2RG1A

Crystal structure of e. coli wrba apoprotein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
196
structure length
168
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGGGQEQTITSTWTTLAHHGMVIVPIGYAGTPYGATTIASRQPSQEELSIARYQGEYVAGLAVKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein WrbA
publication title Structural organization of WrbA in apo- and holoprotein crystals.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase, electron transport
total genus 62
structure length 168
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rg1A00
1AZLA 2FLVA 3U7RA 2Q62A 4FX2A 2QMZA 1CZRA 3NHJA 3OX1A 2V9CA 2BF4A 4ZVNA 3N3AC 4PTYA 4ESEA 5B3KA 4QOEA 2A5LA 1FLDA 3F2VA 4FGLA 4PU0A 3LCMA 3UXHA 2QX6A 2XOEA 1SQSA 2Z9CA 2FX2A 4YAWA 1YCHA 1QR2A 3OWXA 4NLLA 3F6RA 2Q9UA 3B6MA 3FX2A 3HLYA 5NULA 1FX1A 3FW1A 4LTDA 4U7HA 3ESXA 4NULA 3O2NA 1KBQA 3GFRA 2Z9DA 4QOGA 4R81A 3W78A 3W7AA 5B3LA 1NNI1 4LTNA 2MWMA 1CZLA 3TE7A 3NHLA 3P0RA 5EA2A 5FX2A 1OFVA 4YAFA 3U7IA 1V4BA 4N9QA 2RG1A 3RPEA 1ZWLA 1GG5A 1FLAA 1QBGA 5A4KA 2V5VA 3KEGA 1ZX1A 2BPOA 1QHEA 2HNBA 2QX9A 4C14A 3W79A 1OBVA 3UXEA 5F12A 4OXXA 4U7FA 4ZVMA 5LJLA 3OJWA 3LT5A 1AKRA 3B6KA 2FAXA 2WC1A 2QX8A 3TZBA 3L9XA 2X2PA 4QOFA 1DXOA 1J9GA 4YAUA 4YALA 1FLNA 5LJIA 4C76A 4QOJA 1J9ZA 3ESYA 1BU5A 3QFRA 5FA6A 2QR2A 1RCFA 5LLDA 3FVWA 3O73A 2FDXA 3B6JA 3ESZA 4DY4A 1YRHA 2MTBA 4QOHA 2QWXA 3NHRA 1C7EA 4LAFA 4QOIA 3EYWA 3GFSA 1AKQA 3FJOA 4Y7CA 1YDGA 4N65A 4DIKA 4GI5A 2QX4A 4QODA 1AMOA 4H2DA 2HNAA 1CZOA 2FZ5A 3QE2A 1CZNA 1FLVA 3NHPA 3B6IA 2BMVA 4LTMA 1D04A 1I1OA 4PTZA 5LVAA 3TEMA 1XT6A 5JROA 4Y9RA 5EMNA 5NLLA 1TLLA 3OVMA 2KQUA 4FGKA 4D02A 1AKTA 3ZHOA 5EAIA 1JA1A 3GFQA 2Z9BA 3FNIA 3NHKA 3JSXA 4GQIA 1FVXA 2ZKIA 2AMJA 2M6RA 2B3DA 4YQEA 4S24A 4ZVKA 1J9EA 1D03A 1AKWA 2OHHA 1YCFA 1YKGA 1RLIA 3D7NA 1ZWKA 4ICIA 4LA4A 4FGJA 2W5UA 3F6SA 3NHWA 1OBOA 3G5MA 4J8PA 5BUCA 2F1OA 3R6WA 4GR9A 3OJXA 2FCRA 4F8YA 3N3BC 1T5BA 3ES9A 3OWHA 3N39C 1TIKA 4HS4A 3NFRA 2ARKA 4H6PA 2QMYA 1CZHA 2D5IA 1XYYA 5LBUA 1FUEA 2R97A 5F4BA 4U7GA 1X77A 3KAPA 4Y9UA 1WSBA 1J8QA 1AG9A 1RLJA 4DILA 3GAMA 2HPVA 2MOKA 2MT9A 2OHIA 5FUQA 1CZUA 3F90A 3NHYA 4BMPB 4N82A 2FZVA 1JA0A 3L9WA 4XDHA 1F4PA 1FTGA 3W77A 4CETA 1QRDA 1RTTA 1XI2A 5LMCA 1T0IA 1DX9A 4HEQA 1DXQA 1H69A 4YAOA 4C0WA 3NHFA 5ULLA 3HR4A 1H66A 2R96A 1B1CA 1E5DA 5LBTA 3SVLA 1XYVA 4BMOB 2OHJA 5F51A 2N1MA 3HA2A 1AKUA 2KLBA 1BVYF 3S2YA 3KAQA 4M0CA 1YCGA 2XODA 3NLLA 1WSWA 4XDGA 1VMEA 4ZVLA 3KLBA 4CF6A 5TGZA 2FVXA 2BZSA 2X2OA 3K1YA 2GSWA 3NHSA 2V5UA 1AHNA 2M6SA 1AKVA 1D4AA 3OX2A 3K20A 4C0XA 1YOBA 2OYSA 6NULA 3QFCA 1SG0A 2FOXA 1C7FA 2Z98A 3OX3A 1KBOA 3EDOA 2BN4A 1CZKA 3NHUA
chains in the Genus database with same CATH superfamily
1G4AE 2Q4RA 2A0YA 2JLWA 2YWCA 3HADA 5E7JA 4OO3A 4EHIA 5BRAA 4FUTA 3SBDA 5DNVA 1D4FA 1MT3A 1TM1E 2EEZA 1AIPA 5FR1A 1Y9DA 2IEAA 3SOZA 3AR6A 2BGJA 3C3BA 2PKRA 1E2UA 1ZMOA 3JTEA 1ONSA 2IXTA 2YJ4A 4B82A 5LMUB 3GGPA 2UYHA 4Y6SA 5A9SA 3DA8A 4ZVNA 1C50A 3SVTA 1BFKA 1ZBQA 3LUCA 2EIXA 2GOYA 3BWEA 3Q2KA 4KNVA 3X0DA 3JVEA 1DJOA 1RC1A 1VKZA 4IDGA 5ES3A 1NPTO 3MTGA 1KEKA 5THQA 5BVHA 3EHEA 3QTBA 1J0EA 4KXMA 4GOND 3ETGA 2FV8A 2VQFB 2OUKA 3I4FA 1OT3A 2OVBA 1SXJE 2VEOA 2R48A 3GEIA 2ODPA 5H16A 2RCNA 2GBLC 2YH2A 3DOIA 1RPAA 4D8TA 1NWCA 3Q3CA 3UB4A 4DW8A 1VPLA 1K6MA 1L4MA 4MRPA 1IN8A 4KR3A 1AM4D 2P6MA 1XTQA 3WQSB 1APBA 2QMQA 2HK7A 3NBYC 3PI7A 3U3JA 4LJRA 1CE8B 3UA3A 1WVMA 2JEYA 5CT5A 2OBMA 1LQTA 4DWJA 8MHTA 2FEOA 1R12A 1Y6QA 2TMYA 1DPGA 1EDBA 3GLTA 4QWWA 3E48A 2NU7B 3UUGA 1LB1B 2I4RA 1EP9A 4M0PA 1OAOA 4HYEA 2OGTA 3UXYA 4UE6A 4P7JA 2PYIA 4UTRA 3L43A 4AW9A 1JNXX 1L7OA 1KYWA 1WZIA 3Q0EA 3HG7A 1J20A 3RS3A 4D9HA 5JASA 4JI8B 1NF3A 4MS1A 4ND7A 4FSDA 5GZ1A 5H4GA 5CLIA 1L7DA 1ZUNA 1YAHA 1GUDA 1Z18A 2OHGA 1H1LA 3GGGA 3H1PA 3R75A 1ZICA 3TMYA 1GG9A 3NTOA 4PPYA 5H4HA 1NXQA 4YPOA 1SH7A 1NJ1A 1T10A 4CEIA 1PVVA 1OQAA 3NETA 3U4MA 4Z4IA 3QVLA 4MARA 2VHUA 3VPBA 1YJ8A 3OQNA 1KR2A 3KYCA 3H87A 4AJ2A 1E0JA 1QK3A 3NGXA 1RLUA 4PAWA 3BCHA 2EGUA 2BAGA 3DO8A 3L4BC 4X24A 1I4LD 2JH8A 3ET5A 4BXOB 1C3JA 3BK2A 4MQ5A 4W99A 2P3OA 4I4TF 3PDUA 3WTBA 4MRRA 1G98A 4KQGA 1T5HX 5C2JB 1T3ZA 1ZRMA 2NSLA 3KRTA 5EUBA 1V0JA 4TN5A 1SXJA 1ND6A 2ISSD 1V39A 3FHLA 3PEEA 5CAEB 9ATCA 4EYGA 5JATA 2Y1EA 3LA8A 4EH1A 1NVVR 2QY6A 1O5IA 3J81A 1MR3F 4KYUA 2YY6A 3HKBA 4KI0A 3SLGA 3KL2A 3IP5A 1HT0A 4PG6A 3U4IA 2G1JA 3WK5A 3RSCA 2XBUA 3G82C 1XDWA 4WINA 5KUTA 4MUIA 4UXIA 3P27A 4OMFG 4QICA 1A5AB 4LZNA 4OFBA 1AK2A 4Y7DA 4ZI7A 4C78A 1QFJA 1CDOA 2AK3A 3DVLA 1WZEA 3U80A 1CYDA 3MTDA 4A10A 5K0BA 3K6SA 2Y92A 1DC7A 1ZUHA 3ONEA 4JVNA 4OHFA 2DSTA 3EEOA 3ROMA 2PMEA 2P9HA 4AD8A 4DR2B 4TKMA 1SVLA 1YZUA 3AERB 3WP0A 5K6TA 4DT1A 2XDAA 3LFTA 1KY3A 2MSLA 1DEKA 2ZJBA 3SQNA 3C48A 2VYQA 1S2OA 1E9AA 5DSXA 4DANA 4F84A 2GGSA 1GFZA 2V7WA 5ECWA 2CMDA 3W79A 2AYZA 2AXQA 3QUCA 4J0CA 3ZV4A 4BDTA 4MWOA 5I7WA 2BVNA 1AKYA 1HQCA 1RVV1 1FK8A 2GEKA 1PJQA 2WABA 2P90A 3B6ZA 4Q1BA 3UIEA 4DA9A 4DLZA 3BE4A 4DMFA 5IHXA 2CJFA 1FW6A 1KY2A 3D3QA 4YDSA 4UDNA 2TMDA 3CLKA 4PR3A 1W85B 3HE3A 2CLDX 4JK3A 4Q24A 4CKBA 1GGJA 3IAFA 3SN6A 1JHOA 3UM9A 2HAEA 3LQYA 4RQBA 4B09A 1HT3A 2AJBA 3QU5A 3HP4A 3LJKA 3MIZA 2J3JA 3GYBA 5AXAA 3D7LA 2K6GA 1XALA 4GZ3A 1LPMA 2H1HA 3FIUA 4K9PA 5EWJA 3HZOA 5ICGA 1L7PA 2PT7A 5JLJA 4I55A 1UK9A 3KUXA 5FB3A 5CFRA 2XAAA 2DT5A 1F0PA 3EF1A 1DBIA 4WSOA 5EUQB 3SIRA 4AJLA 3QKSB 4YWHA 4YALA 4BNTA 4Q03A 1QFMA 3E9RA 1OT5A 5HFNA 5MN4A 1NQ5A 2IWRA 4MINA 4RLHA 4C2AA 3GJ6A 2IHTA 3ORQA 1S3FA 1PR9A 2CZCA 2XD9A 1Y5LA 2GBCA 1Z0IA 3CC8A 5KYKA 4JGIA 4LUCA 4R4JA 4V0KA 2P9YA 5JZ9A 1IJKA 2YQ5A 3X1XA 4ZDKA 1XRPA 4MB0A 3PWSA 4A27A 2BEVB 1CDZA 3O84A 2HLNA 4U7WA 3M0EA 1K7EB 3W05A 1UMKA 2HU8A 2VPWA 3HCWA 4P2GA 4DMGA 2NMVA 2AKYA 4H16A 4C4AA 4EBBA 5LLDA 4X62B 5K6AC 1E7SA 1FFWA 1QQBA 3ZY5A 3DLPX 1Q6YA 1NJ2A 4LS3A 1E1KA 3SY8A 1QG2A 4Y6OA 1KR5A 2WF5A 2QRJA 1I1NA 2QP3A 4JJ7A 2PGOA 2X42A 2Y99A 2PIAA 4ZO6A 3DLTA 3R5FA 3LLSA 3GARA 1L4KA 2NZXA 1EFDN 3BXZA 2HL6A 1HZJA 2PFSA 2VJYA 4MI1A 1LC0A 1HM5A 2JBHA 3ZC3A 3ZBUA 1UAYA 4B8YA 3ML1A 3RRMA 1RQRA 3A9UA 5K45A 3TX6A 1GQQA 2HRZA 1K8YB 2VJCA 2RHLA 2WVAA 3OQHA 1XPOA 2ZIFA 3KC2A 3W2IA 1N33B 4UD6A 1OFIA 4J1SA 2FFRA 1T4DA 3B5JA 1WBBA 2YDXA 2P35A 2BL4A 5CIYA 1TYAE 1TF2A 3SBEA 3T12A 2GN1A 1P2SA 3ZKAA 1RS0A 2P2DA 2QX4A 1ISJA 2R5NA 3GEDA 3MG9A 1E3WB 4LNHA 5EQFA 1RR6A 4KIWA 4LXQA 4N01A 4RUKA 3W8DA 3ROZA 1NJ5A 3RD5A 4JODA 4D3FA 5CNKA 5H68A 3QE2A 1HTBA 3E18A 5IKPA 3OIDA 3B9PA 2PX0A 2Y6UA 4K6KA 3PXUA 1MGOA 2I3DA 1CE8A 1XO1A 2WUVA 4IQGA 4R71A 3QQ5A 4QXQA 5GV8A 3W5BA 4ZEXA 2XMZA 2CFSA 3FMOB 2IW3A 4G8DA 1E6LA 3ADBA 4QJBA 2H5IA 2P0AA 3WAKA 1FPMA 1UODA 2NU7A 3JWEA 4AJ4A 1U0SY 1E7YA 1GRCA 1AUPA 4Q37A 1P0MA 1Z7BA 4MWEA 1GGNA 2WUEA 3RQSA 1M33A 4B43A 3MRSA 3RDPA 2Q5CA 2PBFA 4DWOA 4TWAA 5C8YB 3SNKA 1C8LA 2AZTA 3ICVA 2AJCA 4KL8S 4OM8A 1BXRA 4BAUA 5HMMA 3SYRA 4FEAA 5KTKA 1WX1A 4MS4A 1PJCA 1D1SA 4FMBB 5TQ0B 4ER6A 3HYLA 1V1RB 4LG1A 3DWFA 3KQSA 4B8WA 4L08A 3PX7A 1ONNA 4GI7A 2Y4OA 3HXTA 2OXTA 2J5BA 1MB2A 3PNPA 3WSTA 1PO7A 1T5OA 4WZ6A 1L7QA 3SHVA 2D1YA 1JZQA 2PUCA 1J6UA 1FVXA 3H2BA 1M34B 3W2GA 1IHXA 4YUAA 1XRSB 3K05A 3WKDA 4CLXA 3RIMA 2RCYA 3ECSA 4B87A 3FGZA 2CL6X 1UCFA 2H1CA 3EFBA 2IBTA 3PEYA 2R7MA 4HUJA 1P0CA 1ZC4A 1YGPA 3CRVA 3HR7A 3JASB 4UHHA 5CAEA 2GXAA 1LPBB 3JVDA 3HUUA 4M9ZA 1OYYA 4E3WA 3SIPA 1WB4A 2HHAA 3WK7A 1PWEA 1ZWKA 2VA9A 4NH4A 4FGJA 4D96A 1DDOA 4OK3A 3ISVA 3P2KA 4KH1A 4Y2XA 2JEZA 2WSMA 5IJZA 1D2HA 1JX6A 3CKKA 3T3HA 1YRLA 1VOTA 5B1EA 2JFUA 2HXGA 4GVPA 2RMKA 1JVBA 3RUIA 4JJAA 2WPDA 3C97A 3BRSA 2JL1A 3A3KA 2Q7OE 4LYEA 5AYVA 5LSAA 3LQ2A 3K3PA 3ZU3A 3TCKA 4R8KA 1XL1A 4ABTA 2GRAA 1ST3A 3OKPA 2J3DA 2B7CA 5FBLB 4W5WA 4KAJA 4C6HA 2G9VA 2C9YA 4GXNA 1XDBA 2HK6A 3AERA 3LGAA 1NUPA 4ILKA 2ARKA 3L0PA 3KT3A 5GMOA 5KNDH 5ED4A 3I64A 4JFAA 2X4DA 3MZ0A 3DV2A 3OFND 4ZU1X 4BYMA 4DIUA 3IT2A 2E82A 5JY6A 3CV3A 3JD2A 4MKXA 2JI4A 1TA4A 1KI1A 5F4BA 4R9SA 2V4ZA 3CKYA 2VJOA 2GERA 4YCBA 1VI5A 5DJ5A 3IDFA 1RWMA 2QNBA 3JYLA 5CU7A 4A03A 1LI5A 4AG6A 2O8EA 3E9CA 3B36A 5K6RA 2AFIE 5FOSA 3UATA 4YP9A 1JG6A 3VH2A 4D3XA 3KAJA 5K20A 3Q3HA 3JD0A 3LG2A 2G80A 5H3LA 4EMBA 5IVKA 3MS2A 3AY3A 3E3LA 1I4EB 3HB9A 3O1JC 5K0NA 4XYEA 2XCQA 2YYYA 2PT5A 2VDNB 2K5UA 1YBFA 3GOQA 3CVOA 3HKEB 4PQRA 3WYEA 1G1MA 4NICA 4NK4A 2FMHA 3BA6A 2VWGA 3CX8A 3NHYA 4TTTS 1Z0SA 4LQCA 3H3JA 1ONBA 1BO6A 2PD4A 1RYNA 2ZBGA 3PXDA 1HDYA 5DTEA 4YLGA 5DP1A 5EP1A 3ZIAD 3NNSA 2O8VA 2C7OA 1OXSC 2WSLA 2NXJA 4NCXA 1C8VB 4R9UC 4V0NA 3RAEC 3H1GA 2R66A 3K0KA 5HXAA 1JDJA 3E05A 4URFA 2RHWA 1RLOA 1X74A 3W34A 2QZJA 2W2PA 4O3MA 2VJBA 3KTOA 2QTVB 2O2DA 1E0KA 4NPHA 1K7SN 2IXDA 2X7HA 3T3NA 5JHGB 3DZCA 1HV8A 1U9ZA 4C0WA 3AR3A 3QEMB 4AMBA 4Q9KA 3DYIA 4K03A 3C70A 4JOSA 5IEBA 3HB4X 4GH5A 4I4CA 1JFSA 1T35A 4B3IA 3CPJB 4XJXA 3FUVA 5T4EA 3LQQA 3Q85A 3NWJA 3WTCA 4BDSA 1E6MA 4X54A 4WXRA 4Q9NA 4QTXA 1E1RD 2HJSA 5TPWB 2ZVQX 3PQEA 4HB0A 2JLXA 5BWLA 1CIVA 2RJ3A 3R0VA 4X66B 4HLQB 5TY0A 2I1VB 1JEDA 3EXHC 3UNXA 4FYPA 1LCIA 1VYUA 2BKAA 2YJNA 1I7DA 1T4GA 2FJ0A 2R8XA 3I8OA 3FUCA 2VP3A 4PHTA 2VAWA 3AETA 3T4UA 2X15A 5F51A 3UWPA 2FZEA 2BMWA 5JXIA 3WWZA 1W6RA 2XE4A 4HUQB 1Z35A 4BV2A 1EVIA 1GZ3A 3IHWA 1M34E 4M0LA 1H4SA 4FZ3A 2A14A 2H54A 4OGLA 4DWVA 2AV6A 1P77A 2ZBDA 4EFKA 3P32A 2ZSBA 3KZXA 3SQMA 3OBBA 2QM7A 1V8OA 4L74A 1J2UA 3JQRA 1BQ3A 1P2VA 5B3AA 3VYTB 1E3WA 5DNUA 4M88A 1FJXA 1WKVA 3OQJA 3MK31 4PG8A 4HWTA 4X71A 4IXWA 2CHQA 3KLBA 4LJ5A 4PX5A 4ZDWA 2FQQA 3LD9A 2WQ7A 1WPQA 3O4VA 2YIDA 1CLEA 4HTFB 4EKEA 4ZQCB 3EN0A 3FGOA 3H13A 1FVOA 3I9V6 1P7CA 2V6MA 2ZW9A 2NSDA 3TD2A 2FSGA 1JAZA 4NCHA 1WL8A 4PAOA 4RELA 4HGOA 3WHKA 2O1XA 4D6PA 4X93A 3JYOA 3TLAA 2C31A 3IBFA 4A91A 1XPUA 4EJSC 2M6SA 1IB0A 4YPVA 1Z07A 3HI6A 5A4AA 3K70D 2CFRA 2G6BA 1ZVJA 3UCFA 3ELDA 1KZ9A 1R4NA 2R3SA 3QI2A 5FLYA 2JIPA 3I12A 4MR8B 1AH2A 3AKCA 1QGDA 3NT4A 1N77A 4C0XA 3NVDA 3RVPA 4ZTZB 3NYRA 3PHIA 3AHDA 4KGZA 4RANA 5DI3B 5TQ0A 4CIWA 3E8SA 4GI1A 3HCDA 4EY7A 2A92A 2AQKA 1PF7E 1YQWA 1WIWA 2KX7A 2WU4A 2ZREA 5LNK6 3SQXA 3TMAA 3HYRA 4D9IA 3WRYC 2GMWA 4L7VA 5CVCA 1M34A 3T9CA 7MHTA 1XQ6A 3NKLA 1S3GA 1XZFA 2C5FA 2ZCUA 2Q3MA 3RS5A 3GT7A 4S1NA 4YMVA 5C4MA 1T5LA 2PE5A 2AS0A 4KQWA 2IUEA 1CUYA 3F3SA 5JOQA 1JMYA 1CVIA 1PT9A 1SCIA 3JASA 4LSGA 4YRFA 1XTTA 2GYWA 4OK5A 3STUA 1WZ2A 3AYZB 4NP6A 1VXRA 2FLVA 2H85A 2V7EA 2ZRGA 2ZWMA 3FDIA 3KTAA 1P0IA 1XMSA 3Q10A 4XYMA 4AZVA 2FFBA 1JTVA 2J32A 1N0IA 2DKFA 3GRAA 4ZO4A 3T7EA 4J2TA 3VI4B 2E4AA 2YHIB 3OCVA 1I36A 3GWGA 3BN3A 1HYEA 1N5RA 3P5SA 2J6CA 3L0OA 4IDHA 4R98A 3HSKA 5CXSA 5EMKA 5TARA 5AVUA 2CY0A 3L4KA 4V0QA 2N75A 1UBRS 1WCXA 4CV3A 4EHBA 2HPAA 4QXAA 3I5YA 1DS6A 3O8LA 4Y9TA 1MPTA 2O7RA 3WZLA 1EK2A 2Z2JA 5ITVA 1CUBA 4E46A 4K3UA 1VKRA 4TUYB 1UOPA 5JVDF 3ND5A 3R0XA 2C54A 4KXQA 4M9XA 5EMHA 1P4RA 5LP6B 2X5OA 1CUWA 2JCGA 1VHWA 5TF0A 2WIJA 1SVNA 2I0FA 1MO4A 3NBUA 4TL7A 3VH4A 5LBIA 1TB4A 4R2HA 4TMWA 5B6JA 4FDUA 1XB2A 1UJCA 2Y6VA 3KYIB 4Q00A 4B1FA 2GZ3A 3Q7QA 1JHPA 4BNMA 3HB1A 3W3ZB 4KHZA 4V02A 3W4IA 4EATA 2XOEA 4MPDA 2B1IA 1I4DD 5JJ5A 1ZO8A 1IUNA 1PK7A 4HGRA 4B3HA 2VHZA 1FFXB 4LRYA 4P3NA 1U1EA 4LW8A 4E12A 5BT9A 1SC6A 2F48A 1H0SA 1Z5GA 3E0QA 4ZHQB 4OMUA 3MJHA 5DBFA 2J41A 1PR2A 2BISA 1R5BA 4G07A 5EGNA 4YXFA 5FL7A 1JU3A 1BIFA 3HKEA 3UWSA 5BRJA 3OFVA 5BN4B 5ISMA 4BX8A 2YV4A 3BM5A 4IRXA 3VVBA 1G8KA 2FN3A 2FWJA 3JQFA 1ZM4A 4TROA 1F14A 5C0OE 1NOJA 3U39A 3VPHA 1WW3A 5T3UA 2I8LA 4BEBA 4MWGA 1SCBA 4R40A 5CHYA 4C4PA 5LL6P 2KHZA 3ZQ6A 3CS3A 3FSGA 4BVAA 1WV0A 4NULA 2C4WA 2Y66A 4OTZA 5WRFA 2NADA 3GYGA 5FOTA 2I76A 2QAGC 2QTVA 1ZOSA 3DD5A 4OHZA 2CE2X 1DZ3A 3F98A 1CWUA 2C07A 3LC7O 4EGSA 4L5AA 3QEMA 5FBWB 2MWMA 1Z2DA 3P0EA 1IIRA 3GCXA 4OL9A 5JALA 1FU4A 3T7JA 3C98A 1QTIA 5K8VA 4IIFA 5IDXA 2Q1XA 1J8DA 1ZXBA 3EPRA 3I1JA 5EA2A 3HY6A 5TPWA 1FMJA 1L7VC 1YNSA 2NV6A 4DSOA 4KMOA 5KQLA 1B4DA 4B81A 4LK3A 1PZNA 1R0YA 4EZIA 2OBBA 2Z3VA 1Z08A 1W29A 2CK3D 1D07A 1Q1QA 2ZJAA 1LF5A 1S8AA 2CJXA 2Q1YA 5I7AA 5JNTA 3TZCA 1P7PA 1VLZA 2N9UA 4KQMA 5DV9A 4ZVOA 3IDZA 3OE7D 4JYCA 5MDHA 3O2JA 4MVJA 5CFLA 4EGCB 5D6NA 1GG5A 1XZHA 2NOAA 3Q3IA 5C8XA 3B60A 5KSWB 4CU2A 4B3TB 1PJ4A 4JSRA 4CEHB 2G5PA 3KZ1E 3FMIA 2UXBB 5SZJA 1ZX1A 1PV1A 5C52B 4FYWA 1BZYA 3CB2A 3QYPA 4NDAA 4WCDA 4BTEA 3SXPA 4QFCA 4Z51A 1JXQA 4EUKA 4YRNA 3UAOA 5M2QA 4E94A 5DE3A 1O9GA 5G4LA 1QZTA 2OWEA 4HBZA 1ESDA 3AHCA 1XZCA 4O5AA 3T61A 2O1EA 5JY1A 2RGYA 2OCKA 2FW8A 1Q0HA 3KPUA 4N0EA 4XB1A 1P8JA 2FX3A 3AWDA 4ZVSA 3T9FA 4HTFA 5A2GA 2FZLA 2X0RA 3ZVLA 3EIWA 1AXRA 2WD9A 5TRTA 1OZ0A 1ORDA 2F9LA 3M33A 4XGQA 4LZOA 1OWLA 4G1UC 5HE9A 4HYTA 3WNQA 3RASA 4HGPA 4EHAA 2ADMA 1X1BA 2I4LA 3INTA 3QMPA 5AHKA 4L7QA 4B80A 5ITWA 1KRHA 1AKRA 4CTNA 4EL5A 5A6SB 1MA0A 2IXBA 3K9WA 2L18A 2FPLA 1E3DA 3CA8A 2XWSA 2QX8A 1T2EA 1YQDA 2XUQA 4R31A 3UT0A 1WQ4A 4MR8A 4HC4A 3UTDA 2JEOA 2X2PA 5LDHA 4QOFA 2VHVA 3N2ZB 4GIBA 2WMNB 5AW5A 3WLPA 1EUQA 4IGEA 2GCEA 2RFLA 2JS7A 3BIJA 4FTWA 4IKPA 5DI3A 3M34A 1A27A 1MRSA 2ZUCA 4W1RA 4ZAVA 3S1AA 4DARA 4NARA 5COBA 5FBHA 5TF4A 2CV2A 1NX6A 2N46A 2KMLA 3FSEA 3I0ZA 5ARDA 3W2EA 4YPFA 5AW4A 3LZDA 4ZCQA 4R9RA 2FDRA 4RPLA 2FQYA 2LZ0A 3QX8A 4G0PA 3TTSA 5KYVA 1AUQA 1JSCA 5IRCD 2PUFA 2I78A 4YUVA 2A4MA 2MJLA 2CLFB 2NVUB 2PGLA 3VPCA 4XGRA 2W6ID 4DMMA 1NYRA 3QHAA 4LMBA 3R7AA 3KUKA 2VA8A 2IPLA 5JW6A 2IV3A 2YV2A 2RSLA 2I29A 3RFFA 1GCGA 3MQ2A 4JD5A 2PLFA 2B8JA 4YIKA 2H4HA 4RTOA 1NVVQ 5FOQA 4K9DA 3VMFA 2Q21A 3RGWS 1RM5A 2CE7A 1KMQA 1Q2UA 1HDRA 1ZD2P 2YHIA 1DC6A 3ADOA 3JVUA 4BLSA 2OY0A 2GZRA 3VO1A 4HEA6 4HATA 1UPAA 3S5UA 4QECA 3D5TA 4Z0NA 4LFBB 1XA3A 3DEFA 4LZAA 4XPIB 1Q7BA 1IXSB 3QA9A 3ELUA 1NDHA 2JDIA 2VRCD 4LYHA 4F3TA 4KRFA 1R00A 4MQFA 1AQYA 4NC9A 2IL1A 3H8JA 1Z5OA 2QXUA 4ZTBA 2Z8YA 4FVTA 3CO5A 1AKQA 3GNTA 2G5CA 2PKYX 4PNEA 3A1NA 5A3RA 3OZVA 1G4HA 4LHSA 4TUYA 3PQ5A 4QSHA 5C5CA 5I4KA 4PN7A 3ERCA 3SX0A 4KMRA 2Q4TA 3QLUA 2IEGA 3KQVA 4RV5A 4XR9A 5LP6A 1N78A 1UOQA 4WXHA 5DWVA 4XWGA 2QX7A 2OO7A 1YJ5A 3QXJA 3V00A 4MHTA 4C87A 4ESHA 1EZ1A 4RACA 3KHSA 3LBYA 4LCJA 5DYGA 1A8UA 3FPBA 2QW0X 3BTOA 1MEJA 3MBOA 3TSCA 4TXHA 2PMFA 4JP3A 1UWCA 1NW6A 4JX8A 4WN9B 2WTUA 1Z68A 3F4KA 4YMUA 4EWLA 1FFXA 3L0CA 4M4SA 1ORHA 3DQPA 1B0AA 5D01A 5EJIA 2HX1A 2RONA 4GT1A 2DVMA 3P1JA 4ZHQA 1E32A 3CF2A 3MPUA 1LBTA 5LKRA 4OFXA 1XT6A 2IEBA 4G1FA 1FSSA 1NYQA 2Q28A 4YC7A 3IQDB 2D8AA 1RCTE 1NUTA 2PX2A 4QD3A 5AKHA 1Q22A 1EUZA 1TTTA 2P5UA 4HAYA 3HM9A 2XIQA 4MQ4A 4R1QA 4EI2A 1FFEA 4DR4B 1RAEA 3OE4A 3O94A 2Q4OA 4FP9A 4TS1A 2H1SA 3PNMA 5DOZA 1VKJA 3HZRA 3JR7A 2DOKA 3SQLA 5G0UA 4ZEOA 3KIPA 3P19A 3WLIA 1G0NA 1QKKA 1ZM9A 1YMQA 3PHGA 4FC6A 4MEAA 3USES 3VR2A 4KPEC 2Z9BA 2ZE5A 2Q27A 4JLBA 2JD0A 4KYIB 1W88B 4K9NA 1WXHA 3JSXA 4R8RA 5CP8A 4G26A 3RV4A 4DNPA 4QTUB 4XSVA 2OVFA 2ZKIA 3VYSB 2Z09A 3ICWA 2PMWB 4QQFA 4JB2A 2ZSDA 4G5RA 4BKUA 2WHRA 4G85A 4P98A 4UHJA 2CXRA 5EJ6A 1TEHA 2XCOA 1DFIA 2GNAA 1VLQA 2BSXA 4ZN6A 5IFLA 3B9QA 1Y8AA 3JD1A 5KJ6A 1U2RA 1B8VA 3L4EA 2WMDA 2JD1A 1IWPB 4POOA 3VSBA 5CA0F 2FF7A 2OZVA 4G65A 1TGYA 1T8UA 1VHJA 1CNEA 5ALKA 1XWWA 3COSA 1V8DA 4QSMA 1QHGA 1TE2A 3ESBA 5KREA 1XQYA 3G5MA 4OHOA 1ZDMA 3SC4A 1EAMA 3U9TA 4U2GA 3W8NA 1VL2A 2PCLA 2G8LA 3FYSA 2XW6A 2BMJA 5JQGF 4RFSA 4KLAA 1WLSA 4FCCA 4CEHA 1F9AA 4HZGA 1N2BA 2VF7A 1ORVA 2PNFA 1E3LA 1VGQA 1PR1A 2O6HA 2WOOA 2XUHA 3FMFA 3PNYA 4FJ2A 4BX2A 5CITA 2F55A 2EKBA 2Y3IA 4UJ3A 3CEAA 3NORA 5DH9A 2OILA 4ZU6X 3SYTA 1ABBA 4QATA 4MKHA 3Q6IA 4RHUA 2CSUA 3A6HA 1T26A 2NU6A 3MD9A 5A02A 1E2DA 4XVUA 4LCBA 4TZKA 3KPJA 3PUWA 2B4KA 1JDUA 3GCWA 1XYYA 2ZI7A 4N0PA 3HA5A 1FUEA 5F5XA 3OE1A 2EQBA 1ZINA 4WW0A 1F6WA 3PLNA 4D9NA 4NDZA 3ZWDA 3JQQA 1MB9A 4K86A 1HBJA 1M2HA 1HDEA 3GGOA 4TGLA 1B14A 4GBED 5HGJA 3VTZA 2IYYA 2WG0A 4YONB 2P41A 4P2BA 2P0YA 1NSYA 3VO2A 2GO7A 3QY0A 1LLCA 1XZNA 4D3YA 4DNXA 1D9ZA 4YREA 2EU8A 2FRXA 1NHWA 1ZGCA 4YYZA 1XVVA 2BHSA 3X43A 5A6SA 1RZRA 4YGYA 3NOXA 4HGQA 4YA6A 4UNNA 2J08A 2CB9A 1SZDA 4GW3A 2EIHA 5B1YA 2VJPA 4G5YA 1PGQA 1VPVA 1S3IA 3A6DA 2QRLA 4GMHA 1K88A 2NTVA 4HPXB 2JASA 4B2IA 4D4LA 4M21A 4MV5A 4NR0A 5CA1B 5TMEA 3H8VA 4RDHA 2AX4A 1T3GA 3NBZC 4AXBA 4DV7B 1CUZA 2Z1NA 1T0PA 3AUSA 1U3CA 3AUXA 3ILYA 3QU4A 4K6MA 1A8IA 2HLDD 5F1YA 2LW7A 1U1FA 2XZOA 2R47A 1QVVA 3GAZA 3B1FA 4HDKB 4J91A 4Z8YA 3D7RA 1LA2A 1UC5B 5B4VA 1YU9A 2B8EA 2VEDA 2ZKLA 3BK1A 2AHOA 1M6HA 4B85A 5FEUA 3RIEA 4JI7B 1DEXA 1KKLA 1RXCA 2OT3B 4JXXA 1DIAA 3R7DA 2F67A 5DHPA 1NRXA 1N4AA 1TYBE 4EUFA 2NVUA 3V4VB 1UBOS 1RKUA 4B7AA 3S1SA 1KAQA 3UJ7A 3QP9A 4GI2A 3U3KA 4ZGGA 2ZAIA 2J9GA 3IBYA 4GOOD 4R84A 1I3CA 3FJ1A 4PZUA 2A5YB 5B4TA 1WJGA 2BM8A 3RK1A 1KJJA 2VC2B 2FPMA 2VP9A 3NATA 2ZB2A 3WDMA 4G0UA 5KJ1A 2Z57A 2EL9A 2QGFA 3WLHA 4DEYA 2CB0A 1CW2B 2YMLA 3BIWA 3L8YA 4UM8B 1CXZA 1U99A 2QP4A 4MUMA 4PSUA 5I47A 2V0GA 1TM3E 2HV9A 4XPIA 3PUVA 4QBGB 5ALYA 4HH3C 3A14A 4ZT5A 2C7QA 3H7AA 1JJFA 3BZBA 4J9VA 4NPCA 3FY4A 5IFKA 4P4GA 1W59A 2C3PA 2CN1A 3H9QA 3DR3A 4IXMA 4PPFA 3FTCA 4UU1A 4TZ0A 1V35A 4TV9F 1I01A 1PG5A 2YWJA 3ORYA 1EK0A 4LQ4A 2I2BA 2JFGA 4MYUA 1G63A 3R3HA 1ZFNA 2IRWA 4IIDA 3WLOA 1S01A 3FNBA 2C2XA 2Z5GA 4RK5A 2ZB8A 4CHGA 4G5OA 4Z3DA 5BORA 2N1BA 4F7WA 3HDJA 4PZLA 2FPPB 4LHEA 3IELA 1F8XA 2GBLA 4OQDA 4UVGA 3QYFA 3EODA 1BGXT 3OC6A 2B94A 3MGKA 4RA9B 2WT9A 1LDBA 3IDQA 3NIGB 5HIJA 3FYDA 3TS1A 4X60A 5KYXB 4WY2A 2ZQZA 1IQRA 1FF9A 1UEIA 1PJTA 4XIYA 1TAHA 2OGWA 1K7YA 2AF3C 4BB6A 3ZDRA 4DY6A 1EUYA 4C5AA 4L5JA 3R6GA 1AHNA 1L5RA 5EVJA 1TU4A 1D5WA 3E2MA 3A58B 1V25A 2QD4A 1YACA 1XTRA 2WJIA 1L7AA 2Q7XA 2XVXA 1NPDA 1ODCA 3KPWA 5E9QA 4P32A 5E8JA 2HLHA 2A94A 2GFHA 3BWXA 4WN3A 3SC2B 5K8UA 1ODIA 2YV5A 4Y1EA 4LXXA 3C0KA 3BIOA 1L4BA 1PK9A 4WEOA 1U2DA 2JJ1A 3THXB 5KYWA 4RMGA 4BV9A 2OYSA 3D4BA 1E8DA 4ESOA 4FFLA 2EG5A 1A9ZA 1Q1NA 1QV9A 4CM4B 1IUKA 1IQPA 2FY8A 4Q4LA 1XTVA 1QOPB 1SKUA 4PQEA 1FDIA 4Q4JA 2PVPA 2RHJA 4WOJA 1JWBB 5L4SA 3QENA 1P3Y1 4R9VA 3VPFA 3L4BA 1W87A 2GJSA 2Q4DA 3BCUA 1V7ZA 1ZL2A 3OHMA 1CNFA 3AW9A 3ZYZA 2HSZA 4KXXA 4MPTA 4DUGD 1IEXA 3AUKA 3GGCA 3GJ0A 2CUTA 4EQ6A 4B6JA 1LSSA 3K5HA 3EPHA 1KP3A 1PE0A 1A9PA 2FOLA 4JUIA 4PSCA 2B69A 5BOVA 3N8DA 5JYEA 2G09A 1KFBB 4WJZA 2HZBA 1E20A 1TNDA 2PAFA 2BM0A 3OPYB 1FJGB 4I5DA 1OC4A 3KR9A 2C95A 1VB3A 5ALNA 3GO4A 4M8SA 3PC2A 3TSZA 2Y77A 4Z7QB 1IY1A 1Q15A 2IXEA 1LQUA 4PFQA 1LFDB 1JPVA 1H2AS 1DKNA 1A69A 3N6XA 3GF4A 3MWJA 2JAOA 1C0EA 4P92A 1EFHA 1BNCA 2Q2NA 3OIWA 3GJYA 1DTWB 3O4FA 5HQJA 4N49A 2VYFA 4RY0A 1WUJS 1QCYA 5BRNA 4FKBA 4J76A 5JBQA 5HVNA 3AVWA 3OJLA 2B35A 2RGEA 2RKBA 4CM6A 4J4HA 1MXFA 2D13A 2FZ4A 2JH9A 2PX4A 5FULA 3W4KA 1VHQA 2GWHA 4GICA 1DAMA 3GD5A 1W4RA 2E18A 2R6AA 3EDRA 4WGGA 5FNZA 4CM3A 1TKAA 4I1OA 1CJCA 3DAHA 4PPNA 1NXTA 1EM8B 4HOYA 3HSYA 4GKVA 3QPWA 3KZOA 1SQSA 3N75A 4JBGA 4TMKA 1R66A 2DWCA 3ZOZA 3O2QB 3CNBA 3GEMA 1ZU5A 3ZD8A 1N0UA 3PDHA 4OKNA 2GS9A 4ZYLA 1UKYA 1QR2A 4GMKA 1DQZA 3WC4A 1MNQA 4DUYB 4JL8A 1C1XA 1E7MA 5A06A 2F90A 1FSZA 3AZOA 1PFQA 2A3RA 3L41A 1UT6A 3JVIA 1WSAA 1P44A 1ZRNA 3IP9A 1FW8A 4NONA 4EABA 1XROA 3QBEA 1HLPA 5CA1A 1IQUA 1KH2A 3DZJA 1CEEA 1D2CA 5ECDA 5NULA 5IDWA 1OAKA 5KTOA 1OFGA 2WI8A 3GWZA 3LX5A 4JH0A 3W5CA 3U1TA 1YZ3A 2GHQA 4IOLA 1N3LA 4DC9A 1NGSA 4HDKA 3W4JA 1VRVA 4LBYA 4KLZA 3E23A 3OZBA 3WGKA 3ZH9B 3E9MA 3GLSA 5ELMA 2ADOA 5J9FA 3CR3C 4DE5A 4PN3A 1CUCA 3EZ6A 7YASA 1TTQB 5AOCA 5FJJA 1GSAA 4CMCA 1PK8A 3E9ZA 2AG8A 1S2NA 5I7UA 3TSOA 3KUUA 3D4PA 3NM4A 2IWHA 5FPHA 4A4DA 1SZJG 4OAPA 4MO9A 1FJ2A 4Y2UA 2V45A 2AN3A 1QGAA 5BNZA 4V2IA 1P4GA 3VKFA 2EG9A 5EOVA 3BSSA 2F59A 4OGGA 2BFFB 3QWFA 4R69A 5A4JA 2ZIVB 3DV0B 2WKSA 4Y6QA 1YVRA 4Y6RA 5CH8A 4F2HA 3EXHB 2EFJA 5DULA 2X1VA 1YR6A 3RPEA 3ROQA 4UTPA 1WXGA 3FN4A 3V6LA 5AVYA 2EX4A 4XA8A 4MIKA 4JV5B 4NU5A 5D85A 1B8UA 4LWPA 4DSTA 1IBKB 4NABA 1M1YB 1RHUA 4A2PA 3NXKA 2OG1A 3D4IA 4G4SO 4JQYA 2QTNA 3A1FA 3OICA 4OYYA 1PYGA 2PX6A 5FUVA 2EF1A 1ICEA 3WXMA 1QE3A 2G71A 3BGSA 5BUQA 1PGNA 2WF6A 2V8OA 4MJ7A 4LV5B 4ODIA 5H81A 2YZKA 5I9BA 4ARCA 4BLQA 2WK1A 2WZQA 1U11A 4X6UA 3NDRA 3FZNA 4CG1A 1DJQA 3CT6A 1QE5A 4OFWA 3ZWMA 2QG6A 1TZKA 2ZQYA 4RA9A 4H4CA 4C4OA 1C0KA 2FG5A 3FUTA 2PZBA 3O93A 3PCXA 2AJTA 3FFAA 3DPSA 3ROEA 3BSYA 4JI0B 3PA8A 3AVYA 3WGMA 5TVKA 4C4YA 5CK5A 4MTLA 3E2IA 5BSRA 1N8SA 4TV8F 3PEUA 4QPPA 3AUJB 3MQFA 1G5RA 4HY3A 4HTAA 5CIQA 4V0OA 1P6XA 3UB2A 1GCIA 1NA5A 4TQ9A 3OHSX 3A11A 1BVUA 2QRHA 3KDSE 3SEFA 3BRCA 1PG0A 3L9XA 3QNWA 3X1MA 2X1HA 4ZCMA 4CKEA 1CUGA 4UQPA 2YMQA 4KSBA 3SC2A 1ELOA 4IDBA 2NT4A 4R1UA 2I4IA 1MHTA 2O6LA 1QSGA 3EXG1 5J2TB 1H23A 2I7VA 3HDGA 3THXA 4ITUA 2EW8A 1U3DA 4PM4A 2I6FA 3N86A 3GPBA 2DBRA 1D1PA 3IO3A 4BWGA 4UFOA 1ADJA 2NU9B 1H05A 1QLHA 3QVUA 2IELA 2A78A 2CL7X 2R44A 3QKIA 4P80A 4WKOA 4YMSA 5EC8A 1BCRB 1DQPA 1C3VA 1J49A 1KA9H 1KDRA 4NU6A 1Y4DE 3NBKA 4OP2A 1VIYA 4HLUC 5DM1A 5F52A 1V9CA 3AOEC 5D86A 1A77A 1RBZA 2OZPA 4NI5A 1DTEA 3SFZA 2P9BA 1PG2A 4RFLA 3ZDCA 3E5MA 4E7PA 1IZ0A 1WXXA 3VPGA 1DCTA 5EJEA 2BD0A 3OE5A 4FYJA 3HXMA 2J0UB 2IS1A 2C04A 2ZTVA 2X40A 4NTZA 5JE8A 2GJ9A 4KWTA 5AJTA 4XSGA 1XV5A 5L3SB 3DM9B 2NZJA 1YRWA 1O95D 5F76A 3OPYA 2ECPA 1E79A 1JG1A 3R9IA 5IABA 2I4OA 4J0GA 4JI5B 5HQTA 2NIPA 2QWXA 3NHRA 2REBA 4TKLA 1USVA 3AQIA 3WBFA 4YT4A 1RAHA 5BV2P 1O7JA 1XJQA 1Y5RA 2X0KA 3R0QA 1TYCA 4N8DA 2YS6A 4QGBA 3TLMA 4TMVA 2WIBA 3V48A 3TFOA 5J5VA 2QKYA 1YO6A 4IHQA 1JG2A 1GTG1 1OU0A 2W2LD 3ITEA 4Y0VA 4XPZA 5BURA 4I3HA 3T4EA 1EQUA 1MXHA 3GELA 1DTWA 3A6KA 3L8DA 4UD2A 4TWZA 3BGWA 4ZTUB 1JQ3A 4B3GA 4G09A 3KWLA 2QD3A 3NM6B 1AKMA 3M1IA 4DJFC 1X86B 3TOSA 4DIKA 3BF8A 1U8EA 5FI0B 2LXNA 1U8XX 2OB1A 5DHSA 2ZRBA 1ESNA 2HFKA 1DMSA 1QJ4A 1GEEA 5EINA 5IWCA 2AOUB 3G88A 5DM70 2C98A 3IQIX 1FLVA 3KJQA 3PBKA 1JHXA 1EM8A 3JQGB 3TQSA 4C7KA 4BFYA 3ZLVA 2XGOA 2W2XA 3B6IA 4BO5A 3M1LA 1MC4A 1A2KC 3LIPA 4K0RA 4Y1RB 3GJ7A 2EWMA 1H3FA 1DRWA 3ABIA 4EGQA 5FOVA 3OT4A 5HZMA 1M1YE 3D2LA 3RBVA 2WMOB 3V8BA 4OFZA 2WM9B 4J1TC 2VHJA 1OBFO 1RZ3A 3IUJA 1IY2A 3ZV5A 4BLTA 4BPRA 4OP1A 5FFMA 3EZ9A 3U7EB 3R8FA 2VHWA 2IHVA 2YOHA 5DHAA 4RDXA 1IM2A 1RYYA 1MO3A 2PGIA 3N9IA 3DTVB 3WISA 4NXMB 1LVHA 2R8EA 3PF8A 3LWBA 2RARA 6ABPA 1FFBA 3BX1A 3KXKA 4LOLA 3FNIA 1S96A 5JADA 3L1HA 5GWXA 4RX1A 3CZ4A 4K9OA 3CGWA 2ZRFA 3WK4A 2FFAA 3MB8A 5AW2A 3DC2A 2GKGA 2Q6KA 3QE9Y 1P0QA 2H9YA 2FK8A 1FQKA 4HSEA 1JLHA 2JCXA 2PPLA 2QAGB 2WHYA 2GD0A 2BCGY 1FYDA 2XZTA 3CLVA 1W5EA 4KDCA 3UZUA 1O0BA 4HFRA 1VE7A 4BKPA 2VAPA 4S24A 1IWOA 1J9EA 5JMTA 2C9OA 2DBZA 3PQDA 1U0RA 4AULA 2JD2A 4FYHA 2V1UA 2ZI4A 3MT7A 4JBWA 1F4VA 3NCTA 3O0TA 5FOUA 2CD7A 4YMIA 4F8EA 1GVNB 1PFVA 4A15A 4UCWA 1SKQA 4U2CA 3SDBA 3TCXB 4FS3A 1R9GA 3M6FA 4CFZA 3T5PA 3EXHA 4NECA 3S8MA 2D4HA 2QYTA 1Q16A 1TO1E 1GPYA 4Y2SA 1ENOA 2VRWA 1CY7A 1PJ8A 1HDIA 4M7PA 4QYWA 3ZU4A 2FN7A 3FH0A 1PZGA 1OXXK 4G5FA 4GQBA 3MGBA 1CY0A 3L84A 5I9TA 3A6ZA 4NBRA 5CCEA 5I45A 1DC3A 1I1HA 1JJIA 1SVKA 1GFSA 1VBKA 1M1YA 1U7OA 1E7QA 2I54A 3KLMX 2PWPA 3F3YA 1N92A 4PWZA 1E5LA 1Z45A 3S2UA 3O21A 1CY4A 1RYFA 2C77A 3LX4A 1QGYA 4HXEB 5AHWA 4RIFA 3KQTA 3VU3A 1HC7A 1TX4B 3QG5A 2QUJA 4ZU3A 1BDIA 1E96A 5HKBA 1KSFX 3UWKA 1PZMA 1CBUA 1N1GA 2RIRA 2XQVA 1KERA 2Z6VA 4R2JA 1FP4B 3N2LA 1C8BA 4H6PA 2WYIA 5CNIA 1NMYA 1CZHA 1N5IA 2GM9A 3BTSA 3V97A 3BCRA 4DJEC 4JOCA 1T1SA 1H9BA 1HT2E 2NTYC 3SFTA 1L4GA 4U2EA 1NMZA 1DBWA 4K8RB 5AW8A 1ITZA 1ZG3A 2D1RA 2JAWA 2AVDA 4DMLA 1PT7A 5KYNA 1GPJA 2JGEA 4URYR 1EFRA 1TVMA 2DY0A 5HOQA 3F2IA 4B4KA 3PKIA 2P4HX 2ZRIA 3LQ4A 3G8YA 2BYTA 4TTJA 4M0UA 2O14A 1MTOA 3A70A 5I8PA 4ND1A 1GAJA 3SR3A 1WDWB 4ZO8A 3ZTTA 1KU6A 1RQPA 1GRQA 1U9IC 2W0MA 3U31A 4EJSA 1EXVA 3T7SA 4D9BA 4DR7B 2DWUA 1D0VA 2QM3A 2NXNA 2CYBA 3GT3A 3PYLA 4ZI3A 1JDBC 4XDHA 2WPNA 3W8RA 2F3QA 1QHHB 3X44A 1OIXA 4MJLA 4Q9DA 3W77A 1PR5A 1RTTA 1TJYA 1D6SA 2HBYA 3JZDA 2ZUUA 4IVPA 4L3OA 1JYSA 3GJTA 2IHJA 4PS1A 4R0MA 2NU9A 3R0JA 2E89A 3G2LA 3I8XA 5E0OA 1M8JA 3KKMA 3QUTA 5JNSA 4A0FA 2R68A 1BCRA 2AF4C 2J07A 3EBOA 4TVSA 3ADCA 3WRYA 1D0IA 1GFWA 3ZUGA 3L6EA 4YAOA 1F7VA 3OSUA 5CYOA 3QGMA 2DUWA 3LQRA 1E6WA 5JXGA 3HXLA 4GQAA 4W6QA 1QS0A 5AW9A 2V74B 3EK2A 3RNOA 3U6KA 2J0UA 3RUDA 3F6BX 1O8BA 3FCEA 3R0ZA 3KWJA 1EX9A 1ISHA 1DQSA 4BFTA 3OPVA 4BNNA 3VGPA 3PWKA 3N59A 1GZ7A 5JD4A 1U02A 3H5TA 5L3SA 1CS0A 4MDEA 2BMFA 1RXWA 1C2YA 2CVPA 2K7ZA 2AUMA 5IJAA 2YVAA 4ZGBA 5CNJA 1W9MA 5EHNA 4I1SA 1O94C 4B4UA 1NSFA 2KBEA 2OPBA 5DGHA 2IDJA 1XRNA 4BB0A 4M76B 3VHRA 2VHQA 5JIBA 5KIAA 4OXIA 4Z1MA 3C8ZA 1O0CA 1GNPA 2O7NA 5EWMB 4J7XA 3DL0A 1O4VA 4IW3B 4CR8A 1TD9A 1C14A 1V4VA 5GV7A 4BN0A 1G2OA 2B37A 3A1SA 3EOZA 2XUIA 5FI5A 3N2GB 4F6CA 1R4AA 2GETA 3UGTA 2AXNA 4MGZR 4IJWA 4BNLA 4HLCA 3UMCA 3KAQA 1ODFA 1G42A 2AN5A 4M0CA 1UMBB 2RAFA 3USCS 2ZWOA 1ECPA 1COWD 4I50F 1QHIA 1TUIA 2HMTA 3TXAA 1T8RA 3G8AA 5F3WB 2GLTA 2GF9A 3O0DA 8GPBA 1JFRA 2F2TA 2HYIC 3GC6A 3IYLW 3FMPB 2EWWA 4Q21A 2AOUA 1AOXA 1IXRC 1U5CA 1Y4SA 3BMNB 3JQGA 4IUYA 2X0FA 1NI5A 4ZCTA 5AESA 1P5JA 4FEYA 5I01A 1ICIA 4AI6A 3HVKA 3IPCA 3FCXA 3KVVA 4TL9A 1S2LA 3MCWA 3PC7A 2HPZA 3UJ9A 4E3ZA 1JH8A 3RG2A 3KUDA 1CB7A 3D31A 4PZDA 5HJ2A 1EB9A 2J6IA 2QN7A 1V5FA 2Y27A 2J45A 3NBXX 4FQ5A 3STYA 4X64B 1JN0A 1U0FA 2VYND 4XLLA 2GJ4A 4EPYA 2BJWA 2PLWA 2YW9A 1TM5E 2Z5FA 2GDZA 5T3YA 4D3SA 4UBIA 4BEJA 1JUDA 3MCAA 9MHTA 4GZLA 2ONJA 1VYHA 2XAUA 2V58A 3II6X 5K1ZA 1EFTA 4DHEA 1H1DA 1XG5A 1E94E 1X38A 3DTVA 4KQ6A 1MZVA 4I14A 1PS8A 3EJ6A 3JWIA 4QRDA 5LA6A 3UCEA 4CLHA 4AUNA 1B3RA 2YC2C 2O5CA 3IJEB 1K7CA 2QTFA 2D4AA 2I6UA 3L5KA 3UWOA 3PJRA 5SY9A 3B3JA 2BBWA 3VZSA 2ZAMA 1V6AA 2PL5A 3TECE 1Y4ZA 2DQKA 1SG0A 2C9BA 3GMDA 5BR8B 4YJDA 2NP7A 1KO4A 2XDWA 2X9VA 2YWRA 4YP7A 4CKXA 2QAGA 3WIDA 3F3MA 2HXSA 3RSLA 5FR2A 3EVCA 3NANA 3ZJ5A 4MX8A 4IUBS 3BFXA 2WOJA 5F7XA 1NKSA 2CHFA 1C0IA 4QJ4A 4RY8A 1KQOA 4ZCRA 2VLIA 2YV3A 5KZMB 3E3AA 4RY2A 2A86A 2XRMA 2QN2A 4HH1A 4NCJA 2PNJA 2QPOA 3MJTA 4P81A 1T8TA 1GZHB 1AZLA 3BGOS 1Z2CA 3L1UA 3PE4A 4CF3A 1A97A 3DAPA 3GFVA 4EB0A 2BFMA 3QHPA 2F00A 4R7ZA 1ECFA 3H83A 1Z6QA 3U4AA 2ZIWB 2WF7A 1T8WA 3PRKE 1XJ5A 2Y1GA 3VMMA 3DCJA 2H7YA 2QR5A 4FX2A 3DTYA 2GZHA 2H6EA 3HWSA 4ZV4A 3NC0C 2P2YA 3D7MA 3GRKA 4URHA 5I8ZA 1V3QE 1V5GA 4AUKA 4E1VA 3AY7A 3OIGA 1AKEA 1DKUA 2P27A 4O2AF 1FFCA 1QP7A 2NO7A 5EHGA 2C78A 1RKQA 2O05A 2NZ2A 5LQUA 1LNQA 3IQXA 1K8XB 5JANA 2YJ5A 1TM4E 2YC4C 2OCAA 3B3GA 3IQZA 5CHEA 1FP4A 3I04A 3OP4A 4BAZA 2PVSA 1WNFA 3ETEA 4DTIA 1E3QA 3O4GA 3ZCPA 1G3IA 4BECA 2JAUA 1L8QA 2GI4A 1SHJA 5KHOC 2E5FA 5FAXA 3LUPA 4OHUA 4CN9A 1A8SA 5C8ZA 1G2IA 2XDQB 3OOHA 1HE5A 3JRXA 4MGEA 3U44B 5CYFA 3OQ1A 1XMQB 5A62A 2Q2WA 2Z9CA 3F8WA 5DNAA 5IVIA 3T1NA 4PE5B 1HKUA 1WULS 3F74A 4NY1A 1TADA 1KEWA 2GKOA 2QRNA 3G2NA 2B83A 4OXRA 5K7SA 2VYVA 1SHUX 5ICFA 3REFA 3ZVMA 2VK8A 4C4ZA 1KAGA 3SEZA 3KU4A 1KSJA 3GFFA 1XJCA 1G2QA 2VOEA 4DIEA 4F5YA 2X5KO 4CZ2A 2Z6AA 4DSAA 1E3IA 4KG7A 4B3MB 1FZQA 5B64A 1KI6A 1RBMA 3CW9A 1IWBB 5HBRA 2YXLA 4PANA 3T3MB 1BSVA 2HH9A 1MJHA 2YOFA 4DWWA 1YFLA 2J0QA 2XB4A 2OBXA 1ZD9A 3KT8A 1IAQA 2ZR8A 1HYGA 3OURA 2QLLA 3BIFA 4Q9LA 2FPKA 4ENVA 1EE1A 4IQFA 2QAIA 3C7AA 2D1FA 3PFCA 3RS9A 3W2TA 2XCIA 3ZIDA 2I03A 2WD7B 2AHRA 3KLOA 3QX9A 4TYPA 5C4GB 2AMVA 4BMZA 1L8AA 4K9MA 1CTQA 1OZFA 2BI8A 3QPCA 5KO2A 2GAFA 4C7JA 1U7PA 1H22A 3ONVA 1QWOA 2GM5A 4KO1S 4JYAB 4R81A 1RMTA 1VJTA 2AR9A 2P9EA 1WP4A 1THGA 2WNHA 3GCDA 1R0LA 4YJ2B 1NNI1 5P21A 4JI6B 3VZBA 5DN6D 3ID6C 4NE7A 2R2AA 1Y3AA 1RYZA 1DQRA 1UPTA 4HLDA 1KWGA 2FXIA 1Q1AA 4OV6B 4BVKA 1JQ5A 4M60A 4Q6BA 4FGSA 3ETLA 3GRFA 4AY5A 5AKYA 1WPRA 2A5FA 1J7JA 1PDWA 1K66A 4KQ1A 4ZA2A 3U7IA 2W9XA 3LW7A 1ZESA 5JNRA 4LQDA 1H8HD 3OFJA 2AQIA 1VLLA 1U7WA 1KO1A 4ZZ0A 3VDRA 5ADVA 5K3DA 5A05A 3QVOA 4F06A 5KOJA 5L8VA 1P3JA 2LDXA 3GLVA 2I80A 4FOOA 3IJ5A 4RGQA 4LJAA 5EWMA 4FN4A 3V2UA 1EUDB 2BRUA 2MSCB 5JTUA 5KNLA 3O8OB 2FMKA 5ALGA 4JA2A 4UHEA 2CCGA 1NY6A 1OR8A 3DVQX 4HWGA 2QJFA 3H1BA 3N2GA 4WECA 1C3OB 1SZCA 3ABQB 4R9NA 1RMYA 2V7QA 4QG3A 3LP8A 3KQNA 4OA8A 1RWPA 1UMBA 4N5MA 1ODTC 4X8LA 3T9DA 5D2CA 4ENRA 5HJ5A 1BFDA 1L7BA 1UR5A 1Z4LA 4FMCB 1IN7A 1Z7WA 2XUJA 5CM9C 5CVEA 1FDTA 2O4UX 4LY0A 2OHFA 2V9ZA 4H7EA 2CDNA 3UKJA 3BMNA 2IIVA 4KQXA 3WG9A 1ZHHA 5D3QA 4FCVA 1DG3A 3Q8WA 2F3UA 2QMEA 1S7GA 3L79A 1QKIA 1XMOB 2Y1KA 3D2AA 4U9HS 2QSUA 1KKUA 2G77B 2VSQA 1GXSB 3COYA 2IV7A 3QX7A 5EL0A 3E3NA 5EFZA 5BXYA 3DPIA 2PX5A 3KKZA 3P7MA 3R4CA 4X1YB 3O8CA 4L5BA 4MUYA 4ZVVA 3X2SA 3BRWD 3TIIA 3RBXA 5M3BA 3HKCA 3RAPR 1EVJA 1QYWA 5AW7A 2HRDA 2DUUA 4J4BA 4RHTA 4TMYA 3RWMB 1RC8A 4YAUA 1M2OA 4EB3A 1PHPA 3A3NA 4ALJA 3HNRA 4P08A 3OPMA 3ZY4A 3A6FA 3LQKA 3ZCVA 2AZDA 3QLEA 1ZU4A 2HJHA 3OQOA 1KDOA 1LDNA 4C21A 2FGKA 3VJMA 3VAAA 1RM0A 1GNRA 2CXHA 1DBPA 1G0OA 1HWYA 3LC0A 5K2OA 2P6NA 1MP0A 1H4VB 3TRFA 1EWYA 3FKSA 3FROA 4D82A 1FTYA 3STVA 2QR2A 2ZYAA 4MP6A 4ZT3A 1MAVA 4Q02A 4ALIA 1K8RA 1P62B 5CT4A 3VHQA 2ATIA 5TEWA 2C7PA 3C3XA 3TMKA 3ROKA 1ULZA 1W2GA 4DLPA 4F12A 2NSHA 4RXTA 3T5CA 3TD9A 2ZJYA 4EI9A 1YNOA 1HTWA 2AC7A 2R6HA 3D8HA 1TO2E 1R6AA 4D57A 4FS8A 5AI9A 1FJHA 4L0MA 2Y9PB 1RKVA 3IPLA 3QWAA 3Q8KA 1WW2A 2EBFX 4NRDA 3ZX4A 1Q3HA 521PA 1X0VA 3I30X 3VVMA 1QAOA 3VC2A 1I3LA 3BQNB 1CR6A 3H4TA 1M0WA 5IW8A 4OQMA 2Q2QA 4UTZA 4XGKA 3LK7A 2VBGA 4IG9A 4MDFA 1E4VA 1UM8A 1B0ZA 1PQ4A 3ND8A 4FFBB 4E22A 2IJGX 4WBNF 1GQOA 2IEIA 4KXLA 5EZQA 1M2NA 3SJCA 2QTBA 3ZK7A 4PZAA 1C2TA 3MHTA 1MW8X 5G40A 4Q01A 5DSTA 4N65A 2VK1A 2JGNA 3M81A 2QEQA 1DC5A 4QODA 1V71A 2X77A 1ABEA 4JCOA 1W25A 4W5RA 4P3XA 5FOWA 1JH9A 2HIMA 4GXTA 1PZFA 1SPXA 3DF9A 2QSJA 1NAHA 1UWKA 1W4ZA 1HR0B 4DCCA 1CZNA 2XDQA 3CEPB 3JQCA 4KR9A 4YAIA 3U44A 2HA6A 4MQLA 4NBUA 1AHIA 2MYUA 3F5FA 4GRIA 2WU8A 4H27A 1UBNA 2IKSA 1KOJA 4YRLA 1R0CA 5FLXA 5EHIA 2G8NA 3KO8A 4XWOA 1IY9A 3ESRA 2DFKB 4JB3A 4XJTA 4P3OA 3O7MA 1NN0A 4LIPD 1GIAA 3Q12A 2Q3FA 2I2CA 3UVEA 1IG3A 3QW4B 2P9GA 5ALTA 5TMPA 4S0ZA 4GM0A 4WK0B 3T0IA 5J47A 2CMGA 1C5KA 1E0DA 3HRKA 3ZWBA 2ZDHA 5H83A 3TLEA 2GEDA 1ZN7A 3ISJA 2B1JA 4EKIA 5K4GA 3NP7A 1ORRA 3JPYA 1FU8A 2XNCA 3WMGA 2N3ZA 4DADA 1I6WA 2HMYB 1OKKD 3ST7A 3Q40A 2WD7A 3PFIA 2COUA 1FUKA 2VT6A 4IYRA 3RSOA 4FNMA 5C1PA 3GGSA 4YGXB 4ALNA 2BFBA 3SE0A 2FZWA 4EDFA 4L5IA 3CSUA 5TQ2B 3UAGA 5L7TA 3ENZA 4EK9A 1JZSA 4D9JA 1PWYE 1E0AA 5L40A 5K2MA 1CUDA 1R9JA 4YI5A 3FF1A 3VX3A 4YI3A 1D03A 5DX1A 4FE4A 3M6XA 1DUIA 1RJ9B 2NZ8A 2QLBA 2XY4A 2Y71A 4UTOA 1K08A 1AY0A 3KE8A 1CR0A 1T13A 1YKGA 1KS2A 5JDCC 4EELA 3JSAA 4GS5A 1RLIA 3HRIA 2PQ2A 3MVEA 4ZCLA 2ECQA 4AZ0B 3OF3A 4GOJA 4X44A 3VR6A 2C5BA 3I5XA 1YBVA 3MJRA 3ZEAA 1W9HA 5BQ3A 3F7OA 2UU9B 1MBZA 1DCFA 2WIAA 5A7HA 3R6WA 4AVYA 1JKFA 4LGMA 5K3FB 4GEGA 1S0UA 3PXXA 1EUDA 3EUWA 3TRJA 4QNMA 3KZCA 3O8OA 1V9SA 1IM8A 3BAZA 1GL9B 4W5NA 2B2NA 1IHDA 3OKFA 3ITNA 4MGKR 1C3OA 1ENZA 1KK3A 1QMGA 1XMVA 1FTQA 1GNTA 2VUSA 3CRNA 4W1SA 4C0KA 3RR2A 5DHTA 4J07A 4TSKA 4YCAA 2PUTA 2YN0A 1D1TA 3IO5A 5LZ8A 1MVLA 5TSDA 4OK6A 3SVZA 3MJDA 4HNUA 4FYKA 4EZEA 4FK8A 3I2HA 2OXRA 1RJGA 2C88A 3L8MA 3Q87B 3AKZA 2O8DA 2YCBA 1G17A 3MWGA 4LJ9A 4CCWA 5GGYA 2OBYA 4Y9UA 3OT5A 2VQSA 1Q0QA 3M6VA 2ZBEA 3CCFA 5AI5A 5IULC 3NUZA 2XB6A 5MHTA 4OBEA 4RWEA 4B6SA 3PT9A 2QYOA 4DNFA 3S8YA 3TG8A 2Z5VA 4OX9B 5GJVC 1AGRA 4X1YA 3T9AA 4IINA 5CLJA 4UAGA 4N3BA 1UKEA 3P20A 2R79A 2PBRA 2YNMC 3CURA 5A03A 3VR4A 3I83A 2CVOA 5C80A 2BUBA 1C1YA 4K2AA 1UDAA 3KOYA 5I7FA 5GVRA 5HOEA 1V95A 5A4IS 4YYEA 4MQ6A 3QKUA 4OQZA 4YXWD 4V2UA 1NATA 4LECA 2AN1A 4OH1A 2A1UB 4Y0NA 2MSWA 2XKAA 3WNZA 5KMGB 2IDMA 2AN9A 3U49A 3PTLA 3L6BA 1F8YA 1LSJA 1KK0A 2BGGA 2ZZNA 1AT1A 2E4WA 3D4NA 4ISCA 1GU0A 3NTRA 3T7KA 3TNYA 4F6RB 4QFDA 2CXPA 3L93A 4Y98A 1DX4A 3CZPA 3OQPA 3H16A 2C7GA 1M2GA 4A0HA 1PWZA 2NP6A 5A7FA 1T5TA 4ZHSA 4B3RB 3GLUA 3HUEA 2XE8A 4RZUA 1AQIA 1CD5A 1DXHA 1IEWA 2HO4A 3EGXB 4TRJA 421PA 5KHLB 1NIJA 2NLOA 1VHDA 2YRWA 1ST2A 3HVUA 3L7AA 4JC8A 2C2MA 4KDFA 3UOWA 3VHXA 3DP7A 3K6JA 1Y3IA 3OCWA 5LD2C 2CBZA 3ASUA 1E18A 2RH4A 5DGXA 3SS7X 5EEGA 3ZGVA 3QNUA 3AM5A 5JCJD 1GNSA 4IKOA 3KYDB 3NS7A 4RU1A 3ZWCA 1QPZA 4ZGWA 3CE9A 5FWXA 1JHAA 1ORTA 2XF8A 5CX1B 1JECA 2QHXA 2F17A 2JFYA 2Q3BA 1X2BA 1V8PA 4C5BA 3P5BA 4X1OA 4LF4B 5J1SB 5LYJF 4BOYA 4CFYA 1B2RA 4CV1A 1T2DA 2FWBA 5EP4A 4KDEA 4NEHB 1CRPA 4FFBA 3HCBA 4FNGA 3N7UA 1AZWA 4KFRA 3PJGA 4J9UE 4RMNA 2BR5A 2XBLA 1SURA 3BRQA 2C1EA 3RF6A 1UKZA 2H0AA 5C9ZA 4LBWA 3S2IA 4IDDA 4K8OA 1IZ8A 5G0SA 3FPHA 1DAIA 1U0OC 2UYGA 3LQFA 1C7QA 5EIWA 4AQDA 4ARUA 2EBUA 3IHKA 3QSGA 4EJFA 2MCFA 3M5WA 5M7EA 3HVRA 3GZ4A 1LJ8A 2QM0A 2AGVA 2XECA 1ZJZA 2EJTA 2XE7A 1T36B 3OU7A 4H08A 4H17A 3TAHA 3UYLA 1ZW1A 3DEHA 5TT0A 4I4TB 4RW0A 1TLFA 1GYPA 4OBBA 5I7EA 4QU5A 3ND9A 4PNPA 2JW5A 3CWCA 3TI7A 1NU8A 5EJGA 4BVEA 4EHKA 4Y2HA 2R7NA 4P35A 1NT4A 2DFVA 2FR8C 1Y8QB 4ND6A 3UK6A 4E03A 1GZUA 2WYWA 2HQOA 4HG2A 3M7IA 1W73A 4Q4AA 4F56A 2P2CA 1DBSA 1DO2A 3SKXA 1LLDA 2HB6A 1ACLA 2Q3CA 4M53A 3NRCA 3EUAA 4ZXFA 3UQYS 1JLSA 1NN5A 2RHBA 2O19A 1WF3A 3C16C 2ZK7A 1GKLA 4BQEA 4F5WA 2WTEA 5H3CA 3L8EA 1JHMA 3RC9A 4QU9A 1NRIA 1GPBA 4LE0A 1UJBA 1KZ6A 6LDHA 3ELBA 4CT4B 2I2FA 1XTSA 4HQOA 2QP9X 3PDCA 1ISIA 1SD1A 2C4TA 3IIMA 3FDZB 4UCQA 4XSHA 4B3BA 5KINB 2X8BA 4RO0A 4EPTA 2IGBA 4IXDA 1ZM2A 2MU1A 5ETJA 4EEKA 3RTCA 1TYEB 2WAYA 1E64A 1EWRA 1EVZA 4QUAA 3RYFB 3UJ3X 4HAZA 5T64A 3M9XA 1FFDA 3C5WP 2VG8A 2OSVA 5AKGA 2F8LA 2A58A 4ML3A 4CMKA 4CWAA 4GLBA 3DCYA 3B12A 3O4HA 3FLBA 2HFJA 1SR8A 1ZD4A 4PZ0A 1ECBA 3ZHYA 1RJ9A 4P3KA 3H9BA 1E58A 4D79A 1CK4A 2LV8A 1XU7A 5CD1A 3QEKA 3AB8A 2R00C 1Q77A 1QIFA 3NO4A 4OHRA 2NM0A 2QN9A 4AZ0A 5EPOA 2RJNA 4WKNA 4D92A 1MOQA 3K5WA 3NYWA 5A9TA 4M7OA 2W2MA 1NUQA 3D59A 4JUFA 1GUAA 2WP8J 1R8SA 3E7XA 4LBZA 1ZVQA 2VPIA 4TXJA 5K3FA 2XUPA 2VLBA 1T9GR 2HIAA 5ITSA 3IDAA 2QUHA 1SUSA 3WFJA 4BBAA 2KW5A 1SY7A 4JASB 4OD0A 4EOGA 1D4OA 2PN1A 1SCJA 3HBMA 5GY7A 4YP6A 4RVOA 1FDOA 3HBLA 5K05A 5LKAA 4I6EA 2I34A 3WNBA 4QQRA 4FGLA 4WXYB 1H2EA 2P2SA 3TW4A 3A0RB 2M32A 1T9BA 3WMEA 5HIAA 5HSGA 1GT6A 3DQZA 3G2KA 4YCDA 3KYJB 3CN7A 2OMKA 2XE6A 4UKDA 3TPZA 1JIJA 1SWWA 2BM9A 2Z2ZA 2D5LA 2X1MA 2W42A 3I9V1 1T9CA 3F4LA 3C41J 3IQEA 1KAEA 4R3WA 4ON9A 3CPSA 4LGCA 3ZK9A 2FZGA 2RK4A 1CRLA 4KQIA 4YAWA 4EJ2A 2LCIA 1QQ6A 3WLFA 4P93A 4RFVA 2EERA 4UUNA 1NZFA 2QSZA 4X7BA 1MIOB 2VUHB 3SOPA 3VU1A 5GP1A 2DFDA 1QK5A 4GPD1 4EP1A 2D5AA 2HDNB 2IYXA 3S4YA 1B2LA 1G2PA 4MLPA 2QM8A 3RVNA 1G41A 1U0HC 2G06A 1K5DA 2NPIA 1LBQA 4LV8B 3W1VA 2VUIB 3PNVA 1YIAA 4RD2A 4ZO7A 3ZH2A 4COOA 3WLKX 4CUZA 3QLJA 3TBFA 2D2IA 2FRVA 2OORC 1JDBB 1WNTA 3M49A 4EEZA 1R18A 5I9IA 3K8QA 2A1UA 5KMGA 3THYB 3ZDBA 2WFMA 5HM8A 4M54A 2F8SA 4S35A 4AIRA 5JBNA 3W8EA 1XDGA 1FS4A 2W93A 3RBZA 3NTVA 4RSRA 1H9AA 2JH3A 1XMJA 2IHYA 4BFXA 2UUPA 3TLBA 2A9FA 2HSWA 4MKIA 5DO9A 4DCPA 4HQ6A 5DGDA 1F12A 1J33A 4HLUA 3IKMB 2ZI9A 3AOEA 1QB7A 1YUMA 1GOTA 1A8QA 2V6FA 4WZZA 2FMXA 3ICQB 4ZP1A 2VPQA 1NXVA 2IHZA 1JT2A 1X87A 4HVLA 3EGXA 1YB7A 1ZK3A 2VO1A 2X9QA 3LC1O 3WQQA 5A5GA 5A0TA 1OF1A 1FDSA 2MR6A 5DHQA 4B5LA 1OFVA 4P54A 4P7BA 4ZYWA 3ZDAA 2IPMA 1QIEA 1V4BA 5B4UA 5KPJA 2VAVA 4P22A 3L7DA 4M89A 4WWHA 5U1PA 3WGVA 5DNDA 2RG1A 3CVYA 3R3VA 3FCSB 2HF8A 1LV7A 5HK8A 1NVDA 3KYDA 1LJLA 2OA0A 1E4EB 1U7UA 1V7PC 1ZWLA 5TEVA 3A9CA 1QBGA 2I5PO 4J0IA 1J22A 1GCAA 5CX1A 1E9CA 2BFDA 2WTXA 3MWYW 4HZIA 4JOBA 4RCZA 5EIEA 4DOMA 1P31A 3L4SO 4S1PA 2OV2A 4A5OA 4AMYA 3PENA 5KEIA 1JFTA 1F20A 3SHQA 4GU5A 2PD3A 3LRPA 4EFLA 1GPAA 1QGED 1TZMA 3UHAA 3UV6A 4EVRA 2QN8A 5KQSA 2R0QC 1PKXA 4E2XA 3NIDB 2VHYA 5IMBA 2YHAA 4WNIA 4LRTB 3TRKA 1E1LA 2IYSA 3UXEA 1XZDA 1FY2A 3CN9A 4IKEA 2K2WA 3AQ4A 4Z0HO 4N18A 4WXPA 1G5PA 3WGJA 4C20A 1P60A 4XQ0A 3CH5A 3GRRA 2CNOA 4TS3A 4DJAA 1NN1A 4PGAA 1NG9A 3P45A 1JS1X 4HWRA 3PQ8A 4I4TA 1BKSB 3VR5A 1CJVC 1BHSA 3MELA 4LC9A 4B76A 3D1LA 4E4TA 3VC7A 5A6VA 3CNQS 3UC9A 3H97A 1BEZA 2VIIA 3NV9A 3INRA 1VIVA 4MAFA 5ALJA 4EENA 3FTNA 4QDTA 3U7FB 3R9XA 4XWAA 1Y8QA 2WKQA 3AFOA 3Q9LA 4X92A 1XRQA 3M89A 3O38A 4U63A 4J1TA 2PBLA 4DMKA 3VX4A 4E88A 3I61A 4EMUA 2XI4A 2L2QA 1VLMA 2GAIA 4FZJA 3PXEA 1I5OA 4NG5A 1J9GA 4L3VA 1QUEA 3WVNA 4B3CA 4GPAA 4CLOB 4EIWA 3C6MA 3W6NA 1AJEA 4UNQA 1H3NA 1O08A 1UDWA 1ULTA 2FMIA 2QS9A 3D6NB 2VAXA 3OHPA 4MWBA 4AMUA 4ZVUA 3FDZA 3LP5A 1K89A 1GT91 5B37A 4F97A 1R6BX 4V39A 5CXXA 1GA4A 5AW6A 4HGNA 1O58A 1ZMXA 4GOKA 3DVSX 1VCMA 3FWYA 3GT0A 3O8DA 2B98A 2HMSA 2H2FA 1EBUA 3BEDA 3NI2A 3RYFA 3S55A 2HA7A 1QM5A 2GJKA 1UPUA 4OVKA 4S1VA 2RD2A 2DT8A 3KPYA 4Z4GA 4F0JA 3TB4A 1MG5A 3TQQA 4RTNA 3GG9A 1FFGA 2O2JA 2DWOA 2XYRA 1VDMA 1X19A 2PKEA 4B8ZA 2AEEA 2FDXA 4K1XA 4ZDJA 1D6NA 3E7PA 3B6JA 2X6QA 4TTPA 4CDNA 1UIRA 4JMPA 4K9LA 1L3BA 3C3MA 2YHBA 5CK4A 3UK7A 4BP3A 1OASA 4O63O 4QPJC 4G4IA 1IMJA 4E14A 4F8JA 2FEXA 4EY6A 3EMKA 4UEWA 4ED9A 2ZLBA 3RKUA 4XRGA 4GBGA 2CHGA 1CCWA 3I9MA 4LAFA 2Y1WA 2H7XA 3HI4A 1JIKA 4YO7A 2FEWB 4RDCA 3N58A 3LYLA 3IB3A 4OCZA 4QOIA 1NDUA 4DFDA 1OLXA 2RGUA 3M4YA 1P4SA 4PSKA 4Y3UA 2O0LA 2X14A 3LXXA 1U2TA 4AP6A 3EXG2 1GYQA 3GR6A 1H0RA 4EG1A 1ZJJA 3CRZA 4P5PA 2RC5A 1F4LA 3GBPA 1YDGA 3HLTA 3FOFC 4IO1A 3HVJA 1PZHA 4U7TB 2WAOA 4KYVA 1FUIA 1UKCA 3Q8LA 3T38A 1VJ0A 2J3KA 4NHOA 1ONPA 1PBNA 4O2LA 3JWPA 5BMVA 3T5AA 4N7MA 1EESA 5AUOB 3U61B 1D1QA 1WF6A 1J8FA 2GCIA 2CLSA 3DW1X 1EAYA 1JSLA 2GPNA 1AGPA 3R5SA 4QBKA 4G3XA 4UUBA 3SPXA 1MX3A 3EWSA 3CZCA 2VSXA 4BGVA 2ZCVA 2ZYVX 1RBQA 2FB9A 4IMIB 2AR0A 3BWDD 4UU7A 1Y5NA 4Z7NB 1OH5A 1SUAA 4GE3A 1FYXA 1MC8A 2UDPA 4FSHA 4OXQA 2XWQA 1L5KA 2QRPA 3ZWXA 1O0SA 3OVMA 1C1DB 1U9IA 5HJ7A 1AO0A 1DWOA 3R5TA 1HOXA 5ILQA 4QU0A 3CUTA 5IDQA 3ZNPA 3MN1A 1OLOA 1PSDA 1IK6A 1RYDA 4JLNA 3THYA 4IIGA 3DDOA 4DA6A 3NHKA 2EBHX 4MI3A 4HNSA 1FYFA 1L5FA 3RKRA 2H29A 4XUEA 1TC1A 1IVNA 3ZD7A 1JKJB 3QK7A 4J3NA 1PT6A 3RW9A 2AK2A 3GIWA 4FOSA 1BVHA 4M49A 3O74A 4KB5A 4AWAA 2JKYA 2EP5A 1RJDA 3Q3GE 4QYMA 4OSEA 4AWXA 1YS6A 5FPTA 5ALHA 4BRUA 2Y8EA 3HCCA 2QT1A 3WL6A 4OJQA 1G3UA 5EWLB 1U8UA 1JNYA 2J48A 1GR1A 4WD3A 2GXUA 2NT3A 2OQIA 1ZN9A 5K3OA 3IOCA 4ZC1A 2CWWA 4CQJA 4CKCB 2PO5A 1JR3A 1LBHA 5KOHB 3E22B 1J7KA 2JJQA 5TLSA 3ND7A 3LDAA 2Q6LA 2SHKA 3P26A 1XR3A 2V97A 3R0IA 4J8PA 2IQ5A 3SYKA 4DLSA 3AEXA 4H7JA 3WMXA 1O94A 2B61A 1WD5A 2C99A 1A96A 4BRSA 2FCRA 1N9KA 2D5BA 4OMDA 5CB0A 4G36A 5ADWA 3GL9A 1FSPA 3EZ7A 1IJEA 1IMOA 4M0DA 3CHYA 4TKUA 2HN9A 5CGQB 3RWBA 5I4BA 1QDEA 1F51E 1XAHA 1ZUD1 2BHTA 1QR6A 1TO6A 2WP0A 3GB9A 3NUQA 4PONA 3NFRA 2GUWA 4XYBA 2X6TA 1FFAA 4YCSA 5H8WA 1SUPA 3K1JA 1PHRA 1EHIA 2GNPA 2FW9A 2FE1A 3CNNA 3HDVA 3SEAA 4UTNA 4OX9Y 4EFNA 1WLYA 1W44A 4LRSB 4ZZ2A 4QUBA 3QVKA 3TL6A 1W47A 1RXEA 4IZHA 4TKVB 4F2WA 1NL3A 4FWTA 2OP1A 3NFYA 3K0FA 4OKIA 1KFJB 2R97A 2XT6A 3KSMA 4DCGA 1SG6A 1QAMA 5DBOA 1S02A 3C3WA 3I2FA 5CCDA 3MMNA 1XD2B 2OHOA 1R5OA 5CD9A 4YV2A 1NJ6A 5EXDA 1QX3A 3R74A 2O7QA 2QD1A 1RLJA 4GKAA 4OL0A 4M8NE 5BSTA 3RU2A 4Q7QA 1BXZA 4YJ3F 4M46A 1U9YA 2P8JA 3OEYA 1SXQA 3T5DA 1YI1A 2I7XA 3MWDB 2O8FA 3OD5A 2G1PA 4N82A 1XAJA 1ZVKA 1U2SA 2WYOA 3WBBA 1SBCA 1KJ8A 1UK6A 2ZE6A 3FPGA 2Z1MA 3G5LA 4HMPA 3TYXA 1G6KA 3ETCA 1U2ZA 4GNRA 1RXIA 1Y7IA 1YV9A 2WAAA 5IVPA 4YJFB 5FPYA 1F7UA 2CBGA 1ID1A 4D41A 1LF0A 5TX7A 3UG6A 5BV1A 4PPGA 2XVAA 2JLYA 2E4UA 2B2XA 3ACCA 3MT8A 4AICA 1BE8A 4XXHA 3PEVA 4TKZA 1F2TA 2ZUBA 1MRNA 2C5AA 1P7ZA 1E5XA 1Z8FA 2COKA 4FHGA 1UPBA 3RHFA 4ZOLA 6GPBA 1GV1A 1CJBA 4JWKA 4JUCA 1N5DA 1T6BY 1EXNA 2RGXA 5JSHA 2CBXA 4AKTA 1IOLA 1WB9A 4J0EA 5CNMA 1VG0B 4P4LA 1KJZA 2QIOA 4KVAA 4NBLA 2A30A 2B6NA 3LWDA 1XTZA 2QL5A 1KMCA 1DARA 5BWCA 5JCPA 5LB2A 2CMHA 1YCDA 3AINA 4QVKA 5FBVB 3IOBA 1DB3A 3K0CC 3BS4A 1YK0A 5B7GA 3HCRA 3L8FA 1E6UA 1UJ2A 3UJ8A 2JFZA 3C1UA 2AEMA 2AOVA 4C1NA 2I62A 3S68A 1I7LA 1IHYA 2F3SA 1OV6A 2PS0A 3DFMA 1XEWX 5DX0A 2CL0X 3DMYA 3ZGOA 4LZLA 3I6IA 1VLJA 3ZE7A 3AEUB 3FTEA 4Q82A 1N5LA 2GK7A 1HLFA 1P4HA 1EM6A 4JT2A 2O7VA 3SSOA 3VKVA 2VH5R 2PCJA 2PA3A 5GADl 3OCUA 4NV3A 2DB3A 4Y9DA 2CXXA 5A9RA 3VOAA 3P9ZA 4C6SA 4CMAA 4ZVLA 1TK2A 2HWXA 2J6BA 2W2KA 4PZCA 4YUWA 5TGZA 4EYKA 2LVBA 5I7HA 3JQBC 3LTNC 2BZSA 3LTEA 1QWSA 1RW4A 3N0VA 1Q0TA 2ZB3A 4LJSA 3WR5A 4B7XA 3RFUA 4EAAA 1TEZA 3WE7A 3TI9A 3FGNA 1ULAA 1DDGA 3C5HA 4Q4DA 2W0SA 5ADHA 3H1FA 5FTNA 3RABA 3C8DA 1O6BA 3GVPA 2ECOA 3G8BA 1FNCA 3GJ4A 1X9HA 2YZMA 3L92A 3CTPA 1LXCA 1C1DA 4FLMA 1YHYA 5I6DA 1L1QA 2BCJQ 1PRYA 1MB4A 1K63A 3OZ7A 2VDWB 3CM0A 5FBRB 4CF7A 4JFRA 3UKDA 1JXMA 2C83A 2VHCA 5EIFA 2FJPA 1XJ0A 3H0KA 3UOGA 2H16A 3PGA1 3HTXA 2OV4A 2ZI5A 2JZOA 1FE8A 3H04A 5LU9A 3IERA 3V9AA 4F2PA 5KYYB 1AA9A 1KVTA 1T0BA 3B5IA 1JKJA 1QCZA 1EIWA 1C7FA 1SBHA 3HO6A 2ZXUA 1OX6A 4L8WB 2JI6A 2H2HA 4DLNA 3WJ7A 5DX8A 2R7AA 2GCNA 4BJ1A 4J2HA 4LZJA 3KEMA 2VT7A 1HK7A 4JWTA 4D42A 1Q7TA 5EWLA 4OI4A 1L5WA 1DIRA 4NS4A 1Y1QA 4D7AA 4V0RA 3CVUA 4DIBA 4PX3A 1OAOC 4OXYA 3VGJA 4F7DA 4FR0A 2C7RA 1J09A 1KMNA 1O2DA 3W9UA 4JSTA 2AOTB 2AFVA 3B8HA 1G21E 3E53A 1YC5A 3IPAA 3OLQA 5KOHA 3E22A 3CCBA 5EZYB 1SZPA 1T4CB 2PVCA 3QI7A 4CT5A 1ORWA 2QU7A 1HEUA 1GPLA 1KDTA 1ZK0A 3AILA 4D9CA 1GV0A 5CFNA 3AZPA 4DV1B 3IFSA 1T0UA 2WJ6A 3CZ5A 2J3LA 2W4IA 2H59A 2Q6TA 3FWPA 1JLMA 3MAJA 1NBWB 3FRJA 2F4VB 3KZNA 1QIGA 2XCUA 3D6HA 1L4UA 5CG2A 3F6CA 1ODJA 2QL7A 3MTIA 4ERNA 4RNCA 3BWCA 1E7WA 2H1IA 2WHQA 3EASA 4KX5A 5F2KA 4IF4A 2GBFA 4UNPA 1P39A 2A5LA 1FLDA 2D0PB 2PMDA 4LJ6A 3MCVA 3D5EA 4RJ2A 5EKSA 3LCVB 1ZGBA 3MMZA 3LP6A 3NNNA 2CVQA 3U81A 1SXJC 1K3TA 4KXUA 5K8CA 3BD7A 4FKMA 3HRHA 2FSSA 4DYDA 4OLAA 4KK4A 5AOAA 4LWQA 2HDOA 4O2BA 4RF3A 5I7SA 3E81A 5EQDA 3CX6A 4M0MA 4UVDA 4Y18A 3NT2A