3FPFA

Crystal structure of mtnas in complex with mta and tna
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
SCYIYWDKIKRIASRLEGMNYHFDEMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLEMEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITGFRRAGVVLPSGKVNNTSVLVFKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein, transferase
molecule keywords Putative uncharacterized protein
publication title Crystallographic snapshots of iterative substrate translocations during nicotianamine synthesis in Archaea
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 96
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03059 NAS Nicotianamine synthase protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fpfA00
3T7SA 3GJYA 5F2NA 4DQ0A 2B2CA 3M6XA 3FPJA 2Z6QA 1EJ0A 3BKXA 3HA7A 3O7WA 4IKPA 3UBTA 1NBHA 1EQAA 3BWBA 1I1NA 3DXZA 1YB2A 1XJ5A 4ATNA 3NTVA 4AZTA 4POOA 3AJDA 5DXJA 2B25A 4IWNA 3I58A 2KW5A 3FRIA 3V8VA 4YUYA 2AOXA 1JG4A 8MHTA 5EIFA 3BT7A 2CL5A 2IFTA 5K09A 1Q0SA 5BW4A 1F3LA 3KQYA 3IYLW 5DTQA 4GC9A 3ORHA 4E31A 1XXLA 1I4WA 3KQMA 3MERA 4DCGA 5HILA 1QYRA 3M6UA 3NVMB 3SXJA 4YUXA 3OZTA 5GIOE 4OX9Y 3HVKA 3IV6A 2JH8A 5FTWA 1M6YA 4C03A 4PIMA 3TKYA 2NNWB 5IH3A 1KYWA 3EGIA 1SUSA 2XVMA 3G89A 2NXEA 1PJZA 3GWZA 2ZZMA 3FYCA 4C08A 2BR3A 2JHCA 4E2YA 4JXJA 2ESRA 1VQ1A 1R8YA 5DSXA 3TMAA 2ZSUA 1VL5A 3V97A 2F8LA 4BY9E 3FTFA 2H11A 3AY0A 1O9GA 1JQ3A 5E1BA 4E33A 3G2PA 1G8SA 3JWHA 2FPOA 3O4FA 4PWYA 3EMBA 5DLYA 4FP9A 2IH5A 2QYOA 3UA4A 3KR2A 4QVKA 1G8AA 1YZHA 2IIPA 3GRUA 4EK9A 5DX1A 3KKZA 1MHTA 3PX2A 1TPYA 2PJDA 1XCJA 1R00A 3P9IA 2PBFA 3HVJA 5FCDA 2B9EA 3OU6A 2C7QA 3LCUA 2Q41A 2YTZA 2GAFA 3FPGA 5JUWA 1F38A 3JWIA 5GIPE 2G1PA 4CWAA 7MHTA 3LKDA 2BM8A 3HA5A 3TM4A 3NMUF 4RTQA 2HMYB 3HA3A 1HMYA 2AOWA 3O31A 3CVOA 4V0RA 1ZGJA 4RTPA 3FUVA 5FWAA 5E2AA 2ZBRA 2B3TA 3HNRA 3LCCA 4KIFA 3TRKA 4EMSA 4X61A 2AR0A 3SR4A 4RTKA 4RVFA 3C6KA 1AV6A 3MAGA 3FPEA 3G2MA 5CM2Z 4DM3A 4FT2A 5EKXA 4KDCA 4EKIA 2V7EA 3CGGA 4E2XA 4E2ZA 5EZSA 3DUWA 5GM1A 4PYJA 5C9ZA 2VP3A 2ZFUA 5H02A 3G5TA 3QV2A 1NT2A 3OU7A 5D1HA 2P8JA 1XVAA 1ZKDA 2YX1A 1NBIA 2NXCA 3C6MA 4QDKA 3ID6C 4E32A 4YV0A 3FPHA 2BR4A 3GRZA 3NW9A 2ZLBA 5IKMA 4M7RA 4HGYA 1O9HA 3FYDA 1D2HA 4FZVA 4HC4A 3SX0A 1RJFA 3GIWA 3NDIA 4FS8A 1JTEA 2PX4A 2NP7A 3A25A 1YF3A 1ZGAA 4X41A 2GPYA 3G88A 2HTEA 1OR8A 3MTEA 1KPIA 3EEOA 3UJ8A 3NDJA 3QOXA 3KPVA 3P2EA 3MB5A 1NW8A 3NJRA 3B3GA 3CC8A 1O54A 5K0GA 3AXSA 4RTOA 3P8ZA 2FHPA 4YV2A 3TQSA 1WZNA 2LD4A 5DM0A 2ZBPA 3SSNA 4PGHA 4H0NA 4UOEA 5EHIA 2PLWA 1P39A 1BOOA 3EVDA 4PYKA 4CTKA 5CD1A 2HV9A 2VZ9A 3WSTA 1UFKA 2C7PA 3KQOA 3REOA 3A7EA 3UJCA 2FK7A 2IBSA 1NW6A 4X63A 2PX2A 2WA2A 3TLJA 1RI4A 5CVEA 3Q87B 4A6EA 3UZUA 4M38A 1D2GA 2PX8A 2ZWAA 1ZG3A 3BWCA 4P7FA 4R8RA 2N47A 5T64A 5LQRA 2JHPA 2OO3A 1PRYA 2ORED 1KIAA 1DUSA 2OXTA 5EQJB 5K0FA 2Y1XA 3EVBA 3FRHA 5K05A 3VC1A 2O07A 1NW3A 1X1CA 3R0QA 2EX4A 2YXLA 5FHRA 5E9WA 5HFJA 5K0BA 3GRVA 2AN4A 5DX0A 4YMHA 5DTRA 4RTJA 4AZVA 3R24A 1WG8A 1KXZA 2IPXA 4PCLA 3T0IA 5G02A 3JWGA 3B3JA 4PONA 2V74B 1VIDA 2ZVJA 1SG9A 2ZZKA 3KQPA 3ELDA 4MWZA 3KPYA 5CVUA 5HIIA 3U81A 3FUTA 3EEYA 3HCBA 3KQSA 4GUAA 5FA8A 5K0LA 1JTFA 5EMMA 4RTLA 3TR6A 4QPPA 3HCFA 1R6AA 4V0QA 4QVGA 5DXAA 5T6BA 2ZIFA 1G38A 2AZTA 3M6VA 5B1SA 5BXYA 3A26A 1JG3A 3L8DA 4EVIA 3AXTA 3KQWA 5D1NA 5LR6A 1UWVA 1YUBA 2H00A 2P41A 3EVZA 3LECA 5KQRA 5EEHA 1D2CA 4CTJA 4F86A 2PY6A 5FHQA 3QOWA 3DMHA 4GEKA 2DPMA 3LSTA 4XCXA 1VPTA 3P9KA 4KW7A 4P58A 5LQJA 5LQUA 3EVFA 5T67A 2AOTA 5HIJA 3GXOA 2P7IA 3PVCA 3DMFA 3FTDA 1JG1A 1SQGA 1Y8CA 3GGDA 2G72A 2DULA 4GC5A 5FA5A 5ICEA 2IH2A 3G2OA 3DULA 1FP2A 3BUSA 3KHKA 4C07A 4CKCA 2YQZA 5LQNA 3OPNA 2QE6A 2E5WA 2Z6AA 4ISCA 1R74A 2P35A 4MTLA 1EIZA 3UJ9A 1X1AA 3SM3A 4C06A 1KPHA 3EGVA 3R3HA 5ICCA 5LQKA 3GCZA 3UJDA 4HGZA 1Q0TA 4RVDA 3I53A 4DA4A 3PS9A 5DPMA 5U4XA 1I9GA 3P2KA 4C05A 2PKWA 3SSOA 2HNKA 3VSEA 3BZBA 4AX8A 3DP7A 3GO4A 2ZCJA 5FQOA 1SUIA 1BC5A 3FTEA 2YXDA 2FK8A 4B17A 4Y30A 3NWEA 4HRAA 5KVAA 3P71T 4KDRA 4YUVA 4U7TB 3DTNA 3TFWA 5EPEA 2I62A 2FRXA 5K01A 2ERCA 1RJGA 1L1EA 3OE4A 4PGGA 3UJAA 3BGIA 1RI2A 4QQNA 2P3QA 5DM4A 3KPJA 3KQTA 2ZTHA 4OBXA 4BLUA 3OZRA 2H1RA 5EC8A 4PYNA 2CWWA 4OBWA 2CMGA 1XDSA 4RYLA 1M6EX 2P7HA 3EGEA 1AF7A 3DOUA 2ADMA 2BM9A 3A7DA 2ZZNA 5CVVA 5C0OE 4ER3A 2XBMA 2GLUA 5KQSA 3OZSA 2PXAA 3DLCA 4GOND 4MHTA 2IP2A 4IV8A 4GOMD 3G7UA 3PT9A 4GOLD 4PYMA 3UFBA 4C4AA 4ER5A 2AN3A 4X60A 4AZSA 3C3PA 4FGZA 4KVZA 4Y2HA 5CUQA 2I7CA 3H2BA 1KP9A 3X0DA 2AN5A 2ZBQA 3M6WA 4RVGA 1VP9A 2G70A 3FTCA 3IEIA 1EAMA 5E1OA 3LBFA 4LWOA 4BP1A 5BW5A 1M0EA 3TM5A 3CBGA 2O0LA 3K0BA 1QZZA 4AUKA 1FPQA 1IXKA 3KR1A 4CXMA 2JG3A 2Z6UA 2GS9A 4U7PB 3KR0A 3C3YA 4RTMA 3B7PA 3HP7A 3SVZA 3UWPA 2GA9A 2O57A 2ZWVA 3LPMA 5DWQA 2OBFA 2WA1A 1IY9A 3GU3A 1G60A 3RW9A 3PLAE 2JHAA 3VYWA 4RWZA 5E1DA 1SVUA 2IDKA 2PX5A 5CCBA 5MHTA 1WS6A 4R6XA 1X1BA 2VS1A 4RX1A 1NW7A 4P7KA 4DF3A 5HOQA 2OY0A 4LWPA 3EVCA 2EG5A 1ZHFA 3KQQA 3M33A 4ER6A 2HWKA 3B5IA 2I9KA 3CKKA 3ERCA 1QAMA 1X1DA 1INLA 2CMHA 2PT9A 4BLWA 3SGLA 4PNEA 1R18A 5K0EA 3FUXA 4DKJA 5C1IA 5LSAA 3BWMA 4PCAA 1WXXA 4PYQA 3HCEA 3HM2A 4OQEA 2IBTA 5ICFA 3OU2A 4KWCA 5K8VA 3PX3A 5EGSA 2Y1WA 2FYTA 3LDUA 5HEKA 4YUWA 3UJBA 2AOTB 1ORIA 2CKDA 5DX8A 1R8XA 2I6GA 3B3FA 4ZTBA 4R05A 3ER8A 4O29A 1NKVA 3MCTA 5E8JA 4BP3A 3MHTA 2BH2A 3UA3A 4QQKA 1L3BA 5M5BA 1L3CA 2O06A 1V39A 3BKWA 5K0CA 1KR5A 1NV8A 1YZ3A 2AOVA 1L9KA 4IV0A 5DRTA 5DRYA 4LG1A 3G8AA 1N7IA 2QRVA 4QTTB 5EMKA 3LHDA 1P1BA 2C7OA 3KR9A 5ICGA 1YFJA 2QY6A 5DM1A 3EVGA 4GF5A 3P9NA 3S68A 4WXHA 1IM8A 3BXOA 5E1MA 2PWYA 5DT2A 4ER0A 5CVDA 2UZ4A 5DTMA 2OB1A 1RI5A 3SSMA 3I9FA 1VLMA 2ZIEA 5FULA 2VDVE 5KYGA 5CVJA 3E7PA 3G5LA 5GWXA 3PFGA 3DR5A 3GNLA 3R6TA 1VBFA 3M70A 4FR0A 4KRGA 4R8SA 4XUEA 4X1OA 3THRA 2NP6A 5EHGA 4GQBA 2UYOA 2OB2A 2GH1A 5EZQA 2PWPA 1TW2A 2R3SA 4FT4A 3G8BA 5K0JA 2IH4A 2C7RA 2BR5A 3LDFA 1RI3A 3DXYA 1RJEA 4K6MA 3EPPA 3HTXA 3OE5A 4HSGA 1KHHA 4OA8A 4HG2A 5P8WA 3FPFA 2OYRA 2OZVA 4P7JA 4RTRA 3KQVA 2PXCA 2VDWA 5F2KA 4HTFA 2AOUA 1SQFA 1XDUA 5FWDA 4P7GA 2XYQA 3UJ7A 3EVAA 4MIKA 2PGXA 2P1DA 3OFJA 1JSZA 3PB3A 1G6Q1 3NWBA 4PYIA 3A27A 1RJDA 1P1CA 2P40A 2XYVA 4RVHA 3PFHA 5EIWA 3T7TA 3E8SA 3VC2A 2PV0A 3CJQA 3ELYA 2VDUE 3MGGA 3PTAA 3MQ2A 3E05A 5E2BA 3THSA 1EG2A 3I5UA 2IGTA 4NECA 3RIEA 3E23A 2WK1A 1FP1D 5CIYA 2QM3A 4RV9A 4RSRA 1QAQA 3BGVA 2O05A 2HR1A 2NYUA 4PIPA 5EMLA 4C04A 2GB4A 3R9XB 2OPBA 1NV9A 1FJXA 3ER9A 3IHTA 3DMGA 3G2QA 2FCAA 3HVHA 2YUIA 3ANXA 4PYLA 4ER7A 5GOZA 3DH0A 4QDJA 2EFJA 2NXJA 5EKUA 4YMGA 3P2IA 3P9CA 5HIMA 2PSSA 1TW3A 4OQDA 5EEGA 1FBNA 4BLVA 4RTSA 3ELWA 4F84A 3BWYA 3LGAA 3CJTA 5GM2A 4R6WA 5KS2A 1Z3CA 1NW5A 4EQZA 5E8RA 5E9QA 5LQCA 1SKMA 4RTNA 1BHJA 3LCVB 4QPNA 5FQNA 2ONYA 2PT6A 3GRYA 4CKBA 3T7RA 1H1DA 4E70A 9MHTA 3MCZA 1EJ6A 1VP3A 4MQ4A 5DSTA 3ELUA 4E30A 1HNNA 5EG5A 5ERGB 1XCLA 2JJQA 2ZW9A 1ORHA 1VE3A 5HZMA 3FUUA 4WVLA 3C0KA 5F2OA 3F4KA 1YFLA 3RODA 5EVJA 3EVEA 3HCDA 2QRVB 1MJFA 3KU1A 3LDGA 4PINA 3HCCA 4DZRA 3MTIA 2UYQA 2EJUA 4HH4A 4XUCA 3LKZA 1KPGA 1X19A 3Q7EA 3BGDA 3KPUA 4E2WA 1NE2A 3KPWA 2P3LA 2ZULA 4M36A 4FSDA 1G55A 1L3IA 5BP7A 5K03A 2UYHA 3ME5A 3B89A 2NXNA 2G71A 2XYRA 5HIKA 1AQJA 2AS0A 10MHA 1DCTA 4PYOA 5GINE 2AVDA 3OFKA 3DLIA 3TKAA 3TPZA 1N2XA 4Z2YA 3A4TA 4G56A 3LBYA 1WXWA 2YVLA 4DMGA 5LQAA 4A6DA 5CCXA 1P91A 3D2LA 5FADA 3LL7A 1T43A 4DCMA 1XDZA 2AVNA 2P3OA 3GRRA 2XVAA 5GP1A 3JWJA 1JSXA 4XUDA 2EJTA 4L7VA 4EKGA 4YV1A 2K4MA 3M4XA 5JR3A 4KIGA 2A14A 2PXXA 3HVIA 4F85A 5EMJA 4OA5A 2G8NA 2YR0A 4HTFB 2AOUB 5K0NA 4AZWA 2UYCA 4LECA 2ONZA 2IDJA 3HCAA 3NVKI 4YUZA 3TOSA 1U2ZA 3EMDA 2OKCA 3FZGA 3LX6A 1AQIA 1UIRA 4QTUB 5EOVA 4FSXA 5E9JA 3DXXA 1JQEA 2JH9A 1KYZA 1QANA 1JG2A 1DL5A 4GOOD 3P97A 3AWIA 3FUWA 1QAOA 1N7JA 2R6ZA 3OCJA 1XTPA 5DM2A 3SMQA 2PVCA 1BKYA 1JR4A 1WY7A 1ZQ9A 2ZIGA 3CCFA 4M37A 5FUBA 4CKEA 2B78A 2YXEA 3K6RA 3GDHA 1RI1A 1B42A 3HEMA 3UJ6A 4GBED 1JQDA 3I64A 3CJRA 2BZGA
chains in the Genus database with same CATH superfamily
1FZTA 1JSRA 1SK8A 4BUJA 2K7ZA 4M8LA 4G1CA 5JQGB 5K0SA 4N8DA 4RKWA 4KAXA 3SOPA 4IKPA 3BKXA 3CTMA 5JAQA 6REQA 1U9IA 2WYHA 1K5DA 3GLHE 4M1MA 3S7TA 3V8NA 4CCSA 4ZI7B 4PAWA 1K5GA 4D4LA 3UG6A 1ZI6A 3QE4A 1XRQA 2IE8A 1C3OB 1YULA 1JG4A 4I55A 4U2BA 3AEUA 1W5AA 2SHKA 3EHDA 3H04A 4NYJQ 1DQRA 1SUPA 3VO2A 1R6UA 1NMYA 1SVOA 3AUAA 5GVSA 1FCJA 3FSRA 4DCGA 1CJTC 4RVUA 3ZHUA 3H5TA 3DWGA 3SAJA 4WNCA 4YY3B 5BYBA 1PZHA 1JXOA 1BS1A 1GQFA 1T5IA 3IV6A 5LMZA 2J9XB 3IOBA 2F90A 3ESAA 5D7BA 1R5OA 4QGHA 2Z04A 2OAP1 3OQJA 4FWBA 3DTYA 3IAUA 3HZHA 3CVUA 2HK6A 1FB5A 1HFKA 1SZCA 1VBNA 4Y2SA 3TD2A 3U4QA 2MMCA 2OCLA 3A1EA 4JQOA 4Z4EA 1ZIOA 3HDYA 2RGGA 3X1MA 3P27A 4UVGA 5JSZA 5IF9A 2XMRA 4RESA 1Z2AA 4BUCA 4MPRA 3PRHA 1A8QA 4OSEA 4DT1A 1BZYA 4LJRA 1MHTA 3HR7A 2H7XA 3TE7A 2GYUA 3TZHA 4P5DA 5SY9A 4TKLA 4JVNA 1PQPA 4G07A 4KLZA 2HLHA 4C0HA 1JMYA 4ZQCB 5J2TB 4KV7A 3IE0A 3BPSA 5HKAA 4NJMB 1E6MA 3JQ9A 3FPAA 5EIOA 2HMYB 4HUJA 4BASA 4RTPA 1V6AA 4FFDA 2ADOA 3PDUA 1QX4A 3CLUC 4B6EA 1RRVA 4J0KA 3HNRA 4KIJA 3BH6A 1T2FA 3I4FA 2AR0A 2QL9A 3OT1A 4K3UA 3VR5A 4WBNB 5FUMA 2ZT7A 2XNJA 4QAQA 2CK3D 1N9GA 1UDXA 1VZ3A 1Z7YA 2B3DA 2QROA 3KB1A 3WLOA 2YJ4A 4RE6A 2X2PA 2IHKA 3Q8XB 4DLYA 2I5PO 3G49A 2VP3A 5KDLA 2C4UA 4Q1BA 1Z6YA 1YZYA 3AR4A 3G5TA 1IZ8A 3VTFA 2WICA 3SHOA 3X44A 3ISJA 4JEIA 3O75A 4D9FA 1Q2XA 2L2QA 1Q16A 1S2MA 2K87A 2VHZA 4IX9A 4J2HA 2VJPA 4JKIA 5J2UB 3NLLA 3T1QA 4B1FA 3BD7A 2QQ5A 4PXAA 1N3IA 2REXB 1ZD4A 3TZQA 2FEAA 3HDHA 4GSYA 4J49A 4HGQA 4LE2A 4FS8A 2AFIA 2C2HA 4R1LA 2XMZA 3BJIC 2ZTUA 3E9QA 2AGVA 1F5NA 3C3CA 1L7PA 4JLKA 1I36A 4PLGA 4PQRA 4XTCS 4D42A 1OI4A 1I7PA 4GX2A 5DMHA 2IPMA 4HSEA 3UJ8A 4MEAA 3KIPA 2K6GA 3NT2A 5CFOA 1KH2A 1YL7A 4LRYA 4QD3A 1RLIA 4J0FA 5AI5A 4WOCA 2CJPA 4Z0TA 2SCUA 3IAFA 4KSBA 3H2YA 3LY9A 4Y2UA 3TINA 1QVWA 1IBKB 2ZAGA 1XZNA 3D3WA 3BD6A 1M8GA 1H69A 4U8GA 2OOSA 2W2XA 1CVIA 3D8HA 3U3RA 4ZHQB 4N39A 4ZAFA 5EXDA 4OUDB 5IKPA 3GA5A 1G5IA 1H6BA 4RJ2A 4EYQA 5ELXA 1S2NA 2FW8A 4RM3A 1GCAA 4TTTS 4AULA 5AIBA 4EF5A 4II3A 3NIDB 4QWWA 5LCXA 1NX6A 3LM8A 1NX9A 2VPYA 1LRKA 2RI6A 3QVUA 2XOKD 3GLIB 3BE4A 2DEUA 1UMKA 2F64A 1IWBB 1LCIA 4J6FA 3NT5A 4ND1A 2YZKA 4N9WA 4ZXFA 1Z4QA 3M4YA 4TVSA 2N1MA 4RSHA 4QHTA 4KR9A 1XZIA 4MICA 7ADHA 1SXGA 5HFJA 1SD1A 4E7OA 2AFHA 5BQ5A 2GEVA 3N7TA 3SN6A 1OWNA 1TDJA 4C4SA 1R4NB 1WG8A 2Y9MB 4KLRA 4OIMA 5HF6A 3L5KA 1S1CA 5CPFA 3VTZA 1KYIA 3W34A 1I6KA 2I4OA 1EP9A 4GBJA 4O4IB 1EX9A 3AESA 2JGNA 4JJ8A 4QRIA 3FUTA 4R83A 5DDIP 4ESEA 1ADBA 1JTFA 1UJ4A 4JL8A 3CH7A 1CIVA 4UMEA 5BORA 3HJHA 3MW8A 3EF3A 3SP1A 3E3LA 1V11A 3M6VA 2GCOA 4MMYB 1QHYA 5HSGA 2P6NA 3A3KA 3EGDB 2UUPA 4FMDF 4C0KA 3PPIA 5KQRA 4CNQA 3U7QA 5FHQA 3DMHA 3G9XA 1P5JA 4XCXA 2XAUA 5CB0A 2ZM5A 5LQUA 1NVAA 1TM7E 2X7HA 1A04A 5T67A 3T7EA 1H0HA 2QAJA 3KT0A 2FWMX 4TTVA 1XZ8A 3GXOA 3H1AA 3T15A 3T34A 3TAXA 3PUZA 3OQHA 4GEGA 2OEPA 2YV1A 4KU4A 3D43A 1NM5A 1JG1A 4H7JA 1Y8CA 4LYHA 2G72A 2OAEA 2FPWA 3FNGA 1Y5LA 3JZDA 5AM1A 2CXUA 2V6IA 4JQCA 4B3GA 4Y0AA 4LZZA 2B7CA 3MTGA 2VK4A 3T54A 2JCXA 3O0TA 4TUYF 1GXSA 4MW5A 2DQSA 1EM6A 4RHUA 1TEZA 4MVJG 4J8PA 4Y9DA 1HTBA 1RTTA 4LMRA 4Q1FA 2VP2A 1M0WA 1EX1A 4NI5A 1EFVA 1G9XA 2Q3EA 3SM3A 3UT5B 4DEXA 5FPPA 5JHHB 5FBRB 3ZU3A 5M7EA 4K9NA 4JMLA 5K6TA 1RM3A 3W9YA 4PSCA 1L5YA 3TW8A 1RABA 4EGCB 1FMLA 1CZLA 4X1YB 1E1KA 2E49A 3DP7A 5K3DA 5FQOA 5HS4A 1BC5A 2D2VA 1NJ5A 4WLNA 1C30A 1TB4A 5KKCA 5M34A 4G9BA 1VRCA 3BE8A 5EP1A 3HV0A 4CQJA 7REQA 1MT0A 4G1VA 2BTEA 5TGDA 3OE4A 4AP6A 4EHBA 1RI2A 4K9DA 4DV0B 1YJ8A 1M10A 3Q3IA 3DBHA 3Q6MA 1DAKA 3T99A 2CWWA 4TYQA 1A7KA 1AKMA 2RH8A 2P7HA 2R8PA 1UDWA 2BSXA 3OOSA 4M1ZA 4N12A 4OP3A 3DOUA 4AMZA 5HRCA 2FW9A 3FCOA 1MC8A 3N8IA 3HDTA 1IY1A 1ODSA 4IUBS 2XUAA 2Y93A 1P0IA 3G7UA 3VNBA 5IM4F 1XMSA 5AVTA 4XXHA 2ZUCA 3NH6A 3JALA 2IY8A 5KQPA 1FUYB 1N6NA 4LJSA 1U0OC 1Z26A 4R1NA 1A9YA 1GRRA 3AFNA 2CXSA 4UHJA 2YWXA 2PVPA 1KEZA 3VVBA 3INGA 3VJLA 1HDCA 4W99A 3VSDA 1Z8DA 1QZZA 1QV9A 2HC9A 4YXWA 3R7WA 1MX3A 1NNLA 1O6FA 2P78A 1TADA 3AUFA 1Z9BA 4WLFA 4YALA 2CCGA 3HP7A 1Q44A 4LHXA 5EUCA 1XZDA 3BWDD 4HV4A 3ZIUA 1QP0A 3N05A 3BB3A 1V2GA 4CQLA 2JDIA 4R2WA 6AT1A 4YMUA 2WV9A 3LG2A 2VWPA 2IY9A 3JQAA 3WLAA 4TKMA 1IXSB 3LK6A 4TV8A 1X1BA 1R7RA 2QYHA 4P7KA 4RD3A 4QPJC 4YJ2A 1HRDA 3BERA 2J3JA 1IRXA 1NXPA 3DC2A 3PYLA 1X86B 3CKKA 1QAMA 1UC8A 2A5DA 2W2MA 4Q03A 4ZQBA 5DLEA 4PNEA 3A1NA 2PGNA 2A67A 4JLVA 4G4GA 4UCXA 1QRTA 3IIJA 1G8YA 4B4OA 4D1YA 1OXUA 3ZU2A 4DR5B 2DT5A 3LP5A 1USVA 1U2RA 1HDGO 1CFJA 4QEZA 1WSWA 3KQHA 1ZD9A 1QHIA 3OT5A 4PCUA 2V7GA 1F8FA 3H6KA 4YS6A 3ND8A 2Z6VA 3AUUA 1H3FA 2AOTB 5I9SA 5GV8A 1W1UA 2Q2VA 1U6JA 1EP2B 4JFAA 5T4EA 4ZAZA 1O6CA 3DQQA 4K88A 4C4XA 3DUFA 2HQ1A 3HBFA 3W05A 3GFGA 3UUGA 4TLLB 3STYA 3K0EA 1EUCB 3Q5EA 2O06A 4WRRA 4CN8A 1ZS9A 3L8HA 3RC2A 4LSZA 2JFBA 5H3LA 1NXOA 5HXAA 3S27A 1ZJWA 1L9KA 3L7BA 1SGWA 2RAVA 1OKKD 3HNOA 1PBTA 1V96A 2NADA 4N3CA 3RF7A 1Z73A 3Q98A 3HJCA 5D85A 3EVGA 3OPYI 3O5AA 3SFZA 4M0PA 1H2WA 3S68A 4AF8A 2ZI5A 5E1MA 3D64A 4ER0A 5DTMA 3N7UA 1NBOA 1DGQA 2B4QA 3N7AA 4M7WA 4U7DA 4IKOA 1K88A 1OREA 3ZKWA 4E2FA 1CVLA 1VI6A 3ICOA 3NGLA 5KJCA 1R4MB 1LPBB 4Y2RA 4KJXA 2MR6A 3U7GA 1RAHA 4AZ3B 2ZP1A 2G76A 3O38A 4KRGA 3WGJA 4BX9A 5H9VA 1YZUA 1RHMA 3B1ZA 3ROZA 4D9BA 3ADBA 4UTVA 4JB2A 1PV1A 3KZNA 2OXFA 4Y2VA 4A6PA 2QUBA 1W88B 2FQXA 1ZSNA 2HU8A 2P62A 2IH4A 4R2JA 2WTBA 1CZUA 1EH5A 1W76A 2AE2A 5SY4A 3GJ7A 4AYWA 4BEWA 4KP7A 2VK2A 1QHNA 3HLTA 1KI3A 4PO3X 5FFMA 5P8WA 4XDHA 3S70A 4BU0A 5A4JA 5CHYA 1A5SB 3V4LA 3KAKA 4YIKA 4E7PA 1W75A 4KGDA 2XYQA 2V5VA 2OQIA 3NKFA 1BH6A 2QJTA 1SU6A 4PYIA 3N87A 1KRWA 1FLNA 2XYVA 4AB1A 3TGPA 3CN7A 3FROA 2XUOA 3ON5A 3TLBA 4MVJI 4ZDWA 3UY4A 3WNZA 4M1YA 2EJWA 1GZ4A 3UAXA 1TM4E 3IPLA 3IUQA 3U17A 4EKYA 5A4FS 3DF7A 1GRCA 3H1EA 4IIJB 3AO0B 3ONNA 1C9DB 4FBGA 2I91A 5B7NA 5MFPA 4IHQA 4RSRA 2BPOA 4IGEA 1F2VA 3OT4A 1E96A 3MOGA 3DE1X 3FTQA 3GLHA 4I19A 3Q9SA 1L5GB 4OKSA 1BCSA 2AK2A 2TMKA 4KPEC 2JFGA 2W6ZA 2O2SA 1PGOA 1XNGA 3OZGA 4ENTA 4HVLA 4BEJA 3IHKA 3EMVA 4ZT5A 3WYEA 4A1FA 1Y33E 3MBOA 4OMCA 2BFBA 2IOYA 4YCDA 2G9NA 3PCTA 1KQ3A 1Z35A 1VL0A 4MMZB 1U3GA 4N82A 3UJHA 3HDGA 5C80A 4BAGA 3QVOA 1U8AA 4FEAA 3TTVA 4H7IA 2C0PA 1VPWA 2RK6A 3ELWA 3GJZA 4LDZA 4DREA 4IGAA 5KWSA 1A72A 3NS7A 3F1KA 2DHQA 2VF2A 3MJFA 2HQOA 2RIRA 2VDMB 3PQEA 3UBMA 1T9HA 2GCGA 4P98A 3P94A 5ILGA 3RHSA 2A3NA 2QTGA 3F5MA 3HB1A 5EA2A 4CMIB 3UAYA 1DIGA 4FCWA 1PSWA 1T0BA 2NQTA 2X1HA 4UEWA 2QVCA 2RGNA 3VR6D 1D1QA 3WFZA 4D8WA 1EJ6A 5SZJA 1PZGA 4JEMA 2PKCA 4DWWA 4IJUA 1U8FO 3IP3A 1AK2A 2XB4A 3TUZC 1YSCA 3DE5X 4IRMA 4CV1A 4Y2JA 3P19A 3QW4B 3ETEA 1Q7EA 3PHHA 1OFUX 1IJKA 4GZ6A 5KWVA 4UUPA 1SCNE 3LA8A 1ZZEA 4PYRA 1ZAYA 4D9HA 1U7XA 5BWNA 5JAZA 1EU1A 4BEBA 1T3GA 2E1RA 3DCIA 2FOXA 2JCBA 4CG3A 1SZPA 1WEHA 1JDZA 2V1XA 4KE6A 4O1MA 1XRJA 2PKQO 1TQ8A 4JI5B 1HL3A 1ODLA 1Y4AE 4B3RB 5BP7A 3QZUA 4GXTA 3FZNA 1YR1A 2VP0A 4UQLA 2X6TA 3FFBA 3SEQA 3COZA 1TKCA 5LOVA 3GYBA 4OHVA 1CUJA 5AVYA 3I5MA 1P5FA 1YIDA 3FWNA 1XQYA 3A4TA 5H9WA 4G56A 4NHEA 4HZUB 1J2YA 1UBFA 3CTPA 1QTRA 2QZSA 3EOBI 3T7DA 4YRKA 3OVMA 1YB6A 2IZZA 3MWJA 5FADA 3WKCA 1T8UA 1ZU5A 1CJKC 1A69A 2X8WA 3D6AA 3LP6A 4NMWA 5ENDA 3VV2A 1TUBA 1NUTA 1LK5A 2ATVA 3B13B 1DT3A 3JWJA 3QUSA 4CCWA 5KYUB 1W36B 4O2BB 3C85A 1IZZA 2PSHA 4YECA 4TT8A 5A9TA 4EP1A 5LQRA 1MNAA 4KIGA 3ZEIA 5KJ6A 1PCXA 1UMCA 4FKZA 2QQFA 4WOBA 3S2ZA 5CFMA 1R6BX 1QQAA 1Y3AA 5F2EA 3GFBA 1LLFA 3RGGA 1SELA 1L4FA 1U2ZA 1W36D 3EMDA 3T7IA 3V42A 3ES9A 1R0YA 5FWXA 2FZ4A 5DNUA 4F04A 4EPVA 1KI6A 2X1LA 5C8YF 1QAOA 2BFEA 4MLZA 2HPZA 2LCFA 1EA7A 1BKYA 4NZZA 4O4JA 3C3BA 3CCFA 4JKOA 2JLQA 5IS2A 3VV3A 3K6RA 4DRZA 2L17A 1XR3A 4YRGA 1JQDA 3FZEA 3H6GA 4Q16A 4HD8A 2OKGA 2GM5A 2B2CA 3M6XA 1TEXA 5BSUA 1DFGA 4ZA2A 4AWBA 1M1YE 2CNKA 3D02A 2Z6QA 3RAJA 3DXZA 4AZTA 1SQSA 4UTXA 1QLWA 4MMXB 4JVSB 1PZEA 1JNYA 1ND6A 2PS1A 3KVVA 5DNDA 1TM1E 1VDMA 3ZHBA 5JCJD 2ZAOA 4N49A 2ZTMA 1JEOA 5C8DA 3DHYA 1N5IA 2QIPA 1BW9B 1Z7GA 3PBKA 4B80A 2WTEA 5HP4A 3CUKA 4CLRA 4I7EA 3DWFA 1C4KA 2DPGA 1Z18A 2OZLA 2ETXA 3CSSA 3BJMA 3IHWA 5ECWA 2XE7A 4ZT6A 5L7TA 1Q84A 2VAPA 1YMUA 3NVMB 1XZJA 1YGYA 3OZTA 2X5OA 1ABFA 1OFGA 1T0HB 3B1FA 3ESZA 2W4QA 1V2HE 3BB1A 3L7MA 4B6RA 4EY4A 4E14A 1DE0A 1SUSA 3SXUB 1QQ7A 1ILWA 4BZWA 1A4XA 3NBZC 4JJEA 4E2YA 2VF7A 2ZQZA 1KU6A 3TLGA 5JYEA 3LYUA 1RYDA 2IZ7A 1T10A 2H11A 2GRUA 1TU4A 3NP7A 3PEUA 1VL8A 2Q5FA 5LP6C 1S6YA 4G1FA 4HQFA 4LQDA 4PLHA 3TEJA 4A3SA 2R8EA 4CF7A 2IH5A 2HHLA 3GLVA 3WV5A 3KR2A 1QKJA 3GVCA 1B0AA 4FSHA 5A7GA 3W79A 3FPKA 3V4RA 3EDRA 5DHAA 3PGJA 5PGMA 3T4PA 3P9IA 2OFOA 2YWRA 3SC2A 3SQXA 4JK3A 1R9GA 2QLFA 1N1MA 1YASA 2BSQA 1WMFA 1BJTA 2F3UA 4N0EA 3I4CA 1U0GA 2WHXA 3JWIA 4M87A 4HHEA 3U4CA 1UBGA 4DLLA 4L8LA 4M9RA 1EXDA 3PUYA 4HPWA 2G4VA 1WZ2A 5AK5A 2I2WA 2XHZA 4MRMA 3Q9LA 3L05A 5JRDS 4ZO6A 2IH2A 5E2AA 3NHYA 2QWXA 4TRMA 4PGAA 4EMSA 3PDIB 5AW0A 3ZE6A 4QLBA 2DY0A 3OZXA 5E6SA 2AMLA 1T8WA 4RVFA 4P54A 1P1FA 1ID1A 2X8LA 3CMCO 3MJTA 3BL8A 1M2OB 4ON9A 3C6XA 5ALEA 4A0GA 4R51A 3IXQA 3N0VA 3DB1A 2NVWA 4XAQA 3R77A 2O2ZA 5IZCC 4P0TA 2ACEA 3K5WA 3L06A 2FQ1A 4O8ZA 1Y8QB 2JBAA 4E1AA 4NPAA 4MGIR 2HA2A 4BNNA 3LT1A 4RK1A 2NXCA 2YWDA 3P4UA 5BY2A 1ZW1A 1QQBA 2PMFA 4HUQB 4EFMA 4HC4A 4F4CA 4MUXA 3LLUA 5GJWC 5DZSA 2IPNA 3R5TA 4D7AA 2QZ4A 1QQ6A 4LK3A 3O7MA 2AQIA 1M2EA 3D1VA 1JP7A 3GAFA 3FPBA 4LJKA 2FV8A 1OR8A 4MWOA 4LCEA 1L7VC 3V4ZA 3EEOA 1ECCA 1FDOA 1UK6A 3LDHA 5BVGA 1RAFA 3P2EA 5F5LA 2I1QA 4IHAA 4DA0A 4DQVA 4R0MA 1XD9A 4P4SB 1G8JA 3IT0A 1P4RA 4BB9A 1UBCA 4A26A 1EHYA 3L1KA 5FWNA 5K0GA 3RU2A 4MEBA 4JBLA 1ZJYA 1NXSA 1QTQA 3CYFA 5AVSA 3I2YX 1XNRB 1QORA 5IAJA 2P6RA 4LNUA 1WNFA 4V03A 2CL0X 1F0YA 5I9TA 2HJRA 3EIFA 3L7LA 2A1UA 3WRYA 4RIEA 1DINA 4HNVA 2YFHA 2GPJA 4CDNA 3M3DA 1I13A 1U2SA 4GI1A 4U6SA 2WI8A 2JIZA 1RI4A 5AUOB 4X45A 4XQGA 2R48A 2V55B 5BPFA 1QRSA 3BFPA 5BMVF 3NH9A 3M9LA 4OGFA 2V1UA 1YZKA 5BQOA 4NU6A 5EQJB 4KMSA 1JU9A 2HRBA 2P9EA 3FRHA 5ITVA 2DKNA 1HG1A 2FLKA 3I1JA 4TRNA 4MVXA 4Q3NA 4CDGA 4HUTA 3W3ZB 3RVBA 2E5FA 2PQ6A 4TLDA 1C9EA 1QXSA 2HMSA 3LPDA 3U13A 5L3QB 4YMHA 2CN1A 1X38A 2OCXA 3KLNA 3QFFA 4YI3A 2REOA 1EHCA 3NHWA 4RXMA 3QTBA 1J8QA 1IN4A 1T8RA 3RBVA 4U6QA 1ZD1A 2HB6A 5EWJA 4ENQA 1Q91A 2IS1A 2OL4A 3I2FA 5CXSA 2C7BA 1N5OX 5FRDA 3JPYA 3NBAA 2X0RA 2BMFA 5A3RA 5B7PA 2XKKA 1DWUA 1VSVA 3RYHB 3ETGA 3WYBA 3L8DA 1WVIA 2XA1A 3KQWA 3OURA 3LECA 4HMOA 2P41A 3C5VA 4U7FA 4MQ6A 1LV7A 2WSSA 1PZNA 4LJYA 2NUTA 4MWCA 4K6OA 4KRFA 2OFPA 1HH4A 3UJPA 2A5YB 3PE3A 4WCFC 3THYB 2GBPA 3N76A 5FUWA 5HIJA 5A4IS 3IA7A 4BNUA 4WA8A 1B93A 2E4ZA 5B1HA 3F6RA 4D9IA 1G66A 2MSDB 2XUDA 5KYXA 4AKHA 1UFQA 4F96A 2HIGA 2QB5A 5C32A 5HPYB 5LA6B 1ZH0A 1PSZA 2J5XA 3G2OA 3MBIA 4J1QA 4LOKA 4QLAA 2NVBA 3BUSA 3ED5A 4H60A 3TEFA 4ZCLA 4C6RA 1ZM9A 2OCPA 4IIXA 1UJBA 1QDLB 1V1RB 5JMWA 4E94A 5JYCA 5A9SB 1C7JA 4MQMA 1PVDA 3TVYA 3I6YA 5LQKA 3PE4A 3GGCA 1U8TA 2MINB 3TUJC 4ENVA 5IC4A 5U4XA 1DJPA 2MSWA 4IDHA 3BE6A 2VP6A 4IJMA 4LVOA 4MV3A 5REQB 2XZOA 5G0SA 1M34B 2DB3A 1TQHA 4AX8A 5CB4F 1EVJA 2ZYWX 1EEHA 1W48A 3WLSA 4B3FX 4GGOA 5EKTA 4WDRA 2Q3MA 4GKAA 4HBZA 4QOGA 4RF5A 5ED4A 4F5EA 4FD2A 1FSFA 4FFWA 5EPEA 1H5QA 2O3UA 2ZXEA 5BSFA 3IL2A 4A10A 3SE0A 1L1EA 2VNHA 1Z0ZA 4D3ZA 5JDCA 1SCDA 1ZRMA 1WUHS 1HE8B 1XCMA 2QZJA 4BLUA 2FVXA 2MIIA 1C3XA 5BSVA 3D4NA 1EXVA 1C1DA 5A2QA 3EFEA 4RYLA 4KXWA 2VTKA 1E1CB 1V7CA 1AF7A 2C03A 3PUKA 3SYKA 3P0IA 4IIFA 3Q8WA 3LHSA 5CFQA 1WU8A 1GP2A 2XRMA 1T13A 2I4LA 3HN7A 4H1TA 4EVQA 1ZVQA 4M88A 1KFEB 4GP7A 1ZIXA 4RETA 3K8QA 2HIAA 1ISFA 1TI7A 4REOA 1F17A 1WXHA 2A0WA 2A6PA 1SZJG 3BSFA 4KK4A 2JL1A 1FS6A 2W6MA 4I6JA 2D4AA 2D74A 5FI0B 2JA2A 1Z63A 3HE3A 2VXOA 3L0OA 4PE5B 1R66A 1TVMA 2F00A 1MTZA 2O23A 2PRKA 1F4LA 2V6FA 2XUQA 2E4WA 3F9IA 2OUKA 3NEYA 4JZYA 1EZ4A 4Y3UA 5FBWB 2Z6UA 2FUCA 2IYVA 1EG7A 1COWD 1GCOA 5K4GA 1E2LA 5IT4A 3G2HA 1MAWA 2QPAA 1SG6A 1OI3A 2ZRCA 2R7LA 3ST7A 4A5SA 2PFSA 1Q12A 3MCWA 4HTAA 1ENYA 4M6WB 1OTXA 2J9ZB 3P9RA 3QY9A 2OESA 1WS6A 2WUEA 1E7RA 4JCCA 3INYA 3W3AH 1H9BA 2F1KA 3OJEA 3GR6A 4PSUA 2Z8ZA 5HKLA 1OLSA 2Q0SA 4NYIQ 1GGFA 3EVCA 2V4MA 3M34A 3IP7A 2ZCUA 1B0PA 1FW6A 2IUYA 1N75A 4YHBA 2WU1A 3FLBA 4X00A 4KR0A 2OENG 4BLWA 2W6PA 5KPJA 1QUEA 3DFUA 1G21E 2MHCA 3ZDEA 2J0VA 5K0EA 4DKJA 2J4CA 3NBQA 4PAOA 3I0NA 2GFIA 1CHNA 2ZSHA 4OAPA 4PYQA 2PRJA 5EYPA 4Z1OA 4OV6B 3KAPA 1U2GA 1KYXA 4PIVA 1IHYA 2XB9A 3JQ7A 1E3IA 1Q5PA 4MEJA 4BFCA 1ORIA 4WN9A 1LI7A 5DX8A 4QIHA 1P9OA 4GOJA 1X7YA 2ZEJA 4XJXA 1NBEA 4BP3A 4FNGA 3D6UA 2FP4B 3QYJA 3HEBA 4J7UA 3C6ZA 4GG1A 1PR1A 4QDOA 4TTAA 1W5FA 1S96A 4YAWA 1O0SA 2JAUA 3G9UA 3ZTWA 3I2GA 2H2FA 2QOEA 2VYND 2X6RA 1HT2E 2OQ2A 3FDIA 5EJ2A 3RTGA 2J9FA 1NLYA 5LBIA 1HE4A 5TPWB 4KR3A 2O6HA 4RHEA 7AT1A 4PZAA 1FUKA 3WO1A 1BEUB 4G1EB 3ZCPA 2W2KA 1UT6A 3I5AA 2FPRA 4B7CA 1IEQA 4PS1A 1Z6QA 2C07A 2QXYA 4LE1A 2DUMA 2J46A 3HFJA 1XEFA 3QFHA 2H85A 1T6XA 1XMJA 3VTAA 2CLEB 3VX3A 3DYVA 3VYRB 3TW4A 2VJOA 3EMKA 1C81A 2ZKLA 3R6TA 4KE9A 2QYTA 2XI4A 4A8TA 3GCGA 5AI0A 2CVQA 3MJEA 4FOPA 2QMYA 2IW3A 3AHIA 3GJ6A 3PFWO 1NOJA 2C61A 3R8CA 1RBQA 2A9OA 3SVTA 4DWJA 3REFA 2ZI6A 3P9ZA 4FHZA 1EFPB 3WZLA 3QELA 1U9CA 2QW1A 3ZDRA 1BMFD 2DERA 4FUQA 1JSLA 2UV8A 3LYLA 2NYRA 4FGWA 4MUEA 5FJJA 1KF0A 1XMPA 2A5JA 2VJMB 3IAS1 4Z4QA 2VDWA 1OYOA 3NTRA 1JZTA 3SI7A 2RH9B 1VG9B 3NWJA 2O14A 4YAGA 2B4AA 3E2PA 1E2BA 3CO0S 4UBJA 3UJ7A 2HD4A 2G7ZA 3W5CA 3E0XA 4TN1A 4DAEA 4HNSA 2YXPX 3U37A 4BVHA 1KK0A 1HEYA 3AVXA 1GZ3A 1HBJA 1KFCB 3J80A 2TYSB 2IOFA 3U3MA 4RMIA 2FJUA 5JNVA 4Q7JB 1XDDA 3PI6A 2ZJ5A 4Q3LA 2KBFA 3I5UA 4HMQA 1C0PA 2HN9A 3RIEA 2BN4A 2JAPA 3K9NA 1W0KA 1XN4A 2V45A 4NBRA 1YHYA 1U0FA 3IOMA 5CURA 2P11A 2OMEA 2PYZA 1M1YA 4OLJA 4ND6A 2RCNA 3D5TA 4ZMSA 4HQLA 5EMLA 1EUQA 2OHOA 3URMA 1ZHHA 1K6EA 2FX3A 4MS4B 4X1IA 5AI8A 3MS7A 1L5HB 3GCDA 3RYCA 3SLKA 4DYVA 1W6UA 1IXRC 1M3SA 3IAHA 2NPOA 4UUMA 1K27A 4GPD1 5F52A 3WKAA 3UXHA 5CDYA 4RTSA 2LP4Y 4X65B 4JXKA 4BQRA 1G59A 3EXAA 4HDOB 2X9NA 1XD2B 5CFNA 1ID8A 1K66A 2SBTA 2VSFA 2R65A 1P8AA 4EQZA 2BEJA 1EBBA 3Q41A 4TXMA 3MWFA 4RDHA 1LSJA 3I6IA 5FQNA 3W78A 4LVNA 2FXVA 3E1KA 4ND5A 2BCGY 3KB2A 3TBHA 4R9UC 4BO4A 1XIVA 3A9TA 4GKVA 1GG8A 5DTIA 2E4YA 1HNNA 5EG5A 4DCUA 2FPPA 3WBKA 2VYVA 1SIUA 1X74A 2R44A 4J91A 5D5PA 3LLCA 4N9QA 5J23A 3NPAA 4B83A 3FUUA 4I1IA 3LCRA 4YAFA 5JD3A 2J6BA 2Q4TA 3U7FB 2ZS8A 4NK4A 3E4DA 1G2IA 4TZ0A 1W44A 1XKLA 1NFQA 5B7QA 1N5RA 4PINA 1E3WA 4GDMA 4UE3S 3DDUA 1QHHA 1EXWA 3AYZB 4KSYA 1W4AA 1ADCA 2J9RA 3GAAA 3KHTA 1FYDA 2CXRA 5KZMB 4M36A 1YBMA 4GKJB 2YQ4A 5ALQA 4MJLA 5GAJA 1YI0A 4KXQA 1WWKA 1QOQB 2AQ8A 2JGRA 4QBGB 5I9BA 1AQJA 4A9AA 2Y2UA 1HDYA 4XEUA 4ZVMA 2I3DA 5CLIA 1J9EA 3L0CA 3R5JA 1C9YA 1JR3E 2YJZA 3KAQA 4WGGA 4Z2YA 5LPNA 1Y8RB 1F0PA 3K9BA 3L8ZA 4Q3AA 1EWKA 2QPOA 1AN9A 1RKQA 4XYEA 4KN6A 1CXZA 4FLEA 3V1TC 3ZCXA 1CUGA 4NYMQ 3PPWA 4P84A 2AUTA 2VP9A 1ODIA 2JFQA 2DKOA 1KY3A 3EOAI 1F14A 4MPPA 4ILKA 2AI2A 1IRIA 2JRCA 2H1HA 3DDHA 4RANA 2ZVPX 2C4HA 4EPXA 5CT5A 3IR5A 4OJYA 5K0NA 2PGOA 2WDZA 4JJAA 4ZVNA 3HA2A 2JJ2D 4TZKA 3MA0A 3ZIAA 3IEKA 4LECA 4QO7A 5FPSA 2IZ6A 4BQOA 4UMDA 2QLLA 3OWHA 1FSZA 3FZGA 3H3FA 3LX6A 4JJ6A 3WRVA 3RUDA 4F4JA 1BVRA 3P97A 4JLOA 4EVSA 1N7JA 3OCJA 2AEJA 3G23A 1YB7A 4MB0A 3GT7A 3WKEA 1PW5A 5KNCH 1IDN1 1BVUA 3ZBPA 2D0PB 3WXBA 1J2TA 3Q3VA 1WQ1R 4FYPA 1T6BY 2P4HX 2PL9A 2DCMA 2OZEA 2YASA 4FHGA 4TQGA 3TRHA 1N33B 3QEAZ 3O7WA 2A0KA 4B84A 4ATNA 1N0IA 1WBBA 3CR3C 4A2WA 1KAHA 2B98A 5AKKA 4DCOA 2FPUA 2J09A 2UKDA 3KXKA 2QLMA 1D2EA 3KKLA 4MINA 5AHOA 5NLLA 3T1NA 3TQOA 2VXYA 4W63A 3BT7A 4HNAB 4NBTA 1IOZA 3LTNC 1MNQA 3EISA 3USES 5C5EA 4ARUA 4B9EA 1C0KA 5BN4B 5BYAA 1ZVJA 3KEQA 3PUJA 2O2JA 2I6TA 4CV0A 1X2EA 1IEXA 1EIWA 2ATXA 1E3SA 2EKZA 2JLAA 2Q3JA 2W4MA 4Y1RB 1I3OA 1HQCA 1T9KA 2IF2A 5B12A 4KVAA 3ZZTA 5I7VA 2ECFA 5HM6A 1MEEA 2J67A 1N2CE 1M54A 1T9ZA 1XRMA 2G08A 2JHCA 2W8ZA 4PLTA 3SY8A 3D3NA 3E5HA 1WDTA 3DS8A 4TQUS 1LLQA 2PUVA 1F8GA 4HLDA 4P5PA 1BX0A 4LZOA 3UUWA 5E1BA 1LK0A 1II0A 2ATCA 3P32A 4NJEB 1NBME 4M89A 4G3XA 3GEIA 2JZNA 3WGTA 2C5HA 3G2LA 3KKZA 4HKTA 5DYIA 3TIVA 1DC3A 1Y1LA 2QL7A 4BZQA 4LRXA 4BO5A 1HT1E 1P7ZA 1XRLA 2B9EA 1NHGA 2GF0A 5FBHA 2BV3A 2XZPA 4L74A 1NSTA 4X1KA 3ZBQA 1U31A 1QNLA 2GFHA 4Z5XA 1OJLA 3V1MA 3WS7A 4RTQA 1V5FA 1VIYA 4MRRA 5CAEB 1UXIA 2CZCA 1RQNA 1WHTB 1HYQA 5H81A 2QAGC 2J41A 4WNIA 1T8YA 4X61A 2E3JA 4CIDA 2AC2A 1KOGA 1IHOA 4FT2A 3ND7A 5D86A 1TIKA 2RK4A 3IQEA 3QP9A 3VDRA 3A4VA 3A1FA 1KMQA 1ETUA 1LFDB 2V9ZA 3OQIA 4OO3A 4YWHA 4BV9A 4U0KA 5ER6A 1JEJA 4FYHA 4YLYA 4M9CA 2TSYB 5CYFA 4GLJA 5G4KB 3MWEB 4MW0A 1KGDA 4D41A 1EGAA 1ODKA 1U99A 3C4VA 1DZ3A 5J4LA 3GYGA 2DXIA 1ZKDA 2YX1A 3DLTA 1G291 3AONB 3ODPA 4J43A 1PR3A 2GF2A 3B20A 3BK1A 2IYPA 4F6RA 3JAKB 2VQ6A 2ID8A 1U2TA 1KHTA 4JBWA 1J0BA 2VJNA 3VKUA 3U5TA 3KM0A 2ZS9A 1EBFA 1CQWA 1L5FA 4KXYA 4DXDA 3A9RA 4V1CA 2ETVA 5JS8A 3CG0A 1QZUA 1JG6A 1BJRE 1EQUA 3GVIA 3NG1A 1F5SA 4M22A 5KYYA 1FUUA 1C80A 3GEMA 4JP2A 1K7EB 1FX0A 3MB5A 3NR2A 3EXEA 2BW0A 1ACJA 4CKWB 4NCJA 1BXKA 3ZOKA 2R6DA 4AG3A 4ZMRA 3NJRA 1FUEA 2HF8A 4JT2A 4K2HA 4M1TA 2V0GA 2EQBA 3AXSA 1XU7A 2VFAA 4UBMA 1IHDA 1L5WA 3EODA 2PH5A 5T3UA 2BI8A 3INRA 4KWIA 6ADHA 5TEWA 1DI0A 5C8YA 3TQIA 1I80A 2BFMA 4CTKA 3LCMA 2FEXA 3SIWA 3HQ4O 3QKSB 2ZRGA 3UPTA 3A7EA 2UUOA 2NXWA 1P2SA 1H05A 4EI8A 1BD4A 2XMCA 3NANA 4MQEA 5BVHB 5L53A 1NSYA 2CLDX 2FPMA 4P38A 2ZIVB 4RMGA 2QX4A 3F6YA 4YRIA 5HS6A 2ZSAA 2OO3A 3D6TB 3SEAA 2OXTA 3CURA 1R8JA 4BBJA 1D6JA 2C2OA 5H82A 2LR0A 1Z34A 3FRJA 4E4RA 4JDPA 1JAZA 3HB4X 4MJ7A 1DAMA 2OSBA 2YHSA 3W7VA 2Z1NA 3BD8A 2XD9A 3NOQA 4Q4CA 3GOQA 5DULA 3M9WA 2FG5A 4NDNE 1D6NA 3IEXA 2R00C 3Q6IA 4L0CA 5B3JA 4RTJA 1IBMB 1G42A 2P9BA 4FXOA 3T0IA 4EHDA 5G0WA 3UAZA 4TWAA 4OHYA 3WQBA 2ZZKA 1D8TA 4HEA6 1KI4A 1SCAA 2V0CA 3ZBTA 4F8EA 2CXTA 4P81A 1XWFA 5HZKA 3MXOA 4IRUB 1W1WA 2AYYA 4RF2A 5DXAA 2ZIFA 2KJQA 3ZS9A 4B6FA 1OD6A 4WBNF 1WTAA 5DP2A 2GLXA 1JHRA 2AH5A 4BBZA 2ZK7A 4ETIA 2FSSA 3RYTC 2O8BA 2DWOA 3KT8A 3NIWA 4GEKA 1ZUD1 2VYQA 1UBJS 3H8SA 3G7SA 3MMSA 1Z8FA 5JBIA 1M2NA 2UZ1B 3HKEA 3AU8A 3GF4A 3WL5A 3BHMA 5DTJA 3WX0A 5CLGA 2PIAA 3EF1A 5AVJA 2X4DA 4DRXB 1R64A 2B30A 2PKEA 4ND7A 2PEYA 1GG5A 2EW8A 2CJYA 4GC5A 3LWNA 4DOMA 5ICEA 1XYYA 3ETDA 1X80B 4I8IA 5FTMA 4C07A 2WMYA 2YQZA 4DHEA 5I7FA 3F74A 2WUVA 5K8TA 4BVFA 4QELA 4V0ME 4NXMB 2E5WA 1EESA 2WUFA 4US2R 2ZYTX 1CERA 4PO1A 3CNOA 5BW8A 5FR2A 4PBRA 1SD2A 3LSYA 5BQPA 5L4SA 1DOAA 2IV3A 1XG5A 2ZYHA 3NOVA 4WCFA 4JP3A 4F21A 3X1ZA 1GUAA 1XEAA 2GPWA 4RQBA 3ROMA 3W5UA 1OAOC 4J7XA 4EB3A 3IXMA 1XTKA 3BIWA 2I6FA 4U00A 4YUVA 2C5SA 1FXWA 2JBHA 3QFTA 3ZN2A 1ZUNA 2YHUA 3WMRA 1SBHA 4LX8A 1QV7A 2FRXA 5JFOA 5JTTA 1EE9A 4DCSA 1V41E 4HAUA 4P3NA 3MJ4A 3IE1A 1CULC 2QVYX 2WJHA 4ZCTA 1I0IA 5LWHA 1NHWA 5ESRA 1VA4A 5DW3A 4ZAGA 3CWCA 4AY3A 3CZRA 3LF1A 4OYHA 4OBWA 4UTPA 2DX7A 4BGVA 2JCVA 3EC7A 1NXQA 2C4WA 2WTNA 3S8MA 3Q3EA 2FN9A 4FYJA 1T2DA 2P9FA 2B83A 1N36B 1UADA 2GJSA 3L84A 1Z47A 4GOLD 5E38A 2H07A 4C4AA 1P45A 3O21A 2PSEA 1R1DA 2GN0A 2BKEA 1IULA 3PDJA 4PG4A 4R71A 1KQPA 5DE3A 1ZIDA 2A9PA 4I5DA 5A4AA 4P6VF 3E53A 2G70A 4OBEA 2QRHA 4ZOAA 3VPAA 4G8CA 4C7BA 5CH3A 4DCTA 3I34X 3CPJB 1GGKA 1AY0A 4W8GA 1FPQA 2D1YA 4P4TA 1ECGA 1UMBA 3WDKA 2NYAA 2BFCB 3B51X 3WQRA 5L8VA 5A5FA 1R9NA 4KQCA 2IEAA 1XZAA 4O3FA 5BMVA 1KFJB 5DWQA 3IR7A 4GLLA 2OBFA 5C34B 5EIFA 4Y7CA 5AXAA 5LU9A 4BLOA 4Z53A 2VA9A 2VNAA 3R9XA 1YVUA 3CONA 1NVVR 2GBIA 3WAKA 1FDTA 3FB1A 4J16C 1X7XA 3QEJA 2LBPA 4LWPA 3AQ4A 4F72A 3KWJA 1HE3A 4QXAA 2I9KA 2BYTA 3O2NA 1VI5A 3K9HA 2WMOB 3KTDA 4YI5A 1CZKA 1DJOA 5AI4A 3V32A 1KEKA 4Z3KA 2QRZA 3G9QA 3QUAA 1ZM4A 3VO8A 1ORVA 2WWXA 2QGFA 1OBFO 3ZWVA 5TVGA 1DIAA 3QXCA 2IBTA 2YJNA 1DAOA 5FLEX 1MJ5A 4QUAA 3OY7A 1CD5A 1RYBA 1E0KA 1SQ0A 3LW8A 4MROA 1LJUA 1VRVA 2IEDA 5E4FA 1U8YA 4YQZA 2QUKA 2ZAIA 2K2QB 5CRIA 3C6YA 2XQVA 2RKOA 4ZAXA 4PQGA 2V6GA 3I6ZA 1NFFA 2A0FA 5JALA 3Q2IA 2G6BA 2O0KA 3WL6A 1WZUA 1KKLA 1BCRB 1XU9A 3V7NA 3L0SA 4P0QB 2BI7A 3C1UA 2XVXA 4GYKA 4EITA 3FYUA 1N1DA 1S7CA 1DCKA 3GBSA 1A2OA 4MP8A 4F5WA 4YR9A 1R0ZA 2J0UA 2ZYUX 1XXHB 2A8YA 1X77A 3BXHA 3CEMA 4H0CA 5EIHA 1DJQA 1QFXA 3Q5GA 3TCNA 1UZLA 1UDRA 4Z51A 4OAQA 4PR3A 2PANA 2PGDA 3TBKA 3KLOA 7GPBA 2C3YA 3REQB 5JASA 4AY4A 3ZDBA 5FBVB 4N8EA 1JE1A 2XTAA 3KSDO 1V1JA 2D54A 4MAAA 3DR5A 1SKAA 4QUDA 4KFCA 4K2AA 2UVDA 3VPDA 3QX3A 2CLCX 2YIJA 3EHEA 4EHIA 3EQ8A 5HUJA 2MR5A 5CB4A 3LUFA 4B6QA 3TB4A 2FSVA 2QUIA 4ABYA 1JBQA 4PFSA 4D80A 2GH1A 3R7LA 5EZQA 3QXGA 1V8FA 2HUNA 3FUCA 2WZQA 5AK3A 4Q47A 2EWWA 3F6BX 3ZNQA 1P72A 2R1TB 1O94A 4WZBB 2BKVA 2MSKA 3RAPR 3GPCA 3OE5A 4HSGA 3DYIA 1KJWA 1IE3A 1N2ZA 2QKYA 3WWYA 4Q7EA 1VM6A 3T3IA 2K7FA 4N5DA 3UB4A 1SUAA 2BGLA 4BQPA 2QX8A 3VZQA 2O8FB 3Q0TA 3ZHRA 1P6XA 2PIDA 4EY6A 3U3KA 3RS5A 3N2IA 3ML1A 3HG7A 4DLVA 3PNMA 3FA2A 2C59A 1ZK0A 1TAHA 4K6HA 4DM7A 1JEQB 3NHPA 4BB6A 1BROA 1XZEA 4XM0A 3SQLA 5FPYA 1AD2A 2WD7B 1EM8B 2QVLA 3MVEA 3ZGNA 2WP8J 2DR2A 4GDFA 1ZNQO 4NQZA 1E69A 1MTOA 4ARAA 2I8CA 1EA5A 1UK9A 3HU2A 1GTRA 1QP8A 3VBCA 4OHBA 2ABWA 1L5KA 1Z6TA 2BBSA 1YOVB 4RVSA 1BX1A 2JFHA 3RKRA 2J08A 4QT4A 1QKKA 5JQWA 4QA9A 4RKQA 2FW0A 3QF4A 5JYDA 2C4TA 5IAGA 4IGIA 3RYIB 2FCAA 5AESA 3CZ9A 1UZMA 3BBLA 3KZMA 4LVUA 2LUOA 2P2GA 5J1SB 2C99A 3N1UA 4IMJB 4XD7D 5CJ2A 5AVZA 2ZSJA 3IDAA 3KUUA 4GSLA 1G20E 4K1XA 4XQCA 1KDZA 2PE5A 4EBBA 1GGJA 1YGPA 1MB4A 1KOJA 2OFWA 3M6FA 5FWYA 3LO5A 5E4JA 2X3UA 1M7HA 3DEFA 4RD4A 1QIKA 1TJPB 4YLEA 1PJ4A 4LISA 3CEJA 2X0JA 4N54A 5IAAA 1Z29A 4QNRA 5E4TA 3AF4A 2W2LD 4R81A 1KK1A 4P0PB 4BFXA 5AOAA 4FNAA 4AZ0B 2IS2A 1CEEA 3JS5A 5JMTA 4RZHA 4CM9A 1W5BA 4NCIA 2IYYA 4UEQA 3UCFA 1RLJA 2GNPA 4BQFA 3CRZA 2C20A 3M6AA 3QLEA 5F35A 5HZMA 4OLFA 3FIJA 1P8JA 4DPKA 5BO5A 4Y0NA 1FFHA 4ZVTA 2NUAB 3EVEA 4C2BA 4GR9A 3VU8A 1CRPA 1QCYA 3KUKA 3QUBA 1FS4A 3DDCA 4GICA 2E7ZA 4J0CA 3KQKA 5KVVA 1N6IA 4W5TA 4D45A 1UOOA 2W6ID 3EIEA 3QYAA 1J20A 2VPPA 4KGZA 3TOZA 1JH9A 2QE7D 2FZLA 5I7HA 2DWPA 1VKJA 1XA0A 3BXEA 3H2GA 4XTRA 5CLHA 1T6ZA 4PPFA 1U0TA 3I5XA 3L6BA 3OUTA 4ZHSA 4DV4B 3EE6A 4H08A 4HQOA 4LPKA 5H4HA 4MKRA 4X24A 3IQIX 3QA3E 4TQ9A 4UU1A 2QD2A 5I01A 1HYHA 3HDQA 3MT0A 5L9AA 3GLFB 4LIPD 1M2KA 2FPXA 4EB6A 2Q4EA 5BN3A 5BUZA 4RD6A 2I76A 3MQFA 1XVVA 4FE3A 4FFNA 1OSNA 4KBGA 5L3SB 3O6VA 4CLDA 3LUKA 1SWVA 2AVNA 3LHIA 2YMMA 3OPQA 4NTZA 2PNJA 5LM3A 3W6UA 2QRQA 3ZDFA 3UGJA 1AXEA 4KX5A 2Z9BA 3CISA 3IVRA 2JI7A 1ZMTA 5C1DA 3WGOA 4MW6A 3B9PA 3JQ8B 2BFWA 2YVUA 3HUTA 4OA5A 4Y2YA 4GE3A 2IJGX 5JG7A 2IDJA 2QM0A 3HY3A 3NO4A 2FSFA 4J2OA 3NVKI 2FU5C 2NUPA 4FDMA 1Q0ZA 3PL1A 4FCTA 1BS2A 3GG9A 3HMQA 4BNVA 1LLDA 5KTRA 1NZJA 4W6ZA 4DTCA 4MWBA 4AUKA 2CDNA 5DLPA 3A2LA 4F11A 5KX5F 1GPKA 4AN1A 5A6VA 1RQPA 1JDSA 2YHAA 2RSLA 3OMWA 4MYRA 4RA6A 2OECA 3G9ZA 3IVGA 4DQ0A 1KQFA 2WWTA 3FKSA 2OCGA 1F6WA 5CT6A 3AOGA 3ZWQA 3NC1C 1R4AA 1EB8A 1E7MA 3IJPA 1IN7A 1Z5WA 2FFRA 2ZDHA 4YYZA 1KC3A 1P3Y1 2C8KA 2B25A 3GEDA 3I58A 4MW2A 2JJMA 1K2VN 4IHJF 2HOQA 4MQ5A 3M3PA 1UJ2A 4B48A 1C7QA 2P4SA 4KQHA 5I9MA 3VUFA 5DTQA 2FRVA 1FFEA 1Y6RA 3C7TA 4H3KB 4MYTA 3WJ2A 4B82A 4NYJR 4V38A 5CBPA 4YP5A 1E2IA 4DSZA 4ZEVA 1X2BA 4YAOA 1JDJA 4CR6A 2PJUA 4PBSA 2X4IA 4C03A 4GO1A 2AC7A 3TKYA 3ZHCA 4ALLA 2EYUA 2VJYA 3ZZMA 1T5SA 3TDKA 2XVMA 1VKNA 3OF5A 3PTLA 4YRNA 3EW7A 3FYCA 4QFCA 1JQ5A 3W6ZA 3PGLA 4GYWA 4AQDA 3L4EA 4DSUA 3QQ5A 3TMAA 3SQWA 2F8LA 1KZ9A 2LTAA 2EHDA 2O4UX 3AHHA 4YPOA 4ITUA 4C1NA 1J90A 1WMBA 2Q6VA 4CM3A 5LKRA 3HEAA 3NFYA 3PP8A 3ZJYA 3QPAA 2CFOA 3AF1A 1CY1A 5I8WA 3W5JA 1N8KA 3HUFA 4GL2A 4QU5A 2ZJAA 2PJDA 1FJGB 4L5AA 4BN4A 1QNFA 4ZO8A 1IIBA 2Y1EA 1VL1A 2FRDC 2XLBA 3ABSB 1YA8A 2KSQA 2VWQA 3EQ2A 4W1PA 2OD9A 1NGSA 2VUUA 3T5PA 4EYKA 3TRJA 2Y4NA 5DBGA 3T3GA 3UHOA 1FRQA 1S7GA 3OQVA 1MORA 1IXZA 4E5KA 1LUAA 4LOAA 3ZZUA 1EK1A 3G9TA 4JU8A 4O2BF 5FWAA 2GNAA 4X20B 1U5AA 2FZWA 3AB7A 3IUBA 3KKEA 3THXA 2WM9B 1J9ZA 3L40A 4DIKA 4BMNA 3U4IA 5G41A 4OGKA 1BU5A 3IDSA 4WASA 5BSMA 5MN5A 4V0MA 3EBPA 4PTLA 3E3MA 1PQ4A 4WK4B 3RTBA 1GQYA 2CLHB 1OWLA 2QBYB 1PO7A 2I54A 1E20A 2IUEA 2YYAA 2VNJA 3D4LA 4B47A 1FU4A 4PFQA 4CF3A 1KO7A 3P5SA 1MG0A 4BP8A 3I6BA 3L4BC 5D1HA 1FTNA 2BHTA 2XQJA 3K09A 3NRBA 3RKUA 1FF9A 1U6KA 2RHGB 1X94A 3OAAA 3DKRA 1WB4A 1V4NA 1TK2A 1U11A 2Y1DA 5G0UA 4LGMA 4DCMA 5IKMA 3BIXA 1QG6A 3TRFA 3CRRA 1OH7A 2YFKA 4RE5A 5BN1A 1LSSA 2GTIA 1HETA 4A8JC 5EWMA 2H2DA 3A25A 4G4SO 5EY5B 1CHDA 2IXFA 4L6CA 4S1WA 1U7DA 5JY6A 4EQ6A 2ZQYA 2C5GA 4EHFA 4F12A 4FGUA 5TMEA 2CYBA 1WP9A 1NVTA 1H4QA 1Y7IA 4TYWA 2AUMA 2EYQA 3L6DA 5A62A 3I01M 3ZI7A 2ZIAA 3MELA 4DVJA 1THGA 2GXSA 2HRZA 1OOEA 4GZ3A 2BLNA 3WIOA 1FDRA 1KMCA 4W5HA 4YV2A 4B4WA 2Z4TA 2Q4DA 5DM0A 1DAFA 2NN3C 3SHQA 2R7MA 4UOEA 2V6MA 5CW1A 421PA 2NGRA 1BOOA 4OQNA 4BVGA 4KNVA 6REQB 3CR7A 2FW1A 4LBYA 1JIVA 4MXDA 1XI2A 2X13A 4OK5A 2Q5OA 1M8FA 3MWGA 3UV7A 4AS3A 1QRUA 2A9VA 3V4SA 4PXSA 4UBKA 4XFJA 1J2UA 1OFTA 3U6KA 5CVEA 3NNSA 3AEUB 1REQA 3R0ZA 1ZG3A 2GZHA 4IMIB 4P7FA 4Q00A 2Q7OE 1TTPB 3N07A 1C1YA 4AF7A 3ANNA 1CE8A 4HN9A 1Q83A 1Z0JA 3M82A 3PR2B 4RY8A 2E87A 3COPA 3HR4A 4BMYA 4K9QA 2Q3CA 2B34A 5I8PA 2AN4A 1C0LA 2WWFA 2HDNB 1UP7A 3DZIA 4YTEA 4D46A 4HQKA 1JJIA 4WFIA 1C8BA 2UUAB 3LE8A 3FDXA 3A3PA 2QG6A 3JASA 5HIIA 4CCAA 4IJQA 2EAUA 4HQ6A 4BECA 5IEJA 3U4QB 2PHZA 4O08A 4QXOA 4C2TA 4KDEA 1SC6A 4MI6A 4YMTA 4PC3A 4EY8A 2FKNA 4DIBA 4S1VA 1KZYC 1PEAA 1Q7GA 1WMDA 4DT1B 1JG3A 2QVGA 3VHXA 4ZU6X 4RAOA 4D6YA 3BK2A 4OXRA 4R1QA 1F4VA 4M1QA 2EL7A 1P31A 4Q3KA 4E5DA 3LSTA 3FLAA 1E1MA 4N41A 1CR2A 1EFHA 1UH5A 1NXWA 1XEWY 1IY2A 4INZA 4L5JA 5AVKA 3SOZA 1ZNYA 4GR5A 1U0EA 3F6EX 4MYUA 5CLQA 4EFNA 5B55A 2NZUG 1Z5GA 3ROGA 3ZD6A 3Q3HA 2PN1A 3LZ6A 4QREA 4HEJA 3OT1B 1A9XA 3ZQUA 3WLQA 2HF9A 1XN1A 2HFKA 5E6RA 4RVCA 1N9GB 4UZFA 2VHUA 2WHRA 2K2WA 3GI1A 5DIFA 1KDVA 1EIZA 3WGZA 4TMYA 5K3EA 4IWYA 1LPNA 1OQAA 3PD7A 4FFPA 5EFZA 1YV9A 5FTJA 3T9FA 1LC0A 2QTNA 3VR5D 3MIZA 5G4LA 4P4NA 2ARKA 4A82A 2NZVG 3GPBA 2JNWA 4K81B 4UHKA 1N3LA 3AR6A 2O2CA 2W0SA 4DA7A 2PKWA 3GLGE 1CBUA 1V8DA 4OHRA 2XT9A 2RJ3A 4ZKEA 4EEZA 4KPYA 3OEYA 3T95A 4JI1B 1HX7A 2AFIB 1JHPA 3PNPA 1M73E 1C7IA 1QGOA 3W3AA 3ZWYA 3CKMA 4D9GA 5K01A 3I30X 1KVQA 4KBYA 2X7XA 4L02A 1PJ3A 4Z86A 2M1ZA 2H1RA 3OZRA 4Q66C 4AD8A 4ENWA 4YQFA 3ADDA 1BEZA 4H7DA 3N0TA 1XDSA 2SCUB 4NX2A 2VG8A 4EJMA 4B3HA 3W2EA 4BQQA 2YCBA 3Q9NA 3EGEA 2E21A 3D3WB 1MO3A 1XWWA 3DE7X 2QRKA 4ACBA 4EB0A 3WXMA 2BBTA 3SMVA 2IP2A 1JB1A 4IUCS 4CZ2A 3V1KA 2FN8A 4X60A 4K0RA 4AM8A 4XWOA 1AB5A 2XRYA 4M46A 4AICA 4X8LA 1KP9A 1EK6A 1NUUA 4BDSA 2PX0A 1K7CA 5E1OA 3JQEA 1Z8HA 2BGTA 1T2UA 3GGGA 3O47A 2XJ4A 2VDNB 4H1WA 16PKA 2WJAA 1W30A 3IQZA 3KR1A 1NRXA 3RDPA 3IQXA 1SRRA 4FYWA 5GZ3A 5IRCD 3CX7A 2VHWA 3DDOA 4IJ6A 3EFHA 4YRFA 3KWLA 2AFHB 1YDMA 3H87A 1WKCA 4EARA 2ZAMA 2IYQA 1SMKA 5DHRA 5JBNA 3IAEA 2YIVX 3VYWA 4KPGA 4UPDA 4N5LA 5BSTA 4YMVA 2JIQA 2QN3A 4KQMA 3R8FA 1SVUA 3HUDA 4NR0A 3O4HA 5LZ8A 3CZ4A 1GL3A 1CYDA 3HWRA 3KSRA 4G9EA 3AESB 4UBOA 3FJ1A 8AT1A 3WB0A 2CMHA 4IY1A 1T0UA 5KHLB 1V11B 1G20A 4ZYTA 1PS8A 1VHDA 2GCOB 1DCMA 1J2JA 3D4PA 2F43A 3BSYA 5DM60 1GPLA 5C31A 4D02A 3U7QB 2EWMA 4ZYYA 3WRWA 3H7AA 5T5QA 3K6SA 3M83A 3A6KA 3UJBA 1UDBA 3RPEA 3IUYA 3S2EA 1QPGA 2CKDA 1WX1A 4UU7A 1FW8A 4OHCA 5KO2A 1KI8A 1P0CA 1XZGA 4L0MA 3T3HA 4J16A 4YP9A 3MCTA 5E8JA 2F62A 2WT8A 3PJDA 4OJQA 1I3LA 4ZOEA 5K4HA 1KDTA 1KAQA 1T2EA 1FNSA 4BOYA 2H2AA 1QTNA 2PKRA 3G2NA 4G86A 5H3HA 5DWVA 1GXSB 2PVSA 4PTZA 1W4RA 1FDVA 1ZIYA 4ZVUA 1MB9A 1NQVA 1KS2A 3VDQA 1HDEA 2VNSA 2RB5A 4JEUA 1JKJA 4YJHA 3U4HA 3LHDA 2VTVA 2Q3DA 1EFVB 4IOKA 4KFTA 2YWCA 1GT6A 5CD9A 4IIVA 1J23A 1PG0A 4MJXA 3LPLA 4X7RA 3P9NA 3UKOA 5M2QA 3TW8B 3WR5A 4PO9A 3HB9A 1KMMA 3IB3A 3BRCA 4LY6A 3RD5A 2GK4A 5FULA 4DMUB 4R1PA 1C30B 4O2RA 3B9QA 4GMXA 3E7PA 1X70A 5LQSA 3PFGA 1W4BA 1XYVA 2GTHA 3FNQA 7REQB 2CBGA 4AJ9A 3E9DA 2BEWA 2GERA 1YMQA 2FWIA 3H5LA 4HAVA 4U02A 5DI9A 2ORVA 3LLSA 4ALMA 4D0RA 4BNMA 3KXPA 1XQWA 2XOKA 3Q7IA 3RSOA 3CNHA 4Q05A 3DBHB 3H0EA 3LUBA 1K9SA 3O2SB 3ORFA 4FT4A 5BNWA 2REQA 2YDYA 4RSMA 4UHFA 1KYVA 4DMFA 5K20A 3SX4A 4LVCA 4P83A 1WDWB 3OEWA 5DI3A 4C3OB 1A76A 2PXCA 4OHOA 3L1HA 2X3YA 3K0SA 1SQFA 1JHYA 4LRWA 3ENQA 3LKBA 2PZEA 2AKYA 3JALB 3WRXA 1IVNA 3PR1A 4FU0A 4LHZA 4ROSA 3FMPB 4C14A 1MIOA 3H1PA 1XEWX 4RVHA 4ZFNA 2H4YA 1RHUA 2VJKA 1A9RA 4B79A 4HXYA 4DIOA 3CJQA 4BZPA 1TYBE 3PTAA 4X3OA 2E0IA 2J32A 3I4LA 4RGBA 3R7WB 1NOIA 3WWPA 4DLBA 3A2KA 1TAQA 1E32A 3CRNA 3EDQA 4FE7A 2PCJA 4KGXA 4YK7A 5HKBA 3I5YA 3SDBA 2P77A 3VR1A 3P9QA 1BU8A 2EU8A 1LSOA 4CQLB 1G16A 2PA0A 3RT9A 4NIMA 1DAIA 4PPQA 4R9SA 5BT9A 1XCOA 3RS0A 4DCCA 4MYHA 4EO9A 1JKMA 1G7SA 4YXWD 4U2EA 3JQAB 1KO8A 4UCWA 3B60A 4HFMA 4PLVA 2OD2A 1T24A 1EI9A 3JD2A 1C4OA 2B61A 4NZPA 1J4AA 4TKUA 5GY7A 5IKXA 2I4MA 1T5HX 4Q7KA 3TE6A 2Q9CA 3DLPX 3KJNA 4YJ2B 5L40A 5AKEA 4D97A 2WU0A 3BAZA 2JDID 4XIIA 2EG9A 4FIZA 2EFJA 4QLOA 5AXCA 4TTSA 5AW8A 3P2IA 4B3SB 3GT3A 3I2HA 3DGFC 3JQAD 4EG4A 1V7QA 4G24A 3EDYA 5DV9A 4ZV9A 3W5HA 1YZNA 5ESDA 2FMKA 2R7AA 2HF7A 5KI6A 4PU0A 4JWKA 4PRYA 1EK0A 3FOAA 1Z5OA 5E8RA 5F3WB 1JIKA 1H5UA 1SIBE 2CJFA 2KMLA 4HLCA 1EDBA 3PQ3A 3WNQA 3OZVA 2PT6A 3UB3A 3VR3A 1E6WA 3BJRA 4CI9A 5FEUA 5K99A 5H3CA 4JLAA 5JEDA 2ZWIA 3N53A 3TBFA 2I6XA 2ZCVA 3TJMA 3B6MA 4C76A 4DDUA 1THMA 3DUFB 3RU7A 1Q1QA 5DCLA 5B64A 2C0QA 2Y71A 4AJEA 3ZJVA 3PHBE 1PJ8A 1ORHA 3IJRA 1CVRA 1F8XA 4BQNA 3H86A 5AJVB 1ECJA 4IJ5A 4MUFA 4UAGA 4WK6A 3VPFA 1FFCA 4F4HA 3MOIA 3HCDA 1YUMA 3I0ZA 4XWKA 5FAKA 1PQUA 1Y7TA 1GAQA 1T25A 1FOEB 2Q6LA 3H9BA 2A1IA 3K15A 4M0KA 3V1NA 4A8PA 1SKYB 4IILA 3SF8A 4AKTA 1SBNE 4JQYA 1PNQA 1DRUA 5ALVA 3LFTA 1ICEA 3H97A 3M4NA 2YYZA 4FSDA 1L3IA 1RWQA 4JR2A 3PCRB 3ZKWB 4GOKA 4HEA1 1Z82A 4JJKA 1HL7A 4O0MA 1DCTA 2BFFB 4F3CA 3BIFA 4FJ2A 3L0YA 3CRMA 3UMMA 1BFDA 1DBPA 4GMGA 3JQFC 5BRJA 2GEJA 1MP0A 3RREA 4AAYA 3LOQA 1E3MA 3LVBA 3JW8A 1FP6A 4A6DA 3W7BA 4XJSA 5IT9A 2POCA 2CVOA 1C8VB 1E0SA 4MS1A 4AJKA 4WKCA 3HO1A 1UXJA 3V6MA 4UQOA 4EKGA 4EUKA 2VPQA 2RE8A 2JANA 4UCQA 5LXTF 4MCIA 3DO5A 4C4TA 3HKBA 4B71A 3OQNA 3H2SA 2JIOA 1X9IA 3T3DA 1FJHA 2DT8A 1DG3A 2HCTA 5K2OA 5AH0A 4RELA 1XAIA 4MAFA 1EWRA 3CB2A 5AI9A 5T8KC 3NC4A 2BH9A 4NL4H 2JGAA 1HC7A 5ALDA 4ZYZA 1PVVA 3A0UA 3O93A 3EX7C 4FW9A 3ZWPA 1DIOB 4D4MA 1KEEA 4QULA 5B2EA 1U5BA 4Z8YA 5EE9A 4ZD6A 4HB3A 3SNHA 2B78A 3U49A 1Z4OA 1B42A 4DMMA 3E3OA 3OCYA 1TE2A 2NSHA 3I64A 3TAHA 1GFWA 1KYYA 3B8EA 3IDFA 4GMHA 3ZCRA 1KWGA 5JAHA 1DQNA 3NGMA 3GLHB 1NBHA 1WBDA 1I1NA 4EFLA 8LDHA 3O9VA 1KBOA 1BCSB 3LNTA 4FFRA 1J21A 2QZ9A 3WK9A 3MPOA 3CVXA 2ZDQA 2VPZA 3EZLA 3MUFA 3OJFA 5A1TA 2O3QA 2BFBB 2C57A 1Q0SA 2MYTA 3MMPA 4KHZA 2ZUDA 3IUPA 4OXQA 3QVGA 3AV3A 4B3DA 2AR9A 1TTTA 3C15C 4S1PA 1I4WA 2HA4A 5JZMA 3LVQE 2OQVA 1KA9H 1OKKA 1QYRA 4XD2A 5CCDA 5KWIA 2D0IA 3A1UA 2GJKA 4R31A 1M6YA 1Z88A 4CNBA 4DLWA 4X41A 2AF4C 1E5TA 2CEKA 2NXEA 2X9VA 2JFFA 2QHXA 1KDPA 3FLMA 2DE0X 3TD6A 1OU0A 3A10A 2FSIA 3PQCA 2Q4RA 4JP5A 5TMDA 5CHEA 3FTFA 4LI3X 3CZ5A 1BE1A 3LOPA 8ABPA 3JWHA 1YS1X 2IZ5A 4BCCA 3C8HA 4L95C 3V1UA 3LVFO 4BKUA 4NBSA 1UXHA 4ZOLF 1IVYA 3PQ2A 2V5UA 2JFUA 2EJCA 5LD2B 3JRNA 1O97C 2A0XA 1OY1A 3NGXA 4PQEA 1CTQA 1RVV1 2WG2A 2AIRA 3LYHA 1LTKA 3OZCA 3RR2A 2H2GA 4Q4AA 2XZTA 4WQMA 1KQNA 2WKPA 1V43A 2AZDA 4AZ3A 1MFZA 5FNVF 4V0RA 3TN7A 3CVOA 1XA3A 3RRBA 4AS2A 4C6SA 3ESCA 3LPNA 2P1RA 4KIFA 5AW4A 1FXUA 4G09A 1GTJ1 5LOVB 4B44A 4QUIA 5AKGA 1P5RA 3EB9A 4R7TA 3RC9A 1WVMA 2WTXA 2XH8A 4ME6A 5DH9A 3NBFA 2IHTA 3LIPA 3JQBA 4C9BA 3I8SA 1HURA 4KVGA 2ZFUA 5KIAA 1P9LA 1GCGA 2H08A 3CZAA 4G0ZA 4KXXA 4MRSA 4CFZA 5JH7B 1TUBB 3PTZA 2P9JA 1Q11A 2WTMA 3GLGA 3C6MA 2H5JA 3RV3A 3TQRA 1UMCB 1NF3A 4ROTA 3FOFC 3I39X 4RLSA 3GIWA 4RK7A 1JLLA 4ZWNA 1E3TA 1DB3A 1JDBB 1UQTA 1J8FA 3C3DA 1YJCA 3QLTA 2C94A 4BVEA 4N0PA 4B5KA 5FWXB 2A1TR 3DE2X 4PV7A 1Q0RA 5T41A 1KI6B 1G98A 4XJVA 1UBOS 2BFEB 1QJCA 2OBYA 3D3JA 2WJZB 4O4JB 4G85A 3I12A 5IVHA 3LQ2A 5EP3A 4PWZA 3T9AA 3EDMA 1VJTA 4Z7JA 4DUYB 1ZU4A 1O87A 2GUGA 3FD8A 1W52X 4OJMX 5AQ1A 1YRBA 4Q9LA 5KHAA 4GQIA 2A7XA 3UWOA 3V33A 4PGHA 4H0NA 4DMLA 2GDJA 5H68A 2WFZA 4G8JA 3VM6A 5J58A 5KX5A 2Z5FA 1NIPA 3FN4A 4UNSA 1SXHA 3COVA 3N9IA 2C7PA 1BHO1 3ASUA 4URUR 3RVOA 2AG6A 3O8QB 3TEMA 3UMVA 4DKXA 1JNXX 3BGWA 5KNLA 3VR6A 1KEVA 1JWLA 5TQ2A 2IBSA 1XKTA 3EA0A 3CVJA 2CMFA 4MUGA 1W4ZA 5A5GA 1D2GA 2ZUWA 3FYSA 3B3QA 3ZD7A 3VPXA 4AL4A 1OGJA 1ICIA 2OHHA 5BWMA 3BMCA 1SCUA 3TI7A 4WY8A 4CLRB 4L3WA 1VIVA 2GD1O 5K05A 3E22A 3T1HB 4LDQA 2OZLB 4BKMA 5K45A 2HQRA 4AU1A 1UT8A 1P7VA 4IHJA 1KIMA 1W0CA 4V3CA 1UZUA 4R9NA 3AQIA 1P4JA 1LNSA 4A92A 4RH0A 1SXQA 2J3KA 1W94A 4JJGA 1F6DA 1PNTA 1UZNA 4DWOA 1L4EA 2XTMA 2AYZA 2GAIA 4UPVA 2ZT5A 2RBGA 3H5OA 3TLGB 3TQTA 1LSUA 4A2PA 4D98A 4DPLA 121PA 1XNQB 3EEYA 4TMXA 1K0UA 2MT9A 2W2PA 3EIOA 4UCFA 5JZVA 1ZI9A 3H2ZA 1JAHA 1MV5A 2AI1A 3K9WA 1DMRA 3LXRA 3FDFA 4RJIA 4YCMA 2HU2A 4ZYLA 4LGCA 3AUJB 3IV7A 3KNZA 3OE1A 1DPFA 5FTKA 2LE0A 4EYSA 1HE2A 3SC2B 3ZTYA 2R1VA 1CQPA 1X7HA 3O73A 3PFIA 1A9OA 3PKZA 2OGTA 4HWOA 4TTRA 4XWYA 4ZVLA 3MJDA 1VPTA 2C4KA 2BEKA 1E1QA 2H57A 3HPRA 1NT4A 1QO0A 1QIIA 3MTQA 4IVRA 1VIAA 2BT4A 4U6NA 1IN8A 4HVTA 5LOVF 4LC0A 4MRMB 5KTKA 4HZUA 1FA9A 1UEXC 2YRFA 2HSJA 3T9CA 5AI6A 2JCGA 4EUEA 1AGYA 3IS3A 3HSYA 5E6SB 1L1QA 1SWWA 2EBWA 4FOSA 4FTWA 3W0LB 1MB3A 5EJ5A 2C8JA 4YRJA 1BHSA 3CVVA 5LQNA 1HY3A 5AJXA 1J97A 3HFSA 4L22A 1TFRA 4O2BA 2JHGA 4U2CA 4QJ3A 2ZJ1A 5KTTA 2QR5A 1Q7CA 1E2UA 2JGIA 3HUEA 3ICPA 2NTYC 2XIJA 4M98A 4BWGA 3J7AC 3UB2A 1M2JA 4XGKA 5ALPA 2X42A 3AP3A 2JBAB 4NZOA 2R66A 4E5YA 4Y0VA 2FG7C 3WYFA 1H2RS