1OC2A

The structure of nadh in the dtdp-d-glucose dehydratase (rmlb) enzyme
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
346
structure length
346
Chain Sequence
b'QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-GLUCOSE 4,6-DEHYDRATASE
publication title The Structure of Nadh in the Enzyme Dtdp-D-Glucose Dehydratase (Rmlb)
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 144
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oc2A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1oc2A02
1P33A 1Y9AA 1EEHA 3BMNB 3LK7A 1QYXA 3DQPA 2GNAA 3D5TA 4Z3KA 1Q1NA 4B7CA 2AQHA 3DDNA 3GG9A 5AVOA 4E33A 1N1EA 3BMOB 1TXGA 4JBIA 4DBVO 3SJ7A 3EK2A 3DHEA 4FOOA 5JCJA 3C85A 3E48A 3VPSA 1DC6A 3KBOA 2GASA 4RVHA 4XRGA 3LT2A 1U7HA 1XR3A 3WMWA 4ZVVA 4WLEA 2NV6A 2E49A 3MJTA 3QHAA 2NTNA 4YRBA 2BD0A 1E3IA 4NQZA 3UF0A 1WZIA 3ETDA 2EW8A 2P9EA 2WE7A 4NBRA 5LCXA 4D0RA 1IL0A 3JQGB 3G79A 1W73A 4YA6A 5DP2A 3ITDA 3ZU5A 1O6ZA 1I3LA 2FY8A 3C1TA 4JJFA 4KUHA 4BB5A 3UICA 1CETA 4URFA 5TT0A 2BRUA 3WGZA 4NHEA 3OM9A 4PLZA 2Q49A 1OC4A 2OGUA 2AEFA 1R0SA 1DPGA 2EXXA 5A4DA 1R66A 3UFXA 4CMEA 4M49A 4B79A 4IDGA 5IDXA 2P9CA 1I2BA 3CXRA 3W4JA 1ONOA 1VJ1A 5JS6A 1RWBA 4BO4A 5KJ6A 2HKIA 5IXSA 3PHGA 1CQIA 1PR3A 4I9HA 4R5HA 4ZA2A 4IDFA 2XAAA 2I9PA 1QXSA 4IDEA 3JQ7B 4XYMA 1VKOA 3ASVA 1ISIA 3MJCA 1Y9EA 2EGHA 3P7MA 3L4SO 4R68A 3UHAA 3NAQA 2PTGA 3ZU4A 2DTXA 2B0JA 3GUCA 5BSFA 1R0LA 2PKRA 4G2NA 2Z95A 3TNLA 2FZEA 1ENOA 3E5RA 4BQPA 3LDHA 3L0DA 1D1TA 1JKFA 1WAMA 2W98A 5ENVA 5HA5A 2B4TO 1UDAA 4W6ZA 2HQ1A 2VUSA 3DFZA 4CR6A 3JQCA 1TB4A 2ZJ1A 1H94A 4Q3DA 1E3JA 5TT1A 4LN1A 3IQDB 4DLAA 5KJFA 3PZRA 1OZAA 1A71A 3BA1A 4Z0PA 2VZ8A 4R1SA 5CP8A 1HWYA 2RH8A 3WQRA 1E7YA 3WGYA 4R9RA 3ZZNA 2YDXA 2EHDA 4BMNA 3C1AA 1XQ1A 4MINA 4YT4A 2CVQA 2VWHA 3I52A 2QHXA 2X0IA 4HX5A 3JQ9A 3QIVA 3SEFA 3VVBA 4AJIA 5JAZA 4A03A 3LSYA 2RHCA 4TRJA 3JCZA 2Q50A 3UOGA 5JDCA 5L95A 3AI1A 3MJVA 3ROQA 1QV6A 4IGEA 2FOIA 4TRNA 1MC4A 2XF8A 3HNPA 1ONNA 1JLLA 5U9CA 1GZ6A 3HN7A 3MWEB 5I9MA 4FC6A 1N9GA 4BNYA 5GY7A 2YHIA 4YR9A 1RM4A 4CV3A 1LRLA 1OBFO 1YKFA 3MOGA 1XU7A 1ZJYA 3LYLA 3VVCA 4ITUA 4CMEC 4YJHA 1HDYA 3G1TA 3JD4A 4F46A 1HF3A 2B69A 3NEPX 3I9OA 3Q1LA 2VNSA 3R6DA 1HDZA 2WMDA 3HQ4O 3HDYA 1BVRA 4GAEA 2YQ4A 1FDVA 4GLLA 2GF2A 8LDHA 3NRCA 1M67A 2W2LA 3ZU3A 3W4KA 3BAZA 3ICCA 1X14A 2YV3A 2YFHA 2J3IA 1CWUA 2FMUA 5JLAA 4L73A 1DXYA 3K92A 4LISA 2VQ3A 5HM8A 3Q6IA 4L4RA 4IDBA 1R4MA 1NR7A 4GPD1 5FFFA 5KNLA 3E9QA 2EV9A 1HE5A 1T2EA 3NGXA 1FJHA 4NJMB 1NASA 4CMIA 4XB2A 1HSZA 1BXGA 1EQ2A 2X7HA 3ZV5A 1ISGA 4DTIA 2B36A 3I9JA 4BNXA 1AHIA 1GQYA 2DQ4A 4OMUA 1GUZA 2D5CA 3OA0A 2O3SA 4A5OA 1IPEA 3EUWA 3DAGA 3MJSA 3M2TA 1I36A 1X7DA 2EP5A 1UZNA 3DMYA 1VE9A 4Y6RA 3NGLA 4PN3A 1Y8RB 4YJDA 1EUCA 4K6FA 3RFXA 1MA0A 1NVMB 4L75A 2X4GA 3INRA 3PTZA 4N54A 3JQ9C 1GADO 1GYRA 1KY5A 1HEUA 3DAPA 3NV9A 3PQFA 4PCVA 4DLLA 2UUPA 4R16A 3P19A 1HE2A 3GHHA 3PPIA 4CR7A 5BSEA 3I1JA 5JDCC 1RM5A 4GX2A 4FOSA 4XYEA 2DFVA 4JLWA 4NR0A 1ISJA 4NBVA 1Q7CA 3GR6A 4ND2A 1JAYA 1P1FA 5DCWA 4EW6A 1ML3A 4ZN6A 3PGJA 1BG6A 1DFGA 2C0CA 4JK3A 2VZ9A 4FS3A 2D8AA 4P4NA 5AQ1A 1LTHR 1V3TA 1H6AA 4GLOA 4M55A 2JFGA 3H65A 3D64A 3L6DA 3IDSA 1DIBA 5IZCC 2BFMA 4E5NA 7MDHA 4KQXA 1VKNA 2E37A 3IIEA 3D0OA 3DTYA 1R4MB 3VKUA 4Q3BA 1QG6A 2J3JA 2RHRA 4JXKA 4Z9XA 4D42A 4R1UA 4HNGA 4Y8VA 1T26A 4L4XA 2O7QA 5JE8A 4EBFA 1NAIA 1G6KA 4J7UA 2BFPA 4CMIB 5ILGA 1BXGB 3C7CB 1LSUA 3GAFA 1ZK0A 3MJ4A 5TIIA 5IN5A 4TROA 1GFSA 4UEOA 3WGTA 5I7FA 1UP7A 4G5HA 1NQ5A 2VRBA 3W8DA 4NIMA 4J4TA 3DMTA 2X0JA 3WWZA 1NXQA 4IY1A 3TZQA 2AA3A 5GMOA 4R01A 1YDWA 4RORA 3ZWPA 3F9IA 1F8FA 4BNIA 3DZHA 2QW8A 3AY6A 3RUHA 3CE6A 3FI9A 2EF1A 3ZHZA 3OEWA 1NM5A 1PJ2A 3OJFA 4Q3NA 4WASA 4JGBA 3UAGA 4NJOA 1IHXA 5JO0A 5G0TA 4YXFA 1LBEA 3GZNA 1PS9A 1SZJG 4KTTE 4EEZA 3X2FA 2O3UA 2VTEA 4JBHA 3O26A 1YBMA 4MDHA 4XIJA 4XJTA 5K6AC 1UDBA 3PFFA 3H9EO 2CF6A 1N5DA 1M6HA 2HJSA 4FW8A 3IL2A 3A14A 2B37A 4J4BA 5BR7A 2VOEA 3O38A 4TMFA 4E5PA 2Q1WA 2PD3A 5DBGA 3QWHA 5IAAA 4PLGA 3VZSA 2JHFA 3KXDA 4LMPA 4PZEA 3FTNA 2C7VA 2O3JA 4LRTB 1RYEA 3PZBA 3S55A 3I9KA 5HWSA 4FB5A 3FWZA 2VYVD 3R1IA 4I8XA 4WK6A 4E0BA 4AJLA 4CODB 4J43A 4CQMD 2Y1CA 1C1XA 5HBRA 2VYNA 3G3EA 4PLCA 1LA2A 2PFGA 5JBIA 2ZTUA 4WECA 2C07A 2AEMA 4R1TA 2XPCA 4D45A 5H81A 4ALLA 4FFOA 5COBA 3DZBA 3E82A 5JCXA 1P1IA 5BNFA 1XU9A 2AMFA 1I32A 3NT5A 5KVQA 4PG8A 5IDWA 3IP3A 4U6QA 2HSDA 4NFSA 2D0IA 2C5AA 2Y99A 1O0SA 2AHRA 2C82A 4GWGA 4E6PA 3GMSA 2E4AA 2QIOA 2C5EA 2FR1A 4Y9DA 4YB8A 1NP3A 1HYGA 1PZHA 2DKNA 4QO7A 2JL1A 3O9ZA 4WLOA 4QQRA 3OBBA 2HCTA 3HB5X 3IOYA 4XJSA 3ZWNA 5MGBA 5B4TA 3GZNB 3QVXA 1FXSA 5JFOA 5ITVA 5FF9A 1Z82A 3TOZA 4C4OA 9LDTA 2VN8A 4HFNA 3RUDA 2J6IA 3EYWA 3GOHA 1NX6A 3DOJA 3ZHYA 3A4VA 4PLWA 1LLQA 1YQDA 1A4UA 4OKIA 3C7DB 3AUTA 4A73A 4HNHA 1LSSA 3WYEA 5A02A 4UVHA 4BNGA 2AEJA 3TL2A 1KERA 2CDBA 5THKA 2I5PO 1C14A 3COSA 1IULA 2DLDA 4PGFA 4DVJA 1P31A 2B5WA 4N7RA 2B4RO 5DN9A 1U4SA 1P77A 4XWYA 5AYVA 3RC1A 4GBJA 5JXWA 4E4YA 5FWNA 1J0XO 4E5YA 4YAJA 1YGYA 3GDGA 1ADBA 5T57A 1P1RA 1C1XB 4WCFB 2ZTVA 1GUFA 4BNJA 3U5TA 3GFBA 2J3KA 4L4SA 1YXMA 1OFGA 1FDUA 2HLPA 3I4CA 5L51A 2ZB7A 3FPLA 1MG0A 1A9YA 3JD3A 1GPDG 1NPDA 4E31A 3MCVA 3ONFA 2UV8A 1T4DA 1DOHA 4DBZA 3FNFA 3GFGA 1KEPA 3WGHA 4WCFC 4BOYA 2IEBA 4DMMA 5JNLA 1C1DA 1E5QA 1JW9B 1NHWA 2PA3A 5JAMA 4HUJA 3V5NA 3PJFA 3L9XA 4YTEA 3VTFA 3PHLA 1DRWA 3WOHA 4IDCA 3RUFA 3WR5A 1PTJA 4YDRA 1HLPA 2ZQYA 2WE8A 3KO8A 3R3SA 3BHIA 3ZWCA 4CV2A 1EVYA 3E1KA 4RO0A 1JAXA 4TKLA 1U8FO 4FFMA 2WYWA 2FN7A 3JQFA 2IYOA 4U6SA 5ER6A 2BH9A 2G0TA 1NWCA 2O23A 4GL4A 3AOGA 5TC4A 1TEHA 2YYYA 3VAZA 5A9TA 2I6TA 5A3VA 4UVEA 1G0OA 1Y7TA 1RKXA 1H9AA 4AFNA 3Q2KA 4DA9A 1MFZA 1CF2O 4K26A 3RSHA 1DBVO 2IXAA 4Z6KA 4YRDA 3WGOA 4B4VA 2AG5A 3GRKA 4WLFA 5KKAA 4PFJA 1Y5RA 4HBGA 4G65A 1I3KA 3SC6A 3TOXA 3UW3A 5G4LA 1T2AA 3H8VA 3JQAD 3WTBA 1EBFA 2V6FA 2NU8A 1N1GA 3ZWXA 1LDBA 3T4XA 3U49A 1YS4A 2P9GA 5L7TA 3KYDA 3WSVA 1HDRA 3PFWO 2F00A 4ND1A 3D4OA 5A9SB 3ABIA 5JC8A 3UGKA 4FJ2A 1VL6A 4QEDA 2QG4A 4CMHA 4J7CA 3V2GA 3HFGA 4IIUA 2XXJA 3T7CA 2NU7A 3W8EA 1BDBA 4DXHA 1W4ZA 1Z75A 1KS9A 5FEUA 1PR9A 1LLCA 2NQ8A 3AU8A 2OP0A 1P1KA 1ZMTA 4XGIA 2DBQA 4FJ0A 3GPIA 2J5KA 2X0NA 4GVLA 4J2HA 4UAGA 4XZ3A 5CDYA 5G0SA 4DREA 1HSOA 4JX8A 4OOFA 3OIDA 2H1SA 2WTBA 3UXYA 1Q7BA 1ZXLA 2GN9A 2VRCD 1XA0A 4IQ0A 3BTOA 3WWYA 4I5GA 4AJ4A 1EVZA 4B8WA 3TPCA 1QYVA 1LJ8A 1ZVMA 1ARZA 1ZUD1 1T24A 4M1QA 4B4WA 2FR0A 5ILOA 1JKIA 3RBZA 4AJNA 1IB6A 4YAEA 3OETA 1ENZA 3IUSA 4G81A 4MIYA 3BMOA 3E9NA 2O2SA 2VHYA 4P4GA 3E03A 2PGLA 3I9MA 1CEQA 1CJCA 1DLJA 1L7DA 3DO5A 3JQFC 4FCCA 1JU9A 2X8LA 3U4DA 3SC4A 1X7HA 3QSGA 3OSUA 4TVBA 2GLXA 4J3FA 1PJ3A 1EZ4A 4QXMA 4W7HA 3ZWOA 2P5UA 1W6UA 1P0FA 1LI4A 5FI5A 3WFIA 4Z0TA 5K9ZA 5BNIA 4IBOA 1WXDA 4WKGA 2CY0A 1GEEA 2O3TA 4ZRMA 3QLJA 2CVZA 1DFHA 4UVIA 4XYGA 1P74A 1UXGA 3INGA 4L9RA 4BNWA 1NPYA 3W6ZA 2PV7A 4R3WA 1P3DA 3IJRA 5DOVA 4OQYA 1XLTA 4O5OA 4INAA 4GMFA 4QFCA 1E3LA 1NR1A 2O4UX 3WNQA 1NQOA 1ZEMA 1QORA 1VJTA 1R4NA 4J90A 2I99A 4DLBA 3P2OA 3AU9A 5MDHA 3KTDA 1B8PA 2YY7A 4IZHA 2X23A 1E7SA 1GEGA 4XYBA 4WNCA 3DOOA 2A9FA 3SVTA 1W0CA 3CINA 4CM6A 1I8TA 4GGPA 2G1UA 1YB1A 4CLEA 4M8SA 3JQ7A 2OXIA 1Y81A 1MP0A 3I6QA 2W90A 5TLSA 2ZTMA 3ADOA 3MTJA 3WIDA 4CM3A 2OUIA 3KSZO 2HMWA 5B12A 2HU2A 5L9AA 3RAJA 3DTTA 1I2ZA 1GQQA 1EVIA 1UR5A 4XIYA 1S7CA 1LQUA 3EVNA 4QX6A 4PLFA 4BHTA 5HS4A 2CDAA 2OL4A 3L6EA 3S2GA 1I10A 1GZ4A 3RWBA 1SC6A 5CPBA 2Y05A 3BZUA 4PLHA 5TX7A 4E5MA 1LDMA 3CH6A 4LRSB 5AOVA 4YQZA 1K5HA 3DZIA 3JYNA 4NMHA 4I1IA 3TJRA 1HETA 4IIVA 2DTDA 1PEDA 4DUPA 1E6WA 1K89A 4XYLA 1J4AA 1FK8A 4IXTA 3ZNNA 2LDXA 1NHGA 5EL0A 1MV8A 3GVIA 1MXHA 2HK8A 3BTSA 3H9JA 3HHPA 4DPLA 1DAOA 1YQGA 1CYDA 4YJFA 3V8BA 1ZFNA 4AL4A 3N7UA 2FSSA 4J1NA 4R4JA 1MGOA 2ZQZA 4LCJA 3WNVA 3DFUA 4XQCA 1XKQA 5A03A 3KEQA 4DGSA 1E6UA 1UZLA 3I23A 3ON5A 2GGSA 1H9BA 3FNHA 1V0JA 2LDBA 1R0KA 1GCOA 4RF4A 2Y1EA 1R4NB 1AUPA 4GMGA 1ZK1A 2DAPA 2WEKA 1ENPA 1SPXA 3TWOA 4YBZA 3VKVA 3OQ6A 1SEVA 3VH2A 1XQ6A 2DTEA 3CZMA 4MVJF 2JFFA 3K6JA 2ZB8A 5GZ3A 1DIRA 3FD8A 4KTVE 3GH3A 2G82A 3WXBA 1GTMA 5G2OA 2BFOA 4BNNA 3KLMX 2OOSA 2D59A 3BYZA 4GWKA 1EUDA 4CL3A 3ZV3A 4H3VA 3BMCB 4BGVA 1EK5A 1YBVA 5BQFA 4MVJI 1FDWA 4OXKA 5JSFA 4EUHA 4RVUA 5BNTA 3FRJA 1E77A 1UAGA 1IZ0A 3RC9A 5AXAA 4E21A 5L4LA 1U2GA 2GDZA 3ADPA 4BNLA 2ZIZA 1U5CA 1XGKA 3PYMA 4I5DA 3K2BA 4MIOA 4IZIA 2BI8A 1PJBA 3EC7A 2OP1A 3H9UA 1ZSNA 2YQ5A 4AJPA 1D7OA 1GY8A 1D4FA 5A04A 5BSHA 1GV0A 4NJMA 2NM0A 1EUZA 3SX2A 1PWZA 2ZCVA 3LU1A 2C29D 1U3VA 1Y5MA 3OHSX 2JFHA 2JAPA 2PR2A 2HRZA 5JYDA 4QUKA 1LQTA 1IY8A 3KM0A 5F21A 1EFKA 1DRUA 3S1LA 1ZKMA 4J16A 1HL3A 3A1NA 4GX5A 3FSRA 4DL9A 3GVHA 2FPIA 1VSVA 4YJFB 3ULKA 3IKVA 1ZEJA 1Y8QB 4MJLA 2D2IA 3RI3A 1AE1A 1Y8RA 4GSKA 3PYXA 1NVTA 4MOWA 1H6CA 3LT0A 3PQEA 3B1FA 4J4HA 1GQ2A 1PJLA 3GZ4A 2GZ2A 4WLVA 1EFLA 2YV2A 3B70A 1S6YA 3AUUA 2I76A 1C0IA 2JJYA 2B35A 4TVOA 4BNTA 3O03A 1RPNA 5CDGA 5LC1A 1PJTA 3U62A 3H2SA 2EIHA 3OH8A 4D79A 1DJNA 1ZCJA 1OAAA 2X22A 2BKAA 1HZZA 2GERA 2W4QA 1QMGA 3NT4A 3O8QA 2JD1A 2ZYAA 2QRKA 4IQGA 5JCJD 1VL8A 3DAFA 1E7RA 1GU7A 4ONEA 1F14A 5IZCA 1XIVA 3RIHA 4CR8A 4OQZA 4RQTA 2CMDA 3D5QA 3VTZA 3DC2A 4DC0A 2JCVA 4ROSA 2PKQO 4B7UA 4TSKA 4R1NA 5DBIA 4NFYA 3RFTA 1C3VA 1JN0A 1TT5A 5DCYA 3G0OA 3OICA 4Y6SA 2CD9A 3R3JA 3PGXA 3EZYA 3PI7A 2Y1FA 4J7XA 5KVSA 4RPLA 4YT5A 1KOLA 4OKNA 3ONDA 4IS2A 5C7OO 5TRTA 4W7IA 2DBRA 4K1LA 4RPGA 3ZWVA 4DWVA 2VUTA 2AW5A 2NTVA 1F8GA 3TL3A 2X5KO 5EIOA 4IJVA 4ILKA 2GN8A 4UULA 1VI2A 2VCYA 4KQWA 4WUVA 2UVDA 4JJIA 2HJRA 2YZ7A 5F1OA 2JAHA 1VLLA 4NDNE 3PJGA 4UUNA 4IJUA 5T6BA 4UEJA 1J49A 2AE1A 3HSKA 1SAYA 3B6ZA 3RD5A 1U3WA 1ZH8A 1QR6A 1YJQA 3FNEA 3WIEA 2F1KA 4QTZA 1JWBB 1U3UA 2YDYA 1NQAO 3AI2A 1AN9A 1Z7BA 4BKPA 4NBTA 2OFPA 5I9LA 3EVTA 3LLSA 5K6AA 1LEHA 2OORA 2I3GA 4DQUA 4GKVA 4WGGA 1GYPA 5TS3A 4XCVA 1HZJA 2NLOA 1I33A 2VYVA 3EZLA 3C1OA 2Y1OA 3RFVA 1EDZA 4Y67A 5BT9A 1B2LA 1BXKA 3LT4A 4D43A 5KJCA 3WGGA 4CQMA 1Q0HA 1FF9A 2OO5A 4W9NA 3K9QO 3O8QB 1O94A 4ALIA 2P68A 1OOEA 2G5CA 3GNSA 1AXGA 4GQAA 4BO2A 2Z5LA 4DYVA 4IGFA 4I5EA 3IP1A 3PIIA 3AM3A 3ONEA 4XDZA 4PG7A 1HTBA 2JCYA 2WJPA 3NTRA 3ZHBA 4NG5A 4R51A 3ETEA 4KDEA 3NT2A 4BQRA 4BNHA 5JY6A 2EWMA 1E3WB 2YV1A 1AGNA 3CZRA 2O50A 3AM4A 5JYEA 1TT5B 1LRKA 3RC7A 2X86A 3ZI0A 4OJNA 3PEFA 3PXXA 1T1RA 4X54A 4YEDA 2Q46A 3F6YA 3WQQA 1QYCA 1T2FA 2PY6A 4MP8A 3PLNA 3ZW9A 5CFZA 2IXBA 3DXFA 1L1FA 5JO9A 2QRLA 3A06A 3CPSA 3HDJA 1DJQA 2VT3A 2D4AA 2CNBA 2JHGA 5KTKA 1PQPA 4Z3DA 3QV1A 3K31A 1LU9A 2W2KB 1YOVB 4XGKA 2A94A 5FYDA 3QWAA 1ZSVA 1U5AA 3M2PA 3PWKA 4YCAA 3UVEA 3WDSA 5I8WA 1BSVA 2HK9A 4U7WA 1KEWA 1FMCA 3SLKA 5ICSA 4XD2A 3ST7A 4RZHA 1JQBA 4N5MA 4N5LA 4L74A 3OIGA 2G76A 1QKIA 2I65A 1PZEA 4E3ZA 2YJZA 4GKBA 3DWFA 3I6IA 3CMCO 4RVSA 3VH1A 1K6XA 1WVGA 2PK3A 4GI2A 3W6UA 2X6TA 3WMXA 1PL8A 1C0KA 2CFCA 1UAYA 3E8XA 3A28A 2EKPA 2HO5A 4KWHA 3FR7A 4NK5A 3JTMA 4KZPA 1JA9A 2X9NA 1Q0LA 4CQMB 1NFQA 2W8ZA 3LF1A 1C0PA 5A06A 1P45A 3N58A 1YDEA 3TQHA 3OF2A 3GC6A 5IXYA 3DZFA 1UP6A 2Y67A 3VDRA 3RVDA 5IJZA 2V7PA 4BO7A 4DRYA 1IZ9A 2Q4BA 5G0UA 3PDJA 3H6KA 3R0IA 2EJWA 4HXYA 5TJHA 2YHUA 2X9GA 4I5FA 4MP3A 4W9NC 3AK4A 1PQWA 3ZWAA 1M76A 1K2WA 2BI7A 3HDHA 2I67A 3I83A 5IF3A 4AICA 1D3AA 2ZTLA 1OC2A 2FWMX 5DOZA 1ISHA 2OBYA 4FR5A 3ZV6A 1GCUA 2RBEA 3RU7A 3WS7A 4DIOA 4CV0A 3M1LA 3NJ8A 4LGVA 1ISMA 2HAEA 3PRJA 4DIFA 5JDIA 4OXNA 4WCFA 4E2WA 5IG2A 3V1TC 3ROPA 4RZIA 2ZB4A 4I9UA 1B3BA 1NFRA 1WZEA 4ZQEA 2ZATA 5KJ1A 1J6UA 1VC2A 3RC2A 3H7AA 1JKJA 1U2DA 4PIVA 3QP9A 4GSLA 4CMBA 2Y1DA 1VPDA 2WM3A 4WEQA 4UUPA 1QRRA 1MUUA 2TMDA 3TRIA 1NAHA 2J8ZA 1N2SA 4MVJG 4NU5A 2R6JA 4XRRA 3F5SA 3FPCA 3TF5A 4CV1A 2C59A 5EQFA 1SEPA 4RVFA 1N7GA 3CMMA 3RASA 2CDCA 2FRDA 2WD7B 1KEVA 1NFFA 4NZ9A 1Z6ZA 2BGLA 3PIDA 3SLGA 3IAHA 3P5SA 5L3ZA 4MVJM 4TZTA 3OJLA 5H82A 1KETA 2Y0CA 2J5QA 4UUMA 5F1PA 2AXQA 1E5LA 3H5AA 4II3A 3RUCA 3RBXA 3W1VA 1HDCA 3C3XA 4AG3A 2CSUA 2AQIA 4RF2A 3I4FA 4KWIA 4ALKA 2XOXA 4NNJA 1DSSG 1J5PA 1XHLA 1YJ8A 4MVJA 4YPOA 3DZGA 3SJUA 1TLTA 1ZK3A 3IJPA 4NPCA 3SBOA 2RCYA 2PZMA 3EDMA 1JVSA 2BMAA 4CLOA 2P91A 4I9NA 1EE9A 4EZBA 5JAQA 2HMTA 1Q7GA 4MKRA 1LSJA 4ND3A 3D4NA 2C2YA 2YW9A 3KEOA 3ENNA 3VOSA 2GN4A 5I7EA 1DHTA 2Y66A 1I5RA 2H6EA 5A9SA 1HXHA 2CF5A 5IDYA 5TNXA 2O48X 3VPHA 3VZRA 2PGDA 1T25A 3C7AA 3WYCA 5COQA 3DBHB 3OA2A 4QFDA 2VHZA 3RU9A 1XELA 3T7EA 1FDTA 1XCBA 1X1TA 1Q2XA 3AOEA 3K8ZA 1DEHA 3GF4A 5JDIC 2IEDA 3UCFA 4E30A 4IQ8A 3WSWA 1A4IA 3QVTA 3TZHA 1PGNA 5TJ9A 1H6DA 4F6LA 3TSCA 2DU8A 2VUUA 4L0QA 1U7TA 3KOUA 1DDOA 1GL3A 4JROA 4WLNA 5THQA 4EITA 1BWSA 3PLRA 4HP8A 4CMJA 2PNFA 4EYEA 2IYPA 4EUEA 1HT0A 2VTDA 4XB1A 4B8ZA 4D41A 4NK4A 3JQAB 1P1JA 2EKQA 3BMQB 3V2HA 5G0VA 2E82A 5LDGA 1V3UA 5C7IO 4D7AA 3EY4A 5A5EA 2D1YA 1YE3A 2DUUA 1R12A 1SNYA 4TRRA 2GN6A 1PQUA 1B15A 4AJ1A 1V3VA 1WNTA 3DB2A 3QA9A 3RQSA 4DC1A 3FNGA 4BO6A 1X1EA 4OXYA 1Y1PA 3UH1A 4AJJA 4CLHA 1LDEA 1MFPA 1A7KA 1HYEA 2VYND 4MVJP 4N5NA 4E5KA 5IZ4A 2EP7A 2I66A 1U8XX 4OO3A 4E13A 1I3NA 5CAEA 3ETGA 5KIAA 3HADA 4YYZA 3H2ZA 2NVUA 4FIZA 5I7SA 4CLOB 4CLRB 4BGIA 1UZMA 4D0SA 1DFIA 3ANNA 1ZK2A 3H3JA 3EAGA 3M1AA 1PJQA 1YB4A 2JD2A 4M54A 4ESOA 5A3JA 2BHLA 5I7VA 1IYZA 2IDZA 1LDNA 2B4QA 1MC5A 1E3EA 3GA0A 3I5MA 3TN7A 5F5LA 5IDQA 3PQDA 5EERA 3KUXA 1KVSA 1G1AA 2DBZA 2O3RA 3CUKA 1GYQA 4J6FA 5HRUA 4CJXA 4CM9D 3QY9A 3ZW8A 4ALMA 5C7LO 4P38A 3MTGA 4LCEA 4EUFA 4AJKA 3VPGA 2ZYGA 2X0RA 4HKTA 3AOEC 1LDYA 3NJ4A 2NADA 1GR0A 1ZIDA 1NWHA 1B14A 1PX0A 2RIRA 3GVPA 4NFHA 4P8RA 1PWXA 2OMEA 5KOIA 4WE3A 2BGKA 4O63O 3ENKA 4IMRA 1IUKA 2D5AA 2NACA 1ORRA 1R15A 6LDHA 4MKXA 1YL5A 3LLVA 1DO8A 4E2XA 5JPIA 4D3DA 3W4IA 9LDBA 5JAIA 1YBAA 3BTVA 3PJEA 5ENDA 7ADHA 1TT7A 4WOJA 2VWPA 4QO8A 1WMBA 3ZDFA 2FHSA 4O0LA 3PHIA 4O59O 4GH5A 3L4BA 1UXHA 1DAPA 1H2HA 5ER9A 3K2EA 4NU6A 4B3HA 3U0BA 4BNKA 1MLDA 1LC0A 3MEQA 1DB3A 2FSVA 3VH3A 4YWJA 3Q3CA 5KVVA 1F12A 1ADGA 1N92A 1LUAA 1SCUA 1X15A 2PD6A 3DBLA 3OJ0A 4JN6B 4Q3CA 1K6JA 1P44A 4OH1A 2NVUB 3TDKA 3TFOA 4ALJA 1Z7EA 1GD1O 1HE4A 3RKUA 1PS8A 2Q1SA 1UP4A 2GPTA 1YQXA 4IJKA 5G4KA 4BO5A 4RDHA 2EKLA 1AHHA 4FFLA 2UYYA 1BVUA 2C7GA 3GT0A 1B26A 1B8UA 4KUGA 1ULSA 1K0UA 5IFLA 4K9DA 5JC1A 1O5IA 4XX0A 3E18A 1TVEA 3H5NA 2WYVA 1BRMA 3GAZA 2EEZA 3OFSA 3SXPA 4ZQFA 1I2CA 3H3FA 5EINA 4B7XA 1CRWG 2WYUA 2Q3EA 4TRMA 1GZ3A 3LF2A 3D1LA 4Q39A 5KJEA 1OMOA 5U1PA 2H9IA 2VT2A 1VSUA 3ZNOA 4DPMA 3U3XA 3B20A 3GEDA 4PZDA 2SCUA 3IS3A 3TFQA 3RUEA 4B3IA 5A1TA 4BNMA 1X0XA 4OAQA 4CMAA 1KVRA 1W8DA 5L7WA 4PLPA 3BMCA 1Q0QA 4F6CA 1T2DA 2CZCA 3OJOA 3RCBA 1Z74A 3GY0A 4JIGA 2X1HA 4GX0A 3OQ1A 4BNVA 2EERA 4LSWA 5DULA 1B0AA 1E0DA 1NPTO 1NTOA 2V6GA 3ZNPA 3GGPA 3IC5A 1N8KA 3EGOA 1ZW1A 2ET6A 2NQTA 4AJHA 2IRWA 1QSGA 3WBBA 3WJAA 3K30A 2Y0EA 1A5ZA 4AJ2A 2GYYA 3WLFA 1NBOA 3H9GA 2PH3A 4BUCA 4E2YA 3DBLB 4IINA 1Z73A 5K0ZA 3L4BC 3GRPA 1JVBA 5DT9A 3HN2A 1YONA 3A9WA 3W8FA 1XEAA 3IMFA 3BXXA 4R5MA 2UDPA 4TKMA 3JD2A 3VC7A 5G4KB 1Y8QA 4FN4A 2FZWA 3AFNA 4O6VA 3V2UA 5C5IA 1HE3A 4CQLB 5L40A 1Z45A 3BIOA 2DVMA 4NI5A 4RV9A 3HUDA 1LX6A 3F5QA 1QYWA 4WLUA 5EN4A 2PZJA 1A9ZA 2FPPA 3CSDA 1G0NA 4NBWA 4OL9A 4PVCA 4DQXA 4XA8A 2YFQA 4J1SA 1KC1A 2ILTA 2VWQA 1LLDA 4K28A 4BKUA 1N7HA 4CUJA 4JCOA 3HB4X 4XR9A 1LC3A 1YVEI 4FD3A 4BVAA 3FBGA 2TMGA 1KVTA 2R00C 3VPXA 2Y93A 3QRWA 5DP1A 4ZU3A 1LDGA 4BNZA 4Y6PA 4ND4A 2E48A 1A72A 3JQ6A 3NDIA 1PJSA 4XDYA 3ZWBA 1YB5A 3KV3O 4MVJH 3F46A 3FN4A 1BTOA 3GGGA 5EMHA 1TI7A 1M6WA 3F1LA 4J9VA 4XEHA 2OHXA 5G0WA 4YRAA 3KRTA 3GQVA 4MO2A 4BKQA 2P2SA 3RUIA 4IM7A 5JY1A 4FFPA 1IE3A 3KVOA 4WJZA 5JW6A 3JQ8A 3JD1A 5CPFA 3QQPA 2B5VA 3WYBA 4LMRA 4MVJE 3ZV4A 4EJ6A 3AWDA 3JD0A 1F17A 4BO1A 1SOWA 3LZ6A 1BMDA 2Q2VA 1ENYA 4IMPA 3Q2IA 4ZHSA 1GPJA 3GDOA 3OEYA 1SB9A 3ZU2A 3JQEA 3KYCA 3OQBA 3DBRA 3INTA 4ZGWA 3DHNA 3H4VA 5TSDA 2QX7A 4FSHA 4K6CA 3DEYX 3GHYA 1CQJA 2FR8A 4EI2A 2ZJ0A 4PZCA 4CUZA 4S3MA 3QVSA 5T5QA 3PVZA 1DIAA 2Q2QA 2DFDA 4Z9YA 2VOJA 5HS6A 2GSDA 3L07A 4RVGA 4J9UE 4A27A 3DL2A 3G1UA 5L4SA 2Z1MA 2AQKA 1U1IA 1V8BA 3LVFO 1HLDA 1E3SA 2DC1A 5JMWA 4UVGA 3CIFA 3STHA 1K6IA 1QLHA 1YWGO 4RPJA 3UUWA 2HRBA 3DONA 1DC4A 3HZZA 3AFMA 2VHVA 1RYDA 5HTOA 1E7WA 4YT8A 2O7SA 1VM6A 3KB6A 1EDOA 3E5MA 5CDTA 3ZHXA 4O1MA 2GZ1A 3ZWYA 4DPKA 1PL6A 3VH4A 1B7GO 1O95A 4R54A 1BW9A 3JYLA 3EMKA 3JYOA 3MJEA 1E3WA 2P5YA 1SBYA 2QYSA 3D3EA 1E1KA 3ITKA 3FR8A 4IDAA 2NVBA 1YL7A 3AI3A 3ZN2A 1PGJA 2IZ0A 4D46A 1PZFA 3UN1A 4YAIA 4R41A 1SMKA 1PZGA 3DZKA 4P4LA 4F45A 5DZSA 2QZ9A 3PJDA 5L53A 1C0LA 2BFAA 2C20A 2NVWA 4LSMA 3TZCA 4KUEA 5CEEA 1I01A 3JQ8B 3LC1O 4B3JA 1WMAA 2GD1O 4EDFA 3L9WA 4C7JA 2BELA 3ZNQA 3NDRA 1IPFA 1B16A 2BF7A 3QWIA 1I30A 4J0FA 2CUKA 5EJ2A 1B8VA 3OP4A 3MZ0A 3WB9A 2DM6A 4D3FA 4HY3A 1ADCA 1L7EA 5EESA 3GNQA 3ROKA 2W2KA 2NU6A 1YOVA 1ULUA 1ZK4A 3KYCB 1GUYA 3DBRB 1DC3A 2FP4A 4ND5A 3F3SA 1T1SA 4J91A 3G49A 3WQSB 3H5RA 4CMGA 4H15A 1BGVA 4XQGA 2FPGA 3B1KA 5A05A 1A27A 1FDSA 4YJGA 1E1LA 2E6UX 4W4TA 3WBFA 5KVCA 4DYDA 4Q3AA 2IODA 2DPGA 4BNUA 3PYLA 3U09A 4EGFA 3GLQA 4LVCA 1BHSA 2WWRA 4MKZA 2WD8A 4IDDA 3PWZA 4TQGA 1DLIA 3U4HA 3HG7A 3JQBA 4OIMA 1HRDA 5CG1A 2JKVA 3U9LA 1M75A 3GVXA 3RBVA 1DIHA 3VDQA 2H63A 2X5OA 1M66A 1V9LA 3T4EA 4JJGA 3GVCA 1I24A 3IKTA 4R9SA 3ANLA 4RJTA 2RH4A 2HDHA 4JNKA 4CM7A 1MXFA 3UCEA 3AW9A 1YH3A 3DBVO 4BMSA 1BW9B 5TGDA 4A7PA 1TA4A 1EVJA 3U4CA 1CDOA 2O2YA 1P9LA 1GAEO 1D8AA 1N9GB 1ZBQA 1O8CA 5KKCA 3KYBA 1HYHA 4PRKA 2YHIB 1XYGA 3O4RA 5L45A 1HDOA 2EG9A 4HFMA 1ZSYA 3NUGA 1HKUA 5ADHA 3LQFA 4M89A 1ZO8A 4GVXA 1YRLA 1E92A 4YJHB 4MPDA 4L8VA 1LXCA 1IHYA 1ZXBA 3KLPX 2Y68A 2J5RA 3OJEA 1WDKA 4PG4A 4ZJUA 1P1HA 4WOKA 1E7QA 4CMKA 4A26A 3I9NA 4ZICA 3FTPA 1BDMA 1UDCA 3H9QA 4J0EA 2X9VA 1DRVA 2C2XA 2AG8A 4JBGA 2ZK7A 3WFJA 2J3HA 4BNFA 2OZPA 1JTVA 3I3OA 1DC5A 2GRAA 4BKRA 2DT5A 3FHLA 4FGSA 1JWAB 4BL5A 4XGNA 4CM8A 5ICMA 2RAFA 1UH5A 1QYDA 4YJGB 3ORFA 2NTJA 2DBVO 5B4UA 4BV8A 3LT1A 1XSEA 2Y0DA 1EE2A 4BO9A 1LRJA 1VL0A 4PRLA 2AQ8A 5T64A 4A10A 5GZ1A 3ZWMA 2GZ3A 5B4VA 1HDXA 1KIFA 2WD7A 5JMPA 4BO0A 4IXWA 4IUYA 1PL7A 3ROMA 1PSDA 3FBTA 3ZWWA 1ZMOA 2GO1A 4AJOA 2W2LD 4BKOA 4YAKA 4Z0HO 2BLLA 2EJVA 2EW2A 1JDJA 1QP8A 1RM3A 3D3WA 2DPHA 3AJRA 4D3SA 1UUFA 1XWFA 3AY7A 4OM8A 4H16A 3FCOA 2Z1NA 1KVUA 1ADFA 2XXBA 3JQBC 4BIIA 1PS0A 5T8KA 1UJMA 4ZD6A 5I9NA 1VJ0A 2A4KA 2VZ0A 2JD0A 3PK0A 3VZQA 4OOEA 5ES3A 2OBNA 1XG5A 3CKYA 2VHXA 1U3TA 1PIWA 3X2EA 1F0YA 3S2IA 3JV7A 3C8MA 3AUAA 3F1KA 3LC2O 3JYQA 4KDFA 2C54A 3PDUA 4S1VA 2WDZA 1ZZEA 3D4PA 3QJ5A 1EMDA 4UREA 3L77A 2PH5A 5CDUA 2PD4A 2O3QA 4QECA 1M2WA 2ZCUA 1IOLA 4U0JA 3DBHA 4C7KA 4XKJA 4OSPA 3UKOA 4DQVA 1WPQA 4JP2A 4ZQBA 3F47A 3K96A 4L76A 5EPOA 5KWEA 1E7MA 3RJ5A 3DR3A 4CL8A 4AVYA 1H0KA 1KEUA 4CM8B 3GN1A 2NU9A 2PGJA 2V6BA 3PP8A 3JQDA 1R37A 1NVGA 3CTMA 4H7PA 4Y98A 2QYTA 4CMCA 1EK6A 1VRWA 1PJ4A 3ASUA 3Q11A 3GDFA 3QW2A 5J23A 1ZJZA 4XQ9A 3OMLA 4BGUA 1EQUA 3JQAA 4TZKA 3HJAA 3BMQA 4RLHA 1R6DA 3OECA 4DMLA 2HMUA 4XR4A 5T67A 3ANMA 2YUTA 3NYWA 4LW8A 3F4BA 3QVWA 2GCGA 2NUAA 5A5FA 2NNLD 2PLAA 1LSOA 1SOVA 4EJ0A 3QE3A 3AY3A 3D3WB 3KHUA 3Q9NA 4J1TA 4B4UA 3IUPA 3TZKA 5F1KA 4E12A 5TQVA 4M86A 2HMSA 3HDQA 1PJCA 3GEGA 5L7YA 4IPTA 2O4CA 2QZZA 4FFRA 3DOCA 5DDIP 3DMTC 4WNIA 1KYQA 4ZQHA 4P22A 2Q1TA 4WCDA 3TZ6A 4JQCA 4CLDA 4CM9A 3NTQA 5COAA 1SB8A 4BMVA 2HMVA 4II2A 4OYRA 1WDLA 4W99A 4CM4A 3MOIA 2IZ1A 4CUKA 4ZRNA 4CLRA 2HK7A 3DZJA 5T8KC 1MB4A 3V1YA 5BSGA 4KMSA 4OHUA 1KC3A 4WPGA 5L4NA 1H5QA 2VNAA 3K73O 4RPHA 2VRCA 2PZKA 4CPDA 1NNUA 3KSDO 2GR9A 4HFRA 4R3NA 4R69A 2Q1UA 3EW7A 3KZVA 4PVDA 5IN4A 5CG2A 3BHJA 2Q45A 1YL6A 2Q99A 3F4LA 4RDIA 1H93A 5CDSA 5C3MA 5AXBA 3QVOA 1KY4A 3GGOA 3ZGYA 1CERA 1WWKA 1O89A 5A9RA 5I8ZA 1PGQA 4EJMA 1U4OA 3GPDG 5C37A 5CEJA 1T4BA 5LDHA 3WGQA 1UXJA 4QSMA 5DBFA 1WW8A 3N74A 2I3AA 4J1QA 2PZLA 1EBUA 2WSBA 3RROA 2NSDA 2AE2A 5AXDA 1HDGO 1MX3A 1E1MA 4KP7A 1PGOA 5U4QA 4FPXA 4BO3A 1T2CA 3PHHA 4A2CA 4YVFA 1O9BA 4IS3A 3B1JA 4RGBA 5GZ6A 1V6AA 3KETA 3RKRA 4U5QA 4Z9FA 2B83A 4NH4A 2H5LA 1PGPA 4OSOA 1AXEA 4FGWA 3RUAA 3WICA 2VHWA 4GX1A 2POQX 5AXCA 1GV1A 3GMDA 4TWRA 4ALNA 5B37A 3GK3A 2QQ5A 3OIFA 2A35A 4LVUA 4CM4B 2R2GA 2A92A 1WDMA 3S8MA 4RF5A 3FF4A 3NKLA 4CM1A 2EGGA 3D7LA 3C24A 1U9JA 1YO6A 2BGMA 4UEKA 5CEFA 3I9LA 2IZZA 5B1YA 4YT2A 5KCZA 1I3MA 3GNTA 4HFJA 1NQTA 1DHRA 4W82A 2IE0A 3FWNA 5EQDA 2JCXA 1LLUA 2PWZA 4FDAA 3QWBA 4PLYA 3GUYA 1H6BA 4RQUA 4BS9A 3UCXA 3GN2A 2CVOA 4M87A 3DHYA 2DUWA 3P2YA 4PLTA 3S2EA 4RCVA 4I08A 4UVDA 1PU2A 4EEXA 1UXKA 2ZYDA 3PWSA 4BV9A 4RF3A 3L6OO 1R16A 3Q0EA 1KBZA 4BO8A 4U8GA 4Q9NA 2UUOA 4HWKA 3RJ9A 4JP3A 4UUOA 4MVJD 5DNAA 3ZH2A 1C1DB 1ID1A 1U28A 2GUGA 1WLYA 4J49A 4B4OA 3KSUA 2VWGA 3WLEA 1CIVA 1XDWA 1E1NA 2ZKLA 3S2FA 3G17A 4A0SA 4FJ1A 3LC7O 4BB6A 1ONPA 2V6MA 5DF1A 2D3TA 2P4QA 4ZQGA 4YAGA 4IJWA 4RLSA 1B3RA 1RM0A 1Y6JA 4CLXA 4YQYA 2PKQP 1V35A 2HUNA 3MWDB 3BMNA 4LK3A 1SO8A 4OGWA 3EHEA 3HE3A 4AJEA 1ZNQO 3HFSA 4FFNA 4HV4A 1D1SA 3E9MA 4FQ8A 4PG5A 1ISFA 5F3RA 5FI3A 1OI7A 5H83A 1GDHA 5DCUA 3BTUA 1WP4A 4RL6A 3PHJA 1MG5A 3NTOA 2P4HX 4ID9A 4RPKA 3BHMA 1K3TA 4CQLA 3GG2A 3QWFA 3CEAA 2R00A 1QLJA 1QV7A 1RJWA 3JSAA 4FC7A 3WG9A 4DIBA 1I0ZA 1LNQA 3ICPA 4HADA 4BGEA 2V65A 3KYDB 4E2ZA 2QRJA 3JQGA 3AM5A 4E32A 5TF4A 3VPFA 8ADHA 4MIEA 2UAGA 2NWQA 3WTCA 1KVQA 3WJ7A 5ITWA 1X0VA 2ZB3A 4WEOA 4CM5A 4YACA 3V1UA 4Q3EA 1H2BA 4KOAA 1X13A 2Q4EA 3K5PA 3NDJA 4GGOA 4D44A 1P0CA 4PLVA 4FBGA 3E6AA 1X7GA 4RVDA 2Q2WA 2X58A 1A7AA 1DIGA 4U0KA 3VZPA 3VHRA 1UXIA 4F3YA 5F5NA 3HWRA 3U4IA 1F06A 2X5JO 3WGIA 3GEMA 4NBUA 4PG6A 2Y1GA 4N18A 6ADHA 4MP6A 4J2OA 4XQEA 1NYTA 3JYPA 3NX4A 1BXZA 3Q9UA 5CHEA 1E6EA 2G17A 3WX0A 3ZCXA 3M6IA 4QT0A 3AUSA
chains in the Genus database with same CATH superfamily
2GJ8A 3W5SA 2XNSA 3HJFA 1ZIYA 3DA8A 1XYVA 1QYXA 4QHSA 2NG1A 3FCAA 2GNAA 1TMGE 4D92A 4Z3KA 2AQHA 4BRUA 3GG9A 4BZWA 5TMPA 4X7BA 1N1EA 3BMOB 3UZUA 2P1RA 2HLDA 1A7UA 4JBIA 4WSOA 1K7EB 2Y1LA 3BE5A 3BJRA 1BHJA 4P7GA 4C1NA 5CGQB 4G09A 1P9WA 1THMA 1QTQA 2C42A 3B78A 3L0PA 1LBSA 1W4AA 2COEA 4XRGA 2XUHA 3C6BA 1GA4A 2AUNA 3BBLA 3U3ZA 4IIEA 3JR3A 5HYVA 2P7HA 4HDAA 2G9QA 4DLYA 3O8RA 4LTDA 4E6EA 1FYWA 3QEOA 2NV6A 3QHAA 5TQ0B 4ETIA 2FYTA 1GG9A 4YRBA 1E3IA 2PWPA 1G16A 3TTUA 3GCZA 3VAAA 2BFCB 2WE7A 4NBRA 2PUFA 4N3GA 2VTKA 1TA0A 1HT2E 4FDMA 4S2UA 2H2DA 4WOPA 3THYB 1Y5LA 2O2DA 5ALYA 4YA6A 1QZUA 3L4KA 4W1QA 3ANYB 3ITDA 1W36D 4B3MB 1U9IA 4CF5A 3BD8A 2PKYX 3IEIA 4KUHA 3GRYA 4KFSA 1WBDA 2AN3A 1D2CA 2QLLA 3LA8A 4S35A 3OZGA 5A3RA 4K9MA 3U0VA 4CEJA 3WGZA 2VXYA 1PEYA 2QRVB 1T8UA 4RYDA 4JI7B 3K0CA 4B43A 2JFBA 2QLJA 3DT6A 5BN1A 5A4DA 1NG9A 2IZ7A 1G1MA 1M2KA 5DHRA 2VDOB 4CMEA 1I14A 3DOEA 4IDGA 5IDXA 1I2BA 3CXRA 1T10A 1ONOA 2JANA 4R71A 5JS6A 1ZN9A 2BDTA 1XLTC 3RVPA 1Y8ZA 4RFSB 4AP6A 2YWRA 4ENVA 4BEVA 4H6WA 5AVSA 2ODEA 4GO1A 3UMFA 1CQIA 3IXQA 1T5HX 1FZTA 3ORHA 4R7TA 3ZE9A 4R5HA 2P7IA 4PNEA 3EMDA 2UYCA 3CLSD 2ZYHA 3HO1A 2W2QA 4B0OA 7REQA 2F9FA 1W1WA 2R1VB 4WL0A 4HVCA 2Z5FA 3MJCA 4R68A 1AHPA 1P5FA 3UHAA 3D8TA 3W5AA 1ZMXA 3FUWA 3IE2A 2PTGA 2QTFA 3MBKA 4Z8XA 5EJ5A 3ZHYA 4G2NA 1FNMA 2FV8A 3VTAA 4EUSA 2FZEA 1ENOA 1U7PA 3N2GA 3LDHA 1P2FA 1N2CE 5IVIA 1EP3B 4R8MA 2MYPA 5GJBA 1MPXA 1Z2PX 5ENVA 3RR2A 3EASA 4MWZA 5BVHB 3K9FC 4DVGA 3AW8A 3T5TA 5DWDA 4W6ZA 5F78A 4MUHA 4LZOA 5IS2A 4QBGB 2PGNA 4WJKB 5CA1F 3E9ZA 3P9NA 2A3RA 5CYGA 3CPJB 1CS0A 2FG5A 4NE9A 5H0IA 4DLAA 4OG2A 2VTBB 4FHCA 4KFRA 3ADCA 4M6WB 1A71A 1X19A 5BV7A 2DWOA 4MUEA 3LHDA 1DJOA 1DP4A 5SYMA 4UQPA 3LFHA 1A04A 1ZS9A 1E7YA 1IN6A 1QG0A 4HDOB 2P9TA 4IO1A 4DMKA 4GDMA 2CNKA 4MV5A 5ALEA 1FJGB 4JH0A 3WLIA 1DINA 2JFQA 2VWHA 3GH1A 4AJIA 3VVBA 4A92A 1JXOA 3ABQB 3LSYA 1PYDA 1B0ZA 1NI5A 1Q16A 4RD3A 4IILA 3U7QB 2WJHA 1TM2A 5I45A 1U3DA 3ABZA 2VNHA 3MWYW 5G1OA 3V48A 4QAJA 2XF8A 1HL7A 4M1TA 4IIDA 2Y2UA 1ZG3A 1ZPDA 1BH6A 1SHLA 4PAGA 4Q00A 1FS6A 3MWEB 4HAYA 1OGYA 1SKAA 2FE4A 2JAUA 1SBHA 3MGBA 1TCBA 4KXUA 2PRKA 3QMPA 4CV3A 5CYFA 4C6RA 4A9AA 1G5IA 2VHCA 3NM4A 1XU7A 5ALJA 1PR5A 4F8JA 3RHTA 4ITUA 3B6IA 4NU0A 1DDGA 1LPBB 4YJHA 2BV3A 3EH1A 3PC3A 5C8ZA 2R65A 2CNNA 2W6ID 1R8XA 3R6DA 2WMDA 2N1BA 2SBTA 1DV1A 1H4QA 3GROA 2YQ4A 3PXBA 4C30A 3D8NA 3NRCA 1LWOA 5JAUA 5L8VA 4LRUA 3W4KA 4RKWA 2X3YA 5JH7A 2YFHA 1KKUA 4Y2PA 3PEUA 4JYPA 1XNRB 4B3RB 2W6JA 2QUHA 5CT5A 5D3MB 4EARA 1Z36A 2GBIA 3FPBA 3WAJA 1FB5A 2ZUWA 4HO1X 4IDBA 4L4RA 1F38A 4U2DA 4QELA 2Q7XA 3C0KA 5FFFA 1EA5A 1WCV1 1I1QB 1ZIOA 2PHZA 1T2EA 3EPPA 5BV2P 3Q72A 5IAEA 3LY7A 2NYRA 3NGXA 1XDZA 1NASA 4CMIA 3ZVMA 1R4ZA 1HSZA 2GA9A 4JS0A 4OQQA 5CURA 3BN3A 1DU4A 3QX8A 3LXMA 3PF8A 2BISA 3ZHTA 3LHKA 1QIEA 4MUIA 1TZJA 2GVZC 4J0HA 3QI2A 2VRNA 2ZSAA 4OMUA 5BWCA 2D5CA 2OG2A 1UFKA 3OA0A 4HMPA 2Q5JA 1SXJE 1TO1E 3MT8A 3N6VA 4A5OA 1N25A 2O8EB 4ZT4A 3EUWA 5AJVB 2VK8A 1DQYA 1I36A 3DMYA 5FNVF 3ETHA 1ZMRA 4PN3A 4FOTA 2AN9A 4G2TA 1Y8RB 4YJDA 1EUCA 3PGMA 5EHNA 3TIFA 2JAQA 3OLQA 4MCJA 4L75A 2X4GA 2EFCB 1JLLB 3INRA 3JQ9C 4I0WB 2DGDA 2BEWB 1Q44A 3PFIA 1YQEA 1KY5A 1HEUA 2C9ZA 3DAPA 4PCVA 2QD4A 3TD6A 1P2DA 1WHSB 3DV2A 2X1LA 4B32A 4JJ6A 3O8BA 3A70A 3R5XA 4Y2SA 5D5PA 3PXUA 3UKJA 1RM5A 3HBAA 2DFVA 1X1DA 2JHCA 4NR0A 5K3EA 1Q7CA 4HDNA 1JAYA 1MQSA 4GM0A 1TUBA 1EUYA 2CVHA 4ADSG 1N7JA 1LS6A 2H00A 5D3KA 5AKLA 3TBFA 4ZN6A 1DFGA 3BCRA 3OMXA 2IUSA 3DJFA 3FG9A 3HBMA 3PL1A 4UDOA 5KOJA 1KAQA 2D8AA 2MU1A 3VJKA 3DPUA 5AQ1A 3NIGB 1IN7A 1V3TA 2H2HA 4M55A 4RGYA 4YLEA 5CJ2A 5I47A 3D64A 2INGX 5DGTA 2JIBA 3H8JA 4ERXA 4I3FA 2VP5A 1FSSA 3PNSA 1U7DA 5CXQA 1FU4A 1QX3A 4KQXA 1DEKA 2B4AA 3A6EA 3QUAA 1T4CA 3BXOA 2AF3C 1O8BA 2A59A 1CUWA 1IXRC 3OIUA 3OWOA 1XNGA 3D0OA 1ZGCA 2XLCA 1CY2A 2FW9A 2WTXA 2Z5GA 3K0FA 4F5YA 4RLQA 3VKUA 4D42A 1QG6A 5ELMA 5AUOB 1AURA 2ZE5A 2YWBA 3MINA 1IUOA 3G9ZA 4WDRA 4YUVA 3VPBA 5BWNA 3CUVA 4DV4B 2AEEA 2EYUA 3AFIA 5DHPA 1RXWA 1BXGB 2QUAA 2IIVA 3FFBA 4KQGA 4BQOA 2I7VA 5JZSA 1GFSA 1RI5A 3HKBB 3WGTA 4PAQA 4J4TA 1J5XA 2I3ZA 1SHJA 1JHZA 4IY1A 3ESDA 4C04A 4D9CA 1QWSA 5TVGA 3ZWPA 2ZSBA 4TXJA 1Q0SA 5AKXA 1K6EA 1IN4A 4NZPA 3DZHA 4ZQCB 5ICGA 2NUPB 4DCTA 2EL9A 5BWMA 2AC7A 2XXAA 1G18A 3AJDA 1QG2A 2VBFA 3E3MA 1ADYA 2J9XB 2E55A 4BC0A 2BVNA 5JTTA 5LA6A 3J81A 3DVLA 2AJ8A 1EWTA 3IMGA 1PG2A 1FYEA 4JGBA 4NECA 5FL7A 3UAGA 4NJOA 4OY3A 2O20A 1MZPA 3U9TA 4EI9A 4YXFA 4N3BA 1LBEA 3CEJA 3O4HA 3R7FA 1M74A 1QGAA 1LK0A 4ITRC 4PYOA 2FAXA 4RIHA 4DEVA 3I37X 4MS4B 3D2BA 3H1GA 2H8KA 2VTEA 4JBHA 2OAEA 3QVGB 5REQB 2G9NA 1NJ5A 3BSFA 3R77A 2GJSA 1U90A 3H9EO 4B7AA 1NUQA 2IXFA 5B7PA 4FW8A 4ARBA 1CEEA 4MQFA 3OEEA 4TYQA 2K4MA 1S8AA 3FPKA 4TMFA 4R31A 5L6MB 3U44A 3LBYA 4L5CA 3AEKB 5FPTA 4ETWA 2WF5A 2JHFA 1OH8A 2WVHA 1H0HA 2OO5C 4JJ4A 3IB6A 3A6KA 2O3JA 5JNTA 1RYEA 1BJRE 1UBSB 1NF8A 2AZTA 2ZE6A 1M10A 3OTGA 3HC7A 3X1ZA 1F2UB 4BP1A 3O6VA 3FWZA 1RJEA 3V2IA 4EJSC 3HVHA 4BX2A 4CODB 1G66A 1Z4JA 4J43A 1S8FA 2G40A 1FBNA 3G6KA 5HBRA 3IV6A 4K87A 1LA2A 2VBGA 2YWDA 5F33A 4DXDA 1BEZA 5JBIA 4DR1B 1E0SA 4RAOA 1ZAKA 2F62A 5T4HA 3NHRA 4OMDA 2XPCA 3NB0A 4PRYA 2YTZA 4XTRA 5B2ZA 4ALLA 4D45A 1DCMA 3ZGNA 4INZA 1JIXA 1JDVA 3M34A 4Z3OA 1UOOA 1DQPA 2RGWA 3Q5EA 3QF4B 5TVKA 3CW2A 3LZDA 3SD7A 5BNFA 4CF7A 4IDPA 4TZ6A 1NOKA 5HZMA 2NXNA 4PG8A 5I3CA 1F5SA 3WLNA 3ORYA 3HXMA 2A4MA 2ONJA 5DJ5A 4OI2A 2Y99A 2C82A 2HQBA 3CR7A 4LKRA 4H7JA 2ZWVA 4YRJA 2B6HA 1NP3A 2BKEA 1T5LA 2IPXA 2WHPB 1QVRA 4U9IS 2JEYA 4RMGA 4QO7A 2V96A 2JL1A 4YBRA 1WTAA 1FFBA 5CT9A 5AI0A 5ALXA 2JBAB 5EMMA 4OFXA 4ZAZA 1XT6A 2FTKE 3RSLA 3HB5X 1G7CA 1U9CA 1DJLA 1RFLA 4XJSA 5CJPA 3NNDA 2BMWA 2YY5A 1F3LA 1FP4A 1LK7A 2E4WA 4HFNA 4UHFA 4EHDA 3T1TA 3H13A 4KAFA 3EYWA 3GOHA 3L43A 1PEKE 5AJYA 1SJ9A 2GTIA 1YQDA 3U1VA 1A4UA 3R76A 3R8FA 3UKDA 1LSSA 3L82B 3WYEA 1FSPA 2QORA 2EJCA 4IV5A 4IIBA 3CB4A 5AVQA 3B3FA 1M5RA 1NW4A 2V7EA 1WCYA 5C51B 3WVNA 4QT4A 2IXGA 5EE0A 3MYRA 1S2OA 1ZCBA 2AEJA 1AS0A 5I7AA 3AHHA 2I5PO 3U39A 1QK4A 1UQRA 3ER9A 3EQ2A 3VU3A 1IULA 3PFBA 5G40A 4DVJA 2ZAOA 2C8JA 2B5WA 1O6GA 4RZ2A 4X63A 2Z4TA 2Q6IA 5DN9A 1ESZA 4Q4CA 3U6KA 5K01A 4HAOA 5AYVA 4XWYA 3RC1A 2BFDA 3G23A 5JBNA 2GSWA 3SG0A 2OXRA 1KAMA 2QTWB 2AK2A 4IFTA 5CVDA 3UO8B 1DBQA 4M99A 1ADBA 4M0LA 1LZLA 1KDTA 4BKMA 5T57A 4JQSA 4WCFB 3F5MA 4YAWA 4G1CA 3I4CA 4GZLA 4TWBA 3FPLA 4FGJA 5EJFA 5JI3E 2WK1A 1DKMA 3ZE8A 2VAXA 721PA 1NPDA 2EW1A 2H57A 5ALDA 1CP3A 4EHBA 2JCGA 4QU9A 2M6SA 3HRKA 1KP2A 1M9NA 4I1YA 5IX8A 1S4MA 5JNLA 1E5QA 1FTWA 4HEA1 3WGUA 3FMFA 1NHWA 1OX6A 1WUTA 2PA3A 1VPEA 4D9FA 5DN6D 4X97A 3OFVA 5EJ8A 1G9XA 2ZUFA 5AW3A 1DRWA 4I4IA 3A6FA 5J2UB 4F9FA 2BR4A 1D4AA 2OEPA 1G5TA 5J5CA 1HLPA 1V8ZA 2WE8A 2ZI4A 2ZQYA 1B1CA 2JI7A 5CRIA 4EHNA 4AUKA 1JJFA 2GRUA 2DQKA 2J41A 1QQ5A 4O2LA 1A9XB 3WC4A 2C5SA 4CKWB 2WYWA 4PONA 4JYBA 4U6SA 1USVA 1R0WA 3GFRA 1NP6A 1ZJ5A 5ER6A 3VGPA 3H19A 2JA2A 3ILVA 5BRAA 2HDNB 4MRSA 1PR2A 3WDKA 1OX4A 2O23A 4GL4A 1UBFA 3AOGA 4B46A 1TEHA 2HCBA 3WV5A 3TMKA 4TL7A 5A9TA 2J33A 4QPPA 3S2ZA 3ILXA 3FCCA 4HXFB 4LNUB 3UJ6A 2VSXA 1XRNA 1Q1EA 3E5NA 4F4IA 5AQEA 5C9ZA 1RACA 5CA0F 1GKYA 4DA9A 3WIOA 3RSHA 1P9NA 2PX4A 3P2MA 5JXJA 1JDBC 4Z6KA 5GM2A 4H59A 2ZIFA 3GRKA 1Q50A 5BMVA 4WLFA 5HVNA 1Y5RA 1V7PC 1W85B 3IOBA 4MWGA 2HTEA 3KQPA 3SF8B 2YZNA 5B58C 3OX2A 3RAEC 4KFTA 5KYGA 4P0TA 2QGFA 1EBFA 2R9VA 2V6FA 3RYHB 1N1GA 3H6HA 3V46A 1LDBA 1VI5A 4RYLA 4BTVA 1WHTB 3LCJA 4MQ6A 3WSVA 1WXEA 1HY3A 1HE1C 2AX4A 2FX5A 3SCZA 5JSZA 4M1ZA 4IFBA 4I4TB 1C80A 4UBNA 1PT6A 3H2GA 4I1UA 3T1QA 3OZDA 2VL7A 2LR0A 3RFCA 1CF4A 2O8VA 4OPMA 2P0EA 2GHTA 1RRMA 4QEDA 5FBWB 3RG8A 5DK6A 4YLGA 5AM1A 2IPMA 3JTEA 2PIAA 1V37A 3DP7A 4TMKA 4L27A 2NU7A 1X77A 4L8LA 1NLZA 3OE7D 1LCIA 4DXHA 4F21A 5FEUA 1E5VA 1PR9A 4W5QA 1ZGGA 5JCZA 5LIRA 4EUKA 4R0VA 1YR3A 2P4SA 3L8CA 4J2HA 4NQRA 1KDVA 1MV5A 1GQSA 2QW1A 4UE2A 5CDYA 2XQFA 2YN0A 3N5CA 3BMXA 1A3CA 2ZSUA 3P9RA 3CPHA 5DKFA 4YYEA 3I05A 4JI6B 5LL6P 1GAJA 2WTBA 4TLMB 4I55B 2CKDA 3D31A 1S2LA 1B41A 4FE7A 3GEHA 5E1OA 1JR3E 3DLPX 4OQMA 1ZVMA 2A9RA 2QMQA 2XCTB 2GYVA 5FEMA 2R68A 4NL4H 4ZTZB 1SK8A 4FNGA 3TLAA 1H85A 2AFIA 5ILOA 1PTJC 2DQSA 4RCYA 3D59A 3QI7A 1IB6A 1AS3A 3DFFA 1J9GA 4Z7OB 2B3DA 3BILA 2XNDA 4QM7A 3GLKA 3CN9A 4IG4A 3OD1A 4X9XA 5K51A 5AO9A 3QZUA 1SRQA 5ADWA 4PBSA 1G4AE 3JQFC 4YP1A 4U7PB 2ABWA 3RGGA 2GZSA 2Q4TA 4DT1B 2IP1A 4O3FA 2A0XA 3SC4A 1T4GA 3TCKA 4BVGA 2P9QA 1PI3A 1E2MA 3NVKI 3OSUA 2E3JA 1VBMA 2GLXA 3WJ2A 1U7XA 7GPBA 3C16C 2D6FA 4W7HA 3SFZA 1JI3A 2P5UA 3ZWOA 3FGZA 1NV8A 1W6UA 2Q2OA 5DVZA 3DEKA 2OXTA 5EPUA 3W9BA 3WFIA 3FDZA 2R0QC 4TXNA 5BNIA 3K0AA 1B1AA 4C0AC 4OJQA 4QBKA 1OBOA 3DO8A 3QLJA 2CVZA 1XNJA 1DFHA 3UBTA 4FINA 1P74A 3F6RA 3DE7X 1PNQA 3BWCA 4LJSA 2BWJA 4MARA 3W6ZA 2PV7A 2YASA 3IJRA 2WU1A 1JDTA 2OWEA 2VJMA 1A88A 1R2QA 4OQYA 1XLTA 4B6OA 4O5OA 4INAA 4GMFA 1PR6A 1U0NA 3DDOA 1OWLA 4Y3UA 4RHCA 2X8JB 4QFCA 5LQSA 1GTG1 3SHFA 3LCVB 2O4UX 3WP0A 3EUAA 4LXUA 1RHUA 4MCIA 5H70A 2ODQA 2D0DA 5HF8A 5EFOA 2C8LA 3TRKA 3KJZA 2HHLA 3NYQA 5E0OA 1YCFA 3P2OA 4M7WA 1CSEE 3O74A 1IN1A 2OC4A 3DD5A 2X23A 1QG4A 1GEGA 4J1JA 2EJBA 2W6CX 5DMXA 5EKSA 4RKQA 3DOOA 3SVTA 1B2RA 1XTKA 5DYGA 1CP2A 4RM2A 3ZLVA 4QHTA 4CM6A 3DR5A 4N8SA 1V4NA 4RV4A 3CW9A 2GTPA 4P80A 4CLEA 4ZMRA 3HXQA 2IX9A 3R0VA 3ZR4B 2PFSA 3E8MA 2HU5A 3C7TA 3HP1A 1IXSB 4PYRA 3ZHRA 4G07A 1UKVY 2PUCA 3NYIA 5FPKA 4YWHA 3K6RA 3ZE6A 3QUBA 5JS1A 2NO5A 5KNDA 1R4AA 5FTNA 2IHTA 2NV2B 5L9AA 3TUIC 1I2ZA 3EXG2 3G9QA 2EP8A 4UCXA 1RI2A 3O9MA 5DNWA 2QQEA 1PR0A 4HDKB 1EFCA 3H5TA 4Q1EA 4E11A 2JH8A 5JWOA 2FEPA 1PHRA 3BSSA 5DWVA 3AKCA 4YO7A 4XIYA 1S7CA 4EB6A 4ZOEA 4M37A 4PC6A 2BHSA 3EQ7A 4BHTA 4L9SA 5HS4A 3SHOA 3UUEA 3VX4A 4B2YA 2H0AA 2RIPA 5TX7A 1MNAA 1N34B 5EWJA 3AB7A 1TYCA 4OD0A 2XUKA 4AN4A 4AN0A 4B1FA 4B2IA 1A96A 1PWYE 1FXWA 4ZVTA 3DZIA 2UZ3A 3JYNA 3TAXA 2OCGA 4I1IA 1UK8A 1JNYA 4X91A 1RTKA 4GOMD 1MO2A 3TJRA 2I8LA 2LXNA 1Z88A 4DUPA 1K89A 3L1JA 1JYSA 2HIHA 1XZLA 6REQA 1QE5A 2CVPA 3PNVA 1Z39A 5KDOA 2CYAA 3GVIA 2P9BA 3O8NA 4IUDS 3CVUA 1DAOA 2WIDA 3NU1A 4R2KA 1CYDA 2QRNA 3P0IA 2GESA 4YJFA 1EVKA 1C8BA 1FFGA 4YECA 1OILA 5BOVA 5K2MA 3QBVA 3EZ9A 3II6X 3QYPA 3N8NA 1KMMA 3MK31 1ZESA 2ZI3A 1A95A 3IAUA 1XKQA 3L8GA 3LYHA 4XQCA 5A03A 3TFWA 4X1YB 5JXGA 1VTKA 2Q2NA 3DEJA 1H9BA 4RS4A 1NVFA 4YDSA 2WWIA 1JSXA 5EOVA 1R4NB 4QOIA 3INYA 1ZK1A 4ZT5A 1T0BA 2O7NA 3ESQA 4G01B 4MLPA 2BFFB 2RE8A 4RD6A 2PXCA 4BMZA 4BYGA 5BT8A 2AMLA 2M9MA 1SEVA 3HGTA 3O4JA 2MMCA 3OQ6A 1EAMA 1M8FA 2JIPA 2VKQA 4MVJF 3N8DA 3K6JA 2ZI5A 1SQFA 3DZDA 2DR0A 2B99A 1JIJA 3B1YA 2PKWA 1KJIA 1XJWA 2O8DB 3FUUA 1KRWA 4Z51A 3KLMX 3T8YA 1CUJA 1Q92A 3ZV3A 2ADOA 3BMCB 3FZEA 1CUCA 1CHDA 3PX2A 5BQFA 2XX3A 5IDVA 5B36A 3ER6A 4TKZA 4EUHA 4FT4A 4RVUA 3IVXA 1UAGA 3RC9A 5F23A 4TTAA 1M1ZA 1MO3A 2A0KA 3ELYA 4A6XA 3SJAA 1LNZA 1TADA 1U5CA 2G28A 4YRRA 3K2BA 1M33A 3CF4G 2RD2A 3B12A 1TJ4A 2G1KA 3H9UA 3NALA 4FI3F 4M0FA 1V7ZA 1JHPA 2VLIA 5BSHA 1FW6A 4URUR 1WCWA 2IYNA 2OB2A 3F6EX 4L50A 5AJTA 3NBMA 2I2CA 1QVZA 5FXMA 1NKVA 1N9KA 1ZU5A 2JAPA 3P2JA 4TYNA 1US8A 4QUKA 5KDDA 1IY8A 2YMLA 2H65A 1NJ8A 1EFKA 3EPLA 4JQZA 2GCIA 4D80A 3UWPA 1FNCA 2VQEB 3PDCA 1NW5A 3CLRC 3BB3A 4OXRA 1N36B 2HRCA 4H35A 1RXSA 1J56A 4MOWA 3MUEA 2IZ6A 3D4IA 1H3EA 1PJLA 4WLVA 2GZ2A 4KRYA 2YV2A 4I8DA 5JTUA 1MVOA 3GPLA 3HYCA 3KWLA 4GOXA 3Q6NA 1MC1A 4CBVA 4EG3A 5HX7A 1SKYE 2B35A 3O03A 4ZZ1A 4LF7B 1HQYE 1JIQA 3U62A 4ZHQA 3ZL9A 1GKKA 4G0YA 3TTVA 1Y3HA 2IW1A 3KZCA 4CF6A 3UTDA 2HLDD 1UBHS 3NT4A 4HB0A 1TYEB 2ZYAA 4UMVA 2QRKA 2YWXA 5DI9A 1V11A 4FNAA 5A2GA 1VL8A 3LH5A 2OCIA 4ZC8A 1MW8X 1GU7A 1ZD1A 1K4YA 2RI0A 4NYIR 4ENUA 4LDRA 1U6KA 1QCZA 2YRXA 4EYKA 3NBYC 1WZ2A 3D5QA 3VTZA 1I2AA 5J4LA 1DIOB 1AOXA 1P2BA 4LC0A 2PKQO 3DNFA 3IESA 2I62A 4TSKA 4B7UA 4NFYA 4EG1A 2C95A 2RK4A 4RQAA 1C3VA 1E4EA 1OXVA 2P1DA 3CNQS 3HPRA 3G0OA 4FE3A 4GQIA 5C53B 2CD9A 3GQBA 1AC5A 1X8LA 3PGXA 4HQFA 5JQGB 3RG2A 1PE0A 1ZNYA 3DMFA 2IWRA 4RPLA 4YT5A 4CDRA 4PO1A 4O4LA 4UHKA 4IS2A 4NENB 4RJKA 1HUQA 1VIMA 4DFDA 1FOEB 5CDHA 2DBRA 2GXQA 1UBRS 2C61A 2ZJ4A 2W2PA 2IUUA 2JK1A 3ZWVA 4GGMX 2FHPA 1ICIA 4E51A 2XE8A 2AW5A 2AV6A 1KJJA 2JVKA 4O2BB 3FYTA 1OW3B 4D96A 4MW9A 2D5BA 8GPBA 4S0ZA 2VDRB 4QGFA 1GLNA 1YZNA 2GN8A 4EO4A 2VCYA 3RGWS 2ZITA 4I50A 1WXFA 2O2GA 3AZPA 4JJIA 4KWTA 5K03A 1VSBA 2HZBA 3ILYA 4NV1A 2QX4A 3BE6A 2A8YA 4P5PA 1F5NA 3T3EA 1ZICA 1GNSA 1G2QA 2AE1A 4EEKA 3HSKA 4EKDA 3ZGVA 1NTRA 5KC8A 1U3WA 1ZGHA 2OLJA 1QHGA 1PT7A 4NONA 4QTZA 2YYZA 1U3UA 1QS0A 2VAMA 1NQAO 3NRJA 4EO9A 4WGFA 2Z09A 1VG0B 4NBTA 3Q87B 3LY8A 4Y1RA 3O2JA 3E27A 3LLSA 3QFRA 4HSGA 5I9LA 5K6AA 1DBWA 5HIAA 2V7QD 4PFKA 2E89A 3ZDQA 4WGGA 3I62A 1GYPA 4DB4A 1KAEA 1I9CA 1HZJA 2I0FA 2P9JA 3BC1A 3DT8A 3HH8A 4XCVA 1BMTA 2R7KA 1PUXA 2UZIR 3CR8A 1Z4QA 4L8GA 4QYXA 3T3IA 3VO9A 1EDZA 3I2JA 2AKAB 1B2LA 3CEMA 3LT4A 5BT9A 4NATA 1PZXA 4W9NA 2OO5A 4X6LA 3G2IA 4KR0A 3K9QO 3O8QB 1MEEA 4LGYA 3ROTA 4KLAA 1O94A 4ALIA 2J48A 2XKBA 3O8CA 2PJDA 1YVUA 2PT9A 2OECA 1AXGA 3NHPA 3ZI7A 1Q74A 4QDUA 4A0GA 2YH2A 4TUYA 1I7LA 2ATEA 4IGFA 4I5EA 4EJSA 1XNQB 4X1IA 5KREA 3AM3A 3A26A 3GRAA 2G71A 2PXAA 2QZSA 4TKVB 3ZHBA 5I48A 2A57A 2Y9PB 4OVKA 1HZZC 4GUAA 1JIIA 2O50A 3LQ4A 1OXBB 3EEFA 1JALA 2VP4A 2ZXFA 1UBNA 4M53A 4ER7A 3KU1A 1CXZA 1KEEB 2A5DA 4LYDA 1JHUA 2ASEA 2C5LA 1KQGA 2H1CA 3PEFA 3PXXA 1CEYA 1MABB 1T1RA 1XDBA 3A8TA 3HB1A 4X54A 2VNIA 1HFKA 1G7RA 3OP1A 2Q46A 3F6YA 5BQPA 3H11B 3ESBA 3U1BA 1ODFA 1TW2A 5SV2A 3WQQA 1T2FA 5IKXA 1ZVKA 4DDHA 2YBEA 1F6DA 3WIVA 2BUCA 2CLHB 3L8MA 3D6MA 3FOCA 3H1FA 4QSHA 5JRZA 5JO9A 3TEMA 1GZSA 3CIOA 5JMOA 2IYLD 2FPSA 4MEJA 3M0EA 5FP0A 3L7YA 3UHJA 1QO0A 2YVAA 4C3OB 5BQ3A 3ABOB 1BA2A 3B8HA 4D9EA 3NAGA 4KN6A 1RC1A 4OBWA 4YMIA 4EFKA 1LU9A 3MM4A 5F2EA 1NW8A 4IDUB 2RK3A 3ANXA 5C8VA 3RK4A 2W6PA 2JLSA 4LXGA 5FYDA 1VLVA 1ZSVA 1U5AA 2ZAYA 3PWKA 4YCAA 1A2OA 2IH4A 1CZKA 2X6RA 2HK9A 1KEWA 4Q47A 1FMCA 4HNQA 4US2R 1A8HA 1GFZA 4ER3A 4Q1VA 1JQBA 1FQKA 2YMQA 4MYRA 2JZOA 4N5LA 3OIGA 3AYXB 1RLIA 4BBZA 3CUEF 4ZZ2A 5LMNB 3DWFA 3SSMA 1FMLA 3LPDA 2PK3A 4GI2A 3W6UA 3VHQA 3FHOA 3WMXA 1NONA 2PJUA 1U1EA 2QE7A 2EKPA 3FR7A 1PR1A 3NI2A 1C7QA 3JWPA 1ZW6A 1CUHA 1JA9A 1K08A 2X9NA 4KZPA 3URMA 4D6XA 2ILVA 3UPUA 2C4HA 2QN6A 1K4MA 3LF1A 3DKVA 4JD5A 4F4UA 5BQXA 1OYYA 1NT2A 1P45A 3N58A 4L5BA 2W6JD 1BO6A 3G5LA 2CLSA 4JLMA 3SX4A 4EBBA 2AXNA 3TQHA 3GC6A 1HKHA 3G2QA 2HT6A 5H3LA 3IERA 2C03A 3RVDA 2V7PA 4BO7A 4KRFA 1NLMA 5G0UA 2ZE8A 4XWGA 3H6KA 3R0IA 1F2DA 2EJWA 3VJLA 2YHUA 2XEDA 2C2WA 3F98A 3U7HB 1Q83A 2Q3DA 3E84A 1FFHA 1R27A 1UPBA 2HLNA 3AK4A 3AYZB 3H8SA 1PQWA 3ND9A 5LZ8A 3A6PC 2C0QA 1AKUA 4H18A 4XUGB 1X2EA 5E6SA 5CCEA 1QO9A 5EMLA 1OC2A 1D6NA 2FWMX 5DOZA 2F1IA 3RF6A 2OBYA 4BFYA 1VPWA 1TTTA 2FFRA 3BGSA 4PR0A 1Z28A 3M1LA 3NBUA 3NJ8A 1AKNA 1SVUA 1X94A 5JDIA 2XGJA 4E2WA 4LV8B 2FEMA 5IG2A 1PDOA 3D8HA 2XB9A 2XBLA 3R6GA 4Q1AA 5A6SA 4MCAA 4FD2A 4V2UA 2ZB4A 4QRDA 2LRHA 4I9UA 4S0XA 1TVKA 3K1AB 1KYYA 1B3BA 2NPIA 4L6AA 3L92A 5BUQA 5KOJB 3JALA 1R9JA 3QOYA 1XZMA 3A27A 1YD7A 2H1VA 5KJ1A 2NGRA 3OOJA 2XCSB 3CZAA 4JR2A 2QWXA 4KYVA 1OI2A 3IQGX 5CM2Z 1D09A 2VVTA 4LHVA 1T9GS 4PIVA 4YCDA 4BLSA 1PVDA 3NHYA 1QGED 2Y1DA 1VPDA 2BFEA 1KI1A 2PEYA 2XT6A 3MD9A 3PC8A 5D8DA 3UV6A 5JAPA 2ZBUA 4MVJG 3TF5A 1Z3IX 4DW8A 3NORA 4DSUA 4WINA 2QRMA 4GPIB 3PUWA 2F43A 5EQFA 3GFSA 2JDID 3AEQA 1N7GA 3CMMA 3QMWA 4XIIA 2BR3A 5CLLA 1FJ2A 3L4EA 2HXGA 4GS5A 2B0CA 4EGSA 1M34B 1AMOA 3HTXA 2FRDA 1W44A 3HP4A 4OHKA 1EHIA 4NZ9A 3GJTA 3PIDA 1NA5A 2CN1A 3COVA 3IAHA 1U1GA 3PVCA 2OGTA 3AVXA 2Y0CA 1Z2AA 4UUMA 4BAZA 3K0BA 1MEOA 2DFNA 4I6JA 3G89A 1E5LA 2EARA 2PUAA 1IHOA 1EXDA 4PE5B 2JKYA 1CKEA 3AR3A 3RBXA 2IH2A 1V5IA 4OQLA 1J24A 2GUWA 2X0DA 3ZVKA 2O19A 1DOZA 3I4FA 4K8OA 3EZFA 4KWIA 4MS1A 5KYVA 5BORA 1QPZA 1VPLA 1FQWA 1HBJA 4C5AA 4DHEA 1H1TA 2XMRA 3SJUA 1U31A 4IIJA 3HXPA 2NSHA 3SU8A 2VPZA 3KX2A 2D00A 4KO2S 4M9RA 1N5KA 4INPA 3NHUA 2N3ZA 1PV4A 2L17A 4BNDA 1AJEA 4WVLA 1YR1A 3BGDA 4I9NA 5EJGA 3N2KB 4EZBA 2F8LA 4JVOA 2BMJA 1J39A 4NMXB 1YS6A 1VB5A 1SG9A 2D62A 3DO6A 5I7HA 1N32B 1SBZA 3WL6A 4A0QA 4P6VF 3VOSA 2WU0A 2GN4A 4YREA 1JLMA 2V3CC 4MW5A 2ZZNA 1HXHA 2CF5A 2PQ2A 3GV0A 5IDYA 4DR2B 1J7JA 5TQ2A 5DASA 1T25A 4HBZA 3RU2A 3M3PA 4EM6A 1NLUA 3NBKA 4EB0A 5EHXA 1ZOPA 4HQ6A 2AT1A 2O6HA 2PYZA 3QPAA 4QOEA 1XELA 3RU9A 5KYWB 1ZUNB 1GPBA 1X1TA 3FNRA 2OGWA 3K8ZA 1DEHA 5FL7D 3SIRA 3V33A 3FZYA 5CM9C 1AF7A 4E30A 2DZDA 2Z6UA 3NFYA 3QVTA 1ZHHA 2EKDA 1XJ0A 3QVUA 4F6LA 3RS4A 2HF7A 4K9LA 5LQRA 1L5FA 4L0QA 1XB2A 3K16A 3KEGA 1SD2A 3KOUA 1GL3A 3ACCA 1LPNA 1GT91 1PTKA 3IUNA 3KXLA 3TQTA 2W6ZA 4MLZA 4WOBA 4Q4JA 1BWSA 1ZRSA 3O92A 5KKCA 3PI6A 4PX5A 3OEED 4IXMA 4G41A 3ZIUA 1SKBA 4CMJA 1GSIA 4I4NA 1QH8B 4AKEA 3GDHA 1HT0A 2REQA 1V25A 4NK4A 3JQAB 4B3DA 4IYRA 4CHGA 3NM6B 1VYTA 1EXVA 1G2PA 2OUKA 4FHGA 2HA2A 2ZVPX 3CJQA 4R8VA 4D7AA 1OPXA 5JATA 3UT5B 1XQ9A 3HY6A 2O06A 1B4DA 1Y1KE 3WQBA 1QQAA 4AYWA 1EGQA 2LGJA 2C2HA 2ZRLA 1TK3A 4QICA 4QOGA 1BEEA 3PNQA 2A58A 3M6UA 3C70A 4AYXA 1B15A 1ACLA 2JVJA 4FUTA 4RD0A 4YV2A 3RADC 3PGLA 4YUAA 1Y1PA 1LDEA 5EUMA 3FLAA 1A7KA 3V8RA 3WNZA 4N5NA 2EAUA 4A1FA 4A8PA 3LMKA 4AKTA 4F8EA 4C2UA 4AURA 1PQYA 1JAZA 4XWTA 3A1WA 4QUBA 3RS3A 2XW6A 4H4DA 4EI7A 2QQGA 3DDWA 4OL0A 4Q6BA 2IGTA 5JZBA 2ZSKA 2H5EA 4RTOA 4KQ6A 2JJQA 4MQMA 1VKZA 4IIGA 2EZ4A 1NI3A 1M5UA 3IMCA 1BQ3A 2QTHA 3EPHA 3WLQA 4WN3A 4BGIA 1N2CB 3AESB 1OI3A 4ZALA 3KZOA 3DCIA 3H3JA 2B2CA 3M1AA 5EP1A 1VBFA 3HU2A 6GPBA 2FZGA 1YB4A 4ESOA 1E3TA 3DE0X 3Q0IA 5AK5A 4QYSA 4JOCA 3RTAA 2IDZA 3W3AD 3ZVRA 5ELXA 1LDNA 3LYAA 5KTSA 3AVQA 2QTAA 3HYLA 1W35A 1MC5A 1RRKA 1MAVA 3I5MA 4OLJA 4RA9B 1YC5A 2OB1A 4TV8A 3TN7A 5IDQA 5LXTA 4GZMA 1UMBB 3PQDA 5EERA 3KUXA 1DCTA 4EZEA 4JYZA 4F4DA 2DBZA 5IUJC 1DS6A 4J6FA 4TPKA 3ZLUA 4CM9D 1UM9A 3TG8A 3L79A 3MTGA 3KV1A 4DR7B 4AAYA 3A10A 2WWVD 1BQ4A 4HDRA 4M3NA 4H7FA 4AKGA 1J99A 2I3DA 5E3JA 2ZYGA 3F97A 4J8PA 3FCXA 2JAXA 2WIJA 2X0RA 2XUOA 4XIGS 3KKPA 1LDYA 3NJ4A 4B6RA 4YR9A 4OX9Y 3GVPA 1JKMA 1ZUIA 2OMEA 5KOIA 4LQDA 4LYFA 1EBBA 4JB0A 2V6JA 3JVIA 2Z2JA 5BRNA 1Z5WA 5HSGA 5LQUA 2WWGA 3DDSA 4WNAB 3FKSA 3UJ9A 3DTVB 2TMYA 1Z0IA 2P65A 4YMSA 5FBZA 3WDLA 3JAWB 4R1PA 2JNWA 2OHIA 2ZAGA 4D9KA 3IR5A 4CIDA 3AF6A 1QO7A 2J67A 2R5WA 4PZPA 3W4IA 9LDBA 5ENDA 3SZOA 1IHPA 1UF9A 4HS4A 2XTZA 5F9MA 3TGLA 4IRXA 4MGYR 2X13A 1A8IA 4O59O 4X60A 3IT2A 3L4BA 1AQYA 3T0IA 5KEIA 2F55A 3EWSA 3CURA 1H2HA 4GM1A 4LHSA 3K2EA 1XDUA 1T9KA 2CNWA 1WXGA 2BGNA 4HRVA 3M7IA 4RZSA 4UOZA 1XU4A 3MEQA 2FSVA 3GEPA 1J90A 1XVAA 3QBDA 5EIBD 4YWJA 2A9KA 5JARA 3F6BX 5AK3A 1KFEB 4H1VA 3EGDB 4TWIA 5SYNA 1X15A 2C3OA 3DBLA 4HTFB 2JEOA 4LYGA 1K6JA 2NVUB 2H11A 1Z7EA 1VJCA 1PS8A 3RKUA 1PRYA 1UFVA 4BFXA 1UP4A 1FRNA 2IDKA 1BD4A 2IGBA 2WMYA 4HQLA 2R6HA 4Q4AB 2JZCA 4Y2TA 4WXHA 2HIAA 2GPTA 4EELA 2O8BA 4LF5B 3LRPA 4IJKA 5JAHA 3P9XA 4NF2A 1FNNA 3CGWA 3I0NA 3IPAA 3LQYA 3SZRA 2HW8A 3OCUA 4MULA 2UYYA 1WP9A 3BXGA 5AW2A 1MDBA 1XTPA 4J0GA 4K9DA 2D06A 1VA4A 1O5IA 2J30A 4MP3A 4XX0A 3G8BA 1TVEA 1F8YA 2WA1A 4KLCA 2DHRA 4Q5IA 4B7XA 3TW0A 4RKYA 1G38A 1CRWG 1Y5IA 3HV0A 2DT8A 4RANA 4E5UA 1DTSA 1NXPA 1DWUA 1VJDA 1SXJB 4FVTA 1GZ3A 2HBQA 1K6MA 4WFQA 1E0KA 2Z5VA 3KU4A 3LHSA 3P0FA 3MELA 4HH0A 1OMOA 5JVDB 3UPDA 1Z7YA 3UMSA 5KSPA 2ONKA 3R5HA 3RREA 3IVCA 3M83A 3W9YA 3HCAA 4RD1A 2OO3A 5KMGB 5B1SA 2D1TA 3IS3A 2B8EA 4KQ1A 4N0DA 4E88A 5A1TA 2GA8A 3CRVA 1L5MA 1QCCA 2PBFA 6AT1A 1C5KA 5JCOC 1CUYA