1EB8A

Structure determinants of substrate specificity of hydroxynitrile lyase from manihot esculenta
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
b'PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDARDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-ACETONE-CYANOHYDRIN LYASE
publication title Structure Determinants of Substrate Specificity of Hydroxynitrile Lyase from Manihot Esculenta.
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Lyase
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1eb8A00
5LZ5A 2WHRA 3DYIA 2VAVA 3PUIA 5EIAA 1S8OA 4B83A 2WQZA 2AXEA 3RLIA 3HI4A 5AI5A 3HC7A 4GHWA 4J0IA 3LIIA 2JEZA 3AZPA 4J3JA 5JZBA 4PF1A 2H1IA 1O6FA 5LZ4A 5CTAA 2GYVA 2OGSA 3IUMA 2XQGA 2XQKA 1QIGA 1H22A 3VVMA 2QZPA 5DNUA 1AUOA 2W6CX 2WIDA 1JFRA 3F8SA 4BC0A 1JJBA 5EGNA 2GZSA 1XRPA 1HLGA 1UT6A 5D3ZA 4HXFB 4PNZA 3IUNA 1IVYA 2IX9A 1RYYA 1H2XA 5ALXA 4ZGBA 5LKAA 5CH8A 2OCGA 1VKHA 1E3QA 4L9AA 4G8DA 4H7DA 3M81A 2ACKA 3C87A 1A88A 5F4ZA 4QDUA 3HLKA 2XUPA 5C8VA 2OQIA 3VJMA 3EIOA 1G5FA 4PQEA 4U2CA 1JU4A 2WFZA 5LP1A 1E89A 1E66A 2HA6A 4FLFA 3BJRA 1C7JA 1ZGBA 1U2EA 4AB1A 3RKSA 1XQVA 1MAHA 4B0PA 3QPCA 3TGLA 4H7FA 3WJ2A 3D2CA 2QR5A 1ZD3A 5ALGA 5AM3A 1HKHA 2RONA 2XMDA 5A2GA 4GBGA 5K3CA 4EHBA 1BE0A 1WPXA 1WHTA 2C5GA 3PF8A 3QPAA 1UKAA 4G8CA 1FSSA 1BN7A 4QE3A 1FFEA 3G7NA 1UWCA 3I2GA 3FVRA 5K3FB 1XZHA 4INZA 1CPYA 3AIKA 3HJUA 1DT5A 3BDVA 1QFSA 4P92A 4Q3OA 4G4JA 2QM0A 4O08A 3TRDA 4RE6A 3K9BA 5T4FA 2DCMA 2EDCA 3T4UA 1IUNA 3BWXA 1XROA 3FLEA 3MGAA 5AOCA 3WKEA 4FHZA 1HPLA 4WDRA 1AKNA 2PU5A 5AKJA 4LYEA 1ZD2P 2V97A 3G9XA 3SWWA 3IBTA 2FUKA 2ROQA 4LXGA 4NS4A 3U1TA 1N1MA 4BCBA 4HRXA 2ES4A 4JH0A 4Y2QA 4Y2TA 2HA3A 2WHPA 2HFKA 4LHEA 3D2AA 1CUIA 4J0KA 3D4LA 1EB8A 2WIFA 4W1SA 5JYCA 5DNWA 2VF2A 3ESDA 1TQHA 2IITA 4DNFA 2WJ4A 1YA4A 3STUA 4IH1A 1KU6A 2OAEA 3DOIA 5HF6A 4GI1A 4H7JA 1ZIYA 4AN1A 2DR0A 2OLEA 4UBLA 5FP0A 4A23A 2QJWA 1AQLA 1QO9A 4C89A 2WUFA 4J0CA 5AI8A 3CCCA 1DX4A 1XZFA 4KRXA 4UHEA 2Z3ZA 2I3DA 4KRYA 5ALMA 1EDEA 1QIKA 2PX6A 4QEKA 2DQZA 4U2BA 1E5TA 1XZLA 2XUQA 1AZWA 5ALIA 5IKXA 3VKFA 1FFAA 2XDWA 3GUUA 3QMVA 1B6GA 4HXEB 4ZREA 1O6GA 3WWPA 1Z68A 3I6MA 1CUWA 4ZI5A 1QZ3A 1ORVA 3WK6A 3STYA 4C87A 4J0HA 1W52X 4MXDA 1OCEA 4HS9A 2ONCA 1BN6A 5ALRA 3N0TA 2I78A 2OGTA 5ALNA 4BDSA 1TK3A 4FLMA 1N5MA 4QDZA 4F60A 4X91A 3UUEA 1G4HA 3M3DA 3K2IA 3HRHA 1MN6A 4WFIA 5ALPA 1ISPA 1X2BA 4ZXFA 4H0CA 2V96A 1PFQA 5LZ8A 5ALTA 1ZI9A 5A7HA 1UK6A 2XMCA 5E2IA 1AMNA 2FX5A 1ORWA 4H77A 3ESCA 4UPDA 2EDAA 2HL6A 1XLUA 4EY6A 5A71A 4B80A 3D7RA 3G0IA 1CRLA 2BKLA 3LP5A 3PDCA 3C6XA 1T4MA 1LBSA 2B9VA 1CFJA 3DKKA 1UOPA 2HRRA 1C4XA 3RM3A 1MAAA 4L3WA 4BYMA 4U2EA 4J7AA 4EY7A 2XUGA 5BV7A 5EFZA 3ICVA 4EY8A 3CN9A 2ZSHA 1IUOA 1H2WA 1KU0A 2WFLA 2GBIA 4UBMA 4UUQA 3WKCA 3SX4A 5LLSA 4Y2XA 1JJIA 2PBLA 5HF9A 3G9ZA 4BC1A 5DTIA 2VQ6A 5CURA 1MTZA 3FCXA 4BP9A 2ZVDA 2H9YA 4Y7DA 4MEAA 5AKIA 3WMRA 4X90A 4HTAA 4UBNA 2WG2A 3H18A 2VSQA 3NOXA 3ZLTA 3WK9A 4B9EA 5C7YA 4K2AA 1VA4A 4KEAA 2JBWA 4GW3A 3I1YA 3IIIA 3R3WA 2P8SA 3QH4A 4DMKA 1ZI6A 4KR0A 2V98A 5HCUA 5I7UA 3AZQA 1XZDA 1DQZA 2O2HA 2YH2A 1UFOA 3C6BA 1TRHA 4Z49A 3W2TA 4DMFA 2C58A 2QJRA 1XQWA 2AJLI 4W1PA 5AIAA 1EK2A 2QTBA 4BE4A 5J3JA 2RHWA 4AMZA 1LZKA 3WKBA 4CCYA 2XUIA 3E1GA 4ARBA 1F6WA 3VDXA 5LIPA 1EH5A 5ESRA 2QUBA 3V48A 1X2EA 2YXPX 3G0GA 5DJ5A 1LPSA 4D9JA 5ALYA 2CEKA 1R4ZA 2WJ3A 2HU8A 5AK3A 1ZD5A 5ALDA 1F8UA 4B9AA 4BB0A 5JD6A 2IIVA 3AINA 5ISMA 2B61A 1EDDA 3ICWA 5T4BA 3O95A 1CVLA 3F97A 4K6GA 4MQLA 4OB8A 3DL7A 1YA8A 4UHFA 2LIPA 1AURA 1MX9A 1WPRA 5T4HA 4B7ZA 2UZ0A 4MWSA 5HZGA 2VJBA 4OD0A 3ZV7A 1K5PA 2HA5A 1YS2X 1OXMA 1XKTA 4WDQA 3AUKA 1GPLA 2OQVA 5HK9A 4KE7A 1HBJA 2BUAA 3G8YA 3KWFA 4KJXA 5CT9A 3H2GA 1ETHA 3QYJA 4RNCA 4Q3LA 3WKDA 5HKAA 1U8EA 1XZIA 5AOAA 1VZ3A 2JGFA 4X94A 5JASA 1A8UA 3C5WP 1R88A 2JGJA 3R3ZA 1TKRA 4EB0A 3AILA 3H2IA 3D2BA 5JANA 3HYSA 4E46A 4Y2VA 1QIEA 4YPVA 2CUTA 1LPAB 4ZRDA 2XUAA 5FDFA 5KWIA 5D6OA 1B41A 4QLAA 2OCIA 3E0XA 4C4XA 4FWBA 3V1NA 5YASA 3G0BA 5CT5A 3VISA 2AJCA 3I6YA 1SOMA 5CT4A 5SYNA 2RHTA 3VJLA 3I2JA 5CXXA 3W9UA 1XZCA 2JF0A 2XQIA 4G4IA 4P93A 4UHDA 1DWQA 3ZWQA 5EHXA 4OYLA 2BGRA 2VT7A 2WHPB 3WIBA 3WIOA 5C8XA 1R9NA 4CG1A 2RIPA 3ANTA 5AK4A 2WIKA 2O2GA 1MX5A 4YK7A 3IUQA 4N8DA 2HFJA 2PSDA 4OYYA 4LXHA 2WUGA 3GA7A 2OG1A 2AJ8A 4EUSA 3PFBA 7YASA 4IQ4A 5FPPA 1BS9A 3VJKA 1TIBA 3DKRA 1LZLA 2VJCA 3BE8A 3H0CA 3A2NA 4AXBA 4KE6A 1XRQA 4JYMA 3H2HA 3FSGD 2DHCA 2HA0A 3WLAA 2YASA 2WG1A 3W04A 3G02A 3W9BA 1WM1A 3QMWA 1LBTA 1D07A 4U2GA 2FJ0A 2I3ZA 1P0PA 1CUVA 4AQDA 4PV7A 3H19A 3O0DA 5DTJA 4KACA 5I8PA 1W76A 5IH7A 4UFPA 1GGVA 5JARA 5LZ2A 5AM1A 5ALQA 5EHZA 3WA7A 1CUAA 3OG9A 2BUBA 2C5FA 2PKYX 3R3XA 2VJAA 3STTA 5JALA 3X3HA 2VT6A 2XUFA 4M0MA 4CCWA 3H1AA 3L1IA 5CRIA 2ECFA 1DTEA 4DIUA 2WILA 4C6HA 4OUKX 4J0GA 1ZI8A 4OU4A 1K6EA 4AO8A 4G9EA 2CB9A 4AZ0A 1BCRA 3RK4A 1AX9A 3E4DA 1VE6A 4X93A 4XVCA 4G9GA 2WFMA 4DSZA 2AJDA 2OCLA 2OAGA 3I1IA 1ACLA 3V9AA 2I03A 1TCAA 2QVBA 1HDEA 3DNMA 2J4CA 5H3HA 3GROA 3MUNA 4GXNA 4CG2A 4JNCA 4GDMA 2HA2A 4IO0A 5EHQA 1USWA 1XZEA 5AM0A 5HKBA 3NUZA 5K3DA 4EZIA 5AOBA 2DQYA 2W22A 1VE7A 2HHAA 1K4YA 2GBFA 3KWJA 3QBJA 1JI3A 3WWDA 5ALKA 4Y2RA 1ODTC 4W1RA 2J4FA 5AKGA 5D7BA 1QIIA 2JEYA 3F67A 2WFLB 3G0DA 1CUHA 1CUGA 1EDBA 3AZOA 3I2HA 4HXGA 2ZYIA 5AI0A 3BF8A 4OB6A 4W1QA 2NW6A 2ZYRA 1G42A 4B81A 2XT0A 3B3QA 1UKBA 3F9CA 1L7RA 3M82A 3FWHA 3WZLA 1Q83A 4C01A 4QNNA 5JD4A 4OCZA 3H1BA 4X7BA 1ZIXA 2HA4A 4IH9A 4C88A 2HU7A 5E4JA 3CXUA 3H2JA 2HM7A 3UMJA 4DGQA 1XKLA 1J07A 1EXWA 4FTWA 3VXKA 4WFJA 1TCBA 5DYWA 3S8YA 5HQ3B 2DHEA 4F5ZA 3A2MA 5K5EA 3KOOA 4B85A 1W6RA 1LPBB 1LPMA 4FLEA 2JGEA 3V1KA 1VJ5A 4BCDA 3FYTA 4BVKA 1GT6A 5A62A 2C0QA 2Q0XA 3KSRA 3GBSA 5A7GA 3DL4A 4H35A 1SC9A 4I3FA 1TAHA 4IHAA 1LLFA 2C4HA 4MQMA 4BBZA 3VVLA 3I2IA 4CCYB 1QE3A 5AM2A 2ZJFA 3FYUC 2HIHA 3PUHA 4H7HA 2ORYA 4L72A 4N5IX 2AJBA 1XZGA 4MYDA 2PSJA 1QTIA 1UOOA 4EY5A 1BU8A 2WU3A 3IUJA 5T4EA 4DMCA 1E8NA 4Y9SA 1FFCA 1ZJ5A 2WTMA 3B12A 4X97A 5FRDA 3HABA 3ESBA 4QDOA 2QXUA 3WWEA 4ZV9A 5JAUA 2VEOA 4AMYA 1JU3A 1YAJA 2XB6A 5HFAA 4K5QA 4HRYA 4E14A 6YASA 1J1IA 2RAUA 4ZWNA 1EHYA 2C0PA 5JAPA 2X76A 4X6YA 2WHQA 4FDMA 5IVDA 3EBLA 3WK8A 1CQZA 4FBLA 4PSDA 3FVTA 1RP1A 4UBIA 1CQWA 1YSCA 1QIFA 1PV1A 4MEBA 4DNPA 1XLWA 5AI4A 1EA5A 3BXPA 2OPHA 3WWCA 2HA7A 1CUFA 2GYWA 5BWCA 1MU0A 4DNQA 4P08A 4X92A 3P2MA 1EVQA 5CT6A 2XMBA 2B4KA 5DWDA 1CV2A 4AX4A 5AI6A 4J0DA 4KYVA 4WFKA 1VXRA 4QDTA 1JMKC 1YASA 3C6ZA 3WK7A 4CFSA 4N8SA 1AGYA 3EQ9A 4BTLA 3DJYA 4GECA 2GYUA 1MT3A 4WCVA 4CG3A 4J0JA 3O4GA 5CT8A 3OURA 1MO2A 1A8QA 1C7IA 2WSLA 3DOHA 3PICA 3A70A 3WQHA 4LIPD 4DLNA 4F21A 4V2IA 2PM8A 4Y2UA 1ODSA 4CI9A 1BEZA 2VTVA 2O7VA 3OM8A 3A6ZA 5HK8A 2G5TA 3RARA 2G5PA 5JZ9A 2JGIA 3PE6A 2BCEA 5AH0A 3QPDA 1L7AA 2Z3WA 3ZPXA 5C8ZA 3TEJA 1OILA 2ZJ6A 4B0OA 2PSEA 2ZJ7A 1YAHA 5LYYA 4E15A 4CIAA 3CN7A 2GZRA 4X85A 4A16A 1A7UA 1MX1A 2XMGA 3I28A 1YB6A 3DS8A 2WUEA 1EX9A 5ALUA 2QT9A 3K6KA 1PJAA 1VOTA 3JW8A 3G0CA 1H2YA 5CXUA 5CH3A 4QLOA 2HADA 3EQ8A 1J2EA 3O4HA 2WM2A 1XRLA 1R3DA 4DMHA 1CUUA 5JAHA 3S2ZA 4Q82A 2ZYSA 4FFWA 2BUCA 2Y2VA 3O4IA 1CR6A 3FCYA 1XRNA 3F98A 4JEIA 2VATA 2CZQA 4OPMA 4HAIA 3HZOA 1NU8A 3JYHA 4FKBA 4PSUA 4BVJA 1IZ8A 3FYUA 2E3JA 4RPCA 3WZMA 1GPNA 4BCCA 4G1FA 1CIJA 5AK5A 1LNSA 3HACA 1Q0RA 1SFRA 4G5XA 1FFBA 4FNGA 1W75A 1NU6A 5FLKA 1DWPA 1K63A 2XUOA 4BP8A 4BVLA 1QIJA 4YX9A 3FBWA 4X6UA 1JT2A 1BEEA 2XLCA 3CCBA 2OXEA 1GQSA 4TGLA 3D0KA 1JKMA 4UBOA 5E4YA 1UXOA 5ALWA 1AC5A 3BL8A 1VZ2A 4Q1VA 3OC0A 3TJMA 2B20A 3WKAA 4Y2PA 5IVHA 2CJPA 2QMQA 3OOSA 5FUMA 4BDTA 3O9MA 4EBBA 3AIMA 4FBMA 4BAUA 2XMRA 4K6HA 3DQZA 2BFNA 3NGMA 1XZKA 1WB6A 5HF5A 3I6ZA 3YASA 4H7IA 1IMJA 5ALHA 3ANSA 3ILSA 4H7EA 3DYVA 5A6VA 2WJ6A 5CW2A 4LXIA 4BAGA 2WG0A 4I19A 5ALOA 4HZGA 5JD5A 3DDUA 4H18A 5FOQA 1TCCA 1QIHA 2WTNA 2Y6UA 4KE9A 3G9UA 1VLQA 1SCKA 4ETWA 1QONA 2XQJA 1ZICA 5AM4A 4EA6A 3EQ7A 1MPXA 2BGNA 1UZAA 3B5EA 5EIHA 1QIDA 5BOVA 3QM1A 4FFVA 2WKWA 3Q8WA 5D3KA 5ALJA 2GBCA 3FLBA 3IVMA 3MUOA 2Z8ZA 3LIPA 4H7KA 4ARAA 4PW0A 3FAKA 3HXKA 4FNMA 4GWLA 3QZUA 3LS2A 2X5XA 2XUDA 4FOLA 1N5RA 4KAFA 3IA2A 3IDAA 1UK9A 1ZJ4A 2VAXA 3ESAA 2XMSA 1CUEA 5BWBA 3C8HA 1DX6A 4JYPA 2ZSIA 3DCNA 2JGMA 1CUCA 1CEXA 3ED1A 1GQRA 2H7YA 5AHXA 1MNAA 2PPLA 4MYSA 4OU5A 4DNOA 2Y1KA 1ZD4A 4HVTA 1EB9A 2PSHA 1Y7IA 1SCQA 3Q0TA 3D3NA 1JMYA 5FPQA 4QA9A 3D59A 3I2KA 5AKXA 4KE8A 4BZWA 3H04A 4OSEA 4N8EA 5LKRA 4U2FA 1MJ5A 1GZ7A 1VA5A 1ZGCA 4U2DA 2PUJA 1FJ2A 1EK1A 4Y2SA 3OTQA 2XLBA 5AI9A 5AIBA 5AKKA 2HRQA 2RI6A 4P9NA 3L1JA 5FKJA 1CUDA 5CH5A 3WL7A 4PSCA 4UHBA 1QLWA 4WY5A 1M33A 5AKLA 1EVEA 1XQXA 3BIWA 3MVEA 2WLSA 2PU7A 4G8BA 3KD2A 1QIMA 4AO7A 4LKOA 4XX1A 3H2KA 1E8DA 1DT3A 2WIJA 1CLEA 2J3QA 1BCSA 1WCYA 2PVSA 2FJPA 4UHHA 5ALEA 1H23A 4NVRA 2R8BA 1CUSA 4LYDA 4QWMA 5AICA 5EIEA 2H7XA 4Q3KA 1JJFA 1XFDA 3DLTA 1CUZA 1W1IA 1KEZA 3L1HA 1FFDA 1ODCA 2PUHA 4M0FA 3LCRA 4C4ZA 4TPKA 5E4TA 1DQYA 4OB7A 2BJHA 1W4LA 1LPNA 1UK7A 4E11A 2Z8XA 5AM5A 4WJLA 2VJDA 4AO6A 5JADA 4F0JA 5LZ9A 1IZ7A 2HU5A 1SCIA 5HF8A 5KREA 2Y2UA 2D0DA 1Q0ZA 1F0NA 5ALZA 4YASA 3U0VA 4ROTA 3STXA 3WK5A 3DEAA 1QTRA 5AJHA 1MNQA 1XZAA 4L0CA 1LPPA 5KBYA 3A2LA 1YR2A 1I6WA 2CBGA 1CUXA 4X6XA 2DHDA 4DTCA 3PF9A 2O2IA 1T2NA 2Y6VA 2OCKA 4MJ3A 1QO7A 5KWJA 5AK6A 4EY4A 3C43A 2DFPA 2G4LA 1YS1X 3ZLVA 3IURA 4N5HX 1CUJA 3C5VA 4XWGA 2JGKA 4B6GA 1GKLA 3WL5A 1UK8A 2BAGA 2WUDA 5DYTA 3E3AA 2CKMA 1QOZA 1LPOA 3STWA 1RWQA 3FNBA 1Y37A 2J3DA 1THGA 1XRRA 2WU4A 4IH4A 5SYMA 3T52A 3GELA 2XUKA 3C6YA 4AN0A 4KAAA 2XQFA 5EHNA 4UBKA 5JIBA 3WJ1A 1H2ZA 1BROA 4QWWA 1P0IA 4I4CA 2G63A 3IULA 5DYYA 2R11A 1WB4A 1NX9A 4Q34A 2K2QB 3R40A 4GEGA 4B84A 4RE5A 5ALSA 3FLAA 5K3FA 1QFMA 3FYUB 2ACEA 3R3UA 3JWEA 1F0PA 3BDIA 1X70A 1U4NA 2HDWA 2RGUA 3LLCA 4B82A 3KDAA 3EF3A 3F96A 5C81A 4Y2JA 3WK4A 3WL6A 2QUAA 3WA6A 2ZYHA 1HL7A 4M0EA 1UOQA 3N2ZB 4BAZA 4BTVA 2QS9A 2XUJA 2XMZA 4ZV7A 5FXMA 5JZSA 3O9VA 4JUIA 2EEPA 1K8QA 2H7CA 3UUFA 2YYSA 1CUYA 3DD5A 4KAJA 1XQYA 4NZZA 4DSAA 1WOMA 3GZJA 1GKKA 3IB3A 3R0VA 3WL8A 3O4JA 3M83A 1DU4A 1QGED 3I2FA 3QITA 3H17A 1WHSA 1VXOA 1EI9A 2QRUA 3NWOA 4C4YA 2DSNA 1XZJA 5K3BA 5AKYA 1N8SA 1Y7HA 4W9RA 1R9MA 4QZVA 4X3CA 2Z5GA 3OPMA 4G4GA 4BRSA 3STVA 1WB5A 3W06A 1P0QA 1YB7A 1DWOA 3ZI7A 4BATA 5IVKA 2XE4A 4BE9A 1ACJA 3BF7A 2VA9A 5HQ3A 4BZZA 1YCDA 5ALFA 3SK0A 1Q84A 1J06A 1G66A 1CUBA 3KXPA 4XJVA 1UKCA 5CMLA 5I9IA 5AP9A 4GLBA 3PFCA 5ALVA 2C7BA 3AIOA 5EI5A 4Q05A 3QVMA 3WWOA 4W63A 5FV4A 1XZMA 5JATA 3R3YA 1GXSA 2O7RA 3PI6A 4X95A 1BRTA 3FSGA 1DINA 5DNVA 4S0XA 3SC2A 4CIBA 4DYHA 3C70A 4K6KA 3HEAA 3R41A 2CMFA 3WYDA 4UFOA 4UHCA 4J03A 4RGYA 4DM7A 1XLVA 2JIDA 2PL5A 1E8MA 1QJ4A 3HSSA 4FMPA 2WIGA 3V1LA 2QXTA 3C8DA 4NMWA 3ZLUA 2V9ZA 2D5LA 5AKEA 5AKHA 2QKYA 4ITVA 5JAOA 3AJAA 1U65A 1XRMA 5K3AA 4TVKA 3BJMA 5LZ7A 5A7FA 1A8SA 2QOEA 5IVIA 4AZ3A 3WYNA 5K3EA 1EINA 1LGYA 2X8BA 4X00A 1GPKA 5AKZA 5CBKA 1THTA 3W05A 3BIXA 2GBGA 2OGZA 4A5SA 3AFIA 4BRZA 4XIIA 1R1DA 4WY8A 2XUHA 2XMQA 1HQDA 2XI4A 1L7QA 3D5EA 3C45A 4PO3X 3WI7A 5HFNA 1XZBA 4UBJA 4Y2YA 5ALLA 5DLPA 4UFNA 3FOBA 5AO9A 3GFFA 1ZOIA 2JGLA 4QDXA 3QMMA 4X71A 1R50A 1IUPA 3V1MA 3G9TA 4MWTA 3R3VA 1P0MA 2PSFA
chains in the Genus database with same CATH superfamily
2CW5A 4B6JA 2WHRA 4KSBA 2JDIA 1TUBB 3JQ8A 1SU7A 3IEPA 4ZZ0A 1X1QA 3IVRA 4MUXA 3TEFA 3VC3A 2WWYA 2Y1LA 4E12A 2I62A 3DVLA 1I2DA 1F2TB 3Q8MA 1O9BA 1YRWA 3JQBA 3OUUA 1JMVA 5BQPA 1MT0A 3ID6C 2B36A 1WVMA 1V2HE 3C3AA 2EG9A 3K8OE 3AT1A 1JQAA 1KP3A 1L5YA 4ODIA 1EFPA 1HF3A 3LA8A 4AY4A 4IDEA 1I0LA 2AG6A 2WVJA 1RI2A 3BL5A 4GHWA 4B3HA 2IV3A 4F1WA 4QOSA 1LBEA 3IL2A 1K2VN 2VR1A 1KDRA 3N2KA 4GGMX 5AJYA 2C7OA 1KKUA 4HCJA 1AGNA 5JNLA 5JHHB 3DE5X 3B6JA 3DTNA 3ZR4B 2JEZA 4J3JA 3MWGA 5FADA 5FNZA 3RVJA 1PZFA 4QT0A 4D9GA 1O6FA 5LZ4A 5H5JA 1LX6A 3ESZA 4F3TA 2HRDA 4IDNA 3SZ3A 3RC8A 1U80A 5CTAA 3T6KA 2Z4RA 2C4KA 1MO3A 2C95A 3EFOA 3O8QB 4BZPA 3BUSA 3LHFA 3TE6A 2FB9A 2WSSD 4QFMA 2Z3VA 3IVAA 2AKEA 4UHKA 2XQKA 2Z9BA 4BJ3A 3LY9A 3U4CA 1H22A 1N2HA 3EMKA 2QZPA 3H8JA 2NTJA 1FFXA 2MWMA 2D5AA 3MELA 2OD2A 2ZJOA 5T3UA 1YI0A 2IELA 2WOOA 3JQEA 4R7GA 2QB5A 4YDSA 3WMRA 5IKOA 3Q3EA 1YBFA 3TKYA 5JSHA 2IH5A 3F8SA 4DJDC 2V3CC 2EYUA 3E7XA 3PQ8A 1JJBA 4GRAA 5IC4A 3L7NA 4AQ7A 2QGNA 1UT6A 1OT3A 2OHIA 3BDAA 5FI0B 4LF6B 4R3NA 3IUNA 1IVYA 3MXOA 1W5BA 3JQGB 1Z7WA 4KQXA 5J47A 1IZYA 3SN6A 3KD3A 4ZGBA 3ZDXB 2OCGA 2VN8A 3AR4A 1D2MA 3IVGA 2F1IA 2YXLA 4D3ZA 4Q0MA 4EB3A 4EDHA 1R6AA 1YVPA 2GAFA 3KDSE 3U44A 1KFEB 1E69A 2BGWA 2WSBA 1UDCA 4G65A 4IW3B 2XDQA 4NJEA 3M81A 3O8RA 2ACKA 1NE2A 4IVRA 1BJKA 2VDNB 1S01A 4N12A 3WLOA 1TOAA 4B6FA 3HLKA 2H9AA 3KT8A 1PQ4A 4HFRA 1G8FA 2XUPA 5DRTA 2A0YA 3LTEA 3B3GA 2O8EA 3EXEA 2OBMA 3LH5A 2VT2A 3AEUB 3ENVA 2GLXA 1P17A 1RYBA 1QP4A 2HZBA 1EX6A 3U81A 2Q6OA 1LC0A 2WJPA 4U9UA 5KB3A 2NMVA 4V02A 1TF7A 3NHBA 3EOBI 2ZWMA 2IF2A 3GQBA 1KSGA 3R75A 3RIXA 2CSXA 1NPYA 3MIIA 2BMJA 4J8PA 2XKJE 4HPXB 3MINA 3TLKA 2HA6A 4FLFA 1QGYA 1G4AE 3BH0A 3BMNB 1COWA 1OU0A 2IY9A 1S0UA 3OECA 5EPOA 3DEZA 1CNEA 3K9HA 3THOA 1INLA 1GU0A 3PD7A 4UCXA 4B75A 3EJ6A 4XTRA 3T7JA 3UYKA 4DLPA 3SR0A 1WJGA 1KMNA 4B0PA 1KYTA 5CM2Z 1NQUA 4ZYXA 1BFKA 5J4YA 2DECA 3A6PC 1T4BA 3CIOA 5DPMA 4MUBA 3BSWA 1LDYA 2QRKA 3RF6A 3HYTA 3T3OA 2B5WA 1TVMA 2A1TR 3V5NA 4BUCA 5LA6F 3FTQA 1H6AA 1E2UA 3AR3A 3FDIA 2OHVA 3JATA 1ZHFA 3QBEA 2X8AA 1ACMA 1IHUA 4LE1A 3T0GA 5AM3A 1U6IA 3A4IA 1AKQA 2XCTB 4X8MA 3TTYA 2AG1A 1NRIA 2XMDA 3BEOA 1BC5A 3LUKA 1NDHA 5CG2A 3OCXA 4WBSA 2C3UA 4YWJA 3BZUA 1U04A 3H9BA 3L82B 3B51X 4PPGA 1RS0A 4I9HA 4PHTA 3WLPA 1U90A 3UPUA 5C3UA 5CB4B 2I9KA 5CHEA 2O0HA 1V37A 3HJTA 2FF5A 1RYNA 3FB4A 3OP4A 3I8SA 4TT8A 1L4BA 3HWSA 2PWAA 4WGGA 3L1VA 4QUEA 1BN7A 4RCVA 2DBQA 2LUOA 1W44A 3TRKA 3ZHVA 4KWCA 4DQUA 3PWSA 3EG9A 3GEIA 2JJYA 3GZTB 2WHYA 3PRKE 1QTQA 4LW8A 2XDAA 3OA2A 2QSYA 1QGUA 3E3NA 4UU1A 2WRZA 3BHJA 4N65A 1C7ZA 3Q11A 4INZA 5CX1A 1V1RA 4CMKA 1LJUA 2FOIA 2XD4A 1CPYA 3BM5A 3NEJA 4IIJA 5G1PA 3AIKA 3T7KA 1OKKA 3HN2A 3V8PA 3W2IA 3LJKA 2QE7A 3EDOA 2HSJA 3B3FA 2HREA 1SC1A 4A2PA 1P62B 1QLHA 2LWIA 3K9WA 1NT4A 1Z6YA 4YUAA 2R1VA 4M9SA 5F3RA 1YCFA 4G4JA 4D96A 5IUJC 3TRDA 2I6XA 4IQFA 4O08A 1ETUA 1F8XA 1RJWA 3EC7A 2WF5A 4RE6A 4F85A 4XASA 3ND9A 3PL1A 4JLSA 3BWXA 3NHJA 3VYVA 3PRYA 1ZCJA 3QHPA 4BZXA 3Q40A 4M8IA 1VP3A 2VQDA 1ZK2A 2WFAA 4FHZA 5BNIA 1HPLA 1G5IA 2VK1A 1N2CA 3DBIA 5F7XA 1GG8A 1Z8DA 1T9KA 1L8XA 1YGYA 1AKNA 5F3WB 2P3QA 4W8GA 3QGMA 5M5BA 2P9JA 4JOQA 3G68A 5REQA 1G8MA 1QHHB 2V97A 2OTCA 2CFCA 2R97A 1PR9A 2D5IA 3G9XA 4LXXA 3MWLA 2XGMA 5H8WA 3KM0A 2OMEA 3TLGA 2OO5C 2R2AA 1QFZA 3O2JA 3TXXA 3VOSA 5EWMB 4WZZA 1QK5A 5FFNA 4JH0A 2F3UA 5IAJA 1ISJA 1Z2CA 4EZBA 4BXOA 2J4DA 1PWHA 5AYVA 4Z5XA 3G5MA 3GRCA 3FPKA 1J5EB 4PZ0A 1X9GA 2PUTA 3GV0A 4YAOA 2R65A 5C8YF 1MRSA 3FTDA 1A5SB 5HILA 1S02A 4F9TA 1X7GA 2O9JA 2BWJA 5F1PA 3FTEA 3D4LA 1JVSA 1F1BA 1KPGA 2OCAA 4O5OA 2JAWA 1E2LA 1ZM7A 3OQBA 3UJ8A 1YB1A 2FFBA 5DNWA 4N5MA 3NXKA 3SSNA 5CIYA 2Q6VA 5IN4A 2SCUB 1XL0A 1V6CA 4FYKA 1OVGA 1WHSB 2AC7A 3O8OB 4LXYA 4CU5A 2R86A 2Q2OA 2ADMA 2WJ4A 3K70C 1O95A 2IU4A 3JD2A 1OPRA 4CT4B 5CXQA 1DJQA 3QSYA 3ZBPA 2QTLA 1W59A 3AXSA 3Q7SA 4P8RA 2ZSAA 3DWIA 2LV8A 2BSAA 1T6XA 1MZVA 1QANA 2JVIA 3LUGA 2X13A 4H7JA 5DCLA 4N3CA 2QTNA 2DR0A 4I2NA 2O3TA 1JR6A 1X0VA 5FP0A 4JVOA 2QJWA 3ZI0A 1EBFA 2HQOA 3QX7A 4GE0A 3FRJA 2JZOA 3SEFA 4C89A 3GO4A 1V1JA 3M9WA 1Q7BA 2I76A 3Q3GE 4DREA 5LOVA 4CIDA 4UAJA 3CCCA 1L7EA 1K3FA 2EFDB 3L1UA 2EVWX 2P0EA 2WMDA 3ITNA 3ML1A 2Y0EA 3O9ZA 5CA1A 1L5LA 1OFIA 2HMUA 4EO7A 3S1AA 3MMXA 3OAAA 4CLHA 3DZHA 1MVLA 5G3ZA 2PS1A 4UHEA 5K0JA 1Y3AA 4KRYA 8AT1A 1SXQA 2FR8A 1PJLA 3DT6A 4Z7JA 3LXUX 4OV6B 4PX9A 4A0FA 1QTNA 3DMFA 3ZU6A 5BNZA 5HMMA 3TR5A 2R85A 1XK6A 1XZLA 4IR7A 3LAWA 4IRMA 4U2BA 5K20A 1PSZA 4JB3A 1P44A 4L22A 5A06A 5FUXA 1CJKC 1XWWA 4S3MA 3IUEA 5CK5A 2ZRCA 1AZWA 1DQRA 4DV0B 3O73A 3ZNQA 5IKXA 1WZEA 1Z0DA 4C1BA 1DBSA 5HIJA 1L4FA 3VYUB 4EHNA 4FI3C 4NOLA 3GPLA 4I5GA 3AG6A 3L07A 2WPDA 4DV5B 3Q9NA 3PGXA 4BVBA 2WC1A 2P9YA 1JAYA 5JDCA 4L4ZA 5JMOA 3PD0A 1I8TA 1BH6A 1LVGA 2JI8A 1CUWA 3D4NA 1U6KA 4MVJM 3DJFA 4LRYA 1LF5A 4ZI5A 1US8B 4B3CA 3MGKA 5FL7A 1U8FO 3WK6A 1PVOA 4UC0A 4C87A 2JFFA 1W0JD 2VZLA 2WTAA 4P54A 3HL0A 2H4XA 4KQ9A 2ONCA 3LHIA 3WSWA 5JZOA 3PS9A 5ALRA 1IOVA 1YU6A 3THYB 3A9SA 2FZWA 1FNDA 1YVEI 3RRJA 4ZCRA 5TGDA 4NNJA 5JPCA 3JAWA 4JLDA 3NNSA 4WINA 2HF8A 2QROA 4F60A 5JT1A 4EW6A 2FUCA 2C9BA 1WP9A 2NTEA 1JIQA 2OHFA 4S24A 4U6NA 4X91A 1N7IA 1COZA 2B6HA 3DUFA 3A36A 3K2IA 2ISSD 1KHTA 3LCCA 4FEYA 4G4SP 1H2FA 3W6NA 3IHKA 1Y34E 2HQ1A 1ISPA 1L4MA 2BIFA 4FR0A 5CYPA 1DKUA 2CN1A 4S1OA 3T5PA 4WKBA 2V96A 4KKXB 4M9XA 1W9HA 1AQNA 1EGQA 1PFQA 5LZ8A 3P9NA 1IK6A 1M0TA 2OXRA 5E6SA 4B3DA 3VPGA 3GRZA 4IEIA 5A7HA 4EUKA 1PZNA 3M6WA 1AMNA 3PXGA 3JX9A 2H1HA 4D43A 2OA0A 4ZVVA 2Q7OE 4ZDIA 4BQNA 3NTVA 5J2UA 2HCFA 2YVLA 2E21A 1QGOA 3MWDA 2PEYA 5C1BA 4UPDA 4BE7B 2AK2A 3RIHA 1LJLA 3S3TA 1I3NA 2VYCA 1HE5A 1C14A 4EBFA 1TVEA 1EZ4A 5HCNA 1DC6A 3IUBA 3TSOA 3OESA 2BDTA 3PX7A 5LP6F 3D7RA 4XWWA 4PNPA 3HXLA 1U7PA 4MKIA 1YDHA 2BKLA 3FFWA 3DBRA 3TW6A 1MFPA 3ABRB 1C9KA 1L4NA 3EVGA 1ZKMA 1BE8A 1T4MA 1P9WA 2YZGA 1LBSA 3R7WB 4NBTA 4KXFB 5C52B 1JB1A 3PQDA 3ZCPA 1U9IC 2UUBB 4YEDA 1UZNA 4ENWA 4I9NA 5EIFA 1SUWA 1KC3A 1XMVA 4AF8A 1MAAA 3ON5A 4E03A 1W4RA 4MPJA 1DV2A 4OYHA 4X61A 4YDRA 1BAPA 1GTJ1 1Z73A 1TU3A 4WXEA 3ONWA 2JK1A 4U2EA 3HJGA 1ECBA 1P9OA 5TMDA 5TLSA 2OORC 3CRQA 5HVNA 1TADA 3PWKA 2C2WA 2NUTA 3GPCA 1P2SA 4KQCA 1NVAA 4YY3B 2XVAA 3WMEA 1PT6A 1U3FA 1VCMA 1O9GA 2H4ZA 2XNDA 2XV1A 3EGWA 3OX4A 1G7RA 3ZX5A 5EFZA 3ET5A 3HY6A 2F59A 3J80A 4YJKA 1DRVA 1ZR4A 3ICVA 3S7TA 5JYEA 4RY8A 1GRQA 4IHQA 3S55A 2QQFA 4CEIB 1WMFA 3K6JA 3OCWA 1T9BA 1IUOA 3AHHA 4U7TB 1Z4OA 1KU0A 4ZQBA 2HLDD 3OFND 7MHTA 3ULKA 4UBMA 1AN9A 4UVDA 3VDRA 4MQ5A 3OZGA 2Q29A 5HF9A 1DE0A 1RM4A 1Z13A 3NHAA 3FUVA 3NV7A 4LQLA 2WT4A 4GMDA 2F1OA 1NDQA 1Z4IA 5MDHA 5JLAA 3Q6IA 4ZT2A 3U26A 3GDGA 1V8BA 2PT5A 2R96A 2RHOA 4JC0A 1DIGA 4N0DA 4X84A 3F5MA 5CURA 5F23A 5A4MS 2Y1EA 1EP2B 2DJ5A 1YWGO 1GV0A 1UAGA 3RK0A 5GINE 1RWVA 4IX9A 5AKIA 5T41A 3AVQA 4L78A 1PW5A 4M53A 4X90A 4HTAA 3L6RA 4LX8A 4YP0A 5E1DA 1TEZA 3M8KA 3JQ8B 4UDYX 1IAQA 3H18A 5JZVA 1JFFA 1O6ZA 2VSQA 3DFIA 4AUMA 3N87A 1LV8A 4AF7A 3WK9A 4GZ5A 5HFJA 3HKCA 4J7XA 4B6SA 4E2XA 4V1CA 1L8OA 1OY1A 2XOKD 4KEAA 3OM1A 3VR6D 1L7VC 4JP3A 2EV9A 2Q50A 4QTTB 1EFPB 4C4OA 3RT7A 2G4VA 2XB8A 1GT91 1WEKA 1QLJA 3IIIA 5AHKA 2GZHA 4Y9UA 2GRAA 4BFXA 4F3RA 5C5IA 5IXJA 2NPIA 4K28A 3N2KB 1OAOC 1K4MA 3CV3A 3E81A 1MKYA 1XK7A 1ZI6A 2XPCA 4L8VA 3UJ6A 1JYEA 1YACA 2V98A 2JJQA 4NU0A 1QVAA 5FTMA 5GIPE 4KMSA 3RAJA 4ZJYA 2PJDA 2J3HA 3GUHA 4L15A 1P2FA 2HH9A 4Y6OA 1A1SA 5BN1A 1T8RA 3EEOA 3HVIA 1H5UA 2O2HA 1JJAA 4E30A 1H8ED 1FF9A 2C9ZA 3EFOB 4GLLA 4JLKA 1TRHA 3P9ZA 5AVJA 3EZNA 4MAAA 2FYTA 3LOPA 3Q3JB 1OU4A 2QYOA 1GU7A 2H31A 4HAZA 3ZVKA 1QYDA 1VHDA 4UDOA 3GXOA 1JA0A 5TGZA 3NVKI 1FFXB 1QZXA 2A84A 4KR7A 1Z0UA 5JWRA 1NR5A 1HEUA 2C58A 5FPKA 4KLNA 4W1PA 2IU0A 4KK4A 1V45E 3H5NA 3RW9A 5EMKA 1OXXK 3GNLA 3V1NA 1A96A 5I47A 1PGPA 2LGJA 1F48A 3SSMA 4G3XA 3A3YA 4BNXA 4R5MA 1KGSA 1VG0B 2LBPA 4JI7B 1VE9A 4AMZA 1TIPA 1Z18A 2EP8A 4XGKA 1RYEA 2CJYA 5KQSA 3X1JA 1FMTA 2F1HA 3ZTYA 4UTNA 1LZKA 1GPDG 5HTOA 2H8KA 4CCYA 3E1GA 1A5TA 4ARBA 4C29A 2AUNA 4NBUA 2B3DA 5LUAA 4DDUA 2QYSA 3U44B 2D13A 3GDOA 3WNDA 4DN6A 5BSWA 5LQJA 5GOTA 3VDXA 3SEAA 3HYNA 3I1FA 3E7FA 2XDQB 4NJEB 4PANA 5AVOA 4LSGA 1EH5A 3ETGA 2PQMA 5THKA 2WSIA 3LPAA 1M6HA 1I14A 2ODBA 4PBRA 2YXPX 3G0GA 5BR4A 5AVTA 5DJ5A 5JSKA 1LPSA 1SHKA 4LVUA 4WN9A 2F3RA 5BSKA 1JZSA 3U56A 2O8EB 2QP4A 2PZGA 2XWQA 3EXEB 2OM2A 3O2NA 2AUMA 1TLTA 1SWWA 1R7RA 2VBGA 3ADPA 1SIUA 5KTNA 1ZD5A 2AXPA 3PHGA 1F8UA 3PTLA 1V43A 3GLHE 5JD6A 3HFSA 2BSQA 1NBAA 4IJMA 4TMKA 3GQBB 3UOAB 4P0PB 1EDDA 3HCCA 4R8LA 3IXQA 5FF9A 1NKSA 1XAHA 3TR0A 1IMOA 3MINB 3O95A 2O20A 2XYGA 4K6GA 3SHTA 5EXSA 5JWHA 2G0AA 2PX8A 1KOJA 2J59A 4O4LA 3GPIA 2IYUA 3U3ZA 4F4FA 3ENQA 2YNMD 5L3SA 4AS3A 1QCZA 4CKBA 1AURA 1MX9A 5KYWA 5KEIA 1RHJA 4Q47A 5HZGA 3UUGA 4JJGA 1HG0A 3EWIA 2B7CA 2XB2A 5IEBA 1QVZA 1P3Y1 5GY7A 1E1NA 1ADCA 2G9NA 3WP0A 1T0PA 2OXFA 2O5CA 3OCZA 1G21E 4WDQA 1NJFA 5BXQC 1NBMA 4HN2A 4P84A 4QXRA 3ZW9A 2OT3B 3LC1O 2HX1A 4QICA 5EQJB 1M5RA 3AVTA 4JGBA 3JATB 2GFHA 5KJ1A 5I9LA 3V4SA 4PY2A 3SZGA 2I4OA 3KWFA 2LCQA 1E79A 2BFMA 1Q3HA 5CM8B 1D1QA 3MFYA 4HHEA 4G0VA 4BWFB 2CT8A 3K1YA 3VMFA 1LUAA 1GTL1 1K5HA 4KSCA 4M1TA 4CTKA 3KKEA 2BFCA 3R6LA 2GB4A 1JHRA 2ZG6A 1H5QA 2M1XA 1ELOA 2E4YA 1NP7A 3MC1A 1XZIA 4GSYA 2I7XA 2BTEA 4DR6B 1BYUA 4N82A 4GX5A 1ZJWA 4NARA 1VZ3A 4RXUA 2EATA 2EF1A 4GZ6A 5JASA 1A8UA 1V7ZA 3C5WP 4MV3A 2HK8A 3EG9B 5JCZA 1YMVA 4YAJA 5L6MB 1SHUX 1DBVO 3R9XA 1N2BA 2K6GA 2PJRA 1QGUB 2O2YA 1KQ3A 2JAOA 5DZSA 5CX1B 1P1BA 1V1RB 3D2BA 3H2IA 3TH5A 3TTVA 1KI7A 2VSFA 3OLYA 3FUWA 3Q2IA 4IIJB 3RGGA 4G01B 2CK3A 4TTRA 5BSVA 1L7MA 3RI3A 4WHMA 1NM5A 1I7QB 2J67A 3L43A 1CQJA 2OBXA 4G23A 4YPVA 4G37A 2JH3A 5KHAA 4XFJA 2ORVA 2PMDA 1RZ3A 3AONB 1J6UA 2R1VB 4FX2A 5A9TA 1PDOA 1RLIA 1LPAB 2JFGA 3UA4A 10MHA 1UPTA 3ZVMA 1XUOA 1XD2A 2XUAA 2C5HA 3QJ5A 4KQKA 1I2AA 1RQ7A 3G3EA 5FNVA 2G4CA 1UJ2A 2NPOA 1B41A 3V7YA 1TD1A 4HJXA 2NXJA 4MICA 2BGJA 4D74A 3Q7EA 3ZXIA 5BPHA 4FBGA 2JIZD 1VJ0A 3CLTC 1OGJA 1TM5E 2ZI7A 3E0XA 4CIXA 2FVYA 4M49A 1UMCA 1N2CB 2PPVA 1PT8A 2RHRA 1XI2A 2Q9AA 5TARA 1IB6A 1MQAA 1SOMA 5REQB 1PX2A 2QAGA 4TXLA 5K2MA 2G83A 2RHTA 2F90A 3VPFA 3B70A 4YALA 3PLNA 5G0WA 2X42A 3VJLA 2QRLA 3BCHA 4B43A 3SLKA 1JHMA 2Q7XA 3ICCA 3FPLA 3LY5A 2NSYA 3KB1A 3TLGB 2O6HA 2EP5A 4MIKA 3GP5A 4G4IA 3B9QA 1DWQA 3ZWQA 4BXOB 1NOIA 3A9TA 2EW2A 3HU3A 1VKNA 3Q7QA 4EPVA 1YRHA 2VT7A 5CDFA 5LNK1 4E1AA 5KPJA 1WY5A 2E4VA 3RQSA 1VL8A 2LDXA 4KK3A 4XM2A 2WA2A 3VC7A 4O4JF 1HT2E 3CSDA 1NJ6A 3PJDA 1OYWA 3ANTA 4EG0A 2COEA 2WIKA 4MZXA 5AK4A 4EB6B 4G97A 4CNBA 1MX5A 3G0HA 3W5DA 1YMUA 1GGEA 3PXAA 1XB2A 2F8SA 2PS0A 3A4LA 1QJCA 2ZS7A 2HFJA 2X5NA 4OVKA 3LQ4A 4MQ6A 4MVWA 5D3MA 4KUGA 2I1VB 1IEXA 2H52A 2H8GA 1U3GA 2R6FA 2WUGA 3PU6A 1WULS 2W4MA 4RZ2A 4YH1A 5IABA 1HDOA 1NNI1 3EE6A 3N2EA 3GA7A 4OA5A 5EIOA 5ICFA 1GYRA 3VU1A 1R0XA 1NJ2A 1KMCA 2IYTA 2WHXA 3PKJA 5FQNA 3VHXA 3PFBA 4BBPA 1YO6A 4BUJA 1U2DA 2QTMA 3SLRA 7YASA 4JL6A 3R5HA 2EFGA 3A9VA 4IQ4A 1YDFA 4E5NA 3KK0A 1SR8A 3IEMA 1BS9A 3PYMA 1SKYE 1TQ4A 3CZAA 4N3AA 2IIQA 3AWDA 3TLXA 1R0LA 2EP7A 1DELA 2NYUA 4RUKA 1WDKA 2F55A 4MRRA 1X1AA 5LOVB 1HQYE 3G8DA 1XSEA 2F8MA 3RAPR 2H0AA 2IF0A 4MDYA 4G84A 3UMCA 1NULA 4UD6A 5CA1B 2C2MA 4FJ1A 3LDAA 3GGOA 1A7AA 1SUCA 2V6FA 1OYYA 1BX0A 3KWMA 4JYMA 3S1AB 3FPCA 3ZWCA 2BHTA 3BTVA 2IXFA 2OG2A 2JRLA 1HE1C 3FSGD 3NC4A 5L40A 4AKTA 3KS9A 4ZDKA 4O5AA 1DAIA 2BV3A 2FZEA 4IIYA 4JUCA 1V4NA 1XBTA 2ZREA 4RLSA 3WLHA 4CMBA 2ZU0C 5GJBA 2WG1A 1JXQA 3CYFA 3JQ9A 4PCVA 3ANLA 3MMZA 5KVQA 2X0DA 4C20A 1CTQA 2ZTSA 4HLQB 5BV2P 4QT4A 3QWFA 3G02A 1O77A 2PAAA 3AY6A 2D54A 3L0DA 4RANA 5DI3B 3JQ6A 4NNOA 2WT9A 4RETA 5B3LA 3NWBA 1FJXA 3BSYA 2PXHA 3QFHA 2D1YA 3EAQA 4H1VA 3NC1C 1SD5A 1D07A 4MWDA 4L4UA 4WCFC 4KX5A 1KYIA 1CFZA 4LUCA 2FJ0A 1DAFA 2AFHB 2ZJ2A 2OWEA 4ND2A 3EMDA 4O2AA 1PK9A 4Q6WA 2D1SA 2QI9C 4IGIA 4YCMA 4EPWA 4PV7A 4QAJA 3S4YA 3EY4A 1OLUA 2GF9A 4L3VA 3WDKA 4GVXA 4E6PA 5FTKA 2YQ5A 1BS1A 1KFBB 3HB5X 2QTRA 4YJHA 1RSZA 1A9SA 2XOXA 5SZIA 3ZGNA 4A8TA 5BOSA 3GLIA 3P4XA 3KDPA 4RA6A 5EG5A 4MCJA 2K87A 2GZMA 1GGVA 1ZAKA 1IM5A 1XPOA 4LCBA 5JARA 4WT7A 1PJZA 3G85A 2AKYA 1P2BA 1I7LA 3GJ4A 1ORRA 4FEGA 4DB4A 3OE5A 3OG9A 3SE7A 4C9BA 2P4UA 2R25B 3O0TA 4IIEA 4KLCA 3O31A 4LJKA 2BUBA 3R3XA 2O8DA 2KW5A 3WB2A 3DA8A 5C51B 4XZ3A 2ZPTX 4OQ4A 3ZQ4A 4TTQA 1A72A 4IL5A 1LNZA 3JAWB 4M0UA 4HUQA 1Y3FE 1L7BA 3R3JA 1MENA 1NFRA 3GPBA 4LK2A 5HIAA 4RSRA 1B2RA 3FKJA 2BZSA 4ME6A 1W36C 3LWBA 4NMXB 3UTDA 4TYWA 1J42A 3DTYA 3H1AA 5CRIA 3GI1A 4K6CA 4NPCA 5BNWA 2QQEA 4X8HA 2R6GA 2ZJBA 2ECFA 1U3UA 1ZL0A 3DUFB 4M0PA 4YRFA 4Q3CA 4TYMA 3G88A 5JMPA 4F8YA 2NX2A 3FF4A 3NI2A 2IYYA 3F6BX 4RK0A 4AO8A 3INNA 4AY3A 4ZP1A 3FUXA 4WZBA 2BBWA 4RV4A 2GEKA 4HLUA 1QK4A 5F9HA 5LSAA 1POWA 3VJRA 1VE6A 2O1EA 3T7RA 2GZ3A 5E6SB 1IRXA 4HC4A 4JKOA 4KFUA 4XUEA 5DBOA 1LQ2A 4DSZA 4HGZA 2ID4A 1ZH4A 4OHOA 4GQBA 1N3LA 1V8OA 2I4RA 5E7MA 5J2UB 3MWDB 2H17A 3KG2A 2C94A 2CHGA 3V9AA 2II6A 2QVBA 3PGVA 1CZLA 3CRVA 4M1YA 3DNMA 2J4CA 5LXTA 2Q3DA 4LJ8A 4BV2A 1CHNA 4DWJA 5H3HA 2FSIA 4QUHA 5L4SA 3E82A 3B7PA 4IM7A 3FOWA 3WSVA 3LDFA 1MO5A 1NZFA 3D3WA 4UHJA 3EFEA 3DBRB 3GHYA 2IWHA 5H9VA 1Q17A 4PHFA 3WGYA 5C0OE 4DLAA 3RSZA 3VNQA 3ZV4A 4Z4QA 1OZAA 3NNNA 4EM6A 3CUSA 3F6SA 1DRUA 1XZEA 4LJ6A 5DO9A 2VBFA 4HVAA 4ER3A 2PFGA 4W6ZA 1TRKA 2AN3A 3PWTA 5K3DA 4TSFA 2PD3A 5DF1A 5DFAA 4UVHA 4DHEA 4JFAA 5AOBA 3R7FA 1L6RA 3B48A 3L0YA 2IW3A 1VE7A 4P7BA 4IEEA 4K3VA 5T6BA 3WIVA 2AMYA 3L40A 4ZMSA 2NUTB 3JRXA 2IPAB 1JI3A 2PUDA 4O2RA 3WWDA 4RL4A 5ALKA 1QUFA 7AT1A 1P39A 2CXNA 2ZJ0A 1TPZA 1G8YA 2VDRB 3QVSA 3R0ZA 2AOTA 2ZXFA 4J91A 4JQZA 3NHZA 4PC2A 2HDHA 2UZ1A 4TS1A 1TCVA 1QQ5A 3AF2A 4XWTA 3BC1A 1U8CB 3F67A 3TTXA 5AJUA 5KX5A 1D2AA 1I32A 1VIDA 5KNLA 1BDJA 1ND5A 4JBLA 3MSXA 3NHRA 1KJNA 3SMQA 2KI5A 4H59A 1SQ6A 1GADO 3L7CA 3F7NA 3VI3B 1TM1E 1JG3A 1XU7A 2C2OA 3SOZA 4DPKA 3V46A 5EUQB 2ZYIA 4X64B 1FDRA 1XDWA 2FZCA 5AI0A 3LGSA 4G0WA 1JZQA 3FHLA 3FTPA 2GZAA 4YP6A 2PRSA 4OB6A 4C3UA 1DCTA 1ZRMA 4W5WA 2P2ZA 2YZNA 3QU2A 3QVUA 4GC5A 4HGQA 1Y82A 4TWBA 4B81A 5ILOA 3TQTA 3B38A 1WABA 3V97A 2XA9A 3B3QA 1P72A 1SCDA 2WIAA 1UKBA 4U39A 4WACA 3RSLA 1JFFB 3M82A 3VDNB 5CUQA 1PZGA 4TVOA 4MQFA 1QZTA 1ULAA 4QNNA 1D9ZA 3HKCB 2WM3A 1AE1A 2IZ5A 4GUAA 1RQXA 1ZL2A 4HAOA 4OHPA 1IBSA 1GNLA 4D56A 5KO2A 3H1BA 3AI7A 2HA4A 3UMBA 9LDTA 2HV9A 4C88A 4UEQA 3W78A 2NO9A 2VRNA 4GLFA 3K9FC 2DGDA 3P5SA 1QSGA 1UFKA 1KDOA 3F49S 3G1TA 4MUAA 16PKA 5HIIA 4CQLA 3I3OA 3MOIA 1UZMA 3BXHA 3R0XA 2BR5A 1RIIA 2HM7A 4TV8A 3UMJA 2DT8A 5F98A 1QHYA 1E0JA 1DXOA 2JKYA 3OFVA 4FZRA 1E20A 1USVA 2Y67A 4G5GA 2V7XA 3S40A 1EXWA 3ZWYA 1YZKA 1TCBA 4YI5A 2ZKIA 2V7UA 1PLLA 3KHSA 3D6JA 4Z4GA 3UK0A 1JPNA 4G1VA 4JI0B 4RMNA 3DYBA 3A2MA 3G82C 4TLDA 3VHRA 1F2UA 5DHPA 3RO7A 4ADSG 5K5EA 2I8CA 3CKYA 3EZ9A 3GJYA 3NDJA 1KHHA 1GNVA 1L4HA 3I3SR 3AHIA 1WU7A 5HBRA 1JE0A 2O3JA 2QY6A 4LA4A 5JSYA 4Z1MA 1JQJC 3FYTA 4EKYA 4PZYA 1FOEB 3FNIA 4CIYA 4Z53A 5I8ZA 3S2YA 3PUYA 3UB2A 1MC8A 2FQYA 2TYSB 4YT8A 3ZWAA 2I0FA 3HR4A 5CVUA 4W5TA 4JI4B 1M6NA 2JZCA 5B2ZA 2VPIA 4YIHA 4EARA 4HV4A 3GBSA 2NZ2A 4CMEC 5IT5A 2EGHA 1JFVA 3IAM6 1SC9A 3ND6A 4PXYA 3AHGA 3ASZA 2L82A 3B1KA 3EAGA 4PC6A 3SZUA 2VJMA 1COWD 3WIDA 4PX5A 3VZRA 3T4EA 2R7LA 4CCYB 1QC5A 1QE3A 3Q12A 2EJCA 5FPSA 5IM5A 5DBFA 2C5LA 3FYUC 2GHTA 1HDXA 5EZYF 2Y68A 3DTVA 3ZYCA 3NDIA 3KYBA 4N5IX 5TE9A 3I61A 3RUDA 4G09A 5CW1A 4RF3A 1B0PA 1RPZA 1Z8FA 3ZS9A 4EVRA 1Z0SA 4BNLA 4WN9B 3ACDA 3UJNA 1KO1A 1M8FA 2ZS8A 1DCFA 1E8NA 4KXMA 4AW9A 2YWFA 3KKPA 1EEXB 3IOEA 1KVUA 4PONA 1KY3A 2NT4A 3HABA 5DN9A 2HWYA 4G0YA 5DMHA 3ESBA 3N86A 2BM0A 4UE3S 4WCFA 1T10A 5FWNA 4IZIA 1RHKA 4OHCA 3JYQA 4EP1A 4HYQA 2FLVA 4Y67A 3ONVA 1EVKA 1XA0A 4HTFA 4ZYLA 4ZV9A 2HBYA 1V5FA 1AN0A 5HS6A 4O4LB 4EYGA 4BQOA 4K26A 4WZAE 3K8QA 5L3SB 5JHGB 1GSOA 4EI9A 4CKBB 2XHZA 2ZKLA 5KMGA 2NYRA 2ZI5A 1YAJA 2XB6A 3WV5A 5KYWB 2JCGA 1ZGAA 2KMLA 3NRJA 4TZ0A 3CEJA 4Y6LA 1N78A 3VI4B 3HCAA 4V24A 5DULA 3WICA 3WQBA 2PSSA 1QRSA 4TROA 5EKSA 3GFGA 4E14A 1DTSA 4GOOD 4J2OA 1NKTA 4ZWNA 2AG8A 4QNMA 4B17A 3IERA 4E2WA 3PGA1 2H1SA 4LYYA 5TS2A 4DAEA 3V80A 4H16A 4XDYA 2ZUBA 1PJBA 5IP5A 3OZFA 4CMCA 3U09A 3GGPA 1CQZA 3UO8B 1NIPA 4PSDA 4YMGA 2DE0X 3LY8A 4WLFA 3EPHA 5CVTA 4M4SA 1HNXB 3TJRA 3FVTA 4KTVE 4Q9DA 5KJEA 4OJNA 4AKSA 2ZCJA 4D8YA 3GDFA 4FYIA 2BFCB 4US2R 4HRAA 2JZNA 3GDHA 1P9LA 1EFDN 1QCDA 3KQWA 4RVUA 1EE9A 4FFPA 3FTFA 1O94C 4PU0A 4XEUA 3O47A 1JLLA 5LJIA 2VXBA 2BEVA 3KU1A 3DGFC 1HZZC 3DLAA 3R9XB 1ZX1A 2FQWA 1TK9A 5BMOA 2J30A 2JJ1D 1MV8A 3VU9A 5C5CA 3GRFA 5DHRA 1K7FB 1GUBA 2Z4SA 4XQ9A 1Z7BA 3ENKA 3HQ4O 4JBGA 4PO8A 5D87A 1BXGA 5CIQA 4HGOA 1JQDA 2G17A 3L06A 1TC2A 5ENZA 3LCUA 2ZLBA 2GN4A 1CUFA 2GYWA 5BWCA 3NNDA 2A5DA 1VJDA 2Y05A 3K6SB 4CW7A 1EVQA 5KYTA 5CT6A 4OKNA 5I01A 3ZDCA 2XYHA 1PBNA 3E1SA 5DWDA 3RSFA 4UUOA 5AI6A 1MGPA 1VI2A 1XD2B 1XOIA 2GTHA 1TJNA 5FNVB 5KVCA 1P3JA 3MRXA 4Y30A 4HPJB 3BWCA 4UU7A 2GETA 1QFXA 3GFOA 3RVOA 4A0GA 3LVQE 1MW9X 1JMKC 1H69A 1AK9A 1R0YA 3CY6A 2FR1A 3I53A 1J5PA 3M6MD 1UMCB 1O95D 3LL4A 3U3XA 4N8SA 1DS6A 3RYCA 1P6XA 1AGYA 2Z57A 1I94B 3T9AA 1QORA 3EQ9A 2YXEA 4PLGA 3QTTA 2QAGB 3C3WA 1NX6A 1E1MA 1F9EA 1XIVA 2PBZA 2JLAA 5TJ9A 8LDHA 3BSFA 2CBZA 5CFOA 3SG0A 2X3YA 3O4GA 1VFPA 1NUHA 1S2OA 3KQLA 1NMYA 5CT8A 3ZWMA 1OX4A 3OURA 4HWOA 1M2NA 1MO2A 1MEJA 1HSZA 2QX8A 1A8QA 1VIVA 3VTKA 3B6MA 2WSLA 1PFUA 2X9VA 3WMFA 4ND8A 3A70A 4XD7A 4HDMA 1Y7TA 1DKNA 1DARA 5EJ7A 1CNMA 1E62A 2M32A 2R5WA 4RFVA 3OAAD 1BZYA 2QSZA 3WQHA 4B32A 4RPKA 4F21A 3GVCA 3QJYA 1JAHA 2F17A 5F51A 4ZDWA 4BX0A 3R6GA 1SQGA 2C84A 1WBBA 3NT2A 1IM8A 3PQ5A 2HCTA 2GASA 4YRDA 4ZAVA 4YCSA 1RPTA 3PZBA 5D3MB 3SCZA 3URKA 4PIPA 4CI9A 1U0SY 3QF7A 2P6UA 1P4SA 2I34A 2NO0A 3D02A 2NU8A 2G7MC 2OECA 1N6HA 2Q3BA 1FZTA 5JNWA 3OM8A 2JFPA 3BJIC 2EAUA 3TZCA 2G5TA 3MNFA 4BASA 1ZRNA 5JZ9A 3VHXB 3S68A 4DARA 5DNEA 3JZAA 2ZUVA 4HATA 3PE6A 5JS8A 3FA2A 3QPDA 1L7AA 1JQEA 2PRYA 5FWXA 5DTQA 3U4DA 3HRKA 2H9IA 5HNKA 2ZT7A 4B0OA 3F3KA 3DBHA 3V8RA 3HSYA 1USGA 5KQMA 2WPDD 2GEFA 3IT3A 4KPEC 3GNTA 2IDJA 1Z0ZA 5AK0A 3KX2A 4F4DA 3RVDA 3RF7A 4NESA 3HCBA 3R5TA 5DM1A 4Q9KA 3W5IA 1D5WA 2MMGA 3MCUA 3NBFA 5IANA 4LNAA 4IJVA 1RWNA 2HMSA 5BV0A 3SKVA 5FL7D 4HYYA 2DYKA 1A7UA 3O7WA 4LTNA 1V9CA 3A05A 2X7HA 4FYHA 2C7QA 1P1KA 3G5AA 3OTWA 3TBKA 1MXFA 3GUZA 2WUEA 1EX9A 1TO2E 4LMPA 1MBZA 3N3AC 4E5KA 1ZXBA 2DWQA 4AT1A 1VOTA 2C2HA 1UJBA 3JW8A 4K6MA 4B2PA 1PJSA 3C6KA 3G0CA 2QM3A 5C4MA 2Q5JA 4O3MA 4XPZA 2R7KA 2WWRA 1NT2A 1Y1KE 3P9CA 4WXHA 1FRZA 2IXGA 2NUPA 5KS2A 4L27A 4MV1A 3B3JA 1PL7A 2UUOA 2QYTA 5TGTA 2IHVA 2WM2A 3RTAA 4RDXA 1G20A 4B09A 4GZ3A 4ROSA 3UWSA 4O2AB 4D9KA 4C14A 4I9GA 2BP7A 1Z5NA 1R6DA 2P7HA 4YQZA 1OLUB 3IQXA 1E58A 3WOVA 1CR6A 1ZITA 3FCYA 1BU5A 4YJHB 2WYOA 1X19A 1NUAA 1FFWA 3BIFA 4BKMA 4COOA 5BOSB 3GLIB 1PJTA 1PD1A 3BXEA 4JEIA 4RA6B 2VATA 1IN8A 4OPMA 3QEAZ 4O0MA 1Z2NX 4YRGA 2UV8A 2DFTA 3BKXA 2N1BA 3NT5A 2ZBDA 3Q9UA 5B4TA 5AW7A 3PDIA 1IPFA 4PLHA 5KSWB 3OZBA 1IK4A 1PV2A 1IN1A 5CDSA 4BVJA 4H3HB 2YMMA 1IZ8A 2P9HA 1WUIS 3FYUA 1Y8QA 2E3JA 4LJ5A 5FUWA 1YBVA 2X7JA 4BCCA 3K6RA 8MHTA 2VUHB 4GBMA 4QFCA 1FP4A 4HUQB 5K0SA 1LNSA 4P35A 4BVHA 2HBZA 3E9MA 1QHGA 3PYLA 2OBBA 4HBZA 3WLFA 1FFBA 8ADHA 3GRAA 4EYOA 3CNLA 4D3XA 4FNGA 3H7IA 1Q7TA 3HB7A 4ER7A 1WTCA 4MV7A 3B2QA 2L2QA 5FEUA 4BU0A 3U62A 3WMXA 3OY2A 2ECKA 4FCTA 4BLSA 1K63A 2VDOB 4BMNA 4C0AC 4DCVA 3I0NA 1SPBS 4L1KA 3O3MB 4WZBB 4RTRA 2J5KA 3NHKA 4O4HF 2H4YA 1T5LA 1GPJA 3DEFA 4MOWA 4YCNA 1SKMA 1PR2A 1KBZA 1QIJA 4BJ6A 3REFA 1ADGA 4ZQIA 1M75A 2M98A 1JILA 3ANYB 5IARA 4YPOA 4J75A 1FX1A 2OK8A 2C98A 3LBNA 4OMFG 5IAAA 3TKAA 3KP1A 1B6RA 2A92A 3CCBA 2ZWOA 4HNHA 4RJIA 5AT1A 1OD6A 4UXIA 5KINB 1DPGA 1NN3A 1GITA 4XB1A 4J16A 2WPNA 5EMMA 3MTAA 1GYPA 1LXCA 3KYJB 4XWYA 3C2QA 5LXTB 4M1OA 5ALWA 2QVCA 4DA8A 3U5TA 1HDCA 2ID9A 2IYPA 4DMGA 5F76A 2R5FA 1IFXA 4Q1VA 3WTBA 2CE2X 1B3RA 1YB5A 3BQMB 3D3WB 5IVHA 4LHXA 2A59A 3QUTA 1L8AA 1WQ1R 5KYVA 3DMDA 4TYQA 3CG4A 5EE5B 1X77A 4BDTA 4ENTA 2NZWA 1OF1A 2GCOB 3WB9A 4V0OA 2IV2X 3PC7A 4P6VF 2PKXA 1BVUA 3A1FA 3DE6X 5FPYA 1D2EA 1Z2EA 3OO0A 3DQZA 5EL0A 5TY0A 2BFNA 1N6LA 4W82A 1C81A 1I1QB 4RESA 3ZWPA 3UBMA 3TVYA 2ZRPA 4OAPA 4PZZA 1UQUA 5HE8A 3KQTA 2MSDB 2J3LA 3L5KA 4GPZA 2WF6A 4V03A 4YRJA 3GAMA 3OEHA 3WV4A 5ALHA 3C3CA 2FPKA 1DKRA 2V3WA 2H85A 5EP1A 1PW7A 4KVGA 4EPRA 3ZE7A 2EFYA 1RI5A 3BBLA 4LXIA 4MRMA 1ZNXA 4JC8A 4PE5B 2AOTB 2HU2A 2PLRA 3K09A 2P62A 4AUNA 3SBOA 2UZ1B 4ILKA 1CJCA 4FZ5A 5ALOA 4E94A 1OPXA 3K0EA 3KLMX 3OLVA 1L1RA 3BFJA 3DDUA 3L6CA 1XCGB 5KX5B 5EIXA 5KOYA 1CJUC 3NKLA 2W8ZA 1GPMA 5ICSA 1E1KA 3URMA 3FCSB 1TCCA 5E2AA 5ENVA 2EKZA 3H9JA 1DKPA 1PEDA 1WXXA 4KO1S 2VSYA 3TL6A 1VLQA 1QONA 4IDFA 4I8DA 4QOEA 5CCEA 1OH5A 2W6OA 2XQJA 1QH8A 3DHEA 4I5EA 1Y9EA 3EFBA 1J9GA 5DX8A 5LVAA 2RD2A 3ZBQA 2Z5LA 4QDKA 4QM7A 2Q45A 3EQ7A 3V34A 2XNCA 1E2NA 5CNJA 3SKXA 5K4GA 1CJBA 3L9WA 2WJVA 3B2NA 3GJ0A 4MAMA 3TZQA 1QHNA 1GVHA 1T0JB 2C61A 2UZ3A 4TN5A 2AS0A 3V4VB 4E22A 3LG2A 1EVLA 1Z5WA 4R01A 5FQOA 2OBLA 3LYAA 3QM1A 1YOVA 1T3TA 1GTMA 2WKWA 1V11A 2QZJA 2OC4A 2F8TA 4R2MA 3PHIA 5DRYA 3I39X 5TVGA 1E5QA 3D4IA 4MQFB 3PHBE 1Q7CA 4ZYWA 5IJZA 1O97D 4K9OA 3LK6A 3P5BA 3VR6H 4KZPA 2A9JA 3FAKA 3HXKA 2VUTA 3VC2A 4AG3A 1E4EA 4TUYA 5J1TB 2XE6A 4N0QA 3O21A 5GZ6A 3L01A 3MMPA 3UJ7A 4CQLB 1IULA 1FXWA 4KR6A 1N5RA 4TV8B 2YZKA 4XPIA 2WUVA 3VZQA 1UT5A 2YC2C 3C0KA 4DNXA 2PGNA 2X2PA 4B1FA 3IAHA 1RQNA 5EKTA 5J4LA 4XB6B 4E88A 1LA2A 3LPDA 2R7MA 3C8HA 4ZJUA 3TLEA 4O1IA 5HRCA 3MFQA 1QVRA 5TF4A 1F2UB 4JYPA 3QVWA 2ZSIA 2B1GA 2F8LA 2WSYB 3EFHA 1CEXA 4R69A 3ED1A 3U31A 3AKZA 2NXWA 1NVXQ 4IKEA 5GQSA 5CVVA 1IAVA 3LLSA 3UW1A 2DOKA 1FTWA 1R5BA 1L1FA 4PNEA 1R6VA 3GJZA 3H16A 3OJCA 1DAOA 3PC8A 2ODPA 2PUCA 3BGSA 4DADA 4D9EA 3NW9A 4HNVA 2WZQA 2Z2YA 2JFYA 1SOAA 3HYCA 5CNIA 1YZUA 3CE6A 1GG9A 4UM5A 2XZTA 4G0MA 2PSHA 2YZ7A 3FNQA 1F4PA 3TXYA 2EW1A 2IGBA 4XFKA 2OILA 4OKSA 1GR1A 1W1UA 3CH7A 2CLOB 1WR8A 3LQRA 2A88A 3TM5A 7ADHA 2VJMB 1DL5A 2X77A 5F73A 1VG1A 3V8QA 4QA9A 4OHUA 3GJ5A 3WLLA 4CDNA 2YS7A 4J1SA 2P2YA 4HEJA 4JBIA 2VQFB 1QC5B 3IEKA 1VG9B 3LGXA 4RZXA 4XWOA 2ESRA 4C04A 5AVRA 2G06A 1NF9A 4F5EA 3DTVB 1ZUHA 1RBZA 3DF7A 3SYNA 5GJWC 1NXWA 4FHCA 3LCMA 4MRSA 3FDFA 1NBMD 5JI3E 2PUJA 3ZHXA 1P4GA 3DHYA 1JLMA 2V6BA 3MRTA 1B2LA 1E3IA 4DL9A 5U4QA 2X15A 5AKKA 1FQOA 1P3DA 3H1PA 3WL7A 4DQLA 3P1JA 2OCBA 1E79D 1KA9H 1GAJA 4R2XA 3GLTA 1VKRA 4DWOA 4EA9A 3DLCA 4WY5A 4OFZA 1O54A 1R10A 4DKXA 4WCFB 2JBAA 3MT8A 4ZEXA 3P2YA 4WVLA 3E9CA 1JDSA 1EVEA 1TJYA 3OIUA 1WZCA 1BMFA 1XELA 2J3KA 4HTFB 4NBLA 4R1QA 1ABBA 1N6IA 3TSYA 1ORHA 3OQJA 3QU5A 4HF7A 3UBTA 2B3TA 4M99A 1Q50A 2PU7A 1IH8A 2Y3IA 3OUTA 4PTLA 3HJRA 1QIMA 1N7GA 3KD2A 5I45A 3SC6A 4HO1X 5KMGB 1WNTA 1HURA 4H4DA 3SU8A 1IE3A 1TK2A 4BFZA 3NWPA 4TWRA 4XX1A 2B5VA 4J1QA 3TTWA 1JEYA 3RV4A 3WGLA 5EJFA 1LFDB 1E8DA 1RM0A 1TM4E 2X9GA 4JP2A 1THZA 3FPHA 4PGFA 2BGLA 2CK3D 2V7QA 3GVXA 2PR7A 4DJJA 4Q1EA 3K2QA 2D06A 3MBOA 4LF4B 2J3QA 4R1NA 4BFYA 5HYVA 1O5IA 1GCIA 1VCHA 3KB6A 4XIGS 4BLTA 1Y1RA 3CX6A 4EYEA 1W36B 3FOEC 2D8MA 2ACWA 2EQBA 3BWVA 3IO3A 3PHCA 5ALEA 3GF4A 1TB4A 4C76A 5EJ4A 4NVRA 1D2RA 1GNSA 1GNTA 3QOYA 2X2OA 3LUBA 3I9FA 1P91A 4XLZA 1Z8HA 2FCAA 3TOXA 2FEPA 2ZI9A 5FI3A 1JLLB 2P69A 3SJ7A 4TRJA 2BEVB 1GSHA 3M70A 1FFDA 3SY8A 3VR5H 2D2VA 2VP3A 2NO7A 2QGFA 3LCRA 5EUBA 4ZVUA 3VU9B 1DAHA 5J5CA 3M6IA 1JLHA 5E4TA 2GTPA 2XRZA 1BXGB 3MTDA 4JJFA 4OB7A 4FR5A 3PC6A 3PXDA 4R9VA 2PZAA 2O5VA 4XJSA 1OFHA 1VIYA 4P98A 3PGLA 2M6SA 3K94A 4KODA 1YFLA 4ZTUB 1PNTA 1Z36A 1YR3A 1Z4NA 1W2GA 2FNAA 1KEEA 3R5JA 1GZHB 2YFQA 1TQ2A 2ISQA 2VJDA 3PDUA 5JADA 3C6MA 4AQYB 1SU6A 2R4UA 5MFZA 1TYAE 2R1UA 4ZMBA 3OJXA 3I9MA 3AO0B 3RRMA 5IU6A 1MW8X 1BEUB 1EXMA 1DGQA 4JJZA 3L02A 5ELXA 3BERA 3KEMA 1YR8A 1Q0ZA 1NQ5A 1F0NA 1SN7A 5ALZA 3ZOZA 4EQ6A 3BAFA 4Z3OA 4RNDB 1DOZA 5CIWA 2EW8A 5ITZA 3RYCB 3DZIA 4XRGA 2DUWA 1TU0A 1XMSA 4U0KA 3RDPA 1D7AA 3OCJA 1I3CA 3STXA 3ZY4A 1JZTA 3QTBA 4JLNA 1T3LA 2AIRA 1S3IA 4M1WA 5B1SA 4DCJA 5AJHA 1OI3A 4NAUA 4DRZA 1MNQA 5KTMA 2C9CA 1LC3A 4N5NA 2A5GA 4C06A 1XZAA 2OV6A 3I52A 4MRNA 5TPZD 3K16A 1W29A 4YAGA 4MEJA 4AM8A 1OX4B 1OYOA 1VHWA 4XRRA 2QSJA 2RG7A 4ICIA 1ONSA 2XCLA 4GUDA 5A3RA 3M0EA 1Y6QA 5KDOA 4KXNA 4ND8B 3ER8A 4LKRA 4HDMB 4JI3B 1DKLA 1VSBA 3WBJA 4X6XA 5HCIA 4JC4A 1SVUA 4CV3A 1XDDA 3AKDA 4NCIA 2XTZA 3EWAA 1PT7A 1IXZA 2OCKA 1GGJA 2EERA 4EY4A 3KSUA 3TQOA 2X0IA 1IVSA 3VGJA 3K8ZA 3OU2A 3U49A 3L84A 2GM5A 4FN4A 3IURA 1U0BB 1NW9B 4K87A 4L3OA 3HCRA 2GEVA 2NU8B 5CLJA 1S2LA 5KVVA 3U7QA 4UZEA 3TIXB 1AO0A 4QXMA 4V38A 2C3PA 4Z2AA 5BQ3A 2O4UX 2ZIWB 5ELMA 5ITSA 5I7HA 5JS1A 2VLBA 1GIAA 2NN3C 1KVQA 2EKQA 3CPSA 3L4EA 4N4AA 3DBHB 2WV9A 5JAIA 2GVNA 4B6GA 3A1VA 4FW8A 4EG3A 2PBFA 1Q1BA 1GKLA 1E4OA 1UK8A 2GBPA 4F4HA 2F6RA 2FAXA 3O74A 3UHAA 3OQNA 2P3LA 3E3AA 4MWEA 4QD3A 1QOZA 1C8BA 4NABA 2R8PA 4IIHA 1QB8A 1RWQA 3ZN2A 3TMKA 3FNBA 5FIUA 1Y37A 2VH2A 1FSZA 3ILHA 4NY1A 2OKGA 1ZQ9A 3WDLA 1X86B 1YB2A 4G36A 4Q01A 1XRRA 2WU4A 5M29A 4LN1A 4UXHA 3FOCA 3UPTA 3M2PA 5DW3A 3Q8XB 4H0NA 3ZDFA 4MQEA 4XGNA 3U4QA 5KKAA 4EHFA 1V8DA 2OQRA 2WLTA 2ZYDA 5CD9A 2XQFA 4RYDA 4PRLA 3L6OO 4IUDS 4M1QA 4XXHA 3TPFA 4DYDA 4L8GA 3RSHA 4M55A 2NUPB 4NXMB 3QOWA 2ZTVA 3H3XA 1H4SA 2OHHA 3WJ1A 3DEIA 3V4OA 1RYMA 4D44A 3EF0A 1BROA 4MITA 3NKVA 4BECA 1G20B 4AWBA 4TKZA 4XA8A 4OHRA 5FLYA 4UASA 3BYZA 4G25A 3D5TA 4I4CA 1B7GO 3WADA 1DJLA 4J49A 1LEHA 5CLFA 1Y1QA 3QG1A 2BP7B 1PVVA 1X7ZA 1S9HA 2BHRA 2CZGA 3C1OA 2O2DA 1U2GC 3LT1A 2X7XA 1AB5A 3KIPA 4LDJA 3Q7PA 3U16A 1XZPA 4Q34A 3DLPX 2X0JA 3V6MA 1TDJA 2K2QB 4GEGA 1P6QA 1ECPA 2QK4A 3EQ6A 2J6CA 2NUBA 3LUJA 3PDIB 4KC0A 4WL0A 4YLGA 4QBIA 3BXZA 3D64A 2PQ0A 1C3OA 1FQWA 3ZQUA 3FYUB 3L7LA 3H84A 1Y8QB 1EUQA 3AEXA 5CA0A 4N6NA 3IDFA 1S3SA 3TD2A 1FP4B 4XLLA 3UJCA 2I3AA 3E23A 1IHOA 4HN9A 1Q77A 3T99A 5PGMA 4ND7A 1IYZA 2ACVA 4U7JA 4B82A 5C18A 1NVKA 2I2WA 3L6EA 3N2LA 5B1HA 4TYNA 4RIGA 2DR2A 1PV4A 2GLTA 4O33A 2FPRA 3EF3A 4PLFA 3HS3A 1JSRA 1FP1D 4Y2JA 1Z17A 2GN6A 5KSZA 3PBKA 2FSHA 3DAOA 2C07A 1EM6A 2ZRHA 2J9ZB 1FX0A 3F7TA 2PX4A 3F0TA 5EIWA 3AC0A 4GMGA 4BOYA 5DCYA 3GA5A 1UMKA 2W42A 3UW3A 4FP9A 1T36A 1X8KA 4L75A 1Q7GA 3EQ2A 4JSTA 4NV1A 2WHEA 1YZ3A 2QU7A 3NFRA 5B1DA 2JI7A 2RIRA 3QEKA 1UC4B 2C2KA 1GRRA 1S1CA 3F2VA 3GQVA 4UEOA 3CW8X 1UP7A 3L7MA 1NSFA 2O8BB 3RNOA 1OC2A 4LYGA 1DC7A 1UEXC 3OUZA 2C9YA 4R71A 4BMXA 5JZSA 1NQVA 3UGJA 5ERGB 1N2CE 1OI4A 1GRVA 1N1GA 4ZPXA 1EX1A 2EEPA 2IQ5A 3BIOA 3DO8A 4IXMA 4KREA 1T6YA 5CDYA 1CUYA 2VYFA 5LKRA 1I5EA 3VGPA 2GWHA 3VZBA 2AMFA 2IGTA 4KAJA 1BQ4A 1HWYA 1E32A 1DOAA 3LLUA 5D3QA 1VSUA 1Q7RA 3BMCB 2HHJA 3IPLA 5IYZF 4S0ZA 3RS4A 1R2QA 3VFDA 3E53A 4UW9A 1E3LA 3ZD9A 3V3KA 1PF7E 2QT1A 2YS6A 3WL8A 1I5RA 4G5FA 1MPTA 1UH5A 4I1UA 4NOMA 4IKOA 4J29A 3ISJA 4MUKA 4NULA 2BT4A 3M9XA 5F2OA 3VR3D 3M34A 2CMHA 4GKAA 2C7RA 5JROA 3TRJA 4F7WA 5DHQA 5THQA 2M1ZA 3HWX1 3ZJ4A 2HF7A 3F6CA 1X0XA 3SYMA 3WTCA 4YFVA 4QJ4A 2WABA 1SBCA 3O1IC 4R3UC 1BWQA 3CG0A 1UINA 5IC6A 5B53A 4N48A 2YOGA 4EPXA 4MP3A 1DUIA 2AD5A 1AT1A 2QD1A 5IG2A 1ZD8A 3WHKA 1U5BA 3OT4A 1F14A 2I7TA 2VAMA 3A4TA 2R6DA 2Y0DA 3HUDA 2WYIA 1T9CA 3KOMA 2YJ6A 3S8EA 3MHPA 3HCPA 3OPYA 4XH9B 3RKUA 4ZOCA 5H70A 2ZBFA 1XEWX 5MFPA 3R5SA 4G4GA 3DFZA 1EWRA 4U9IS 2JHFA 3KSAC 3S5UA 4XCVA 4P0QB 1F9AA 4IV0A 4BP3A 3KYIB 1Z25A 1ZPDA 3OM9A 1YB7A 1QH8B 4KH1A 4PAQA 3TQFA 3H5RA 1HDGO 4K9MA 3ZI7A 4BATA 2D2IA 1A9OA 4FKZA 4Y6SA 2CWWA 3BGWA 2XADA 2JKVA 4RVFA 3VNAA 4BE9A 221PA 1EWKA 5JJLA 5HQ3A 4ZHQA 3QVGA 4QYTA 4AULA 4Z1MD 1YCDA 1YOVB 1YR9A 3P0RA 5ALFA 3CNHA 1BQ3A 1V11B 4TLMB 1FW6A 3I30X 3NHYA 3THRA 4EAAA 3ZK9A 5G1NA 2AF3C 2EJWA 3U7GA 3V4PB 2QMOA 1R5OA 4I99A 2ZSDA 1VKZA 2PL9A 3NBZC 5AP9A 3LYHA 1YJXA 1FUEA 1A04A 1E4EB 2AB0A 1G64A 2HPZA 4KLAA 4TUYB 3BCSA 5E4FA 3FAZA 3E4CA 1DOHA 5EI5A 3KV1A 3EDMA 1F5SA 3ZWXA 2AE1A 2P1ZA 5FV4A 4W63A 4GICA 1PGOA 4XPIB 4AG5A 1S2IA 3UK2A 1XZMA 4G8JA 4LVCA 3PQFA 3E3MA 4R8SA 4QTXA 4HB0A 2C8LA 2XDYA 5FFMA 3UYLA 3ZHUA 4M3NA 4ND6A 3PI6A 3KVRA 2AQ8A 1EWVA 4GM1A 4MV6A 4U00A 1P0FA 3DTVD 1DINA 1NXSA 1X7WA 2LNDA 3NRBA 1OTXA 5DNVA 4KR2A 4S0XA 4EF4A 3NHFA 3CVYA 2HPVA 1WUKS 1R66A 1N5KA 4AJ4A 2JFNA 2ENWA 3T3EA 1P1JA 3E7DA 1G7CA 4TKVA 1DPFA 1TCUA 2ZSBA 2OYRA 3KT3A 1E6UA 2I22A 1IDN1 1ZJZA 4QQ8A 4RZSA 4B85A 1XCJA 1SIWA 2QENA 1YIOA 5HEKA 4EG4A 5KHLB 5HZHA 1DADA 1GTG1 2O5RA 2HTEA 2Q49A 4HNTA 1Y98A 5FOWA 4IWNA 4QOHA 3PFNA 2H4FA 2B92A 4EJFA 1WZUA 2LXNA 2WY2D 2OZLA 1F2VA 2VK8A 1YQQA 3MAGA 2VWGA 3UT5B 1MO4A 4BY9E 4J03A 2Q3CA 3RYHA 3KUDA 3GY0A 4N18A 5LDHA 2HYIC 3M49A 1XLVA 2QEQA 2HCJB 1RJFA 1J7JA 1E8MA 2QL5A 1Z9BA 5ECYA 2F48A 1W94A 2NM0A 1V41E 2FMFA 5G3YA 3V1LA 3UFBA 4NECA 4EECA 2VO1A 3C8DA 3P9XA 4F2WA 2V9ZA 2OFPA 5IZCA 2VJOA 4HFJA 5SY4A 4DCUA 1UBKS 1F4VA 4JB0A 4LXUA 2QP3A 5CNKA 1ZBDA 1XRMA 3ZHBA 1JL3A 3LHKA 3SOPA 3VYWA 5EPEA 2A9QA 1SB8A 1B8NA 2J9FA 3IEIA 4YYZA 1TMGE 1E9SA 3ER6A 4XIJA 5K4HA 4HDAA 2NP7A 2QPOA 2P0YA 3BJMA 2X6TA 1PJ2A 1A8SA 2GPYA 5H02A 4IQ8A 5LZ7A 5A7FA 4DA4A 4CGZA 3WYNA 5TS3A 1BTOA 5C7LO 2P5YA 4G5RA 3T3GA 4EPTA 4WLVA 5FBKA 1W36D 4CT5A 1JKIA 4X00A 3ADKA 4PZAA 1Z74A 2ZTUA 4S1TA 3UHFA 2JLBA 3C7AA 2ZZNA 5CBKA 3VR2A 4O2BF 3D1LA 3T95A 4JWTA 1W4ZA 3CGWA 3RYFA 2JBAB 4JU8A 2RAVA 3ROEA 3PCTA 4HJRA 1O6CA 1WDTA 5TNXA 1SHTX 2I6GA 4CV2A 4ABTA 2NVUA 4PLPA 2H5EA 1YJQA 4WK4B 4TMTA 4ZOBA 3WRYA 3ETCA 1SUSA 4UNNA 3TOSA 1F0YA 3EGDA 2OGWA 4QU9A 1KJJA 1JDZA 2Y71A 4JOSA 1V5EA 2BR4A 2P67A 4MS4B 3T06B 5I7WA 1JEYB 1TM3E 4KI0A 1PQYA 1M54A 3IBSA 2WKSA 3SQDA 3CLUD 3QY9A 3C45A 1K8YB 5H82A 5HOQA 1VL1A 3OWOA 1IC6A 2P9FA 3LZ6A 1XZBA 1FPMA 4MGHA 5HFNA 2YCBA 4KOEC 3B20A 4AZWA 1L4GA 1VLJA 5JG7A 3H0KA 1USUA 4GH5A 3G79A 3LDGA 4M2LA 4UFNA 2IW1A 4F4CA 3EYWA 3IKLA 3LFTA 3FOBA 5AO9A 4HAVA 1XVTA 1SG6A 1QP8A 1KQPA 1UXJA 1YJ8A 2CLIB 2EX0A 3VPAA 3VO9A 4AMBA 1C1DA 4YRMA 3GG9A 1HFKA 3BK1A 1XDUA 4Z4EA 2B1IA 4NBKA 1RKVA 4PFJA 3EC2A 5EKUA 5C2JB