1EB8A

Structure determinants of substrate specificity of hydroxynitrile lyase from manihot esculenta
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDARDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-ACETONE-CYANOHYDRIN LYASE
publication title Structure Determinants of Substrate Specificity of Hydroxynitrile Lyase from Manihot Esculenta.
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Lyase
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1eb8A00
4HXFB 2Z8ZA 3M81A 3STWA 4AO8A 4J7AA 4ETWA 2HFKA 1IZ8A 3WWDA 5LZ4A 2VJBA 5ALMA 4AQDA 3H2HA 3A70A 4CCWA 3G9UA 2WG1A 5LZ8A 2WUEA 1X2EA 3G0BA 4GI1A 1QJ4A 1A8QA 1ZJ4A 5AK4A 1U65A 3WWCA 2PSHA 4M0FA 3FYUA 3W9UA 2OQVA 4H35A 4UBKA 5LZ2A 1XQVA 1SCIA 5JD5A 2XQJA 4EY8A 5CH5A 1KU0A 1QIJA 3C6YA 3FYUB 2BGNA 1QIEA 5C8VA 2ES4A 4L0CA 3HLKA 5BWBA 5KREA 1XLVA 2R8BA 4BZWA 4I3FA 3R3YA 3HZOA 3QPDA 4FLEA 2Z5GA 3FLAA 1AQLA 2B4KA 4S0XA 3WL7A 1FFDA 4RNCA 2XMSA 2RONA 3SC2A 4LXGA 3QPAA 4CG1A 2OAEA 5JAOA 3DD5A 3BL8A 1O6GA 3E3AA 3CXUA 3C5VA 1N5MA 3I2KA 5EHZA 5FKJA 4FMPA 4FBLA 1VE7A 3ESDA 3IBTA 5ALLA 2K2QB 5E4JA 4N8SA 3H1AA 2DQYA 2G5TA 5AIAA 4X6XA 2CMFA 4BCDA 4ZGBA 5AK6A 3ICWA 1XLUA 2D0DA 4WCVA 1C4XA 2OGTA 2ZYRA 4NS4A 2HIHA 1DQYA 4W63A 5IVIA 5AKZA 1DT5A 3SX4A 4ZV7A 3G0DA 1QIHA 1CPYA 7YASA 2LIPA 5ALRA 5ALEA 1AMNA 4UBNA 4LYDA 1XZGA 1UKBA 3AIMA 4X6YA 2XMCA 3PUHA 2W6CX 2GYUA 1K6EA 5CT4A 5K3FA 1EK1A 1OXMA 3FVTA 5IVKA 4QE3A 2OG1A 5HKBA 3NOXA 4L3WA 4J0HA 5K3FB 4X95A 3CCBA 1D07A 2AJDA 1BRTA 5ALXA 1X2BA 3C8HA 2XLBA 2VAXA 5AI0A 1XRPA 2PUHA 2EDAA 5KBYA 4F60A 4U2DA 3M82A 4HXEB 2G5PA 3HRHA 5ALSA 1CUSA 4KACA 2WIKA 3H2KA 1Y7IA 3R3VA 3B5EA 3T4UA 3OTQA 3AZOA 4IH9A 3WQHA 5K3EA 4FNMA 4GLBA 4X92A 2RGUA 3TEJA 3O4HA 3IDAA 3Q8WA 4U2BA 4HTAA 4YPVA 3O9VA 1VA4A 1WHTA 2H1IA 3FSGA 3C87A 5AOCA 1ORVA 2OGZA 3WJ2A 4XVCA 2VT7A 4KRYA 3PF9A 1C7IA 3OC0A 4J0CA 4X85A 3WKDA 1LZLA 1W6RA 4BAUA 4LKOA 2BKLA 3H19A 3DYVA 4E11A 4QWWA 3A6ZA 1VKHA 1R9MA 2JEZA 1XKLA 1C7JA 1CUHA 1ZOIA 1LPAB 2J4FA 3D0KA 3IULA 1E8MA 4Q82A 3EBLA 5EIHA 1CUIA 4LXIA 5JYCA 4AMZA 2FJ0A 4M0EA 4W1RA 1JI3A 1L7RA 1NU6A 3ZI7A 1BN6A 3AJAA 4WFIA 5C8XA 4Y2RA 4HZGA 3MVEA 4AZ0A 1E3QA 1CIJA 2PM8A 3DL7A 2IX9A 2BUCA 3PICA 5HF5A 5FPQA 1GQRA 4KJXA 4ARBA 2R11A 2QJWA 1P0QA 1PV1A 4UPDA 1QIMA 3JWEA 1AUOA 1A8SA 4P93A 1MN6A 1QGED 3WIOA 2H9YA 2B20A 2W22A 1LPOA 4X00A 4DIUA 4AX4A 3R3XA 4EB0A 1CUCA 4TVKA 4Y2SA 5ALKA 1PJAA 4XX1A 2OQIA 3M83A 4IQ4A 4JYMA 5AM1A 4I4CA 1YCDA 1BS9A 1XQWA 5HF6A 1BE0A 3WYNA 4FFVA 5CXUA 2VATA 2WHPA 3IA2A 5DTJA 5DNUA 3ESCA 3QM1A 2WHPB 1EVEA 4XIIA 2XQKA 1LPSA 1CQWA 5IVDA 4JUIA 4K2AA 5CTAA 2NW6A 1VOTA 5AI6A 3S2ZA 1ZICA 3CCCA 4Y2YA 2XUHA 4HRXA 3I2HA 3GROA 1CUZA 2V97A 1AURA 2QZPA 2I3ZA 2G63A 1ODTC 2HADA 4X6UA 3R3WA 5AM2A 4QA9A 4BAZA 4C6HA 1QOZA 3HEAA 2QOEA 3H2IA 2Z3WA 2HA3A 1EI9A 5HK8A 3H1BA 1QZ3A 2QMQA 3HYSA 1MU0A 5T4HA 3PI6A 4BTVA 3LIPA 4NVRA 4PQEA 4P08A 4DNOA 3DYIA 1WB4A 4X91A 4UHEA 3QITA 2VJDA 2GBIA 5FPPA 3DOIA 1CUYA 2CUTA 1XRQA 2QR5A 4EA6A 3ANTA 4AZ3A 1LPBB 2XMZA 4B6GA 5BV7A 2BCEA 5AKXA 4BBZA 4CG2A 3FCYA 3NGMA 3GBSA 1EA5A 2Y2VA 4BRSA 5LKRA 4I19A 3C45A 3AUKA 3BWXA 4HVTA 1MNQA 3QYJA 5CT5A 4QZVA 3N0TA 1HL7A 2Y1KA 4UBJA 3HJUA 5FUMA 2JEYA 1GPLA 1CUXA 3PUIA 3H2JA 3QMVA 5JAHA 3AINA 5ALQA 2YYSA 4OU5A 1E8DA 1XZHA 5D3ZA 2XUKA 4YX9A 4Y2UA 3G7NA 5AHXA 3V9AA 5AJHA 4E46A 4F5ZA 3A2NA 4M0MA 4Q1VA 5A6VA 4AO6A 1B41A 4W1SA 1JMYA 2FX5A 1H2WA 4OUKX 1XZAA 3DDUA 3R3ZA 5FDFA 4MJ3A 2PBLA 2OPHA 2J3QA 3V1NA 3A2LA 4ZRDA 2WIGA 3FLBA 1ZGCA 1CFJA 3H17A 5C81A 4BCCA 4BYMA 3V48A 3SWWA 4GHWA 2WG2A 1N8SA 3IURA 5AOBA 2GYVA 4FOLA 4WDRA 5BOVA 3O0DA 1HBJA 5DNWA 3LCRA 2ZJFA 3BIXA 3PF8A 1Y37A 1ISPA 1K4YA 3W2TA 1ZD2P 4YK7A 3BF8A 2VEOA 1ZD4A 5HK9A 3WKAA 4J0DA 4BVJA 4RE5A 1RYYA 3WKBA 2GZRA 3F8SA 2DR0A 5LZ9A 4EY7A 1I6WA 1A7UA 5ALWA 3BF7A 4Y2JA 5JAUA 1M33A 4UHFA 4KE7A 1WCYA 1W52X 1Q83A 1JFRA 1QO9A 1IVYA 1EB8A 1YAHA 3OURA 3RKSA 1ZI8A 2V96A 5LKAA 1VZ3A 4Q34A 4H7KA 5A62A 2P8SA 2QT9A 4NZZA 4QDZA 4AB1A 3O95A 1SOMA 2C0QA 3WL6A 1EDDA 2Y2UA 1P0MA 4C88A 3UUEA 1YB7A 1R3DA 1H23A 2HU7A 1HLGA 4DMCA 2DHEA 2D5LA 1YS1X 5ALIA 3U1TA 1MO2A 1HDEA 4UFOA 5F4ZA 2XE4A 1UZAA 3Q0TA 2VA9A 4Y2XA 2JGEA 1JMKC 1BCSA 4W1PA 1YASA 2HFJA 1OCEA 4U2CA 4BVKA 5HZGA 5YASA 4FDMA 3IUNA 3EF3A 3KXPA 5FP0A 2OCLA 5ALHA 4FBMA 4GW3A 5LYYA 4O08A 3GA7A 2QXUA 2BGRA 4UBIA 3FNBA 4DMKA 4PNZA 3V1LA 1GPKA 4UHBA 3OPMA 2HA5A 3BDIA 1O6FA 3B12A 5DYTA 4Y2PA 1EK2A 3ESAA 5AKHA 1XZIA 2QS9A 1YS2X 5ISMA 3WI7A 2C4HA 4K5QA 1L7QA 3C8DA 3FYUC 5E2IA 2O7VA 3ILSA 4B84A 1CUAA 3C43A 4FWBA 5AH0A 1WPXA 4C87A 1Y7HA 3BJMA 3AZPA 3C6BA 1W75A 2AJ8A 3DS8A 4XWGA 3WK7A 3STUA 2YH2A 4BZZA 1QE3A 4P9NA 3M3DA 3IUQA 2HA2A 4F21A 3VJLA 5AI9A 2CBGA 3VVLA 1JKMA 2Y6UA 4EY6A 1AC5A 2QTBA 2HRQA 3ZWQA 3IVMA 1R1DA 3FVRA 2OAGA 3DKRA 1TCBA 5EIAA 1BEEA 1NX9A 2BUBA 1WOMA 1DX6A 3IUJA 5JATA 4J0JA 4QLAA 5DYWA 2CKMA 4QDTA 1FFEA 1LNSA 1EVQA 4DTCA 3BE8A 1TK3A 1AX9A 5SYMA 3O4JA 2XMQA 5LZ5A 3H04A 5AM0A 2QVBA 3BJRA 1JJIA 1YAJA 3QH4A 3WZLA 1TCCA 1CUEA 4UHDA 2O7RA 3VJMA 1AGYA 4EUSA 4DYHA 1UK8A 3N2ZB 5C7YA 2XMGA 1IZ7A 2DFPA 4DNPA 2VJCA 4MEBA 1LPNA 2XUDA 2Y6VA 5I9IA 5JZSA 2VT6A 1E66A 4RGYA 4B0OA 2C5FA 3TGLA 4EHBA 5HF9A 3BDVA 4GXNA 1ACLA 3K9BA 1RP1A 4ZWNA 2E3JA 2VSQA 5AKLA 1DWOA 1FFCA 1MNAA 3HACA 1JJFA 5LLSA 3C6ZA 4BATA 4G5XA 3AIKA 1XZMA 3P2MA 1R4ZA 3VVMA 4J03A 4MQMA 3L1HA 2RAUA 3ANSA 5CMLA 5ALNA 3F97A 1MPXA 1GQSA 4GDMA 5E4TA 2QXTA 5LIPA 1GZ7A 1ORWA 1DWQA 1H2XA 1ZIYA 2OGSA 2BUAA 1QO7A 6YASA 1XFDA 4U2FA 3R40A 2WILA 3D59A 3X3HA 5AP9A 4DM7A 4FFWA 5AK3A 4J0IA 4B9EA 1CUGA 1UOOA 2XQFA 5CT8A 2OLEA 4GWLA 5A7GA 4FTWA 3G9TA 3O9MA 3ZLVA 4W1QA 3G9ZA 3H2GA 1GT6A 1SCQA 5CBKA 1NU8A 3ESBA 2H7CA 3DNMA 2J4CA 1ZJ5A 3K2IA 3IB3A 3I6ZA 2Z8XA 3UUFA 3I28A 1G4HA 2HL6A 4WDQA 4OSEA 2PPLA 4Z49A 4MYSA 1QTIA 1U4NA 4JEIA 1QFSA 2XUIA 4PO3X 2PL5A 4KAAA 3WWOA 4H7HA 2JGLA 4AMYA 4Y2VA 5CURA 2XUQA 3F9CA 4MYDA 3FAKA 4B85A 1F8UA 2GZSA 5AOAA 5HF8A 2AJBA 4H7IA 3STVA 3QMMA 3FBWA 5T4FA 2WU3A 1ZI6A 1JT2A 2AJCA 2RI6A 3G0CA 1F0PA 1TIBA 3VDXA 5AI5A 2OCGA 3OM8A 2V9ZA 5CT9A 4UFNA 4BC0A 1J07A 4BDTA 2PUJA 4LIPD 5EI5A 3DLTA 4FHZA 5EIEA 4AN0A 1ZIXA 4UBOA 5AKGA 2PKYX 2I03A 1W4LA 2WSLA 3DQZA 4P92A 3LLCA 3IUMA 4U2GA 1SC9A 1E5TA 5KWIA 3I1IA 3WK8A 3C5WP 4Y2QA 5CXXA 3T52A 2AXEA 1ODSA 3L1IA 2OXEA 1XZEA 4ITVA 3I2FA 4K6GA 1QIIA 3W05A 1DQZA 5I8PA 4AN1A 1DX4A 1XZBA 4X94A 5H3HA 2HA0A 4D9JA 3F98A 3KD2A 1R88A 2I3DA 3QZUA 4BVLA 3ED1A 3RLIA 5D6OA 2CZQA 2RHTA 2VQ6A 4ROTA 4G1FA 2YASA 3STYA 3KWFA 3U0VA 3G9XA 1W76A 4DSAA 1WM1A 4U2EA 4G4JA 1KEZA 3C6XA 4PF1A 1RWQA 4IH1A 4BDSA 2WFMA 1QIKA 1CUJA 5JADA 3VJKA 2WUFA 3F96A 2ZYIA 5JANA 1IUNA 4B82A 3STTA 4CG3A 4K6HA 5DYYA 2XMBA 2QUAA 4UHHA 1XZCA 2ZJ6A 4OU4A 1VXRA 1GPNA 4H7FA 5AICA 5KWJA 5HFNA 2HM7A 4G4GA 2B9VA 4PW0A 3H18A 2ZSHA 3K6KA 2B61A 5T4BA 5A7FA 2FUKA 1XZDA 4FLFA 3D4LA 1HKHA 4UBLA 2GYWA 1FFBA 1TCAA 2WTMA 2ACKA 4ZI5A 1LPPA 1ZI9A 1CUDA 1MAAA 3FLEA 5J3JA 1CRLA 4X97A 4CCYA 1VJ5A 5CRIA 2PVSA 1R50A 1N5RA 5ALVA 1VLQA 3ZLUA 4CCYB 1XZKA 2C5GA 2O2GA 3GELA 1EDEA 5CW2A 2WJ4A 4N5IX 4RE6A 4DNFA 1TKRA 4ZXFA 4Y7DA 2DQZA 4MXDA 2ZVDA 3JW8A 2BAGA 3IIIA 2IIVA 3WL5A 1VZ2A 4UBMA 1K8QA 3HC7A 1WHSA 4A23A 4C4YA 2JGKA 4LXHA 1FFAA 4HRYA 2UZ0A 4JYPA 2QJRA 3AFIA 3NUZA 1PFQA 1T2NA 4BRZA 5ALJA 1QIFA 1Z68A 2H7XA 5AKJA 2X76A 4GEGA 2JGIA 5HFAA 4G9EA 2XQIA 1JJBA 2VTVA 1ACJA 4CIBA 3TRDA 4HXGA 3C70A 4KEAA 3OOSA 5ALZA 3WK4A 5LP1A 2WUDA 1K5PA 1VA5A 1U2EA 4H7JA 2Q0XA 4OB7A 1UKAA 4BTLA 2WG0A 4G8CA 3ZV7A 1XZJA 4JNCA 5I7UA 1BU8A 1MT3A 1A8UA 1B6GA 3HSSA 1J06A 1P0IA 4WFKA 4MEAA 5ALGA 2PU7A 4BAGA 4KRXA 4OCZA 5AKIA 2CB9A 1UT6A 1BCRA 4KAJA 3WWEA 1DTEA 3G8YA 4UUQA 4H0CA 4UFPA 3I1YA 3EQ8A 2XUAA 5JAPA 4KE9A 1F6WA 3WA7A 2WUGA 5A71A 5FV4A 2HU5A 4QLOA 4C89A 2HRRA 4WFJA 3B3QA 3O4IA 1GXSA 5ALYA 2WTNA 1MJ5A 1MAHA 1G5FA 1CV2A 2ZYHA 2WIDA 1UOPA 1A88A 2XMDA 4AO7A 4X90A 3F67A 1LBSA 1JU3A 3LS2A 4DMFA 4OYLA 1GKKA 3R3UA 2XUFA 3BXPA 3UMJA 5C8ZA 4FNGA 1MX5A 1WB5A 2XB6A 3I2JA 2G4LA 2QKYA 5JALA 4KYVA 2C0PA 3WKCA 4L9AA 1CEXA 1GGVA 2IITA 4DGQA 4FLMA 3I6MA 2VF2A 1CUBA 4F0JA 3WZMA 5K3AA 1SFRA 5EHNA 2WFLA 3I2GA 2WJ3A 1TAHA 4HAIA 4QDOA 1QLWA 5ALTA 2ZYSA 1ZGBA 2WIJA 2HU8A 4Q3OA 2WFLB 5ALFA 3ICVA 1CVLA 4MWTA 5LZ7A 3HI4A 4WY8A 2H7YA 5JIBA 4J0GA 4LYEA 4Q3LA 2YXPX 4ARAA 5HQ3A 3E1GA 1HPLA 4H7EA 4FKBA 4TPKA 4CIAA 4B81A 1X70A 2GBCA 3FSGD 4BB0A 1YR2A 5HQ3B 5HKAA 4OB8A 2C58A 5AM5A 5HCUA 3S8YA 4GECA 1S8OA 2PSEA 3GUUA 4E14A 3D2BA 1WPRA 3A2MA 1EH5A 5AI4A 2XUJA 4J0KA 3DL4A 5JASA 5AKKA 1UOQA 4WJLA 2WM2A 4DLNA 1IUOA 3G0GA 1H2YA 3DCNA 4HS9A 3HXKA 1BN7A 1EHYA 3WIBA 2JIDA 1XZFA 3G02A 1DINA 5JARA 4DSZA 1LZKA 3O4GA 2XI4A 3NWOA 5FXMA 1IUPA 3V1KA 1Q84A 1G42A 4QWMA 4X93A 2DHCA 5CH8A 4OB6A 3PFCA 2BJHA 5FRDA 4EBBA 4H18A 1Q0ZA 1ZD5A 5K5EA 2X8BA 2V98A 1SCKA 3FYTA 3HABA 5JD6A 3FCXA 4PV7A 3MGAA 3JYHA 2XMRA 1AZWA 2HA4A 3WLAA 2QRUA 1K63A 3D2CA 1L7AA 1TQHA 5K3BA 1XRRA 2JBWA 1UXOA 3WK5A 4W9RA 3R41A 2HDWA 1YSCA 3WK9A 1EX9A 1ETHA 1IMJA 3W9BA 3RARA 5EHXA 4BC1A 1EINA 5JZ9A 5SYNA 5IH7A 1FJ2A 1R9NA 3L1JA 4A5SA 4TGLA 3QVMA 5T4EA 5IKXA 3OG9A 3KOOA 4KE8A 4KAFA 4BP8A 2PSDA 4J3JA 1H22A 2XUOA 4X3CA 2DSNA 4KR0A 5EHQA 3ZPXA 4C4ZA 5D7BA 3EQ9A 5FOQA 3TJMA 2WJ6A 2C7BA 3W04A 1T4MA 4ZREA 3LP5A 1UWCA 2CJPA 2HA7A 3MUNA 1DWPA 4KE6A 1BEZA 2AJLI 1UK6A 1CUVA 4PSUA 3EIOA 4B0PA 3DJYA 4UHCA 1CUWA 4X71A 2EEPA 2J3DA 1CUUA 5AM3A 1OILA 1E89A 4Q3KA 4X7BA 3I2IA 5AM4A 2XT0A 5A7HA 5AKEA 4QNNA 3QBJA 3DEAA 3PFBA 4AXBA 5AKYA 4LHEA 3D5EA 3KSRA 3AILA 3VISA 1XLWA 2RIPA 1QIGA 5ALDA 4XJVA 4CFSA 1ODCA 1DT3A 4B80A 5CT6A 4V2IA 3R0VA 3KDAA 3KWJA 1CQZA 1H2ZA 5AO9A 2GBGA 3GZJA 3BIWA 1XRNA 1J1IA 1USWA 4OPMA 2XDWA 4IO0A 1LBTA 1EB9A 4RPCA 3YASA 1UK7A 3WK6A 1THGA 1ZD3A 5ALOA 2CEKA 1UFOA 2PU5A 3VKFA 2ACEA 1U8EA 4OD0A 3WWPA 5ALUA 1KU6A 3RM3A 3AZQA 1N1MA 4A16A 5A2GA 4MWSA 1Q0RA 5ESRA 2FJPA 3D2AA 3D3NA 3DKKA 4K6KA 1MX1A 3RK4A 3I6YA 1J2EA 4PSCA 4QEKA 4Y9SA 1W1IA 3E0XA 4EY5A 2O2IA 3EQ7A 4N5HX 5ALPA 2OCIA 1GKLA 1LPMA 3WMRA 2WHQA 2JF0A 1CLEA 4INZA 2PX6A 5D3KA 4H7DA 1QIDA 2VJAA 5JZBA 2JGMA 2QUBA 3DOHA 1XQXA 2GBFA 3WL8A 4ZV9A 3AIOA 5IVHA 4IHAA 4G9GA 1VE6A 1QONA 5DNVA 2HHAA 1YA4A 2WHRA 3PE6A 3D7RA 4OYYA 1CR6A 4MQLA 1XZLA 5E4YA 3FOBA 1XKTA 1E8NA 4GBGA 4C01A 4N8EA 1JU4A 2O2HA 5FLKA 3ZLTA 3SK0A 3H0CA 4EZIA 4DMHA 3W06A 4B9AA 4YASA 2Z3ZA 3VXKA 5JD4A 1EDBA 4Q05A 2XQGA 1XRMA 4G8DA 4N8DA 5K3DA 4QDUA 5AK5A 4BE9A 2XUGA 2QM0A 4JH0A 5AI8A 4PSDA 4CI9A 1P0PA 5K3CA 2ONCA 4L72A 1G66A 5BWCA 1UKCA 1DU4A 4B83A 2EDCA 1EXWA 1THTA 2JGJA 1XROA 4BCBA 1F0NA 3CN9A 3WYDA 3GFFA 2XUPA 2ZSIA 2ZJ7A 4G4IA 3WA6A 1TRHA 4C4XA 3MUOA 2JGFA 2PSJA 1XQYA 1BROA 3LIIA 4Y2TA 5CH3A 4QDXA 4WY5A 3V1MA 5EGNA 5DTIA 1LGYA 2DCMA 2ECFA 2WIFA 4IH4A 1LLFA 2WQZA 1CUFA 2PSFA 1QTRA 4G8BA 3FWHA 5DJ5A 1MTZA 3CN7A 2X5XA 2WKWA 1FSSA 2XLCA 3WJ1A 3QMWA 1XRLA 2WLSA 4E15A 1HQDA 3WKEA 1YB6A 4B7ZA 1VXOA 5EFZA 2ROQA 1UK9A 5DLPA 4BP9A 1WB6A 2WU4A 3QPCA 2I78A 1MX9A 1QFMA 3G0IA 4DNQA 3E4DA 2HA6A 2VAVA 3STXA 4EY4A 3PDCA 1YA8A 1AKNA 2OCKA 5DWDA 2BFNA 2WFZA 5AIBA 2RHWA 2DHDA 4H77A 2ORYA 4NMWA 4BE4A
chains in the Genus database with same CATH superfamily
4FSXA 5CDFA 4Q1FA 2UZ3A 3LYHA 3V8BA 3ZZ1A 4OUDA 2DF8A 3RAFC 3WHIA 1VGVA 4AO8A 1VPTA 4J7AA 3D6VA 3IHKA 3ICQB 3QVWA 1JR2A 1Z74A 3DZ8A 1PS9A 4TX1A 2GCIA 3RUHA 3SEQA 2V1XA 5ICSA 5LZ4A 5CAEB 2IS4A 1XD9A 1S3IA 3EPJA 3PC4A 3L8GA 4S0ZA 1QRAA 4GL4A 4QHYA 2ATEA 2WMOB 4Q66C 5DT2A 4AQDA 4LJ6A 2WG1A 5MFZA 4E5DA 4C3OB 5LZ8A 2WUEA 3RS5A 3K4PA 3ROKA 2NPIA 1LI7A 4W7HA 4EMSA 3KR9A 1QJ4A 2RBGA 1NJGA 1YB1A 4KV9A 4OAQA 4M88A 5AT1A 5E7IA 1BDMA 3KQTA 4GLOA 3VH3A 3W9YA 8GPBA 2JLVA 4W8HA 4L6AA 1M9NA 4WXHA 1JSCA 2WSBA 3I61A 5ADVA 3RF7A 2PYIA 1MOPA 4Q7QA 4Q7KA 4DLWA 1S89A 3IAUA 2O3QA 2OQVA 4MUIA 4UBKA 5LZ2A 3UMJA 2NU9A 4FCCA 4L4ZA 3O7MA 4FSDA 4Y30A 3IAM1 2VZ8A 3I9KA 1XL0A 1TJ3A 2FLWA 4WRRA 5BSGA 4KREA 2MWMA 5AW3A 1TVEA 2BGNA 1QIEA 2B8JA 1PGQA 3EB9A 1R0YA 3I83A 1YRBA 5B6JA 3SHOA 5CFLA 4L0CA 4DN6A 4UREA 3WR5A 2VTEA 5BWBA 3B8HA 5CX4A 5E6RB 3KKLA 3L0YA 2NT4A 5BNIA 2OXFA 2BPOA 3MQFA 1ZMTA 3L1VA 3QE0A 4J1TC 1AGPA 1MQAA 2FFQA 1MV5A 3CSSA 2WZCA 3MINB 4OXRA 4WTOA 1GTZA 3ORSA 3N8GA 3RIHA 3ZC3A 1JH8A 3GPBA 3I12A 4DFDA 2RD2A 4DR6B 3GNQA 2POCA 3JWJA 4UAUA 2Z5GA 3CV3A 2MCFA 3FLAA 2GLUA 2WC1A 1RJ9B 3L0CA 5GONA 3ZCUA 1JDVA 3QLTA 1NN0A 3GRPA 1N7IA 1UODA 4CN9A 3ASZA 2QPLA 5KMGA 4LDAA 3DMDA 3VTFA 1MAWA 5AUPB 1G5PA 1U1EA 1U8TA 2J9RA 3C39A 1E4VA 4RV4A 2D2XA 1AHPA 4XEHA 1PV4A 1PL8A 1ADGA 5BSEA 1QU2A 4GGOA 3X1YA 2JH3A 1NPTO 1EM8A 2BV3A 3GYBA 4NAUA 1X6VA 1X3SA 4UE6A 3LCVB 4ZGWA 1G0NA 3A3NA 3H4MA 3VR0A 2RONA 1M5RA 4AUKA 5D1HA 2MT9A 5BQXA 3VYTB 4LXGA 4CG1A 3KD3A 1H0RA 2OAEA 5JAOA 1MC8A 1NUHA 2L2QA 2QRQA 3BL8A 2W6JA 2J0UB 3IBSA 1QZZA 1T6YA 4AG3A 1I2BA 1B93A 1I2DA 1ZGHA 2KWIA 1T9GR 1KZ4A 1WF6A 2W5UA 3W1VA 4RTLA 2KBEA 5JMWA 4DWWA 2IXBA 4HK4A 5EHZA 5KWVA 2IE8A 4UNSA 1SIBE 3ETNA 4BLPA 3I6BA 1P4RA 1E9EA 4TMWA 4WGGA 5FAKA 1VE7A 1YI0A 2C1XA 1I1HA 3IO5A 2I34A 3GWZA 2AFVA 1T3GA 3O8BA 3KT0A 4JSYA 2NTNA 1CZNA 4NMLA 1KWKA 5KX5A 3SNKA 4Z53A 1UJ5A 2G72A 2UZ1A 1EQUA 2DQYA 1SD1A 3L8MA 1OHHA 4ZYWA 1QFYA 5IHXA 5JFGA 1GPH1 4ILEA 1MFZA 3EMDA 4QBHA 1EUCB 1JEYA 1I6LA 1ZHOA 2H08A 3OAAD 3I76A 3HCRA 2VDNB 4TT3D 4UOQA 3PNLA 3GK3A 3P2JA 2P68A 1RS0A 3NHZA 1QQ7A 3DVAB 1V47A 5TMEA 3C85A 2DPLA 1II8A 1OWPA 2KSQA 5TS2A 3V7UA 4RTNA 1XMPA 2PQMA 5AK6A 1N36B 2ODBA 3L6BA 3QNWA 4DA4A 2BTEA 2KJQA 2ZYRA 3N0VA 4NS4A 4QYWA 2PL1A 3QEAZ 2CJWB 3PA6A 4W63A 2B4RO 5IVIA 4BFYA 3THRA 3CF4A 2ID4A 1RYMA 1GVHA 4JJIA 3Q4GA 3GGSA 1U2DC 3M9XA 3N2IA 3SX4A 2QAGC 2FF5A 3JWPA 5ITVA 1E92A 3DLAA 1L6IA 1ZIPA 3WGZA 4B6EA 5CA0B 1NUQA 1AHIA 7YASA 3W8RA 2I2AA 2JD1A 2CDRA 2VYNA 5CVJA 5U4XA 4PQGA 1I2ZA 1AMNA 1IWBB 1QX4A 3L4BC 8MHTA 1H1TA 1UKBA 1UMBA 3AIMA 5CM8B 3PUHA 2GK7A 2W6CX 3QPWA 1PHPA 3GDFA 1QB8A 2GYUA 4LRTB 3TECE 1MIOA 3QPVA 5K3FA 4ZVMA 3ROZA 3ABIA 4O8ZA 2GVZC 3OOWA 1T2EA 2DHRA 2DTDA 4QYSA 3D6TB 4LJSA 3A3OA 1DADA 3NOOA 4N82A 1JQDA 3FYSA 5FA6A 2R48A 2GJ4A 3X1DA 3X43A 5BSFA 2OG1A 3S0JA 2CWWA 1LKZA 5K8TA 3CH6A 1NI4A 3QLVC 2BFMA 1SCAA 3M4YA 1J25A 4J0HA 4L3WA 4ZDKA 5KCZA 4UUNA 3DDSA 4JGBA 1R16A 1QRSA 1RQ2A 3QEMB 1PL6A 1WUIS 1X1RA 4LK2A 4MS4B 1BRTA 3CBGA 2XLBA 4YIHA 3INTA 1LRKA 1CF2O 1HETA 4NCJA 1KKUA 4D1YA 4CODB 2JEOA 2W48A 4DYDA 4CQMD 1TXGA 1K9VF 3I9V1 2J0QA 5EIBC 3SLKA 2EDAA 4WD3A 5TPZA 1VCOA 1T26A 3VSBA 1E61A 1MO4A 1QAQA 1KFKB 2G5PA 4MGYR 3BICA 1YA6A 3LECA 4OHOA 3QX8A 2WP8J 3DBRA 3GI1A 2OL4A 2Z43A 4MRPA 5DEOA 5ALSA 4B2IA 4DM4A 3H0KA 5LOVF 3GFBA 4ZA2A 1LD3A 2GPSA 4RJIA 1M0SA 2HBRA 1Y7IA 1Z5GA 3CIOA 3T4UA 1GZ3A 3LCCA 3LUDA 4GLBA 1KYQA 2ZRJA 4BECA 3WGHA 4EJSB 1ZVMA 3TEJA 4PYNA 3G5MA 5F64A 4O4HA 4GE0A 2EQ5A 4HRAA 1XELA 1ZMOA 2CUNA 4MR7B 4LXUA 4QJ5A 1PQUA 1VL6A 5IANA 1D4AA 2OP0A 1GQQA 3UHAA 1JBKA 3CR8A 3U3XA 3PHCA 5BN1A 1L8XA 3GGOA 3SXUA 2JI6A 1ECCA 3DL0A 1L7XA 1YZHA 4DSOA 1I13A 4KHPB 6AT1A 3NHSA 2GZHA 4LGYA 5IBPA 3VYVA 4R3UC 4YPVA 1V1RA 5EJGA 3SQOA 2TECE 4R2HA 4NFHA 1N4AA 2ZZNA 4IDEA 4MS1A 1CZHA 1VA4A 2G8NA 5IJXA 4EABA 1HE4A 1HURA 4X41A 4YAUA 2JG3A 3K6JA 3F3MA 3X0DA 1XD2B 3KXDA 1PD0A 4KRYA 5A5EA 4EOGA 1GAQA 3CO0S 3G1TA 5HX7A 1K6XA 3PF9A 3E23A 3OO1A 3HPQA 3Q9UA 2I33A 2J9YB 1I9GA 1SAYA 4X85A 4OL0A 3N05A 1N5DA 1DQPA 4LDJA 3BMQA 4L9WA 4PC6A 3ZI4A 1ISSA 3GLFE 5LU8A 3V6MA 4XKJA 1BFKA 3CINA 3CURA 4FS8A 4TQAA 1VMDA 2GJ8A 3A6ZA 1VRWA 4FE7A 4GR4A 4KLRA 4PG7A 2IS2A 2YIMA 3IP3A 4ZTZB 3TEMA 1BSVA 1EFPA 1R9MA 2H1SA 2JEZA 2SCUB 3G2LA 3GLKA 3PGLA 5EUBA 3OQIA 1NVVQ 4LF4B 2R25B 1C7JA 1CUHA 2W6ID 2ZFUA 3AP3A 1M34B 4LHWA 2R66A 2HF8A 4M1TA 3G85A 3G79A 4WY2A 4YHBA 3TVDA 4CFYA 4EF4A 3OJCA 4ER7A 5C8YB 1SUIA 3NIBA 3D0KA 2WWFA 5B2EA 3E5RA 5FD8A 1UFVA 4Q82A 2ZK7A 1XEFA 1XMXA 4GU5A 1N32B 3DBOB 1QFXA 1V4VA 4JI6B 4L5IA 1O5TA 2H8KA 5JYCA 3T4XA 1CJBA 1DJMA 3FRHA 3BFXA 4OHUA 2AOTA 1Y4ZA 4L8GA 5EE1A 5DH9A 4Z0NA 3UJHA 2PZMA 4C4OA 2J5RA 1I4DD 4BY9E 1JFVA 1T9BA 1YMQA 2WNHA 3N70A 2VVTA 1Q77A 2UDPA 3BOSA 3L79A 2ZSAA 1Q50A 4M8SA 1JI3A 1WX1A 2AMJA 2C9OA 2ZB3A 4MIKA 4B17A 4FM9A 1NU6A 5FTLA 3KKOA 1SN7A 2YWEA 3AJAA 3GJTA 3H9QA 2MSCB 3KQMA 4HLUC 3RROA 3IT2A 4Y2RA 5FUVA 4MI6A 1Q20A 4DM3A 3NFRA 2CXSA 2Y0EA 4LE1A 2P9CA 2Q4BA 2F67A 2HF7A 3EPLA 4M1OA 2ZI5A 3MVEA 3RYFB 2GM3A 1ZONA 1JFLA 1PX2A 3PTZA 3IVRA 3MTBA 3TQTA 1TC2A 4B6SA 3G7UA 5JD3A 1NJ1A 4G2NA 1E3QA 1R37A 2GLTA 2J3MA 2MSEB 2PGXA 2AB0A 2B37A 2G4CA 2IYFA 3OCCA 4V39A 3PNVA 2BLNA 2QTVA 2V0NA 3CTPA 1VCNA 3K9NA 3MB5A 2IX9A 2BUCA 3MELA 3VSEA 2UU9B 4YRQA 3LBYA 1N2ZA 4L95C 5KYYA 1GQRA 5A0FA 3A9VA 3PQ7A 4KJXA 3ECAA 3MBOA 4OI4A 1B42A 4IV0A 4R2MA 2PPVA 3T8YA 4MP3A 3EWNA 4WOPA 5A3JA 4P4LA 4S1NA 4IOKA 1E7WA 5JSYA 3JWEA 3MRVA 3JQ9C 2IYWA 4KMSA 1JA9A 4M9ZA 4RHEA 4FYWA 1ZOLA 3V4PB 5DXJA 4CQMB 1UQTA 5THKA 4LJAA 4PCAA 2HWWA 2G1KA 1TD9A 1KR2A 3A9RA 3JD2A 4LVOA 5DBHX 4XDGA 1U31A 2HTEA 1J33A 3SGLA 2H9YA 3QF7A 4X84A 1U0JA 1Q0LA 2J85A 4J9VA 1T4GA 1L1EA 2CXUA 4HB4A 4C6TB 1SKQA 1UWKA 2AYZA 2BHLA 2PBFA 3HJHA 4KIJA 5C5CA 3F6BX 4OM7A 2M1ZA 1LPOA 2BH2A 1IIRA 1E9AA 2YV5A 4X00A 4L4XA 3RRBA 3T9FA 1HMPA 2IYRA 2QJTA 3X1ZA 1C9DB 5T8KC 4M76B 4LYYA 1O87A 1XD8A 2J7KA 3RU2A 1G6OA 1S3FA 4TVKA 1V41E 2JLQA 4Y2SA 3VR2A 5ALKA 4RABA 1PJAA 1UIMA 1Z75A 3N6RA 4JL8A 3BG5A 2WJAA 3E5HA 3NJ4A 4IMRA 2DFDA 4IIFA 1BS9A 4YPOA 3TLEA 1WW3A 1E2UA 3QFRA 4IL5A 3HCNA 5BORA 1Q74A 3BX1A 4G0QA 3WYNA 2ZRBA 4FFVA 4F1WA 5HJEA 1CCWA 2IPXA 3QI2A 2FWRA 4HB3A 1S3GA 2ZG6A 4FCVA 4BN4A 2WHPA 1H9BA 3J81k 4BLOA 2C2KA 3V4ZA 2IS6A 4HCJA 1C2YA 4IICA 4JBXA 1QK4A 1WEKA 5I7HA 1YIDA 3V6LA 1MXHA 3WWYA 4DCCA 5L3RA 3T3HA 3PJGA 1NG1A 3RANA 3ZQUA 4TV9A 5CVCA 3E7FA 4B4OA 3EZ7A 4EG6A 3IJEB 3ILVA 4DGSA 2WJIA 2E4ZA 4TWZA 3HYCA 1A3CA 1XCLA 1V1MA 2NTEA 1JLLA 2O6HA 4MUXA 4JK3A 1W93A 4OBBA 5AJUA 5FPHA 4DEVA 1AE1A 4JIGA 2JI8A 4I5GA 3GDWA 4Y2HA 1G3QA 3QXCA 1ZICA 3TD2A 1RHQA 1YL6A 2NYVA 4O2AF 4RVGA 4Y2YA 3R9IA 4EJFA 2A0WA 2PTGA 4HRXA 3EPKA 1GZDA 3I2HA 1VLHA 3J7AC 3NBZC 2ZR8A 4NCHA 4Q0MA 5IJ0B 5C37A 4RHTA 3MJRA 2XSZD 3EDMA 4IOJA 4AT1A 4L0MA 4E5KA 1Y9DA 3W4JA 4L5CA 3SYLA 4WBNB 2IVFA 1HO3A 1AURA 1T4CA 1TCVA 1ADYA 2BFPA 3BH0A 2W6NA 5KTKA 2VLIA 2QTLA 2QZPA 3IDZA 2EFGA 1UFQA 3RFCA 4GPIB 1A4IA 2G63A 1EHCA 4AMVA 1BD4A 4JVSB 4QUBA 3CWCA 1AGXA 4M8IA 1QRUA 5B1IA 2JZNA 3C4QA 4R7TA 4KIFA 4MUKA 3QTTA 4KN8A 4QHTA 1G19A 2ID8A 3HCFA 2GBPA 3C98A 2BGMA 3ET4A 2ZVJA 3L7KA 3OZFA 1JTFA 4BMNA 2OK8A 1E2KA 1PR1A 3M1AA 4CF6A 2XW6A 2QOEA 2MOKA 3Q7SA 4C22A 3H2IA 3IGFA 3N7AA 1F7VA 4GR5A 4Y18A 5IC4A 2AN4A 2M9MA 3NVKI 3HS3A 2BBOA 1SZPA 2WYUA 1E4YA 4FR0A 3PI6A 1W2WB 2EFCB 4PQRA 4ZOLF 4OX9Y 4NOLA 5DHQA 1ZWLA 4G5RA 3E9CA 3GJ4A 2WM9B 2YFQA 2ZDQA 3IOEA 4NVRA 5DNDA 5BRAA 4JLOA 1NQTA 4P08A 2CNKA 4DDVA 4D0NA 1ML4A 4LBVA 4QBGB 1WB4A 2I1LA 4UARA 2Y1FA 4X91A 5FCDA 3BSWA 3I72A 1MC1A 3K8ZA 4YQYA 5BSRA 3SLGA 2EFEB 4PYIA 1FLNA 4ISBA 1CRQA 4D25A 2FEOA 3QP9A 3UWOA 2ZUTA 4XD2A 3RS0A 3VMMA 3U26A 3A32A 3CM0A 4BOYA 3IS3A 1Y6JA 4EA6A 1E0JA 3R7BA 1O08A 2V7TA 5DHPA 2R85A 1VP3A 5CW1A 2GK4A 4CF4A 4PYQA 1APBA 4A6DA 4GKJB 2VNSA 2ACWA 1R6AA 2QT0A 3S28A 4B6GA 1P4JA 1NM5A 2BCEA 2YYZA 3GQVA 1QH1B 1FDRA 2QE7D 4CG2A 2FUEA 5F2NA 3D8RA 2JDID 4HDNB 2QMZA 4DA9A 4CEHB 3NGMA 3GBSA 2Y2VA 3RREA 1R9GA 1QDLB 3O3MB 2IEIA 4NPAA 5A06A 4CR6A 2Y1LA 3PSAA 3RAJA 5FNVB 3VZPA 5KKAA 4GLJA 3KOZA 4EYQA 1OIWA 3A1TA 2NU7B 3T7IA 4D82A 5CB0A 4LRUA 3ASVA 1V7PC 1Z5WA 3FY4A 3QYJA 5CT5A 4XGRA 3WV5A 2OHJA 3IHWA 5BUSA 4GOJA 1W0KD 1T6BY 3K1TA 4FHGA 1FP7A 3SEAA 2CL5A 3PV0A 1D4ZA 5FUMA 2JEYA 1GPLA 1L5OA 2YVQA 3RYIB 4W6QA 4OLAA 1CUXA 4PG5A 1N6NA 3OBBA 5CVDA 3FR8A 3MNFA 5CXQA 3H2JA 3U4IA 4ZGGA 3A28A 3SJUA 3AOEC 1PW7A 1MZPA 2YYSA 1D8AA 1JAIA 2RGAA 2VJLA 3OLVA 4JFRA 1RMYA 1YR8A 4H3KB 5D3ZA 3W2EA 5JSUA 4QSHA 4QIHA 4TWJA 2YWBA 2WABA 1N2IA 3VU9A 1RRKA 1YOVB 1U3DA 3IQXA 4TUYF 1M1ZA 4GX0A 2QR3A 2FR0A 5BYAA 3OF5A 4MW0A 1DRKA 4EW1A 1GQYA 3HXOA 2A33A 2SBTA 2IPNA 4FIDA 3UCXA 4BNXA 4MA0A 2C03A 4CL2A 4GG1A 4OFZA 5DHUA 2O52A 3EMBA 4IIJB 5EXPA 1ZOSA 2NPFA 3S99A 1Z2NX 4AYWA 2F4VB 3ROGA 2D13A 4YV7A 1XZAA 3EZFA 4ZZ3A 4EKYA 4OSPA 4JLBA 3PXBA 3SHVA 1YONA 1Z15A 2C2MA 3WZ2A 3ND9A 1OTXA 1ZY2A 1TLFA 2J3QA 4EHJA 5B1EA 1LVUA 2RBKA 3PPVA 1TD1A 2YS6A 2ZULA 3DM9B 2CHQA 2Y93A 2W7TA 5K0FA 4MKRA 2QX8A 2R84A 2VYCA 3QXHA 2R5NA 4KKXB 3SBDA 1H3EA 1HX7A 4WZAA 3LQKA 1TKAA 3QEJA 2IHTA 2RI0A 1NT2A 1E5XA 3FSEA 4BZQA 1MJGA 3S81A 3TQQA 3UC9A 1RJWA 1K3TA 5C81A 3NH9A 4IOLA 2I62A 3OFJA 3VZRA 5EXXA 3TMAA 3BZWA 1PR0A 1VSUA 3H9UA 4JASB 4BNHA 2CJFA 4UJ3A 1QKIA 3OFVA 4UZSA 2WG2A 3SZMA 2C5EA 3F5FA 3ED5A 3OZXA 4O4LF 3IURA 5IYZA 3WDLA 1M83A 3GNLA 3TBFA 4E5NA 3U56A 4Q3DA 4WDRA 3GXBA 5BOVA 4Q7LA 4BFSA 4LI3X 1A8PA 3O0DA 3ZDRA 4DYVA 5J23A 3A6EA 3ONWA 2YFYA 4G4SO 4AY3A 1MO5A 4D6YA 2I3AA 1Y5RA 4HMPA 1GO2A 1HDXA 1THMA 1K4YA 4YYZA 3FETA 3BWMA 4EG8A 1GTSA 3KB6A 4I7EA 3K16A 3AVQA 4R0MA 2VEOA 1ZD4A 4EUHA 4QXPA 4OXKA 3O84A 4I14A 4CEIA 1AOXA 2W70A 2OZLB 2VHCA 1E32A 1ODIA 2DSTA 3I6QA 1DAMA 1P9WA 3JAWA 3MWEB 1F2TB 2WU0A 2QGFA 5ULLA 4F5WA 5AOVA 4YCMA 4JWKA 4BFVA 4DUYB 4FQ5A 4DBLC 1IG0A 1VB5A 1W9MA 3ILHA 2A84A 3EXIA 2DR0A 4ON9A 2ACVA 3RBXA 1XEWY 2HMTA 3F4LA 3GHYA 3OY7A 3EVEA 4IDDA 5K45A 5LZ9A 2BGIA 2Z2YA 2C3YA 2MYUA 1U0RA 1KKMA 3A4NA 1A7UA 3NBYC 4LZNA 4TZKA 3RRFA 5C1BA 5I45A 3JVEA 5KYTA 1PZFA 1ZZGA 4RVSA 3GJZA 2H1HA 1CWUA 3CEMA 1R4AA 4Y2JA 5JAUA 2JIRA 2PEYA 2OAQ1 4UHFA 4B4UA 5BQOA 4LG1A 4BNIA 2FK8A 2IHYA 1RYBA 4YWJA 5C53B 1X1SA 4TLBA 1WCYA 4UZEA 3SKVA 4RTMA 1W52X 1I2CA 4D46A 4KR9A 5JPDA 2GXQA 2QTZA 3CSDA 1YHNA 4N76A 1QO9A 3IAM6 4MP6A 1UXKA 4CIWA 5L3QB 3RC9A 3EYWA 1IVYA 3GLTA 5LDGA 5D84A 3HNOA 1Y0BA 4RLFA 3T3OA 3PXXA 2ZRAA 4HDKB 3SMVA 2R1VA 4KR6A 1CNEA 1NBME 1CY2A 3VHQA 1CP3A 1YAHA 1YNSA 5TDHA 1IN8A 3KR0A 2BKXA 4BUJA 4DANA 1ZI8A 4ID3A 2RE8A 2V96A 4PIMA 5LKAA 2B3DA 3L1UA 4Q34A 4ZT7A 2R7KA 1B0AA 1F2VA 4FPXA 4TTJA 2YZNA 1EWTA 3S70A 4BRWA 4AB1A 4RTPA 2WV9A 2H65A 2VLBA 1ZGJA 3B6KA 5T3UA 3RFVA 3S1SA 2C0QA 3S8MA 4NABA 3LF1A 2GX6A 1LS1A 2PD3A 1CT9A 3HJNA 3LGXA 3SYTA 3GPDG 1J8MF 3NOVA 5KYWA 3K0FA 1W5TA 3I53A 4YDSA 1XDBA 1PS0A 3KJXA 5BMOA 1H8HA 4IIDA 4CM4A 1U5AA 2QRVB 1YB7A 4S1PA 4WPGA 1XJ5A 3O83A 4WN9A 3ZBUA 1J6UA 5JS8A 1GDHA 2WKRA 3JQ8A 3TNYA 2D5LA 1YS1X 1TK2A 4MIOA 2GUWA 1R5NA 3U1TA 1YQDA 2OV1A 4LF8B 3ZHZA 4BVAA 2IWHA 1FW8A 3FD8A 4RY8A 3P9SA 1D7AA 1GL6A 4YJGB 4WA7A 1OZ0A 3N3BC 2ATIA 4Y2XA 2QA5A 2JGEA 1WXHA 2XXJA 3ACDA 3NBQA 4MQUA 4ZAXA 4IVRA 3TFOA 2VPQA 1BCSA 1KO8A 1JVNA 2IODA 1VMAA 2XOKD 2I2CA 3TRIA 1RD4A 3FTQA 3QV1A 1PU2A 4KSBA 1DBPA 3GNTA 4BNDB 3K1AA 4C4PA 2PLRA 4EIWA 2YHAA 3SE7A 1M8PA 3I9JA 4DV6B 3HG7A 4E6EA 5CEEA 3FMGA 2EOAA 1Z0KA 2JJYA 1W35A 2P79A 3IDSA 4L85A 2J4DA 2FE1A 4W1PA 3EIQA 4PZCA 2HFJA 5JDCC 3OOJA 4CN8A 4ZT3A 4BZPA 4U2CA 4LPKA 4DLBA 1HE3A 3ECCA 1E9RA 1S8FA 1I51A 5A6SA 5IAOA 3CLUC 5J1SB 2VNHA 4KFRA 3PZBA 2A6PA 1FY2A 2JHPA 1TA0A 3IEVA 4XIYA 3R7WB 4FDMA 1TVKA 1EWQA 2GM9A 1NP6A 2KMLA 2X5JO 3EF3A 3KXPA 4BBAA 2OE2A 3EULA 1OPXA 2XTMA 4KGXA 2PKQP 1U8YA 3VH4A 2FHSA 2ZI9A 4UAGA 3FTPA 3OF2A 1H66A 5EA2A 1L7OA 1F4VA 2FW8A 1R8YA 3ONFA 4O08A 2EW2A 2OAP1 1JEAA 2QXUA 4OHFA 1L1FA 2Z08A 3NZEA 1BWRA 5LPNA 4YXWA 2IBSA 2V7EA 1Z0JA 4LF5B 4MSUA 1NXVA 1WQ4A 1YQQA 2I6FA 1LBHA 4EJMA 3DDNA 1GPKA 1KAMA 3N8KA 3OZBA 2AN5A 1O6FA 3QE9Y 2UVDA 3B12A 5DYTA 2GJSA 4F2GA 3BTVA 5GV7A 3ZVRA 4JI0B 4YRSA 4E3WA 3RQIA 2FP3A 5FOTA 3IIJA 3WNDA 3V4LA 2AC2A 4ZV4A 2UYCA 3N2GB 4RHYA 4LMAA 4DEYA 3WWZA 2O19A 1Z7YA 4TTTS 3CTMA 4O1MA 3EXFB 4DT1A 4R9SA 1LDBA 1ISRA 1IYZA 2WYWA 4X64B 1JDPA 4OXQA 3VR4D 3WI7A 2IBMA 4TMYA 1OT3A 1UQUA 3FHLA 4NYJQ 1GEEA 1UP7A 1Y9EA 1XNGA 2UYYA 1EVZA 3AVOA 1D6JA 1QK3A 1KFEB 1RAHA 4LWZA 3K15A 4WZ6A 3C8DA 1VBFA 3C0KA 2RAPA 2C9MA 3FYUC 4KXUA 3AT1A 3WQBA 4B84A 2I9KA 3W6UA 1VMEA 5CIYA 1ISJA 3KBOA 1H1LA 1FQOA 3DE3X 1JEEA 1F06A 2CCGA 3T9CA 1YJ5A 3H3FA 3UHOA 1IAVA 4WUVA 2VBCA 4PHGA 3CRNA 1WPXA 3I0ZA 5EWJA 1EP2B 1T2AA 1WL8A 2PMFA 3M3PA 4GC9A 1IBSA 2AJ8A 1Y81A 3DS8A 3Q87B 1UPUA 2RK3A 3QVJA 4GH5A 2PWZA 4H0NA 4QL3A 4PO1A 3DAPA 4QU5A 1O0CA 4HQFA 5K6RA 3HJGA 3WGTA 4KQEA 1SCJA 1NV8A 1ZPDA 1D9XA 4IJQA 4TTAA 3ZW8A 1BXKA 2PH1A 3OTOB 1KMMA 3NHMA 1N3IA 1IY8A 1GNQA 4EI9A 2H1LA 5COQA 1J97A 4U39A 1W85A 6ADHA 2JJ1D 4NZPA 3ZJTA 1TQ2A 2HA2A 4G3XA 1K1EA 4D97A 3LT5A 4F21A 5A0TA 2AX4A 2QUIA 3WS7A 4PSVA 5AW6A 1RJGA 1OLXA 1S8AA 1YZGA 2BI7A 1M0WA 2DWPA 4HDQB 1ZM7A 2FEKA 1R4MA 5NULA 3LA8A 1C3VA 4G0VA 4YDRA 2R8PA 1X7ZB 5K0TA 3KUKA 3R5JA 2W2TA 4IDHA 2HF9A 2Y6UA 2NO4A 1WZCA 2H63A 1JAYA 4EY6A 4NXMB 3L7YA 4RMNA 4C9BA 2CDBA 3L0IB 2ZE6A 1AB5A 4FFRA 4NF2A 4S1VA 1QCDA 2OAGA 3DKRA 1TCBA 1I30A 1VIDA 3DL2A 1N8TA 3IRVA 3LCMA 2XGMA 4I4NA 2GJ9A 2Y68A 3AF2A 2PH7A 1WVIA 4L7VA 5EIAA 3RS4A 4MYCA 4RL6A 4ACAA 3ZUPA 2JFVA 2YC2C 1J9ZA 1IC6A 3AFMA 1YKSA 3KJZA 4JOCA 1NUSA 4QQ8A 3L0SA 5DYWA 3THOA 3V32A 1SUDA 2G0AA 4FYVA 4KQHA 1FW6A 1FVXA 4QDTA 4RQTA 4GO1A 2DR2A 3FGNA 4ZCIA 4KLCA 3ZWXA 1FQJA 3U7QB 4HWOA 4I8IA 4MCHA 5TV2A 3WXBA 5C0OE 4DTCA 1TK3A 2VJPA 3R76A 3O4JA 2Q7DA 4WLOA 1IONA 1B23P 1ENPA 4AP5A 2XH8A 3H04A 2Z4TA 1OAOC 4G84A 3KB2A 4DCSA 4MVJE 3CS3A 3S7TA 4QX6A 3CR7A 2F8SA 1JJIA 1MIHA 1F2DA 4EYEA 5AVTA 3GCDA 3KWLA 1B00A 4IFBA 4XQ0A 3D8SA 4AJOA 4F9EA 2O8EA 1M8JA 1OLSB 2XBLA 3BZBA 4TSFD 4BNKA 2NZVG 3FOAA 4BQRA 4CKBB 2J3JA 4NJEA 3VJMA 2Q3EA 3O82A 2BKUA 1HRKA 4TT8A 4CL8A 1L5LA 1CTQA 2CHUA 5KTTA 4I3GA 3KFLA 3Q9LA 3OZWA 1RHMA 1J9GA 1FDVA 4EA8A 4GEKA 1BMDA 3BHNA 2CLSA 1GM5A 4DYHA 2DRIA 2FGKA 2VK2A 3N2ZB 4KFSA 5KJ6A 1FVFA 4Q1BA 1QVZA 5C7YA 3SDSA 3DEYX 3TTUA 2V7GA 3NKLA 2XMGA 5TF0A 3V34A 4BEVA 1MZVA 4EPXA 4RK5A 1IZ7A 1FLDA 1WCWA 1GSHA 1IDOA 1ZU5A 2VJCA 4I4TF 4KX3A 4DNPA 5GINE 2F90A 2QLNA 2XDYA 2Y6VA 3O26A 5I9IA 5JZSA 1QRDA 4KQCA 4W5HA 1KETA 3AXSA 3QSYA 2VNJA 4PFQA 1LTKA 4JC8A 5CJPA 1KAOA 3IP9A 4RXMA 2WJPA 4B0OA 1Z0ZA 3GY0A 4P0QB 1M54A 4OQXA 2QWXA 7AT1A 3A7DA 1OTYA 2FEAA 1T2UA 4CCYB 3AR5A 4GXNA 1C7RA 5EQFA 2RHDA 4ZT5A 4C2TA 1GTJ1 1PYGA 4WXYB 2B1RA 4B8ZA 5DULA 4MR8A 3WYCA 4X44A 1M6EX 4BMCA 5AKLA 1DWOA 5DP2A 3RASA 1MNAA 1DTWB 1QGZA 2I80A 5FUBA 1H2RS 2GFIA 4OQDA 4KR2A 2OZEA 3ZTWA 3AB3A 3AIKA 2RHHA 1L7VC 3LGAA 5CDHA 5KOJB 3AKZA 3FOEC 5J9FA 2IZ5A 2JBAA 2ZIFA 3E7XA 2XNKA 4ND8B 4UHKA 1IZ0A 3NTVA 3NRJA 5AJYA 1C9NA 2ZR7A 1SXPA 1A69A 3IMEA 3VO1A 2CW5A 2YW2A 3OU6A 3L1HA 4A0SA 1GKUB 1VIMA 2RAUA 3ANSA 3B7GA 4LZPA 5CMLA 1MVNA 5DZSA 5HE9A 4GFDA 1MPXA 1ZU4A 4JQZA 2PE5A 4I46A 5ITZB 5EGSA 3OHMA 1UR5A 3BE4A 4QOGA 1MXFA 4IIYA 5DEIA 3QWIA 3DM5A 4K05A 2NUAA 4MTCA 1NKTA 4ZYLA 3M0EA 4M1SA 5DMXA 2P2CA 2RB4A 2BYTA 3DOOA 1KH1A 1BVHA 2CFCA 1V43A 3PUKA 1L7DA 2AKEA 1XQ1A 5L7YA 1SHJA 1DWQA 2C2XA 5KI6A 1T8YA 4BUZA 2XUZA 5KNBA 5LD2C 2OGSA 4O4JA 1YKFA 2BUAA 2CUZA 4XLLA 3T7CA 1XFDA 4U2FA 2LIVA 1JW9B 4L4YA 4EB8A 4MINA 5AP9A 4UOEA 1I8TA 4FFWA 1U0GA 3MWFA 4CMEA 5KJFA 4J0IA 4B9EA 1Z6GA 4DUPA 1UOOA 4QBIA 4G5HA 5CT8A 5KJ1A 2LV8A 2BHSA 2PLAA 2GVDC 4HTFA 4U6SA 4MRVA 1V39A 4GI3A 1ZNQO 1MJGM 5HKKA 2G5CA 1GT6A 3H2GA 3T1VA 2C9YA 3IHTA 3IVCA 4DG8A 1LC3A 1ONPA 3BKWA 1VBKA 2J67A 3DNMA 3GJQA 3CUTA 3IB3A 3I6ZA 2Z8XA 4A6PA 1K92A 1ZLYA 1U8FO 2A92A 3I28A 4LY3A 1H9AA 4RNDB 3GT0A 4OSEA 1AIPA 3BK2A 4O8CA 3UK0A 3EWAA 4KN6A 2Z0MA 3WLEA 3ZHRA 3RU7A 1TFRA 2ZYTX 3PQ8A 4Z49A 2UUBB 2P5TB 2H8GA 2IHZA 3E48A 4LE0A 2NO0A 3TGPA 3AY3A 2X4IA 4H4DA 3LHKA 3WFZA 4DV2B 2XUIA 4IDBA 5B7QA 2YY7A 2PT6A 4KAAA 2VDPB 4CR7A 5UKDA 4MUEA 2RGEA 4H7HA 5D51S 4FVTA 1V11B 4PXSA 3LG2A 3N07A 1XN4A 1TO1E 2PO5A 4FZ5A 3DONA 2V4UA 2E9SA 4NR0A 4QOIA 3UGKA 4KPGA 4DPMA 5BW4A 4FI3C 2ZI6A 5AOAA 1IBKB 2TYSB 1MRNA 3GDGA 4NTZA 5LMUB 2Z5VA 3DMYA 3RQSA 3ODGA 4P32A 1A9XB 3UATA 3FWZA 2BEWB 4DG5A 4O3MA 2BH9A 4HI0E 2ZYDA 4DIBA 1F0PA 4I5IA 1Y3CE 1E3TA 1XB2A 1YKGA 1G64A 2HSWA 3CRVA 4FHEA 4RKEA 4WLFA 2VRBA 4BB5A 4BVHA 3IDFA 1XP8A 4Y7CA 1PEKE 1UZMA 2XXBA 3KQNA 4BC0A 1GILA 1T3LA 4DAOA 2AFRA 4GQBA 4LIPD 2C1EA 1JIKA 5EI5A 4FHZA 1N9GA 2R4TA 4R0NA 3L40A 2JIZA 4PG4A 1M6NA 1F9EA 4LWPA 2Q07A 3CPEA 3FZEA 4BFUA 4C1BA 3IMFA 2FKAA 2ZUCA 5L4NA 3NBUA 3BTSA 4ZVKA 3URKA 4H1HA 4BQIA 2G70A 3I9MA 4PLYA 3FH0A 3I6IA 3LLCA 4NBLA 5TPWB 1N6PA 4AAYA 4G0PA 2OA0A 5HW0A 2QN1A 4NAVA 5IT9A 1YWGO 4N41A 1IBRA 3QKWA 3QMPA 2FV8A 3VPFA 3VC3A 3FVVA 1BQEA 1GSIA 1JR4A 2W11A 3JQPA 3TRFA 1ODSA 2A9PA 3AVVA 1GT91 2A1TR 1XZEA 3CH4B 2R6HA 1Y80A 2GKOA 3PQ5A 3HI6A 3C14C 3CKYA 1E9SA 3L4SO 4BFLA 1EJ2A 2V7QD 1X39A 3O8NA 3QFTA 1QGYA 5ARCA 3SZRA 1NSYA 3RC1A 3DE4X 2XTZA 5IKOA 3UA3A 2AWNA 4HAUA 2HA0A 4HWRA 2WJHA 3HR8A 4IILA 1L4GA 4XVQA 2ZS9A 1R88A 1NY6A 2I3DA 3QZUA 4BVLA 4ZDIA 3DTYA 3RLIA 4N6OA 1VHLA 4JP1A 3NBAA 2BFBA 3IT1A 3R6GA 1XDWA 1NVMB 1KI6B 4MQEA 1FFXB 2O4CA 1OWOA 4OAPA 3A0UA 1DRVA 2KX7A 4F7WA 1DBRA 1VKRA 2JI7A 4R31A 2FCAA 2W6QA 3ANXA 3OFND 4X1IA 2EBHX 4ROTA 1UMDB 2UYGA 4G1FA 1LSJA 5CBPB 2HW8A 3BULA 1D1QA 3KJHA 2XCSB 3KWFA 2X7JA 1GL9B 1Q22A 4MIEA 3H1TA 1GSAA 2XE7A 2HHJA 3FSJX 3R9KA 1KAHA 2QD2A 4M60A 3P45A 2YV4A 4IOMA 1YGPA 4KNWA 4GZMA 1QQ6A 3C6XA 4PF1A 1RWQA 1OYVA 2OQRA 2VNKA 3PFFA 2ZE5A 4N9WA 3ZVLA 3GEDA 4E4RA 5LQMA 4J7CA 3SQWA 5JNSA 1HEYA 3ZHCA 3IUBA 2A9FA 2Q7XA 3JYNA 3OI7A 3RFXA 1J56A 1N1DA 1RM0A 3DO8A 4CR8A 3ITKA 3KT8A 5CGZA 1IUNA 3UO8B 4OK3A 4ODIA 5DYYA 3GLUA 4G36A 2QTAA 2XMBA 4N5LA 5L53A 2NU6A 2QX6A 1HQCA 4FGUA 3VOTA 3CF4G 2JIQA 4QGGA 1KK1A 3HJFA 1D6NA 3DWEX 3HWX1 3E3NA 3OIUA 4BO2A 5MFPA 5HIMA 3Q5DA 4DCMA 4OU4A 4O2BB 3P9KA 5HMMA 4R98A 4ZAWA 3I30X 1Z2EA 1Z6PA 2WBLC 3QOWA 5FX2A 1XVUA 1AGNA 4ND4A 2GCNA 4CM8B 4MUMA 4NCIA 2OO3A 4H7FA 4ZCSA 1HYGA 2NSYA 3WOHA 5HFNA 2A5JA 5G0TA 4AJEA 5DBFA 2B9VA 3QF4B 4J76A 1NW9B 2ZSHA 1JHMA 3WVNA 1A2QA 4B7CA 3K6KA 4D5EA 2B61A 1N3YA 1NE2A 1RKBA 1XZDA 2CKDA 3ELUA 1BFDA 3HSKA 4FLFA 1XE3A 4MV6A 5EP4A 3SS7X 3U0BA 1F1JA 4EX7A 1CETA 4UBLA 5MGBA 3WLSA 1E1QD 1IL0A 1HTWA 1NXSA 3S7ZA 2GYWA 3BN3A 1TCAA 4U9UA 4ZI5A 1BXGB 1R18A 5JC1A 3EODA 1Y1TA 4P5DA 2AOUA 4CQLA 5JJBA 3FLEA 5J3JA 3DUWA 4KOAA 4HYTA 3I01A 2NXCA 4YAOA 3ZE0B 4C6SA 1SULA 1T4BA 1CRPA 3VKWA 4D79A 3B6EA 3RGWS 1R6VA 3UIEA 4DJTA 3M6XA 5LNK1 3G49A 4PO9A 5T64A 5JQWA 1PFKA 1ZN2A 2IEDA 2YNMC 1O6BA 4Q4HA 4ZRMA 5LSAA 1R50A 1PWYE 4Q4JA 3UFXA 1RLUA 5C4GB 1NBEA 3SC4A 4EKDA 1MABA 5GJWC 4BJ3A 1E98A 3K9LA 4L16A 3UXYA 2C5GA 2NUPA 3O03A 2OV8A 2RHCA 3BM5A 2O2GA 2OWEA 3I92A 3GELA 1E2FA 1IXRC 3EXG1 1EDEA 1FS5A 5CW2A 3REQA 4DC1A 3QYAA 3JV7A 1L7MA 4PRZA 1I5OA 3H0EA 3MQ4A 5G1NA 4EKIA 3TDNA 3BREA 2CF5A 4XYGA 2WFAA 3K31A 4V1CI 5D3QA 2F3UA 4PTZA 4M99A 4MVJA 5K8CA 1EP3B 4ZXFA 1YZVA 3M4JA 4Y7DA 4YCLA 5E2BA 3GUZA 3EZ6A 4HXYA 3IKTA 1NNI1 3D4PA 4I8XA 1GG5A 2BAGA 4X1KB 3P9CA 3SD7A 4YQFA 4HNQA 2HWYA 3R5TA 1PHRA 3DKVA 1VZ2A 4JB0A 4JMPA 2V5UA 2RKBA 2ZUVA 3CLSC 2NU8A 1D0IA 2VJMA 1VCHA 3V8PA 3OKPA 4OMUA 4LWOA 1EWRA 2ZRFA 2FSSA 3VHLB 2D3WA 1X19A 4J1TA 4LXHA 1S01A 5G0SA 3VC7A 4NG5A 5B7GA 1FFAA 4I0WB 1N2GA 4I55B 4N7BA 2ZVPX 4V03A 2B1GA 3U49A 4JYPA 4YMUA 4ZEVA 2F7SA 3ER9A 2HCJB 3CUVA 3IEKA 3PPIA 1V0JA 4OKSA 1T2NA 2VHWA 1N2CB 7GPBA 3KZCA 3PCRB 3NUQA 3ENNA 2WI8A 2Q3CA 4FFDA 3AM1A 3HVKA 1A9OA 2FZWA 3IPRA 4X3OA 4X8LA 4URHA 4AYXA 3RBVA 2PS1A 2W2LA 1BWSA 4CRWB 1B3BA 3D8TA 2LZ0A 3NOQA 4GEGA 3TAHA 3ENKA 4LA4A 3BGSA 3RJTA 1GPBA 1EGAA 2E1RA 1QLHA 2GD0A 2X22A 3ZHSA 1J7JA 1JJBA 1KY2A 2Y27A 5C8YF 3GOQA 1XG5A 1OIVA 1SKUA 3BWVA 1UBUS 3HUFA 4HXGA 3F2IA 3I23A 4Z3DA 3ZWDA 3FIUA 4AJ9A 4IIHA 3LK6A 4BO5A 4KEAA 1LK0A 3VO9A 2VKQA 4LRXA 1LW7A 2IIBA 2HXYA 4QELA 3SHQA 1O6CA 2ZJ2A 4WZZA 3O9ZA 4F91B 1K5PA 1U2EA 1WMAA 2J0EA 1FEZA 1B8OA 1Y6FA 4DSTA 4QVKA 1L3BA 1EHIA 4OB7A 4WKOA 2WR8A 1UKAA 3NATA 4X8MA 4G8CA 3VI4B 1VDMA 1ENZA 2MIIA 4BFTA 1SXJD 1NZJA 1JAXA 2Q5IA 2NO7A 1AXEA 3J80A 4TMFA 3MSCA 3Q1KA 1KBOA 2GHIA 1Q0TA 1A9SA 4L74A 4MLPA 5D5PA 5I7UA 4F3RA 2QVZX 1MT3A 3A1CA 3LQRA 4B7UA 3OUZA 4H0FA 1X8XA 2Q2NA 5TXGA 3HSSA 2FVXA 1G60A 1UKVY 1J06A 4WFKA 4ITRC 4IMPA 4JR0A 1TT7A 4TYNA 1I94B 1FLVA 4YUYA 2EVWX 2QYSA 5ALGA 2PU7A 3RVSA 1RFGE 3SFTA 3LQQA 3O73A 5FFFA 3SMQA 1YR1A 3KQQA 3M1LA 3QVSA 4KRXA 4PLHA 3K09C 1PZNA 4WKPA 5AKIA 5BRNA 1RCUA 1UP4A 1UT6A 1BCRA 1X1TA 1Z7BA 2XKAA 1K89A 1FA9A 4PONA 1D1PA 5B53A 3OA2A 3WWEA 1QORA 1XCJA 1LDEA 2FSVC 5C35A 4RLSA 3WMEA 2O5EA 1KI2A 2IKQA 1XWIA 2QTCA 4RXTA 5JAIA 2P7HA 5JH7A 3ABSB 1XA0A 1OFHA 1E9BA 1U2DA 2NXEA 3LBAA 4WCDA 5DHFA 3K2EA 1WZ2A 2GTPA 2QAGA 3ANMA 1C0PA 3AUYA 4E08A 1SA0B 5GGXA 2ZBDA 1SD5A 3L9XA 2EZ8A 3AV3A 1CDZA 2MMGA 2VHVA 1NQWA 4Q00A 1X1AA 4ESEA 1ARZA 5JAPA 3IE0A 1CS0B 3JQAA 2EZ4A 1YRLA 2ZQZA 1SZCA 1D9ZA 3C3MA 3GLHB 4KE9A 3L4BA 5A71A 5FV4A 1PJ4A 1TYAE 4AX8A 3UQZA 4Q16A 5KSOA 2HRRA 2C8VA 3B3QA 4A27A 2C88A 5DCUA 3OE7D 3JVVA 4DY6A 1GXSA 4OGFA 4QLBA 4ZD6A 3T5AA 2GMWA 1N0WA 2CD9A 2NPOA 2NYUA 2MTBA 3QWAA 2HNBA 3VU3A 3ZNOA 1AHHA 3K4HA 3C3EA 3MF4A 3RIGA 4Q3NA 3H2YA 3MTAA 5F9HA 1X1EA 4WJKB 3ZIDA 4Z51A 3DBHA 3QLVA 3ACBA 4FDVA 3OTHA 1TLTA 4E22A 3ICEA 1U8AA 2A2ZA 5SYAA 1J00A 4BFCA 3PITA 2AFIB 1LBSA 1XF9A 1OBVA 4I50F 4NV0A 1NF8A 3GX1A 2NNLD 1ZAKA 2RCNA 4BP3A 1DPGA 2IZ0A 2GJAA 2YCLA 1P18A 3HL4A 3VKUA 4CIVA 4YP7A 5BUZA 4I5FA 1O9BA 3BXPA 3VU8A 5FUYA 2NZUG 5U1PA 3UAOA 1KFJB 1MX5A 4ADSG 4ESOA 4OKNA 3V97A 4FGKA 3C24A 1TEHA 2REQA 1KO7A 2XCUA 2XB6A 1NVEA 1MUUA 3AFOA 4N3BA 2GH1A 4WCFC 1DL5A 1RPTA 2QKYA 4M36A 3ZWMA 3W79A 1IFXA 1URPA 2A9QA 2AMFA 4PINA 5E0OA 4RCZA 3AERB 3DP7A 2PY6A 4DGQA 4FLMA 4DR3B 1DXOA 4NH0A 2GNPA 3N3AC 1Y9JA 3BXHA 5KSWB 5IS2A 2O0KA 2VF2A 3AF4A 4TXNA 3EGXA 3SXPA 2ATVA 3DEKA 3QELB 1CUBA 5I9LA 5BUQA 1N5OX 2GRUA 2IDMA 2B25A 3JQBC 4IQFA 2PJDA 2BCGY 2PO7A 3AXTA 3EDYA 3GCZA 4AC9A 1LTHR 2QW8A 1QLWA 4OV6B 5J40A 4DLRA 5C46F 2QB5A 1SXJB 5CNJA 1ISFA 3L8ZA 2AW3A 3D8HA 3WGQA 4RHXA 4D9MA 2EF1A 3ORQA 4FS3A 5FTMA 2WIJA 1QFZA 3VTZA 2WFLB 3TRHA 2YIJA 5KQPA 2FNAA 3RSGA 4GWKA 1TMOA 3K0EA 4YY3B 1ZH8A 1N6OA 3IBGA 3QUSA 3SZ3A 1LSOA 1CVLA 3GGPA 4IWNA 4MJLA 4MWTA 5LZ7A 3TX6A 1I36A 3CUUA 1JLSA 4EHNA 1QDUA 3FUWA 1ZHFA 3H5NA 4L7QA 1YDWA 1N92A 2GO1A 3BFJA 4GMKA 1GVNB 3PDUA 1SG6A 2H92A 4PO8A 2YXPX 1GUAA 2HPVA 4RIEA 4UXHA 1Z83A 2QBYA 4HFNA 4JLAA 4YIKA 3E1GA 1A9RA 3ILYA 4JP8A 1HPLA 4O2LA 2PCLA 5ECGC 3B2QA 1AN9A 5KNLA 2J0SA 3W4KA 5HILA 1MX3A 2CLKB 4MYUA 3TN7A 2OXTA 1NV9A 2OCXA 1VJ0A 4LDNA 1LLQA 3FSGD 5TS3A 3S55A 4BB0A 4R71A 2FK7A 2WDPA 2ZAOA 4IWYA 5EE3A 3RPEA 3ECSA 4EP1A 1J0EA 3MTGA 1WXIA 2A9VA 1KY5A 1LX6A 3F6PA 1Z7EA 3UCFA 3V4OA 2JFZA 4OB8A 3BSSA 4RLQA 5LXTA 1C1DB 3U4QB 5AW1A 1A95A 1R5OA 2J09A 1TI7A 3D7MA 1PR6A 5AM5A 2WY2D 4AYTA 1X7DA 2IOQA 2GKGA 3EG9B 1KVQA 3S8YA 3N2KB 2WV7A 3W6NA 1KJWA 3FZQA 3GUUA 1YJXA 1TF7A 2FRVA 3N75A 4NZNA 2C5HA 2L17A 4PX9A 4YMSA 4IEIA 3LD9A 5AI4A 5JQGF 1I4OA 2WNIA 1QHNA 3A27A 3FTFA 5DBEX 1IJKA 3DL4A 1DTSA 3RAPR 3VR3D 1JB9A 5CLIA 2ONKA 4TYYA 4EG4A 2AQIA 1TM2A 2RH9B 3O8OA 1OZHA 2DH6A 2VUIB 1E9CA 1PX0A 1XGKA 3P4XA 4FDTA 4DLNA 1RPJA 5MF6A 4YJKA 4ALIA 2O20A 3KOMA 4QATA 4ZQEA 5KVSA 3K2BA 3G0GA 1F8GA 3AYXB 1TTTA 3K5HA 3PRKE 2JW5A 3KT6A 2FZVA 5EIXA 4HLUA 2YDYA 3DH0A 1BN7A 4IZIA 3T41A 1XZFA 1B8UA 1DINA 3DE0X 4DREA 4ZPJA 3UGJA 1LZKA 2IYEA 3KTDA 4OQZA 4LBWA 3O4GA 2X19A 5CYPA 5SZIA 4AJPA 2XI4A 1JDNA 4QOFA 5FORA 4LZZA 1IUPA 1Z28A 3V1KA 1WVGA 5KPDA 4UCFA 1T36A 3MCZA 3PTAA 1DKPA 4R8VA 4W9MC 1ISIA 1KYTA 1JBQA 3FBGA 4MWOA 1RQPA 1E6MA 3AKDA 2QDXA 4NYIQ 4DRXA 1OKKD 2AX3A 2B99A 1AQNA 1AJEA 1Z2PX 4EBBA 4H18A 2NWQA 2W58A 4ZI7B 2O8FB 1P2GA 1SCBA 2XJ9A 1RWVA 2P5SA 4JXKA 1FYFA 4V0NA 3ZHOA 5A9TA 4AULA 4LMPA 3JQ9A 3IMKA 2IKSA 1QAOA 4B2YA 1A96A 4UU7A 2O2ZA 3SIRA 3LE8A 3ROMA 4XWKA 1IJFA 2Z30A 4DV5B 4ER5A 3CE9A 3FN4A 2GEDA 2B5WA 2JCXA 1PR3A 4HOYA 4R7ZA 5LYJA 1AMUA 5AHKA 1BDBA 1ZG3A 4N3GA 2ZI4A 2AJTA 2QRUA 3H8WA 4Z4HA 1TJ5A 4PGHA 2YV1A 4R4JA 3C3KA 4WBSA 4BPRA 3KQUA 3GAFA 3I5MA 5EWLA 4WK6A 2CUKA 5EN4A 2JBWA 1ZUHA 1B26A 4IKEA 1M6YA 1O96B 4UQPA 5T8KA 1VP9A 5BN3A 4B75A 3L07A 3D3WA 4W9RA 5DK4A 2NP7A 2XKBA 3LY8A 3DMPA 3MJCA 1SU6A 1P29A 3CUWA 3WX0A 4TL8A 2NZJA 4YO8A 5EVCA 3IQFA 3W9BA 4X45A 5EHXA 1ZMXA 3RC2A 1YJAA 2PCJA 3CT6A 5JZ9A 4A0FA 2ISCA 2UZAA 1AQUA 2J5KA 4MTLA 2OPBA 4QJ3A 4MV8A 4IXWA 5SYNA 2XOEA 1G59A 5IH7A 1KRHA 4RD2A 3ZYCA 1R9NA 1LEHA 2FN3A 3IR6A 1ONOA 4KGVA 3WICA 4AZVA 4DC0A 2OY0A 4FE4A 1NF2A 5KJEA 3WL4A 3S29A 1O3YA 3CNHA 4CMKA 4DR5B 5FBQB 1P1BA 3F90A 4HVLA 2O1XA 3GQBB 4DHWA 3Q5GA 1SUFA 1K6MA 4EKGA 4OATA 4UD2A 4BP8A 1KTIA 2PSDA 3EIUA 4P33A 1JGTA 1PTJC 4II2A 5ILGA 2XUOA 3EAGA 5B6IA 2PRYA 4X3CA 2DSNA 5CEFA 2XPCA 2WT4A 3P0FA 4RA6A 3D54D 4PYMA 4R5MA 4WBXC 3CO5A 5A5FA 5A3RA 1DIRA 3AESA 1YMUA 3I01M 2HV9A 4Y2GA 5FYDA 4EDFA 4F4IA 1DCFA 1PJ3A 2HXGA 1X77A 5D7BA 1USGA 1M66A 2X0KA 4MWGA 2FWMX 4RELA 4Q3BA 1ZCBA 5FOQA 2ILTA 1KGDA 1K08A 3RLFA 3OSUA 2AVNA 3HKEB 1BH6A 3USES 3MXOA 1UM9B 2OLKA 3ICOA 1DFIA 3H87A 1G16A 1I0IA 4EJSC 2HA7A 2J9GA 2P8JA 2XTAA 3AJEA 4Y6RA 4GNRA 4H27A 5DLQC 3QUBA 2VDOB 1CE8A 1F4PA 3TZQA 2FZLA 2FPIB 2J6IA 3H4IA 1NP3A 3RTAA 3T7RA 4MGKR 4HY3A 1CS4C 4RO0A 5KPJA 2GGSA 2QPOA 2TSYB 1QHEA 4ZVUA 2R8RA 5C5DA 4H6VA 1X7HA 3EIOA 6GPBA 5EJ4A 4DR2B 4CHGA 3W5BA 4B0PA 1A98A 1E99A 1E2JA 1ZXLA 3EGDB 3TZKA 3B9PA 3VPSA 5B58C 1FS6A 1QS0A 2EEPA 1DRWA 1GPAA 2FSIA 2J3DA 4BVGA 1OI7A 2PH3A 2QNBA 3DLCA 1YZNA 4PC1A 1I0ZA 3CZAA 2YR0A 2HB6A 4NKRA 4CKEA 3I2IA 5AM4A 1V4NA 4AZ0B 1Z0FA 1C0LA 2ENWA 3A6DA 2XT0A 5A7HA 4PE5B 1RXEA 3TKLA 2XHEA 3PQ4A 3TLMA 1SJ9A 1CF4A 4XD7A 3ZXXA 4N7MA 1BNCA 1TPYA 3AG6A 3DEAA 4L76A 4EO7A 3PFBA 3GJ6A 1RSZA 2P2ZA 3HR4A 3I3OA 5I7EA 5M5BA 4GRAA 4LCJA 1PG5A 4LHEA 3B36A 1CHNA 3DNPA 2Q0HA 1UC9A 5JMPA 2OXIA 1FVHA 3TQRA 3AHDA 4G37A 5HRAA 2H4WA 4U6QA 3JSAA 4FW9A 2VPPA 4D0SA 3P9NA 2COKA 4JKOA 4LJ5A 1QIGA 4L57A 3ORYA 4L1KA 5HIIA 4RVOA 4V2IA 2YZGA 5ECDA 4C7OA 2ZS7A 4CMJA 5MN6A 1ISGA 3IO3A 3LT4A 2WJGA 3G82C 4A1OA 4YUWA 5BSMA 1U0SY 2IX3A 3EFBA 3PGKA 2N9UA 5DX0A 1H2ZA 1RMQA 2RAVA 2OYRA 2HJWA 2JKZA 2GBGA 4M0LA 5LP6F 3GFPA 1JI0A 1KMNA 5BR1A 4JXZA 1PVOA 4K81B 1DJOA 1USWA 2PKQO 2XDWA 3B3GA 4IO0A 2PT7A 4M38A 4MAFA 3ZIAD 1ENOA 4RPCA 1MLDA 5BSKA 5DX1A 2IEAA 1UK7A 2VS1A 3Q0IA 1ORTA 2DTEA 3H8JA 3AY6A 4MPDA 3WIDA 4NQRA 3AHHA 5ALOA 1NWCA 3KAPA 4EHLA 1NW4A 3OOEA 4OHVA 4DIEA 2GCPA 4HYEA 4X7MA 4Z99A 3VKFA 5HIAA 5HRUA 1LFDB 2ACEA 3NWEA 4MW9A 3WWPA 5IZ4A 2PRSA 5DYGA 3AZQA 5A9SA 1YMVA 4GYWA 5HJ7A 1N1MA 1C8KA 2EJBA 2I29A 2ZP1A 3JTEA 4QNRA 1U7UA 4ZVSA 3D6NB 3TM5A 1WXEA 1B2RA 2FP4A 1F17A 2Y1XA 3DHVA 1FUKA 1Q0RA 3EVTA 2HBYA 3IT3A 1VL2A 3D2AA 1UBSB 5B1DA 5KHOC 1ZNZA 2QHXA 4N54A 3AOEA 3KXIA 4ZVTA 2GCGA 3OEED 4R16A 4MLCA 3Q2IA 3RK4A 1J2EA 1IK4A 1YU6A 3DWFA 3E61A 1ZNXA 2C92A 1OZAA 4IY1A 2PZLA 2ZT8A 3D02A 4M6WB 4FU0A 3V7YA 3W5DA 3D43A 4EL5A 1WAMA 3E5MA 5ICMA 4C2UA 2P2LA 3E0XA 4C5BA 1DEOA 2B7LA 4CLRA 2QD3A 4YRBA 1CG6A 4W6ZA 2O2IA 4YUAA 3HU3A 3KZKA 4EAQA 2DWUA 2WSSA 4B7XA 5ALPA 3UFBA 1KDPA 3FWYA 2ZKLA 2GQ0A 3CX8A 3MOGA 4H6PA 4RMHA 1JXAA 4EPYA 5IX8A 1U3CA 2XE6A 4K6MA 5CNMA 4IJWA 2JHAA 1YR7A 3G5LA 1I33A 1ULZA 3PHJA 4DDHA 3RFUA 3S2UA 2LVBA 3E8MA 3RGGA 1U0FA 4F38A 1FIUA 1N6HA 2Z6UA 2Q6IA 2BKAA 4FYPA 5HM6A 3ASUA 1ZN7A 1Y8RA 2EHJA 3SIXA 4Y6GB 1FFGA 2ODEA 2NVUA 1DKNA 1ESMA 3HXTA 4H7DA 3VKVA 4J1NA 1QYVA 4ZYYA 3I4CA 5JZBA 4EGSA 1ADBA 1UC8A 2LE0A 4W9NC 2QUBA 1KEVA 3JRNA 2IV3A 2QL5A 2I7CA 3TRJA 2ZT7A 1AB6A 4U2KA 4ETIA 1EJ0A 5JHHB 1Q7TA 3SBEA 4YAJA 2FB9A 3TR6A 2PL3A 3DOCA 2EJWA 3LRTA 5IVHA 3QEBZ 1W5BA 2R87A 3CPJB 4PTLA 3WGUA 4XX0B 4EVRA 1D2CA 1UPAA 3LLMA 1QYCA 1CB7A 2HHAA 2I6SA 1YTUA 2AR7A 3PE6A 4B1FA 1W0CA 1ZVJA 1E4EA 2WAOA 3NAMA 1T6XA 4OXIA 3TLGB 2X6RA 4OK5A 4XGIA 2I7TA 4FX2A 5HEKA 3RIXA 3GOHA 2R5FA 3EOAI 1RI2A 1C41A 1YBFA 1XZLA 4MQLA 1N4DA 4DPLA 1XIVA 3DV0B 2Q46A 5DSZA 4JXJA 4RD3A 3QVXA 4BS9A 5JJIA 3QLUA 3DHEA 4GBGA 1JG7A 1QG4A 4BX3A 3TPFA 4UU1A 3U7RA 1JA0A 5LQCA 2HCTA 3ZLTA 1ECLA 1IMOA 5G0UA 4ESVA 5EYPA 1F9AA 1I24A 1Y8AA 1WO8A 1LSSA 3GA0A 5LOVA 3KYIB 4IM7A 5AXBA 3W06A 4F06A 4XVRA 5DGTA 2ST1A 3KT3A 3RS8A 4B9AA 1BMFD 1PEAA 2Z3ZA 4DDMA 4Z1MD 4BO7A 2BMVA 4BNTA 4D45A 3JASA 5H16A 1JIVA 1QPGA 2XQGA 4C5CA 3JYPA 3SVLA 2JA2A 4I6EA 2QQ0A 4JLKA 4N8DA 1V5IA 1NVKA 1QH0A 4RKWA 5A3SA 3TG8A 4ZEXA 4YRKA 4FQ8A 4QDUA 5AK5A 1PT7A 5BQPA 1KQFA 4RULA 1NIPA 4LY9A 3FX2A 1A1SA 2ZZKA 3FPSA 5DI3B 4RZXA 1I7SB 2XUGA 5IEBA 5A3VA 1CULC 3ZEAA 1KARA 2NZYA 3EAQA 3OU7A 2NTVA 4JH0A 1CZLA 2R8XA 1ZAYA 1DUIA 3UICA 2WHXA 2I5PO 4CI9A 2DFTA 3FZNA 2ONCA 5K3CA 3NHBA 4L72A 1G66A 1GFSA 121PA 1CRZA 3Q9SA 4GC5A 2QY9A 3VR5D 4L22A 1QOPB 5KTSA 1BKYA 1Y7TA 4B83A 4XYMA 4DEXA 4QICA 3KJEA 4GVPA 3WSTA 4C1NA 2IBTA 5C7OO 3RIEA 4BLRA 4QAQA 4FMCF 4S2EA 4IIEA 1LVGA 3U4AA 1R6DA 4KGDA 3BD8A 2AHRA 1K06A 1HFEL 3GFFA 2C9CA 3M9WA 3E8SA 1IY2A 1FFWA 2B21A 2IYPA 1RZUA 1XTTA 4MCJA 2CBXA 3MWJA 4RKRA 4R1QA 1YHYA 2EFYA 4KWTA 4LGCA 1W47A 4WERA 4XTRA 4AICA 3LXMA 2DAPA 1CU1A 3MUOA 1XBTA 1B4DA 4C3ZA 1RC0A 4S3MA 3ZD9A 3G1UA 3LH5A 4K6OA 1COWA 2Q1WA 3PL1A 4N5DA 1US8A 5FWAA 4DJAA 4F46A 4QOSA 4LZAA 4LJKA 1RFLA 3PQDA 1PK8A 1LX7A 3PJRA 5EOVA 3F6RA 4JC4A 1NPYA 1RVDA 3EZXA 4GIBA 1JH9A 1WMFA 5CPBA 5ES4B 1C9EA 5KQSA 5D1NA 3RYCA 1TA9A 3PXCX 1OLUA 2PSFA 1QTRA 4UDYX 3SF8A 3NCHA 5J59A 5JW6A 3F47A 2HWKA 2QL6A 1RLTA 5JLAA 3NV7A 4FNAA 4FDAA 2B69A 3EVAA 4Q7MB 4BMOB 2PFKA 1JPVA 3IOCA 2IT1A 3N58A 3WIEA 4R3NA 2PWYA