1OC2A

The structure of nadh in the dtdp-d-glucose dehydratase (rmlb) enzyme
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
346
structure length
346
Chain Sequence
QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-GLUCOSE 4,6-DEHYDRATASE
publication title The Structure of Nadh in the Enzyme Dtdp-D-Glucose Dehydratase (Rmlb)
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 144
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oc2A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1oc2A02
5KVSA 2DC1A 4DIBA 2GYYA 5L4SA 2V6MA 3ROKA 1ZK2A 2Q45A 3DDNA 5TQVA 1XHLA 4F46A 5IAAA 4MINA 1KVSA 5LDHA 1JAYA 2YW9A 2I99A 2JFFA 3PHHA 4R9RA 3F6YA 4XJTA 4GSKA 1RM4A 4XX0A 4BKRA 1JDJA 1ZO8A 4TZTA 5TRTA 1HETA 3FPCA 2BI8A 3S1LA 3UN1A 4I9HA 5CAEA 4DQUA 3WGQA 1UP6A 4HX5A 3DQPA 1HLDA 4U0JA 1G1AA 3A4VA 2PK3A 3DBRB 3VKVA 1DJQA 2CUKA 3AWDA 3T7CA 3QV1A 4N54A 4KUGA 4B3HA 5CDTA 2JAHA 1HL3A 1F12A 2X86A 3W8DA 3EDMA 2CFCA 3WGOA 5IDWA 4R3NA 1ZH8A 3H9UA 4J2HA 3UH1A 2FN7A 4EEZA 4MJLA 2C2YA 1EEHA 3AU9A 1P0FA 1NQAO 3EUWA 4NHEA 4L73A 1XCBA 3GEGA 3PDJA 4Z3KA 4E4YA 2ZYGA 3GUCA 2AEJA 3B1JA 2B5WA 5A9SA 2VHZA 4OSPA 4BGUA 3JD4A 3AOEA 3VPFA 4FGSA 3P2YA 3WGHA 4Q3CA 1Z73A 1D4FA 1NVTA 1ONNA 1NVMB 3U09A 3LDHA 2QW8A 4Z9FA 4CM8B 2Y93A 4FJ2A 2NQ8A 1ZZEA 3DTYA 3WDSA 4DQVA 3U5TA 1JLLA 1VPDA 1DB3A 3EC7A 3H4VA 5L95A 1ZK0A 2BGLA 4H7PA 3DAGA 2O2SA 3HSKA 3ZW9A 1HF3A 3ICCA 5J23A 1P1KA 2B4QA 3W4JA 1J4AA 3WG9A 3F1LA 1BVUA 4GMGA 4CM9D 4EJMA 5A02A 2FPGA 2YHIB 8LDHA 4E5YA 2HK9A 1YQGA 4GKBA 2C7GA 4QEDA 4EJ6A 3Q1LA 1H2BA 3L4SO 3SJUA 2YV3A 5IG2A 2WSBA 4WNIA 3OETA 1CQIA 2NLOA 5KWEA 3R3SA 1P1HA 1HTBA 1HDYA 1E3IA 2GN9A 3ST7A 1PJBA 2DUWA 2GASA 3FNHA 3F1KA 4WLOA 4CQMB 3FTPA 1GPDG 1K3TA 4JP2A 2JD2A 5A5FA 1RJWA 1XQ1A 2W2KA 4LSWA 2HMUA 2GZ2A 4E5KA 1VJ0A 4GPD1 5JS6A 4I1IA 3ZV3A 3KETA 3BMOB 4PG5A 1C3VA 3DAPA 3V5NA 3L77A 1KIFA 2Y1OA 2X0NA 1ISIA 3B6ZA 3FD8A 2OMEA 1HT0A 5T67A 1GPJA 5T5QA 4IZHA 1V3VA 1PZFA 1EVYA 4O6VA 1IPEA 3DBLB 4KUEA 1FDUA 4XQ9A 3ZHYA 5IJZA 5CPFA 3SJ7A 5DBIA 3OIFA 4GL4A 5JAMA 1BGVA 2Q3EA 5IZCC 3WQRA 5CG1A 4OXKA 4RQTA 3RUCA 1FF9A 4BMSA 3HNPA 5DCYA 2WMDA 4WOKA 2AE2A 4RPHA 3PI7A 3JQ6A 1U4OA 5KOIA 4DTIA 1WP4A 1MV8A 1SMKA 1WNTA 1WXDA 2ZQZA 3WYEA 2VUSA 1GZ3A 1F8GA 3TNLA 5I8ZA 3V1YA 2X6TA 3BZUA 3HB4X 3IJPA 1Y8RA 1GCOA 3NAQA 1T2DA 3O26A 3DTTA 4YB8A 4YJFB 4B7CA 3BMOA 3DMTC 3UCFA 2W90A 3CIFA 3FR7A 3K9QO 5COAA 1ENZA 5TC4A 3PJEA 3I9JA 4FFOA 1M2WA 1GYQA 1SAYA 3FF4A 2OL4A 1L7EA 2FY8A 4XDYA 4ZQFA 1MG0A 3DBLA 3PVZA 4YAGA 1PSDA 4NU6A 4PIVA 2PNFA 3TFQA 3O8QA 3PEFA 1NFFA 1CETA 1PJTA 2J6IA 4W9NA 1U3TA 2YV1A 3OIDA 1X7HA 5TNXA 4F6LA 4ITUA 3WGTA 3WWYA 4YAIA 4OJNA 1U2DA 5JDCA 1X0XA 1Z7BA 3UXYA 3ZWYA 4D42A 1ZK3A 3KEOA 3BHMA 4CM3A 4BO7A 2EWMA 4BKPA 5ILGA 2ZKLA 1BW9A 3GUYA 4JBHA 2EEZA 3QW2A 4WE3A 1GD1O 2DFDA 3JYOA 1DAPA 1P9LA 1TT7A 4OIMA 2HKIA 4FFMA 3EW7A 1AXEA 1WW8A 1U28A 2ZJ1A 3ADPA 3TN7A 1XWFA 4DLBA 1VM6A 4YJFA 3CUKA 1AE1A 4BGEA 4L4SA 1XELA 3OBBA 3NJ4A 2JKVA 3ITKA 3ZU4A 2HMVA 3PP8A 2X22A 4MVJE 1CIVA 2A92A 4EI2A 4BNWA 5ITVA 1BWSA 4BMNA 1EMDA 2CNBA 4U6SA 1ADCA 2G82A 4BNVA 2O48X 2IEDA 1GZ6A 2DQ4A 1X14A 4IGFA 1ISMA 1JQBA 2WD7B 4IIUA 2GR9A 1YDWA 3PJGA 3F4LA 1NP3A 1XEAA 1U3VA 3RC9A 1YB4A 5EL0A 5HS6A 5L45A 4D3SA 3UUWA 1X15A 1E3EA 4NK4A 1G6KA 2ZB3A 3TZCA 1Z7EA 1LA2A 2O3JA 4RF3A 1EVIA 3GVHA 4R5MA 2CVZA 4PLGA 1NQOA 4F6CA 3GVIA 3OIGA 3WLFA 3WQSB 4BNMA 2RH8A 1QSGA 2PD6A 1C0IA 2VNSA 3QE3A 3DONA 1YL6A 1EBUA 1GDHA 2AW5A 4D41A 1W0CA 3GN1A 3RKRA 3LZ6A 2Y0DA 1ENPA 1IHYA 3NT4A 4LCEA 4JGBA 3MWEB 4N7RA 1WAMA 4Q3AA 1D7OA 2BFAA 3A14A 3ASVA 2IZZA 1HZJA 4IJWA 4MKRA 4CLOA 2YUTA 2YDXA 3WBBA 3WSVA 3FI9A 3E03A 2BHLA 3ANMA 4NPCA 4WLNA 4DMLA 3ZWXA 2J8ZA 4PZEA 4K26A 4PG7A 3PYMA 3AY6A 3MJSA 1DBVO 3U0BA 4E5PA 3PXXA 5LCXA 4B4UA 5EERA 3PJFA 2HRZA 4WNCA 1JAXA 1NHWA 1ZKMA 1Y5RA 1HYGA 1B8PA 3EYWA 3U4CA 4AJ1A 3NX4A 1NWCA 2UUPA 5K0ZA 2FWMX 1GYRA 3ZWNA 5LDGA 3VH3A 4PG8A 2C82A 3UKOA 9LDTA 1VRWA 3OEYA 2DU8A 3FNGA 3W8FA 4OKNA 3ZZNA 5L53A 3RD5A 2DM6A 2UUOA 3JYPA 3GGPA 5L4LA 3BTUA 4TRJA 1SO8A 1HDXA 3CINA 1M76A 1FK8A 1NR1A 4IJUA 4E2YA 1GYPA 2RBEA 1N9GA 4J49A 1OBFO 5DZSA 3O38A 3E18A 3QIVA 1MUUA 2Q2WA 3S8MA 4A03A 1OC2A 2IODA 1LEHA 3BMNB 4RV9A 9LDBA 3C7AA 1SB9A 1GQYA 4U7WA 4C4OA 2I66A 1PJ4A 3RWBA 4TZKA 4GAEA 4WJZA 2WD8A 2XOXA 4R1UA 1PJSA 2P9GA 3KUXA 4TMFA 4F3YA 3GN2A 1PJ3A 3KLMX 2NQTA 3ZV5A 4BHTA 1VC2A 4CMHA 4UVHA 1E7MA 4P4LA 2TMDA 3QVWA 3W6ZA 1R66A 1GUZA 1U4SA 1A71A 3OJEA 2QZ9A 3SLKA 4RLHA 1YB1A 1IPFA 1O95A 3PQEA 2C59A 2B5VA 3JQGB 4HUJA 3VZPA 2IZ0A 4BIIA 1I2ZA 4QO7A 1VL0A 1G0NA 4XRRA 4GKVA 3ZHZA 1K6XA 2V6FA 3DXFA 5DNAA 3ZWPA 2BRUA 2G1UA 3EVTA 2EERA 3JQAA 4BKOA 3AY7A 2EP7A 4HXYA 5IN5A 1NAHA 5A5EA 3WGGA 1GY8A 3H6KA 4EJ0A 1JWAB 1UDAA 5BR7A 3QVTA 4O59O 3TZHA 2FZWA 3JYLA 3H5AA 4CM4B 3TDKA 3GG2A 2IXAA 2YHUA 1HSZA 3I9LA 3DZBA 1NQTA 4JBIA 3HG7A 1YS4A 1PS9A 3JQFA 3E6AA 3WWZA 1HKUA 5DCWA 1I32A 1ZNQO 4RORA 4CL8A 3N58A 2Q4EA 2PZJA 4AJLA 3B1KA 3IKTA 4MVJA 2ILTA 3UFXA 4D44A 4TROA 4P22A 1X7GA 5TS3A 5JC1A 4B7XA 4G81A 3PHLA 2C54A 2RCYA 4UVDA 1Z74A 2CDBA 1HWYA 2Q1TA 2Q1SA 5IF3A 3VC7A 4Q3BA 1N2SA 3NTQA 4YACA 1K89A 4PGFA 2UYYA 5ICSA 1XU9A 2Y68A 1LU9A 3C8MA 1YO6A 2EHDA 2JFGA 3DZIA 4E0BA 5JAZA 1ULSA 1Y7TA 2HUNA 2VHWA 2G76A 3E48A 4FJ1A 3NTOA 4R1TA 4DIOA 3G49A 3AUUA 4BO8A 2E49A 4I9NA 4P38A 1PGQA 1ZEMA 4NG5A 4GLOA 5C7LO 4RPGA 3PHJA 1YVEI 4B8WA 1EQ2A 2W98A 4O0LA 4YJHB 5HTOA 1H93A 1TB4A 2ZCVA 3GPIA 4RL6A 3WYCA 4UVIA 4R3WA 1ZSYA 2VWPA 1XR3A 4D45A 2VRCD 3HN7A 2PY6A 4UVEA 2PZMA 2QRJA 3E5RA 1ARZA 5K6AA 1H6DA 3TRIA 2F1KA 1V6AA 3FRJA 3OQBA 4KP7A 3LK7A 2GDZA 4PZDA 4KOAA 3A06A 2QHXA 4DVJA 2OBNA 1DFHA 4CM7A 4M54A 5JDIA 1KVTA 4KTTE 1WMAA 4TWRA 4A2CA 2V7PA 3MEQA 4R68A 1Q0QA 1ISFA 3D5TA 3RUIA 2G17A 1X1TA 3Q9UA 4RF4A 3W8EA 2XAAA 4H16A 2YDYA 1E3WA 3NGXA 2Y1GA 2AEMA 4CV0A 4PLCA 5IDYA 4D79A 1P1FA 4R5HA 4BNZA 2B35A 3O03A 4FOOA 4AJPA 4EDFA 3GF4A 7ADHA 1I5RA 1ADGA 5IFLA 3INRA 3A1NA 4BO2A 4HBGA 5HM8A 1PWZA 5L40A 2I5PO 1GUYA 3L07A 1WVGA 3CEAA 1E6UA 1F14A 1IHXA 4FC7A 4TVOA 4ZRMA 3UVEA 3LSYA 3LT1A 1VJ1A 4YR9A 5EQDA 2FSSA 2NU7A 3GZNA 4KDFA 3ZDFA 1FDTA 1TT5B 1UXIA 4XD2A 3CMMA 4FFNA 5TT0A 3PWSA 4NJMA 4KWHA 2VHXA 1GQQA 3RASA 1UP7A 3GGOA 4CM5A 1YBMA 3OJLA 3RC1A 4U0KA 3I6QA 4R16A 2VQ3A 5CDYA 5ENVA 4W7HA 1NBOA 3I4FA 3H2ZA 4J6FA 1I3NA 2Y66A 2YQ5A 4Q3EA 1SOWA 3JQ7A 1AHHA 3GVCA 1NNUA 1GADO 1ZUD1 3IP1A 2GN8A 1RYEA 4J0FA 3CH6A 3KOUA 1E7RA 5C7OO 2QG4A 1KOLA 5JBIA 2X23A 3PQDA 4JIGA 3Q0EA 3L9WA 4OSOA 3B70A 3HB5X 4J4TA 3WNVA 3VZSA 4UREA 4ALJA 2VNAA 1IOLA 2O3RA 1MGOA 1U5AA 5KVQA 3QLJA 2HK8A 1ORRA 3PDUA 5DOZA 3WGYA 4CMGA 3QY9A 4FCCA 4FC6A 4PCVA 5FFFA 1UAGA 2GZ1A 4ALNA 3ETDA 2GZ3A 3NKLA 2IYPA 1LNQA 1NPTO 1T4DA 3FCOA 3RC2A 4OOFA 3GH3A 4OKIA 3PFWO 4IMPA 1UZNA 3Q9NA 3HUDA 4QT0A 4ROSA 2I6TA 3SEFA 4AJ4A 2PGLA 3TQHA 1QG6A 1PS8A 2EJWA 2O3QA 3JCZA 2H63A 4FR5A 5ER9A 3HWRA 4PG6A 1PJLA 2SCUA 3EHEA 2OHXA 4WUVA 3ROQA 5L51A 3AJRA 2BFOA 1PX0A 3AUSA 1DXYA 4KQXA 1U2GA 4TVBA 1MXHA 3ASUA 1U3UA 1WWKA 1W8DA 2NUAA 1JKJA 1RPNA 1ZJYA 2X4GA 3HJAA 3KYDB 4JN6B 4R9SA 5I7SA 2CF6A 4RF2A 3ZWOA 1PQWA 2ZIZA 1LDMA 3WGZA 5A4DA 7MDHA 3QRWA 4J1QA 4II3A 1FJHA 2EP5A 4PRLA 3IQDB 1F17A 5G0WA 1SPXA 3JQBA 3LU1A 1OFGA 3NUGA 1MP0A 4A27A 2B4TO 3WMXA 1K6IA 3RIHA 2RHRA 2HMWA 3ZWAA 3ENNA 3PFFA 3BA1A 2H6EA 3RUHA 3SX2A 4DBZA 4CV2A 1WDKA 2Y99A 3NGLA 3AFNA 5T57A 1LDNA 3GA0A 3HADA 4YQYA 4ZD6A 3JYQA 4BKUA 4FN4A 4BMVA 3DHNA 3GMSA 4P8RA 1Y81A 4YDRA 5HBRA 3C1OA 4FSHA 1HDRA 4BNKA 1PJCA 2JCXA 2RHCA 4ND3A 1LDYA 3ZGYA 5A9SB 3D3WA 1JN0A 4IXWA 5CEFA 4CMIB 3O9ZA 2IEBA 4Z3DA 1YKFA 1E1LA 4QUKA 4XGKA 2HK7A 3QWIA 2JFHA 3MJVA 4XIJA 4EEXA 4NDNE 2GRAA 2DKNA 3K2EA 1WDMA 2PD3A 3S2IA 3ETGA 2EIHA 3KYDA 1PGNA 1ZCJA 3ZNOA 3PQFA 2FR0A 2AHRA 3FWNA 1NTOA 3VPSA 1R0LA 5F21A 1YL7A 2C5EA 5I9NA 1UAYA 4UUMA 3GAFA 4ALLA 4B8ZA 4WOJA 1UDBA 2HO5A 1K6JA 5BQFA 4C7KA 4EBFA 1KS9A 1GAEO 3OQ1A 4LMPA 4RZIA 2UV8A 3AI2A 4R51A 1HDGO 1VJTA 3TZKA 4X54A 3ZHBA 4D0RA 1PR3A 4AJNA 4BVAA 1VSUA 2BF7A 2W8ZA 4JJGA 1R4NA 3FTNA 5KJ1A 1PEDA 1EK6A 1U8XX 3DEYX 3ANLA 3RROA 1JW9B 4XKJA 4HP8A 4DXHA 4Y6SA 2PV7A 1PIWA 2V6GA 2HJSA 1NAIA 5IDXA 2AMFA 4PG4A 1J6UA 4O1MA 3TJRA 4CMIA 3G1UA 2YJZA 1XU7A 5GZ1A 1U9JA 4UEJA 1LRJA 1T25A 1MXFA 1VE9A 4ND4A 4WCFA 1PQPA 3BTVA 5DDIP 3ZWBA 3ITDA 4M86A 4YEDA 3AM4A 5B4UA 5TGDA 1DIAA 2PTGA 3IUSA 4M89A 2W2KB 1H94A 3U9LA 4BO4A 2V6BA 3OHSX 2A35A 1E6EA 2GPTA 4PVDA 2HJRA 1PGPA 2G5CA 3VZQA 2PKRA 3T7EA 1LLQA 3KB6A 4FFPA 3BAZA 3RUDA 3PWKA 1NX6A 1SZJG 2Y1DA 4XQCA 3U4IA 4RVSA 3CTMA 3MZ0A 3UF0A 2B4RO 4YT4A 2EW2A 1PGJA 4HFNA 4M1QA 1Z75A 2P91A 4D3DA 5CDSA 3LT4A 2X0RA 1P31A 5BSGA 3UOGA 2QYSA 3D0OA 3INTA 4PLVA 2OO5A 3GFBA 1PZEA 3MCVA 4NQZA 3PWZA 4WASA 1IE3A 4RLSA 4BKQA 1XGKA 5GZ3A 1JU9A 3ZNNA 1MFZA 3NDIA 4G65A 2JHFA 2WJPA 5EINA 4RDIA 3TOXA 1P1IA 3RU7A 4U5QA 1Q7GA 2DTXA 4XB1A 1GR0A 5F1PA 5IXYA 2ZYDA 4ZJUA 3Q2IA 1O8CA 1D1TA 1Y8RB 1E0DA 5B37A 4XYEA 4ALKA 1R37A 4RDHA 4IS2A 1LDBA 1DFGA 2NV6A 2DPGA 4QSMA 2AQIA 4IIVA 1D3AA 1P74A 1UZMA 4LK3A 4K28A 4DPKA 1I3LA 4ZICA 1LDEA 1LLCA 4KTVE 1JWBB 4RVHA 4MO2A 2O3TA 1QORA 2QRKA 2H9IA 4ZN6A 3BMCA 1AN9A 3V1TC 4TRNA 4NFSA 1NHGA 1TVEA 3IL2A 3VZRA 1WMBA 3C3XA 2QZZA 2AEFA 2VHVA 3O8QB 1EFLA 4NK5A 2Q4BA 3U4DA 3ULKA 4L0QA 1DEHA 3LC2O 3CXRA 4RPLA 3WFJA 1HZZA 4OMUA 4CLHA 2BMAA 2D2IA 3L4BC 1BXGA 2C20A 3TFOA 3VVCA 1GTMA 4RF5A 5T8KC 4ALMA 3TZQA 1B8UA 3B20A 4L74A 1BW9B 4RO0A 4IQGA 4ZRNA 4DLLA 3OA2A 1R6DA 4I5FA 2FSVA 5JMPA 1NM5A 3MTGA 4MVJI 1MLDA 3QVXA 2WTBA 3UHAA 3D4PA 1Z45A 4HNHA 3I52A 5CFZA 1KBZA 3DZHA 1LBEA 3IAHA 5GZ6A 4DYDA 3HDYA 1B7GO 1PR9A 1JVBA 2NADA 2UVDA 1CEQA 4OQZA 2OBYA 1E92A 5EN4A 1SOVA 2O4UX 4BS9A 4IS3A 3EK2A 4DL9A 2HQ1A 3JQEA 4YYZA 3COSA 2RAFA 1K2WA 3VPHA 2DBQA 4CL3A 2NNLD 4GGOA 1B8VA 3OH8A 5A1TA 1EBFA 1C14A 5DBFA 2YY7A 1T4BA 2ZTUA 1BXZA 4WGGA 4BV8A 4W82A 1ISGA 5DF1A 1GL3A 1E7WA 1DAOA 2J3IA 3FWZA 3G1TA 1O94A 3PJDA 2Y1FA 3D64A 3RAJA 2IXBA 4MP8A 2DFVA 3M1LA 3PGXA 3PLNA 2VUTA 5I8WA 4GQAA 3WR5A 4PFJA 4MKXA 3R0IA 1SNYA 4IDEA 4TRRA 1O9BA 3IP3A 4UUOA 1VLLA 1OMOA 4JK3A 2Y0CA 3ONEA 2ZK7A 2DBVO 3AFMA 4M55A 3L9XA 4CMKA 1XSEA 2NU9A 3WNQA 5IN4A 4E3ZA 1YOVA 4CLOB 3S55A 4A0SA 4BL5A 4BO6A 4IINA 5JYEA 1PTJA 2DVMA 1C1DA 3GT0A 4Z6KA 1FMCA 3JD1A 3GNTA 3HE3A 1QMGA 4CMJA 5KVVA 1WLYA 2HCTA 2OZPA 2WWRA 5JC8A 4IGEA 1OAAA 1N92A 5L7TA 3S2GA 5B12A 3MJ4A 3JQCA 5TT1A 3RQSA 2C0CA 5I9LA 2Z1MA 2O50A 1EE9A 3H9GA 5BSFA 1C0KA 1Q1NA 3DMYA 1TA4A 3ONFA 3V1UA 1ZSVA 3K31A 5CEEA 1LC0A 3GRPA 3GPDG 3OJFA 3OJ0A 2VOEA 5BSHA 3RKUA 1NQ5A 2J3KA 2J5RA 1J5PA 4ND2A 1HE2A 1P77A 2D0IA 1JKIA 1T2FA 1DLIA 1R4MB 4MPDA 3U49A 1T1SA 3DO5A 3EGOA 4UULA 1N9GB 3BHIA 4YQZA 5C37A 2I3AA 3X2EA 4J9VA 4PN3A 1KY5A 5IZCA 3ROMA 1CDOA 3QWFA 4KWIA 3PZBA 1N7GA 5JMWA 3IS3A 2AG8A 2H5LA 3CE6A 3LVFO 4WEOA 1NR7A 3GVPA 3PIIA 2EKLA 4GH5A 4E2XA 4EW6A 3K2BA 3WYBA 5DULA 3TL2A 5THKA 2BFPA 4IDBA 4B3IA 1DPGA 2OGUA 1GV1A 1ONPA 3KHUA 4FB5A 3NT2A 2QYTA 3RUEA 6LDHA 4O63O 2GN6A 3GZ4A 4JX8A 1V8BA 5DOVA 4CQLA 4ZVVA 1HLPA 4J2OA 4J9UE 1HE3A 3MOIA 1I2BA 3OA0A 5DP2A 4AG3A 1W4ZA 1Q2XA 3JQAB 3T4EA 3DMTA 3OECA 1DRWA 3K30A 5DT9A 4CQMD 4K9DA 1UXGA 4CMCA 2UAGA 1P44A 2VRCA 4J7XA 4AJOA 2BD0A 3BMQA 3ORFA 2EXXA 4LSMA 1R4MA 2NM0A 4B4WA 1B14A 2X9VA 4TQGA 1LQUA 4I9UA 2VYVA 4RPKA 4B79A 1B0AA 1LUAA 4ZA2A 2P68A 4MIEA 4XR4A 3IKVA 3GY0A 2X0JA 3PYXA 4E32A 4DWVA 4JNKA 4ZQBA 5AQ1A 1CRWG 2QRLA 3GLQA 1MC4A 3AI3A 4XQGA 3GHYA 5G0VA 1A9YA 1M6HA 4YCAA 4HFJA 2E4AA 3ONDA 1S7CA 4D3FA 1G0OA 3KYBA 2WDZA 5B4VA 2X5KO 2FOIA 2PZKA 4AJIA 5CG2A 4DC0A 3DR3A 4M8SA 5T6BA 4FQ8A 2PA3A 2WYWA 4WLEA 3H8VA 4NNJA 3K5PA 3EMKA 2C2XA 1T24A 2B69A 1GU7A 4KZPA 5TJHA 1DIBA 1BSVA 2IRWA 5G4LA 4L4XA 3MJCA 2J3HA 3AM5A 1I3KA 4U6QA 4E5NA 3QWAA 3LC1O 2R00C 3LLVA 4XRGA 5I7FA 4JBGA 3OEWA 2BGKA 1UZLA 3MTJA 1LSUA 3M1AA 3WS7A 1ZSNA 3WJAA 2ZATA 1IYZA 4ZGWA 4CODB 4GX2A 1HEUA 1HDCA 3RBVA 2EGHA 5IDQA 1SCUA 4PLTA 3PYLA 1HE5A 3DFZA 2YV2A 4DMMA 4NZ9A 1PZHA 2I9PA 4NH4A 4UEKA 4A26A 2VYND 3WOHA 5KTKA 3ZI0A 4Y8VA 3R6DA 4XYMA 4R54A 4JROA 4QECA 1I2CA 4ZQGA 4GMFA 1ZVMA 4XCVA 1YJ8A 2VZ9A 4YAKA 2J5KA 3BTSA 3Q11A 4D46A 2JCVA 3DBHA 1ZMTA 3DHEA 3NEPX 4XJSA 3JD2A 4BNXA 5ER6A 4E13A 4WK6A 4CUZA 3GRKA 1JTVA 2WYUA 3DZJA 3KVOA 5CPBA 1BMDA 3E9NA 4OO3A 2Q99A 1QYVA 2Q1UA 4QXMA 4E33A 1E3WB 5JY6A 1MFPA 3GAZA 3R3JA 1OC4A 1HSOA 1K5HA 1NVGA 5H83A 2EW8A 1UXHA 3KV3O 3ANNA 3FBGA 4CMEC 4FFLA 3NRCA 3I9NA 1H9BA 4K6CA 4IJKA 2D3TA 1I10A 2QQ5A 4XIYA 1C0LA 1LQTA 4FIZA 1N1EA 5G2OA 3JYNA 3GZNB 3AU8A 2UDPA 4CR6A 3ZWWA 5ICMA 4NJMB 1IL0A 4PRKA 4YT5A 1FDVA 2PFGA 3MWDB 1RM0A 1LI4A 1A9ZA 2WE8A 4XZ3A 1Y6JA 2GCGA 3G0OA 2Q50A 2VYVD 1U1IA 4DYVA 3WGIA 1F0YA 3MJEA 4IUYA 4J0EA 2QX7A 3BHJA 1NPYA 4J4HA 3P7MA 4W7IA 3ZH2A 4DRYA 3JQ7B 2OFPA 2I65A 1BDMA 2BELA 5IXSA 4MVJM 4RVDA 4JJFA 3K73O 2AA3A 1EUCA 2OUIA 1Z82A 4R1SA 3I9OA 3PZRA 2CVOA 4NMHA 2P5YA 3KEQA 1ZK4A 1A7KA 3P2OA 4BUCA 3ABIA 1KVUA 4N5LA 5EMHA 2Y67A 4Y98A 4QO8A 4Y6RA 4BB6A 4JLWA 3RSHA 1A4UA 1I24A 1XA0A 3PPIA 3QWBA 3Q2KA 3TZ6A 4Y9DA 5TIIA 5HRUA 1EFKA 4AVYA 3C1AA 4KUHA 1A5ZA 1KEVA 4NBUA 1CJCA 1I3MA 1LSSA 3H3FA 3L6EA 4MVJG 1EDZA 1Y8QA 3JQ9C 3TSCA 5ITWA 1YH3A 4DBVO 1VL6A 4IY1A 3F47A 2E6UX 1SEVA 4BNHA 2Q1WA 5K9ZA 3UAGA 4RQUA 3VH1A 1ENYA 2X58A 1E1MA 4PLYA 2NVUA 3T4XA 4OH1A 2PKQO 3RBZA 4MVJH 1DSSG 4MOWA 5A06A 1LXCA 2FRDA 1YQDA 2FPPA 2CY0A 2BI7A 2RH4A 4CMAA 1B16A 3DOCA 5L7WA 1QYXA 2LDXA 4FOSA 5A05A 1GEGA 1R0KA 4J91A 4XGNA 2VT3A 1UR5A 2CMDA 5AXAA 2YFHA 1QXSA 1FXSA 2PD4A 3LYLA 4GWKA 4N5MA 4XYLA 5KVCA 4R1NA 2P4QA 4E6PA 4YVFA 3TWOA 1UXKA 3GG9A 3H5NA 2D5CA 3K92A 5L4NA 3HDJA 4TKMA 3K8ZA 3GNQA 4ILKA 4OXNA 3WTCA 3KM0A 3DZFA 3DBVO 3STHA 1KC3A 4LISA 1E3LA 3NJ8A 2Q46A 2Z5LA 3Q3CA 5B1YA 4IDFA 3UGKA 3TPCA 3V8BA 1RKXA 1D1SA 1PJ2A 3LC7O 4IM7A 1W6UA 5A3JA 4MP6A 2OP0A 3AOEC 2VZ0A 3ETEA 3EZLA 4FFRA 3HFSA 4FPXA 3BYZA 3E1KA 4D7AA 3KBOA 5I7EA 1Q0LA 3D3WB 5H82A 5A9RA 1O5IA 3IIEA 4DLAA 1XLTA 3C7DB 3KSUA 1BDBA 2EF1A 2FMUA 2XF8A 2ET6A 2VZ8A 2VWQA 2AXQA 2GF2A 1HE4A 2BGMA 1Y9AA 2DPHA 4M49A 1VI2A 1ZFNA 1AUPA 4BV9A 1E3JA 2GSDA 2PH5A 2VHYA 4PVCA 4ESOA 3EZYA 1R12A 4W99A 1DC3A 3B1FA 1T26A 1F06A 4XWYA 1V35A 2GERA 4CLXA 4GSLA 3WICA 3A9WA 3G17A 3E8XA 3PHIA 4R41A 4AJHA 2NSDA 1EVJA 4YRAA 1QLJA 3OMLA 3LLSA 3SVTA 4BB5A 4XGIA 1N1GA 1H2HA 1R4NB 3UCXA 3RUFA 1PL8A 4BO1A 2DUUA 4AJKA 3VDQA 5LC1A 3KYCA 4H3VA 2R2GA 2AG5A 4WCDA 3WJ7A 5BSEA 3TL3A 2VT2A 4YBZA 3GDOA 2IZ1A 5JLAA 4UUPA 1HDOA 2C07A 5CDGA 5MGBA 3AUTA 4OXYA 4Z0PA 5AYVA 3EAGA 1PZGA 3F5SA 4JQCA 4WCFB 3CPSA 4NBRA 5EIOA 4UEOA 4NBTA 3ZV4A 1J0XO 3GFGA 4IJVA 4MIYA 1TLTA 4IQ8A 3UCEA 4AJEA 2X0IA 4Y6PA 1B26A 2Q2QA 3C24A 6ADHA 5KNLA 1DDOA 3KXDA 4H15A 1QR6A 1B3RA 3CZMA 4J1SA 4DQXA 3GK3A 4HY3A 5FF9A 4AFNA 4RVUA 3PK0A 4YXFA 1DOHA 3I9MA 1U7HA 2W2LD 2Q2VA 2AE1A 3D5QA 1W73A 1NYTA 4PLWA 5GMOA 1X13A 2WE7A 1UH5A 5JO9A 2NU6A 5FEUA 1VSVA 3KLPX 1H5QA 3W4IA 4DREA 1BTOA 3KRTA 5CHEA 4DGSA 5JCJD 3W1VA 2YFQA 4NU5A 4EYEA 5U9CA 4S1VA 1KC1A 3ZWCA 1KVQA 4J90A 1E1KA 2E37A 3WB9A 1ZK1A 2VN8A 4UAGA 2HRBA 2DAPA 4PLZA 1KERA 1RM5A 4CUKA 3RJ5A 3U3XA 3DC2A 4L9RA 4RJTA 3IOYA 4INAA 2C5AA 2Z95A 1KEPA 5AOVA 5HS4A 5AVOA 1M6WA 4Q9NA 4MVJP 1LDGA 4YRDA 3E9QA 1ID1A 4JXKA 4EUFA 4MP3A 3L6OO 2V65A 3QA9A 1H9AA 1LRKA 4BQPA 4TSKA 2ZQYA 1R0SA 2Y1EA 3GC6A 3V2HA 5CDUA 3RC7A 4J16A 1IUKA 4KQWA 3QP9A 2YQ4A 4GVXA 4BGVA 3RJ9A 1DJNA 4L75A 1C0PA 4N5NA 2ZYAA 4LCJA 3EVNA 3BMCB 2NVBA 1NXQA 4W9NC 4LMRA 4CM1A 1GQ2A 2C29D 1QV6A 4Q39A 5JDCC 3QVSA 1PGOA 4BNJA 4WKGA 1ADFA 4DPMA 3IC5A 1RYDA 5F5NA 3GOHA 2HAEA 1NWHA 3D3EA 3WXBA 3WIEA 3DBRA 4FW8A 1QV7A 1B15A 2AQ8A 3JQ8B 1BXGB 2DTEA 3VTZA 3WMWA 4YPOA 1L1FA 4YRBA 2B36A 1ZXLA 2A4KA 3GNSA 3LQFA 4B4VA 3GR6A 5KCZA 3QQPA 1BG6A 3I4CA 1YXMA 4E5MA 1Q7BA 5JSFA 4CR7A 3ZU5A 3PRJA 4OAQA 3S2EA 3ZCXA 3ZW8A 1AXGA 5JW6A 3Q6IA 5KJ6A 1H6AA 2EKQA 1M66A 5EPOA 4BNUA 1Y9EA 1A72A 1WZEA 4FGWA 3RBXA 5A9TA 5T64A 4ONEA 4AICA 3U62A 4J3FA 3DHYA 1ZJZA 1XYGA 5L3ZA 3JD0A 3KSZO 4YA6A 4OM8A 4CM8A 3ZV6A 4A73A 1CF2O 1A4IA 2VRBA 4EITA 5AXCA 1DFIA 1GUFA 1E7SA 3VKUA 1NFRA 3IMFA 3G79A 2H1SA 1EZ4A 3WTBA 4YJGB 1DIRA 3H9QA 2FZEA 1OOEA 2D59A 3JQ8A 3TF5A 4QQRA 3GVXA 4IBOA 1PJQA 1R15A 2IE0A 1YQXA 1JKFA 4OYRA 4OOEA 3JTMA 2JL1A 2ZCUA 2YHIA 4AJJA 1EK5A 3WBFA 1GEEA 2OORA 4IDCA 4CLDA 1YWGO 3ZWMA 1E7QA 1NFQA 5DBGA 1NPDA 2DLDA 4R01A 1X1EA 2CDAA 2EG9A 4JP3A 4ZQHA 1T2CA 3N7UA 2PKQP 4WLFA 1E1NA 3MOGA 4BNLA 4W6ZA 5ADHA 2I67A 3VPGA 1XDWA 4PLPA 4BO9A 5ES3A 3IUPA 2ZB4A 1YOVB 2HU2A 3ZU2A 2CF5A 2P5UA 3I83A 4K6FA 4AJ2A 1VKOA 5JY1A 2BH9A 1C1DB 4N18A 4CQMA 5FI5A 4GBJA 4E21A 4BNYA 3NDRA 2WM3A 2BLLA 4II2A 2P2SA 1DC6A 2ZB8A 2A94A 5L9AA 1MX3A 4YJGA 1WDLA 4E2ZA 3PLRA 3MJTA 1IZ0A 1GV0A 5MDHA 3INGA 3A28A 1GFSA 3QJ5A 4DIFA 3VH4A 1A27A 4EZBA 1XG5A 1X0VA 3OICA 1ONOA 3QVOA 1MB4A 2O4CA 1Q7CA 5I9MA 4E2WA 4Z0HO 3GEMA 4HKTA 3D4NA 1SEPA 4FS3A 2Y1CA 1SB8A 4K1LA 1ISJA 2D8AA 1V3UA 4J4BA 3D1LA 4I8XA 3K96A 5BNIA 1B3BA 2D5AA 5THQA 1ZW1A 4Z9YA 4NBWA 3D4OA 5F1OA 1S6YA 1I33A 2CDCA 3CMCO 1EUZA 2VUUA 3M2PA 2E82A 3KSDO 4KMSA 1FDSA 3I23A 3UW3A 1HYEA 2GGSA 3ENKA 1P33A 2I3GA 4Q3DA 4MKZA 3DZGA 3GDFA 4RVFA 1U3WA 5U4QA 3H65A 4CQLB 1BVRA 5TLSA 3H5RA 2R6JA 1QP8A 2Q49A 2JJYA 2FP4A 2O23A 3ON5A 4LRSB 1Y5MA 1ZXBA 3C85A 3H7AA 5FI3A 3RCBA 1RWBA 2PGDA 1TI7A 4RZHA 3GGGA 4YWJA 5JXWA 2JD0A 2VYNA 1PWXA 5AXDA 3VOSA 1DIHA 4GX0A 1E6WA 4A5OA 3BMQB 1Y1PA 3ZNQA 1QYDA 3SC4A 5C7IO 4LRTB 4ND1A 1DLJA 2JD1A 2LDBA 3ICPA 1EE2A 5FWNA 1V0JA 3PTZA 5KIAA 1YJQA 3JQFC 1M75A 3RFVA 4XYGA 1E5LA 3S2FA 1ML3A 5COQA 1YBAA 3FNFA 3L4BA 2VOJA 5JE8A 3F5QA 4YTEA 3SLGA 3ZNPA 4BNFA 4LGVA 3U4HA 4AL4A 5KJFA 4URFA 4D0SA 2AQKA 4TRMA 1IULA 5T8KA 4FBGA 1YE3A 2BFMA 3NDJA 4U8GA 4J1NA 1MC5A 1XQ6A 1MG5A 3GEDA 2VCYA 4J1TA 4FD3A 3GMDA 4IQ0A 1TXGA 3SC6A 3JSAA 1OZAA 3AW9A 4NJOA 1EDOA 1YBVA 1PS0A 1DRVA 1H6CA 2P9CA 2VWGA 2B37A 3HHPA 5A03A 4IDDA 5DN9A 3M6IA 4BO5A 4F45A 4L8VA 5BT9A 2NU8A 1CWUA 3SBOA 4FJ0A 3RFTA 3DOOA 3NV9A 2GUGA 4HFMA 4BQRA 5EESA 4DA9A 2DBZA 3WQQA 4S3MA 3AOGA 4P4NA 1HXHA 2PWZA 5B4TA 2WD7A 4NFHA 1A7AA 3O4RA 2FHSA 5ENDA 4J43A 1O0SA 3AY3A 2CD9A 3OF2A 1EQUA 5AXBA 3HDHA 5C5IA 4GX5A 1UXJA 5IZ4A 4ZQEA 3P19A 4M87A 5DCUA 1BRMA 4YAJA 1LRLA 4OL9A 2FPIA 5K6AC 5L7YA 1LTHR 2VWHA 5EQFA 3VH2A 2PLAA 3IDSA 1KYQA 1O89A 2JHGA 3BIOA 1TEHA 4JCOA 5JDIC 3GHHA 2O7QA 1UDCA 1UJMA 4J7CA 1KETA 3VPXA 1GCUA 3H9EO 3DBHB 4HV4A 2G0TA 3F9IA 3JQDA 4IXTA 1ZBQA 3WLEA 3H2SA 3ZHXA 4IZIA 2X7HA 3NYWA 4WLVA 1LSOA 1U7TA 4YJDA 3LT0A 3RI3A 4YT2A 5JAIA 3P5SA 4XR9A 1J49A 2J3JA 4BNGA 3FSRA 1P3DA 3FNEA 1N8KA 2Y0EA 2X8LA 5CEJA 3OP4A 1C1XB 3DZKA 1SC6A 2GLXA 4C7JA 4Q3NA 4HNGA 4G5HA 4RPJA 1E5QA 2X1HA 3OM9A 5G0SA 4DPLA 4B4OA 3AK4A 1DHRA 2EV9A 4D43A 2IDZA 5TF4A 4CV3A 1EVZA 4TKLA 1ULUA 4A7PA 1KVRA 3DB2A 4P4GA 1YGYA 5I7VA 2BKAA 4E30A 4MVJF 4BGIA 5GY7A 1JA9A 1EUDA 1XKQA 2XXJA 3FR8A 4RCVA 1WZIA 2Z1NA 1XIVA 1CERA 3OJOA 4XB2A 3DL2A 4XYBA 4CJXA 2YYYA 2VTEA 4XQEA 4NI5A 3BMNA 5JNLA 3HDQA 1AHIA 1LLDA 1Q0HA 2ZTVA 1CQJA 5F3RA 2DT5A 3PHGA 5F1KA 3E82A 2P4HX 1N7HA 3LF2A 2VTDA 3F46A 1CYDA 4HFRA 1MA0A 2POQX 3ROPA 4KDEA 4R69A 5HA5A 3JV7A 5FYDA 4WEQA 1DHTA 4W4TA 2NWQA 1C1XA 4XEHA 1DRUA 3JQGA 4QFDA 3GQVA 3OSUA 4HADA 1BXKA 2X5JO 1LC3A 1VL8A 4NIMA 1IY8A 2CSUA 3WFIA 2O2YA 1I0ZA 1I8TA 2JAPA 1IB6A 3GDGA 5BNTA 3V2UA 3VDRA 5A3VA 1NASA 1ZMOA 1Y8QB 3KZVA 1ZEJA 3RU9A 1ADBA 2EKPA 4IMRA 2D1YA 5JFOA 4EUEA 3I5MA 2O3SA 3W4KA 4CM4A 3QHAA 5U1PA 4JJIA 4OHUA 4DC1A 4LVUA 2NVUB 2HDHA 4O5OA 5JYDA 3N74A 2GO1A 1H0KA 1D8AA 2NTJA 4GGPA 4WECA 5COBA 2ZTLA 4MDHA 3AM3A 2WYVA 1N5DA 3I9KA 1FDWA 1HDZA 4XA8A 1H6BA 1E7YA 3CKYA 3DWFA 2EGGA 2HMSA 2NACA 4QTZA 5KKCA 4GI2A 4GWGA 2C7VA 1I36A 4UVGA 2GD1O 1VKNA 4XDZA 4PLFA 2F00A 3JQBC 4I5EA 1R16A 1M67A 5G4KB 2DBRA 2OP1A 4Y67A 3PGJA 2WEKA 1YONA 4EGFA 1HYHA 1UUFA 4IDGA 4G2NA 4B3JA 1P0CA 5DP1A 4LN1A 5G0TA 1ISHA 1QKIA 3HQ4O 1ZIDA 3QSGA 4OGWA 4PZCA 5TJ9A 4B7UA 1PL6A 1PU2A 4I08A 4BNTA 3V2GA 2ZTMA 3WIDA 1P1RA 3VHRA 4BNNA 1IZ9A 2IYOA 1I30A 4UUNA 1OI7A 2NTVA 4OQYA 3HN2A 3SXPA 2B0JA 2R00A 3LF1A 1K0UA 1U5CA 1DC4A 3H9JA 4FDAA 5BNFA 5CP8A 4CM6A 5HWSA 3JQAD 3ZN2A 4ALIA 4YJHA 2FR1A 3FN4A 4YAEA 4CMBA 1YB5A 5JPIA 4CLRB 2X9GA 2PH3A 4E31A 1RM3A 2W2LA 3NTRA 4CV1A 3BTOA 3VAZA 5JAQA 2TMGA 4BO0A 1ENOA 3C7CB 3C1TA 4Z0TA 1AGNA 1PL7A 3D7LA 5KJCA 2PGJA 3M2TA 1KY4A 3DAFA 5JCJA 3TOZA 4ZHSA 3FHLA 2OXIA 2XPCA 1QLHA 4GVLA 1PQUA 3ZWVA 3CZRA 2PR2A 5G4KA 1L7DA 2ZB7A 1LX6A 3CSDA 1I01A 5F5LA 3F4BA 4GX1A 4L4RA 1UP4A 4HWKA 4A10A 5JO0A 4Z9XA 1GZ4A 2GNAA 2ZJ0A 1T1RA 4WPGA 1E77A 1WPQA 5KKAA 5ILOA 4WLUA 2D4AA 3VTFA 4MVJD 1YL5A 1F8FA 2RIRA 4CPDA 2E48A 3WX0A 2OOSA 4RGBA 2YZ7A 4ZU3A 5C3MA 8ADHA 5A04A 3FPLA 3LT2A 2GN4A 4I5DA 1LJ8A 1BHSA 3KYCB 4J7UA 4CMEA 4CR8A 4QX6A 3DOJA 1P1JA 3PIDA 4CLRA 1YRLA 2DTDA 1TT5A 3ZU3A 4ND5A 5TX7A 4WCFC 2P9EA 2CZCA 3E5MA 2PZLA 1B2LA 3DFUA 4NFYA 3K6JA 3HZZA 3NT5A 5TSDA 4IPTA 3VVBA 4GLLA 3X2FA 3I3OA 4RVGA 1QYWA 4YT8A 5KJEA 1HRDA 3RFXA 3RVDA 3IJRA 2X5OA 5JCXA 1E3SA 4LW8A 1KEUA 4PLHA 3R1IA 2NVWA 3AI1A 2O3UA 2JCYA 3BXXA 3I6IA 4LVCA 4NR0A 5H81A 1Z6ZA 2XXBA 2Y05A 4IDAA 2W4QA 1JVSA 2HLPA 3KO8A 4QFCA 5EJ2A 1V3TA 2FR8A 3I1JA 4BO3A 1O6ZA 2I76A 4BOYA 4ID9A 4CLEA 1QRRA 3UICA 2J5QA 4EUHA 2AQHA 1QYCA 5G0UA 3FBTA 3OFSA 3WSWA 4CM9A 1LSJA 1DC5A 4L76A 2EJVA 1U8FO 3QWHA 1DIGA 4NBVA 1SBYA 4R4JA 1V9LA 3W6UA 3F3SA 4MIOA 3RUAA 2QIOA 2HSDA 3E9MA 2O7SA 3JD3A 3KTDA 4E12A 1LLUA 4CUJA 2NTNA 3L0DA 1DO8A 3ADOA 3H3JA 1T2AA 1YDEA 2CVQA 4DUPA 1X7DA 4I5GA 1KEWA 3L6DA 3AUAA 2B83A 3HFGA 3OQ6A 2A9FA 4BNIA 3JQ9A 1P45A 1T2EA 3EY4A 2X9NA 2HMTA 3G3EA
chains in the Genus database with same CATH superfamily
4XWTA 5KVSA 5EP3A 2WTXA 3P1JA 5BQPA 4DIBA 5K0BA 2K4MA 3FLBA 1BQEA 1G19A 5ALNA 2Q45A 1ITZA 1HV8A 5TQVA 4LWZA 1XHLA 5IAAA 1LFDB 4F8EA 1MW8X 5E9AA 4FT2A 4TT8A 3PHHA 4R9RA 1Q0PA 3A6DA 4XJTA 5DTMA 4GSKA 2E4VA 4BKRA 2I3DA 2QRVB 1A5SB 1NSFA 3JZIA 3UC9A 3M5CA 3UUFA 3EPRA 3KPUA 4LKOA 2GD2A 3L1VA 5AVRA 2GZHA 1NF9A 1GNTA 1GGKA 1FFBA 1Y1LA 1WMFA 1HZZC 1Y3FE 2BI8A 2ZTHA 1CC1S 2JASA 4GM4A 3S1LA 3UUGA 4JDPA 4HNVA 3RHZA 1A3CA 3AESB 1A50B 2GILA 1O54A 4B3BA 3D54D 3PC2A 2XNKA 4XCQA 4HX5A 4L0DA 4KH1A 5AW9A 2EWWA 3A4VA 1K66A 1VRVA 3IUMA 4ZO8A 3PL1A 5KNDH 3K05A 1DJQA 3PC8C 1UBFA 4Q9AA 5AVVA 2EDCA 4KUGA 1Y82A 4B3HA 2JAHA 4P4TA 1HL3A 3T0IA 3T1HB 4KR6A 2FSVC 2XNJA 2ZGVA 4EVRA 1NM5C 3EDMA 3H4IA 5IDWA 2XCOA 4Q3OA 2EBFX 3H9UA 4Q3LA 2FPGB 3RS4A 1SVUA 1II9A 2FN7A 5K0FA 1A04A 4H4DA 1FNCA 1EEHA 3TYXA 5IUNC 1ODTC 2J4CA 2JIMA 3KPWA 4CL0A 4I46A 3PDJA 5AK0A 4X8HA 5H68A 2ZYGA 2J6HA 3EQ7A 1DX6A 3GUCA 3KLOA 2AEJA 1LWNA 2B5WA 3LQQA 2ZYWX 3KEFA 4KXNA 3SBEA 3MILA 2YR0A 1JQLB 5ALTA 1QIDA 3SJZA 2B2CA 2O57A 1E5VA 4G9EA 5IKXA 1QNFA 2HU7A 2X8WA 1ONNA 3JWGA 4OAOA 3FHTA 3E58A 1C81A 1SG0A 2QW8A 4EG8A 4D92A 3KKNA 2BM9A 1JG4A 2EFEB 1T8PA 2B4AA 5I7OA 1NUSA 2P41A 4FJ2A 3ZKWB 4H7EA 4ZYLA 5I01A 1MO5A 1ZZEA 2X4LA 2O0LA 3DTYA 3N2LA 3WDSA 1ESDA 2ZSBA 4EPWA 4U63A 1JLLA 4LVOA 2CVPA 1SVMA 2HY7A 3D81A 1DWPA 2IY7A 3D3KA 3T5TA 5ALKA 2IEIA 1HF3A 4BTVA 3QUQA 3I2KA 2C4WA 3RUPA 4R2LA 3SX4A 3W4JA 5J23A 4DNOA 3EX7C 3T54A 4LZWA 3F1LA 4GMGA 1SCQA 2ISSD 3IXMA 3WG9A 4EYQA 5KQGA 5BN1A 5FEMA 2M98A 3CSSA 2WILA 5C0OE 1J0AA 4IP0A 4ERNA 8LDHA 1GITA 3TM4A 1IVSA 5LIRA 4QEDA 2XCSB 4Y18A 3BXZA 5KU1A 4UTXA 421PA 4D9EA 2OVBA 5EG5A 3UAXA 2YV3A 2X8JA 1FW8A 2ATVA 4ILEA 4J0CA 4KXLA 4AZSA 3HNRA 5F23A 3AUJB 2UVPB 2BBOA 5LJIA 1XYYA 3T9DA 2AYYA 3L6BA 2CVHA 4K03A 1HTBA 4NNPA 1H1LA 2PXCA 1E3IA 2FEAA 3C4VA 1KDTA 2NSYA 3AYZB 3SJAA 3Q6MA 2RDMA 4KJXA 2IXDA 1VG9B 4MV6A 4Z2YA 5AVUA 2GASA 3FNHA 3F1KA 3W2HA 5IAOA 1UDXA 3CT6A 3P0IA 5TXGA 3BXFA 3IEIA 4HDSA 4R81A 5JWHA 1Z2DA 1GPDG 4RTPA 1A82A 4AY3A 4Z1MD 2JD2A 5HJ2A 3EF1A 2C2KA 2W2KA 4LSWA 2JGKA 2CJXA 2HC9A 5A5FA 2I33A 2VJYA 1NLYA 4Z4HA 4E5KA 1K06A 5JS6A 4I1IA 2O1XA 4YRMA 3EF3A 4RTLA 3HWWA 1Y7PA 3V5NA 3VPDA 2IZ5A 1Z17A 3AI7A 3GLHA 2JGNA 3OHMA 5E6UB 5I7RA 2X0NA 1ZHOA 4M99A 3P71T 1ID8A 1WQ4A 5K20A 5EJ5A 1GPJA 3WLSA 5AI5A 3VNSA 3GJ8A 2ZUTA 1SU7A 4DEYA 1IPEA 3OZBA 1RZUA 4KUEA 1REQA 1DQYA 3KWJA 1H2XA 2FMFA 4RSGA 5IAEA 3OLCX 5IJZA 3IDZA 5JSUA 1JLRA 3R7FA 5JAMA 2IV3A 2E9SA 5AT1A 1PLLA 1YIAA 3TTTA 3B1ZA 5EP2A 3IP7A 2IYQA 3JALB 5CA0B 1F1BA 1SBQA 2GWHA 4ZVRA 1JSRA 1UPCA 4KQGA 2O1SA 3I2HA 4MWDA 4D9FA 1EI9A 2FN8A 4DR1B 1QK5A 5EMMA 5FJJA 1D03A 4IHQA 2WMDA 4KPUB 2AE2A 2BFEA 2O5VA 4HAUA 2G9UA 4QGGA 1PKXA 2ZDQA 1PWHA 2CNKA 1WP4A 1GAQA 2IYRA 5EWJA 1VPTA 1LY1A 2XV1A 3L8MA 3MGAA 4PO3X 3H84A 2VUSA 3S28A 3STXA 1F8GA 2P5TB 3TNLA 3EVCA 4N8EA 3WYEA 3EJWA 3BQ9A 4J76A 3TZLA 1G2QA 5LYJA 4CG0A 4TXNA 2X6TA 4US1R 3HB4X 3NAMA 2OD2A 3IJPA 1Y8RA 1GCOA 3OOEA 1KMIY 1RJ9A 4IRMA 2X3UA 4M3NA 5AVJA 4F2WA 3S8YA 3BE4A 5LB4A 1JHMA 3DMTC 3UCFA 1BO6A 1ZC4A 1P0MA 3IQGX 4MMXB 5COAA 3FUCA 3LX4A 1Z6QA 4NS1A 4ZRDA 4IFTA 4JNCA 1VHDA 2ZRFA 2P4UA 1E98A 1L7EA 2HQOA 2OL4A 1OASA 2WICA 4LXQA 5AJVB 5C4GB 3WYAA 4GXQA 3RT9A 2P65A 2NUTA 4UPEA 5AJYA 1YTLA 3SSOA 5CFNA 3Q6NA 4BMYA 5JZOA 1THZA 4PIVA 1PJZA 2ZETA 3TFQA 1V9SA 3O8QA 5IAGA 3MWKA 1T5LA 3GEHA 3FMIA 3OJCA 3B2EA 2J6IA 4W9NA 2DHDA 5JYBA 3GJTA 4QNRA 3PSAA 4QYIA 3KKEA 3WWYA 1E64A 2P9JA 3NBUA 4YAIA 1AKVA 1U2DA 2OV6A 1G5RA 2LIVA 5FBZA 3SVLA 2GCIA 4H1WA 3OWOA 3BHMA 2VLBA 4N7BA 3GLGE 3TTUA 4JBHA 5HJ7A 3QW2A 3DHVA 1EGHA 4MGEA 2DFDA 4WE3A 3JYOA 2YJ3A 2YFKA 3QLVC 1P9LA 5DT2A 2XR1A 3H8JA 3L0PA 4OIMA 4WINA 2HKIA 3T3EA 3FUVA 5ESWA 3VMFA 4H7FA 1P4RA 1HTTA 2OPBA 1POWA 4BV2A 2WINI 1TFRA 2ZJ1A 4GZ3A 4PNPA 3TN7A 3QKUA 4LDAA 1I4EB 4QYMA 1KZGB 1XRMA 3OC0A 4ZI2A 4MHTA 2NSHA 1GRCA 1Q0ZA 2ZI6A 2DUJA 4HBZA 3LP5A 4MCAA 2WTMA 2JKVA 2ZIWB 3ITKA 4AS3A 2RKOA 4O5AA 2NV2B 3Q8WA 1BHQ1 3UNXA 1Y7HA 5BN5A 2PUCA 3CUYA 3CU5A 2ZJOA 3ROEA 1A95A 3FJ1A 2HEIA 4FCVA 3LRXA 6GPBA 3R6TA 3PNVA 2QF7A 3TNDA 3N3BC 4M9SA 4QAQA 4BNVA 5IPFA 1GIAA 2YRWA 1QQ7A 1GZ6A 1U65A 3ZX4A 4IGFA 1KNQA 1JS1X 1ISMA 1WZUA 2M2IA 4IHAA 3KQSA 1YDWA 1PUXA 3PJGA 2H00A 1NP3A 4IO1A 4BGEA 3EDQA 1JPNA 4BYGA 1KWKA 3B3AA 4D3SA 2VL7A 1X15A 1BQ3A 2FTKE 2J3LA 1G6KA 3KXIA 5JSHA 2YXNA 3G7SA 2FZVA 4X1KB 1NQUA 1OWOA 3LG2A 2P2DA 3QLTA 1RAIA 4NICA 3FUWA 3S27A 4R6XA 3WGVA 2WT4A 1ANKA 1NQOA 4F6CA 2WT9A 3GVIA 4L15A 3WLFA 3FYSA 5J40A 2RH8A 3WQSB 5IM5A 1C0IA 3M6LA 4CKCA 2G07A 1VJDA 5K1ZA 1QCYA 2ORYA 4PTZA 4D41A 3M5WA 5AW7A 5IFKA 2GZSA 3RKRA 3GEEA 3NM6B 4P7JA 2Y0DA 3DE3X 1IHYA 3NT4A 4J3JA 2P4SA 1XOIA 4X8OA 3MWEB 5B58C 1D7OA 4LBYA 2IZZA 2OB1A 3T3HA 5ALOA 5SYNA 4Q4DA 4WOCA 2P0EA 2YDXA 4V2UA 1JFLA 3WSVA 4OH7A 3DWIA 4HTFB 1TTTA 4HLUA 3LO8A 4MHOA 1ZHHA 4C6RA 2CLKB 3DW3X 3PF9A 4LNUA 4PZEA 4UCXA 5JG7A 1AZSC 1IY1A 1Z28A 2BKVA 2PMDA 3MJSA 4E5PA 1BWQA 2VDOB 1WW3A 2TYSB 3F74A 3FCAA 3PJFA 2NZWA 4WNCA 1JAXA 1ZKMA 3MTEA 5E3IA 1JQAA 4JGIA 3SDZA 3K2IA 2WW8A 1TIKA 1HYGA 1A8IA 3C6XA 3NX4A 1P18A 2UUPA 2G6BA 5K0ZA 3JWIA 2QM8A 3ZWNA 2HSEA 2R6AA 4B83A 4R8VA 3UKOA 2GNOA 4QXRA 1IONA 9LDTA 3H2IA 4MZXA 4MRPA 4OKNA 4H1VA 4C2AA 4OXRA 3VSAA 3WRYC 4Z8YA 3STTA 4P53A 4OM7A 3GGPA 3BTUA 3ZBQA 2F6RA 3BWYA 1R6TA 3IKMB 1FK8A 2AD5A 1KFCB 2FUNB 2IXEA 3KU4A 4X63A 2B8TA 4E51A 5DNCA 4PPNA 2C83A 2E5LB 4WH0A 2KLBA 2WU4A 3PUWA 4RNCA 3T1TA 1QTNA 2JVKA 2YCLA 3E18A 3O38A 3PX2A 4NLLA 3QLUC 4NPHA 1ICEA 1H85A 4LQ4A 3S8MA 1WETA 1R4AA 9LDBA 2HBRA 1SB9A 2W58A 3VR2D 4C4OA 3THYA 2Y4NA 1FS4A 4UDXX 1DNPA 5TPWB 3QMMA 3N5CA 1CQJB 2XOXA 2ZKIA 3BD6A 4R1UA 1PJSA 3ANTA 3LE8A 2CDNA 2OAP1 3KUXA 1XTJA 2G67A 3E27A 5E38A 5H16A 2QVCA 2HUPA 3GN2A 4E7OA 2Z1DA 5CXSA 3THYB 1VC2A 2FXVA 3OFNA 4YDSA 1E7MA 1WX1A 4BZWA 2W2TA 4MQLA 2V6IA 4X3PA 5CLHA 1W85A 1ZD2P 2QZ9A 3EMBA 4FBLA 1YB1A 1IPFA 3LYHA 1RXIA 1JLMA 2ZS8A 5EJGA 3VZPA 4ER3A 2IZ0A 4F8JA 3W3AH 2H2AA 3VHQA 5JMWA 3O1LA 2BRUA 4BKOA 1T4MA 1DWUA 2RB4A 4M1ZA 1VPLA 4CEHB 1V41E 3E9DA 3FNIA 1QOQB 3K35A 4CDNA 1Z5VA 3PFNA 5KNCH 3N2GB 2EYUA 1OV6A 2QJWA 3TB6A 3HFRA 3AM1A 5A5EA 3N53A 5EHNA 3WGGA 4EPTA 4BIIA 1QGUA 3RIGA 3JVDA 4HXFB 3TCNA 1FXWF 3LQ1A 1XTRA 4PBRA 5LOVB 1AS3A 4B74A 2QN3A 2YZ2A 1E0AA 1G16A 2VDKB 4KC0A 1G8AA 1G5PA 4QPCA 3GLGA 1VCOA 1NJFA 1JJ7A 4G36A 4RH3A 3TMAA 3NV7A 2DR3A 5DW3A 2CFSA 3WHPA 1N6IA 2BGJA 3MMSA 4CM4B 3QGMA 2FRDC 3R3UA 4FYKA 3GG2A 3KC2A 2OQRA 1ETUA 1TUGA 3TO5A 4BLUA 4ZCTA 1ZRHA 3HG7A 1YS4A 1PS9A 4LJRA 1G8FA 1UBMS 3AYXB 3IBYA 1FX0B 1HKUA 5D1HA 4MV1A 1YBFA 2FUCA 1UKBA 4U9IS 4FLMA 3KL2A 4BLPA 1SQ5A 4FMCB 3R3YA 1JMKC 3N58A 1R18A 2POCA 2Q4EA 2YWDA 4J0KA 4NS4A 4Q15A 5K3BA 5IF9A 3VYUB 4K8OA 4JBXA 2ZUEA 2H57A 2JCBA 2OBMA 3Q15C 5JC1A 4HH3C 3JAKB 1YF3A 3E7XA 2UYCA 4DIUA 2Q1TA 4AY5A 1SM4A 1D2RA 4HQ0A 4C0KA 3WLIA 3QHPA 1SUDA 3E5HA 2PSFA 1VZ2A 5F7JA 3ZDXB 4Q3BA 2W6MA 1N2SA 3N6XA 3UMFA 1XKXA 3HGQA 3TGPA 1YIOA 2RG7A 2OBXA 1NXWA 1ZD4A 2GRJA 2HF8A 3CJTA 3VFDA 4BNDB 3G85A 4ND6A 2AUTA 3SPXA 5JVDA 5M04A 1QH9A 2EHDA 1ZCBA 4B48A 3K70C 5JAZA 5F64A 4AMZA 4Y2YA 4L28A 2G76A 2IYFA 3RS8A 1NDQA 2P3QA 2JGAA 3NTOA 4L8GA 1RI2A 3SC2B 4C7BA 3AUUA 4KK3A 4I55B 3ESXA 1RMYA 3UB2A 3T0GA 4I9NA 3IOCA 1E4OA 1A2KC 1EEXB 1PGQA 1UEJA 4M7WA 4GLOA 4PAWA 1JI0A 3OZ7A 3PHJA 4RPGA 3QH4A 4U39A 1GLNA 5G1NA 4B8WA 2XBMA 5EY5B 4P54A 1EQ2A 2RAVA 1XZKA 1FNNA 4DQKA 4DTIA 1H93A 4Z53A 2G83A 4TQAA 5E2AA 4PSDA 5EUCA 4FYYA 4M0UA 4HRXA 1L5OA 2WR8A 5IAKA 3K5HA 2OM6A 3QEOA 4HAOA 4I8IA 4NV3A 1U9YA 4LGMA 2VRCD 3R0ZA 2QRJA 5EJ6A 3KQLA 1TQ2A 1N0UA 2FZLA 2BGGA 1X7XB 3WKAA 3LK7A 1R0WA 2GDZA 2Y0PA 4XE5A 4AKHA 3CURA 3OZWA 4H3KB 2OBNA 4BZPA 2AC4A 5D87A 3H2YA 4KTTE 3LPDA 1WMAA 4A2CA 2WWHA 5FR2A 3MEQA 2WHPB 3D5TA 1X1TA 5KMGA 3W8EA 3ESCA 4O29A 2EFYA 3TTVA 2YDYA 3IAM1 4XXHA 1E3WA 3NGXA 3JASA 1H8HD 3R9IA 3WISA 3LH5A 4JC5A 1A5AB 4LRUA 2B35A 3O03A 4AJPA 4EDFA 2XZTA 4I4IA 1SN7A 2PLNA 2RSLA 3A1NA 4O4IA 2J9RA 3KELA 4YRJA 3OLWA 3SNHA 2R1TA 4PNHA 5HM8A 5C8VA 3PNKA 3KJZA 1GUYA 2V7BA 2QL7A 5IEBA 1HMPA 1RQXA 2BEKA 1WVGA 4EZIA 5K8CA 1E6UA 1IHXA 4JQZA 2ZE7A 3MMNA 4TYQA 1VJ1A 3EXG2 3LUDA 2FSSA 2H07A 2NU7A 4RZSA 3REOA 3QU7A 4P5DA 4EKIA 2AZMA 3LCVB 5B1IA 1FDTA 1SVKA 1YB2A 4EI8A 5IC4A 3CMMA 4LZAA 5ADVA 1L5RA 3LHDA 1Q57A 3BBPA 2EBWA 1NY6A 4J7AA 1NXVA 3GGOA 1XE3A 2BH2A 5C51B 1S2GA 1TIBA 2PVPA 3IO5A 5FPYA 3R3VA 3TEJA 1E2GA 4BGDA 2LR0A 1PR4A 4J29A 3MWLA 1C2YA 1WKCA 2HGSA 1N6HA 4JYCA 5ENVA 3UWDA 3ILVA 3G7UA 2LCFA 4I8DA 1V6SA 4MQBA 4H3SA 2YQ5A 1AQYA 1SOWA 3B7PA 3JQ7A 3UENA 1AHHA 3EPHA 4CZ2A 2ZM5A 3OSZA 3IP1A 3CH6A 1TJNA 1JUDA 4AO7A 1YFLA 5C7OO 2CXHA 3HYSA 1SCBA 3NVAA 4JEUA 1T0BA 2OXEA 5JBIA 4JIGA 3JZDA 3Q5EA 3Q0EA 3ABQB 4OSOA 2P1RA 1NBHA 4RHFA 1IUNA 3VV2A 3HJFA 3PA8A 3GFFA 1WULS 1EGMB 1EFPB 1JJBA 1YC5A 1OX6A 4HRVA 4JP5A 4LMBA 2OKCA 1IOLA 1JIQA 2D54A 3L8ZA 3GYGA 5CB8A 3HU3A 4EG6A 2HK8A 4M9UA 1JPVA 5E8RA 3WGYA 1XX6A 4C3ZA 3G0IA 4EKDA 2WLSA 1YD7A 4DM4A 4MLCA 2A1IA 1UAGA 3ZE7A 1TF5A 2XTJA 1DKQA 3V80A 4P3KA 3THWB 4IYJA 5KAMA 4I2NA 2DFTA 4M4SA 2BHNA 4IGAA 5IRCD 1M8PA 4OKIA 3W9BA 5B6JA 2RGYA 5JR3A 3MRXA 2UYOA 5CB4F 1CNFA 3Q9NA 1TW3A 3M6VA 1QIJA 3WHIA 3V1LA 2JI9A 1KEEA 4AJ4A 2PGLA 2O14A 4L2IB 1QG6A 1J1IA 3R0VA 3NBAA 4J16C 1YT5A 2O3QA 3VTKA 3Q8KA 2R6CA 2Z3ZA 4BEWA 4B6PA 2O0KA 1KSHA 3B7WA 3MLEA 1RWOA 3T8YA 1CR0A 3E2PA 3QUSA 4Y2VA 5BR4A 1S7GA 1U7OA 4KACA 4EF5A 5L51A 1CUYA 3BORA 2BFOA 1AA9A 2OHVA 3LGXA 3FPAA 1CULC 3UGQA 5FL7A 1UBLS 2PX3A 2QP4A 1U2GA 4AW9A 4RZ3A 4DY4A 4BBJA 1WRBA 2VAMA 2ZVQX 4PIMA 4TVBA 5CIQA 4ZV4A 1W35A 4OGKA 1M1ZA 4NAVA 3U4QB 4Y2HA 3NNSA 1WWKA 5HBRA 1W8DA 2NUAA 1JKJA 2J30A 4JN6B 4R9SA 4YCCA 5KWVA 1DX9A 1XEWX 4P32A 4QBKA 4WXYB 3UXHA 2CF6A 5L3SB 5C53B 5ALVA 1U8YA 1TGVA 2ZUUA 4FR0A 4FYJA 5FCDA 1DQPA 3AEUB 4PF1A 4II3A 4ZZ2A 5DFAA 3WFZA 2CHUA 3HLKA 3IQDB 3OM8A 2OYRA 3TEMA 1H4TA 3H1FA 1OFGA 4KFUA 1MP0A 5FYQA 4MA0A 4JB2A 2FVYA 3AVPA 4A27A 1R27A 4YV0A 3INNA 3O90A 2JDID 4K9LA 4NBKA 4MWSA 2GZDA 1KMNA 3BA1A 4G4JA 3V97A 5JD5A 5IEJA 1I7QB 3RUHA 2VAXA 2BONA 4C08A 1RKUA 3WHKA 4J1GA 3NGLA 3AFNA 1ZGGA 3ZKAA 4D9GA 4HVAA 1XVAA 3ESQA 3HADA 2QM7A 5ALYA 4JXZA 4ZD6A 3JYQA 2PUBA 1R0CA 4MQEB 4EA9A 2EZ8A 3GFRA 1L2TA 1R1DA 4BN5A 4P8RA 4DMKA 4HDNA 2O2CA 2OLKA 4FSHA 1HDRA 4FFVA 2PCLA 4G84A 1RCTE 4FLEA 4YDHB 4BNKA 1PJCA 5KINB 2R8OA 5LQJA 1C7ZA 1Z6PA 3Q7EA 5LBIA 3THOA 1K86A 3ZGYA 4B6RA 4WNAB 3AKDA 4OI1A 1MABA 5BSRA 3K20A 3ZY6A 5CEFA 2Y0BA 5LBTA 4QUGA 1SVIA 3QWIA 4GZ6A 5B58T 3SIXA 1JAHA 3SXUA 4CIAA 1T4GA 2I55A 2RI6A 1OHHD 2OHFA 4G1UC 3ZXXA 1WV0A 4FT4A 4Q01A 1NUAA 4MA5A 5AJTA 4QM7A 2X2OA 3O9VA 4ZVPA 3ZNOA 1ZCJA 4IDUB 4ZZ3A 1NMSA 2QAGB 3FWNA 4NMWA 5TEWA 2YFYA 1NN1A 3NYRA 3QMVA 5HF9A 1UAYA 1T3ZA 3GAFA 1RLJA 1UPFA 1CG6A 4Y6OA 3SYLA 1UDBA 2REBA 3R75A 1IXKA 1GAEO 1KS9A 4RZIA 5DHQA 5DK6A 4ZVKA 3ACDA 2H1FA 2OORC 3FCXA 1V25A 5HIMA 4X1OA 1B23P 3BCSA 4JGGA 3TZKA 4X54A 3CM0A 2JK0A 2GYVA 4D0NA 3CUSA 3IJ5A 2QW1A 3L7OA 3MINB 4G0XA 3AERA 2W8ZA 3IDFA 1FFXA 3CQ9A 3U1BA 4AKIA 4LQLA 2VHEA 1BMFD 1Y89A 1XMPA 3GCDA 3UZUA 1PEDA 1KI4A 4RSRA 1Z2CA 1ZISA 2VTKA 3VYVA 2WVAA 3USZA 3I5UA 4EY6A 4C4RA 1OROA 4XKJA 4GP6A 3FOCA 3TEFA 1Q1ZA 2PV7A 2WJYA 1GWNA 4REMA 4DANA 2VDRB 1CQIB 2AMFA 4PG4A 1J6UA 2UZ1B 1G5FA 1XU7A 4UEJA 2IP1A 4ND4A 1VE9A 5J3JA 3TECE 4QTXA 1HFWA 5IK2D 2AFIE 3H5LA 3ITDA 4JUIA 5FBWB 5DYWA 1WZCA 2HHCA 5JANA 2D5IA 1I6LA 1VHTA 2G88A 1Q83A 3HABA 3K70D 1NTRA 4IOKA 4AULA 4DV4B 1VMKA 1NG9A 3OT1B 1G42A 4K9MA 1U6IA 3SWWA 4C21A 3OHSX 2OE2A 5CLIA 3W05A 3Q7RA 1MU0A 1T6ZA 2C7PA 1BD4A 1ZI8A 4PVDA 4BVHA 4YUZA 3GYBA 1PGPA 4H1TA 1KOGA 1NJ1A 3GT4A 4FFPA 3RUDA 2V74B 1J8YF 4TQ9A 2CYAA 4ID3A 2JG3A 1WCV1 2BSXA 3FMVA 4RVSA 3UF0A 2IYUA 4G5FA 3TQTA 2ZE6A 1CUUA 4IIGA 5LD2B 4M1QA 1Z75A 2P91A 4ZU1X 3WGMA 5ECDA 5CDSA 4CFZA 4RFSB 2QTLA 1G5TA 2G1AA 1YUMA 5L8VA 4DT1A 2BFNA 2RAPA 4NZYA 5BV2P 1QGYA 2HA2A 2VSQA 4F4IA 1M6EX 4RK5A 2BZ0A 1VZ3A 1SUEA 1H2YA 4IDPA 1J0CA 3KTOA 5K3AA 4RLSA 4BKQA 2C8KA 5GZ3A 3BQNB 1KKLA 3NDIA 1X8KA 2ATXA 3TLCA 4BUZA 2PRIA 3A05A 4RHYA 1QBKC 5FA6A 3RIYA 2FQYA 1Y4DE 2INGX 2VEDA 5FTNA 3RU7A 4U5QA 1GCAA 4K9QA 1Q7GA 2DTXA 2M9MA 2X9QA 4HDRA 1GR0A 4NEGA 3EB9A 4XB1A 4KRYA 5F1PA 2H65A 3TKLA 4QFBA 1XALA 4KHPB 4QUDA 2NUPB 4DV6B 2ZDGA 3W06A 3O95A 1N2GA 1NNI1 4WZ6A 3V9PA 4UHKA 3KFVA 2DPGA 4QSMA 1YAJA 1D3AA 1P74A 1HLFA 4ZICA 3RFUA 1I3LA 1V9CA 1W4LA 3DD5A 3HXMA 4B32A 1LLCA 3A4YA 1G6Q1 4RVHA 4WBXC 4MO2A 4BQIA 2JGDB 3ZVMA 1J0BA 2O3TA 2WVJA 1JFVA 4BXOA 1U9IA 2FOXA 4O2BB 4F11A 1ZINA 2WJZB 3DKKA 4ZN6A 4LIPD 4JR1A 4TRNA 4NFSA 1NHGA 2Y6UA 3T3IA 5KQSA 3W2GA 4C7VA 3IBTA 1R3UA 1ADJA 1KFEB 2IZ7A 4GXRA 3C3XA 3EZFA 5M3BA 2AEFA 3TLJA 5FBLB 1EFLA 2AG6A 3R0JA 2Q4BA 2XRFA 1ZM7A 2WWIA 3G5UA 3K0HA 3LPLA 4PIPA 3U4DA 3ULKA 2DP4E 4C6SA 3RT7A 1D4AA 4X64B 1DEHA 4QULA 5G53C 3FM9A 3CXRA 1KPIA 2Y1WA 3FWKA 4OQNA 2BMAA 3I09A 2NMVA 3A6EA 4PE5B 1T3LA 3L4BC 4PBSA 1SU8A 2QTZA 4CTMA 5KOHB 4FS8A 4AX4A 3F97A 1JG7A 2RGWA 3GQBB 4JY7A 3T3GA 4MQFB 2P9QA 3VVCA 1XFDA 4RF5A 4X1YB 10MHA 3KJFA 1B8UA 4A5SA 2BFFB 1Z08A 1V1MB 4F3RA 6PFKA 5JS7A 1BC5A 1W2WB 2CNWD 2D7JA 4IQGA 5BWNA 3ZD7A 2H48A 1Z33A 3LIPA 1RP7A 3PUVA 4AG5A 4RJJA 3N0XA 2PWPA 3PD0A 3L1UA 3ZW7A 3WGJA 1W4AA 4HZGA 3A2NA 3DZDA 4MVJI 5BN4B 3T7RA 3OLQA 4ENUA 1IRXA 1XTZA 3TDNA 1O5TA 1VMEA 3F67A 4FE7A 3EIWA 3ZLJA 2ISCA 1DQZA 3T6KA 4YRLA 3H42B 3ORQA 4QXPA 4ZO7A 3PFKA 4DYDA 2GHRA 4JJ8A 1MZPA 1Z4KA 2ORED 1JVBA 3OLZA 1CEQA 1U8EA 2OBYA 1LZLA 3GFQA 3GO4A 3RTBA 1LLFA 3VBEA 2HQ1A 1TA0A 3PDCA 4DL9A 5JZMA 1MRSA 5D51S 4AAYA 4MWEA 1XEFA 4F5WA 1H0SA 2E6KA 1KNXA 4JB3A 4MKHA 2NNLD 4GGOA 1B8VA 4UHFA 1EBFA 5DBFA 1T4BA 3RK0A 3U7FB 1NLFA 1Q1GA 2ZTUA 3NEYA 2BR3A 4BV8A 4CU2A 2HRCA 5CA0F 5J58A 2R2AA 2OO7A 3U44A 1BHJA 2OXFA 1TM4E 2IU4A 1U1FA 5DXFA 4KQHA 3F2IA 4MVXA 1QHSA 1O94A 2ZBPA 5AO9A 5EE0A 4DV3B 4WV3A 2JJ8A 2A7QA 4GOXA 3UAYA 1RRGA 3L7BA 8GPBA 5EMKA 4KR3A 2VZEA 4JI3B 3PLNA 5NLLA 1L9KA 1SGWA 1CJSA 1IEQA 3R0IA 1VG0B 2WB4A 3K94A 2PE5A 3LO5A 2VFAA 4TRRA 1O9BA 1R0BA 4IJ5A 4JWTA 1CS0A 4KNVA 3OQJA 3R8FA 2IXGA 3FDFA 1ZIPA 4AT1A 1QQAA 2HA0A 3CVJA 1OX4A 4OFBA 5DNWA 4KAAA 5FFMA 2AFIA 3AFMA 4G1VA 4KRGA 4DM7A 5HR5A 1KP2A 2NU9A 2FSGA 2I62A 3GP3A 4Q4JB 1Q7TA 1USUA 3WNBA 4BL5A 1IQ0A 4FSDA 1C1DA 2XB8A 4ACBA 4CKBB 1COZA 1JDBC 3TUZC 4UOQA 1HG0A 1ZGAA 4GI1A 2YOFA 3DR5A 1QGZA 2O6LA 4I81A 1MB9A 2BPOA 4DZZA 1K6EA 1NLMA 3DFIA 1XP5A 3R23A 3HB0A 1QH8A 5AOCA 4CMJA 1WLYA 4O4JB 2WF6A 2WWRA 3TINA 1OAAA 4F93B 1V11A 5JC8A 1L7XA 4WZZA 3S2GA 5IKMA 5B12A 3GLIE 3BKWA 3MJ4A 3RQSA 2V98A 2C0CA 4MW6A 1L4HA 3IQIX 3WIBA 3L0OA 1P2UA 3GCWA 5KTPA 4GMXA 1B6TA 1EE9A 5BURA 3H9GA 3IDQA 5FWXB 4Z4EA 1KFJB 4Z2AA 1OVGA 3U3KA 4JJ4A 4TT3D 5T6MA 5CEEA 3R9XA 2EOAA 3DWGA 1AQ6A 2ZRIA 3GRPA 4IGIA 4LC1A 2QA5A 3RKUA 1NQ5A 3T9CA 1R0RE 5ALXA 4DGQA 2JC3A 3EZ7A 2J5RA 1J5PA 3GUVA 2R4TA 4ND2A 2GFHA 2QI9C 1JKIA 2D0IA 4RPIA 2J1LA 5DGIA 5EIEA 1M1XB 1W0KA 1G8HA 1DPFA 3BC1A 1OGYA 1N9GB 3NM5A 4UULA 3BHIA 4H7DA 5CA1B 4QL3A 5K01A 4JYAB 3U60B 3FDJA 2Q3CA 3AGPA 3P0JA 5T4EA 2B9VA 4J9VA 4CW7A 4PN3A 1KY5A 5IZCA 1TZ2A 1CDOA 2X15A 1KORA 4TN1A 1BCSA 1IDN1 1QKKA 2DULA 1N7GA 2ZRHA 3IHLA 3LBFA 1NXPA 2H5LA 3CE6A 4RLQA 4X20A 3OZXA 2IH4A 1NR7A 1E9DA 2AT1A 1ZS9A 3T1VA 1M6NA 3OEED 4DCCA 2V7UA 2WJIA 3AUFA 2V0GA 5DE3A 1GL7A 4MMYB 5T4FA 5DULA 3WDMA 2BFPA 4RKQA 4B3IA 1GV1A 1ONPA 1QQ6A 3KHUA 3RYCB 1YC2A 1C3XA 1N8SA 2XCLA 3RUEA 3D4BA 3HJBA 4HYYA 4O63O 6LDHA 3QE9Y 1QCCA 1V43A 4ZVVA 3DEKA 4A3SA 1WSBA 4ED9A 2XSZA 4J9UE 1NNEA 2OOKA 3MOIA 4FM9A 1I2BA 3OA0A 3T9BA 3D2CA 2ETXA 4AG3A 3JQAB 4JSYA 4DKJA 2IHUA 4OQ4A 3UWSA 5B2EA 1DRWA 1XZLA 5PGMA 3HLTA 4KYUA 1EJ0A 4F2GA 3LLUA 5G41A 4WACA 4EATA 3GL9A 1P44A 4AJOA 5JNTA 3ORFA 1Y4AE 5LN1A 1R4MA 1QK4A 2NM0A 1U5BA 1VMIA 3MRTA 2M1ZA 2VDVE 2VYVA 2G5TA 5ELMA 4AMVA 1XLVA 2XKBA 1S8AA 3NHUA 4B79A 2G40A 2AC2A 4FYIA 3U7JA 1WTAA 2C5LA 1VFNA 4TUYA 1C9JA 4D9KA 2CLMB 1RMQA 4ISBA 5AJZA 4DWVA 4NE2A 4ZI7B 4C4XA 4QHTA 2C5FA 3KIPA 2CLHB 1E6LA 1KYTA 4F85A 2P40A 5C5EA 5G0VA 1A9YA 3H0CA 4YCAA 1BE6A 1FOEB 1Y4SA 5JBQA 2X5KO 4LGYA 1JYSA 1FS6A 3B6KA 4MV0A 3DJFA 4HGNA 1FQWA 1M34B 2QZ4A 4Q34A 3UFXB 3HYNA 3MYYA 4M8SA 4C9BA 5T6BA 4DC0A 4FQ8A 4V24A 2CFTA 1L5SA 1G3IA 3RTEA 2W6JD 2WYWA 3N28A 5JSZA 4NNJA 4FOTA 3M3PA 2AZXA 4Z9BA 1F6DA 1T24A 2B69A 1GU7A 4KZPA 4AYWA 1C29B 3L82B 4FB4A 1EZZA 2IRWA 2Q5FA 3ZQ4A 2PXHA 4KB5A 3THXB 3CN9A 5KYUA 2QY6A 4U6QA 1N8TA 2PUAA 1D2AA 3LLVA 1NZJA 3W2FA 1RXVA 2AZ4A 1BDIA 2Q4TA 1NV8A 4HNSA 1TZBA 3ET4A 1IYZA 3EUFA 3U3OA 4ZGWA 1AM4D 5CDHA 1DEKA 1LI7A 5FFNA 3A1SA 2HYDA 3M9WA 4ZHQB 1QIMA 3OIVA 4PLTA 4WK4B 5LZ4A 1HE5A 3GPLA 2A57A 4Y9UA 1IUOA 3O2QB 4NZ9A 5HG0A 4NH4A 1KOFA 3L8FA 2ODQA 3OX2A 3OZDA 2WIAA 3II6X 2GJ8A 4UBOA 4JHLA 2X76A 2ZR8A 3B1WA 2P8SA 4JROA 1RHUA 1FXWA 4R54A 3RRBA 4XCVA 2VZ9A 2W37A 3WOVA 4TYWA 2A9OA 1Z15A 3AZPA 4RIEA 2J31A 4RBNA 1R3DA 2UUCB 1THMA 3JATB 5AWFC 4AUEA 6CHYA 1RRFA 4BNXA 3I9V1 1IOWA 2REXB 2PKCA 4C0LA 2OCGA 3WK6A 1EIZA 2FN4A 3IAS1 5A0VA 1JTVA 1S2MA 4JHXA 1T1JA 3DZJA 1YS2X 2BISA 2IYSA 1YZNA 3BREA 3E9NA 3O8OA 4FCWA 1FUUA 4FI3C 3QTTA 5CPBA 4CCYA 2GKSA 2HA5A 4INJA 4V0QA 4E33A 4ZAWA 4WBNB 3B5IA 3UMGA 3ZCUA 3QZUA 2I2CA 4RY0A 1Q84A 3ZVLA 1RRMA 3GLIA 3ONVA 3ZGNA 1OC4A 3BL5A 1K5HA 1LBQA 2JHCA 2QLTA 5H83A 1T29A 4FLFA 5LOVF 3KV3O 4WJLA 1QX4A 4EO9A 1Z4LA 2Z43A 2XOKD 2C7BA 3KPYA 5JISA 3IVAA 4LJAA 3AR2A 2R7NA 2ID7A 1L8AA 3GCGA 3R9WA 2DT8A 1GGJA 2D3TA 2IDKA 4HB3A 2QQ5A 4IOLA 5DHSA 4RHCA 3KQVA 3PNLA 1ZVQA 5K51A 3AU8A 4Y6QA 4CR6A 4Q6WA 1QJ4A 4TYMA 2JFQA 4ZYXA 4C22A 5CCXA 3PGA1 4NJMB 1AUVA 2IEZA 1P2BA 4C6TB 3KJHA 1LQ2A 2C92A 2GEVA 2PFGA 3QF4A 1RM0A 2WIKA 4FMCF 3PGVA 4Q4HA 4DN6A 3KAPA 2ROQA 4RTRA 1KQPA 2XGGA 5JIBA 1FP4A 2O8BA 1IK6A 3IR7A 3SMVA 2VYVD 2FPXA 3IB3A 5B1HA 1QF7A 4JBYA 4IUYA 3AVUA 2YWCA 4J0EA 3LWBA 3DV0A 4XH9B 1NPYA 3OE4A 2BGRA 2YOHA 3P7MA 1DTWA 3U31A 4BAGA 4OATA 5DBHX 1XZGA 2JPDA 2QENA 4N47A 2EBHX 4FVTA 2WIGA 3B78A 4Y2QA 3RPEA 4DABA 4UBLA 2BELA 2R44A 1Z2EA 4KGDA 4MVJM 4RVDA 4HEA1 4OU5A 1CP2A 2HTFA 1U3GA 3LDUA 4DDUA 2ADOA 2Z9CA 4QBGB 4RZQA 1HRKA 4BQOA 1Y98A 4YH1A 3EEQA 2QSJA 2X2PA 4OVKA 2N42A 3VUFA 2XKAA 3KEQA 1XLWA 1JR4A 2PIDA 3ABIA 4N5LA 4I55F 4DYHA 5CNKA 2QD5A 2Y67A 4Y98A 2WJAA 1TTPB 4Q93A 1PSWA 1VOTA 1TJ4A 4TKVB 2Q6IA 1A4UA 1I24A 1XA0A 2H0QA 5ALIA 2DKFA 2E18A 3B1XA 5EPUA 2QLNA 5TIIA 3GFVA 2GJ4A 2D8MA 5CMLA 3C39A 3RIMA 4BP1A 1WMEA 4ITRC 1OWNA 4NDAA 5FQNA 4AVYA 4UZSA 2MINB 4AXBA 2AN4A 4NBUA 5AKKA 1I3MA 2AFHE 4MR7B 3BEOA 5I4KA 4MVJG 1EDZA 1Y8QA 3JQ9C 4NAHA 3MWDA 3ZDCA 2TS1A 1UBRS 1BFUA 1GPKA 1XD2A 3BH0A 3L7KA 3Q98A 4BZXA 1VL6A 5MFZA 1W36B 2FUG1 2E21A 4GNKA 2O5RA 1FNSA 3OF3A 5F1YA 1F3LA 1PUIA 1AUOA 2Q1WA 5CLQA 5K9ZA 3NCTA 3AJ8A 4RQUA 5FBKA 2ZBEA 4KOEC 4ZT4A 3COVA 3RTCA 4BWFB 4KWTA 3R7LA 4P1ZA 3T4XA 2BEUB 2YVAA 4CCWA 3IKJA 2PKQO 5K3SA 3CW2A 5J59A 1RCFA 5A06A 4KWCA 4YJ2B 4ZC1A 4QU5A 4IIXA 3VA7A 1TK9A 3EF0A 4KVGA 2RH4A 1IQRA 1B16A 3DOCA 3QU5A 4CMAA 2LDXA 1JQ5A 4FOSA 5L7WA 4RULA 1GEGA 5I9BA 4J91A 2XH8A 4YRRA 3D8BA 5JALA 3HBMA 5EIBC 2XWBF 4LECA 4OF4A 4BVLA 3UC5A 5CXXA 1G60A 3U7GA 1XFAA 3KXKA 5JROA 2I4TA 1ZAYA 1DT5A 3KOXA 4DDMA 2NPOA 3JWPA 5BYAA 5M2QA 3TWOA 1C7EA 3M49A 3V4RA 3AHJA 3H5NA 4DUGA 4EWLA 4AECA 1TD1A 3IHWA 4S1NA 1P2DA 1NF2A 2EFGA 3HDJA 2Z5GA 4HEHA 1DG1G 3GNQA 4D8WA 5HVNA 3WTCA 4C4AA 1QE3A 5EJFA 1E9EA 5G3ZA 4AO6A 2D0DA 5KOYA 4JC0A 2IHKA 4XVUA 3FGPA 4M1OA 4TM7A