3GLVA

Crystal structure of the lipopolysaccharide core biosynthesis protein from thermoplasma volcanium gss1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
GMIRVMATGVFDILHLGHIHYLKESKKLGDELVVVVARDSTARNNGKIPIFDENSRLALISELKVVDRAILGHEGDMMKTVIEVKPDIITLGYDQKFDEAELQSKINKLGITVKIVRISKYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the lipopolysaccharide core biosynthesis protein from Thermoplasma volcanium GSS1
rcsb
source organism Thermoplasma volcanium gss1
molecule tags Biosynthetic protein
molecule keywords Lipopolysaccharide core biosynthesis protein
total genus 41
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 2.7.7.2: FAD synthetase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3glvA00
2PXHA 1O95D 3RHSA 3FDXA 3ZJUA 1PFUA 3IMGA 5DEOA 3IOEA 3MLBA 4ZT4A 5HUHA 4NAUA 3JXEA 3CVUA 2QTNA 1KH3A 3NV7A 2E18A 3COYA 3COZA 1M8JA 2WSIA 5DB4A 4X0EA 1X8XA 3IODA 1N2GA 3CLUD 3SDBA 5H16A 1EFVA 2VTBA 1TYBE 1EUYA 1IQUA 4I6EA 5LFAA 1PG0A 5KHAA 2PZBA 1GN8A 1QU2A 2CV1A 1N75A 4YP6A 1O96A 3ND6A 1WQ4A 3DV2A 1T9GR 1IVSA 4HJRA 1WZ2A 1T6ZA 4MUIA 4I6JA 2CT8A 2QTRA 3COWA 3G5AA 4ZCPA 2YWBA 1QRUA 2QTMA 3H97A 3ILVA 5TS2A 4J76A 4GRIA 2CV2A 3UOWA 4QRDA 1P7PA 3SZGA 3CA8A 4MUGA 4XSVA 3SEZA 2A84A 1A8HA 3HGMA 1WXEA 2DXIA 2A4MA 4MW0A 4EG8A 3IVCA 4U7JA 3CLRD 4PBTA 1J1ZA 4MW9A 5K0TA 5IJXA 2G36A 3F3MA 4NDAA 1MJHA 4AQ7A 1GLNA 1WXIA 1IQ0A 4GU5A 2GOYA 3FIUA 1U7XA 3LOQA 3AKZA 3ND5A 4KR6A 3TZEA 3FI0A 4UZEA 1WKBA 4MVXA 2OV4A 2X0KA 4EG6A 1M1ZA 1NP7A 3C8ZA 1M83A 3FETA 1O96B 1J70A 1KORA 3G6KA 1MRZA 3FY4A 1ZH6A 5FNZA 2AKEA 1EFPA 2QUIA 3CLTC 4HJXA 3QE4A 4A91A 1OBHA 4ND7A 3MXTA 2A7XA 1QNFA 1Q15A 1QJCA 2IJGX 2J07A 4RUKA 2D13A 5EKDA 3H05A 4MWDA 5LM3A 1WXGA 4H3SA 1GAXA 1Y42X 2WQ7A 1EFPB 3A04A 1O97D 4J75A 2H29A 1KAQA 1KR2A 3U1VA 3ZXSA 1KP2A 4JXZA 1SURA 3H9BA 4EGAA 1UFVA 2Z09A 3TS1A 3P0JA 4YBRA 1M8GA 3QTBA 1KKUA 4YP5A 1NUQA 3M5WA 3ISJA 4EG5A 1V8FA 4ARCA 4F3RA 3UC5A 1S4MA 1WQ3A 4TS1A 1QTQA 2E89A 2XRZA 1VBMA 4NX2A 4CQNA 3N8HA 1KQOA 1N2OA 1KQPA 4E1AA 3AFHA 2IP1A 1RQGA 5K0SA 1MB2A 1KH2A 3DO8A 1OBCA 1YUNA 1PG2A 2ZP1A 4EG4A 5HUJA 3D6UA 4NAHA 3A05A 4R0NA 2A1TR 2PFSA 4ZCQA 3KT8A 4MUNA 4AS1A 4DDKA 4MW6A 3IMCA 1HYBA 2DR2A 1JIIA 1R6TA 3RK0A 3HL4A 4ND6A 2A1TS 1JIKA 2GKSA 3FH0A 3IH5A 1JECA 1G8FA 1XJQA 3KT3A 1BS2A 2VXOA 4MLPA 1N78A 4RPIA 3HMQA 2YWCA 3CVVA 3DPIA 1MBZA 3UK2A 2V0CA 1GPMA 1ZJWA 2E21A 4QBTA 1GZUA 1NUUA 4PY2A 1J1UA 3P0IA 1U7DA 4G6ZA 5TGTA 3I05A 1XNHA 3CR8A 4MUEA 2O8VA 2PZAA 1R6UA 1WY5A 4MVWA 2CYBA 4OJMX 1IFXA 3IUEA 3X1KA 1EFVB 1TYCA 3VU8A 2VTBB 4MW7A 2JA2A 3QTTA 4R2MA 5HG0A 1N2BA 4U8HA 1TYAE 2JAXA 4F4HA 5DASA 1LW7A 1N2EA 2DUMA 4MWCA 2JANA 3RFFA 1U0BB 1M8FA 4OUDA 4CT0A 3IMEA 3CLSC 5J58A 1O0CA 2IELA 1NYLA 2V0GA 4G5YA 3CVYA 1V47A 1X6VA 2Z3VA 4DLPA 3NBAA 3DLAA 1O5TA 1I2DA 3KFLA 4PBRA 1ZUNA 5J5AA 5BNZA 1DNPA 3MMXA 3KT6A 2HMAA 4Q16A 4MAFA 3N2YA 2WB2A 4HPWA 4HK4A 4MWEA 1EXDA 3H99A 3IUBA 4WNYA 4MWBA 1XNGA 3BL5A 5TEWA 1QRSA 1OWNA 1YUMA 2J09A 4MVYA 3Q10A 5DK4A 3GUZA 2YXNA 4EG1A 2HGZA 1OWMA 1T9GS 3PXUA 4MW2A 1KAMA 3PNVA 3S3TA 2BTEA 3ZJVA 1OWPA 1IH8A 1I6LA 2D5BA 3RK1A 4MUHA 3HV0A 2CSXA 2PZ8A 3UY4A 1O95C 2WQ6A 1IHOA 4JFAA 1PFYA 1JEEA 4ARIA 2EL7A 5F23A 2J4DA 2CFOA 1PFWA 2A86A 4CDMA 1TEZA 4OUDB 2H2AA 3ELBA 3COVA 4CDNA 1Q77A 1COZA 2QUJA 4DE5A 3ZGZA 3TNJA 4DDMA 3N05A 1JZSA 3IVGA 1I6MA 1YIAA 1ULHA 2A88A 3INNA 4KPUB 4L2IB 4KKVA 1K4MA 3ZXIA 1FFYA 1O94C 4MQ6A 1Q11A 2YY5A 3D6VA 1U3DA 1LI5A 1O97C 4JZYA 2RD2A 4XFDA 1WJGA 2A1UB 3CVXA 4DNXA 2DEUA 1CT9A 1F4LA 4ZCTA 3E27A 3PRHA 3AG5A 3ZJTA 1N3LA 4MW5A 2QUKA 4YP7A 2J08A 3H9CA 3ZIUA 1VBNA 1G8GA 1KP3A 3VGJA 1MOPA 2RE8A 3TQOA 5H7XA 2CV0A 2HZ7A 1M8PA 4WSOA 3AIIA 3PNYA 1F7UA 1O0BA 1EE1A 3NBKA 3A4IA 1D2RA 2ZUEA 1WXFA 1JEDA 2XRYA 1H1TA 3OTWA 1N77A 1WOYA 1H3NA 1JIJA 5KWVA 1N1DA 4XFJA 2DPLA 3UMVA 2O5RA 3RBAA 2J5BA 4ZT2A 2X1MA 1GTRA 1NI5A 5J59A 2CYCA 2ZUFA 1MAUA 2BYTA 3IOCA 1NZJA 2NZ2A 2QJOA 3CLTD 4P2BA 1H3FA 1O94D 1G8HA 3SP1A 4ZCRA 4ZT5A 3CLRC 1QU3A 3GLVA 1K97A 3TQIA 1I6KA 2I1LA 3A2KA 4MVCA 4YMIA 2A1UA 2R5WA 1N2HA 2NSYA 1XNJA 2E0IA 1M8KA 5LLTA 1OWOA 4MUJA 4NATA 1IQRA 3SZ3A 4KR7A 4ZT3A 3P0HA 3CLUC 3G59A 1QRTA 1JMVA 3SEQA 2DETA 3K32A 2AG6A 2QJFA 2DERA 1TQ8A 2PIDA 3FG9A 4I6GA 2GM3A 4K03A 1NSYA 4EG3A 4KPUA 3VRHA 2CYAA 3AL0C 1MAWA 1T6XA 1N2JA 3FOCA 1YI8A 4Q93A 2CUZA 4FZJA 2TS1A 3Q12A 1KH1A 3Q4GA 4R2LA 1FYDA 1F9AA 3CVWA 4S1OA 5FO0A 1ZH0A 1EJ2A 1LI7A 4MW4A 2QUHA 3TZLA 1J21A 2PG3A 1T6YA 3P52A 3KT0A 3FNRA 4EF6A 1K4KA 4L2IA 1N2IA 1F7VA 4KR9A 1QQTA 1PFVA 2AZXA 4ZT7A 1K92A 3IDFA 3L93A 1O6BA 1WXHA 1YULA 1GTSA 4EG7A 1YIDA 1OWLA 4JYZA 1EUQA 3MUEA 1JILA 4G5FA 3X1MA 1TYDE 2OQ2A 3HZRA 3K9WA 3FHJA 4K0RA 3IOBA 1MC1A 3GMIA 2QJTA 2X1LA 5KCMA 2D54A 2B7LA 1U3CA 1VL2A 1NUSA 4MULA 4ZT6A 3RJZA 2EJCA 4QREA 4ZCSA 3CLSD 4DDHA 5JBNA 3FWKA 1Q19A 1JZQA 1TFUA 1IRXA 2X3FA 3OP1A 2Z08A 1J20A 4PBSA 3X1JA 3ZUGA 1VLHA 3MLAA 5IHXA 4MUKA 1NUPA 5FO1A 1VBKA 1JHDA 1R6XA 3N9IA 4DJAA 2C5SA 5AHWA 2DLCX 1NURA 4MUFA 3SYTA 4BWVA 4EFKA 1H3EA 1KQNA 4UZFA 4JXXA 3LE8A 3AG6A 1JGTA 3PNBA 1ILEA 4U63A 3L92A 3ND7A 1J09A 4MW1A 1B6TA 3IVXA 3HFJA 5TEVA 1OD6A 3LCJA 1MB9A 4NZPA 1G59A 1NUTA
chains in the Genus database with same CATH superfamily
1V1MB 4TYPA 2YINC 1VG1A 2D1YA 2RAFA 4IY1A 3KBOA 5CH5A 4D9BA 4QHSA 1UK8A 2MR5A 1ONBA 2C2KA 4MR8A 5FR1A 3BMXA 5JZMA 1G7RA 3CVUA 1Q83A 1V35A 1KH3A 1P75A 2E6UX 1H2EA 3CKLA 3JD1A 3NV7A 4GXQA 4IBOA 1G38A 4PLVA 1Z4PX 4JIMA 4XW2A 2E6KA 5FPYA 1JZTA 5JFOA 1D2NA 2E4AA 1UKCA 1IXRC 3GPIA 1DMSA 4EHDA 1LDGA 2FN7A 1U0BB 3M6MD 2IF2A 1MEOA 2ZTSA 2QR3A 2O20A 4F12A 4EY7A 1RJ9A 3WSVA 1Q1BA 1N5KA 5JNRA 3P9QA 3HXPA 2CC2A 4B8YA 1MORA 4R69A 4Y30A 4WK6A 5HIMA 4PQRA 3WLTA 2OCYC 5TLSA 3MCZA 2CLSA 5KYKA 3IVAA 2QLJA 1IVSA 4HJRA 5AHRA 1KY5A 1HLPA 3OKFA 4Q12A 3KUXA 1LZKA 1RYZA 1V7QA 2XOEA 4BX9A 3UUEA 2GK7A 3L7JA 3OY2A 1UZLA 4K05A 1G6HA 1KOGA 2JD2A 1F0NA 1R4AA 3CB4A 1KPIA 2OXIA 3BEDA 3TBFA 4DNFA 1WPRA 3HGQA 1DCTA 3R8XA 3ECCA 1M2KA 1TC1A 3V2IA 4XM1A 3AF1A 3ZC3A 4CVNA 2DF8A 1RCUA 2QNIA 1E2BA 2O0HA 2R5NA 4UTNA 3E5RA 5CH8A 2F1KA 2IXFA 4OLHA 1EFHA 5CGQB 1G1AA 3RBZA 5L53A 2OZLA 3LP5A 1U9JA 1EK2A 1W19A 2BFFB 1Y5LA 1GQRA 2IQ5A 2QRVA 4Y7DA 2QAJA 4JFRA 4B3HA 3SPXA 2I1QA 4RJLA 3LUFA 1U1EA 4H6WA 3OI7A 1TU3A 2PUEA 5EL0A 3EEOA 2A5FA 3SZRA 1FRFS 1PVOA 3O91A 4MCAA 3TL2A 1XZFA 5FH9A 1AGPA 4BNDB 2FPOA 1BX3A 4MVJD 4D56A 1HNXB 3VBCA 5HFNA 2K7ZA 2JI6A 1VSUA 3FI0A 4UZEA 3T5AA 3W06A 1THMA 5G3YA 2ZPAA 1W2GA 3R1IA 4L75A 5JMWA 1OTXA 3N7TA 1KI8A 1P3DA 3L02A 3CTPA 5JCOA 4F85A 2X0NA 2B2NA 4I1RA 2P4SA 3DZ8A 2YYSA 5JCOC 2JZOA 4K9LA 2NM0A 1FDTA 1WL8A 4CQMD 1H2XA 3L7OA 2WWXA 4KQHA 2GH1A 2OO3A 3BILA 2QUIA 3E4DA 4D0LB 2RHCA 5CXXA 4AP6A 4OFBA 5KNLA 1NXVA 5HDQA 1DBWA 1O3YA 1VI6A 4QUKA 3TW4A 1U2GC 3CNBA 4NZMA 1J2JA 3EW7A 2D13A 4U2EA 2OWEA 5IEBA 1KI1A 3NOVA 5F7XA 1YR3A 2BAGA 2Q1TA 4U8GA 5TJ9A 2NUAA 1VPWA 2A0FA 5DM60 5MN5A 1W581 3U1VA 5E9AA 1KP2A 2GRAA 5EIXA 3IV9A 3C3CA 4BEBA 1ZOOA 4EBFA 4I55B 4HRXA 3GFSA 4NNPA 5E6RB 3GJTA 2PANA 2PSFA 1JHRA 1LD3A 2QSJA 2O1XA 3SBEA 1GV1A 2C92A 1I7PA 2NO6A 5FORA 3INTA 1EWQA 1U0SY 2R79A 1KZHA 2E89A 3WB0A 2GFHA 3TZ6A 3QM1A 3FX2A 3ZE2B 1Z8NA 3SHTA 3KBBA 1KQOA 3A1WA 1CYDA 3A1VA 5K20A 3PNMA 1SIUA 2QNRA 5GV7A 4CF4A 1TF5A 2Q5OA 3QFFA 3IV7A 1RQGA 2R8RA 2ZE8A 4CIVA 4CI9A 5HKBA 3ORFA 3SS9X 1Z22A 3ZWNA 4AYTA 4KFCA 4AL4A 3E81A 3TTXA 1HDEA 3MJDA 4YTEA 3OT1B 4NENB 4UVIA 5LLDA 3WMWA 2H5LA 2KB0A 3CLVA 2EFDB 4IGFA 1PJ8A 1LH0A 1O1YA 1KJJA 2ZS7A 3BHIA 5ENDA 3T5TA 3U19A 3TOXA 3T7RA 3M89A 5AKHA 4GVPA 3S70A 2R5FA 4NFHA 3NONA 3DDCA 5EWLB 1O7JA 3HYTA 3IHLA 4IIDA 4MW6A 1U7HA 2O0JA 2PD3A 4NCBA 3NJ4A 4A16A 5ISMA 5E3JA 5F51A 3NZEA 1Y8AA 2BW0A 1K7CA 1LB1B 4ZANA 3U37A 4C1BA 2C2YA 3ABQB 1PQYA 3LQQA 4ETIA 5C53B 3EZ7A 3BREA 1KSFX 4PC1A 1GYPA 2VF4X 4RTJA 5JVDA 3NYIA 3T9CA 4H15A 5BR7A 4GQIA 2C61A 3S55A 1H8EA 3SX0A 2G6BA 5LB4A 1XLUA 2ATCA 2PLWA 2BP7B 1KERA 1LZLA 4AMUA 4FW9A 3GRPA 1TUBB 5EMHA 1J8FA 1FXWA 3CRQA 1TZMA 2FDXA 2W90A 3BFJA 1E3TA 2N1MA 4WVLA 5KYVA 5T6MA 4HH1A 3K5IA 5LZ2A 3CH5A 1F14A 2XBUA 1XRPA 2JF0A 4V2UA 5DM0A 4G1CA 2VK4A 4FCTA 2IT1A 3D4BA 5AXBA 2MINB 2QZZA 2CYBA 2CB9A 3I1IA 3IUEA 5CIQA 3PD0A 2DWQA 4KXWA 2OZVA 2CDBA 1J6UA 3I2GA 1M0EA 1QPZA 4L78A 1XB2A 1K0FA 3AEZA 2I4RA 2MIIA 3HRKA 1QHHA 3LPCA 2CBGA 2VJOA 4QXMA 5AI8A 3RYTC 4DYHA 1YVRA 4QYMA 4WKNA 3C0KA 1ZD9A 3CPEA 1I5RA 2UV8A 5DWVA 4ACAA 4D97A 3A36A 1SEVA 5J58A 5LU9A 1T4CA 4DUGA 1H2RS 2FMTA 4FD2A 3DEFA 3GAMA 1FBNA 1SVOA 1MX5A 3LHIA 4LDNA 2H1HA 4URYR 3Q85A 4KTTE 2X0EA 2FW6A 4TS3A 4C4AA 4CMKA 4W8GA 4RTMA 4OLJA 4OU5A 3MTIA 1E6LA 3DVRX 3WY9A 1JAXA 1USIA 2QPTA 4Z2AA 4JQSA 5DKFA 1Q74A 3K30A 3WOVA 1VIAA 3DCYA 1F20A 3DMFA 3KT6A 2FSVC 5JWRA 1Q0UA 4IVRA 3L4KA 3A6FA 5FA8A 3H1GA 4RD4A 3M6FA 4ZAZA 5HFJA 5L45A 3VYTB 1Z26A 1ZVJA 2BEUA 3PBKA 4JB0A 3A3NA 3L7AA 5M3BA 3ANLA 3VOBA 4IGEA 3BL5A 3IAS6 3IP3A 2ZIGA 1UDWA 1J97A 2Q3MA 4FLEA 4E32A 5CBPB 4RZIA 2G5PA 4K81B 3GGGA 3PXUA 4V1CI 4MW2A 2BTEA 1XZMA 4ENTA 1TUIA 2QQFA 1KZ6A 1G21E 2B5OA 2E85A 4L57A 4RGBA 1PJTA 1V9SA 1YD7A 1W85B 4ZDIA 5ULLA 4L7VA 3GG2A 2OZLB 3UV6A 1ORVA 3CKMA 4LW8A 2WYUA 4AXXA 4L15A 2R1ZA 5AR1A 1C9JA 2B4RO 1JHXA 1A3CA 1PS8A 3EH2A 1NONA 3WLAA 4BP1A 4YPOA 1WX1A 4DB4A 2DR0A 3P4YA 2I71A 4QTXA 3VFDA 4GI1A 2FG5A 6ABPA 2OCDA 3DYIA 1OAAA 4PO1A 1C1HA 4W7SA 1XDUA 1TMGE 1TIPA 3CRRA 3D4IA 2AD1A 3WB2A 3QEOA 4DE5A 1L6RA 3RYCA 2EC5A 1NVTA 5EP1A 3RS5A 4PPFA 3PWZA 1MHPA 4LGCA 5KWEA 3HJNA 3RLFA 3ZY5A 2E82A 5K4HA 4LYJA 2JLYA 4X92A 5ED0A 3PQFA 3U48A 1O94C 1PR5A 3FTPA 4XAQA 3EIOA 2EKPA 1YS6A 3A2NA 4N5MA 1EVZA 3Q0IA 3K9FC 3C98A 2Q2QA 2YWRA 4JKIA 5C0OE 2J3JA 2XMQA 3D2LA 2OPHA 2C3MA 3KQPA 3FPKA 3N8GA 3PDWA 1Y6GA 4ANFA 2YMPA 2VAVA 4OK3A 4UFOA 1X7XB 2AN4A 3MBOA 4QU0A 4Z7QB 2K7FA 4QEKA 5LA6F 4ENVA 1H93A 4AKIA 4YCDA 1GCOA 1M2VB 3QQPA 3DCNA 1P62B 3VHLB 2Z4SA 5FWYB 2M6LA 3BAZA 3EGXB 4TSKA 3S40A 3WYCA 2V5UA 2YJ6A 1PLJA 1U3FA 1H42A 3MRVA 4E31A 1UWKA 1VM6A 1YS7A 3QOWA 4M7WA 4DA8A 1F60A 1L4YA 4OI1A 3E9QA 2JH8A 5K09A 1PS0A 4KQ1A 3QYAA 4KK4A 3QLUC 4R1NA 4LFAB 3UCXA 2G1KA 4EYOA 3VYRB 1XHLA 5EJAA 3PEVA 1O89A 1SIOA 1YCFA 1Q1GA 2CMDA 2I5PO 5HF6A 5C5DA 3TNFA 4WKBA 5KJFA 4DWJA 4OF4A 3ZCQA 4K6CA 3AIMA 3T9AA 1QX3A 2WWYA 4JYZA 1J5PA 3BWYA 5CA1F 4B46A 1VHJA 1CF2O 2R8XA 5FULA 3AR9A 2ZRNA 1COWA 1T9AA 4E3ZA 3I9MA 4EJSB 3THYA 5BQ5A 4FGWA 1DAGA 1VZ3A 1REQA 2HQOA 2ZRDA 4BL5A 1Z2DA 1PSWA 5FWDA 1SVSA 5E1DA 2ZUUA 4P2BA 1XXHE 4AJ1A 3UJNA 4MV8A 1RXYA 4C05A 3MGCA 2P0AA 3RBXA 2PAFA 2F3RA 4GHWA 1XR3A 2NVUA 3GLVA 1WHTA 4JD5A 4JOCA 4P33A 5CLJA 3L1UA 3KKLA 3EY4A 2VSYA 3AEYA 3BL6A 3T1HB 2QXYA 2UZIR 4Z7NB 1MC4A 4QTTB 1EXMA 1XNJA 4UU8A 4XEUA 3KLOA 3WMEA 4BYMA 1UQRA 3MQ4A 3P4XA 2G0TA 16PKA 1EBFA 1NUHA 2WD7B 3EXEA 4Q9IA 2HA6A 3TCXB 4YLYA 2A9KA 1DAIA 3CLUC 4GXRA 2CNNA 4IQ0A 5SZHB 5I9LA 1U04A 4KB5A 4D9KA 3OE7A 1TB4A 4G56A 4LSMA 4AO8A 2DERA 3DDZX 1TQ8A 3NGMA 2Y27A 5JHHB 2CEAA 2NXEA 2F3QA 2G63A 1IN8A 2JEYA 2I55A 3GZTB 2QHXA 4AKGA 3QF4B 2A9FA 3HWWA 3BGWA 4JMLA 2H1SA 2JJMA 3HI6A 5JD5A 2QM0A 1SXPA 2EL9A 1N2JA 1OZ0A 1YI8A 1N7HA 3NIDB 2N0SA 3ISTA 3OT5A 5EHQA 1JKIA 2VZLA 2C8KA 4A03A 2QYSA 5KNBD 1RAEA 3BK7A 3KKKA 3ZY4A 1P7YA 1YA8A 3PA8A 1G64A 3I9V1 5DU2A 4MHTA 2FWNA 3DEJA 4JLBA 1MENA 4LRQA 4AJJA 1BVYF 3RFUA 4WGFA 1XEAA 3R24A 1GFSA 2WTBA 5TC4A 1JX6A 5IM5A 3V2UA 2HL6A 4EO9A 3BIWA 1YC2A 3FFAA 1NV9A 3FMIA 5CW1A 3ZZUA 1GZ6A 3T9EA 4EF6A 2IYSA 2QT9A 3CRNA 4EBBA 4LFBB 2AI2A 4KIWA 1WY7A 3H9JA 4B84A 3OLXA 2IWHA 3KZKA 3II6X 4P6VF 1NVDA 4Y2QA 1FX0A 4MITA 3WO1A 4TZ6A 1KFKB 1NW7A 4WOPA 3ENVA 1S9HA 4GI7A 4HNRA 4K6KA 5F1YA 3W05A 1Q22A 4LBZA 3A6DA 2IV3A 2DVMA 2VK1A 3JQQA 3M9XA 2HFKA 4QGGA 5GAJA 2FR0A 3T4PA 4HXFB 5CB4F 1FSZA 2BEVB 4WXYB 1ZBDA 2WWRA 2ZIZA 4JS0A 4K0RA 3OIVA 2GD0A 1F0YA 4TLEA 1RXUA 3NKLA 4YAEA 2X77A 1DUSA 3LVRE 3LDGA 3LKBA 4QQRA 2AOXA 3HGTA 3CT4A 1S89A 5FLKA 2EX0A 3OJLA 4C0SA 2ZCUA 4ZZ3A 1U7UA 4TM7A 3QEJA 4J0IA 3NOXA 3KSRA 4MJLA 1XD2A 1YRAA 3UWKA 1OJ7A 2X2EA 4OL9A 2ZBRA 3VR0A 1E3WB 2IHYA 4DDHA 1KZ1A 4X9XA 3AUJB 2F55A 2WVGA 3TNLA 1NP6A 3H0CA 2DOKA 2X3FA 3RHZA 2JCXA 3KELA 1T9KA 2JHGA 3X1JA 2CLDX 1VLHA 3H6HA 4C0BA 4EABA 4YUYA 3AXTA 4M1ZA 1H6DA 2GEVA 1N9GB 3GFPA 1DC6A 5FO1A 1P9WA 2FN9A 4UUQA 3N9IA 2OBBA 1QP7A 1VDZA 3QPVA 4RW0A 5A7FA 1Z18A 3BH0A 4GMXA 1LLQA 4PIVA 3FPCA 5GZ1A 2OCBA 4HG2A 1EK5A 4PRKA 2DLCX 4EJMA 3ER6A 1VE5A 1BSVA 4XR4A 1YZTA 4J7CA 4FMCF 1C30A 1NAIA 5A6SB 2EF1A 5JWOA 2ZSFA 4ZI7A 4Y2VA 2Y66A 1QO0D 2HXGA 1D4FA 5FFNA 3TOVA 3FW1A 4RJTA 1V5EA 1AURA 2VHXA 3L8CA 1GVHA 3BXEA 4MW1A 4R81A 2HA4A 1IY2A 1GGEA 1U2DC 2JVJA 4FVTA 1GZ3A 3UAXA 1U3VA 4YLEA 3MJRA 1JE1A 4R3UC 1XU4A 2W93A 4B9EA 4NXMB 1VJDA 2W2NA 3S8EA 1SKQA 1D3AA 2EHJA 1I1NA 1B15A 4QOFA 3S6JA 1P72A 2H2FA 2BV3A 5IABA 2EERA 3T34A 4C06A 1JFTA 4Z4FA 1VCIA 1AG9A 2P2YA 2Q0XA 3QYJA 5FYQA 5TX7A 3C1TA 2P3OA 3ADKA 1DEOA 2M1XA 3B38A 3I9V6 4KXLA 3GLFB 1XQWA 3N5CA 3OCJA 4US1R 4GP7A 1RT9A 1PR3A 4CTKA 3BM5A 3G8YA 2D1RA 2V5VA 4C7OB 1T43A 3EDYA 3JWJA 2WJZB 5KSZA 1FP4B 3R9XB 2VT7A 4HGRA 1CEXA 1TZCA 3CM0A 3EBPA 4DCTA 1OYWA 1E60A 3GCGA 3GLGE 4GT1A 4EGJA 1EX1A 5CFZA 4DLBA 4HXEB 1MPTA 4Q00A 2JFVA 4B45A 1C3OB 4B17A 3A06A 1D04A 2IXGA 4BO1A 1O96A 5MGNA 4NBLA 5EUBA 1T9GR 4CG2A 2I2DA 1F2UA 1S96A 3IUSA 3EGWA 3PLRA 4AZ3B 4URZR 1TT5A 4MPTA 5TQ0A 4X24A 4GS5A 2XHEA 3G5AA 2PH5A 3MJVA 2OVFA 2QTMA 4FFSA 2AN3A 3F98A 1W73A 4FP9A 3ILVA 5AYVA 4GFDA 4Z1OA 3LXMA 3V4VB 1CUUA 4OQDA 3WFJA 3ZKAA 4FB5A 2FX2A 3ZHRA 3T3GA 1M67A 5DLDA 1Q50A 3EBLA 4C2BA 1DBRA 1IPHA 2O2EA 3UEOA 1A8HA 5C8YA 2F8TA 2VHZA 2B8JA 2O3RA 2Q6KA 1JVNA 3SYMA 1AK2A 1V2HE 2PRZA 3V8EA 2O14A 3TG2A 4ML3A 2C8LA 3BORA 2QG9A 3BWEA 5DLEA 3HL0A 1VJGA 4Z0TA 3LYLA 2NO7A 1DXHA 4Q15A 3TTWA 5I7OA 1KO8A 2CXTA 5D5QA 5JXWA 3D6AA 2FP4A 3DR3A 4XYGA 1DKUA 4L8GA 1G5TA 1R6DA 2O1SA 4LJ7A 3JRNA 4CI0B 1AF4A 3OZRA 3NATA 4YUAA 2CDNA 4HEQA 1W94A 4KYIB 3FMPB 2GOYA 1GPAA 3KEGA 1DKLA 1ODSA 1T36A 4DM7A 4EI2A 2PH1A 2LDBA 4YGYA 2C5BA 3OICA 1H9BA 3OT4A 5M7EA 3SC2B 2W6ID 3ETJA 1WDMA 2FRDC 1DFHA 3WWCA 1P0FA 3FSEA 4ZO6A 2XJ9A 3RT9A 2Z9DA 1PU2A 1ZYUA 2ZJ3A 5AJXA 5HA5A 3DTVD 1JXMA 4ZI7F 1S5PA 1EX9A 3GLFA 2ACWA 3DC2A 3KZVA 4UEKA 5KQGA 2J3EA 4PZEA 1G5HA 5BYKA 3DZIA 5LYJF 5JD4A 1FRZA 1YR7A 4J1TC 4UCQA 2C7OA 4KQFA 5JC8A 5BMVF 3ZVKA 1GZHB 5BMVA 3C3XA 3EA4A 1BXZA 3Q72A 5CFMA 1MQ8B 1ZEMA 1GPLA 1XTVA 4ZOLB 4B2YA 4INJA 1P9NA 4PXAA 2ZUTA 3DD5A 1P5RA 3VAAA 3GCXA 1BE0A 2IDKA 3CMCO 4F8EA 1KAQA 3K5HA 5IM4F 5IAJA 1XIVA 3SE7A 4GOLD 2WK1A 1FU4A 3BFXA 4ZC1A 3TS1A 1D0IA 1CERA 2C4VA 2C5EA 2XE6A 2JAHA 3K31A 3P0JA 5EIBC 3NM5A 1UQTA 4GZ6A 4LNHA 3BF8A 3F3YA 1XA4A 3BFPA 3AV3A 5KX5F 2F64A 2OBYA 1II9A 4QPZA 4NQZA 5EWJA 1XVIA 2GD2A 4G81A 2A35A 2OV2A 5AM0A 2WPDA 4JY7A 3IMKA 4ZI5A 3D3WA 1RW4A 3JW8A 1BNCA 2DCMA 3H4TA 5GM1A 2DTEA 3TW6A 4Q05A 2VJMA 3IAS1 4DQDA 1NU6A 5HRCA 3BS4A 4FKBA 1UXJA 2PN1A 4MGKR 1GPBA 5FLXA 4LFCB 4B7CA 1KMHB 2XXAB 4IINA 3FROA 3TTUA 5FPQA 3ANTA 1PG2A 1X80B 2HBQA 1MV5A 1NVVR 1RAIA 2JIZD 3OZEA 2EYQA 4FMCB 4X84A 4YCAA 4Q7QA 4BXOA 4IJKA 1PV1A 1LBSA 3I6BA 4P98A 4DCOA 1BHQ1 1PO7A 1O0SA 2GF0A 3V3KA 4D9NA 4XGKA 4W7IA 2YXEA 1GCIA 1E9DA 1QGAA 4JEMA 1AU9A 5DTJA 4K46A 2JBHA 2I4IA 3V7FA 3AP3A 3GRAA 1BGVA 1X9IA 3LK6A 5KHLB 3LTEA 1XMOB 2Q46A 1TJYA 1CQXA 3E6AA 2FEMA 2HK6A 4DLNA 2GJ8A 3O8QB 1Y9JA 2OKCA 3KT3A 2BTOA 2VXOA 2HYIC 1KYXA 3DLHA 3D8BA 5D1NA 2FWRA 4Z1MA 2JGJA 4REOA 3DM5A 1PFQA 3R09A 3RFTA 1TM4E 4WKCA 4C3UA 4URVR 5KVCA 1M2WA 3ETDA 1FLVA 2QZ4A 5CYOA 5EXXA 1X92A 2PKYX 3A1CA 3A4YA 2YR0A 5ITVA 5K0BA 1OGYA 1CE8A 4V0KA 1HTBA 1ZI8A 3A11A 3PDHA 1CHDA 3IQIX 1TC2A 4WOBA 1YOVA 4MKRA 1XNHA 1SQ5A 3CR8A 2R6HA 2R96A 1XAGA 3OBBA 4M1QA 5JS7A 2AH5A 7MHTA 4AJ4A 1TKCA 3HKCA 5LWQA 1QUFA 5C8DA 1SXJA 1JXOA 1OJLA 3X1KA 4M89A 2VWQA 1OC4A 3CH4B 4FMDB 2IYZA 3EVTA 2JLZA 2FWMX 1Y1PA 5CDHA 4MKFA 1JYSA 2HPAA 2JZCA 2H07A 5FTJA 2YW2A 5K3FA 3L41A 4KIJA 2HRDA 1OXKB 4ZN6A 1EESA 4MDHA 2CLOB 1UC4B 3VTKA 1MT3A 1Y8CA 4MR8B 5AKJA 3ROGA 3AM1A 3DBHA 1NKSA 2H1VA 2HV9A 2XWBF 2CNKA 1E2QA 4CMEA 5AIBA 1FFHA 1XXLA 3D7RA 1M0SA 1NDQA 3GOQA 3ICWA 4P3XA 5J63A 3R7AA 3SS8A 4GKJB 4KQEA 3B5JA 4YT8A 2AN9A 3OC0A 3HY4A 4I9FA 2C2MA 2FH5B 3QPWA 4INPA 4JA2A 4TROA 5BVGA 2PRYA 3QOFA 2D8AA 5CFRA 2QTTA 2IDZA 1WPXA 3AXSA 3Q7SA 2ZJOA 3KFLA 1BMFA 1LK7A 4CL0A 4KU4A 2IYLD 2QAGC 3JWPA 5AWFC 3VJRA 4NNOA 2GTIA 1P4JA 2HPVA 4JWTA 2IPNA 3CXUA 3ROXA 3TJRA 4AN1A 2R8YA 3UJ6A 4DIUA 1HDOA 1X2EA 1PR0A 2Z6AA 1UPBA 1Z16A 4TT3D 1JQAA 5GMOA 4DXHA 1O2DA 1CY7A 1W6RA 3U1TA 1GNSA 4BQIA 4X97A 4XIGS 3LT4A 1TK9A 1S2IA 3PX2A 4WNYA 3DOUA 3SQXA 1SHTX 1EG7A 1Z36A 2QLLA 3H5NA 3I6ZA 1M6YA 3BCUA 4H7KA 1R12A 2WWWA 3KO8A 1KAMA 3PNVA 4HNAA 3OZCA 5CDGA 3UJ3X 3HABA 1L5HB 2B5WA 2HSZA 1WDLA 2X6QA 1PFKA 2Y1LA 3GAFA 2R66A 4WZBE 4YALA 3O2SB 4UJ3A 3W3AD 1II8A 3DE3X 1SQ6A 4FOOA 2EL7A 3NDIA 4XLZA 4KODA 2W6NA 4NULA 3LNCA 1X1TA 4AKSA 4CNQA 1QMGA 1JI0A 5BVGB 1OXXK 5DYTA 3P71T 3GA0A 1ZOSA 3RE1A 4YJ3F 2ZWVA 2R1TB 1XROA 4YASA 4CKYA 1ID8A 5EA2A 4Q7LA 4TYYA 1V7PC 3K5PA 3MPUA 1JXQA 2YQ5A 4GR4A 5EXTA 3WWDA 2IYEA 1GPYA 3NEAA 4BEVA 2GKGA 4B82A 3LCMA 2Q62A 1ABEA 2RKBA 4JJGA 2PGOA 3OE5A 1C0PA 1S8AA 2VJCA 4EUKA 3KKPA 1VHQA 1CRQA 1PT6A 3GUVA 3INNA 1ODKA 2PJZA 1WDTA 3EEFA 3IP5A 4L2IB 1E1RA 3ZZMA 2O50A 4DR7B 3ED1A 4I55A 1NAHA 1ONOA 2Z2XA 2GYUA 3CW2A 3IC5A 2WV7A 3BBLA 3I2FA 3BICA 1U02A 4MB2A 1IN5A 3RU2A 3TFQA 1Z56C 1BHO1 1DWQA 4TWIA 3UANA 3IOYA 2R60A 2Q1YA 5F2NA 1EK1A 1R8JA 3OKPA 3PFGA 3MJCA 4TMWA 5AUOB 1U31A 1UEIA 1P7WA 4B81A 1ZCJA 3DP9A 2YV2A 3IRVA 1W2HA 4FEEA 4G0MA 3WGLA 5AVRA 1OROA 2PXCA 4R1PA 4LZOA 2IIBA 1K1EA 3E27A 5IXYA 5CM9C 1U1CA 1TTTA 2Z1MA 3ABSB 1Q1QA 1Q2XA 2P0EA 3LZDA 4QAQA 1ESDA 4JJ8A 1GO2A 2WYHA 3CTMA 4FYJA 2J08A 1UC5B 3DB2A 2WA1A 3G9UA 2H2IA 3MUOA 5EP3A 2PSSA 3O1HB 4P7FA 3AHIA 3IQXA 4UHHA 5COAA 5ALKA 3VKUA 5AW9A 4IIJA 3PP8A 4D4MA 4M0PA 2B2CA 2HWKA 2R68A 2GEBA 4IDPA 4U7FA 2RE8A 1QOZA 1U2GA 2C59A 3ESBA 1N0VC 3JALA 1ZRMA 4YAFA 2KI5A 4MV4A 5HM8A 1GV0A 1KZGB 5ALZA 3T5DA 6REQA 5J4YA 5K4GA 1RAHA 2D06A 3USZA 1GU0A 1WXFA 1VYTA 4XQEA 1N5LA 4NDZA 4R2WA 2HWYA 2WF8A 3DQQA 5J5VA 1SU4A 1AB5A 3VX3A 2FW8A 3QNUA 5DNCA 3VU3A 1T3SA 3GJ3A 3MTGA 1ZS9A 1NR5A 3IAXA 3I6IA 1KMNA 2E4WA 2GLUA 1GQYA 3C24A 4GXNA 1E0DA 2XYVA 4IXDA 2PKEA 4JU8A 5A2QA 1JH8A 4D3XA 1CUSA 5DLPA 4P0PB 2GN1A 1TUEA 3TG8A 1AXGA 3GH3A 3UUFA 4YRDA 3DNMA 3K0CA 4RD1A 1L7BA 1Z35A 1RPJA 4LI0A 4TLDA 4QM6A 4ZVLA 3JZMA 2J3QA 3ZVLA 3Q7TA 1K0UA 4BP9A 2IVZA 3A58B 3DE7X 5HZGA 2VQFB 3VU1A 1NX6A 2ACEA 3NHAA 1OFUX 4G2TA 4RELA 3NTXA 3PNKA 4E46A 1LPPA 4LZPA 1IQPA 2GSWA 4CQLA 2D00A 4YMLA 4PPYA 4RPLA 5FL3A 3E3OA 2O05A 2PNFA 5FBQB 2IUSA 2B6HA 2WG2A 1XEWX 1IQRA 1V4NA 3BXXA 3G5LA 3LIIA 2F7SA 2J1LA 3P0HA 1DBPA 3K92A 5FBZA 5CFOA 5FTNA 3NVAA 4JLJA 3SEQA 1S8FA 1FXWF 4MCJA 4Z51A 2Q6VA 2RAPA 1GU1A 1B8UA 1DAKA 3TLGA 4L28A 4TWJA 4LPKA 3TLZA 5B57C 4DIEA 1VLVA 3EWSA 4ZYVA 3FVWA 3K2EA 1HDCA 3FPEA 3QXJA 3KQVA 2XMPA 2HU7A 3GXBA 4R84A 3T3EA 5F5XA 2FUG1 3RWOA 1U11A 4GC9A 3QX3A 1IOWA 5ESWA 1ZSVA 4UQPA 5A06A 5JJ5A 1QIGA 3N59A 3TECE 1Z13A 2G77B 1KH1A 3L7CA 3A1SA 4ARUA 1VXOA 4RU1A 4YBZA 4DSOA 1FYDA 1P8JA 3LH5A 4HFRA 1NMEA 3Q8LA 4CHTA 1F9AA 1RU3A 4YQZA 4DLAA 4P7JA 2BM1A 3DE5X 1Q0LA 1CU1A 2CNDA 2B98A 4A1OA 2IITA 4PHHA 4LI3X 4JBNA 3LX4A 2FN8A 4ZJUA 1QYXA 3SLGA 4JIGA 4B31A 5D01A 4ME6A 1M5UA 1A2QA 4WZAE 3TDMA 3JQDA 4RIIA 1OH8A 3L6EA 2H1CA 1NOJA 2ECOA 2GZHA 4HDKB 4MJ3A 5ALYA 5FTKA 1Q1NA 4DIDA 4Q3BA 1USWA 2J0EA 5BOSA 2AF4C 2GLTA 2Y93A 1K92A 1LFDB 1RPTA 2FF5A 2V9ZA 2W5UA 3EAQA 4LJ4A 4FOTA 4QBKA 5FFMA 3SHVA 4K9MA 3UBMA 4DLWA 1Y5IA 4PXSA 4YV2A 2ZAIA 3R9IA 1TXGA 1TYDE 2OQ2A 1JKMA 2Q7XA 3B13B 4QG7A 3SJUA 3WGOA 4IO1A 2PWYA 3I4CA 4UBMA 1JAZA 1W5FA 1DAEA 4FJ2A 1IE3A 5CEJA 1T35A 4HDNA 4P4NA 3UXEA 4F9FA 3DGFC 3A9CA 4ALJA 1XXHA 1WCWA 1XQYA 4NBKA 4P7GA 4XDGA 1NHWA 1M10A 2BMJA 2EZ4A 2YRWA 3NTLA 4ZCSA 4E88A 3CLSD 4DLYA 2QT0A 4XWWA 2I2AA 2OAP1 3TDKA 4EI8A 3EWNA 1DADA 2P4EA 4BGVA 2DPYA 3IT0A 1HE4A 1D9ZA 1M73E 4BLUA 2B9VA 3IKVA 3S8MA 3IP1A 1KI2A 4XTRA 1FJXA 3D3NA 3L6RA 3LLVA 4EMTA 2GO1A 4R41A 3BQNB 1B73A 2OZKA 2PEZA 4KN5A 1V1RA 3WBKA 2COKA 5AW2A 2ZPUA 4RHEA 5HEKA 4FX2A 4OHPA 4V3CA 1ZOIA 5DTIA 1JDBB 1RXCA 1ILEA 1SA0B 2H7YA 1PGQA 2TMKA 4TV9A 3B6MA 1LSOA 3OD5A 4W5WA 3WGHA 1O77A 2Z56A 1J09A 1LA2A 3L82B 1NG9A 1DLIA 1ZW1A 4UEWA 5IFKA 1ZC3A 3BJEA 3H9EO 3IUYA 4DFDA 5ETJA 2AS0A 1EVIA 1SBTA 1P2GA 3CPJB 3WSWA 1YQ9A 4DR1B 1K3TA 2O2YA 2FPUA 2QF7A 1ULZA 2R8OA 4XGQA 3EUWA 1SOUA 3BJIC 1ZK2A 2DTXA 2JASA 2VA9A 2ZIFA 1E63A 4JLNA 4LVUA 1AT1A 1GZ5A 2DJIA 3GEEA 4IGIA 3K70D 4IEEA 3P4UA 2FLVA 2QTNA 5C2JB 3F7MA 1LQ2A 2PGLA 3COYA 1QUEA 5JY1A 3HR7A 1A8PA 1IN6A 2BR3A 3NDJA 5HIIA 3TJMA 4CEHB 4IX9A 3RANA 4HT3B 5E4JA 5LQAA 1BCSA 1EFVA 2GN4A 1IQUA 1KDRA 4ZEXA 4P8RA 1SQ0A 3IDOA 4LQDA 1AM4D 1FPMA 1IM5A 4GMFA 3TX6A 3G02A 4PX3A 4GYJA 4GNKA 4PWYA 4QBIA 2IZZA 3A25A 4K6OA 3AKYA 3CH6A 5DPMA 2RB4A 4HAUA 4DMFA 4TUYB 2IV7A 4NEGA 4WBXC 2GEJA 5KNCA 4S1NA 4W5HA 1EWKA 4HNUA 2ZUBA 3GUHA 3EMVA 3LAWA 3VSEA 3OO1A 2IKQA 3ND6A 4G23A 4LHVA 4KREA 2G5TA 1R64A 4JQYA 2GCOB 5K6AC 3GU3A 1L5SA 4P3PA 4RLHA 4UHFA 1TM7E 3W8EA 4F3CA 2V1UA 2X5OA 1C1DB 4NOJA 1UPAA 3Q3HA 4NH0A 3H9GA 4FR0A 4G1UC 3UZUA 2FUCA 3DHWC 1KXJA 3ZS8A 1S3SA 2C0QA 5IVKA 2J5RA 2DPMA 4KO8A 5JCJA 3OLYA 1M76A 2OOKA 1WW2A 4NXNB 4P31A 2FZVA 4O4IF 4A92A 1SUEA 4JKOA 2YIDA 2JFFA 5IAEA 1LBTA 5IHPA 5G4KB 2ZATA 3TBHA 3HUFA 4PBTA 1J1ZA 4M37A 4FWBA 4YAUA 1Z5NA 1VQ1A 4A3SA 1TM5E 2G80A 5D86A 1YKFA 2G36A 3BWMA 3H3XA 4YO7A 3ONNA 5H3HA 5HKOA 5GADl 2W2VA 1Y81A 3F5QA 1XDBA 2PMKA 3QMVA 3ZDFA 3ML1A 4R4JA 3MMSA 4OATA 4ZQHA 3GI1A 3QWHA 1TNDA 3ANNA 3KJFA 2QORA 3LT0A 4J3JA 3JQAB 4KR6A 1UCFA 1U8XX 4CN9A 3HN7A 4H6XA 3JZIA 5ALTA 4DMHA 1RXVA 2FXVA 2JAWA 1C1DA 2OV4A 3E7WA 1AHHA 3AQIA 3C8ZA 4LXYA 1QCDA 1VKJA 4URFA 1ZI6A 3UGTA 4ZEMA 5ICGA 4RACA 4FIDA 3D1VA 5JLJA 2OA0A 2QRGA 4J2OA 4NE2A 4OHBA 4OYLA 3VC1A 1LLCA 4PZ9A 2KYRA 1EUCA 2QL5A 2Z8XA 1IVYA 1WSDA 2MYNA 4N3CA 4AMYA 4OXRA 4B7AA 4Y7CA 5B3KA 3EIEA 3TKYA 4ND7A 3MS7A 4WLUA 3N0XA 4X64B 1GXSA 2A7XA 4NBSA 2OCGA 4PNPA 2I6UA 2PFKA 1E3WA 1NGSA 1FMCA 4FBMA 4Q3EA 2IZOA 3W1WA 3PT9A 4L9SA 1M2JA 2BEVA 4I1UA 2XVXA 4CBVA 2OP1A 1Y6ZA 3ERCA 1OFIA 4J75A 2BMAA 1FFXB 4Y2JA 3CBGA 1I1OA 1G66A 3IT1A 1GAQA 3KRTA 1KR2A 2A5LA 3L8GA 3RC2A 2W9XA 1SURA 5C8ZA 4DBVO 1BCSB 2FWBA 3DMTC 1E2JA 1P19A 2AD5A 5DM1A 2P75A 1UJ5A 3TX2A 1LRJA 2GVDC 4L22A 4ZIRB 1Z5ZA 5JDIC 5CU7A 4EB6A 4BY9E 4YXWA 2IK8A 1V7ZA 2BEWB 1JPNA 1V8FA 1LLFA 3T1VA 4IWXA 1WCXA 1YVUA 2IUEA 2QX7A 3B36A 3M6XA 1U0RA 3X2EA 3FOWA 3BERA 3Q7PA 4B73A 2JI4A 4DV6B 1RE0A 4A5OA 4QXOA 1JDZA 2GEFA 1TQ4A 4RZUA 2PT6A 3TQQA 1V11B 2ZQZA 5BV2P 1DT3A 2ZJBA 2YXPX 1KMIY 3KR9A 3FBTA 1GARA 2IP1A 1PD0A 2QQ0A 2VHCA 2CMFA 1BFDA 3GT3A 1SEPA 3MSXA 2BSXA 3TNYA 5IKXA 4YUZA 1ZPDA 1GY8A 1ZD1A 1OIXA 1JEQB 5EPOA 1Z2PX 2ZQYA 3OJ0A 1V95A 3IBFA 2VUUA 4RXUA 1DIOB 1L6IA 3OWXA 4C03A 2MSLA 1DQRA 4DCSA 3E22A 2ZCJA 3MILA 1WR8A 4UVDA 4EW2A 3UT5A 4EATA 3MTQA 4E2YA 1CQIA 4TYWA 2O2SA 3WNDA 3EGIA 4BJ5A 3H13A 4OXQA 1MO2A 3VR3A 4C0HA 4DSUA 4IJUA 1AIPA 3FOZA 1G8FA 1F38A 3IDZA 1X14A 5MHTA 4RC9A 1UPCA 3AZQA 1TE2A 1UM8A 4GECA 2IOFK 1PR4A 3A32A 2FOIA 3MWDA 4G0PA 3HJHA 1R16A 5FLYA 3UBTA 2HO4A 2NUAB 1OB2A 1Z0FA 3OQJA 4TSRA 4KFTA 2VHEA 4BZZA 1FC0A 1U2SA 2PAAA 3L1VA 1L5HA 1SC4A 5E6UA 4LMBA 3EODA 4MARA 2ZETA 4LE2A 4YDQA 2PJUA 3TIFA 4XJVA 5LN1A 4G07A 4S3MA 2ONKA 3GJSA 5DHFA 4MYTA 5KX5A 2RKOA 2O8DB 4OJMX 3S1LA 3LWDA 4I1PA 1JHUA 1TYCA 1QSGA 2IYQA 4KI0A 4MW7A 2I4NA 1NMYA 2ST1A 1T0PA 1ISIA 1CQZA 4IL5A 5KTNA 1B93A 1Y1TA 3PTAA 2AFHB 3SOZA 1QPGA 2YV1A 2VNJA 4P82A 2W2XA 1RP7A 2O2ZA 2Q8NA 5THXA 3ZW7A 3FAZA 4E5VA 3U6BA 4EO4A 4FE4A 3VM6A 4Z4CA 3IMEA 3LUAA 2OORC 5CHYA 1CZNA 2NO0A 5AI6A 1W9MA 1CZLA 2UZ1A 4Q4DA 4LDJA 2BR5A 3AFMA 3W3ZB 5HP4A 4L8LA 3HNRA 2V7VA 3JQEA 4RSHA 2C2OA 1U3WA 1U3TA 3H19A 3DFIA 3ETEA 3IYLW 4KQ9A 1UKEA 2QUAA 3CHYA 1FP4A 1I2DA 3SHQA 4FB4A 1I80A 2QTBA 3G68A 2VWGA 1WNTA 3HCNA 1PX0A 3UH0A 1SK9A 1BD3A 2BFDA 3KAPA 4WH0A 4NTZA 2Z8YM 5EMMA 4XYLA 5LPNA 1G5PA 1RLTA 4MP3A 3AQ4A 4EL0A 2XVZA 2RBEA 1JHVA 3DDUA 4HMPA 4QOSA 5AQ1A 5E4TA 1CZOA 3HEAA 4YCCA 1SH7A 2VZ9A 1P17A 4QC2A 1E2KA 2GCNA 3PGLA 1XZAA 2FPKA 4GOXA 3IELA 2JW5A 2VP0A 2H63A 5TEWA 5LU8A 2YASA 5HILA 3QWAA 1ETUA 3B3QA 1T9HA 1SWVA 1X7XA 4D1YA 3W5DA 2O8BB 1AS0A 3R3WA 1QP0A 1W35A 5ALUA 3B5IA 1M2VA 3URKA 1HXHA 1YKSA 1JL3A 2K2WA 5I8WA 2E55A 3C3DA 3CEJA 1UDXA 3V2HA 2WQ6A 4W99A 1B8PA 1K7SN 2VO1A 4PYLA 4QTZA 1VG9B 2AC7A 1XMXA 2PT9A 1EVYA 2WJ6A 3AOEC 4OU4A 4AF8A 4KNWA 2PUAA 1E3DA 3AUSA 1LJLA 2ZREA 3C7KA 5AKKA 3KEMA 2BJHA 3NTOA 3DOJA 2Y6VA 1O87A 1K8YB 3VZRA 3K05A 4AWBA 4B6GA 3A2LA 4E07A 4ZAGA 1C80A 2L0XA 5C7OO 4R71A 3ADDA 3NALA 4ND3A 3CMMA 1RJWA 1HKUA 3I72A 3FE2A 4K1LA 1P1IA 2CXPA 3ZY6A 3C3BA 4IAOA 3D54D 2LD4A 3MT9A 5B30A 5JMOA 3IXQA 3BVPA 4CL2A 2XLCA 1ZGGA 5IPFA 3QWIA 3KQWA 1EWYA 4DVJA 5IEJA 4KQKA 5CM2Z 2EWVA 2AF3C 3EC2A 3ORYA 4Z4EA 2IH2A 4WZAA 1QMPA 3D6VA 3O9MA 3UJHA 1KMHA 1EUZA 1XJWA 2LCIA 1Z12A 3VGPA 4BU1A 3KJXA 2L82A 3FR7A 1FFCA 3N8KA 1D6NA 2IYXA 1S1CA 3BH6A 1NW3A 5DGDA 3WGIA 5IDXA 4RH0A 1F4LA 2QVZX 5FI3A 2NU9A 2Z2KA 3CZQA 3GWZA 3G2JA 1P6XA 4M36A 5H4HA 1RYMA 3LPLA 1GEEA 2A9OA 2OC4A 3AY7A 3PR2B 2JKYA 1EZ1A 1N3LA 1SIBE 4TKVB 3STHA 4OHOA 3CNNA 1HYGA 4YP7A 3L2OB 3QVGB 2IEZA 2AW5A 4Y6PA 3VR4H 2G5CA 4KWHA 4PQGA 4XWTA 4HDSB 1AO3A 3TXYA 1OAOC 2BY4A 1VBNA 2SCUA 3FDZA 2P2NA 1NXXA 4LISA 4JBWA 1E3MA 1H94A 3TLMA 1ZSNA 4E5YA 1MVLA 4EUSA 3ZWQA 3FWPA 4OLBA 3GAAA 3H4MA 3YASA 1SVIA 5DT2A 1L4LA 1X7GA 1FDOA 1OU0A 3MOSA 2I9KA 3NIGB 1VPTA 4O29A 3SLKA 4EUEA 4PVCA 1HQDA 4ZQIA 4ARZB 4IZOA 2QRJA 4ZK6A 4A8HA 2Q8QA 1BWRA 5FJJA 2D0OB 3B9PA 4EGSA 1UWVA 2YMQA 4LXIA 4BFUA 2GUWA 3NW9A 1WV0A 1XL1A 1U2ZA 1VZ2A 2V59A 3TIXB 2NUPB 2XA2A 2DGDA 2RK6A 3LC0A 1I94B 2QXTA 4F6CA 2C7GA 3E5HA 4IRUB 4QA9A 4C4YA 3H8WA 2WBLC 2NZXA 1PWEA 2JLAA 3FUUA 3K2IA 5GY7A 2Z1NA 1RAAA 1JR3E 3WL5A 2CMKA 1PNOA 1E5TA 3EQZA 4UD6A 5AW4A 4REMA 7AT1A 1R9NA 3SJAA 1EMDA 4C3ZA 4JX9A 4PV7A 1K6IA 1KAGA 3CRVA 2C58A 3EPJA 3P26A 4G5XA 4OJQA 1UR5A 4ZT5A 3M82A 4BNGA 1VA5A 3AUUA 3TR6A 4ROTA 3WS7A 4ISCA 3A2KA 4JJAA 3KVYA 4YMIA 1V9LA 1C3XA 2C96A 2WKPA 1X7ZB 1XAHA 3L0BA 3MA0A 6Q21A 1RQ7A 4M9UA 2F43A 1CUCA 1PK9A 3V00A 4PNZA 2X22A 1GQQA 1W88B 4TRMA 3OC6A 5JJIA 3OFVA 3WJAA 2IOQA 3BTSA 3I8XA 1TD9A 2C78A 3PJFA 5CLHA 3PK0A 4AG6A 4UOZA 1U8EA 2YHUA 3AJEA 4BFLA 3SJBA 1MRNA 1QQBA 1ADFA 2C03A 3TO5A 3UMYA 3Q11A 3ABIA 4JL6A 2J31A 3DA8A 4J49A 1EFCA 1U2QA 1GQSA 3M4ZA 4HZIA 1ZD2P 4Z0HO 3CIOA 4NHOA 2QOEA 4QNMA 4U02A 3TRFA 1ZIDA 2BFEB 4HDSA 1H22A 4M9XA 3FPFA 3TCNA 1MRSA 4PYRA 2RH8A 1PJSA 3MWYW 5I4KA 4EW6A 3WGVA 3DPUA 1EM8B 1VL5A 3GY0A 5FTWA 1U9ZA 4S05A 4KN9S 4PVDA 4O2BF 3F8WA 1Q0ZA 2W6JD 3FNFA 4I55F 3FKJA 3L79A 5KTMA 1X1BA 4ZMSA 2RG1A 3E3AA 1GSHA 3MINB 4HADA 1UBFA 1XRSB 3LNTA 4ON9A 1XZNA 1X7ZA 4X7PA 3DBHB 2EV9A 1LI7A 1E2FA 4IMRA 4L5CA 3GFQA 3GEHA 3TZLA 3V2GA 5DGTA 3WWEA 5HZMA 3D31A 1PT7A 3FKSD 5DHUA 4M49A 3UVEA 4DG8A 1KJNA 1RAGA 3WMFA 2HRRA 1ZIYA 2J87A 3D0OA 3HDYA 3P9PA 4KO4S 2O4UX 4N3BA 1X8JA 4U6SA 4ZGGA 2N1BA 1O5OA 1QM5A 2A0WA 3FN4A 4YJ3A 2WJAA 2QVCA 3O7WA 1JAHA 1QQTA 4KO1S 2V7TA 1VPVA 1LDYA 3DTTA 3MAJA 4ZT7A 1OYOA 3A10A 2ZJ7A 3A9TA 3BYZA 1GL6A 3HP4A 1TIBA 1VKRA 3R9XA 2F8SA 5D3MA 1QVVA 2QTHA 2IOHA 2JFHA 4REQA 5DNWA 5A9SB 4AP9A 1JFSA 1MD9A 1KYQA 3DDWA 5FP0A 5CJPA 4IHJB 4JC0A 4GOOD 4PANA 3ROEA 3RQIA 4X6YA 1A71A 1O4WA 2W6OA 1T8YA 3ZZTA 4LTNA 3OZXA 3O5AA 3RREA 4GPIB 1FS4A 1O94A 1B0AA 1SQFA 1E79D 1I4OA 2CE2X 4W9RA 1QO7A 1L7AA 3OTIA 5J4VA 5IJZA 3SNKA 3H4IA 1CNFA 1GPH1 3FPHA 4HF7A 4BRZA 2QD3A 4XD7D 2RGRA 1W59A 2R4TA 3ZHVA 2O4CA 3FWKA 4ND4A 5D00A 4G1BA 1K8XB 3IILA 3EFOB 3OZVA 4M8IA 3U26A 5EJ6A 3K8OE 3QVLA 2XAUA 1LCIA 1FFAA 3NANA 2J5KA 4MUKA 1RZRA 4ZHQB 1VE9A 4Z86A 1SA0A 5TQ0B 4CFYA 2E48A 1R6XA 2DBRA 3BIOA 2I91A 4JB2A 2V8BA 3CURA 4IIFA 5AHWA 1G3MA 4Y0VA 4BUZA 5KWSA 1I4WA 1N6PA 1JHOA 1ODTC 1KQNA 3VPSA 4DTIA 3GMSA 1IM2A 3U60B 2WWIA 2PRSA 4OXNA 5CITA 4MKZA 4NLLA 1JGTA 3JQ7B 4OUKX 5IXJA 3HLYA 3FUXA 3L92A 2HR1A 1OY1A 2H4WA 4L73A 4QNRA 2IY8A 2HD4A 4YH1A 4KG7A 5A1JA 3PC6A 3RUCA 2VP6A 4QZVA 1KHTA 4OB7A 1WHSB 4CXMA 1OLUA 2JDIA 2BHNA 3DOIA 1GHTA 4I4TF 2R6JA 3C4QA 2I6TA 4LOAA 1KWKA 2C9MA 1IOLA 4MP8A 3VNSA 4E4TA 5JAIA 3ZJUA 1PFUA 1XRRA 2XDAA 3M1AA 4MQUA 3AI3A 1XD8A 8ABPA 1W4ZA 3MLBA 3MWLA 5HUHA 5AP9A 3PEUA 3RYHB 4YK7A 5SV2A 5AUQA 4MWOA 3IA7A 3MTDA 5HIJA 3WL7A 1BOFA 1W44A 3COZA 3AY0A 3IB3A 4I08A 4IFBA 3FPBA 1R4NA 2F48A 1P6QA 2H2WA 2BZSA 1GU7A 1EBUA 2ZWIA 1VJCA 4MV0A 3HVUA 5DB4A 3CLUD 3G79A 3CZ9A 5BRAA 1B2LA 3RIHA 1YB7A 3LD9A 2BI4A 2PKRA 1RDFA 4CV2A 4M9ZA 1FDSA 2R48A 1JAIA 4KXMA 4IW3B 3NHWA 4P84A 2XF8A 1V5IA 5ANRB 3WRXA 4YXFA 4BTEA 4UUMA 2JZNA 4WCFA 3ER8A 1HY3A 2WIFA 3D43A 3AEUB 1JMYA 4YP6A 1IULA 1O6GA 2Y8EA 5E9QA 3LM8A 3DV2A 4DLLA 5C4GB 5A9SA 4CLOA 1T6ZA 2VQ3A 1P74A 4AZWA 1RIIA 2B4QA 3DVQX 3DG9A 4QSMA 4Y2RA 4CCYA 5BNWA 1OPRA 1PZFA 1VLZA 3CZRA 1I01A 3GNLA 4PC7A 4D96A 4RTRA 2EW2A 2B9EA 1CUHA 2HADA 3FMOB 1ZNZA 3CT6A 3ITEA 5JH7B 2JGEA 4RVUA 3ZKWA 2CV2A 1RZUA 4L0MA 5J9FA 4PN3A 1E4YA 1Z3IX 3I83A 5FBLB 4JUIA 5TV2A 1F1JA 3X3HA 4MUGA 3TZQA 3QE0A 5K3FB 5CW2A 4A2WA 6YASA 3B7WA 4UU7A 2H0RA 4RA9B 5AM1A 4DC0A 3I2YX 2YXDA 3CLRD 1N1GA 4BKOA 3BGDA 1U4SA 1AN0A 3DUFA 1DTEA 3TAUA 5BWCA 4LZWA 1GPUA 3DB1A 4JUAA 3T7TA 1YBHA 3HSYA 4TZKA 2QS9A 3WZMA 3OQIB 3CF4A 3OZDA 3SOPA 3CUTA 1JFVA 1KDVA 3JCZA 3OA0A 2FSSA 4PQFA 5A5DA 4Q7JB 3BTVA 4PPNA 1W4RA 3DW3X 4WCFB 1PDWA 3OX4A 3KPJA 4EPRA 2PUBA 5CBKA 4ZTUB 1X1SA 4A0HA 4DCNA 2R7NA 3CWCA 2WIJA 3IAHA 2IYNA 3OSUA 3P1JA 3TM5A 3W6ZA 4E22A 1FNDA 3AEKA 3COJA 1ADJA 3CCFA 3W8FA 3ZW9A 1T91A 1M1ZA 4QLBA 5KTTA 5EEGA 8GPBA 4RF5A 2X7XA 4L27A 4KRXA 3SQDA 3KPWA 4WBSA 2IV2X 4C4RA 1R4NB 1QG4A 2G4CA 4Y0NA 1E64A 2AKEA 2YX1A 1JFLA 4BX0A 4PEVA 2B7BA 5BOSB 4TZ0A 4TM8A 1SKBA 3SXUA 4GE0A 4G9BA 4P92A 2AMYA 4EW1A 1AGXA 2RGAA 3D8UA 2PXXA 4CM5A 4UFPA 4Z6KA 1PZGA 2GS9A 3OUZA 1YB4A 2NW6A 2D0DA 4NFYA 3LU1A 1OT5A 1CDZA 1UADA 2QVXX 4JNKA 4F4CA 1WCYA 2XD4A 2C2GA 2YQZA 1K3UB 1X38A 4BC1A 2ZDGA 1UBOS 5LQUA 1XMIA 3OU2A 4FCWA 4WZAB 1K86A 1QH8A 5DN9A 2YNMD 3HJGA 4DLUA 4GP9A 1DPGA 1YJ8A 1I2ZA 3FCEA 4RA6A 1WMSA 3I58A 3S5UA 4DUZB 1BAPA 3QVUA 2FEXA 3CKYA 4HAOA 1UDAA 3LT5A 2Q7OE 3V8BA 5FX2A 5IT4A 3MIIA 4ODIA 1M2GA 4J1NA 2AZDA 3FOEC 3HXMA 3ED5A 5B4UA 3MHTA 3EGOA 4KSYA 1NN0A 5SZJA 4BJ6A 4ZDKA 4ZEWA 2XI4A 3KVRA 2XRFA 5NLLA 2D2VA 4D82A 5D3KA 4DWWA 2J7PD 5C5CA 1NYTA 4QRHA 4H1UA 1XKLA 5KNDD 1VMKA 2YIVX 1QZZA 3GVIA 1IVNA 4XVRA 1WDKA 3ACCA 2B20A 3GJ6A 3MVEA 1DBIA 3AOGA 1UINA 3MMNA 2ZJ6A 1K4YA 5DXAA 5MGBA 4OQZA 3KB1A 3N70A 1IHYA 3C3MA 3PYXA 1XTKA 4JJKA 2G7ZA 5G3ZA 4NPCA 1F17A 2HCBA 3DGEC 4B3DA 4QFDA 3HE3A 2VUIB 2OHFA 1BHSA 3KD3A 1H1LB 4LYHA 4UAVA 5CAEB 2J3HA 3WA6A 4CN8A 2ZROA 1J56A 3FSGA 3ONFA 4F38A 5KNBH 1BH6A 5I5GA 3B2EA 1R6TA 1CP3A 5AJTA 2Z6QA 3QKWA 4OKSA 4DHEA 3L8EA 1BS2A 4HYQA 4N6NA 2P5SA 5AW1A 3HMQA 5KAPA 4MUMA 1GT91 5DP1A 4FXOA 2PVCA 3LUDA 3LDUA 4IQGA 4II7A 3BGVA 4TYNA 3SDSA 2X15A 4W6QA 4XQ0A 3RVSA 4OTZA 4OHXA 4O4JF 1RKBA 4P7BA 4WDQA 1GQ2A 2PPLA 4JI1B 3CINA 3NDBB 1KZ4A 1QE5A 3FTCA 2I1VB 4UBLA 2W2LA 1ZGAA 1KO5A 2XNDA 4Z2YA 1VBFA 2YOGA 4DV3B 4UDXX 2G04A 2JFYA 4GPD1 1Z4KA 3M1IA 4MNTA 4YUVA 4AM8A 5GOZA 3FTEA 2PKWA 2WV9A 4LTMA 1U4NA 2O7RA 3DMTA 1N6OA 3OIWA 3QV1A 2MT9A 1C9MA 2C5AA 4DIKA 2V96A 5EJGA 2ROQA 4PHGA 2Z3WA 1DS6A 4HSGA 4HNQA 4I2VA 2JAXA 2YXBA 5DIFA 2KSQA 2WYIA 1WXXA 3QLVC 4Z8XA 5G02A 1DX6A 1ACJA 1DAPA 3WQSB 3F96A 1T2CA 5KU7A 4CLXA 1NOIA 4LS3A 1KP9A 2ZRGA 3MCWA 1SOVA 2I03A 4HH3C 1M8FA 1RWXA 2BC9A 4OUDA 4O4LA 4BVFA 1N6NA 1YQQA 3NEJA 4PXYA 3CY6A 5B58C 1NYLA 1WO8A 4QPJC 1RJEA 4FGJA 3TTYA 2H4FA 1RJ9B 3Q3CA 5MFZA 1QF7A 2XSZD 3D7MA 5FJIA 2G40A 4EB0A 4MWGA 2BFBB 1ARZA 1VXRA 2Y05A 4OGWA 5J2TF 5JFGA 2YY6A 3TD2A 1B2RA 2PDAA 1OI7A 1THGA 3I6QA 2W70A 3MMXA 5JJBA 2LIPA 3G2PA 4WK0B 4C7XA 5EWMB 4EUNA 1OQAA 3AINA 4WK2B 2H54A 2Y4NA 4MUXA 1ZP6A 1T1IA 2FQXA 3ILSA 2QLFA 3CONA 2JLBA 1F1BA 2VZ8A 3NBFA 1MW9X 1WVIA 2B8EA 3RYFA 3TJZA 3AERA 2ATIA 1FMLA 3FDIA 2WICA 3QXSA 4X8HA 5DHRA 1YTUA 5HBRA 3X1XA 3QUQA 3OEHD 4CM8B 2POCA 3LOUA 1DO8A 1RWWA 3WHKA 5FYDA 4EG1A 1NRXA 4HUTA 4A0GA 2GDZA 1CRLA 1T9GS 3C3PA 4BNWA 3R7WB 5CVTA 2UYHA 5C4MA 1ZHOA 3FUWA 3N87A 1I6LA 1NXPA 13PKA 2IHJA 4TMZA 4C9BA 4IV5A 1CY4A 2LCQA 2NX2A 2C98A 1ZY2A 1G42A 3SBDA 3FF1A 3PICA 4NS1A 1KHHA 2RBGA 4TTIA 2AZMA 2QENA 1PFYA 1HZJA 1JEEA 4JN6B 4QGHA 3VR6A 4POAA 3WKDA 2A14A 1IHDA 4FYMA 3WLFA 2CFOA 4YRPA 2I3DA 4EDFA 1C2TA 3LTNC 3GO4A 1UPUA 1AKNA 4J0EA 3TZHA 5REQB 3RH0A 1GZVA 1KEZA 3P9NA 3WV5A 1G8AA 3N3BC 1KJZA 3HFSA 4W5OA 2PFGA 2QUJA 2MMGA 1GZSA 1R3DA 3HCPA 4PW0A 4UEOA 4NY1A 2WIGA 3QH4A 4RD6A 5JNUA 3KXDA 2W0SA 3JQPA 4UTXA 4UKDA 1PGOA 1S7GA 3TPFA 3WIEA 1VLQA 4CKCB 4Q3LA 4U2BA 4KQIA 1WSWA 1RYBA 5AT1A 1DQPA 1Y3BE 4MQ6A 2XKJE 3ILHA 2Z5VA 4DY4A 2BGLA 3ROFA 3TM4A 1WWKA 2G76A 1P2SA 1N9KA 3LUJA 1C7IA 4JYPA 1KFJB 4LKRA 8ATCA 2HCJB 2QMYA 1A8IA 3RHTA 5GTDA 4M87A 2EBFX 5HF9A 2CHFA 4I9HA 1J33A 1G6KA 1MFPA 1VJ5A 2GSDA 3OIDA 2WAAA 4J6FA 5C1DA 2XRMA 1HH4A 2WJVA 4K9SA 4PFJA 3W9YA 2DHRA 3NHLA 4OP3A 4WX2B 3RHFA 1KYIA 2ZIUB 1DTWA 5ES3A 3OE4A 1Y63A 1L7PA 3DV9A 1H4SA 1Y98A 1TKRA 3LIPA 2GXUA 4RYDA 3WB9A 4CE6A 1Z47A 1RKQA 3VPAA 4BFZA 1KP3A 1ZZGA 3VGJA 5GIPE 3AP1A 5COQA 3JATA 4PPQA 1EX7A 4LMAA 4R5HA 3P2IA 4L95C 1O5IA 2QTLA 1YB1A 1VHTA 3AIIA 4WSOA 4W1SA 1AF7A 3R40A 1CW2B 5TT0A 1MFZA 5EESA 3WZLA 3T1TA 1FX0B 2OAGA 1O0BA 3AHFA 3G1UA 1F0PA 2J6BA 3B2NA 3QGMA 1GJRA 1DWOA 2OESA 3A6JA 3K1ZA 1TQHA 4RZQA 5JSKA 3TLKA 1KY3A 1NYQA 1LVGA 3O4JA 3O4VA 1BO6A 4O0LA 1E1QD 3HVKA 3RGWS 1WZIA 2ZS8A 2ZBFA 1J2YA 5BSRA 5KWVA 2OG1A 3HG7A 3QUAA 5FBKA 2Q4EA 3OKAA 3CH7A 1FVXA 2XITA 4EFNA 2DKOA 3QA9A 4I9UA 1NSFA 2BBWA 5ADHA 1FYXA 2FGJA 2GEDA 2W2OA 4G84A 3UYKA 2J45A 3EDOA 3GRVA 1UDCA 1Z15A 2OBLA 3BJMA 4M8KA 1U2DA 2HT6A 5F33A 4S04A 4A36A 2V74B 3ZQ4A 3KNZA 1MEJA 4G5HA 2V6IA 3B6KA 1YV9A 3IUMA 4WD3A 2WUEA 3CXRA 5ALJA 1GWNA 2DC1A 2QE6A 2O8BA 2H3EA 4LNUA 3SC2A 5JNTA 4BO9A 1G3IA 4W9NC 3AUFA 4PX5A 1E7YA 1K5HA 3DCIA 5SYMA 1OFHA 2BGWA 3QXCA 3TOSA 1N9GA 2F8MA 4RQBA 5CPFA 3ZWPA 3GZNA 1CF4A 5HIAA 2ZI5A 2PMEA 5SYNA 1AQ6A 1F8XA 4ESOA 2R5WA 3R7SA 1G0NA 4ICIA 1PW7A 1TX4B 4R0VA 5EZYA 3UMSA 1K7XB 4O1HA 5JI3E 1OWOA 1CZUA 4L5AA 3ANYB 4TUYA 4KR7A 2WQZA 4CTOA 4KTVE 3MAAC 4L9AA 2BUBA 4LSGA 1JH9A 1JMVA 1QTRA 2I7VA 2QTVA 3TBKA 1PN3A 5JASA 3IGFA 5F4BA 3KB6A 4G5SA 1NIPA 3U61B 4IIJB 1HZZA 1AA6A 2H4ZA 9ABPA 1E1DA 1E6KA 3EVDA 1JHPA 4I1SA 5J2UF 3NM4A 2O3JA 5KKNB 1EGMB 2ODEA 1Z6AA 5TNXA 5AM3A 4EG3A 3ZIAD 3FB4A 4KPUA 1SPBS 2ZYGA 1TVKA 3HJUA 2ZGVA 4RVOA 3ZV4A 1I8TA 1SVLA 4JJ7A 1LX6A 5A1TA 2BD0A 1U8AA 2OE2A 3LY7A 3N0RA 5KX5B 3AEKB 4RENA 3AETB 1GFZA 3CF4G 3OTHA 5D6NA 3ZHCA 2FJ0A 1WXQA 1ZQ9A 3C6YA 4ND1A 3MW8A 4R2LA 1Z07A 2ZAOA 1U0LA 2VPWA 1MMFB 4M7PA 4DY6A 5IYZF 5CG2A 2H4YA 3GLQA 1ZMRA 1PV2A 3B9QA 3N76A 1MN6A 1D2EA 4E6EA 4CFSA 3VVBA 4NP6A 2SICE 1YU9A 3GJYA 4URHA 1VCOA 2GN0A 2I2FA 2CJWB 1LBQA 2EG9A 3HWRA 3JATB 1F8FA 2HK7A 2X42A 5IASA 1VE6A 3COPA 3I1YA 4AUEA 5HWSA 1Z2AA 2BF7A 2RB5A 4KW7A 3QFTA 5MN6A 1G2PA 3AVXA 4UMFA 1L9KA 4G24A 3Q88A 1NBHA 1YULA 3FTQA 1QH8B 2OM6A 4N8EA 2B8TA 4CEJB 2VJBA 5C3UA 3RVMA 2DHDA 1DJOA 1FS5A 4CUJA 2AA3A 3FLAA 4OA5A 5EZQA 2HO5A 3BCRA 4FHCA 2IZ5A 5TGZA 2QM7A 4TVKA 2WM8A 3FFBA 3T0FA 3UXHA 2VDWA 3GRCA 4IEIA 3TI9A 1JSLA 5LMNB 3EPHA 5G0WA 4WADA 4ZT6A 2JI8A 2RMKA 3GJRA 3CW8X 3KOZA 3O94A 4O2AA 3KOMA 5BV8A 4CF7A 5LQDA 4PSUA 3ZX5A 4BNXA 1ZI9A 2LRHA 2Z08A 3OPYB 3ZU5A 3WMGA 4IIGA 4NZZA 1P33A 2HIHA 2CXUA 4Q9DA 3ZWWA 3WAGA 3HJRA 3LFHA 5E1OA 3U7RA 3ETNA 3HUUA 4X91A 3FA2A 3UC9A 3GLSA 5DM4A 3L1HA 1F8GA 1BN7A 2F4NA 2M2IA 2OMKA 3OQ6A 5C8YB 4FWIB 4FZ3A 2AQ8A 2CWDA 4AX8A 3ONWA 1RHRA 4K8RB 3WNZA 2FPGB 4COKA 3F0TA 3IQZA 4BLWA 5LBUA 4ZYUA 3ZV5A 1HLDA 3HDJA 3GQBA 4WESB 1XEXB 1JDTA 2XIQA 4N0QA 1GTZA 1DKNA 2J9GA 1JR3A 5E7QA 4RA9A 4XFKA 1BEUB 4ZO7A 3SJ7A 1EA5A 2EGHA 5CB6A 1D5WA 1KQFA 4NYMR 5CFLA 5JNWA 1VTKA 3PWTA 2F2TA 2AEMA 3PVCA 1ZNXA 1DG1G 3SZUA 2XGMA 3H1EA 3OMXA 4AY2A 5FOXA 4K86A 2O23A 4WOKA 2HJHA 5DFAA 5MDHA 1JXAA 5EIFA 3MIZA 1I3CA 1XRQA 3IEVA 1FUYB 4MPPA 2VH1A 2GBFA 3O90A 3GRUA 3BE5A 4CF6A 5EKTA 1TA0A 1JA0A 2ORIA 3NTQA 1ZUIA 3CRMA 4RK7A 2LUOA 4MPRA 4LOJA 1MDFA 1SU8A 1X8XA 1XO1A 2XOKA 4FOLA 1ML4A 5GGXA 5F3WB 1KSHA 3EXEB 3V8PA 4RY8A 4RY9A 5F7JA 5AM2A 1TYBE 2P1RA 5IF9A 4YJ2A 3SQOA 4I6EA 4UAJA 1D2CA 1VLMA 4N0PA 1I3NA 1NVVQ 2H52A 4MV3A 4AN4A 3PFKA 2NXJA 1AQLA 1QZXA 1X77A 4RVDA 5KHAA 3A27A 2O48X 3ESRA 4MVJM 1R18A 3KIPA 4FN4A 2G4VA 5H3CA 2J8ZA 3F3SA 4EKIA 2PHZA 5C1BA 2DKNA 1F06A 3JASB 5HCNA 3X1WA 1I1QB 5CLGA 4XOUA 3TL6A 2QP3A 4HI0E 4U7PB 4NV1A 3E5MA 2JS7A 4BQQA 4Y0AA 2AUTA 2BM0A 2C5HA 1OE0A 1DKOA 1C3LA 2AUNA 3EDQA 3WJ2A 3OAAA 4JI5B 1MJNA 4A0QA 5B55A 1IXSB 2ABWA 1BHJA 3HCRA 4IXWA 4U9HS 4YJFB 2VAXA 2CK3A 3H8SA 5L51A 1JDVA 4OMFG 3V8NA 1E9AA 1VRWA 2A84A 3VR4D 2DHEA 2A2ZA 1RIFA 4H7DA 4G5GA 5C32A 5AVQA 4G86A 5IJ0A 2GWHA 1EJ6A 3TYXA 5HTOA 4I50B 3HB7A 1RRGA 2Z8YA 2I99A 3M6VA 2B8NA 3PWSA 4IMPA 4LWQA 4X8LA 2BBTA 3C5WP 2ZRJA 3I42A 4NDAA 3EUEA 1A1VA 2FFRA 1ENYA 1FUKA 1M34B 2AE2A 2I8LA 2IEYA 1Q5PA 3AEXA 2P2GA 5DLQC 1NBOA 1PG5A 3B1YA 2C2XA 1Z0AA 2CFIA 4Z9YA 5U1PA 1IQ0A 1AUQA 1P1RA 1SMKA 2WSYB 3TSCA 4BB6A 3W3AH 4YC7A 1W36D 4ZXFA 4RGYA 2DWUA 3TZEA 2FWAA 3MMZA 5ALDA 3LUCA 4MVXA 1XT6A 1K9VF 1BQ3A 1TM2A 2HCRA 3L1JA 3W04A 3FTFA 1VHDA 2CSUA 1AKMA 1TADA 3AZPA 2XCSB 4OI4A 3O3NB 2CVZA 3AI1A 3VR5A 5BXYA 1QWSA 4RV5A 5LSAA 3CGGA 1NXQA 2YMLA 3PE3A 4K9KA 2QVLA 3QVSA 3NBUA 4OJKA 2XEXA 4HJXA 3OHMA 5FAXA 2V98A 2YQ4A 3E7DA 4M60A 4A91A 3BIFA 1RFGE 1WV1A 3H5IA 4ARSA 1X87A 4KYTA 3BULA 5KYUA 3ZIDA 2IRWA 3GROA 2ODBA 2Y9MB 3ZDAA 4Z0PA 1Q0HA 3KK0A 1V96A 2EKQA 1L5FA 2O6HA 3BZUA 5E8JA 1EE2A 1EGVB 2II6A 3BXHA 3FNEA 1TYZA 1D07A 5AI9A 3UFXB 2WUVA 4F9EA 2LKCA 4BEWA 2A0UA 4H4CA 5CDTA 3OZFA 4I5DA 2EIHA 2CJPA 4OBEA 4EKGA 1WCIA 3KOWA 5IT9A 4FFLA 4B4KA 1KEEA 5MF6A 1YZNA 1U7PA 4DCCA 3ZU3A 4CYMA 4ZV9A 2MINA 2FOLA 4NV3A 1J0EA 1FUIA 4G25A 1YMVA 2H17A 4PTLA 4ETMA 4J9UE 4CIYA 3I2IA 4FBLA 1TCAA 4RKEA 2NZ8A 1JG6A 1VBMA 1NMZA 1CEQA 2ZVJA 4Z4GA 4NX2A 4CQNA 1C0KA 1TCUA 2I1WA 5DSXA 1QCCA 3DMRA 3KP1A 3UK7A 4M83A 2C94A 3T7JA 2NTVA 2XE4A 5I7FA 2Q49A 3O8NA 2PEYA 5CB8A 4F3TA 4N03A 2J5XA 4HH4A 3OBIA 4MVJH 2Q27A 4DV1B 1JWBB 3DO8A 2BKVA 4EVIA 2BMDA 2A5GA 3MTAA 1SVUA 3V6LA 4AMBA 1JV2B 5A9TA 4H16A 4MV1A 1UDBA 1Z8FA 3HHEA 5CYFA 1E2DA 1VGQA 3QSGA 1YHNA 4MI6A 1NVGA 4YI5A 4XJSA 4INAA 1OHHD 3A28A 3JQ8A 5DYYA 3CG0A 2W7TA 1L5RA 5KWJA 1XDGA 1UFRA 5DEIA 2NADA 4WOJA 4EEZA 4PCVA 2P1DA 3U49A 3BDAA 1PLLA 1P2DA 2KLBA 3BRCA 3ASVA 4TXMA 1J1IA 5FUQA 1G21B 3F6RA 3HJCA 1JECA 1L7RA 1N8TA 3ZHZA 3BK2A 4QNNA 1YUBA 4JX8A 2NVOA 1DFIA 1E6UA 1TT5B 1F6BA 2PY6A 3FVVA 1SHZA 1P91A 3LP8A 1JKFA 2BBSA 3OQIA 1ULSA 4IIEA 4UASA 4X71A 3WGMA 2FP3A 2H85A 1YL6A 1GGHA 2JRCA 1JLRA 2Y0BA 3HBFA 4QBTA 3L0DA 1GLVA 4D9HA 2WHRA 5KPDA 1SJ9A 3FYSA 4G4SO 3N53A 1U7DA 3C87A 3PVSA 2PX2A 5EJFA 4PO9A 1OH7A 3ZHSA 1D4ZA 2X13A 1KC3A 4XH9B 4QODA 2CLMB 3KZMA 1L9XA 4MVWA 3M5DA 1CF9A 4RFSB 3GLIB 4K87A 2LWIA 1NJ5A 2PZGA 4GG1A 5JO9A 3TLEA 2ZJAA 5FOVA 2VTBB 4WECA 4MYUA 2I7TA 1NXWA 4GUDA 5CT4A 3WIUA 3DE1X 2YS7A 4UEQA 2UUOA 3PC3A 1GILA 1VPEA 2ALJA 2KM1A 4Q9NA 4GZ3A 1KEPA 1WIWA 3GD7A 3SIXA 2HGSA 2QIOA 5JC1A 1MW8X 3VUFA 4B9AA 2V6FA 3RFFA 1C8KA 1FPQA 3LYAA 4JQCA 2CFRA 1NE2A 2FMIA 4HGQA 2BGRA 4WZ6A 5DNEA 2JIOA 3GYGA 4FM9A 1DHRA 4YMHA 4XUGB 2ODTX 1MLDA 1M1YA 2YHIA 4CF3A 2A78A 2ZUCA 4ARZA 1JT9A 2XUKA 1TTQB 4G41A 4P36A 3MCVA 4PBRA 1W5AA 4G4IA 1DAMA 1P80A 5EJ5A 4PICA 5F2OA 2XMZA 3F49S 5BSVA 1IOZA 4NR0A 4FPXA 4Y9TA 4GKAA 3HRHA 1IDN1 4Z4QA 4C7VA 1YBAA 1XL0A 1S9DA 1SKUA 1YJBA 2HX1A 4P58A 2D74A 2NSJA 2W8BB 1NP3A 1B26A 1UBTS 1PL7A 1T0IA 1DG9A 2QN7A 4G0NA 2Y67A 1DLJA 3T95A 1JDSA 1V48A 5IRCD 4X93A 4M9CA 1E20A 4N3NA 4PLPA 1LW6E 2DCUA 2MSDB 3OQHA 1K5DA 3Q10A 4O25A 4QYWA 4U00A 2HGZA 1UBRS 5FF9A 1JG2A 2IW1A 3DBRA 5EYPA 3PTZA 2ZI6A 4UDYX 5IUJC 3WK8A 1J8MF 1PGJA 3UV3A 1UZAA 1LFAA 3AL3A 3VNVA 4ATNA 1V71A 2E4ZA 4US0R 3EZGA 3T06B 2VSNA 3DH0A 3FM9A 1OPXA 2J4DA 3IJEB 5K5EA 1KA9H 1R88A 1T24A 1XDWA 1IUPA 2G5GX 2X23A 1ZC4A 3AVQA 3DE0X 3MJSA 4KYVA 3VZPA 1K2WA 3AONB 3ELBA 3AHGA 2XCUA 3L77A 3C7TA 1IK4A 4OMCA 4HDCA 5I9MA 2BFCA 1PJCA 2H2GA 2QI9C 2WIAA 3S44A 5CAEA 3FOFC 5JHGB 3NWOA 1H4TA 2HEIA 3UW3A 2AI3A 1OFUA 1QTNA 2PSDA 2IEAA 1W52X 3QELA 1JZSA 3GP5A 3PZBA 3IVGA 4ZDWA 2G9NA 4B4VA 4DL9A 4D41A 2XQKA 3OJCA 3GDHA 1YJAA 3KEOA 1VIMA 3ZXIA 3U6KA 4GVLA 4IQ8A 4Q02A 4BMNA 1MH1A 2OXTA 4E33A 5JQGF 4PM4A 4U4AA 5SY4A 1MO6A 4BKPA 2FKAA 1F9EA 2XMSA 2RD2A 2ERYA 1TT7A 1ZRSA 2GI4A 4NOKA 2ZI3A 4CM4B 4UPVA 1BGWA 5LP6C 3WHLA 2W83A 3PRHA 4BIMA 3WIVA 1W46A 3ZNQA 4OSPA 4E21A 3VPCA 5AKZA 4FHFA 4HUQB 3W7VA 1JJ7A 4I99A 3UWSA 1BE6A 3MS4A 4F72A 5BUSA 1UWCA 4RY0A 5H70A 2A33A 3ZIUA 2GEKA 3MJTA 2FRDA 1KU6A 4RZ2A 2VN8A 1CJSA 5H02A 2SHKA 2YWFA 3RGGA 4JVOA 3VJMA 5GJBA 3L1KA 4TS9A 4N48A 3OVMA 4MWSA 3U16A 3M0EA 5G4LA 1U2EA 2VBIA 2XOXA 3PNYA 3O8OB 5CEEA 2QRVB 2H1LA 3FHCB 1SD2A 2ZRCA 4DZTA 1FK8A 2VPPA 2BFAA 2VJLA 1H2YA 4YDSA 4JUBA 2GETA 3TAXA 3A6PC 3WL6A 4DCVA 3ANSA 1GADO 2DWOA 3KX2A 1J0XO 5FOUA 3A6ZA 3RSQA 1E3LA 3O1IC 4AULA 1UJBA 3AL2A 3EF3A 5LP6F 5JVDB 3H1AA 3K9HA 1GTRA 3AUXA 2MYTA 2RJOA 1F2DA