3GLVA

Crystal structure of the lipopolysaccharide core biosynthesis protein from thermoplasma volcanium gss1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
GMIRVMATGVFDILHLGHIHYLKESKKLGDELVVVVARDSTARNNGKIPIFDENSRLALISELKVVDRAILGHEGDMMKTVIEVKPDIITLGYDQKFDEAELQSKINKLGITVKIVRISKYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Lipopolysaccharide core biosynthesis protein
publication title The crystal structure of the lipopolysaccharide core biosynthesis protein from Thermoplasma volcanium GSS1
rcsb
source organism Thermoplasma volcanium gss1
total genus 41
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 2.7.7.2: FAD synthetase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3glvA00
4PBTA 3HGMA 3ISJA 1N75A 2DUMA 3Q4GA 1J09A 4OJMX 1KH2A 1FYDA 3N8HA 2AKEA 1TYCA 5DEOA 3P0IA 3ZUGA 2DEUA 1MAUA 2J07A 5LLTA 3CR8A 2RE8A 2WSIA 4UZFA 5IJXA 3ZIUA 2CYCA 4Q93A 4XFJA 4E1AA 4WNYA 4ZCRA 3D6VA 2YY5A 1QU3A 3DV2A 5K0SA 1IVSA 3VU8A 1N78A 1EFVA 3IH5A 3TS1A 3DPIA 2A1UB 5DK4A 4MVCA 1NSYA 5TEVA 5DASA 1KP3A 4L2IA 1R6TA 2PZ8A 3COZA 2QUHA 3COYA 4U63A 1ILEA 5J58A 2J4DA 4X0EA 2A4MA 3MMXA 1XJQA 3IUEA 3PNVA 4ZT2A 3H99A 4NAUA 3IVGA 1JIIA 1GN8A 1QNFA 4MUEA 1NP7A 1V47A 4MW1A 4DLPA 4JYZA 1QTQA 4DE5A 5DB4A 1KH3A 1JEDA 3FETA 3I05A 1WXIA 2YWBA 3FH0A 4F3RA 1MRZA 4GRIA 2CFOA 1WXEA 1KORA 2V0CA 3ZGZA 4MWCA 3AL0C 4JXXA 1OBHA 1PG2A 5FNZA 1ZH0A 1YIDA 2A84A 5FO1A 4A91A 1IQ0A 1WJGA 3CLTC 1F7VA 4EG3A 1QU2A 1IFXA 3FI0A 2CV0A 4EGAA 4L2IB 3N9IA 2GM3A 5FO0A 1N2OA 4YP5A 3TNJA 3KT8A 4NZPA 3IMEA 1PFVA 1ZH6A 3FWKA 1GAXA 3G6KA 2VTBA 3UMVA 1G8FA 1QRTA 3TQOA 4CQNA 3AG5A 3GLVA 3D6UA 5TS2A 1JIKA 1R6XA 1QRSA 1M8JA 2J5BA 1J21A 1Q77A 2R5WA 3L93A 4MVYA 3AG6A 3H97A 3A2KA 1O97D 3CVWA 1N3LA 3IVXA 1GZUA 1G8HA 3HL4A 5BNZA 4Q16A 3C8ZA 4MUGA 2O8VA 4XFDA 4ZCPA 2O5RA 4R2LA 3SEZA 3AKZA 3A4IA 4KR9A 4I6EA 1K92A 1PG0A 1JECA 1N2IA 1YUNA 3ELBA 1WXHA 3CVYA 4GU5A 2CUZA 2IJGX 4ZCQA 4MW6A 2VXOA 2Z3VA 4MW7A 2XRZA 4DDHA 1NUQA 1WQ3A 3FDXA 1O6BA 4KR6A 3OTWA 2OV4A 2YXNA 1MJHA 2WB2A 3Q12A 4YMIA 1T6XA 2VTBB 1O0CA 5J59A 2A86A 3HZRA 3X1JA 3P0JA 3PNYA 1KQNA 3A05A 4ZT7A 1QJCA 1IHOA 1MBZA 1QQTA 3KT0A 1N2HA 4ND6A 1KH1A 1NUTA 3UOWA 4G5FA 3ND5A 1O97C 1LW7A 3GMIA 5K0TA 3AFHA 1IQUA 4ND7A 3NBAA 3RBAA 3CLTD 3RHSA 2J09A 5LFAA 4QBTA 3FNRA 3RK0A 5JBNA 3NV7A 1YULA 2E21A 1KP2A 3LCJA 3SP1A 1WY5A 1JEEA 2EL7A 3IMCA 4KKVA 1XNHA 4S1OA 1KAMA 3KT3A 2E89A 3FY4A 5LM3A 1IH8A 1EE1A 1H3EA 4MUHA 2G36A 4F4HA 4PY2A 4NX2A 1IQRA 3IODA 1TYBE 2Z09A 2JA2A 1X8XA 3ZJVA 2PG3A 2DERA 1O0BA 2HZ7A 2I1LA 4EG7A 4DNXA 2CV1A 4DDKA 5KWVA 2D5BA 1J1UA 4ARCA 4EFKA 1MOPA 1ZUNA 3SYTA 4CDMA 4DDMA 1U7DA 4EG8A 4MWBA 1K4MA 1M8PA 1SURA 3FOCA 4TS1A 1WOYA 4MWEA 3L92A 1PFUA 2QJTA 4J75A 1O94C 1I6LA 4AS1A 1TQ8A 2IP1A 3BL5A 1ZJWA 3LE8A 2QJFA 2X0KA 3M5WA 2BYTA 4HJXA 1JZSA 2QTMA 3KT6A 1H3NA 4HPWA 3MXTA 4ZCTA 1H1TA 3A04A 1T6ZA 1DNPA 4EG5A 1O95D 4XSVA 1X6VA 1VBKA 2WQ6A 5IHXA 2AG6A 4MVWA 1M8KA 3FHJA 4FZJA 1GPMA 5KCMA 1F7UA 3Q10A 1UFVA 2E18A 2X1MA 2CV2A 3CLUC 4EG4A 4QRDA 1HYBA 4PBSA 2QTRA 1GLNA 2ZUEA 1M8FA 2A1TR 1I6KA 2GOYA 1T6YA 4JZYA 3IOEA 4KPUB 2H2AA 1JIJA 1T9GR 2CSXA 4QREA 2B7LA 4R2MA 2BTEA 1P7PA 4K0RA 1JGTA 3K32A 4MUKA 2OQ2A 1COZA 4MULA 3UY4A 4NDAA 4AQ7A 4NAHA 2Z08A 3IDFA 1U7XA 3SZGA 4MW4A 3VRHA 1N77A 4UZEA 5EKDA 5AHWA 3ZXIA 2DLCX 1OWLA 4U7JA 3ZXSA 4KR7A 1O95C 2X1LA 2D13A 3ILVA 2PIDA 1YIAA 2NSYA 3SDBA 1D2RA 1M83A 3RFFA 4MUJA 3SEQA 3CVUA 1TFUA 3CLRC 2V0GA 1TEZA 1XNGA 3FIUA 3P52A 4OUDA 5F23A 1JILA 3AIIA 4ZT6A 1JZQA 4YBRA 1O94D 1YI8A 1N2GA 3QTBA 1VLHA 4MW9A 1M1ZA 4HJRA 3ZJTA 3K9WA 1B6TA 3OP1A 3IOBA 1U3CA 1IRXA 3X1MA 4MW5A 2H29A 3ND7A 2GKSA 4U8HA 1KR2A 1NYLA 2CYBA 2ZUFA 1BS2A 2QTNA 4MUFA 3TQIA 5HUJA 1KAQA 3CLSC 3PRHA 1Q15A 4ZCSA 2PXHA 1OWMA 3HFJA 3ZJUA 1NI5A 1U3DA 4J76A 4CDNA 1Q19A 1NUSA 3LOQA 1WKBA 3HV0A 3QE4A 2QUJA 3CLUD 3ND6A 4G6ZA 5KHAA 4G5YA 3X1KA 1V8FA 1N2JA 1EUQA 3JXEA 1N2EA 4I6JA 3DLAA 1I6MA 4P2BA 1U0BB 2C5SA 4JFAA 1LI5A 4MLPA 5HUHA 2QUIA 1EUYA 1S4MA 1J1ZA 1I2DA 1Y42X 3NBKA 2CT8A 4KPUA 4OUDB 4RUKA 4RPIA 3FG9A 3KFLA 1NUPA 4EG6A 1A8HA 1GTSA 1YUMA 1N1DA 3IUBA 1CT9A 2DR2A 2A88A 3TZEA 1PFYA 4BWVA 1G8GA 4YP6A 1NUUA 1EFPB 1J20A 5H16A 2A1TS 1MC1A 3HMQA 3CVXA 1OWNA 3VGJA 3PXUA 1T9GS 3N05A 2PZAA 5HG0A 3RK1A 1WXFA 3H9CA 1R6UA 1XNJA 1H3FA 1NURA 2QUKA 3GUZA 4MUNA 3MLAA 1O96A 2IELA 3N2YA 5J5AA 3CLRD 1K97A 1JMVA 1OD6A 2X3FA 3MLBA 4ARIA 2DETA 5H7XA 1MB9A 3PNBA 4CT0A 1OWOA 1VBMA 1NZJA 3UC5A 4HK4A 1KQOA 2RD2A 1F4LA 3H05A 1VBNA 4H3SA 3S3TA 2EJCA 1WZ2A 3QTTA 4MW2A 2JAXA 1J70A 2ZP1A 1EJ2A 1EFVB 3E27A 3P0HA 2HGZA 2YWCA 4WSOA 3MUEA 4PBRA 1EXDA 2D54A 1F9AA 1OBCA 1Q11A 3U1VA 1ULHA 4ZT5A 3DO8A 3IMGA 3CVVA 1JHDA 3CLSD 2E0IA 1GTRA 4ZT3A 1PFWA 1WXGA 2XRYA 3TZLA 4JXZA 2A7XA 4I6GA 3RJZA 4MAFA 2WQ7A 2J08A 3H9BA 1M8GA 3COVA 1MAWA 1QRUA 4MVXA 2AZXA 1N2BA 3SZ3A 4EG1A 3CA8A 1TYAE 3UK2A 1RQGA 2DXIA 2QJOA 1O96B 4MWDA 1LI7A 1FFYA 1TYDE 2NZ2A 4MUIA 5TEWA 2TS1A 4ZT4A 1G59A 3G59A 4YP7A 1O5TA 1MB2A 5TGTA 3F3MA 2PZBA 1WQ4A 1K4KA 4K03A 3IVCA 3INNA 3G5AA 2A1UA 1OWPA 4NATA 2JANA 4DJAA 2DPLA 4MQ6A 4MW0A 2CYAA 2HMAA 1KQPA 3COWA 4EF6A 1VL2A 1EFPA 1KKUA 3IOCA 4R0NA 2PFSA
chains in the Genus database with same CATH superfamily
4YPOA 2X1HA 3ISJA 3I9NA 4A8JA 3Q4GA 1FFWA 3PT9A 2EW1A 2X3YA 1G5QA 4R41A 4M49A 4Q3KA 3QH4A 2Z2YA 1TZJA 3NBXX 5FAKA 2PSHA 2PANA 3SNKA 4LF8B 1MAUA 2XHZA 4WACA 1UOOA 3M81A 3CE6A 1YCGA 1EWVA 4I1YA 3VTZA 3ZLTA 5DWQA 5HE9A 1XXHE 1R0XA 4IDOA 4GBGA 1GCIA 4K28A 1IL0A 1Y5RA 2FPMA 2IYAA 4URUR 1ZOOA 5HRCA 1DBIA 1A9PA 2ATVA 3OZVA 1RU3A 1C8KA 2EKQA 3OCJA 1CRQA 3U7QA 1ST2A 3U39A 3D6VA 3MUFA 5BW5A 3R0VA 2RAFA 2ZJ8A 3M83A 4BU0A 1JPJA 1SCKA 2LD4A 2QS9A 4FQ7A 5EE1A 1H2HA 2QX7A 4BTLA 2DY1A 4TRRA 4UU8A 4YJFB 3K5IA 5CD9A 3BJIC 1F17A 2XF8A 1HQDA 2W93A 4KBYA 1VA4A 2QDXA 4MDFA 2CSUA 2TMDA 4GWLA 2PH7A 3O4JA 5AVVA 3U44A 2FPPB 3FGZA 2AG8A 3NPAA 1CUSA 3TPZA 1V3QE 4ITRC 2PZ8A 4PC3A 3DCNA 4PCVA 4B7XA 2ZATA 4BO1A 4E33A 1IMJA 1B93A 3L1HA 3PFCA 1Y9EA 5DT9A 4UUBA 3F5DA 4I9FA 5FOUA 4XD7D 3L8ZA 3RSZA 4LYFA 3K6SB 1RI1A 3Q7EA 5AVKA 1O6ZA 1C4WA 4Q7EA 5JSYA 2JD2A 5JMPA 5ALHA 2GK4A 1JIIA 1S9DA 1XTVA 2PKQO 1NP7A 1KRXA 1PR5A 2Q5QA 3K3PA 4PPFA 2PLFA 3MA0A 5FYQA 5DNUA 4CIAA 3GMTA 2EARA 3BOSA 4EMSA 3VO9A 5K0EA 2DJ5A 2VWHA 1W0JD 4N54A 2C7QA 4FI3C 4YJGB 2JLWA 4KWTA 4RKEA 1QP0A 2H9YA 5BQFA 5CA0A 1X0XA 2JDID 1A72A 5BV1A 1PT6A 2BFCA 4KHZA 4PICA 5JRDS 2R1VA 1I4EB 1N5LA 3HV2A 2X0DA 4Z5XA 2W48A 2REXB 3OOWA 4OBWA 2GPNA 3K0CC 3PIDA 1HETA 1RQ2A 1U2DA 4K1XA 1WDWB 2G8NA 2Y0BA 4KXWA 2BRUA 3IQFA 2H4ZA 5CFPA 3VKGA 3UT5A 3B13B 5EMLA 1A27A 1IZ8A 4P0PB 2XNJA 2D2IA 2EDAA 1ZXXA 2FUG6 4Z1OA 2XKKA 1SXPA 1CUIA 1YSCA 1USKA 3IQZA 4GMFA 4HDOB 3Q87B 4ZC8A 1RRGA 1FMJA 3R0ZA 4J16C 1DZ3A 4V39A 3D1JA 3HKBB 2P5YA 3WLLA 5K0JA 4FGWA 3BGSA 5EJMA 2NUTA 5IF9A 1GTZA 1ZCAA 1YJ8A 1D7AA 2WB4A 1VG9B 3I5XA 4GPTA 4YT2A 2G88A 4DUZB 3V9AA 4YPFA 5CCXA 1L6RA 4YJDA 2EATA 4JUCA 3AOGA 4E08A 5MFPA 2GCOA 3KSAC 2P2LA 3B52X 4PFSA 5EJGA 5A5FA 2WWGA 4PR3A 5TPWA 4BRWA 1QLHA 2HEIA 3VO1A 2H18A 2H92A 2MYNA 5AK4A 3SC6A 5FT9A 4WWHA 1HT0A 1SFRA 2GEVA 4P53A 3UOAB 1SUDA 3HKCB 4MR8A 1C7QA 2C99A 2PUWA 3PLNA 5DCUA 5DISB 1H1LA 3PNSA 1GZUA 1HG0A 4ZVUA 3R7FA 1NUHA 4X6XA 4LY0A 4G0NA 2B37A 3EEIA 1IEXA 3V32A 3OURA 4Q9KA 4HWTA 1CUZA 4JJFA 3P2MA 2WLTA 1P3DA 3O9VA 2FK7A 3OOYA 3NB0A 5DSZA 3Q0EA 5L6LB 3CF4G 1DEKA 1K92A 2X9QA 1Y3DE 4M9RA 5EPOA 2B20A 3EZYA 3UWKA 4Z3OA 5D2CA 2GZRA 3ENQA 2HSWA 3VC1A 3MW8A 3GUCA 2BKVA 3ZDDA 1YU9A 4D56A 4TTRA 3FDXA 3LHDA 5CFMA 3Q15C 3UGJA 1CZUA 1Y1QA 2VWQA 3UMYA 1YR2A 1Z34A 1ZG3A 2YJZA 1L7VC 1YZHA 1YAHA 3TIIA 1PR6A 3A6GA 1J5EB 1JP7A 1X1EA 1VE3A 3PE3A 5F3DA 5JVDB 5DM60 2QTBA 5KJ6A 1Z0AA 2XE4A 4MAMA 1XRLA 3E4CA 3KXLA 3GXOA 3ROMA 3DKPA 1FTWA 4GXRA 4KACA 5KYYA 3PQCA 3OQJA 2QE7A 1Q7TA 1RDFA 2WHPA 1RYZA 2ZUWA 3GEMA 4JGBA 3SR4A 4IIHA 3HWWA 1GG5A 3D6TB 4QDTA 1K6XA 1W581 3OHSX 5I4CA 3KQWA 1XHFA 1W30A 3FGPA 2JI8A 2IYRA 3A2LA 1D1QA 1U8AA 4N0MA 5FNVA 1MQ9A 4AICA 1UOQA 5LP6F 2COKA 2XBUA 4A0GA 1IQUA 3R3UA 2QGZA 2XGGA 3RBAA 1T4CA 3H2KA 5JXHA 1IOVA 2WT8A 4OMUA 4K6OA 2IDMA 1E9SA 4ECEA 4KI7A 2VPYA 3FNRA 2EDCA 2QY9A 4DG9A 2NTEA 1KP2A 2FU5C 4XJVA 3SP1A 1GR0A 4DADA 4FD2A 1C80A 4ZAFA 4KLCA 4H27A 1U3VA 4YRDA 1R9GA 3HKDB 2C2ZA 1MFZA 4ZI2A 2ZPUA 2OV3A 1SUCA 1E3TA 1GPJA 2P0YA 5C8VA 3OZSA 1A7KA 2YY6A 5D3ZA 2UYYA 3LT1A 3RKRA 1AHPA 3MTDA 4IV8A 1QSGA 3I2YX 1C4OA 1NRXA 1ZLXA 4TWBA 3B1FA 4ND2A 2XNKA 4YX9A 2O8BB 2F3QA 4S1TA 1N5MA 4PRLA 1YZGA 2CXQA 2O8BA 3UHPA 5BMVF 1K4MA 5IJ9B 2CXHA 3F67A 3KYBA 5C34B 4EVRA 3OQVA 4MTCA 3L6CA 1H2BA 1WD7A 3SWWA 1VMDA 3ZJ5A 3NHMA 5EXTA 4KO8A 4NU0A 2W6JD 1L5FA 1F2DA 2ODWA 4WUTA 1TYZA 2G67A 4Z0NA 1D6SA 2W43A 3KB2A 4QYMA 4OY3A 2YWJA 1RADA 4P80A 4UTZA 3DE1X 1BJRE 1GILA 3C74A 4C88A 4P3YA 3RVKA 3CUEF 1ZAYA 2FPSA 3IJRA 4MQFB 5JS6A 3EXIA 3O26A 4DLUA 4NFSA 2BFEB 4TQUS 4YP0A 3LZCA 3GPIA 2VLIA 1HNWB 3CM0A 4HB4A 3RTBA 1BH6A 1J7JA 4XYLA 1S2OA 3BXHA 3C15C 3R6LA 3BPSA 4IIFA 1Z5UA 2OGUA 2ECPA 4WZAA 2ILVA 4HDRB 3JAMA 2J6HA 2QRZA 2FPUA 4LW8A 1SXHA 5THKA 3QVUA 3UKOA 2OYCA 3FB4A 5IVPA 3ZCUA 4BLPA 1CRLA 1J0AA 1IPFA 3HACA 3MG9A 3A0RB 4PBSA 4E14A 1YVRA 1ZH2A 4PEVA 4YH1A 1NMZA 1DTSA 1N92A 4ALIA 4L95C 5AVWA 2EG9A 5JSUA 3IP6A 4LMRA 2RJOA 4F2HA 2M1XA 2HCBA 2YHIB 1YFLA 1DO0A 1G8MA 2ACEA 4XDZA 2V7TA 2C5GA 4Z86A 4MTLA 1KAHA 4ZOCA 3B5IA 3EUAA 1CWUA 1RTKA 2E1PA 3HCNA 4IOJA 5DNVA 1RAGA 1XELA 4RETA 4BNFA 2QKYA 3O4GA 1X38A 3QOYA 1NR7A 1U9IA 2ZRHA 3H5AA 4NK4A 4RD3A 1T2VA 2NYUA 5BN5A 1LRLA 5BRNA 4C6HA 1QO7A 1RLJA 1ZVJA 2YZGA 3KPWA 4RD1A 4CLOA 4OHBA 4DM7A 1SVWA 4QBHA 4ZAWA 2FR1A 1MA3A 1MORA 4R40A 3C6MA 4DA9A 3WLIA 2HV9A 1KI1A 1UMDB 1ISGA 2C88A 4GQBA 4YMWA 3W8EA 1OWLA 4TX1A 1X9GA 2XUOA 1NE2A 3DJFA 1Y9JA 1ND5A 3UENA 4EJ2A 4C2UA 2UVPA 3DULA 4NH0A 4TMWA 4EJ6A 3GAAA 1GZSA 1J8VA 2CJYA 3JYQA 3N2KB 3GZJA 4GLBA 4MQBA 3HEAA 2HSGA 4WKOA 3AK4A 4H31A 5HK9A 1EJ0A 1KERA 2IHUA 4MHSA 4WCFC 5AW8A 3I6QA 1FFXB 1SA0A 1HE1C 1Y3IA 2IP2A 3IAHA 1PT8A 1GDDA 2QG9A 3GFFA 1D3AA 1XEAA 2ROQA 4YROA 5DHPA 5AH0A 2HCFA 5LQAA 3MB5A 5F1KA 2VP5A 5JNUA 1XVIA 2CDRA 2BHRA 5JS8A 4H7PA 2FQXA 2GKOA 1JZQA 2YJ4A 5DOZA 1WHSA 3I3SR 3FHLA 4WBSA 1Y1RA 2GBCA 1N2GA 3W5JA 1LTQA 1UP6A 2Q49A 2FWPA 1J2YA 3DEHA 4GX2A 2G9NA 4YEDA 3CJTA 2NV6A 1Z0FA 4R98A 4DY4A 3BWDD 1SOMA 3AONB 3PQ3A 2VSXA 3OP1A 4RABA 4GPBA 2G7MC 1FDWA 2VDWA 4N82A 3LCUA 4XUEA 3ND7A 4U8HA 1VPWA 3L7OA 2DR0A 1H94A 4B81A 3UGKA 3FFXA 4UARA 3S7TA 1TZMA 3UJ8A 2P7IA 1E69A 1ZD5A 2G3YA 2PSEA 2IZOA 2QL5A 1Q15A 3K30A 4OM7A 4X1IA 3T1VA 5ICCA 5IYZF 3O6VA 4JUBA 3ULKA 1ECCA 3PGMA 2ZSHA 3GB9A 4H0CA 1V95A 3EBPA 1LA2A 1XDSA 2LDBA 1H0SA 4O5AA 4RA6B 3DVLA 1Z6AA 4RGBA 1GVHA 4UJ3A 3WLNA 1E5TA 4DJFC 5CXSA 5DHAA 3MINA 4MWTA 3ND6A 4MGEA 1LU9A 2WHRA 1TF5A 1SNYA 2BTQA 3EMDA 3KCNA 1UXJA 3FDJA 4FMDF 4RE6A 1BDIA 3GGGA 1G6Q1 1X7YA 3NVDA 1QIMA 4ZIRA 2YWGA 3CZRA 4LSGA 4XXHA 1XZEA 1ZGZA 3KZCA 1RE0A 2DECA 4R0VA 4UMEA 4IV5A 2C9BA 1CF9A 1G16A 2OAP1 3R0XA 5M29A 3JD0A 1WU7A 3C70A 2IIQA 3GUUA 4WN9A 3W7VA 4A03A 2DJIA 1VFPA 3OLQA 4UNQA 3VPBA 5DLDA 4HZUA 3ZLJA 4IUCS 5E0KB 3D6JA 3GX1A 2Y0PA 4CGZA 2O54A 6ADHA 1NUUA 4HFJA 5T3YA 3SHFA 1ZNQO 5KNBH 2FE4A 2QL7A 4HHEA 1BXKA 1DPGA 1UM8A 1GSAA 3NEJA 4HQOA 4IHJF 4F9FA 1XCOA 1WUTA 2QVZX 1EBBA 4URZR 2QD3A 4O1MA 1WXFA 3RU2A 3PQFA 1XG5A 5AVRA 3U7FB 1NG9A 1RYEA 3RS9A 3FCOA 4UHJA 1TAHA 5K7SA 3T9CA 1P7CA 3NT4A 1BGVA 5LKAA 3GUZA 3R5XA 4IO1A 4I5FA 1IY9A 2VCHA 5F64A 1ZN7A 2WQZA 4J0GA 1H66A 1A9XB 2OBYA 4LUCA 3WAKA 1L4EA 4A2WA 2WJIA 4XX0B 2XUHA 1OD6A 1Q50A 5JEDA 2ODEA 5TARA 2AQKA 3PKJA 4CT0A 4KXFB 4DLAA 1GPDG 1AK2A 2WPNA 4JVOA 4FWTA 3F1KA 2RK3A 1WUKS 2R4TA 1SKMA 1J8MF 3PEVA 2BGKA 4X71A 3F5SA 1MAAA 3HRHA 3KYJB 2HJRA 4QDXA 3COSA 4OH7A 2RH5A 2JI6A 1I80A 4O3FA 3RSOA 3QP9A 2PX5A 5IRCD 4GG1A 3HA5A 1LJLA 1CVLA 3BHMA 4WCVA 421PA 1TM1E 3OTQA 1M5TA 4HYEA 3Q8KA 5AM3A 4JP5A 2GA8A 4L6IA 4UCXA 1PKXA 3BXGA 4HPXB 3TZHA 1SBYA 5IS2A 3GH3A 4GX1A 1T8UA 4XJTA 2KWIA 3DDHA 4E07A 1BXGA 1OBCA 4OQFA 3TQQA 1H8HA 3HU2A 3ZGLA 3OPMA 3G17A 5G4LA 1Z4KA 2C00A 3T35A 3R3VA 2EOAA 1HYQA 3IUNA 4L75A 1TZCA 1LDEA 2V7XA 3H0KA 1ZKMA 3BF8A 4LXUA 5DWDA 2JLUA 3GJYA 3EOZA 3EARA 3L43A 3O1IC 4ER0A 2BHLA 1K98A 2PX8A 4LF6B 1N2BA 4JSRA 4CG1A 1WBBA 3IV7A 3T4XA 4IJQA 3LP6A 1B6SA 4R7GA 1Y1LA 3G0GA 1I32A 3WHLA 2ASEA 2BF7A 3UCEA 2IYVA 3NVAA 3Q9NA 5EE0A 3SIRA 1Z3CA 4XI9A 1H2FA 3U6BA 1QFYA 3OT5A 4YP7A 1Z4NA 3GUVA 2HWWA 3TI7A 2V7QA 3DUFA 2PX6A 3KBOA 4K03A 3OE7A 3R7NA 1JX6A 2HCTA 3OZCA 2I2BA 3WWEA 2A1UA 1X3LA 2OENG 4HFRA 4C6TA 4R16A 4AZ3A 3GUYA 3WL5A 2GJSA 3DFZA 1UIRA 4M7WA 1YWGO 2O8EA 4IM7A 4UHEA 3FROA 3KWFA 2WD7A 2ZRJA 3S7ZA 4R0NA 1T5BA 4S1VA 3VV3A 1EE9A 3ENKA 4B6EA 1TNDA 1TXGA 1EZZA 4BFSA 4BJ3A 2XY4A 2ZJ1A 3BTVA 4QVGA 3ZBPA 4QGFA 2QBYA 4NJMA 3RYHB 4TL8A 1MCZA 1K6EA 3HB1A 4G26A 1YXMA 3E6AA 4L4SA 1TYCA 4ZDKA 2YR0A 1RD4A 1R37A 2GVNA 2FJUA 3IIIA 2C58A 4N9WA 1E2NA 2BT4A 2CLLB 4GHWA 4IP0A 3GD7A 5FL7A 4GDFA 1JDSA 2YWRA 3PGVA 4MB2A 3UJ9A 1RI4A 4LE2A 2AF4C 2GB4A 3AVVA 4D6YA 3R20A 4F4DA 4QC2A 2QRUA 2R86A 3WJ7A 2AJCA 2JIZD 1YB5A 1ZZEA 2FK8A 4E1AA 2ZYGA 3ZY6A 4AYWA 1RWKA 4HNRA 4MA5A 4IIBA 4IW3B 3R7WA 2A33A 3BG5A 3SMQA 1IXZA 4F38A 4NKRA 1CNFA 3ZCXA 2IH2A 5ENDA 5DO9A 3I5UA 2R7AA 3TW4A 4WGFA 4AP5A 1YE3A 4HO1X 2ZIZA 1JQJC 1BX3A 1Y34E 4JLDA 4OA5A 1KZHA 2FF5A 4HXEB 1E9VA 2C5LA 4TXLA 5NLLA 3VU8A 3GUHA 2Q1SA 4C04A 2NO5A 1XRNA 1SUAA 3Q7TA 3LL4A 1B6RA 3TN7A 4G3XA 4OHMA 1U0GA 1GNVA 4YQYA 3QLTA 4DMCA 1AURA 1JTVA 1A5ZA 1P17A 2YICA 3EA5A 4B31A 1ONBA 2AA3A 3LUDA 2QUHA 4Q4AA 4D8VA 2GZ2A 5CX4A 4EW2A 5KKNB 3U1BA 4Q01A 1XTSA 3BK1A 3H8SA 5K2OA 4DXDA 1REQB 2QU8A 3HYSA 3RJ5A 1QPBA 2A4MA 3OAAA 5IMSA 1Q83A 3PZRA 7AT1A 3SBXA 4N12A 1BGXT 3G0BA 1TIKA 4XYBA 4EHKA 3IUEA 3O2QB 1MH9A 3I0NA 3DV9A 3K0EA 1S2MA 3SGLA 3AHIA 1UK9A 4AUMA 2YYAA 4H4DA 3C39A 2BI8A 2N1BA 3OFSA 1LRKA 1U90A 3TMKA 2WK1A 3QYJA 4BS9A 1A7AA 1GNLA 2ZU6A 3D1LA 2BEUB 4HDNB 2VN8A 1UOPA 5AVZA 1SELA 3SC4A 5IC6A 1U3WA 1VL8A 3L1VA 3QPDA 4MPJA 3QI2A 1D2NA 2QM0A 2AWNA 3CT6A 3BMQB 4AT1A 1S1MA 1SD2A 4A73A 1DAGA 4LXHA 5HQ3B 1Y3AA 3B60A 4JXXA 1ZYUA 2RHMA 3H6KA 1RS0A 1Q6YA 1XTUA 1M6VA 2V7VA 3BFVA 1WSDA 5EP4A 3LCRA 2IU0A 3TLBA 2VLBA 3MCZA 4QU5A 3H3FA 5DRTA 3TEMA 4C87A 1QHYA 1DC4A 1QYDA 2HH9A 3U40A 2Y1LA 4KFRA 2I4IA 5G1PA 3THYB 4HY3A 1U6IA 1Y1PA 4JNCA 4P5PA 3G8AA 4DLYA 4Q6BA 4L5AA 4A5SA 5B7GA 3CF6R 1I2CA 2ZYAA 2ZQZA 5I8WA 4W5OA 1DGQA 5EP3A 1UXOA 1OUMA 4Z7QB 4A8PA 3JVEA 3K8OE 3K8QA 3LNTA 3UFBA 2YX1A 3QOWA 3SAJA 4X3OA 1E2LA 1Q0RA 4KH1A 1SOAA 3W2TA 3TQOA 1SCJA 4E0BA 3BRQA 1NWHA 3LSYA 4JC8A 3O0DA 1R6XA 2BR4A 4JMLA 4PYQA 3WKBA 1XF1A 3C1UA 2PBRA 4WD3A 1AGPA 1XQYA 1LRJA 5B3AA 4ZVVA 5FBWB 1XUOA 1O97D 2ZYUX 3MTBA 1XZCA 5E4FA 3HSYA 5BP7A 4D46A 1ZM7A 3BREA 1AKNA 4NEQA 4QGGA 3HCDA 3T06B 4MS1B 3V1TC 1CR4A 3GD5A 3W9SA 2FKNA 1VGRA 3M6LA 1HTBA 3GARA 4NTZA 1PJAA 3WJ2A 1QHHA 1A5BB 3W8RA 1CUGA 1CU1A 2G70A 1N8TA 3PD1A 2O2SA 1UJ2A 3GCWA 1AXRA 3OKPA 4IDPA 4OL0A 1UZAA 4F3KA 3AKZA 4JCCA 3F46A 3A4IA 5DXJA 3LHIA 3TX6A 1OBVA 1PG0A 1YUNA 3PQ6A 2O9JA 4HQNA 4GVLA 2FFBA 1R0SA 3J7TA 5DTQA 5T64A 1W49A 2C5BA 3FAKA 1IUOA 2ZJAA 4WVLA 1WW8A 2FWAA 4R71A 4ZJZA 4X85A 3K6SA 1M2JA 4BBJA 5BSWA 3M49A 1FRQA 3C14C 1KGSA 1WQ3A 2PSJA 2J0QA 1O6BA 3PC3A 1K66A 1XXLA 1C1HA 3KD3A 4PXSA 3SZLA 3ROQA 4Y98A 4YMIA 1OOEA 2X8WA 4IVPA 2CLFB 3K9BA 1V3VA 2HBRA 2QRPA 3BGIA 3OZFA 1TGYA 1V4VA 2IPAB 3FOBA 2X0EA 2VTBB 2PXCA 2HFJA 4ZZ0A 1HLDA 3QV1A 3IAXA 4R83A 1W2WB 4HAYA 1PLLA 2J0SA 1P7YA 3AF3A 3TZKA 1IZZA 4IUBS 1I5RA 3K73O 2ZI3A 3DYVA 1PNTA 3AU9A 1T6BY 1GUDA 4Y2YA 5TGDA 3TIGA 1APBA 1LDNA 4UTPA 2C4KA 4FONA 4UE6A 2UXDB 5DBFA 1E0SA 1RKUA 4DDWA 1DL5A 1JDUA 3BJRA 6NULA 1R5BA 4PIMA 4LWOA 3HI4A 1ZP6A 2OAQ1 3PFGA 4U2FA 4DQLA 1W19A 2Q27A 4U00A 2JKYA 1WF3A 4BHTA 1AGXA 2GHQA 3N0VA 4JWKA 1VI5A 3VAAA 2YBEA 2VHVA 3P27A 4E7OA 1DDGA 3HN7A 2Z2KA 3I32A 4ZALA 3ZV3A 2BIFA 2ZRGA 5HCNA 4IYRA 1ZCZA 4B79A 3DTVD 2H2WA 2VUSA 2SKDA 3CLTD 5JAMA 4F06A 2J09A 1CUDA 4RVUA 1BCRA 3A6KA 1YONA 2QJRA 4FCCA 5B2ZA 1Y7LA 2Q3JA 1CJKC 2X5OA 5JASA 2QTGA 4IXDA 3TLGA 2EL7A 4KKVA 4UHKA 2C54A 1SKAA 3C5HA 5CDHA 1CY2A 3UHJA 2FN9A 1QQBA 3ZV7A 2R6HA 2VIIA 2J6CA 3OC6A 3OLWA 3OJFA 2FVXA 4MYCA 4Q3LA 4U9UA 5AVYA 4C7OB 2VJYA 2K87A 5L7YA 2VPXA 4CDRA 1E3MA 1S5PA 1ZINA 3H86A 4XEHA 5CU7A 1P3JA 1A76A 4XWWA 3AVWA 4PXYA 1O0BA 2QD5A 4L6AA 1HWYA 1VLMA 5JZBA 1B73A 1BWPA 3BFKA 1J42A 2VP3A 3D3QA 5DM2A 3VPAA 3ZWYA 1BXZA 1FXSA 3C4VA 2H59A 4G0QA 4O0LA 5SY9A 2OFWA 4DC0A 1G5HA 3EBLA 3JD1A 2BMJA 1NPYA 2HU8A 4P8RA 5CFNA 4AFNA 2NXCA 1W0KA 4H7IA 2FPGA 4EJFA 3GEHA 1U9IC 3U48A 2FMFA 5ALXA 3B78A 4PXAA 2AOWA 1B6GA 5IEBA 3RC3A 1P33A 1B8NA 3MK31 4GGPA 3RUPA 4AJ9A 1NW4A 1M2OA 2IHVA 3ISVA 3ORHA 4CI9A 4EY5A 1JZSA 4N7MA 2F9FA 4TV8B 4CEIB 2F3RA 1TFRA 3NC4A 1HDXA 5DYYA 3E3OA 3H19A 5HM6A 1TPZA 2ZRFA 1H1TA 1XD8A 3IOMA 3DEYX 2I3ZA 3IUJA 4H0FA 1DNPA 4Q1CA 5LOVB 5BQOA 3S28A 1FF9A 3CRNA 1Y7HA 5KVAA 3SZMA 2CLHB 1XF9A 3GLIA 1H8ED 4UZSA 4BV9A 1RI3A 1OT5A 4R4JA 2XYRA 4II7A 1EAMA 3E5RA 2C4VA 4YPVA 3FHOA 1OH5A 2NYVA 4TKUA 2AVNA 2IF0A 1HDZA 1X3SA 4XGRA 4O4IB 1QIIA 3HO6A 1RHMA 2AN5A 5IBQA 5JVDA 4AY3A 4UASA 2A59A 2J48A 2WAYA 2R1TA 2W5UA 1IXSB 2OFFA 3NEYA 1RPZA 3EXHA 3ZK9A 2YUIA 2ZJ7A 2JFNA 4JZYA 3PC7A 4NSNA 4INZA 4AZVA 2Z6QA 4QREA 3HO1A 1DWPA 4NY1A 4XB1A 3IEVA 3QPBA 4DIBA 3AVQA 1JDBC 5JNRA 3U09A 4R2MA 1L5OA 16PKA 3LKVA 3S2IA 4BJHB 1QRRA 4EHLA 1U31A 3JQ7B 3HWRA 4ZTBA 3RHFA 2PYZA 4EZBA 3STVA 1MG0A 5JXWA 1CVIA 1JJBA 1TAGA 2ID4A 4O2LA 1HZZA 3FVQA 2IYXA 3HWSA 5D5PA 1N6LA 4K6KA 4NABA 3KAJA 4AWXA 5B6IA 4WKCA 3WIUA 5EKDA 2G07A 4RHCA 2F67A 3LTEA 4QQNA 3V00A 2BUBA 2NYAA 4KJXA 2IPMA 3DP7A 2O59A 4Y2UA 5DBHX 1QKKA 2ANBA 3LHFA 3WWCA 1HSZA 4FI3F 1H0KA 1VG0B 3ML1A 1JA0A 3BDAA 1RWPA 4XPIB 2Y4OA 4A3SA 2XDQA 3OOHA 4I55F 2XSZD 1G2IA 1KAEA 3L8HA 3FTEA 2HPVA 2UV8A 3L0SA 3PXGA 2JHFA 3A6JA 3DVRX 3K5WA 3W05A 1Z3IX 3BQNB 4DIKA 2VSNA 2OVFA 4MVJP 4CG0A 4ILKA 3ZHRA 1HE2A 2DLDA 1YJQA 3ZVLA 1DQNA 4LJ6A 1G7CA 1TMOA 5DTEA 4I4TA 2HRBA 1SJ9A 2P6RA 3L6DA 2WUWE 5EJ8A 1L7BA 2EX4A 5IJ9A 1KA9H 3ZR4B 1G3RA 3WNVA 1QUFA 3T3DA 3NTLA 5FADA 5D5HA 3LT4A 2ZVPX 4F9TA 4N01A 1GL9B 5GQSA 2NWQA 2EFCB 4HJRA 1C1XB 9ABPA 2C9OA 1QRDA 1RYMA 4ZWNA 3SI7A 3LQ1A 4EABA 1ZQ9A 5DWVA 1GPWB 4PZPA 3ZS9A 5TJHA 3V7YA 2GXAA 4ESVA 2DFPA 3TE6A 1EDDA 1BS2A 2B5VA 3PITA 4DSAA 1E66A 3PUVA 3REFA 2AC2A 3A0UA 3DL0A 4RZ2A 3D5QA 3M7IA 1NQOA 1DKUA 1ORVA 1JFFB 1MO4A 2V7WA 2WOOA 3JZMA 4V0ME 5A6SA 3KZOA 3FIJA 4QLOA 3E8SA 1BEUB 4IUDS 4KI0A 1NI5A 4RY0A 3C7AA 4KREA 1GRQA 2YMPA 5CB4B 1P4AA 3BBPA 3WL7A 3WGLA 2HPZA 3EODA 3FZYA 1D0VA 2ZZNA 1GQQA 4H7DA 2VP9A 3X1KA 1ZBQA 4C4TA 1A3CA 4DSZA 5CA1A 5EGSA 1M2NA 4P2BA 2AOVA 1U8TA 4CN8A 4GP7A 2I7VA 3AERA 4HNUA 4KOEC 2Z3WA 3KQOA 3W6UA 4O08A 3DL7A 4M0DA 3FYCA 3L7KA 1IIRA 4G5OA 2QIPA 4OFWA 4LGMA 1J90A 1FP7A 2RBEA 2FPOA 2E9SA 2PA0A 5T41A 3WX0A 4ZQIA 2XOXA 1TTHA 4QEKA 1QFSA 4EQ6A 2GBLA 3TXXA 4KQXA 1YQGA 3ACCA 1ZD8A 5J4HA 1G8GA 1L7QA 2HT6A 2OFOA 3H8VA 3MUNA 3ENNA 4I3GA 2CJWA 2GTHA 4UFOA 3RT9A 1L1QA 4WJZA 3OZ7A 3WGGA 2C5FA 2XQFA 4DCJA 3E7WA 3TTYA 4FFDA 1NVFA 2H9IA 4MJXA 3JSAA 2BEJA 2G9QA 3F8WA 3MGGA 5A0FA 4IJWA 4Z2AA 5E1BA 2IPLA 2PBLA 1X1AA 4G5RA 3ZZUA 5I9BA 5IWAB 4J07A 4D2IA 3C3EA 5T67A 1R00A 3L8YA 3VO2A 2DPMA 4IL5A 5H4GA 4W5QA 2YBDA 3MJFA 2R68A 1DBSA 4ZVNA 5CEJA 4N6GA 1M73E 1WMSA 4LJAA 3V8EA 2YXBA 5G2OA 3NDRA 1K0FA 3IPXA 5H7XA 4GIBA 2QYOA 3DGEC 3WICA 3CYFA 2BVNA 2CDAA 1Z2DA 1U5BB 1P6XA 2F3SA 2Y0DA 2JGDB 3FNGA 1H4VB 1RXEA 2IYYA 3E9ZA 3KKKA 5JNVA 3WP1B 1TM2A 4AJKA 1OGIA 2ZBFA 4EHAA 3DGFC 4TVKA 3E27A 4HNGA 3PHBE 4TM7A 3SHWA 2C4HA 3P0HA 3QX8A 2RI6A 2YWCA 1U7OA 2O8DA 5BSTA 4AKTA 3U19A 1UZNA 1QB7A 1Q11A 2NGRA 3KYDB 4CMCA 4K46A 5AJTA 3HXQA 3OTHA 2H4JA 4KQKA 3CG4A 1FFEA 3OOEA 3SX0A 4N1AA 5EP2A 1ADYA 4ZMRA 3F0TA 2AUTA 4ZT3A 4D6XA 3DL2A 3RASA 2BZ0A 2IU6A 4K0KB 2G76A 1L8AA 2J08A 3H2SA 4DV4B 2RG7A 3TG2A 3LF2A 5AJXA 4MV0A 4BO5A 1P39A 2FVYA 4U6QA 2VCYA 4EG1A 3OQNA 4A2QA 2IT1A 2DRIA 2GWRA 2RHDA 2B1QA 3H1GA 1LWOA 1O6CA 3OLXA 1SOVA 4XQGA 4DLRA 5AUNB 2ZK7A 1CUUA 2Q0XA 3OQOA 1KHTA 4U7TB 1O03A 3ZHTA 5AVOA 2VPTA 4BLOA 2DB3A 1P1BA 1F2UA 3A9TA 3BSWA 1OWPA 1MC8A 2Y2VA 4FYXA 3D3EA 3JYOA 4DLVA 3K72B 3PX3A 4MUYA 5K0LA 3CUVA 5IJZA 4ZYVA 1AB5A 3LF1A 4Q1FA 4Z2YA 4KR0A 2ODTX 2B4KA 3LX8A 1JJFA 1F38A 4FMCF 2RG1A 4LMAA 4EF6A 3C3JA 5K0CA 2FN3A 5AI8A 1US8B 2ZBGA 2PFSA 2ZR9A 3FR8A 1QIDA 2YVUA 2ZYWX 3MWDA 4CEHA 4UM5A 3ZGXA 1PJLA 3LVBA 3MUOA 2R6FA 3PTLA 3D6FA 3EIXA 3P9ZA 3RQIA 4V1CI 2ILTA 5HKKD 4XD7A 1BVUA 1R4MA 5FOVA 4D9NA 5DXFA 4LXTA 2RGEA 3RRFA 2B1RA 3EOBI 1CUAA 1EFAA 3DZIA 4AP9A 1T5HX 1CR2A 1B76A 2NZVG 5T4EA 1QCDA 3JR7A 3RG2A 3QVVA 3F3YA 4QGHA 1C1YA 1ECJA 1K5DA 1Z6PA 2DM6A 2V6BA 2XJ9A 4XX0A 3WJAA 2CYCA 5C8YF 5LPNA 2WFLB 3AVUA 1ZOPA 3M2PA 3B2QA 2FG5A 2W2XA 3SD7A 2SHKA 1LSSA 2OBLA 1IHDA 1W0JA 2J8ZA 3ELDA 1OV6A 1XPJA 3GLGA 3GP5A 1XZHA 4U2CA 1MX1A 3D6NB 2Z83A 4PSKA 4L1KA 2EEZA 2EX0A 2JDIA 4G4GA 3T3IA 4BDSA 3BXPA 5DYWA 4D43A 1JV2B 5JDIA 3GFPA 1IVSA 5TMEA 1F0YA 2ZVJA 2HDOA 5HZMA 1ODFA 2R8BA 5JLAA 3SKVA 3TNDA 3VSCA 2WSYB 3QWAA 5A9SA 5IM4F 3DTVB 3S0JA 1Y6JA 2ENUA 5I7VA 1ICIA 3UAGA 4K6FA 3T41A 1EDOA 5LUAA 1Z07A 3PSAA 4QO8A 1WM1A 2C57A 5K6RA 2QHXA 2OHJA 5FUWA 1Y5NA 2Q1UA 1RQXA 3ENVA 1EFHA 3KM0A 4WPGA 3VH4A 3T1TA 1R5NA 2WWVD 3BIOA 5IZCA 4EQZA 1OMOA 1B8OA 3AVPA 1RCUA 1Y6FA 1NYTA 2P2NA 3OM8A 4FWBA 1LPAB 2QRVB 1GN8A 1T8RA 1DRUA 1YH3A 4ISBA 4GZ3A 1Y7TA 2IOHA 3L18A 1WW2A 1JAHA 2C5EA 4DM3A 2X2OA 3LFTA 1YMQA 4BB9A 3ZLUA 1U5CA 2C42A 4C0LA 3A4MA 4BRZA 4BLSA 3HLTA 4BZWA 1BYIA 4F3RA 2CNBA 2MYUA 1G9XA 3LQ4A 5DNCA 1IXRC 4QPJC 1YA4A 5IFLA 5ITWA 4F4IA 2HXYA 1ZL0A 2CK3D 4MV3A 4P3OA 3RKUA 4Q3BA 4PLTA 1N36B 3IEXA 2OK8A 3HVIA 4MVJA 2FPXA 1MRNA 2OORA 2QGNA 1H42A 1NVEA 2PMDA 5CLLA 5EQDA 5FNZA 5JUWA 5JY1A 4K7JA 1MJ5A 3FPSA 1GNRA 2XITA 4WKGA 2GUGA 1T5DX 3R0JA 4IG4A 4LRTB 4AL4A 4IWXA 4P0TA 4OI2A 4OB6A 5U1PA 3FOWA 9ATCA 1WMFA 2C2XA 3U0BA 4QRHA 4XUCA 1F8XA 3NDBB 2EP5A 4UTNA 4G1BA 3L07A 4DBVO 4DB2A 1NVXQ 4RCVA 1AX9A 1MB4A 3KJIA 3QVLA 2H3EA 2OV1A 2HUPA 2V4UA 4FDAA 4FHEA 2OPHA 4A0HA 1FMFA 4XM0A 5B1DA 1SXJA 2EGGA 1V25A 2GJKA 2MSKA 1O0SA 4YALA 2FV8A 2KSQA 2R9VA 3A06A 3CX8A 3VI3B 1SQFA 4DMUB 1VJCA 5CLQA 2BHTA 3RFTA 3RVSA 4TTVA 4B0PA 2W6CX 1WCYA 2H54A 4A9AA 5ESDA 2OB2A 1QDLB 4ZI5A 5LB4A 1QVAA 1Y6GA 3BSFA 5F1PA 3QGMA 4I4IA 4QNRA 3A6ZA 3KUCA 4U2GA 1GEEA 2G08A 3VDNB 3NNDA 3WMRA 5E2IA 2RKBA 3ZEAA 1QH0A 3YASA 1GL3A 4D4JA 4LF7B 1C2TA 1IIBA 1G8HA 1O94A 3H11B 4O5OA 2HGSA 3F2IA 4KMOA 4P9NA 3HYTA 1L0BA 3GPCA 4DEYA 3UJPA 2YZ2A 1SG9A 4LBWA 1NYQA 3C2QA 3UAYA 2GHRA 4CKEB 4EZIA 4JROA 3ZVRA 1J5XA 5JDIC 3BXFA 2XCTB 1YS1X 2GTPA 3R44A 3LSTA 5GIPE 5GY7A 3JQ9A 3S2GA 5BYAA 2HKIA 2I8AA 1REQA 5E4JA 1T35A 1KC1A 1NVUQ 2I4NA 2LKCA 3EF3A 5ALUA 5EMHA 4M76B 5LQRA 3I12A 1G1AA 3G2LA 3N28A 4YRCA 5DBEX 1PO7A 2QMYA 3HNOA 3DVAB 3WRXA 1E92A 5JD6A 2HFKA 1J2UA 4IDDA 1Z39A 2XNHA 3OEHD 3O8QB 1DEOA 1QH8B 4OAPA 3QVXA 1FUYB 3R5KA 4P6VF 4P4SB 4RK0A 1JHXA 2WWIA 1NT2A 1FZQA 4RWEA 2XGMA 1TW2A 1JG2A 4HQ0A 3NH9A 3P0JA 4QYIB 4ITUA 5EIBD 3VPHA 4HDNA 3ADDA 2ONKA 1ZVMA 4OQPA 4D92A 5TQ2A 3BERA 3N7UA 1YOBA 2HD4A 1N2HA 2HA5A 1P5FA 2ZSDA 3P96A 3O03A 3TTUA 5K51A 1RHUA 1V96A 3ABSB 5EC8A 5DH9A 3UOWA 3KXIA 5ARBA 1JHAA 1DCTA 3GMIA 1FMTA 3KJNA 5HQ3A 2GCNA 5G1OA 4B6OA 1PK8A 1XYVA 1WCIA 2VDUE 4ND7A 2C29D 4Q19A 4E70A 3IAEA 4PRKA 3IKJA 3IUSA 4DIFA 1EAYA 4G36A 3FPCA 1DIGA 3TRJA 3TDKA 1A0OA 2NOAA 3E7XA 4RKRA 2YFQA 4OU5A 4BFWA 4O4JB 1UM9A 3G9UA 1OTHA 1N6NA 1E62A 2PNFA 4UE3S 5I7WA 5AVXA 2QRKA 2E89A 4CCSA 4UW9A 3L0DA 4NWIA 5A3SA 4HX2A 3UATA 1T43A 4N7JA 5HBGA 2PZFA 2H31A 2XB8A 4DPMA 3ZWNA 4L6CA 2JAPA 2JFGA 4DZTA 1ETUA 3CNHA 4BO3A 2CL5A 4GX5A 1ENYA 2MHCA 4WXPA 5F2KA 1J9EA 4YQEA 1OROA 1BDJA 1U9JA 5CNJA 4EI2A 1X1QA 2VK8A 3PJDA 4RU1A 3VJMA 1JYFA 2F48A 3CR3C 3CZMA 3UBMA 5DM70 2Z3ZA 3PIRA 1EUCB 1URPA 1Z6GA 2BD0A 2XX3A 4RM3A 5LU9A 1K7EB 1KKLA 2ZSKA 2O1XA 4ZODA 5J2TF 4S12A 1YRQA 3RQSA 1C3LA 3RIEA 5BVHB 4RDXA 1XZJA 1LPPA 2HEGA 3P2KA 3FPJA 3MT0A 3UB4A 13PKA 5FWDA 2BZSA 3IBYA 2P6MA 1CC1S 4JEHA 3L7NA 5I9TA 1CY4A 3NHPA 4O29A 5HFAA 3NW9A 4EG5A 5EIXA 1BWSA 4X93A 2OXTA 1DTWA 2QMUA 4TQGA 1U0HC 4KDEA 3CMCO 1C8LA 4XQEA 3WSTA 1XKLA 3HCOA 1BKYA 3K0FB 4Y2QA 5A4JA 3FHJA 4NEGA 5JSQA 2WG2A 2ZJ2A 4FC7A 2PM8A 1WKCA 2ZB2A 3FMFA 5CVUA 5JE8A 8OHMA 2F1KA 1VE9A 4M0PA 1GKYA 3O73A 4JR2A 2E18A 4ZXPA 4Q00A 4BN0A 2YXDA 3HPQA 1SMKA 2BLLA 1HORA 4RIGA 1YRBA 2WZDA 3H9EO 3DZBA 1RMYA 3VMMA 3RI3A 4QPPA 2IS1A 3DLPX 3EPPA 8AT1A 3MQ2A 1JI3A 3MJSA 3OKAA 3UXMA 3IVAA 3TW6A 4AECA 2W22A 4F7WA 2CSXA 4HG2A 3NGLA 4PX9A 2OV6A 2WZBA 4Q3NA 3FPBA 4ZQGA 4ETNA 1P7PA 1JAIA 3IUMA 4K8RB 3FCCA 1Q7GA 4YO7A 3VXKA 3GBVA 2YOHA 1BH2A 3KTDA 2P9BA 5GM2A 4YYZA 1SHLA 3KOMA 4S0XA 3CY6A 2JGJA 3E9DA 1FA9A 3ZVNA 3H2YA 3R3WA 4MCJA 4NOJA 4UZEA 1EVLA 3CCFA 4XCXA 3CH7A 4C6SA 1IM2A 3H4VA 2HQ1A 2SICE 3KDSE 1SO8A 3JYNA 4NJEA 3ZXSA 2DP4E 3DXXA 1BDHA 1NOIA 2WG1A 2X9GA 2GS9A 5ALRA 5LA6A 1KQGA 1V4BA 1NR5A 1ID1A 3LCCA 3QHAA 4OQQA 4RMGA 5BSUA 2VP2A 3PNKA 3SEQA 2P9GA 5FUQA 1UC4B 3SF8A 1D2AA 4NE2A 1W59A 5IC4A 3SPXA 4MS4B 1S3GA 4CL3A 4ENPA 3QLUA 3Q72A 5EMMA 5LNK1 3ZNPA 2IL1A 1L1FA 4DYHA 4MQUA 3RVOA 2OQRA 3K9QO 1L5GB 4ATNA 1UXHA 3ADOA 5AM2A 1H4TA 5SY6A 1QHIA 2C97A 4GECA 5I7FA 1C30B 3USCS 3EQ6A 2PMCA 3IP9A 3JRXA 5E1DA 5A2QA 2BGTA 3DHYA 3O3CA 2GWHA 1Z73A 1IRXA 2DHEA 3GGDA 2DX7A 3H1BA 2BONA 2HHAA 4PLZA 3TR6A 1FNNA 5IJAA 4TOIA 1UZLA 1A9TA 3AL3A 3FVTA 4K9DA 1LDBA 2VHZA 2HXGA 4H6VA 3PHIA 5ERGB 3QEBZ 4C3UA 1ZVQA 5DHFA 4N39A 3T6KA 2DT5A 3O5AA 1QV9A 1X7ZA 3GEDA 1KMHB 4JLMA 4L4UA 4P7FA 3STYA 4G0UA 4UCQA 4OIMA 1C9NA 3HXMA 5JECA 4MYUA 2QZ4A 3WDKA 4KE6A 4CG2A 3AR3A 3CR7A 4P3KA 1N2JA 4IWYA 3NEPX 1GT91 3BB3A 3R3ZA 2XE8A 4I6JA 2C2HA 2G1UA 4BFYA 3AU8A 3RJTA 3LAWA 4BYMA 3OZRA 3Q40A 4G1CA 5BSFA 4RTJA 4MR7B 1UK7A 5K99A 4X1OA 3K31A 4XGKA 3HRKA 4Q3EA 1EUYA 3WFZA 3C5WP 2GILA 1NJSA 4M0MA 1JJVA 4I4NA 5J4VA 2PGAA 1GTSA 1UBRS 4ZOLA 5CH8A 4ENSA 4QO7A 4LPSA 3DEJA 3E7PA 4AROA 2NQ2C 2GZHA 3OE4A 4CR7A 2GNAA 3H2IA 4LDAA 3SYMA 4GRAA 1IQPA 1BX1A 1DX6A 2O06A 3N76A 5ARCA 4JI6B 5JAPA 4J1QA 2DBRA 4OQMA 4RO0A 2ZB3A 2EWWA 4M8SA 1N2XA 4MV6A 5FTKA 2Q2NA 3GI1A 3JATB 3OJOA 3PXUA 2QMZA 1EX1A 3WRWA 5I9LA 3NCHA 4AZ0B 4PZZA 4J0IA 4I2NA 1U04A 1KMCA 1W2GA 2UXBB 4EW1A 3KSZO 3RVNA 4HVCA 4CLXA 1R64A 2ZR8A 3GDOA 4CIYA 1P29A 3NHSA 4KQMA 1PJCA 4MUXA 5DGXA 3MPUA 4QELA 4ZQEA 4OJNA 1JDNA 4NULA 3OESA 1IK6A 3QBEA 4ER3A 5DOVA 2XZDA 1TZBA 4D45A 2PN1A 3OQ6A 4P54A 3MLBA 3BORA 4TT8A 2Y1KA 5F76A 5AXBA 5TX7A 4UXJA 1VBMA 1NZJA 1Z4MA 2OZLB 4AX8A 4B84A 5BN4B 2PCJA 2O19A 1F4LA 4BFUA 1RAIA 5H4HA 3DSRA 2OBFA 3L8CA 1OLSB 2ZP1A 4F93B 2ZBQA 3VNRA 2MSEB 1T2FA 2Y6VA 3H84A 1R6AA 1EWYA 4M60A 4MWZA 3ZQKA 2IH4A 2QW8A 3WZ2A 3WQBA 1P6QA 1TA0A 1C1XA 4LY3A 5JWRA 4Q4HB 2C3UA 2NQTA 2FMIA 2DPHA 1CFZA 3AM4A 4FYPA 4B2YA 4RY2A 1LBSA 2D1QA 3G9XA 3KV1A 4CKCB 3CVVA 3QY0A 2OCGA 2QZ9A 3IP1A 3K9GA 3B20A 2WV7A 4ZC1A 4G0VA 2J7KA 3B6JA 4N5NA 2FW0A 1OYWA 3JYPA 4K6MA 1ZGBA 1AKRA 2A7XA 3KSBC 4IHQA 4LKOA 1Y3HA 4ZVLA 1YQDA 3CUUA 2VUUA 5FOTA 3VU1A 3ZD8A 3RJ9A 2WU4A 3IPCA 5CRIA 2BKLA 1T8TA 4XDHA 5BSEA 2AZXA 1OXTA 4X63A 3IV6A 3WGVA 5JNWA 4CEJA 3WFIA 3LPCA 1E8DA 5H1YA 5GJWC 1VE6A 1FSFA 3PDCA 5HF8A 1QDEA 3R3XA 5SY4A 1PYDA 3OQMA 1Y4ZA 2ZJZA 3AHJA 4DABA 5HFNA 4I4CA 4JWTA 2Q1XA 4Z4CA 4IFEA 2P4SA 4MUIA 3ZOZA 3EAGA 2JIZA 2ZJFA 2AC7A 1JA1A 2NTNA 2WR8A 3C16C 3FUXA 1GAJA 2QLTA 3MNFA 3W7BA 3CRRA 3G5AA 1HGXA 2B3DA 3I52A 1QGOA 4WXHA 5L53A 5EPEA 1LVGA 3FRHA 5DDIP 5A4KA 4TGLA 5CVDA 5AK6A 4FSXA 4MW0A 1F0PA 5EIFA 1U99A 3SX4A 4MI6A 4Z4QA 1GCOA 2HMAA 5CB0A 1WSWA 5FA5A 4ZI3A 2QJWA 4IF4A 4DEVA 4C9BA 2CVHA 2M6RA 3U3XA 1GUYA 3PXBA 3RRZA 2GZMA 1R88A 4DR6B 1LVHA 2P3LA 3WGJA 3WKCA 3RC2A 4RTPA 4EYEA 1QX3A 3ZY2A 5K1ZA 1VJGA 3FLMA 4B3IA 2IFTA 2VJMA 3N8HA 4W5NA 2KPOA 3P0IA 2DEUA 4FN5A 2E4ZA 2ZRIA 1OKKD 3TE7A 1NRJB 3ESQA 4U1RA 2EBWA 1Y82A 4I3FA 2IYOA 1YJAA 5LDHA 1YS6A 5EJAA 3ZIUA 2BN4A 3VTKA 5JNSA 4Y1GA 1Y9ZA 3AGQA 1ZCJA 3GOHA 5HDBB 3D3WA 2OZEA 3EH1A 3FYUB 4NPHA 4WNYA 1BE8A 1BKDR 5EVJA 1G60A 1T4GA 2HK9A 4G1UC 4A6PA 1MO6A 4AIIA 2OORC 3K71B 1GZHB 3DV2A 3G89A 2Z04A 2XWSA 2FSSA 2OHGA 1JYSA 1ZK1A 3LY8A 4NONA 4IJVA 4KXLA 3SS8A 1M2VB 4RLQA 4AXBA 1AKVA 3JPYA 3ELYA 3M5DA 1JF8A 4UUPA 5K3FA 2NZWA 1WVMA 2CDBA 2EP7A 4GYYA 4KYVA 2OHHA 4YMSA 3EUWA 2J0UA 3ZPXA 1G291 2UYGA 3OCYA 1XCBA 3KYDA 2OD9A 4AN4A 4BFZA 2Q3EA 4KITB 3LUKA 3D8NA 4QUBA 2JCXA 4OXNA 5JQGB 1POXA 4J0HA 2GETA 3X1YA 1FSGA 3W3AH 4C43A 3CGWA 1FLVA 3GFSA 1NASA 4GH5A 4L0DA 2ZQYA 3TGWA 4YT5A 4FOOA 1V47A 3TRHA 2VZLA 3KQVA 3QX3A 3BD8A 5DB4A 4P5EA 4FOLA 1GCGA 5GVRA 1Y4AE 1GFWA 1NXVA 3FETA 4JVMA 4WK0B 4EHHA 1SUPA 5A02A 1UJMA 1F6DA 3OTOB 3DB1A 3HJFA 2NXJA 4BGUA 5E6SB 1KDOA 2PX4A 4X92A 5BNFA 2DFLA 3IQEA 1K8ZB 1UC8A 4KB5A 1DRVA 5KUTA 3ZW9A 7GPBA 5ALIA 4NCBA 2V0CA 1OYVA 2YXPX 3TCNA 5AHOA 1T3TA 3EGOA 4BE4A 4CFYA 1IN6A 5I4KA 2XCSB 3KJZA 3NIBA 3MWEA 3SYRA 4RX1A 4FBGA 1ECFA 1N9ZA 5E6UB 1DKOA 3AMVA 2H17A 3ESBA 1XXHA 3BD6A 3P2YA 3DW3X 1V26A 3RG8A 2H65A 4B6FA 1R9JA 1Z4PX 4G65A 3WYGA 4N6OA 1IHPA 1B0ZA 2QRNA 4R9RA 5EJFA 1ZM4A 3V1KA 2Q4DA 4EGAA 1Q2UA 2Z57A 1US8A 1X9HA 2XA1A 4D9BA 4ZARA 4ND3A 1JG1A 4WNIA 3CG0A 2J7PD 1KI6B 1R4NB 3KJFA 4MDEA 2X4GA 3OECA 4Q37A 3X43A 4BNVA 5AKEA 3G6KA 4JUDX 1WHTA 1TRKA 2WVAA 2F9LA 4H1UA 4KLZA 4B80A 1XAIA 1QPZA 3JQAD 2EFGA 1FUEA 3VDQA 2ZBDA 1U0NA 1X7DA 2CHEA 2ZIEA 2HJGA 5LBIA 4E03A 2J45A 4A8HA 5I7RA 4Q3OA 3H97A 1GNTA 4N3CA 3VH3A 2I65A 1DBRA 2C3YA 1JFSA 4HLDA 1X80A 5HUQA 1VMAA 1L4NA 1CY1A 4IH4A 3K9CA 3F6PA 4IIJA 3SBEA 4TUYA 3ZWQA 3ER9A 1TJNA 1ZOSA 1W5AA 3MAAC 2FETA 3EGXB 1LZKA 4XFDA 4KFTA 2QWXA 3R9KA 3UJDA 3S2SA 1FE8A 1LPBB 2Q5CA 5EVCA 2YHBA 5C8ZA 3T7IA 1UBOS 1GCAA 3ELBA 2H85A 1NLFA 2CCJA 3F98A 5FP0A 3L0OA 1PAUA 3TMYA 2B2CA 4EKNB 3DE0X 4PG4A 4AYTA 1L5ZA 1Z2NX 1ONPA 4ZK6A 2JLBA 1YOVA 3AM1A 3DBOB 2MINA 2UUPA 2PGOA 4FUQA 4MW7A 4XW2A 3DMDA 3P32A 4C7VA 1RC1A 3ITKA 4YRGA 3STHA 4DNPA 1O08A 3C3MA 4YAGA 5E3JA 3RWMB 2WG0A 3AEQB 2Q3MA 2JRLA 1PEKE 3MJRA 2BFFA 4RZUA 4KHPB 1ZMTA 5CHEA 2GH1A 3I0ZA 3I2FA 5EERA 2ACWA 2H0QA 3UTDA 4UBOA 1QYVA 5ADUS 3WBKA 3UPTA 1FFGA 5T5QA 1ZO8A 3IPYA 1DMSA 3E1SA 4EB6B 1D1SA 1EGHA 4GLFA 1AN9A 3DOFA 3KUDA 4Q4JB 3BMCB 2WWWA 1HTTA 1RXYA 3KE9A 3IULA 3R7DA 4CG3A 4BATA 1LW7A 4LCJA 4V0LA 2XUAA 2PKQP 4RQBA 1ARZA 1F0NA 4X91A 4EFNA 1Y4SA 5GV7A 1GZ3A 1ZWKA 3FJOA 5D85A 3I9JA 3PFFA 3F1LA 4TSFD 4HH4A 4EW3A 4MH0R 2HSDA 4PZEA 3NDPA 5GONA 3RK0A 2Y3IA 1D6NA 5H5JA 2F90A 5LYJA 1BXRB 3T8YA 3WL4A 2W8BB 3K96A 2O3TA 6PFKA 1Z18A 2VZ8A 4J94A 4ESOA 4AXXA 1B2LA 4TN5A 2VG8A 5M7EA 1VKNA 3GMDA 1FP4A 2BBOA 1H8EA 4FS3A 1MT3A 3IDSA 3MCVA 1Z7WA 3BFJA 3PHHA 1T1SA 1IQRA 4HN2A 4PY2A 4CM8A 5C1OA 5C53B 3EDCA 4GRDA 1FVOA 4UHDA 3D8HA 5JMTA 2C1ZA 2QAJA 3ZJVA 2MR5A 5JI2E 3E0XA 3PX2A 2FH5B 5KWVA 4HMPA 4MO2A 3D02A 4EFKA 5BVGA 4EG8A 3GOQA 1G8SA 3PG5A 4HWSA 4PQGA 1XLVA 4CQLB 2PRKA 4IQGA 5C3UA 1GGVA 4TROA 4QZVA 2PLNA 1DI0A 1HL7A 1RXVA 2Q2QA 5C31A 1OR8A 1ZJZA 5HE8A 4ZCLA 1QH1B 4ER6A 4BEWA 5LB2A 1PQWA 2QJFA 4TMXA 1LS6A 1RJ9A 1JR3D 2CB0A 3OWHA 4UHFA 5C7OO 4PZAA 4RKWA 2PJDA 3PSHA 2WFMA 1K9SA 2MSCB 3DB2A 1SPXA 3ILSA 3T3GA 4ZCTA 3SHQA 4RTRA 1WUHS 3ILYA 3CZQA 1G4HA 2BCGY 1SEPA 1JPNA 4HT3B 1XZKA 5KX5B 1II8B 1T2NA 2J9GA 1M0TA 3BILA 4NMMA 3PJEA 3FVWA 4MVWA 5EIHA 2NU8B 2EFEB 1A9SA 1NOJA 2FP4A 1Z6TA 2J9XB 3JVIA 4BNMA 3OSZA 3DVAA 3AEXA 4IIVA 1XJWA 4UU7A 5H9VA 5BYBA 1I4WA 2R60A 4GF5A 4AY5A 2IITA 4LWZA 5L3SA 3T0IA 1C7EA 2NAFA 4OLHA 1N6KA 2QR3A 2YCBA 2XSZA 2OMKA 3JD2A 3QBVA 3NANA 4L3OA 1PWEA 3NG1A 2LXNA 5FUYA 2J46A 4QYIA 3FCUB 4DUYB 1Z9BA 5H82A 2COUA 4J9UE 3L06A 3C98A 3GR6A 4FXPA 5FTMA 4MI1A 4E94A 4BEVA 1FJ2A 4CKYA 1X13A 2R6JA 3AI2A 4CWAA 5HK8A 2NADA 1EFTA 2IYEA 5BMVB 3IAAA 3O4FA 1Y37A 2RI1A 3CUSA 2XCIA 2XE6A 1JQLB 1GPUA 1NKVA 1S6YA 1SCUA 2FUKA 1MB3A 1QG0A 2F4NA 2Z2JA 1JFTA 5A4IS 1VKZA 4P58A 3ZKAA 3GPDG 2DWPA 2GESA 2Q5HA 3K1ZA 1LZLA 1P9RA 2ID9A 3GEGA 4MPTA 1PZNA 4O4JA 3P94A 4RBNA 1VIAA 2X23A 4N5IX 1AD2A 1JKFA 5I8PA 3A2MA 2J5KA 2VAVA 3FVVA 3WMWA 2GSDA 4KR7A 2RBKA 3H2JA 1N0IA 2AG1A 5CHYA 3U9LA 4Q34A 1F4VA 5FFNA 1I0LA 3J80A 3DBRB 1TCUA 3I61A 4UDOA 1SRQA 2PL9A 4K9RA 1TFUA 4UHCA 3RWOA 3BT7A 3HR8A 3JWPA 3FIUA 4OYRA 1FBTA 4Y2JA 4B33A 4IIEA 10MHA 1ESZA 2OXCA 4U2BA 4WUVA 4FZ5A 3N8GA 3Q5DA 4Y9UA 4URFA 2P2ZA 3MAJA 3GHYA 4ZICA 2FRXA 1COWD 3ZE7A 1U2QA 4I2VA 2G82A 2ZYTX 2WOJA 2FGKA 2XHEA 1YI8A 4RSGA 5BNIA 1XBTA 4L08A 2G06A 2ZPAA 3HUFA 4CVNA 4I1UA 4TMTA 5EXDA 3KAQA 5BVHA 3HCPA 1P0MA 1U11A 3K2IA 4X66B 4BVHA 4EPXA 3FUVA 3VDXA 5DI9A 4DTCA 4GL2A 2GKSA 1G8AA 3OIYA 4L73A 2HLDD 4OXXA 3U4MA 2D7DA 3H5RA 3LYLA 5GGXA 5TS3A 1PEAA 2Y0CA 3EG9B 5HOQA 3C5VA 3PRHA 4C21A 1QFJA 2BJWA 2QSJA 2IOQA 4P81A 4BP8A 3EQ2A 4BBZA 3IMKA 1N7JA 1PK7A 1U3DA 4TMFA 3ESRA 4LOKA 2G5PA 3KKZA 1G3UA 2BSAA 1EM8B 4X97A 2I4TA 4Y2PA 3FCYA 4IVNA 3GJ3A 1ULZA 2IIBA 1K88A 3CQ9A 3Q2IA 4F2PA 4IWNA 3X2SA 5IKPA 2JGNA 1JDTA 1RZUA 1XZDA 4HGOA 4MRPA 4NECA 4NJOA 2H5EA 4PX2A 3T7KA 3ZLBA 4DSOA 1Z7GA 1PX0A 2VZ0A 2ZWAA 1R12A 2YOGA 1R0LA 1I2DA 2SECE 4IKPA 4LC1A 4C0AC 4P4TA 2WTBA 1W1IA 3RW9A 4RVNA 4EG6A 5JCOA 1L3BA 1YUMA 1WU8A 4DQUA 5ALWA 2A78A 1BN7A 4LSZA 1BA2A 4IKEA 2VNIA 3IJ5A 4IS2A 4U5XA 4IRUB 4G4SO 4F5ZA 4LJ9A 2RGXA 4LV5B 8ADHA 4H4EA 3NTOA 2CHFA 3L7BA 4L5YA 4UM7A 4XVHA 5FWAA 4Z0HO 2CVOA 2OMEA 2NZYA 3MSXA 3UK1A 2V98A 1SVIA 4JUIA 1N0WA 1U6JA 1NBEA 2H6EA 1KYYA 1U4SA 3WBBA 5CB8A 4RTSA 3IUYA 3CVXA 4I66A 1EUDA 2C20A 3H9JA 4KK3A 4RJLA 5K8IA 1EIWA 3JU3A 4ZAYA 1H3FA 1KK3A 2J4CA 4E5MA 3DV0B 1UF9A 1ADCA 1PE0A 2OO3A 5BRAA 4RQTA 4DMKA 4MVJG 1CDEA 2W4MA 4BB5A 3WGOA 1SK8A 3KSRA 2QK4A 1CQJA 2R25B 4BFTA 2K4MA 1YBFA 1J0DA 4HS4A 3DLTA 2EP8A 1ZI9A 1YKSA 5C51B 1Z35A 4RPCA 4UM8B 1A2KC 1GKUB 1N1EA 2Z9CA 5KOJB 2RHTA 2QB5A 4KE8A 3SYKA 4FMDB 4BCBA 5I4BA 5KINB 2C5AA 3FPFA 2N1MA 1R3UA 3SXJA 5TSDA 2ZE7A 2AS0A 2CLKB 5ALPA 1R0CA 2WMDA 3QY9A 2BDTA 3DOEA 4BNJA 3MZ0A 2DWCA 2JLVA 1GUBA 3NBMA 4OHUA 4Q3AA 1X7XA 3WZMA 1WL8A 1QCCA 2PMWB 4FUTA 4RV9A 4AI6A 1K8QA 2OCIA 1QS0A 1JDZA 4OL9A 4JVNA 1LPMA 2X2FA 2D54A 1KS9A 2VH5R 5D84A 3OF3A 2ZDHA 4TN1A 4YWHA 1WZIA 3X1XA 4F91B 3U6KA 1VKOA 2C7BA 1WUYA 3G82C 1JKXA 5FJJA 3L04A 1B42A 1VSQA 2QW0X 2ZSUA 3GROA 3R0IA 1P2VA 1WO8A 1WXGA 1PW7A 4GLOA 4PAMA 3RVLA 1HDOA 1WB9A 2F3UA 2HA6A 1UBUS 1SY7A 4IHJB 1QQ5A 3WYFA 2A9QA 2X86A 2PZEA 3NTRA 3VMFA 3T5TA 3ZY5A 1TLFA 3CSDA 3GO4A 3JQAB 5EZYB 1TYAE 3DJYA 3OHMA 1FOEB 1U1EA 2PWPA 2VQFB 4MVJH 3ZWCA 3NALA 2XI4A 4NCKA 1LV8A 3G5TA 4RD0A 1QIKA 1ST3A 2NZ2A 2VDMB 2ZI6A 2EZ4A 3O91A 1U3GA 4HYYA 4DRXB 1BJTA 1KYQA 3MTGA 4ZT4A 5L7WA 4HYTA 5C0OE 2OE2A 3D2CA 1XNRB 3QKSB 5B53A 4YRZA 4S04A 5K3AA 1M6NA 4EI9A 3L4SO 4HEQA 1QX4A 1RLOA 1XCGB 2FNAA 3E3NA 4KIJA 2XZTA 2I4RA 3BK2A 1TJPB 3LU1A 3OJXA 4P4LA 4Q9NA 3RE1A 1XK7A 3U13A 2VJBA 4QUGA 5IAAA 5JHHB 3TECE 4F8JA 3OCUA 3HXOA 1GWNA 1USWA 1NF8A 2D59A 3TK1A 4DV6B 4ZP1A 1RP7A 3OMLA 5A5VA 4BNHA 2BMVA 3LMKA 5FCDA 1C3EA 1P4GA 5JCJA 4ZMBA 3I53A 2JKVA 1GTMA 3IOCA 5JXJA 2ZIXA 3QPCA 2GPJA 4PBTA 1Q0HA 1USGA 1OH6A 3DCIA 4HH1A 4RXMA 3QE2A 5AJWA 4AZ0A 4H7KA 3I72A 4LFCB 3L0IB 1M54A 3ZUGA 7ADHA 4YDQA 1Z7BA 2AEJA 4JI2B 1J2TA 1AZLA 4ZCMA 3TIFA 2Z4RA 2BDEA 2Q4OA 2NU7B 2D1SA 3LY7A 2PUVA 1VJTA 5F35A 4JJEA 1KJIA 3PS9A 1TLLA 3M6MD 5KDLA 1B41A 1DDIA 2G1AA 4IFTA 1Z06A 3GH1A 4Y8VA 2G17A 3IBTA 5BN4A 3WNBA 1NI4B 4G24A 5U9CA 2IXTA 1HE3A 1XMVA 2CK3A 5FQOA 4DREA 1OLSA 3KJEA 1NNUA 3KOYA 3AQIA 2MSLA 4GUDA 5CIQA 1IY0A 3FZNA 1P4RA 1G42A 2VYND 2N0SA 4OGKA 1SAYA 4LDRA 4EY7A 5JQWA 2WABA 2I9KA 1G38A 2H4YA 2JGRA 5C80A 4R1OA 5GTDA 2V1UA 2B4TO 2VYVA 2A9JA 3M1LA 3NTXA 4WXEA 3QWBA 3PNMA 1OI7A 4CKCA 3GCDA 1SVKA 1E3SA 1JG3A 4X0EA 2FEMA 3ZE8A 3EUFA 1A8SA 3T7CA 5J4LA 2QVBA 1M34E 2BE9A 2VK2A 3C7CB 2ARKA 3E61A 2PE5A 1CIJA 1NXQA 4GOKA 2FWIA 2V9PA 3QV2A 5AIBA 1ZHFA 5J1SB 1XR3A 2V7BA 2JVIA 5SYMA 1DEAA 4QQ8A 1TPYA 3CINA 3T5PA 4IDBA 2NSJA 3RS8A 4BKOA 4DG8A 4F7DA 3PFNA 1ESCA 4UOZA 4CF7A 4ED9A 3E2MA 2GF9A 1AZWA 2W90A 4PZDA 5ARDA 1NKTA 4JLAA 1PTJC 1WBDA 3ASVA 1WXEA 3HXKA 1F2TA 4KDRA 1PR0A 4L07A 1RM4A 1C9JA 5A04A 5LLDA 4E46A 1IBCA 2Q5IA 1WOMA 3AR2A 1OBHA 3V33A 2XKAA 4YI5A 1Q7RA 4D97A 4IV0A 1DUVG 1ZK4A 4KAJA 5KJFA 2RC5A 1K5PA 3U7JA 1KJQA 2W71A 4OJYA 3RVQA 1SXQA 3C97A 2V1XA 4RF2A 3ADPA 3RGGA 3TL2A 1UKYA 1FMCA 1ORTA 2Y77A 2O2GA 2YYYA 1LV7A 1PK9A 3CLTC 3NU1A 4XEUA 4M3NA 2EKLA 5DMXA 4EG3A 4NDNE 1QU2A 3Q6IA 2J67A 4L2IB 3N74A 4YHBA 2DFKB 2CFRA 5BY2A 1K8YB 2A92A 4GPAA 4OATA 1SPBS 1W4LA 4GR5A 4NZPA 1QO0D 1Z5GA 4IKOA 1GOTA 3IT1A 4M7PA 1ZH6A 4EYSA 3MWYW 3UMSA 3CWQA 3MCUA 4JASB 1CS4C 3GLSA 4G84A 4ONEA 3UG7A 2I2DA 1QRSA 1JIKA 1HH4A 3OEHA 4II3A 1M8JA 3GJTA 3V1MA 3RFCA 3FE2A 1V3UA 5ESRA 4BCCA 5JY6A 2PKYX 2KE5A 1WP9A 2YS6A 4X94A 4HDAA 3QFTA 4OQLA 5DSXA 4M8LA 3FDFA 2ZS8A 3L7MA 2ICAA 4PSDA 4AUKA 1Q44A 1Q7EA 1T15A 1XZFA 1N32B 3FYUA 5DNYB 3REQA 3AV3A 5KNDA 3CUTA 4X54A 3B6MA 1NXWA 1F3LA 1TO2E 4JLUA 4M0UA 3VR3A 2YW9A 5C7LO 4G1FA 4WJLA 4KMSA 1KYZA 4EPRA 1PV2A 5FLXA 2E6KA 4RD2A 3SEZA 4CHTA 5JH7A 4EHIA 3E53A 5ADWA 2O8FB 2L69A 3CE9A 3UQYS 4HQLA 1BTOA 1O7JA 3ORFA 4D1YA 4F9EA 5DV9A 1N2IA 1SRRA 4G5SA 4WECA 4EJ0A 4JBYA 4OQXA 4HXGA 3QOFA 2C0CA 4DMMA 1VZ2A 1A4UA 1GGNA 4RULA 4PQRA 2FPKA 4UBLA 4CT4B 1WXDA 4K6CA 3JR3A 3U7GA 4EX6A 2JGFA 3OPVA 5KHLB 3AP2A 1EGVB 2RGNA 3QXSA 4GSYA 3PE4A 4MSUA 1K7FB 4B3SB 2IXDA 3CV3A 3FBWA 3KKMA 4JOQA 3VH1A 3NM6B 4KRFA 4R9UC 3ME5A 5KU1A 1BDMA 3G0DA 3SF0A 5CDUA 4LRXA 4QECA 4YJ2B 3SDSA 4HPJB 4WZBE 1I1QB 4O2AF 2Y0EA 1FTYA 3G9QA 3RYIB 1J8QA 1ZUD1 4NZOA 1GZ4A 5HIIA 3M5CA 4KODA 1IHOA 2WAMA 4REMA 4WLVA 4L15A 3DEAA 3DNPA 1QQTA 1EA7A 1YR9A 3I4FA 3OUUA 5E6SA 4KXYA 1G4AE 1T36B 3OA2A 5FBVB 3ND5A 1B74A 3MT7A 4AMBA 5B2FA 3D4IA 3ZXUB 3FJYA 1A69A 4H1HA 2AE1A 2D0IA 1OXKB 1QNLA 1ZWLA 2BM9A 2UZ3A 2ZWPA 3M4ZA 3QJYA 3WWZA 3EXG1 4BKRA 4C76A 2ZYRA 4UPDA 1CIVA 1E2JA 1XEFA 2ZE8A 3TAUA 4EJSB 3IBSA 1BQ4A 5LQMA 3QIVA 3U4IA 4ZZ1A 2Q9CA 4TXNA 4RV5A 1YULA 1J8YF 2OK7A 2PH1A 4NCXA 2JBAB 3FCEA 1NBAA 4X20A 4B3HA 4IR7A 4TTQA 1KAMA 5AW9A 4OSEA 2C4NA 3WIOA 5KC8A 2G36A 2AFVA 1BHO1 1D4AA 1KEEB 2B6HA 2GPYA 4F4HA 4RF3A 2FN4A 3HJAA 3IODA 3CO5A 1AZSC 2QT0A 3MAGA 1WMEA 4Z0PA 4EO7A 1M1UA 5AW7A 3TL3A 4G67A 3LPNA 3LLUA 1ORDA 1ZGAA 1N2CB 2AFHE 1U6KA 1VRWA 2IEYA 2MYPA 3H1PA 1T5LA 3QF4B 1T34A 5BSMA 3T1HB 1XRMA 1MOPA 4TWAA 4Y9SA 3S29A 4DPKA 5EG5A 2NSHA 4PVCA 4LYEA 3HXPA 3QWFA 4C05A 3BMOA 1KDPA 4TL7A 4MWBA 1E7SA 1SURA 2C2BA 1QF7A 2HA2A 2JGLA 2PK3A 2X7HA 4CR8A 5HX7A 4K26A 1YZKA 2IOFA 3NC0C 5ALZA 3ZGVA 2YHAA 4X84A 1ETHA 2DSTA 4J75A 3U4CA 1RCTE 3DPSA 5JRJA 2DCMA 2CZQA 1TUEA 3I4LA 1VDZA 3FFAA 5JXIA 1PSDA 2X0KA 4HLUA 2AFIB 4R1SA 3S40A 5IFKA 1GPH1 2OXFA 1GQFA 2QTLA 3AXSA 3GBPA 1DLIA 4B47A 5HZHA 2VZEA 3HQ4O 2OCBA 4PYLA 3EGCA 3K9LA 1DSSG 4D5GA 4Z7NB 3RADC 1CR1A 3RIHA 4US1R 4LE1A 1ZITA 3A1NA 4FCVA 1ZRHA 4EGFA 1DXOA 1PN3A 4TKMA 2WQ6A 4LHXA 4JELA 6REQB 4E4YA 1NVMB 3H42B 4ZOQI 1JKMA 1VG8A 4FZJA 5DYGA 4JP8A 1JTFA 1YFJA 3L2OB 4H7HA 1CQIB 1CQZA 4LJ4A 3WG9A 4V0OA 4G41A 4OIFA 4F11A 3AEQA 2X1MA 4INJA 5F4BA 3VR5D 4D82A 2NMVA 4B8YA 3OU7A 4YMLA 3RAEC 3MMNA 2WVHA 5F5XA 3DCJA 2PKEA 3G1UA 1CZRA 3OE5A 4MO9A 3U7RA 4OHCA 4R1PA 2DQZA 1JA9A 1JSLA 2OL4A 3QKUA 3PI6A 1RQPA 4MKXA 4GKBA 2SCUB 1RWNA 3R9XA 5KVVA 1HLGA 3S5JA 1U7UA 4M86A 1T9GR 4JCOA 1JEYA 3MJVA 2R79A 2QQ0A 3QHPA 4F3YA 2BJHA 3ODGA 5K01A 1A4XA 3ZU2A 4LMPA 1QGZA 5EIEA 2R48A 2J3HA 5IHPA 1HEUA 1WPQA 4D3ZA 5CFLA 4A10A 2HF2A 5K3CA 3BQMB 1VXOA 2NUPA 3NNSA 3EEBA 4L5CA 1HRDA 4FDVA 4KE7A 4BNWA 4F2DA 3BIJA 5REQA 1FQOA 3NBQA 4IUYA 4AU1A 1G7RA 5DIFA 4MB0A 1CE8A 2F1RA 2A58A 5H68A 1J00A 1G20B 3KOUA 4EUSA 4TVSA 3ZCQA 1FSZA 4UD2A 2EQ5A 4PHTA 2R8PA 4EAQA 4B3RB 3G85A 3WRYA 4OH1A 2E5FA 3C1AA 3CZPA 4BLVA 4LWPA 4RK5A 1M2FA 5K3EA 1WETA 2PWBA 4I5EA 3M4XA 1FNMA 4UNSA 1ZR2A 1U7WA 1D2RA 3DG9A 3OBIA 3QTLA 2FX3A 5ED4A 3B2NA 4QDJA 2IUUA 4IDEA 3ITNA 3JD4A 1ZESA 1IMOA 2ZSFA 2OKGA 4RK6A 3HBJA 1YL7A 2DFDA 5ALEA 4DT1A 3VR4D 2QI9C 4RFSA 3IQXA 5HMLA 4GNKA 1OZHA 5CM8B 1HM5A 3PQ4A 5CJJA 3AIIA 1XZGA 2AN1A 3D64A 4N40A 4W9RA 4ESHA 4B5KA 4H35A 4CQLA 1GAWA 4M9CA 4DDVA 2QPLA 1XMPA 3MF4A 4ZI7B 4WZZA 1EB8A 4ZYWA 1DG9A 4LA4A 2H2FA 1B6TA 4JL8A 4XJXA 2IWRA 2E4XA 3MHTA 2VRWA 4FBLA 1KR2A 1NYLA 1HYHA 2WYVA 5DHRA 4M1OA 4U3JB 1OBFO 2K2QB 3Q0TA 1TUBA 5HUJA 1U1GA 3U56A 2NO1A 1YB4A 1KBQA 3A6EA 4KPFC 4BLRA 2K7ZA 5C52B 2NXEA 4E15A 1H2RS 4MQLA 1XCLA 2FA9A 2HF7A 3DHEA 2NU8A 3AESB 4B6RA 2OCLA 5MFZA 2O7VA 3KUUA 1NUSA 2A9KA 2F6RA 2F3TA 3LOQA 4HQRA 2IHTA 4RSMA 4D5EA 2BTOA 2XA9A 3CLUD 4OM8A 3H4MA 3ZDYB 3GELA 4CHGA 4P2GA 1IVYA 3FKJA 3GFGA 3KKEA 4BRSA 4HAXA 2XCRB 1XVUA 4I55B 3EG5A 5PNTA 2I1QA 4E4RA 4BXOB 3T3HA 2SKEA 1ZW6A 1P7VA 1F1BA 3F7MA 2A0KA 3QEOA 4NS4A 3WRVA 4BNLA 1XLWA 4HDCA 1YTUA 3TW0A 1EP2B 3SCZA 1DUSA 4IGAA 4UHBA 4FOTA 1UMBA 3KPVA 3MJCA 1EJ6A 5A1JA 1P5JA 3IXMA 5CMLA 2PJUA 2WD9A 1R1DA 2GPAA 5KNCD 3IBCA 1O9BA 3FBGA 3UXYA 1H9CA 3DPUA 3JQGB 1PFYA 3F6EX 4GYJA 4HLNA 4C20A 1UEJA 4BKQA 3T4UA 1QYXA 2DWOA 3HB4X 4O33A 3NDIA 4WFKA 4R0MA 2WKPA 2HI0A 4QJ5A 1Y6QA 4B45A 3M9WA 4PAQA 1JXOA 2R62A 3T5DA 1OC2A 4ZO7A 1YGYA 1E6KA 2QVGA 5HG0A 2JAUA 2KJQA 3PPIA 4JB3A 2QV0A 1XNJA 5CLJA 1H2WA 2PQMA 4GP6A 4AUNA 4BNZA 3KYCA 3AF2A 4Q9LA 4X8MA 3WNQA 1T0JB 2Q3BA 1VP3A 5BT8A 4NCHA 4MYDA 4YRTA 3RNOA 5E95A 4NARA 4Y7CA