1OC2A

The structure of nadh in the dtdp-d-glucose dehydratase (rmlb) enzyme
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
346
structure length
346
Chain Sequence
QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Nadh in the Enzyme Dtdp-D-Glucose Dehydratase (Rmlb)
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
molecule keywords DTDP-GLUCOSE 4,6-DEHYDRATASE
total genus 144
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oc2A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1oc2A02
3X2FA 1DC3A 5JE8A 1I2BA 1OC2A 4R5MA 4IUYA 3IP1A 1U3VA 5CG2A 3C24A 3KEQA 2D8AA 1YDWA 1T2EA 4IY1A 3WSVA 5KJEA 2QIOA 3PZBA 4FJ0A 1A71A 4DIFA 1PJSA 1N8KA 3C1OA 1BVUA 3TF5A 4J9VA 4KUGA 3DTYA 3S2FA 1KEPA 1OC4A 3WB9A 3Q6IA 5TGDA 3TZ6A 2JCVA 1G6KA 1YJ8A 5DOZA 4IINA 3VPXA 2BLLA 4RVGA 4TRNA 4AJJA 4TSKA 1GZ4A 4K6CA 3IUSA 2B36A 4GX5A 4B7UA 1NM5A 3W1VA 2FP4A 5G4LA 4DVJA 3DONA 4CV2A 3I23A 1T1RA 5TT0A 3U4HA 1VSUA 1NQAO 1U9JA 2QRKA 3NDRA 1NWHA 1KS9A 3GNQA 5U1PA 4RZIA 3MJ4A 4UVEA 4DQXA 4YB8A 4ZICA 3U0BA 1TT7A 3TZQA 3PXXA 4KUHA 3GUCA 1SZJG 5DCUA 3E9MA 5A06A 2I5PO 4CODB 3RBZA 4WNCA 2O3SA 2ZJ1A 3C85A 3KZVA 4CQMD 3QIVA 4PZDA 2B0JA 2DTDA 3NV9A 2Y99A 1K5HA 5AXBA 3V2HA 1WZIA 2I3AA 4KWIA 1ADBA 2Q2QA 3WJAA 4AFNA 1NAIA 4NK5A 5IZCC 3PTZA 1EK5A 3JSAA 1U1IA 2H5LA 3S2GA 4PG7A 3KM0A 3PJGA 2X86A 4Q3DA 3F47A 1J49A 1AE1A 4BV8A 5I8WA 3M2TA 2DAPA 1KVSA 1A9ZA 4YXFA 1Q1NA 3U3XA 5DCYA 2CZCA 4XJSA 3WGQA 4L73A 1SEVA 4GH5A 4I5DA 3VVBA 1MLDA 1U2DA 2VTEA 2YV3A 3QVWA 3L6DA 2YV2A 4JLWA 3LT2A 4E31A 1VC2A 2DPGA 3LDHA 1ADGA 4GAEA 3M2PA 5CPBA 1HDOA 4M1QA 1DAOA 3T4EA 3G3EA 3Q9NA 3HDJA 2NQTA 2ILTA 1DB3A 4J1TA 3H5RA 3F5QA 2XOXA 2O4UX 1HDZA 4B8ZA 1JKFA 1ZEMA 2GR9A 3DQPA 1SB8A 1YE3A 2CDAA 5G4KB 1GPJA 5BQFA 3Q9UA 3JYLA 3PYXA 1E1LA 1XQ1A 4J1QA 1AHHA 2B69A 5DBIA 3PIDA 2GN8A 4Q9NA 3HDYA 1E6UA 2XXJA 4GX2A 5ITWA 1KERA 2ZJ0A 3ETGA 4DMMA 3LQFA 1ISGA 1Q0QA 2VT3A 1NAHA 3TN7A 4PFJA 1LRJA 1DXYA 1CJCA 1Z82A 2J5QA 4TRJA 4ILKA 5B12A 4Q3EA 2BMAA 1I3KA 4TRRA 4WNIA 3DZHA 4ALNA 2I67A 3GY0A 4CMHA 2WD8A 3IQDB 4G65A 3VDQA 4FOSA 4NBUA 1B8PA 1X0VA 2PGJA 1ADCA 4U8GA 2TMDA 3H2ZA 1RYDA 4W6ZA 4D43A 5G0UA 1BW9A 3LVFO 1HYEA 4I8XA 3R3SA 4CV0A 4BB6A 3R6DA 3OQBA 1NFFA 5T64A 1HLPA 4BGVA 3PLNA 2Q50A 4ESOA 3AUUA 1Z73A 4RPJA 5FYDA 1C1XB 4S3MA 3EZLA 2BELA 1HDCA 3QSGA 1U7TA 3VTFA 4BMVA 2W2LA 4RVSA 3QVXA 1EUDA 3HN2A 4ND5A 1HF3A 4PLYA 4LGVA 3RFXA 1ZKMA 3DMTC 3DFZA 2AEFA 4GX1A 3DDNA 1A9YA 3OJFA 4EJ6A 4Y67A 1R37A 1UXKA 1JKJA 4FGWA 1LTHR 4H7PA 1PL6A 1R0LA 4KWHA 1CF2O 4CM8B 3GVCA 1M75A 2O2SA 3WGTA 4A2CA 3PDJA 4DWVA 3WGIA 1DJQA 1XHLA 1CRWG 3JQFC 1I36A 1ONOA 1BW9B 1UXJA 1LQUA 1GAEO 5IFLA 4JJIA 5IZ4A 3I6IA 1M6WA 4XGNA 2Q1UA 3G17A 5L53A 1WAMA 4KQWA 1C1XA 5ER9A 4N5LA 4YDRA 2IZ0A 4D3FA 1HXHA 5KJCA 4R01A 1E7WA 2WYWA 5I7VA 1E92A 3BHIA 1BGVA 4XQ9A 4MPDA 2DUWA 2JCXA 1CETA 4I5EA 2YFHA 3CIFA 5DZSA 1CYDA 1SB9A 3R0IA 4PLWA 3OETA 3RBXA 1OAAA 1B26A 4O5OA 4FIZA 4KTVE 1P44A 1XQ6A 2OL4A 5GY7A 4ALMA 2VWQA 3CEAA 1DLIA 4HUJA 1WVGA 1X7HA 1E1MA 2QW8A 2GCGA 4OJNA 4BOYA 2Q1SA 5HS4A 4PGFA 4RQUA 3ADPA 1ENZA 4BNHA 5A3JA 5L45A 5HA5A 3MJEA 3NTOA 3GLQA 3LT0A 5KKAA 5C7OO 3DBLB 3CE6A 5A5EA 4J0FA 3WDSA 5JDCA 3PQFA 3QRWA 1P0FA 2P9CA 4DC0A 5JLAA 2HMUA 4R3NA 4JXKA 3OIGA 3RUHA 3OIFA 3F9IA 2JCYA 3IJPA 1M6HA 4RPLA 4DL9A 1ZMTA 3DL2A 2CD9A 4DPMA 4BB5A 4XYLA 1PJQA 3MOGA 3JQBA 4GVLA 4QO7A 3RKRA 1NPDA 4BQPA 2PZKA 1XA0A 4URFA 1ENYA 1HSOA 1ZMOA 3TL2A 1X15A 2HRZA 3JQFA 2R00C 2NQ8A 1LRLA 2O7QA 4PLHA 3UGKA 4PZCA 3BAZA 4PZEA 5I8ZA 5I9NA 3VZPA 3DMYA 5TT1A 3QWHA 1Y9AA 4RF4A 5JCJD 3I9LA 1W0CA 4IXWA 4FFOA 5A4DA 4NJMB 5F5NA 2FY8A 2JJYA 3Q3CA 3VPGA 5BSHA 5FEUA 4B3JA 3DBLA 1ZSVA 1HE5A 2EKQA 2C0CA 5CDTA 5AYVA 1LDEA 3UH1A 1DFGA 4YAKA 4PLGA 4NQZA 4RORA 1YBMA 3ZN2A 3ITDA 1M76A 1MXHA 3P2YA 4FFMA 1BVRA 4EEZA 4ONEA 4UVIA 4WKGA 2OUIA 1GYPA 1X14A 3LC1O 1FDVA 5ILGA 1IE3A 3HWRA 5U9CA 3ZWCA 5TQVA 1KC3A 3K5PA 5IG2A 2R00A 4DGSA 1UZNA 4IGFA 1TVEA 1DC6A 1PJ4A 4TKLA 3P2OA 3QA9A 4UVDA 2D2IA 2J5KA 4JX8A 2UV8A 5DT9A 3IP3A 1I33A 1MFZA 5JDCC 4NJMA 3IDSA 4Z9YA 1E3LA 4I9NA 1CIVA 2E82A 5L3ZA 3WFIA 1WMAA 4MVJM 4YCAA 4B79A 2FOIA 2F1KA 4PLCA 1WLYA 3QVSA 3JTMA 3L77A 4IGEA 4G81A 3VKVA 3E48A 3F1KA 1QSGA 4D41A 5G0SA 4CMIB 1R6DA 1HL3A 5B4UA 1GV1A 1Q7GA 4IJWA 3D5QA 1H2HA 2IYOA 5BNFA 1CQIA 4FSHA 3ZWBA 1V3TA 3I9KA 1LRKA 2LDBA 1KEWA 1PGNA 3N58A 2UVDA 4J2OA 2NVUB 5I9LA 1NHGA 5KKCA 3DHNA 2Q1WA 1LJ8A 3FWNA 4HY3A 1ID1A 2AE1A 3JYNA 2BFPA 4CMEA 2X9NA 4DREA 1U4OA 1T1SA 2YFQA 2RAFA 3BMNB 4WLOA 4BNUA 1O0SA 4IM7A 3ANMA 2X0RA 1E3IA 1KYQA 1LSJA 2X4GA 1E3SA 3GUYA 5KTKA 3GEDA 4UVGA 4B3IA 1A7KA 3PHJA 4OYRA 2BD0A 4S1VA 3RROA 3ZNNA 5KWEA 4WEQA 1ZJYA 2JFHA 3DZJA 4A03A 3AY3A 4A5OA 4CMIA 1DC4A 1JN0A 4F45A 2CF6A 1ZK4A 2BF7A 1R15A 4O59O 1QYVA 5C5IA 3L07A 1K6XA 5J23A 2ZTLA 4CMAA 1VJ1A 4WLEA 3TPCA 1YGYA 1N92A 3DEYX 1HLDA 1S7CA 3WWZA 4EJ0A 3E18A 1KEVA 4BO8A 1SPXA 3X2EA 3C1TA 5KJ6A 3WJ7A 2C20A 1OZAA 4LISA 1AXEA 3TL3A 4DC1A 1WDMA 4AICA 2C29D 3BMNA 4K28A 4UEJA 1ISFA 1PJLA 3PFFA 4IQGA 1KVUA 4YAGA 2ZTUA 1W8DA 4PLTA 2OFPA 4CLOB 5COQA 1DSSG 4FCCA 1U5CA 4HV4A 1NQOA 2DBVO 2VOJA 4MVJD 5IXYA 3I3OA 5THKA 1V6AA 4BGIA 1PGJA 3JQEA 4U5QA 2P5UA 2VUUA 1GQ2A 4BO5A 1KC1A 3JV7A 3FNHA 1T4DA 5JY6A 4J1SA 4J16A 5IZCA 2WM3A 1DO8A 2B35A 3JQ7B 4KUEA 4YR9A 1V3VA 3AUAA 3OH8A 4GLLA 4WCDA 3MJTA 4JROA 1E5QA 2AEJA 2BI8A 1E3WA 1LI4A 3VVCA 3OHSX 3H9JA 3WSWA 3GNTA 1QV7A 4CLRA 3D7LA 1WPQA 1HYGA 3ZV4A 3CPSA 4J91A 3K73O 3DOCA 4P8RA 1A4UA 4LSMA 1H9BA 1HDGO 4FFRA 4IIUA 1HT0A 1N2SA 2XPCA 3EYWA 3ABIA 4XYGA 4KDFA 4CM4A 4CMCA 1P3DA 3O38A 4NZ9A 4ZGWA 3EK2A 3QLJA 1JA9A 4RF2A 4PG6A 4UUNA 4MINA 4WUVA 2NWQA 2WMDA 3OEYA 1UAYA 3AW9A 3NJ4A 2O3RA 5JFOA 5FF9A 4PLPA 3RU7A 1HZZA 3N7UA 1H6BA 4GWKA 3RC7A 5I7EA 2BKAA 2JD0A 1BXKA 4PRLA 4FN4A 1RJWA 5BT9A 1Y8RA 3JQ6A 3NAQA 3BMQB 4YBZA 2ZYDA 4DA9A 1IOLA 4KDEA 4NPCA 1H9AA 4ITUA 1XELA 4RPKA 3NX4A 4RDIA 4ROSA 2H6EA 4AJOA 4XR4A 1E3WB 4HP8A 3D5TA 4HBGA 5COBA 4BQRA 3ICPA 4RCVA 4WCFC 3U5TA 2ZIZA 1VI2A 1A4IA 1N9GA 1B3BA 5G0VA 3SC4A 3A9WA 3L4SO 3G1TA 1TB4A 3ZV5A 3AJRA 1IZ9A 4YVFA 1I0ZA 4BIIA 4JQCA 3KO8A 5EESA 1ZSNA 1PZEA 2O3JA 3DBRA 2FWMX 2GUGA 5EERA 3BMOA 1UZLA 5G0TA 1EVYA 3GHHA 3L9WA 1GQQA 3RC1A 3EDMA 4HWKA 4GWGA 4M8SA 7MDHA 3WR5A 4WEOA 3ASVA 1P0CA 4TRMA 1BTOA 2J3JA 2BFOA 3OSUA 2OOSA 3BMQA 4EBFA 2C2XA 1PZGA 3DHYA 3EC7A 5F1KA 3GK3A 1XDWA 3NT5A 5DOVA 4YQYA 4OSPA 3WG9A 1H6AA 1C0LA 4CMBA 1I24A 3W8DA 4BGEA 3H9UA 1I3NA 4FR5A 3QWFA 1NHWA 2UYYA 3K96A 4XCVA 1SO8A 2PGDA 5HS6A 1N9GB 4RV9A 2EIHA 3UCFA 1EBFA 1KVTA 4E2YA 4NFSA 1D4FA 2JD2A 5BNTA 3UN1A 1C1DB 1LDMA 3FBGA 2GZ1A 3NEPX 2FN7A 4LW8A 1I2ZA 2WTBA 3GMSA 4XB1A 1LDGA 4ZN6A 1U7HA 3BMOB 3JD0A 3MJCA 2G17A 2O3UA 2WDZA 3EUWA 4QFCA 4PRKA 1NR1A 1GYRA 2E4AA 2OZPA 1LLCA 2J6IA 3F6YA 4R54A 4AJEA 3V2UA 3NT2A 2HJSA 1MFPA 4NU5A 1DOHA 2BI7A 4DRYA 4J7XA 1EVZA 4L0QA 4XGKA 1P74A 1X7GA 3ONEA 3BA1A 4XDZA 1KY4A 4I1IA 4U6SA 1H93A 3C3XA 3PHLA 1LXCA 1UJMA 3I4CA 3LC2O 1MG5A 4CLHA 2G76A 1EK6A 1WP4A 3ON5A 4BO4A 4XDYA 4TQGA 2IRWA 2PGLA 1ZK0A 1HE3A 2W8ZA 5I7FA 3DOOA 2X23A 1N7GA 3EGOA 5I9MA 3JQAA 1ULUA 1AGNA 5JS6A 2O3QA 3H9GA 4MVJF 3KB6A 1MC4A 1DIGA 3O03A 1V3UA 1ZJZA 1CQJA 2PH5A 4R4JA 3ZHBA 4N5NA 3WGYA 3ZWVA 4BKUA 1DPGA 3INRA 4JJFA 4NHEA 4AJPA 4BO3A 2VHZA 3C1AA 4YWJA 3W8FA 3PPIA 5JO9A 4EJMA 3GVPA 2P2SA 2NACA 4ALLA 1Y81A 4BNFA 1YH3A 3GEMA 2Y1DA 3VOSA 4RF3A 5T67A 1QR6A 1UDBA 1LDBA 3OQ6A 4OXYA 4J3FA 2NM0A 1SEPA 2B5WA 3FNFA 2BGKA 3NJ8A 4OXNA 2ZKLA 4DMLA 2OMEA 1GD1O 4OMUA 2SCUA 3W4IA 1Z75A 2HU2A 1FMCA 3JQAB 4EUHA 1ZK3A 1LC0A 3K92A 4BNLA 2Q1TA 2Y1OA 3KEOA 1H5QA 1ZVMA 3K6JA 3PYMA 1RM3A 1VLLA 3G49A 3PLRA 3RWBA 4W9NA 5JC8A 1XIVA 1ML3A 3IS3A 1YOVB 3B1FA 4YAIA 1Q0LA 4E32A 4PVCA 5HWSA 1PGPA 1YB1A 3ETDA 3PFWO 1YRLA 2GZ2A 4Q3BA 4AG3A 4BNYA 3RUFA 4JCOA 4IDDA 1DFHA 5L4SA 2R6JA 3OBBA 3LT4A 2EEZA 1TLTA 3PGXA 2GRAA 3VAZA 4FPXA 1N1GA 2Q3EA 1P77A 2HDHA 1DRWA 4DIOA 1FF9A 1CWUA 1VJTA 4EYEA 2RHRA 2D1YA 3QHAA 3T7CA 3UCXA 1P33A 5HBRA 3DC2A 3KUXA 1GZ3A 1XG5A 4BNIA 2OBYA 1EMDA 2DTEA 2ZYGA 4I9UA 4EGFA 4D79A 4BO9A 3O8QA 4YJDA 2O2YA 3RJ5A 3CSDA 3NDJA 4JP2A 4YJFB 4FFPA 4MIOA 2EHDA 4D7AA 2OORA 4DXHA 3INGA 4BNMA 3ONFA 2XAAA 2VZ0A 1Q7BA 4IQ0A 3RC9A 2X9VA 4JIGA 2EW2A 3DHEA 5EPOA 2PLAA 5FI3A 4WE3A 4MVJA 4MVJP 1UP6A 1MB4A 5JO0A 1HZJA 3SJ7A 3DAPA 4Z9FA 1UDCA 3MWEB 4WPGA 3BZUA 3U4IA 2RH4A 3WBFA 2NTNA 2Y93A 2B37A 2NU9A 2WYVA 3BIOA 4FGSA 4ZVVA 3V1UA 4MKZA 5DBFA 5IDWA 3KSUA 1TT5A 4E5NA 1SC6A 2J5RA 3CKYA 5JDIA 4LCJA 1EQ2A 3O9ZA 3JD4A 1G1AA 1VPDA 3JQCA 4RVDA 5L7WA 4GQAA 4MVJG 2DFDA 2IXAA 1E1KA 2VUSA 3FF4A 3O8QB 2YW9A 3BMCA 1HE2A 3NDIA 3OJEA 3KYDB 5COAA 1R4NB 1QYWA 2X0NA 1X13A 2ZB4A 3H6KA 4U7WA 2VYVA 3FRJA 3W8EA 4CUKA 1LX6A 3C7DB 3H9EO 4KQXA 5KVQA 4IMPA 4H3VA 5F3RA 1PL8A 4MOWA 3ZWWA 4Z6KA 1VL0A 2B5VA 3GN2A 4YT2A 1DIRA 2X7HA 4ID9A 2VT2A 1I10A 4ZJUA 4MKXA 3WXBA 5A02A 4B3HA 5K6AA 2X0IA 1NASA 1WMBA 2WSBA 5B4VA 2VHWA 5JMWA 3VH1A 4I08A 2EGHA 4BO2A 4PG4A 1TT5B 4P4LA 4XKJA 2UUPA 4II3A 4NR0A 4BNTA 4ZU3A 1NPTO 1VKNA 3CUKA 4Q3AA 4M55A 4CM1A 2PR2A 2P9GA 3FWZA 1X0XA 3W4JA 3AI2A 3BMCB 4OL9A 3GRKA 4AJKA 3GDOA 4E6PA 3JD2A 4RJTA 4LN1A 5L40A 2DVMA 3L6EA 3ONDA 3VKUA 5C37A 2Q45A 1QMGA 3WNQA 1ZIDA 3EY4A 4RPGA 3ICCA 8ADHA 2IEBA 2HUNA 3KOUA 4TWRA 4B8WA 4BNGA 3TJRA 4WGGA 4XIYA 3RFTA 3SBOA 3PK0A 1OOEA 2D3TA 3K8ZA 4JBGA 1E7YA 2Y0EA 4L4RA 3UAGA 3FNEA 4CQLB 1PS8A 4XQGA 2DU8A 1A27A 5ADHA 1EBUA 3ENKA 1E7MA 3GG2A 3VZSA 1NYTA 5DULA 1WWKA 3OJOA 4K9DA 4B4UA 4E5PA 3I83A 4DIBA 1EFLA 3NTQA 4XQCA 4RO0A 3QP9A 4XRRA 1QRRA 1EQUA 3B1JA 2YJZA 1G0OA 3VPFA 3GZ4A 1TEHA 3HHPA 1R0SA 1GEEA 2HRBA 2YUTA 2NV6A 5AOVA 3NKLA 5JNLA 4WCFB 5A5FA 4ALIA 1JTVA 4XR9A 2ZB3A 2PFGA 2HMVA 2ZQYA 1VJ0A 2D5CA 3ZWYA 3OMLA 1B0AA 3PJFA 4B4WA 1D1TA 2WEKA 3IL2A 3K9QO 2DLDA 3RU9A 4DBZA 5EQFA 4OH1A 5H81A 1Y7TA 4BNXA 3H9QA 4R3WA 3W6ZA 3A06A 3KYCB 1LNQA 1V8BA 3KYBA 4RVHA 2C59A 4GKBA 2O4CA 3KETA 2B4TO 4QX6A 2X5KO 2V6GA 1CEQA 3JD3A 1E7QA 4CV3A 4CMGA 1P9LA 2GSDA 4A0SA 3U4DA 2XXBA 4L74A 3L4BA 2VRCD 1ZO8A 3INTA 2OXIA 3ENNA 5TNXA 4M49A 1HE4A 1KBZA 2Q4EA 4GX0A 4PLFA 2YZ7A 3UVEA 4L9RA 5ER6A 3JQGA 4DQVA 4EI2A 3ROQA 1PWXA 6ADHA 4WCFA 2Q49A 1O8CA 3AWDA 4J0EA 1E6EA 4YJGB 4GSKA 3OJLA 1B7GO 1ZW1A 2EP7A 3G0OA 4YRBA 1F8FA 1VM6A 2QQ5A 3FHLA 1JKIA 1LEHA 1LQTA 4Q3CA 1PZFA 3DTTA 3KYCA 5TJHA 2RBEA 4L8VA 3VHRA 2W2KA 4CR8A 5L7TA 4WOKA 1E7RA 3ZW8A 2C2YA 1JDJA 4LVUA 1UXGA 4MKRA 3ZV3A 3GNSA 3H7AA 3PYLA 2PD4A 2GLXA 1P31A 5CP8A 4O6VA 3B70A 2NNLD 2Q4BA 2JAHA 3GAZA 2Q2VA 5KJ1A 4RVFA 4E2WA 2QRJA 3D3EA 2CUKA 2RCYA 2FRDA 5DCWA 3ZCXA 1Y1PA 3JYOA 2YHUA 1N1EA 3GEGA 3AFMA 4BO1A 2IXBA 5ES3A 5CG1A 4W99A 1NVTA 2EV9A 4DUPA 1D3AA 1VKOA 3DZIA 3D1LA 4G5HA 2IYPA 4Y6RA 5TX7A 2C82A 1U2GA 5BSEA 6LDHA 3HADA 5EL0A 1OMOA 1PGOA 2FR1A 3F1LA 3GHYA 4YQZA 1GZ6A 2JL1A 3PHIA 5AVOA 2JD1A 3BTSA 3DBHA 3G1UA 2HMSA 3ROMA 4BKPA 2J3HA 3BTVA 1GEGA 5AXDA 1WNTA 1F12A 3I4FA 4HX5A 4MIYA 4CLXA 3WTCA 5DN9A 3AFNA 1BG6A 4L4XA 2CMDA 1QLJA 1GY8A 1JVBA 4ZRMA 3D3WB 3LU1A 3ZGYA 4DPLA 1P1JA 3SX2A 2HO5A 4ZHSA 3AOEA 2B4RO 2BFAA 1LDYA 1C0PA 1N7HA 2HJRA 2YY7A 5IDXA 4GVXA 4DLAA 4AL4A 5A04A 3A1NA 1YQXA 5H82A 1BSVA 3FPLA 3MCVA 3QW2A 1IUKA 3QVOA 1BDMA 3OFSA 2I65A 3OA2A 3H65A 1ADFA 1PGQA 1Q0HA 4Y8VA 5IXSA 2C5AA 4KMSA 3UKOA 4F3YA 3DBHB 4ALJA 1T2CA 4R41A 2BH9A 2J3KA 4IJKA 1I32A 3IKVA 1UDAA 1PQPA 2GZ3A 3E1KA 4ZQEA 1L7EA 2X22A 1L1FA 2POQX 1NX6A 3DZGA 4GSLA 3WQQA 4BO6A 4JP3A 5TC4A 1BMDA 1O6ZA 3NGLA 5FWNA 4X54A 4FJ2A 5L4NA 4CM5A 2DM6A 3AY7A 5THQA 3UICA 4P4NA 3DR3A 1MX3A 3KVOA 7ADHA 2JKVA 1DBVO 3EAGA 3I9MA 3CXRA 3UHAA 1Z74A 4TKMA 4QO8A 1CDOA 5F1PA 3VZRA 2QYTA 3KRTA 1GYQA 2P5YA 4N18A 1DC5A 4EDFA 3GT0A 4WECA 1NFQA 3W6UA 3E82A 5L51A 1EDOA 4R69A 3H3FA 4CR7A 1JW9B 5LCXA 2FSSA 3MWDB 4QFDA 4J1NA 2Y0DA 1GQYA 2Y67A 3JQ9C 4J43A 4MP8A 1VRWA 4PLVA 3MTGA 4XB2A 5G4KA 5TIIA 2Z1NA 3UUWA 3M6IA 2AW5A 3UF0A 1XLTA 2X8LA 4GKVA 5K9ZA 2NVWA 5JPIA 4FC7A 3FD8A 2HKIA 5CAEA 1RM5A 4E30A 1ENPA 3FCOA 2I3GA 1Y9EA 3ZU5A 1ZNQO 1U8XX 4XD2A 1YB4A 4M86A 2PD6A 3HZZA 4R1NA 1PQWA 4ZQBA 5KNLA 2YDYA 2C54A 1I2CA 1SOWA 3ADOA 4WASA 1BXZA 3RUEA 2VWHA 2YHIB 3SC6A 4J9UE 3F5SA 2ZATA 1LA2A 4WLNA 3FSRA 2G0TA 1RYEA 3KV3O 4XYMA 4AJNA 3FR7A 3GFGA 3GVIA 2H1SA 3WMXA 4GGPA 1XU9A 4BKRA 1VL8A 4FD3A 1K6JA 1HYHA 4CMJA 2AHRA 1J0XO 1OFGA 3AU8A 1F06A 4OXKA 3RKUA 2PY6A 5JW6A 2Z1MA 4ND1A 3GG9A 1T24A 2P4HX 4MVJH 3ZHZA 3V1TC 1XGKA 1BWSA 1H94A 4YT5A 1Z7EA 1B3RA 1LSUA 5U4QA 1JWAB 2OO5A 1FDTA 1J6UA 4J90A 2VHVA 3MTJA 3JQDA 4XRGA 2YHIA 4BKQA 5CDGA 1F8GA 1ZXBA 3SXPA 1TI7A 3KHUA 1NWCA 1ZSYA 4HFJA 3GOHA 3L0DA 3EHEA 4CL8A 5BSFA 1ISJA 2V65A 4CM8A 3MJSA 3K31A 1I30A 1R0KA 2HK7A 3GGOA 1IHXA 2E6UX 2WWRA 4TVBA 3I9JA 3WOHA 2AG8A 1B2LA 1X1TA 5ICSA 1E0DA 3BTOA 4O63O 3I1JA 3Q2KA 4MVJI 3WWYA 1NP3A 2G82A 4QTZA 2X6TA 4QEDA 4LMRA 2YYYA 1QYDA 2VWGA 3H5AA 4FFLA 4NBVA 1T2FA 1P45A 4IDCA 4TROA 3ZWMA 5KOIA 3KTDA 2I9PA 2VYNA 3PQDA 4KP7A 3GPIA 4LSWA 4Q39A 1SBYA 4IDAA 3K2EA 4F46A 1ZCJA 4TMFA 4XYBA 1KVQA 1PS9A 2FR8A 3V2GA 4OAQA 4XYEA 4ZQHA 3UCEA 1ZEJA 1EE9A 1DHTA 5B37A 3ZWNA 3LLSA 1NR7A 4OKNA 4NI5A 5ENDA 1QKIA 3ANNA 3H3JA 1CERA 3P7MA 3LC7O 4A10A 3SVTA 1DRUA 3DXFA 1EEHA 4N5MA 1BRMA 2ET6A 4JBHA 5GZ3A 1UUFA 3O26A 3I52A 4U0JA 4UULA 3GRPA 3AK4A 1LSSA 4OIMA 3ZHXA 3GDFA 3WS7A 4YPOA 1R12A 1J4AA 2QZ9A 1P1KA 4R51A 4L75A 3NTRA 5F5LA 1B14A 1PR3A 5JY1A 1MUUA 4MP3A 4GMGA 4RQTA 4D42A 1EVIA 4B4VA 3KXDA 2PKQP 3WTBA 3ZNQA 4BKOA 4CLDA 5T8KA 4U0KA 3ULKA 1TXGA 2JFGA 5ITVA 4R68A 1B8VA 4U6QA 4L76A 1FDWA 2X1HA 4RVUA 1I3LA 3U62A 1R66A 2YQ5A 8LDHA 1T26A 2X58A 5B4TA 2V7PA 1EZ4A 2WE7A 3E9QA 1QXSA 4OO3A 1BXGB 3CH6A 2CVZA 2VNSA 5JC1A 3QVTA 1SCUA 4Y6PA 3SEFA 2GYYA 1A72A 1JU9A 1ARZA 1Y5MA 4R16A 4A7PA 1BHSA 4CM7A 5T5QA 5T6BA 3DFUA 1GPDG 1PQUA 5CEFA 4FBGA 4IXTA 2FPGA 3AU9A 4BHTA 1GUYA 3LYLA 1ZH8A 4HFRA 4EEXA 4RDHA 1U5AA 1I5RA 4DLBA 4AJIA 2CY0A 2X5JO 3CZMA 2VHXA 5JCJA 4O1MA 2A9FA 4J7CA 1U28A 5C3MA 3OP4A 5LC1A 2I99A 3L4BC 1KVRA 1IHYA 3LZ6A 3ASUA 1YL6A 1Q2XA 3DOJA 1GL3A 2D5AA 4R5HA 4EUFA 2OHXA 4GL4A 4H16A 1DDOA 1YS4A 1O9BA 2O50A 4HNGA 1DIHA 2HCTA 4CMKA 5DDIP 1DFIA 2IDZA 1VSVA 2FSVA 4IMRA 1H6CA 4W4TA 3V5NA 2Y66A 4R1SA 3G79A 2CF5A 3TWOA 3PJEA 3H8VA 1BXGA 2QG4A 4IZHA 2FZWA 4TVOA 4D44A 4A73A 3I5MA 1K2WA 3WNVA 4XX0A 4CLEA 2P9EA 3E5MA 1YQDA 1QYCA 1XWFA 4OKIA 1WXDA 2QZZA 1KETA 1YDEA 2C7VA 1D1SA 2VOEA 4ZD6A 2W2LD 3D4OA 2B4QA 2C5EA 4Z0PA 2RHCA 4YJHB 2DUUA 4MO2A 5L7YA 3PWKA 2GN4A 2Z95A 3GA0A 2VZ8A 4BGUA 2FPPA 2P4QA 5DF1A 3WGOA 2V6MA 5KIAA 3IUPA 1HDRA 3M1AA 4E2XA 2NVUA 4INAA 3WMWA 1V9LA 4Y6SA 3F4BA 4Y9DA 3AM5A 3LF1A 3ZU2A 1YB5A 5IJZA 1NPYA 3PI7A 4A27A 4P4GA 3JYQA 1Y6JA 4MIEA 5G2OA 1GCOA 4XGIA 3COSA 3QWIA 3U9LA 1GDHA 3WQRA 5A03A 3KLMX 3WIDA 5CEJA 4R1TA 3GR6A 1PL7A 3RUIA 5JAZA 1FK8A 1ISMA 2P68A 2BGMA 1EUCA 3A28A 3MEQA 4I5FA 5JCXA 2ZQZA 5DBGA 1TA4A 1O89A 3N74A 3WYEA 3AI1A 5A1TA 1HTBA 1AHIA 3DBVO 4YJHA 4LVCA 5F21A 5EQDA 5BNIA 4DBVO 3MOIA 1EFKA 4IS3A 4D3SA 2A94A 3GGGA 1KOLA 1ORRA 3P19A 4NDNE 2GN9A 1NXQA 4NIMA 4CV1A 4WOJA 3QWAA 1IB6A 1NFRA 1OBFO 3W4KA 2PZMA 5C7LO 1ONPA 3GZNB 4CQMB 3TRIA 5A9RA 3DWFA 4JJGA 4PIVA 4CM3A 1GR0A 1DLJA 4BO7A 4M54A 4YYZA 1LUAA 4BMNA 1GTMA 1QYXA 1G0NA 2QYSA 4NH4A 2DBQA 2VYND 9LDTA 1UP4A 1HRDA 5IAAA 1NVMB 1RWBA 4CJXA 4OHUA 1PX0A 4WLFA 3FTNA 4XWYA 4J4HA 4XA8A 1I01A 1YL7A 3B6ZA 3NGXA 1VE9A 4BNJA 3MZ0A 1L7DA 3ANLA 5ENVA 4M89A 1U3TA 3WLFA 4FJ1A 1O5IA 1KIFA 3HG7A 3JQBC 1QV6A 3JQAD 4QXMA 2WJPA 2F00A 2HMTA 2W90A 4E2ZA 2Y1CA 2NSDA 3JQ7A 1ZZEA 5CDUA 3PIIA 4WK6A 4CUJA 4CUZA 2PH3A 2X5OA 3OIDA 2GASA 4CLRB 3V1YA 4Y98A 1P1FA 2PWZA 2AMFA 3QV1A 4DTIA 1M2WA 5JAIA 3GZNA 4J49A 4CQMA 3UW3A 3PDUA 1EDZA 3ZNPA 1T2DA 4UVHA 5L4LA 1PJ2A 2EKPA 2IZZA 3ZWPA 1IL0A 1GU7A 1P1HA 3GC6A 2OP0A 4PCVA 5TLSA 3KLPX 3OF2A 3H2SA 1Y8QB 1LLQA 4BS9A 4PG5A 2NADA 2NU8A 3PEFA 3LK7A 3QQPA 2GF2A 3VH2A 1XSEA 1NQTA 1SAYA 1E3EA 3ITKA 1Z45A 3BXXA 4RZHA 1JAYA 1WZEA 4UREA 4UUPA 3VTZA 1Y8RB 3RUDA 4NU6A 3ROKA 3AI3A 1MA0A 1UP7A 5JMPA 3HFSA 5JYDA 1Z6ZA 2VZ9A 3T4XA 4B7CA 2DTXA 3FN4A 3HNPA 4JNKA 3CTMA 4JK3A 2EKLA 4XZ3A 3ZV6A 2EG9A 4NJOA 3ZH2A 2NTJA 3WGGA 1MGOA 4E12A 4E5YA 1HWYA 3L9XA 5B1YA 4GBJA 3RCBA 5EINA 2CDBA 4Q3NA 4Z0HO 2GD1O 4E5KA 2AA3A 1BDBA 1WDLA 4CLOA 1ULSA 1PSDA 3DBRB 1Y8QA 3HQ4O 1YBVA 4PVDA 4A26A 2PTGA 4LMPA 5T8KC 1K89A 1Y5RA 4E4YA 1I8TA 4UUOA 4OOFA 2PD3A 3GPDG 3Q1LA 4HFMA 1T25A 1QORA 3RASA 5GMOA 1PZHA 5EJ2A 4C4OA 3WQSB 2VQ3A 3C8MA 1UZMA 4IDFA 3OQ1A 4W9NC 1HKUA 1U3UA 3GVXA 2PA3A 1SNYA 2HAEA 3FI9A 2EWMA 2DT5A 4O0LA 3VZQA 3DZKA 5AXCA 3PQEA 3NUGA 3GMDA 1GV0A 1YVEI 2PZJA 4IDBA 4NMHA 3ZU4A 5K0ZA 2JAPA 3AM3A 5IF3A 2Z5LA 2VRBA 4D0RA 1ZBQA 2NTVA 3I9NA 4NFHA 4ALKA 3A4VA 2LDXA 2AXQA 3SLKA 1SOVA 3D64A 2VTDA 4CM4B 5AXAA 2IZ1A 3STHA 2DBZA 2I76A 1DHRA 1O95A 2IODA 2NLOA 3ETEA 2D59A 3GAFA 1UXHA 1JVSA 3DAFA 5JXWA 1ZK2A 4CPDA 2VWPA 3E8XA 3OA0A 3SJUA 4NNJA 2UUOA 1ISHA 2GO1A 1E1NA 4WJZA 4FOOA 3PRJA 5A9SB 4IS2A 1DIBA 3Q11A 4EZBA 5IN4A 4PLZA 2HQ1A 1U8FO 3UXYA 9LDBA 1QLHA 3DAGA 2GDZA 2OGUA 5A05A 3S8MA 2NU6A 2AEMA 4GGOA 5IDQA 2EXXA 1DRVA 4BNNA 1LSOA 2J8ZA 1HDXA 2OP1A 4BO0A 4J7UA 1H0KA 2HLPA 5DNAA 2DKNA 5MGBA 3FPCA 1N5DA 4HADA 2EJVA 4FFNA 3HN7A 2O3TA 3CZRA 3HUDA 5A9TA 2FR0A 3IOYA 2DFVA 5KCZA 3SLGA 4F6LA 3VPSA 3OECA 3F3SA 3ZU3A 3OM9A 4CL3A 3P5SA 1P1RA 1IPFA 1GUZA 3TDKA 5CPFA 5JBIA 3NYWA 5A9SA 1ZUD1 3FR8A 1I3MA 3E03A 4E21A 5G0WA 1X1EA 3IMFA 2D0IA 2J3IA 4ZA2A 4XIJA 2VHYA 3OEWA 4OOEA 3HE3A 3RI3A 3C7CB 2YV1A 3GH3A 3ROPA 1U3WA 4GLOA 2Y1GA 3PGJA 2PNFA 2GN6A 2ZCVA 1XU7A 3CMMA 4MVJE 4NG5A 2DC1A 1XCBA 2V6BA 4BUCA 5JYEA 1OI7A 1C14A 2Q99A 5T57A 4GI2A 1ZFNA 3D4PA 1C1DA 4FDAA 5FI5A 3TNLA 1GUFA 2BRUA 3IKTA 4AJLA 1T2AA 1LC3A 3HB5X 3RBVA 1DAPA 3TQHA 4YEDA 3CINA 3S2IA 4UAGA 4Z3KA 3LT1A 5BR7A 1NVGA 2ZB7A 2HMWA 3F4LA 1F17A 2UDPA 3L6OO 4OM8A 4XJTA 3TSCA 1PR9A 4LCEA 3TFOA 1H6DA 1JWBB 4FW8A 1P1IA 3AUSA 2AG5A 1K0UA 4JN6B 4K6FA 1VL6A 2AQ8A 5AQ1A 3DMTA 3GVHA 4YACA 3ZNOA 3M1LA 4ZQFA 4EW6A 2BGLA 4UUMA 1A5ZA 1D8AA 3GN1A 3I9OA 4CR6A 1XR3A 2Y05A 5TJ9A 4J4BA 2TMGA 1X7DA 5A3VA 3TFQA 4XQEA 3IIEA 4QECA 3EVNA 4Z3DA 4B7XA 4I9HA 5EN4A 4ND2A 2WE8A 4RGBA 1B16A 2JHGA 2E37A 4YT8A 1A7AA 4FC6A 3WFJA 2VRCA 3PVZA 2W4QA 4E5MA 1HEUA 2CFCA 4CM9A 3TOXA 4D0SA 4YJFA 1IY8A 1AUPA 4CMEC 2EGGA 3WLEA 3WBBA 4HKTA 3I6QA 2O23A 3FBTA 2I6TA 3OICA 5CDYA 2ZK7A 1RPNA 4IQ8A 4FQ8A 2PZLA 1FDSA 3VPHA 3FNGA 5GZ1A 3VC7A 4K1LA 4N54A 1HSZA 3U49A 2C7GA 2WYUA 3CMCO 5C7IO 5LDGA 1RKXA 3A14A 3AOEC 5KJFA 1S6YA 1ZK1A 2ZB8A 3EVTA 3BHMA 3ST7A 3FTPA 4ZRNA 4TZTA 2VCYA 3H4VA 4H15A 2WD7B 1XEAA 1PTJA 4WLVA 4YAEA 1IPEA 1MC5A 3AM4A 4TZKA 4D45A 1EE2A 1JLLA 3GGPA 4E3ZA 4I5GA 4YT4A 2QRLA 1V35A 3KBOA 3HJAA 1R4MA 1PEDA 3KSDO 1MP0A 3RC2A 3QY9A 3D4NA 3KYDA 2EF1A 2EW8A 1MG0A 5CHEA 4NBTA 1QP8A 1FXSA 5TRTA 4QSMA 2CDCA 1PS0A 2G1UA 3QE3A 4RLHA 2RH8A 1MV8A 1NBOA 4OQZA 4G2NA 4AJ2A 2HK8A 4UEKA 2DBRA 1W4ZA 2GERA 1YOVA 3RSHA 5KVCA 5ILOA 4XEHA 1D7OA 5HTOA 1R16A 2Y1FA 4J4TA 3HDHA 1IYZA 4LRTB 4W7IA 4L4SA 1ENOA 1U4SA 2Y1EA 3PJDA 3U4CA 2W98A 3BTUA 3JD1A 1YJQA 4AJHA 4CM9D 3ORFA 3PP8A 3WGZA 2FMUA 3U09A 1LDNA 2PK3A 4GMFA 4YRDA 4R9RA 5EMHA 3ZZNA 3ZWOA 3PWZA 3B1KA 3WICA 2WD7A 2YQ4A 2BHLA 4FS3A 1YONA 2CNBA 3WX0A 4BNZA 3AY6A 3RIHA 1KY5A 5IDYA 2GNAA 2ZCUA 1R4MB 4OQYA 4UEOA 2XF8A 2P91A 3JYPA 4BL5A 2C07A 4HFNA 3S55A 3LF2A 1UXIA 5JDIC 4BVAA 1F14A 3JQ9A 3S1LA 3HDQA 2E49A 4RLSA 1HDYA 2ZTMA 1DEHA 1PJCA 5TSDA 2RIRA 3DZBA 4P22A 2NUAA 3RVDA 5BSGA 2ZTVA 2ZYAA 2AQKA 1W73A 1PWZA 1C3VA 4B4OA 4IDEA 4BV9A 3QJ5A 3V8BA 4WLUA 1PJ3A 4QT0A 2EP5A 3HFGA 1C0IA 4JBIA 1YWGO 1NNUA 4IDGA 5GZ6A 2A4KA 1YKFA 1ONNA 2V6FA 3DZFA 3TZKA 2GPTA 2X9GA 3ZHYA 3D0OA 1K6IA 4GPD1 2H63A 1K3TA 1W6UA 3QWBA 5IN5A 2CVQA 5K6AC 1B8UA 4EITA 2QHXA 1FDUA 1C0KA 1YQGA 3VH3A 4E0BA 4RL6A 1UR5A 4MP6A 1R4NA 5CFZA 4II2A 5KVSA 5DP1A 3BHJA 1M66A 2E48A 3JQ8B 4YAJA 4M87A 1NQ5A 2FZEA 3WGHA 4E33A 3IC5A 4KOAA 2X0JA 2UAGA 2FHSA 3E5RA 1LLUA 3E6AA 4HNHA 1GFSA 4E13A 3TZHA 4BNKA 3UFXA 2AE2A 3TOZA 1AN9A 1B15A 2EJWA 1QG6A 1UAGA 2GGSA 4IIVA 3RFVA 1PJBA 4J2HA 1YO6A 3WIEA 4W82A 2NU7A 4RF5A 4HXYA 5JSFA 4W7HA 1E5LA 4IJUA 4P38A 3T7EA 5JAMA 1O94A 5HM8A 3JCZA 2PKRA 3EW7A 3ZDFA 3K2BA 1Z7BA 1E77A 3H5NA 4ND3A 1PU2A 1IULA 1V0JA 4YJGA 3GQVA 4F6CA 3GDGA 3PHHA 3WYBA 3ZWAA 5F1OA 5KVVA 3B20A 4KZPA 4LRSB 4IZIA 1WDKA 3PHGA 1FJHA 5HRUA 1XKQA 4DQUA 2Q46A 2PV7A 2O48X 3C7AA 3JQ8A 1PJTA 3ZWXA 4ND4A 2Q2WA 4R9SA 2HK9A 1J5PA 1LU9A 3RD5A 3ZI0A 5CDSA 4C7JA 2BFMA 3EMKA 3RUAA 2AQIA 4D3DA 3NRCA 4NBWA 4CQLA 4BNWA 4DLLA 2VNAA 3AOGA 1M67A 2DQ4A 4KTTE 4QQRA 4K26A 1EVJA 1LLDA 2EERA 3VH4A 2Y68A 4YTEA 1SMKA 1DIAA 3E9NA 5DP2A 3VDRA 4EUEA 1ZXLA 4DYVA 5L9AA 3R3JA 5CEEA 1KEUA 2CSUA 2JHFA 3TZCA 3Q2IA 1XYGA 5JAQA 4FB5A 1IZ0A 1JAXA 4RPHA 1E6WA 2A35A 2FPIA 2VN8A 1YBAA 5TF4A 3IJRA 3UOGA 2JFFA 4C7KA 1E3JA 1YXMA 4BMSA 4MJLA 5EIOA 3LSYA 4D46A 2A92A 1NTOA 1E7SA 5L95A 2IEDA 3GFBA 3NT4A 4NFYA 4YRAA 2B83A 4AVYA 1Q7CA 1RM0A 3PZRA 3RJ9A 5FFFA 3LLVA 3WYCA 2YDXA 3ZW9A 4MDHA 3EZYA 3OJ0A 4DYDA 1H2BA 3HSKA 3K30A 1T4BA 4LK3A 1EUZA 4IJVA 4NK4A 1ISIA 1HETA 1GADO 5H83A 3D3WA 3R1IA 3RQSA 4DPKA 1YL5A 4Z9XA 2O7SA 2PKQO 4J6FA 3MJVA 3RAJA 3BYZA 4R1UA 3PWSA 3JQGB 3O4RA 3GF4A 5ICMA 2H9IA 2VYVD 3HB4X 4BNVA 3S2EA 3IAHA 3DO5A 4YA6A 4PN3A 2HSDA 4AJ4A 5I7SA 2R2GA 2NVBA 1MXFA 1F0YA 5TS3A 1UH5A 3KSZO 2Y0CA 1GCUA 2VUTA 1DJNA 1PIWA 3Q0EA 4OGWA 2OBNA 3F46A 1RM4A 4NBRA 2AQHA 4N7RA 4OSOA 4Z0TA 3RUCA 4AJ1A 4IPTA 1JQBA 2I66A 5LDHA 1LBEA 2G5CA 4ZQGA 2W2KB 3DB2A 4QUKA 2IE0A 3AUTA 2D4AA 2DPHA 2CVOA 2QX7A 1WW8A 1AXGA 4IBOA 4PG8A 5MDHA 4CM6A 4JGBA
chains in the Genus database with same CATH superfamily
3TRKA 3CW8X 3A4TA 1DC3A 3IAXA 2VDOB 3IBYA 2IEYA 5DYNA 4EHNA 2V7XA 1J90A 1I2BA 1J2UA 2QTCA 2WB2A 2R8EA 1BX0A 4ZEOA 2JIZA 1YDFA 1Y1TA 1KI6B 2IYAA 1P8JA 3CW2A 3FDIA 3QU4A 3ROFA 4Q03A 4BMOB 4IY1A 2D8AA 4CTJA 1C29B 4TKVB 3WSVA 2OOKA 2QM3A 1IIBA 2CNKA 1XRLA 2V4ZA 3ER6A 2CN1A 2E1PA 1EQAA 5DYIA 5EE9A 2F8LA 1PJSA 2JI7A 1QG4A 3H5TA 3KVVA 2WIGA 2QYHA 3UWSA 5IMSA 3OZGA 3MT7A 3R09A 3SJAA 5DM60 5FLXA 2Y9PB 3UOWA 1JECA 4G0UA 2BGGA 3Q6IA 3MRSA 2QT9A 4BZQA 2QAJA 2WAYA 2X2FA 5DOZA 4X1IA 3VZBA 1TRHA 3W5CA 4RVGA 1D1PA 4PQGA 2QE7A 4PIPA 2NZWA 3E3LA 3H04A 4AY2A 1ZITA 1XD2B 2AOVA 2G67A 1TTHA 2MSDB 3IUSA 3L92A 2B36A 4LECA 3R8CA 4WBNA 1DKMA 3U48A 2NXEA 3I2JA 3T12A 2ZBQA 4C6TB 4I2NA 4JYCA 3M3DA 4YJ3A 4ZVLA 4A15A 4KL8S 4CV2A 2AIRA 5HQ3A 3KOXA 3I23A 1VHJA 2HIMA 1T1RA 1CUWA 3G2KA 4IOJA 5F4ZA 1BDJA 5TT0A 3X1DA 1QFYA 1VSUA 1G3IA 3IPYA 1FFAA 1NQAO 4R1PA 1KS9A 3OTQA 2QF7A 4BRZA 4DCJA 3EODA 1M0EA 1SOMA 4YB8A 5AM0A 1CC1S 1E4VA 2AFIE 1DTSA 1JYEA 3N2GA 4WADA 3ZVRA 4CWAA 4ZICA 4EH1A 3TZQA 4KUHA 4LDNA 3GUCA 5AO9A 5KKNB 1JEJA 2C1EA 4EENA 3LUPA 5BPFA 5IABA 3KAQA 4PHFA 3KEGA 2ZANA 5D51S 2ZJ1A 3C85A 4GPBA 5GJBA 2JPDA 3IAAA 5E1OA 1NRXA 4HGNA 1UPUA 3KS9A 3TCXB 2DTDA 4X7MA 1JIIA 3NVKI 3TRDA 1UBTS 4JWKA 2EZ9A 5IS2A 4PSCA 1F2TA 4FOLA 2PXHA 1WZIA 1NN0A 4KXYA 4PNHA 1V5GA 2C97A 3C14C 4G9EA 3WJAA 4PAOA 3RHZA 3CRMA 3USCS 2HC9A 3EPKA 2FP4B 4BZXA 1FFWA 3KM0A 3PJGA 1JFVA 2OGZA 1KL7A 2X86A 4Q3DA 4DUGA 2J3MA 2OUKA 1J49A 4C21A 1J25A 1ORHA 3WZ2A 3M2TA 4YXFA 1VBMA 2HZBA 2IOYA 3OVMA 3PXAA 5KAPA 2AC4A 4GH5A 5EIHA 4S1OA 2P9FA 5AVJA 4N9QA 1MLDA 1U2DA 4IH4A 4B3MB 4QUIA 1P4AA 1G20E 2YV2A 3M83A 3IIJA 2EDCA 3AH8A 1D2AA 4IXMA 3LT2A 1GPH1 4JLWA 2A3NA 3HVHA 2WFZA 5EJ5A 2MR6A 4ZRDA 3AQIA 1DAOA 4EHKA 2YXPX 2R60A 3U4AA 1E96A 2NQTA 1K8ZB 2HJGA 1YRYE 3B6JA 3L8EA 4M1ZA 5CD9A 5D7BA 4QXOA 1PSWA 4J1TA 4QPJC 4RZ2A 2R8BA 1I1HA 3HB7A 3M4ZA 1KDZA 2JFBA 1A9QA 2QX9A 3JVEA 3QYFA 4GKAA 3AR9A 3RYIB 1C30A 3OJCA 3DXYA 3EDYA 3T1OA 4N7BA 5LKAA 1ZYUA 2CDAA 1GPJA 1X9HA 3FG9A 2NP6A 2WJ4A 2YQZA 3B9RA 5BOSB 1NLZA 1W75A 2PX4A 1E1LA 4B80A 1YRQA 3OFJA 1L4NA 4P53A 4G0PA 1AHHA 3WGKA 1ZZGA 2AFVA 2A4MA 1FQOA 3AEUA 3OC0A 4ZO7A 3PIDA 4C0HA 2GN8A 3FWYA 2NIPA 2MINA 4B6SA 2QD2A 4MV5A 2Q5JA 1TEXA 2ZJ0A 3V4FA 3JATA 4GVPA 5F73A 5JQGB 2OM2A 1QHSA 4LOAA 1X6VA 3NBXX 3D7RA 3KQQA 2DFKB 2EYUA 1ISGA 4HS9A 4RU1A 3WIOA 1J06A 1VIYA 1NAHA 1E3TA 3BKWA 3KCNA 1DBIA 4RTQA 3RS9A 2XZTA 4CL0A 5DNCA 1Z82A 2GTPA 1Q21A 1PVDA 1JA1A 2J5QA 5TPZA 3T7JA 1MD9A 4DCMA 1WXFA 4Q3LA 5BYAA 1ML4A 2QEQA 3BQ9A 1FTYA 4FFWA 1JBQA 2JH3A 4ALNA 2I67A 3GY0A 3FRHA 2RGXA 3EBLA 4GNKA 1M7HA 4OM7A 4FOSA 2HBZA 4KXLA 4Y3UA 1NNLA 4U8GA 2VPYA 1DCMA 2TMDA 2SKCA 3EPLA 3ZVMA 3X1XA 3CB2A 2DKFA 2REOA 3M3PA 5JAPA 4YMHA 2W2VA 1N0IA 5IJAA 5G0UA 3QE2A 1MB2A 2DX7A 2XQGA 1JDVA 1T5SA 1Y63A 2O2XA 3LVFO 4TZ0A 3WLOA 2YRWA 1UOQA 2CLDX 3O8LA 3DEHA 1NFFA 4BB6A 1XNRB 1HLPA 1OXTA 3PLNA 3NHBA 1FS6A 4ZVTA 1QGZA 5FYDA 4Q18A 3N8KA 1DAHA 4QOJA 1LPNA 2BELA 3VVMA 3QPWA 4YP0A 2TRSB 4MICA 5HS6A 3W5UA 2FW7A 3WMGA 4YY3B 4B17A 3GLIB 5DSZA 2C3OA 3V2IA 4UCWA 2R5WA 3QVXA 2WA2A 1EWYA 1J00A 2OV3A 2JFYA 4C3OB 4HTFB 3OU6A 4Y2HA 2QD1A 5DK4A 1FP6A 2OGTA 2XUGA 3HXKA 3KR0A 5IVIA 2WP0A 3ELWA 3IPCA 5HOEA 1KPHA 3CUSA 1PR0A 2IKSA 2OBMA 3DKPA 4FGWA 4WXHA 1LTHR 1Q91A 4MRSA 3DE2X 4Q4HB 4Z4HA 3GI1A 3NIWA 3V42A 2CXNA 3W2EA 1N2CA 3PDJA 4N5HX 3Q3HA 4MLPA 1DJQA 4PF1A 1VLZA 3W5BA 1I36A 1BW9B 3EZGA 1LQUA 5I8PA 1GSOA 5IFLA 2PT6A 1KARA 3C6KA 5H0IA 4JLVA 3GLTA 4TV9F 1CR0A 2ORYA 4D6XA 1U94A 2FJ0A 4RHUA 3BK1A 3DP7A 5ED4A 3KUUA 4KSYA 4N5LA 3MBOA 4LVOA 1QHYA 3A1DA 3A10A 3SHTA 4TLAA 2A9JA 3K7EA 3BBLA 2EQBA 1IJFA 2HLDA 2P4SA 1U6IA 3JWGA 3JX9A 4JT8A 4QQKA 1E59A 5F7OA 1Z4QA 4IVRA 2V7EA 4XQ9A 2AJCA 2MU1A 1LW7A 2XYQA 2VJBA 1HQDA 4I5EA 2YFHA 2ZI3A 4URHA 1JG3A 2R5NA 1CYDA 1A82A 3E23A 4R81A 1G8MA 3OETA 5GAJA 4AX4A 4EYSA 2EJBA 1L4EA 1YAJA 3I53A 1XQ6A 2GJAA 4JLAA 4ALMA 2UZ3A 2WHPB 4BCDA 1DLIA 3EFEA 1CZNA 3V1NA 3QBEA 3TIVA 3HB9A 1N33B 4DW8A 2VDMB 2CHUA 3RVMA 3A37A 4TT3A 4JLDA 4DG9A 5HS4A 5JVDA 4PGFA 4RQUA 5CYPA 3ADPA 3CGGA 4YYEA 5A3JA 3UXEA 1VPEA 3BDAA 3NTOA 3GLQA 1AKUA 4RA9B 4H6XA 1JFFB 4KXNA 5C7OO 3DBLB 4NDAA 5A5EA 4J0FA 5A3SA 4L51A 3OWXA 3LUDA 5B6PA 5J4LA 4DC0A 2P9CA 3QVKA 4H1VA 4RTMA 4FGZA 2D8MA 3FXAA 5JUWA 2IHBA 5LA6A 3ZLUA 1M6HA 1ZAKA 1P5JA 1DBSA 4KYVA 2OBBA 2OHJA 2WWWA 2VYQA 3DPUA 2H9YA 1PJQA 4BB5A 2G5TA 4R71A 4DDMA 1CUVA 3J81A 2QLJA 2R751 1YMVA 3RKRA 2DF8A 4D3ZA 2BUBA 1NP6A 2GN2A 3HBMA 1ZJ4A 3R7WB 4JYAB 2PZKA 1XA0A 1Z36A 3FPEA 4REMA 3TL2A 2FGJA 3JQFA 2ERXA 4PLHA 2O7QA 1VP9A 4F71A 2NZ2A 4GFDA 1MEJA 4PZCA 4DM3A 4DDWA 3IUYA 4P31A 5I9NA 4HAXA 3VZPA 2QENA 3EF3A 3EPHA 3LVBA 3SQOA 1Y9AA 1T10A 2FZ4A 3AERB 3L8YA 5DM2A 4NJMB 1R0BA 3D3JA 4O2AF 2W22A 4LJ8A 2W8BA 4MB2A 1YB7A 5BSHA 1FLNA 4OHFA 3UJAA 4IZ6A 3HVUA 4UPVA 1RWXA 1OILA 1SCUB 3T3DA 2NX2A 3PDIA 1RXIA 3TSAA 1VCMA 1U63A 3BUSA 5CDTA 5AYVA 3VO1A 5F51A 1DFGA 3BXZA 3OQOA 1A5SB 1USGA 3WDLA 1QO0D 3N5CA 3A2KA 4MV4A 1TM1E 4RORA 1GGNA 2VS1A 3TAXA 4LQLA 3ZCPA 4NG4A 1M76A 1V2HE 1MXHA 2GCPA 4FFMA 3UC5A 2G1KA 2OUIA 4FMDF 1LB1B 1ZN2A 2E5WA 1G4HA 1X14A 4B76A 5K0CA 3IKMB 3CISA 2HLHA 4C0JA 1FDVA 4YCDA 4MR9A 2CZQA 3HWRA 5U9CA 5FV4A 3ZWCA 2QXUA 2ZUBA 2WW8A 1P5RA 3M6MD 2O0HA 5K51A 1ZLYA 1X7WA 4KACA 3TVTA 2GA8A 1T6ZA 3L6CA 2BL4A 2ZRQA 4O3FA 1KMNA 4MITA 1DC6A 4P81A 2A1TR 2A5JA 2XUZA 5DNDA 4K9NA 5JI3E 5F9HA 1XB2A 1S8NA 1FUUA 2GPWA 2J5KA 2UV8A 3PDWA 4QJ5A 1I33A 1UMBA 2DHEA 4ZCQA 1CJUC 1XEWY 4IRUB 5JDCC 3ZEAA 3KVNA 4M0LA 4HDNB 4BRWA 1S4MA 4Z9YA 5C8VA 3KKNA 1SD5A 1XCMA 4L8WB 2I6XA 5L3ZA 3BWMA 3RG2A 1YRWA 4JI4B 2GPBA 2AOTA 1PNTA 3JPWA 3RYCA 3FDFA 2NO4A 3H6HA 3A6KA 1JG2A 4QQNA 4ZCPA 2R48A 2PIAA 3E48A 1T15A 3F1KA 4G81A 5A3RA 2BZ1A 5G0SA 3N0XA 1D7AA 4ARUA 1GV1A 1ZQ9A 3RVSA 3C8ZA 2HU8A 2IDJA 2IYOA 3QU9A 4FSHA 4AO6A 2HHCA 2EZ4A 3X1WA 3UBMA 3ESZA 2Z6QA 3NC0C 3R44A 2F3RA 5HJ5A 1V3TA 4LMAA 5E6UA 3IQWA 1LRKA 1TL7C 1X1RA 1NU8A 2LDBA 5A0FA 1PGNA 1W36B 3N58A 2UVDA 4H27A 4J2OA 4LDPA 121PA 3PSHA 3JARB 4QUGA 4U4AA 4HY3A 1LJ8A 1NYQA 4TYYA 3TI7A 2OE2A 3G2HA 2WSMA 3MGBA 3F78A 3PJRA 2YCLA 4MH0R 2BFPA 2JLSA 5CH3A 1S2GA 4M6WA 4A4DA 1U2RA 6ABPA 2Y1KA 1ZJJA 1BGWA 2HSJA 2RAFA 2YFQA 3F7MA 4PS0A 3TXAA 2P30A 5CK5A 4IM7A 1YZFA 2PX5A 1CUYA 1UL1X 3TBKA 2DSTA 4EY6A 3A9RA 3GUYA 1SURA 1TZBA 2YH2A 3OPXA 4UVGA 4B3IA 5AOBA 4O8ZA 4TUYB 3WWCA 2A2ZA 3JALA 3LX4A 2PNJA 1Q92A 3GLHA 4K1XA 2WKRA 4A1OA 3AR8A 1YVPA 1FMTA 4CMIA 2VHUA 3NASA 2R96A 1AD2A 1ZG3A 4JI6B 4F45A 2I71A 3LHSA 4Q66C 3FYHA 3EUAA 3JVIA 3Q5DA 5KC9A 4R83A 3AUFA 1M6VA 4QOSA 3V8PA 2ZTLA 4WMLA 3VPCA 1DMRA 3TPCA 1YGYA 1N92A 1DQRA 1SG9A 2BGIA 5PNTA 4YRCA 3WGUA 2OQVA 3VNRA 1SPXA 2I4NA 4BO8A 4BFYA 13PKA 1K2VN 4N6GA 1OXUA 3EA0A 2PHZA 3F8SA 3R3YA 3WLTA 4Q1CA 2FTKE 1CUXA 3DT8A 3HV0A 1WDMA 4EM6A 2C29D 3BMNA 1WKCA 1MX1A 3PFFA 3HU2A 4OY3A 1BVYF 1D6MA 1JMVA 1SUCA 2OFPA 2ZTUA 3A6JA 3DL0A 3S0JA 4FWTA 5COQA 4FCCA 2OCBA 1SU8A 1BFUA 2DBVO 2LUOA 3QH4A 3CVYA 2YXEA 4MVJD 4N6NA 3EEOA 2ZJAA 3CUEF 1PI3A 2ADFA 4YMGA 5THKA 2ONJA 1KIMA 1Y3HA 2WHQA 1NUQA 4XVCA 4BO5A 3OOWA 2J0UB 3RFFA 1QFXA 2PX6A 3QXCA 3JV7A 3QUQA 3IAS1 3VNBA 4EVIA 1YAHA 5BRAA 5JY6A 1RXEA 4KFCA 1M10A 3MSXA 5JZ9A 1L4FA 1PD0A 1N9KA 1H69A 5ALKA 2G83A 2B35A 4AF6A 3WJ1A 3BXFA 1OJ7A 5K3AA 4DJAA 1V3VA 3EQ8A 3OH8A 2GF9A 3P9XA 4GLBA 4JROA 1XU4A 1E3WA 1U8AA 2FR8C 2LZ0A 4XOUA 4K9SA 1GA4A 3OHSX 2RJ3A 1Q0PA 4KI0A 4Q7QA 4OFWA 3RSCA 5KMGA 2QAIA 3O94A 5JCOC 2JVJA 4JXZA 4H60A 4RFSA 4MW9A 1A4UA 4H7JA 4LSMA 2G4VA 4XEUA 3KQNA 1IJBA 1HDGO 2JRLA 5AW7A 1XNJA 2AJTA 4LGMA 4XYGA 3BIJA 1PNVA 2FSUA 3R24A 5ALYA 5T4EA 4FNMA 4CMCA 1K6EA 2G28A 4RF2A 1PO7A 4ZTBA 1OTXA 5JH7F 5JS8A 1JEYA 2WMDA 2GXAA 1J07A 1T91A 5F35A 3KHTA 1UAYA 1UOEA 1UBKS 3MT9A 5FF9A 5HFJA 4PLPA 4I99A 1S8AA 4F3NA 3DZDA 2HDNB 4N8DA 3NBAA 3HXQA 1N2CE 4PRLA 5I7EA 4MS4B 4XIGS 3J80A 1Y8RA 4QJ4A 4BY9E 1B76A 1U8TA 1ZM2A 2QUIA 1QZZA 1D09A 1H9AA 4IMJB 4IW3B 3GLFB 3K1JA 1B41A 1JG1A 1XELA 2MIIA 4RY0A 3QPVA 1BE1A 4RPKA 4C0BA 5FAKA 2Z43A 4MW5A 1MIOA 3FAZA 3EVBA 2PLRA 4AJOA 1UF9A 1U9IC 3KV1A 1F51E 1J22A 4G41A 1NJ1A 1N2XA 1CUIA 1P3Y1 1XRJA 2ONKA 4OQXA 2E4ZA 3ICPA 1SUAA 1R8QA 3PBKA 3CB4A 4RCVA 4Z2YA 1B3BA 1C8KA 3Q8LA 3CLRD 3IAS6 2ZRBA 2VHCA 1FUYB 2WLTA 2RHHA 1PHRA 3L4SO 4I7EA 3G1TA 1TB4A 2X4LA 3ZV5A 2OXCA 3QMVA 5ALDA 3AWIA 4K5QA 4LYEA 2Q5OA 4QJIA 4AQ7A 3DQQA 2C7QA 3DBRA 2Z30A 3HCFA 3E70C 3I05A 2J7PA 2ORED 1Y5LA 2J0EA 4FE3A 2HF2A 3BMOA 3DEZA 5EERA 3PFHA 4O4JB 4U6NA 1UZLA 5G0TA 2HADA 1J8FA 3GHHA 1Y3IA 2QM8A 3L9WA 3WNDA 4C4AA 2WNIA 4HWKA 1B8NA 4D97A 4B3BA 4L7QA 4MW4A 1B6GA 4WXRA 3QELA 5BRJA 3NHSA 2OV8A 3EIUA 4L9AA 1DJLA 2XA9A 3AV3A 1UMCB 2OOSA 3DEAA 3M4XA 2C2XA 4NCNA 5DTJA 1AZLA 1XDWA 3NT5A 4X1KB 1QDUA 2VJLA 2J67A 2P1ZA 4BE9A 1FZTA 3IPXA 4BGEA 1I3NA 1BS1A 1KMIY 1XTBA 4M9RA 1EVEA 4M8NE 1VPVA 2FETA 4R98A 3WRYA 4CKWA 4XCVA 1SO8A 1XK6A 3A0RB 2D62A 1BS2A 1Z25A 1N9GB 1QPBA 4O4IB 1IATA 1KVTA 3L02A 4I36A 4RV9A 3ABQB 3UCFA 1DKPA 2IS4A 2NOAA 3IV6A 3DVAA 3FX2A 4J0HA 2P1RA 1QNLA 1C1DB 2QRGA 4PSDA 2RHBA 3EZXA 2F1RA 2DQYA 1IY1A 3DYIA 4LW8A 2CXQA 4X44A 1KR2A 1M2JA 4ZN6A 1P4JA 4RA6A 1OI3A 2GLTA 5IBQA 4GPAA 3H6GA 2FUG6 3FYTA 1JU3A 4HAYA 1DE0A 2WDZA 4QFCA 1RXSA 1M5RA 3AINA 3OHPA 2VP6A 2UZ0A 5HM6A 1W2HA 1QH9A 4R54A 3V2UA 1H1DA 4XWTA 3M1YA 2BWJA 3NT2A 3H0CA 3ROEA 1HA3A 1P0PA 2BI7A 3C16C 3N2KB 4NU5A 5C1BA 4L0QA 4DLNA 1VLVA 4EX7A 1WO8A 4L5CA 3B1ZA 1X7GA 4YAWA 2J5BA 3BA1A 4XDZA 5EJAA 4DA7A 5EIXA 1X74A 4DNXA 1NJGA 3ZHCA 4Z3OA 4LJLA 4OHBA 3C3XA 4ATNA 3S8YA 1WZ2A 1LXCA 3WK6A 5HJEA 1K7SN 3KXIA 3LC2O 1PR2A 3T9FA 1P9NA 3H1TA 1P4HA 1N6PA 4HDCA 5DIFA 3GOQA 4TQGA 5DHTA 2IRWA 3C2QA 1U98A 1GTL1 3D5EA 3G8DA 2XZPA 3DOOA 2FOLA 3A4NA 4RGYA 4GKJB 4XCQA 3JQAA 5BOVA 3SF8A 1AGNA 2FKNA 2I1WA 3G88A 4E7OA 1V7ZA 2O3QA 1UK6A 2CXSA 3FMIA 1XTVA 2LGJA 3R5SA 1DIGA 1B0PA 5DW0A 1DCTA 2DEUA 2DWCA 1NUAA 4N5NA 3WGYA 1FS5A 1S9DA 2GCNA 3ZHBA 1MAVA 1O94D 4QAQA 4B4KA 4NHEA 4NDZA 3CVWA 1CE8B 3C1AA 1DUVG 1NDQA 1Z3CA 2D1RA 4JOSA 5HR5A 1XX6A 5IP5A 4CKCA 4MVCA 4GRDA 4K87A 4N0DA 5H70A 4G5FA 3KPVA 1W0KD 1E5VA 3H5LA 4ALLA 3C7KA 1Y81A 2XMPA 1BH2A 4H35A 4UHBA 4J3JA 3CPHA 5H02A 3VOSA 1RT9A 4RF3A 1TJYA 4LF9B 1WX1A 3L0PA 2QLNA 3KJNA 1LDBA 4I50B 5LYYA 5AVUA 3OQ6A 1OX4A 4OXYA 2NM0A 5J40A 2F67A 3E53A 3NJ8A 1UJNA 4OGLA 1OAOC 4KLZA 4OP1A 4R2LA 1BA3A 2C2OA 4AP5A 1VHQA 3AGPA 4XQ0A 1YIAA 3UV6A 4L8YA 4ZO9A 1MB0A 4OK5A 8AT1A 1N5MA 1X2BA 2I1QA 4L95C 3TM5A 5TMPA 5CYOA 3FTEA 1M1YB 1NLUA 5E2AA 4F96A 1YA4A 3ZE8A 1GGFA 1I9GA 3GJ3A 1GUBA 1KZ6A 3UAZA 4MUJA 4L3WA 3T61A 1QIHA 1TM3E 4W9NA 5JC8A 3WB1A 2C8JA 3EIWA 2XNKA 4E7PA 16PKA 1V96A 2ODBA 3PQ3A 4HAVA 4P3PA 2QTWB 2P8SA 1F3LA 4E32A 3H1EA 2O57A 3KNZA 3OC6A 3REQA 4L0DA 4GQIA 3NALA 2GZ2A 1X94A 3E7XA 1OYYA 3RUFA 1EA7A 3IFSA 5FD8A 3GQBB 3CLUC 1BCRB 3TS1A 3QMPA 3CZQA 3FFBA 2WUVA 4FZRA 1TLTA 4DR1B 1I2MA 1N1GA 1K75A 2BGRA 1P77A 2E4XA 2FOXA 4HGRA 4JOCA 3LOUA 2WA1A 3A32A 4EYEA 3F7NA 4B81A 2D1YA 1TM4E 5F3DA 1YQQA 4JC5A 2H1CA 3AC0A 4JP1A 2H1FA 3SX0A 4QREA 2B9VA 2OBYA 2ZSKA 3ZE2B 5BMOA 4I9UA 3IV7A 1K7XB 2XRZA 2I2CA 4IVNA 1AGPA 4DZTA 3AEKA 2AV6A 2JK1A 1F4VA 4OVKA 3THYA 1K92A 4MROA 2RK3A 3F5DA 3NDJA 4KRGA 4EY3A 2BJWA 1VHWA 3TLJA 4TTTS 1BNCA 4MV1A 4F3TA 1RQRA 4PZZA 1U0JA 3INGA 4BNMA 4EKYA 1CDZA 3T5CA 3U7FB 5EUQB 3TIGA 3T99A 3RC9A 1R3DA 3DHEA 3EA5A 3OUZA 4RX1A 2UZIR 4P54A 2IPOA 3IT0A 5FI3A 3OQNA 2I54A 3UOAB 2PE5A 2GYWA 3E7WA 3L4KA 4JUDX 1F2VA 2XCOA 5CNJA 2NNWB 5F77A 4FX2A 4NMXB 5EKXA 3FGOA 1B42A 3BH7A 2BEKA 4KSBA 2RH4A 3RF6A 2ICAA 3KSRA 4OBWA 2NTNA 5DWQA 2XE4A 3ZTWA 4R8KA 1HT2E 2PRZA 2WVAA 2Y93A 3BIOA 2X4IA 3P4XA 4FGSA 4JA2A 4KH0A 5HJ2A 3F6PA 3R3ZA 3LLCA 1GPLA 3LGXA 1R64A 1CQZA 5CT8A 2C3UA 2VIIA 2P9ZA 4B2LA 5JDIA 1OJLA 2P4UA 4LCJA 1JLLB 1VPDA 1ZD2P 3JQCA 4RVDA 4D0NA 4GQAA 4TM7A 3CLRC 2DFDA 4A6PA 4AG6A 2B4YA 4JNGA 2DWQA 2VUSA 4AECA 3CT6A 5F5XA 5EGSA 2QVXX 3OZTA 3NDIA 3SBDA 2YS7A 3PU6A 4ER6A 3OLQA 2CD7A 1E1CA 1IEXA 1TYDE 1SUFA 1C3XA 1FX0B 5EMLA 1THTA 3KQPA 1QYWA 3PGMA 3QVUA 1S01A 3VI3B 3ECCA 1X13A 4OQ4A 3U1TA 4AWXA 1NIJA 5LQUA 2ZB4A 3H6KA 1TAQA 2AN1A 2ZJOA 3WMEA 2Q6IA 2UXDB 1JR3A 1KY3A 4Q4LA 4DJDC 1GFIA 4JJKA 3ABZA 4KQXA 1SN7A 2XZOA 1U7DA 5AVYA 3OO1A 1TK3A 3FETA 2CBGA 5K5EA 4FOPA 4IJ6A 4IMPA 3JAMA 1YFLA 4H3VA 3WLNA 1PL8A 2FFBA 3D54D 5K8CA 4KHZA 4Z6KA 4FYXA 4G23A 3P20A 5JZBA 2AC2A 1DIRA 4ID9A 1OXKB 2G07A 3U4QA 2QR3A 3MJHA 2WYOA 2J08A 2H1LA 4JI2B 5LBUA 3TECE 3IKLA 4N1AA 4UM7A 4WXMA 2F1HA 2IPMA 2NPIA 2X0IA 1NASA 1WMBA 2DG2A 2HEGA 1S9HA 1U1CA 5FFNA 3OF3A 5FQNA 5JMWA 3RTGA 3GMIA 4B6EA 1Z0FA 1L5QA 1TT5B 4ZU3A 4DV3B 3PITA 4WESA 1YNOA 3R20A 4M55A 2L82A 4HNRA 2PR2A 2W6OA 1AMOA 3L8FA 4L72A 4E5VA 3Q87B 3PEUA 3W4JA 3S7ZA 5FOXA 3AI2A 3BMCB 3G0IA 2J3LA 4FW9A 2EJUA 4OL9A 2WWTA 3QVGA 5CLIA 3ZCRA 1G9TA 4AJKA 4ZYWA 2FP3A 3G8BA 2HJHA 1Q0ZA 5K4AA 4DIEA 5L40A 2IA5A 1U2PA 3ONDA 3VKUA 5C37A 5IT0A 4TZ6A 1R5JA 1IONA 2L2QA 2QNRA 3QUAA 3WNQA 2AJLI 5IEBA 1QX3A 1PE0A 1XMVA 3EY4A 8ADHA 3D4IA 4ZV7A 2PGOA 4DCGA 5LZ7A 2VXYA 4B8WA 1NSFA 3TJRA 5I4BA 4M36A 5B3KA 2D3TA 3K8ZA 4XD7D 3HB1A 1YIDA 3UAGA 3WK5A 2JAQA 4CQLB 1G59A 3PLAE 2F62A 5ADHA 5CA1F 3GRFA 3QYJA 1E7MA 3SYLA 4JMPA 1IQUA 3VZSA 5KNBH 4RKQA 3OJOA 2MSKA 1XCJA 5EJIA 3RIMA 1CJVC 1IBSA 1RBYA 3NTQA 4XOIA 1YR7A 3PA8A 5DCLA 1INLA 4BPRA 4EWLA 3U5ZB 3A3PA 1J0CA 1EQUA 1HYBA 4MWGA 3B1JA 2G9RA 2O0MA 1XPOA 1QO7A 1G0OA 3GZ4A 5J9FA 4LI0A 2A1UA 3MUNA 3JRWA 4I46A 3HHPA 1BQ4A 1R0SA 2HRBA 1ZVQA 1DQPA 2ACEA 1U5BA 3AB8A 3T52A 1DOZA 1UODA 3EG9A 3GT3A 3LY8A 4WCFB 5C18A 5LQRA 5KPJA 3VU8A 2AS0A 1GARA 2PXCA 5HG0A 3QNWA 3H0EA 3GFTA 3QU5A 5JZVA 1Q3TA 2J6BA 4RUKA 5G1PA 1XLUA 5LL6P 3OMLA 2GK3A 2VPXA 1UC5B 2O06A 3M6UA 4OH1A 5EIAA 4AMUA 4HH0A 4Q00A 4BNXA 4Y7CA 1ODKA 3A06A 4YRMA 2R7NA 3G5LA 1V8BA 2I34A 2X6RA 5DV9A 4UFNA 2P62A 3MMXA 2WMYA 5EYPA 4RNCA 2VXCA 4PV7A 1Q1AA 1CEQA 2C00A 3U9TA 5FTNA 1XF9A 1P9LA 2RHWA 2GSDA 4A0SA 1P19A 2XXBA 4RSMA 2C95A 2GI4A 4YHHB 4WNAB 1CNFA 2PXXA 5K05A 1FFHA 4HDMA 3ENNA 2ZFUA 1UAAA 3N0TA 1EZ1A 4YP7A 3MAJA 5DYGA 5JZMA 4BWFB 2I6QA 2Q4EA 1E98A 2RD2A 3UVEA 4V2UA 3EUFA 4IXDA 5DLYA 4L9RA 4NAUA 3ZU6A 1HI9A 3AETA 4D4HA 1PWXA 1VBKA 2QMYA 3EDOA 4DQVA 4LK2A 1RI4A 1GAXA 2Q49A 1D9ZA 3AWDA 4J0EA 4K81B 3CVXA 3IMEA 1E3DA 3KJHA 3G2JA 2BHRA 3OJLA 1UFRA 4I66A 2AXPA 4YRBA 3WBJA 3MXOA 4IFEA 3PF8A 2AXEA 1A8UA 2P3QA 2XCLA 3H11A 4PZLA 5CGQB 3DE4X 3SEAA 5CCXA 2IS6A 1ZISA 1D2NA 2Y27A 4Q3CA 1KQGA 2VZLA 3KYCA 4KQKA 2J9GA 3RGWS 3VHRA 2W2KA 1Y9DA 4F4JA 3ZTTA 5L7TA 5CURA 2XNJA 1CJMA 4V24A 2XUDA 2W42A 4RC9A 3H8JA 1R1DA 3L7DA 5AOAA 3VR6H 1ACLA 1UJ4A 2WKPA 3Q3GE 2PUTA 3N6RA 2XWPA 3UJHA 5I7VA 3ZLTA 1C3JA 2BP7A 2PD4A 3PYLA 4G1UC 4DSAA 1FRVA 2HFJA 3MMSA 4O6VA 1DAGA 1NUTA 3FY4A 4RVFA 3ZD9A 3MJFA 4Q5IA 3SC2A 2ZAIA 1ZH6A 3D3EA 3I4LA 4M9UA 4EUNA 2I2WA 4RTOA 2C9DA 3BREA 3HBJA 2JGDA 1BAPA 3P9KA 4R7GA 2YINC 3JYOA 2JLXA 3ENQA 3GEGA 1GR1A 5EZQA 3AFMA 1AGYA 1JDTA 1X3SA 2EV9A 3A6HA 3KAPA 1D3AA 1QVZA 3RRFA 5TQ0B 3DE7X 5JZOA 1I7QB 5B3LA 3U1BA 2ZJ8A 4G5HA 3SDSA 4ZCTA 1C7JA 2HTEA 3MCAA 1TF7A 1RP1A 4NICA 1UT6A 2OKGA 2Q5QA 3HADA 5EL0A 5BUZA 3H2HA 4IKOA 3GHYA 1Q74A 4KMRA 2JL1A 1X19A 2QMQA 4FHDA 1ADYA 3K0HA 1OZ0A 1SC4A 5AVOA 4JI1B 3ACDA 2D7CA 3G1UA 3GFFA 4CTNA 2BM1A 4TXJA 4BKPA 2AUMA 3BTVA 4ASUA 2UU9B 1G18A 2PT5A 1M2FA 3H86A 2I1VB 4MQEA 5AXDA 3WRYC 4EA9A 2YFYA 2R6AA 1F12A 2WJWA 4UEWA 1RMYA 3FOFC 3PXBA 4CLXA 1CY2A 1DG1G 1BG6A 3WWEA 1V2GA 3VSAA 1Q83A 4JGIA 1VBFA 2CMDA 4C4XA 2RMKA 3EQZA 1GY8A 2GAOA 2XF2A 1P2GA 4J7AA 3UKJA 4LC0A 4YDSA 4OFXA 4IICA 1E2JA 3MHPA 5DHUA 2Q7OE 2YY7A 1XV5A 1JE0A 1NW4A 2HF8A 4AL4A 3GA7A 1T5BA 1XZKA 2LBPA 3EC1A 1QGED 4H1UA 3A1NA 4X24A 3PCTA 5H82A 3HVJA 3T7DA 5CLGA 3QVJA 3MCVA 1BOOA 3T4PA 1NVUQ 2HBYA 1I80A 1BDMA 3KXKA 4P3NA 1ZL0A 4F2DA 1ESEA 3M33A 1ZUHA 1QQ5A 3ZPXA 1P5ZB 4JEUA 4C7MA 5DX0A 1KEKA 5FAXA 2QIPA 2GKGA 1XJQA 5ICFA 2GYVA 1D4ZA 4RGVA 4Y8VA 5AIAA 3OZDA 3ZDYB 4YC7A 5B36A 4IXNA 2B8WA 3DBHB 3K9GA 4ALJA 5E2IA 3D2LA 1AB5A 3QFHA 1HE1C 3THRA 3QUSA 2JFZA 2X22A 1ZD4A 5BUQA 3DZGA 4ROTA 4PM4A 1U3CA 2P2LA 1OIVA 1FLVA 3G9QA 4Q01A 4IHJB 1UQUA 4JHLA 3PQ7A 4L3OA 1O9HA 3QXHA 4IZOA 1ORDA 1WCXA 4S0ZA 5DGIA 5DNWA 1RJEA 4Q1AA 3AVXA 4Q9HA 3DR3A 1MX3A 1W88B 2P78A 4F4CA 3EAGA 4WXEA 1Z74A 3E9RA 1YS7A 2OCDA 4C3VA 1WABA 5AI4A 2ST1A 5KHLB 2V9PA 3PKIA 3G8YA 4PU0A 3OWHA 3EWAA 2PJRA 2P3SA 1ISSA 2VG8A 1OT3A 4N18A 4R0MA 2PEZA 3F6CA 4C7VA 1SHKA 4P4SB 2VK4A 1NF2A 1RYZA 3WGJA 4OQLA 4B3CA 2NYVA 1VCHA 2B7CA 1JW9B 2A5GA 4KLRA 4RZ3A 5LCXA 2FSSA 4BEBA 4QFDA 1C5KA 3KALA 4J1NA 2Y0DA 2Y67A 3B2QA 4ER5A 5TIIA 4KN9S 5E4JA 4C7OB 1R8SA 2PMFA 4KO2S 1K66A 4U9HS 5HMMA 2NVWA 4FC7A 2DT8A 2Z98A 1J8MF 2H2WA 4FK8A 3WP0A 1OLSA 1Y9EA 5F2KA 3ZU5A 5HQ3B 2VQEB 4EJFA 5G1NA 1I5EA 4XD2A 2ZSHA 4BCCA 1SUBA 1XKTA 2PD6A 2QORA 3HZZA 2QM0A 4OH7A 4ZI7F 1I2CA 4PICA 2ZUTA 1R9MA 4AT1A 4ZI3A 1L4HA 3E8SA 2VWHA 3OAAD 1FTQA 4GW3A 2OWEA 2KLHA 1GM5A 2MCFA 4AI6A 1XAGA 3E22B 3KZOA 3FSRA 4KU4A 3RYFB 4JDUA 3H42B 3RIEA 2H1SA 5EWLA 4MJ7A 2EYQA 3ZHRA 3TGLA 1VL8A 1LQ2A 1YUNA 4I8DA 3E58A 1K6JA 2GZDA 1HYHA 4CMJA 3QMMA 4M83A 1W59A 4ENWA 1A9XA 3D8RA 2HUPA 2YY5A 1GCGA 2HA4A 1OFGA 3OTHA 3ZLVA 5SY4A 5BWNA 1JR2A 4OXKA 2Y77A 4Q12A 1Z4OA 2QSYA 5E4YA 5JW6A 2Z1MA 1DP4A 1ND6A 2JIOA 3ZLBA 2Z9CA 2P4HX 4OMFG 1J8VA 5FX2A 2FSGA 1UC4B 4YT5A 1FQWA 5IKEA 1C3OA 2DP4E 1XAIA 4KQHA 1PJZA 1V4BA 4YJ2A 3QM1A 1Y3FE 4NENA 1OX5A 2WAOA 2VHVA 4MRVA 2JI4A 3JQDA 1XWWA 5K8VA 3PT9A 3SG0A 3G9UA 4QYIB 3TTTA 3SXPA 5CDGA 1JKJB 3PDCA 1NWCA 3THWA 3HKCB 1NQUA 4Q1VA 4F5YA 5JS1A 4A91A 3KT8A 5IT5A 1JEQA 3MJSA 1BO6A 3DDUA 3DULA 1K1EA 2WJHA 2HK7A 4LOKA 4EKDA 5MN6A 4V0LA 2UUAB 2E6UX 3ZS8A 2QSUA 3I9JA 3TI9A 3E15A 2AG8A 2BFBB 3C3CA 1B6RA 3FWPA 1CB0A 1A69A 1CVRA 2C2ZA 4IFTA 4U7DA 2D3WA 3MUEA 1JQKA 4DIUA 3BTOA 3SQMA 4ZOEA 5BXQC 4O63O 3I1JA 1IDN1 4TTRA 3EZ2A 4ZAXA 3W78A 5H3LA 2KYRA 1MV5A 5BN1A 4QEDA 3Q72A 2QAGA 3HKBA 4KAFA 3DLHA 2YYYA 1F0PA 1QYDA 2IXDA 2OESA 1IWOA 1T2FA 1P45A 3DBIA 3FVWA 4NBVA 4OHKA 5DLDA 1A9OA 5J5VA 1I2AA 1XTIA 2I9PA 2VYNA 4LC1A 1X38A 4KP7A 4RXMA 1PNQA 4LSWA 5A5DA 4JXXA 2ZIUB 1SBYA 1WSWA 4BZZA 1T9AA 4FHEA 2IDMA 4F46A 1ZCJA 4XYBA 1HEYA 5IT9A 3HDVA 5AVZA 4LXGA 3V2GA 1UQRA 1ZRSA 2EFYA 1JSZA 4ZEMA 3BB1A 1DXHA 1EE9A 1QTIA 2CMKA 3FDJA 1JL3A 1AC5A 4O2BA 5B37A 4RJIA 3R0QA 3WC4A 4BAUA 4OKNA 2R5FA 3HCNA 4LBYA 2ZZMA 4OLHA 4CW7A 2HPVA 2VDWA 3RRZA 4ARAA 4WZBA 1CRZA 3EYAA 3U31A 3IO5A 1DAFA 2HIGA 5CT6A 1LNZA 4XJVA 4KFRA 221PA 5IKMA 3EIOA 2JI8A 3U4GA 5CMLA 2HCRA 3TX6A 2RB4A 3U80A 3AK4A 3CX7A 2CXTA 3ZHXA 4KCGA 2WNSA 4M9CA 3SLRA 1DC8A 3B13B 2HMAA 1R12A 1J4AA 5KB3A 2ZJYA 4M2LA 3A70A 3D6UA 3NTRA 2XRYA 5HDQA 4D80A 3FFAA 3VO9A 3C3BA 3NAGA 4B4VA 2VP0A 5DIZA 2PRIA 3WTBA 4KREA 2JCSA 1ZM3A 4ZOLF 4CLDA 1D2RA 1SUWA 4LZAA 4DCPA 1RW4A 2ECPA 2QLMA 2VUIB 5T8KA 2J7KA 3EXG2 1JV2B 4HTFA 1EPUA 2HMYB 3SJZA 5E9WA 5IVPA 3GP8A 4AIIA 3SXJA 4XSGA 1XDGA 1TXGA 1UWKA 2JFGA 5ITVA 3K0CC 5K3SA 4D92A 2OFWA 5IM5A 1LPSA 5BQXA 1SIUA 4UJ5A 1K68A 2H29A 3K0AA 2E55A 4CBVA 4RVUA 2C2HA 3V1LA 3HY4A 4C6HA 2G7ZA 5E7JA 7ABPA 2YQ5A 3AIOA 2X58A 5EP2A 3OEED 5K20A 1IHPA 2B4KA 3GDHA 4AO8A 4DLRA 2VTVA 1RYNA 5EJ4A 1P0MA 1TYZA 4RV4A 1BE0A 1Q0RA 3CNHA 3VU1A 3TGPA 3STUA 1FMLA 4OUDA 3SEFA 1UC8A 2O8EB 2QD4A 3ZCSA 3GP3A 2PX2A 1BIFA 3QEKA 5HIKA 5T5QA 3GXOA 1OT5A 3V8NA 3RGGA 5TV2A 1CY8A 1TGYA 4D9CA 4M1YA 4EB8A 4LRWA 3HBAA 5B1HA 4IXTA 1T0PA 1TF2A 3AU9A 1GDDA 4QHYA