1OC2A

The structure of nadh in the dtdp-d-glucose dehydratase (rmlb) enzyme
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
346
structure length
346
Chain Sequence
b'QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-GLUCOSE 4,6-DEHYDRATASE
publication title The Structure of Nadh in the Enzyme Dtdp-D-Glucose Dehydratase (Rmlb)
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 144
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oc2A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1oc2A02
5H81A 2W4QA 4BO3A 1W0CA 1W4ZA 1ULSA 2J8ZA 3U49A 3DEYX 3Q0EA 1ZXBA 1Y8QA 3A9WA 1SPXA 4BNJA 3INTA 4L4XA 2HMTA 4OMUA 1FMCA 4XYMA 2OBNA 1LBEA 3AY6A 1PWXA 4CQMB 5EINA 4G2NA 1P1KA 3G1UA 3ZV5A 4CMEA 3VPFA 2F1KA 5COQA 4EEZA 4JJGA 4GLLA 1MB4A 4BO9A 4XQ9A 3PWKA 2DFDA 2JAPA 4MIOA 3SC6A 4JBGA 3OSUA 3I9MA 4DL9A 1EVZA 1MC4A 2NVUA 5A02A 2P5UA 3HDJA 3NGXA 4GVLA 1DIHA 3KSUA 4II2A 2NTNA 2NSDA 4YJFA 4UVGA 4F6CA 1N9GA 3QVSA 2Y67A 1KVUA 1UJMA 3ZHYA 1SNYA 2WMDA 1WAMA 4R41A 1E1KA 5IZCC 3VH3A 4BO6A 4WEOA 4ZGWA 1A9ZA 3T7CA 2Z1MA 4KDEA 4U5QA 5JAMA 5CFZA 1DC3A 3ZN2A 1L7DA 5EJ2A 2JD1A 1LDYA 2HMVA 3Q2IA 4B4WA 4J91A 4MVJH 4IIUA 2VHWA 1QYXA 2DUUA 2UDPA 2IODA 3FWNA 2UV8A 1OMOA 5I8WA 3KEOA 1D8AA 5AQ1A 2D3TA 3QV1A 3PZRA 1T25A 2AXQA 2B4QA 3QIVA 4IM7A 4MKXA 4ND1A 5F21A 4PCVA 3B70A 3B20A 3VZSA 5CDSA 2VZ9A 2YZ7A 3ETDA 3PWZA 1PGJA 5HA5A 1V3UA 3U5TA 4GMFA 2VUTA 3ZWWA 3AY3A 1DIAA 1PJLA 4IJKA 2ILTA 3K2BA 2O4UX 5FEUA 1T4DA 1I5RA 3F1KA 1R4NA 2CF5A 3DZGA 4I5GA 1UR5A 5TRTA 3OJ0A 1DLJA 3X2EA 2YV3A 1P1JA 3TJRA 1R0KA 2PGLA 2EIHA 3FCOA 3FNGA 1PL6A 4Q3EA 3HZZA 1RKXA 3UUWA 1U7HA 3FF4A 3KYBA 4E5YA 3A06A 4NZ9A 3L6OO 4YRDA 3DQPA 3Q3CA 4N5MA 4XD2A 2DBRA 1ZBQA 4Z0PA 2TMGA 3U4DA 2C20A 3IMFA 4R3NA 1B2LA 1E3WB 3GFGA 2HLPA 2X5OA 2XPCA 5COAA 4WLEA 1UP6A 4GQAA 3AUUA 1CETA 1UZMA 3GVIA 2PNFA 4YDRA 5TGDA 1DC6A 3CMMA 1IY8A 4OQZA 4XRGA 2JCYA 1M66A 4ZQHA 5JY6A 4AJ4A 1QLJA 3DMTA 1QYVA 4OIMA 5AXDA 4YQYA 3IUSA 4IGFA 3IJRA 2XF8A 5JSFA 4QO8A 3QWAA 4HNHA 4WNCA 4MVJI 1VLLA 3H2SA 4YRBA 4TZKA 1NX6A 3U4HA 3VOSA 3A4VA 3JD2A 1XEAA 2NNLD 2PLAA 4EUHA 1YOVB 4QT0A 4UUOA 1UP4A 4BNMA 3JQAB 4ZQFA 1EMDA 2Y66A 4B8WA 4RF3A 1VL6A 4ALJA 1K6JA 1RM0A 2BRUA 3GGPA 2VRBA 2EP7A 1YVEI 2FSVA 3KYDB 4J3FA 2F00A 1EBUA 3ICPA 3FRJA 4NG5A 3PYMA 3D3EA 2ZJ0A 3NJ4A 3DBLB 5BSGA 4GKVA 3D5TA 5FFFA 5JPIA 1ENYA 2GDZA 4Z9YA 4W99A 2EV9A 4GH5A 4ALNA 1LRKA 2X4GA 1KY5A 2Y93A 3I4FA 2E48A 4FOSA 1UDAA 2HSDA 4P38A 4DQUA 1GPJA 3OA0A 4BNZA 3K2EA 3MZ0A 2VZ0A 1NQ5A 2G5CA 2EJVA 4RVGA 4CV0A 2VWHA 1NTOA 1FK8A 3RSHA 3DZFA 3RBVA 3CMCO 1DRUA 3NKLA 4YAKA 3JQCA 3WQRA 4YEDA 3JD1A 7MDHA 4YPOA 3HN2A 4LSWA 4W9NA 5K6AA 5I8ZA 3UAGA 4NU5A 4KUGA 1GYQA 4MP8A 4ZQBA 3IQDB 2P9CA 4YJGA 1PJ3A 1SO8A 2EW8A 4WJZA 5T6BA 3T4XA 1N7HA 4DA9A 2O3RA 5G0UA 4CR7A 2VT3A 4EI2A 2O4CA 4O63O 1GY8A 1LC0A 1UAGA 2X5KO 2FWMX 2H1SA 5IDQA 2Q50A 1TXGA 2EG9A 3DAFA 4Z0HO 4CM9A 4OXNA 1YKFA 2WYUA 1KS9A 1N8KA 4LVCA 1GL3A 3GN1A 5THKA 3C1AA 1WWKA 1CDOA 4BO8A 2HQ1A 2ZTUA 4CV1A 4TKMA 4ZD6A 4L0QA 3TZQA 1QYWA 4FC7A 1EFLA 1BXGA 3FWZA 3V5NA 3NRCA 3RCBA 4NMHA 1DFHA 2V7PA 3JQ7B 5EL0A 5C7IO 4KTTE 4TRJA 1DLIA 5MDHA 1Q0LA 1PSDA 3ZWPA 3F9IA 3ULKA 1I32A 3GG9A 4GL4A 3WGYA 5BR7A 2O3SA 5KVCA 2JCXA 5IN5A 5K9ZA 2LDXA 3PYLA 1LSJA 2BMAA 3DL2A 3C7CB 4DMLA 4N54A 1BSVA 3NDJA 1BMDA 1KVRA 1T26A 2OFPA 3VKUA 3ZHBA 2YDYA 3I9KA 2VYVA 3V1TC 3E5RA 5IZCA 1LX6A 2Q2VA 3LT1A 5JY1A 3E5MA 1FDWA 2EKPA 6LDHA 3PQFA 3WYBA 3IC5A 4RF5A 2NQ8A 4CLRA 2OMEA 3ETGA 3NV9A 4LK3A 4RDIA 1U8XX 4XR9A 4R69A 1PWZA 2RBEA 1GPDG 2G0TA 2P2SA 3ZH2A 5TJ9A 3OMLA 3ZU2A 1Y8QB 5CDUA 5GZ3A 1GAEO 1P9LA 1U3TA 2O2YA 2O23A 2QZ9A 3PHJA 1V6AA 3PPIA 1NWHA 5ITVA 3VPXA 1UDCA 4CMCA 3U9LA 5T5QA 2Q4BA 3PZBA 4PRLA 1ZW1A 2Y1GA 4FJ2A 5IDYA 1GQQA 1YJ8A 3RASA 3D4OA 1I2CA 4RVFA 4B7UA 3K9QO 1U4SA 3BA1A 4EYEA 3NX4A 4FS3A 1Y5RA 4RL6A 1PR9A 3HHPA 2J5KA 2NU6A 2NWQA 1SEVA 1NBOA 2RH8A 2NVUB 5DF1A 4CPDA 4GSLA 3NTOA 4OXKA 3HDYA 1XYGA 4RPJA 4CLEA 4BV9A 1B8VA 1GCOA 4E3ZA 1XGKA 3D4PA 4YJFB 4M55A 3ZNOA 3D0OA 3KSDO 1A4IA 1N9GB 3T4EA 1E1NA 1I0ZA 4B3IA 4HKTA 2X0JA 5JCXA 1JN0A 3WWZA 3BHJA 2G82A 4PVDA 1SC6A 4D46A 4LRSB 3R3JA 1U2DA 4QECA 3PFFA 4CLOA 1Y9EA 2IEBA 3ZWOA 3INRA 2FR1A 3C85A 4Q3BA 2NADA 3RJ5A 2AG5A 4I5FA 2JHGA 1QYDA 3GUCA 3JCZA 4BKOA 3AJRA 4IZHA 1YL5A 3DWFA 1NPDA 3PYXA 4BL5A 4D3DA 3CINA 3S2IA 4BUCA 2ZYGA 4NIMA 1CJCA 1F14A 2VNSA 1O9BA 1NHWA 3QQPA 4RQUA 3M1LA 3ROQA 5I7VA 5A3VA 1L1FA 4BKUA 4TSKA 3LF1A 4BS9A 1U2GA 2X86A 2PGJA 4BMNA 1EFKA 3RKRA 1LLDA 2J3IA 4LISA 2ZB7A 1HLPA 4Y8VA 1MFPA 3LT2A 1MC5A 4IXWA 1R4NB 2W90A 3COSA 3P7MA 5IFLA 3LT0A 3ITKA 3SJ7A 4FFOA 4B7XA 2D2IA 4FOOA 3WNVA 3W8DA 2DT5A 4Q3NA 3OEYA 4H16A 2DTEA 5TX7A 3KOUA 4AJPA 4J0FA 1VM6A 5IG2A 2ZB3A 2P5YA 3JQ9C 4J2OA 4BO2A 4TZTA 1BWSA 1RM4A 1ZJYA 3KYCA 5H83A 5DP2A 1HYEA 1PJCA 2YHIB 1A71A 3FPLA 4ND5A 1Q7BA 3UOGA 1X7GA 4AL4A 1W6UA 5HBRA 3PHHA 3PDUA 1C0LA 1YO6A 5I9MA 3KLPX 4IDCA 3GEMA 4NU6A 4A03A 4TMFA 4YAIA 2D5AA 1FDUA 1PL7A 3OA2A 4UAGA 3AFMA 4UVHA 4E33A 5ICMA 4CM6A 1NR1A 3S8MA 4NHEA 5JO9A 5A3JA 4AJHA 3PJGA 5JE8A 3OECA 4YWJA 4IGEA 2C07A 3Q9UA 4GWGA 4ZA2A 5KJCA 2JFHA 4LN1A 2VHVA 4UEOA 1IOLA 2DPHA 4YRAA 1UXKA 3NTRA 4XA8A 3CUKA 3JTMA 1A7KA 3Q9NA 4UREA 2X8LA 1ARZA 3A28A 3DTYA 5EMHA 3GGGA 1XHLA 5COBA 3OM9A 4XYLA 1KOLA 3UXYA 2Y0CA 1R16A 4HY3A 4GGOA 1H6DA 3CZMA 1I2ZA 4IS2A 2VCYA 3IP1A 3K96A 3LQFA 1E3IA 3LK7A 4U7WA 4IDGA 3HDHA 3KVOA 4FFMA 4CODB 1GYPA 5TNXA 5TLSA 1RM3A 5A04A 4BIIA 3WTCA 2X9NA 2HUNA 1R4MA 4RQTA 3CPSA 2ZQZA 6ADHA 3DHEA 1HEUA 1VJTA 2P4HX 2PKQO 4P22A 4G81A 1TEHA 3V1YA 3DDNA 2GN4A 1A9YA 2J5RA 3IP3A 3W6UA 4BO4A 1WZIA 2HAEA 4K9DA 2WD7A 5CHEA 3K5PA 4NI5A 4XR4A 1ENZA 3C1TA 4X54A 2NVBA 5GMOA 1LSSA 2VN8A 2J6IA 4IUYA 3FR8A 1NFQA 2D1YA 2DU8A 3ONFA 3I83A 2E49A 5JCJD 2W98A 3MWEB 4PLVA 3V8BA 1HF3A 1ZNQO 1Y9AA 3U09A 2E6UX 4OAQA 1HDZA 1YJQA 1NVGA 2EKQA 3D1LA 4PLZA 3TZ6A 4ZICA 3DBRA 4BQPA 3GQVA 1BRMA 4W4TA 5CDGA 4NFHA 3GHYA 1EQ2A 4WUVA 3F1LA 4BNIA 4YJGB 2PV7A 4MP6A 4K28A 2JL1A 3K92A 3LT4A 5L95A 4E2YA 5A9SA 3VKVA 2QIOA 1PJTA 1JAXA 4TVBA 4XYEA 1TT5A 4PGFA 1N92A 1EE2A 3D64A 2B4TO 2C59A 3OH8A 4ROSA 3ROKA 1HWYA 3BYZA 3HDQA 1Z7BA 1GQ2A 3INGA 1A7AA 5LDGA 1I3LA 1JKIA 1I3MA 3S2EA 3ZNQA 3ETEA 2H6EA 1HYGA 3LC7O 4CMGA 5CEFA 1PZFA 1M6HA 4HUJA 4YJDA 4NPCA 3GFBA 4CLDA 3JQ6A 3WYCA 1BXGB 3W4JA 4RVHA 5AYVA 1MV8A 3UH1A 3HNPA 7ADHA 4ESOA 3ZGYA 3EY4A 3TL3A 3C3XA 4B3JA 1ADBA 5BSEA 4F3YA 3E8XA 4F45A 4Z6KA 1T1SA 1PEDA 1TT7A 2O2SA 4CMKA 5KJFA 3ZCXA 4RPKA 1NPTO 4H7PA 3LLVA 4DGSA 5IJZA 3BTVA 3ZDFA 1TB4A 5JLAA 3TOXA 4EJ6A 4TKLA 1HDXA 3I52A 2I76A 3QWFA 3RJ9A 1K6IA 1N7GA 2CFCA 2EXXA 4E30A 1GUZA 3H8VA 4L75A 4YQZA 4BO0A 4CLRB 3EHEA 2AA3A 1XA0A 2WDZA 1IE3A 3H2ZA 4BGVA 4HBGA 1PIWA 3CE6A 3M1AA 1BDMA 4ND4A 1C0KA 1IZ0A 3AU8A 5DOVA 3DO5A 1HSOA 4EGFA 3ZWCA 1MA0A 4RVSA 5HS6A 5F5LA 2QG4A 3BMOA 1D1TA 1B8PA 1X0XA 3RFVA 3WJ7A 1B7GO 4Q3AA 5JC1A 2P9EA 3GUYA 5JAQA 1H2HA 1UAYA 3I9NA 4O59O 4Y98A 3VZPA 4CM4A 4XYGA 5CG1A 1RJWA 1QSGA 4WLOA 3L9XA 3WX0A 4BB5A 3NUGA 1O5IA 1PZGA 1U9JA 1LLQA 4IS3A 1GEEA 4FIZA 4S3MA 3FHLA 4G65A 2I66A 1Z74A 5CP8A 5TT0A 3L77A 2Q45A 4M54A 5K0ZA 4PZEA 3AI3A 4CR8A 3F4LA 4HP8A 1O94A 1QV7A 2VTEA 2PZLA 3H6KA 3I9LA 4GX2A 4RPLA 3JQ9A 4CLOB 4F46A 4ALKA 4YXFA 2G76A 2OHXA 5DDIP 3CIFA 3ENKA 1U4OA 3LC2O 2NLOA 2CVQA 2BKAA 1I2BA 1J5PA 1JVSA 1PU2A 1LJ8A 2EJWA 4IBOA 4H15A 5AXAA 1E7MA 4IY1A 1BGVA 1NNUA 3SJUA 3D3WA 2YY7A 5AOVA 4L73A 2DPGA 4AJKA 2PFGA 4E2ZA 4PLYA 4BV8A 4BO1A 1YBMA 4TRMA 2IXBA 2NV6A 4JJIA 4QSMA 4R01A 2C7GA 1Y8RA 4L76A 4NNJA 4YAJA 2FN7A 1ML3A 1P31A 3IUPA 3H3FA 4JNKA 1OI7A 2C2XA 2O50A 4FDAA 4J43A 2ET6A 4B4OA 3AY7A 3JYLA 5CPBA 4EJMA 1SBYA 1DAPA 4MPDA 1RYEA 2Y68A 2PKQP 1BVRA 1DFGA 3RUHA 3IAHA 2BFMA 5C7LO 5FYDA 3KBOA 1UXGA 3VPSA 3O26A 4BQRA 3GT0A 3G17A 5CEJA 4R4JA 3K8ZA 4Q3CA 3WQSB 2GZ1A 1J4AA 3FI9A 3IIEA 3ANNA 3KYCB 1F0YA 4YVFA 4BKQA 4R1NA 1ISFA 3ZW8A 1C0PA 4ND2A 3BMNA 4MP3A 4PG4A 1ZFNA 2OP1A 3GVCA 3WG9A 1VKNA 4BNWA 4I9HA 4U0JA 3WGTA 3GDOA 3RC1A 1HT0A 4JBHA 2DFVA 4DBZA 4WASA 2I5PO 1Y7TA 1DPGA 1PQUA 1LXCA 2R00C 1OC4A 1D3AA 3QHAA 5DP1A 2H63A 3DC2A 4A10A 2EHDA 1BW9A 1U5CA 3JQEA 5DBGA 1WNTA 5A9TA 4OXYA 2R6JA 4LW8A 1AHIA 4UUMA 1IPFA 2C5AA 4CMJA 3N7UA 3KB6A 3CTMA 1ZK2A 1PJ4A 2IRWA 2WYWA 1LLCA 2G1UA 5JDIC 4DIBA 4IDFA 3WYEA 1GUFA 1O0SA 3PHIA 3GPIA 5CPFA 1X13A 4XQEA 3HQ4O 2P9GA 2X9GA 4FFLA 2ZCVA 4HADA 4I9NA 4BNNA 1CQJA 3NT2A 4UVEA 3GHHA 4YAGA 4YCAA 2VUUA 1DO8A 2EWMA 2LDBA 2WM3A 3PEFA 2HRBA 2VHXA 3LLSA 4KWHA 4ZU3A 1P74A 5HWSA 1V8BA 3GF4A 1LNQA 1R4MB 2UAGA 2CDCA 1MUUA 4JROA 4KUEA 4L4RA 1C1DA 3E82A 4WLUA 5TT1A 3EVNA 2EF1A 2ZJ1A 2V65A 3VDQA 1HE3A 1K6XA 5L4LA 4FQ8A 3U4CA 1I10A 3WSVA 4CV2A 2WD7B 4QUKA 3ANMA 3M2TA 1DB3A 4MVJP 4FB5A 1HRDA 5TIIA 3I9JA 5DT9A 1E0DA 3IOYA 4U0KA 3HFSA 3AOEC 1JVBA 3TSCA 1Q0HA 3ZWYA 4M8SA 2YFHA 3KEQA 2CD9A 2X7HA 2IDZA 3UICA 3W1VA 1HDGO 2RIRA 1LQUA 2V6FA 1MLDA 2O3JA 1PQPA 3O4RA 4IDEA 5JDCC 1XCBA 5A5EA 4E12A 2CNBA 3H4VA 1D7OA 2ZCUA 4JK3A 4LGVA 4XWYA 5F1KA 4AJ2A 3ICCA 4RGBA 1ISHA 4GSKA 5A9SB 2SCUA 2WE7A 2WTBA 3BMQA 1ZH8A 2I99A 4W7HA 5JCJA 1TT5B 1MXFA 4OKNA 1LRJA 1U7TA 2EKLA 3GPDG 4ONEA 3B6ZA 1YBVA 3PQEA 3I6IA 5JC8A 3WICA 3NGLA 3VDRA 1GFSA 1YQXA 3UCXA 4A0SA 4D0RA 4OO3A 3HB4X 2VNAA 3GVHA 1CIVA 4RCVA 1S6YA 3JD0A 1ZIDA 1DJQA 3ENNA 3VTFA 1QP8A 3MCVA 5TJHA 2YUTA 1E7YA 3WXBA 3JQFC 1GR0A 1NFRA 1ISIA 3P19A 1SAYA 5L40A 4MJLA 3ZWMA 5F3RA 1HSZA 3GAFA 1I30A 2UYYA 3W4IA 1XLTA 2OOSA 4NBWA 1ORRA 3I3OA 3TF5A 4J7UA 3F3SA 1WVGA 1LQTA 1DBVO 1ZK3A 3NT4A 3I9OA 4DPMA 1VKOA 2Y1CA 1Q2XA 2EGGA 1NYTA 4R9SA 4LCEA 4DYVA 1LC3A 3AW9A 3KLMX 5THQA 4FFPA 2EP5A 2FOIA 3WGOA 4D44A 3VVCA 4CJXA 3PQDA 1BDBA 1SOVA 1B3BA 1FDSA 1LSUA 4NFSA 1HETA 1Q0QA 4JLWA 3FBGA 4J1SA 2VHYA 3DFZA 4YYZA 3P2OA 4CV3A 5KVSA 1LDNA 1UP7A 4OOEA 4XQCA 2HJRA 3BMOB 1B26A 5B1YA 2YDXA 4N7RA 4NBVA 1KETA 1WLYA 1DIGA 1EVIA 1V3VA 1HL3A 4WEQA 1MFZA 1M75A 3VTZA 4UVDA 2IEDA 1YB1A 2GZ3A 3L9WA 1PS0A 1MXHA 2BFOA 2W2KA 1NVMB 1SEPA 4GI2A 5A4DA 4GX1A 2O3UA 4BVAA 5DULA 2DC1A 2GCGA 2IZZA 4PLFA 3F47A 5BT9A 1V3TA 1P1IA 1XKQA 2IE0A 3E9QA 2AQ8A 1QG6A 3JQGB 3KTDA 1JA9A 1GADO 3JQAD 3P5SA 2A35A 4P4GA 2ZIZA 5ER6A 3TPCA 4E6PA 4WOJA 2Q49A 4HNGA 4A7PA 2ZTVA 5B37A 3RAJA 1P77A 2PD6A 3CZRA 3DOOA 2OGUA 4FJ1A 1IB6A 5U9CA 2Y0EA 4J4HA 1DC4A 3FTNA 1H6AA 3NAQA 1YQDA 4HV4A 1LUAA 4ZQEA 2IXAA 3D3WB 2B83A 3IJPA 4JIGA 4TROA 1HDCA 4RVDA 1Y1PA 4IQ8A 1A5ZA 2AQHA 3MOGA 2NTJA 3O38A 4U8GA 4IJVA 2O48X 2R00A 4Z3KA 1VJ1A 5BNIA 3P2YA 3VH4A 1Y8RB 3BHIA 3RROA 3OBBA 3MJCA 2RAFA 2HMWA 1YL7A 3V1UA 5A1TA 1GDHA 4NFYA 1I36A 1ZKMA 3T7EA 4MVJM 2CF6A 2DUWA 5JDIA 1M2WA 1N5DA 4N5LA 3ZI0A 3BAZA 2RCYA 1P0CA 1E1LA 3L07A 4R1SA 5KIAA 1EDZA 4J9VA 4R54A 3F5QA 1EUCA 2GF2A 1VPDA 4RORA 1XWFA 3ASUA 2W2LD 1NHGA 4GGPA 1ONPA 4TRNA 2NU9A 3M2PA 5G2OA 1E6WA 1XIVA 2PH5A 4M89A 2ZTLA 1Z75A 4EITA 1YONA 4RJTA 1Z6ZA 1U3WA 2GNAA 4FC6A 4L4SA 1JKFA 3K73O 3BXXA 5KVVA 2AG8A 3QSGA 3VVBA 4D42A 4UULA 5G4LA 1PGQA 1FF9A 2PH3A 1SOWA 3HFGA 4KQWA 2GASA 3E1KA 4FFNA 4GMGA 3RU7A 4WCFC 4IZIA 4PLTA 3AI2A 5LCXA 3UN1A 4DVJA 1H9BA 4GX0A 3SXPA 1V0JA 1B16A 4Y6SA 1FDVA 1GUYA 2J3KA 1BW9B 3AOEA 3EUWA 4QTZA 3E6AA 5J23A 1WMBA 4D7AA 3GVXA 2FP4A 4BHTA 4PG8A 3Q11A 1XELA 1TI7A 4EW6A 5JDCA 3PLRA 2JD2A 2OBYA 3E48A 3EVTA 3S55A 4CM7A 2C7VA 1JWAB 1HXHA 5L7TA 3GLQA 3QY9A 1IUKA 3AUSA 1ISJA 1F12A 3S2FA 3AM5A 4KMSA 3BIOA 4LSMA 3GGOA 1YDWA 1GZ3A 1ZK0A 2GN8A 2PD3A 3ADPA 2IYOA 3S1LA 4PLPA 3RBZA 2FZWA 1QORA 1P44A 5IN4A 1VE9A 3F5SA 1YXMA 2JKVA 2E4AA 1WPQA 2ZTMA 1EK5A 4B7CA 3MJTA 2BFPA 1UXIA 3UW3A 1C1DB 4OM8A 2B5VA 3QVWA 4BNGA 4EBFA 3PJFA 1RWBA 2QHXA 2JFGA 2Q99A 5BQFA 3HUDA 3U3XA 2C5EA 1TA4A 3A1NA 3S2GA 1PTJA 4IJUA 1OBFO 3L0DA 4BNVA 1ZO8A 2IZ1A 3DHNA 3NYWA 5IDXA 3FNHA 2HMSA 4AJ1A 1M6WA 2EGHA 3JQFA 1WXDA 1SZJG 1GYRA 4ZVVA 5IXSA 5ICSA 3FBTA 3ONEA 4CL3A 3E9NA 2JCVA 4Z3DA 4BO7A 4CM8A 4MKZA 2EERA 4FSHA 4O1MA 4BMVA 2GD1O 3AUAA 4NBRA 1E3LA 1AN9A 3B1FA 1QXSA 3LSYA 2VOJA 1KIFA 2YV2A 2ZYDA 2RH4A 2X9VA 5FWNA 2R2GA 3BTSA 3MJVA 4UEKA 5C7OO 2O3QA 1WDLA 3BMQB 2HDHA 4IXTA 2OXIA 4CMIA 1T2FA 2AEJA 3EDMA 1VJ0A 4E5PA 2P4QA 1E77A 5IF3A 4U6SA 3L6DA 4Q39A 4AJOA 5ITWA 4XKJA 3N58A 3ABIA 3RUDA 1GV1A 2PZMA 3H9GA 3OETA 1R0LA 4J1NA 1X1TA 3NJ8A 5DCWA 4EUFA 2QW8A 2VRCD 5IDWA 5A5FA 4DRYA 3GZ4A 4K26A 2PD4A 4DQVA 2QYTA 4PRKA 2RHRA 1BHSA 3HJAA 1NQTA 3G0OA 3HG7A 2Q1WA 3KRTA 4QX6A 4E2XA 1WP4A 2GPTA 1DC5A 3H3JA 4D0SA 3O8QA 2PY6A 5L51A 4KQXA 4BGIA 4WPGA 3DZBA 5T8KC 2GR9A 3OJEA 4BOYA 2HKIA 1F06A 1L7EA 2FY8A 2B37A 4LCJA 1EEHA 3ZU3A 2E37A 1HE2A 1KEPA 1I33A 4MO2A 5C5IA 3WGZA 4MVJG 2O7SA 4RVUA 3STHA 2FRDA 4WNIA 1G1AA 1HLDA 3ORFA 3DZIA 3ZWBA 3WNQA 4K1LA 1IULA 4I08A 3WGQA 2QX7A 1I24A 2DTXA 1MG0A 2I9PA 1B14A 3WS7A 2NQTA 1KVQA 1BG6A 3LVFO 3ZW9A 1KC3A 1YBAA 5G4KA 4J0EA 3DZJA 2NUAA 2HU2A 3GDFA 1QKIA 5F1OA 1JU9A 1E5LA 1T1RA 1ZEMA 4R9RA 1Z7EA 5U4QA 1MG5A 4M49A 4WECA 1P1FA 1H2BA 3NEPX 1N2SA 2DM6A 1ADGA 4WLVA 4R68A 4AG3A 2FHSA 2UVDA 1SCUA 3R1IA 4FJ0A 3CH6A 4PZCA 1JKJA 3C7DB 3DHYA 1FJHA 1P45A 3TFQA 2WYVA 1ZJZA 2OP0A 3EZLA 3GEDA 4N18A 4R51A 5DNAA 2W2KB 3H5RA 4N5NA 3B1KA 3ZV3A 1E3JA 4I9UA 1Q7GA 4HFJA 1ZSYA 2C82A 4WCDA 1EVJA 5JS6A 1IHYA 1G0NA 3RC2A 4BNFA 1R37A 3BTUA 3SX2A 4CM5A 1E7RA 1F8GA 1D1SA 4HWKA 4XDZA 4BO5A 3D5QA 3JQBC 1HE4A 3I6QA 2YQ5A 1Y6JA 3SLKA 4E4YA 1X7DA 4ILKA 4QEDA 3DXFA 4PG5A 1AUPA 1NR7A 3W8EA 1ADFA 4YJHA 4Z9XA 3RFTA 3U4IA 1R12A 3G3EA 1T24A 4P4NA 4P4LA 1Z73A 2DKNA 3QW2A 3EGOA 4XIJA 1PGPA 4WCFA 2I6TA 2A4KA 3UHAA 3KV3O 4BGUA 4LVUA 1CEQA 3JQAA 1X1EA 5A03A 4I1IA 3QWBA 2X0IA 3JYNA 4DC1A 4C4OA 1I8TA 2Q2WA 2VT2A 4ZRNA 1XQ6A 3JQ8A 1GEGA 2NTVA 3KYDA 3DBLA 3VHRA 2EW2A 3UGKA 1R0SA 4J1QA 1ONOA 2D0IA 3UVEA 1IZ9A 2VYND 5DBIA 4MVJF 4JCOA 5JXWA 1J49A 5TSDA 1KERA 3GMDA 5EESA 2I3GA 1O8CA 5TS3A 5ILOA 2X5JO 2YW9A 5KOIA 3AM3A 3WR5A 1NXQA 4KP7A 3VPGA 1EUDA 2DVMA 2VHZA 4MIYA 1ZK1A 2GYYA 5C3MA 1KEWA 3PI7A 4NH4A 1PZHA 1KVTA 3GMSA 5F1PA 4ZHSA 3H9EO 1P1RA 3H9JA 4NJOA 2W2LA 3EYWA 3TQHA 1CRWG 2QYSA 1H5QA 5JBIA 4BNXA 3RUIA 4B4UA 3PHLA 3K30A 2Q4EA 1LI4A 1T2DA 1ZSVA 4HX5A 4PVCA 1BXKA 4E5MA 2V6BA 1HDYA 2V6MA 1ISGA 1C3VA 3DOCA 4L9RA 2OO5A 1CWUA 1DHTA 3MEQA 3TZCA 1G6KA 4Q3DA 1NVTA 1SB8A 2BD0A 2GO1A 4A5OA 1NQOA 3WMXA 4FW8A 2HK8A 4A2CA 3SC4A 4J16A 4ZJUA 2J5QA 3GG2A 2AQIA 1KEUA 2ZQYA 1GV0A 3A14A 2OZPA 1OZAA 4MVJE 5L45A 4L74A 4R1TA 4K6CA 2RHCA 2Q1UA 2ZATA 4XGNA 1P3DA 2ZYAA 2DTDA 3LZ6A 5JAIA 4DTIA 1E6UA 3GR6A 3GOHA 4IPTA 2B0JA 3DTTA 4A26A 3VZRA 3OICA 1DEHA 2GN6A 3PLNA 4HFMA 5TQVA 1M67A 4XGIA 1UH5A 3QVTA 2VUSA 3GN2A 4UEJA 3R6DA 3QE3A 4TRRA 4BB6A 3UCEA 1VL0A 5AXCA 5LDHA 5B4TA 1K5HA 5KJEA 2X58A 4PIVA 2HJSA 5JMPA 3OJLA 4XDYA 3RQSA 3ZU4A 4YAEA 1ID1A 4KOAA 4Z9FA 4URFA 4JJFA 4II3A 1OAAA 5G0SA 1UZNA 2OL4A 1ADCA 1Y5MA 4KZPA 1YH3A 1PGOA 4CM8B 2FR8A 1P1HA 1GZ6A 1RM5A 5T8KA 3TRIA 2YQ4A 3L4SO 5HRUA 2CY0A 1BTOA 4J90A 1DHRA 2GERA 2A9FA 2PGDA 4QXMA 2DQ4A 4J49A 3NT5A 4AJNA 5JNLA 4HFNA 3BTOA 1EBFA 3OJFA 2VTDA 3VZQA 1AXEA 3OIGA 3ZWAA 3WFIA 3DFUA 3QWHA 1YB4A 5JW6A 3WSWA 3PVZA 1K0UA 5H82A 1AHHA 4CMIB 5IAAA 4E5NA 1ZUD1 3Q2KA 3UF0A 4C7JA 3LU1A 1SMKA 1YE3A 2NU7A 4WGGA 1LEHA 4BNKA 2YHUA 4IINA 2ZB4A 3KZVA 4E2WA 4DREA 1OFGA 2G17A 1LU9A 3HB5X 3IS3A 5I9LA 3BHMA 1JWBB 1EZ4A 2ZKLA 4J4TA 3GNSA 1ZMTA 3LF2A 3VAZA 3RVDA 1PS8A 2PZKA 2DAPA 4QFDA 4JXKA 4PLHA 1DFIA 3ROPA 2Q1TA 2BELA 4MVJD 4WE3A 4CMBA 3ZWVA 1DAOA 1VL8A 3GY0A 3O8QB 4XYBA 4FCCA 4DIOA 2VWGA 2X0NA 1ZVMA 2PK3A 2DBZA 3GEGA 4BNHA 1TLTA 2VRCA 3GA0A 5ES3A 1ISMA 1SB9A 1KEVA 3DZHA 4LRTB 2D5CA 4NBUA 4FR5A 4O5OA 4D79A 4J6FA 4DXHA 2E82A 1UZLA 2BF7A 3AUTA 3DZKA 3PRJA 2ZB8A 3V2HA 5C37A 1Z82A 3E9MA 3JQBA 1TVEA 3KETA 2AMFA 1I3KA 1HDRA 3DMYA 3OFSA 3EZYA 4CQMD 3WIDA 3U0BA 4DPLA 2WD8A 1N1GA 1XG5A 4JBIA 3GVPA 1P33A 5JYEA 2AW5A 1ZCJA 3RUCA 3WGHA 5B4VA 3V2UA 1LTHR 2NVWA 4OGWA 5G4KB 1KYQA 4GLOA 3DBRB 4R16A 1V35A 3Q1LA 5DOZA 3MTGA 1H94A 3RBXA 4M87A 4B79A 2FSSA 1YRLA 4J2HA 3JYQA 3H5NA 3HN7A 2BGMA 5G0VA 5ENDA 5TF4A 1NWCA 5KCZA 4CUJA 1C1XA 1C0IA 5JAZA 3WDSA 1K2WA 3PJEA 4OHUA 2C54A 4PG6A 3TWOA 1YGYA 2YHIA 3SVTA 3OIFA 4Q9NA 4IDAA 1NAHA 1B3RA 3OIDA 1K89A 4KTVE 1PR3A 2HK7A 4RDHA 3SLGA 1HDOA 3OEWA 4FFRA 5KVQA 3MJSA 4CLHA 1VRWA 1Q7CA 4ITUA 1T4BA 2IZ0A 2Y1FA 4DUPA 1ENOA 1GZ4A 4XJSA 3UFXA 4AJEA 4AJIA 1IHXA 3RI3A 1NQAO 3CKYA 1HTBA 1PZEA 3GDGA 3OQ1A 5DCUA 5LC1A 2AEFA 3EC7A 4QFCA 4YR9A 1K3TA 4D3FA 4YJHB 4CM1A 2QRJA 1MP0A 3HWRA 4CQLA 2QQ5A 3D4NA 3KM0A 4WCFB 3GZNA 4LMRA 3HSKA 3BMCA 1M76A 4OJNA 4E32A 4OSOA 4KWIA 3KO8A 1CF2O 3KSZO 3G79A 5EQDA 5F5NA 1U1IA 1U3VA 2PWZA 3CXRA 2WEKA 3PFWO 1E7SA 1LDGA 3RC9A 2BLLA 2I67A 3WLEA 1EDOA 4D45A 4E5KA 1PS9A 3JQ8B 4AVYA 3RKUA 1EUZA 2Y05A 3DB2A 1XU7A 4I5DA 1MGOA 4NJMA 4DLBA 3I5MA 1JLLA 1ONNA 2X1HA 1BXZA 3PJDA 1VC2A 1WDKA 2Q2QA 3QVXA 5L53A 1W73A 1LDMA 3I23A 4CMAA 4DYDA 2PZJA 1X0VA 4J4BA 5DBFA 1AGNA 2FPIA 1GU7A 2Y1OA 4R5HA 3WGIA 4XQGA 3ZNPA 3N74A 4D43A 1X14A 3K6JA 2DBVO 1DOHA 2QRKA 3NDRA 3WGGA 4M1QA 4DMMA 1H6BA 4J1TA 5BSFA 4D41A 4CM4B 1DRVA 1H0KA 5L3ZA 5BNTA 5JYDA 4Y67A 3OF2A 4YT2A 4IMPA 4RZIA 2QRLA 3QP9A 1E7QA 4G5HA 4RPGA 4XJTA 2VYNA 5U1PA 3QA9A 3RUAA 2HO5A 3AK4A 4EZBA 1ZSNA 4WK6A 4XX0A 2J3JA 3GH3A 5G0TA 1F8FA 2B35A 5I9NA 4JP2A 1ZEJA 4Y9DA 4GPD1 1A72A 3IL2A 3ONDA 2CUKA 2HCTA 4OOFA 1XQ1A 1EK6A 3JSAA 1U28A 5T57A 5HS4A 3RUEA 3FNFA 3PTZA 4MIEA 5CAEA 1DIBA 1FXSA 5ADHA 3C8MA 4Z0TA 2VOEA 2GUGA 2PR2A 2CDBA 2FZEA 8ADHA 2VWQA 5CG2A 3AWDA 3G1TA 1ZXLA 3KXDA 4W7IA 4B4VA 4ALLA 4IQ0A 4PLCA 4MKRA 2YV1A 4WLNA 5EERA 2X23A 4OKIA 3TOZA 3FTPA 1W8DA 3PHGA 2FPGA 1UUFA 1V9LA 3QVOA 4FPXA 3FD8A 4IDBA 5GY7A 1PJSA 4C7KA 5L7YA 4BNTA 2Y0DA 4WKGA 2X6TA 1S7CA 3DONA 1HZJA 2TMDA 1DDOA 3UKOA 2X22A 3E03A 3M6IA 3L4BC 3EW7A 2DBQA 4DLAA 1RYDA 3AOGA 1E3SA 1H6CA 5FI3A 4YACA 2GZ2A 2I3AA 3VC7A 1A4UA 3MJEA 3GNTA 4BNLA 1YQGA 1CYDA 1EE9A 2VWPA 1O6ZA 1QR6A 4AJJA 2BFAA 2UUOA 4RF2A 1ULUA 2HRZA 3PGJA 1OC2A 3DAGA 4NQZA 4ZN6A 3BMNB 4XRRA 1LLUA 4R1UA 5KWEA 1GCUA 3GNQA 1NFFA 3PK0A 3WLFA 3TFOA 4JQCA 3K31A 5KTKA 3CSDA 4XCVA 4D3SA 2OUIA 2D8AA 4BNYA 3AFNA 2POQX 5DCYA 3QLJA 2WSBA 5FI5A 3TDKA 4TQGA 4NR0A 1LSOA 1WMAA 1RPNA 1BVUA 4BNUA 3DBHA 4W82A 4WLFA 2FR0A 1C14A 3EAGA 1XDWA 4E0BA 2WE8A 3I1JA 3ZZNA 4CUZA 2Q46A 1E1MA 4PFJA 5I7EA 4YA6A 4ZRMA 3ROMA 3RU9A 5BNFA 3LC1O 4AFNA 4DLLA 2GGSA 2GLXA 2OORA 3AI1A 5I7FA 1B8UA 3ST7A 4O6VA 4A27A 1Y81A 1XU9A 2Y99A 4Y6PA 1VSVA 4P8RA 4EJ0A 5CDYA 3RUFA 5I7SA 1QV6A 1YL6A 5B12A 4OQYA 3UCFA 1HKUA 1O89A 1DRWA 1T2CA 2D4AA 3I4CA 4INAA 1X7HA 3WBBA 4CM3A 3WQQA 1IPEA 1PQWA 1GTMA 1ZZEA 2IYPA 3OHSX 5JO0A 2JHFA 4KUHA 3RWBA 4GX5A 1R6DA 1DXYA 1QMGA 5JMWA 1E5QA 4OL9A 4O0LA 3H7AA 2Y1DA 3B1JA 4MINA 3G49A 4RPHA 1QRRA 5AVOA 2Q1SA 4LMPA 3VH1A 1PJ2A 4OSPA 5A05A 4MVJA 4CMHA 2YFQA 5L7WA 5JFOA 1B15A 4AJLA 1E6EA 4IQGA 3R0IA 5GZ6A 3ZWNA 3HE3A 3ZWXA 2JD0A 3SBOA 3WOHA 4NBTA 1J0XO 2JAHA 2Z5LA 1E92A 3TN7A 3AM4A 3ZHXA 2C2YA 3X2FA 5KJ1A 5KJ6A 4CL8A 1LA2A 1NM5A 1GQYA 5L9AA 4IDDA 3BZUA 4CQMA 4PG7A 4RZHA 4YBZA 5MGBA 5L4NA 3LDHA 1C1XB 1NPYA 2XAAA 3JD4A 5DZSA 4ALIA 4YT4A 3QJ5A 3MTJA 2B5WA 5EQFA 3NTQA 1D4FA 3ITDA 3ADOA 3DOJA 3FNEA 1B0AA 3W4KA 3WIEA 2GSDA 4YTEA 4ID9A 4GKBA 3NDIA 3PXXA 4NK5A 4E31A 4ZQGA 3PIIA 4YT5A 3QRWA 2CMDA 1PX0A 1CERA 1G0OA 5KNLA 1KY4A 5A9RA 2Q3EA 1X15A 5T64A 2CVOA 2WJPA 2B4RO 2BI8A 4QQRA 3H9QA 3LYLA 2AE2A 3SEFA 4I5EA 1R66A 4PLGA 1HZZA 4FGWA 1ZMOA 5GZ1A 2GN9A 4S1VA 3H5AA 1E7WA 3ZV4A 4I8XA 3ZV6A 3IKTA 3EK2A 4UUPA 5FF9A 4F6LA 4DBVO 4BKPA 4CQLB 1I01A 3MJ4A 2W8ZA 3ASVA 3WWYA 2PKRA 4MOWA 3GZNB 1ENPA 3D7LA 2J3HA 3MWDB 1DIRA 3BMCB 3C7AA 4JP3A 1NASA 4EEXA 1IL0A 1XR3A 4FN4A 3H9UA 1EQUA 5IZ4A 3ZU5A 4CMEC 4R3WA 3Q6IA 3QWIA 2CDAA 2VQ3A 4NJMB 2CVZA 4DC0A 4XIYA 3DAPA 2BH9A 1FDTA 3MOIA 3PWSA 1JDJA 2CZCA 1U8FO 3FN4A 4DWVA 2O3TA 2H9IA 1DSSG 4RF4A 4XB2A 5DN9A 3JYOA 1KBZA 1JQBA 1ZK4A 4GWKA 2PTGA 4PZDA 1Z45A 4B3HA 1H93A 1WDMA 5ER9A 3R3SA 3RIHA 4EUEA 1AXGA 4R5MA 4B8ZA 5BSHA 2XXJA 3TZKA 1XSEA 4PLWA 1A27A 3C1OA 1WW8A 3TNLA 1UXHA 2VZ8A 1VI2A 2HMUA 4NK4A 5TC4A 2UUPA 3DBVO 3L4BA 1QLHA 3OP4A 5AXBA 3WTBA 2D59A 4RV9A 4U6QA 1E3WA 3O9ZA 4PN3A 2NU8A 4UUNA 2H5LA 4W6ZA 4M86A 4E21A 1E3EA 4BMSA 4L8VA 1NAIA 1J6UA 1O95A 5EN4A 2FMUA 8LDHA 4DPKA 3C24A 4CLXA 3OQBA 3KHUA 3KUXA 4J7CA 4A73A 1I3NA 1NP3A 1YWGO 2Z1NA 3U62A 4JX8A 3JQDA 1DJNA 3RFXA 2C29D 3JD3A 3PP8A 1EVYA 1JTVA 4YB8A 4GBJA 1KC1A 1YOVA 3WJAA 5KKCA 4JN6B 1T2AA 2QZZA 4IIVA 4NDNE 5EIOA 4Y6RA 3GK3A 2XXBA 3OJOA 1IYZA 2A92A 3IDSA 3FR7A 3TZHA 1YDEA 3F46A 4BKRA 5L4SA 1H9AA 4JGBA 3AU9A 2X0RA 5IXYA 2YJZA 3GRPA 4HXYA 4ND3A 1U3UA 4RLSA 1HYHA 3OQ6A 4FGSA 2AQKA 3F4BA 4TVOA 2BHLA 4OYRA 5ILGA 4FBGA 5G0WA 9LDTA 1KVSA 2Z95A 3JYPA 3ON5A 2P68A 5KKAA 2A94A 3JV7A 4KDFA 3RC7A 5A06A 4J7XA 2B36A 1GD1O 4TWRA 3DMTC 2DLDA 1CQIA 1F17A 3W8FA 5B4UA 3L6EA 2HK9A 2I65A 1QYCA 1AE1A 2AE1A 3CEAA 4XGKA 2ZK7A 3TL2A 2B69A 4CM9D 2NACA 2BGKA 4RO0A 2C0CA 3V2GA 3PDJA 2V6GA 4GVXA 4QO7A 2BGLA 4IJWA 3VH2A 4AICA 2EEZA 3DBHB 1Q1NA 2JFFA 4IMRA 4DQXA 1YB5A 1HE5A 3E18A 5ENVA 3ANLA 1U5AA 1LDEA 2PA3A 3ZNNA 4HFRA 4H3VA 4YT8A 2O7QA 3DR3A 2CSUA 2FPPA 1VSUA 1WZEA 4DIFA 3PGXA 3W6ZA 2XOXA 3H65A 4UVIA 2WWRA 4OH1A 3VPHA 3WBFA 4EDFA 1P0FA 1N1EA 3JQGA 3O03A 4WOKA 3RD5A 2VYVD 3PIDA 3EMKA 5T67A 3WFJA 5CDTA 2YYYA 3FPCA 4XZ3A 5CEEA 5HM8A 2AHRA 3JQ7A 3GC6A 1PGNA 3IKVA 1JW9B 2NM0A 3HADA 4CR6A 3F6YA 3WMWA 4CUKA 2BI7A 2AEMA 1PJBA 1UDBA 1MX3A 4FD3A 1R15A 2JJYA 5HTOA 3WB9A 1LRLA 3GAZA 4XB1A 4W9NC 5K6AC 4K6FA 4RLHA 9LDBA 2Y1EA 1OOEA 4E13A 4ALMA 1UXJA 1YS4A 1LDBA 1JAYA 5EPOA 1PJQA 4BGEA 4MDHA 1T2EA 3FSRA 1PL8A 4J9UE 2GRAA 3ZHZA 2P91A 4GAEA 3GRKA 4XEHA
chains in the Genus database with same CATH superfamily
4C6SA 4MR7A 4ZAGA 3FPKA 3FHOA 3FIUA 1NNI1 3ZXSA 1ULSA 4Q7EA 3KDAA 2J8ZA 4YRQA 5DKFA 3THYB 4MW1A 5CK5A 2ODPA 2QMEA 1RWVA 4HDMB 5BYKA 5J3JA 2PT7A 1W5BA 3PPXA 4C22A 1T9ZA 4POOA 5LMNB 3KX2A 2II6A 1SPXA 3INTA 3OE1A 2DOKA 4N82A 4L4XA 2I1WA 4GC5A 4F12A 1RQ2A 2LCFA 3I2FA 1FMCA 5HJ5A 2OBNA 3RSGA 3WLHA 3PC6A 1S4QA 1DZ3A 1PWXA 4CQMB 1II8B 5A4KA 3NGMA 3P71T 4EEZA 1D6JA 4JJGA 1B42A 4P9NA 4A0HA 4MWEA 3KSAC 1JGTA 3LGAA 4TXLA 4RXTA 1J5EB 2OXTA 1XTUA 1MC4A 4MNTA 2FDRA 4V3CA 1KMNA 3RTBA 3ZVKA 3OQOA 3VR6A 2CLLB 4JOBA 5FV7A 1KTIA 2YNMC 1PWEA 3IBSA 2ZE8A 3NGXA 4JIMA 4MLPA 4ND6A 3K70D 4CEIB 1DIHA 2DPXA 3EGDB 2NSDA 3HRKA 4JAVC 3TQOA 3LQKA 3WLIA 3I5XA 1YZVA 4QM6A 4JGGA 4HH4A 3M89A 2Y67A 1Z47A 2CL0X 3SQWA 1UJMA 1Y0BA 3ZHYA 2PJRA 5EIFA 1YSCA 2QUBA 4X90A 2FWNA 1MB3A 1MNQA 2H65A 4HZUA 4WK2B 1L4MA 1SU7A 3LY9A 1G64A 1YJCA 4ZGWA 5JYBA 4JWKA 4PWZA 2PSEA 4X66B 1DC3A 2GAAA 2XRFA 1QLWA 1FLAA 3LIIA 5EJ2A 2AB0A 1QO0A 4BQIA 2BGJA 4MAFA 4V0NA 4G41A 1BJKA 1G3RA 3N7AA 1IFXA 3EVGA 2FVYA 4QM7A 3J7AC 2PGAA 1Z0ZA 2Q0XA 2OD9A 2WQZA 2Z9CA 3K9CA 2B92A 2A0XA 2F2TA 3C87A 2VP5A 3IBFA 4JB8A 3ZDDA 3IUJA 2X7XA 5AQ1A 5AJXA 4MQ6A 2RMKA 3PNBA 3QV1A 3PZRA 4PEVA 1ODTC 1T25A 2AXQA 4ND1A 3QIVA 2XW6A 5AK5A 5CA0F 4IVRA 4DANA 1JHYA 3B3JA 3L7BA 3B20A 1QWSA 5DI3B 1XRNA 4ARZA 5IABA 1F48A 1IQPA 5C8YA 1C9NA 3T1OA 4MUAA 4IWXA 1QCCA 5HA5A 3WLTA 4DIKA 4OHVA 3T3NA 2I4NA 3GUVA 3OY2A 1LBHA 1YDHA 2EFCB 4RQAA 2Y6UA 1DIAA 1DEAA 4R6XA 5KWJA 4RK5A 2WY2D 1AVTA 2ILTA 2J9GA 3NS7A 3IOMA 3II6X 3W34A 1T4DA 2RI6A 1ECLA 4FB4A 3LW7A 1R4NA 1A8PA 4FDMA 3DZGA 4EBBA 3AFOA 2X5NA 2H2HA 1JEQA 4P0PB 2DHRA 4QXPA 5HJ7A 3IYLW 3P0IA 3F8TA 3JX9A 3NWEA 3PT5A 1B76A 4KJXA 3T9EA 3K0SA 3UANA 5HIKA 1RQ7A 4JBNA 3PXDA 1T0HB 1G8HA 2DULA 1PR2A 2H54A 3C6MA 4GNRA 3IKLA 3PKIA 4Q3EA 5B53A 2HNBA 5JH7B 4DABA 4YRDA 3Q3CA 3SKYA 4Z1OA 4UZSA 3C3BA 4NC9A 4AP9A 2E7ZA 3R75A 2DFLA 2VAMA 4D74A 1OFUA 1V25A 4JX9A 1UINA 2XPCA 2QSYA 1T5SA 3V8VA 3KKZA 2BP7A 4NE9A 2R8XA 2QLLA 3KFVA 4G8BA 3TLGA 1A5AB 4Q3OA 1YK1A 4YDRA 2C2KA 1P9RA 3G8AA 4HDOB 3RYHB 2HLNA 4BAGA 3G7UA 1ZCAA 2VP9A 3L7MA 3PD1A 4OQPA 5DK6A 3W7AA 4Q5IA 4ZQHA 5K3CA 2X9QA 3DMTA 1VLQA 1U2GC 2Q4TA 4OIMA 2V7VA 5F78A 4G5GA 4YQYA 2AL7A 4ZTZB 4AY3A 1SU4A 4QEZA 1X7WA 2J0SA 1KWKA 2HJHA 2Q41A 3ZDAA 3E5HA 3DMRA 3IJRA 5JSFA 2HRDA 4QQKA 3TG2A 5A6SB 3LQ1A 5LP1A 1TZ2A 2O5RA 2HIGA 4YRBA 3U4HA 4K8RB 1YR6A 2FA9A 3KT6A 1S8FA 5FUYA 2SECE 3PE4A 2PLAA 4QT0A 1UP4A 1UC5B 1MJFA 2FSGA 2P2DA 2XUHA 3L3BA 2Y66A 5EUBA 3AZQA 4AULA 1YC2A 1KOFA 1K6JA 2FUG1 1A77A 3K5HA 3NU1A 4GOLD 3I5AA 3DD1A 5AJYA 2YIMA 3UMJA 3VJLA 1IAVA 3AGPA 2FSVA 1DT5A 1NVDA 2C61A 4J3FA 1E5VA 2F00A 3VOAA 3PYMA 1DBWA 5ALQA 2WPDD 3LKVA 4PZPA 4OYYA 4EFNA 4EMBA 1YC5A 2IH5A 4H9GA 3H2IA 3MILA 4Z9YA 1CR0A 3GLFE 5LBUA 4U2CA 5P21A 3RFUA 3EQ6A 2HU5A 4D9BA 5KSOA 3R7SA 2EV9A 3C3MA 4GH5A 1LRKA 1QOPB 5D00A 4ALNA 4AN1A 2RB5A 4BMOB 4QSHA 1KY5A 5JS8A 2WF9A 3RYIA 2HSDA 1P62B 2IYNA 3A3KA 4P38A 3OA0A 3VU8A 4C20A 4URVR 2AT1A 2R0QC 4BNZA 4P0QB 5KC8A 3L0BA 4EJSB 5AKXA 5AVSA 1H66A 1C7QA 3L7AA 1RMTA 5IAGA 1KMIY 1MZVA 2Q9CA 4RVGA 2B7LA 2IYWA 4CV0A 3AGQA 2AS0A 2BCEA 1JAZA 3DNMA 5LP6F 5A4IS 3DQZA 1EUDB 1GTVA 1QIKA 2WJJA 5T4BA 3RSHA 1DRUA 3VJMA 4AY4A 2J1LA 3JQCA 3HO1A 1KJQA 2WUFA 4GZ3A 4D02A 3O3NB 4YPOA 3HN2A 7MDHA 2CLFB 3ACCA 4KUGA 3OAAA 1QCDA 2OYCA 3DDHA 3IQDB 2P9CA 4YJGA 4DXAA 4QOJA 3SQLA 1PJ3A 4FW9A 4WJZA 2XMPA 1W36B 1N3IA 1Z7WA 3T4XA 5SY9A 3L7OA 1J90A 5IULC 4KLCA 5G0UA 4DZRA 4AXBA 1X19A 1VRCA 3B7WA 1BU5A 3QI7A 1U7PA 4MULA 1G7CA 4UPVA 2O4CA 3G2JA 5K3AA 1MO2A 1UAGA 1JTFA 3FJYA 2ZRGA 3BD6A 5K4HA 3Q3JB 3O9VA 4M1EA 1EX9A 2JFPA 4LDQA 3RG2A 4NV3A 4CM9A 4OXNA 2RJ3A 2C4MA 1KS9A 2WYUA 3MBIA 3BKXA 4LRQA 2F67A 2PTHA 3VYWA 1OTXA 2PGXA 4DIUA 2OV2A 3GN1A 4ZWNA 5CBPA 3HA3A 1AO0A 2HQ1A 2W2TA 3KQYA 2KM1A 3O74A 4L0QA 3E1SA 4UAUA 1G55A 4M1WA 1Z07A 4EY4A 4RDIA 1YQ9A 2GXSA 4NMHA 2CUNA 3ZBQA 5BR4A 4RHFA 1D2MA 1PEYA 4REQA 1TMYA 2XWBF 1MOQA 1V8DA 3ULKA 1AV6A 1R7RA 1I32A 4P98A 3TB6A 4H60A 2YNMA 2TMYA 1RHJA 5HP4A 2GYVA 2O3SA 5KVCA 1AQJA 4Q3KA 1P8JA 1QGYA 3EQ9A 2UKDA 3ZE8A 2ZIXB 3LBNA 4DMLA 3CR8A 4AO6A 4N54A 3VKUA 1BMDA 1KVRA 1T26A 4TN1A 4NNPA 3NC0C 4W9RA 1FDIA 5D51S 2PUHA 3E5RA 4B5KA 4S2UA 3O1HB 3WC4A 3RSOA 1KIAA 2Q7DA 3E5MA 2EKPA 1FS5A 3C41J 4HDNA 4MJ3A 4WJKB 3WYBA 2VHUA 3UHFA 4LK3A 3E2MA 1RPZA 1PK9A 3IMCA 3KQLA 2RBEA 4E7OA 1GPDG 3QBEA 4WUTA 2P2SA 4FQ7A 5EJGA 1IOVA 1MNAA 3AHJA 2OYSA 2B1QA 1PI3A 3NHAA 3I01M 1J97A 3OMLA 1DBSA 4IZOA 4B7ZA 1GAEO 2QZ9A 1U3TA 2O23A 3QMPA 3Q40A 4Q1BA 1Q7RA 4Q18A 2XA2A 1ZYUA 3VPXA 1UDCA 2LKCA 4TTIA 3MMNA 4CMCA 3U9LA 3BJZA 4UQOA 5BR1A 5CFMA 1QHHA 1SGWA 2Q4BA 4H3SA 2ZUEA 3FSEA 1WB9A 1ZW1A 2IF2A 5DYNA 3O4VA 1W75A 4M9RA 1VB3A 4JNCA 1AH2A 2OBLA 3DJYA 4RVFA 4MPPA 3K9QO 1DAIA 5J9FA 2R86A 2IFTA 5G1PA 4IDUA 5DNEA 4PHFA 2QX6A 3LMKA 3FZYA 3OD1A 1NBOA 1ULHA 1NW8A 1X7YA 3IAXA 2WZQA 4FEGA 4CPDA 3F2IA 3HDYA 4IVNA 5H9VA 1B8VA 1QNLA 3UXEA 1E94E 3EBOA 3HB1A 4ZCTA 3ZNOA 3G5AA 1ZU5A 3KSDO 1RS0A 3K72B 4PTZA 5HJ2A 2ZRMA 2JH3A 5ICGA 4NEHB 1JJ7A 4L02A 5E4YA 1FBTA 4XW2A 4BWGA 2VPYA 3WWZA 1SZDA 1MRZA 3C98A 2C83A 1WBDA 4KHPB 3H0KA 4FOLA 3ECCA 2POCA 1D09A 3ZWOA 4Q3BA 4W5JA 3WB1A 4RKQA 4ZYUA 2I78A 4ZJPA 4N8EA 2ORIA 4KVAA 4P31A 1OFTA 3DO6A 1K88A 2YZMA 2YJGA 1L4KA 2NXCA 4IZHA 3PDIB 3D6HA 1D2EA 4PBSA 1ZL0A 4Y9UA 4MI1A 1P7VA 2DH5A 5FTWA 4CKCA 3R9XA 4D3DA 3ISVA 2XWSA 4EKIA 1Q1BA 3S2IA 4BUCA 1OLXA 1YZ3A 3D7MA 1CJCA 1F14A 2ZXFA 1CY2A 4NU8X 1NHWA 4RQUA 4EUKA 3MK31 1GFIA 2G71A 2RHTA 4FXPA 4N6GA 3PHCA 3K9WA 3SF0A 1FTQA 2WIFA 4IHJA 4O2BA 5ILQA 5JD6A 1U1DA 4YAWA 2VXYA 3BORA 1F5NA 2W11A 4O33A 3STYA 2RI1A 3LF1A 1ODJA 1U2GA 2PQMA 2PVPA 2X86A 4D96A 1SFRA 2JA1A 5C8YB 2Z6VA 2BFFA 5GGYA 2PGJA 1EAYA 2Y0PA 4UDXX 4FM9A 1EFKA 1SH7A 4YJ3F 2IXTA 5ALHA 1RCTE 4GWLA 4DV5B 3D02A 1D5CA 1HLPA 2RGDA 3B3GA 1U9CA 3CG0A 4GSYA 5C81A 5KYWA 2E87A 4BE7B 1MC5A 1Z26A 3IIMA 3KPUA 4HI0E 1R4NB 4IXWA 3LQRA 5AT1A 3VUEA 3P7MA 1NUPA 3QX8A 5EIBC 4JUIA 3A32A 4HWSA 2PLRA 3KL4A 4JB0A 2RBKA 2D2IA 4FOOA 3WNVA 1PFYA 2DT5A 2IL1A 3OEYA 4Q3NA 4DJAA 4ENVA 1O94C 4DUGA 1SM4A 4WSOA 2XLBA 3KT3A 4AWBA 2P5YA 4OHWA 1UDXA 1Y4SA 4J2OA 4B34A 5BUQA 1XO1A 1RM4A 2IF0A 4HAYA 5EOVA 4RH0A 1DUSA 1XTKA 1JG7A 1Y63A 2ZBQA 1H4TA 2UYGA 3IPCA 1N5KA 3L46A 1M34E 1J9ZA 3PHHA 5EQJB 4HWOA 2RG7A 3PDUA 2G8NA 2C5HA 1C0LA 1YO6A 4CF6A 1YKSA 1U0TA 3KLPX 2BP7B 3GEMA 2HIMA 3TLGB 4A03A 1J00A 4YAIA 1PL7A 2AJ8A 1NLUA 3OA2A 4II7A 4UVHA 3A6PC 1AMUA 1V16A 1YA4A 2XR1A 4JJZA 5EJEA 5LQRA 3CURA 5H80A 3T5BA 4ENPA 4AJHA 3PJGA 1E6LA 1SVSA 4YWJA 4AJNA 2EX0A 3EZ7A 1WKCA 1ZDMA 1YIOA 2BHRA 3B6JA 3OSZA 4ZA2A 1HR0B 4QBIA 3UMBA 4DV1B 1L5QA 1X7WB 4GHWA 4Y2TA 2QL9A 3O0DA 2FF5A 5KB3A 2XGJA 4CBVA 4G5SA 4EFMA 3Q9NA 4UREA 2YR0A 3DTYA 2R6FA 4G1MB 1RD4A 1Y3HA 1L5YA 1O97C 1U0FA 2B99A 2IXGA 3JY6A 5AHOA 4RV5A 2ZSEA 4CF3A 3UXYA 4CI9A 4CTJA 2NPOA 4UQLA 1XYYA 2Y0CA 3MYYA 3OUTA 2B4YA 4HY3A 3UT0A 5IJ0A 1HT3A 3DW1X 4R7ZA 4ZK2A 4IS2A 2GCPA 2VCYA 1ZM7A 5GADl 3KXPA 4LY3A 4WOBA 4IDGA 3X44A 3AB8A 3OUZA 1IEWA 3KVOA 4FFMA 2Z57A 2PUBA 1RP1A 4U2KA 1QIMA 3IV9A 3VBEA 2QYHA 1NN3A 1QFZA 1U80A 1RM3A 2B3DA 2BGNA 4BMCA 5IKPA 5TLSA 3EISA 3KVRA 4BIIA 3WTCA 1K6EA 4JJ7A 3L7YA 2X9NA 1K7SN 3HY6A 4RQTA 2CE7A 3CLTD 3ILSA 1W49A 3FFWA 1NY6A 1HEUA 1VJTA 2P4HX 3BD9A 4FKZA 4H1TA 4P22A 1U0EA 4MO9A 2R7NA 1T6BY 3FYHA 2QG9A 1TEXA 3IUYA 4Q4AB 1CUCA 2ORWA 2J5RA 2ZE6A 4UZEA 4ZOLA 2DR0A 3W6UA 2IYEA 3RYIB 1ZN8A 1EFPB 1QQ6A 2BOVA 3FLEA 3K5PA 4NI5A 2Z5GA 5I48A 2IIBA 2NVBA 1V7QA 4IHQA 2ZB2A 1LSSA 2VN8A 2J6IA 3JWPA 3NTXA 3EOAI 4IUYA 1BO6A 3FR8A 4LE2A 1F6WA 3WNBA 2D1YA 2DU8A 3M33A 1NULA 2W98A 2OR3A 3N53A 4ISCA 1T8PA 4M36A 1Z6TA 1OF1A 2C4UA 1Y9AA 3VDNB 1MT0A 2E6UX 2QM0A 1XD9A 4OAQA 2AX4A 1OT5A 2PSSA 4RABA 1ADYA 4R31A 3HDVA 2PX0A 1LQ2A 4QAQA 1E63A 5BV8A 1QG4A 1ISRA 4WXHA 5E8JA 4Q48A 1BRMA 4W4TA 4WXPA 5FPYA 4LKRA 2VQFB 2VP3A 3H8SA 1D7AA 1QNFA 2OZVA 3Q7SA 2GNPA 4QDZA 4BNIA 4YJGB 2LKDA 4XX0B 4BX9A 4MP6A 4L72A 4NE2A 2ISQA 2XNKA 3IFSA 3ED1A 3PKZA 4TMWA 2A1UA 4WKOA 2BSAA 3BXOA 3O9MA 5JZVA 4XYEA 3M9WA 3SM9A 1NVWQ 1SG9A 1TT5A 1XZQA 2FAXA 2C7OA 1ZX1A 2XITA 1TUIA 2QS9A 4C04A 4KXFB 3OH8A 2EW1A 2FPOA 2GT1A 4ROSA 5EP3A 3BYZA 3HDQA 2RAPA 3KUKA 1H4VB 1PJRA 3NHLA 5AVWA 2Y77A 4XWAA 5CLFA 2HA7A 2H1IA 1CY1A 1VG9B 3ETEA 3KWJA 3L84A 4UASA 5CBPB 4JBXA 1N0IA 1PZFA 4IVQA 4RHCA 1USVA 5AICA 4AS2A 4XCXA 5CEFA 2H1OA 5H3CA 3K6SA 3HR4A 3PGKA 1S2IA 3S5JA 1Z0DA 2DLNA 5K0LA 1JDZA 5AYVA 1FP6A 1GSHA 3HJGA 4IF6A 3WWYA 3AETA 4ZAXA 4FCTA 4C21A 4MGZR 3A05A 3JR3A 1ADBA 3EVAA 2QM3A 2R6CA 3E8XA 3KKQA 1GILA 3GFSA 4A16A 2ZUTA 4AAYA 3SOZA 1DO2A 3QTTA 4CI0B 3ZQUA 4TVSA 3CXUA 4RPKA 1E2DA 2H4FA 1U3CA 4XLZA 4A0FA 4JI5B 3NG1A 4CFSA 5IJZA 3GJ8A 3P0HA 4RZUA 3WOVA 4MV6A 4RKFA 2HM7A 3E9RA 2QZJA 3TOXA 3V8NA 4TKLA 3QWFA 2ZBDA 2CFCA 2HF7A 3D6NB 1A88A 2NT4A 4OA5A 2EXXA 4NOLA 1C7JA 2FRVA 3H8VA 4HDNB 4N7JA 2GJ4A 1Z2AA 4H3KB 4ZT5A 1X86B 1P6XA 3EHEA 1R1DA 1XA0A 4BO0A 5JR3A 2XE7A 2ID4A 1LGYA 4GFDA 2L42A 1NDHA 2HCJB 4G8JA 4CU5A 4WACA 1RBYA 1BD4A 3GCXA 4EA7A 3CE6A 4X3OA 1BDMA 2ERCA 3GFQA 3UATA 4JKYA 1AS2A 5CNMA 1JJFA 2GAJA 2C3YA 1JJVA 1HSOA 2OO7A 2P0EA 3FPSA 2JGDB 3KKMA 5DHRA 3EXEA 3V4LA 1T5DX 1JT2A 3R7WA 2XGSA 3DDUA 4MW7A 3T34A 3QEAZ 1D1TA 1QHHB 1NXTA 3HLTA 3TMAA 4JR2A 1MU0A 1L5SA 5E4FA 1WOYA 1W5TA 3W1WA 1H2EA 1KK3A 2VJMA 4GT1A 5DLYA 1UMDA 2UXDB 2EWWA 1SBHA 4LF8B 3MGKA 1ZIXA 3N8DA 4U7PB 1P7WA 1XE3A 1QHXA 2D7JA 4D0NA 3EPKA 1X7YB 2ZAMA 4L0DA 3TQSA 1HO3A 4BLUA 4J0QA 1R8XA 2D06A 3GDHA 3QG1A 2MINA 1P75A 4TWZA 1DQPA 4G85A 1Q74A 3WVNA 4FIZA 4J03A 1RMYA 4A0GA 2CC2A 1SXGA 1T9DA 2ZUVA 3CWQA 3LSTA 3JAKB 3R5SA 4ZAVA 1Z74A 4PYRA 1C1HA 5FOWA 4GR9A 3WDLA 2AG1A 4V1CA 4K9NA 4M54A 3FZGA 4B3CA 4O4IA 4PZEA 5BW8A 1YCDA 1Q91A 4V03A 2XB2A 4YUYA 1NVKA 1O2DA 1O94A 1QV7A 2VTEA 4GX2A 4Q03A 3I9LA 4PO8A 1U1FA 2WK1A 2Z83A 3GH1A 2QAGC 4JQYA 1RHUA 2LE0A 3H2GA 2G76A 3OCVA 3SHQA 4F11A 1TK2A 4QUJA 5LKAA 3SFZA 2BWJA 3KE8A 1J5PA 1W5AA 4H15A 3T7JA 5K4GA 4IY1A 2GETA 2V4UA 4MB6A 5GM2A 3PQ6A 3WYFA 3SJUA 5A0TA 1JVNA 3ZJTA 1Q7TA 3ITEA 3I42A 5A3SA 2CLMB 1OLXB 1OYOA 3QPWA 5EQFA 1DV1A 4OJMX 1UBFA 5D1NA 5HUQA 3IT0A 2QD5A 2HMAA 4MCJA 4BZPA 4FK8A 3EH1A 4OHMA 4PLYA 2KX7A 3KPYA 4BO1A 4BV8A 4IHJB 4O2BB 2YV5A 1YBMA 1WEKA 2VKTA 4TRMA 4Y1EA 3RB8A 2ZRIA 4NVRA 2R87A 3QEMA 3THWB 2RGNC 4UD6A 2P3QA 5DRTA 1Y8RA 2GPJA 1V45E 4QBFA 4YAJA 1Z15A 5TQ0A 2BFFB 1P31A 3N2LA 3IV7A 3IUPA 1WUYA 1X87A 1OI7A 4JNKA 5E95A 4J43A 1PLKA 4X6LA 1GKKA 2C1ZA 2ET6A 4QZVA 5JTUA 3VYRB 1KKUA 2A4MA 1I0IA 2AMYA 1RBZA 2PKCA 3KWFA 4GPIB 3WK9A 5KYWB 2OSVA 2NO7A 4Y2QA 5EZYA 4MPDA 3HABA 2H07A 3QU5A 1BVRA 4EIWA 1HGXA 1DFGA 2HHCA 4RSMA 2BFMA 1EFRD 3KBOA 5JT1A 1UXGA 1P0IA 5EZ5A 3GT0A 3WGVA 4S1PA 2RH9B 3GNLA 3LDUA 5HK8A 4BVEA 3QW4B 4JFRA 5DHTA 1J4AA 3DL7A 2O2CA 1IN4A 3EIUA 3IIEA 3ANNA 1JG2A 1F0YA 3QOWA 3FB4A 2I4OA 4RE5A 4V2IA 1AMNA 4BKQA 3ZWDA 5IAEA 3RIXA 4R1NA 2XZDA 1ISFA 5AIBA 3ZW8A 1JPVA 3NAGA 1Z2PX 1FFSA 4H59A 1EA7A 1KGDA 5I7WA 1E3MA 1XV5A 5HR5A 1SG6A 3WG9A 1VKNA 4QREA 3PICA 4Z54A 5H8WA 1U99A 3GDOA 1HT0A 3RS0A 2W8BB 4JBHA 4WASA 3ZZUA 1V16B 1Y7TA 2AJTA 2HJ9A 4FYMA 3KQSA 1DPGA 1PZXA 5ERYA 4WY5A 4ZVRA 4Y7DA 4ITRC 1T8UA 5JHGB 1D3AA 3QHAA 4RIFA 3TD2A 1LZKA 2OQRA 3WAKA 2DEUA 1EJ0A 1I4WA 1M5TA 1BW9A 2H1WA 2PBZA 3EEIA 3EXHC 4NBKA 5DBGA 4RJ2A 5A9TA 2GHRA 1V41E 1WPRA 3T1YB 1JAHA 1M2HA 1UWKA 2JHPA 2NOAA 2XYGA 3A2NA 1HOTA 1IPFA 4UUMA 4FGUA 2QTMA 3N7UA 4EKEA 3KB6A 1GZHB 4CKBA 1G20A 2BGUA 2QN2A 3KR9A 1F4VA 4F4IA 3LDAA 4RE6A 1EGMB 4PQYA 1KMHA 3LLCA 5C1OA 2BJVA 1O0SA 1P17A 3KSRA 3PHIA 2O07A 2HUPA 2Z2XA 2WI8A 3IELA 4XQEA 3Q9LA 5F7XA 3WV4A 5IJ0B 4I81A 1R10A 2GJKA 2X9GA 3IVCA 2O5CA 2QRUA 3NT2A 4X97A 5C5CA 3ZDZB 3CBQA 4YCAA 2NV0A 3FTCA 4ZU3A 3H5WA 3LLSA 5EC8A 2NP7A 2PHZA 5ALKA 2FX2A 2R48A 2UAGA 2CDCA 3WIUA 1MUUA 3A36A 1B23P 2RJNA 4L4RA 4NLLA 4WLUA 3E82A 1FX0A 5TT1A 1FJXA 3EVNA 5IEJA 3L0IB 3VDQA 2RD2A 3I62A 3T7DA 1K6XA 3UB3A 5L4LA 3FNIA 2A5LA 4K2HA 2ZXUA 4M1OA 4ZOLB 2QM7A 4MUEA 1SQ6A 3QGMA 3C74A 3HYRA 3ANMA 3JQQA 5CYGA 4MVJP 3F98A 3I9JA 5IJXA 3HZHA 4A5SA 2QN9A 3EIQA 4QASA 3HFSA 2FB9A 3M6FA 3QQ5A 2H7CA 1X8JA 2CD9A 5KDOA 2V4MA 1NJ2A 2Q4RA 2G4LA 2RIRA 4H7DA 5ESXA 3UICA 4E51A 2A1IA 3KPVA 3F7OA 2ZYVX 2O3JA 1Q6ZA 3O4RA 2W4MA 3JW8A 5CX4A 1XCBA 3AR4A 3Q41A 5MN5A 2FN9A 2JJ2D 2J0UA 2IYLD 2JFZA 4CIXA 4EVQA 2F8LA 2R79A 3ICCA 2RAVA 3MA0A 1ISHA 2AEEA 4RGBA 4KOEC 3SS9X 5HBGA 5BMOA 3JU3A 4I36A 1SVIA 3IB6A 4KL8S 4WH0A 3W3AA 1TT5B 1MXFA 1VKZA 3QU4A 4YS6A 3ZK7A 3A3YA 2ZI9A 1KRXA 1U7TA 1W4AA 1S9HA 4F2HA 3B6ZA 1R00A 4KIJA 1FVOA 2FOLA 3B6IA 3I6IA 1K2VN 3WICA 7ABPA 3QX7A 4DARA 4OYHA 1AK2A 1ZWKA 3N9IA 5H59A 3EFEA 1YQXA 3TLKA 3VDRA 4A0SA 4B80A 4D0RA 1T2UA 2RE8A 3AUFA 1D0VA 3NRBA 4RCVA 4UUAA 3NEYA 1KY3A 5JTTA 1WQ3A 5CITA 1DCMA 1G8FA 4PGGA 2EZTA 5GJBA 2LIVA 5LJIA 1DJQA 3SS8A 2X1MA 1Y33E 5A1JA 3T3PB 2CJWA 1PTJC 2QM8A 3PQ5A 5TJHA 3V46A 3EEOA 1N2CE 2YUTA 1MVOA 2FSFA 4KYTA 4D4MA 3WXBA 3JQFC 1N6HA 1BDJA 1P9WA 1ISIA 3P19A 1QM5A 2ROQA 2Z8YA 4KK3A 5L40A 1MMFB 1DS6A 1W1WA 3AETB 3QYPA 4S0ZA 3E9CA 3GAFA 3OX2A 3W4IA 1MO6A 4KWTA 2DQZA 3CNBA 4NBWA 1KARA 1Z62A 2L0XA 1E9EA 4V0SA 3I3OA 5EYPA 5KNBA 3CX6A 3MWFA 4J7UA 1LFDB 5K4AA 221PA 1VG0B 5ARDA 1LQTA 1DBVO 1ZK3A 2DP4E 1C4XA 2GF0A 4GG1A 2IWHA 4KQ1A 4ZCMA 4PXSA 4CTOA 1MGPA 3A1FA 3OCYA 3W3ZB 4DPMA 4C6RA 5BWNA 1TQ2A 1Z29A 1AHNA 1VKOA 2H0RA 2WP8J 1AUVA 1Q2XA 3A6FA 2G88A 2IOQA 1S2MA 4M88A 5EPEA 4R9SA 2DB3A 1L9KA 1F5SA 1JSRA 1T3LA 4H35A 2FLVA 4R3UC 2GYWA 4H0FA 5THQA 1BKSB 2EP5A 2FOIA 2X15A 3PRYA 4UHJA 2QAGA 1HQCA 4C78A 4LBVA 4CJXA 2R7LA 1S3FA 4TTAA 5CX1A 3HKBA 3JYHA 4RDXA 1B3BA 1LSUA 1T1EA 2ZRFA 4NFSA 3RYCA 2CVPA 3BVPA 3OFKA 3ND8A 5I9SA 4IDOA 2R1VB 4M0MA 2HO4A 3KHSA 1W0JA 3VSDA 1A5SB 5JOQA 5K5EA 1Z2OX 5KNDD 3BG5A 5KVSA 2QA5A 3I2YX 1HDEA 2IH4A 4XQCA 3R7WB 1AX9A 1MENA 4E14A 2Y8EA 1CS0A 4NV0A 2VJMB 2YDXA 2KBEA 1UMDB 2IH2A 3FUVA 4D5GA 2YZ2A 2RGNA 4HDSB 3LP5A 2I33A 3AL2A 1EVIA 1H1TA 4OQMA 2RGGA 5TGZA 5BWBA 3AKZA 4WEQA 2AOVA 2DXIA 1CUEA 5CIWA 3IR6A 4TV9A 4QDKA 3AY0A 3L9WA 4BC1A 1KA9H 4Z49A 2BFOA 5HRUA 1NVMB 2MINB 2PS9A 3CPJB 5B30A 1NRIA 1SEPA 1GGKA 3E27A 6PFKA 1JFLA 2GHTA 5DX0A 4BVAA 2ACWA 4JV5B 2CYCA 1H2YA 1AKEA 5DULA 4BN4A 1T0PA 2H8KA 2WMNB 3PTLA 5BT9A 1VSBA 4HOYA 4UBLA 4BVLA 1XKQA 4K9RA 2AQ8A 2ZP1A 1ZIYA 1HFEL 2QTBA 1JA9A 3NDPA 3EGWA 4RIEA 4FZVA 1CW2B 4GE3A 4U9IS 3P5SA 4P4GA 421PA 1WUHS 1JQLB 4KXLA 3HB9A 5JD3A 3VPBA 2IEAA 1ESDA 1ES9A 1IIBA 4HNGA 4A7PA 1P77A 1QZUA 3DOOA 1JSXA 1NF3A 3DMHA 4HZIA 1J25A 4GUDA 4J4HA 3FTNA 4ZDKA 4OLAA 2ZSKA 3W05A 4R84A 2NPIA 3H1EA 1J2UA 2P0YA 3IJPA 1HDCA 2ZWAA 4C0QC 1Y1PA 3OEHD 5FUVA 4IQ8A 1A5ZA 2AQHA 2B7BA 2NTJA 2WJGA 3FMIA 4HVLA 1PJAA 2WNSA 3GU3A 3ER8A 4ZK6A 3QEMB 1RZVA 3IAS1 3EXHA 1Y8RB 5TQ0B 2PU7A 2DCMA 3MJCA 1VCHA 2RAFA 4WKBA 2C0PA 2UYCA 3LLUA 2V7QA 4CHGA 1I5EA 2WVJA 4NPHA 1T9HA 2EFJA 1UBNA 2W2XA 3PNYA 2W2OA 1I36A 3S2UA 4RZSA 3TQFA 1ZKMA 3MUOA 4G37A 2H51A 1CUAA 1UPBA 2W2MA 4LYGA 4PPFA 2DUWA 1RR6A 2FPLA 2OQIA 2ZGVA 3CB4A 4L8LA 2N75A 5EZYB 1SWVA 1UMKA 1G38A 2R5NA 2ZYRA 3HGTA 2RCYA 2P27A 3O1JC 5BSTA 5AVTA 5JQGF 4L8FA 4NZYA 3AX6A 1EUCA 1ZZGA 1XWFA 2XT0A 1FCJA 4FI3F 4GGPA 4LOIA 4TRNA 5F5XA 2IQIA 4RELA 2NU9A 3FUWA 3U1TA 1BXRA 3OE5A 4ANFA 4KQCA 1E6WA 4NX2A 3HJFA 1XWIA 4QLBA 2WJHA 2LCIA 2PIAA 3Q7PA 4KQFA 4HH3C 1KE1A 4RJTA 4FLFA 1PR5A 1R9JA 2FDXA 3DDCA 2W6MA 1BKYA 4NZOA 4B17A 5E6RA 4GLJA 1S5PA 1G21E 1UKZA 1D1QA 1I1HA 3BXXA 1S2NA 4MKIA 4PO9A 5FOUA 3SI7A 3TAXA 2GBLC 4M9ZA 3VVBA 5G4LA 2QUZA 4IUBS 4KFUA 3TVDA 3UPTA 2PQ2A 3N5KA 1FUEA 2OTCA 4UBJA 2GASA 2Z9BA 5GP1A 1FNBA 4GI3A 3GLHE 3SZOA 4IZIA 2DFPA 3AI2A 3R6TA 2YWGA 2FW8A 3UN1A 2Z2IA 4G9EA 4RD3A 3DEZA 3D7NA 5B2FA 1XRLA 3UAOA 4DDMA 4TUYA 1GUYA 1GCAA 1BW9B 1M5UA 3E6AA 3GEIA 4AZSA 4RH3A 2BUBA 4UHDA 2P9JA 5D3MB 4EP1A 3B3AA 4C1BA 1M1YA 5LQDA 1P4RA 3G7NA 4PNZA 2P11A 3MCAA 3VI3B 2YS7A 4EW6A 4L50A 4MR9A 2YXDA 1JEOA 3OTQA 1WF6A 1G20B 3TIGA 4CKBB 5FBVB 2PUCA 4WHMA 1OFUX 3EN0A 2GJAA 1UFVA 1KMHB 2M2IA 2C7VA 1QIIA 4FYKA 3VFDA 1ZRSA 4R9UC 1N3YA 1T43A 4QU0A 5JXGA 3PG5A 1Y4AE 4EG1A 1IUKA 1SHTX 4KWEA 3ICWA 1J2YA 1ZXXA 1ZGZA 1E89A 3DEKA 4KMSA 3TBKA 2RSLA 3U9SA 1Q20A 2WHYA 1KIMA 3FGOA 2V7XA 3K7EA 3MLAA 3B3FA 3H99A 2GN8A 2PD3A 3ADPA 5CDFA 1RXYA 2GOYA 2R62A 4YHBA 1P44A 1AGRA 1VE9A 2X2OA 3F5SA 1YXMA 4LQCA 5J40A 4GM1A 4KU4A 1BYIA 2GPYA 2ZTMA 1EK5A 1KU6A 3MJTA 4B7CA 1D4OA 3Q3HA 4H1VA 2XE6A 1SQ5A 3GP5A 4OM8A 1FX0B 2P9ZA 2IUSA 4ZCQA 4ZREA 3H6GA 4EBFA 2NZVG 3PJFA 1F6BA 4OBXA 1RWBA 2QTVA 2Q99A 5U4XA 4M0EA 4OHPA 3U3XA 2O7RA 1NATA 5WRFA 1PTJA 1ZKDA 4I4CA 3BFXA 3L43A 5GJVC 1JFVA 2IZ1A 3L6RA 5JUWA 2PCLA 3NONA 3IUQA 4P84A 5EE1A 1OI2A 1PWHA 2HMSA 2QRMA 2ZRQA 3FLAA 1WXDA 3JQFA 4IYJA 1SZJG 3DFMA 3FSGA 1GYRA 3QJGA 4O08A 4OY3A 5IXSA 4LYAA 1R4AA 5ICSA 4CIBA 2C84A 3NH6A 4X00A 4B0PA 1X6VA 2JCVA 2P65A 4G0OA 5BT8A 1SC1A 4EI7A 4MKZA 1IJBA 3I58A 4RCYA 1G5FA 1Q3TA 4PSUA 1TKBA 2GD1O 3BIJA 4NBRA 1E3LA 2VXBA 5E6SA 2YWBA 1AN9A 2GZAA 3MPUA 1OIXA 5BN4B 2VOJA 4E15A 2RB4A 1XYVA 2J0UB 1XDBA 2VHEA 2ZYDA 1IK6A 5K0JA 4FGJA 4JXZA 1VHQA 2VLBA 3EBLA 2OXFA 5KQPA 2G63A 2R2GA 4UEKA 4KRGA 4PS1A 3NVDA 5DNVA 2HDHA 3AEUA 1SG0A 2Y76A 2XDQA 3RTDA 1VJ0A 4E5PA 3M81A 4KGDA 1FU8A 1PZMA 1RNLA 1Z8HA 4GPEA 4UOZA 1A7JA 5IF3A 4DRZA 3K4PA 4KXUA 3GI1A 4XKJA 3RUDA 2YBEA 4M38A 4MVYA 2FH5B 2AKYA 2PZMA 4QBKA 4J1NA 4QOGA 3LOUA 3RSQA 1X1TA 3SZRA 1AXRA 3VHXA 4DJFC 3PBKA 3VSEA 1Y4ZA 3O95A 4HCJA 5IDWA 1H42A 4BLSA 3MWYW 1A8SA 1BMQA 2CNDA 3GZ4A 4HAUA 3I5UA 4J0CA 4YQEA 4W1SA 5E6UA 2OPHA 4DSOA 1PW7A 4ZGGA 3P2KA 4ESEA 1ZM3A 1X9GA 2PXCA 2CJWB 1CLEA 4P82A 3ZGNA 5AUQA 3UTDA 3O8DA 2QU8A 4IV8A 2QE7D 3HJAA 1BHSA 1WTAA 1NQTA 3G0OA 3KRTA 2Q1WA 3OQVA 2GXUA 1SQFA 4MQ4A 3X2FA 1DC5A 4E2XA 5CD1A 4DBLE 1FPMA 1RYZA 2JI9A 4BVBA 3HSYA 2X8AA 2HBRA 2AJDA 2PY6A 3M5DA 4JDPA 4LRYA 4KQXA 3PCRB 5L51A 3CNHA 1OFIA 1XLWA 3BEOA 4NOJA 4RSRA 3R9KA 3D6AA 2BSQA 1YMUA 2HKIA 2ESRA 2J85A 1WIWA 1XA4A 4M3NA 1Q1QA 2G0NA 1RIFA 1EEHA 3ZU3A 1Z2NX 4UD2A 4ER7A 2XVMA 3B85A 4MO2A 5C5IA 3LUCA 2RHHA 4KQJA 1UZAA 3G5TA 1JDTA 2O7SA 2ZYTX 3NXKA 3P9KA 2WD9A 4Q01A 5C35A 4FSXA 4WNIA 1BJTA 1G1AA 1M7GA 2QAGB 3OZIA 4FIDA 1HLDA 2M6KA 3DZIA 3LX5A 3VSBA 5B6JA 3DT9A 4W5NA 2IIVA 2W0MA 1UK9A 1GLGA 3S1AA 3UMRA 3HKBB 3BB1A 4P7JA 3WGQA 1I0LA 2QVCA 3RYCB 1XQYA 3LXXA 1I24A 4EEKA 1RABA 2G9QA 3MTQA 3NM5A 3UJAA 1B14A 2BYTA 2PZFA 1GPYA 1G8SA 3LVFO 4GPAA 1L5KA 2C8VA 1ZPDA 2JK1A 3STXA 4E2FA 4Z51A 1HG1A 4EGJA 3GDFA 2NUAA 3ANXA 1APBA 2NP6A 1R74A 3NUQA 1JU9A 2LWIA 3P2IA 1E5LA 1GPAA 2NO9A 3VNBA 4EA9A 1KFBB 1MG5A 1TUEA 1TKAA 4IKEA 1CS0B 4QPNA 3UHJA 4M49A 1GVHA 4MRNA 2XYVA 1XTQA 3NEPX 4G1EB 2YCLA 4WLVA 5JEEA 1GO2A 1OROA 3IUEA 4MUXA 4C0XA 2UVDA 4FJ0A 2FWAA 3CH6A 3GBPA 1OLOA 4X61A 1JKJA 3DOUA 3WIOA 3DHYA 4KQ9A 3CZPA 2WB4A 2IGBA 3TFQA 1Z4PX 3GEDA 4JJKA 2R8PA 3BWCA 4N18A 4AECA 3GEHA 1URPA 2HPZA 4TZ6A 5INTA 1CPYA 1CJUC 1ADJA 1YR7A 1QG0A 1DJMA 1E3JA 3LDFA 3QXHA 3I30X 4QYTA 4ZC1A 4WCDA 1ZSYA 2C82A 1IBCA 3ZY5A 1GQSA 4FFSA 4JEHA 1EVJA 5I9IA 1UBSB 1IHYA 2N9UA 4TKZA 1G0NA 1U9YA 1BCRA 1R37A 3HVUA 2ZRCA 5FTKA 4ZZ1A 1U9IC 1HURA 4MGIR 5DVZA 5AKJA 1Z7YA 2VNKA 1ICEA 1QGUA 4PHHA 4JUBA 5KQSA 3L8HA 3VZCA 5AUNB 4RL4A 4A91A 4LDAA 3DXFA 2DX7A 2QLMA 2ZZKA 5LIPA 5G53C 4I19A 1XAJA 4YAFA 1QAMA 5KREA 3W8EA 4OI2A 1FFGA 1OX4A 2GBLA 3W06A 4O29A 2WHQA 5HGJA 4EY3A 4XIJA 4DJ5X 5BW5A 1V2HE 3LUHA 4BMXA 2XDWA 3F3KA 1DQRA 2A5GA 2JLWA