B4TA 1GZ4A 3K92A 3TZQA 4ALMA 2HMWA 4DREA 3RUFA 3ULKA 3RIHA 2XPCA 5F3RA 4EUHA 5AXCA 4MP3A 4N54A 4UAGA 4RJTA 5DF1A 3TF5A 3AI3A 1I10A 1QRRA 2D8AA 2ZTUA 1VL6A 3AI2A 5KJEA 9LDTA 5IAAA 2VZ0A 3ENKA 4J91A 3ZU4A 5JY6A 1Z75A 3KBOA 4AL4A 4WJZA 3HDHA 3RC7A 4YACA 4ZD6A 4GX0A 1K0UA 1TXGA 2C5AA 2NSDA 3U09A 5TT1A 4WOKA 3NRCA 3DL2A 3GN2A 3Q9NA 3R1IA 3QE3A 2PZMA 5THQA 3ZGYA 1Y8QB 4RGBA 2E49A 4MVJE 4IJKA 4RPJA 1NAHA 1BWSA 1N8KA 2ZJ1A 3JQFC 2P5YA 2DAPA 3P19A 4ZQHA 2TMGA 1I2BA 5IXSA 1RM3A 3H9EO 3GDGA 1U4OA 3X2EA 4FFOA 4OAQA 2HMSA 2O48X 3KUXA 4LK3A 5BNFA 1QKIA 5A9SA 5K6AA 4DLAA 1SB8A 1ZW1A 2PY6A 3N58A 3DAFA 1SC6A 4BGVA 2GYYA 1AHHA 2DPHA 3AWDA 2VRBA 5KWEA 5T57A 3NX4A 4LW8A 2ZK7A 2FP4A 5ADHA 3F5QA 5LCXA 3W6UA 3WFIA 2ZTLA 4CLDA 5DDIP 5GZ3A 1JTVA 4FGWA 1BRMA 3OQ1A 1P33A 1W6UA 3FPCA 4EEZA 4YT8A 2EW2A 4PLWA 3DO5A 3ONDA 1M76A 3ICCA 1IZ0A 1IHXA 1YONA 5G4LA 5BNIA 4I5FA 2C5EA 5CPBA 1S7CA 3FR7A 4P22A 3PJGA 1XIVA 2OL4A 5G0SA 1XYGA 4OO3A 3AOEC 3NV9A 3DFZA 1BTOA 3K5PA 4XB2A 1Q0LA 4ID9A 1JQBA 4I9HA 4NPCA 5F21A 9LDBA 1YRLA 3JSAA 2YYYA 3BMNA 3PLRA 3N74A 2G5CA 3GNSA 2ZYAA 4CM6A 1BGVA 2VCYA 2JHGA 3TFOA 4BMNA 2HK8A 3FWNA 4E2XA 5AOVA 3RJ9A 4UVIA 1E1NA 1F06A 3CTMA 4PG5A 1QXSA 3INGA 4M54A 2NU8A 4OKIA 4W99A 1VC2A 1GQ2A 4MIYA 5F1PA 1N7HA 2RH8A 3A06A 4E5YA 4IDEA 2X7HA 2AXQA 5C5IA 4EBFA 3GLQA 1PQPA 2HU2A 4J9UE 4MPDA 1EBFA 2HDHA 1GV1A 3IC5A 2DT5A 4R54A 2BFAA 2NADA 2EJWA 3SVTA 3JCZA 4BNKA 1N2SA 3R3SA 1H9BA 2PA3A 4E2ZA 4J7CA 2IZ1A 2P91A 2OFPA 3GH3A 2JD0A 2Q2WA 4L4RA 2GO1A 1GY8A 1W73A 2QRKA 4KMSA 4IZHA 3K31A 4EI2A 2D5CA 1YGYA 1VKOA 4RORA 4XYMA 1N9GB 1C0LA 2VOJA 4OOFA 3RC2A 4CM5A 2BH9A 4K6CA 1V8BA 2PH5A 4MVJD 1XQ1A 2CZCA 4E3ZA 4J1TA 5K9ZA 2HKIA 3WX0A 3IP1A 5KJ6A 1HDGO 4B7XA 4EZBA 2NVWA 2PZLA 5IZ4A 1ENYA 3VC7A 1B26A 2JFHA 3L4SO 4TROA 4DPMA 1LRJA 3L6EA 3PWKA 1QYDA 3OQBA 3WQQA 1CETA 5ENVA 1DXYA 3LLSA 4I5EA 1PJLA 4TMFA 1P3DA 3E5MA 1E7SA 2VWPA 1P31A 3JQ7B 3WYEA 3SLKA 3ZW8A 3H7AA 3HN7A 2DBVO 1EVYA 1I30A 5HM8A 3KYDA 2YZ7A 2ZYDA 2HRBA 2JKVA 2VZ9A 3OICA 3DBLA 2DM6A 4W4TA 1U28A 4YAKA 4FFMA 5A9RA 4DQXA 1MC4A 4XYLA 1I5RA 1XDWA 2BKAA 3TL2A 1CERA 1GCOA 1M67A 1SMKA 2Q2QA 2FR8A 3EGOA 4BNVA 1QYVA 2A94A 3JQEA 5TSDA 1AN9A 3JD1A 4FJ2A 2E6UX 2I6TA 1RJWA 1FDSA 2WYWA 4TRRA 4RPLA 1KVSA 2HMVA 2RCYA 3PJFA 3TWOA 1D1SA 5CEJA 3T7CA 1PZGA 1VLLA 1ZK3A 2QYTA 2FPPA 3WJ7A 4B79A 4YBZA 4L4SA 3RASA 3VDQA 4BNUA 3GF4A 4M49A 3QJ5A 1YL7A 1E3IA 1X14A 2P9GA 4ND3A 3LF1A 1BVRA 1I24A 4TRMA 3FWZA 4Y98A 1ZNQO 1HZZA 2EW8A 3GUYA 1ZJYA 2OZPA 3INRA 3RUIA 3K6JA 1IUKA 1YE3A 1FJHA 4IXWA 4K9DA 3JQBC 3GAFA 3ZCXA 4P8RA 2CDBA 1R16A 4BB6A 4JBIA 1JDJA 4NI5A 1EFLA 3K96A 2DLDA 4YDRA 1NTOA 4J2OA 1DBVO 3SEFA 3UICA 2ZCUA 5EQFA 1QSGA 1F8GA 1LRLA 2O23A 2QX7A 3GVIA 3OJ0A 4P4GA 4FSHA 3AUTA 1OZAA 3DOJA 4XRGA 3CKYA 2EP7A 3GZ4A 5TJ9A 1J49A 5A9SB 1HEUA 1V3TA 4S3MA 3VAZA 4CMEC 3ZH2A 5FEUA 1B0AA 1M6WA 4MKRA 4Q3NA 4HBGA 4WGGA 4NJMB 3A14A 3HDYA 1UXGA 1J5PA 1YB1A 3ASVA 5MDHA 1SO8A 1EQUA 1UR5A 2VYVA 2PZKA 4A5OA 3CPSA 4I9NA 3P2YA 4LSMA 4A73A 1EVZA 2EXXA 3D5QA 4YAEA 3WTBA 1C0PA 4CR6A 3DQPA 5JDCC 1LTHR 2EEZA 5KJCA 5A1TA 1YDEA 1XCBA 1HYGA 5L4LA 4YAIA 2X0NA 4J4BA 3ZWPA 3MJ4A 1ZK0A 4XQGA 1E5LA 1GEEA 1P1IA 1K6IA 4YTEA 4OIMA 1TLTA 2ZATA 1E7WA 3VPFA 4P4LA 1UDAA 4ILKA 2UDPA 3NT4A 1GU7A 3BTOA 3JQGB 3F4LA 1OI7A 1YQXA 3G1UA 4U0KA 4E0BA 3BMNB 3WGYA 1C1XA 3H2ZA 5JDIA 3NYWA 3NDJA 1YVEI 3PP8A 3QHAA 2B5VA 4Q3DA 3QIVA 2BI7A 2FRDA 3ITKA 3Q0EA 1T2CA 4KUHA 2IZ0A 1Q2XA 3KSUA 2VWHA 3HJAA 3HNPA 4ZN6A 1UXHA 3VVCA 3G49A 1UZNA 3BMOA 2Y67A 4IGFA 4WNCA 4YQYA 5ENDA 1VE9A 3AUUA 5AXDA 5LDGA 5A9TA 4YJGB 4RVGA 5C3MA 1RYDA 1HE3A 1PJ3A 2VTDA 1GCUA 3GY0A 5EMHA 2VN8A 1P1JA 4Z3DA 3E48A 1U2GA 4CODB 4EITA 4CPDA 1BXGA 4JCOA 4IBOA 4DQUA 4DYDA 2EERA 4OXYA 1HLDA 3QQPA 4QT0A 5C7IO 2OO5A 4LISA 3NT5A 2YDYA 1W0CA 3DHEA 5I8ZA 2Q50A 4JK3A 4DIOA 3DTTA 3WMWA 4BV8A 1ZBQA 2Y1OA 4NBUA 2R00A 4FJ0A 3GHYA 1H6BA 4GBJA 1PL7A 1YS4A 2I67A 5CFZA 1A7KA 4FQ8A 4R1NA 5EJ2A 1PJTA 4AFNA 4OHUA 4E13A 3SJ7A 3PYMA 2BMAA 4MKXA 4GWKA 3WGHA 1LDNA 1E1MA 4R9RA 4ALLA 4FD3A 4DBZA 4UREA 4Z6KA 1NQAO 4XIJA 2YY7A 4PFJA 3KXDA 1QV7A 3T7EA 4AVYA 4ALJA 4GKVA 3DAPA 3K2BA 4BO3A 4A2CA 2GN4A 5BSFA 1J0XO 2B69A 2BGKA 1IE3A 3NGLA 3RUHA 2OBYA 3KYDB 4A10A 3B6ZA 2I76A 5HWSA 2V6MA 4O1MA 2CMDA 1HZJA 3DBLB 3WBBA 1GUYA 1DEHA 2CY0A 2PGJA 3E9QA 3UCEA 3Q3CA 1PGQA 3UN1A 3M1LA 3VPHA 1Y5RA 1T2DA 1T4DA 2YQ5A 3ZNPA 1OFGA 1V35A 2X4GA 1O89A 1ZMTA 3AY3A 3HE3A 4U6QA 1HDCA 4Z9XA 3V5NA 4IINA 1R0SA 2RBEA 5L53A 3H4VA 3JYOA 1KY4A 1LSUA 1LUAA 3OBBA 3GMDA 2CVOA 2HMUA 3FR8A 4JP3A 4PZDA 4LVUA 5IDQA 4YEDA 1E7RA 4BIIA 4Q3CA 2NVUA 4NFYA 1F17A 4D3SA 1I2CA 2R2GA 2HAEA 3HB5X 2VT3A 3RBZA 3PFFA 4W7IA 1DO8A 1YO6A 4B7CA 1HKUA 2FMUA 4Z3KA 5AVOA 3JD0A 2LDXA 4CMEA 2ZB8A 4ROSA 3INTA 2GZ3A 3NJ4A 4P4NA 3KZVA 4BOYA 1CQJA 1UP4A 1JKJA 3CIFA 4FIZA 1Y5MA 3OJLA 2VRCD 1FK8A 3OEWA 3QA9A 1BW9A 3MJEA 4W9NA 3C85A 3IIEA 4Y9DA 4IDAA 1YBAA 3RAJA 5KNLA 1JWBB 5DBFA 4B4WA 1C1DA 2VUUA 1U3VA 2GASA 1R4NA 3RD5A 1XEAA 3FI9A 1FF9A 4I8XA 1F12A 1G0NA 2JCYA 4N5LA 4WLUA 1NWHA 2BFPA 4GPD1 5L40A 3WBFA 1CJCA 3CUKA 4U7WA 1EDOA 3JQ8A 2CD9A 3M2TA 4DMLA 1RM5A 2NTVA 1PJBA 5AXBA 5TIIA 2C2YA 3RJ5A 4PGFA 1O9BA 2YV1A 1P44A 4J16A 4MIEA 4DL9A 1VJ0A 1LRKA 3H5RA 3RSHA 1DHTA 1N7GA 2X0JA 5JMWA 2PFGA 4M1QA 1VRWA 4NDNE 1DPGA 1ISJA 3D3WB 1O0SA 1JU9A 2B4TO 3ANLA 3DBVO 1IZ9A 3OF2A 3PJEA 4FFLA 4IDCA 4XZ3A 3QWFA 3ANMA 1E3EA 2F1KA 2GZ1A 2WSBA 1WZIA 1MB4A 4FPXA 2QHXA 1T2FA 3ASUA 3LK7A 4E31A 1A72A 4MVJI 1Q7GA 4CMIA 3Q1LA 5I7SA 3TJRA 3PYXA 3EVNA 2J6IA 1XU7A 4L76A 1KY5A 4BNGA 4EJ0A 1PWZA 4RVUA 1GD1O 5U9CA 3PEFA 4UEKA 3LSYA 3V2HA 3WS7A 4NFSA 1C1XB 3V1YA 5ITVA 1SNYA 1R12A 5T8KC 3BA1A 2DPGA 5COAA 5F1OA 4RL6A 1NM5A 1Z7EA 1EBUA 2NVBA 3SBOA 3VH3A 1H93A 4K28A 1U7TA 3JV7A 1XHLA 3R3JA 1JKFA 3BMQA 4YWJA 3N7UA 3RKRA 1E1LA 3I83A 2RHCA 4BKPA 1PGNA 4FW8A 4L74A 3WGTA 1NXQA 2VHWA 5JNLA 4GQAA 3UW3A 4C7KA 3OECA 3FN4A 3KTDA 4LRSB 1CYDA 1UXJA 3GK3A 4BNXA 4GMFA 1IHYA 4TVOA 5ES3A 1YL5A 5JAZA 4W7HA 1WMBA 3LLVA 4B4UA 3DBHA 1CQIA 3OJFA 4R16A 4AJLA 2WEKA 2B0JA 2JCXA 4F45A 5A06A 1MFZA 1V9LA 1X1TA 4Y6SA 2Q4EA 2NUAA 1T1RA 4WEOA 1KEPA 1E3JA 4FFRA 1K6XA 1E7QA 3H8VA 3JD3A 1HXHA 1BDMA 2I9PA 2YUTA 5A3JA 1QG6A 4JP2A 3IUSA 1YBMA 1ZIDA 1HRDA 4IPTA 2X86A 4WLVA 2A9FA 2Q3EA 1RWBA 1NWCA 2SCUA 2Z1MA 1F8FA 1ZKMA 4HNGA 3DTYA 4XDZA 3UXYA 2B36A 3GOHA 2PV7A 3KEQA 2DBZA 1GFSA 3GC6A 4PLCA 1IYZA 1R37A 2UYYA 2XAAA 4BGUA 2WDZA 1ZSVA 3F47A 4DIFA 4HXYA 5CPFA 3U4DA 5JLAA 4ZQFA 4R5MA 1DAPA 4NFHA 3PVZA 4QUKA 4BMVA 1NNUA 1Z7BA 4RO0A 1RKXA 4CV1A 5F5NA 4JJIA 4RPKA 4AJOA 2X22A 4I08A 5H82A 3H3JA 3ONEA 2W8ZA 5TGDA 4BNIA 4B8ZA 3PHIA 4ZQBA 4AG3A 5HS6A 5ITWA 1Z45A 4JLWA 6LDHA 5CEFA 4ZHSA 3MOIA 1M66A 5A04A 2GLXA 3QVSA 1E7YA 3EY4A 3QY9A 2FSVA 3MZ0A 2NVUB 4YT2A 5THKA 4QECA 3VTZA 4BO4A 3C7DB 3R6DA 1NFRA 4HV4A 1I3KA 3P7MA 3KSZO 2NNLD 4DTIA 5JC8A 3H65A 2NTNA 3G0OA 4GH5A 5LDHA 2WD8A 4NZ9A 1Y8RA 5KVVA 4O63O 2VYNA 1MC5A 5JCXA 3ROPA 1BW9B 5FF9A 4BQRA 4XGKA 4UVHA 1UAYA 1ISGA 4LRTB 3GRKA 3PZRA 5EINA 3Q11A 1LLUA 4XKJA 4B3IA 3ZHBA 4J7XA 3RROA 4QEDA 5IN5A 3JYPA 3HWRA 3WTCA 1H2HA 1PL6A 3PIIA 4CMHA 3S8MA 3L9WA 2RHRA 3RU7A 3ZDFA 1HSZA 2GRAA 4FOOA 1GYQA 1K6JA 5TNXA 4AJKA 2X5JO 4HUJA 1KEVA 4FCCA 4ZU3A 1VKNA 3IAHA 5ICMA 4D43A 3BMCB 3RFVA 1ZVMA 1H6DA 2PWZA 2NU7A 4XJTA 5B1YA 4YXFA 1WW8A 3C7AA 1E0DA 2YW9A 4YB8A 4ZICA 2AE2A 1H2BA 3H9QA 4AJ2A 4RF5A 4A03A 3G79A 1ADCA 2Z5LA 1GQQA 3G17A 3UCXA 2WJPA 2B4QA 4HFJA 4CL8A 1HE5A 2PD3A 4IDFA 5KJ1A 4BHTA 3PHJA 4E6PA 1P0FA 3ZV5A 1OC2A 3TPCA 3JYLA 2VYVD 3VOSA 3IS3A 4U8GA 2HJRA 1NR1A 1PGJA 1KIFA 2RAFA 2WD7A 4E32A 1E3WA 1BXKA 1WDMA 1E6WA 2GPTA 4MVJG 4E30A 1ZH8A 4GX5A 4KQXA 1U3WA 4LCEA 1YBVA 5C7LO 1K5HA 4Y6PA 4AJHA 4DLBA 3H2SA 3DONA 2IYPA 3HG7A 4CMAA 4XJSA 4XYBA 4F6CA 2WE8A 2X58A 3GHHA 5TT0A 2W2LD 4E2YA 1E92A 3NT2A 1LQUA 2X5KO 3DWFA 4WEQA 1ZSYA 2JJYA 2X5OA 4R5HA 4BGIA 1SB9A 5JW6A 1GDHA 4Q9NA 3EZYA 2I3AA 4DLLA 1O5IA 3ZWMA 1DJQA 5DULA 3U4IA 3H5NA 5JXWA 1GPDG 2GN6A 3BZUA 4WCFC 3JQ9C 1C0KA 7ADHA 2A35A 1J4AA 4PG4A 4XA8A 2ZB3A 3HSKA 8LDHA 1NASA 4D7AA 3LZ6A 4J2HA 3S55A 3NEPX 1QP8A 3BHIA 3JD4A 4BO7A 1E77A 1B7GO 4S1VA 4FOSA 4GX1A 3MJCA 3FF4A 1VI2A 1WXDA 1GPJA 4XQ9A 1Z74A 3JQAA 4CR7A 1D1TA 3GGPA 5T6BA 5COBA 5T5QA 4YJFA 4URFA 3UUWA 1QV6A 3WJAA 1ZXLA 3UCFA 4CQMA 4CUKA 3ZZNA 4CM3A 1MGOA 4DBVO 5A4DA 1IPFA 4UEJA 4BB5A 3H9JA 1AUPA 3OJOA 4IS3A 4HFNA 4BUCA 2P2SA 3ZW9A 4K6FA 5COQA 5GZ6A 4BNTA 1NQ5A 3MJTA 3JYQA 3VZRA 1XWFA 5EL0A 3VPXA 2PLAA 1MUUA 1ZO8A 2Q1UA 3OIDA 5IFLA 1DOHA 5ILGA 5JE8A 4XD2A 2JL1A 5T64A 4LMRA 1P9LA 1TT5A 2VHVA 3C1TA 3KSDO 2YV3A 2O7QA 3PPIA 1DIAA 3NTQA 4PCVA 2B4RO 2DBRA 4WE3A 4J0FA 2F00A 3TQHA 2G76A 2G0TA 3DMTC 4IUYA 3GEDA 5JAQA 1HDOA 3ON5A 1ZZEA 2J5RA 1CDOA 3EK2A 3UAGA 1Q1NA 1GL3A 5K0ZA 4NU6A 1BHSA 1GUFA 4BNWA 3GZNA 1KBZA 4KZPA 5DCYA 1V3UA 3GNTA 3FNFA 4XEHA 1HSOA 2O2YA 1E6EA 3ZWVA 1D4FA 2C2XA 3ZV4A 1XA0A 2UAGA 3BHMA 3I6QA 1PX0A 2IXBA 2AMFA 3K30A 3RCBA 3I9KA 2Y0EA 1DJNA 2DVMA 2WTBA 1NVTA 1R6DA 1E3SA 1U2DA 1KC1A 2O50A 1GR0A 3AY7A 3JQDA 4ZA2A 4DQVA 3ETEA 4CMKA 1OC4A 2J3IA 3W4IA 2D59A 2HJSA 3HN2A 1X7DA 4Q3BA 1D7OA 5I9MA 2FR0A 2BGMA 4W6ZA 1YL6A 2Q4BA 3M6IA 1P1HA 4KP7A 3V2GA 2H6EA 3ZV3A 1H9AA 3CZRA 3NTOA 4FJ1A 3S2EA 5HBRA 4OJNA 1K89A 3DZIA 8ADHA 2Q46A 3TDKA 4RVSA 3GVCA 4CLEA 1X1EA 1XG5A 3ZNOA 2VUSA 3ANNA 4BO8A 2AQKA 3GR6A 3QVTA 1YDWA 3JQFA 1T26A 4K26A 4R68A 4OQZA 1C14A 3NAQA 4NK5A 5BR7A 3U62A 2GCGA 4E5PA 2GF2A 1DC3A 5JPIA 1KEWA 1I3NA 1CF2O 1AXGA 4ALKA 4UUNA 1EUZA 3S2GA 2FOIA 5KOIA 2CUKA 2QZZA 3F5SA 4M89A 4YJHA 4ND1A 4R3WA 4Y67A 4XWYA 2FPGA 4J4TA 3BTSA 2NM0A 1PEDA 2YFHA 1ORRA 3FNEA 2DUUA 3RFXA 1KC3A 1BG6A 4J9VA 4LVCA 1ADGA 2IZZA 5I9NA 1JVBA 5KIAA 2IODA 2O4CA 2GD1O 2JFGA 3IQDB 4KUEA 2EP5A 5TRTA 5TLSA 1XSEA 1KVRA 3IOYA 3TRIA 5CDYA 1DIRA 3AOEA 1WNTA 4GGPA 2EWMA 3DHNA 4FGSA 5IXYA 1Y9EA 1X7GA 2W90A 1DC5A 4Y6RA 5L4NA 2HMTA 2B83A 1A5ZA 4FFPA 2GGSA 2CNBA 4OMUA 2D2IA 4UEOA 5BSGA 4YAGA 3TFQA 1VSVA 4NJOA 1XU9A 3UHAA 4UULA 2D3TA 3OFSA 1I2ZA 3AM3A 3F4BA 2EKLA 3U5TA 1VPDA 3EHEA 3LU1A 1JAXA 5L3ZA 4OH1A 4QFDA 3WSWA 2V6GA 3TZHA 1NPDA 2VHXA 4RDHA 3ORFA 5KJFA 1PZHA 3PHLA 4BMSA 2V7PA 1RM4A 1WMAA 1V3VA 1CIVA 6ADHA 5HRUA 4PLTA 4LMPA 3ZNQA 2C07A 1ZFNA 5TQVA 1D8AA 3W1VA 3ZHZA 4B4OA 4JGBA 1ADFA 3OA2A 1MG0A 4JROA 4GLLA 3CEAA 3DC2A 5JYDA 3VH4A 3JQAB 3BAZA 3VZQA 4EJMA 3PI7A 4FN4A 4IGEA 4BO1A 5A5EA 4CQMB 1TT7A 3KLPX 1GYPA 4YT4A 3I9JA 4IY1A 1IPEA 4AICA 2X8LA 4I5GA 3NGXA 3C1OA 1GEGA 1R4MA 5B4UA 4B7UA 3ROQA 3CMMA 1DFIA 3DZFA 2D0IA 2AQHA 1TEHA 1XGKA 1IY8A 2WWRA 4XB1A 3ZWNA 1NBOA 3GUCA 4FS3A 1C0IA 1EZ4A 4RQUA 4F6LA 4D41A 3G1TA 3D4OA 2BFOA 4JBGA 3W8DA 3ONFA 2OXIA 3WNVA 4KTTE 1HE4A 5AXAA
chains in the Genus database with same CATH superfamily
1T1GA 1VA4A 3BX1A 3PYLA 1O95D 4X91A 5EIOA 4BGPA 3BRQA 1ODIA 4HDRB 3RTDA 1EFVB 4NCBA 4CG0A 3OJCA 1MZVA 1JMVA 2A33A 2V4MA 4AWBA 3DDNA 2UYCA 4Z1OA 1EB9A 1JBQA 3DG9A 4D42A 3VNSA 4KR2A 1TMGE 4E4YA 1EQAA 3GLGB 2OHGA 2OCBA 2AW5A 2ECFA 3O94A 1G5FA 4AY2A 2JGAA 3GZNB 2ROQA 5FTJA 1Q0UA 3QLUA 3UG6A 4Q4JB 1KNQA 4DV5B 2VT2A 5CVTA 1IXYA 3GDFA 1EFRA 3RUAA 1IAQA 4BVGA 3KEFA 5CW1A 4B31A 3PPWA 3DKPA 3DHVA 5EHNA 2UV8A 2WDPA 3OO1A 3QPVA 2ET6A 2D3WA 4HNHA 3M6FA 3KAPA 3GRPA 2HHJA 5HPYB 4IOKA 2JAWA 4J6FA 3DE6X 3FZNA 1P2GA 1JRLA 1RPNA 2G83A 2XYQA 3EQZA 3KALA 2PLFA 2BRUA 3BRCA 1OLUA 1DAKA 1GZUA 4J3FA 4LRUA 2XCIA 1YQWA 1CDDA 4IIJF 4II3A 1VL8A 4UEWA 4MX8A 4KSYA 1FFXB 3K0AA 2X4DA 3KS9A 3Q9LA 4KE9A 4WJLA 3VU9A 2IH5A 1I32A 4H4EA 1KU0A 3GL9A 3IKVA 5IG2A 4I50F 2J6BA 4RCVA 4D0RA 2I03A 4PAQA 3UIEA 1LC3A 1W5SA 3JQBA 1LK5A 3IQZA 3AU8A 3L7YA 2C88A 1M1UA 2JCBA 3STVA 3U4QA 3AVUA 2X15A 3B7GA 3CXRA 3GZTB 4LGYA 3U4HA 2VI5A 1YK0A 3I6ZA 4UU0A 2I66A 2VYND 2VPXA 1JUDA 3HWX1 1YWGO 3Q6IA 2WNHA 4UNIA 3QFHA 3SLGA 3QG1A 3ZVRA 4CVNA 4D3FA 5JI3E 1P7CA 4O2BF 1Z56C 4KO4S 3UJBA 4B5LA 1PGOA 5YASA 3ZHQA 3KQKA 5AVUA 4FYXA 3KAQA 1WB6A 4TS4A 5D01A 5SY4A 1N32B 4ZRNA 3ZDQA 4Q7KA 1IC6A 4ADSG 4YA6A 4IXTA 5EMMA 4RSGA 1OXUA 3U0VA 3PFHA 1CFZA 4F1JA 5EZYF 4OM8A 1KKMA 2OFWA 3RS8A 4UD6A 1FBTA 5EIXA 5C53B 1TVCA 3TD6A 3IPRA 2FPGB 2GPYA 3MGCA 4GL4A 1V7ZA 3AY6A 3HYLA 5ARDA 3TOZA 4XM2A 4MTLA 2GHTA 1QDEA 2W42A 1FNNA 3S44A 3C3EA 4FFNA 1FTNA 3RE1A 5JDCA 3Q41A 1C50A 2DQ4A 3FYCA 3V4VB 5AM3A 3L8DA 3BCRA 3FDXA 2J0VA 4HDNA 1A1SA 4IZIA 5E2AA 3AGQA 2Y1WA 1OWNA 3IV7A 1FVFA 4TUYF 1KZYC 3LX5A 5DHSA 3HMQA 4QO8A 3I9MA 3Q9UA 2OXRA 3PDUA 1VIDA 4MW9A 2JI6A 2FSSA 2HI0A 3O82A 3OWXA 1CUYA 3K8OE 4NFLA 4P84A 4TTTS 5IABA 3JXEA 5GZ1A 3MJHA 4GWLA 4S35A 5ER9A 5C1IA 4UPVA 1CEQA 1BROA 4DMMA 3QE2A 2DQKA 2WUGA 3VYUB 4QPPA 1M2VB 1H6CA 4UDXX 3H5OA 5BQOA 4QJ3A 2CF6A 3N7AA 1QYCA 4RELA 3LGXA 5D51S 5A02A 1TAHA 5C8YA 1VYTA 2I3ZA 3GQVA 4BQPA 4TLAA 1WDKA 1R0WA 1KHTA 4H4CA 1PSDA 1XZDA 4JQZA 1F8XA 1MFPA 2O5VA 1V1RB 2AYYA 2PJUA 3B2NA 2H07A 3OSUA 4AJ1A 4NV0A 3I5AA 5K4HA 3UTDA 4UM9B 2Z5FA 5KWVA 1HLPA 2YIMA 5B6JA 3QV1A 1QH1A 2CHUA 3TRHA 4EOGA 1QR2A 1QVZA 1OFUA 2GB4A 2VK8A 2YJ3A 3B48A 3KHUA 3CE6A 3SIXA 1CBUA 3TLAA 4I8DA 4QM7A 3KLMX 2BEWA 4EGAA 1A7AA 1YR9A 1XR3A 2HB6A 2QLTA 4IL5A 1PKEA 1IMOA 4TQ9A 4H7DA 3W4JA 4DT1A 1KVUA 4DV2B 3PXGA 4AJJA 2HW8A 3D54D 5FX2A 3QG5A 3R7BA 3AL0C 2F59A 5F3WB 4X54A 5KNCD 4Y7DA 2FWMX 2EC5A 1JKIA 4Q82A 3WHPA 2P2NA 1VIYA 3K0CA 3K70B 1KEEB 5FL3A 1USGA 2AX4A 3NM5A 1V5GA 3SIRA 4BNYA 5IVPA 1CUFA 2ZI5A 4YY3B 1RYFA 4BYMA 1DWOA 1DXHA 4S1WA 1P7VA 3H8JA 3LKBA 3UK2A 2I91A 4GOLD 3FCOA 3TBKA 5CCBA 4JXZA 2PKRA 4P92A 1MIOB 3A1WA 2C98A 2XWQA 1D8TA 1RM0A 1U2ZA 5SYAA 4MIKA 4DMRA 4L4XA 1Q1ZA 2OG1A 1KSFX 1BDBA 2QY9A 2C2ZA 1XMQB 2P4EA 3WXMA 5K0SA 3ZE8A 1GADO 5IC6A 4DOMA 1OWPA 1ZVQA 3HZZA 3DCIA 3LT0A 2EG5A 5DT9A 3KV3O 3A6FA 4WZZA 4EY7A 1CJBA 1CK4A 1TM7E 1L5LA 3CUVA 2BBTA 2DTDA 3H4IA 5LYYA 3Q72A 3QFRA 3RABA 4C4PA 3INNA 1O9GA 3HJUA 7REQA 3E22B 1U1GA 4DWVA 4EY8A 5KZMB 3NJ8A 1W46A 4LDAA 3KQYA 4V02A 1YKGA 4DKXA 1XNJA 1KAGA 3KUCA 3C3XA 5A5EA 3MS2A 3LXXA 3TKYA 4CDGA 3C6XA 4E21A 2CZQA 1M6EX 3I52A 4RWEA 1U4SA 4NMWA 1RW4A 2AGVA 4WTOA 2OESA 3WHLA 3W06A 1TPZA 4D3XA 4HYQA 1ZIYA 4UUBA 4OQFA 3FPFA 3BYZA 3PEUA 5AH0A 3T3PB 5CBPA 3M9LA 1XTJA 1VHQA 2GCIA 2P8SA 1UOPA 3THYA 1KK2A 4A2QA 1RYNA 4W5JA 3DF9A 2JW5A 1RIFA 3NXSA 3CBQA 5J9FA 3RRZA 4BZQA 4ZZ1A 3ZN2A 5HJ5A 4KDRA 1F9AA 2CHGA 3DSRA 3A1CA 4KWIA 2EG9A 3FOZA 4LCJA 4RJLA 1L6RA 2BI4A 1OH7A 1XU4A 4AMBA 4CIYA 1DHRA 1JSLA 3U13A 1OWMA 1YCHA 4LTNA 3S1AA 3ZW7A 1SCIA 5EPUA 1QK4A 3MS4A 2F8LA 1DRVA 2H3EA 2NQTA 3NASA 3HO1A 3LZDA 4PRYA 5LYJB 1L0BA 2E48A 3WK9A 3PFCA 2VWGA 3FA2A 3OQNA 3E2MA 3G8YA 2LR0A 3R3XA 3BE5A 2HR1A 5LD2B 1PKXA 1RWOA 3A3YA 4MVXA 4AUNA 4G41A 4ES6A 1IM2A 1CY7A 5DM60 1CXZA 5FBWB 2H9YA 3C8DA 3W2HA 3FOAA 1DV2A 1YCFA 5B3JC 3RS7A 4X61A 3OEHA 4KLCA 2ZYRA 4R7GA 3MINA 3VPCA 1TVKB 5HTOA 2UYHA 1NMQA 1JMYA 2O4UX 2Z83A 3A25A 3CO0S 4I46A 4RVCA 2Z8XA 2PZEA 2NU9A 1RRKA 2CYAA 4AC9A 2CZGA 4JQOA 1BO6A 1PFGA 5ALTA 3P9KA 1PR9A 4KJZA 4C3OB 4DV7B 3VYRB 2FMFA 3HFJA 3EEIA 1W44A 4BAZA 5IKEA 1A4IA 2FPIA 1SBCA 1Z0UA 2EAUA 4RPHA 3EEYA 5CVDA 1E3LA 2A9QA 3R74A 3PTZA 2ZSFA 2W83A 3F7TA 4Y2YA 2H8KA 3T9EA 5KS2A 4GMKA 2Z1DA 2BHSA 1UC5B 3NONA 4Z4EA 4FMBB 3WV5A 1SHLA 3QELA 1TEXA 3OM8A 2P4HX 4CEHA 2AEFA 2IYYA 3PQEA 4CHTA 3MD9A 3NWOA 3CSSA 1JDPA 3IMKA 3TSYA 4A0SA 2HC9A 3FUVA 5BSMA 4NOMA 4TLLB 4OFWA 5G4KA 2BMFA 3ZU3A 4A16A 3O8OA 5B2FA 2Z04A 3U0BA 1WUIS 4LZAA 1MG5A 2EDAA 1V0JA 4QPNA 5AKEA 2DT8A 4JVLA 3DOUA 3ZQKA 2CXHA 1NZFA 3KYJB 2ZTSA 1BYIA 3N2GB 1BMFA 3QIAA 3ZY4A 1CE8A 4RDXA 5HKAA 3IAFA 3LP8A 2O7SA 4FMDB 2BZGA 2AJ8A 1XTSA 3IB3A 3T4UA 1ULAA 1GTJ1 3WO0A 1E6MA 5HQ3A 1OH5A 4MQBA 1C1DB 1Y4AE 1SUBA 4MNTA 2E7ZA 3MVEA 5CX1A 5M2QA 5A0VA 3TSOA 3GJZA 3S81A 4FMPA 4OX9Y 3RREA 2JLYA 3PGJA 5ESWA 4RK5A 2HA3A 4FWBA 4PNEA 4F5YA 3DFUA 2E1RA 4LYEA 4QLBA 3AZOA 3GJ5A 4WACA 3UGTA 2LW7A 3U48A 5FBRB 1YR8A 1R6TA 3GJXC 3VR6A 1CUSA 4XR4A 3IGFA 4LRWA 2CUNA 3V42A 5CB0A 4J43A 1EK1A 1Y5IA 5EI5A 5FA6A 4EJSC 4NARA 3ZJVA 2JGEA 3AR8A 4G81A 1MVOA 5K3OA 3WDSA 4OI0A 4EBBA 3KAJA 1WZNA 4PPGA 3WICA 1DRJA 3PDIA 3B20A 4Q16A 2BYTA 2XF2A 1QH9A 3Q8WA 3PRYA 2VQDA 3LDHA 4H35A 1JQ3A 4QQRA 1UC8A 4CKWA 2YRWA 1FDIA 3VPGA 1Q21A 5H83A 4BRZA 1SKYE 3ZUGA 2ODAA 1Q74A 1QCZA 3WLEA 2OORA 3KB2A 1GTL1 3DV2A 2RK3A 1VKJA 2NTJA 3ZOZA 4EA8A 5HA5A 4ZHQF 4DJJA 1GFIA 1FUKA 2WAMA 2EBWA 1NF9A 3K9GA 4L9SA 2JH3A 1AXEA 1Y81A 2OGTA 2ANBA 1WF6A 3MCWA 4M87A 3WIVA 4UM9D 4ZI7F 5TMPA 1UK9A 2FR8C 3B13B 4DE5A 2JGKA 2ZXUA 2L42A 4MDHA 4O6VA 1ESZA 1W4RA 1ZL0A 2J07A 2ZIXA 3HR4A 3MWGA 3PC3A 4HGPA 4QDTA 3SR4A 4AUEA 5TC4A 1JH9A 1OTXA 1WP9A 4ITUA 3WG9A 3CPJB 4KKXB 4XOIA 3S2ZA 2ECOA 1JDSA 2XIQA 3IHLA 4KI7A 2GFQA 4K9SA 1Z39A 2FFHA 2Y66A 3OY2A 1Z4KA 5A6SB 3STXA 4AI6A 1BXZA 2IOFK 1EVQA 1FYFA 3GCXA 3FGOA 4DLSA 4ZEMA 3K70D 1JHYA 3SZGA 5E3HA 3T5TA 1KO4A 3JWGA 3EHDA 2BFDA 2ZR8A 3E8SA 3HABA 4P7FA 5BSRA 3FCSB 3HKEB 3MPOA 2A5LA 3BD7A 1Q7EA 6ABPA 3ZUPA 1U63A 4Z53A 4BEVA 2C59A 4ARAA 3AM1A 1C9YA 1WP4A 3KOYA 1EG2A 1R6VA 2ZRMA 4P35A 5F4BA 5BN5A 1M0WA 2BHTA 4QXQA 5JI2E 5G0TA 2ONYA 2ECQA 2RGNC 1O5TA 4XYGA 4GVXA 5KI6A 1IY2A 3NZEA 2O2IA 3UMCA 1MMFB 2QJOA 4EARA 1U9JA 3BC1A 3CM0A 3AIKA 4UZSA 5A4MS 4UUMA 3RUDA 4PCUA 3EJ6A 1PR3A 3WLIA 3W0LB 3ER8A 4Y6LA 4PO3X 3IEXA 1GGEA 4HYTA 3E03A 1IUPA 3K1AB 1IVNA 2V6FA 4GC5A 4YCBA 4NBWA 2Q3FA 3RAPR 5KMGA 1OH8A 4I1PA 1HFWA 4YROA 2GN2A 4FFWA 2V6JA 1LDEA 3TLEA 1X7XA 2VA9A 1H05A 1OFTA 4CM8A 5E2BA 1Q1GA 2WYOA 3QP9A 4A6PA 4K3UA 2R87A 3DS8A 4QEKA 1L4FA 2PX6A 1MXFA 4L57A 4OOEA 2VLBA 2HADA 2GEJA 2VWQA 4Q1CA 4DA6A 1VQ1A 1GQFA 3SNKA 3FROA 2XUAA 1TD1A 3LWBA 3O4RA 1FUYB 4Q1DA 4HNQA 1J8DA 4IXDA 4L85A 4MGZR 1VE7A 2AN1A 4MW1A 1AO0A 3QVGB 3D7KA 2PMCA 4GSKA 5C9ZA 4AG6A 4I4TB 5F7XA 3LM8A 1JPVA 3DZDA 3FAZA 3HL4A 5E8RA 5IZCA 5JYBA 3U61B 2W93A 1NPYA 4TS9A 4DDHA 4ZANA 3TCXB 1XF9A 4LOHA 1I0ZA 2VDNB 2V9CA 1DC8A 1K8ZB 1R9NA 4IDGA 4UJ5A 3ANTA 3FZEA 4F56A 4S04A 1F9EA 2PRIA 2YJZA 3T3GA 1FMCA 3JS5A 4RLQA 2ZI9A 3VHQA 4JSTA 3IUEA 4KTVE 5IJWA 1V96A 2C99A 3E8XA 1ONBA 1Z5PA 1H0SA 1YB4A 2BF4A 1JHVA 1WUJS 3GOQA 1AHNA 2QQGA 3GMTA 5CM8B 2Q0SA 4P5DA 5JDIC 2DKFA 3LPDA 1GPMA 1S2OA 3CEMA 1YUMA 4GEGA 1ESEA 3L7AA 3ETDA 1NL3A 3PXBA 2NN3C 4KX5A 4MV4A 3AETB 4H15A 4WOPA 3V1TC 3GX1A 3MHPA 3MGKA 1YQEA 5G3YA 4BLRA 3V8BA 2C8VA 3DP9A 3LRTA 4PBSA 3LGAA 3Q0TA 1FZTA 4KWHA 5CXUA 1SOUA 2OENG 3IE2A 1T10A 4LS3A 3ESRA 3ZX4A 1G3MA 1Y8RB 2EKQA 1M2JA 4ZQEA 1HMPA 5C8YF 2HHLA 4G0NA 2XRYA 2C4VA 4FMCB 1KZGB 1RKQA 1IJEA 2J5QA 1TDJA 2Q3CA 3I53A 3RRNA 4EG0A 1M2GA 4MPJA 1FTQA 5TB5A 5BT9A 2FSIA 4IIGA 3VTKA 1U2GC 4HO1X 1AG9A 1S3FA 1BAPA 5JO0A 4YMIA 3HADA 3MMXA 1ZMRA 3MWJA 3EZ7A 3EYAA 4J0KA 3WFZA 4D6XA 1EK6A 4YRSA 3OJEA 2AVNA 1J00A 5ARBA 1DV1A 2XNHA 1V11A 3SEZA 2P41A 4N41A 1ENOA 3PC2A 2XDYA 3R9WA 1ARZA 1J0DA 1VIVA 3MGGA 5DHUA 2HDOA 2Q8NA 1ABFA 2ZI3A 4QYIA 2XZPA 3WIDA 5K8LA 1J2TA 5EERA 2OXCA 3MT0A 4US1R 4E33A 4F2PA 1KFBB 4DA4A 5LQUA 4ESVA 2AKAB 4OYLA 4RF2A 1N5DA 4ZVQA 4LYFA 5H9VA 1PR2A 2F9MA 3LBAA 3QU2A 3HZRA 4JQSA 5TS3A 3DR3A 4EEXA 4EW2A 5LKRA 2HUNA 1L7DA 3DLBA 3MWYW 4OK3A 2IC5A 2X6QA 2ZEJA 3HN6A 3QXGA 5REQA 5JJ5A 1MX5A 1B8VA 2OK8A 3QF4A 2Q3LA 1TU0A 1E5XA 3HNRA 3L3BA 2A0UA 3F90A 2ID8A 2GJSA 5FTKA 2DU8A 4ALNA 3NNDA 2IXFA 1GAWA 4O4IB 1L4UA 3IMFA 4PZLA 4RA6A 5JFGA 4ICIA 1XPJA 1E3TA 4G5QA 3TW0A 3O1IC 4WCFA 3AP3A 1TUIA 2H5LA 2A58A 2WKQA 4JLPA 2HLDA 3BGOS 5JD5A 3EC1A 1H8ED 4H3VA 4JL5A 5C4IA 3PFKA 3HY6A 3REFA 3KFXA 4HGRA 2HPVA 1JMKC 1YRHA 3PXXA 5CGZA 4NY1A 4XVRA 1A9YA 4MKIA 5F5LA 4RETA 3RAGA 5KSOA 1QFMA 4HZIA 2QE7A 2FFBA 3PQ2A 1JLLA 4NZPA 4TRJA 1K7FB 2B37A 1BS9A 2XMBA 4K46A 1U0HC 1QZTA 2IHYA 2O3QA 3D0KA 3PUIA 3HVKA 1Y48E 4G1MB 1PJ2A 1X8LA 1YXMA 2CVFA 1YGPA 3DXXA 4XE5A 4GR5A 4PXSA 4A26A 2O2SA 2J0UB 3OHSX 4G86A 1K75A 2WHQA 1ESCA 2JEYA 3H75A 1L7AA 5AI5A 1Y37A 1OX4A 1IAVA 2HV9A 4B73A 5ILQA 2QTTA 1Q0SA 4NABA 3B5EA 2AMVA 4DVJA 3V9PA 4EHNA 1VA5A 1PFUA 5KKCA 4C4TA 2FRXA 2RHWA 5L3RA 2WWHA 4BX9A 2PSDA 3P9IA 2PQMA 4LJKA 3KWFA 4CNBA 1V7QA 4CQLA 3D3JA 1G55A 4Q9DA 5G3ZA 3OTOB 3FRJA 3CFYA 1MVNA 1E5QA 2OTCA 4H7KA 3AYXB 1GYRA 2K5UA 2FG6C 3O9MA 5FYDA 4MV8A 3ADOA 1SBNE 3UVEA 1KARA 2Y0DA 2ZROA 3LPCA 4B8WA 2DUMA 1NC3A 3RKSA 3S68A 4X20B 1NSTA 2IYXA 2JVIA 3GJQA 3HU5A 1OGIA 1VBNA 3OM1A 2DLCX 3C8MA 1NP6A 3IKJA 3QEKA 3DVSX 4EQ6A 3GRYA 4URVR 3U7IA 4PNHA 1FJXA 3TLYA 1B3RA 2ZI7A 4BVFA 2PVSA 4CKEA 1C2TA 1Z0JA 4YRIA 5HS4A 3GGOA 3M34A 2O8EA 2R1VB 2X19A 2NNWB 1GGJA 3I1JA 1BNCA 1S2DA 5BYBA 2Q7OE 3SDBA 2B5OA 3DCYA 5JMTA 4KYUA 4ZCSA 2JI4A 3KB6A 3ZTWA 1PSWA 1WWKA 2VP2A 3KZKA 3QM1A 3EG9B 5BYKA 4Q1VA 3EVBA 3FUCA 4IFEA 1SY7A 2YHIA 4N5NA 4UBLA 4LRXA 4PZ0A 3T3NA 3LDFA 1MHPA 3BDAA 1YUNA 5JNVA 1EE9A 1USVA 4UJ3A 2O3RA 5THXA 2HEGA 3QTBA 5IDXA 2MWMA 4ARBA 1PD0A 2AQIA 1RHQA 3MMPA 3O4VA 1GIAA 4Z7OB 5D3QA 1KF0A 1HT0A 3HI4A 5L4SA 2R6HA 4IYRA 1VSTA 3A1UA 2HA7A 2HWYA 2RFLA 3NVMB 3W8FA 5CB4B 3IDOA 2I0FA 1MHTA 4GVLA 2QVLA 5DH9A 4TKUB 3RRYA 2C9MA 2CDCA 1BS2A 2Q49A 3DBRA 4L0QA 3EIWA 4GX2A 4UHDA 2IPMA 2OD2A 4YR9A 4NJEA 4HH4A 4ESOA 2NU6A 4CFZA 3NUGA 1L5QA 3U1TA 1M33A 4IM7A 4JJFA 1IXSB 3GD7A 1B6TA 3TZLA 3SQNA 1CR1A 2I3GA 1BMDA 4PX5A 4YRJA 4CM4B 4NZNA 1QFZA 1UQRA 4LXTA 4JGGA 3V8PA 3O9ZA 1RHUA 1QIIA 2ZIFA 4ETWA 3DMNA 3O8QB 2A5GA 5EJFA 1BVHA 3DE4X 4EFLA 4HDQB 3EW9A 4R05A 3U60B 3GEPA 3VNQA 2PBLA 2AK2A 4M1EA 2BFBB 3QSGA 4J3NA 3K20A 4UMEA 3K5IA 1AX9A 4OLFA 1YOVB 2GZHA 3PUXA 2P30A 3CKKA 3UMSA 1ORWA 3ZWAA 1Q1EA 3IXMA 2GFHA 4MHTA 2HPHA 2PD6A 3BK1A 3W8EA 5CFPA 4MS4B 2QZ4A 3TW8B 2ZUUA 3IR7A 5CLIA 1ZL2A 1ZINA 5D3ZA 2VP0A 4R1PA 3SG0A 4ZJYA 2FGKA 3O03A 1O1YA 2EFDB 2G82A 3OX1A 5E7QA 2C5BA 2QUZA 3BE4A 1UDWA 4I55B 1UP7A 1Y89A 2PKEA 3I5MA 4KXWA 4MWSA 4NONA 1VL2A 1H85A 1O7JA 3EDYA 2OHIA 3IQGX 3HHEA 3I1IA 4DJAA 1DLJA 5KKAA 1XE3A 1NTRA 1X13A 2BEVA 4WUTA 3QUTA 4JUIA 1H6AA 1Y8CA 3K5HA 1VLZA 2OB2A 3DKKA 4J0JA 1E2JA 1EHCA 2GUGA 5LNK1 1TD9A 2Q5LA 3TOSA 2WHYA 5F1KA 5E4TA 1EM8A 3GMSA 1R6XA 3L7KA 4YWHA 5KWJA 3KETA 2OQIA 4AZWA 2BSAA 4KXFB 4UTOA 3ZVNA 1E9VA 4B33A 3LC1O 4NQZA 4U5QA 4KDFA 4KO3S 4RL4A 1K2WA 1OBVA 1FQJA 2FFQA 1FZQA 1QZ3A 4S2UA 5AW1A 4MV0A 4CDRA 3NRBA 4Q4CA 1KO1A 3G0HA 1P2TA 3K73O 4V03A 4XYEA 3R0IA 2CFRA 2J9FA 3QKSB 4DA8A 4OHOA 3LRXA 3WZ2A 4BP8A 5JYEA 2OFOA 5EXXA 3IJRA 3BXEA 4GS5A 3RWOA 4IVRA 2I29A 3QXHA 2FZEA 4R0NA 5LXTB 3H2IA 2FPKA 4XIGS 1GUBA 1IOVA 3DOOA 4B4DA 1E8DA 2QEQA 3UJ6A 5BNTA 1YKFA 1Z0KA 2O8CA 3VTAA 3QFFA 1UPBA 2AYZA 3OLYA 3PNBA 1KO8A 2YC2C 2GVNA 1FE8A 3VU8A 5E95A 5TMDA 2UZIR 3U31A 1BX1A 3P9SA 1T1SA 4X7BA 3WKDA 4CKXA 3GP3A 1U02A 1EMDA 2AN9A 2QV0A 4FW9A 3AFIA 1IPHA 1RYBA 4H3KB 2QAGC 4MZXA 3I04A 2P9ZA 2P6PA 2GNOA 1PZFA 4G0YA 3T7DA 2QRUA 1FLDA 1KK0A 2FWIA 3MGBA 1YMUA 4G5XA 4BNFA 3T1VA 5J2TB 3DZGA 1SRRA 1SOWA 1JQLB 1E9RA 1L4KA 1P29A 2QW8A 1ADBA 3PGA1 4DG9A 1XMIA 3GVPA 3EFEA 1V8DA 3F67A 3R2JA 1FS4A 2X6RA 4IG9A 1RMYA 3RYCA 2H0RA 2W6PA 3EOZA 4QRIA 4RIEA 5FL7A 4JJ6A 1H2YA 2WWIA 3KYIB 4CLXA 3FD8A 4G4GA 2VXBA 1X1RA 5EHZA 2CXTA 4ZVVA 1VLVA 3A26A 3UBMA 4KC0A 3HK2A 1K3TA 1N2ZA 3EOBI 5LZ7A 4KBGA 4CHGA 4M9QA 3SQXA 1X1QA 2YFQA 2ZAYA 1WTCA 2XGSA 3AV3A 1GG8A 3GUZA 1N6NA 2PXHA 1I1QB 3G2KA 3LUHA 2G7ZA 3OWHA 4TV9F 4D9HA 3WVNA 1E5VA 3THOA 1TRHA 1Z28A 3BHJA 1HNZB 3L4JA 1XZQA 2CMFA 1K8QA 2CMKA 2PUTA 2V6BA 1EZZA 1XJQA 1HT1E 2RGGA 5CJ2A 3DE2X 4NHOA 3DYIA 3K8ZA 2D5BA 1P2DA 4N3AA 4OYHA 1XXLA 1OSNA 2ZYTX 1RR6A 1SC1A 1J8QA 2C5FA 2JS7A 2ZSUA 3E82A 4EYGA 1X0VA 4Q1FA 1JIXA 2Q5CA 3R41A 4E7OA 3V4LA 1H42A 1UH5A 4OXNA 4LBVA 3GG9A 4S2EA 4P7JA 3VH1A 5LQKA 2IE0A 4FS8A 4D44A 4DQKA 2CBZA 1J0BA 1QIJA 2DYKA 3AZPA 4ND5A 1WEHA 4EG6A 1NUUA 4CZ2A 8ABPA 3C7CB 3B9RA 1M75A 1WMEA 4RK0A 3LP5A 4HVCA 4BUJA 2RC6A 1AKTA 2WQ7A 3LDGA 4RLSA 3ZY5A 4E4TA 5I5GA 2HRDA 2P9FA 3N0VA 1Y6QA 1Z6PA 4JMLA 1PQUA 4AM8A 5BW5A 5L9AA 1DRWA 1OVGA 1UBJS 3NTRA 4LV5B 3RNOA 4MV6A 2I6UA 3HO8A 1O8CA 3I2IA 4FEYA 5DGCA 3A05A 4MGIR 4FB4A 3B7PA 2AX3A 1QTNA 3EGXA 2GCOA 4AJEA 4OYRA 4QO7A 1LWOA 3WFJA 2W4IA 4UOEA 5JBIA 1T6NA 3N70A 3BWYA 5T4BA 1PJCA 2WTNA 2YMQA 2PR7A 2GN0A 3EN0A 9ABPA 5TMBA 3X2FA 1L5MA 5KU1A 1F60A 4L9RA 1T8TA 3GVXA 4XVCA 2CXSA 1JIJA 1F48A 2B34A 2C7VA 3HXTA 4AG5A 1T4MA 1ZIXA 2NQ8A 4CQJA 1KIMA 1Y6JA 1NVBA 5DNWA 2YXEA 3TD2A 4B6GA 2X8JB 1SU8A 3CCFA 3L4BA 4G2NA 2X0IA 4MCIA 4W7SA 3MMNA 3ZGXA 4JXKA 3LTEA 2F8MA 3WBKA 3I9NA 4NV1A 2DQZA 1XZNA 3MSXA 2HJWA 2JLUA 3C6YA 1IL0A 1JFVA 1I7LA 4X24A 2RIRA 3UJHA 1J8YF 3SZLA 4UHKA 3F78A 3L05A 4UUQA 1GZ3A 1W1IA 3AWIA 3D64A 1O95A 4NBVA 4PYRA 4PVDA 3RWBA 2ZJ5A 1T8RA 2AHOA 4M88A 1L8LA 1ZN7A 1X2EA 3LFTA 3O3OB 4LHWA 4PZ9A 1T25A 4S0XA 3QYAA 1LVHA 2Y68A 3NUZA 1WBJB 1K86A 2EFJA 2P2CA 3GFPA 4TVBA 2IUEA 5TF4A 4DSOA 1OVMA 1TCVA 2WF5A 4TSFD 5FWAA 5DMHA 3WB9A 2FW0A 4MUNA 4R6WA 3HCBA 4Q1BA 2J41A 3AKEA 4ZO9A 2PKQP 3E9CA 3VR4D 2RHMA 4LY6A 3P2MA 3GDOA 2PX2A 3AX6A 4LNHA 4MI3A 1JLRA 5H80A 2ZR7A 3RYFA 4NIMA 3UF0A 4B44A 2UXDB 3DHYA 1V45E 4A0FA 4G0VA 3ICVA 5JOQA 1BCSB 2AFRA 4ZXFA 3CQ9A 1SXJB 1JHPA 1W19A 1J1IA 4G1BA 4JT4A 2ZRQA 4NMHA 5FNVA 1FDUA 5GJCA 2LUOA 2YHBA 3MMZA 1RKVA 1SKAA 3AUKA 3OBIA 3V4RA 1ZN9A 2YWFA 2ZUDA 2EJTA 3IVMA 3ICPA 3ITDA 5GGYA 4C20A 3M81A 1YR7A 5AI6A 4GHWA 2II6A 5AKGA 1GZSA 4CMGA 3UMMA 3HXQA 2ZKLA 4BY9E 4JMPA 2O05A 1CY8A 2H17A 4RLFA 3SD7A 2FCRA 4D9EA 4TYYA 1NZJA 1X2BA 3NW9A 3BFKA 3LVFO 5HF9A 4F4DA 2E89A 3KEMA 3LL7A 3AR6A 5C81A 3ESDA 5TVGA 2FEWB 4YRQA 1LWNA 1XV5A 3IPAA 2BGJA 1LGYA 1AQUA 5KB3A 1OZHA 2O1WA 4QATA 1GUDA 3H83A 2Y8EA 3FVTA 5JR3A 4F4IA 1IUOA 3OLQA 5LKAA 4GSLA 3UMJA 4H1WA 1SG6A 4L6AA 4B6OA 2V96A 2ZAGA 3CRRA 1GNPA 2HBQA 1M8GA 4NCHA 4URWR 2JCVA 2LV8A 2B98A 3DE3X 1VLMA 3JARB 4BLVA 1G8PA 4EW3A 3ZK7A 1QB7A 1HBJA 5LZ5A 2JG3A 1T0UA 1MB0A 2JEZA 3R09A 1FLVA 5DW3A 5F3RA 4PANA 3H9BA 3ZHOA 4EWLA 4YMWA 5KNBA 1SCDA 5DF1A 4HQOA 3R7WB 1HQCA 4BBPA 3EDCA 1BQEA 2D8AA 2C4NA 3E27A 3AI2A 2AC7A 4NCNA 1DINA 4D4IA 2NO5A 5J5CA 4BB9A 1J2JA 3CONA 3DOFA 3C39A 4UU1A 5JCOA 2C9CA 5DU2A 3ZU4A 3KBOA 1GPNA 1BH2A 2A0XA 2IZ5A 3GLRA 5DX1A 4J8PA 3HDHA 3RC7A 4AQDA 3DCNA 2XD9A 3NEJA 1TMYA 1E3MA 3H8WA 4GX0A 3PDWA 3QXCA 3DD5A 2WG1A 2C5AA 4AYXA 3U09A 1GCAA 3B6JA 3O84A 1S01A 4WOKA 5TT1A 4EY5A 3MGAA 4ZK6A 1L5GB 3MCUA 2O52A 1K63A 1XEXA 3GN2A 3QKUA 4H7FA 4NMLA 1DG1G 1XKLA 2O6LA 3ABRB 3G2JA 3Q9NA 3LWDA 1KBQA 1Y8QB 2E49A 4KQ2A 1E6KA 2R7NA 5TGZA 1QHSA 4DCJA 2CEAA 5HM6A 1X7YB 3ITNA 3LIIA 1KHHA 1N8KA 1NG9A 3JQFC 3P19A 1I94B 3UT6A 5IXSA 1I2BA 2H00A 3ADCA 3Q8MA 3H9EO 5EXSA 3D8RA 4IVQA 2PUBA 3SOPA 4OAQA 5K8CA 2O48X 2P7IA 5JS7A 3FB1A 3EBLA 3JATB 4F9GA 3VVLA 4EABA 5A9SA 3EZGA 1SB8A 1LPOA 3O4IA 4GI3A 4HVAA 4U7JA 2OBMA 4U9HS 4ZV7A 1IN7A 1RACA 1U8YA 2I8AA 1SC6A 3U26A 1T3ZA 4ZCMA 3B1VA 1DOAA 1EUDB 5BW4A 4B6PA 1SC4A 4L5BA 4UOZA 3QE4A 2ECPA 5LQAA 1I2AA 1PQ4A 1F7UA 3ZJ4A 2FP4A 2V7XA 1GP2A 3PFIA 4YRNA 5ADHA 2FPUA 5LCXA 2ZTLA 4OQPA 1JTVA 2F7SA 1RYZA 4AX8A 4FGWA 1XQYA 3CLSC 3F71A 3IQWA 1S1CA 1MW8X 2B9VA 5AP9A 1U04A 2C03A 1XVVA 3KLNA 4I6GA 2IHJA 1XUOA 3QBVA 1M76A 1KMHA 3ICCA 5ICCA 2VF4X 1XXHA 1JFLA 1YONA 2O0JA 5M3BA 1YZFA 1P4GA 3FR7A 4HS9A 3D9QX 3NIWA 4P22A 5FBZA 5G0SA 2RGDA 1PLLA 1XYGA 4OO3A 5AVQA 2N46A 3VPAA 1ADYA 5PGMA 4RMGA 1FFGA 1BTOA 3D6TB 1JKMA 1Q0LA 9LDBA 1PV4A 1P8JA 2B25A 1G9SA 2Q5FA 3BMNA 3PLRA 1MPTA 5AOCA 2PUEA 2G5CA 4FBMA 2ZYAA 4CM6A 3WL4A 3VR6H 421PA 5AUNB 5AJXA 1XZGA 1E2IA 2A78A 2XT0A 4DARA 3A9VA 4BMNA 3A7EA 3FWNA 3F74A 2I7VA 4CT4B 3F6PA 3E4CA 1VPWA 3ADDA 2C3UA 4AZ3B 2W2XA 1PVVA 1S02A 2B92A 3IEPA 1I4OA 1NNSA 2J59A 1QBKC 4BX3A 1TO2E 5JAHA 1J9GA 1N7HA 2OV4A 2QF7A 3A06A 4FOPA 4MO9A 2D4HA 2BP7B 2X7HA 2AXQA 3JZMA 1JXQA 2JGDA 2ZBGA 3GLQA 4WK0B 3DLCA 4AMYA 1EBFA 5F51A 4XLLA 1PG0A 2DT5A 2HCRA 2BFAA 1JJAA 3NM4A 2AFVA 3JCZA 1M7HA 3P4YA 1RP1A 5CIWA 3SVTA 3PICA 1N6RA 5KYXA 4NNPA 4UW9A 5AVRA 4ZCIA 1RU3A 1WD7A 1B2RA 2P91A 4WKOA 4TL9A 3X1WA 3TSWA 3PGVA 4L4RA 3WB1A 2GO1A 1CZUA 2WJ3A 3TGWA 2OCDA 3E3NA 2GLTA 2QRKA 2GHQA 3VSEA 4C3VA 3JWPA 4Q9JA 3FZGA 4IZHA 2ZSKA 5ERGB 4EI2A 2AZ4A 2D5CA 4FK8A 4XYMA 1EFVA 1S2LA 2QMHA 1C0LA 3ENQA 4G1CA 4WGFA 4MVJD 2CZCA 2BUAA 2Q28A 1RYYA 1E1YA 3E8MA 3FVVA 4JA0A 2DBYA 1KBOA 4JKOA 4CKYA 1JX6A 1LNZA 5LLTA 5IZ4A 3ABSB 3QEBZ 4Q4JA 1CJMA 4GOOD 3VOAA 3HEBA 3KXKA 3ZXUB 5HE9A 4GYYA 4DPMA 4US0R 1ZRHA 1OAOC 2IZ6A 2XDQB 3L6EA 1LPBB 2FX5A 3OQBA 2XUQA 1OBCA 2IDJA 5ADVA 3KQSA 4JI4B 1DXQA 1SXJD 2PGIA 3L40A 1CZNA 1RQRA 2QRQA 1K3UB 3KOZA 2GILA 3Q8XB 3R5XA 4H7HA 5ALWA 3ZI4A 1PJLA 3WDLA 3ETJA 3QENA 2QN1A 2UVPA 2X9QA 5DXAA 2ENUA 2VWPA 5HP4A 1JHRA 3ZW8A 4BZXA 4QPJC 4M1SA 4QAQA 1EVYA 1KZ4A 2YZ7A 2ZYDA 2VPQA 4RKRA 2DM6A 1U28A 3CIOA 3ZGLA 3I05A 2IQIA 1I5RA 2RKWA 3TL2A 1CZRA 1NVFA 3K35A 4XYLA 2C77A 3LQQA 3QE0A 2HQOA 4CTNA 1FFXA 3ZE7A 2QI9F 2H4WA 4KKVA 4Z99A 3UJ9A 4Y9RA 1LPPA 3JQEA 3QLUC 2AR7A 3Q6MA 3JD1A 1ATZA 2GD6A 2I6TA 2GA8A 4UBIA 2D2FA 3G8CA 2WYWA 3NB0A 2VTKA 2Y92A 4F06A 4HWPA 3HL0A 3UWSA 2F48A 2I8CA 4GD3Q 3MXOA 1QUEA 1PUIA 4HXGA 4MS3B 1II8A 1IN5A 2G40A 2MYUA 3WJ7A 4AKTA 3BQNB 2WUEA 4YBZA 2HDNB 5FLKA 3T34A 3VHLB 4LGMA 4M49A 4WMLA 2AC2A 5JAUA 3QJ5A 2ZAIA 3VR5D 5H8WA 1WCYA 3ZLAA 2P9GA 3IOEA 1A5TA 5KHAA 1YA8A 4KPYA 1MENA 4X1KB 1I24A 5CFOA 3RS9A 1Q50A 3WGLA 1BE6A 1VCIA 1H2ZA 2KI5A 2WZBA 3FWZA 2FQWA 5DISB 5F1YA 4CNQA 3DLPX 1I9CA 2EW8A 1FIUA 1ZJYA 4OAPA 1T6XA 3ZOKA 2Z57A 1M5TA 3GYBA 3B12A 2YV4A 3K6JA 1IUKA 5FB3A 4DB2A 1ULZA 1ZDMA 5ED0A 4YRMA 1GPBA 1OQAA 1YE3A 3R44A 1G3RA 3DPIA 1BZYA 1YQUA 4Q9LA 2IF0A 5B1SA 2EJBA 3JQBC 1IVYA 1OD6A 4QJBA 3ZCXA 1CB0A 3FHJA 1XEWY 5F4ZA 3UUEA 4NI5A 1MW9X 1EFLA 4TLEA 2F1HA 2PKYX 4C14A 1NTOA 4J2OA 1DBVO 3SEFA 2IIPA 4ZRDA 4Q4AA 1HTWA 2B1QA 1VHLA 3EEOA 1OZAA 1GFWA 4L9AA 2OK7A 3AF5A 1TZMA 1UPFA 1V25A 1RVDA 3DOJA 4HLDA 2Q5IA 4WNYA 4XRGA 1ULTA 3C5VA 4GNKA 1V3TA 4P93A 4S3MA 5LU9A 2ZW9A 3SXJA 1NKSA 1Z6YA 3W9UA 2X1MA 4H3SA 3ZH2A 1A5SB 3WHIA 3PUJA 4Q3NA 1Z0ZA 3A14A 2ZE6A 4IMJB 4PR0A 2AK3A 3DDSA 5DNDA 5HUHA 1SO8A 1FMLA 2BBSA 2C9DA 2GK4A 2VYVA 2JIDA 3AO0B 3QFTA 4WESB 3T5MA 4DS3A 4A5OA 2A0KA 5JRDS 4Y2JA 4MUFA 3HCRA 3NPMA 4A73A 3D5QA 4B85A 3WTBA 1XLUA 3KKKA 4JZKA 5C1PA 1PJRA 2M9MA 3DQPA 5JDCC 1KQOA 3JQPA 3TLXA 4FYYA 3ZDCA 3EF1A 1HYGA 1V16B 4P3NA 4ZVPA 3AT1A 3JQQA 3DT8A 4TWZA 3ZWPA 3MJ4A 3U40A 3G8DA 5K0LA 3KCQA 3O3NB 1P1IA 4RH0A 2BMDA 3C6KA 2ZATA 3E7PA 3V80A 1GSHA 1S4QA 4DAEA 3W5UA 3JQGB 4K81B 2IDKA