3FPFA

Crystal structure of mtnas in complex with mta and tna
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
SCYIYWDKIKRIASRLEGMNYHFDEMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLEMEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITGFRRAGVVLPSGKVNNTSVLVFKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystallographic snapshots of iterative substrate translocations during nicotianamine synthesis in Archaea
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Biosynthetic protein, transferase
total genus 96
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03059 NAS Nicotianamine synthase protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fpfA00
2ZW9A 3UA3A 3CC8A 3LCUA 4IWNA 2ZWAA 4FP9A 2ZBPA 3B3JA 2YR0A 4OA8A 4KVZA 2QE6A 5K0NA 1QYRA 4EKIA 3FUVA 4GOND 4GOMD 3GRRA 4R8RA 5B1SA 1G8SA 3KR0A 5C0OE 2FRXA 2GPYA 5LQJA 3TMAA 5LQNA 5HZMA 1D2CA 1L3CA 1L9KA 2B3TA 2G72A 1AV6A 2C7QA 1D2GA 1RJEA 3EGEA 3EGIA 2QM3A 3FTDA 4RTMA 4ER5A 4EK9A 4BP1A 3RW9A 3I64A 4AZTA 4B17A 3PLAE 4RWZA 3K0BA 3PX2A 1P1CA 5E9WA 3BWMA 1RI4A 4RV9A 3E05A 3NDIA 4BLWA 2NP7A 1M6YA 3FTFA 4AX8A 3MERA 3M6WA 3HCEA 3MAGA 2FPOA 4M7RA 1JSXA 5DT2A 1N7JA 1ORIA 1F3LA 2PV0A 3RIEA 1F38A 3DP7A 3KQWA 3O7WA 2QRVA 3A4TA 4C03A 3LKZA 1YF3A 3E7PA 2EG5A 1UIRA 3AXSA 1QAOA 3AJDA 3BUSA 1KPIA 3DMGA 3EMDA 3G7UA 3IEIA 4HGYA 5K05A 3DXYA 3CKKA 5DM4A 8MHTA 1XTPA 4L7VA 2JHAA 3I9FA 3BKXA 4HTFB 4PGHA 2GLUA 3LDFA 3SXJA 4BP3A 3ER8A 2VDVE 2ZFUA 3NTVA 4M37A 1XCJA 3BGVA 3T7TA 2PXCA 4MTLA 4PYNA 3PS9A 3VC1A 4UOEA 1M6EX 3P9IA 1HNNA 3G2PA 1PJZA 1FP1D 5HILA 3THSA 1JQDA 3D2LA 3GRYA 3A7DA 3PB3A 4V0QA 2UYHA 3VC2A 3TQSA 4C07A 5M5BA 4ER3A 2CMGA 5MHTA 3HTXA 3BZBA 4C08A 5E1BA 1NW8A 1Q0TA 3HA5A 5KQSA 2ZIGA 4PYOA 2YTZA 5F2OA 3U81A 4PWYA 4Z2YA 5T67A 5JUWA 3DTNA 3GRVA 3NVKI 2H1RA 5IH3A 4YUVA 4DQ0A 3KQTA 1I4WA 3NVMB 3M6XA 4DCGA 1X1AA 5E1DA 4DZRA 1L3IA 4IV0A 1WY7A 3OZSA 3SX0A 2PWYA 1KIAA 1WG8A 4E2ZA 5LQUA 3GCZA 2E5WA 3P2KA 5KYGA 4H0NA 2O0LA 5LQKA 3GWZA 5K0BA 3REOA 1JR4A 2OB2A 3DULA 4U7TB 4RVDA 1R74A 2YXLA 3EGVA 3EVAA 2IH4A 1EQAA 1MJFA 1VP9A 4HH4A 2NP6A 5CUQA 5H02A 3T0IA 1VLMA 2A14A 1QAQA 4A6DA 3KHKA 3PX3A 2IP2A 4LG1A 3HP7A 3FUUA 4XUCA 5E2AA 1AQJA 4OQDA 3HVJA 3E8SA 3BWYA 3LKDA 2GAFA 1B42A 5FQNA 4DM3A 5DPMA 2PX4A 4QPNA 3FYCA 2CMHA 2G8NA 2V74B 1H1DA 1VE3A 1NT2A 3MB5A 1ZG3A 2JHCA 1U2ZA 3FPJA 4HRAA 4DF3A 3EVDA 3P2IA 4GBED 5T64A 3L8DA 4C4AA 5CVJA 5EGSA 2C7OA 1ORHA 3QOXA 3UJBA 3SSMA 3K6RA 5C1IA 4M38A 4R6WA 1BOOA 3G2MA 4XUEA 1XXLA 3IV6A 4IKPA 4OBXA 3AY0A 3UFBA 3HA7A 4CTKA 4E70A 2C7RA 4QDKA 3BXOA 3DUWA 2GS9A 2AVNA 4LWOA 4X1OA 5CM2Z 5LQCA 3OU6A 1G55A 1G8AA 1SG9A 3KQVA 3P9KA 4K6MA 1JTEA 5EKUA 3MQ2A 4RTOA 3B3FA 2OYRA 3IHTA 2O07A 1SKMA 7MHTA 1BKYA 4F84A 2IGTA 1EIZA 2NXJA 3HCCA 2PGXA 3AXTA 3CCFA 1EG2A 5HIJA 4C06A 2QRVB 2VZ9A 5CCXA 1G38A 4MHTA 2XYVA 5EHGA 5EIFA 1EJ6A 2NYUA 2OZVA 1BC5A 4IV8A 4JXJA 4RYLA 4FR0A 1G6Q1 2FHPA 3MCZA 3FRHA 3FUTA 3ELUA 5DTQA 2P7IA 3C6MA 2ONZA 2NXNA 4EQZA 2BR3A 4KDRA 1HMYA 3KQQA 2R6ZA 1FPQA 3CVOA 3ER9A 2JH9A 3ELDA 5EMLA 3SGLA 3RODA 1JTFA 3HCBA 3X0DA 3EPPA 2JH8A 4QQKA 5DM1A 2ZBRA 1X1BA 4YUZA 3FUXA 4RTPA 2XYRA 1VPTA 4F86A 2ZCJA 2ZIEA 2HR1A 2ESRA 3LCCA 3R3HA 4V0RA 2BR5A 2EFJA 2PJDA 4A6EA 5ICCA 3G2QA 3KR1A 3Q87B 5GWXA 2VDWA 3DMHA 4OBWA 4YUXA 4GC9A 1JG4A 4ISCA 1JG2A 2AN5A 5IKMA 3A27A 3B5IA 3LCVB 4QQNA 1KPHA 3HCFA 3THRA 1KHHA 1ZQ9A 2Z6QA 1KYWA 1QANA 3CBGA 3DLCA 3OE4A 3ORHA 3LHDA 5BXYA 1NBHA 2Z6AA 2I62A 2ZTHA 3B3GA 1NW7A 3P2EA 3GRUA 5DRTA 2ZWVA 3UWPA 3ERCA 1M0EA 3JWJA 1RI2A 4PINA 5K0EA 4XCXA 2P35A 2XYQA 3KQYA 2PT9A 2P7HA 3EVGA 3LGAA 3DH0A 3P97A 3MGGA 3A25A 4ZTBA 3B7PA 4AZVA 3V97A 1EAMA 1Q0SA 4CKCA 2B25A 3P9NA 2IH2A 3CGGA 4MWZA 2IH5A 1OR8A 3M4XA 2PXXA 3HA3A 3T7SA 1FJXA 2PBFA 3TKAA 1QZZA 1SUIA 4AUKA 1UFKA 2AOUA 4KDCA 5E8RA 4E31A 2GB4A 3NWBA 2G70A 3KQSA 5LR6A 2C7PA 5EOVA 5BW5A 4PCLA 3ELYA 5K0LA 2EJUA 2AZTA 3CJQA 4E2WA 3R24A 5GIPE 4GUAA 2Q41A 4CWAA 3KKZA 3LSTA 4QTUB 5T6BA 3ANXA 5E9JA 5GINE 4RTNA 2GA9A 4OQEA 1NBIA 1O9HA 1IY9A 1YZ3A 1I9GA 2K4MA 3SSOA 4E2YA 3BT7A 1R18A 2AOXA 5HIKA 3QOWA 3ID6C 1YZHA 2V7EA 2AOTA 2PSSA 4YMHA 5GM2A 3KPYA 5K0CA 2EX4A 2PX5A 5HFJA 2AN3A 3KU1A 3CJRA 3OU7A 1R6AA 5DRYA 2WK1A 3GXOA 5KQRA 3HNRA 2OO3A 4GOOD 1X1DA 4KIGA 5DTMA 5FA8A 3SSNA 3HCAA 2UYQA 4GOLD 10MHA 1L1EA 2I9KA 4KW7A 4X41A 5EC8A 5CVUA 5FULA 4YV0A 5CCBA 5E9QA 5P8WA 2ZULA 4YV2A 2B78A 4E2XA 1T43A 5CIYA 1XVAA 2P3OA 3UJ6A 3BKWA 2ZZMA 3HCDA 4PYIA 3I5UA 2UYOA 4RTJA 2P3LA 2R3SA 5F2NA 1TW3A 4PYLA 1Z3CA 4KRGA 4CKBA 3OE5A 5FWDA 3PFGA 3O4FA 1UWVA 4P7FA 4E30A 2BM9A 2XVAA 2VS1A 5CVVA 1FBNA 2VP3A 3UZUA 4C05A 1QAMA 1YB2A 3TOSA 2B2CA 4PIPA 3KQOA 2YVLA 4QVKA 5LQRA 4PYMA 3DMFA 5FQOA 5D1HA 4FZVA 2JJQA 2XVMA 5GOZA 4CTJA 2OPBA 4P7GA 2I6GA 1N7IA 3DR5A 2CWWA 5F2KA 4EKGA 5EG5A 5FHQA 5EKXA 3OPNA 1PRYA 1XCLA 5DX8A 3F4KA 1KR5A 5ERGB 2DPMA 4ER0A 1SUSA 2BR4A 2JG3A 4MQ4A 1P39A 3BWBA 4PIMA 3V8VA 3KQPA 3KQMA 3DXZA 3GRZA 4P7JA 4DKJA 3GGDA 3LDGA 4FSDA 4E32A 1FP2A 2PWPA 4RVFA 3TKYA 4DCMA 2H11A 5LQAA 4GEKA 2FK8A 3G89A 5DXAA 5DTRA 4EMSA 1KPGA 4WXHA 3EVEA 3MCTA 3A26A 2PT6A 4HG2A 3WSTA 3MTEA 5EZQA 3M33A 4NECA 3R0QA 5G02A 3EVBA 4ATNA 3VYWA 5DLYA 2PY6A 3R6TA 1EJ0A 3FPHA 4X60A 3NWEA 1WZNA 1XDZA 2FCAA 2IBSA 1ZKDA 1AQIA 2AN4A 3FPGA 3ME5A 4MIKA 2HNKA 2AOUB 3PT9A 3P71T 1VL5A 2B9EA 3FRIA 3DLIA 1O9GA 3P9CA 4PYKA 5EEGA 1XDSA 3SM3A 2CKDA 3C0KA 1NV9A 1WXWA 3B89A 3BWCA 5DWQA 2UYCA 5K0FA 3EVZA 5CVEA 1RJGA 1YFLA 4PYJA 1P1BA 2PLWA 4PCAA 5HIIA 2FYTA 4QDJA 2NXEA 5HIMA 3SVZA 9MHTA 3UJCA 3FUWA 3I53A 1RJFA 3LDUA 4FT2A 2AOTB 1JG1A 3HVIA 1RI5A 4ER7A 2OBFA 5EMMA 1Y8CA 1N2XA 3NMUF 2OY0A 5ICFA 1WXXA 2UZ4A 3DOUA 5DXJA 2G71A 1NW6A 1JQEA 4R8SA 2GH1A 5KVAA 2IDKA 3GJYA 3G5LA 1NKVA 1SVUA 2YXEA 2ADMA 3NJRA 2ZZNA 3UJ7A 2IBTA 4Y2HA 1DCTA 1DL5A 1VIDA 2AOWA 1R8YA 3KPJA 3QV2A 2F8LA 2KW5A 3KPVA 4AZWA 3PVCA 1X1CA 5EMKA 2NXCA 1R00A 4GF5A 5HOQA 1SQGA 3G5TA 1VQ1A 2BH2A 4FSXA 3LL7A 4GC5A 5K03A 3TLJA 3OZTA 2AOVA 5DX1A 4AZSA 4RTLA 1BHJA 1KP9A 3HVHA 4HGZA 4G56A 4HC4A 4RSRA 3GO4A 3EMBA 2P8JA 4FS8A 4DA4A 5CD1A 3C6KA 1XDUA 3PFHA 5ICEA 5EHIA 4OA5A 2IDJA 4PGGA 3GU3A 3NW9A 5EPEA 3UJAA 2ZIFA 4RVGA 1YFJA 2IIPA 2ZLBA 1VP3A 2BZGA 3HEMA 2JHPA 5FCDA 2HTEA 4BLVA 3ELWA 5CVDA 1G60A 4P7KA 3C3PA 2HMYB 5E2BA 4BLUA 1JG3A 1NE2A 2YXDA 4RVHA 1X19A 4X61A 1R8XA 4KIFA 4YV1A 2XBMA 2DULA 3LX6A 5DX0A 3R9XB 3FPEA 3FTCA 5EZSA 1P91A 3PTAA 1MHTA 3FYDA 3C3YA 4P58A 2QYOA 3OFKA 3UA4A 4DMGA 4EVIA 3EVCA 3EEOA 3EEYA 3A7EA 5EEHA 1INLA 1NW3A 3G2OA 5FUBA 4RTRA 3EVFA 4FGZA 5ICGA 4U7PB 2PXAA 2IFTA 2ZVJA 1RI3A 3HM2A 4XUDA 4RTKA 1SQFA 2ZBQA 5FADA 4PYQA 3UBTA 1JSZA 5LSAA 2PVCA 1KXZA 1RJDA 4LWPA 1TW2A 5DM2A 3AWIA 4M36A 5E1MA 2EJTA 3KR2A 5GP1A 4RX1A 4BY9E 3M6UA 4CKEA 5FHRA 3SMQA 1TPYA 4F85A 5GM1A 1YUBA 3JWHA 5C9ZA 2PX2A 5BW4A 2CL5A 2BM8A 4QVGA 1AF7A 3CJTA 3G8AA 5EIWA 4E33A 3TM5A 3M70A 3O31A 2ONYA 2WA1A 2AVDA 3BGDA 1WS6A 5K01A 3BGIA 2QY6A 4RTQA 3T7RA 5FTWA 3OCJA 3TM4A 3VSEA 3OZRA 5EQJB 4C04A 4KWCA 3OFJA 4O29A 4R05A 3TRKA 3M6VA 3LBFA 4FT4A 1NW5A 2I7CA 2YX1A 3GDHA 3TFWA 3H2BA 3E23A 4R6XA 1JQ3A 4HTFA 2ORED 4PNEA 3GIWA 1ZHFA 4X63A 2HV9A 3LECA 5EMJA 2IPXA 5DSXA 2AS0A 2PX8A 5HEKA 3KPUA 2YQZA 5E1OA 2Y1XA 1VBFA 3NDJA 2OKCA 2PKWA 3FZGA 4QTTB 1RI1A 4RTSA 2WA2A 3DXXA 3JWGA 2O05A 4PONA 5D1NA 1V39A 3UJ9A 5K0JA 5GIOE 1IXKA 3LPMA 2Y1WA 5DSTA 3G88A 4ER6A 2O57A 3P8ZA 3KPWA 3UJ8A 2ZZKA 2NNWB 3LBYA 3OU2A 5E8JA 3MTIA 2G1PA 1I1NA 4QPPA 4GQBA 3SR4A 2VDUE 4WVLA 3GNLA 3I58A 2ZSUA 3IYLW 1KYZA 2ERCA 2H00A 5K09A 2N47A 4LECA 4YUYA 5U4XA 5K8VA 2Z6UA 2P40A 3FPFA 3TR6A 5FA5A 1O54A 3KR9A 5BP7A 2HWKA 2OB1A 2AR0A 2P41A 5JR3A 1ZGJA 2LD4A 1DUSA 3G8BA 3S68A 1XJ5A 1L3BA 1D2HA 3JWIA 5FWAA 4YMGA 4HSGA 4YUWA 4OX9Y 4Y30A 5K0GA 2O06A 2OXTA 3UJDA 4CXMA 1NV8A 3HVKA 5DM0A 3MHTA 2FK7A 3Q7EA 3FTEA 5EVJA 5KS2A 2YUIA 4POOA 2P3QA 3TPZA 2P1DA 1ZGAA 1IM8A
chains in the Genus database with same CATH superfamily
2V54A 1NHWA 1US8B 2M9MA 4EKIA 2AJCA 2CFOA 2O3TA 3U44A 2BGWA 4A15A 4QOHA 2SCUA 3I6IA 3NIFB 3STTA 4YRDA 4YAIA 5AXDA 4NV1A 2V1UA 2QW0X 1PSWA 4H27A 2PL9A 3GJ7A 4BNLA 1HG0A 2JGRA 2ZI9A 1JIQA 2IIQA 3SHQA 3V7YA 3RADC 1TVCA 1T36A 2X7HA 1GCAA 1OWOA 1L9KA 3B1WA 4Y6PA 2R1TA 3GPLA 2GYWA 4Q48A 4BUZA 1OVGA 2XUGA 1XRLA 1Z7YA 1GPYA 1RVDA 2DSTA 2QM3A 1L5FA 3O83A 2C1EA 2WF8A 1N9ZA 4J0HA 4LQ4A 4BUJA 3PC6A 4RQBA 2ZSAA 1RI4A 2A9OA 3G1TA 2FP3A 3WS7A 3SQOA 4PV7A 1M6YA 3H8VA 4CKEB 4RVOA 3HCEA 3QVUA 4HEA6 3A36A 3A3YA 3BIWA 3CLTC 3F9RA 5I6DA 3D8TA 1JDBB 1Z4QA 5BO5A 2B6HA 2GZSA 2QXTA 4Y6GB 3T9BA 2BZ0A 3PEFA 4E5PA 3AM4A 4DHWA 1L5GB 2OAEA 4YPOA 3GNQA 4WNAB 5CVCA 1NVBA 4FKBA 3ICEA 3KR9A 2R25B 3AF3A 1G20A 2GD0A 2QRNA 4PTZA 5JS8A 4O4LB 2XHZA 1O2DA 4IGAA 3TD9A 3HBMA 3E5NA 4B85A 4Z7JA 1JWBB 2FZWA 2R6DA 2VJOA 2Y0CA 4IVQA 3VZCA 4XIFA 4ARZB 4KR2A 1A98A 1BWRA 4ND5A 3OOWA 1IN1A 1ZFNA 4LJKA 3P4XA 4KBGA 3S70A 1NF9A 1HF3A 1WCYA 3TDMA 4EEZA 3OOSA 2UUBB 1SCUA 2FJUA 3X1YA 2HH9A 3X1DA 1MO4A 5AVUA 4FM9A 2O6HA 3I9MA 3VC2A 3OT1B 4F1JA 2EC5A 1UEIA 2GQ0A 4DXHA 3OQJA 2LXNA 3O1JC 1E9VA 2RB4A 3LY5A 1ECGA 2R1VB 4OMDA 3BRWA 5FI3A 2AR9A 4WA8A 1CT9A 3C5EA 4J1NA 3E9YA 2W5UA 2QI9C 1BWQA 3TAXA 3EMVA 3F2VA 1RTKA 5CPBA 4FW8A 4DQ0A 4ZYWA 4TTIA 4WHMA 1P74A 5KQMA 2MSLA 3TZCA 1CRZA 2Q1TA 1QO0D 4DRXA 4PN7A 2GUWA 4L15A 1YZQA 3UIEA 2DHRA 1P7PA 1BYUA 2G04A 3MBOA 1WB5A 2I2FA 1XRNA 3B5EA 3BREA 3K1YA 3UH0A 1EH5A 1NJ8A 4RWEA 4BO8A 5HKOA 3HV2A 3K9LA 4BKQA 4NULA 1G6HA 1IRIA 5DNWA 1RABA 1YJ8A 2FSGA 2KLBA 3LPNA 1F9EA 3M4ZA 4L5AA 4HT3B 3GNSA 3AF1A 1MOSA 1S3GA 1Y5IA 1QAQA 4MWBA 4FIDA 2DYKA 1R6VA 1Q19A 2OHXA 1NLUA 1NWHA 3LCJA 3T1OA 3U3JA 3ZHTA 1L7AA 4R2WA 4ZDIA 2HXYA 2W2LA 3CUTA 1E32A 4B82A 1G7CA 2VLIA 3B7WA 5LMUB 2KQUA 2AUTA 2J59A 4TV9F 2XCQA 6AT1A 4DEVA 2BDUA 4LK2A 1VPWA 3PKJA 3MB5A 1BKSB 4LI0A 3RO7A 4G1CA 1RLMA 1Y3CE 2OENG 1H5QA 3FR7A 5JHGB 2JIZA 4OLAA 3N0VA 1U6KA 3PDUA 4D9MA 2PO7A 3L01A 4PGAA 2RAFA 1NW9B 3Q6MA 5K3FA 4IEEA 5IXYA 3BFPA 4U02A 1DKRA 2TMKA 3SZRA 5ALVA 4L08A 2FN8A 1MVNA 3M34A 1O03A 4N01A 5FV7A 2J5BA 3LX6A 1FNCA 1XMVA 2X58A 1F6WA 1PKEA 2FA9A 2XWQA 2VSQA 4IVRA 1MN6A 4OQQA 4PAQA 4EB3A 5EKUA 3TL6A 2QUAA 2Q5FA 1NG9A 3ZE9A 4R1UA 3A14A 1X0VA 3AXTA 5DB4A 1MD9A 2QRVB 4MVXA 4BFWA 3PE3A 2ID7A 3F6YA 1KORA 5A6SB 2Z56A 2XXJA 1KWKA 1IZ0A 4RK1A 4WZAA 2B8EA 2HJHA 4CG0A 1NN0A 1H8EA 2ONZA 3FJ1A 1G7SA 4LV6A 1UBKS 3FWHA 4Q1VA 1EX1A 1O97D 4RD2A 4BNHA 2AX4A 3IEXA 1VSBA 1XT6A 1OXSC 4DQXA 5JDIA 4K87A 2SKDA 4K1XA 5E4YA 1JTFA 2FPMA 4B33A 5BW8A 2ZBRA 1ZS9A 1X14A 1B0PA 3W2FA 1X7HA 4Q9HA 3WGIA 2VQEB 1FDVA 4FFLA 4M2LA 4NMMA 3FCCA 1SCDA 1SZJG 3KR1A 2AEMA 4HPWA 1MEEA 4NEHB 4OSEA 1D0VA 1XHLA 1JG2A 1NQTA 3ENZA 3HBLA 1XJQA 3OBIA 4PR0A 2GBFA 2HB6A 5AI4A 2OQVA 2X4GA 2PMFA 4LJ6A 4YV7A 3QUSA 4F5DA 5BXYA 5EL0A 1H2RS 4DXDA 4I1SA 2VAXA 1CULC 4Q39A 5D85A 4AULA 1EVZA 3NTXA 4EL5A 1SIBE 2ZSFA 4O4LF 5ECGC 3HRHA 5LYYA 2W2TA 3V9AA 3FOEC 3CINA 4PY2A 1RHJA 4QNRA 1BW9B 1UXOA 3MGGA 4ZTBA 1WVGA 3DP9A 2Y0EA 3DL7A 1WD7A 4IDHA 1SRQA 2QF7A 3JZAA 4B45A 5FAXA 1PR1A 5A3QA 2CKMA 4JSTA 2VZ8A 3ZYZA 3AUAA 4UULA 1ZAKA 3RJMA 1M7BA 3NUGA 1Y63A 3CXUA 3OOHA 1T3LA 5JPCA 4HDMB 3JRWA 1TECE 4IF4A 5JCPA 4KDCA 3NWBA 1XTJA 1UK7A 4DTCA 2F62A 2GN4A 5EESA 2G06A 2IOHA 2AZTA 1XA4A 1C3EA 3CJQA 3K2EA 3KAQA 1DG3A 2HWWA 2Q41A 1D8AA 1U7DA 3KKZA 2TMGA 1YR1A 3QWIA 4Q93A 1NJ1A 4F2HA 8ADHA 3VC3A 5A1TA 4PNHA 2XB8A 4UEKA 3E22B 4P22A 1GFWA 5HF8A 3LBIA 2JD0A 3IVCA 2X40A 2XITA 4FLFA 4ML3A 3UT0A 3GWGA 2XT9A 5K7SA 3EPHA 4CQMA 2V8BA 4C2AA 4MKRA 2W8BA 4JKOA 1W36C 4IS2A 3STUA 1RBYA 1UANA 4MITA 1LW7A 1CEXA 3IT2A 3UKDA 3LC1O 1YUNA 2OO3A 2V59A 4F4HA 4KIGA 1OB2A 1CR2A 1PLKA 3AUJB 4M6WB 3SJ7A 1GPJA 3TW8B 4LZZA 5CLQA 3UAOA 3HKCA 2LVBA 3ADBA 4KQ9A 4EW1A 3QYJA 3HYLA 4EB6A 4YWJA 1MNAA 1W49A 4HX5A 3KE8A 5C2JB 1FRQA 3E0QA 4AYXA 5JDIC 4L9RA 5FI1B 1KI3A 1JIVA 4IF6A 1XNRB 1NQ5A 4B4UA 4DA7A 3KX2A 1GEEA 5C37A 4CKBA 2XX3A 1RAHA 3K70B 3MXTA 1ZY2A 4R9SA 3PFGA 1DAFA 1CR1A 2I4OA 4U9HS 3WIVA 2YMMA 2C5FA 1PT7A 4C4YA 5KTOA 4A36A 2FZCA 4ZPXA 4LZOA 3N5KA 1ISSA 2YIVX 2UVPB 2WWYA 5BWLA 5IVIA 4PYMA 3E2MA 3B9QA 3BCRA 4F04A 4YJFB 3X1ZA 2XVMA 2ZUCA 1B23P 1KK2A 2NU6A 3WHIA 2FWPA 2V7BA 3HN7A 2QVLA 3R3SA 2OLEA 2Q9BA 1DB3A 1E9AA 4DA0A 2I9PA 1ISIA 3OPNA 4GNKA 1DSSG 4FU0A 3GAAA 3ND9A 1W19A 1B15A 4UPEA 1WMDA 2EL7A 1TQDA 1WCXA 3ABIA 3OLQA 2BR4A 1S0UA 4N7MA 3R9XA 4DIEA 4F92B 4JELA 4TSKA 1BFKA 3JARA 4B3FX 1J9EA 1E6LA 1O95A 1VKZA 4LE1A 4DIBA 3IQGX 4JT9A 4ZAZA 5DTRA 4QARA 3L7AA 3DL2A 1HOXA 2AFHA 2GZRA 2ZWPA 3DHVA 3TZEA 4CG1A 3FOFC 1SQ0A 1RWQA 3TZHA 3ASVA 5LP6A 4L3WA 1RU3A 5IF3A 4OXRA 1VCNA 2HYDA 3DKIA 4QX6A 2BMVA 3V5NA 2R7NA 3WJ1A 2AD5A 1HH4A 2QUHA 3ADOA 4GOXA 1O6BA 1CF4A 3O8DA 4ZANA 5EUMA 3AYXB 2WT4A 2NO0A 3PT9A 3TKLA 2W7TA 4EO4A 1L5YA 2PSDA 1O9GA 4KQFA 1LI4A 2R11A 3P0EA 4C2BA 1DEKA 5IJ0B 4U00A 4PSKA 4WKPA 1LBHA 1PZHA 4KI0A 1YDWA 1EP3B 2HRRA 2DQKA 2Y05A 1KDOA 3BQNB 1XZGA 4KTTE 4Z0PA 5A3SA 1NPTO 4FYYA 1SZDA 2FZ5A 3T3DA 1VJ5A 2NYAA 3D7RA 4LBZA 3QG1A 3HP4A 2AOTB 3QOFA 4Q9JA 5AM5A 1A96A 2BFCA 2P4HX 3KEQA 3PGMA 4DSUA 1QU2A 3AR4A 1D9XA 4NS1A 5KAPA 4D0LB 2XRMA 1WTAA 2B9VA 2ES4A 5J2TB 3R5FA 4GYWA 2QGFA 4R8SA 3RVKA 3JASA 5AI9A 4REQB 1K63A 2FMXA 3CUVA 5KREA 5ECWA 2D59A 4LGYA 2ODQA 5T57A 1LX6A 4YJ3B 4H35A 3TLGB 1R0YA 3Q12A 3ND7A 4Z86A 1FFAA 2B61A 3VKHA 1VBKA 2W2NA 2OLKA 2J87A 4HO1X 3Q2OA 3JAWA 5FIUA 5J1SB 3LL7A 1Q50A 1UFQA 2B82A 4P5PA 4U3JA 2I1VB 2VQSA 5HKLA 2J41A 5EUQB 3HUTA 1QFMA 1O87A 4XA8A 5FT9A 2JLUA 4G37A 1E89A 2GJSA 4UMFA 2OCPA 1U7TA 4MB0A 4MYDA 5KWEA 1DINA 5FPKA 1ZOLA 4OA5A 3EGXA 4B09A 1VHJA 4KQWA 2HIMA 1O57A 2IT1A 3LVRE 4L4ZA 3OPYI 4BQRA 1PTJA 1XAJA 3QU5A 4DG5A 3BXXA 1H2HA 2WJ4A 3TJZA 1UBEA 2JHPA 1M2GA 3OQIB 1LB1B 2R66A 3IDZA 3RVQA 1RAEA 1ETUA 1DC5A 3WDKA 4ECEA 4DZTA 4X61A 4K03A 4RYDA 5FL7A 5DX0A 3Q15C 1XZIA 3MBKA 4Z4GA 3KEOA 2A9QA 1IAVA 1UEJA 5KQGA 3FTCA 1Q7GA 4DCJA 4DILA 1PE0A 2JS7A 1O0BA 1WCIA 4QXQA 2P2LA 1OLUB 1U2DA 3T34A 4ALMA 2EU8A 3CNBA 1KK0A 2ID8A 3DQPA 1FRNA 3JSXA 5EEHA 4G0PA 3S8MA 5I7UA 3CCCA 3D7LA 4TMZA 2A7QA 4JGIA 2AQIA 3LWBA 1J49A 4X0EA 2UUAB 2QEQA 2XTAA 3LW7A 4EUNA 1QVZA 1R0BA 2O1EA 1G4AE 2IXBA 2IOQA 5GV8A 4MLPA 2V7VA 4NZZA 1U5AA 1TCUA 1GNLA 5AYVA 5JCOA 2ZU0C 2PSFA 2O9JA 3GFVA 3M6UA 5FHRA 4FCCA 2H5EA 1Z7WA 3I28A 4CCAA 1FRFS 2PX2A 2OZKA 3AUYA 1QRAA 1Z12A 2N46A 3W06A 1CUWA 2II6A 2WAXA 3QJGA 4TRNA 1OYOA 4TYQA 4W7SA 5KOJA 1WZ2A 3M2PA 1M66A 1Y1SA 4KAFA 1D8TA 2G9RA 1YQTA 3B53X 4HFMA 3OZXA 2I6UA 4RKWA 4FE4A 4UUPA 2CDAA 3LBFA 4OH7A 4RLHA 3WZMA 4Y2UA 3WLMA 4JR0A 1JKJA 3EISA 3A0UA 4BO9A 1E2NA 4KITB 1NVWQ 4F96A 4GPTA 4LYGA 5DIZA 2IPXA 3TBHA 3RUDA 2RGYA 5JH7A 4DJDC 3KTFA 2QLJA 3I9V1 4PTYA 3K0KA 2JAPA 2LUOA 2VF7A 3OX1A 3AFOA 3EUWA 3G9QA 3KSMA 3QMVA 4CI0B 1U5CA 4CKYA 4F9GA 5K0JA 1F4LA 4DRYA 1KBOA 5L4NA 4AMUA 3Q0IA 1PJBA 3E3AA 1L7EA 1K5PA 2NNWB 4YAJA 5CXQA 3ORSA 5AM0A 4RPHA 4AL4A 2V5VA 3NUZA 1GG9A 2QUIA 1FOEB 4ZVOA 4E1AA 4NH0A 5B3LA 3EDRA 4I14A 1YZVA 2VPYA 1BQ4A 3NIBA 4MW1A 3F74A 2QD4A 2QBYA 2Z1MA 1MPXA 1EB9A 1GGHA 1NXWA 3EDQA 1U5BB 2QN9A 1PTJC 5CK5A 1NJ2A 2BGRA 3AZOA 2RI1A 4X3PA 3D7SA 5A3JA 2C07A 1GGMA 5CNMA 4BLSA 5ITSA 2EJBA 4D44A 3CUKA 1Z2DA 1LDMA 1W4RA 3KCQA 4KRYA 5LJLA 3M9WA 4OXYA 3CV3A 1XJ5A 2QE7A 4TQ9A 2K7ZA 5CD9A 1GUBA 4D46A 4YXWA 1CPYA 1K27A 1T2NA 1R0ZA 1CC1S 3DOCA 4OK3A 4CKXA 4D4KA 4I50F 3HKBA 3VR3D 2QSYA 5BYKA 4MMZB 4UNSA 4D7AA 5KS2A 1KOGA 4WDQA 1U2DC 1ULTA 1Y42X 3LE8A 4WUVA 5J2TF 2OG1A 2ZW9A 3BMQA 2H2DA 4PZYA 1UQRA 2GNAA 2FW8A 2IV7A 1ABFA 3DVAB 3LF1A 1M2VA 3JYNA 4H2DA 5JROA 4EELA 5HKAA 4G07A 5TIIA 3G2HA 3U5TA 5J2UF 4JV5B 4IGEA 2CVOA 4YJ3F 1G8SA 3F7TA 2HA5A 1EMDA 3Q1KA 3RVNA 5JNRA 1NX6A 1TIKA 2HXSA 4IDQA 5DHTA 4FYIA 2J6BA 1OAOC 2O6LA 4L6AA 1GKUB 4COOA 4JI2B 2ODBA 5LOVF 1JMYA 2Z98A 1GCGA 4B2YA 2X8BA 4TXMA 1DLJA 4WIAA 5GVRA 1F5NA 4HNUA 1OI7A 1P62B 2XXAB 4WVFA 1D2GA 1Q11A 4NIMA 2QNRA 3F2IA 4NBRA 3T7DA 4OI4A 3ZLBA 1G63A 4B44A 1RMYA 1FTYA 2AT1A 1XJ0A 4GYYA 3RSGA 5F98A 3DDZX 3LRPA 1YU9A 1QH1A 4LBWA 3K9FC 2IYQA 2OXFA 3QNUA 4PAMA 1AT1A 2HRCA 3TXYA 1MQSA 3KSUA 1P0IA 4C7OB 1C7RA 2HLNA 1SCIA 4FMPA 1IEWA 3DAHA 1OIVA 3AVYA 5ESWA 1D1TA 1W35A 3LRXA 1O5OA 2FEKA 3TQIA 4M4SA 1JL3A 4NYIQ 2AV6A 4M7PA 1E4YA 1WETA 2OYSA 4ZZ1A 5AW7A 3CKKA 2PLAA 4MLCA 2WYHA 1XTPA 4B3HA 4W1RA 2AKAB 2QTBA 2NU7A 1P7VA 1KFBB 3LDFA 4BNDB 4AKHA 3U3ZA 4JJZA 4YRCA 3T9AA 1ODKA 2O7VA 1FFEA 3UTDA 2R1ZA 3KUCA 2WU8A 3A06A 1TI7A 2V6GA 2VHCA 2XMBA 4HAVA 4D4GA 1DEAA 3IVGA 2AQKA 3S1AB 4ZGWA 3KEMA 2UYHA 1KRXA 4E51A 1Z5GA 4ZCPA 4RL6A 1V4VA 3CEHA 3WLPA 1HOTA 1IPFA 3BZBA 4QIHA 3H75A 1KI6B 5AJWA 3WIOA 4WZBB 5AOVA 2E55A 4MPPA 4BKMA 1C80A 1R0XA 4Y6SA 1LXCA 5F2OA 1RCFA 4H1HA 5H0IA 2HA4A 3IQZA 4J90A 1E3JA 1L5NA 4IHKA 3I2GA 2HDWA 3R7WB 2HSGA 3DNFA 5C8DA 2ZS9A 3OO1A 5AM4A 1JHZA 2C0QA 2GZHA 3EUFA 2AK2A 3KQTA 4XDZA 3UW3A 1S1MA 3IE2A 1LBTA 3AVVA 1WO8A 3KBBA 4TTJA 1ORDA 1EFLA 3QKRA 4EHFA 2ZYAA 3DTVB 1E96A 2WUFA 4X20A 4C01A 1V8BA 3SF8A 4JYCA 3GGJA 2PAFA 2HCRA 1PR6A 2I87A 2PQ2A 3AW9A 3B2QA 2PCLA 3IMKA 3P2KA 4RENA 5K0BA 4BXOA 1WZIA 2QKYA 2W6QA 1ENOA 1OW3B 1W88B 4S1TA 3C45A 2ZRHA 5THKA 4CVNA 1MJFA 2CLLB 4D4HA 3MTJA 3P9YA 4BB0A 4JODA 2BFBB 3L41A 4GZ5A 4UM5A 4DMUB 3PX3A 1B41A 2WWGA 3G9XA 3K8OE 3L92A 4Y8VA 1JEOA 2GF2A 1JP7A 2VHUA 3TB4A 2A4MA 3AL2A 2QL6A 3O74A 1E5VA 4FLEA 3T15A 1KI8A 1D6JA 1YMVA 2G8NA 3NAZA 1YVEI 4U39A 5DBHX 2ORIA 2R8YA 3V3TA 5CFOA 5L51A 1NT2A 1BXKA 1QDUA 3GHHA 1AKTA 1TF5A 1JQKA 1XWWA 2XZTA 3X1JA 5JANA 4G36A 3ZNPA 5G0WA 3ZQ4A 4B3XA 1O58A 1THMA 3UK1A 2VT2A 4G0YA 3K6RA 4JYPA 5ALWA 5KCMA 4BLRA 2A35A 5JO0A 1XXLA 1S8OA 4QXMA 4BO2A 1C8VB 1RYZA 3ZW9A 1GILA 1BJKA 4DLWA 4GQAA 1JTEA 1DG9A 1QLHA 1KP3A 2HBRA 2ZJFA 3MQ2A 3OC6A 3QH4A 1SKMA 1TQ8A 1K9VF 3PRYA 2YC4C 4JQOA 4F9FA 4CT4B 5J43A 2PGXA 1XXHE 1VG1A 2QX6A 2TS1A 3EEBA 1MCZA 4DEXA 2ZSEA 3NRJA 5FUWA 3PWSA 1T0PA 2FN3A 4K88A 3D64A 1MH1A 1TEVA 2WNSA 4CV0A 3U4GA 1TNDA 1SRRA 2WQ6A 2HJGA 3I1FA 4RESA 2O8VA 2OP1A 2WTXA 1IPHA 2GAOA 3R7NA 4FN4A 2AHOA 4PC7A 1GTG1 4NZOA 1EVQA 4OYYA 4K9QA 3VAYA 2AW5A 3KJQA 1QPBA 1FJ2A 3EEFA 4UUOA 2NPOA 3E1KA 2VQDA 2B4QA 3GAZA 4BX8A 1FTNA 1YKFA 1LD3A 1KZGB 3ZVKA 1PJ2A 2UZ3A 4UHKA 5IK2A 4OIMA 1ABBA 1U3TA 4BNZA 1ZL2A 3DAYA 3HCFA 3THRA 5TQ2B 5IEBA 3LCRA 1TK9A 1B6GA 2VWQA 3NIGB 4YIKA 2WKWA 1LA2A 1C3XA 2HMUA 3A6EA 3H11B 2Z6AA 4UUAA 1SOMA 4TLAA 3G9ZA 1DX4A 1BD4A 3TPCA 2YJGA 4HI0E 3TSZA 8OHMA 1YE5A 1JDUA 5ER6A 5E6SA 2OILA 3JATB 4PHGA 3RRJA 3RVJA 1NVVR 1IN8A 4KGXA 3HBAA 4PO8A 4U7GA 4BYMA 3U13A 2DR2A 2JZNA 3IA7A 3KOWA 1F2UA 3F5QA 1FP7A 4IGIA 3NONA 4G26A 4J1QA 2NIPA 1XZNA 1ZESA 3NPMA 4CLOB 4ECAA 2J07A 2P2SA 1Q0SA 3RS5A 3HRKA 1Z74A 4ZZ3A 4TL6A 1FLNA 1USGA 3N2EA 5LU9A 1EVYA 2HIAA 4IO1A 4BVJA 2PM8A 3LI2A 1Z17A 3ICQB 1F06A 1U9IC 1R8QA 3FNFA 2PBFA 2WD9A 2D4HA 3NLLA 1P18A 1I30A 2BSAA 1PWXA 4TWAA 1JKIA 5K0ZA 1CEEA 4OI1A 3LX8A 3NH9A 4R9UC 3K0AA 3W1WA 4X45A 1YS2X 4L78A 4O25A 3UB2A 3TRFA 3OQVA 4UPVA 4I4TA 1G21B 1Z29A 2X5OA 3LSTA 5JSYA 5T6BA 3ND5A 2BE7A 3ZH9B 4CWAA 5KX5B 4W6ZA 1V5FA 2DG2A 5AIAA 3UF0A 1O9HA 1DIGA 3ABOB 2PU5A 2GEJA 1GXSB 2VYNA 4KQCA 3SSOA 3MXOA 4CYMA 1Z2CA 4E2YA 5KJ1A 1S7CA 3RYCB 4Y67A 2C4NA 2PSSA 4BHTA 2BGTA 2RHLA 1DTEA 2O4CA 3CEJA 3VZQA 4M1ZA 2PX5A 1C5KA 2COEA 2FI1A 1UZUA 4DR3B 1UBUS 2ZQ5A 1RWPA 3HUDA 4JT2A 1Q22A 1GVHA 2BPOA 2GCPA 1F2TA 3QHAA 4OGGA 5B12A 1I80A 3WTBA 1YR8A 1ZIXA 2AYZA 2EHJA 3M1AA 2HSEA 4AZ3B 5FR2A 2PUFA 2O8CB 1QKJA 2DFLA 1N6IA 1XA0A 3HKEA 3ZD6A 3H1EA 4WN9B 5AW9A 3TSAA 4YO8A 4Q4JB 1CJCA 3D6AA 3IJ5A 2NU8A 1ISRA 3ZBUA 3GLGB 3ZI0A 3UHJA 1TMYA 1WSDA 1CUIA 4MS4B 4O33A 3ZDQA 3UJ6A 2QS9A 2FQQA 4H7FA 2IV3A 3UGJA 4RTJA 2AH5A 2R3SA 4RGYA 3WVNA 4TYMA 3TUJC 3WWYA 2P6RA 2H8GA 4PIVA 4LYHA 1KP2A 3LZCA 4M7WA 3BYZA 3B60A 1QIDA 4NOMA 5G40A 2BEVA 1ONOA 2IWRA 4B80A 2EZTA 2BRUA 3TLAA 1CLUA 1L7RA 3DL0A 1EK6A 2VUTA 3QXSA 5E4TA 3R9IA 5A3RA 4URXR 4TLDA 1E9BA 4ZV7A 4IUCS 2JJQA 2O7QA 3ZWDA 4DIMA 3OZDA 3DZJA 4RK6A 2V7UA 4DLTA 2I67A 5EG5A 3CURA 2XDQA 3LQQA 3QMPA 2IZ5A 3RT7A 4HJRA 5DX8A 5ERGB 4Z4CA 3MTAA 3P9QA 3GGSA 1WA5A 1Q44A 5FNVB 2G1KA 1JIJA 2ZUVA 1SCAA 4G1BA 2F2TA 1PZEA 2WICA 4FUTA 4QJ3A 1Q15A 1OLSB 5G4LA 3WNZA 3GRZA 4AJ1A 4DDHA 1JSCA 3GGDA 3PSHA 3ZDRA 3SC2B 3ZGNA 2QA5A 2H57A 4KO3S 4E22A 3WQQA 4LVCA 1ZXBA 2FK8A 3MN1A 4NOKA 3EXG1 1GAJA 4KGVA 4OQLA 1EGHA 2X9GA 4L3OA 3EWIA 4R1MA 4F8YA 4XLLA 4O1IA 4FWIB 1KO7A 2P9EA 2QLNA 5JQWA 1W34A 4GLFA 1Y6RA 4MARA 1OC4A 2VSYA 1RXIA 3U0VA 3VYWA 5A5DA 4RQTA 1Q21A 2HK8A 5L7TA 4INPA 1EJ0A 3DTYA 4Q7JB 5K3SA 3H13A 1K4YA 2AJ8A 3EQ9A 3T5CA 3TLEA 1Q6ZA 1FFDA 1M2EA 2RBEA 3W2GA 4EQ6A 1C30B 2IBSA 2IZ0A 2J5QA 2J3LA 2AN4A 5CH5A 4MIKA 1GIAA 1XIVA 2AOUB 1U2SA 1ZSNA 1S2OA 2C84A 2ZSHA 4MGHA 5DGCA 1G66A 3VOSA 4Z1OA 1E2UA 3DLIA 3WGYA 5KVVA 4NDAA 1Y3DE 1YL5A 2UVDA 4Y6LA 5DNAA 1TXGA 2C9ZA 5FUVA 4R71A 2BE9A 4TZKA 1XDDA 2ACVA 5TLSA 4DEYA 3MELA 1A7UA 3EZFA 2H2GA 3PFKA 4F2GA 1YFLA 3ZWKA 4PYJA 2X9LA 3RH0A 3SMVA 2B94A 5KKCA 3ZW8A 3KAKA 1HE1C 2XRFA 4HH3C 3BEOA 2J9ZB 2HPVA 2FX5A 2ISCA 3O5AA 3PUKA 3MG9A 5B36A 2Z5VA 3D4LA 4MOWA 5EMMA 3QITA 3U62A 3RFUA 2WVHA 4NFHA 1A8IA 2BM1A 4YRZA 1X13A 3JTMA 3NU1A 3ZY4A 4YCCA 3L9XA 4UVHA 3EAQA 5D5QA 5FPQA 1MTOA 2GH1A 3JQCA 4DT1B 3GJYA 2VKQA 3MT7A 1PI3A 2HQRA 3G02A 5DCLA 5JVDB 1LLCA 3RQIA 2IEZA 1P9LA 4MUFA 4P54A 3RKSA 4QELA 4Y2HA 1G2IA 1RR6A 1NYRA 1LX7A 4PPGA 1YQXA 4F3CA 5GV7A 2BD0A 3ONNA 2CB9A 1DTWA 1CUSA 3Q0EA 4P4SB 2H1IA 1HUQA 1YGYA 4GF5A 4ZQIA 3LUFA 4UVIA 3RVRA 3QLJA 1FSSA 1SHUX 1MP0A 3IEMA 4AJEA 4KHPB 2DLNA 1Y3AA 4TKVB 4KFCA 5KX5F 1B1AA 1GNVA 4IUDS 1YCHA 3C6KA 3ZN2A 2O3QA 1SC9A 4N03A 2H31A 4R0MA 2IDJA 1L8OA 3HNOA 1E1YA 2WJWA 3PNBA 3UFXA 3DUFB 1EUDB 1MORA 1XTTA 5IHXA 2LKDA 3K6SB 3GJXC 1H2FA 4RVGA 3LYUA 5EJFA 4DMHA 4DS3A 3ONVA 4DPKA 2ZLBA 5BVHA 1WHSB 3TQRA 3UOGA 2JFXA 2O2EA 5GZ1A 3BXEA 1DUVG 5T3YA 5FWXB 2REBA 2NACA 3T12A 3H2IA 1ADGA 3HLYA 1RTTA 3QVXA 4HDKA 3GDOA 4PNZA 5B7GA 1NE2A 2FZ4A 3BL8A 3QNWA 3RRXA 4G3XA 2ZT7A 3RK0A 2ZI3A 4I5EA 4O2AB 5EFZA 4YV1A 2XSZD 3ESBA 2YICA 1QO0A 4OXXA 1BGVA 3AB3A 3MK31 3QKIA 3ZPXA 4MUXA 2C0PA 3PTAA 2GYUA 4L02A 3BB1A 1Q1BA 2HQOA 4LQLA 2A78A 5ALMA 2QUBA 4QLOA 3L7DA 4RDHA 1TF7A 2Y9PB 1R50A 2FU5C 2VH1A 1ACLA 2DSNA 1JEQA 3BC1A 1L4BA 4Y2YA 2LCQA 2GPBA 3IULA 3UMBA 4F2PA 1JFSA 4PLFA 4X6YA 3ZCVA 3SU8A 5K3OA 5J47A 2NQ8A 3O1HB 3AWIA 2V1XA 3PYMA 3R0JA 2ZPAA 1G8MA 1UT5A 2PRIA 4RLFA 3QELA 2ZM6B 4ARSA 3DCJA 4B3TB 3CQ9A 1ZVJA 1V16A 3U48A 1KJYA 4PCUA 2BM8A 4PAGA 3V48A 5EIWA 5BSHA 3ABZA 5MN4A 4RY8A 1FXSA 1BQ3A 3ZXIA 2QIPA 4UZEA 4AY6A 1GA4A 3OLVA 1V8PA 3CW8X 3T7RA 3EUEA 1C0IA 2YY6A 5FNVF 3R7FA 4FR5A 1FW8A 3RC3A 2GNPA 3SX2A 1A8PA 1YMUA 2I7CA 1H9CA 4Q4LA 1A4XA 2FFQA 1QIKA 2Q9CA 3STYA 3F4LA 4MWDA 2PUCA 1RRMA 2ONJA 3W78A 1HZZA 1K98A 2Q7XA 1RACA 5AK3A 4WACA 3GUYA 4DCCA 4X97A 1NAIA 1CIPA 1R4NA 3N1UA 4BFZA 1VSTA 4JLUA 3LO5A 2WQ7A 4HN9A 1XOIA 4KUHA 4MVWA 4BGIA 4D80A 3Q85A 1FMCA 2Z1NA 2BDTA 3P8ZA 3ZOKA 4AN4A 1JRLA 1K8XB 1P2FA 3M4JA 1J1UA 3NX4A 4RY2A 5FWYB 3PITA 5J59A 5K9ZA 1F8YA 1RWMA 1M2WA 2JVJA 1HDXA 3DM5A 4JDUA 5IUNC 1JHDA 1W5EA 1MZPA 3IBGA 3W2HA 2H00A 3VZPA 5AUNB 3D54D 2IY8A 3WAJA 1YIOA 1E63A 4BO1A 2NVUB 3UK0A 4EARA 1WIWA 3E3NA 5C7LO 1HC7A 1AD2A 1I0LA 2Q99A 3DFKA 3EAGA 3P9ZA 3QPUA 4KWEA 4MYTA 5H59A 2JCSA 2D0DA 4QGAA 1JECA 1I2CA 3ORRA 1M1NB 4BLPA 2VNAA 3FSJX 4U9UA 5K0GA 5LQMA 3H87A 3OJFA 1BD3A 4ABTA 4LMBA 4CG2A 3DD5A 1KJZA 4WK6A 1PWYE 5ERYA 1H2XA 2GM9A 2WAAA 3GG2A 4IHAA 2ZGVA 2JIMA 1X7XA 3CC8A 3E2IA 1NTOA 2ZWAA 1FXWA 1Z0UA 4FW9A 3GUVA 1LPAB 4W8OA 3V8VA 1M7GA 4X95A 5IZCC 5JVDF 2C2GA 1SXPA 3NKLA 1KAGA 4TTPA 3HO1A 3B7GA 4AO8A 4MUEA 1H2BA 1QH0A 2FSVC 3KTDA 4W5QA 5DNYB 1AHNA 3ASUA 4ZGBA 3NAMA 2XMPA 1PZMA 2ZT5A 4EL0A 1UC9A 2QPAA 1T2EA 3Q40A 3JQ7B 3PDIA 4RTMA 2PLNA 2YINC 4YCBA 1DFHA 1GPAA 4QGFA 1BN6A 1U7XA 3OTGA 3K0BA 3R41A 1GU1A 2Q45A 1P1CA 3D3EA 2QZ4A 3DF9A 3SM9A 4XGRA 1XEXB 4OXIA 3LRTA 1QM5A 4BC1A 4E14A 4KR7A 1WEHA 4PG6A 2XEXA 8AT1A 2IVFA 3BAZA 4A2WA 3RU2A 4FTWA 1AZSC 3WDSA 4LXYA 4DLAA 2O3JA 3WIEA 4ZHQA 4G0ZA 2Q6VA 2VYVD 1PL8A 2X6QA 1N7JA 3R1IA 1JS1X 4KODA 2R97A 2B0JA 1TZBA 1ZSVA 4FFNA 4YCLA 4B75A 1YF3A 1P8JA 2YRWA 3MTGA 3PK0A 4OUDB 5BN5B 3WGVA 2F55A 5G0TA 4O2AF 2G83A 4R9VA 1QJCA 4PC6A 3AKYA 3UJNA 5DCYA 8MHTA 3I9FA 2VQFB 5DVZA 3BKXA 1FDIA 4IY1A 1S8NA 1OA1A 2YIMA 3C1TA 3FTNA 1YO6A 3GLSA 3ODGA 4B4WA 5C7YA 1QF9A 4GBMA 3PGA1 4CFZA 9LDTA 4LJRA 2JBHA 2P2ZA 4CLRB 1QE3A 2PXCA 2REXB 1VSQA 1FIUA 1C9EA 3K9WA 2FRDC 3L3BA 3V2HA 1CY1A 4AP9A 3JQ9C 1EGAA 3T6KA 3BA1A 5BV7A 2VP9A 3L0OA 5KHLB 3SR3A 3PB3A 1XL0A 2PA0A 3N7TA 4LZLA 4AF6A 1OHHD 3G0DA 2FRVA 1T9CA 4CLDA 4KCGA 4LXUA 3ZJ4A 1L8AA 3BMCB 3L5OA 1NBWB 2Q5QA 1IE3A 4KG7A 5KKNB 3JZFA 1FX0A 2XA1A 4AXBA 2XWPA 4R1SA 1NGSA 4JLBA 1JMVA 1JA1A 1Y3FE 4UMEA 3N2NA 4WASA 4QUEA 6REQB 2ACKA 3A4YA 2HHLA 1ML3A 1UXIA 4RIIA 4HXFB 1ILWA 5F23A 5E4FA 2JFOA 4JI0B 2P5TB 2XE8A 4KC0A 2P8SA 4H1TA 3CVYA 5JMWA 5JXHA 4OHYA 2C4VA 3QEMB 4QBFA 2EXXA 5KYTA 3KNZA 2PTGA 3CLHA 1TO1E 3WI7A 5JZ9A 4Q03A 3LX4A 3N5CA 3PUYA 3O92A 4FNOA 1FSFA 5B6IA 2Q0HA 5K99A 4RVDA 5U9CA 4E12A 2QQFA 2IQ5A 1BMFD 2IH4A 2G5GX 4WAUA 2GEFA 1VP9A 3QENA 2DWUA 4HH4A 5CUQA 5L3SA 3GN1A 2FMUA 5ENVA 4JI8B 4I46A 3VHRA 4EPTA 3Q72A 2MIIA 2X8JB 3ZDYB 2XNSA 2MSDB 4UUMA 4ZT3A 1DEOA 1CX9B 1G8JA 1SUAA 2PX4A 5T4FA 4CNBA 1A2BA 2BTOA 2G9NA 3ANMA 5ILGA 3TBFA 4HEA1 4HR7A 4BO5A 1H4SA 1ZG3A 1H8HD 3Q11A 1NA5A 4EEXA 5JS2A 3T54A 4NZNA 4ZP1A 4RJIA 2UZAA 3C3AA 3CS3A 2C7OA 3QFRA 3H9EO 1E62A 3CIFA 5FBKA 4RD6A 3UJBA 2WG1A 1C4KA 4NPHA 3M83A 4C6TB 4CCYB 1JHRA 2RJNA 3QPAA 3TZLA 3WRXA 2Q1SA 5LQCA 5JAZA 4YJHA 2I2DA 2V4ZA 2XNDD 2IXAA 4NJMA 3Q9NA 2IU3A 3C1OA 2A1UB 4AECA 3E5HA 1CQIB 4B47A 1AKRA 3PRJA 5CR9A 4F84A 1Z4MA 1CUVA 4EEKA 2JCVA 5CCXA 4XIYA 4I66A 3OAAD 3H05A 4ODIA 5CITA 4JXJA 2G17A 4YECA 1GJRA 3DLBA 3EHEA 2BGJA 3MCZA 3AKDA 2QN3A 2ZXEA 3ELUA 1J0DA 3QFSA 4JB3A 1GEGA 4K2HA 3IBSA 4X8MA 4D2IA 3QYPA 2PBLA 4OXNA 5KU1A 4QBHA 4WT7A 1QGZA 4LS3A 2FPPA 1OZHA 4FCTA 2VXYA 4NYIR 4YAEA 5EMLA 4B6GA 4E5SA 2M98A 4ESHA 3MWEA 5BUZA 1KEVA 4QQKA 3R76A 4U2EA 4MEBA 5D7BA 5I7HA 4K8RB 1NY6A 4HX2A 1XV5A 2YYAA 1P9RA 2IU0A 3GI1A 1U28C 2EFJA 3QE0A 2QNBA 4URZR 1FRZA 4R81A 5T8KC 3TNJA 3ZV3A 1YACA 4RHCA 1U8AA 3B5IA 3WWEA 3Q7QA 2OA0A 3KYDA 2GJAA 2LV8A 3GLVA 4PLWA 2IYEA 4BNUA 5BN4A 4JZKA 2P5UA 3IVRA 2R8XA 2ZDHA 2ZJOA 4BO6A 4AY5A 4PG7A 3VPDA 5JC1A 1N25A 2VAVA 1EINA 3M3PA 1WTCA 4XUGB 4EMUA 1PF7E 1ZD5A 4Q82A 4S1PA 1UJMA 2GEDA 2XUFA 4CM4A 1G6OA 3R3UA 2H16A 4BWVA 2PT9A 2YWCA 3LGAA 3DH0A 3IT0A 3QW4B 4NYJQ 3ZVRA 4C21A 1A9OA 4NMLA 3AZQA 3U60B 1ECCA 2F3UA 4AK9A 4MWZA 4CKWB 1EFRD 4QZVA 3M4XA 1QGUA 4L8VA 3RRYA 4OJMX 3I09A 4BV9A 3E9CA 2ETVA 1A8UA 4AUMA 4I2NA 3D6FA 4HDRA 3AO0B 3MNFA 4LMRA 4D9EA 4E6EA 4MS1A 1RYDA 3LFHA 1SB9A 3RS8A 2B3DA 3IIMA 1H3FA 4LYEA 4XJVA 2ZK7A 3WRYA 5GINE 2VRBA 5J58A 3ANXA 4FYVA 3G2IA 4HL6A 2ODTX 2COKA 1QHXA 3SPXA 3S5UA 4CMBA 2VDRB 1I7LA 4RSGA 3PSAA 4X91A 1IHUA 4JITA 3EQ2A 2ENWA 5DTIA 1DCKA 3OIVA 2Q4RA 1WVMA 5KQLA 4N5MA 4CM7A 5HFJA 3PC8C 4JCCA 1R6AA 3LHKA 2V65A 2QAGB 2J1LA 2ZUUA 2FPXA 4QEKA 1W85B 1F8UA 5FA8A 2CLOB 2XOKD 1MW9X 4ETNA 5KEIA 3QX3A 3IVMA 4U5QA 1KMCA 1CE8B 1Y81A 4JBLA 1KA9H 1PFYA 2XMSA 1VL0A 3G23A 4UNNA 4YV2A 2IYUA 1EGVB 5CIYA 2W00A 3AYZB 3K1AA 2XF8A 4MV8A 5EYPA 4HNVA 4NOLA 5LL6P 4O0MA 3CVUA 5F2NA 3KQLA 1F0YA 1Z3CA 1Y82A 4KNVA 3JAKA 3PNMA 2H2FA 1CJKC 4PN3A 1Y9ZA 2VN8A 4D9BA 5IYZA 1SOAA 2FPIB 2XTNA 1M1YE 2BEUB 2CNWD 2IOFA 2YHAA 4PIPA 4QVKA 5EWMB 5HJ2A 5LQRA 5A4IS 4DHEA 3I52A 1HFKA 3GJ0A 3QX7A 1KI7A 5GOZA 5IASA 1W5SA 3UMJA 1DRJA 3BILA 4ZEOA 2I66A 3AFIA 3HCNA 5F2KA 4J2OA 2MINA 3MVEA 2CUZA 1XAHA 3BEDA 1II0A 4B6PA 4EGFA 3PD7A 1AS0A 3OJEA 5AKEA 4RPGA 1DKNA 1U04A 4UUBA 3VR0A 1KYTA 2W93A 1FSPA 1REQA 3LA8A 3F6PA 2FUCA 1DWPA 2G5PA 3CZ9A 4GVLA 4B7ZA 2O2XA 2D2IA 3O75A 1SVOA 3OIDA 4GOJA 4GKAA 1AGRA 1AM4D 1DVRA 1T9GS 3DXZA 3HB5X 2CLFB 4MQ5A 1D2RA 5JS7A 1QTIA 4DV2B 2WHPB 4J2TA 1T0UA 4CODB 3CF6R 3O4RA 3OX2A 1WR8A 3ENKA 3RHTA 5AKZA 4QHSA 2WINI 1QC5B 1J00A 3VR3A 1MX1A 4EYOA 1IATA 5JJBA 1GAEO 3DKVA 3KC2A 1Q0QA 3ZGOA 3ZXSA 4HDSB 2FUNB 4TZ0A 2H2IA 3ON5A 4G8CA 2ONKA 2P9CA 3EIOA 1MG5A 3PXBA 4G1EB 3R6TA 1X7DA 3OJCA 5IN5A 3IBYA 2PJZA 1RHMA 1H05A 4BVKA 1QZTA 5D3ZA 3GA0A 4KJXA 1IPEA 3QNMA 1V43A 3L0SA 3O8OB 1XEWX 2ZRIA 3L1UA 1M9NA 3VSCA 1KYYA 4I55B 4XWTA 3BCSA 3MUOA 1XK7A 4KKVA 4REOA 1OX4A 4BRUA 3GP8A 1DCMA 1UP4A 4I5IA 1XZFA 3FSGA 1NFQA 3CNLA 1EDBA 3B2EA 3HSKA 4CL8A 1HE2A 1OBCA 1Y98A 2H0QA 2VJBA 4UEWA 5IHPA 2XCOA 1MR3F 2P4UA 1XTUA 1KFEB 1DAEA 1RC1A 1ZUIA 3CB4A 2FR8A 3I53A 4Q66C 4X7BA 1KNXA 4FDMA 1RI5A 2VCEA 1TT7A 3PFCA 1I2BA 5DE3A 2D5IA 2FDXA 5C1PA 2AI3A 2VG8A 3ORQA 1OJ7A 4JKYA 3ZCQA 5H4HA 1IAQA 3UUGA 3IPYA 3G5LA 1JAYA 1SVUA 4L3VA 1J8VA 1K6MA 2WKSA 2HWXA 1OI3A 2ANBA 2GM3A 4M9QA 4WXEA 4DCPA 2IBTA 1ODJA 3BAFA 2CL0X 1NJSA 1PGOA 1C0LA 1RXEA 1MIOB 3QMWA 4ASUA 3THWB 1H3EA 1N4AA 1XMOB 4BMNA 4X1IB 4BBPA 4HVLA 4DLPA 4ZYVA 1Q1QA 2CV1A 4U6QA 5LD2B 2P6UA 4FSXA 221PA 1JHXA 4K9LA 5JS1A 1SIUA 1U2EA 1KQGA 1ZLYA 1BXRB 4FX5A 1PGJA 3ADPA 3GV0A 4HC4A 2HLPA 5JSUA 3LLUA 3FH0A 5KYUA 1GNTA 5G0SA 1YR2A 4FC6A 5J3JA 5FUQA 5ERXA 2C59A 3N28A 5ABPA 4GI7A 5KNBA 5K8LA 3GU3A 3GT4A 3C1AA 1F5SA 3IX7A 1PFUA 2PFKA 2WSBA 4N39A 3VGPA 3DFUA 3HEAA 3CEAA 5AVWA 5MFZA 4Z9XA 5IANA 3I2FA 3L0IB 3PYLA 3N8IA 1T5OA 3C5VA 3PZBA 3UYKA 4KXYA 1E1RD 2VSNA 1D2NA 3GRPA 1I0IA 4NNJA 1X19A 4CQLB 5A03A 1XXHA 1Y1TA 2JDID 2JI8A 4S3MA 5CHYA 3WADA 3CCBA 3PR3A 3WNVA 4AJIA 4BZZA 2P9BA 2QYHA 5H80A 4I8XA 3QEOA 5JW6A 4GMHA 4JWTA 1JQJC 1HQCA 1KMNA 3DZCA 3SX4A 3QU2A 5F1OA 3O1IC 5TX7A 1KJQA 2ZUDA 3ML1A 2HMAA 2J7KA 3GD5A 1IC6A 3FZQA 1IQ0A 2Q3EA 1YJBA 4QBKA 4PSUA 5EWLB 3ZBTA 4ESVA 1IULA 1JIKA 3BB3A 1JEJA 3CXRA 4PC2A 2OV4A 2G09A 2YJ3A 5FADA 3UBTA 1MB3A 2P77A 1Q3HA 3K2QA 2EBWA 3TNYA 1AF4A 1CWUA 1MV8A 2OGSA 1Z5NA 2GN6A 2EJTA 2X13A 2ZEJA 3I6MA 3G9UA 3PFIA 4HEJA 4N5IX 2JGDA 4YH1A 5GPBA 3T3IA 2C96A 3AVOA 3BL6A 3WLKX 4JI5B 4DR1B 2CL5A 4Q6BA 1Y48E 5K6TA 5FLYA 4IIXA 1KJNA 5YASA 1Q1AA 2ZTVA 1T3GA 4R8KA 1GZVA 1XALA 4ENQA 1U3VA 1T8WA 2QY6A 2HRZA 3E2PA 3RS9A 2PX3A 1AUVA 2GVDC 3N2ZB 1E92A 2R6R1 1E0DA 1GG2A 1I2AA 2BMJA 3T5GA 2A9JA 4LQDA 3OUZA 2SNIE 3GD7A 2QLMA 1YGPA 2JJ2A 3Q9SA 3QXJA 2G6BA 4PNEA 5HUQA 4HPJB 1B74A 1ZHFA 4X63A 4HK4A 4IGKA 2FX3A 3KDAA 1K3TA 4ITVA 3PHCA 1J90A 5GGXA 1Z0JA 1MC8A 1MAHA 1ZD9A 2P9TA 3A37A 1C1XA 5FPHA 4HBGA 4CMJA 2WIKA 2WUWE 3HFSA 3PRHA 2FE1A 3QWAA 1U3FA 3UHFA 2C5HA 5DSTA 3WO1A 2O57A 1T36B 2XW6A 4BATA 2ZZKA 3RSSA 4GMDA 5FFMA 1Y6GA 1RPZA 3H0CA 4QPPA 4NZ9A 3TLCA 3AHHA 1U4NA 3L0CA 5KYXA 2DECA 3LOQA 1KYZA 2N75A 1AG9A 4Y1EA 2PHZA 3G7NA 1PLLA 5K4AA 3ILSA 5J5CA 2QTRA 4I55F 2DXIA 3TL2A 2DQYA 2ZANA 4DUGD 4IOLA 2Y0BA 1F7UA 1OXTA 2QK4A 3J80A 5HK8A 4FHDA 4B6RA 1XQYA 4JUBA 4NE7A 1NR1A 1UAAA 1SUBA 3I8OA 4JJFA 2Q8PA 3WKAA 1CB0A 3DC2A 4WADA 3CKLA 5ALPA 4DJTA 4DSOA 1HLFA 5BV8A 5DN6D 2CSXA 1N5LA 4ZVVA 1G19A 2L17A 1EFPA 1YDHA 1CXZA 1Z2EA 1NSYA 3LM8A 1A04A 3COJA 1X7ZA 4POOA 3L1HA 4IFIA 1BE1A 1UMCA 1YOBA 2NSHA 2QL7A 4U7HA 4ZVUA 3FCXA 1I3LA 3ESAA 4XWOA 4FGJA 3WBJA 1SG0A 1YZLA 3MGBA 4NX2A 1MLDA 3AERB 5L7YA 2CDNA 1YDFA 4O2BB 4IINA 1JLLA 3MYYA 4FMDB 3SEFA 1CNMA 1SUEA 4PFQA 4FEGA 3JQBA 2FQ1A 1GPKA 4JP5A 2B3TA 4CL2A 1UPFA 2O23A 3FDXA 1EUZA 3ORFA 2PR7A 4TVBA 5BVGA 1ZM7A 1NUPA 3AR2A 4C2UA 4A92A 2C7RA 2WJJA 2UXCB 3QLUA 3DBRA 1FDOA 2F4NA 2FHSA 3MB8A 4AZTA 4BB5A 2I4NA 1S3FA 3U0BA 1FSGA 1ODLA 4S1OA 2ZYDA 4XJTA 3PEVA 4D92A 5BPFA 2ALJA 1PGNA 2C04A 4QHTA 4TXLA 4B6FA 4ZFNA 2NP7A 3SDBA 1R3UA 4AWXA 3CG0A 3LUCA 2QL9A 4D45A 4TOIA 1ZCJA 3RYFA 5JXWA 4RLQA 4ZVMA 1NLFA 3ZHZA 1YTLA 5EHZA 2O2CA 1L7XA 5DFAA 1S96A 1F3LA 1GNQA 1ZC3A 3OCCA 2CUTA 1E7SA 2FLWA 3BTUA 1OBVA 4HDNB 4PGFA 4GLOA 4FC7A 4MV1A 4BFSA 5JBIA 3F96A 1GPNA 3SR0A 1EB8A 3D6UA 5CB4B 2ZTUA 4BMYA 2B69A 5DGIA 3L6CA 1TU3A 3THXB 2ZITA 2XADA 3HA2A 2YWRA 2Z8ZA 5GJVC 4CM9D 3DCYA 2A5LA 2ZE7A 1V35A 3CKYA 1FQKA 5AQ1A 3V1MA 3VC1A 1LLQA 3IAEA 3P9IA 4PRYA 3QBJA 4WGGA 2JCXA 4D56A 3LIIA 2IPOA 4MQLA 5ENZA 1GZ3A 1R6BX 4BO3A 5H8WA 5MFPA 2IEIA 3S8YA 3N75A 1YCDA 3IUPA 4RETA 2QU8A 3ZDXB 4C07A 3BMOA 3IAAA 4ER3A 4FYXA 4NARA 2PGDA 5B4UA 2FQWA 4RGQA 4DMFA 3TZKA 4CU5A 1C3LA 4YMLA 3MINA 2ZAMA 4NBNA 4URUR 2QRJA 2HCBA 2ZJAA 4JI6B 3U9SA 3VU9B 4E11A 1FP4B 1NVFA 2OV1A 5EWJA 5FD8A 2HJSA 4LJLA 4JKIA 1I6KA 1PS0A 1Y7TA 1ZUNA 3DTNA 4GUDA 4NC9A 4OHUA 1KNQA 4URWR 4JL8A 4M0UA 2GAJA 3O2JA 3MEQA 4TVOA 2HRDA 2IUEA 3G9TA 1P6UA 4UBLA 2VBGA 1BJTA 1JR6A 3RJTA 2IC5A 2X9NA 2NZJA 2IYFA 2PV7A 1OYVA 4G4IA 1OTHA 2I65A 1X7YB 3G5MA 5C3MA 2RGRA 2C2ZA 2NADA 2VCYA 3GLKA 3HJBA 1LF5A 1D5WA 2C98A 1A0OA 2Q1YA 5CBPA 5KTRA 1JR4A 3DULA 5IN4A 5C81A 1YVUA 3EGVA 2YYSA 4J07A 2G0NA 1RHRA 3PEUA 3I6YA 5DMHA 2CY0A 3A6DA 5C31A 4JN6B 3DKKA 1Z5UA 3T0IA 3WSVA 4B7UA 4HAYA 3SOZA 2VJLA 1W5AA 1NOIA 1NP3A 3PUIA 1OIWA 1ZOOA 3TWOA 3U9LA 4D8UA 1WB4A 1AQJA 4NCJA 3K1JA 3X2FA 4BJ1A 2DFDA 2ZBUA 3LKDA 3PPXA 1E5TA 2PZAA 2C29D 3NYWA 4HS9A 1YBAA 1GSHA 1T8RA 4K3VA 3C15C 1H1DA 5IVKA 3CIOA 3D1LA 4V0SA 2WU4A 3QXHA 2HHHB 1D03A 2C57A 4HRAA 3CUYA 1SC1A 1V71A 1YU6A 2BOVA 3E18A 4Y2GA 5DZSA 1LSSA 5EZYB 4Y9TA 3WGNA 3OY7A 4PANA 5C7IO 2FEMA 4B81A 5IW8A 1ORHA 2LDXA 4I3HA 1T1SA 1YZNA 1YDGA 4D82A 1TC1A 1WPQA 3KP1A 3OQ6A 3RIMA 3AY0A 4E70A 1DRUA 2W42A 2P6NA 3WFIA 3BXOA 4X1OA 4JJAA 2DX7A 1E1CA 3AETA 3Q2IA 3EG9A 3P9RA 4A6XA 4PU0A 1W4AA 5DO9A 2BTEA 1DC4A 1MGOA 5DNEA 1BKYA 3G2JA 4Q9LA 2NXJA 3DV0A 4S0XA 2NOAA 3HBNA 1P9NA 2Q0XA 1B93A 3I9JA 1PN3A 4KQKA 1AGNA 1ZRMA 2FFBA 4XCVA 3HDVA 3VMMA 1D7OA 3OJ0A 3P9SA 4NBKA 4TZTA 4CF3A 1K88A 4YI3A 5I51A 3HV0A 5H70A 5K8JB 3KKEA 4O2BF 2WB2A 4FMDF 9GPBA 2R00C 3TZBA 4DTIA 1O6ZA 3KQQA 1UL1X 2ZJZA 1I7NA 2PZKA 3T99A 5ULLA 3DT6A 3MWFA 4DLUA 2I7DA 2LP4Y 2C4KA 1XAGA 2MTBA 2I03A 1T5HX 3JQEA 1ZPDA 3I2HA 5EXPA 3AUXA 1JU3A 3ULKA 1J56A 1SQ5A 3EN0A 4V0RA 5ESDA 4RC9A 1N6RA 2GZMA 5GWXA 1Y6FA 2A1TR 2HWYA 4NBUA 3IJRA 5DHRA 2AN5A 3OQMA 5HK9A 1B16A 1POXA 2HPZA 2QX9A 2R79A 4MQMA 3JR7A 1I3KA 4P36A 3DLCA 3QEBZ 1O94C 4C29A 3WGUA 2I62A 3VC7A 4L1KA 1DAOA 1KZ7B 2BW0A 1A7AA 1XVLA 2J85A 1RBQA 4JGGA 3FFTA 4UTPA 5LP1A 1U0BB 2NAFA 3NFYA 1HDGO 3QVWA 4EB6B 2WU1A 1OX6A 2XYQA 3VHLB 5TPZD 1UPAA 1NMXA 1VFNA 3F3KA 3H2ZA 4TWIA 3VTAA 5CB4F 5JYCA 4XD2A 3IODA 3VAAA 3ZU3A 2E0IA 3I2JA 3AKZA 3S2ZA 4RAOA 5ALUA 2IHVA 3TIGA 5L4LA 1TK2A 3K5HA 4CKBB 1UBJS 2PXXA 4G0UA 3K8QA 4JJIA 4ARAA 4YNBA 4I1YA 3I2IA 5JI2E 1QHSA 5AI5A 4Z3DA 4A8HA 4ND8B 4PZZA 3H8JA 4AUKA 2BKAA 3ED5A 5INTA 4E31A 2G9VA 2Q6TA 3I6QA 2PUWA 1IFXA 1VB3A 5GOTA 4ZAXA 1T8PA 4FBGA 1SBNE 1Z8FA 4GLBA 5A3VA 1XQ1A 4X64B 4E2WA 5HQ3A 1M1XB 1DX9A 1T26A 2I8AA 3DNMA 3IKTA 4RD1A 1WPRA 5HR5A 1YZ3A 3EARA 1I14A 1I9GA 3MFQA 1U8YA 3N0RA 1R18A 2V3VA 3JD1A 3K9NA 2WWIA 4P92A 5F5LA 2GXAA 1JH8A 1II8B 1NVEA 3WNQA 4G5HA 3T5DA 1NY5A 3FCOA 3FBWA 1NN5A 1L4EA 1X1EA 2HNBA 5AVSA 3LDAA 1H22A 3C70A 3P0RA 4G85A 3DS8A 3QV1A 1SUCA 1CUFA 2J7PD 4IDOA 5C4GB 3UOAB 1AX9A 2ZCVA 4KACA 1S4MA 1L1FA 2G5TA 4OQNA 2VVTA 4IHQA 1MU0A 3AC0A 1ZW1A 2DKOA 2G7MC 3EG5A 3VR5A 4DXAA 4ALLA 4BVGA 1W59A 3D81A 2B78A 3GJ6A 4CR7A 1WZEA 3GFGA 1XF1A 3TL3A 4UOQA 3OTOB 2W98A 4YDRA 1ZZGA 3ROGA 2FMKA 5KI6A 5DNDA 3UMCA 2GGSA 5JD5A 2WZCA 2I2WA 2CFIA 4MLZA 5I7OA 3NNNA 3PEWA 1ZN2A 3MUNA 4JYBA 2J0UB 3CNEA 3ES9A 3TECE 1OGIA 2WAMA 2DPYA 3QF7A 4P31A 4QECA 1C9DB 1V1MB 2O0KA 4I4NA 3VI4B 4H9GA 3RTBA 5FDFA 1KDTA 2YVLA 4CFYA 1QVRA 2G5CA 5D3MB 4C0QC 5JJKA 1WW2A 2HJRA 5EZYF 3ZLTA 2QTVB 4KO2S 2I6GA 1N7IA 2H17A 3A6KA 3IQFA 4PQEA 3U6BA 2Z2YA 4QTZA 1ZD8A 5JU6A 4MW2A 3KLPX 4UMVA 4UDOA 4A0QA 3WGKA 1GUZA 1CS0A 2OAQ1 3UJ3X 2OO7A 1XCLA 4NS4A 3F71A 3R0IA 3TTYA 3UTCA 3WC4A 4IV5A 4GKKB 1H5UA 3IBCA 4GGPA 3RJZA 5DWVA 3UXHA 4PXAA 5SICE 2QRZA 1ZH0A 4GR9A 1KXJA 4UFPA 2NWQA 3KELA 5G4KA 1K92A 2Q4DA 3CWQA 4AMVA 1Z34A 1EUCA 3AIKA 1JQAA 4N3BA 4JVSB 1IEXA 5IVDA 1KY4A 4X54A 4X5OA 1G8HA 2WM3A 3PR2B 3MD0A 4X84A 3SYMA 4B34A 4EMSA 1FU8A 4BNNA 4JA0A 1URPA 1YRAA 2OBBA 3T3OA 4OUKX 4EG6A 4YRFA 1N7HA 2A8YA 5KC8A 3BSWA 3W8FA 1JFFB 1SELA 2WHQA 3KTAA 5DLYA 4IJQA 2R5NA 3VTKA 2RH5A 1I4OA 1CJMA 1YNOA 2WYIA 1MC4A 1ESMA 4QFBA 5CGQB 5J9FA 4EY8A 2OUKA 4YP0A 5K3EA 2L69A 1A69A 3CLRC 4ID9A 4UKDA 5HWSA 3TBKA 3VR4D 1VL5A 1Q5PA 3EZ2A 3VKFA 1G16A 1ID1A 2P11A 3C3CA 3D7MA 4J94A 5FWNA 1MFPA 1NUQA 2NTYC 2JFPA 1X8XA 3SF0A 4M9UA 2UYCA 1ZJWA 4MW7A 3MSCA 1C1YA 3KZXA 4PLHA 3PUVA 2ZM5A 3PPVA 3FR8A 1OTXA 1RKBA 1F51E 3RYHB 1RD4A 4ER7A 1M0TA 3BD6A 5DEIA 3PF8A 2H5LA 3WWCA 2A33A 4A23A 3D2AA 4ON9A 2WIJA 4EUKA 1LDEA 3Q88A 5D7NA 4MKGA 1E3WB 3D6MA 4HUQB 3ZTYA 3RU3A 4AQDA 1U1EA 4DDWA 3EX7C 1DJPA 1Z6PA 3C3WA 1YRYE 4FD3A 4UXIA 3VZBA 1YR3A 1MH9A 5ADHA 5BR4A 2PZJA 5BPHA 4TV9A 1P80A 4C0AC 3V4SA 4IMRA 2GD1O 1L8QA 1DXYA 2NVBA 2OHHA 2ZETA 3TLJA 2EWWA 3WYGA 3LZDA 4QD3A 4EF4A 3X44A 3IS3A 4HGZA 1KYIA 2AG1A 2VHVA 3BVPA 4RSRA 3ODPA 2B8JA 1T4BA 4JK3A 1G17A 1HKUA 3ZTWA 3KLMX 4AYWA 1UM8A 1GGJA 1OE0A 3PFHA 4K40A 4RMHA 2RG1A 1CRPA 2ZG6A 2ZOSA 5AK6A 1RAIA 3I8SA 1OHHA 1UBSB 4UFOA 3M9XA 5EJ5A 3Q10A 2NLOA 2P9GA 5AO9A 3V4VB 3DONA 4JJGA 5EUBA 4BIIA 3O8NA 1VGQA 1G291 4TWBA 3BJRA 3M5DA 4MIEA 3AV0B 2RK3A 1KDVA 3WLQA 4J1SA 3KLNA 2XVZA 3KETA 2HFJA 1JKJB 1US8A 2I7VA 3IUJA 2CF6A 3VOTA 3PBKA 1E5DA 1I6WA 1QXSA 2ZYWX 3A4LA 4PM4A 2OZEA 4OCZA 1R8XA 4XR4A 3VH2A 4DSTA 1XZCA 3AR6A 1W1WA 3SHWA 5JAIA 3HY3A 3VO2A 5CJJA 5EZSA 4BNTA 1EFTA 1U8ZA 1HDZA 3AHIA 3FYDA 4TWZA 3L8CA 1UPUA 4JBNA 4FEYA 4NKRA 4YQEA 1LCIA 2WF9A 2PUHA 3O38A 5TGZA 4BKRA 5T7BA 4DR7B 4JX9A 4GXTA 2DFKB 1MEOA 2W43A 3Q7PA 4R31A 1BMFA 4QKQA 4RIGA 1VB5A 1RQ7A 1KEEB 1B3RA 1JG7A 2NT4A 1TVEA 2MSEB 2RC5A 3A9TA 5JC8A 2ZSIA 4KU4A 1BVYF 4CKEA 5EJ9A 5BRAA 3KJNA 1A27A 3H5LA 1FK8A 4GEGA 3T9EA 4JU9A 4MJLA 4DV4B 2DAPA 4OQPA 3FPBA 2YNMA 4EJSC 3BGDA 2BKXA 3DE0X 4JL6A 3PYXA 4WNAA 2QRGA 2P3SA 4MQBA 1H8HA 2GKSA 4IMPA 3JQ8B 3NC0C 3RBVA 2ZRAA 1PWEA 3O82A 1DI0A 4O4LA 3CX4A 2A4KA 1AQ6A 1HEUA 3HKBB 5DK4A 3OBBA 2O3SA 4P32A 1AVTA 1HI9A 1Y6ZA 3EFEA 3NH6A 2QPOA 3QA3E 3OICA 5HDQA 4J0GA 1YI8A 1YJAA 1G8GA 1X7GA 4ARZA 2X4LA 2YYYA 3R44A 5HEKA 2RARA 1M2VB 4Y18A 1WBJB 2XNDA 1JPUA 4R1TA 4G5RA 2MYPA 2DCMA 3E27A 2IV2X 3RK4A 1C9MA 3WE7A 3ZDCA 2IJGX 1DBSA 3WV4A 1IXKA 1YQQA 2H1CA 3OT1A 1UF9A 3A1FA 4LDJA 1UJ2A 1U8CB 1OLXB 1W25A 2R8RA 1SHKA 2XI4A 1G5HA 3DDUA 4MUBA 1K7XB 2K5UA 1ZK4A 1BDJA 5LQDA 2RD2A 2WUVA 2R1VA 3FDIA 3GW8A 5I47A 2ERCA 1IBRA 2A86A 1JKMA 4M9SA 4YT2A 2PKQP 1QCYA 3O8QB 4U2GA 2A5GA 1NVGA 3KAPA 1M1ZA 2ODNA 2C95A 3BH6A 1K5DA 3Q3GE 1T0HB 3TR6A 1QONA 1SUWA 4JSYA 1RDFA 1N6KA 2OB1A 2PZMA 3IRUA 3U4AA 5HOEA 1NMSA 1V3TA 1I4TD 2LD4A 2N42A 1W6RA 2NTEA 5CH3A 5BNFA 3O1LA 4XOUA 1D2EA 1N5IA 4Q12A 2R68A 1QSGA 2YN2A 2A6PA 2UZ1B 3HVKA 4FWBA 4M99A 1WV0A 2XKKA 1G2OA 4I6GA 2C5GA 2ZIZA 4HY3A 3AT1A 1OWNA 2VDKB 5AJZA 1SVSA 3VH1A 2VDLB 4FR2A 4I4CA 4I1OA 2VDQB 4FP9A 2ZBPA 3DLTA 3KB6A 3NHMA 2XODA 3VKUA 1QYRA 4YDQA 4W1PA 4IXWA 1B0ZA 1CBUA 4F6CA 3QEKA 4QOIA 5EZ5A 1PR0A 4CIAA 5SV2A 5JADA 4QJIA 1BE8A 4HP8A 5E9AA 5HG0A 5HX7A 4LCEA 4ZKDA 5LIRA 2PUEA 4Y6OA 3E4CA 2Q29A 3VBEA 4EG8A 4ZO6A 4LRWA 2BLNA 4Z9AA 2VK4A 5LA6F 3DWEX 3L9WA 4WKBA 1ZL0A 3B8HA 2PZFA 4M87A 1ZITA 3E58A 3WLEA 2Y66A 1K8ZB 3NORA 1ENYA 3V8QA 2M32A 1COWD 3UKJA 5A04A 2FFJA 5BOSB 2YNMC 4S0ZA 5L3QB 1EFRA 3RW9A 3VJLA 4B17A 4OXKA 1OXVA 2OCLA 3MOIA 4MQFB 4U0KA 4IOKA 3TX2A 1QIHA 3ROEA 1NONA 1GRVA 1E2BA 1VHQA 2V3CC 1GRCA 3H2YA 1LBIA 4QHYA 4NBLA 3CB2A 4Q9IA 1E2PA 2X4IA 4HAXA 1E0JA 5IX8A 3GEGA 4Q3AA 3KFXA 1QIJA 4RNDB 1GLGA 1G6KA 1H23A 2VNHA 4X20B 1BXGB 3DP7A 3U7QB 3N39C 3R3XA 4JU8A 2QRVA 2FW0A 4QWMA 5A6SA 5H83A 1JLRA 3R8XA 4XYEA 1S89A 1XLTA 1GNRA 3ETEA 2OK8A 3MJSA 1JR3D 1WQ4A 3ILHA 3TOCA 5IAOA 5IDYA 2QN8A 5C80A 4K81B 3A4MA 1YS1X 1R4ZA 2FLVA 3G3EA 4FZ3A 4JBGA 4PGHA 1YHYA 4ZOLB 3ZKAA 5JECA 4AKSA 3BIOA 3SLRA 4UDNA 2XOKA 3QE3A 1MZVA 2PT7A 3O94A 5TQ0B 4QTYA 2WABA 4GWGA 8ABPA 4U7DA 3U4QA 2QG4A 3QE4A 1NM5A 5E0KB 2PG3A 3FN4A 5HILA 2PS3A 4LOKA 4WDRA 1G5PA 3F8SA 4W5NA 2JLAA 5MHTA 3D8RA 3GDFA 4G5QA 2JANA 2BSXA 2IHJA 1QS0B 3M8KA 3G13A 3HA5A 2X8WA 1WKCA 3C4QA 4HYTA 3V8MA 2V58A 4Z2YA 3HG7A 4MI1A 1CUDA 1G8FA 5T67A 4KR3A 4LW8A 4HZGA 4Q9AA 1HM5A 2CNWA 1QOQB 2QP4A 3JQPA 3T95A 2ZVDA 4ZV9A 1G4UR 3FVWA 2FPUA 2IYVA 2JLQA 3AGPA 2FPKA 3STXA 1T29A 5CTAA 3WRWA 1KIAA 2X8LA 4WRRA 1BW9A 2RGCA 2IIBA 1ODSA 4CKZA 2ZUEA 2VPTA 2JGFA 1VPEA 2JAQA 4DZZA 5C34B 5FOXA 3U37A 2ISSD 1Z9BA 2LIPA 4Q01A 4HNHA 2NP6A 1SXGA 1FTSA 4ZOQI 1AOXA 4TT3D 4HDMA 4R51A 1BRMA 1GPMA 1P1JA 3NCHA 4KPFC 2XA9A 1QBKC 4INJA 4JBXA 1FNNA 2J6HA 3MS7A 4IJ6A 1ZWKA 5ESXA 5F52A 1KE1A 5AXBA 1LRKA 1CUJA 3T3PB 1GL7A 4QUJA 2UV8A 4URFA 3FCSB 3HUUA 3CW2A 4X1YA 2FP4B 3KL4A 4ZRMA 4CMKA 3D6TB 5KTMA 1POWA 1J4AA 1WOMA 1JDVA 3HXMA 1CF9A 1OWPA 1DIBA 1JNXX 1IBCA 1SXJE 3F7MA 4WE3A 1TKRA 4P4NA 5FF9A 2GHIA 1BOOA 3DZHA 4MICA 1Q1EA 2FZEA 4DABA 4M6WA 5AI6A 2FV8A 3H4MA 3TW8A 4YXFA 4H16A 1JJAA 2OOKA 2B4YA 2AVNA 2O5RA 2V6MA 3DUWA 4NTZA 2ZRCA 5H68A 4XWGA 2ZAIA 4LJYA 2DKFA 3OHPA 5B58C 4JNCA 2QZZA 1Q7RA 2XB4A 1C9JA 3EIEA 4CW7A 4DVGA 3HCCA 2HLDA 2ZAOA 3OJLA 2Z08A 1P0FA 3CCFA 2AF3C 2QDKA 3PNYA 4HWGA 1DMSA 4YHHB 4OMUA 3J81A 1WQ3A 1DAGA 4IV8A 3WLLA 1E4EB 4MX8A 4L76A 4LDQA 1W48A 1NXTA 3HCRA 4JOSA 5HF5A 2QGNA 2CE2X 2NXNA 2N3ZA 1E79D 2O3RA 4YA6A 4DNXA 2UVPA 2XMDA 2CF5A 2FW7A 2YHIB 3WYCA 3SJCA 2D1FA 5B57C 2CJYA 2QV7A 3BK1A 2GN9A 3LF2A 4J1TC 4WERA 1C8LA 4YJFA