3GLVA

Crystal structure of the lipopolysaccharide core biosynthesis protein from thermoplasma volcanium gss1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
b'GMIRVMATGVFDILHLGHIHYLKESKKLGDELVVVVARDSTARNNGKIPIFDENSRLALISELKVVDRAILGHEGDMMKTVIEVKPDIITLGYDQKFDEAELQSKINKLGITVKIVRISKYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipopolysaccharide core biosynthesis protein
publication title The crystal structure of the lipopolysaccharide core biosynthesis protein from Thermoplasma volcanium GSS1
rcsb
source organism Thermoplasma volcanium gss1
molecule tags Biosynthetic protein
total genus 41
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 2.7.7.2: FAD synthetase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3glvA00
4NAHA 3NV7A 2PZ8A 5J5AA 1QRSA 4MUIA 3SYTA 1F7VA 1IRXA 1LW7A 4RPIA 2JA2A 1VL2A 2YWBA 3H05A 5J58A 1NURA 1Q11A 2VXOA 3G6KA 4MWCA 4KKVA 3INNA 2XRZA 1IH8A 1U7XA 3D6UA 1FYDA 1PFWA 2NZ2A 1WJGA 4ZT3A 3ND6A 2D13A 4DDHA 3OP1A 1O94C 4XFJA 4S1OA 4JXXA 4ZT5A 4DE5A 2E89A 3CLRD 1F9AA 1B6TA 1NUQA 2ZP1A 3FG9A 4MWEA 3UOWA 1U3DA 3AFHA 1Q15A 1GAXA 3COZA 3CLTC 1T9GS 2CFOA 3UMVA 4G5YA 1ZJWA 3P0IA 1TYAE 1TYCA 3ZJTA 3TQIA 5EKDA 3FH0A 4ARCA 4ND6A 1V47A 3FNRA 3IVCA 3PNBA 4MUNA 3NBKA 4ZT2A 3HMQA 2OV4A 1JEEA 3PXUA 1IFXA 2IELA 1IQUA 4AQ7A 5HG0A 1GN8A 4QREA 1WKBA 1H3EA 1KQPA 3GMIA 1YUNA 2CYCA 2QUHA 1IHOA 4YP5A 2QUIA 2X3FA 1M8JA 4NZPA 2A84A 3Q12A 4XSVA 1WY5A 4EG1A 2A4MA 2J07A 3IMGA 1NUTA 3FY4A 1YI8A 3GLVA 3SDBA 5LM3A 1MB9A 2CYBA 1N1DA 1QQTA 4CT0A 4MW9A 3OTWA 1PFYA 3KFLA 3CLTD 4I6JA 4ARIA 1NI5A 2Z08A 3TNJA 3A4IA 4EG6A 1M8FA 4MLPA 1K4MA 3TQOA 1MAUA 4NAUA 1WQ3A 1J20A 1N2BA 1N77A 1NUUA 2EL7A 1KKUA 1JEDA 5DASA 1VLHA 1O0BA 2A88A 2JANA 3IVXA 1NUPA 1MRZA 1EFVA 1G8FA 1Q77A 3CR8A 2PG3A 2QTNA 1FFYA 1KQNA 3CLUC 4U63A 2EJCA 2CSXA 2D5BA 4F4HA 2DETA 1I2DA 5IHXA 1KAMA 4GRIA 1X6VA 1T6XA 1KORA 1SURA 3FI0A 5BNZA 2WQ7A 3VRHA 2CYAA 4MVWA 1KP3A 1OWOA 2BYTA 4KR6A 1N2JA 1N2HA 4MQ6A 1N2GA 1RQGA 3UC5A 4RUKA 4XFDA 4ZCTA 4ZCRA 2E21A 4MVCA 4MUEA 3IMCA 3FHJA 1D2RA 1PG2A 4DJAA 1OD6A 5LFAA 5FO0A 2AZXA 1O95C 1EUYA 1QTQA 3PRHA 3IODA 1TQ8A 2J4DA 1NP7A 3A04A 2HGZA 3ND7A 1KQOA 2JAXA 4J75A 5TGTA 2QJTA 2VTBA 2YXNA 2AG6A 1QRUA 3M5WA 1T6YA 3H9BA 1XNHA 1WQ4A 3IOBA 3AG6A 3IVGA 4MW1A 4AS1A 3DO8A 1JILA 2A7XA 3CLUD 3COVA 4YP7A 2OQ2A 3K32A 4I6GA 4ZCSA 4EGAA 4MWBA 2I1LA 3VGJA 1MJHA 2R5WA 1MB2A 5DEOA 3X1JA 1H3FA 2A1UA 3PNVA 2QJOA 1VBNA 4OUDB 3IOCA 1JMVA 1ILEA 4EG5A 1K97A 1Q19A 1J1ZA 4HJXA 1O96A 4Q16A 4DDKA 1OBHA 2NSYA 5TEWA 1CT9A 3LCJA 3DLAA 1O95D 3DPIA 4MUHA 1F4LA 1QNFA 4MW5A 1GPMA 4MW2A 5HUJA 1PG0A 3MXTA 2XRYA 3TS1A 4DDMA 1JIJA 2BTEA 3ZIUA 2ZUEA 4UZEA 3P52A 4KPUA 3ZJVA 1OWNA 1EE1A 4E1AA 1GZUA 3ZJUA 3COYA 1QRTA 1N3LA 1OWPA 2O5RA 2B7LA 1G8GA 5IJXA 3FOCA 3IH5A 3SZ3A 1QU2A 3AKZA 4L2IA 3ND5A 1KH1A 4MAFA 2DR2A 4PBRA 1ZH0A 1OWLA 5FNZA 3HGMA 3RK1A 2PZBA 1EXDA 1KH3A 4NX2A 1WXFA 2A1TS 1ULHA 4ND7A 2QJFA 1XNJA 3BL5A 4R2MA 1N2IA 4WNYA 4Q93A 4QRDA 2RE8A 1H1TA 1WXGA 1I6LA 1JZSA 4GU5A 4U8HA 1O6BA 3RBAA 2HMAA 4P2BA 1R6UA 3ILVA 3COWA 1G8HA 2CV1A 1XJQA 2A1UB 3K9WA 2A86A 4CQNA 1N2EA 1O5TA 5J59A 4DLPA 3P0JA 1O0CA 1YIDA 2GM3A 4H3SA 1O96B 1TEZA 3TZEA 3HV0A 4NDAA 1KP2A 1T6ZA 5K0SA 4EF6A 1PFVA 3IDFA 3ZXIA 2IP1A 1N78A 5AHWA 1J1UA 1HYBA 3KT8A 1GLNA 3JXEA 1QJCA 1J09A 3ZUGA 3D6VA 3MLAA 1EUQA 1WXHA 3FDXA 3CLSC 3ISJA 2H29A 2GKSA 3N9IA 4L2IB 2ZUFA 5TS2A 3ELBA 3F3MA 2E18A 1WXEA 3AG5A 4EG8A 3RHSA 2DXIA 1TFUA 3ZXSA 3UY4A 4CDMA 1U0BB 1H3NA 1JHDA 2G36A 4J76A 4MWDA 4ZCQA 2C5SA 3Q10A 1ZUNA 1TYBE 1JIKA 1IVSA 5KWVA 1UFVA 5LLTA 2WB2A 1P7PA 3A05A 4BWVA 1TYDE 1X8XA 3CVXA 4G5FA 3X1KA 3HFJA 4NATA 3RK0A 4EG4A 4MW7A 5HUHA 5TEVA 2YY5A 4PBSA 4EFKA 3GUZA 3UK2A 2J5BA 1NZJA 3CLSD 1KAQA 2D54A 2CV2A 1EFVB 4WSOA 2DEUA 3E27A 1GTRA 3KT3A 3HZRA 4PY2A 1MBZA 3SEZA 1KH2A 1YULA 4HPWA 4U7JA 3FETA 1N75A 3PNYA 4MW6A 1BS2A 1YIAA 3N2YA 4MUGA 1JECA 1EFPA 1JIIA 1M8GA 4HJRA 4K03A 1R6XA 5FO1A 3I05A 2QTRA 3C8ZA 3RJZA 3G5AA 2CV0A 3IUEA 4QBTA 2DUMA 4MW0A 1MOPA 1A8HA 4CDNA 1YUMA 4TS1A 1NYLA 3CA8A 1IQ0A 3SEQA 3HL4A 4ZT4A 1VBMA 3Q4GA 2H2AA 3LE8A 3NBAA 2HZ7A 1GTSA 4JXZA 2J08A 1V8FA 5DB4A 3IMEA 1M83A 3N8HA 4MUKA 2VTBB 5H7XA 3TZLA 4R2LA 2WQ6A 3P0HA 1ZH6A 4JYZA 2QUJA 3IUBA 2YWCA 3KT0A 4MVYA 1U7DA 1O97C 1VBKA 2E0IA 3A2KA 1IQRA 4JZYA 3MMXA 2DLCX 1M8KA 1KR2A 1EJ2A 4G6ZA 1JZQA 2O8VA 4PBTA 4UZFA 4YBRA 2GOYA 2CUZA 4YMIA 1MAWA 1Y42X 2X1MA 4X0EA 1T9GR 3CVWA 4F3RA 2PFSA 1MC1A 4EG3A 2Z3VA 1M8PA 5JBNA 4KR9A 1J70A 3CVUA 2J09A 2PZAA 1J21A 2DPLA 3X1MA 1O94D 5F23A 2CT8A 4ZT7A 3U1VA 3AIIA 1EFPB 1F7UA 3VU8A 1JGTA 1I6MA 2X0KA 1WXIA 1LI5A 1WZ2A 1NSYA 2PIDA 1I6KA 2QTMA 3L93A 3H97A 4KPUB 3SP1A 1XNGA 1K4KA 5H16A 3FIUA 2QUKA 4ZT6A 1PFUA 2A1TR 1S4MA 4KR7A 3CVYA 3LOQA 1WOYA 4FZJA 2DERA 1O97D 4MUFA 5K0TA 2AKEA 3N05A 3DV2A 1QU3A 4R0NA 5KCMA 4ZCPA 1R6TA 3FWKA 2WSIA 3MUEA 3H9CA 3QTBA 1M1ZA 4A91A 4MW4A 2RD2A 4MUJA 1G59A 1K92A 4OUDA 5DK4A 3KT6A 3SZGA 1OBCA 4K0RA 4EG7A 1NUSA 2PXHA 3AL0C 4YP6A 4MULA 2X1LA 2IJGX 3IOEA 4JFAA 2Z09A 3QE4A 4I6EA 4OJMX 5KHAA 1LI7A 2V0CA 4MVXA 3H99A 3S3TA 3G59A 3CLRC 3RFFA 4HK4A 2TS1A 2V0GA 1COZA 1OWMA 1DNPA 1U3CA 3MLBA 4DNXA 3QTTA 3ZGZA 3CVVA 1N2OA 3L92A
chains in the Genus database with same CATH superfamily
3ROKA 4B34A 4V0LA 2FFAA 3KOWA 3LC0A 1FJGB 4MUIA 3DHVA 3G0BA 5J23A 3L8YA 1NVAA 3ZVLA 2D3TA 2PQ2A 3QVLA 1YRYE 3FNFA 3I6IA 1U1DA 5E4FA 2DX7A 2GJAA 5AVZA 2ZVQX 3PVSA 4M76B 2WWFA 1D3AA 1ISRA 1N4DA 1IH8A 2ZRNA 2XIQA 3CIOA 2FF7A 5HJEA 2X8LA 1KBOA 5AJUA 5JXWA 2O59A 1D9XA 4U2DA 2ECKA 2IZZA 3GC6A 3BGWA 3AF0A 3VR5A 3TLMA 3GROA 2YC2C 3OLXA 4NCJA 1G3UA 1U0EA 3IBGA 4YEDA 4YX9A 3IDOA 3CF4G 2A5JA 3HUDA 3OD5A 4D4KA 2P11A 4JXXA 1UZMA 4HN4B 2JLAA 4MWEA 1UM8A 1XZKA 2O48X 5KX5A 1V1MA 1F3OA 1D03A 5EI5A 1HH4A 2XITA 4ZV7A 3GQBA 3HGQA 1AY0A 5G0UA 4EENA 4MNTA 1MG5A 2IYTA 4TVOA 4ENUA 5G41A 2XIJA 5TQJA 1PZXA 1RYHA 1ZMRA 2FZLA 2JIRA 3DP7A 3Q1KA 1BDBA 1V8BA 2WRZA 4JUDX 1YDWA 1ZN9A 4HHEA 3SHWA 1JX6A 1P1FA 5CBKA 3K70D 1ZN8A 3EGCA 1AMOA 3HXLA 2ERCA 2J0SA 4FDMA 4TV9B 2W2NA 2W70A 5KYYB 1Q3HA 1FY2A 1P4HA 4MJLA 3REFA 2ZRLA 4DUYB 1TA9A 4IEFB 4K9LA 4AQ7A 1QAQA 4YT2A 2OESA 3NT5A 4BVBA 3DFKA 2IW3A 5FTWA 4BCCA 1KOGA 1PNQA 3BXGA 4CEHA 1UJ6A 1AKQA 3JWIA 3JVEA 1JEJA 2GX6A 4JYPA 3S2EA 1PW7A 2DBQA 2QUIA 4UNPA 1JJBA 4RY0A 1QE0A 1QTRA 1EM6A 4X3PA 3MWEA 4JHXA 2RB5A 1WY5A 2ST1A 5I7WA 2ZSJA 5DI3A 2FJ0A 5C8YF 2R6FA 3IIJA 3B6MA 4UE3S 1T1GA 4JEHA 3Q7EA 3KJIA 3HCBA 4O2BF 1IEWA 4LRSB 1GQ2A 3GRPA 1BKDR 1UT5A 2I4NA 1NKTA 2YVKA 4KKXB 4KGDA 1SA0B 2HK6A 4OH1A 5AM3A 1E5TA 2ZUCA 4IFEA 1JF8A 1A8UA 1YGYA 2OCYC 3B38A 2YIMA 3TNJA 1XRMA 4IWNA 4QRHA 2QGZA 1PL7A 1MNQA 4PXAA 5F2KA 3SD7A 3VI4B 2QU8A 1GEEA 1ZVKA 3ELWA 3G9ZA 2PYDA 3V8BA 3TE6A 1JG7A 2AR7A 4CLRB 4NYIR 3B53X 3PR3A 5F78A 1Q92A 2VN8A 1XRJA 4S05A 1FFYA 1A7KA 1QOQB 3D8UA 4OI0A 2XB2A 2VJAA 5D7BA 2ZAOA 2YWXA 1BA2A 2B6HA 1Z29A 2A88A 2WJAA 3LX8A 4I46A 1WA5A 4P7BA 4YQZA 4J7XA 5H3HA 4E33A 4C30A 4FT2A 1EAYA 1LPPA 1HTWA 1QC5A 1ADFA 1UOPA 2O20A 3IXQA 3MJFA 1MC8A 4U63A 3ZKWA 1YF3A 2CSXA 3QX7A 3FPLA 4M8IA 3TYXA 3QVKA 4TRMA 3VX4A 3TF5A 3LVQE 2C5AA 4KN9S 1CY4A 1VJDA 4IUDS 4KJXA 1T6XA 2QU7A 4GT1A 2DGDA 3ZE6A 4IWXA 3RRJA 4RIGA 5FI1B 3CCCA 4C06A 4RVGA 2I1VB 3AWIA 4HL6A 1M2VA 4MKZA 2ZYDA 2XUOA 4X8LA 5D5PA 4ZI2A 1RHRA 1SXHA 4KR6A 3IJPA 1PZFA 2VS1A 4D4JA 1UPFA 4FYKA 1ABFA 4ZCTA 5CFOA 1RLUA 2E5WA 1OLSB 3L6RA 3WLRA 1NSTA 3OEHD 2IS2A 2PSDA 3HACA 4OB6A 2RCNA 3BFPA 4QPZA 4RWZA 5GGYA 5FO0A 2WU3A 3O1HB 4KL8S 4PLYA 2EBFX 2PY6A 1TQ8A 2BFPA 2J4DA 3QKTA 4XA8A 5K8IA 4S24A 1KMIY 5IT9A 1BGXT 4AZSA 4U6SA 1YR8A 3EC7A 1NGSA 4UVHA 3DOIA 5G1PA 1N7GA 5AXBA 4C0BA 1H93A 2ETXA 1VRWA 3BXOA 3GJ3A 1EUDB 1E18A 1A5BB 2REOA 1DI0A 1PE0A 1UFOA 2ILVA 2P6MA 2VF4X 4CCSA 4OGLA 4CCAA 1E2MA 2NQ2C 5EPOA 4UVEA 4ESHA 3B7PA 1NW6A 1WKVA 3DAOA 2ZAGA 5ESXA 3V4FA 5FJJA 3U1TA 1U0LA 4MW1A 4YJFA 2X9GA 2JGIA 3DZIA 3FRIA 1SQ5A 3HKCB 3L8EA 4CL0A 4QFMA 1DEOA 1DTWB 1L2TA 1Z13A 2D2FA 3FDZB 3WNZA 1WW3A 1VRVA 3ZU2A 4J0KA 4BZWA 2HCRA 5KYUB 4GAEA 4OOEA 4KO2S 2P8SA 4K5QA 3S2YA 2YQZA 5JVDB 1YB2A 1CIPA 3EIQA 2YV5A 1PEKE 3FD8A 3LHKA 2FFJA 4JYBA 1VBNA 4NYJQ 5DWDA 3GJ4A 3ZDFA 1Z18A 2VHEA 4HXFB 3HY3A 4MR9A 1J1ZA 1KYXA 3CZ4A 1KU0A 1G9XA 1WULS 1I4OA 2Z43A 2WM8A 1WV0A 3KPUA 2K5UA 5IDQA 1VSUA 2GEFA 1JKFA 1AHPA 4LY9A 1PUJA 3INGA 4KK3A 2UUPA 5M29A 3H5NA 3L01A 3O4IA 4MW2A 3K09C 5K8LA 4FINA 4INPA 1C1DB 3FPGA 3FX2A 1EFHA 2PFKA 2P3SA 3IAAA 1JNYA 1J8QA 1QO0D 1JIJA 3I58A 2AOTB 4GSYA 4OKNA 3WYDA 2IA5A 3CBGA 1PQPA 3EUWA 2GM5A 4H2DA 2AI2A 3TAXA 3I9V1 1G21E 3E9RA 3OESA 3ZCUA 4OJKA 5CDUA 2Y1EA 4B82A 4PSDA 5TMPA 1Y3CE 1YONA 2PT7A 3FTPA 2B7LA 2DQKA 4WY2A 3WLTA 4JX8A 1GPDG 3JRNA 1M33A 1QRUA 5IAGA 2HGSA 2NVUA 4MP8A 1ZUD1 2JGDA 4K9MA 1X15A 2BGMA 2GH1A 2PVPA 2W2MA 4L2IA 5F7ZA 1IXZA 1H5NA 3IHWA 1GTVA 3PQ7A 3RC2A 1ZUWA 1ECFA 2NXWA 5IS2A 1YQEA 1U9CA 1J97A 3RRFA 4ZI7B 2WT9A 2C4WA 2A9VA 4CE6A 2ACKA 1XCLA 3P9IA 4R7ZA 2CKDA 1L5HA 4M9RA 5HOEA 5JIBA 2J0UA 4PO9A 1NIJA 1NC3A 2ZU0C 3W2FA 5DW0A 1QGUA 5LCXA 2AHOA 3TOSA 4CLOB 5JH7B 2YBDA 4YRRA 3KSUA 4UE6A 4B74A 3ICOA 5KAPA 1RXSA 2W8ZA 4HLDA 4GYKA 4KTTE 5SY6A 5C9ZA 3VGPA 4BMSA 1L9XA 3DZBA 1OXMA 3S2FA 1DMRA 2VDNB 4PSCA 4XWTA 5G4KB 2JF0A 4DQUA 4N1AA 1YZKA 1JHQA 3ZE2B 3A3PA 4W4TA 3COWA 3EGWA 3UH1A 4C43A 4HMOA 5K6TA 4RLSA 4ZKDA 1HDGO 2J8ZA 3N76A 1RHMA 4JU9A 5FPYA 3P2IA 3GLHE 1TNDA 2B2NA 4HADA 5G0SA 1MENA 1O0CA 1E58A 4CN8A 4FIDA 4C5CA 2GHQA 1OAOC 1TGVA 3O4HA 1QVAA 4WCFB 1NRJB 1O3YA 1ULUA 1N2CE 3RYCA 1E6CA 3ETEA 4JLVA 3AERB 1QH8B 4G0YA 4OQMA 2HSWA 4XB1A 2GAFA 4AICA 3AVXA 1ZBDA 2VUSA 1CUYA 1KZ7B 4I2VA 1JHXA 4QXQA 3WGGA 1GLNA 5HIJA 3FIJA 2W2VA 2IIQA 2DY1A 1GXSA 4B3IA 3MLAA 2ZIGA 5LKRA 1AZSC 4H1HA 2W6OA 4G0PA 4JA0A 5I7FA 2ZYTX 5KPJA 3VC7A 2XF8A 1G2IA 2RH4A 5K3EA 3VA7A 4NJMA 3ZBQA 1XMVA 3L05A 2OM6A 4EGFA 3RYIA 1UANA 5I8PA 1SPXA 4OYLA 2WJWA 4ZU1X 2D7CA 2RAVA 3NOOA 5FL7A 3K9LA 4D96A 3N2ZB 5JW6A 2DXIA 2NYRA 1G20E 2YYSA 1YU6A 3P26A 4PGHA 3VAAA 5CLIA 1R37A 1AGNA 4EX7A 4MWDA 2QL5A 1XKQA 4ZOEA 1CTQA 4FQ8A 1JIKA 3KKPA 1OSNA 1TTQB 1KI4A 4YMWA 3DL2A 3SOZA 4EY5A 2DTDA 1U2GC 2WD7B 4RH1A 4DIMA 2WF8A 1B8PA 4QUJA 1Z22A 5D1HA 1VL1A 3ZCTA 1AHIA 5FLYA 3K6RA 5EIAA 4ZDIA 1DELA 1I2ZA 3RB8A 2VT7A 3L02A 3NHBA 2PUVA 3NEYA 4MJXA 1HURA 4B9EA 4NATA 5K7SA 3QU4A 4NY1A 4JI6B 2V0NA 1LEHA 3UT0A 1RRVA 4YPFA 1SK8A 4U2GA 4CMIB 1LSSA 4WLOA 1JNXX 2P68A 4EJFA 4FNOA 3C97A 4QFBA 1Z5GA 2Q1SA 2O8DA 2DTXA 1L4FA 4MDFA 1H6BA 2RHHA 2ZRBA 2I2XB 1US8A 2W58A 3CRVA 3ANMA 2Q29A 4OBEA 1F4VA 2JI8A 4OO3A 4X1KB 2DT8A 1U28C 1MBZA 2VLIA 3SGLA 4FWTA 3U9SA 2VPXA 5TT0A 2ARKA 1T2DA 4D99A 5C4GB 3ET4A 4O59O 1N75A 2NGRA 3W3AD 3TCNA 1W36D 4TL9A 3AKDA 2G0AA 3Q7IA 1VL6A 3UT6A 1QHHA 1T0JB 5J5VA 3M34A 1VZ3A 5H68A 2P0EA 4RZSA 2AC4A 4ZEMA 3QBDA 4L85A 1M34A 4KU4A 4X7MA 4ETNA 5F3WB 2OL4A 3TSZA 2QRVB 4LW8A 5I9MA 2OYCA 3WGKA 4D3DA 4PC6A 1OA1A 3AR3A 4TS1A 4CGYA 4B2LA 4EBBA 3LQ1A 4DNQA 1JI0A 1JIVA 2R1VB 1LS1A 3M1AA 3JYNA 2BEVA 2XYVA 1UC9A 5LPNA 2FLWA 3CZ5A 3LCMA 2OY0A 2PKYX 4LJ7A 5EEHA 2JVKA 1QMGA 1SCNE 2GN2A 4CKCB 1DEXA 3WGVA 1XQ1A 1JDVA 5H7XA 4BX8A 1Z7WA 3AUJB 2Z2YA 4HSEA 4OSEA 1RC0A 1HLGA 2XBLA 4GX2A 5TQ0B 2IPAB 4M22A 2ZJBA 1L1EA 1BE0A 4WRRA 1C80A 2YJZA 4GWKA 3GI1A 1UXJA 1V8DA 1PO7A 2BSAA 3KS9A 1IN6A 1HDZA 3M82A 1P0IA 1MJNA 3NYIA 4MO9A 3MPUA 1G7TA 4UMFA 3SC3A 2ZE7A 5JSUA 1N32B 3VKHA 3KKLA 3IPXA 4DY4A 2O57A 3THXA 5CA0F 3N39C 5FDFA 1L6IA 3PHLA 1P1CA 2ZTLA 1I4TD 1KJ8A 4DA9A 5BORA 2IPNA 2H1RA 2OKCA 4OQYA 1XTTA 2HHAA 5EQFA 3PVZA 1CNEA 1AHNA 2C07A 2P2SA 1XU4A 4OSPA 4OX9B 2XB8A 2YRXA 2BFEA 1TO6A 3B51X 3EXEB 1FFXB 5E2IA 3GJ7A 5FA6A 3IB6A 5LZ9A 4TKZA 3MJTA 5EJFA 4BVEA 4KVZA 3TLCA 4ZD6A 3CXUA 2H85A 3UMSA 4QPPA 1ZI8A 1F7UA 1TK2A 2IGBA 3URMA 1IIRA 1BX3A 3DCJA 1L7PA 1WUJS 1UEJA 2JFQA 2X0KA 2WA1A 2VJBA 1X8JA 1XA3A 2RI1A 5T41A 4CKYA 4GZ6A 4BE9A 1MN6A 1NVFA 4M99A 2DULA 3RRXA 3ZXYA 4U9UA 3LQYA 4TVBA 4BNWA 3CUTA 4B4UA 4E4YA 1D07A 3FBWA 1OKKA 2OCAA 4P6VF 4XLTA 2XZLA 1GRVA 5T4EA 1A98A 4PNPA 4UE2A 4ZOBA 3TLBA 4BLVA 2XYRA 3Q8LA 4O4LA 4URYR 1G6Q1 2ZRCA 2BEWA 3P9XA 3QEMB 3RC7A 1KAGA 3TRJA 1E9BA 2VKTA 2W83A 3RGWS 2G7MC 4ZZ2A 4YTEA 5CLLA 4I9GA 1RFGE 3ZOKA 1UK9A 1QVVA 3P8ZA 2HCBA 3IT0A 3H84A 3VH3A 3VDRA 4ZHQB 5KYYA 2MYNA 3FYCA 1M1ZA 4OB8A 2GJ8A 3PL5A 3CBQA 1G59A 5H9WA 3T61A 3L6BA 3A9VA 3MEQA 3PQ8A 4YO8A 5DJ5A 1VHDA 3VV2A 3WFIA 4F85A 1M6NA 2F3QA 4YP6A 2WU1A 3GDGA 2Y76A 3RABA 4KWCA 2P77A 2XWJI 3FCEA 4WVFA 4CM1A 3EZ9A 1QH1A 3W5VA 1G8PA 3JQFC 1HL7A 3KZMA 4GMFA 4L0CA 1DUVG 3T95A 2JHPA 3EX7C 5CVUA 1T8YA 1HOXA 1CUAA 1YJQA 3CG4A 3N2NA 4N5NA 1DQZA 2GF0A 3G59A 3L6CA 5IK2D 3KB8A 4CTJA 3T5AA 5HILA 3IIKA 4ZOQI 2I9KA 4B80A 4AVYA 2EG5A 4F5ZA 5JAMA 4FJ1A 4FD3A 2OGUA 1OX4A 1XT6A 2I6XA 3QIAA 1AKTA 1SKMA 2FETA 4YP0A 3BCHA 1E2PA 4L0DA 5DM4A 3C3CA 3EWNA 2NU6B 4JSYA 4KXMA 1G5PA 5T3YA 3WBKA 1QX4A 4XTRA 1F7VA 2HLNA 4PSVA 3C6BA 4NBKA 4K88A 1QWOA 3UHPA 2DLDA 1VL2A 4EJMA 3PX2A 3IRUA 4MLZA 4R6WA 5DNCA 4TWAA 3WIDA 4O29A 1KY5A 1ACLA 2VXOA 3IBSA 3JQ6A 4KKVA 4QFCA 4W1QA 4CR6A 1RBQA 1LWOA 1R6VA 1RYFA 2XV1A 2UXCB 1YJAA 2VF7A 2C9YA 3CUSA 5HF9A 1HT0A 1Q21A 2FSPA 2P3OA 1OTYA 3CEMA 3O2QB 4P38A 3CUWA 4AZ0B 5CFMA 4JSTA 4YJDA 2GXAA 3PIRA 4JJEA 4R5HA 2ZK7A 1QSGA 4HVTA 1UMCB 4DDHA 1RQXA 1T4DA 2P9BA 3I6MA 4GOMD 4JASB 4X60A 4DM7A 4ZA2A 1VPTA 2LIPA 5HCUA 3LQFA 4A9AA 4EKYA 4FKZA 4DE5A 4HLNA 4LF9B 2IZ0A 1RKXA 3LUDA 4UBMA 2ZP1A 5BRJA 1JWAB 2BKLA 5ECGC 3DO5A 2W6ID 1CX9B 1TM7E 3I34X 1ULAA 4IRUB 1S0UA 5L6MB 2PZMA 3OZSA 3LRPA 1IVNA 3SYLA 4OXYA 1IMJA 4TQGA 5IH7A 3ICEA 3AEKA 4ZOLF 1AKMA 3H87A 3C6YA 4K9NA 3W90A 3FRJA 2PMDA 3WK6A 3ZUPA 4AY5A 1JEQA 2ODAA 1WTCA 4F5DA 4LI0A 3F5DA 3G9TA 4CFYA 2PUCA 4TZTA 3FWNA 4KRFA 5ALDA 2B36A 3U3MA 1N9GB 4KMSA 1OJ7A 5JYDA 1L9KA 2C84A 2D2VA 2P41A 4JNKA 1LDMA 4HBGA 2VXCA 4WH0A 5AW5A 1GN8A 5T6MA 3TOVA 5G40A 5A7HA 4QOIA 2BM1A 4PC1A 4DMHA 3U3DA 4LQDA 3FYUA 3HADA 2CJPA 3VC1A 3CTMA 5CYOA 1L5SA 4B76A 5HKLA 1KGDA 2IYQA 3ZX5A 4I14A 1FE8A 4QHYA 3D1LA 1BNCA 2EFJA 3AVOA 2ZVPX 2JJ8A 2PK3A 3V80A 4DNOA 4ZVTA 1DIOB 2JGRA 4IS2A 3IURA 3OM0A 3TQSA 3A31A 5BNWA 1OFTA 2IY9A 3DE0X 3H9UA 3PFNA 5TARA 5TX7A 4O4JF 2H8GA 2FPXA 2CHVA 1G41A 3K1YA 3ZYZA 4D3FA 3NM4A 1AN0A 2HJWA 4LZWA 1VCHA 4P34A 1JHYA 2PL1A 5BSKA 3LBYA 2Z08A 4DJ5X 2VOEA 1ZD4A 4L4XA 4EY3A 1EIWA 1BS1A 3F3KA 1G9TA 4W82A 2UUBB 1HSOA 4AJOA 4P83A 4MWSA 1Q1QA 3TBHA 2I6QA 5T8KA 3PTZA 3B60A 4XAQA 2HIHA 4KVAA 4C7JA 2OXFA 2QB5A 1UZUA 3EVBA 1U2EA 2HA5A 1ZRMA 1RMYA 2NZYA 3JWJA 4BLQA 1YHNA 1JQKA 2EL7A 5CITA 3EE6A 3GP3A 5JARA 4PG5A 3EGEA 4HQRA 4P4UA 3VUEA 1R6BX 3DULA 4EW1A 3QLUA 1P7ZA 3RTAA 1D7OA 2ZT6A 4B3DA 3NC1C 4NOLA 2OBLA 3W9UA 5HJ7A 1NMQA 3O93A 1DV1A 4DSZA 1UBCA 4N9WA 5IZCC 1OAKA 1SZDA 2ZROA 4FDVA 4R8MA 1ISJA 1LQ2A 3LQ2A 4EYKA 2UXBB 4CL8A 2O2GA 2AN9A 2PRYA 4L78A 3HWX1 4LG1A 3I8XA 4REOA 4D8YA 4Q7QA 1DIAA 3IALA 4MMXB 4CWAA 1TIPA 4LYGA 4JLPA 4HNTA 5IM4A 1OWOA 3RVQA 1SOAA 3PHIA 2OBMA 3HA3A 3D8SA 2X8JB 3S55A 2CFTA 4RUKA 4XOIA 1I3OA 4JLDA 1VXOA 3MRXA 5BURA 4JBNA 3EH2A 2X0JA 3KE8A 2P65A 3TINA 5A2QA 1BXKA 3V1MA 4OAOA 1QIKA 3ILHA 2IU4A 1HMYA 4GP9A 4IBOA 3GJQA 3RSHA 2H8KA 5KWEA 2CEKA 2LXNA 4KODA 3CNNA 4OXIA 4YJGB 5KUTA 1F2DA 1ZESA 3IX7A 4UM9D 1Z5UA 5LA6B 4DXAA 1Q7EA 2QJTA 2VPPA 2OORC 5A9SB 1C2TA 5ALWA 2W6QA 1TVMA 2FLKA 3L9XA 4MEJA 4ABTA 2FPMA 2ZITA 4E51A 2Q5FA 1QIMA 1A71A 2ACWA 2LBPA 2ZSKA 2QAIA 1TRHA 2CK3D 3IOBA 2A0KA 1E6EA 4LZOA 4YBZA 1JXAA 4B3MB 1N5LA 3ASYA 5D51S 2F43B 1BOFA 4TWRA 1CW2B 5IMSA 2A0FA 4EF5A 4Z4QA 1PT5A 3GGGA 5I7EA 1Y3FE 1CPYA 4C4AA 1MJHA 2B8NA 3EEBA 2PR2A 1G7SA 3GPIA 2O5VA 1V1RB 1DLJA 3G88A 1ZOSA 5H4HA 2P3LA 3T9EA 3IXMA 5CYPA 4OUKX 2YWFA 1Z2OX 1Z34A 2G0NA 3GDOA 2QQGA 3U3OA 2EDAA 1HOTA 1W5FA 2QLFA 3FFWA 3Q41A 4LX0A 4Q00A 3Q87B 4XWAA 4K0KB 4M83A 3LPCA 1OILA 1TECE 3W9BA 1ES9A 4F97A 3V1KA 1UUFA 3GJTA 1FOEB 3L5KA 3BEDA 1LLCA 1DWOA 4MRSA 2FRDC 5FOXA 1F2UB 1F4LA 3ZW8A 1L5VA 3UUGA 2JK1A 2Q2QA 2W7TA 3DOCA 2FG6C 4YB8A 2C77A 4AD8A 3ZDXB 1YB1A 1YZHA 2V7GA 2B25A 3NPAA 4H9GA 4P3NA 5BQOA 5F2EA 4XYMA 2PSFA 4WKNA 1TUEA 5BN5A 2FSSA 2JFZA 3GRYA 4RSMA 3NXSA 3IAS1 4PPNA 3BEOA 2PZLA 2XZDA 1BS9A 2X58A 1Z0KA 1D04A 4DOMA 3I2KA 2R4UA 3QP9A 4RKQA 4GKVA 1G1AA 1G8GA 1W85B 4R2HA 2R86A 4RACA 1DBPA 1TZJA 1MEJA 3BSWA 3PHJA 1D2NA 4L9AA 2BCEA 3FZYA 1XQXA 2SKCA 1G42A 3MWDA 2ANBA 3LHSA 4PBRA 3WZLA 5JCJA 4Z1MA 2YJ4A 3AJAA 2PZBA 1XVIA 2B2CA 3MOGA 3BHJA 4DLLA 4Z4HA 3MB8A 2A0WA 4DL9A 4FVTA 1CJKC 3G9UA 4ND7A 4QGBA 1QIHA 3N2IA 4G97A 4EJSC 5LYJB 1LBHA 2PBLA 2W4IA 3ASUA 4Y2HA 3C4QA 5CW1A 3ESBA 5PNTA 1KRWA 2JFHA 1C4XA 1WXGA 3U62A 5HHTA 1HT2E 4RELA 3H5IA 1UR5A 4RJJA 3AVVA 2E6UX 2ZM5A 5LXTB 3KK0A 1IZZA 2F1JA 2P35A 3DKVA 3EIUA 1RJWA 3JR7A 3U39A 1UT6A 1NW3A 2ID9A 3KKEA 4GECA 1EK1A 2AUTA 2Q45A 3JARB 3DL7A 1XHLA 3K9WA 1SXJD 3KVVA 1AQJA 4N0PA 2IV3A 4FHFA 3R5XA 2DUJA 3UANA 4MZDA 4EAQA 2B5VA 5LZ7A 2R8XA 2I66A 2OBBA 4H3SA 3WLPA 3PX3A 1E1MA 3I30X 5HZGA 4PZPA 2HCTA 1R8XA 3V2HA 1PFVA 2AYXA 1FRQA 2W6CX 3QYAA 4C88A 3WY9A 4PLPA 3TTWA 5JS8A 3GMTA 4JAVC 2QP3A 4DCMA 4DVGA 2B5WA 4IH4A 3IHLA 5DK6A 5B7GA 4DDWA 4UARA 3SHQA 4JS0A 5CYFA 4KGXA 3ROMA 4Z51A 3FWHA 4UUNA 2P5YA 4RL4A 1UDAA 4WPGA 3RWOA 3PC7A 2YHIA 1X1BA 3A27A 4UTXA 4DIDA 3FDXA 2PFGA 4LJ6A 1EBBA 1RT9A 3AHEA 4GLLA 4Q4CA 1M6VB 2YIJA 4I5FA 2EKDA 2O3SA 4UDNA 1OAAA 1W5SA 3ESAA 3GCGA 1UKVY 3M6FA 2QYHA 2GKSA 3N9IA 3ACCA 1KY4A 5CNKA 4NXMB 5JNSA 4G24A 1AK1A 5IBPA 1W75A 2E18A 4MWOA 3GJ5A 4NCXA 2VP6A 3DYVA 5CT9A 1VCNA 1R4ZA 1T8RA 5AK3A 2X4LA 3KYCB 4ATNA 5BMVA 2LTAA 1U0BB 1X7GA 2WG2A 2ZVDA 1MQ9A 3G3EA 3LBNA 3RO7A 2UVPA 4ZHSA 5KNCH 5L53A 1YZNA 2GK4A 1STOA 3GIWA 3L4JA 4CQMA 4XE5A 2IBMA 1A7UA 2XEXA 2ATEA 2DH6A 5JADA 4V0QA 2G3YA 2PMFA 4B5LA 2WB2A 4OK5A 4LVCA 3WK4A 4PAWA 3W6ZA 4HZGA 4EB3A 4TYMA 1BXZA 2CDCA 1T4BA 2YV2A 4RGVA 4ZRMA 4BWVA 5CFRA 1WY7A 4RDIA 4H7JA 1PX0A 1XCJA 2BR5A 3IKMB 1FP6A 1RYMA 1SXJE 4BX9A 4CF6A 4YN3A 3RWMB 4ZI3A 5EXDA 3EXHA 3RYHB 1TX4B 2X4IA 3QE0A 5KPDA 2YNMD 5JLAA 4UBLA 5AKYA 5G3ZA 1IAQA 3N8DA 1OBVA 5JRDS 2EP8A 3AF5A 5JY6A 1G7CA 3H5VA 2YY5A 1JLMA 4YRZA 5FHRA 4Y2JA 4DCUA 2R1TB 4XPIA 2VP9A 1DKLA 5E1DA 2JGLA 1W88A 1J8DA 3IQWA 4G1FA 1NN5A 3QHAA 4RDHA 4AJ4A 5IFKA 2PX0A 1V9CA 2KLHA 1ZKDA 2FHPA 4NJOA 2B92A 1BCSA 1EWKA 2N47A 3AR7A 4KQHA 2G71A 3KHKA 4PLTA 5HSGA 1UDBA 3KZCA 2NO0A 1JQ5A 1S6YA 5K03A 2O1WA 2DFVA 2NU7A 3E7XA 1PR9A 3LX5A 3FETA 5HXAA 2O8BA 5BVGB 4OA5A 4AS3A 3V1TC 3MXOA 4ND8A 4CDRA 4JB2A 1CRLA 2RSLA 5IXJA 3ZBUA 3FNEA 2H6EA 3WL7A 1IATA 3L6OO 4HJRA 4I5GA 4GF5A 4HLUC 1KOFA 1NJ5A 4KQ2A 3BJRA 2TSYB 3D7MA 1RRGA 1A8HA 2H0QA 3QXXA 4IMPA 3UXYA 4EFLA 3TL2A 2WMYA 4IDGA 3EQ6A 4BNDB 4MYSA 1WUTA 2Q0XA 4N39A 1FBNA 4J3NA 3TSOA 3R9WA 1QIIA 3SYNA 3ER8A 3NBAA 4H08A 3AVTA 4UEKA 3NFRA 5P8WA 1PJQA 2CMHA 5JJBA 2ZZKA 3SHVA 3FCUB 3IMEA 2OCXA 3OHPA 3KP1A 4OHYA 1BSVA 4X1YA 3JYQA 1TKRA 2JA1A 1H85A 2XE7A 2XPCA 5CFPA 4TYNA 1R5JA 1LBTA 1ZIOA 2HRZA 2PCJA 3D54D 3LX6A 3OEED 1PJAA 4JI3B 3BN3A 2JLVA 1GVNB 2Q99A 3M8KA 3OIUA 1AMUA 4H7FA 1VZ2A 2HCJB 4M21A 1T8SA 4NP6A 1TK9A 2ZW9A 2C9DA 3UGKA 2PBRA 3MMXA 2ZDGA 3USZA 4AB1A 4QIHA 4DNPA 1EP9A 1JUDA 4W5JA 2RHTA 3VPDA 2PKQO 2GBFA 1KIFA 2XZTA 2AE1A 3H8VA 3U5ZB 4YV1A 3DMYA 1F0YA 2M6KA 5CDFE 1DADA 3RJ5A 3UFXA 2QY6A 1T2AA 3EA0A 5HFNA 5KQSA 2JIPA 2CFSA 3KBOA 1EEXB 1FP4A 4M38A 4F96A 3JZMA 1RLIA 1V37A 3CVUA 4M89A 1USVA 1XQ9A 2OE2A 4FHEA 3RU2A 5C53B 3INRA 2NP7A 5FLKA 3HYNA 3QXCA 2DB3A 5HA5A 4GI5A 3CWZA 3LHDA 4HDMA 4PHFA 1W0JA 1FS4A 3GAFA 2DCMA 3KWLA 3MJEA 5CD9A 3KCQA 3IP9A 4RHFA 4UXIA 1NF2A 5CNIA 4OLJA 4BMNA 3WIVA 1CWUA 3T9BA 3G5TA 1NM5C 1XRSB 1MQAA 1I6KA 4HB4A 1LW6E 4YLEA 3A10A 3Q2OA 4B45A 3T3EA 4WW0A 1YKFA 2GARA 1EDEA 1V8OA 2HV9A 2AF4C 2IXGA 1H8HD 3LDHA 4G5XA 4F8EA 5JNWA 2JB9A 1G3QA 4Q12A 4XIJA 3N6RA 1KL7A 2VQ3A 3O2NA 4AIRA 3FVVA 4D9NA 3UFBA 2WD9A 3FLEA 4I66A 1MT3A 4AZTA 2ATCA 1VOTA 1VIAA 5DBGA 3CVYA 1Z56C 1J2UA 1YA4A 1OT5A 3EB9A 4TS9A 1P3JA 1FXWF 5IWAB 3UPTA 5I5GA 4D0RA 4RA9A 4DUGD 3T5BA 1MKYA 2FW9A 1OB5A 1EYZA 3NUQA 4HGQA 5FBZA 5KCMA 4ZCPA 3P0RA 4MINA 2EG9A 5CRIA 1L4UA 4RK0A 4HEQA 1NVVQ 1GO2A 3LQRA 5HKKA 2BMAA 5F21A 3B6IA 2PTGA 1DAOA 1R8YA 2IY7A 3HR8A 4PLFA 4MV0A 1J2JA 4A8PA 2IDKA 4V02A 3UJ9A 3WB1A 4EG7A 4EW3A 3R6TA 1X2BA 4K9RA 1CQJA 1CBUA 3DDHA 2Z09A 2V7UA 3QE4A 4O0LA 4GM4A 3D8BA 4EZEA 4I6EA 5IN5A 4TSRA 1IUOA 1F5SA 2ZBRA 1J7JA 4DJJA 4EMTA 3FW1A 3CHYA 3CRRA 1T8PA 3HCAA 1V6SA 1CXZA 4MUAA 2W2PA 1P60A 4BEJA 1WE2A 2PWAA 3USCS 1COZA 5EEGA 5DW3A 1B6SA 3KNZA 1QYIA 4WBNB 3KTOA 4NTZA 2ZWOA 3PE3A 1USIA 3GLTA 3K0FA 4GPBA 3BMNB 5AKJA 3ZV4A 1AS3A 3SBXA 1NKSA 2CSUA 1QV9A 3HFSA 2OZLB 4YI5A 4WD3A 5AUPB 1AC5A 2OHGA 3C6ZA 5J5AA 3SM9A 4D5EA 1V5GA 3O0DA 3SYTA 5EJ9A 4RPIA 3JYLA 3OECA 3PGA1 1TT5A 2V45A 1KYWA 2PRZA 5TT1A 4F2WA 1YQWA 2LR0A 2XMZA 4WNCA 2X1HA 2GYVA 1E89A 1UWCA 2JLYA 1P0PA 2GZ1A 2CMKA 5IF9A 1Q11A 2XNDD 4TTQA 3SNHA 5CDGA 3B2EA 3D9QX 1TLTA 3OAAD 3C43A 5EZYB 1K75A 2JJYA 5GMOA 3PSAA 5LR6A 3GGSA 4YDSA 5I7RA 1FYDA 2YWDA 3GUCA 5T57A 3TSCA 5JI2E 3NU1A 3ZD7A 3KPYA 5LBIA 1G5HA 3MTGA 4JK3A 3MW8A 4GWLA 4YAFA 2C29D 4GKBA 2HUPA 5ENVA 1PBTA 1JQLB 2V9CA 4GE3A 4XUGB 4C7KA 4ARBA 2Q62A 3COSA 1B14A 4FS3A 5HMLA 3BC1A 3A9RA 3KQVA 4AZVA 4F1WA 4FE4A 5EIFA 1E5LA 1SQGA 5JS7A 1OIVA 3WGYA 1C1XA 4KYUA 3NO4A 1GAXA 4CLRA 1B0AA 1OYYA 2VJCA 2P67A 1TM4E 2V7PA 4ICIA 4KLAA 3ETDA 1ZM9A 4YRIA 3VPXA 1VMDA 2OUIA 5ULLA 2XDQB 2FEOA 3IKJA 4P8RA 3JZAA 2JBWA 1H1LA 3ZU4A 1PKXA 3CF4A 3W78A 1NF8A 3FPAA 2RI0A 3TQIA 4ARCA 4ODIA 4YCAA 2UZAA 1T1EA 1ZA2A 4K26A 3LUPA 4LOHA 5AKIA 4Q3CA 4JB3A 4QU5A 1ZD9A 1XAHA 3ICVA 4ITUA 4TTJA 3ABOB 3GT0A 2Y2VA 3II6X 3VBCA 2ZRJA 1Y3HA 3DVAB 5F5XA 1XDGA 3RFXA 1CUFA 1GN9A 4AS2A 4YRDA 4NU5A 2A58A 4ID9A 1J6UA 1R0RE 1FDWA 4B3XA 1CZHA 1JE0A 3BORA 2JKZA 3FWYA 2BTQB 1JYFA 3CZRA 2GK6A 3FAKA 4WEOA 2OO5C 4FEEA 1G55A 2BFBB 2XUAA 3C85A 4NJEB 2FWAA 5DHTA 3SQWA 6ADHA 2R96A 5EIOA 1M8JA 4NZPA 4ARUA 4FFPA 2G5TA 4KITB 5FWXB 3W5BA 2GPBA 1TF7A 1TVKB 4P5DA 1HGXA 3LF2A 3WICA 3ZY6A 5CXUA 3DR3A 5IC5A 4BGUA 2RG7A 5I7OA 3ADOA 1ZCAA 4YCCA 2BZ1A 2QTLA 4BN5A 4ZTUB 1PL6A 1CNMA 2V6FA 3A28A 4AW9A 4CT0A 5C5CA 2RBGA 3T9AA 3IQIX 2NNLD 5F3DA 2O2DA 1ODFA 5AW1A 4KG7A 2H7YA 2YWJA 3FZNA 3B82A 1PTJC 2WI8A 3GLGE 2RHLA 1CERA 3A06A 3RD5A 4LNUB 1PFQA 3RS8A 3FR8A 2ZI6A 2DTEA 1TADA 3QMMA 2GK7A 1GKLA 5ITSA 1JXMA 2AFIB 2PDAA 1QQ6A 1FU8A 1XN4A 1YBMA 2XX3A 4NMMA 4WCVA 3KJEA 1DTWA 4CIAA 2Q3LA 3OZTA 4UUQA 1WZUA 5KYUA 3K1AB 3BH6A 5GIOE 1OPXA 1CR1A 1JU3A 2CBGA 1W0CA 1D1TA 4YJHA 1ZM2A 3OUUA 3ZR4B 5GZ3A 2FN7A 5JVDA 1ONNA 1OI4A 4B87A 4MKXA 4Y6LA 1GARA 1U31A 2YJGA 4IICA 1Y63A 2WTBA 7YASA 3VOTA 1U7HA 3GLHA 1DINA 1I2DA 4OYHA 1YE5A 3AJ8A 4A0RA 5IHXA 2FW6A 2PSJA 4ZVRA 2AE2A 4DWVA 3V7WA 3E84A 1ABEA 1P1JA 1F1BA 3TNDA 2GPTA 4WCDA 1NVDA 2I55A 1FTGA 3IO5A 2H63A 5LOVF 1GGEA 1UBUS 1J0EA 2FQYA 2UDPA 3JQ9C 3MMZA 4KXFB 3HB4X 4QDTA 5GM1A 3VZQA 1AT1A 4MVCA 2G1JA 3OUTA 4WA7A 4OLBA 4X95A 1HFEL 5EVJA 4D0NA 1JTEA 1QYCA 2ZETA 2YIVX 1NV9A 3PE4A 4FYIA 4KZKA 4YCNA 4DR6B 4ZICA 1LVGA 3VR3A 4EF4A 5ICMA 1QO0A 1J39A 1DKOA 1Z6PA 1PCXA 5AM4A 2BKUA 2WAOA 4GS5A 4M8KA 1C7FA 1L5OA 2RHMA 3BTOA 3H83A 4C3VA 1M7HA 1KDVA 1W47A 1FZTA 1Q7TA 1CB0A 4RS4A 3E0QA 2O9JA 4HSGA 3T7DA 2E4ZA 1C8LA 3H1AA 2XR1A 2YXNA 1H1DA 3CWCA 4ZI7A 1E64A 1QV7A 1Y5MA 1VXRA 3ONDA 1FU7A 4NV0A 5TQVA 1MFZA 2A57A 3ADBA 5AHXA 5JH7A 1IVYA 4W63A 4B2YA 4ITVA 4ZYLA 1E1CB 3P9RA 4EHNA 3NVKI 2R97A 1ZVVA 3S5UA 1CEYA 4M0DA 1XVAA 2IDJA 1CV2A 2OMKA 4UD2A 2BE7A 3AK4A 1OFUA 2DPMA 2Q4BA 3OTQA 2WIBA 1X8KA 1EP2B 3MIIA 2I1LA 3OC0A 3OY2A 3GN2A 3OT4A 4MWBA 5B1IA 3RODA 5BNTA 3B6EA 5FNVA 1XLTA 1FBTA 4DM3A 3EF1A 2BBWA 4CV1A 5GZ6A 1ZQ9A 4ZO9A 4EQ6B 2GLTA 2IF0A 4DIKA 1K97A 2Y0BA 4YDHB 1N57A 1X42A 2XQKA 3KYDA 3TUIC 2CNWD 1DQRA 2OFFA 4HEA6 4FFRA 1NBIA 3IUPA 4WCFA 3S68A 2GB4A 2QM8A 3ZGOA 3A1TA 1MOZA 1D0SA 5ALQA 3VC3A 3D7LA 4EIWA 3AERA 3F0TA 1QH8A 4I4TA 4EGAA 5CB4B 3EGXB 4CCYA 4RFLA 2C98A 3TZCA 3HUFA 1DG1G 4ZIRA 2OVFA 5AQ1A 4CKBA 3PC2A 1E2IA 1KYVA 3JYPA 5B4UA 1I2MA 2L0XA 1UDRA 4MRRA 2V1UA 5GV8A 2R751 3P2EA 2HPAA 3H42B 2O5RA 2H5EA 3GJZA 2O0JA 5CX1A 2HSZA 1L1RA 4D43A 1A9OA 2NADA 2X23A 4YWJA 4JJZA 2GEVA 4FOLA 2CWWA 1GL7A 4R3NA 3P9CA 4XB2A 1QM5A 5DN6D 1H05A 1SC6A 3HYTA 2COEA 4N7BA 3ZI7A 3D0OA 1Y8RB 1PI3A 1RAIA 3OPMA 4NF2A 3JZFA 1XZAA 3KL4A 1X38A 1DC8A 1GSIA 4M7OA 1DKPA 3H75A 1N2IA 4MXDA 4BUZA 4G0WA 1Z0JA 2RHBA 1EHIA 4BDTA 5LZ8A 1Y9EA 1RVV1 2I29A 1D09A 2LDBA 3VYRB 1NT2A 1JZSA 1ZONA 3KOXA 1XZBA 2ZOSA 4MJ7A 1R6UA 2GAOA 1Z2NX 3DUWA 4V3BA 2ZI9A 1T9KA 2IW1A 3SX4A 4AMZA 5I3CA 5J4YA 1CJSA 4XM1A 4ENSA 3DAHA 2ZRKA 2ZVJA 1GCIA 4TSFD 3VDXA 4D9FA 1LK0A 1JQ3A 4IRXA 4B83A 1RZRA 1N2EA 2V7BA 2XWBF 4HDOB 2Q4RA 4URHA 3CYFA 2X6RA 2ZDHA 4KLRA 3MWGA 5BQ3A 2LVBA 1G8AA 2IPLA 3QWAA 1W8DA 4RVNA 1X2EA 4IEEA 4B4OA 2NO9A 3BAZA 3I09A 4LUCA 4N7RA 5IZ4A 3EFBA 8ATCA 2Y1DA 3I4FA 1RAEA 5BVHA 5AOCA 1GGHA 1QQ5A 1WMSA 4Y0AA 2DKOA 4AAYA 5DNUA 4Z3DA 2RGCA 4F5YA 5JUWA 4DMUB 1JG4A 3ISVA 3NTQA 2HMVA 2WQZA 1J22A 1SCBA 2X4DA 3I2FA 2PX3A 4X1KA 2D4AA 4FHCA 2VQDA 1QJCA 1YK1A 4WQMA 2C5LA 3B70A 4TTVA 2R7LA 3ZWBA 4OQPA 4C6RA 5KMGB 2QT0A 3HB9A 4AJNA 4XQCA 5I4CA 2FFRA 1E0SA 5TXGA 1NN0A 4JP5A 4PRYA 5FWYB 5TB5A 1M0SA 1E0AA 2BKEA 4OHBA 4HNAA 2C00A 3RW9A 1TJPB 3T52A 2BL4A 3F3MA 4CV2A 2CXNA 4RW0A 4C4XA 2E4WA 3MJ4A 3G2OA 4TYQA 3RVLA 3RHSA 1N36B 1O77A 4J6FA 5C18A 4RYLA 3LUGA 4C0KA 1T9DA 4I9UA 4AL4A 4TT3D 2Q8PA 3UY4A 4ISBA 3QBEA 3L2OB 5K4HA 1I7QB 4BXOB 3S40A 4R2WA 3MQ4A 1HFJA 2GNPA 2XMBA 3Q5EA 3Q3HA 3QU9A 3IEXA 2R1VA 3ZHCA 4YLYA 3AETB 4JODA 5C8YB 4NPCA 4ZCQA 5BV2P 1TCBA 2NSHA 3GZNB 3AB8A 2B7CA 3A2NA 4DT1B 4LWPA 3KM0A 3T3IA 2VK8A 3Q9SA 2EKQA 4CKCA 1A9ZA 4ALMA 2VJMB 3OKPA 3UUEA 1S2IA 5C80A 4BKPA 3QUAA 5TQ0A 1HZZC 4B6SA 2GN0A 4YJ3F 3AEQA 3S8MA 4F11A 1GQFA 2AWOA 3R6WA 1GTJ1 3RTBA 4TOIA 1QZ3A 5F5NA 3WS7A 4BB6A 5AJYA 4RK7A 1IU9A 1EX9A 4B40A 5B36A 1K88A 1IBLB 3PWSA 4Q1VA 3AFMA 3GUZA 4YVFA 1S2LA 1TJ3A 2IEGA 4FNAA 2P9FA 4IMJB 4RZ2A 1DO8A 3QNWA 1ULTA 2D54A 1QYXA 3P94A 1MJGM 3Q2KA 3DDNA 3D4BA 4P7FA 3OMWA 1S3FA 1I94B 3W7VA 1TLLA 5CEEA 3ERCA 3N58A 4JC4A 4AMBA 2NO7A 5FV7A 1ISGA 2VJQA 5HNKA 1H0RA 4DYVA 3OQOA 4IDFA 3MJCA 1FFXA 3IDSA 2QTWB 2C57A 5E2BA 3K20A 5FUBA 4MKGA 2O3RA 4CF3A 3GXBA 1I7NA 3H1FA 3TIFA 5F35A 5IANA 2OILA 2RJ3A 3B6JA 1V16B 4KHZA 2W90A 2WHXA 3D2AA 4IIVA 2QS9A 1NBMD 4PCLA 5A0VA 5EUCA 3I05A 2AK3A 1GV1A 3R6GA 1BWQA 4KTVE 5DNDA 3HGTA 1SMKA 3QM1A 4J0EA 5E9QA 3T99A 3GFPA 2Q9BA 5AIAA 1M3SA 3U26A 2DAPA 3ICQB 1E3DA 2XMDA 3L7OA 2J5XA 1HF3A 1WSDA 1G5IA 2BGRA 2YZ2A 4XJTA 4N03A 5JDIA 2JGAA 4G81A 4NG4A 3RYFB 2H2AA 2NUTB 5IKOA 3QEMA 3T7JA 3RVMA 3UJCA 3NHLA 4MP3A 5ALGA 2ZB2A 3E9EA 3MRTA 4KMMA 3LX4A 5HDBB 1XWWA 3QA3E 4XW2A 4FEGA 1U9IA 2QMZA 4AYXA 1ZPDA 2CVZA 2QROA 3Q6NA 4U4AA 5ADUS 3GP8A 3ZLBA 5E1MA 5F98A 3R3ZA 4R2LA 4IIEA 5EL0A 3TUZC 3T0IA 4LC0A 3S1LA 2O23A 4ZHQA 1HV8A 2F1HA 1CU1A 3TKYA 2BMJA 2FEKA 3FJOA 1PQUA 1V7CA 3KT0A 3C87A 1TTTA 1HI9A 1PX2A 3LV8A 3B9BA 4HH3C 2XI4A 1P7WA 2CLIB 3X1DA 4E5MA 4RTMA 4JENA 2P5TB 2H2WA 2L42A 4L4YA 4LRXA 3DNFA 3WJAA 2YJ6A 1KQGA 2GOYA 3D02A 4JQYA 2W00A 4L4UA 4O5OA 4KSCA 1U81A 4I7EA 4EHAA 2ZSFA 2OLKA 1P5HA 1HEUA 2QM7A 3N2KA 1DC4A 2R8YA 3LZDA 3C1AA 2J09A 2QMYA 2AN1A 4HDSB 1J21A 3X1MA 5EGNA 5C5IA 5IK2A 1FFCA 2LKDA 3LQQA 2C7BA 3ADPA 3AGQA 4JJFA 5C4MA 4JI5B 1HY3A 5LU9A 4EHJA 2NU6A 4EDFA 6LDHA 1NBME 5JBIA 2QTMA 4GYYA 4IILA 3QY0A 2VQFB 5AQEA 5EHXA 3UJ7A 2XQGA 2JI6A 1Q3KA 4MEAA 3WSVA 2PXXA 4N3NA 3ZU5A 2GVDC 4QDUA 2HEIA 2WFAA 3M6LA 2UZ1A 5FTMA 4EFNA 3CKLA 2QUKA 1G19A 3C5VA 3P2JA 3D1JA 4ER3A 4TM8A 1VJCA 4K28A 3L6UA 4RX1A 3SM3A 3KPVA 3LWDA 4GLOA 5HBGA 1NJSA 1Z4KA 3PHGA 5BRAA 1IPEA 4R0NA 3LOPA 4BBPA 1BX0A 2HMWA 7ADHA 1YZ3A 1HLPA 2QE7A 1UMCA 2ZJ3A 3BH7A 3PJFA 1IY1A 2HOQA 2J3QA 1IXRC 4IZ6A 1GA4A 3F2VA 2EATA 3KUXA 3DOHA 1GG9A 5JPIA 1C3LA 3GRVA 4LRTB 1I4EB 3M6VA 2GXSA 2SHKA 1R5BA 4G67A 3AU8A 4TKUB 2IRWA 3L6EA 4FD2A 4XLZA 1A72A 1Y7TA 4B44A 3VKUA 5MN6A 3HU5A 1UMBB 2A59A 2OB2A 2Q21A 3HCDA 4NENB 3V55A 4AURA 1SOUA 1BVUA 1PR0A 5BV8A 1ST2A 2C2HA 4BVJA 1GA1A 1XB2A 4RQUA 2HK7A 2V6MA 2HU7A 5EE3A 4XTCS 1LI7A 4TXMA 1NXWA 4IJMA 4MPDA 5DOZA 4O6VA 2BMFA 4AP9A 1WUHS 1AKUA 3V6MA 3TGLA 3I9MA 1VKRA 4Q18A 1HNNA 8GPBA 4LNAA 4BFTA 1N0VC 2PL5A 4JN6B 3C4JA 2HFJA 1DIHA 1Y3IA 2H1WA 4CW7A 1TLFA 2AHRA 1Y6FA 4PHCA 1Q0TA 4I1PA 3I2JA 1N9GA 1CQWA 2WE7A 5LP6A 2GM9A 1LF5A 1K6EA 1K4YA 1SKUA 3L92A 2DY0A 3L8GA 3JAWA 3Q7PA 5SYAA 1A69A 1E3WB 3D7KA 1U8CB 3H16A 4IAOA 4PQEA 1GQRA 2XQJA 4X8MA 4DBLC 2YWHA 1H0KA 1YR7A 1J2TA 2BKAA 3C7DB 4HUQA 2Y67A 4OV6B 5FNZA 5KHOC 3Q9NA 1KS9A 2G83A 1DJPA 1RPNA 2IYXA 4BBAA 3OBBA 4R1TA 5CUQA 3SKVA 2YKGA 1DBSA 3INNA 1JHZA 1KS2A 3HN6A 1RM3A 3QLVA 4D6XA 2UUAB 1QO7A 4BNFA 4EHHA 1G6OA 1ZD2P 3IUQA 4S1NA 3S2SA 3SJCA 2BT4A 5JHHB 1K89A 1XDWA 1N2CB 2AZ4A 2BFDA 2WWHA 3DHNA 3QXGA 4ESOA 1CY2A 2VSOA 1IJKA 1HUQA 4NMHA 3GUVA 4CV3A 4RC9A 2BN4A 3PUXA 1WSBA 4L6AA 3V4SA 1UQTA 3HBAA 3ND6A 2QTBA 5IASA 4KPGA 1IXKA 4URWR 1ZN2A 5DRTA 3L82B 3AXTA 1C0PA 4RM2A 4AJIA 1IBCA 3LZCA 3TI9A 3HXOA 4ZYUA 1C7RA 1BCRB 2EP7A 1EU1A 2C4TA 4F1JA 3O7MA 1PYOA 1MU0A 4GZMA 4OQFA 1T9GS 1MJGA 1N3IA 1O03A 1NY5A 5H82A 2AUNA 3UPDA 2BMVA 3CKYA 4PTLA 1NRIA 2HYDA 1LDEA 1GHTA 5IXSA 3HVRA 1X86B 3VR6D 1W73A 2ZUVA 5MN5A 3NVDA 1GZ4A 1SKAA 3AKYA 5JS2A 5BQXA 2FMKA 2O50A 1ZYUA 2PEYA 3ZV5A 3FOWA 3A6LA 3QFCA 5K6AA 3C39A 3A9CA 3RIHA 2YZMA 4MQ5A 3CO5A 2A4KA 5JAZA 1HA3A 1KVUA 1PQ4A 3OPXA 4EUEA 1M75A 2OV4A 2VJDA 1OBOA 3B1FA 4OD0A 4IGIA 3PXUA 5IBCA 3ZY4A 3EFHA 3MZ0A 3FNBA 4Y2TA 4II7A 4DC0A 4QARA 2W98A 3LKDA 2IUSA 3ZC3A 3ZI0A 1HYHA 3HJUA 4J0HA 4X6YA 3KDAA 1ZNZA 4QOHA 4J94A 2PX5A 4PAOA 3M6AA 1G60A 2EW2A 2VO1A 5FP0A 1EVIA 3KAKA 4ISCA 3AVYA 3KEQA 1P4RA 3TBKA 1PJRA 2XGMA 3F6BX 2NUPB 1IK4A 2P6NA 4ZEVA 4OHCA 4R2KA 4NICA 1NUTA 5C1BA 2Y1GA 4YJGA 4K05A 4Z4CA 3DBRA 3EXG2 3QJ5A 1P9NA 4I1SA 1TAGA 1OFHA 1TFRA 3ESYA 3GFQA 5A9SA 2BIFA 3CLTD 4LXHA 4BQEA 1L5MA 3MAGA 4NC9A 1M1YB 4R51A 5FUQA 5GV7A 2IHJA 2HA0A 3WIBA 2OAP1 4HP8A 4TPKA 2I0FA 3GJXC 4M1SA 4U3JB 5A1JA 1A2OA 2NW6A 4P81A 1DMSA 3H0KA 4L3OA 4UTPA 3AX6A 3FPEA 4DRXB 5LQRA 4AY2A 1XJCA 2CK3A 1G8MA 1OZHA 2X86A 2ZRAA 2MHCA 4P5PA 5L51A 2F8TA 5L7YA 2FWBA 1SVMA 1V1RA 2C59A 3CRQA 4NOKA 3S70A 4Z2AA 1T3ZA 2B1IA 2Z4RA 3DCYA 3P5BA 4HN2A 1Q1GA 1XXHB 1GYQA 2QTNA 3BKXA 3M2PA 2GJ4A 4L7VA 1KQNA 1L5GB 2ZXEA 3UZUA 5HX7A 3NT2A 4WZBE 1UK7A 3KKNA 4JT4A 1GPLA 2JL1A 3HSYA 1FVHA 3MWYW 4NMWA 1WU7A 1XRQA 2WSMA 3FLAA 1R9NA 2OA0A 1T0IA 3HS3A 4ZDWA 2J7PA 2G70A 3H6GA 5CA0B 1F2UA 5HCIA 1YTLA 2X0EA 1PJ8A 1QAOA 2ZULA 3D6HA 3W06A 3OA2A 2J6BA 3L0CA 2NLOA 3WKBA 4DDVA 4ZCRA 5C7YA 1WOMA 4XGQA 1E69A 3QPUA 1EJBA 4IF6A 4HYQA 1YNOA 5ARBA 1CQIA 1D2RA 1RXIA 1E63A 4TKVA 3E5MA 1YQTA 4GQBA 2W5UA 1XCGB 1WV1A 2FMTA 1JDJA 3TAHA 2CF5A 1N1GA 1I5OA 1W85A 2PAAA 1P75A 2AFHA 4EPXA 3BTSA 4OMFG 1W87A 3PQ2A 3USES 2ZUDA 3EGIA 4HQ0A 1Z7YA 4JOQA 1E9SA 1AE1A 3U60B 1COWD 2C7RA 4X84A 3WWOA 1OYOA 2CLMB 4AY4A 1NVTA 5CA1F 1KDOA 5JU6A 3O8OB 4WFIA 4PX9A 2QHXA 4AO8A 4F38A 2C3UA 4U9IS 3IVGA 4OFXA 3TGWA 3G2HA 3P9QA 4GE0A 4YAEA 1JIUA 2QRJA 4O4HF 5K2OA 3NT4A 3K32A 1Y82A 3EW7A 4DQLA 1PJLA 3F96A 1LWNA 2RC5A 4HAWA 1Z4IA 1VA5A 2DKFA 3NBZC 3NHJA 3V8RA 4KPYA 3TXXA 3KQNA 1DCKA 1R74A 3NUGA 4A8TA 3JW8A 2QDKA 3JQAB 3LO5A 2AD1A 4QUGA 5CDHA 1M2OB 2QRUA 1U1IA 3NIFB 3HCWA 1NSFA 4FI3F 3TCXB 3ZTYA 2PKQP 5IJ0B 3OF2A 3H6HA 1JVBA 1XMJA 4Z3OA 3P96A 1ZH2A 2ZSEA 1QRRA 1O95D 1PK7A 1UKAA 1XCOA 3M70A 4MUHA 3TW8B 4E32A 4Z7OB 5J4KA 3OQNA 1KMHB 3RS9A 5HUJA 2E4UA 4YHHB 1MH9A 3UYKA 3O91A 4DDMA 4IQFA 3EUEA 4L8VA 1Z8FA 3KOUA 2I80A 5AESA 5A4IS 1NNSA 1OWNA 3H1TA 3A4MA 4D25A 1GR0A 4Y6OA 3B89A 3O3OB 3COYA 1WW8A 5LBUA 4UHCA 1ZSNA 1JT2A 2VPTA 3AVQA 3EHEA 3KLOA 4RAOA 4XVQA 4INOA 1AXEA 1JSRA 2B20A 4KE7A 2I4OA 4DAEA 5IKPA 1HQKA 5FB3A 4LRQA 3UHOA 1P73A 1ZH0A 3I2HA 3UTCA 3WGMA 4RJ2A 4BKUA 4FX2A 3NCHA 5FR2A 4GXRA 1G18A 1YL6A 3FNGA 1WXFA 3OM1A 1XNJA 5JWRA 1DFGA 1L5RA 4DMCA 3IP5A 2OC9A 4KH0A 5G1OA 1IM2A 2B2XA 2Z9CA 2RE8A 3OLZA 3I42A 4F7DA 4GU5A 3GH1A 4AUNA 3MBKA 1RKBA 1ZZEA 2X77A 3CB2A 2RB4A 4Q7MB 1NC1A 3V1YA 1RAGA 3EIHA 5KNBD 1VMIA 3IAHA 4R40A 4C6SA 1R6DA 1ZW6A 2Q4DA 4RVOA 4AM8A 2C2ZA 3I52A 3MINA 2D59A 4YALA 1WAMA 2WUFA 2B4AA 4MDYA 4U7WA 3NBQA 1E3TA 1QKKA 3VR4D 3FGOA 4DC9A 3B1WA 1C3OB 3C5CA 1UBGA 1IDOA 1Z12A 3E1SA 3RYHA 3TRFA 1JAZA 2P79A 5DHAA 2QSZA 3HV0A 3SU8A 3CO0S 3F3YA 2VWPA 3ZE1B 5K0SA 1P74A 4IDBA 2UZIR 1DCTA 2FSVC 2BLNA 1FP2A 1LY1A 1AGYA 4HFNA 2YNMA 4A16A 5IN4A 5MGBA 5EP1A 1MFPA 1ZM7A 4W9RA 3NWEA 4HH1A 4BFSA 1OLUA 4OLFA 4WZAB 3SF8A 1HYBA 1E2QA 3UH0A 4I50B 2IVFA 3BF7A 4QU8A 3K2EA 3UW1A 3VNUA 5JXGA 3OSUA 4INZA 2F64A 1XYYA 2E87A 1V11A 1EZ1A 16PKA 4EARA 5LKAA 1ZBQA 5HIAA 5KKCA 1H9CA 3O94A 4MYTA 3AY7A 3VTFA 1YUBA 7REQB 1DXQA 4FKBA 4XLLA 3HEMA 2FUG1 3PC8A 4ESEA 1KDTA 1TFUA 3DMHA 4NI5A 4ZO7A 2EF0A 4KV9A 1RWKA 1R0YA 4ZEWA 2XVAA 5BXQC 2KM1A 4A6EA 1VM6A 5IJ9B 2WIJA 3UWSA 2V59A 4PQYA 2QLNA 2W9XA 3A6GA 5E7JA 4WLFA 5BR1A 2ZBVA 1UJ4A 1WMBA 1YSCA 3DVQX 5B4VA 1ODJA 1DOAA 1GPUA 2E37A 4KK4A 3N8GA 4IIGA 3TZBA 4PLWA 4C89A 1GJRA 4BASA 5AVOA 3DQQA 4ZC8A 3WA6A 2JFOA 2W8BA 4C0WA 1D6JA 1QPGA 2WMOB 1RWXA 4Q4LA 3OJCA 3OEEA 4HWKA 1R0ZA 1ZLYA 1ZXLA 3HBNA 1XLWA 2AG8A 2C4UA 2PUTA 3DZHA 5BPHA 4UTNA 3CT4A 5KYTA 2CUKA 1ORWA 1P5JA 4MDHA 4ZQIA 3CCFA 4D42A 1YTUA 1RAAA 1JRLA 3BDIA 4DMMA 3PKIA 3E35A 2CV2A 5CM8B 1E9RA 1RPAA 1JXOA 3O8QB 3WYAA 4R9SA 4DV1B 4G2NA 2CLFB 4R01A 4YS6A 1KF0A 3RBZA 1A5SB 2AMFA 3GG9A 1IN7A 4M1MA 2AYYA 1KH2A 3FGNA 4HPWA 1L0BA 4Q24A 3A6PC 4MS1B 1V35A 2J59A 4L8GA 2H1OA 1W4LA 2EYQA 4Y6GB 2HT1A 5L3SA 5DCYA 4B09A 1F2TB 2AI1A 1R6XA 3R5HA 3GFSA 3PVCA 3B6ZA 2JEZA 1X1TA 2H07A 2EWVA 1I01A 1IEXA 4MVJI 3UKJA 4MIOA 1X1RA 4HVAA 3I2IA 8ABPA 1POWA 3R4VA 2BEKA 1FS5A 3H4VA 3CSSA 2D5AA 3Q4GA 5EIBC 3TFQA 1CRWG 2ZQ5A 2J08A 4PGFA 1NP6A 4MB2A 1BKYA 4MS4B 3Q85A 2VPYA 4HB2A 2FWRA 2VHZA 3H7AA 2PA0A 1O0SA 3IULA 4LVNA 3JASA 2GM4A 1T3HA 1C14A 3MC1A 4URXR 4NXNB 3IP3A 4CUZA 4DA0A 3EPLA 1ORHA 3UAWA 2J4FA 3DCIA 3G0DA 3K15A 3U81A 4C0SA 5EQTA 3EOAI 5A6SA 1WEHA 1NTRA 3BB4A 3DEJA 2PUGA 4BRZA 4ERXA 3I61A 2W6JA 4H3KB 4PBTA 4BLUA 1N4AA 4JEMA 1KWKA 2EYUA 1T0PA 1ADJA 4MMYB 5B37A 2UVDA 4YJ2F 1IOVA 1VPVA 2GKOA 3PQEA 4GXQA 1J8VA 5LBTA 3R7AA 4A8JA 3G2IA 4V0OA 1L5WA 2PRSA 4EUFA 1Q1EA 2QUZA 2VJOA 5AW8A 2ISCA 1ND6A 4RHYA 1MP0A 1XLVA 2J5RA 1HG0A 1LA2A 1W5EA 2ZAMA 4WBNA 2FK7A 1JEOA 4CIYA 2NYAA 3MT9A 3ON5A 1NX6A 1PNVA 3G5UA 1Y5RA 3BMNA 4NV3A 4MVJH 4ZT7A 1EFPB 5F1OA 2WD8A 4B81A 3N8IA 4D4IA 1YWGO 2OZLA 5JJLA 3NRJA 5G02A 3JZDA 3GLFE 3HJGA 1UBTS 4D57A 1GTL1 3UMMA 1P1BA 1R12A 2FOLA 4N48A 4M6WB 4A92A 3KUCA 3REQB 2OQRA 3OETA 4JLOA 1EGHA 2IIPA 4OBBA 4PRKA 3BSSA 4ZT6A 5HKOA 2N42A 2Q6OA 1YO6A 1KQFA 3GH3A 5HJ5A 1UMKA 5EZYA 1M5RA 3IBFA 2FN9A 3PQ4A 5CP8A 4CBVA 1IEVA 3LQ4A 4I0WB 5K0TA 3PLAE 3GBSA 4OOFA 3DV2A 2FHSA 1E7MA 4RGYA 5BSMA 3THWB 1FFWA 2J5QA 2PLNA 3I62A 2CLCX 5A4AA 5JV5A 2NZXA 2G9UA 3EJ6A 4LPKA 4OQDA 4BGEA 1U4SA 2VTKA 4AJKA 4MUJA 3U31A 1YFLA 4OUDA 5KTYA 3WMWA 3RAFC 2X2FA 5AJVB 1TZMA 1XTJA 5JY1A 1HYEA 3I23A 1X3LA 3GLGA 2I2CA 5JYBA 3R9KA 3HZHA 3M9WA 3PUYA 2OGZA 1ANKA 1Q0SA 4JL5A 1DS6A 4YY3B 1YQQA 4IXTA 1JPNA 3LFUA 5C4IA 1Q20A 4UM9B 1KFCB 2G9NA 4NYMQ 1G17A 2WOOA 1WG8A 3RIYA 2PX4A 4LDAA 1WIWA 3ANTA 1PDOA 4DNFA 4CM8A 4B6PA 3G2LA 4JBIA 4YQFA 5AH0A 1L1QA 3JWGA 5A5GA 1YDMA 3KCNA 3T3NA 3H2ZA 1APBA 2G1PA 1KEPA 3MWLA 5DP2A 1KEKA 3DVAA 3ZWVA 1D1PA 2L82A 2O7RA 1N2OA 2PU5A 4ZCLA 1VFPA 2BGLA 3NV7A 5C2JB 1HT1E 1JQDA 4D97A 1UKBA 3WGUA 2P0YA 2HIMA 3W6PA 2WMNB 2R00A 1SXQA 2Q9AA 1X70A 4B4DA 2IUYA 3CGWA 2BFBA 3DWGA 1XQWA 1FYFA 1FA9A 4JIMA 4MWCA 1YCGA 4K9SA 1TVKA 2O8FA 4B7CA 1NLUA 1JPJA 2NTVA 3OFND 4Z9FA 5BSGA 4KIGA 4MKRA 2A35A 4PC3A 1U3GA 3D6UA 1E9AA 1K6IA 2JIOA 4M1YA 3PGLA 4UHKA 5EIHA 4DXDA 5ALVA 4M1EA 3G1UA 4W7HA 2NU8A 4W7SA 2GERA 5KJFA 2MTBA 4OL9A 1T1JA 2CJWB 3B6KA 2QNIA 3FB1A 3HP7A 3QW4B 4NK5A 1K8QA 2I91A 4IPTA 3EDYA 3FF4A 3MIZA 4PSKA 1H0SA 3IP7A 4PFJA 4RKRA 5AI8A 2MR6A 2QZJA 4OGKA 4PHHA 4H6VA 4I3HA 3U7QA 1F9AA 5DXAA 1L8OA 4EJ2A 2B8JA 2IS4A 2ZJYA 1R64A 3BX1A 3PFWO 2VP4A 2JBAB 1NRWA 4K6CA 1VRCA 4CI9A 2HWYA 1HYGA 3MSCA 3K1AA 4V0RA 4ZK2A 1NJ2A 2GXQA 5JDCC 4JI0B 4AKSA 3GJ6A 1JAYA 5ES3A 2HBRA 3ZJTA 3IEPA 4IUCS 2FYTA 1U0GA 3HDHA 3JPWA 3HSKA 5ESWA 3HNOA 1XG5A 5CJ2A 3WLSA 3FNRA 3R7LA 5IDYA 5IW8A 5ICSA 1IXSB 1F0NA 1Z4OA 1HLFA 1RNLA 2AV6A 1MEOA 2YXLA 3ZDCA 4F7WA 1MVLA 3Q0IA 4PICA 3CX8A 2P0AA 5DYGA 3WYGA 2W2KB 3S2UA 2ZATA 3RM3A 4ROSA 4OHPA 4P53A 5FAKA 5FLEX 4QREA 3LCUA 3CINA 4C4TA 1U0JA 4F12A 9ATCA 3LP8A 2OEPA 3U61B 1PYGA 2PS0A 3UNXA 4ALIA 5FOSA 5KI6A 1VG9B 3D31A 4BGDA 2QUHA 2FR1A 4HUTA 1JN0A 5LMUB 3P20A 1NF3A 4HPXB 4W8HA 5DDIP 3FYUC 1NMZA 3HUTA 4LMAA 3V33A 3HUEA 1JFLA 1FNMA 1LDGA 3N0WA 4WJLA 3ZD6A 1F6DA 1MA3A 1JMKC 1T5DX 4DV2B 2MINA 2NZJA 1IJBA 3O1LA 2I6SA 4HFJA 1GV0A 3R7WA 1DEKA 1IZ0A 1XZ8A 3C4VA 3DDWA 3I92A 4L5IA 3SI7A 1D6SA 1QB7A 4MWZA 1SGWA 1NWHA 1PFYA 4KI7A 5A5EA 3VHXB 1PUIA 4BN0A 3G8YA 2JIZA 3WSWA 3DWIA 5ALJA 5CYGA 3QE3A 1T5TA 1TCVA 2B7BA 2DQZA 1PR1A 3FYTA 1FSGA 1K7YA 3LMKA 4KRGA 1AF7A 1WUKS 1MV5A 1HDXA 2M2IA 4RJLA 4MLPA 4DPKA 1JHUA 1R3DA 4UBNA 2FW1A 2DP4E 1U7OA 2ZUSA 3AJEA 5BR4A 3PQFA 2O6HA 1Y8QB 3EVAA 4IUBS 2CHFA 2R47A 1E66A 5T8KC 4KBFA 4G0UA 1H2EA 1IY8A 1LB1B 4LDZA 4JVOA 3LC7O 2NV6A 5LZ5A 1XZQA 3VJKA 1FMFA 2N9UA 1EFVA 1E5QA 1EA7A 3RNOA 3V7FA 3AI3A 3HO6A 3WNCA 3G9XA 3E15A 4PZZA 3GW8A 2AA3A 3QLUC 4CIBA 4A73A 4XUCA 2RGEA 3M89A 1A9PA 1VIVA 2W2TA 4QJ3A 4FGLA 4L95C 1O08A 4X3CA 3ZW7A 4RPCA 3K2BA 3LT5A 3PICA 2WP0A 2FR8A 2CNWA 3DCNA 1KP3A 3R5FA 3WXBA 3NONA 2D1YA 1RHJA 5LQDA 1XNRB 1UINA 1ID8A 3DOOA 2GZRA 1ORVA 3PRYA 5KJ6A 1JB1A 3FPSA 2QJWA 5ER9A 1WCYA 4KQKA 4NHOA 2AD5A 4NOJA 2QWXA 4QEDA 3WHPA 2VG8A 4H7PA 1N0HA 3DBHB 1EUYA 2WV7A 1QTQA 1FLDA 1HDRA 3HRHA 1DOZA 1GDHA 3IODA 4QXPA 4BNGA 1NP7A 4RPJA 4K9PA 1SVKA 2Y92A 2EW8A 3FTCA 4C0XA 3PXBA 3UPUA 1Z25A 3ESQA 1E2FA 4A26A 5BT9A 1DEAA 4ZP1A 1ZX1A 1NHWA 4BV2A 4CKZA 4K1LA 3OIGA 1HFKA 1RIIA 2C3MA 2Y2UA 4KXLA 1FLNA 1X1DA 1DFHA 2EWWA 4PW0A 4NNJA 2UUCB 1NY6A 1TUBA 4LBZA 5DSXA 1KEWA 1XHEA 4C2UA 4ZVLA 2BBSA 1C3JA 3PPWA 3OG9A 4KP7A 3RR2A 4UJ5A 3KDSE 5J2UB 2BSXA 5EQJB 2AEJA 4TV9F 5GAJA 5HJ2A 2ONCA 1AO3A 4DRZA 1RTKA 2MMGA 2G4LA 4C01A 4D9GA 3GRKA 5KSOA 5DEOA 3B3JA 4PSUA 1GPAA 1WB9A 1AUOA 1CZOA 5ALNA 5I7HA 1XZPA 1XJ0A 4R69A 1NFRA 4EG5A 4G2TA 4FLFA 3DDOA 4TSFA 4BLRA 1KE1A 2NVOA 5AVWA 2R44A 4HMPA 4LXXA 2ZJ5A 1TU0A 3RIMA 3V97A 3EPPA 5DIZA 2FN8A 2HLDD 1P9LA 1Q3TA 2FZEA 2Q1YA 5BP7A 3KVNA 3B3GA 3GO4A 1X94A 2V7QD 3KQTA 1NN1A 1AG9A 3EFOA 4J9UE 1XKLA 1RM5A 2PCLA 3IVMA 2WU8A 2GYUA 2X9NA 3VZDA 3ZTWA 5HWSA 5K6RA 2DFKB 2ZIZA 3JAKA 4W5HA 3BT7A 3KSRA 1L8AA 1YJXA 1NMYA 2LP4Y 2VP0A 2PVCA 3MCWA 5E6UB 2XB4A 2WY2D 4KYTA 4E6EA 1GRCA 3W5SA 1CDDA 2QD5A 3PG5A 2ZKLA 1E99A 2Y8EA 3M5PA 3WLFA 1C30B 2FEPA 4IZHA 2VYVD 3ZJ5A 4EHLA 1HWYA 4MR7B 2LPMA 1OE0A 4Q1CA 4RK5A 4RVSA 3VO1A 3NHKA 3ZIAA 5KOYA 4GHWA 3M0EA 4YRKA 4AP5A 1KXJA 4YMVA 3HCCA 1P2DA 3NKVA 4BXOA 1FCJA 1KNQA 2NT3A 4NKRA 1XWIA 3K6SA 3ZNPA 5C8YA 3ITEA 4OXNA 3AETA 5F1PA 3HCPA 1Y6JA 2XXJA 1PGPA 1XTQA 1KKLA 2FU5C 4TT3A 4FFBB 4TUYB 5JSKA 1THZA 4O2BA 1VG0B 2C88A 4OXKA 4UEQA 1TL7C 3EXAA 3EIXA 3F4BA 5ENDA 2R66A 4TRRA 1JLLB 2FQXA 3ZGVA 4R5MA 4L76A 4Z8XA 3WX0A 5IH3A 1B26A 1KEVA 4I9FA 4CMGA 4D2IA 5J59A 3SG0A 3AIKA 4D45A 1OFUX 5ALZA 4DG8A 3SWWA 1O96B 1QF7A 2BI7A 5E4TA 1EWVA 1OFVA 1Q14A 3TZEA 1TXGA 4CMJA 5KSWB 1T6ZA 4BC1A 3OOHA 4QTXA 2WIGA 3P4XA 5J40A 1FFDA 1LDYA 2XMCA 4C0JA 1ZGCA 3R3JA 1KEZA 1SUWA 2FPGB 3TNYA 1KTIA 1ZWKA 1WBDA 2V3CC 5DFAA 4REQB 4OATA 2Z4TA 4HCJA 1WB6A 2IUTA 1PJCA 3O8RA 1HE8B 3X3HA 3TQFA 1P77A 2ECFA 1BJKA 3SF0A 3BH0A 3FPCA 4FMPA 4ZYVA 4PZYA 3UM9A 3R40A 2IE8A 3MRVA 1W48A 4MSUA 5A03A 2W2OA 1D5CA 4JBWA 1UF9A 3LGSA 3PS9A 3KLNA 2H29A 1FB5A 1W44A 3AP3A 4CR8A 4YT5A 3HM9A 1QQ7A 3M1LA 1C41A 1DBVO 3J80A 4D3ZA 4YGXB 1WXEA 1U63A 4EG8A 3DE5X 5DNVA 2ZSDA 3T4UA 5JVDF 1C5KA 2I87A 3CF6R 5HFAA 3PSHA 1YZFA 4G01B 2XSZD 4F4IA 3ZE8A 5AHRA 4G8DA 2EKPA 2XCTB 2YOGA 1K5GA 4I9HA 1WXDA 4IQ0A 3A4LA 4IIBA 1T4CB 2IYEA 3HVIA 3PEYA 3RYFA 1YS1X 2BUAA 2XE4A 2ZIFA 3Q3CA 1RPZA 1NW4A 1IDN1 3HVJA 3ZDZB 1NQAO 3CQ9A 1MIOB 2QMEA 3GA0A 2P40A 4Z4GA 1SCUB 4EM6A 3ODPA 4LNHA 5DYNA 1CFJA 5KOHA 3MWKA 2YHAA 4F4JA 5B58T 3L8CA 4LJYA 3U3KA 3LT4A 3HB5X 3NMUF 4HGYA 4LOKA 2J67A 2Q7DA 4URFA 3O9VA 3OQ1A 1HDOA 1SKBA 3CZQA 1VHLA 2CMDA 4OFZA 3CCBA 2XOKA 1V71A 3T3GA 4ARZB 1ZSVA 1H2YA 2NQ8A 2AZTA 4TWJA 4Z7NB 5ESDA 4Y18A 2SKEA 1W1IA 2IEYA 3EXHC 2GGSA 4PBSA 4AUMA 2PS9A 1JBQA 1T6NA 3R2JA 5EZ5A 3T5GA 1QHGA 2AUMA 3GK3A 3WC4A 1NZJA 5K3OA 3D0QA 4AXBA 3PDCA 4ARAA 1HTBA 4LIPD 3GV0A 4HGRA 3HDVA 3B5JA 3QU2A 4IXWA 5B1YA 4M9XA 1X0VA 3ZVKA 1E1RA 3T35A 2HXYA 3G8DA 1N3BA 4FLEA 4ZI7F 4UMEA 2CB9A 3SEZA 1TAUA 4LZAA 2RKWA 3S7TA 4HDSA 4E11A 4B3RB 3MVEA 2F3UA 3WAJA 1MZPA 1PEAA 3N2YA 4QTZA 3A1SA 1VCOA 1WHSB 2A9FA 2BFFA 4CDGA 3IR7A 4IL5A 1V4VA 4QUDA 3SQDA 5AOVA 3LQKA 4QBTA 5KNDA 1P7YA 2PH7A 1MOPA 1EG7A 2Z04A 2BJHA 3QPVA 2DHRA 2CNKA 2PAFA 3RS0A 1YUMA 3ESZA 4PHTA 1DSSG 3OT5A 1NYLA 4WAUA 3FKSA 4DLAA 5KOJB 1LXCA 2QRNA 3W8DA 4QRIA 3FYHA 3R23A 3KXKA 1R9MA 4E2FA 3EY4A 5K0ZA 2M98A 2NQTA 4DIBA 2B8TA 2YDYA 2AEMA 4K8RB 2VHTA 4BPBA 1S02A 2REBA 5JD4A 4HRAA 1TYEB 1QDEA 5BT8A 4JI7B 4ZDKA 3M83A 4CVNA 3O38A 3SX2A 1JQJC 1CS0A 3D6AA 1ZGHA 4U9HS 1LGYA 3TH5A 3IVRA 3TR0A 1FLVA 4OJNA