2RG1A

Crystal structure of e. coli wrba apoprotein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
196
structure length
168
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGGGQEQTITSTWTTLAHHGMVIVPIGYAGTPYGATTIASRQPSQEELSIARYQGEYVAGLAVKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Flavoprotein WrbA
publication title Structural organization of WrbA in apo- and holoprotein crystals.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 168
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rg1A00
5LBUA 3K20A 4ZVLA 3UXEA 2M6RA 5LLDA 2V5VA 2QR2A 2ZKIA 3KAPA 4U7GA 3NHYA 2D5IA 3G5MA 3NHUA 2N1MA 3B6KA 1KBQA 1CZOA 1QRDA 5FUQA 1YRHA 1C7FA 3W77A 3TE7A 4GI5A 1T5BA 3K1YA 3SVLA 4ZVNA 4HEQA 4QOJA 4PTZA 2A5LA 2QX9A 4N82A 2ARKA 5TGZA 4QOFA 1BU5A 1E5DA 2MOKA 4LTMA 4Y7CA 1WSWA 3HLYA 4GR9A 1AMOA 3W7AA 1DXOA 3O2NA 4C0WA 4H2DA 6NULA 1CZHA 1NNI1 4N65A 1AG9A 3OWHA 1H69A 2BZSA 1C7EA 3EDOA 4CETA 3OX3A 3KLBA 3R6WA 3KEGA 4ZVKA 3NHKA 1AKVA 2WC1A 4YAUA 1JA1A 1J9GA 1FLDA 2OHHA 4FGJA 2FAXA 2X2PA 4PU0A 5LVAA 2BN4A 3N39C 4U7HA 4LTNA 1J9ZA 4C76A 2QX4A 4DIKA 3NHFA 5LMCA 5LJIA 5NULA 3GFSA 1BVYF 3NLLA 4QOHA 1J8QA 1OFVA 3N3BC 3NFRA 2OYSA 1SQSA 2FDXA 2Z98A 1XT6A 2V5UA 3F6RA 1SG0A 2W5UA 4N9QA 1YCGA 2KLBA 3FW1A 1X77A 1AKUA 2HPVA 4C0XA 1ZX1A 4Y9RA 1OBOA 5B3LA 2XODA 3JSXA 2X2OA 3HR4A 5EA2A 5EMNA 3F90A 1CZNA 3ES9A 3NHLA 1I1OA 3NHPA 3F6SA 3ZHOA 4YAOA 4PTYA 1DX9A 3B6IA 2FZVA 4BMPB 4NULA 4LA4A 2QX6A 5FX2A 4DILA 1TLLA 3S2YA 1D04A 3FVWA 3N3AC 3OJXA 2FX2A 2M6SA 4LAFA 3GFRA 1RCFA 1CZRA 1RTTA 5LBTA 3QE2A 4NLLA 4C14A 1FUEA 4FGLA 4Y9UA 1YCHA 2AMJA 5LJLA 3P0RA 3ESXA 4XDHA 2Z9DA 2V9CA 1FLNA 3UXHA 4H6PA 2HNBA 3FNIA 4LTDA 1VMEA 1F4PA 4D02A 2BMVA 1XI2A 3QFRA 2R96A 3OJWA 3TEMA 1D03A 4CF6A 5A4KA 1QR2A 5F4BA 1GG5A 2QMZA 4U7FA 1YDGA 1KBOA 3F2VA 1J9EA 3W79A 3ESYA 1DXQA 3D7NA 4GQIA 4HS4A 4YQEA 4BMOB 1QHEA 4FX2A 1CZUA 3LCMA 1AZLA 2MWMA 2QMYA 4R81A 5F12A 5NLLA 3ESZA 2FZ5A 3U7RA 1YKGA 1AKRA 1RLIA 1CZLA 4YALA 2F1OA 2R97A 3B6MA 3OX2A 3NHWA 4QOIA 1V4BA 1FLAA 3L9XA 4XDGA 3GFQA 1AKQA 4ICIA 3QFCA 4YAWA 3NHSA 4F8YA 2B3DA 3RPEA 4QOGA 3NHRA 3FX2A 1XYVA 1B1CA 3B6JA 1WSBA 4DY4A 2FVXA 2Z9CA 1AHNA 3NHJA 3OWXA 2HNAA 1YOBA 3LT5A 1ZWKA 4ZVMA 3W78A 1RLJA 2FCRA 3EYWA 4OXXA 1XYYA 4S24A 4ESEA 2BPOA 3HA2A 1FTGA 5ULLA 2QWXA 4QODA 2XOEA 2Z9BA 2MT9A 1T0IA 1AKWA 3O73A 5EAIA 5F51A 1H66A 1AKTA 1FX1A 1FVXA 4M0CA 5B3KA 1FLVA 3OVMA 2RG1A 2OHJA 3OX1A 1TIKA 2FOXA 2KQUA 2BF4A 3U7IA 2FLVA 4YAFA 3KAQA 2Q9UA 4FGKA 1CZKA 2MTBA 1ZWLA 2GSWA 1YCFA 3L9WA 4J8PA 5FA6A 1JA0A 1OBVA 3FJOA 3TZBA 4QOEA 1QBGA 2QX8A 1D4AA 2OHIA 5BUCA 2Q62A 5JROA 3GAMA
chains in the Genus database with same CATH superfamily
3QFTA 5BW6B 8LDHA 1IN5A 3K0KA 2O3TA 4IWYA 3HVJA 5ADHA 2BUBA 5F7OA 3E61A 4FPXA 3KD2A 4W1PA 1KPHA 5B53A 2P41A 3BQ9A 2P8JA 3O6VA 5I9NA 3PDHA 4CJXA 1Y5NA 2CNLA 3T99A 1PNRA 1SD1A 3JAWB 2X5KO 4BEBA 3T7SA 1NHWA 3QHPA 3HRKA 2RBKA 2P9CA 4YUYA 4ZK6A 3SICE 2DHDA 3K0FA 2QM7A 3M4ZA 4ETWA 5HVNA 5EERA 3SR0A 3D3WB 4U7PB 1UPTA 1WS6A 5FCDA 4A15A 1BMDA 1JJFA 4JBWA 4CMGA 4EGAA 5B7NA 5IABA 2JGIA 2REOA 4DTCA 1FEZA 2ZW9A 4MGEA 3DZIA 2RHJA 5CDFE 4R7TA 3T5PA 4IM7A 1II9A 3UW1A 1PI3A 4HQNA 2OO7A 3H11A 3HCEA 3W2EA 1E2MA 3CXUA 4WKOA 4C5BA 1U1CA 2V03A 5REQB 4B74A 2C31A 3S44A 2CLFB 2VH5R 2GXSA 3FPEA 3D0OA 3JYLA 2QR5A 3QWAA 1MO3A 2GZSA 4RMJA 3GNSA 3CEHA 1KO4A 4X7BA 2LD4A 4OQPA 2ZT8A 3GRUA 3RSFA 3UK7A 5ADUS 1DMRA 3TVTA 2R6FA 3BJIC 2FPGA 3IAAA 1JEJA 5JY1A 1W5EA 4J0FA 4P3XA 3AXSA 3R8XA 2C2KA 1RPAA 5JWRA 3RFTA 2V65A 2ZIFA 3OMWA 1NZJA 4RVHA 3V4FA 4UM9B 4D46A 2AF3C 2Y67A 4OQYA 1T8SA 3TW0A 1UAAA 4LOJA 1S1MA 1E0SA 4H2DA 4HWKA 2YOHA 1CQJA 2NO5A 3CRMA 3UICA 4UBKA 3ENNA 1WHTB 3K32A 3KXKA 1DRUA 1N34B 1UEIA 1C9DB 4U5QA 3WHIA 3ZLBA 1R8JA 1SCDA 4N7JA 1H69A 2NUAB 1YNOA 4E6PA 5AW7A 1C7EA 1YDFA 1MA0A 1E79D 2XYRA 3EGDA 1VHWA 1J0BA 3SHQA 3PGVA 4A10A 3AF3A 3RAJA 2BP7B 3H2IA 1VCNA 3A1NA 1ZOOA 4XD7A 1L5KA 5B7QA 3WJ1A 3HS3A 1GPBA 2FW9A 1CQWA 1YCDA 4L1KA 3VR6D 3NT5A 1I2MA 1XNGA 2NU9A 3SFZA 5CFLA 1CF9A 1ISIA 2VDNB 5FOVA 4EHAA 1ZXXA 1P1BA 2CJFA 3ZNQA 1ICIA 3D2BA 1BMTA 5L9AA 1Z3CA 3VUEA 1MKYA 3AIKA 4P5PA 5EMKA 3BKWA 4OIFA 1SZJG 4BX3A 4BJ5A 3Q3VA 2D1SA 1PZHA 4J7AA 5KTYA 4P86A 4QYIB 1IVSA 3EFEA 4WK2B 5AKGA 2OHHA 1KMNA 1R4MA 2O7QA 4Z6KA 1E5QA 4ZV4A 4ZYXA 3HVKA 1NVVR 4BXOB 1NVBA 2N1BA 1F06A 2FAXA 2GPTA 4I2NA 2FOIA 3RWMB 1BD4A 4FNAA 4CM6A 1XTZA 2A35A 1NURA 4OQNA 4BFCA 1KJNA 2XMRA 3S2GA 1YRYE 4U7HA 3EJ6A 4LF4B 4BRUA 1NVAA 1B6RA 4DR4B 3I4LA 4OFXA 4M8IA 2WF9A 2FOLA 4B2YA 1I2CA 3K5IA 1DIOB 3PBKA 3BBPA 4WRRA 4KREA 4RVDA 5IJ9B 3FLAA 3OTIA 4KQFA 3IELA 3NBXX 4HDKB 1TM1E 3LAWA 5LJIA 4I55B 4LC0A 3CH6A 4KPUB 1SO8A 2AFRA 2ZRBA 3NG1A 4MUEA 3UAGA 1T9BA 5DX0A 4D92A 5CFRA 4EJ2A 3R1IA 5E3HA 3F3SA 4KTTE 1MJGM 1RJ9B 1WPRA 2FTKE 3ETEA 1OZFA 2J3QA 3MM4A 3KQQA 3Q7SA 4C7OB 2C96A 3BTVA 4AN4A 1J7KA 2AI3A 3V6MA 2ZE8A 4O8ZA 1LC3A 2C04A 2O57A 3E27A 2PBLA 3KYDA 2HQSA 3Q6IA 3HXTA 1HSZA 4HH3C 2PMFA 4BE9A 4XEHA 4RO0A 3JATB 2AI2A 3BA1A 4G26A 3SQLA 1NJ1A 1UIMA 4LXHA 4COOA 2QJTA 1UBKS 3QQ5A 3H65A 4FOOA 2LE0A 2VTBA 4RD6A 3VKWA 2FN8A 4EB6B 1YSCA 1SG0A 2RHHA 3RS2A 4FK8A 5DGXA 1WF3A 5L45A 4DDMA 4B5LA 1CJVC 2ANBA 5C53B 4DV2B 2ZSKA 3DNFA 5FPQA 4OGWA 5EXSA 1RXUA 1J2RA 3NHAA 2ZE6A 4N7RA 1X77A 2RGUA 1FBNA 3VR1A 3UG6A 2JHAA 3IOBA 4RCVA 1LV8A 1UP7A 1YUNA 1HT1E 3A2MA 3PQ6A 4MUMA 2JIZD 1R6BX 3P5SA 3FYCA 4RZHA 4TT8A 4UBLA 5PGMA 4BB0A 2WWTA 1T4DA 3C3YA 3LKVA 3FLBA 4MEAA 3UOGA 4Z7JA 1LVUA 2OMKA 1ONBA 4M1ZA 3AGPA 4RU1A 1SD2A 1MVNA 1SEVA 2H4HA 2IRWA 4DKJA 4OLAA 3TQRA 1D0IA 2C4VA 4P8RA 3O1IC 3DBVO 3LLSA 4PXSA 4ESHA 1FJXA 1J90A 4F84A 2Q2VA 3AFOA 2R1UA 4CEIA 2ZVDA 1NW6A 1J2EA 4R8KA 2SBTA 2QD3A 2UUAB 3PC2A 3PVSA 1XA4A 5KDLA 4CRWB 2Q9AA 2XLCA 2G7ZA 4RXUA 5EMNA 2NQTA 3UAZA 1J70A 4NPCA 1KGSA 2J9YB 3O0TA 3WQBA 4HDRA 1Q1AA 1N92A 3HKDB 3Q7TA 4G9GA 1Z4IA 4UZFA 4YP7A 3T3IA 3QX3A 1ULBA 2CVOA 3QA9A 4KE9A 4GL4A 2EEPA 2EFEB 4GMFA 3MOIA 3VR4D 1K0UA 2AMYA 3KT8A 3RS4A 4C5AA 1BKSB 5BURA 1D6MA 1KEZA 2BGUA 3F5MA 3G02A 1E5XA 1ONSA 1YJCA 3VJRA 3BK7A 4RPJA 3IRVA 4C88A 3A3YA 2D6FA 3FSGA 4JLNA 4P2BA 1T2DA 1FYEA 4PYIA 4II7A 3AL0C 3R7BA 1FTSA 5KPDA 3HYLA 2AFIA 3X44A 3P2MA 1BA3A 3FVWA 5DM70 4NNJA 2QUKA 5GOZA 3SSMA 3UMJA 2NYVA 3HYRA 3D2AA 2VKQA 1Q7RA 3HN2A 4YI5A 3SDSA 4JI4B 3I1JA 1P2BA 1NW9B 4S1WA 1RE0A 2Y93A 1NN1A 5KJ1A 1VE1A 4JEMA 3HU2A 1TFUA 3ZDRA 2XKBA 3FNGA 2IOFK 4C6SA 2EFGA 3E5MA 4FTWA 1Q0PA 3H6GA 1DMSA 1KYVA 1UBOS 1UWKA 3L46A 3V7WA 4YXFA 1V0JA 1GGMA 1HYEA 2ZJ8A 3N6VA 4GNKA 4I46A 5SYAA 3ZBPA 8MHTA 2QVZX 4BLTA 1TD1A 1CUHA 4IICA 2W8BB 3AUYA 2X6TA 1ZA1A 4TWRA 2ZJFA 3X1XA 2OXIA 5AW0A 5DX1A 3C6XA 2PA3A 2X7XA 3AK4A 4ENSA 3NOXA 5EQDA 2A1TR 1XQYA 4J3JA 1KC3A 1G9XA 4CFZA 5T3YA 1P7YA 5CCBA 3JR3A 3NVMB 2AE1A 4PNPA 5GONF 3MLAA 3IDSA 4WBSA 4TS4A 3GCXA 3ESXA 1LJLA 4DMGA 1CC1S 2BM1A 2Z9DA 1ZGHA 1ZMBA 1EAYA 3B3QA 3FFAA 4M98A 5EHNA 2OQIA 3TLMA 3VM6A 3WX0A 2GFIA 1GDTA 2BFDA 2C9BA 2B5WA 4TV9F 3MOGA 3QVXA 3FM9A 5DH9A 5F9MA 5F2KA 2WWWA 5M7EA 4DV7B 3I9JA 1J5PA 4RSMA 1QH9A 2IYXA 1Z73A 1X80B 4TXJA 3JD2A 3ECSA 1XI2A 4BMVA 1M8PA 4LNHA 1IY9A 2ID7A 1YE8A 3CZCA 3ZWOA 1YR7A 4DNFA 4WIAA 1XPRA 2FK7A 2HU8A 2GKOA 5ALNA 1YMQA 1WW8A 1ZQ1A 3DZHA 3NNNA 3QG5A 3CZPA 3FTEA 4PSVA 1KDYA 3ZYZA 4Y2GA 1RWXA 4IHKA 1C3OB 2FN7A 3EZNA 5JXGA 3B8HA 1PWZA 3BA6A 3LCCA 4F11A 4TRJA 5LZ5A 1ORWA 1CSEE 1UEXC 5H59A 2WJHA 3V8QA 4U7FA 1W5SA 2ZRLA 4QU5A 1S01A 2FSIA 2PEZA 3KYCB 1NX9A 4Q16A 1EVEA 3CVXA 2X9QA 4F8YA 3HA3A 3FH0A 1QG4A 3TD9A 5IXJA 5FOWA 2Y71A 3HYTA 3LKDA 1YL6A 3HBAA 3E18A 3U13A 5IK2D 4QG7A 2EIXA 3D5QA 1DXQA 2NUPB 1UQRA 1INLA 1GILA 2IYYA 1GZ6A 3ZDYB 3H2SA 1GCAA 1LQ2A 2BFEB 2QB5A 3ZHZA 2AZXA 1VJDA 2BSAA 1AUVA 5ESWA 1RSZA 2VRBA 1Y89A 1B8PA 2I4LA 3ZCTA 4YRLA 2Q1SA 1XN1A 3GJ4A 4J2HA 2OCLA 4KXXA 2IZ6A 3IP1A 4IP0A 3RVRA 3LOQA 3QVKA 4EB0A 2ZI5A 4PYJA 3CT4A 3HVIA 3RYCA 2HCFA 3JAKA 1ZC3A 1LLCA 1SK8A 3D8BA 1NR1A 1NJ6A 3IJPA 1GY8A 4K8RB 1W35A 4YRTA 3WJ7A 3VVLA 3MAGA 2VZ0A 2J9FB 1RLIA 5ENDA 3C3EA 2NNWB 2P9JA 2CCKA 3H2JA 1XA3A 2F67A 3MOSA 1MA3A 4YRMA 3WIOA 4XE5A 4C0LA 3GMDA 1VIDA 3HJAA 3UCEA 1M2OB 3J81A 4E51A 1UXGA 3VPAA 2I6FA 2QN9A 3GNQA 5K8TA 3IHTA 3JQPA 4J0EA 4HSEA 4LWPA 2DT8A 3E22A 4NDAA 3QKWA 4QTUB 4CQNA 3HDTA 1T3TA 3PHLA 3PUJA 3PVCA 4Z4IA 5AM0A 3W7BA 3MWFA 3D59A 4KWIA 4D9HA 3AF4A 4EG8A 4YRAA 1WB4A 4KXYA 4H27A 5AMXA 4JBLA 4KPYA 1ETUA 3L8EA 2K4MA 2GAOA 3O4RA 1SK9A 3SQWA 3QU7A 4JT4A 3UAYA 1NNLA 3WYBA 1NW7A 2WJVA 4XDGA 1J06A 1H2XA 2WBLC 3NKFA 2WDZA 3RREA 2RGWA 3IIKA 2O3QA 2Q9BA 4OXKA 5AKEA 4AWBA 2P2SA 2AC4A 2V5AA 2ZBEA 3KTOA 4FUTA 4O4IF 1XROA 1R6TA 4OA5A 3C87A 4RF5A 1VPTA 1USVA 2LTAA 2V8BA 1Q0SA 3R3UA 1NU8A 2FR8A 1L8OA 2P4UA 1L4EA 1PU2A 4IX1A 4IIDA 1JH8A 3DMGA 3M4JA 4S3MA 3ZWAA 1SHLA 2I33A 2QG4A 1CHDA 2P4QA 3IAFA 3LXMA 1JIVA 3K9QO 5IT9A 3G9ZA 3JQFA 4MWSA 4ZZ2A 1Z7YA 3AHDA 1V1JA 2QN7A 3DE3X 6PFKA 3O8QA 4ZVMA 3E9ZA 1COZA 2VT7A 1LQTA 1M0SA 3A3PA 4NHEA 1GKKA 3L8YA 1QF7A 5LP6A 4DSAA 3OO0A 3QTBA 4HF7A 4LOKA 4LWZA 4NG4A 5FWYA 4RCYA 2I1QA 3CT6A 5E3IA 3BRWD 1ISRA 3OJOA 1VE9A 4TLCA 3TQFA 4CKYA 5C37A 3AEKA 1PIWA 4JQCA 2PZMA 2JIDA 2RH5A 3GP8A 1E6CA 3PFHA 1A8SA 3ZUPA 3VA7A 2R68A 2JH3A 4EHKA 2YHBA 3BXEA 1A98A 2UVDA 3LM8A 2J0QA 4K1LA 1P5ZB 3U31A 4DLTA 1YR3A 1EIWA 3T9AA 3OPYB 2G9RA 1U8ZA 3DZFA 1JQKA 3MT0A 2DHRA 3UB4A 3W05A 3RK4A 2AC2A 3SQNA 1JG7A 3WV4A 4U00A 5DDIP 5C4IA 3EA4A 2D7DA 1AQLA 2PH7A 1UZMA 1H6DA 3ANXA 3CNBA 4A0RA 2KPOA 2WMNB 4R9VA 5A7GA 5JC1A 3TD2A 3UGQA 3PEVA 2OVFA 3RHTA 5BR7A 2AVDA 1EX6A 3Q5DA 4X94A 3ZR4B 4HNUA 3H5IA 2I2AA 2ZR8A 2FP4B 1C80A 1QH1B 4S2UA 2UXBB 1WSDA 2GDZA 3A05A 4WUVA 3IALA 4IFTA 1LDNA 1QVWA 2FOXA 4CG2A 4AP5A 3RSSA 3LQRA 3X43A 4C01A 5JNRA 4YAFA 4EFDA 3PC8C 2O7NA 2AXPA 2ZJOA 1MFZA 2AVNA 1G3UA 4B3XA 4FGKA 2J67A 1CZKA 1FXUA 1MAUA 2OKCA 3WWEA 3ICQB 4RULA 3CW8X 1YA8A 2B30A 5GY7A 3UFXA 4F1KA 4JC8A 2AQIA 1I6LA 4LY6A 1QV6A 1ZWLA 2I4MA 5HOQA 3HB9A 4IIJB 2A92A 1FNMA 1G6HA 4HDSA 3A3KA 3HCPA 4DANA 2QW1A 3B8EA 1CEQA 4WWHA 5KNBD 4B3MB 3BK1A 1S8NA 2A5YB 4EYSA 3CLHA 4IH9A 1JNYA 5DP2A 5M3BA 10MHA 2ONJA 1JTEA 4FLEA 4Q9LA 3UYKA 3L6BA 5KYXA 3H8WA 5CIQA 2IWHA 5C1DA 4FYYA 4GMXA 3HJTA 1N3LA 4OLJA 1Y3FE 3TX6A 2D2EA 3E9MA 3KL2A 4PW0A 4E5YA 1AKYA 1SM4A 2A0UA 5HJ2A 4I4NA 2QRGA 1ZY2A 2ZWIA 2C2GA 3GMSA 2BBWA 5SYNA 5A0TA 3U37A 3WWCA 2WVGA 3PGLA 4LIPD 3EMBA 4PTLA 1U2GC 2H59A 3AUSA 4GR5A 2FPOA 4WH0A 4O63O 3ZW9A 1ZUIA 1N36B 1M54A 2I99A 2GVZC 2QTWB 3QXXA 4RQTA 4CDNA 2D3WA 3HWWA 4RENA 3A3OA 2DF8A 5H5JA 3VKFA 1XQ1A 4XYEA 3FFTA 3K9LA 4LJ9A 2JHGA 4RD1A 4BNWA 2POCA 1DKLA 4BFWA 1ZL2A 3CMMA 3QBDA 4KGXA 3GO4A 4AUKA 1VXRA 3O03A 1VJ0A 3W77A 4JL5A 1XP8A 3FZGA 3G13A 4MJLA 4PFSA 5F2EA 5LBIA 1OA1A 4Y7DA 3EZFA 3TE7A 2WFAA 2XHEA 2IHKA 3GGPA 1T9GR 2GPJA 1KF0A 2R62A 1VGQA 2X5JO 2XYGA 3P4XA 4YECA 1JR3E 2AZMA 2B1JA 2ZSJA 4KWHA 5BNTA 4JLVA 2ZDQA 1D5WA 4F72A 4ENUA 3AIOA 1US8B 1BOOA 1NN3A 1UDRA 4ZO7A 4CM9D 4HAWA 5IAEA 2XF8A 4BUCA 1RR6A 3D8HA 1PQ4A 3Q8XB 5BOVA 1DAEA 3IPLA 2ECKA 1U2SA 1E3WA 2QMHA 3B1JA 4Q4JB 4U2CA 1KQOA 1FFCA 4B80A 4DMKA 3E82A 5I9IA 2E4AA 3VZRA 3MCVA 4QOFA 4HR7A 3WLAA 1BO6A 2IA5A 2AWNA 1EBFA 1JV2B 3NIDB 4LTMA 4LBWA 5ISMA 3AW8A 3F67A 4V3CA 3RIYA 5C7YA 2ECOA 3ZV3A 5IYZB 1P0MA 4DA7A 4CTJA 3VMFA 1GAWA 3O2NA 4XQCA 2JJYA 1IEVA 2IKQA 2V7BA 3COVA 4P0TA 2H1WA 4JI0B 4D56A 2R66A 3IKMB 5TE9A 1SHZA 4ZQIA 5EVJA 3SLKA 1VE7A 3C2QA 4FWIB 2YWFA 4NU8X 2Q5FA 4TN5A 1JG4A 1TU0A 2XUJA 2X1MA 3F49S 3G0BA 4N65A 4OOEA 1XD2A 5A03A 2J07A 4C6HA 4HQRA 5BW8A 4JLAA 1EYZA 1QYCA 2Q5CA 1GDHA 3DFMA 3ETNA 3NCTA 4GR4A 1HZJA 4GHWA 1KL7A 5EIFA 2AH5A 1KA9H 2W6JA 4GSLA 3NANA 3V1MA 1K8QA 3WNDA 1TZKA 1G41A 2W2VA 1AUOA 3A1DA 1AGXA 3RJ9A 3RJ5A 3HFSA 1QVRA 2GT1A 3HGTA 3NHKA 3P0HA 5J2UB 3TJZA 5FIUA 3NJ4A 2EATA 3D3JA 1W2HA 1A4UA 3KL4A 2W2LD 3SNKA 4HX5A 3KUUA 1C8KA 4DRZA 1I30A 3ZBUA 3GX1A 1X7YA 4KI7A 2A57A 3RFUA 3K2BA 3DKVA 4D43A 1E1QD 2VDRB 4B3BA 3PI7A 1WW2A 1BJRE 3Q40A 5K0NA 1LI5A 3BHIA 1ISFA 3CO0S 3KB2A 5LWHA 3VI3B 2CFTA 4V0KA 4EG6A 3P0IA 2VDWB 2YJGA 1BWRA 5FYDA 3WGQA 4AMVA 1P2SA 4MLPA 3OEWA 4IQ4A 5EP4A 1N1EA 3LQ1A 4ZI5A 1C0KA 4HV4A 4P4LA 4TVOA 4LF9B 1FJGB 1NI4A 3I39X 1NKVA 2XIQA 3EXIB 3EBOA 3DO6A 4RK1A 1I1HA 2PCJA 2RC5A 5FOUA 5FUXA 1AHPA 2XLBA 4GMHA 1Y1PA 4G2TA 1QS0A 4R9SA 4LBVA 1SXPA 2VWHA 3PEUA 5KSOA 3GYGA 1HDOA 5TMDA 5MN5A 5LMCA 1E6EA 2N0SA 1NT4A 2Y1LA 1A9PA 1NUTA 1P60A 3NDJA 2YHUA 1QQTA 3BMOB 3TOVA 4Q19A 1SPBS 3QTLA 4Q1DA 5JPCA 1K97A 1WXFA 3DBLB 3OD5A 1OHHA 2PSEA 4UM7A 3SZUA 5IKEA 2JF0A 1S4MA 3WLNA 3CLUD 3RAEC 4I1IA 5SZKB 1WP9A 1PFKA 5BXQC 2DY0A 4F8JA 1XYGA 3ASZA 4BATA 5KQSA 1N2BA 1ESZA 2V0CA 5EKTA 2ZB8A 1P2UA 2P0EA 2FN9A 1C0LA 1ZO8A 4DQ0A 3ZK7A 1GEEA 2RK4A 3JVUA 2CWDA 1NVDA 4WXRA 1T1JA 4A3SA 4KR7A 2W5UA 3QX8A 2OFFA 1UM8A 3PS9A 4MDHA 4MKGA 4D41A 3JARA 1YH3A 4CCSA 2HRBA 4X1IB 4GKAA 2WIFA 4F93B 2QPOA 3IQGX 2ERXA 3K09A 3MLBA 1Z6ZA 3PPXA 5KJFA 4YP6A 3ZZMA 3SDZA 4QUKA 2ZT5A 3C3WA 2I6QA 1USKA 1TF7A 2QJRA 3BH7A 2ZE5A 4PZLA 2FPRA 4G07A 2QM8A 3ZIAA 1Q0QA 2X8JB 1BWSA 1K9SA 4WL0A 4ZVNA 1XFDA 4CCYA 2H57A 1LF5A 2Q1TA 3H75A 2YZ7A 5CVCA 3FY4A 2ZYIA 1IL0A 1ZN8A 1KH2A 5IT5A 4R41A 2DKNA 1I24A 3EA5A 2LCIA 1FY2A 3ZE2B 1PS8A 4HCJA 4MULA 5T4EA 2QN1A 3ROKA 4DUZB 4V1CB 4J16C 1ECCA 2OZKA 3F98A 4U2EA 1UWVA 2BEVA 5DHPA 2B8EA 1KJJA 4JYCA 3GH3A 4RXMA 3ZCUA 3AP1A 5KU1A 1FFWA 1W581 3HACA 4YAKA 3A9CA 4P0PB 1R0SA 4FN5A 3UY4A 9MHTA 4YAOA 3W9UA 3ZVLA 1ULHA 1FP6A 4UXHA 3TZLA 1MJ5A 1SVSA 3MSCA 3VSDA 3V2HA 3KSZO 2PJZA 1CUCA 1Y5LA 3DMTC 3WYNA 5E1DA 2HRCA 3H4TA 4URHA 5LM3A 4H3KB 3MBOA 1IB0A 4FW8A 4BEVA 4PR3A 5C5DA 1JFSA 1ABEA 4DE5A 5JDCC 4AZ0B 3BXPA 3P32A 1T4GA 4QOSA 5ALVA 5JZ9A 3HEAA 3HXLA 2GPWA 2ATEA 3FNFA 1G5PA 4O02B 2Q4RA 4Z0TA 5K2OA 2OGTA 1PFVA 2HO4A 1ZUNA 1WCWA 1ZBDA 3LH5A 3DMPA 3N3AC 4W5HA 5DYGA 1H94A 2VPQA 4MRNA 2F17A 4FI3F 3IAM6 2VBIA 2B0CA 1RZUA 2RGBA 3KHTA 1N6IA 1QH0A 2H9IA 3NTVA 1IG3A 3OQPA 5JANA 3ZOZA 2WSMA 4I1VA 5HSGA 3LYLA 1IM5A 4JGGA 4RD2A 4QKQA 3FF4A 3RB8A 1SXJC 4ZJYA 4FT2A 4YV7A 4HNTA 3ABRB 1WVMA 5KKAA 3IB3A 4MHSA 1QE3A 3FYSA 3CISA 1VSUA 4JUCA 4C4XA 2QN3A 5BOSA 5KTMA 2FFHA 4RTRA 2Q21A 4YIHA 5JBNA 1CETA 2JVJA 3PL5A 4LZAA 4NECA 3ZCQA 2F4VB 3AG5A 1ZI8A 3TSCA 3FKSD 2I54A 4H3VA 4WCDA 2YN0A 3VNBA 3K0FB 1LPSA 3W4JA 4CQMD 3BL8A 4LXYA 4CLHA 1Y5IA 3IMKA 3PDUA 4BNVA 3PQDA 4OH1A 4H1VA 1N2CA 1WHSA 1ZM9A 2WW8A 3DBOB 3ZIDA 4V02A 4K9QA 2DQ4A 1H0HA 2UXCB 3ED5A 1MVOA 2R4TA 3D8SA 1YB6A 3H11B 4XDHA 1YAHA 4DCPA 4XVCA 5BUSA 2AEMA 3DCYA 1U11A 4NFYA 2JGMA 3HVHA 3ENKA 2VYNA 4ND7A 3VPFA 2PS3A 2AXEA 5IEJA 4OV6B 1M8JA 5EPEA 2Q9CA 5DIZA 2XYVA 1ZGJA 3LPMA 4X85A 1FYWA 1OYWA 2C5SA 5ALQA 4I4LA 1R0BA 5HF9A 4B48A 5C32A 5LR6A 2LP4Y 1XEXA 2GN0A 2J9GA 3I37X 4G3XA 5BV7A 5JCZA 1P73A 3FWHA 1IXYA 4QX6A 3X1JA 4E5DA 4BQIA 2WSIA 5A3SA 4CL3A 3HL0A 4RZQA 4DRYA 5DBGA 1Y1SA 2WI8A 1IQ0A 4ETNA 2KS6A 2NTEA 3C7CB 1DQSA 1X7ZA 3D4IA 4ZT3A 2ZIAA 3MWEB 3ELDA 2K5UA 4TLAA 2C2MA 5EI5A 5KJEA 2C7RA 2IHNA 1WXWA 1D03A 3A6ZA 4LRSB 3NB0A 3RSZA 4EARA 2O8CA 1Q14A 4K8OA 4LI0A 3B70A 3I28A 1LI4A 4TRMA 1F3OA 4B8WA 3TLYA 3PFFA 1L5HA 2C1ZA 3QKRA 1QKJA 1WA5A 1YMUA 4GLBA 4CR7A 4OYYA 5L4NA 3EGDB 4AY6A 2HMWA 2WHRA 3O8NA 4O2BA 2HZBA 4UMDA 1JVBA 1QG0A 4UTNA 4RTNA 3KQUA 1EWQA 2BM9A 4O8CA 3S1AB 4QDUA 4II2A 2ZXUA 4DABA 1K68A 3V48A 1OF1A 3EFOB 5E7JA 3BREA 4TL9A 1PGNA 1Q5PA 1V16A 2NU9B 4AJ4A 3UBMA 2RJ3A 1C5KA 3VSCA 1K1EA 4ZRDA 1UJ6A 3RJTA 2VAMA 1POWA 3CWZA 3G1WA 3VV3A 4C7KA 4ZGBA 5ITZB 1Z5NA 4E31A 5LYJA 3RAPR 1QGOA 3TAXA 1KDTA 2Y1WA 1F12A 3HI6A 3ZXUB 1URPA 1R4MB 1LNQA 2G3YA 3ND7A 3R3HA 2VZ8A 2DZDA 1B41A 4YPFA 4FHCA 4BNGA 4TXMA 1HNXB 3GT7A 3EZ6A 3IVRA 2E6UX 3ESZA 3H5NA 4UFNA 3VRHA 3TOCA 2A1UA 4EMBA 2B69A 3L7LA 4MQFA 3UMSA 3A26A 4IJWA 2DR2A 4AYXA 5AVQA 3LA6A 4RQBA 3DW1X 3JD1A 4GDMA 5TJ9A 1W73A 2VT2A 4C0KA 2F1RA 1SQ5A 2F1OA 3PXAA 5AT1A 1M2WA 1JHDA 4G67A 2R97A 1SKYE 4EO7A 3A6HA 4WKPA 3M6AA 3I01M 3LOPA 5EHIA 2EX1A 4DBLE 3V4SA 2V7PA 2BGLA 3HCWA 3IJ5A 4ZI7F 1PN3A 3WJAA 1DO8A 2FSPA 4F12A 3FYUB 5AHOA 1FLAA 1TQHA 1HTBA 2EFJA 4N8SA 3DTTA 3PJDA 4UJ5A 3S5JA 3P4YA 4AKEA 2GNAA 1IBRA 1U28C 1AK2A 5HX7A 1O95D 4ICIA 2JLYA 2R6R1 3KYDB 2RH9B 5ERXA 3SHVA 1P72A 3OF2A 2NU8A 2FFRA 2RCNA 4P9NA 2VPZA 3MBKA 1VSTA 2P62A 4EVIA 1ZJZA 3KO8A 2X9LA 2BONA 2J0SA 1IJFA 1IZZA 1E2QA 2VTBB 3MCTA 2D3TA 3C3JA 3FX2A 4A0QA 5LQJA 5I8ZA 2AKAB 1SKAA 2H16A 1BXZA 2MDTA 4UW9A 7AT1A 1DCFA 2YFQA 4HYQA 3DMNA 1WCXA 5HW0A 1H2AS 2CNDA 2ZYAA 2JFQA 2PIDA 1DOAA 3LG2A 4BZQA 1RYMA 2YIMA 3FDXA 4FEGA 1W6RA 2NUBA 5ESRA 1U81A 1Q57A 2XWQA 3TLAA 1WLSA 4F4IA 1K98A 1KQ3A 1TZBA 2QRVA 1QOPB 5B1DA 3THOA 3WA6A 1JPNA 1IZ0A 3DFKA 4EIWA 3BCSA 5F7XA 5KREA 1EX1A 3QYFA 4IJVA 2WLTA 4H7DA 3TPCA 1EVJA 1JAIA 1Q0LA 4B2LA 2YBEA 4N6NA 3HUDA 2PRZA 4Y1GA 5EWMA 4YFVA 3CF6R 4X62B 4G5OA 1Q1EA 1NQXA 3P9PA 4LJKA 3DR5A 3LNTA 4CLOA 2B25A 3PRHA 4KMMA 3TQCA 3ZZTA 2BMEA 4LPKA 4EUHA 4CEIB 1VIYA 2OORA 3H5AA 3WGYA 4C4PA 4LJ4A 3HTXA 2PD3A 3Q11A 4XZ3A 1WXQA 4ES6A 2ZRDA 3CR3C 5K99A 3A1EA 3THWA 1QJCA 1X1DA 2BWJA 3USCS 2EHJA 5EFZA 1G9SA 2C99A 1EQAA 1NBAA 1PP4A 4YONB 3ICVA 3QK7A 4HAXA 4NYIR 4RH3A 1H8ED 5BWMA 3ZDCA 4MJ7A 3GLGB 1CJMA 3OJ0A 3OZVA 3ROPA 1DOZA 1EDEA 1LB1B 1FLVA 3U4QA 3ABOB 3WC4A 2QEQA 1AC5A 3K70B 2J5QA 4NCKA 4IDDA 1SA0A 2NVWA 3W6PA 1CNFA 5DNCA 1O6FA 1T3ZA 2FWNA 2O6HA 3E0QA 3OIUA 4M1YA 1XVTA 2JJ1A 5SICE 3ZK9A 4A27A 2B92A 3VDRA 2D0DA 3EC7A 3RCBA 2CYBA 5CK4A 4CN9A 3FZNA 2Q7XA 2AFIB 3MTEA 4TVKA 3SJBA 5DM4A 4MUFA 4UJ3A 1MJFA 4J0DA 2E0IA 3ZTYA 5B2EA 2W7TA 3THXA 3IV7A 5HF8A 5BN3A 5DXAA 1O4WA 3TRKA 4PLFA 3TR0A 1Z4PX 3GUYA 3L9WA 2I3ZA 1CS0A 5KNLA 1I4OA 1PTJA 3LVBA 1SU7A 2CV2A 1UZLA 1X7DA 4RETA 5DTJA 1RT9A 1XOIA 5IFLA 1JA0A 4FUQA 3LKZA 3BORA 4AT1A 2PGJA 1N2XA 1L5LA 1KP9A 3EQZA 4HDNB 1AMOA 1QP0A 4L7QA 3OCUA 1T0HB 3BDAA 4G84A 1E0JA 3M6XA 1DWPA 5E1BA 1QQAA 1D1SA 1JIUA 2C78A 4G0WA 3BD9A 4DG5A 4WX2B 1BH6A 1E2EA 2QAJA 2VHWA 1K6EA 3DZKA 4BFSA 1KZ9A 4K1XA 3ZDZB 3I3SR 2V4MA 2V7TA 3FCEA 3F8SA 3SNHA 5HKKA 3D2CA 1KP3A 5HKBA 1WUKS 2W6IA 1T6BY 4HYEA 1G42A 3K20A 1L8LA 1TEHA 1W5FA 1SWWA 1TUEA 4P7BA 5TQ0A 2OGSA 2R6CA 2P9HA 3EXEA 5AJUA 1KFCB 2FG7C 4EPTA 3F3KA 2JGLA 5IAGA 3ABSB 1MB9A 5CJJA 4YJ2F 3P9NA 4RHEA 5CJ2A 3I6QA 3ABIA 4CG0A 3NHUA 4OJQA 4JLJA 4FGUA 1ESNA 1B26A 3ZHXA 4COKA 1GTRA 3T1QA 4C2TA 5IDQA 3L8FA 4IL5A 5KVVA 1PT7A 1Z5VA 3NVAA 4FNGA 4QBGB 3DVSX 2W37A 3RUPA 4ZVUA 3PLNA 1UKBA 3NNDA 1MGOA 5FAXA 5HDBB 5COBA 2GK7A 4LJ5A 1GTG1 5FLXA 1OT5A 4MV5A 4I9FA 4CL0A 5DV9A 4JMLA 4S1NA 2R86A 2XNJA 3E2PA 5AI9A 2OCAA 2EFCB 3KSDO 5FL7A 4X97A 5JSZA 1JNXX 3EH2A 4QXQA 1XMSA 2CXOA 4RANA 5BYBA 1DZIA 1UFQA 5B3JC 4MVJD 1GA1A 4N82A 2N75A 5EJFA 3Q88A 5GPBA 3VC2A 2JLWA 1B8NA 3RVLA 3TCXB 1L7BA 5JALA 3UPUA 1E7YA 3TB6A 3EQ7A 4Q24A 1XWFA 4PZUA 4Z4GA 2MSCB 3EC1A 4QJBA 4S1OA 3U4AA 4B6RA 1XU7A 2EERA 2J4CA 4TYYA 2W83A 1MAWA 4GEKA 3RV4A 1WV1A 1SY7A 2WMDA 2NZVG 2FPWA 4TZTA 2L0XA 2VYCA 4MJ3A 3D6HA 1GKIA 3OH8A 2VXBA 5G1NA 4Z7OB 4QDTA 1JDJA 2FWJA 4X9XA 3TNDA 4EAAA 16PKA 1SBYA 3II6X 4I6GA 4KMOA 1M7HA 1V7QA 2IYZA 5AKJA 2ZYTX 1TE2A 2GYYA 4Q01A 1LPAB 2LDBA 3TX2A 3CNEA 3HEBA 4DV3B 1M6VA 2V0NA 3R0ZA 5DBEX 1FX0A 3GARA 1RPTA 2DPLA 1R0LA 4Z7QB 5I7EA 1XLUA 4RHTA 3SBDA 4L4UA 3TLBA 1FDSA 1MU0A 2ZANA 3JAKB 3RRNA 1K7XB 4NAVA 4C5CA 2CFOA 4DYHA 4KN6A 3L04A 4UQOA 4DWJA 1IAQA 2FPPA 3O8DA 3RFVA 1B93A 4B35A 4XQEA 3OE7D 5CLFA 4PLYA 4GP6A 1L4BA 1PNQA 3DMHA 2CLCX 2FR1A 3SYTA 4OH7A 4YI3A 4L16A 2OK7A 2GLTA 4FGJA 2NQ8A 3RVNA 5ICSA 1JIKA 1N7JA 3E22B 3EMKA 1JWLA 3JD0A 3K0AA 2H9YA 4UVHA 1IIBA 3AUJB 3E3LA 1RYZA 2MIIA 2C2ZA 2JCBA 2X5NA 2ZRIA 2HHCA 4LSGA 4IDBA 2NV2B 3N39C 1T5TA 4TTPA 4TTQA 5CNIA 2VJQA 2AR7A 3VJMA 1H8HA 1AA6A 4KK3A 3TRJA 2E5LB 2HYDA 2GYVA 1DINA 1NF2A 4AICA 3HN6A 4X1KA 1BN6A 1VMAA 2NZ8A 4QXMA 4MCAA 3NHFA 4KWCA 4JB2A 1E9BA 4R71A 2GZRA 3K1TA 2YDYA 3BXXA 2J9XB 3SDBA 1YC2A 3GU3A 4UE2A 2DTDA 2XY4A 5D3ZA 3CF4G 3N76A 2I34A 1N7HA 4PHGA 5HA5A 3ZHSA 4D9IA 5A7FA 3SVZA 5FTNA 3NDRA 3AMVA 3QW4B 1EZ1A 1KORA 2Q1UA 3BVPA 4X8MA 2WYHA 3KZMA 4M7PA 2YNMC 1AH2A 2I2XB 3C14C 2RDMA 3P2YA 4DREA 2GJ4A 4MR9A 4JGIA 1W47A 2FMUA 1II8B 1MXFA 4NBNA 4ACAA 4JR2A 2XVMA 1SMKA 3LX5A 4QGSA 4LDQA 4NKRA 1KY5A 3ZDQA 3CG4A 4JNKA 2HRZA 2XTZA 2N42A 4OTZA 4CTMA 5JCJD 1T8TA 2IS2A 5FBLB 5C51B 1YXMA 3C7AA 2UYCA 1U02A 2GRJA 3AR9A 1FQOA 5J40A 2C8KA 1FRNA 5LP6B 3PEYA 1O5TA 4L0QA 5A3JA 1A77A 3PD0A 4KLAA 2O4CA 4W63A 2OXFA 3FDJA 4R1OA 1XJCA 2F55A 1AZSC 3GHHA 3NWPA 3EIOA 1W1WA 5FWYB 5BQ3A 5DNAA 4LJLA 4HZUA 1HO3A 4RIGA 4BNDA 1Y3IA 1IY2A 2UZ3A 3QHQA 2WF8A 2WTBA 3AEKB 3KR0A 5H3CA 4EYKA 1P39A 1OWPA 1I0ZA 1QFZA 3SKVA 1DTEA 1CLUA 1P1KA 1YUMA 2JFOA 4IG4A 3S70A 1FTWA 2LNDA 3FETA 2E4ZA 3A9TA 3EODA 4NEHB 4LCEA 3U7QA 2IBMA 2I6UA 4NBKA 2O2GA 1Z88A 3EK2A 1ZX1A 4GRAA 1EFUA 1DI0A 1L7OA 1OBOA 1R0WA 1Y98A 2QRKA 1QZUA 4LV8B 1ZKMA 2XODA 4KQ2A 4FB4A 3T06B 3MGGA 3HB0A 5JQGF 3FHOA 5GZ3A 4WN3A 5KQMA 2A0FA 5DI3A 4YX9A 4EA7A 2SCUA 2ASEA 3OPXA 1E18A 4B3JA 3M6MD 1FNCA 4I36A 4IEEA 1JEDA 2GCGA 1LWNA 3WYGA 4EJSC 3T3NA 1ECPA 5B4VA 5K4HA 2CSXA 3EGXA 5F1PA 5F2OA 1XZBA 1GNVA 3HFGA 3Q1LA 4JXJA 2YV1A 4KMRA 2PJDA 4XIIA 4TZ0A 2Z6VA 1TMOA 3ZVNA 5JPIA 3ZU5A 2ZGVA 4BNMA 1CUYA 4LZWA 3CEPB 3NHLA 2C29D 3LS2A 3R6DA 1HZZA 4Q37A 1E2DA 1Z2PX 3B3JA 4LGYA 2P6PA 1ZRMA 3IEPA 2H6EA 2J3HA 5CBKA 2CMHA 1YDEA 3DEKA 3OIWA 4G0ZA 1HE8B 3AUUA 3FWNA 1RXVA 3EAQA 2PGAA 3IAEA 3U4HA 2FEAA 4Q9IA 3TB4A 1BHJA 3UFXB 2VHVA 4R2WA 1QLHA 4U2GA 1FYFA 4N3NA 1ESEA 3D3KA 5FOTA 4D6PA 5LMUB 4NULA 4EKGA 2R25B 3PI6A 5KYYA 1QUFA 2J0UA 3QZUA 4HDSB 1ENZA 1IC6A 2SECE 3CHYA 2W42A 2VP5A 4UREA 4CODB 4NEQA 3VJLA 5EIEA 4P33A 2YASA 3RS7A 5SZHB 4A0SA 5AFSA 3ORYA 1QH8B 4KKXB 1G98A 1GGFA 1R9NA 2XUKA 2AL7A 3OICA 3HXOA 3STVA 1ORIA 2EZUA 1T0UA 2R84A 3GLSA 3UUFA 5K8UA 2F8TA 2HB6A 5EJAA 4TV9A 2Q2QA 2CVZA 9LDBA 5IASA 3FOZA 4BMSA 2JAOA 2P6MA 2QTTA 2YXBA 4BASA 1BNCA 1LNSA 3WHLA 5IAKA 3GJSA 3U3JA 1BFDA 3ANYB 4ZN6A 1TVCA 1IPFA 1UZNA 3ZC3A 1GZ4A 1XTPA 3LX6A 5BQOA 3EVCA 4IEFB 1PJ3A 3PLAE 3QPBA 4RD0A 5IAJA 2PKCA 3LWNA 4EUKA 1SGWA 2JKYA 2ODEA 1KIFA 1UP4A 3MMNA 3AOEA 4MK4A 1PF7E 3UV3A 4NNOA 1GADO 1Z06A 2G17A 5TY0A 5BNWA 3MJVA 4ZOCA 4EGJA 2WJJA 3B6EA 4O1MA 4JV5B 4ABTA 2IU4A 3IQIX 1DBSA 4MQ6A 3Q10A 5I4BA 5JEEA 3DJYA 1VECA 1YCHA 3G0OA 2CXHA 3L92A 2VVTA 4IF4A 1LBQA 4EEKA 3PNSA 1X7XA 4QULA 4YV2A 5BQXA 2TMYA 4L95C 4L4YA 4M2LA 4GXNA 4UVGA 1N9ZA 4YRDA 4E13A 1TW3A 1QAOA 4EX6A 2JG3A 4W5NA 4ZJZA 1J2TA 3E84A 2V9CA 1NOJA 1V8DA 3IUQA 5B37A 3CF2A 3TTYA 3PFWO 1C7RA 1NKTA 3E7XA 5C3MA 3KQKA 1CDZA 4H59A 1C8VB 5K01A 3VKVA 1IBCA 3CZ4A 1NM5C 4OQ4A 2CNNA 5CIWA 1E6KA 2FE1A 2P5YA 3BZUA 4XTCS 4YDHB 1E3WB 3S1SA 4L4ZA 4H0NA 1FFHA 1U2RA 3D31A 4KQKA 4UCQA 5CT9A 2ZJ7A 3V4ZA 2JARA 3N74A 4D9GA 4BECA 3MTGA 1EFTA 1JEYA 1QHNA 1XXHE 2OCYC 4CM7A 1ULTA 4UE6A 2XCQA 1LCIA 5FNVB 3QPDA 2VAVA 2HF8A 5K0GA 1Z2EA 1YR1A 3M81A 2AG8A 4BX8A 1JXOA 2VHZA 5F9FA 1HXHA 2FG5A 1QTQA 5A9SA 3FCOA 3LT1A 5UKDA 5I4KA 1EESA 4ZGWA 4BO7A 1Q1QA 2C54A 4B3IA 1EMDA 2IE8A 3NX4A 3F73A 3KWJA 5F9HA 1EXDA 4BFTA 2B4QA 3C3CA 2D7JA 5EXPA 3KAJA 4FX5A 1NUUA 2JLAA 2OCPA 2XUAA 1TQ2A 1XD2B 2QP3A 4R05A 1KBOA 1GPAA 1CK4A 3HN7A 4G9BA 3FVRA 1RQXA 1QU3A 3KWMA 2WF6A 4B3GA 4J03A 1V7ZA 3OCWA 3VU0A 3VVMA 1O6CA 4MQLA 1EE1A 4L8YA 4TTAA 5FHQA 2ZATA 2ATXA 4YQEA 2C7OA 3EBPA 2VEOA 5B64A 1YOVA 3HJFA 5DGDA 4A36A 2R7KA 3LHSA 3NC4A 3RYHA 2X19A 2C83A 3EZ7A 3FTFA 5KCZA 1EP3B 2ZBGA 2Q1WA 1X7YB 2XUDA 2YH2A 5AJZA 1WD5A 3IJEB 4OHBA 4R1MA 2O6LA 5KVSA 2WU0A 1HDRA 4OO3A 3IESA 4BGEA 2NZYA 2QLBA 1IK6A 4RPHA 3AJAA 4O4IA 3I76A 4ACBA 1SULA 3GPBA 1YR8A 3H8VA 1V7PC 2GO1A 3W3AH 2YMLA 4P5DA 1TM4E 1W9MA 2XWSA 4GLFA 2Z3VA 3AHJA 4EVSA 4ND5A 5EE3A 4ZMBA 1CD5A 5F35A 2H2FA 3IIMA 3LF2A 5BSTA 5FEUA 1ZS9A 5ALZA 3F78A 1NA5A 1KAOA 2C4UA 1NI4B 1A1VA 3A32A 1KOFA 4J1TA 1V8FA 3KLOA 1IQRA 2QJFA 2JA2A 1QS0B 4TMVA 4ZVRA 5KQRA 2IELA 3FCXA 2E6KA 1DEAA 4LY0A 3BOSA 1GRRA 1T26A 3NHWA 3AEZA 4W7HA 1CPYA 1P1CA 4BMNA 1CR4A 1FRVA 1PT8A 3A9WA 4MTCA 1P45A 4ZDJA 4U7DA 5LZ4A 1KH1A 1NRJB 2WZBA 4O4JF 1DCTA 2UKDA 4LHYA 4R1UA 4DCTA 5LQUA 1VG8A 1JDTA 3IURA 1Z33A 5BMOA 1PZFA 3UJ9A 1JXQA 5J63A 4E0BA 1P33A 2R1TB 4U02A 1X13A 4IMIB 2OPHA 3TQHA 3EJWA 2FUG6 4XB1A 5FT9A 4LJ6A 1ZMXA 1I13A 1DC3A 1IN6A 1T9ZA 1VKHA 5BWCA 1TJ4A 4Q3EA 5AHRA 2W90A 2WKSA 3ELBA 1VJRA 1QZ3A 3BWCA 1NVXQ 2M1XA 2I5PO 4DT1B 3JARB 1ZK0A 5AVZA 4IXMA 4C03A 1G8PA 3MRVA 1D4OA 4YFYA 2HLDA 1EWKA 3TG8A 3DFIA 5BMVF 1XUOA 4PXAA 4E5UA 5JFOA 2ZJBA 1DAHA 3JXEA 2QQFA 4AKIA 1QHHA 4ZOEA 1G2OA 1NRXA 3FYTA 3GLKA 5JR3A 3M83A 1Z26A 1E9AA 1EXNA 2XBUA 1O9GA 2G63A 1B43A 3I1IA 1W4LA 3P20A 1BXGA 1ES9A 2Y1GA 4FMCB 4CI0B 3DM9B 1GO2A 2P9ZA 3U3KA 1FP4A 4MAFA 4EVQA 1K06A 4CCYB 5KNDH 3AO0B 2NO4A 1XQVA 3HB7A 4ITRC 2B3TA 2JD1A 4MUIA 1EFKA 4PR0A 2NSYA 1JSXA 3W7VA 5JATA 4MITA 4BTLA 2FPUA 2ZAOA 3NRJA 1MC5A 5CW2A 3RUCA 1K86A 4YPVA 3RADC 5F52A 3CJTA 3A36A 4W4TA 1L4FA 3AW9A 3ZCSA 4LFBB 2AOTA 3I8SA 1OLSA 1T1IA 4TSFA 6Q21A 5T67A 5K20A 4PLVA 1WJGA 4ZCRA 1N6RA 2YS7A 1VJ5A 2BEVB 3FOWA 2NP7A 1E4YA 1Z6GA 3VH3A 1WVGA 1UMKA 1ZKDA 2PLWA 3I9V6 3TZCA 1NPDA 2AMLA 1N25A 1UMBA 2E4YA 3F7TA 3ND8A 3MTBA 4GU5A 2CXRA 2JFXA 4RKFA 4ZT6A 1U0BB 2VLBA 3OY2A 4E2XA 3HUUA 1ORTA 1PLJA 2VCYA 4XUDA 3GDHA 5CW1A 4AJ9A 4EZBA 3IV9A 2VJBA 4J91A 2L17A 3AYXB 1O6ZA 1E2IA 1JECA 2OB1A 3ZZ1A 4ECEA 2WQZA 1V48A 4GQAA 2PS1A 5B1YA 3G88A 2KI5A 3HV2A 2FRVA 2OLJA 4BYMA 4C78A 5I7RA 1T2NA 5CT5A 3S68A 4JJ4A 2HXSA 2BF4A 1I10A 2XT0A 3H19A 1RQLA 3NC0C 3GEPA 1O97D 3FXAA 3OAAA 3IEUA 1ACMA 3BAFA 3DMFA 2IZZA 2JIOA 4K7JA 1QNLA 1ZUNB 5FJJA 3G9QA 4ZFNA 1R37A 1J2UA 5IBCA 1JPUA 1VLVA 1Z6AA 3R4CA 1AM4D 1W44A 3ZWYA 4L28A 2JNWA 4GXRA 5EP2A 2B0JA 1EXMA 2GSWA 3OFSA 5FTMA 2BCEA 2GAIA 4MV7A 3GJRA 2IXDA 4JJGA 1HA3A 2JLUA 2B7CA 2BISA 4ZANA 1TT5A 1QCCA 4AF7A 3OLQA 3IVAA 5BOSB 1RM5A 3RH0A 2NPOA 4IUDS 5AKYA 1OI4A 1S7GA 1M3SA 4TMFA 5IMBA 2OHIA 1XTSA 1J0XO 1V5EA 1M1UA 2Y1FA 3WK4A 2GRUA 3ZZ0A 2JFBA 4DA4A 1PYOA 3AFHA 5CTJA 5TRTA 3TTWA 3ZNPA 3WQHA 1OIVA 2I7XA 2I65A 4MNTA 1T29A 5AUNB 4OFWA 1GSIA 1I3NA 1N2CB 2FN4A 2Z30A 3LWDA 3OJCA 4POAA 4Q4LA 3IVXA 4ZU3A 3L0IB 3WGTA 4JBNA 4BAZA 1UPAA 1Q74A 2CZQA 3H7AA 3EQ9A 4RGQA 5EQTA 4PRYA 3DCJA 3UB2A 3ZDAA 2F8LA 3E7FA 1RJGA 2EFHB 2DXIA 3RU7A 1BS9A 3NHMA 2ZTMA 2ZUWA 4IHJF 1TK9A 2HY7A 2V4ZA 3DT8A 2ZT7A 1QIDA 4XB6B 2Q1XA 4K6KA 1XCMA 2GCNA 2GXUA 4JYPA 5FUQA 2ZTVA 3RO7A 1OX4A 1E9SA 1E4VA 3DWEX 2WDPA 1AKEA 1B16A 1XEXB 3BHNA 4O2RA 4AU1A 2AT1A 5CD1A 3K70C 3MPUA 3IDAA 5EXXA 1ZHHA 2C2XA 3PHCA 4PINA 3K9FC 4AY2A 3OT1B 2VBFA 3OLCX 1RZRA 2ZTUA 4QXAA 5FL3A 2C9YA 2EP7A 4OHKA 4JKOA 3FDZA 1PD0A 2OM2A 2VZEA 1ML3A 4Q48A 1U8AA 4A7PA 3M5WA 4AM8A 1COWA 1Q12A 2RGXA 2QX9A 4KAJA 3HO6A 2WE8A 3WLFA 4KRFA 2O8CB 1TMGE 3JQGB 2O05A 5EE1A 1WUIS 3CG0A 1MAVA 4ND8B 1P4RA 3C39A 3ZWPA 4DV0B 4LDAA 1L5HB 3LLMA 2CK3D 3GJQA 4O59O 5EIBD 1U7OA 1OREA 4OHUA 1V9CA 3G85A 3DDSA 3QKRB 4FZ3A 4WXYB 2HHAA 4ENRA 2P6UA 1E3TA 4B4WA 4HADA 4O2BB 1FNBA 2GEFA 2BBOA 3H2ZA 1M34E 2A59A 3FRIA 3I1FA 4KFTA 3T7TA 4IJQA 2HDOA 2E21A 4UUAA 4DLBA 1UBHS 2FX5A 1ZZEA 3NJ8A 4RF2A 1LWOA 2R11A 1ZEMA 2HDWA 1NVEA 3DE5X 4NYMQ 5ALDA 4UM5A 5KDDA 1WZ2A 1FNNA 1HDCA 1OY1A 1RU3A 1V16B 1ABFA 2P9TA 3K9HA 4JNCA 5HG0A 5A4JA 4DA6A 2BI7A 2FQWA 3D8TA 1M5RA 1AG9A 2XTNA 4FHZA 5FR2A 3P45A 3OCXA 2EBFX 5KBYA 4W8HA 5LYJB 3CPSA 2V6IA 1ZLYA 5LQCA 5GWXA 2P35A 4B34A 1LX7A 2Y76A 1UODA 2HMYB 3WMWA 1A9SA 3R6WA 3U1TA 1SRRA 3TK1A 4E4YA 1W6UA 1PWYE 3D6JA 4S12A 1JU9A 1VZ3A 4WN9A 5AM1A 4PGAA 1K5DA 3GN1A 4WY5A 2A1UB 2OV8A 2XCTB 3WKEA 4MQFB 1L7DA 4YMVA 2IS1A 4E12A 4B46A 1UBLS 2WG2A 1U98A 3NIGB 1DRJA 3DZBA 1KYTA 2D5CA 4X41A 2VWQA 3OT5A 3TLEA 5G0WA 1I6WA 4DJFC 3W3AA 1XSEA 2PQMA 4HC4A 4C2AA 5CDSA 2NYAA 5LWQA 4TKUA 4QQKA 3NTRA 1LU9A 1WPXA 2H4WA 3DOOA 2XDYA 4GD3Q 3BN3A 5T57A 1VI5A 1JW9B 2OBXA 3C48A 4RFSB 4BDTA 4ERXA 5GIPE 4LHSA 2DERA 1GNLA 4LTNA 2X58A 3QBTA 4XYBA 3G0HA 3ABZA 5J9FA 3P27A 3BFXA 1IULA 2ZRAA 5FQNA 4NJOA 1GR1A 4NJMA 3KKLA 5K0LA 3TRIA 4BTVA 4EELA 4BMCA 3OPQA 2BBSA 5LUBA 4G5HA 5TPWA 3WJ2A 1L1EA 1KWKA 3BHMA 3DNMA 5ERGB 4JEUA 5CX1A 3M3DA 4OU5A 1VCMA 2IHBA 4G0VA 2TRSB 3JQ9A 4OHFA 5NULA 3UV7A 2D5BA 4DBLC 3DE7X 5CTAA 3RRZA 4E07A 2ZJAA 3H9GA 1J2JA 1JTFA 2VQEB 2OFWA 4MQUA 1KDOA 2IHTA 3TGWA 3G0GA 4HO1X 3BSFA 3GJ5A 3RKSA 2I7DA 1SRQA 1Y9AA 1YRBA 3WQQA 3ZWXA 1MT0A 1T8PA 3FDIA 4BQFA 1WUYA 2O07A 4LYFA 4OK5A 5K45A 5MFPA 1RE1A 1TQDA 2JAUA 5EWMB 1P1HA 3T0FA 4C2UA 4L8VA 1QZZA 2IYTA 4F3CA 4RJJA 3QMPA 2G1PA 3FPKA 4DIOA 3LU1A 2X8AA 3EXFA 1WMEA 4LF6B 1P5FA 4OHXA 4RDXA 2H54A 3L7BA 4F4CA 4CLOB 2O8EA 1E9EA 5I9MA 3U7FB 4YN3A 5HJ7A 4EKEA 3PNKA 3BFJA 3HRIA 4JLBA 3REGA 1MX1A 3I9FA 4QARA 3G3EA 2B21A 4NCNA 4OHRA 4Y9RA 2F3RA 4KO1S 5KNDA 1GR0A 3EISA 3W8RA 2JBAA 1PJAA 4M6WB 3I05A 3VPDA 2XVYA 3CEAA 4WY8A 5B1EA 1PNOA 5C8YA 2PBZA 4EABA 3RJZA 1XCGB 3PHJA 3TPZA 1RC0A 4E15A 3PFGA 2P1ZA 1RXEA 2BGWA 1UFOA 3LL7A 4BS9A 3HC7A 3FZQA 3ELWA 4LF8B 3LW8A 2XOKA 5K3OA 3U4QB 1HYBA 4ZEVA 3JVDA 2VYVA 3WMFA 4H7IA 3DKKA 1SA0B 1ZRSA 1GGHA 4UHHA 2KSQA 4GIBA 4OXIA 4QICA 4Q7QA 2QMUA 2ZRGA 3EQ6A 4WZBE 4U8HA 4FQ8A 1TJPB 1MTZA 4GICA 4QYWA 2IU6A 2FR8C 1J4AA 2GHRA 3CW2A 3KHUA 4IJKA 3DEAA 4R54A 1RWMA 3GDOA 1R5JA 1JZQA 4TSRA 4MROA 4EOGA 4CF7A 4MA4A 1HLFA 1WXIA 2CEKA 2FSHA 4W8GA 5CLLA 3T12A 1ZJ4A 1NI5A 3RARA 4X63A 5A5FA 5BN3B 2X8LA 3KPJA 1QIIA 2YYZA 3NOQA 4BKMA 3OESA 1QYXA 3QVOA 4EW2A 3ONWA 1FBTA 4AJKA 1XEFA 3S1LA 1JVSA 3ZLUA 3DLPX 1EI9A 3C70A 3RUIA 2G5GX 5CB6A 5CJPA 3AU9A 1FW6A 3AXTA 3CLKA 5BSUA 3GT4A 5AD1A 1T9AA 5ICCA 2GPSA 4E5MA 3LGXA 4JJZA 3AKYA 4DLRA 5EQJB 2XB4A 2O54A 2MR6A 1ZW6A 2CDRA 2H18A 3HBJA 4J3FA 3EG9A 2XE7A 3E2MA 4WA8A 1DBQA 4PBTA 4Z1MA 2P1RA 2Y66A 2M6KA 4LRQA 4MVJG 3S2UA 2WSBA 4ZOLF 2VXYA 2ETVA 1JU3A 1CUJA 1E3DA 1NQWA 2WAYA 3SKXA 3JALB 4Z54A 4ZRMA 5FB3A 4B47A 5I4IA 1C9KA 4PN7A 4RQAA 1AGPA 1PQPA 2X40A 4CV0A 1ZMOA 1ZCFA 1UK7A 3Q98A 3PUZA 1JLRA 4JU9A 2HLHA 3DV0A 1Z5OA 3EXEB 3LUPA 4IIHA 4N1AA 2OCKA 2GZ2A 3QE2A 4QWWA 5CH5A 3RS9A 1CJKC 5F23A 2VDJA 4QE3A 2ZYGA 3Q2IA 1XZGA 2IPMA 2PE5A 3E8SA 2IPNA 3E35A 4S2EA 2A30A 1KDZA 5L53A 2B6HA 2HT1A 1N1MA 3ZCRA 3W9BA 1Q6ZA 4KQCA 2GHQA 3WKDA 1B74A 3QWBA 2XUQA 5B4UA 4ALLA 3QE3A 3ZLTA 1SPXA 2ORYA 1P1JA 2Q5IA 3ILYA 3EEIA 3LFUA 3RBVA 4ZCQA 5FFFA 3FKQA 3R6TA 2PCLA 3H4VA 1M9NA 3L4EA 4OAQA 3OE5A 2QAGA 4OX9Y 4I55F 1ONOA 3MS2A 4IDGA 4F96A 3AHIA 4IDCA 1QRAA 5JSZB 4LCJA 4H6PA 4HRAA 2HNBA 1BEZA 4HWPA 3KQHA 3FOEC 4KH1A 1N78A 1EJBA 1QLJA 1KU0A 4L8LA 4DAEA 3O3MB 4G0OA 1JQ3A 5EXEA 1SOAA 4OKNA 5DRYA 1TMKA 2QGNA 4PVCA 3NM5A 4ZARA 3PGKA 4UEQA 5GM1A 5IZCA 4QQFA 4DTIA 1L2TA 1XCLA 2VF5X 3NKVA 4Q18A 3RC1A 1V95A 4HOYA 4M8KA 2JJ2A 1XTTA 1SC6A 1WMDA 3KTAA 2CB9A 1NULA 2BHTA 2XDWA 3GLRA 4X7PA 1QV9A 2CFSA 1OXTA 3AEQA 3N2IA 2ENUA 4BB6A 1F51E 4K6MA 2H7XA 4DSNA 3S8YA 3T1NA 2FSSA 1Q15A 3AVUA 3NBFA 5T4BA 1M1YA 3T7JA 5AWFC 2CVPA 3L7IA 1EFVA 2FWMX 4XARA 3NBZC 4FR0A 5KWSA 2AFHA 1M2HA 4IQ8A 2B8NA 2NVBA 4MWTA 5K8LA 1G55A 2G6TA 1M6VB 4RGVA 4R5MA 2JFUA 5DLPA 3W06A 5I48A 3F96A 2H48A 5BRAA 2YJ3A 1XPJA 3BMCA 3EOBI 1H2ZA 3DP9A 2Z5GA 4WI1A 2G9QA 1GDDA 5EHGA 3V4VB 1FFDA 1Z15A 1GZ5A 2O50A 2XQJA 3BSSA 3WSVA 3D6TB 3EUAA 1E60A 2BJVA 4OLHA 4KQ6A 4US0R 2R5NA 1C0IA 1L4KA 2WYOA 2FPPB 3S6JA 2PSJA 1C4OA 1KR5A 2QTZA 1XMPA 2JAPA 3KU4A 3M6IA 2IZ7A 3P2KA 4GKKB 4D2IA 4EHJA 1C50A 1T3GA 4EJMA 1F2TA 2WF5A 3GBVA 1L6IA 1OSNA 1T43A 2MHCA 2NVOA 3EGOA 3U7HB 1PT6A 2Q45A 4JB0A 1YVDA 3MQ2A 3K0AB 5TR9A 2I1WA 1S8FA 5MHTA 1WETA 2EWMA 2JATA 3IDOA 1XC7A 2FZ5A 2ZSEA 3KDPA 2WU3A 4WCVA 2XB9A 3BBLA 4Q3LA 4TWBA 4EG3A 4EZIA 2AHOA 1NY5A 3D8RA 4CIXA 5JYEA 3JZDA 1SG6A 4V0ME 3CZAA 3ISJA 3M49A 3SR3A 2A78A 3UYLA 4JP5A 3HFJA 4F7DA 5HQJA 3LDUA 2ZE7A 3IEKA 5JI2E 1J99A 3IMGA 4WOCA 2DKOA 1L5FA 4F92B 4MUKA 1H6CA 4X65B 2Q0HA 3KEOA 4QDKA 3ZV4A 5IJ0A 1VLZA 1ZITA 2YX1A 2Z2YA 3HP4A 4MR9B 3RVOA 2OMEA 2C9OA 1E1YA 4ZZ0A 4JP1A 2HYIC 1Y4ZA 1E0AA 2UYHA 1C0EA 2Q50A 2EX4A 2QI9C 4Z0HO 4ZZ3A 1UT6A 2CXUA 2J6HA 5I7UA 4HRXA 2PRKA 1TPYA 4EL0A 1A4XA 3B48A 1BD3A 3JZFA 4YRNA 1E1DA 4I5GA 4BKUA 4GBGA 4YS6A 1SUIA 2E87A 4LJAA 2E55A 3NYQA 1C8BA 4P81A 4OQLA 1CY0A 4AJEA 5FV4A 3UJ3X 1GFWA 2EJVA 3TH5A 1MF7A 1EUZA 1K6MA 2O2YA 1Z39A 1X8LA 2UUOA 1BS1A 3NHJA 1Q11A 4QEDA 4IVQA 4B0PA 4BNDB 1L6RA 1O87A 3MJCA 1D2AA 3C4JA 2IFTA 3DO5A 3TIXB 2H5EA 2WHQA 2YYYA 3S2IA 1Z07A 3SG0A 2ASVA 3UAXA 2AG0A 1GKUB 1GU7A 1NP3A 3Q72A 1U2TA 4OUDB 3U7QB 3EYWA 5DASA 1E66A 1KO1A 2VBGA 3PX3A 5FP0A 5SZIA 3R3VA 2BPOA 2D1TA 2XQGA 3SIXA 1SVOA 1DU4A 1XZJA 3IE2A 2UZAA 4HGOA 3I42A 4DHWA 4C7VA 5D2CA 5IKXA 3NH9A 3QNUA 2IHYA 5BW5A 2XB2A 4GOND 2SCUB 1NRIA 1GGVA 5K0CA 1WBBA 1I32A 1J8YF 2XBLA 3PL1A 3GQBA 2J6IA 3EGXB 5E6SA 4RTMA 1GZHB 1I01A 1I4WA 3FB1A 3K0BA 3ZQ6A 4QGAA 1WCV1 3UMGA 1RHRA 4R4JA 1XQXA 1AQNA 4AO7A 1NQUA 5ARBA 3LY9A 1KJZA 3RU2A 4B31A 5I4CA 1ZR4A 1OUMA 2VJMA 3B9BA 3CH4B 3DGFC 3KELA 4Q3AA 4B75A 1OX5A 1S9HA 5L7WA 5CB4A 4JEIA 1DRVA 1Q1BA 4D0SA 1A7JA 1T0JB 1CUZA 1Y8QA 3SJZA 4XCXA 3UAWA 2HU7A 2RHMA 2GXQA 1VL0A 4N4AA 4YP0A 3F6EX 5I9BA 1YFZA 5KYYB 4XYGA 4PFKA 1MIOA 2J0UB 3OX1A 1J20A 3CNLA 3JD3A 4UASA 5AK4A 3VX4A 4CLXA 3KSRA 5FWXA 4DIBA 2KQUA 1JAZA 3BCRA 4M46A 1LK5A 2J09A 2ZULA 1BJTA 3Q7QA 4HLQB 4FHFA 4MMZB 5GONB 4EMSA 2IUUA 1FIUA 2PIAA 1KJQA 2FJ0A 4HGZA 4K40A 2CL7X 1IEXA 4LGMA 1R8XA 2PBFA 3I2JA 4FFVA 3ZU2A 1JP7A 2G40A 3DC7A 5J58A 1G64A 1I4LD 1X14A 4TV9B 1RFLA 5IT0A 3IHKA 1L8XA 1E3MA 1AUPA 1KXZA 1KI8A 2XCLA 3K09C 3BEDA 4KLZA 3K53A 4U6QA 4X20A 1C0PA 2P67A 2R8PA 1T36A 3FVTA 2J59A 2MYNA 2O1XA 1A76A 3M2TA 4D3SA 4INAA 2VDKB 1BSVA 4RJKA 3V55A 1NZDA 4JP3A 3IPCA 1E6WA 3MFYA 4TLEA 2EXXA 1D4AA 2DG2A 1BROA 1WE2A 1AS3A 1GLGA 1QDUA 4G5QA 4Q1EA 3UHFA 4F3YA 3RAFC 1VRVA 3Q9SA 1TZCA 3ZU3A 5FUMA 5JROA 1C29B 3LRXA 3NONA 4DA9A 4FVTA 3BFVA 4OQZA 3TRHA 2R8EA 1USUA 3T5CA 4XGIA 4P98A 2C4KA 3HG7A 3PTAA 3BYZA 3TAHA 4KNWA 4BO2A 1A5SB 4BYGA 1PR3A 1T8YA 1KSJA 1X7XB 2P3SA 3SE7A 1ZRHA 1V37A 4GWGA 4XWAA 2BEJA 2QUJA 3RAGA 1C14A 2OWDA 4KBYA 4AZVA 1JHPA 5HM6A 3IA2A 1H2WA 1WDLA 4YCSA 1LSUA 2F1IA 5DOZA 5EIOA 2QSUA 3KKKA 4L07A 2K87A 3D4OA 1WCIA 1G38A 1O94C 5CG1A 2G72A 3RD5A 4OGKA 1YRHA 1NFQA 3JTEA 5TXGA 1IBKB 4UDOA 4X90A 2RC6A 4C89A 1O7JA 1NUPA 3GHYA 1V1RA 3HFRA 3DDHA 3QBJA 4X44A 3ZN2A 4HEQA 3HKCA 1JEYB 2XZDA 3PXGA 1AS2A 4XSHA 1QK4A 1APBA 3EH1A 3WLHA 3OFJA 4OHCA 2Y99A 3NHBA 3WK6A 2EW8A 5EXTA 2P4EA 4GAEA 1EFLA 1NJ2A 4PBRA 3U80A 1GGEA 2HNKA 2VPIA 3L1KA 2X0IA 1JUDA 1VGVA 4NCHA 5TQ2A 4CM4A 1QK5A 4LISA 5IFKA 1DEKA 3PKJA 1RPZA 5C5IA 4B1FA 2FMTA 3IQZA 1U0OC 3C24A 2JFNA 4X71A 1HFWA 1HYGA 1X1BA 5JZSA 4O4HF 2OHFA 3OO1A 3BF7A 3K71B 3L6DA 5BYKA 1E1RD 1NMYA 3ICOA 4AY4A 2LDXA 1WF6A 1CCWA 1C7IA 5EKSA 1JFVA 1HG0A 2WWIA 1OB2A 4P7GA 5L3RA 4IKPA 4KVFA 2XGJA 2VXCA 4HB3A 2DBZA 1ID8A 3ZXSA 4LDJA 1CUUA 2WTNA 2WHEA 1YOVB 4GWKA 1AO0A 6NULA 2XKKA 3T5MA 1DKPA 1NNI1 3JZMA 9GPBA 3RYHB 3SSNA 2XNCA 4G0XA 4P80A 1PSZA 2XVAA 1FDTA 3K0HA 4B7CA 2QRMA 2QR3A 3GA0A 4L5YA 5DJ5A 3A2KA 3F5DA 4AECA 5J2TF 3L7YA 3KEGA 4O4IB 4L78A 5CIYA 5C81A 4RFVA 2DFKB 2PXCA 1U8EA 2QW8A 2WNHA 4B4UA 4BCBA 1PWEA 3NCHA 3LT4A 4WOKA 2ORVA 2QLMA 1HORA 1L7MA 2OA0A 5K1ZA 3U4DA 1SUCA 1W9HA 2NO7A 4K9DA 2ILVA 3RLFA 1BQEA 1CQIB 1HMPA 2J85A 2DMRA 3KOOA 3PGA1 4R1NA 3ZE1B 5TS3A 3WHPA 1FSZA 2YJTD 3EVZA 5BN1A 2XZOA 3GCZA 1DDOA 2YIDA 2VJYA 5L3VA 1GHTA 3R3SA 3TIVA 2JIPA 2ZT6A 2GUGA 3H99A 4MUAA 4ZVQA 3FUCA 1EB9A 4DQKA 1N1DA 2V98A 5ALSA 5LVAA 3HNRA 3LK7A 5F7JA 4QDXA 4I8IA 4ZYLA 1KYQA 1R8YA 4BNFA 1CBUA 2J08A 1M83A 4C0SA 4GZLA 2VFAA 1DS6A 1GITA 3EUWA 3P94A 3ZWBA 1OD6A 3M6FA 2ID9A 4NBSA 3WLIA 2QU8A 3L7CA 3IOCA 3AEUA 3K8ZA 4RA6A 4C0JA 5DCWA 1XZHA 2WT4A 3EWNA 4C4ZA 5A4IS 2HWXA 4IIJF 3BGVA 3LA8A 3LHFA 2RGGA 4B3RB 4LX8A 3PX2A 3FB4A 1N6NA 2NXEA 4GI1A 5DBHX 1EP2B 1EEXB 2WFLA 1IQUA 3FYHA 3LQ2A 4RHUA 4ZC8A 5KYUA 3TVYA 1LPMA 2Z8XA 3CRZA 4X6YA 5KYWA 3OWOA 4QOHA 3COZA 4Q9KA 5C4MA 4WLOA 1OFVA 3OFND 2PUHA 1ML4A 2HXGA 2WQ6A 2C3YA 3ST7A 5DTIA 2BUCA 1M5UA 2VQ3A 1E77A 2OYSA 1KO8A 2OHGA 4B83A 1FA9A 1DQPA 2WUFA 5E8JA 2IPXA 3DBIA 2PZAA 2QY6A 2JGDA 2Z95A 2V1XA 1P2GA 1QHHB 1KEWA 4QHYA 4RK7A 5CNKA 1LBSA 4MTLA 3RVKA 4KI0A 1EFPA 3E4CA 3GN2A 2ZBUA 3QEKA 3B7GA 4TKMA 5D85A 4JI7B 4ZYTA 3HDYA 4WOBA 2ERYA 4TL8A 5TGTA 4N76A 1B6GA 2I4RA 2Q0SA 2ZUDA 3AKEA 4RGYA 2QPAA 1FP4B 3OA0A 3BULA 3TKYA 3OLVA 1OI7A 2I0FA 4ZIRA 2J48A 2CT8A 1SCUA 4KGVA 2PVCA 4YQFA 2VP2A 5JSUA 5L3SB 1XN4A 4AJNA 3V42A 1YL5A 3L43A 4ZAFA 1F6BA 2XMZA 3CF0A 4GC5A 5AI5A 5E7IA 2CLSA 1P1IA 1I2DA 3R5XA 4DCMA 1N0HA 2AOTB 4PZPA 7GPBA 2HSJA 5T8KA 5AUPB 5BQFA 1FSSA 2OAEA 2A88A 4UE3S 2RGNC 3SMQA 5KJ6A 3RRFA 4LHEA 3GUHA 4QYTA 4HH1A 2HWKA 3KR2A 2HSDA 1CY6A 4KMSA 4N0DA 1UMBB 4QGGA 1J5EB 2PZGA 4TOIA 2ZR7A 1YT5A 3KYBA 3AV3A 2DFPA 1ETHA 4FLFA 5FF9A 3E7WA 3O75A 1E2GA 1XU9A 1QTRA 1WL8A 3B2NA 3LYUA 4PS1A 3D7LA 3PC4A 4G56A 3ENVA 1STOA 2LKCA 2NO6A 3QKSA 1K8ZB 2AN5A 2OEPA 2AD1A 3AY0A 1S2IA 3OLWA 4HMOA 1OWMA 5F2NA 1QX3A 2MYTA 2ZJZA 3TQSA 5E2IA 3BE4A 2GAJA 1L5RA 1PZMA 1NW8A 1SUAA 1H6AA 2CXXA 2I76A 1WRBA 3EC2A 3I9KA 5D5HA 1OFHA 2JIMA 5IYZF 4N47A 3SC3A 5LIRA 3V33A 1L4MA 1NTRA 4B9AA 1GLNA 4C4TA 3EG5A 1NLMA 3D8UA 3KNZA 3WGVA 2H2DA 1N2JA 3FGZA 1OYYA 5CYOA 4B4OA 3NUQA 4C07A 2IZ1A 4OYHA 4RPLA 2HPAA 1TT5B 2EWVA 1R16A 5B30A 1OAOA 3WGKA 4DILA 1UUFA 1S96A 4Z5XA 2RFLA 3DLBA 4P32A 1IWBB 1QAMA 4JP2A 2M6SA 3L0ZA 3I5AA 3WGMA 1TD9A 1QG6A 1I3MA 3GFRA 4JVLA 2QVGA 2C0QA 4KKVA 2OORC 4NV3A 1OTYA 3UVEA 1AF4A 2BZ0A 2C8LA 4I14A 1G20E 1UXIA 4G0MA 4B87A 3CR7A 3LCVB 5JD3A 2HD4A 1IFXA 5FULA 2GBFA 2D5AA 5F21A 5IP5A 1CUFA 4I50F 2XA1A 1J0AA 3HU3A 1I7NA 5DCLA 3SY8A 2ACWA 2C8VA 1FDWA 1PUXA 2RGRA 4KQGA 3SYRA 3H84A 4KEAA 1VP3A 1YI1A 3GF4A 1ISMA 5IAAA 3PPWA 4JYAB 1OX4B 2OLKA 2JANA 3PKIA 1WXGA 4GFDA 4PC1A 3ZG6A 1I2BA 3A1FA 4KUEA 4NI5A 3B2EA 4MP6A 1YE5A 3IILA 2J0VA 2P0YA 3S27A 5AVYA 4ILEA 1ORVA 3WICA 3HP7A 3FNIA 3VYRB 2PVPA 4LTDA 1PFYA 3MB8A 3UH0A 4F3KA 5DHRA 2CW5A 2ZETA 3WBJA 4JL6A 4QLBA 3IIEA 2E4XA 2HKIA 2FEKA 4D9MA 1JLHA 1WMSA 3LE8A 4HQFA 4D5GA 4QYMA 2VHTA 3GV0A 1PTJC 3PVZA 1RWQA 5KNCH 1TKBA 3H18A 1ZN9A 3OX4A 4FGZA 1E8NA 3BJZA 2IU0A 3NP9A 1WAMA 3A10A 2CLIB 2M6LA 4EECA 3L49A 4I8XA 2YJ4A 4MLZA 1QRUA 4L8GA 1N0VC 2I4TA 3KOUA 2XAUA 3CGGA 3CLVA 3K4QA 3TEMA 1N2GA 1WUHS 4CDGA 2C4MA 2QL9A 1ECLA 1REQA 2P9FA 3C97A 4BMYA 1ICEA 1E2FA 3KZVA 3H42B 1DG1G 1MOQA 2ODNA 1GG5A 4FB5A 1VSVA 2BR3A 4FN4A 1WY7A 2X2FA 3CLRC 3OIVA 1ATZA 4CIBA 4IJ6A 1TT7A 2P9EA 2WIGA 4D96A 4DADA 2FP3A 3L5KA 1N6HA 4LSZA 4R40A 5ALIA 4GECA 4WNYA 3DOCA 3IT0A 5D7BA 1NVWQ 5PNTA 1EWTA 1NWCA 4PSUA 4LV6A 1JA9A 2WUGA 4MEJA 3AVXA 2AHRA 3I61A 1SU4A 2GUWA 2IXEA 1N5RA 4M0LA 4RSHA 1VPEA 2JAHA 2XDQA 4WN9B 4EFMA 3A4LA 2FSFA 2JEYA 1CVIA 2R6ZA 3BFPA 1EVLA 3KSBC 1MRSA 4O4JA 5F7ZA 5LQAA 3S28A 3DM5A 3OA2A 1SURA 3ZDBA 1TW2A 3UMFA 1PZXA 1SCNE 1X1TA 1Q44A 5B6JA 1MX3A 2A8YA 2H1SA 4YJKA 2QSYA 4Q3KA 2AS0A 3W8FA 1H3EA 3VGPA 5LL6P 2OBMA 3VNUA 3AVWA 2OGWA 2FV8A 4KZKA 2ZVPX 3HHPA 3ROFA 1R64A 5IN4A 1FFGA 2JI8A 1M1YE 5GADl 3LTEA 2XQVA 1R6VA 4TMKA 3ZI4A 1XMQB 5NLLA 3NTUA 1AKRA 2W6QA 1YNSA 2AC7A 2ZB3A 2X9VA 2ZKLA 2I29A 4G8CA 1XF9A 2PO5A 4ENWA 4NXNB 4EHHA 5L4SA 4TTRA 2PWAA 1Z4OA 4B40A 3SHFA 5ED0A 5H4HA 3FWKA 1R0XA 1KEEA 2LXNA 3DC2A 4B73A 3QFSA 3OKPA 4EF4A 3IDZA 2AOWA 2Y2VA 5TPWB 3MC1A 5C0OE 1KWGA 1RXWA 2JJMA 1UDBA 3NM4A 2ANCA 5CX1B 2IIQA 3C5HA 4RTPA 4G1EB 5I7HA 1B15A 3D1JA 1JFFB 3AINA 3E3AA 1XTIA 1JYSA 1N2SA 1W0CA 4KO3S 3C16C 4HNGA 1ZVKA 1M5TA 4LS3A 3H2YA 4MKHA 3QTTA 3F7MA 1XX6A 2DKFA 2W2QA 1YQDA 2MMGA 2R47A 1DTSA 3B1WA 4J0KA 4L85A 1A5BB 3R23A 1D6NA 1X38A 2JGEA 2VA9A 5THXA 4LXUA 3KXIA 3H3JA 2YYAA 4LZLA 1CY4A 2C2OA 1K7SN 4M37A 4P4TA 1NJ8A 3DE4X 4PYLA 4D98A 5BY2A 1NE2A 1BU8A 1HE1C 3CCCA 4N8EA 1PKEA 4P35A 4YNBA 4CU5A 5AM5A 1RC1A 2QT1A 4J76A 4C20A 5BR1A 1WKBA 5E4TA 4PIPA 2UVPA 3Q8WA 1RVV1 1KY4A 3TL6A 5TSDA 3PC6A 3EXFB 1CLEA 1RI4A 2D59A 1L4HA 1T6XA 5IUNC 2O8EB 1T5LA 2BMAA 3ZWQA 2ADOA 5EJ4A 1D1PA 5IF9A 4O4LA 4WK6A 2J87A 2AOUB 2I4NA 2YWCA 3OE4A 2GYUA 2VP0A 2HQ1A 2UV8A 3QFHA 5AJTA 1GL9B 2R48A 1UWCA 3Q5EA 1UBRS 3O2QB 1J21A 5FUWA 3N9IA 3ZQUA 3X1DA 1KFBB 1SZPA 1XO1A 4L7VA 1V5WA 5ALJA 5CRIA 2B99A 3STXA 1JDBC 4Q3CA 1MX9A 1BVUA 2H1IA 2PV7A 3I01A 5C8YB 4CGZA 2H11A 1E5VA 3DL4A 4N3AA 3IUYA 1NDUA 2DFVA 2I3GA 1Q7GA 4YLYA 4DOMA 2BI4A 4JJ6A 3D54D 1OTXA 2P7IA 4AG6A 3ZWMA 1MZVA 4ZV9A 1AY0A 1BFKA 1FE8A 1NDHA 3ZKWA 1W4ZA 3X0DA 2GD1O 1B0PA 3ESBA 3OC6A 2CHVA 3EXHA 2B2XA 3LY7A 2BI8A 3OOEA 3MJHA 1M0TA 3Q3CA 1PAUA 1L5YA 3AUTA 3WI7A 4RH1A 1UC9A 3DQQA 1FVXA 4M0UA 1VPWA 2R1ZA 4U2KA 1P4JA 2DRIA 4KXNA 1FS5A 5HFAA 4ENTA 4BO8A 1RXCA 4NEGA 3WL8A 3G8AA 2WABA 4WSOA 3RUAA 4FYKA 3RASA 5CDUA 4IJUA 3VU8A 1RBQA 1DX6A 3OIDA 5DN6D 3A7EA 1QP4A 4NCAA 4HBZA 2HX1A 3MCZA 1U2ZA 1AS0A 3A6LA 1NV9A 3MJDA 3SS9X 3IIIA 2WB4A 1PYDA 1ZHFA 1J8MF 3O4HA 5HEKA 1F0YA 2RARA 1KPIA 4YH1A 1F14A 3PJRA 3EG9B 3SF0A 4FQ7A 2ZUSA 1I9GA 2VF8A 4IHJA 4KRYA 3R09A 4RM2A 4OGLA 2VCHA 5G3YA 4BUZA 1EVIA 1PVVA 2A67A 2I6TA 2IUFA 4LZZA 1NC1A 2JRCA 3K2IA 1RI3A 2OZEA 4ZQHA 4QNNA 3WV5A 8GPBA 4Y2SA 5JT1A 1IXSB 1YD7A 3A27A 4OHWA 5IJZA 3DEFA 1QZTA 2JHFA 4DDTA 3DV0B 3UMRA 3PNMA 3QUTA 4UBIA 2Y0CA 5AJXA 1JHZA 1T0BA 2EDAA 1P4GA 2EJBA 4MICA 5KHAA 5U4XA 5CVTA 2WAAA