2RG1A

Crystal structure of e. coli wrba apoprotein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
196
structure length
168
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGGGQEQTITSTWTTLAHHGMVIVPIGYAGTPYGATTIASRQPSQEELSIARYQGEYVAGLAVKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural organization of WrbA in apo- and holoprotein crystals.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase, electron transport
molecule keywords Flavoprotein WrbA
total genus 62
structure length 168
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rg1A00
3B6JA 1KBOA 1AZLA 3KAQA 1H66A 2BZSA 2M6SA 2V5VA 3OWXA 2QX8A 3OX2A 1BVYF 3G5MA 1D04A 4QOEA 2QMZA 1WSBA 3OJWA 1DX9A 2KQUA 2FVXA 1T5BA 4LA4A 4XDHA 3L9XA 1AKUA 2QX9A 3NHPA 3NHRA 4S24A 1RTTA 4XDGA 4C14A 2OHHA 1FLNA 1YDGA 3N3AC 1NNI1 2R96A 5LMCA 1AKVA 4N9QA 3F6RA 3P0RA 1BU5A 1DXQA 3KAPA 4DIKA 1OFVA 4HEQA 5LVAA 1D03A 1FLAA 2QX4A 5A4KA 1CZKA 3ZHOA 2Q62A 2ARKA 4NULA 1TIKA 3L9WA 4FGKA 1FLDA 4Y9UA 4FGLA 3NHKA 2FAXA 2W5UA 2Z9DA 1VMEA 3ESXA 2FDXA 3FNIA 2V5UA 2RG1A 4U7FA 5F12A 4QOGA 3UXHA 3U7IA 1XT6A 2HNBA 3B6MA 3JSXA 2OYSA 2QMYA 4ZVLA 1T0IA 4GQIA 4QOFA 4YALA 4QOHA 4YAOA 1YCGA 1XYVA 2N1MA 5FUQA 4PTYA 4C76A 4YAUA 4OXXA 3LCMA 1C7FA 3S2YA 3HLYA 3QFCA 3NFRA 4LTDA 5EA2A 1ZWKA 1DXOA 2QX6A 5EMNA 4N82A 1SQSA 5LBTA 5B3LA 2XODA 3HA2A 4ZVKA 1I1OA 4BMPB 4C0XA 1B1CA 3KLBA 3N39C 3N3BC 4H2DA 3TZBA 1YKGA 1D4AA 4FX2A 4LTNA 5F51A 4ESEA 3W78A 1AKQA 1FTGA 3GFRA 2X2PA 4DILA 2GSWA 1XI2A 1YCFA 2A5LA 2FOXA 3NHLA 4NLLA 5BUCA 3EYWA 1FUEA 2HNAA 2OHIA 5NULA 2FZ5A 2HPVA 2Z9BA 3O73A 1J8QA 2Z98A 3O2NA 4PU0A 1QR2A 2MWMA 1KBQA 1QHEA 3B6KA 3QFRA 1J9ZA 2QWXA 6NULA 4R81A 3OVMA 1X77A 3F6SA 4PTZA 1CZUA 3GAMA 3NLLA 4QOIA 2FLVA 3TE7A 2X2OA 3GFQA 1SG0A 4ICIA 1J9EA 1AMOA 4Y7CA 1H69A 1F4PA 3U7RA 1RLJA 2V9CA 1J9GA 3OX1A 4H6PA 4GI5A 3FX2A 1YOBA 1YCHA 3OWHA 4YAWA 1FLVA 5LLDA 4U7HA 2BPOA 2KLBA 4M0CA 2OHJA 3OJXA 4Y9RA 1FX1A 2ZKIA 5LJLA 3F90A 2M6RA 4YQEA 5B3KA 2MOKA 1AHNA 3NHFA 5TGZA 2Q9UA 5FX2A 2D5IA 4GR9A 2XOEA 4C0WA 1TLLA 4YAFA 2BF4A 1AKRA 1AKTA 4FGJA 1FVXA 3F2VA 3GFSA 3HR4A 4QOJA 1XYYA 3NHYA 2AMJA 3ES9A 1WSWA 3TEMA 1QBGA 3NHJA 1QRDA 4N65A 5F4BA 1OBVA 3ESZA 4LTMA 3LT5A 2FX2A 3FVWA 3FJOA 4HS4A 5NLLA 1JA0A 1JA1A 5ULLA 1GG5A 3OX3A 5FA6A 1CZHA 2MT9A 1ZX1A 5JROA 1RCFA 4CF6A 1CZRA 2QR2A 4D02A 3D7NA 2BMVA 3W79A 4BMOB 4F8YA 2FCRA 1C7EA 3ESYA 3FW1A 3NHWA 1ZWLA 4J8PA 3RPEA 2MTBA 1OBOA 2R97A 2WC1A 4ZVNA 3UXEA 3NHSA 4LAFA 4U7GA 4CETA 2Z9CA 3W77A 4QODA 3QE2A 1CZLA 1RLIA 1V4BA 3SVLA 3KEGA 3R6WA 5LJIA 3NHUA 3K20A 1AKWA 3W7AA 5EAIA 1AG9A 3B6IA 1E5DA 1CZOA 5LBUA 4DY4A 1CZNA 2BN4A 3K1YA 4ZVMA 1YRHA 2B3DA 3EDOA 2FZVA 2F1OA
chains in the Genus database with same CATH superfamily
5CT9A 3UW1A 1TIPA 3U48A 4F0JA 4UOZA 4PSCA 4UNPA 5FBQB 3X1XA 1E0SA 3W5VA 3E9ZA 2Q3JA 1FPMA 4YJKA 4QXOA 3GX1A 3L79A 3MCVA 3DM5A 3UJ9A 5J23A 5IK2A 4LIPD 1MG5A 3MXOA 5BN1A 3T3NA 1C1DA 2X1VA 1ULHA 1RE0A 5F3DA 5A9RA 1CY1A 3C3XA 1N1MA 1VE9A 4JFAA 4TXMA 1X7XB 1YBMA 4OYYA 3HKBB 4KGDA 4UUQA 1JJBA 3RQIA 1QM5A 4ENRA 3TSCA 3CB4A 3LPCA 1HG1A 3K8ZA 4BUZA 1KYIA 2IYVA 2I6GA 2DHDA 2PCJA 4BMDA 3SHQA 3TBHA 4R9NA 3W3AA 3I2FA 4IHJB 2LTAA 4HSGA 2IA5A 5DFAA 4MO9A 4C76A 4QSHA 4OJYA 1NT2A 2YWBA 2CHUA 3OOJA 3PFHA 5TRTA 1O0SA 5ECYA 1EFCA 2I7DA 1N36B 2G1PA 3FPKA 2K87A 2XUPA 1HY3A 4FT4A 3P4UA 4LOKA 1QS0B 1E5XA 3DDNA 1K6MA 1JR3D 2N3ZA 2J0SA 1FS6A 1YCFA 3AOEA 3HB5X 2QLNA 5GJWC 4HH0A 1E79D 2ZU6A 4I36A 4BVLA 1IE3A 4MVCA 1X13A 1BGXT 2PWAA 4JUIA 2J67A 1XQWA 1P3JA 2YWDA 3AP2A 5DMXA 5ILQA 2RONA 5BWMA 1UXHA 5BXQC 2IS4A 1C14A 3MELA 2IEDA 2O1WA 3JATB 4ATNA 1S02A 2YFKA 3H1AA 4BNTA 1J25A 3F6SA 5CAEA 2GF2A 3TMKA 3UICA 1WUTA 5A0TA 3TLKA 2CNNA 4HKTA 3T41A 1HNZB 3D1JA 2ZITA 1SK9A 3VU9A 4EG4A 3GRZA 4RVGA 1Y63A 2D0PB 1X1TA 4MMYB 1FVOA 1YC5A 1YA4A 2ZIEA 4OMCA 1NU8A 3AJEA 5SV2A 3SF0A 3SFVA 4A0QA 1KYTA 4WJLA 1E77A 1UJ2A 2AOXA 1JSCA 1KO8A 2FN8A 2HA7A 2ICAA 3HEMA 3M1IA 1PUXA 3E9QA 3G2QA 4KE6A 4M54A 4BLSA 4DBVO 3IUPA 1DE0A 1IN1A 1WPXA 3H2ZA 4GMHA 3IVAA 2Q2NA 5LU9A 4BEBA 1WVMA 4TMZA 3UEOA 2IP4A 3W1VA 4NYJR 5IM4F 1CQJB 1CY6A 1WSWA 2GMWA 1AUOA 4KQMA 4S1WA 4YDQA 1KGDA 3LBNA 3NHJA 3I0MA 5SY4A 4LRWA 5IFLA 1F9AA 1JA0A 5T3UA 4B5KA 4DV6B 2W6ID 3DXXA 2WIBA 4BAUA 2IPMA 4PZEA 5P21A 3W79A 2F1IA 3CLRD 3CSUA 4JOCA 3TTWA 1ORDA 3F9CA 2QB5A 2Z8YA 4HGNA 5LBIA 1BCSB 3KYDA 3OFND 3R7BA 3CN7A 5ELXA 2ONYA 4KR2A 2C4UA 3MYYA 1SD5A 1TLTA 1XNHA 2LCIA 1FRVA 3N0VA 4QVGA 1Z9BA 3JATA 4XR4A 4YHBA 5AKYA 1FRQA 1XWFA 4JOBA 4GF5A 1T5DX 1T4MA 4GVPA 4JT2A 2HTEA 3S2FA 4MRMB 1R6AA 3UATA 4FMCF 3UGKA 4TSFD 1XA3A 1XL1A 4QJ4A 1V7CA 3CW8X 3VR2D 2AE1A 2WF8A 3FNBA 4FHCA 4Q4JA 1EINA 1EVZA 3B3GA 5IWCA 3BHMA 4Q3AA 5K3AA 2GJSA 1WIWA 4UAUA 3ZWBA 2QX9A 1DP4A 1E1CA 2VJMB 4Y1EA 2AJDA 3ABSB 1JAYA 3UFXA 4BKOA 2GA8A 1HEIA 2D06A 5CXSA 3RVOA 3IS3A 1FDWA 3IBCA 3VJMA 4B7ZA 2F3UA 4OLJA 2MU1A 3SXUB 5HRAA 2RAPA 2QX4A 1X92A 1CZKA 4I55F 3QK7A 4D79A 2ARKA 3MXTA 5B3JA 3DV0B 4X1YB 4HN2A 4PN7A 4JL8A 3I6IA 4IIEA 5FQOA 5CA0A 5J4LA 2X7JA 4BE7B 1E94E 1NV8A 4IH9A 4L5AA 4PIVA 3RAFC 1RCUA 3PICA 2EJUA 4ME6A 4GM0A 2OQRA 5LP6B 1O57A 2ZTUA 3DZHA 4H3SA 4EA6A 1FYWA 2HYIC 4IG4A 1MH1A 4BEVA 2I4OA 1BHO1 2N46A 2N75A 3BE6A 1MOPA 1RKBA 4F2WA 3AFOA 2AEEA 1HDIA 3JQFC 3DCIA 3B8EA 1XTJA 3DAYA 3HDGA 4MV7A 2HEIA 1C3XA 3FETA 1G6KA 4Q34A 2FPUA 4JLSA 1NWCA 3P1JA 5AXDA 3AZQA 1P0FA 1Z4PX 3A4IA 2WWXA 4CMBA 4EPRA 1DIGA 1FRZA 2OHIA 4YRJA 3TR6A 4N5HX 4R1PA 4AY3A 4U63A 1OXKB 2RCNA 5DXJA 1L4UA 1N6NA 1ZGBA 4MW0A 4XPIB 1WDLA 1A2OA 2J6CA 4BKUA 1L5HB 1GAEO 4DCUA 3IP3A 1PD0A 2A86A 1UDBA 1HLGA 4F4FA 2ODPA 2V74B 4NY1A 1JEEA 3AVVA 1YRBA 2J5XA 4MGHA 2WFAA 5KJ6A 1Y34E 1RKVA 2KLBA 3H6GA 3HLTA 4BEJA 13PKA 4F4DA 3DBIA 2JGRA 3PT9A 3V7NA 5A7FA 3SI7A 1EM8A 4D9FA 1A82A 3IXLA 1Q3HA 2HA5A 4X60A 2Q4OA 5FJIA 1JFRA 4D8VA 5AQEA 4Q9JA 3LKZA 4EGFA 2BMWA 3QKTA 1OE0A 1YB4A 5AK6A 5I9NA 2HJVA 1MGPA 3F71A 1G5IA 1TM7E 4Z6KA 2PZFA 1UJNA 3I5YA 3F3SA 4M36A 2X7XA 3IUMA 4JX9A 3LBIA 2ZYIA 4TS3A 1TK3A 3WLAA 1H9AA 5ED0A 4NFSA 3BEOA 3VR4A 2ZBUA 2QLMA 2FMIA 3KYIB 1JB1A 4KFTA 3E9EA 5FBWB 1BWPA 5B7QA 1VPTA 1VI2A 3NFYA 3X1WA 4MQMA 2CLSA 4DA7A 2FDCA 5EPUA 1B4DA 1FMLA 1U63A 2ZT6A 1O8CA 1USWA 4LAFA 1I33A 2KS6A 2YOFA 4QTUB 3W2IA 4GMKA 4X6YA 3G1TA 3SVLA 2JGDB 1RYDA 3C0KA 3OZBA 4NDNE 4W8GA 2C5SA 2BTOA 2J3DA 4YJ3A 3EXHA 1XZMA 2C9YA 5I7FA 4HCJA 2VDVE 4GNKA 2R47A 4RORA 4ZMBA 4W1QA 3T3MB 1I0ZA 1IJFA 3H3FA 4ZYVA 1YDEA 3KZXA 4TKVB 3UNXA 2XMRA 2VPZA 2YYSA 1XVVA 3DCNA 3H9QA 4I5DA 2VQ3A 4RPCA 4YRNA 3CLUC 4HMOA 2VCEA 4HYTA 4WADA 4O8ZA 4DV3B 3H11A 2OZLB 4JY7A 7REQA 2OV6A 3VAZA 3RH0A 1T2AA 3CISA 1Y3FE 2YTZA 4GXQA 4YJGA 1J0BA 4YN3A 1GNQA 2Q8NA 3N8NA 2GDJA 3M82A 4KO3S 1ATZA 4HATA 3I05A 1B23P 3DWEX 2B36A 3OURA 1EA7A 1O9HA 5TEVA 3WY9A 1NKTA 3GCGA 4HNAA 3UAGA 3VAYA 2W5UA 4CL3A 1A72A 1F0YA 2A5FA 5AKJA 3M6IA 3EEIA 1GV1A 1TAGA 1JUDA 2NU9B 3DEZA 3UENA 3WLMA 3NDJA 2FTKE 4NZOA 4Y2QA 5A6SB 4LYHA 2P9GA 4FFDA 3FCXA 2YN0A 4JP1A 4MOWA 1E1DA 1P9WA 3GD5A 3GMDA 4BFVA 5F3WB 2GGSA 1RJEA 5EIHA 4B4KA 4H17A 3D4NA 4TYPA 5CITA 1H9CA 1UXOA 2R4QA 3BJEA 3QUAA 4BVFA 2ZJOA 4EY7A 5CCBA 4YR9A 1FYFA 4Q15A 5DP1A 1M2OB 1TKAA 2EZ9A 3AZPA 3BGSA 3N5CA 4CIBA 5ARBA 1XLVA 2P7IA 3GPDG 3MCUA 5C7OO 1XGKA 2FOXA 2JA2A 4CVNA 5AW0A 2D1SA 5DASA 1OX4B 2RIPA 2H08A 2WWWA 2Q5JA 4FYVA 3VU9B 1TYDE 2V6BA 1ODTC 2D00A 2J9FB 2JJ2A 2BFDB 3OUTA 4IHKA 4NL4H 5M5BA 3AF6A 2V1UA 4EF6A 3WGNA 3MILA 4KRXA 5K03A 1D4OA 4YREA 1GEGA 1D0IA 1NAIA 3BRCA 1Z6QA 3CEPB 1VGVA 3G8AA 3K96A 4PNPA 3WV4A 1G41A 3L5KA 1WZEA 1RPNA 2XCLA 1KEKA 2IYEA 5E7IA 3KQQA 2GOYA 1NX9A 4W99A 4HNAB 1ZQ1A 3I52A 4QUIA 3NO4A 4J49A 2C7RA 4LRUA 3LC7O 4YACA 3V2HA 5KJFA 2MYTA 5COBA 1EWYA 2XB2A 1M34A 2GNAA 3MS7A 4LY3A 1H22A 1FJGB 1IU9A 1G7TA 1YULA 2QRQA 1K3FA 1V26A 3HFRA 3NYQA 3U81A 5HW0A 3CUTA 1ICEA 5HYVA 5KO2A 3W34A 1Y33E 5CVJA 2H7YA 3RT1A 2QN8A 1CRWG 2WUGA 3A0UA 3O2SB 4U3JB 5GJCA 4B35A 2WF6A 2C5FA 5DM4A 1YJ5A 5IJXA 3WB9A 2OYRA 4C08A 2QTGA 3NGXA 4UTVA 3HB1A 3THXB 4CQMD 4ZTBA 1T1JA 2RH8A 2Q5IA 4MVXA 3A9VA 5IMBA 2XHZA 5FOWA 2HXSA 4K9KA 1YGPA 3UAWA 4P3YA 4TYQA 2OFOA 4Q9AA 3CRW1 1JHXA 1T5IA 2DGDA 2J0EA 2YXBA 3EMVA 2WC1A 3SLRA 2HSGA 2JI7A 5FPYA 1JIUA 4OBWA 3L7NA 3O38A 3K35A 3U5TA 4WA7A 2ZYHA 3DEHA 1SHJA 4PLPA 1NG1A 4CEHB 1PWHA 1ULTA 1UANA 3C6KA 3ZVRA 2IU6A 3EE6A 4A8HA 3GJYA 4IDNA 1W0KD 3UIEA 4HDKB 4TLMB 3UV3A 1HZJA 3LRTA 3NU1A 2HJHA 3QKUA 4BC0A 2X77A 3BL8A 4NENB 1L5HA 3KYCA 1R0CA 2PRIA 1XMPA 2B2XA 3BPSA 5M3BA 1PBNA 3FUXA 4BQRA 1DX9A 2HBQA 1G38A 3D31A 3D8SA 1XQVA 1LLQA 1KKMA 5TVKA 3ILXA 1OGJA 2QD2A 4WXMA 2JGFA 3WIEA 3EZLA 5DM60 3D6UA 1OILA 2NSJA 4NPAA 4D3ZA 1R6DA 3GMTA 4PZ9A 1ESMA 5KOIA 1ODSA 3DE3X 3USES 1TCAA 1YS7A 2P3OA 2PRYA 5EVCA 1SUSA 1CNMA 1KFKB 5LB4A 5HQ3B 3S8EA 3WL8A 4Z4QA 1Y37A 1F2UB 2PG3A 2ZG6A 2CVOA 1UZUA 3IPCA 5G53C 1PJLA 5B2ZA 5HRUA 4KMMA 5LZ9A 2V9ZA 3LHDA 1H65A 2PMKA 4W7IA 1NC3A 4G63A 5BUZA 2GVNA 2Y9MB 2WU4A 4AZVA 5J47A 3VSDA 2VHTA 1G5TA 4FJ1A 2JCVA 4GLBA 3SEAA 4QUBA 3QFCA 5JOQA 1NJFA 3TLXA 5P8WA 1Y42X 3U0BA 3NUGA 5EN4A 4Z0NA 3E58A 3EAFA 4PONA 3UFBA 3GNTA 4B3BA 1DJMA 3M4ZA 3CX6A 1IJBA 2BDUA 5G3YA 4MR8B 2G04A 1DC6A 2I87A 2GZRA 4Q4HB 1MPTA 3TIIA 1KVQA 3G6WA 4YCBA 1U1FA 3WRXC 1HR0B 4TS4A 2I2AA 3QEAZ 1QVZA 3DMNA 1RXUA 3K1TA 4K6HA 4LV6A 3AFIA 3AP1A 4CLOB 3SX4A 1UXGA 4GLJA 3O8BA 2IOQA 3OHSX 4KDFA 6NULA 5I7HA 2M1XA 2WDPA 4NYMQ 4YECA 1F2TB 3WLTA 5HOEA 5B1SA 1BWRA 1B7GO 1RWMA 1YQWA 1TPZA 3ZWNA 3H4IA 5E6RA 5AUQA 1CUAA 1OXSC 1UBOS 1F3OA 2CNOA 1P5HA 1V8BA 1EVLA 4MPPA 2UVPB 1TF7A 2JS7A 4Q7LA 1TKCA 3GQBA 3OZWA 4LMRA 1HG0A 5DLPA 1L8AA 2VRCA 3N2GA 4JYAB 1JE0A 2I1VB 4H3VA 3CMCO 4JVSB 5F21A 3RIXA 3WLJA 4BLVA 4Y2XA 4WPGA 4ZOLB 4BX8A 4UQPA 4Z0TA 1R18A 2OLKA 4QUHA 1NOKA 1UK8A 4EI8A 4MZXA 2WWFA 1SBIA 4OKIA 3S70A 4BVAA 3NZEA 4WCVA 4INZA 4F3TA 5A5FA 1WXGA 1FFEA 4IYRA 4XIYA 2P75A 3IEPA 1W0CA 2NZ8A 2QTZA 3ICOA 4Q3DA 4RFLA 2Z6VA 3G89A 3DGFC 3LQ4A 1Z7EA 4LECA 2DXIA 3IEMA 5HF9A 3CUVA 1W0KA 3GRRA 4O8CA 4MQFB 3IE1A 1YFKA 4BLWA 1G64A 3T7KA 4XCVA 2ZRFA 5AKZA 4LHSA 1DFIA 4CMCA 1NY5A 2J07A 2QRLA 3NWPA 4AJOA 2BKVA 3SQXA 3IGFA 2ZEJA 1O77A 1XKXA 1UMKA 2A4KA 4U7WA 2BI8A 1CQWA 3FPEA 4UNSA 3E7FA 1OFIA 2H9AA 2IZ6A 1A9YA 4HGPA 3TE6A 3UBMA 3PRKE 5LCXA 4R2JA 3WGMA 1BS1A 5LOVB 2XE6A 4B6FA 3OJEA 3IERA 3LPMA 4TLLB 2G40A 2VYFA 2ZJ4A 1ZUHA 3NRBA 4G4JA 1EP2B 3A4MA 4BZZA 3C7KA 4EATA 5AVWA 4KMOA 3WSTA 1HTTA 3HU5A 1QHFA 4DJAA 3H9JA 4G26A 2C96A 3BJMA 3KKNA 1JEDA 3N76A 3SNKA 3PQ2A 4QUJA 4BFSA 2KSQA 4DBZA 3Q15C 1MV5A 2AYYA 2OGUA 3V1MA 3LT0A 2IU0A 4MYTA 2H51A 1LX7A 1ENYA 5EIBC 3MYRA 4YEDA 4F7DA 5IC4A 1UZAA 1K6EA 4ITVA 4YXWD 1TECE 4KO1S 1R4MA 3ZDFA 2VJDA 1GCGA 3O6VA 4MVJA 2HK7A 2PLWA 1SCNE 4DIMA 2BP7B 2F8SA 3AHIA 3V4FA 3AM5A 4OBXA 4P4TA 2ZB7A 1N1GA 1IQUA 3ZHOA 1P6QA 2EP5A 2WKSA 2AFIA 5BWBA 4ETMA 5EWJA 1Z26A 3GLGA 2FG6C 1O95D 4AL4A 2JFUA 1NNEA 4NE9A 1RHRA 5DMHA 5ALUA 5E7MA 3QZUA 2C20A 1JBEA 3UXHA 2J30A 4RZHA 2GD2A 4YYEA 4POAA 4NEGA 4IJ5A 4KHZA 1L7PA 4OH7A 1KEUA 2QPLA 2RB5A 3STWA 5CJJA 3T9AA 3P9ZA 5IJ0B 3K0BA 4MJ7A 2FQWA 3COPA 3LPDA 4NX2A 1XCGB 1O1YA 4YTEA 3KUKA 3HS3A 5AOVA 3VJRA 4ZK6A 3W06A 2QN2A 1T3GA 4KXMA 4DIBA 1EFPB 1D2CA 5B64A 1QIFA 4K9SA 5HK9A 1U7WA 2PUHA 3CW9A 3E9MA 2IZ0A 1S89A 2B69A 5FP0A 4K05A 4OJNA 2C2BA 4RY0A 1J2UA 3MJVA 4EYSA 5KTKA 1HI9A 3ANMA 4Z9XA 2HNAA 1D9XA 2BFEA 1Q0HA 1UKBA 2HAEA 2I22A 2I8AA 2JCSA 2X6RA 3HBMA 1MJGM 4M9UA 4FMBB 4PPYA 4Q4LA 2HPAA 2LPMA 5JBIA 1ITZA 2EJTA 2YV3A 3HSKA 4ND6A 3GLIA 3QUBA 4ZO7A 2H4YA 3C48A 1Q0PA 2OCGA 3NLLA 3B89A 5ALEA 5LZ2A 5JVDA 1ORHA 1OW3B 2D5LA 4HLCA 5BWOA 2XAAA 3LQQA 2AG0A 1MJGA 1IIRA 3C3YA 2J31A 3PHGA 1U1IA 3IHWA 4PLHA 3BHIA 3WBBA 5I9LA 3GLGB 4AKIA 4RFSB 2E18A 1SHUX 4EHNA 1LZKA 1EXWA 2H85A 2QY9A 3O94A 1ZM7A 3DW1X 3GEEA 1QIMA 3KJNA 5BYJA 2VF2A 1E2PA 4LKOA 5AK3A 2CUKA 3IH5A 5AJWA 5F5LA 5FLYA 3ZKWA 3ZIAD 5IG2A 1EG7A 1BE8A 4IVPA 4JYMA 3VKGA 4EHHA 1NKSA 4NK4A 2CXHA 1I51A 1Q77A 3BIOA 3A9WA 3A11A 4OQLA 2JKVA 1AJEA 3K9LA 3D3KA 2ZUEA 1YAJA 1XRMA 4TT8A 4PAGA 1I3KA 4YRFA 4TRRA 3ZXIA 4WK4B 1P9RA 2DOKA 1E3MA 1R2QA 4XEUA 3DKVA 2LZ0A 1I7NA 1NN0A 5COQA 2NXJA 4P32A 4X90A 3PUYA 4Z7QB 5LKRA 1M1NB 2DFLA 3TGLA 1BOFA 3IVCA 3IJ5A 1BU8A 1WA5A 3LECA 5JUWA 5IK2D 2PKXA 5JYEA 2CNWA 2ZE5A 2AWOA 2NO4A 5ENDA 4C03A 4KN9S 4HGRA 4N39A 1PRYA 5AW2A 5ERGB 2XD4A 4NQRA 1OH5A 3V3KA 4F6CA 3MUNA 2J9YB 4O3MA 1S7CA 4IW3B 4PQYA 2UZ4A 1QFYA 3CLKA 2OL4A 4RULA 4WLEA 2Q6KA 3Q9LA 1RWBA 3FSEA 4R8MA 4H7FA 3G23A 3JASB 3GLFB 1GQRA 2UV8A 4OKSA 3O1HB 4QARA 2EVWX 2A9KA 2X8LA 1QOQB 2JKYA 3O3NB 4Q3NA 4AWBA 1NF3A 4EF4A 1LK5A 2Q0SA 3Q0IA 1M83A 5EE3A 3PIIA 4MGYR 2LWIA 5AI9A 2QPAA 1VGQA 3VPGA 1SU7A 4HLUA 3VKHA 3HVJA 4IQ0A 4MA5A 1DARA 4O25A 2W0SA 3HYSA 1O0BA 1CEXA 4E07A 4F8JA 4QOGA 5E8JA 5KQSA 5JHHB 3BMNA 3GT0A 3HBFA 4J91A 1RAEA 1Y6JA 3EC1A 1UMDA 2QRPA 3Q5DA 4Q3OA 5ALHA 3EB9A 4J1SA 2REOA 4D6YA 4DDMA 3F1KA 5G0VA 1Q92A 1J24A 2O6LA 3D6TB 5T3YA 5KPJA 2ONCA 5J59A 1OFUX 3LA8A 1U3VA 1IN8A 3GA7A 3FUVA 1GSOA 2YHIB 1A4UA 1UBJS 4H0CA 4BL5A 2CUTA 1UAGA 3DF7A 2ZI4A 5DRYA 2PZBA 1UT8A 2ZRJA 4TWBA 1RMQA 2HY7A 3LUGA 4Q1FA 4O2BA 3TZEA 4ID3A 3Q8WA 2PH3A 1ULUA 1XZJA 5JCJD 2JD2A 1NN3A 1YBFA 4LXTA 2PKYX 4AVYA 4E2XA 2VNAA 5JAUA 2QNBA 4ZIRA 2BRUC 5FO0A 3ZQ4A 1OTXA 2OMKA 4NK5A 5IKXA 1KZ4A 1UBKS 5KYNA 2CDBA 2V58A 1I36A 1G3RA 1FXUA 3ID6C 4NCAA 4DLTA 3RKUA 4ECAA 5EQDA 2VPXA 5A7HA 3DFMA 1HE2A 2N47A 2QN1A 4RF5A 4Q1AA 5AHWA 4LHEA 1T0BA 3G8BA 1DQSA 3V2UA 3ZDZB 4BX3A 4YPVA 1X7ZA 2QTLA 3H2JA 4PFJA 3ZGYA 4DEYA 2OE2A 2XQJA 1O9GA 1N2CB 3BWCA 5CM9C 4ZRDA 4Q7QA 1CG6A 1DAEA 5ITZB 1B76A 1GPAA 5HVNA 4EW3A 2ODWA 1IULA 5LZ4A 1HYGA 1JDBC 2XF8A 1UJBA 2FZ4A 2WSLA 1QNFA 2IXGA 3F2VA 4GKBA 4RANA 2OXIA 3VR4H 3WLQA 1A8PA 3X1YA 1JXAA 1G60A 5JO0A 2ZWAA 5JATA 3VR6D 1NSFA 3SHWA 2CHFA 3L2OB 5HF8A 5K09A 1J5PA 3DSRA 3AYZB 4D0RA 3ONWA 4FZRA 1M2JA 4RAOA 4TUYA 2O1SA 4O08A 2V59A 2I8CA 5FI0B 3WGGA 8LDHA 1ZXXA 2PWBA 3HJHA 4GPTA 3ICEA 3NQ41 5T4EA 2C07A 4DDTA 1XTRA 1E7SA 1XHLA 3CT6A 3D2CA 4MW4A 3I6ZA 2HJSA 5FF9A 1E6LA 1R88A 3O4RA 4KX3A 5JASA 4MW7A 2XMSA 4W8OA 4BUCA 3SS9X 4YRMA 4Q5IA 1QYVA 4RD2A 2I78A 2BFBB 1EM8B 2CV1A 2R6DA 3VV2A 1NRXA 1U5AA 2EKPA 2N1BA 4TGLA 1BIFA 3PXXA 1F2UA 4Q21A 1SG9A 1FTSA 5JXGA 3VOBA 2VZ9A 4H7KA 2BE7A 1R74A 4KJZA 4PQRA 3H18A 2P40A 4QREA 2WD7A 4HVTA 4RGQA 1AB6A 2Y67A 3BM5A 1ZD4A 1YGYA 2DKOA 4A92A 2FPSA 2INGX 3R0IA 4RF3A 1K5GA 1DV1A 2W6QA 1FF9A 5KVQA 4KR3A 4IGEA 2V3CC 5LMCA 3MMXA 2F9FA 2DX7A 4L0DA 4Q24A 1Y3CE 3LW8A 4V0QA 1QRRA 2ZROA 4OQZA 1PDVA 2IIPA 5IKOA 2OC9A 4URYR 2LNDA 1OC2A 3D2BA 4Y9UA 1OXTA 3AL2A 4DZTA 1IXKA 2PKQO 4QEZA 4Q1VA 3ZD7A 4KO2S 3AQIA 1WE2A 5K99A 4Y1RB 1RPTA 1I2ZA 3O4JA 1NLMA 3OU6A 5TVGA 3T15A 4E4YA 2H7CA 3PXUA 1A96A 1IEVA 4IOLA 3STYA 2VWGA 5J4VA 1I3LA 2WE7A 2A0YA 3H5RA 3VYVA 3LX4A 2ADFA 2ZSDA 1QRSA 4QT0A 1L7XA 4HOYA 5HRCA 5HZMA 1GU7A 1N8TA 2JJYA 4HJXA 2XKBA 5B58T 5IT5A 2HQOA 2PO7A 1E9VA 2YMMA 3GLHE 3RAPR 2JBAA 3GB9A 4JU8A 4CMHA 1EDZA 1KJYA 4R41A 4YMTA 4YRDA 4RKWA 1YKGA 1L5SA 1MC4A 2AEJA 3JPWA 4KHPB 2GD0A 1GA1A 3EJWA 1Z6XA 1T8TA 1VSVA 2PEZA 1G3UA 1Z2OX 1TCUA 2GRJA 3P5SA 4PLWA 5E6UB 2E55A 4XI9A 1NUAA 3BS4A 2R7LA 2HDOA 3FHJA 3I4CA 5FBHA 5CDFA 2YIDA 5JDCC 1BKSB 1C9KA 1QGUB 2V6IA 3BB3A 2L42A 2KX7A 1OY1A 4R81A 3SC2B 3VZPA 1E59A 2WV9A 1QNLA 3OPQA 4DQ0A 2IYYA 3X3HA 4DA9A 3HB9A 4HZGA 2PZ8A 4YAGA 1PR0A 3OQ1A 4MQFA 2M6LA 3KJQA 1G5QA 3P9SA 4P36A 1JMVA 2V8OA 2IELA 4CQMA 3WK4A 3PC6A 3IKMB 1EVIA 2BPOA 1ISIA 4D45A 2WMOB 2FWJA 1ENZA 1KBZA 2EJWA 4RL4A 4XR9A 4A2WA 1W2GA 3UKJA 3RUIA 1S2MA 4KQ9A 5G41A 4MYHA 2MMGA 3MT9A 3W2EA 4AO6A 4JIGA 4N0QA 4RK6A 2C1EA 4HDQB 5PGMA 3G5TA 3PKIA 4B31A 4BNUA 4CMEC 2I5PO 1HORA 1NTOA 3IE2A 4P6VF 4P7JA 2CLEB 5BW4A 3PHLA 3UO8B 1F14A 5DX0A 3KHTA 1IXYA 1ZOLA 3E0QA 1VE7A 2QAIA 4NHEA 3W9SA 1GG5A 4TQAA 1UKYA 4O4HB 1CQIA 1WZUA 2HA6A 4XCQA 2GAJA 1XVAA 1REQA 2MR6A 2AZMA 1RQRA 3CE9A 3GAAA 3MWLA 2FGKA 4P7FA 1TI7A 5JVDB 2WB2A 1VBKA 2A1UB 2VWPA 4U02A 2DFTA 4UDXX 2MINA 4NXMB 3PPYA 1RP7A 1JDNA 3MFYA 2WT4A 1SN7A 2YH2A 1Q2UA 3UPDA 4JITA 1PJ8A 5CFZA 1AKWA 2G4CA 4CTOA 2H4JA 2QTAA 4DQDA 5CDGA 1U0NA 1KYXA 5E9QA 3FYUA 2XY4A 4IPTA 3DC7A 4F72A 1RFLA 2B35A 2PT7A 5C5IA 1YBVA 4BRUA 1DEHA 1NUQA 2HRZA 2I3BA 3AFGA 4ZT5A 4QYXA 4KFUA 1QIKA 4WOBA 2QM7A 3QJGA 4KPUA 4NRDA 1DKUA 2P3QA 4S1TA 4AS3A 1NVVQ 5DHUA 1ZVJA 2W7TA 3Q85A 3VZQA 1MNAA 1YBAA 4TN5A 4S24A 1J2EA 2YXLA 3K09C 4HZIA 4BZWA 5CLFA 2JLVA 3NANA 3GA5A 3LDHA 3WKDA 1FYEA 2CVPA 2G0AA 3GL9A 3QE0A 5FTNA 3UJBA 4ISCA 1E8MA 4D9NA 3I28A 3BCUA 2FGJA 3GJ8A 1SM4A 1XPOA 2SICE 1E7WA 1T0JB 3CO0S 3CURA 1DCMA 5BNZA 3DA8A 2PZKA 5H9WA 4OLBA 1CQIB 1KIFA 1ADYA 4Q4HA 4U0JA 4JLNA 5BURA 3Q41A 2GHIA 1B0AA 1GNRA 1SCBA 4R2LA 2ZJ3A 3WMWA 2EZ8A 4G2NA 1F7UA 3A1CA 2Q4BA 3GPLA 2VHUA 2V4MA 3G59A 4IGIA 5F2OA 2WINI 3A3KA 1B3BA 3MCZA 3R7WA 1AN9A 4D4KA 5EMMA 3F8WA 3KPWA 3TAXA 3TIFA 1LQTA 1I4TD 5BSMA 3ZWWA 2REBA 2CJXA 1DDIA 3QVOA 4PC7A 4IZIA 4EO7A 3DCYA 4QLOA 1A9QA 3UMRA 1GA6A 3ZWMA 1DB3A 1CBUA 1DG9A 2VUSA 3FTDA 1GAXA 2DR0A 3SE7A 2H6EA 2QX7A 4NMWA 4TQ9A 5K9ZA 3CRVA 1FDOA 2X8BA 2ZAOA 1L3CA 2OFXA 1BX0A 4ESOA 1R16A 3MJHA 4I4TB 5FWDA 1AZSC 4TWZA 1U2PA 3EVBA 4Q4CA 3EGVA 4PR0A 4LS3A 3R7DA 1KY2A 2RB4A 4H6PA 3VO2A 4OX9Y 1OQAA 2BUAA 5EUQB 3U7QB 2R5WA 2P3SA 4M7PA 2W2NA 5K6AC 1SCUA 2ZKIA 1ZSNA 2ZYGA 1G21E 3PU6A 1CP3A 2M6RA 3I9JA 4KQFA 4AN1A 1VCMA 3IFSA 4BTEA 2DLNA 1MAHA 1Y4AE 2DULA 2H9YA 3DBLA 2GDZA 3VOSA 7ABPA 3ZW9A 2FMXA 2HF8A 1I2DA 3K31A 3L1KA 4UJ5A 2ZBEA 2ZS7A 4GOXA 1IEQA 1QU3A 3EEOA 2A58A 2QLFA 2WF7A 3WNBA 2WM8A 3V00A 1XQ1A 3ETLA 4LTMA 4DB2A 3OT4A 1J2JA 4NDAA 3RU2A 3SQDA 1BA3A 2CBGA 3OPYA 4FN5A 2A4MA 2CXOA 2IRWA 3AV0B 4QAJA 4E7PA 3T1HB 4PX2A 1N2SA 4MI6A 2HI0A 5FUVA 4P7BA 3WL7A 5AI0A 5ENZA 5IN5A 3GGSA 2P79A 3GT7A 4OXNA 3AERA 3JARA 3AVXA 3OZUA 5EWLA 2HDNB 5DNYB 1GDHA 3QE9Y 4RDHA 3FMGA 4TYNA 1P6XA 1HE3A 2JJ8A 2Q4TA 4CKZA 3M6LA 3CUEF 3GLRA 3LUCA 3A1FA 3P0HA 4NBUA 2WU3A 4FNOA 3SBOA 1MAAA 2AMVA 1SXIA 1QB7A 1ZK0A 2AMLA 3C6YA 3EVTA 2BN4A 3QOXA 4INOA 1AUPA 1GUZA 1K68A 2D1RA 1RU3A 1X19A 1VBNA 3DHWC 4IV5A 3RUPA 3U4HA 3RSQA 1LRKA 1TXGA 3KKPA 4RXMA 3ABRB 1RWKA 2QUJA 3EFOA 2DUWA 4HG2A 1N7HA 1GILA 4X85A 3PUHA 5JBQA 1WL8A 4JSTA 1TC2A 4D4MA 4EB8A 4MV0A 1ZH6A 5FXMA 1NBEA 1K86A 3GRVA 3H5TA 4I1OA 3PNKA 4JEHA 5H9VA 4TSKA 4ACBA 3H99A 5BUSA 4YMSA 4WE3A 4K9LA 4GWLA 4URFA 4OHPA 1J70A 1R0KA 1VECA 2VDUE 3P9CA 4NHOA 1OX4A 3HKEB 2Z8YM 5E2BA 1BMFA 4JSYA 4A8TA 4BDSA 5L4NA 4L78A 4F1KA 3KTFA 3ZHSA 4GPIB 1Z12A 5A03A 3G2OA 4W7HA 1L7NA 4LOLA 1XEAA 4L5IA 1R8YA 2EGHA 3LHIA 4MP6A 3U19A 4C3ZA 1LPAB 1TU3A 2AN4A 4M8NE 3E22A 2A14A 3I1IA 5AIBA 1ENPA 1OAAA 2C7BA 2DAPA 2R44A 1NI5A 3JR7A 4TL9A 2EOAA 3RHSA 1N9KA 1JLHA 4LTDA 3SIXA 3ZGOA 5CDUA 4IIJA 5IVKA 3RUFA 5KC8A 4R68A 5DTMA 1OXVA 1JWAB 4WINA 1EFRD 3QA3E 5AW7A 2GB4A 3TG8A 2PJUA 1XIVA 2A9PA 4C06A 1QFXA 2I7XA 1AKNA 2NU9A 2I7VA 2V1XA 1P9LA 2XWSA 3L6RA 5EZSA 4BNKA 4FB5A 4YMGA 1XEXA 3GN2A 4CN8A 1PWYE 3IT3A 3R3HA 2E4WA 4MRMA 4PIMA 5T67A 1XRRA 2P2DA 3HNRA 1NMYA 4V03A 1YO6A 4CCAA 4HI0E 4HMPA 3HFJA 2H2FA 3ONFA 3KTDA 1OPRA 2O7SA 1VLLA 4LF6B 3DVQX 1T4GA 4IDDA 3KR2A 4LYDA 5DNWA 4YCDA 3ACCA 3BMOA 4L76A 1ADFA 2LP4Y 3A3YA 4RCYA 2IYLD 3RVLA 1S8AA 3M5DA 1GPDG 1K27A 1W94A 1X94A 2N9UA 4FBLA 3FWYA 1W75A 2WPDA 4UEJA 2R9VA 3QEBZ 1YFJA 1A8UA 2O4CA 5I47A 1HDEA 3B48A 2LCFA 1D0SA 5ALRA 5A02A 5C1BA 3C87A 4QVKA 5KWSA 1MX3A 3J81A 2WAMA 5AWFC 2IHUA 3E61A 4J0HA 5U4XA 1P2UA 3RG8A 3GFOA 4WX2B 1H2HA 2YVQA 1QTNA 3LXMA 3NRCA 4XB6B 4BV2A 5ALVA 5ALKA 3GLTA 4X9XA 3C15C 2DPXA 3ZLVA 2P2YA 3WGLA 4DCJA 3M9XA 3HFSA 1SPXA 5C37A 4JVMA 1FDIA 5IANA 2BMVA 4RBNA 1BKDR 3SC2A 2WT8A 5EIEA 1LFDB 3ZGLA 1P0CA 2A5YB 1EK0A 4QAQA 1E9FA 3G1WA 4X3OA 3CEJA 3CMMA 3I58A 3IMFA 4IMPA 1SRRA 1E1QD 1XD8A 1BJTA 4XQCA 1RAFA 3G7SA 4XDYA 1P8JA 2JZCA 3LP6A 5I7AA 2X0RA 3SQNA 1F7VA 2OCXA 1F8FA 4F11A 4Y2HA 2MSKA 1SXJA 4R5MA 1SJ9A 4BMSA 4DCSA 4NV0A 4HLQB 2E5LB 3HKCA 2I7TA 1ZCFA 4LF9B 2C3UA 1CR6A 1BVYF 1WEKA 1CR0A 3AUYA 4QWMA 2C3OA 4IGAA 2IYWA 3LHSA 3AZOA 4ZU6X 1OZGA 2QLLA 4PG8A 1KPHA 3UWOA 3TBFA 2GI4A 5JROA 3U40A 3BD7A 2JIRA 1E9CA 1O4WA 1UC5B 1R64A 1AD2A 5SYNA 1E1QA 4BNLA 621PA 1QFSA 3KWFA 4X1IA 1A4XA 3DBLB 1M1NA 3NCHA 1LD3A 2JD1A 2OA0A 5HIKA 5BR7A 2PT6A 3FCUB 4XYBA 4NSNA 1R27A 1VCIA 2JB9A 3E2MA 4PYKA 3IHLA 2OFPA 4UU8A 3EGCA 1IXRC 4GO1A 4OK5A 3UANA 2CNKA 1D1SA 3A28A 4RO0A 1BFDA 4ASUD 5AESA 2C58A 5K8TA 5KSYA 3QMPA 6ABPA 6PFKA 1JQ5A 4ZT3A 1IRXA 3HZZA 2GA9A 3PTZA 1FNMA 5FUQA 3ZDXB 4XOIA 4RA6B 3LCMA 3EGEA 4TLEA 3UAOA 5EMNA 4LQLA 4WXYB 3VR5D 3F98A 5IN4A 1FQJA 1PR9A 1OHHA 2ID9A 3A32A 1VSQA 3ENNA 4MKIA 4OL0A 4PYQA 4EKYA 1ST3A 3FMOB 1ZRNA 4RZQA 4Y18A 4MYDA 5BVHA 5FBRB 3E03A 3S0JA 3ND9A 2PXXA 1X8XA 3LW7A 2W8BB 4WZBA 1UBEA 1NW9B 2D7JA 3RC9A 1EPUA 2Q6TA 3B1FA 4B48A 5KNDA 1WXXA 4X1KA 2I4RA 2V4ZA 4KAXA 5EXDA 3W3AD 2DWOA 1GPBA 1JKJA 3JQAB 1EFKA 3JWHA 4IL5A 4FDMA 4P0PB 1SOUA 4DMRA 1V37A 1T8SA 4Y9DA 5EHIA 2CXTA 1R9GA 4NFYA 4D26A 4PHTA 5ALYA 3JQEA 5JS7A 2WUDA 3GFQA 3V1UA 5U4QA 4RVFA 3S5UA 1YDMA 1EWKA 4UFOA 1M2GA 4TWRA 5KQGA 2EJVA 3VSCA 5EIXA 1II0A 2H5EA 2YQ4A 3MTDA 4GI5A 5KI6A 4ZZ0A 5JXHA 4CM5A 2LE0A 4G86A 1UBGA 4GOMD 5FKJA 3OEHA 2XT9A 1EWTA 2BD0A 2YHIA 2VH1A 3FYSA 4K2HA 3LKVA 3UUGA 1XWWA 2A0FA 1P4HA 4QUAA 2DT8A 1JEAA 3NCTA 4MAMA 1FSFA 4Z9AA 1U3TA 4TMVA 3GVIA 1A0OA 3EVAA 2WJWA 2YJ4A 4QPPA 4DPMA 3E23A 4HDRA 2NUTA 2A5GA 1XROA 1DEOA 3KKMA 4G1FA 3T9CA 1GGEA 3QVSA 4XRRA 3V2GA 4YB8A 2PJDA 2X5NA 4B3SB 3PXAA 2GKOA 1UWLA 5JPDA 3PBKA 4RDIA 3ZDCA 1K7FB 1KSFX 1K6IA 3MS4A 4F5WA 4I8IA 4EG7A 5T8KA 4ARAA 2OGSA 2GBLC 1X70A 3OM0A 3QH4A 4R1SA 1OX6A 4UE2A 4TMKA 1K7YA 3K1ZA 3ZDEA 4DMUB 1N1EA 5TNXA 4DVGA 5KNBH 2J09A 4ZOLF 3ABZA 2ZT7A 3ZWAA 2FMHA 2C2HA 4EPTA 2BUBA 1G4AE 4W4TA 4Z1MD 1KRHA 4IXMA 2JEYA 4C3UA 2WHRA 2CNWD 3I9MA 4ND5A 3WNVA 4E21A 5MFPA 1P1RA 5AJXA 3ZJVA 3L7LA 7ADHA 3GGPA 4JLPA 4YRIA 3FIUA 4IIBA 1G6OA 2FYTA 3WP1B 3ZWKA 4DJTA 1JSRA 3CQ9A 1MX5A 4ZVVA 3UV6A 4F5YA 2GM4A 4MWGA 5FEMA 2VNHA 2DP4E 3CX4A 4WZZA 4R71A 3B6JA 1BMTA 4L0CA 3IA7A 2PYIA 1F38A 4HNGA 3D8BA 1ECCA 2PR7A 4UREA 3PNOA 1BXRA 3RRXA 4C4ZA 1M5TA 1XQYA 5ALNA 3OEEA 2FN3A 4Q66C 2UYGA 3PFGA 5GTDA 2CF5A 4MS4B 1K5HA 2G72A 3QBEA 3DEKA 3VNVA 4WERA 5HQTA 3HM2A 5L3SB 1ZINA 2FFJA 3B1WA 1EFTA 5CYGA 1UBLS 1CUVA 2Z2KA 4UD6A 1T2NA 3EGDB 1UIRA 3C4VA 1QH0A 3TKLA 4EW6A 1RI1A 1JJIA 1I32A 2IOHA 4X95A 1U6JA 3SQLA 3SZ3A 4CV1A 2O8DB 4WESA 2W6IA 1DDGA 5LMZA 1JMYA 3SS7X 3D2AA 2X0IA 1QK4A 2VNJA 1DKRA 2AFRA 4B3XA 5KQPA 1EJBA 3PA6A 4B6GA 3WQHA 4XDZA 5HTOA 3RK4A 5EMHA 4M0EA 4NARA 3L4BA 4P3PA 3R9KA 4ZODA 2HO4A 3T9BA 3LYUA 2QW0X 3TBKA 2E4AA 1VFNA 1G1AA 1L5ZA 3TQSA 1N2BA 1GZVA 5DGTA 4EO9A 2W2OA 1G8JA 5AKIA 4BYGA 1Z2AA 2HPHA 4ZXPA 3ETGA 5JC1A 2ATXA 4CDGA 1MHTA 1IHOA 4W5WA 4R16A 3KZOA 5TJ9A 1JR3A 1J5EB 2HF9A 4OIMA 1I01A 4RIEA 2G17A 3GBSA 3CZPA 1XJCA 3A1UA 1UK7A 1XO1A 3ONNA 3R5HA 4FOPA 4XAQA 5HEKA 2O2CA 1Z73A 1FJHA 4F71A 2YJ3A 4FDTA 3PNSA 3M9LA 1BD3A 4UM9D 2AOUB 1N75A 1D2GA 4MVYA 1A2BA 4B0OA 4KR6A 3QY9A 2GASA 1VE3A 4L2IA 2BY4A 5EJ2A 2FSPA 1L9KA 3C7CB 3BGOS 5DYNA 4KW7A 3RG2A 2G4VA 3CG0A 1NQAO 3AM3A 2GS9A 3KP1A 4RK1A 2AYXA 3FY4A 3W6OA 3QNWA 4OF4A 1BWQA 4CEJB 1CX9B 3HJCA 3KZ1E 5BN4A 1SXPA 4R2IA 2XEDA 4HTAA 3I42A 4G1EB 4MUGA 3EXHC 4WA8A 5C3UA 2ZUUA 3P9YA 1S01A 1EFVA 2GEBA 1ZD2P 2FMKA 1P7ZA 3NWEA 4ZDWA 2ACVA 4D4HA 2IEGA 1TFUA 2HMYB 4JP2A 4IIFA 1CPYA 2O3UA 1C50A 1V45E 2ODBA 2VSNA 1EDOA 4JJAA 3MJFA 2VP5A 4F86A 1J7KA 3D5EA 5EKSA 4H0FA 2DG2A 2VNSA 2Q9BA 1YKFA 1WG8A 3A2LA 3CTPA 2ECOA 2W9XA 1FFDA 2C78A 3KOOA 3FNHA 4GD3Q 4X20B 1HYQA 3RFTA 3IEUA 3KB2A 3KAKA 2JFOA 3NTVA 4N8EA 4DG8A 4AWAA 4YPFA 4FEYA 5CVCA 1YQDA 4YHHB 2UUCB 3DV9A 4QBFA 4R3UC 4FFNA 2WJVA 4S35A 3IULA 4MO2A 4D9IA 3E35A 1P80A 3CUKA 4QECA 1FU8A 3AVWA 2ZIAA 5KDLA 3O2JA 4PGGA 1F5NA 2XWBF 4I9FA 4X1YA 4UM7A 3EXIB 2PA3A 2Y71A 4UBJA 2QX8A 4AG6A 4FHFA 2GT1A 1JSLA 3I62A 3OE7A 3F6BX 3EODA 4L72A 1SWWA 1JG7A 4QJBA 4KAJA 1BCSA 2KHZA 3KYDB 1NNI1 2ABWA 4DA6A 1P7PA 1IM5A 1TAQA 2XZOA 3PHIA 2PS9A 4GMGA 1EVJA 4HDSA 1T34A 4P3OA 5FYQA 3DHEA 3K1AB 2JGEA 5E7QA 1X1AA 3RODA 3TI9A 3PE3A 4PHFA 4D44A 3OE4A 1CR4A 1XC7A 5K0ZA 1MMFB 3AG5A 1UMBB 1QHIA 4XIIA 2OPHA 3ZJYA 2VA9A 5DI3A 3L8CA 3ZTYA 2J5QA 4AJLA 1HKHA 4QC2A 4TPKA 4B73A 5BSWA 4YO7A 3TQCA 5KOJA 3LSTA 1OAOA 1DGQA 4QXAA 1WTAA 1BRTA 2B8WA 1ZO8A 3SDZA 3HLYA 4C0LA 3DEFA 2QT9A 3I34X 2GN6A 5F1YA 3IAAA 5EJEA 1QP7A 4WXPA 5I9MA 2IHBA 1DXYA 5EGNA 4LN1A 3UK0A 3GJQA 2OBFA 4J4HA 1RD4A 2HEGA 1D4AA 5EZ5A 2ZTHA 4MICA 2C4MA 2BFWA 2PSDA 3FYDA 3L8FA 5G0TA 4JI4B 5LOVA 4M1MA 2PLNA 1PK7A 4ZCIA 1B6GA 2ID4A 3S1LA 5EIAA 3CJQA 3UT0A 2HHJA 4Q3KA 4LFAB 5FI5A 5B1IA 1G21B 1E2BA 1HLFA 2A1UA 4UPVA 1G21A 1EK6A 2JCBA 4EDFA 3PC2A 4O33A 2FFBA 3B1JA 4XFKA 4F91B 3TD2A 1Z3CA 3N2LA 4C7KA 3A1WA 4I19A 5DCLA 5A9SB 3K1AA 2DUUA 1E64A 3MTJA 1EX9A 2ID8A 4H3HB 3LRXA 3IPRA 4HPJB 1QANA 4Q6BA 3JZMA 1CUZA 1DRWA 2O2ZA 3F2IA 3GRYA 2ANBA 2C2GA 3P97A 4PQFA 2DQZA 1VDZA 4QPZA 1NJ8A 3NHFA 4YA6A 5L7WA 1IOVA 1Y7LA 4H7JA 4C0QC 4X7PA 2EG5A 1MXFA 1PV1A 3E0XA 4RW0A 3VNRA 1XXHB 5TF4A 4YIHA 4KZKA 1FNCA 3F46A 3DZDA 1TEVA 4DPKA 3ZGZA 3WWDA 3OLQA 1IK6A 1F0NA 4G85A 4KB5A 1G5PA 3ZV5A 2BZ0A 4FGSA 4HS9A 4O3FA 4IXDA 3RYCA 3GEGA 3I2IA 1E1KA 4EWLA 3H2HA 3T8YA 4YCMA 2ETXA 1VLMA 5AI8A 5E95A 4TX1A 2DQKA 1ZIOA 3KWLA 5FYDA 4BCCA 3EDRA 2DLDA 1Z33A 2J4FA 1RWQA 2QD1A 2W98A 2ZETA 4N6GA 2BIFA 2MTBA 3T7SA 4AZWA 2IXAA 4YCLA 4J94A 1M54A 3KPVA 4JR2A 4MTLA 4CM6A 3KD2A 3C1OA 2QMHA 3QVUA 5GZ3A 3QE2A 1FS5A 1UPCA 1DO2A 1XRPA 1TJ4A 2VZLA 2JH9A 4GR5A 5HMMA 4BLRA 1PNRA 2R6AA 3PDHA 4PX5A 5IVHA 3N0RA 2JEOA 1ECBA 1HL7A 2BE9A 1KI9A 1TOAA 5A1TA 1COWD 1OBHA 1E6CA 1NI4B 3P7MA 4H7DA 4KIGA 4N6OA 4OHZA 1DCFA 1ZC3A 1XZKA 4G1BA 5JD3A 4C89A 4HDOB 1E96A 3RVRA 3GK3A 5AM0A 2IXBA 5EWMB 3BB1A 5A4IS 2WTMA 1HNNA 5CFMA 4Q7KA 5HMLA 3ICCA 4GDMA 1G20A 2ENUA 1FFGA 4LI3X 4R1UA 3OJCA 1FS4A 3QG1A 3DBVO 2PH5A 3O9VA 4MRRA 1S2NA 3N3AC 4FIDA 2ZULA 3P19A 2AC4A 1W25A 4JLAA 2GZSA 3G79A 1NJ2A 4K7JA 2O8DA 5JMTA 1GZ7A 3DR3A 1U94A 1I2MA 5ARCA 1WMBA 3LE8A 1XXLA 3RARA 1B6TA 1U8ZA 3IAM1 2DFVA 5JDCA 2WPNA 1O96B 1X7YA 2Q3HA 2YV2A 3DULA 5F9MA 2QF7A 1FQKA 5KPDA 2WTBA 3NUQA 3D2LA 4Z8XA 1CQXA 3AR2A 1X9IA 2P2LA 5J43A 1XZEA 3ZK7A 1II8A 2B9EA 4PZZA 3HA7A 3URKA 5IABA 3IJPA 4OHRA 4JI0B 2VSQA 4Z53A 2DJ5A 2HLPA 2CKMA 5ILOA 2RD2A 5GONA 3LBHA 1IZYA 4RPLA 3F9RA 3V8BA 1LLUA 1EZ4A 3ABIA 4OGFA 3A3OA 2GAAA 3GJTA 1GPLA 3H05A 4Y1FA 3EH2A 3IAM6 3ZGVA 2Y1OA 4KXUA 3ED5A 3V6MA 3TEFA 4X1OA 3DPSA 3O3MB 3II6X 4EA7A 3TQRA 1OB5A 2XXBA 4JBIA 4FHZA 5CLLA 1JWLA 3WGJA 3MAGA 1TZMA 4NJMA 5DBIA 5LLSA 1DX6A 2CLDX 4JR0A 4C01A 5JJ5A 3KQWA 2NO1A 3TX6A 4OGKA 1D1PA 4N0EA 1WMAA 4N8SA 3B12A 1Z0JA 3NBKA 1UXJA 2R66A 3KSRA 4N7JA 4HB2A 4RHFA 3F67A 2WAYA 3GGOA 2A1TR 3JY6A 4DRYA 2WWVD 4B32A 3AR9A 5HDBB 1UFOA 4C4PA 4BOYA 3C3EA 4XH9B 2PUCA 4ZDJA 2IUEA 4FKMA 1HZZA 4S2UA 3QX3A 3FF4A 1I2BA 4RLFA 1EKXA 1S96A 4IJ6A 4RVHA 5DTEA 1ZD1A 3CXUA 2QMEA 2XX3A 4JYCA 1JG1A 3PR3A 4TTAA 4UAGA 2QV0A 4D46A 2O8CB 4COOA 1ACLA 3KQKA 1GQFA 2I3DA 4HAUA 2HADA 1P7YA 2WD8A 4JLWA 1W5AA 3FWKA 5IUNC 3K2EA 4PSDA 3WWCA 3B9QA 1NRIA 4BQPA 1GKIA 1PBTA 2QXUA 4M7RA 3VH1A 1R10A 5I3CA 5THKA 1HSZA 3BICA 4UEOA 3THSA 4W5TA 2JFPA 1T1IA 1N5JA 4D98A 2NTVA 1ATIA 4G23A 2F17A 4LSWA 4J8PA 4UBLA 3A6JA 4B45A 4BNGA 1B8OA 1P18A 1Z6PA 1TJ3A 3IVXA 3OZRA 5FHQA 3IQZA 3RVBA 1L5LA 2FK7A 4XWWA 5L3SA 1EGMB 3W77A 5DK6A 1WTCA 2WUFA 3C43A 4XIGS 5FEUA 4EKEA 3N86A 4FUTA 4WLOA 1GL6A 3GY0A 2HA2A 2VRBA 4L6CA 5GZ6A 3NC4A 4DV5B 1UEJA 1QH8A 3MLEA 1B42A 1O2DA 3LC0A 3B3QA 1PFKA 2HMVA 4I0WB 1LPBB 3MWDB 4ND7A 4REQA 4EP1A 5K6TA 4AKHA 3QU7A 5HE8A 2K6GA 4NG5A 3TL3A 3WE7A 4D7AA 2WTEA 1MPXA 1SBNE 1XAIA 4LBVA 4GT1A 4PS0A 4YBZA 3VVLA 1EB9A 3VR6H 4NCHA 5C53B 1X7WB 1JBQA 5L4SA 4NECA 5FAXA 1MX9A 3U4GA 1XBTA 4ZI3A 3N2KB 1OLUB 4EJSB 2OBBA 3AEQA 3EXFA 4RIFA 2ZWIA 3SAJA 4U2CA 4EUHA 2CHVA 4NJEB 2J45A 3IT2A 4BRWA 1QZ3A 3U60B 1YF3A 1GUDA 1OFVA 5FPHA 5DYIA 3Q0TA 2O14A 1D09A 5A4KA 3ML1A 4M1ZA 3B3AA 2MYPA 2H1SA 3CCBA 1NW6A 4WKCA 1RHJA 1SQ0A 1TVKB 3ZHBA 1WHTB 5CYFA 3Q8XB 3ZU5A 1U0RA 3ZLTA 3EPHA 2H3HA 2VP3A 3CZQA 4X1IB 3RIMA 3WKAA 2M1ZA 2Z58A 1WULS 2P6MA 2AFHA 1U2GC 2RBKA 2YDYA 5GGXA 3ZVLA 1TA4A 3DMFA 3GWZA 1IWPB 2UZ3A 3D5TA 4TS1A 2QNIA 3RW9A 5K20A 4EEKA 4RFVA 2O59A 1YONA 2QVCA 3RAJA 3N2YA 1CC1S 4JB2A 2FSVA 5CNJA 1XTKA 1H2XA 1JIQA 4MI3A 4QTXA 4NMMA 3N87A 4FYWA 5DV9A 4DYDA 3ORQA 5KTSA 1UK9A 5JJIA 1VL0A 3ABQB 4REQB 4F1JA 1QHXA 3GFVA 4A8JC 3NHLA 1OYOA 1YU6A 2PMCA 1G19A 3E15A 3WRVA 2WM2A 2MCFA 4NXNB 2OO7A 3C3JA 2NU8A 2D0IA 3BWVA 4FFWA 1Q74A 1M67A 2P4SA 3NVAA 1BRMA 1FXWF 4K8RB 4O4JB 2WSIA 1RQ7A 3TMYA 4BGIA 1O0CA 4O2LA 4WGFA 4RZXA 1EFDN 1LSOA 1T43A 2C84A 2CB9A 3OIUA 2PX6A 3QEMB 5DX8A 1CYEA 5BYKA 5KNDH 4DXDA 1EZZA 1RR6A 2ZREA 1E6EA 2H1LA 1ZJ6A 2ES4A 4KPGA 4DCOA 5A62A 4K46A 5H16A 3RF6A 4DMHA 1AZWA 1R9JA 2BFOA 1J6UA 2O2GA 3EFEA 1CHNA 5J2TB 1A77A 3LCRA 3SC4A 4EEXA 3F73A 4LXIA 3C5EA 2XCIA 4XIJA 5C5CA 2QROA 1VMIA 4K1XA 4YJ3F 3B36A 4EF5A 4Z1OA 2QRVA 4WFKA 1EJ6A 1N5OX 1RJGA 2Q6LA 4IS3A 4F2PA 5HUQA 3OD1A 3HV0A 3G8CA 3M6WA 1WP4A 4TYWA 3N6RA 3LV8A 2HMTA 3IV9A 4FR5A 5G4LA 1JPNA 1WX1A 1ZP6A 3OCJA 5AM4A 1J5XA 3PNMA 3Q12A 4DYHA 4EHFA 3FG9A 4AM8A 1TFRA 2EYQA 1U2EA 2O3QA 1YJXA 3IO5A 3B20A 3M89A 4M6WB 4O4IB 1SCUB 1T9GS 2SKCA 3ZV3A 1U7HA 1EH5A 1IAVA 3RS0A 3TLEA 2PBLA 3IUQA 1VJCA 1SKQA 3EIHA 2OSVA 3F3YA 2D2XA 1JEOA 1WY5A 2QRKA 3SKYA 1E2LA 1ONNA 4JEMA 4CE6A 3FLBA 1L7VC 2J6IA 3FPBA 4DRXB 3W5BA 1E9DA 3SU8A 4J7XA 4KN8A 2QVGA 1TYZA 2XNSA 1XNGA 3GOHA 4D81A 1KEZA 1F51E 4RZIA 4Q12A 2M2IA 3F6EX 1LV8A 2PLAA 4LGVA 2AZ4A 4DTIA 2DPGA 1V7ZA 1OLSB 1P4JA 2NSDA 2V0CA 3BB4A 1Y4SA 3O4VA 4FLMA 4LC9A 4NNJA 4ZWNA 2WZDA 2G9RA 1PQWA 5KTMA 1TAHA 3RSSA 4M8LA 5ER6A 2HQ1A 2IX3A 1CIVA 3KSAC 3P45A 1YQEA 1FFXB 2QXTA 2V9PA 4L50A 4LDJA 4R0NA 5BW6B 3VVMA 4YAKA 1G8MA 2I2XB 3HDYA 4MUKA 5GVRA 1CUXA 2O2JA 2VK2A 4TUYB 4EB3A 1X42A 4Q82A 1X7HA 1SURA 1N8SA 3EDCA 2XOKA 4CFYA 2FI1A 1T3TA 3H0EA 4L1KA 1FP6A 4RMGA 2D1FA 3E3LA 2AG6A 2VQ6A 3FPCA 3WO0A 1TM1E 5SZJA 2QN3A 4JD5A 1JEJA 1LZLA 1KP2A 1ZK3A 2XUFA 2NM0A 2X3FA 1O5TA 1DTEA 4H16A 4DSAA 5JQGB 4HAYA 4LJLA 2X0DA 2PL9A 3L06A 2A92A 4EVQA 4RE5A 3CNQS 4L22A 1PT6A 1M0TA 1NLYA 3PGMA 3MGAA 4JQYA 1LW7A 4NS4A 5EUCA 3OTGA 8AT1A 2NYUA 1Y6QA 2XW6A 3WAKA 1D8TA 4EG6A 3NJ8A 3E3MA 4A10A 3A0RB 1XTPA 3ENWA 3IXMA 3KIPA 3ORRA 4M99A 4NE7A 4DL9A 4UE3S 3TQTA 1BFKA 4A2PA 3K70C 1I9GA 3INRA 3ZHXA 4DILA 2WIFA 5DCYA 1Z5UA 1XI2A 1P2VA 1NDQA 1MF7A 2YFQA 3KYJB 4XGKA 1QIDA 2ZZKA 5CT8A 1A7AA 1AOXA 4DLPA 5F1KA 5HFJA 2NP7A 2PRZA 3NKLA 1FSPA 2H1FA 4HAOA 2FR8A 2B6HA 1RWNA 1QDUA 4DREA 1NSYA 2VO1A 5CIWA 2BHNA 4G09A 1W46A 4MWTA 3KVVA 1WW2A 3ILVA 5CVDA 4KKVA 5LZ8A 4II3A 1NW8A 2VHVA 2LKCA 3DP9A 3K9NA 4OBEA 3UKOA 3FB1A 1DX4A 3KV3O 3C3PA 1AK9A 5KNCD 1CF2O 3DHVA 3EG5A 2ALJA 4D82A 1T0UA 3HHEA 4QQ8A 5JW6A 2HMSA 1M10A 4JEIA 4B47A 4BNFA 1U9CA 3OJOA 3FNRA 3FHTA 4GUDA 4BO4A 2GVZC 4K1LA 2BFDA 2J6BA 3H1PA 3LJKA 5ECDA 3OCXA 4YJGB 4LGMA 2I80A 1S3FA 4EUSA 3GRKA 4EFLA 4YRTA 2ZYAA 1T24A 2AMJA 1GZ4A 2P1RA 2XRYA 3NKFA 4L07A 3UB4A 1AXEA 3WLRA 4KYIB 4ZCQA 1I6LA 3BIFA 3T7IA 4ERXA 1YVEI 4TV9A 5D1NA 4CI0B 3DPIA 5KTPA 2XRZA 3KKKA 1U98A 3T4UA 4AB1A 4O4JF 5A7GA 2ZBQA 1YS2X 1DTSA 1NVUQ 4H0NA 3Q40A 5LB2A 3TNDA 2OPBA 4MR7B 2Q3LA 3HCRA 3ODGA 2V6JA 1KEVA 5E3HA 3UY4A 1U3CA 1LI7A 1Y8RA 4J0GA 4RABA 4WSOA 2H31A 2YHAA 5EKDA 1G8AA 5KJ1A 1G66A 2WJ6A 2ZQ5A 3KALA 3X44A 5IAAA 5FA5A 3MWEA 1SXJD 3SDSA 1U9IA 3UPUA 4RJTA 4UM9B 1XFAA 4QVIA 2P6OA 4ONEA 2AFIE 2IYRA 2O0KA 2PV0A 2W2LA 5BVGB 2R6JA 4GVLA 1P61B 3G2PA 2IHJA 3G85A 4RMNA 4CGZA 4MUEA 3T0FA 4LWZA 3PUXA 4X54A 1KJJA 1E2QA 4PG4A 2PU5A 1RWXA 4RSRA 2GXQA 1PU2A 4PYNA 1LPSA 1VPLA 1XN4A 2JVJA 3HR8A 4HH4A 4YK7A 1YMUA 2ZWOA 1KFJB 7REQB 1A9XA 4CEHA 2R96A 1C1HA 4IXNA 3PS9A 1VCHA 3AHDA 1KJ9A 4LJ6A 3AGPA 5CH3A 4AYXA 2F55A 3OLYA 4DQUA 2VQDA 1N0VC 2ADMA 4G0YA 3NC1C 4P54A 1DOHA 2V7GA 4ENSA 2WLTA 1X9HA 3VH3A 1Z7WA 2Y6UA 2HNBA 4MHTA 4L6IA 2WM9B 4LJ7A 4CL8A 5KYXA 4EKGA 4FFLA 2C99A 3JWIA 2OAP1 3T9EA 2JJ1A 2NU7A 2YRWA 4OYRA 1JHQA 1Y4ZA 3Q87B 1IQRA 2H48A 3SEZA 2JRCA 1H93A 4R1QA 3AJAA 1R8SA 3V42A 4BX9A 4LRTB 2CK3A 3GJ7A 4LY0A 3WDSA 4KWIA 1BMQA 4IVQA 3OD5A 1WSAA 3R0QA 2FRVA 4QBKA 2VP9A 1QRTA 5KYYB 5EP2A 2QPTA 2P62A 3M70A 3CZRA 2B78A 4ZCSA 3FB4A 1ZPDA 1LDBA 2FPPB 1UM9A 2QG4A 5BV7A 5T57A 1DINA 1CSEE 5I4IA 1G9XA 3RNLA 4XARA 2IDJA 2F9LA 2I6QA 2C59A 4Z2YA 3SYRA 4V38A 4AP9A 4LJ8A 1NVVR 3DLTA 4KP7A 1HH4A 2VLBA 4IIDA 1R3DA 3OFSA 1VG1A 2C92A 1OCEA 5GIOE 3ANNA 4X20A 3KWJA 4YROA 5KVCA 4M8SA 1J9GA 2IBTA 2I76A 3MCWA 2VHCA 5C81A 4AJ4A 4MJLA 4ZO6A 3BFVA 2GK4A 1P2BA 4TROA 1PT8A 1OTHA 2IIQA 2EFGA 2D7DA 2M98A 3G0DA 2R7NA 3VR3D 4GEGA 1N5MA 1NBWB 1GUYA 3RRFA 1RC8A 3BUSA 3AONB 3CX8A 1NBMA 2EATA 1DG1G 2O5EA 3NHYA 1ISGA 1WXWA 1T3HA 4GI1A 3P94A 3UYLA 1Z5WA 2K2WA 2VF4X 1BYIA 3MINB 4DZRA 1A5AB 1XZBA 1LSJA 4B81A 1IUNA 1M6NA 3ZK9A 2P2CA 3RSGA 3L1VA 3MWJA 1H4SA 1NVBA 3C6QA 5FLKA 3CLTC 3CZ5A 4J4TA 1AQUA 5SY6A 1OA1A 2ZI3A 3E2PA 4H7IA 5B4UA 4YCJA 4C2TA 4OP3A 4G25A 1L5KA 1BHSA 3T5GA 4JKYA 2P9CA 1V4BA 1QHNA 1UT6A 3OO1A 3T06B 3WAJA 2WMNB 5AW5A 1RPAA 3BXXA 1BHJA 4HPWA 3Q88A 4RACA 5ALLA 5JZBA 5FI3A 1M1YE 3D0QA 3GEPA 3CIFA 3ESRA 3SLKA 5CB4F 1JLLA 1V2HE 1VRCA 5KDDA 1TTHA 4BO8A 4ASUA 2O0HA 3FVRA 1M5UA 2BGGA 3ZCVA 2WKPA 1NZJA 3TZQA 3N0WA 1IMOA 4N18A 3I8OA 5JBNA 3L93A 5G4KB 3T7JA 1VBMA 2GTPA 2IY7A 1E1YA 3ESCA 3MJRA 4UARA 2R751 5K0SA 3RSHA 1M3SA 1KP9A 1CERA 2Z2JA 3ESDA 3KSMA 5DGXA 2CJYA 5AVQA 2VTDA 2C5BA 2WYWA 1K4YA 1M8KA 5DH9A 4ZVPA 3TUZC 4PSAA 4W5RA 1VGRA 3RBAA 2RBGA 1D2NA 2P6UA 4ED9A 2O8VA 3A31A 4XQGA 4XE5A 4D4LA 1WKBA 3EZ6A 3Q3CA 1L4GA 3F6PA 1HDYA 5HE9A 4KQ1A 4F6LA 5B6PA 4DCCA 1GGJA 5B55A 4R2MA 4ESVA 4LYFA 3M3DA 1JG3A 1RMYA 1M5RA 1EXDA 2XSZA 4PFSA 5E2IA 5AYVA 2N1MA 5HSGA 5GOTA 4YXWA 4G9GA 4NNPA 4BQIA 2X6TA 2EYUA 4AJNA 4F5EA 4M7OA 4C9BA 1RM5A 221PA 4FZVA 3HCCA 1L7QA 1EXVA 5DSXA 3A04A 3R9XA 4F4JA 4ZVQA 2WOJA 3SHVA 2JIBA 5C8ZA 3G7UA 2Z56A 1V8PA 2FEKA 2VSXA 2YMQA 4E5SA 4IQFA 4KU4A 4PZLA 1T36A 3EQ2A 1TTQB 4CQMB 4HB3A 2V7PA 3WBFA 2FZ5A 4MR9A 1XEWY 4IHAA 4LWPA 1C30A 2ZVQX 4FI3F 4GFDA 5DTQA 1VHDA 4QFDA 3A7EA 2CSUA 4CLOA 2PT5A 1PN3A 1W9HA 1LW6E 3CRMA 4ALMA 2D2VA 1V4VA 4EA9A 5JADA 3BMCA 3WKBA 2XNCA 3USZA 5CJ2A 2HK9A 1KR5A 3AI7A 4Y2YA 2ZE7A 2BM1A 2EEZA 2BVNA 2NNWB 3TLBA 4AD8A 2PZGA 4UTPA 5KYKA 3DLCA 2ZIVB 4C0BA 5DN6D 4BV3A 1EP1B 4XYEA 3U3MA 2XBMA 3MCAA 5JFGA 4IXTA 2XJ9A 4KIWA 3VDNB 4J0KA 4BGVA 1Z4MA 2FFAA 3SEQA 4Z86A 5I7EA 2GM3A 4KUHA 4AKTA 2G80A 3STXA 1O9BA 1JLKA 2V6FA 1TQDA 1BWSA 1HPLA 1LXCA 2R6FA 3H16A 1E5TA 2RH9B 4K28A 3MQ2A 3CVUA 5IBQA 2P0YA 4C4AA 2NTNA 2X0JA 1M6VB 3A9UA 2LV8A 3HEAA 3HVIA 4J07A 6AT1A 4DV1B 1IAQA 1JALA 1JQAA 1NFQA 4KMRA 3ZGNA 1SBTA 1QCYA 3ZI4A 1BDMA 3AR5A 2AJ8A 1NU6A 2GK6A 2ONJA 3TZCA 3GNSA 1HT2E 2HWUA 4HL6A 2QYSA 4GHWA 3WGUA 2YVLA 4Q1CA 3HCAA 3MOGA 1DDOA 3IV7A 4MW1A 3SPXA 2D7CA 3MT8A 1Y8QA 3UHPA 4JODA 1BFUA 1N3IA 3PD0A 5ES4B 2I29A 2GF0A 4O4LB 2C8JA 2J87A 4U00A 1W9MA 4QXMA 4O4LA 3M1YA 4AJKA 5JD5A 4YUZA 2R6HA 3TFOA 3BQNB 1NKVA 1Y9DA 4MKXA 4LRYA 4Q6WA 2P68A 1CZOA 4J2HA 5FUBA 2ZCJA 4ZVOA 5DWQA 1NXSA 3AEZA 1RM3A 1U0HC 1S8FA 1JDZA 3M5WA 4BEWA 1Q0SA 4WOJA 3X1KA 3HG7A 4EGCB 4E3ZA 3M83A 4YWHA 1WABA 4AP6A 3U44B 4GRIA 2CD9A 2DWQA 2MSCB 4KVAA 5FUXA 3INYA 2QXYA 3OICA 1PKEA 2R85A 3H0CA 3KQTA 2YZ2A 3EEBA 3F1LA 4O4IF 2X2FA 2VS1A 4IZHA 4BLTA 4DB4A 5T4FA 2IV2X 2ST1A 3JYPA 1CLEA 4TS9A 3WYFA 1XQ9A 3SR4A 5LOVF 5CA1A 2XA2A 4HK4A 1NIJA 3W1WA 4BCDA 4G1CA 4RIGA 2NO6A 2LR0A 4FJ0A 4HFJA 3B5IA 4BNNA 1WRBA 1XEFA 4JJ4A 4FMPA 1L8LA 4R1LA 4OV6B 4X7RA 4D8YA 1GR0A 5HQJA 3ZS9A 4DIFA 3U1VA 4BBZA 5TLSA 1E18A 2JVIA 5BWLA 3QYFA 4W1SA 5FLEX 2D59A 2HC9A 4GC5A 4L4SA 1SZDA 3UJAA 1A69A 4EJ0A 5JHGB 2J0QA 1W35A 5IKEA 1L9XA 1D2AA 1D2HA 4W5QA 4OHCA 4YFVA 5D85A 4EMUA 1BX1A 5L45A 3EVCA 4E70A 1AVTA 3PPXA 3TVTA 4DAOA 5L53A 1EUYA 3OE1A 1ZH8A 4OHWA 1DBSA 4BFWA 2VP4A 1QH1A 3I2GA 2QYHA 4XWOA 5BW5A 5LQUA 4R9SA 4EVRA 1E98A 2I4MA 4EVIA 4U4AA 5CA0B 1WHTA 3NYWA 1HZZC 2QRZA 2OB2A 4AJ2A 1T2CA 2HRCA 1EAMA 1CE8A 1K89A 1ZNQO 3CNBA 3M1LA 2M32A 3R3XA 4RKFA 4YDHB 5L4LA 1VZ3A 2G06A 3AVUA 3KOXA 3DP7A 3TNFA 4ZZIA 4IGKA 3ZHRA 2IDKA 4NC9A 4M2LA 5BSHA 1J9EA 5GJBA 4PLYA 4MCJA 1YZFA 4NCKA 2NV2B 1ONSA 2GBIA 3M7IA 3ACDA 1I24A 1IG3A 3KUDA 4AO7A 1E4YA 3GHYA 5I01A 3A9RA 1YVPA 5BRJA 4RTPA 1PL0A 1KEWA 1VFPA 2RKOA 5CM8B 6YASA 4GKKB 2TS1A 4YQEA 1RVV1 3ND7A 1QFMA 3MEQA 2BKXA 4V0RA 1JQLB 5FULA 1NSTA 2C29D 2HQBA 3E7DA 2TYSB 5GADl 1Z3IX 2CNLA 2RGXA 3K5IA 3P52A 1TUBA 2VTBB 1UOQA 5I51A 4C6HA 2LVBA 2I3AA 2JJ1D 2BKEA 2JCYA 5DOZA 1UFVA 3SP1A 2EARA 1E32A 1E3WB 1U9ZA 3UJ8A 2PUEA 2H1IA 2QUKA 1PX0A 3BILA 3GYBA 1M7BA 3FPSA 4XSGA 4ALLA 3UCFA 4LHYA 1OF1A 1QF6A 1MJHA 4QBGB 2EBFX 3CXRA 5EEHA 2IPLA 3N2EA 3SX2A 4QGFA 1OV6A 2J9GA 4FFBA 3D7NA 3RS9A 2EL9A 3M6XA 2GARA 4PYIA 3COYA 3QBVA 3MUOA 5CYPA 4JR1A 5I3ZA 2O57A 5KVSA 2EBUA 5E4YA 3KZCA 4RVSA 4AZ3B 3WLOA 2ZDHA 2J3HA 3GEHA 2FSIA 2RI0A 1M0WA 3TKAA 3T5PA 1S2LA 1VE1A 4M22A 3HV2A 2R1UA 2FZEA 2Y05A 4C6TB 2AR9A 1ZJ4A 4D8UA 1FP4A 1ZC4A 2IX9A 3WOVA 4WOCA 3PC8A 4KWHA 1II9A 4I7EA 3BE4A 3M4JA 4P33A 4P4SA 5H3CA 1RI5A 1ZNWA 4EMSA 1N3LA 1V16A 3BFXA 4IKEA 1EA5A 2KW5A 4YP0A 3K73O 4C7MA 1XU9A 5CB4A 2CJWB 5BPHA 4KFRA 4WBSA 5E1OA 3SGLA 4AJIA 3E82A 4CUJA 4FMDB 5HM6A 1TD1A 3DAOA 4AS1A 1HM5A 5LQNA 1Y7PA 5KNLA 4EYQA 1JR3E 2LRHA 4OGGA 1JI0A 2QAJA 3PG5A 4K8OA 2ZLBA 1FU4A 4ZT4A 1AGXA 1ZGAA 1ZW1A 3UYKA 1JTVA 1OSNA 4GL2A 2YV4A 4RELA 3CH4B 4U7FA 2B1RA 1M1XB 4I5GA 3AJ9A 1ADCA 2HCJB 3MQFA 1PFVA 3QEKA 4BMVA 3UWSA 5DI9A 3BWMA 4YMIA 5AVKA 1XRQA 1JQKA 3OLZA 4MV6A 3KOUA 4OXIA 1KI1A 1OROA 1FTWA 1IBSA 1A9SA 3ANSA 3CO5A 3VAAA 4BJ1A 3DO6A 3IUBA 5GONB 4PANA 4JH0A 1K4KA 3TQFA 2WTAA 4HX5A 4WNAB 2RHTA 3K5WA 3PJDA 1KQ3A 4QWWA 4BKRA 4E7OA 4ZVUA 4IINA 4N5MA 4FX2A 4F38A 4F9GA 1OMOA 5A4FS 3BF8A 5KQMA 2CZGA 4KQCA 1BH2A 2GETA 1LLFA 4N9WA 1P4SA 3NOXA 3F7TA 1B1AA 1GZUA 4GP6A 2ZS8A 3HBAA 3O2NA 4NH4A 5CT5A 5ALOA 4BMXA 4IDCA 1WY7A 4Q7EA 1QIJA 5A6SA 3JQAD 3OTOB 1QUFA 3WYBA 5K7SA 1PK9A 1Z75A 2BFEB 2CNDA 3UKDA 3WQRA 3JARB 4WASA 5HZHA 3AUUA 1BKYA 3BMQB 1FSZA 2Y92A 3LYLA 2ISQA 3NV7A 4ALNA 1GCOA 1CR2A 1V5WA 2YJ6A 3UUWA 3W6UA 5AW1A 4JNCA 1SKUA 3M6FA 3O84A 1HX7A 2AWNA 1EJ2A 2BFNA 3FLAA 1R4MB 1H1TA 2VTVA 1C1XA 4CIAA 3OF3A 3A1NA 1E99A 2WTUA 1R66A 2YWJA 5L3VA 3O75A 1PGJA 2YRXA 3SBDA 1JHYA 2QZSA 4JP5A 4Y2JA 5F4ZA 3O8CA 1UMCA 3HWSA 1YB1A 1GUBA 2IZ5A 1JJFA 3C5WP 3MWYW 3SICE 1J8FA 3W04A 4Y6SA 1FU7A 3NIFB 5TQ2B 2YN2A 3AY3A 1U0SY 3HA3A 1YMVA 1VM6A 2VSOA 3AVQA 4ZOBA 5AKKA 1ZX1A 4AG3A 3E3NA 5BORA 2O54A 1LA2A 1RRCA 2BR5A 5FWAA 3GH1A 3OQHA 3O74A 1D6SA 3VHLB 1J0AA 4JGGA 5FX2A 2IEZA 5KNDD 1OBOA 2O8CA 1KY3A 1V8OA 3GT4A 1F6WA 2IOFK 1AB5A 5JMPA 3ZU6A 5LPNA 2J9FA 3KEGA 2JVKA 1JJVA 4JELA 1X8KA 3PEEA 4UE6A 3S99A 1W0JA 2QL6A 5AT1A 1XLTA 2YXPX 3VPHA 2OK7A 5CXQA 5CGQB 1F48A 4FYXA 2H2WA 4EMTA 3L4SO 3AETA 5KMGA 4D6XA 4FU0A 3TRFA 5MGNA 3UBTA 2BHSA 3FPGA 1SGWA 1X1DA 3FAZA 5HKKD 4MVWA 4IJMA 1RBMA 4KWTA 3P0EA 2IS6A 3R7WB 4ZGGA 3NM6B 4L28A 1CDEA 4RS3A 5ALPA 3TECE 2HK8A 5KOHB 2GH1A 3RU3A 1IATA 3SWWA 4X61A 2CVHA 3IAFA 1GITA 2COKA 3LFTA 3OCWA 4M83A 3HJRA 4QG7A 1MQ8B 4UUNA 3VPBA 1WP9A 3QXGA 4KL8S 4WMLA 3ZOKA 1W0JD 4YV0A 3L7CA 1N6RA 5DLQC 3WWYA 4TTSA 3ME5A 3TSYA 4KLAA 5EQFA 4EOGA 1I10A 2RGDA 3ZTWA 1JHVA 1WOYA 2OYSA 1MU0A 1Q17A 2ET6A 2IF0A 4LVNA 4PRLA 4BJ3A 3IEXA 2W2MA 4RPKA 3GJXC 2B61A 4BCBA 2FPPA 2DQYA 1EFAA 2Q6OA 1QYDA 1JKXA 4QNNA 5A05A 2NP6A 5JCPA 4A15A 1NDUA 1A76A 1IWBB 1QOPB 4JUCA 2I3GA 3AKYA 2OZLA 4ZYLA 3R5XA 3G88A 2V7WA 3PXDA 3EW9A 2CDNA 2IYSA 4HR7A 4Y3UA 2R00A 1GQYA 3U37A 2WQ6A 3NTUA 1Z4OA 3N7AA 2UKDA 4L4XA 3TVYA 4CM8B 4CT5A 4LWQA 1T6ZA 4CQLA 4KQWA 2B4AA 5GV8A 1KKLA 2Q07A 1DG3A 1V43A 3GF4A 1RRPA 4MS3B 4JLUA 4RK7A 4Z3OA 3P2MA 4M1OA 4UHCA 1JKMA 3SK0A 1F8YA 2OGWA 3KPYA 3TNJA 3ZWOA 1P1BA 1Z7BA 4J90A 4JI6B 1QAQA 1B26A 1U5BA 1SA0A 5FBZA 4Z0PA 3PDUA 4UUOA 4WN9A 1FYXA 1XCPA 1KO4A 1T10A 2VH5R 3D6JA 2OWEA 4R6XA 4DN6A 3G2KA 3GEDA 7YASA 3K9QO 5JZSA 1PNQA 4JQZA 3VRHA 1EHIA 4QTZA 3AVYA 3AHGA 4MR8A 4RTMA 3I45A 4OQXA 2VDOB 3QFFA 6REQA 1Q21A 2AJTA 4CG1A 1NXPA 4RKEA 4HEA6 1IN7A 1BW9B 2ZSKA 4CL0A 1XDBA 5B6JA 3DAGA 4OSEA 1DRJA 2MDTA 4FQ5A 4ZZ1A 4IF4A 5I7RA 4OQ4A 4X63A 2FX5A 1GN8A 2NT3A 3N7TA 2EP7A 3ES9A 4MGIR 3L7BA 4TTQA 4ZAYA 2NIPA 1SU8A 1QRDA 1PQUA 5K8JB 1JQ3A 3EEFA 2XGOA 4EJFA 4JUAA 1DIBA 3Q3JB 4FGWA 1YAHA 1Z0AA 3SJAA 2HXGA 4CCYB 3B52X 1ZFNA 4H6WA 1UF9A 2GILA 3AU9A 2WJIA 1ORVA 1PZXA 1NQVA 3QQPA 1SMKA 4MQUA 4DNXA 1E4EA 1K7EB 4X8HA 1K3UB 3ECSA 3ZCPA 2FPOA 1FA9A 4QTYA 3UM9A 2RHJA 2UAGA 4PC2A 1WJGA 1QHYA 3B9BA 2GESA 3MTGA 5MN4A 3ZZUA 3QE4A 1H2AS 5FI1B 1ZEJA 3QPVA 2OWDA 3TF5A 5AD1A 1NAHA 9LDBA 3WICA 4LZLA 2H5LA 4NBNA 2VDMB 1QR6A 1QMPA 2XDQB 1ZD3A 3IPLA 5FWXB 2VHXA 1NQTA 3ZD9A 3DPUA 1MG0A 3TZKA 3C7DB 1IXZA 2IQ5A 1C81A 1OOEA 3JWJA 1AKEA 4O4HF 4KJXA 4BNYA 2C5LA 4TL8A 3EF3A 2FE1A 1GPJA 2FPGA 4UDYX 5REQA 5BRAA 3PIRA 3D64A 1P4AA 1F3LA 4XVHA 1YIDA 1L8QA 1XZPA 2WJHA 3ZWXA 4FFPA 5FWNA 3AGQA 1PLKA 3ER8A 1EWRA 2YQ5A 3M33A 2WILA 2YNMC 1JZQA 2NZWA 1ACMA 3I73A 3OC6A 4OU4A 3CF4G