1EB8A

Structure determinants of substrate specificity of hydroxynitrile lyase from manihot esculenta
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDARDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords (S)-ACETONE-CYANOHYDRIN LYASE
publication title Structure Determinants of Substrate Specificity of Hydroxynitrile Lyase from Manihot Esculenta.
pubmed doi rcsb
source organism Manihot esculenta
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1eb8A00
2XUJA 4H7IA 1FFAA 4NMWA 3O0DA 4QWMA 2R11A 3HZOA 1LPPA 2B4KA 2WHPA 4GEGA 1XZBA 3ZWQA 4FLMA 1T4MA 2VEOA 2HM7A 4K6GA 3W06A 5LZ9A 3IUJA 2QVBA 1N8SA 5ALMA 2QJWA 1MU0A 3OPMA 1Q0RA 3R40A 5HQ3B 4FKBA 3W9BA 4WFKA 1U4NA 2WUGA 1CRLA 3G7NA 2JGIA 1ORVA 2QJRA 5JAOA 1GQRA 3P2MA 2WIKA 3O95A 4Y2VA 5AOAA 3C8DA 2IX9A 1UOOA 3WL5A 5AKZA 1DINA 2WU3A 5AI5A 1CUUA 2HU7A 1YS2X 3I2IA 1WHTA 5A2GA 2HA5A 2C5FA 1E5TA 2WTMA 2OG1A 3F96A 3LIPA 1LPBB 3QPCA 4Q82A 4WFIA 5A7HA 3SC2A 3VKFA 6YASA 3IDAA 5DYYA 4BCDA 2XQFA 2HFJA 3DEAA 3EBLA 1XRPA 3QPAA 3SWWA 3WKDA 4HTAA 3LIIA 3E3AA 3B3QA 5AKYA 1UK9A 5ESRA 4X71A 3LS2A 5C8ZA 2YYSA 3OTQA 2V96A 3H17A 5AKEA 3EQ7A 3O4GA 2BGNA 1TKRA 4K6KA 4U2CA 1AUOA 1EDDA 1J2EA 5CMLA 4AN0A 1LNSA 1K5PA 4W1QA 5AKHA 1BN7A 4DYHA 3V1NA 2ES4A 3CN7A 4ARBA 2PX6A 1L7QA 1J1IA 2JGMA 1JI3A 3QITA 1CUDA 1VKHA 4OPMA 4G8DA 1LZLA 2FX5A 3CCBA 3R3XA 3YASA 1PV1A 4EY8A 2XMCA 2HA3A 1T2NA 4KE9A 1TCCA 3PI6A 3ZLVA 4MQMA 3H2GA 1XZKA 1CUFA 2XLCA 4GXNA 2JEZA 1CUIA 1MNAA 1R9MA 4BCBA 4IO0A 3TRDA 2GYVA 5HF6A 3D5EA 5EHXA 1YSCA 1FFEA 5EHZA 1QO9A 2Y1KA 4H7JA 3JYHA 4QA9A 1YB7A 4B82A 1YCDA 2OCKA 4N8EA 3AILA 4FFVA 4PW0A 3NGMA 2AJBA 4HXFB 1EK1A 2EDCA 4UHCA 1TQHA 4L9AA 1WHSA 3WK5A 4BZWA 2QXUA 1EXWA 1ZD2P 2PU5A 4UBKA 1G42A 2XUHA 5DWDA 1Q83A 3FOBA 2C0PA 4MWSA 4X93A 5CT5A 2XUOA 4UBNA 3ESBA 4K5QA 4N5IX 1XRQA 5HF8A 5AO9A 1ZI8A 1P0QA 5F4ZA 1FSSA 4G4GA 1E3QA 1B6GA 5ALRA 1THGA 4KJXA 3T52A 5A7GA 1AX9A 2XUGA 2V97A 3FLBA 3UUFA 3FVTA 1R88A 4QDOA 3WK7A 5BWCA 1MJ5A 4GDMA 5JASA 1CUEA 4UBOA 3WJ2A 4C88A 1JJFA 2WFMA 5AKIA 1X2BA 4HRXA 1AZWA 3M3DA 2WIJA 1DX4A 2RHWA 3W04A 5JANA 4EZIA 1TCAA 2XQGA 4XVCA 1M33A 1Y7IA 5AM4A 1NU8A 3QMMA 5IH7A 1ORWA 1JMKC 2HA4A 2BGRA 3F98A 4OU4A 5I9IA 1QJ4A 4OD0A 4PNZA 1PJAA 2BCEA 2Y2VA 3L1HA 2HA0A 4J3JA 2Y6UA 1E8NA 1MAAA 3ESCA 5AKLA 2E3JA 2K2QB 3CXUA 5AI0A 1JKMA 1OILA 5CURA 5ALWA 1CUWA 2QOEA 1MNQA 3C6XA 3FCXA 3HJUA 2AJCA 4EBBA 3AZQA 2CEKA 1VZ2A 1EHYA 5ALIA 1CEXA 4QEKA 1XZHA 1G66A 2XUFA 4C89A 2WIFA 1EINA 4ZWNA 3N0TA 2ZSHA 3ICVA 2IIVA 2GBGA 3HLKA 3B12A 5CW2A 5T4EA 3R3ZA 3Q8WA 1USWA 3DYIA 2QT9A 1CUHA 4PF1A 4D9JA 3KXPA 3L1IA 1XKTA 5T4HA 4W1RA 4B80A 2XUPA 1GQSA 1ZIXA 2H1IA 1JMYA 4G8BA 4IH1A 3T4UA 3WIBA 2XQKA 3WK4A 4NZZA 4QDTA 2J4CA 3C45A 2XDWA 4L0CA 1W76A 4C4XA 2JGKA 3G0BA 4H7EA 3D7RA 1XROA 2WHRA 3STXA 5HQ3A 5FV4A 3FLEA 3V48A 5HKAA 5K3AA 4KYVA 4Y2RA 2OCIA 2CJPA 4J0CA 5JZ9A 3QBJA 1SOMA 5CT8A 3IVMA 4HXGA 1CUYA 1ZJ5A 4C87A 3R3UA 1XRNA 2VJCA 1DX6A 2I3ZA 5SYMA 5DNVA 1LBTA 1W6RA 4X6YA 4KAFA 1EDEA 4FNGA 2V98A 3MUNA 1QIJA 1IZ7A 2Z3WA 5FLKA 2GBIA 5C8VA 2OGZA 2QRUA 5H3HA 2RHTA 4H7HA 2BJHA 4UHEA 4BTLA 3NOXA 4BVLA 1ZI6A 3U0VA 5ALYA 5T4BA 3WWPA 1CUJA 4AO6A 4DMHA 4AQDA 2VQ6A 2WFLA 3DD5A 3F9CA 1BROA 4JUIA 2OCGA 2HDWA 1VXRA 2PM8A 4BBZA 3WWDA 4E11A 4CG2A 4FTWA 1MTZA 4KR0A 4UUQA 2VATA 4B7ZA 1EB8A 4CCWA 3GZJA 5C8XA 4DLNA 3WMRA 5LKAA 4OB7A 5HF5A 2Z3ZA 2WILA 4CIBA 4Y7DA 2WJ3A 2ZYIA 5JADA 1BE0A 4FWBA 5A6VA 3G9ZA 2BAGA 1DWPA 3BL8A 5CT6A 4J0IA 5JIBA 1HKHA 1EA5A 1SCQA 2DHEA 4ZGBA 5CH8A 2W6CX 2QMQA 1Y37A 5EIAA 4PV7A 2WJ6A 1QO7A 4X00A 3VJMA 1ZI9A 2Z5GA 3N2ZB 3MVEA 3I1IA 4ZV9A 3DNMA 4E15A 2WSLA 4PQEA 2XMQA 4A16A 4Y2PA 5BWBA 2WG0A 3DOHA 4WFJA 3I2HA 2J4FA 2WM2A 1LPAB 1O6FA 1KEZA 4DMFA 5FP0A 3L1JA 2Q0XA 5KBYA 4Y2JA 1CQZA 3WL7A 2ACEA 5ALZA 1K6EA 1WB5A 1TCBA 4UBIA 5KWJA 1F6WA 2OCLA 3FYUC 4KAAA 4KE7A 2WG1A 1A8UA 2GBCA 2I03A 4LHEA 2XMGA 4X94A 3G9UA 1DU4A 3X3HA 3H18A 2JBWA 5LZ8A 1P0PA 5LLSA 1ZICA 3A70A 4AO7A 3S8YA 3H0CA 4Q05A 1C7JA 1XFDA 5D7BA 3STUA 3STTA 2I3DA 2YXPX 3BE8A 1XZEA 4CG3A 1XRMA 4H7KA 4X95A 4Y2QA 1AC5A 4EB0A 2PSHA 5ALJA 1JU4A 1C4XA 2XMBA 1YB6A 4DNFA 1ODTC 3I6ZA 3W9UA 1VOTA 1CUZA 2EEPA 3OOSA 2ZSIA 2G4LA 1SCKA 1UZAA 4U2GA 4F0JA 1DT5A 3CN9A 3D2AA 2VJDA 1XRRA 3GROA 1XZGA 2XE4A 2D0DA 3IIIA 1LGYA 1LZKA 4G8CA 3SK0A 4GWLA 2BUCA 4I3FA 1QONA 2XUQA 4QLAA 3DQZA 3ZLTA 5SYNA 4E14A 4FMPA 4XIIA 2JGLA 2PPLA 5T4FA 5IVDA 2G63A 2Y6VA 2EDAA 1RP1A 4B81A 1XZIA 5ALHA 5K3FB 2QS9A 3I6MA 5CXXA 3WK9A 1GPNA 4N8SA 1Q84A 3H2IA 2BUBA 2VJAA 4QDUA 1WPRA 5AOBA 4BE4A 5JAUA 4BDSA 1ZJ4A 1P0IA 3WL8A 3PFBA 2HRRA 5JAPA 3ESAA 4OB8A 4XWGA 3IURA 1CR6A 1RYYA 1DQYA 4ROTA 3DCNA 3GBSA 2XMDA 1VXOA 1XZJA 5BOVA 3AZPA 1CQWA 4MQLA 2CUTA 4Y2YA 3E4DA 4BTVA 5CT4A 3FCYA 4F5ZA 1E89A 4C4YA 3G02A 3QYJA 4ZXFA 4H35A 1H2XA 5FXMA 1H23A 3KOOA 4HZGA 3QPDA 3JWEA 1ODSA 3I1YA 4TGLA 3K6KA 4AZ3A 2OGSA 4U2BA 5FPPA 4BB0A 1VE7A 3PDCA 4GLBA 4ZV7A 2D5LA 5FRDA 2ZVDA 4J0JA 4BC1A 1WB6A 3TEJA 1ODCA 1ZD5A 2XUDA 4DNOA 2FJPA 4BRZA 5AK4A 2DQYA 5AK6A 4PSDA 4O08A 4B0PA 5EI5A 4KEAA 1R50A 1A8SA 2DR0A 1CUSA 5DTJA 4IH4A 2G5PA 1A8QA 4K2AA 5JZSA 4QE3A 5HKBA 1QE3A 3EIOA 2P8SA 1WB4A 5CTAA 1FJ2A 3QVMA 3R41A 4B85A 4OYYA 1X2EA 3MUOA 2C0QA 1SCIA 3R3VA 1AURA 4G9GA 5HF9A 4BATA 3DYVA 3WYNA 3HI4A 2RI6A 4LYDA 5LZ4A 4N5HX 1Z68A 1N5MA 3G9TA 2WU4A 1QIDA 3WA6A 1VLQA 4RGYA 4FFWA 5HFNA 3C6BA 1QIKA 1N5RA 1CPYA 1XZCA 4AXBA 1GKKA 1W1IA 2IITA 4P08A 2XT0A 2YASA 3I2KA 3I6YA 4AB1A 3AINA 4X90A 2O2IA 4XJVA 4Y2SA 1LLFA 2O2GA 5FKJA 2HU8A 1YAHA 4ITVA 4PSCA 4XX1A 1F0PA 1CUBA 1H2WA 1UOQA 4FLEA 1QOZA 3GUUA 5AI4A 2HRQA 1BU8A 5I8PA 3H2JA 5DYTA 2Z8ZA 3DS8A 4S0XA 4W63A 2WKWA 3GELA 3PUHA 5K5EA 4CG1A 3G0IA 1L7AA 1ACLA 1EH5A 4A23A 5AJHA 1DTEA 3I2JA 1EX9A 2G5TA 4QNNA 5JYCA 4HAIA 4BYMA 1QTIA 1A88A 5EFZA 3MGAA 1CUCA 1GPLA 3WLAA 2PUJA 1CIJA 5IKXA 1QTRA 1DQZA 3OC0A 4CFSA 4C01A 1TIBA 4RE6A 2H9YA 1HL7A 3PF8A 5AM0A 3WZMA 4CCYA 2RAUA 1XZDA 1F8UA 4IHAA 3PF9A 3VVMA 4Y2UA 2XMRA 4QDZA 2O2HA 4AMZA 4BP9A 1EI9A 5LZ5A 3G0GA 1U65A 4KE8A 1CUGA 4HS9A 2WIDA 3V1LA 4X97A 2XUKA 5ISMA 1FFBA 2O7RA 1LPSA 4IH9A 2VT6A 1QIEA 4BRSA 4L3WA 5AOCA 5E4JA 2QTBA 4GW3A 2PSFA 3S2ZA 4HRYA 2AJDA 3G9XA 4EY7A 3FVRA 5LP1A 3DKKA 5FUMA 3TJMA 1R9NA 3DKRA 5E2IA 2DQZA 1DWQA 3VJKA 3IB3A 1JU3A 5HK9A 1ZGBA 2ZJ7A 2Z8XA 1MT3A 1BCSA 5AKJA 3H1AA 5AICA 1C7IA 1QIGA 4K6HA 4A5SA 2XUIA 3C5WP 4LIPD 1K63A 2PSJA 4I19A 4J0GA 2ONCA 4EY5A 1GZ7A 3ZPXA 4GECA 1WOMA 3D59A 5BV7A 4F60A 1BCRA 2WLSA 1AKNA 1GPKA 1BS9A 1BEEA 1RWQA 1E8DA 2QUAA 5AI8A 4LXGA 3FWHA 1E66A 3DJYA 2VSQA 3F8SA 1IUNA 4Q3KA 3G0DA 2ZYSA 4U2EA 1YA8A 2GBFA 3U1TA 2FUKA 4X91A 1ZIYA 2WIGA 1IUOA 1NX9A 4UHFA 4P93A 2DCMA 3RKSA 2C58A 4CI9A 4UFOA 1XQVA 4AMYA 5AK5A 4UFNA 2DSNA 1MX9A 1LPMA 2JIDA 2OAGA 4DMCA 3OG9A 4INZA 7YASA 3WYDA 4B6GA 5FPQA 1CUVA 3O9MA 3O4JA 4UBLA 4W1SA 4Y9SA 4DIUA 5ALDA 3AZOA 4EY4A 2OLEA 2XI4A 1WPXA 1QLWA 1YS1X 2WQZA 2UZ0A 4WCVA 5K3FA 3G0CA 4J0HA 4BC0A 3O4HA 3M81A 2B61A 3WJ1A 1EVEA 3PE6A 2FJ0A 5LZ2A 4UHBA 1UK7A 2GYWA 5D6OA 3F67A 4UHDA 5DNUA 3AIMA 2QUBA 1MX1A 3IUNA 1HPLA 2ORYA 3EF3A 2HU5A 5AI6A 3WKAA 4YX9A 1KU6A 4H77A 3VJLA 3C43A 3V9AA 2C5GA 2QXTA 1MPXA 1QIIA 4DNQA 1XZFA 1GKLA 2BKLA 4F21A 5AIAA 4BZZA 5EGNA 2VTVA 3WA7A 3C87A 2AXEA 1D07A 3A2NA 3JW8A 3FYUB 3LCRA 5JZBA 2CBGA 1LBSA 5DLPA 4ETWA 2HA2A 4DSAA 1YR2A 5JALA 3OURA 3AFIA 3WKEA 4QZVA 4RNCA 1JT2A 2XMZA 1G4HA 3QMVA 5AKKA 2J3QA 2PL5A 1GGVA 4X3CA 1UWCA 5LZ7A 2YH2A 2J3DA 4RE5A 3W05A 5AKXA 3AIKA 5AM2A 1FFDA 5HCUA 1H2ZA 3ZLUA 3QZUA 3ED1A 5E4TA 3Q0TA 1EVQA 5ALPA 4G1FA 1MAHA 4U2FA 3IUMA 3H2HA 1H22A 4FLFA 2VT7A 1CV2A 3ZI7A 5D3KA 2R8BA 4PSUA 3DL7A 5CH5A 4YPVA 3G8YA 1JJIA 2XMSA 1LPNA 2X8BA 1MN6A 1OCEA 4MEBA 4AO8A 1ZOIA 3PFCA 1SFRA 5KREA 4Y2TA 2DHCA 1G5FA 5YASA 2ZYRA 1JJBA 2BUAA 4EA6A 4ZREA 3VISA 1KU0A 5AM3A 4QWWA 4YK7A 3STYA 1YASA 2RONA 1PFQA 4Q3LA 3ILSA 1XZLA 5CH3A 4DNPA 4QDXA 3ICWA 4KAJA 1UKAA 4FHZA 4KRXA 3WKBA 5A7FA 2BFNA 2AJ8A 3LLCA 3FLAA 5LIPA 3I2GA 2WHQA 1UXOA 2XLBA 2C7BA 3BF8A 5K3BA 1L7RA 3WWEA 1YA4A 2CB9A 2HADA 4OB6A 5ALOA 4EHBA 1K8QA 3DDUA 3M83A 5CXUA 2PU7A 1VE6A 4AX4A 2JGFA 3STVA 1GT6A 5DYWA 2WFLB 5K3EA 5HK8A 3AUKA 1TRHA 4Q1VA 1O6GA 3ANSA 4ARAA 2QM0A 4BCCA 4UHHA 2OPHA 3WIOA 2Y2UA 2VAXA 4DM7A 1W52X 3FBWA 4UBMA 1OXMA 1A7UA 4X92A 4GI1A 1QGED 2VF2A 2WUEA 1ZGCA 4LXHA 4DMKA 5AHXA 3K2IA 5D3ZA 5ALGA 3C6YA 3KWFA 1HBJA 5AKGA 3LP5A 3UUEA 4BAUA 4WDQA 3H1BA 3PUIA 1AGYA 4EUSA 3SX4A 4AZ0A 3HXKA 2ACKA 4Z49A 3GFFA 4QLOA 1Q0ZA 1XLUA 4HXEB 5CBKA 2H7XA 1QIHA 3M82A 1XKLA 4FDMA 1R3DA 2PKYX 1THTA 1ZD3A 3HABA 4RPCA 2CMFA 4WDRA 3QH4A 3A6ZA 3NWOA 3WK8A 5J3JA 4P9NA 4FOLA 4M0FA 4C6HA 1ETHA 1Y7HA 3TGLA 2PUHA 2HFKA 2CZQA 4X6XA 3HACA 1SC9A 1K4YA 5AM5A 4DSZA 4B9EA 1WCYA 2NW6A 4NS4A 5DJ5A 4X85A 2WHPB 1UKCA 3BIWA 1QIFA 3E1GA 5ALKA 3O4IA 5DNWA 4H18A 5C81A 4Q34A 5JAHA 2PVSA 4G4JA 4OYLA 3UMJA 5E4YA 4N8DA 3D3NA 3HSSA 4WY8A 4JYPA 1W4LA 3F97A 3V1KA 1UT6A 3ANTA 3FSGA 4LKOA 2ZJFA 3RM3A 3HYSA 2DFPA 4G5XA 2WUDA 3VDXA 4WY5A 2W22A 4TVKA 1R4ZA 3I28A 5ALEA 3PICA 1VJ5A 1BRTA 3V1MA 3VVLA 3WKCA 4BAGA 3IA2A 2HA6A 4MYSA 3FAKA 4JNCA 2DHDA 3H2KA 3WQHA 5AP9A 3DLTA 1XRLA 5CT9A 1U8EA 4PO3X 2XQJA 2WFZA 1HLGA 4ZRDA 1AQLA 2ZJ6A 1DT3A 5EHQA 4C4ZA 4H7DA 1ISPA 2GZRA 4EY6A 4CIAA 4JEIA 3IULA 1BN6A 1UOPA 1VA5A 1QFMA 1GXSA 3FNBA 1YAJA 4E46A 2HHAA 2ZYHA 1IUPA 5K3DA 2OQVA 1X70A 2ECFA 5AH0A 3E0XA 2PSDA 1P0MA 1XZAA 3HRHA 4GHWA 2X76A 3C8HA 3RARA 2JF0A 3RK4A 3CCCA 5A62A 3D2CA 2ROQA 1AMNA 5AK3A 4B83A 1R1DA 4IQ4A 2VJBA 1XQYA 4YASA 1U2EA 2XB6A 3KSRA 5JARA 5JD4A 4B84A 2HIHA 2B9VA 4BAZA 5FOQA 3FYUA 1UK8A 3WL6A 4B0OA 3BDVA 2VA9A 1F0NA 3GA7A 4OSEA 3KDAA 4MEAA 1MX5A 4MJ3A 2I78A 3D4LA 5IVIA 1HQDA 2GZSA 4G9EA 5ALNA 3AJAA 4BP8A 2RIPA 1EDBA 2PSEA 4KRYA 1IMJA 4KE6A 3WZLA 3A2LA 3BXPA 2OGTA 1DWOA 5JD6A 5ALXA 3BDIA 5A71A 4AN1A 2WJ4A 2LIPA 4B9AA 1N1MA 1ACJA 4WJLA 5ALSA 2JGJA 4G4IA 3DOIA 3EQ9A 3C70A 2JEYA 1I6WA 2XQIA 5ALLA 2VAVA 5FDFA 2CKMA 1UKBA 1XLWA 4UBJA 3K9BA 1TAHA 1XQWA 3O9VA 2H7YA 3R0VA 3A2MA 3W2TA 1JFRA 2WTNA 2QKYA 1W75A 5AI9A 5AIBA 4LYEA 3FSGD 1XLVA 3WWOA 5C7YA 1BEZA 2GYUA 3QM1A 4FNMA 1UK6A 1B41A 5CRIA 3HEAA 4FBMA 1J07A 5JD5A 1QIMA 3KD2A 5HFAA 4MWTA 5IVKA 3ESDA 3EQ8A 3STWA 1MO2A 4OU5A 4OUKX 4J03A 1HDEA 1WM1A 3IBTA 5I7UA 3B5EA 4JH0A 1LPOA 4ZI5A 2PBLA 2OXEA 1CUAA 3OM8A 4LXIA 4TPKA 5EHNA 2OAEA 4MYDA 3WI7A 2QR5A 3R3WA 1TK3A 3H19A 2B20A 3BF7A 1J06A 2QZPA 1NU6A 5LYYA 2X5XA 3BJRA 4P92A 5ALVA 4DTCA 4FBLA 4J0DA 1H2YA 1CUXA 4OCZA 4I4CA 4W9RA 5ALTA 1VA4A 4U2DA 2AJLI 5HZGA 1IVYA 4KACA 4M0MA 3I2FA 5DTIA 3QMWA 5LKRA 3WK6A 4NVRA 2RGUA 5IVHA 1S8OA 2WG2A 4Y2XA 4UFPA 3KWJA 2HL6A 3NUZA 3BWXA 4BVJA 4BVKA 2H7CA 1FFCA 1CFJA 3D0KA 4X6UA 3BIXA 4J0KA 1UFOA 1VZ3A 5ALUA 3HC7A 1CVLA 4UPDA 5JATA 1EB9A 2WUFA 4JYMA 3DL4A 4J7AA 4CCYB 4BDTA 2XUAA 3RLIA 4DGQA 1XZMA 1XQXA 3VXKA 3BJMA 5AM1A 3WWCA 5ALFA 5ALQA 3AIOA 5EIHA 3FYTA 1ZD4A 2HA7A 1E8MA 2O7VA 5EIEA 3R3YA 1QFSA 4BE9A 4W1PA 1IZ8A 4X7BA 1QZ3A 5K3CA 5KWIA 4GBGA 4M0EA 4V2IA 1EK2A 3C6ZA 2C4HA 3C5VA 4HVTA 1CLEA 2JGEA 2OQIA 4H7FA 4MXDA 4Q3OA 3D2BA 3H04A 3ZV7A 4L72A 3IUQA 2V9ZA 4H0CA
chains in the Genus database with same CATH superfamily
2HD4A 4G1BA 3S2YA 1ORDA 1FFAA 4P3OA 3LZ6A 3P26A 3BT7A 4Q12A 4Q3AA 3IP3A 2YNMA 2H4HA 3HZOA 4WQMA 1Z35A 1OIWA 4J1NA 2WHPA 2F90A 2JI9A 4GEGA 3WBFA 4CXMA 2PT6A 4YCBA 3AB3A 3WLJA 1T4MA 2I8AA 4WE3A 4MUBA 2PV0A 4MYUA 5CDFE 2HM7A 5FTMA 4K6GA 5IC6A 1CJMA 3L9XA 3Q88A 3EPJA 2YWHA 3CF2A 3UWDA 4QPCA 2JBHA 1C1XB 1MU0A 2W8ZA 2QE7A 3OPMA 5C34B 3WBKA 5C52B 4CMJA 4KPUA 1FDUA 4OMFG 5U4QA 4J3FA 1C3OB 3ZZTA 2XDQA 2CYCA 1S8AA 2PZAA 2PO5A 4FKBA 4NZMA 4QL3A 3VC1A 1U4NA 3K0CC 3Q11A 4B47A 5JROA 2Z08A 4BO4A 3MJRA 5G0SA 1S3SA 2DZDA 2BRUA 6LDHA 2E82A 4R3WA 3VNAA 4CI0B 2X0IA 2EIXA 2EYUA 3NC0C 5BR4A 2PZFA 2HEGA 3RWOA 4GMHA 4XSVA 1LDGA 5AQ1A 3U9SA 3ZYZA 5IJWA 3G3EA 3TIFA 1JU9A 3MCWA 1V5EA 5AOAA 4CN8A 4Q7EA 3CZMA 2YR0A 1G5RA 3L8FA 5I7FA 2LBPA 1JN0A 1TJ3A 1XBTA 1RYBA 5G3YA 1Z6ZA 5DBFA 3W8FA 1ZJZA 1QTNA 4MOWA 1QZZA 2VIIA 1M6EX 1DINA 2FEWB 2HNBA 2JIPA 1AS3A 4XOUA 3LUKA 3E2IA 2BBWA 1Z39A 4ZI7F 4BUJA 1RKUA 3T9DA 2QIOA 5A3VA 1NN5A 2PZBA 4PSKA 1PUXA 1TUGA 4RF4A 3AKZA 3W9SA 1RMTA 4B48A 1KNXA 1Z45A 1WUJS 2HA5A 1KJJA 4ZI3A 2C5FA 1F9AA 4L15A 1HMPA 5KOYA 2PEYA 4PLWA 3OKCA 2OG1A 3F96A 4ID3A 2EFCB 3FJYA 4OHVA 4OMCA 5IDYA 2RGGA 1M83A 4MTCA 5LR6A 4IL5A 1OH5A 3D31A 2FUCA 5EWLB 3QPCA 4Q82A 4B6JA 4CMAA 2V7UA 4WFIA 4DOMA 1KOGA 1PSZA 1G8SA 2QW0X 1FZQA 3E05A 3N8DA 4G0MA 4KVGA 3SC2A 1RTKA 3VFDA 3I6BA 4REQB 1YR9A 3FMFA 3CPHA 3PDWA 5AVOA 3SXJA 4QU8A 5HIAA 1R5OA 1WS6A 1E1QA 2HFJA 3LK6A 1AGNA 1S7GA 2R47A 4HDCA 4ID9A 4B7AA 5DLYA 4MK4A 1LW7A 2PUGA 4PIPA 2E7ZA 3VKGA 4PO8A 2Y67A 3SDSA 1P0FA 3LIIA 4OJNA 4A0RA 4B5LA 3M8KA 3B3QA 5SZJA 1QAOA 5F7ZA 3TTSA 3W6OA 3HO1A 2PMKA 2BDTA 1UEIA 1QXSA 2YWJA 2Z2XA 3IRUA 2VJQA 2H08A 3DE1X 3EF1A 1CRWG 2QQGA 4OQLA 3FJ1A 1U8FO 1R4MA 4LXYA 1W44A 1ZVVA 3KV3O 4FYPA 1WUKS 2PRYA 4LVNA 1DDGA 5AKEA 5KS2A 1KFBB 3EQ7A 4YDRA 1VKNA 2EJWA 2V6JA 3FROA 5JDIA 4JYAB 4KLCA 4BU0A 2TSYB 4FYVA 3W2HA 1JHAA 2D0IA 3HZRA 1IXYA 4K6KA 4U2CA 2QD3A 2VBIA 4HEA6 3COSA 1B6SA 1T9KA 4TV8F 4KHZA 1YQGA 3L43A 2ERXA 2PUAA 4MIEA 3ND7A 1KKLA 4DMRA 5JD3A 5IU6A 1XO1A 3WMWA 1IDN1 1EDDA 2XB9A 1YBVA 4HPJB 3OLQA 4MV3A 4GRIA 2Y1OA 4J4TA 3HFSA 1J2EA 1TVCA 2NZUG 4ZRNA 2PUBA 1Z6GA 2COEA 2AG0A 2GAIA 3I05A 5AR1A 2CSXA 1CB0A 2BMAA 2PLWA 3D1LA 3LPMA 3OMLA 4BO9A 4CHGA 3AB8A 5G0UA 3DE3X 1V0JA 1G9TA 3UMVA 3CVWA 4EA9A 1EWVA 3TRIA 1BXRA 2BPOA 1LRLA 1RCFA 1VJDA 3EZ2A 3PC8C 2JD0A 4OIFA 2E5WA 3CN7A 1YDWA 2IEDA 2AZXA 5LNK1 1T0HB 1UBFA 2PX6A 2VJOA 4WLFA 1L7QA 4Y1FA 1D1SA 2HMVA 3PNVA 3O8OA 4ER6A 1G3IA 2C7QA 2AWOA 4NXMB 1VCIA 2YFQA 1JI3A 1NW7A 3OIVA 4NK4A 4N5LA 3KYCA 3OQJA 4W99A 3KQLA 1VKHA 4XB1A 2UV8A 3V3TA 2FPIB 1V4NA 3A7DA 1ZGGA 3WB1A 1RAGA 1PV1A 1GR0A 4I5GA 1Z0AA 4EPYA 2XMCA 4XM0A 2YWGA 1Y5RA 3CHYA 1BC5A 1DAHA 4EGFA 1GNPA 4BJ3A 5KVSA 1UFVA 3H2GA 1CUFA 2XLCA 3OIYA 2A0KA 4B3DA 3MS2A 4L0QA 2X3UA 2FRVA 2DY1A 4QULA 3HYTA 4MS4B 4EP1A 3UZUA 2UVDA 2PDAA 4IO0A 2GCEA 2WJGA 5HF6A 3SEZA 3UJPA 1I5EA 2IOYA 3A6JA 3AF1A 2VDLB 1PU2A 2ODWA 2C2GA 3F6SA 1NPYA 2CYAA 3QBVA 5EMHA 3S40A 3T4EA 3LQ1A 5JAMA 4DJ5X 2A4MA 1FFEA 2G6TA 3O26A 1OI7A 2BFEB 3TIVA 1RI2A 4HQNA 3D4PA 2Y1KA 2X13A 2VXCA 5COBA 2QX6A 4P54A 5A06A 5CVTA 1J2JA 3OOHA 2BI8A 4M36A 2I6QA 4ER3A 2JARA 1DC3A 3HCPA 4M37A 3AOEC 1A8PA 2MDTA 3JVUA 7MDHA 3B1KA 4GLJA 3SHFA 4B4WA 3V4FA 5EKXA 4LV8B 3JD4A 4QJ3A 1QX4A 4UCQA 4Q7MB 1TQ6A 5HP4A 3HKBA 2I29A 4YJ3B 1DIBA 3W1EA 4RTQA 4L73A 4D96A 3VBCA 2PQ6A 1TQHA 4UM9D 5K2OA 2QX9A 2AF3C 3I52A 3K70D 1P18A 2UU9B 5LLTA 3OM9A 5F5NA 4XDYA 1M2JA 4W5HA 1GN9A 2C1ZA 3QVGA 3JV7A 2HF2A 2QXUA 4R84A 4MW6A 5DV9A 3OOYA 1CQIA 1ZD2P 2GD0A 2PU5A 1G42A 2GRUA 2XUHA 1QCDA 3D4IA 1J90A 3JZIA 4FDAA 1Q83A 3BTSA 3U19A 3R24A 4TXNA 5DK4A 1H5UA 4TZ6A 4ZT3A 4Q16A 2TMKA 2B99A 2H2HA 3Q87B 4D8YA 4DA9A 2JCVA 2IX3A 1CS0A 1P75A 2BY4A 8ADHA 1DKUA 2X4GA 3BFXA 5BR7A 1YZ3A 4K5QA 4Y1EA 1ZIPA 3WHKA 1W9MA 4D0LB 4XQGA 5AO9A 3W3AH 5F4ZA 5K0ZA 2UUOA 3KJZA 1CJKC 1E3QA 3G5AA 3KSZO 3LPCA 4GGPA 1Q0QA 3BERA 1Q19A 2I2WA 4AJNA 5DBHX 1BJTA 3NAQA 4KJXA 5ALRA 5A7GA 5IX8A 5SZKB 4J1TC 4LGYA 2AOWA 1T8SA 1HYGA 3TTWA 4AUEA 3PIDA 5F1KA 5GV8A 4PANA 2VSOA 4Y2HA 2QQFA 3UUFA 4BZXA 2QK4A 3G13A 3GRVA 2OHOA 4OQ4A 1PTJA 2IYUA 2P2ZA 4YT8A 1GAXA 3IR6A 5JSQA 1IJEA 3T15A 3WYEA 4GDMA 4IIJB 1MUUA 2IY9A 5JASA 4HDNB 3CF6R 4UTNA 2ZDQA 5GPBA 2NVBA 4C88A 1JLLA 1YHNA 4QM7A 4HAUA 1ZHHA 1KJ9A 1E96A 1OT5A 3PFKA 3WQSB 4A8TA 4C4RA 5BMVB 4LY0A 2FG5A 4M1TA 1E3SA 2A1TR 1N92A 2VK2A 4BIMA 2QB5A 5HKOA 16PKA 2I2DA 4HB3A 4EH1A 4ZI7A 2Z6UA 1TPYA 1HQCA 3OE7D 4NFYA 4S04A 3OZUA 5WRFA 3H9GA 3OZEA 3HDGA 3WMFA 4TUYF 5IAAA 5KQGA 4AY5A 3RFVA 1XKQA 3QOFA 4EHKA 5I7WA 1WVMA 2XQGA 4YRCA 3VRHA 3FGOA 1P1RA 5KYWB 2H0AA 2RGAA 4H4DA 4RAOA 5TVKA 4PZ0A 1NU8A 1Q5PA 2FSUA 1HDCA 1JLKA 2IU3A 3BG5A 5IH7A 3KQYA 2E4UA 2HA4A 5AW2A 4CNQA 2NSDA 4EPVA 3TSZA 3GIDA 2HK7A 1MQ9A 3KKPA 1FFYA 4OU4A 3ND6A 5IRCD 5I9IA 1Q11A 2NZ8A 4O3FA 2C82A 1WJGA 2GN1A 2Y92A 3D4OA 3DPIA 4I5DA 4CM4A 2YKGA 2OKCA 3CEMA 2KHZA 4B87A 1LCIA 1U9IA 2IZ5A 3U7FB 3AX6A 4MVJF 1JILA 3KSMA 4PC6A 3ENWA 3G2PA 3UOGA 1PEAA 4W5TA 4FGKA 3RYHB 3C7CB 1E8NA 2B25A 3OIWA 5A1JA 2VCHA 3BB4A 3UJ3X 1BFUA 5JS1A 1DQNA 2HI0A 1MAAA 2NU7A 2ZFUA 2V9CA 5G4LA 3SICE 2B1IA 4R01A 4IFIA 4II3A 3C3BA 1RXSA 5HM6A 1DCKA 1P1KA 1SKYB 2C94A 2V5VA 4A9AA 1G2QA 5BT9A 5AW5A 2V3WA 5BVHB 3T38A 1QE5A 2JLRA 4FC7A 1HDOA 4TS4A 2HV9A 1NQTA 1P2VA 2PR7A 3B3AA 4ITRC 4WKPA 3ER9A 4DDWA 3JVDA 3D3WB 4LTNA 2FFRA 1NXSA 3W3AD 2EFJA 4H9GA 1OD6A 3DZGA 3KEQA 2ZREA 5CURA 3SFZA 3OHPA 2G4CA 1L5RA 1CUWA 2RGEA 1KZ7B 4FNOA 5HOEA 2H00A 1KZHA 4LF9B 2VHQA 2VJMA 4JLDA 4D4JA 1CBUA 2WSSA 3A1DA 1OZHA 1Y1KE 2D1QA 2V03A 3AHGA 3GJ6A 4KR7A 2J3EA 2MSNA 1E7QA 2R751 3N8KA 3A4YA 4O5AA 4UASA 5FB3A 5TPZD 3UWPA 3TIXB 1IN4A 2IZZA 3WAKA 3IELA 4EYGA 1L8QA 2EL9A 3UWSA 2X2OA 4G3XA 1E1LA 4AJ2A 2AGVA 1TKAA 1GRNA 2CEKA 3JCZA 5ALIA 3PSAA 3DZKA 2ZROA 4Z86A 3I4CA 1XMJA 4UD6A 4WLUA 1G66A 2EG5A 3L8GA 4JJFA 3K09A 1ZR2A 3SGLA 4NCAA 3DE5X 5HILA 4C89A 1G5TA 1OLXA 2G71A 3JALA 5KQMA 3LU1A 3U4QA 5G1OA 1WW2A 5KNDH 1EINA 4N3BA 3WNBA 2AOTA 2XYGA 5A0VA 4D9HA 2V7PA 2E6UX 4IGAA 3ICVA 3I4FA 3WRXA 1D0IA 2B2XA 3MQ4A 3V7UA 5IYZB 5K0LA 3ABSB 4RW0A 5F23A 3AR6A 3DFMA 3PNKA 3PEUA 2AKEA 3DUFA 4BGDA 4WWHA 5K7SA 2HIMA 5TMPA 4JI8B 5T4EA 3VZSA 2NGRA 1P7CA 1V8ZA 2JAOA 3R3ZA 4DG8A 3KB6A 3PVCA 1IY9A 1E20A 2QT9A 2AG5A 3M4YA 4AT1A 4G24A 3F3YA 4ECEA 2X1HA 1UT8A 1HTTA 3FVVA 4UEKA 4D9JA 4YV7A 2HHHB 3KXPA 5B2EA 1NVEA 3AEUA 3L1IA 4QC2A 5DX8A 4I1UA 5LP6C 5ENVA 2A9FA 3A4NA 1FXUA 1NW5A 4LJ6A 2H18A 1HI9A 5JBQA 4NRDA 1V41E 2GB4A 4LJSA 5BSRA 3A06A 4ACBA 5CCDA 4AZ0B 2GK3A 3QG5A 4WZBB 4CIWA 1U2GC 3W5CA 1MJGA 3RS9A 2LV8A 1L3BA 3ONWA 4C7OB 3T4UA 2BKXA 3F90A 4ZC1A 5TB5A 2PZKA 3P8ZA 3Q7QA 1TF7A 3AUYA 2AMFA 2XQKA 1ADYA 1K75A 4RK6A 3MEQA 3NTLA 4NZZA 3DOOA 4TXJA 4BMDA 4DDUA 3Q98A 1NVMB 1E79D 4RGVA 4PQGA 1NV9A 4LF8B 3UW3A 2NZXA 1LJLA 4G07A 4ZHQA 4J07A 2VR1A 3UGQA 1I2DA 2ZJ8A 5E6UB 2R7AA 4EFMA 3RBZA 3TDMA 1QVRA 5CM2Z 4PSAA 4AU1A 3ZCVA 1LA2A 3EVZA 2JBAB 5JCPA 5KHOC 3JRNA 2XUZA 1VYVA 1GL7A 2KMLA 3D7RA 3ELDA 2BI4A 4G36A 3BE4A 4LSZA 1UAAA 2FSVC 4QYTA 5FPYA 3T0FA 2JIRA 1MC8A 2AXPA 3R09A 1OXBB 2NTVA 1QH8A 3FLEA 5HKAA 4JSRA 4QPDA 2VN8A 1SN7A 3PFNA 2R0QC 3U44B 5IF3A 3UYKA 4IAOA 6GPBA 5IMSA 3T3HA 3LKDA 2GN9A 4RL6A 3LPLA 1HT1E 1TQ8A 1G7RA 2NUBA 3TG8A 1RQ7A 1SOMA 1BE1A 2MSEB 4R1MA 4N5NA 5CT8A 4DLYA 4M1SA 3OUZA 5BOSB 4EB6B 1AF7A 2F1IA 4HXGA 2RI0A 1LH0A 3KJQA 5LWHA 1T1EA 4J8PA 5HIMA 3DOJA 1JG1A 1G38A 5KYNA 1SU4A 1Q1NA 1J7KA 2YV1A 4FUQA 2WKQA 2R3SA 3LYAA 4BMXA 4D0NA 1PYOA 2NO6A 2W7TA 5KTPA 2XNDA 3KRTA 2JFUA 2NYAA 2J5QA 2XW6A 5JLJA 3DYBA 1LBTA 3QTBA 5KNDD 5TQVA 4LZWA 2WMNB 1EDEA 2V98A 4S2UA 4YAEA 4CDMA 1T9GR 4KX3A 4M60A 2QN8A 3QBEA 4MJ7A 1D8AA 1GQYA 5BQ5A 5TT1A 3EVNA 3AVUA 3N86A 2GO7A 1I3NA 1RAFA 2OXCA 2Z3WA 1KC1A 2VBFA 4RKYA 2ATXA 5FUXA 5KOHB 4YFYA 4DCOA 3AKEA 3V3KA 1MVNA 2QRUA 4EF5A 3AW8A 1H1DA 2WYUA 1Y8RB 4CM8A 3AEZA 1B16A 3NHFA 1JEJA 4EABA 1C7QA 4IGFA 4NAVA 3VR3A 3VR2D 1KFJB 3PC4A 1ECGA 3NTOA 2MSDB 5A4AA 3ZQJA 2IP4A 4LC9A 2Y1CA 2BJHA 3HXPA 4Z4FA 3D54D 3A1SA 3ETLA 3TR0A 1G5PA 2IZOA 1BH2A 3U0VA 3X0DA 1EVIA 3FIJA 1NBMA 2C9DA 2JLQA 4Q7JB 4YWHA 3EZLA 5JCJA 4E4RA 4TUYA 2BE9A 2OCXA 3WRVA 4QATA 4MRRA 3WP1B 4YRIA 3JWGA 4DGSA 2EZ9A 3HWX1 1QC5A 2PX5A 5TIIA 2QAGA 3A58B 4XPIB 4Y1RB 1JNXX 4CHTA 2WFLA 2G7ZA 3IDQA 3IIMA 1X39A 2AQKA 4BX3A 1NXTA 3EXG1 4X8MA 1QG2A 1KR5A 4RQUA 3UB3A 1IWPB 2JI4A 4M87A 3IDOA 1ZUNB 2ZB4A 2HDWA 3BJEA 3INTA 3Q12A 4BV8A 3X1YA 2Q6LA 1JHYA 3AKYA 2FWJA 1NT2A 4IHJA 4XARA 2J0VA 1WDTA 4BBZA 1OWMA 4BNWA 5FPKA 1PT9A 4M0CA 5JVDA 5AW9A 4E11A 1O94C 1CJUC 4HFNA 4JLNA 4KR0A 4UUQA 4MVJA 2XEXA 4MYCA 3H65A 2J7PA 1SZPA 4K81B 3LYHA 1FTYA 1MA0A 2MYTA 3SIWA 3DVAB 4X84A 4ARIA 1H3EA 4GX5A 4G5RA 1GTZA 1NJ2A 4RMGA 1QV9A 13PKA 2LTAA 3W5IA 3GLFA 4YRSA 1PJZA 3IDSA 3AWIA 4E5YA 2JAHA 2GERA 1KFEB 3I8XA 3QUBA 2E89A 5FWAA 3K9NA 1BZYA 5GJWC 1N2CB 3IV6A 4II2A 1HL3A 1ILWA 3EAFA 3U4AA 4A2PA 2CWDA 4FYWA 1E9VA 5HOQA 1ORIA 2E4WA 2GA9A 2WJ3A 4FFBA 4HN4B 2ZYIA 2WPDA 3DJFA 2MWMA 4UJ5A 2A7QA 3TMAA 2W6ZA 1AKRA 1Q0UA 4RZUA 1DFIA 4ER0A 3F6RA 5CDFA 4RDXA 3JWPA 2B1JA 3G9ZA 4E12A 4E5UA 1HE1C 2D7DA 1D2EA 2FF7A 3CF4G 2NTEA 3E23A 4O4HA 3KQOA 4UMEA 4FMBB 3BL8A 3KELA 2BF4A 1NN0A 3EIQA 3L18A 4DV7B 1YE8A 4M55A 1Q21A 2D2VA 2GO1A 3DHNA 5TQ2A 5JIBA 2J09A 4J1QA 2QROA 5KWSA 4NICA 2I8CA 3CW2A 2Z8YA 3T7IA 3F6EX 1DKPA 3OT5A 5D5HA 4D97A 1E0SA 5K8UA 3AV0B 3SQMA 4CR6A 3OKAA 3INYA 2BHRA 2SICE 2HBYA 4TKUB 3UAGA 2B3TA 1OPXA 4X00A 4JLVA 5L6LB 1C9EA 1YQTA 2Z5GA 2WF7A 4HWSA 3ZDZB 4F3CA 3N2ZB 3J80A 3Q9SA 5K0SA 1LBEA 3MVEA 2OGUA 2D3WA 2X9NA 2QTGA 5LMUB 1ISFA 3CRQA 4LQDA 2DGDA 2Q7OE 2YVUA 3HUFA 2FU5C 3VNSA 2WSLA 4PX9A 2JHCA 1BXZA 3M9LA 3NBKA 2NV2B 3KPVA 3FOAA 5M3BA 2K87A 2XMQA 1Y7PA 4A16A 1JQJC 4Y2PA 2DLNA 1C7RA 2AHOA 5BWBA 2VJKA 4P34A 4CWAA 4XFDA 3DOHA 3PJEA 3U48A 4EL0A 5EYPA 5BN1A 2X42A 2H1CA 3ANXA 3NLLA 3O3NB 4CEJB 1CY2A 1XT6A 1NI4A 5C5IA 4KITB 1UMCA 3B1VA 4DL9A 4D5GA 4HNSA 4WLEA 4L02A 2KB0A 3TZQA 2FXIA 4OXRA 3DUWA 1UBLS 1C0KA 1A5AB 1CQZA 1S89A 3PQ7A 4KR3A 3CX8A 1S2OA 1BIFA 4MTLA 1LWOA 2ACEA 1K6EA 1TCBA 1EP9A 2Z5VA 5KI6A 1OXXK 4GM0A 4NZPA 8AT1A 4PRZA 3TLYA 2WMDA 1NT4A 3VR6A 1IEWA 2HLDA 2X0EA 4IVRA 3VSCA 4KE7A 1KBQA 1LJ8A 2AFHB 3O84A 4TRJA 4CMIA 1N6PA 3CLSD 1Z29A 4ITUA 3TZBA 1A8UA 3L4EA 3VU8A 4DT1A 1V16B 3RW9A 3VKVA 1HT0A 2I03A 3KXIA 4R2HA 5DBEX 2XMGA 3UJBA 2JLWA 2BM8A 1JWBB 3PXDA 3UHFA 1F5NA 3CKYA 4ZIRB 2ZBFA 2X58A 1KSHA 3KYDA 4QU5A 4C7BA 1H4SA 1C2TA 1VPEA 4EKYA 5BNZA 3RC9A 3TL3A 1DG1G 1YL7A 3H18A 4JJ8A 3OU2A 2ZRGA 5LZ8A 4AY2A 3DAFA 4WBXC 4DG5A 1QWSA 5CPFA 3A70A 4ZCMA 4OJKA 3UEOA 1VBMA 3OTOB 2IOFA 3H0CA 4ASUA 2EEZA 3WV4A 3KL2A 3RSLA 3FPKA 4LZOA 3VZPA 3X1JA 1OBHA 4Q4AA 2FMUA 1V1JA 3U5ZB 5A05A 1R6AA 2H1SA 2HO4A 5LN1A 1ITZA 1ISJA 1VE9A 1XCPA 4RACA 3PUXA 1KIAA 3ZCQA 4P4SA 2YXPX 2YWCA 3Q8XB 5JBIA 5DHQA 3EXAA 4DCMA 3QXGA 4DC0A 4P83A 4H7KA 3U3ZA 1Z4LA 1AC5A 3I12A 4ARVA 1NXQA 5P21A 1X7DA 3DG9A 2O3JA 5ALJA 4RFSB 1C4XA 3PR1A 4B76A 2XMBA 2C0CA 2C4WA 4B3CA 2O2EA 3DBLB 1XMOB 1C30B 2UUPA 2G9RA 4Z9FA 5HUQA 1ONNA 1U0JA 3B1JA 3EG9B 2P7HA 5ILGA 4LJLA 1A9SA 1YQDA 2C77A 2HF9A 2OO7A 2SKEA 4JQOA 2A8YA 2ZQZA 1D0SA 2OG2A 1IU9A 4NMXB 4IIEA 4U2GA 3R7SA 4F56A 4V03A 3CN9A 1AUXA 1GDHA 1TECE 4BVFA 1TTHA 1TAUA 4EI9A 5HWSA 5CEEA 2OENG 3TE6A 3BBLA 3G2QA 4J91A 4I14A 3IIIA 2NV6A 3C15C 1LGYA 1WZNA 2XNCA 5IPFA 2IE8A 4EYKA 1FFXA 2EQBA 4DCVA 2BUCA 4I3FA 5HKKA 4G0VA 4NCIA 1SZJG 1Y89A 2Q0QA 2H16A 2YZNA 3P9CA 3MELA 5GWXA 4E5MA 3G8DA 3QIVA 4PTLA 3PGMA 2EZUA 1A5BB 1UXGA 4ZTZB 3GT7A 4S1TA 2H0RA 4ND3A 5SYNA 3RS4A 1PBTA 1PR6A 1NDHA 1SQ5A 2J3LA 3L0YA 1U0SY 1YB5A 2WAOA 3EJWA 4MICA 4NNOA 3HEBA 4LHYA 4QTXA 1GNLA 3AEQB 2JZCA 1UP6A 3WGYA 4P32A 4WEQA 2G9NA 2NN3C 1OQAA 2ZRLA 2FZGA 3H1FA 5B3JC 1WQ3A 2BFBA 5FLEX 1PLJA 1D5WA 1HQKA 5KJ1A 3RREA 2G63A 1DOAA 5EP1A 4ERXA 2P7IA 2XTMA 2Y6VA 2QI9F 4MCJA 4TTRA 1EUCA 3RU9A 4WN9B 3GRCA 1B3RA 1RP1A 3AR3A 4YS6A 2PL1A 4B81A 5CFPA 4WECA 2FVYA 4RH1A 1RYMA 1D1QA 4K6MA 1XZIA 4XD7A 5ENDA 1X0VA 2QS9A 3HCDA 1GPNA 2E6KA 4NX2A 3WNQA 1S96A 5FPHA 3KAQA 1E9EA 4NF2A 4ZO6A 2I7CA 3H2IA 2X1LA 3TBFA 5KOJB 3F5QA 4FB5A 3E53A 5B30A 4A8JB 1WCIB 2D2EA 3DXXA 2UDPA 1P0IA 4QTZA 4RF5A 4TS3A 2AZDA 1MB9A 1T4BA 4R8KA 3PFBA 4H0NA 5JAPA 2AOXA 3TOZA 5ICMA 1K5GA 4XWGA 5E3IA 3FDZB 4QQKA 3SSOA 2C5BA 4UNQA 3UUWA 1RYYA 4BNZA 4BPBA 4ROTA 4I66A 2IS2A 2EC5A 5DN9A 2NXCA 3R0ZA 1QYIA 1Q6ZA 2OD9A 1QANA 2ZDHA 4TT3D 3RCBA 3EZ6A 1U0TA 1QP7A 4PPYA 3DTVD 1GTRA 5IP5A 5DP1A 3K9WA 4I99A 3DE7X 3GJ7A 3LHKA 3PHCA 3QLUA 2WW8A 1TT5B 2CUTA 4MQLA 1YZLA 5CLJA 2CZCA 2B1GA 2A9PA 5BN4B 1E2IA 3SZ3A 4A8JC 3X44A 1HXHA 3LX8A 5DXJA 4ZOLF 1PG5A 3U9TA 2IEIA 5EP4A 2NP6A 3BZBA 3L02A 5CT4A 3R5JA 2FZWA 3RG2A 4GSKA 5LSAA 1RM4A 3NDBB 3OU6A 4BMCA 3NETA 2EL7A 1S2MA 3TDKA 1IXZA 4PHTA 5CA1F 1Y6JA 4HFRA 1YCGA 4UPVA 3ZBTA 4CKEA 3A11A 3ZJ5A 1Y8CA 4HDMB 2Y99A 1H23A 1FSZA 2C9CA 3QPDA 4JC5A 2PUWA 1TTQB 3A6LA 4KFUA 1ODSA 2HIGA 2V8BA 4Z1MA 3RYFB 4BY9E 2YIMA 1EWQA 1N5DA 2GN6A 4BB9A 5THKA 2WJZB 3D9QX 1VP3A 1L4NA 2QZ4A 1ZN2A 2HU2A 3EZNA 1XUOA 1Y1SA 4C06A 4BB0A 1AVTA 3FUWA 4IGKA 1L1FA 5JMTA 5BYBA 3FDIA 1E7MA 1UWLA 2WF9A 2B35A 3B9BA 1PJTA 4Q21A 2PFKA 1DFHA 2AW3A 1Q3TA 3JPWA 2BHTA 4X1YA 1S3GA 4D3DA 3BFVA 1M2WA 1NQXA 3HG7A 2ZVDA 1GAQA 1VLLA 2RHLA 3Q7RA 4BC1A 6ABPA 1P4GA 3KTFA 1X0XA 3TEJA 3VHXA 3FWKA 5CITA 1C9KA 3K0FA 4RGQA 2AEMA 3GWGA 1ZOSA 4DNOA 3LHDA 1C7EA 3ZI0A 4RJIA 1EUQA 5K0BA 4RY8A 3EVDA 5AK6A 2BN4A 4A15A 1CNFA 5T3YA 4PO1A 2NT3A 4DQDA 1UFKA 1WU7A 4PSDA 5GZ3A 1Z9BA 2C3UA 3AUAA 3G5UA 2AKAB 1U5CA 2GDJA 3T5MA 1R3UA 2PYZA 3TZCA 4B0PA 1JA0A 1PT6A 3FTDA 4RO0A 1OI4A 2JFGA 4DV3B 4ZT6A 1M1UA 5EI5A 4KEAA 4LX0A 1R50A 4YRGA 3UCXA 2DR0A 3EXHA 1T5DX 4YJ2F 3L0CA 1CUSA 2WDPA 4Q15A 2JJ2D 1P9WA 4FT4A 2Y1WA 3KZOA 4JB2A 4IH4A 3GN2A 1J8QA 1U8CB 3EHEA 5DTJA 4PEVA 4JASB 5HKBA 4K3UA 4LFAB 1EXNA 1X94A 2J3JA 1E2QA 1N5KA 3TLGB 1JHUA 4FINA 3IQGX 4YAIA 2HHLA 4H4EA 4Q4HB 5CTAA 4NCBA 4DB4A 2VKQA 1SEVA 3NDIA 1EGMB 3ZHVA 1FDTA 1DB3A 3QVMA 2SNIE 3CUUA 1NMQA 1DRVA 2ZE6A 4DARA 1H6BA 1X2EA 3G9QA 1DWUA 3EDYA 1V48A 3NHMA 3OCUA 5KIAA 3VC3A 1LQTA 2YFYA 4RS4A 5BV2P 2XB2A 3RVRA 4G67A 4DLWA 1P33A 4DR2B 4KQKA 4AJ9A 4DQLA 4R05A 4XVRA 5HF9A 1RQXA 3KZCA 4UNIA 1Z16A 4OOEA 3UXYA 1OGYA 3IXMA 4ETMA 3GLIE 2JLXA 3BMOA 4LOJA 5B2ZA 5K4HA 2ENWA 1OXTA 1NUSA 3IEKA 3TR6A 5H80A 2RKWA 3LGXA 4IQ0A 5I5GA 4KH0A 2RI6A 4JXKA 3CJRA 4OMDA 3DPSA 4OQQA 5LZ4A 2OBXA 1I4DD 2ON6A 4EHJA 3T3MB 3GFPA 3BCRA 2V7QD 721PA 3IUYA 3RAJA 4KFTA 1ISHA 2GKSA 3ET4A 4O2BB 3ZOZA 4BVHA 1N5MA 2AN3A 3FFAA 3DGFC 1T5BA 2YHUA 3GDWA 4MP3A 4QICA 1HX7A 4WZBE 3DT9A 4QYXA 4YRZA 1DVRA 1E77A 1RAAA 2P1DA 5KU7A 3CEHA 4BN5A 3ILXA 1KJIA 3UMCA 2QT0A 2R00C 4K87A 2I1WA 3X1ZA 2HNAA 4PG7A 3ZY3A 1Q95A 3TZEA 3UAVA 1NUUA 2QMYA 1PQPA 1WF6A 1H85A 3OOJA 4A0QA 4YJGB 1JEAA 5L4LA 5F3DA 2A59A 1MD9A 1ZJWA 4EPTA 5IKEA 2WJYA 1KVUA 2PRIA 4QJIA 2XB8A 1PX0A 4AXBA 2Q3LA 4D43A 4HNRA 3DZBA 1O96A 3JQ7A 4UQOA 1EAYA 1Z6YA 2G67A 3IBCA 4LN1A 4MCHA 3E5NA 5I9LA 1UBOS 1L5NA 4AG6A 5F2EA 5EJ6A 5JOQA 2VXYA 1GIAA 2VJPA 2R6DA 2FW0A 3M3HA 2E85A 2IZ0A 2ZCVA 4TTTS 1YI8A 1QVZA 2YJGA 1ZH8A 1IJBA 1U7WA 1EBUA 2YASA 3I2KA 3I6YA 1RTTA 5D2CA 5K0EA 5L51A 3WLIA 2EW2A 1IJFA 2O1EA 3FMOB 1LLFA 4QRIA 4XH9B 1KI4A 2O2GA 4QUJA 4TN5A 1W0JD 2WJHA 5FKJA 2CDAA 5C8YA 1Y98A 3RTEA 2XXAB 3LQ4A 2HF8A 5T41A 5ERXA 4XX1A 3OPNA 3UXMA 1CUBA 4BNXA 4CJXA 2I33A 3GUUA 2HRQA 4I4NA 1QVVA 5KWEA 3TGPA 3AR8A 3WGLA 3IKTA 5HJ5A 3VX3A 3H3FA 3PNYA 4NLLA 3VAYA 4G8JA 2Z8ZA 4XB6B 3VR4H 4S0XA 3KSAC 4G89A 3M0EA 5C1PA 3EW9A 2ID7A 2GD6A 2WKWA 5J5VA 1I36A 3PUHA 2YJ6A 1J0EA 2IW3A 4ETNA 5B7QA 4CG1A 1WIWA 1E58A 2ZJ1A 3LF1A 5IYZF 2I7DA 3V8BA 4R1PA 1NHWA 1ZNZA 4KNYA 3B5JA 3RS8A 3ACCA 4Z4IA 1ACLA 3EMDA 1EH5A 1BMFA 2ZR0A 4GFDA 4JOCA 4QFBA 1YR6A 5DLDA 1VM6A 5BQFA 3Q7PA 5G40A 1NLUA 2XDYA 2WI8A 4KQ9A 4R1QA 4WVLA 3ZOKA 4FX5A 5AJHA 4ZFNA 4DKJA 3LO8A 1T1GA 4G0PA 1DTEA 1XX6A 4DYVA 3PEYA 4HAIA 1G21B 9LDBA 4M9CA 3RC2A 4A10A 4B2IA 3RR2A 5EFZA 1U0RA 5IG2A 1CUCA 1NOKA 1GPLA 3K4QA 3WLAA 5H16A 2FEKA 3MT0A 2IELA 1G9XA 4N54A 2ZQ5A 4IUCS 2EOAA 2CLLB 2YMMA 2CJXA 3OC0A 1NZFA 1MR3F 3BWCA 4CFSA 1ENPA 1TF5A 4WKBA 1NF8A 2XF2A 2OT3B 5CD9A 2IBSA 4RK1A 3PF8A 3JAMA 1NKVA 3VO2A 2AEEA 3WIDA 3UAXA 1XZDA 3C8MA 3RTDA 3T7RA 2GAJA 2W9XA 5AVKA 3RU2A 3PDHA 3VMFA 2QTZA 1FQOA 3UV6A 3T5AA 4QQRA 4ENWA 4Y2UA 4CT0A 3QJ5A 5KUTA 4CTNA 1CR4A 1XLTC 3FHLA 5BNFA 3IVCA 2IWRA 4IJVA 2Q5LA 2EHJA 2Y93A 3RI3A 3U4HA 4BBPA 4V0SA 1CY0A 2QJTA 5IJ9A 5EQDA 2OV6A 3B8EA 2IS1A 4HQ6A 3AGQA 1GZ6A 1M2VA 1CUGA 1WTAA 4P4NA 4US1R 3K5HA 4KMMA 2N0SA 1EK5A 2I87A 4JL6A 2PUDA 3MSCA 5GVRA 4KMRA 4YIHA 4Q4JA 3K71B 4HL6A 4AP9A 1P3JA 2XUKA 3GNTA 3OM0A 4RA6B 1KAOA 1N2BA 1M6VA 1UOEA 2O7RA 3C98A 4LPKA 5FL7D 1GZ4A 3P9YA 4ZYYA 4B79A 2G5CA 3RV4A 5CA1A 2VT6A 1P5JA 1US8A 1W36D 1GRVA 1QIEA 4BRSA 3SBEA 2Z5LA 5C1OA 2NXNA 4GW3A 1N3LA 5FT9A 3KTAB 5U9CA 5IDXA 5TXGA 1FPMA 3CX4A 4XYLA 3LH5A 1XMQB 5BN5B 2VPXA 4FYJA 1CP3A 1OX5A 3GVHA 3T94A 3REQA 3FVRA 5LP1A 3VU9A 4I9UA 4JQSA 5FUMA 2MJLA 1IY2A 4R51A 4C6SA 1N2CE 1UODA 3K0CA 3QX7A 2AUNA 4EDHA 4MUKA 3H6HA 4KXYA 3HDJA 2IXBA 5E2IA 3VR4D 1SHLA 5E38A 5KYYB 3DB2A 3UWOA 3WGJA 4F5WA 5IN4A 1ICEA 4FW8A 4ZJUA 1O95D 1VPVA 2AK3A 4P53A 1V5IA 2FW1A 4L8WB 2RH4A 2J6CA 1MT3A 4AJHA 4KYUA 5C37A 3HM2A 1BCSA 4RULA 3GCZA 4OXIA 1XPOA 3CJTA 1TK2A 3NJ8A 5AICA 3SXUA 1C7IA 2BSAA 3MT7A 4UEWA 4K6HA 1C1XA 4UOZA 3ZK9A 2XUIA 3TEFA 3C5WP 4FFNA 1IL0A 1C3OA 2B4QA 4LIPD 4U5QA 2V58A 5BSTA 3WG9A 4KH1A 3NM6B 3FHOA 1ENOA 4AZSA 5BYKA 2Q2WA 4YJ2A 1PGJA 2GPWA 2R8PA 4EENA 2I3GA 2CHVA 4V0LA 4IF6A 2JANA 5BV7A 4AWAA 1MXHA 3FMVA 1T8YA 3C7AA 3TW4A 2ZANA 4FK8A 2XVZA 1BCRA 1PG0A 4ZPJA 3WGQA 5I4IA 3LP8A 2VSXA 2BEJA 1P2UA 2B94A 1BS9A 4EX7A 3CZAA 4HWTA 3SZLA 4P7KA 2PIAA 2QUAA 4MARA 4X7RA 2Q41A 5DHRA 4QFMA 5THQA 1S4QA 4JVSB 4IDAA 4LJ8A 4ZCTA 1KI8A 1WDWB 3W2FA 1AS0A 2WV9A 4EG6A 4EUKA 1YTUA 3DJYA 1EM8A 1PQ4A 3GLKA 2VSQA 5JYBA 4LDAA 5DN6D 1YOBA 5DFAA 4F7WA 3RBXA 4B46A 1Y0BA 4G5SA 2FTKE 5B12A 5I3ZA 5BYJA 4UQPA 4DRYA 1EXDA 2W6JD 2BGTA 3O3OB 4LSMA 3G1WA 5K0FA 3PKJA 4IFTA 4URYR 1GPBA 4Q9KA 5C35A 1IUOA 1NX9A 1RYNA 2FOXA 2NAFA 5LYJB 1S0UA 1EFPA 1M54A 1K86A 1ZL2A 4C0KA 3RKSA 5JTTA 4JITA 3VPBA 4LF4B 4BGIA 2E1PA 4TSRA 2VAWA 4REQA 5FOWA 1FPQA 1KK1A 2FN8A 1QNLA 2RARA 1TCVA 3FI0A 4GI3A 4MA5A 3L79A 3TD9A 2Y05A 1SBHA 3I04M 4DLAA 2XHZA 2H31A 4KV9A 4UFNA 3SQXA 2DSNA 4UEOA 2GF0A 1MX9A 1BAPA 4E2YA 4C5BA 3QVOA 3DVQX 2FN7A 2OAGA 5M7EA 1P29A 2H4XA 2WAXA 1K7YA 3O7MA 2PO7A 3GCXA 3P19A 1K7EB 1E9BA 1JZQA 3GD7A 3HCNA 3L4BC 3MRXA 3COPA 2A1IA 1JTFA 4QXMA 2C7RA 1V25A 5CFZA 4IFEA 1FYXA 3WQBA 4MHTA 4JUCA 4UUPA 1NMSA 2Q2OA 1KF0A 3OT4A 3RV3A 4V0RA 4D99A 4KZKA 5ALDA 2R8OA 3AM1A 1E2JA 3S1AB 2OK7A 2IGBA 4JR0A 5EE9A 3PC8A 3R7FA 3RIGA 1KO7A 2UZ1B 3BGWA 5KKNB 1MVOA 2V3VA 1W2GA 1E9SA 2WJVA 3ID6C 2WQZA 3K5WA 4M3NA 2UZ0A 2IPMA 2P1ZA 3DMHA 4OK5A 3W78A 5K3FA 3PGXA 5JO9A 4MPJA 3FKSA 1H2HA 4NAHA 2DRIA 3G0CA 4TKZA 4RZIA 3SJBA 1SVIA 4BC0A 1PHRA 4P3KA 3O4HA 4TXMA 3KUUA 3EXFA 4RD2A 3VA7A 2J0QA 1KE1A 3RUCA 3CISA 4A26A 3H0EA 5AQEA 1M1YB 3BRQA 3FW1A 4OSPA 1U1DA 4IR7A 3CR8A 3ZH2A 1BX0A 1DJNA 4JL5A 3D6AA 5F73A 3R7LA 5IYZA 2B61A 2OILA 4S12A 4A0FA 3GVCA 4DV0B 1EVEA 3MN1A 3PE6A 1RXCA 2BMDA 2GTPA 1UWKA 2IXFA 2CYBA 3BH7A 3CH6A 4UHBA 3TFWA 5LP6F 1GXSB 1UK7A 1L6RA 2V4ZA 2PVCA 3OF3A 2HNKA 4GOOD 5DNUA 2EF0A 5KX5F 1WXGA 4FI3C 3Q5EA 3IUNA 2FPIA 2OLKA 5JJBA 5LXTF 1NLYA 3EF3A 4O63O 2IKQA 2HU5A 1P5FA 1ZP6A 3EK2A 3WKAA 1UPUA 3NBQA 1EJ6A 2BR3A 3WO0A 3GHYA 3U7QB 3UW1A 2GCOA 3VJLA 4DLTA 2OWDA 4L9RA 4RKQA 1OWNA 3OFKA 4NATA 3V9AA 3K96A 1QGUB 2C5GA 1NN3A 1YRHA 1I5RA 3AOEA 3B6ZA 1L5MA 1HRKA 3COYA 3PQEA 1QIIA 2V55B 5J43A 2QWXA 1Z3CA 3KXDA 4FP9A 4LZLA 3C3KA 1H4VB 4M98A 4GLOA 1SBQA 2ZUSA 5TS2A 3DKIA 1KPHA 1YKGA 3GT3A 4Z99A 4OHWA 1RW4A 4UATA 3QA3E 3BA1A 4PNPA 2AC4A 2NQ2C 2BKLA 5SICE 4B7CA 4HNQA 1D5CA 3FSJX 4F21A 1AHIA 4TVOA 2BFEA 4MIYA 4XYGA 2RE8A 3TINA 4BZZA 3LKZA 2VTVA 5DBIA 5AW1A 3LPNA 4K86A 1T24A 2BM0A 3PUVA 4F2HA 4IWYA 1D07A 1M6HA 2ADFA 3A2NA 3BSWA 3JW8A 1TIKA 5LQNA 2CBGA 4HNAB 3V7FA 5DLPA 3V97A 1GL9B 1P73A 2CLMB 2HA2A 1SURA 1DQSA 3ECCA 3ORRA 4OJTA 4ZVNA 2CXXA 5LQDA 4JGGA 3OURA 1VHTA 1G8FA 4B6FA 2QVZX 1D04A 3K6RA 2PJDA 2HO5A 4MKHA 1UAYA 2HZBA 3GBPA 4XTRA 2WTEA 3ZW9A 5JRJA 3KHSA 2AQHA 2I2BA 3A4VA 3QMVA 1FRQA 1XDZA 4TMWA 2CCGA 1XL0A 5DGHA 3CX7A 4J1TA 2ZJ4A 2BKAA 1EFRD 1PCXA 1H6DA 1UWCA 4GR5A 4OH7A 1SULA 5K99A 2JLBA 2CEAA 2J3DA 1F6BA 5GZ1A 3OPVA 1Z3IX 4G9BA 4RE5A 3W05A 1I1NA 2NPIA 5JAIA 4YV2A 1QK5A 4CT5A 2HJGA 3FPLA 1SD2A 4H3VA 3ZWWA 1XD9A 2X77A 2B83A 4OUDA 221PA 4KR6A 2AA3A 2A4KA 5F1OA 1RYZA 3OICA 2PKWA 5E4TA 3T1NA 3Q0TA 4JKIA 1R6DA 3KC2A 4R2WA 1VBFA 2JH8A 1LD3A 3PKIA 1OXVA 2IY8A 2PHZA 3V2HA 4YJFA 3H2HA 5DTMA 4KXWA 1HETA 1JQ5A 3FWPA 4FLFA 2YHBA 5LDDC 3L05A 1X7YA 2I6TA 3G2HA 4LNUA 1VL6A 3G5LA 4WW0A 1KOJA 3DL7A 1YZYA 1T9GS 1X9HA 2VQ3A 3GQBB 1T6XA 3UM9A 4NL4H 4I50F 3NI2A 4P3XA 3IT0A 2YBEA 3T35A 3VYRB 1K3TA 4BX0A 1GPDG 2ZE7A 2PZJA 4FOOA 2GZMA 3DNPA 4MMYB 3TD2A 3TX2A 5KOIA 3DZDA 3IQDB 4AO8A 2XITA 3ILHA 5DNEA 5CM9C 4TLDA 4RS3A 4CM9A 5KREA 4Y2TA 1IZ9A 1SHUX 2V6MA 3RQSA 3U3XA 4KNWA 1YB1A 2IEZA 1G5FA 4IDBA 5GOTA 4JUAA 3VSAA 2UYHA 2O8DB 1H9CA 3ETGA 3NS7A 2I80A 2Q5HA 3LDHA 1QFXA 1UBKS 3CRZA 1NV8A 2ZYRA 3MWDB 1SKMA 3ADPA 3DD1A 1KJNA 2WNIA 1DKRA 1JJBA 2BUAA 2I6GA 2O3SA 4N65A 4Y9UA 4BNTA 4EA6A 5IT0A 4O1HA 3EXIA 1JR3D 2D59A 1RJGA 2JFVA 1DAGA 3AKDA 3BEOA 3P9XA 5ECWA 3DO5A 3ZHZA 1XVVA 5KYWA 1T6NA 1EZ4A 1K8YB 2J7KA 4PBSA 3QA9A 1BH6A 1C9DB 2W2TA 3OE1A 1FDIA 1Q0HA 2JRCA 3TLAA 3NCHA 3PNQA 4W5RA 3NRCA 3JQQA 1HE3A 1XZLA 5CH3A 4DNPA 4QDXA 1PS9A 5IJAA 2V7EA 4KAJA 3MAJA 4MR9B 1T34A 4FHZA 3WICA 5JJLA 3P2KA 3PITA 2WP0A 5T3UA 3AM5A 1SIOA 3CRNA 4B3TB 1E2FA 1QMGA 1VCNA 1VMDA 3BWMA 4K9KA 5FD8A 5JS6A 2BSQA 2FSIA 3C5CA 4U9UA 2HMYB 5EIFA 3HCAA 3LLCA 3QU4A 2B8TA 3ZW8A 4M0UA 1XU7A 3R5TA 3FCCA 3I2GA 2QX8A 2ZTMA 2Q50A 3JQAA 1A9RA 4RVSA 4ZVOA 3DMDA 5CLIA 3GA5A 1UXOA 4CIXA 1HG1A 2CE7A 3C97A 3N2YA 2C7BA 1JDSA 3VH3A 3WWEA 3NH6A 1SKUA 4QUBA 2XGJA 1TQDA 1Y4DE 1IN6A 1NJ5A 1U2SA 3V8PA 4TTAA 5BVHA 1YJXA 3CRRA 2CNWA 2AXQA 4HD8A 1YXMA 3KVOA 4KQXA 2FKNA 2IOHA 3FUTA 4NSNA 4YMSA 4CN9A 1JALA 1BE6A 5LOVB 3EEIA 3FGPA 2VUUA 2C3OA 1VB3A 4M0PA 3VH2A 1FL9A 3EUFA 4AX4A 2I1QA 1DAIA 1GT6A 4E6PA 5K3EA 1XTUA 2QT1A 4C6RA 1BA2A 3V1TC 4UDOA 4OV6B 1K7SN 1KXZA 1N9GB 4IRUB 4Z7QB 3FNRA 2VAMA 2G76A 2OHFA 4ZQFA 1PF7E 4IXDA 4L8YA 4ZTBA 3CMCO 1JG6A 4JWTA 3NIFB 3KE9A 4WSOA 2YJ4A 3JQ6A 4AFNA 4BQNA 6AT1A 2B82A 4PLHA 3C4QA 1XTZA 2ZBEA 3N7TA 3IP8A 3R7AA 3W7VA 4RU1A 5BW8A 4WAUA 1DLJA 2I4MA 2F3UA 5J40A 4D80A 2BMJA 4G5OA 1P17A 4X1OA 5K6TA 5DW3A 2X1MA 1GPUA 2PTHA 4BVEA 2PQ2A 1GZ3A 3F6CA 4C0XA 1KARA 2IYXA 5IARA 5LP6A 1OZAA 3IHKA 3QX9A 4EUNA 4EG7A 2QL6A 4DLUA 1FNSA 1L7EA 2JLCA 2XV1A 3EEBA 2CMGA 3BUSA 4LE1A 2O5RA 4J0EA 4RD1A 4NV0A 5F21A 1X7WB 2WUEA 4W5NA 4ZQHA 5E4FA 5JCXA 1U2GA 4NIMA 5AHXA 3HCWA 5LXTA 1R5NA 1Y3HA 3KCQA 3F5SA 4N47A 2VSYA 4BFVA 3KQPA 4F8JA 1GYRA 3KWFA 1HBJA 3GLIA 4B75A 3NVAA 3CEPB 1A69A 3LP5A 2HBQA 2CJWA 1G2OA 3SS9X 2CBXA 4AM8A 4BAUA 4KTTE 2ZP1A 1TLLA 2EKZA 2ZRKA 4YWJA 3WGMA 4TV9F 2FDXA 4KC0A 1WLSA 2FPSA 1SM4A 2FWBA 4UE2A 3QNMA 3TLEA 1L7VC 4FHEA 3SJCA 3PPIA 2NVWA 1P60A 1RHKA 2JI6A 4AZ0A 4RHXA 4WZBA 2ACKA 4RSGA 3SEQA 4QODA 3ZD7A 2BEKA 4ZVKA 2EF1A 2FSVA 2OV1A 3TUJC 1WMDA 2CFIA 2W2QA 3TZ6A 4KFSA 2BLNA 3RS2A 1M34B 5E1DA 4C4PA 5CBKA 3BL6A 1XKLA 2VH2A 1BMQA 1FTWA 1E7SA 2QXYA 3JWJA 3ABOB 2ZBRA 3ZDXB 3TAXA 7REQA 2DECA 1L8XA 3JAWB 1VLHA 2OFPA 5FOTA 4Z7JA 2B7BA 3E7PA 4M0DA 5FWYB 3HTXA 5J3JA 2W4QA 1FOEB 1JLMA 5E6UA 1X7HA 2I4NA 1R27A 1ECCA 1NE2A 2JBAA 1LQ2A 4D6PA 2XECA 5DWQA 2BEUB 5EY5B 1Y7HA 5GVSA 3IUEA 3LBHA 4O4LB 4BMOB 3ISJA 1U8YA 3VTFA 1KJZA 2HMAA 2RIRA 2PUHA 2XR1A 2XIJA 1R15A 2IDMA 3BWYA 4X6XA 5GONB 2Q27A 3U44A 1GNVA 2R7LA 2YL2A 1Q77A 1CE8B 1OAKA 2J46A 4I5FA 4MV6A 1NAHA 2H9AA 2HY7A 4O02B 1PR9A 3TSWA 2KPOA 4DUYB 4GQAA 3HACA 5B1IA 1SC9A 1KJYA 4Z8XA 5AM5A 5AVUA 5KYUB 3IKVA 4YI5A 3LZCA 1VIAA 1WCYA 2X23A 2GYYA 2QYHA 1P6QA 2X0DA 3A4LA 1J0CA 2DLDA 4EB6A 2HSJA 4NS4A 4XVUA 1E59A 1CB7A 3VKHA 1IB0A 1P1BA 5F2OA 2CLHB 5BNWA 1HE2A 3T8YA 1RLMA 3MFQA 4Z9BA 3UFXB 1UKCA 1D2GA 5BRNA 2FWIA 4CIYA 3OECA 4RK0A 3O94A 4UM9B 4OKSA 1QE0A 3K70B 2HJSA 3E1GA 1IEXA 1QVAA 1SUEA 4MX8A 2QGZA 5ALKA 1UPAA 2ZSBA 4YUZA 3PTAA 2D7CA 4JT9A 3D7SA 4YHHB 5DNWA 2JKZA 5CK5A 2ZSDA 5JS2A 2KW5A 2X8JB 1J5EB 4GZ5A 3GD5A 3HHPA 3DLAA 4CFYA 1NMXA 3FSEA 2D1SA 1BXGB 3T34A 1A71A 4I50A 3RE1A 3T7DA 1R8XA 2PVSA 3UVEA 3NWPA 2OOSA 4FIZA 1B7GO 5KOHA 1E6EA 1DKMA 1ZU4A 3NXSA 1Z63A 2AR9A 3P52A 3QU2A 4N8DA 1GPH1 2DFNA 3Q3HA 1PJCA 3HSSA 1V5WA 1Z8HA 2WWGA 2SBTA 3F97A 1Z7YA 3IR7A 2KS6A 3TB4A 4I1YA 3K70C 2AI2A 5FO1A 3U4MA 1UT5A 3ZLBA 1UZUA 5A4DA 1YZHA 2ZJFA 3OFND 3UPUA 1TW3A 3RM3A 1OVMA 4XUGB 5DNAA 3B36A 1FU8A 4UQLA 4UU8A 5JG7A 5IWCA 4PINA 2F8MA 4G5XA 1FSGA 2H2AA 2PBFA 2UVPB 3GW8A 4WUVA 3VDXA 4CFZA 1O94A 3GCGA 4C6TA 1WO8A 1BRTA 2OHJA 3JRWA 4KK3A 4Y1RA 5CLLA 2ZE8A 1WHTB 1BDMA 3VVLA 3WKCA 1CNEA 1IAQA 3E84A 2HSZA 2HA6A 3ENKA 3GRPA 1USUA 3ZQUA 2EW1A 3VO8A 1XN4A 3WQHA 1KO5A 1C0PA 1M2OB 3BM5A 3E7DA 3DLTA 3AIIA 3THRA 1U8EA 1WBJB 1PZMA 4TS1A 3ZD9A 5LQRA 2CXUA 4E0BA 4FWTA 4JUFA 4WZ6A 2YYZA 3BSYA 1KK3A 1H8EA 1V1MB 1WF3A 5GP1A 3QJYA 3U4CA 2VDOB 2WFZA 4GRDA 2WUVA 2DWOA 2HPHA 5KKCA 1BS1A 4LJ4A 3O4FA 4ZRDA 2R79A 1T10A 2ZJ6A 3DMPA 5EHQA 1OA1A 1OZFA 1YS7A 2GLTA 4H7DA 2A5FA 4A5OA 4EY6A 1BMDA 3DVAA 2DVMA 3THXA 3AVWA 1H8HA 4JEIA 3B38A 3O3MB 1SO8A 3WWYA 1OTHA 4QPZA 2G4VA 2I71A 2IBTA 2PD4A 1N2CA 3KR1A 4FQ7A 4UCXA 4PNEA 2QLTA 1SUWA 2WT9A 3H4VA 5HCNA 5C8DA 4Q6WA 4UC0A 2ANBA 3RNLA 3DP9A 1ZCFA 3FDFA 1QFMA 2OZVA 5ABPA 1TEZA 3FNBA 5JXJA 3AFHA 1U8ZA 5EJ5A 4WXYB 2JLZA 3C3MA 3PQ6A 5K3DA 4L5JA 4NU5A 4DDTA 5LUAA 3L7BA 1UMDB 2IHUA 3HYCA 3V4ZA 1ZMXA 1HDYA 4R5MA 5SY4A 4TYNA 3CV3A 5AXBA 3E0XA 5ESXA 1V2HE 4UM7A 2NX2A 3EIEA 4A82A 1P0MA 1XZAA 2PUTA 3MILA 3KK0A 4M21A 3ZDCA 4CMHA 3WADA 4ZPXA 3C1TA 2A14A 1DNPA 1D2CA 2JF0A 1NATA 1PWHA 3T1VA 5I7EA 4IQFA 1LVHA 1S2NA 2EJTA 2ROQA 3K15A 1AMNA 4XYMA 2DT8A 2W2OA 1BGXT 4WESB 4XVHA 1R1DA 1VHJA 3UXHA 2G04A 2VJBA 3UH1A 4WNAA 3FZEA 4BQOA 3R7WB 2JHPA 1FDSA 1I14A 4YH1A 1U2EA 1ZQ1A 5LL6P 3OBBA 2G5GX 3ROPA 4HWGA 1K8XB 4RZHA 3L6DA 1V8FA 2XB6A 2GJSA 1Z7EA 5JARA 3ZLJA 4EFDA 4XIYA 5CVCA 1IIRA 1VB5A 2XKAA 5EWJB 2W48A 3HL4A 2HIHA 5IK2A 4NZYA 3T5BA 1HH4A 1OJ7A 2PJUA 3ADKA 3LBAA 1GD1O 1UK8A 3HXLA 4IQ8A 3WL6A 1F14A 1QO0A 1YRLA 1WQ4A 2GWHA 2VA9A 5JPCA 1F0NA 4CEJA 3H11B 4EFNA 1MX5A 1QS0B 4TV9A 1Y7LA 2FJUA 2WP8J 3VR5H 3WB9A 3BD6A 4MJ3A 2V65A 3AEYA 1SBTA 3MGGA 5FPTA 2OP0A 3CZRA 4O4IB 4MUNA 4FJ0A 1J21A 3PNOA 2OHIA 1TQ4A 4UUOA 1TAQA 1KS9A 2ID8A 3IIJA 2HCRA 3D6JA 5DM4A 3F1LA 1Y1TA 3EGEA 1YQEA 3ZXYA 3ONEA 5B1EA 4U02A 5JU6A 1EDBA 4K8OA 1UPCA 1K97A 2ZK7A 3PFIA 3EUEA 4QLBA 2ZI3A 4ZVSA 2VO1A 4RFVA 4LBVA 1V71A 3A2LA 1MIHA 5DM0A 4UMFA 2O8BB 2W43A 1V16A 1TVKB 5GQSA 4JOQA 5JD6A 1II8A 4I6EA 1HYBA 1PP4A 1RDFA 5ALXA 4H17A 3NB0A 4BASA 1ISSA 4QARA 4Y9RA 4ZIRA 4CMCA 3SFTA 4AN1A 3KUXA 4UHJA 4DEYA 3AP2A 2P9BA 2XT6A 3ESRA 1Q1AA 1MQ8B 1A7KA 1U7XA 2XOXA 3JAKA 1H3NA 1CJTC 1VCOA 3H5VA 1ADCA 4LOKA 4BKQA 3ZZ0A 1IXKA 4WLVA 1G0NA 3ZWMA 4E1VA 1P2TA 3DOIA 1XNQB 1ORHA 1TCUA 3QKRB 5K4AA 3OWOA 1G59A 3WV5A 4V1CA 2AD1A 3A3OA 4WXRA 1TUBA 1ELOA 1XE3A 1LC3A 3FFXA 2NVUB 1I6WA 3WLOA 4BWYA 4YMWA 2RHBA 4JQZA 4DMGA 3SEFA 4CE6A 1U2RA 3E9QA 3KDSE 3TTUA 2H1OA 1WCWA 3AY3A 4EL5A 2AMVA 2H0QA 2TS1A 2WMYA 1E2KA 1PYGA 4C2AA 4JFAA 1XAIA 3QLVC 2Y1GA 3CW9A 1XLWA 4OP3A 4RH0A 1SG6A 1E2MA 3OT1A 4OQMA 4DIFA 1TAHA 5MFZA 3S5UA 5I01A 2WNSA 3AFNA 4NZ9A 4U7WA 3W2TA 4B3BA 3QLEA 3L0PA 4BO8A 2BFFB 2QKYA 3DBLA 3TUZC 3V2GA 1C30A 2QQ0A 4NCHA 1VIYA 4Y8VA 2GS9A 3FSGD 3EG9A 2O54A 3PVSA 4JHXA 2GEKA 4D9MA 1X1DA 2F3QA 4URWR 5C7YA 2JJ8A 4NESA 3GPDG 4QU9A 1E62A 4DLRA 1XCOA 4D26A 4EB8A 3FHJA 4MRVA 2EYQA 1RXUA 3LO5A 1DBRA 4B3RB 1UK6A 4XYBA 2VBGA 5B3JA 3OVMA 1QBGA 1WKVA 1IRIA 2G17A 1XB2A 2FZLA 4RA9B 3ICPA 2RGRA 3HEAA 3OQ1A 1B8OA 4ZMBA 2W6OA 2R6CA 4TL7A 2IQ5A 3VNUA 3R5XA 3GFVA 3VR5D 4XW2A 1TZ2A 2GZAA 3B1YA 4MWTA 2WNHA 3ESDA 4CYMA 2HMUA 1MEOA 3NZEA 4NBKA 1RNLA 4K9OA 5DSZA 2RJOA 2PT9A 5FF9A 3HCRA 4RETA 4Q9JA 5D5PA 2P9YA 1QR2A 3O8BA 4GZMA 3UGTA 2HXYA 3LVQE 2ABWA 2AOVA 2WD7B 5F7XA 3AEQA 2O1SA 4J03A 3IBTA 5JDCC 1E6CA 5KQPA 4KLRA 3U62A 3Q8KA 1O57A 1CDDA 1JA1A 4YDHB 1U28C 2L18A 5CNIA 4ZT7A 5FWXA 5ITSA 2PBLA 3EHDA 1XVTA 2I6SA 2JHFA 2QYOA 1U11A 1KMHB 2XTNA 3QVLA 3A1CA 5HZMA 1GCUA 5ES3A 1OB5A 3TE7A 3HP4A 4WN9A 1ZWLA 2QR5A 3WI7A 3R3WA 4V2UA 4PYRA 2I6UA 4OI4A 1JJ7A 1GQQA 3O8RA 2AE1A 3IHLA 3OLWA 2B20A 3BF7A 5L4SA 1YD7A 5IN5A 1J06A 1G63A 1YK0A 2D5IA 2QTFA 1GTVA 4KIJA 4L9SA 4R98A 5KOJA 2QZPA 2FPOA 1HOTA 4A8JA 4Z0NA 1DCMA 1RBMA 2A7XA 3OTIA 2X5XA 2A5DA 1WG8A 3HKDA 4OM7A 2VFAA 1T8PA 3T3EA 3EJ6A 5K3OA 1PS8A 5DU2A 3RK0A 3D43A 521PA 2AC2A 2V54A 2QBYB 1O8CA 1IBMB 4N0MA 3DZHA 1E5XA 4FJ2A 2O2ZA 1H69A 4EIWA 2DETA 4HF7A 1XOIA 2APJA 2C8VA 2EX1A 3IEIA 3OZTA 5KDLA 2QTWB 3RUAA 4A0HA 1JEQA 3H4TA 1KY3A 5ALTA 5FUBA 4MV8A 2AJLI 3W4IA 5HZGA 2FVXA 2PXXA 1DHRA 2P0AA 4FEAA 1O8BA 2PD6A 4G1EB 5BN4A 3AY0A 4R2LA 4WKCA 2E2WA 5IVHA 4U6QA 3LUBA 1YB2A 1D2RA 1E1MA 1Y4UA 5D85A 4HH4A 1XCJA 4FOTA 4CMBA 2PRSA 3W5JA 4BVJA 4MYRA 3FIUA 2ZRMA 4ILEA 5EZYB 3MM4A 2GAOA 4LC1A 1K2WA 3PQ4A 2ERCA 4I5EA 1QQ7A 4IDGA 4S35A 4JGBA 1SRRA 4TWIA 2BR5A 2OVFA 5ER6A 3BIXA 3MTJA 2XNHA 3OD5A 4HDMA 4Z4EA 1ULHA 1ULSA 4BO2A 4NENB 1NVUQ 2IUUA 1PNVA 2WQ7A 2JAUA 5JYEA 4TLLB 3QPUA 4UPDA 1KH1A 1EB9A 2WSBA 4U2KA 3DLBA 2YMPA 4P22A 3EMBA 4AYTA 5JSKA 3R3SA 3UHOA 1YZVA 2CZGA 3WFIA 4J7AA 3U31A 4QQNA 4F5EA 3UC5A 1OFGA 4L28A 2O0KA 1XZMA 1ZSYA 3QSYA 2M98A 3H3JA 1RRFA 1FX0A 2NZWA 1WVGA 1Y3FE 4TKMA 5AM1A 4N40A 2NQTA 4BRWA 3NTQA 1I94B 5ALQA 3JZMA 1SHZA 3UV7A 2NZ2A 4MW4A 4AJLA 1E18