2RG1A

Crystal structure of e. coli wrba apoprotein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
196
structure length
168
Chain Sequence
b'AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGGGQEQTITSTWTTLAHHGMVIVPIGYAGTPYGATTIASRQPSQEELSIARYQGEYVAGLAVKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein WrbA
molecule tags Oxidoreductase, electron transport
source organism Escherichia coli
publication title Structural organization of WrbA in apo- and holoprotein crystals.
pubmed doi rcsb
total genus 62
structure length 168
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rg1A00
2B3DA 4H6PA 3NLLA 2QR2A 2QMYA 3UXEA 2Z9DA 2ZKIA 3ES9A 2Z9BA 3NHUA 1FX1A 3FX2A 5LJLA 2OHIA 1C7EA 4QOGA 3KLBA 2KLBA 2MOKA 2AMJA 3QFRA 4H2DA 6NULA 1AKTA 1NNI1 4QOEA 4DY4A 1RLIA 1CZOA 1E5DA 2QX4A 1YOBA 3EYWA 1OBVA 3LCMA 5NULA 4F8YA 1AMOA 1AG9A 1XI2A 1YCGA 4YAOA 3G5MA 4HS4A 1KBQA 3TE7A 2FCRA 4BMOB 2QWXA 4GQIA 1H66A 3SVLA 1FLDA 1YRHA 2GSWA 3L9XA 1WSBA 4PU0A 2N1MA 5F12A 1YCHA 5LVAA 3ESZA 4LA4A 1T0IA 2BMVA 2R97A 3NHKA 1YCFA 4J8PA 2V5VA 1XT6A 1RCFA 1RLJA 2BF4A 3N39C 4XDGA 5EMNA 4C14A 1J9ZA 2BPOA 2QX9A 1CZHA 3NHSA 4Y7CA 2RG1A 1D4AA 3N3AC 3B6JA 4CF6A 4C76A 2FOXA 1GG5A 1QBGA 2MT9A 4FGLA 1J9GA 1D03A 2FDXA 1DXOA 4QOHA 1TIKA 5B3KA 4N82A 1KBOA 2BN4A 2WC1A 3ESXA 3B6IA 2F1OA 4LTNA 5FX2A 1DXQA 3B6MA 2Z98A 2FLVA 4U7FA 1AZLA 1ZWKA 5FA6A 3U7RA 4DILA 5JROA 4YAUA 1QHEA 3HA2A 4YALA 1VMEA 2FZVA 2X2OA 4YAWA 4C0XA 4DIKA 2FAXA 3P0RA 1QRDA 1D04A 3F6SA 1JA1A 2Q62A 3GFRA 4HEQA 4U7HA 4GI5A 3KAPA 4LTMA 3D7NA 3TEMA 3FJOA 4GR9A 1CZKA 5B3LA 1YDGA 1WSWA 3KAQA 4N9QA 5F51A 5ULLA 3NHFA 2FX2A 3GFSA 3OWHA 1QR2A 3R6WA 2R96A 3FW1A 5LBTA 3W79A 5NLLA 3NHWA 1SQSA 1X77A 4S24A 3ZHOA 1ZX1A 4M0CA 2M6RA 1SG0A 2MWMA 2QX6A 2FZ5A 3HR4A 2QX8A 3OX2A 5F4BA 1FLNA 2Q9UA 3K20A 4LTDA 1H69A 3W78A 5LJIA 1FLVA 3K1YA 5LMCA 1V4BA 2FVXA 2V9CA 3OVMA 4ESEA 4ZVNA 1XYVA 1RTTA 4Y9RA 3KEGA 4C0WA 2M6SA 1BU5A 2A5LA 2ARKA 2XOEA 5BUCA 2Z9CA 3GAMA 5TGZA 2OYSA 3NHYA 4N65A 3ESYA 1AKQA 1CZNA 3F6RA 2X2PA 3F2VA 3OX1A 2V5UA 4QOFA 3OJXA 1B1CA 1AKVA 1ZWLA 1AKUA 1CZLA 1J9EA 1AKRA 2MTBA 3FNIA 3OJWA 1CZUA 2OHHA 4QODA 3S2YA 3TZBA 3W7AA 1I1OA 4OXXA 1AKWA 3LT5A 1FLAA 3HLYA 4NLLA 2D5IA 4U7GA 4CETA 1DX9A 3O73A 1F4PA 1T5BA 1J8QA 3GFQA 3OX3A 3QE2A 4LAFA 3NFRA 3FVWA 3NHLA 1CZRA 3F90A 3RPEA 4XDHA 4BMPB 2QMZA 3L9WA 3NHJA 4ZVMA 3QFCA 4QOIA 4R81A 4PTZA 3U7IA 5A4KA 2HNBA 5EAIA 4PTYA 4D02A 5EA2A 2HNAA 2KQUA 4ICIA 2XODA 4ZVLA 4Y9UA 1C7FA 3B6KA 3NHRA 4FGKA 4ZVKA 3NHPA 5LBUA 4QOJA 4FGJA 1OBOA 4YQEA 1FTGA 2HPVA 2OHJA 3OWXA 1BVYF 1XYYA 1YKGA 3O2NA 1JA0A 1FUEA 1FVXA 5FUQA 2W5UA 1AHNA 3UXHA 3W77A 1TLLA 4YAFA 5LLDA 3JSXA 4NULA 3N3BC 4FX2A 2BZSA 3EDOA 1OFVA
chains in the Genus database with same CATH superfamily
3KAKA 3VTFA 1X8XA 4HYQA 3KXDA 3UPDA 2BVNA 3M2PA 3HO1A 1N0WA 2PZKA 5CEEA 2XBUA 2GFHA 1AO3A 2W2LD 2WHYA 4JLPA 2TMDA 4D9KA 3EUAA 2ZB3A 4PHTA 4BMVA 4CLOB 1YVPA 4M1MA 4Q00A 4U8HA 3UAWA 5C8VA 4NENA 5I5EA 3CUYA 1JR3E 3K6KA 4JL6A 1GHTA 1PJLA 1UXKA 2N9UA 4OOFA 2B2NA 3BDVA 3ICWA 4QASA 1EX7A 3CB2A 4IZIA 4ESVA 3FUTA 5EP1A 1OTHA 5ESWA 3OE1A 3EVBA 3SP1A 4H59A 3EZFA 3COVA 3L49A 3UTCA 2C97A 3FZEA 4IXMA 4QBGB 3A4TA 3FOFC 2LKDA 4DLVA 2HCRA 9LDTA 1ULHA 1E1DA 3FLMA 1G8PA 5A0TA 3FZNA 4ZMBA 3GLSA 1JDBB 2BM9A 5KHOC 2X0JA 2P6MA 2XYVA 3UYLA 3D3JA 2ZRNA 5AJHA 4RMJA 4TQAA 1HA3A 1T9BA 3UGTA 1UFQA 4NC9A 5CB4F 1FE8A 5BN3A 3EPKA 2Z98A 2QRJA 2YVAA 3ISJA 2IW1A 5DHAA 3V7NA 1I4OA 1WNFA 3LCVB 1DAOA 2BIFA 3ML1A 4AZWA 3WWDA 4WGGA 2EGGA 5JZMA 1RFLA 2HJSA 1O9HA 4HEQA 5ADVA 4DTCA 1OYWA 1XZCA 2YIJA 1AY0A 1HT1E 3HP4A 6LDHA 3CUUA 3WWOA 3TO5A 4ND8A 3QLVC 4EKGA 2PWBA 4ZHQA 5FBKA 4C7JA 2D13A 4M1KA 4DAEA 4ZTZB 3A3PA 2JFVA 3NHFA 3FR7A 4GMHA 3QNUA 4IH1A 3VC7A 3W79A 4J7UA 3BXHA 2Y99A 3DEFA 4PX2A 1ODTC 4YV2A 1QYVA 2WHQA 4JEUA 1PTKA 3KQYA 4BNDB 3FF1A 2WWVD 3AB7A 5BW4A 3DV0A 5C4MA 2QZPA 3KIPA 2WINI 7GPBA 3B2QA 4GMGA 1CUXA 3DEYX 2GZMA 3EH2A 1KI6B 5DMXA 1TAQA 5DCLA 4E2ZA 2ZJYA 1CB7A 3PC2A 1B74A 4FEYA 4H4EA 3FHCB 2G4VA 4WACA 2QM8A 2F8MA 2OD7A 2WB4A 1I51A 5JS1A 1R4ZA 1H1LB 2ORED 4MI3A 3CSSA 4MP8A 4F9TA 3FTPA 3PWSA 1Q11A 3K1AB 2ID7A 4C4RA 4EFNA 1N33B 2FWJA 3B3GA 1JXAA 3CCCA 3FFTA 1GSAA 4Q3DA 4ZDIA 1QRRA 2OHHA 5BWMA 3Q0EA 3TF5A 1H5QA 1VKOA 1G8GA 1UKVY 1HFWA 3PPWA 4ER5A 4TROA 3SQMA 3L7LA 2B94A 1V1JA 3ZU5A 2RFLA 1TU4A 2GXUA 3AKCA 1B8PA 3PGKA 2RGNC 3G5TA 5E7JA 4J1NA 2NXJA 2XCTB 4RV9A 3FVRA 4I4LA 1LNZA 3DEAA 1M34B 5EP4A 2J31A 4ZA2A 4O4LB 1QDEA 4ENQA 1PNTA 3OZFA 4IYRA 3RVNA 2YN0A 3E82A 4DLKA 1G9XA 2R68A 3GRAA 3INTA 3KEOA 4BPBA 1MH1A 3P26A 4DLZA 2AZMA 3I4LA 3RF6A 5ANRB 4NOJA 2JJQA 2VSFA 3ZDYB 5LMUB 2H1SA 3PE4A 3QVMA 2OD9A 1V7ZA 1WBBA 1B3RA 1W30A 3AVUA 3RVMA 3AV3A 1C7QA 1GEEA 2NZVG 3SNHA 1DTWA 4M6WB 5FOWA 3GF4A 4BWGA 1E3DA 3OQHA 4P4NA 1KDRA 1KEVA 1I0IA 1PZMA 2C4TA 2EVWX 3EF1A 3EGDA 3SBEA 4ZKDA 2HQSA 4GP6A 3EZ2A 5B6IA 5IRCD 4XQ0A 5EL0A 2RGWA 2XUIA 4QOEA 3CLTC 5IYZF 1TK9A 1NSYA 4X85A 3NBAA 4TYYA 1XEFA 1V16B 5DRYA 1TM4E 1JFFA 5AH0A 4AN0A 3IR6A 4IXWA 1EVKA 1VCHA 1CE8A 3OWOA 4ARCA 2YXPX 3NM4A 4BEBA 4JQYA 2XUGA 2W90A 4JGGA 4UU1A 2TS1A 1E3TA 3EK2A 3PEFA 2G0TA 3KL2A 4JQZA 4N8SA 3ZQUA 2DUUA 3ZJ4A 1LSUA 2FUCA 4YUZA 1QF7A 3HDVA 4ZGGA 5AI5A 1JHUA 3GNTA 1L5MA 1P45A 4JVNA 3RE1A 3RIMA 4C2AA 5CURA 3U4IA 2X0RA 1L5YA 3ZJYA 2XWQA 3RAPR 1Y42X 4H3HB 1X7WA 2NVUB 1D2CA 1UH5A 1GRQA 2GEDA 2G9VA 1T36B 3D3WB 5TQVA 2YDYA 3JZDA 4RJTA 4IDHA 2QQFA 3N5KA 3UKJA 1WNTA 2UUOA 3VSBA 4B73A 1XROA 4CLEA 3CRNA 1G4UR 4KPUA 5JI3E 3BRWD 2Q9BA 4PLHA 1SXGA 3TECE 3HYRA 5AO9A 1OXXK 3MAJA 3KEQA 4KPUB 4Q9NA 1J8FA 5GADl 2IEDA 4KO4S 4YIHA 1RWMA 4X91A 2QBYB 4LF8B 3FYUC 1OZFA 4N7BA 2R87A 3TVTA 1E2IA 1W4CA 1XU7A 3PXBA 4MQUA 4RSMA 5BR1A 5LQJA 3DOIA 2AK2A 4D82A 1ID8A 1CY0A 1KI8A 1LZKA 3G7NA 1E9DA 4G8JA 1VLQA 2GM3A 4DOMA 4MMYB 3IVGA 3W3ZB 2B8EA 3SKVA 4NYMR 3A27A 2BFMA 3NT5A 3WJ7A 4C0WA 3U0VA 3ZGOA 1GU0A 1M76A 1TZCA 2ARKA 2L0XA 1E1CA 3GRRA 3ORHA 2E85A 4WXHA 2F1RA 3F2VA 5I9LA 3WNQA 1T1JA 2QEQA 4L8WB 2X8BA 3TLJA 3D6HA 4YQZA 1Z75A 2A5YB 4G2NA 3SG0A 2UUCB 3LHDA 4CV1A 1CZUA 4GH5A 1PEYA 1C8KA 1RYDA 3NGMA 4FNOA 2XT9A 1W36B 1P1JA 3K2BA 2Q8PA 4HH4A 3UMYA 3VBCA 2CLMB 1K5PA 1KARA 1NLFA 5J9FA 3CUVA 2V45A 3V3TA 1T2AA 3ZQKA 4B4KA 4C6HA 3FSRA 4NZ9A 5TQ2B 1M6EX 4QUGA 3DKIA 4WNAB 3WFZA 4EMTA 1CRQA 2C5LA 1IYZA 2OHGA 2QGFA 3NCTA 3EW7A 1OYYA 1ILEA 2HA3A 2EWVA 2WDZA 1KF0A 3DHWC 2X42A 4JFAA 3PIRA 2H07A 1PTJC 3FLBA 2OECA 3L0CA 2POQX 5JH7B 3EFBA 1R8XA 1LLCA 4J03A 4MZDA 1G8YA 1PWHA 3ROKA 4DCJA 3P9KA 1NL3A 5I6DA 2O2CA 3ELBA 4Y2XA 1MIHA 1JKJB 4OXKA 2Y1WA 1N7HA 3KQVA 3UV7A 4MUKA 4YRKA 5L7WA 4B3RB 5BXYA 1FRZA 2DULA 2VPXA 3WDMA 2PUJA 3PDWA 4C20A 2SKCA 4P4UA 4EVQA 4F2HA 4ARIA 1KC3A 4ZU6X 2PMBA 2R4QA 3PT9A 4QBTA 1AMOA 5CM2Z 2OBNA 3DLPX 3BDIA 5AK3A 1G7RA 1SIOA 1V5WA 2ODBA 2P4QA 3DA8A 5EKSA 5LQCA 2JA1A 3ZY5A 2R1VA 4FEAA 4BMOB 5BOVA 1BCSA 3UTDA 1BQ4A 3T7CA 5CB4A 2HSGA 3RGWS 1ZJ4A 2YWFA 5J1TB 3SYKA 4YUVA 2XKBA 2IHJA 3DFUA 5DXFA 1HDYA 2Z8YM 3LGXA 4R0MA 4LRTB 2ODQA 5DWQA 1RCFA 2XQKA 3ANSA 3UV3A 3UV6A 4E7OA 1FRQA 1J9ZA 1O0SA 3N2KB 4M7PA 4P3NA 4CL8A 4TLBA 4FKBA 1TUGA 3K5IA 1TKCA 2HLPA 1RHMA 4NIMA 1U1DA 4HATA 4V0MA 1VKNA 1N4AA 1D03A 1ABFA 1XFDA 2W2KB 3PA8A 1LDNA 2FLWA 4F85A 3IERA 3VPHA 3VZSA 3DMRA 1Z83A 4CL0A 5JFGA 3KQWA 3ENWA 2HHHB 2WFLA 2P9JA 3B2EA 4OHWA 3V48A 4P4SB 4CEHA 1VDMA 5M2QA 1R50A 2ZZMA 2X22A 3OF5A 3IC5A 3E9NA 1W2HA 4QYWA 4LYAA 4TT8A 5AUOB 3PWKA 2PYZA 2F3RA 3F5FA 2IUUA 4JU8A 1UKAA 2EYQA 3ZUGA 1NC3A 1GUDA 1Q7TA 4YPOA 1LD3A 2ZYUX 3LKDA 1O6ZA 2QL7A 3KWLA 5K8IA 4E3WA 1KEEA 3FGPA 3TZ6A 1RT9A 1JLLA 1RYZA 3PVSA 4QQRA 1T2CA 4OGLA 5IEBA 4DUPA 2PR7A 4J9VA 1X8LA 1YOVA 1CR6A 2WFMA 3KZMA 4B7ZA 3LLSA 3PNMA 1OKKD 2IF0A 1C0KA 4WLNA 1MJGA 1XMJA 2JFUA 2QN1A 4M9SA 3PCRB 1TZ2A 3JALB 3DBIA 5K0SA 5HIIA 1NBIA 4HD8A 4PG6A 4NBTA 4J90A 1LLUA 1IIRA 2CK3D 2PL1A 2YXEA 4BFSA 5I7VA 1LNSA 1JEDA 3AH8A 1QGUA 3R5TA 4UM9B 3NUZA 4G6ZA 1KQGA 4UDNA 1ICIA 1OGIA 4KYUA 2Y6UA 1M2KA 3P9YA 1JHZA 3KCQA 4KOAA 3ZWAA 1NVEA 4DRXB 1KFEB 4WNIA 2NTJA 2W4MA 1CEEA 2RB5A 2QN2A 4NWIA 2FI1A 2YOHA 3HKBB 4A5OA 3UJPA 4CLOA 3J81k 4D3YA 4OV6B 1FSFA 4DM3A 2DPHA 2DVMA 3AKDA 5HE9A 1KDYA 2A9PA 4UQLA 1HNNA 1O8BA 3HWRA 5IHPA 2K5UA 3C6QA 3U4AA 2C5FA 1UBUS 2OR3A 5B3AA 5LBUA 5ALSA 5CFRA 5CEFA 5K5EA 4M8SA 4PPFA 3RHSA 3LVQE 3I0NA 1E6EA 3LXXA 3U2QA 4FM9A 3A1WA 4J1QA 1JSZA 1PDWA 1VI5A 1WAMA 2HW8A 4POAA 3I62A 4ZZ0A 1QZ3A 2HCJB 4GPD1 4UNPA 1T4MA 1T9AA 3O75A 5EP2A 5C7YA 1Y6JA 3FZYA 5IASA 1KHHA 1KEUA 1E58A 5DH9A 7MDHA 3ZCTA 5HS6A 3B3JA 1V3TA 2OC4A 2OORC 2PJUA 2OQ2A 3FWHA 4F84A 2AZDA 1INLA 1UFKA 1XDWA 5HRUA 2P5YA 3GN1A 1EE9A 1U7PA 1ORDA 3P2MA 4JP3A 3SFVA 1IVSA 5FR1A 1G9TA 1N8TA 4FDMA 5LB2A 2JJ1D 1P7WA 1Q17A 3BTUA 3IILA 5K3BA 3T35A 5E1MA 5BWNA 4DV4B 1A97A 3ZVNA 4OGWA 5FUYA 1KY3A 5D51S 1UJNA 3JQ7B 3SVLA 4RY8A 3JVDA 4AJHA 5JPCA 1RPTA 3B36A 3L79A 1EFLA 3R41A 4HZUB 5CHEA 4OA8A 4A4DA 3ND5A 3ESRA 4LXTA 4GBED 3QPCA 2H1IA 3DLCA 3C6XA 4WKPA 2ZIXB 5TNXA 3ROEA 5KTYA 1CZHA 3NRCA 1PL7A 4LFCB 1RXYA 2W6OA 1NRIA 4KR0A 2H7CA 4GRDA 3RIHA 2WV7A 3C3YA 3IOEA 1D2AA 3BTSA 3CWCA 3EG5A 3B52X 3UFBA 2CSUA 1YJXA 2KPOA 2JLVA 1QH8A 2BEWB 3KXLA 4QPCA 5I7RA 4MCIA 3M49A 4DILA 4CPDA 4K6OA 4WT7A 2XMDA 1CUUA 2X8WA 1P31A 4DMRA 4YX9A 4Z54A 4QPPA 3CPEA 4H77A 3CISA 4XH9B 4CLDA 2FAXA 4KBYA 4ND5A 3ZKAA 4I4TB 1K8QA 3RC7A 2EJVA 1T1EA 4LVUA 3RG2A 5BMVF 4C7BA 3L4EA 1KXZA 4N9QA 4KUGA 5ALJA 2O8FB 2XYGA 1FYEA 2Y1CA 3C48A 3L0IB 4F9FA 5JDIA 3ZW8A 3ZY4A 1ELOA 4HDQB 5FEMA 3ICPA 2VPYA 3LX5A 1GTMA 4QU0A 3HL0A 4K8RB 1CUCA 1T0UA 1Y8QA 2QAGA 2I2CA 1YZQA 2ZJ7A 4GEKA 2IIPA 3P20A 4MOWA 4YHBA 1SXIA 1Z0DA 4O1HA 5AI0A 4EPVA 2Q41A 4IHJB 3MOSA 3PNPA 5EUQB 3CG4A 2N3ZA 3AJDA 3C8HA 2VBCA 1H65A 2J1LA 1IZ8A 2RH8A 4KUHA 1KE1A 1ZVVA 1C80A 2DB3A 1AK1A 1D09A 4KO8A 2Q07A 4EEKA 1U8CB 1SCNE 2JFQA 3QOYA 4PG5A 1ZWLA 3FDZB 1N6LA 1V1RB 4N7JA 1P0QA 3H5NA 3REQA 6ADHA 2GPAA 3CN7A 4LGMA 3WV5A 4NLLA 1ZH2A 2GKSA 3C3DA 4LVOA 1T1RA 4E6PA 3VGPA 2WKPA 1PLJA 3QYAA 2C83A 4O0LA 4PCUA 4Q3CA 4AYWA 1K3TA 2Z30A 2OCDA 1Z06A 1Y1LA 3TMAA 4V02A 2OO5C 3ICOA 3VKVA 4EL0A 4QTUB 3QF4A 4U2EA 5LP1A 3CEHA 1SXQA 5EINA 3HKDA 3DKKA 5DX0A 4UTPA 3K9LA 3JZIA 1FJGB 2D62A 3W7VA 2XRYA 4RH1A 5GZ6A 1GKIA 1IMOA 1DAPA 2Y9MB 3QU4A 3A36A 4W5OA 3ZBTA 4HQ0A 1SQ6A 3T9AA 1ESEA 1EXMA 4YMGA 2AH5A 2JCBA 1OZ0A 4X8MA 2RGDA 3MELA 2BDUA 1S3FA 2RI1A 3PXXA 4P0QB 2R7KA 1BXRB 1NKTA 1DO0A 2DTXA 3AG5A 3OEED 1W96A 1Z35A 3DMTA 5CM9C 5REQA 3RASA 3KSAC 1Y1TA 2MYUA 4MA5A 5IKMA 2XEDA 2GK6A 4Q6BA 1QE5A 3ANTA 1Q15A 5A3JA 2JFXA 2W6CX 4YCLA 2H3HA 2A58A 4MUYA 1EM8A 3ABZA 4YFVA 2P40A 3BA6A 3D6TB 2KWIA 2HK6A 4PVDA 1EXDA 1H6DA 3PKIA 1QZTA 2IYPA 3TD9A 2NUTA 4N8DA 4F1WA 4REOA 4CM9A 1YCHA 3IHTA 2AUNA 1RYHA 1R9MA 1UF9A 3C41J 1ORHA 4LHZA 3LKZA 3KSMA 4UTXA 2P4UA 1EEHA 3K2EA 3ZN2A 1V7QA 1IBKB 2UZ1A 3PKJA 4JBNA 4F1JA 2YFYA 3FCAA 3MCZA 5GIPE 1H8HA 5ECDA 2ZIXA 4MR7B 3CRRA 1ONOA 2VLIA 2CFSA 1PX2A 3GT0A 2NO7A 1FU8A 4FHCA 2RMKA 5CCXA 3K0AB 1R5JA 2Y67A 3AI1A 3FBTA 2IZZA 4M7WA 3WO1A 3U1VA 5FI3A 4KNVA 3SHOA 1KYTA 3CVOA 1EK0A 2CBGA 3F6BX 3PQ7A 4FIZA 5JYCA 4K9SA 1JTEA 2IZ5A 1EJ2A 2EBUA 3UANA 3VRHA 3SXPA 4L08A 3H5AA 5CIWA 4H7PA 2HWUA 5PGMA 3MWFA 2JGAA 2WSSA 1B23P 1XA3A 3DC2A 3G1TA 1Z74A 3KR9A 4OL9A 3INNA 1DIBA 1HDEA 5KSOA 2WVGA 5C1DA 1M2VA 4KI0A 5KOYA 2O59A 5DYYA 3TZHA 3UMBA 2CNDA 1FDTA 1QP8A 2DP4E 3I2KA 2Z2ZA 4GC9A 3MLBA 5HOQA 3ROGA 4RS3A 1AF7A 2QAGB 1P3JA 2AVNA 3AR3A 1RTTA 4PZ0A 4ZVNA 3T99A 1U7XA 3GK3A 3DL2A 5CYPA 2QNRA 5BV8A 1RIFA 2QTMA 1KI7A 1PFVA 4QC2A 4U2CA 2HHJA 1II8A 5JFTA 1BU8A 1N2CE 1USWA 2YIVX 1DB3A 1MXHA 2CB9A 5BW5A 2ZM6B 1DE0A 2B9EA 3GP5A 3M4XA 1H8EA 2FEWB 3WRXA 2DAPA 1Q91A 3L8DA 4JWKA 5BURA 2NN3C 4YQYA 5FHQA 4DIEA 1GO2A 3IPAA 4OK5A 5BOSB 3S1LA 4QG7A 2K2QB 1B0ZA 4AURA 4Q1FA 2ORIA 1JIXA 5KTPA 2KYRA 1C7FA 2FUEA 5ES3A 3TJRA 1G20A 5C53B 1CF9A 2CLDX 4YJDA 2IHVA 5C37A 2D8AA 3AY3A 2II6A 1T9HA 3NFYA 1A2KC 2CGEA 2CHGA 3G23A 3D4NA 3K7EA 1ADJA 4DS3A 2ZTUA 4LNUA 3CXUA 1KXJA 5C8YF 1RJDA 2OMKA 3CR7A 3CTMA 2QENA 4EGAA 1HYGA 3LT1A 4U02A 1O5TA 2DT8A 2FF5A 3V4PB 5TX7A 1RR6A 1N2SA 2RC6A 3F78A 1DI0A 1XVAA 2B5VA 4Z53A 3KEFA 3QEMB 2YWEA 2FSUA 1P4GA 4J49A 5KWIA 2I8LA 4JLDA 1HE8B 4WFQA 4K6CA 2Z6QA 2NVBA 4LVNA 3ROQA 2ZRPA 3RW9A 4R69A 5SV2A 4L27A 4CM8B 1NUUA 1U1CA 4MUIA 1AKMA 1CUEA 1ZUWA 3GRUA 1CP2A 4TS4A 3VSDA 1C7RA 1OROA 2FQXA 4MVJP 1DU4A 2C9MA 1Z6ZA 1X86B 3U56A 1P62B 2R2AA 2YOGA 4TN1A 2CD7A 3A70A 4DV3B 1PJ4A 4EKEA 4PAOA 1K6IA 1J25A 1GPMA 4IRXA 2BPOA 4QGHA 3UPUA 1E2GA 3ZOKA 3FBWA 4Q3AA 3OU2A 5ELLA 1Q44A 4M7OA 1G8FA 1QAQA 4ZU3A 4MPTA 1E1NA 1IE3A 3WRWA 3B48A 5KTRA 1SR8A 2HOQA 1OH7A 1T34A 2H63A 4O2AF 1YT5A 3SZUA 1DXQA 4C7KA 3WRYC 2PHZA 1F8YA 3PUKA 4L4SA 3HKBA 1JFVA 4XAQA 5DO9A 4HLUC 4AKSA 4DIKA 4A1OA 5T41A 2ZSBA 4NL4H 3ZHRA 1D9XA 1GWNA 3TNLA 1D0VA 5I7OA 4MGZR 1YA6A 3ENZA 4ARSA 5AI9A 1LW7A 5H3LA 5AVZA 2GEKA 4XGRA 2BBSA 2YNMD 5EHQA 1NGSA 4Q7QA 2FX2A 1QYWA 2VDWB 4KN5A 3KQTA 4Q34A 3U3KA 4TRJA 4ZVPA 1A9TA 4NAUA 3W4JA 3H9UA 4DY6A 1GQRA 1CEXA 1R0BA 3HU3A 4DCTA 4FFNA 4CMKA 4FLMA 4MXDA 3OCWA 1TQ8A 4OIFA 4RORA 4RZ2A 5EWMB 2Y9PB 3B85A 5JAUA 1FCJA 2OC9A 2PSDA 3OZAA 2Y1KA 5LFAA 1HZZA 5MDHA 3RS5A 2FGKA 4Q24A 5TS2A 1X1TA 3MS4A 4R1QA 2IYLD 5EUMA 1KAOA 1N9ZA 1ORRA 2C2XA 3G8DA 5KWJA 2OYSA 3Q41A 4QULA 2SCUA 1AKUA 3T3EA 3V00A 3BXPA 2OOKA 4B80A 4OYRA 4UZEA 3D54D 4F21A 3KB1A 5EIWA 1U4NA 2CJPA 2A6PA 1FFDA 4MQEA 4YJHB 4BECA 3IOMA 4DLLA 4V1CI 4HVTA 4YC7A 4G8CA 1GZHB 1TADA 3D3WA 1MOSA 2VDOB 4PGGA 1Y1QA 3VVCA 2O0KA 1TVEA 4DSUA 4EQZA 4WLEA 1U81A 1JHOA 1Z0FA 1S8FA 5I4BA 5AKZA 3R3YA 1Y33E 3EAFA 4GGOA 1MC1A 2FWRA 3VMFA 3O8RA 1BFKA 1UK9A 1VJ0A 4FSDA 4PY2A 4QHTA 4QUKA 4BBPA 1PLKA 3UVEA 5GTDA 3CUWA 1C4WA 3HA5A 3JWGA 3KXIA 3GFTA 3IJRA 1M2WA 3KUCA 5DCUA 4IIHA 4QUHA 1MVNA 2JIZA 4CNQA 3U4QB 9GPBA 3KJHA 4DDHA 2W5UA 2ZBRA 2C9BA 4BRUA 3LJKA 5EI5A 4EH1A 4QL3A 3U3MA 1H0RA 5AVQA 1QLHA 2RAVA 2GCOB 2X6TA 3FKJA 1YZGA 4LY3A 4UDXX 3G2MA 4BEJA 4LZOA 5HG0A 1M73E 4RKRA 3HLKA 3IS3A 1L0BA 3P9NA 1QUEA 2QL9A 2J45A 1Z88A 1IBCA 1B7GO 3BBPA 3DOUA 1PFGA 2FDRA 3AU8A 1YOBA 1K92A 1T5IA 1H94A 4U9HS 1KSJA 2ODTX 1JE0A 4YMSA 1AG9A 1YMVA 3R5FA 4TTIA 4WOKA 3H65A 5E6RB 1SZCA 4BNDA 3RK1A 4I7EA 3VA7A 4B6PA 3SKYA 3DOOA 4MW9A 5P8WA 1NQUA 3COZA 4GBJA 1HWYA 1YQTA 3QPVA 4KB5A 4PNHA 1FUUA 1NF8A 1NYLA 4GXRA 1T91A 2B78A 2OTCA 2XNSA 3HVIA 4M8IA 1U1GA 2OPHA 3NIGB 1OLSA 3FCCA 1IXZA 3WGZA 2ZPTX 2H65A 1WZNA 4CEJB 2KLHA 3UMVA 1PR0A 1PV4A 4CF6A 1Y1RA 1X15A 4G5RA 2XI4A 5ESDA 4LOLA 5TS3A 4UM7A 1J0BA 2FMKA 2IYNA 3L1KA 3DPIA 2P7HA 2V54A 3D1VA 2PGAA 4LC9A 1U7WA 4TZTA 3V33A 1Z56C 2HA4A 2XUKA 3P96A 3EQ6A 1KO5A 1Q74A 3QM1A 4M0PA 3HMKA 4QFBA 1QG2A 3GT3A 1FU4A 1A50B 3Q2OA 4GYWA 4XB1A 1GY8A 4UMVA 4F4DA 3NDBB 3AUFA 3LD9A 3H11A 3MYRA 2J0QA 4I9FA 2ZYHA 1JG1A 1ZESA 1IUPA 1FYVA 3AW9A 1UFOA 3NDJA 3QX9A 3CGGA 2G80A 2WU8A 2XIQA 1WMDA 3DFKA 4Y9DA 5BY2A 1OYOA 5B3LA 4PX9A 4UVHA 3BK7A 5DM4A 3C74A 4MV8A 5TVKA 3JZFA 4CG2A 3RUEA 3DO6A 1HDXA 1ZEMA 5E2IA 4OI2A 2VRBA 2MINB 3MS7A 4IOJA 3UT5A 3ED5A 5BMVA 1KI6A 1R8YA 2HHAA 1GGHA 1A27A 3AM5A 2EJCA 1N5OX 3W78A 3B1FA 1JLSA 2HDNB 3DE3X 4CU5A 1T2UA 3WK4A 2O7RA 2GCEA 721PA 4QUAA 4GFDA 1U2SA 4F91B 4ND6A 3NBKA 1BHQ1 1DNPA 2X7HA 5FOTA 4FXPA 4IV5A 1NOIA 1FDSA 3PC3A 2JJ2A 3V1MA 1RD4A 5EQTA 1IVNA 3AOGA 4BV9A 4ZKEA 1QHIA 1WZUA 2OCIA 5KDDA 4MUHA 1FB5A 3GLIB 1AJEA 3TXXA 1E1RD 3NPMA 1X94A 1J0AA 3WGNA 2PH1A 5FFMA 4KWCA 4AS3A 2V74B 1RXCA 4A10A 2JDIA 1ZUHA 3F9RA 3L8EA 3ZXIA 4TQUS 1E1RA 3VDMA 4O3MA 4A3SA 3AEKB 3HEBA 3RREA 4QDJA 3LO8A 4JI2B 2YJ3A 2YHSA 4HDKA 4XGQA 1QPBA 4DHEA 3W2EA 3FUWA 3W3AA 4FOOA 2JIPA 4UMDA 1W6RA 1XDGA 1OYVA 4XFDA 4BB9A 4BLRA 5DSXA 3HTXA 1NW6A 2IDJA 3D0OA 4QTTB 4E2YA 1JDVA 1PRYA 2H5JA 3C3MA 1QR6A 1OLXA 3LCCA 4MRMA 5JBNA 3T7EA 1BMFD 2BFWA 1TEVA 4QBFA 4Z3OA 3KOZA 3MXOA 3PDCA 2FZWA 2VC2B 3HJNA 4HGPA 3RKRA 1KZYC 3VMMA 4F3RA 3QBTA 2GSDA 3EGXA 4I19A 4R01A 3CX4A 2AMJA 2HU5A 3DPUA 4OMDA 4B3HA 4N40A 3G0OA 4JASB 1ECGA 1OBVA 2JFGA 2QYHA 1E8NA 3UXMA 2RJNA 3Q9NA 1TLFA 3K30A 3WNCA 5AVUA 2BHTA 4G1EB 4JB8A 4MQFB 2C42A 3H4VA 4OKNA 4ZO8A 4AS1A 1JIVA 3RSSA 1PLLA 2NMVA 2VQDA 2IITA 2X7JA 2QRQA 4EPTA 4HMOA 2V5VA 1Y4DE 2F9FA 3VU8A 1K7EB 4S12A 3ZDFA 4KQXA 2IPAB 3H9EO 5LQKA 3UJNA 5DI3A 5DJ5A 4RIEA 4B6EA 3SQXA 3UK2A 3IBGA 3AERB 3OSUA 3D8NA 4LYHA 1S9HA 3SF8B 3PX3A 5CB8A 3E4DA 2H2GA 1MAVA 1QZXA 2QV7A 3EFOB 4OHXA 5EHXA 1VP3A 3PDIB 2BKAA 3KX2A 4LRSB 3ZX5A 1U7OA 2C4MA 4MJLA 1U3WA 2QUBA 4YAUA 1XU9A 2JCYA 3RJ9A 2Z4TA 2VH2A 4PSVA 1ZUNB 2O3RA 4QGGA 1BX3A 3AJ9A 4X90A 1GZ4A 5ER9A 2IHYA 3HCFA 4Q4HA 4XE5A 1B14A 2VRCA 1JJFA 2XUOA 3OPNA 5P21A 1WXIA 3WK5A 2E5WA 1PW5A 3AM4A 3LQFA 3W5IA 4LYEA 3WS7A 2DG2A 1M67A 3GMIA 1RTKA 4GUAA 4X92A 2QGZA 3HBNA 4LMBA 3DD1A 4KJZA 4BE9A 4LN1A 1UP6A 4MA0A 2RKWA 1LK0A 1PI3A 3GQBA 4MR9B 2WFZA 4RM2A 4TLEA 5CBKA 1M8JA 3VH4A 7REQB 4MW1A 4PZDA 4J3NA 1YUMA 5JSQA 4WNYA 2DFNA 4Q4AB 3U7JA 5JNTA 1XMOB 4JI5B 2ZJOA 4F5WA 3ZHUA 2DKNA 1XYVA 2VK4A 3DV0B 4P5DA 4NNOA 1NP3A 2JHGA 1EFVA 3H13A 1SBHA 3DCIA 4Z4FA 1TNDA 2IGBA 1JEQA 2Q0SA 2QW0X 2P27A 5LZ4A 3OTQA 1ZJZA 1ZITA 4YV0A 5KKCA 4BMYA 4D46A 1YMQA 5D5PA 1GFWA 3KKZA 4WJZA 3UK0A 4D9BA 4LJ4A 2ACEA 3I2IA 3JS5A 4YV1A 3QEMA 1Z4LA 3SWWA 3LC7O 2VZLA 1PJBA 1I6WA 4BB6A 1HETA 2FMXA 2O7SA 4ZRNA 1UIMA 2J7KA 1IC6A 5F33A 2JZNA 2QTLA 4KXWA 2CNOA 4HLQB 2PSSA 2YS7A 3DUWA 5BVGB 4AWBA 4MYHA 4ND2A 4BV2A 4RDXA 3NTXA 2QTGA 1DKMA 1V2HE 4QJBA 1MJNA 4QQNA 1IJFA 1JYFA 1GTL1 1T9GS 4LXYA 2H7VA 4Q93A 2POCA 2QI9F 4ZC8A 5MHTA 3F5SA 4MB0A 4MWOA 3W8DA 1I30A 4NBUA 5A04A 4EYGA 2WQ7A 4QJIA 2W7TA 3O38A 2H59A 3WJ2A 3FDZA 1BYIA 3K32A 4I1RA 2BH9A 3QY0A 1TL7C 2GKOA 2ISQA 3GC6A 3P0EA 4MDHA 4OHFA 1PDVA 4JEHA 5TV2A 4EG0A 1SXJB 3CNLA 4DV5B 1K7YA 3L6OO 3VJMA 4C2UA 3OFSA 3BEDA 4P36A 4WUVA 4D57A 1XEXA 2P6UA 3DHEA 1CUBA 3FUCA 5CNMA 4W5QA 1YB7A 2QTNA 1E0DA 1NWHA 1IPHA 1FX1A 2HCFA 4BFZA 3IP3A 3OOSA 4R2IA 3GIDA 3DZGA 2JGRA 1HTTA 5COQA 1G0NA 2WYWA 3PC8A 1RFGE 3V4FA 1TGVA 3QSGA 2BL4A 3LCMA 1U2GC 1VIYA 2ZQ5A 1GPH1 3EXFB 3HDJA 3JQ7A 3R40A 3QHQA 4J4BA 3MSXA 4Y98A 1YDEA 3LVFO 3BBLA 1BJTA 1R15A 3EIQA 4KXUA 3FGOA 2I4RA 3ZY6A 3EZGA 2ETXA 2C1XA 2D7CA 4R8VA 1MX9A 1ZMRA 1DJLA 4DRYA 1POWA 1Z6GA 3I5UA 4J1TA 3SYMA 1WZEA 3KO8A 2C7QA 3M6AA 4GL2A 1V35A 4TVSA 4XD7D 2AFHB 4C7VA 4EB6B 3OY2A 4W6ZA 4D43A 1EE1A 4E31A 1DOHA 4B3FX 4XVRA 1K0FA 1QCZA 3DOHA 5KQLA 1OV4A 4C76A 1WE2A 2Q5LA 3E3MA 3MBKA 3GQVA 4AC9A 1RQ7A 2VH1A 5AK4A 4IX9A 2C2GA 5TT1A 4UUBA 3ZE7A 5AM0A 3ROTA 4EY4A 1KK3A 4I50A 4TXHA 1V5EA 4C43A 5L3SB 5LP6A 5KSZA 1OFIA 2YWGA 4ZOLA 1MP0A 4IRMA 4OAQA 4UBMA 1CETA 1NDQA 2XMRA 2YV1A 2FWMX 5HILA 1Z5WA 1CIJA 1P1FA 1SU7A 1SH7A 2YX1A 1U8XX 4GI5A 4GL4A 5JQGF 2JVIA 1HXHA 2BFCA 1DKLA 2GNAA 5BUZA 4CE6A 3RC8A 3SJCA 5KOHA 4MJXA 4XEHA 4YT4A 1NPDA 1OOEA 3BD8A 3DZCA 2BE7A 2AJBA 3E3LA 2MSEB 2Z09A 3O3OB 1VG8A 4M0CA 1ISRA 2D1RA 5KQMA 1EGAA 4R68A 3RVQA 5K99A 2VYNA 3C6BA 4TSKA 3MMSA 1OT5A 4M9UA 2IRWA 1DMRA 3PI6A 1YBFA 4GHWA 2YQ5A 2CCKA 2FW1A 3OFVA 1KDZA 5LM3A 3Q10A 3IMGA 2JHFA 1YWGO 4EAQA 2NV2B 4Q1DA 3W5HA 3PIIA 3AVTA 1CF4A 4X41A 2XXBA 2JLBA 2QVXX 1PK9A 3QVOA 5BO5A 4WBNB 2VYND 2IX9A 3D31A 3O8QB 3RHFA 2I66A 4L4UA 3DQZA 1E8MA 3PICA 4RYDA 1RM3A 3TSAA 5BXQC 1H3EA 2Z83A 4RK6A 1P1CA 1LW6E 3SZOA 1C1DA 1R7RA 3O4GA 1AGYA 3IAM6 4M9XA 4Q7MB 1NHWA 4OP2A 1JQBA 4AZ0B 2OYRA 1EAMA 2VAPA 2IBSA 4DDVA 4KE9A 5BSEA 4KK4A 3T54A 1HDCA 3MTBA 2E21A 4TM7A 3BCHA 3EXFA 4KUEA 4EX6A 4Q19A 4YGYA 2H2DA 3Q7PA 5K8JB 1KDTA 1EHIA 1CNEA 1OHHD 5DPMA 3CX7A 4BZQA 5I5GA 2OCKA 1AA9A 5ITWA 2X4LA 3OCXA 1AQNA 2HQOA 1WW2A 4BNZA 1PJRA 1AMUA 1HLGA 1TPZA 2BHRA 1WV0A 5CVJA 5F98A 2DR3A 1BWPA 2P4SA 3X1YA 2B9VA 4D26A 2XDQA 2MR5A 5HQTA 2D00A 5CA0A 1OH5A 3LDAA 2HBRA 2NQ8A 3GBVA 3GJYA 3I09A 4KO3S 5HJ5A 3JALA 4RE5A 2K2WA 2AK3A 2JGEA 5LP6B 3REQB 3FG9A 4A73A 1NU8A 3JQFA 2KI5A 1UXHA 4JYMA 1Q1EA 3EODA 1OIXA 1VXOA 3AIKA 4NJEB 3UMFA 1A8QA 5AQ1A 1R0RE 2WWGA 5FF9A 2WTEA 4DCPA 1IEQA 1Z2OX 1JNXX 1MOPA 1VL2A 4BMXA 1LDYA 3QPWA 1FNNA 2C2KA 3ZQJA 4MTCA 1QIHA 4G9BA 1N3IA 1M0EA 3WO0A 4HWSA 4LEIA 3L8FA 4N7RA 3N39C 4EUHA 4P1ZA 3EGCA 3CQ9A 5GGYA 2O6HA 4PZAA 1JEQB 2J85A 5F35A 1I36A 4PGAA 1QG4A 2C2ZA 5C35A 3IUBA 3CUEF 3KE9A 4H31A 5TGTA 2FG6C 1XMPA 3NKLA 4BO4A 3ER9A 3SZGA 1WABA 4DDMA 4EHJA 2FPXA 2XKKA 1P7VA 3DB2A 3H2HA 4G07A 1EE2A 3FHLA 1EDZA 2OCAA 2XA2A 4EENA 1C29B 1D4OA 4UBIA 3QP9A 3IMFA 4UU0A 4B0PA 2PUDA 1I0ZA 3DP7A 4ZT3A 4BASA 5JROA 3T3PB 4J7AA 3TNFA 2EHDA 4GPTA 2ORWA 2NO6A 4DE5A 1UINA 1UWVA 1V9LA 4XQGA 1P4RA 2XNJA 3GJSA 4L3OA 3T52A 3Q3EA 4COKA 3IAXA 2C99A 3KAPA 4BYGA 2BF7A 4DR5B 5C9ZA 1C0LA 3NAZA 4AG6A 3U60B 3LLCA 1FNDA 1VKRA 4IEFB 2J9ZB 1WUHS 2R6GA 5FPSA 1O03A 2ZYGA 5CIYA 1UC4B 3FPGA 2CFIA 2DLDA 1JJAA 3SVZA 4FCVA 4TL9A 3PFIA 4NBVA 3OQIA 3W5SA 5HKKD 3L1JA 4MQBA 2EWWA 1WXXA 1ISJA 2COEA 3K09A 5TJ9A 1F8GA 4AJEA 4WE3A 3EFOA 1X7YA 3DSRA 1BC5A 4A7PA 1Y0BA 2XNHA 3W8NA 3UYKA 3VUFA 1RQRA 4C2TA 1QU3A 4RTJA 4TYMA 4EHLA 1EDDA 4J0QA 3W1VA 3HM9A 5DF1A 2B8NA 1NQOA 3QVSA 2W4QA 3DBLA 3J81A 3LP6A 4QYMA 3BF8A 2GA8A 3D1JA 4WXYB 5LU8A 4QOFA 2AN3A 5A4KA 1PJ8A 4A8JB 3FOAA 4DV1B 1G55A 2V3WA 3OOJA 1J2EA 2V7EA 2QD4A 1NVBA 3SC3A 4CUKA 2BI4A 5AP9A 5HJ2A 3WGUA 5JS8A 3IUNA 3HBJA 5I8ZA 5JDCA 4JVOA 2Q3LA 4JLMA 1U94A 3PQ3A 5AKXA 3TYXA 4GD3Q 3G79A 3R2JA 2NU9B 3TVDA 3OA2A 4GM4A 3F6CA 4OBWA 3NC4A 1XMSA 4M37A 1P4HA 2JGJA 3KLOA 4Y9UA 4A91A 1H2EA 3NHPA 3C7DB 4N8EA 3UG6A 1U2PA 4HGRA 1NN3A 4R1LA 1FNBA 1SB9A 1J5PA 1WG8A 2NYRA 3RSFA 3N07A 1ES9A 4HO1X 4JN6B 4PZPA 2LCFA 4R7ZA 5DLPA 3H2JA 2BFCB 1EKXA 1UPCA 2IGTA 1P4SA 4TQGA 3OPYB 1ZNYA 3TL2A 1R5BA 4FGWA 1CS4C 1RE1A 3E84A 4JT4A 3OH8A 1RJ9B 3FBGA 1KC1A 3GOQA 4BIIA 4I8XA 2AXNA 3OJLA 4E1AA 5J2TB 3QXCA 5H5JA 3VPFA 5F7ZA 1VZ2A 3UMRA 3G0IA 4EITA 4BJ5A 2ATXA 4IH4A 2PX3A 1Z0IA 1K9VF 2VTDA 3FNHA 3C14C 3GEMA 3R20A 5CT6A 2BEVA 4L0CA 2DEUA 3W8FA 3ZS9A 1EUQA 2W2QA 2QD2A 3FD8A 3JQFC 4PR3A 4PZYA 5BNTA 5FPKA 1JI3A 1JAXA 5DXAA 1K9SA 4CV2A 2CZGA 3HJCA 4EGJA 1P61B 3TDNA 2PSEA 4DNOA 5J59A 2IYWA 1SUCA 3CE9A 2W2MA 1JBEA 3P0IA 1A5ZA 4E5VA 4DCNA 4C6TA 1X92A 3FUUA 4AJJA 5CBPA 4H7HA 5I7HA 5JT1A 1UJMA 1EUZA 3W3AD 1JIJA 4N82A 2UZIR 5LU9A 3TZCA 2LRHA 2REOA 1CFJA 1NVGA 4LRYA 4YDQA 2Q9AA 2H8KA 5FX2A 2CMHA 4M0FA 4PONA 5FI1B 4ENRA 2HK8A 2VT2A 5IVHA 2M6KA 4LGYA 1WLSA 1PV2A 1QH9A 4K6FA 2P69A 4F71A 1PKEA 1JA1A 2FPIA 5EQJB 3EEQA 1Z6TA 2C2OA 3OLVA 1N9GA 1SQ5A 3TAXA 3ZDEA 5FNZA 2RGRA 1SEVA 3O9MA 3ZKWB 2OCPA 3N6RA 2AHRA 1KSFX 1JFLA 1JPVA 1B00A 1KVTA 2B4KA 3HCAA 3OT5A 5E0KB 5IN4A 1KMMA 2JH3A 1HYEA 3VNRA 3WKEA 3AK4A 3MCAA 5D3MB 5GPBA 2HMAA 3I12A 1XWIA 2QVZX 4D0SA 1U1IA 4FB5A 3TLBA 1OAAA 2IIBA 1MC5A 3UBMA 4C04A 1SZJG 2PJRA 4XIIA 5BWLA 4NE7A 4I5FA 4PW0A 1Y4ZA 3SBDA 4DG9A 4WCFA 2L42A 4JSRA 2CLIB 2YN2A 5B36A 1M8GA 3L4JA 1K4YA 2Z9CA 3Q4GA 4WN9A 3ZK7A 2P3OA 2X8AA 1U7DA 4CCYB 1JZSA 2MSWA 3E7WA 2JEOA 4PYMA 5LJIA 1J8YF 1AKRA 5JTTA 1E18A 4P7BA 2HWKA 3I23A 5TMPA 3ZYZA 5HUHA 3KUXA 1C4XA 1J22A 5H80A 1STOA 2CVPA 2G9QA 3E35A 3W5AA 1ZOIA 4P80A 3VR6D 2J9RA 2VDJA 3OX3A 1ZPDA 3LSTA 1ONNA 4ROSA 5ALIA 1I5RA 2AXPA 5AR1A 5KKAA 3WL6A 3E9EA 5JAMA 3MMNA 5H4HA 1HNZB 3ZXXA 2GBIA 5IEJA 1HQCA 3HYLA 1AGRA 1BO6A 2QZ4A 3LK6A 1H4TA 1H8ED 3AM1A 4URXR 3KQNA 2JFHA 4HUQA 4E5DA 4G0QA 2BTOA 2ADFA 1ORTA 1U8UA 1E64A 5YASA 1QWSA 4RV5A 3RD5A 4XB6B 2IY8A 4N5NA 1MBZA 1PR6A 3BWVA 1N0UA 2GUGA 4GR5A 1Z8HA 4LE0A 4WNAA 5DCWA 4F3TA 2XECA 1XJWA 2Y1DA 1XTJA 3LX6A 3T5BA 1G3QA 1GAEO 1G8SA 1WLYA 4UJ5A 4ZYWA 1LQTA 2V7XA 1TT7A 3BH6A 4GOLD 5JBIA 2BP7A 2ZZNA 1S6YA 1U7TA 4LDPA 3G0BA 1NJ5A 3N1UA 1JE1A 2J59A 3JCZA 2C4KA 2B3DA 1E3QA 2HJWA 3EVEA 1U8EA 3EJ6A 5HKBA 1RAHA 4MQ4A 4NONA 4DQDA 1U2DC 4O2BB 1JLRA 1L7DA 2NAFA 3OLYA 3T5DA 1XZEA 3M3HA 4OU5A 4YDSA 6NULA 2EBFX 1AKTA 3N8IA 2WPNA 3GGJA 4NDZA 2GAOA 2D8MA 3RI3A 4EJSA 3I2FA 2PLFA 2ZB2A 3Q98A 1V11A 4DCVA 1A9RA 2NT4A 2ZAGA 2ZT6A 3FNEA 4HJXA 4QG3A 3PUWA 2C57A 4JUFA 1KY5A 2P65A 4OX9Y 2HBYA 4FS8A 3I64A 4OH7A 2WKQA 4RELA 4U2GA 4YLYA 1TJ5A 1RLJA 3WIVA 3QITA 2C0PA 1WCWA 3S44A 4URZR 3U49A 3U1TA 1FS4A 2AV6A 1CT9A 3RSZA 4RDHA 1UBOS 4LK3A 4I55A 5KYWA 1Z18A 2Q4OA 3HN7A 4RQTA 4RZHA 3X2SA 3ACBA 1HFKA 4D99A 1BIFA 4M3NA 2R6ZA 1GA6A 3PD7A 1HX7A 4ITRC 1PW7A 4P81A 4E46A 3IQEA 3R7NA 2QIOA 4HADA 3IAM1 3LL4A 1VBMA 1XNGA 3CVWA 1EPUA 2HZ7A 3UJHA 4I08A 1GLGA 2EAUA 3CZ5A 4M1SA 1JKFA 1QVRA 1TW2A 1UPXA 3LX4A 3G8YA 2QMEA 4W5HA 4WOPA 4WV3A 5TPZD 3WE7A 2Z4SA 4YAKA 3DKRA 1AS2A 5CYGA 2AOXA 4GWGA 3MAAC 3TEJA 3V8BA 1W5AA 3U16A 3L8CA 1GJRA 3BJIC 2JCVA 5JCZA 3NRBA 5BSTA 5AKIA 1GQOA 5JNUA 4IDPA 5JWRA 3TW6A 4P86A 1FP7A 3T7IA 1H0HA 3ZEIA 4S24A 1F4LA 1ENZA 2LV8A 4DM7A 1RABA 3O4FA 3I6QA 4FDUA 3U6KA 2PSFA 3FMIA 4EG1A 1CYDA 5KQSA 1XYGA 1U5BB 1USIA 3I34X 1WVMA 3BL8A 3DE0X 4FOPA 3CVVA 1WOMA 1XWWA 3OEEA 3R9XA 2VYQA 1VCIA 4YRNA 1X7DA 1BE1A 1Y4SA 3AV0B 4LDQA 1GNRA 1E77A 3VU9B 3QRWA 3RTAA 4DYDA 4BUJA 4I1UA 3EIFA 1T5HX 4RO0A 1G59A 4OQQA 3ESYA 3AY6A 3TTYA 5F76A 4FVTA 3LPMA 1T2VA 4CTKA 4KDEA 1W4ZA 3DCJA 2N0SA 1YAHA 2WIBA 4NKRA 3BIFA 1C9EA 1EVYA 1KJWA 3KU1A 3CMMA 1SUBA 2AJTA 3GEHA 1LGYA 3GNQA 3O73A 2QDXA 4O2AB 4I4NA 3ZS8A 2M2IA 4PQYA 5IM4A 3DWFA 3EWIA 1HE5A 4QOSA 5DP2A 1XVLA 3GUYA 1T5DX 2PY6A 3GRVA 1P9OA 1FQOA 4J6EA 1QP0A 2GFQA 2G1AA 3OLXA 2O7QA 4ZGBA 3OJOA 4C0QC 1LX7A 4V0OA 1E59A 1N34B 4D8XA 3QVXA 4AF7A 1EXWA 4GX0A 4FPXA 2A78A 3E5MA 5C18A 3P71T 4IKOA 3AL0C 1NSTA 3OZWA 2KW5A 5LZ9A 4XWWA 4IJKA 1I2MA 3L8GA 1WQ3A 1TTTA 4WK0B 3AF5A 1BCRA 1OX4A 3BERA 1E3WB 1MC4A 3WGVA 5HUQA 4DEXA 3AVYA 3GT4A 2YJ4A 4G0YA 1I1QB 3RFXA 1EK6A 3OM1A 2X3FA 4AXXA 4HVAA 5AVWA 3T95A 3GRKA 1JHQA 2VYVD 2WE8A 3AJAA 4AJLA 3G8BA 1XTVA 3F67A 3HKDB 4MKHA 1DRJA 4HQ6A 3R0VA 1F9AA 1P2TA 3GUCA 4H2DA 2QLTA 3L7YA 4O08A 4QAJA 4BU0A 2EX1A 4L8VA 2H2FA 1CJKC 2C8JA 1ZSYA 3IO3A 3FTQA 4HWPA 4YONB 3Q7EA 3ZC3A 4AUMA 3A4NA 3CONA 3HZHA 5A6SB 1MB9A 1Q0SA 1XD9A 4AAYA 1K6JA 5IVIA 4RTMA 1CJMA 1DBQA 2H1LA 2WAYA 2VDNB 2XYRA 3FCXA 3QH4A 1BSVA 1FVHA 3L0PA 1I9GA 1I7PA 3HB5X 4RFLA 4RMHA 4BQPA 3V8EA 4DNPA 5AVVA 1M2JA 1N3YA 3NOXA 2LNDA 3GMTA 4Q3BA 1HKHA 1RADA 4JYBA 5FB3A 2F9MA 4G89A 1DO8A 5LNK1 3ZE9A 1PYOA 4H1TA 1WMFA 4Q21A 2KS6A 3GL9A 5CX1B 3ONWA 4DSOA 2Z3VA 2JH8A 1IHPA 1EEXB 3I73A 5FPHA 3GJ4A 1QE0A 1HE3A 4L6AA 4LCJA 3LYUA 4YDRA 2LZ0A 3G0DA 3PLRA 3LP8A 1PIWA 3ZWWA 2Q3BA 1UZNA 3P0RA 4INJA 1JAIA 4IGFA 2I34A 1RZVA 5L6LB 4U9UA 1CUZA 1AQYA 3KQQA 3TQFA 1H42A 3Q5DA 1RW4A 1WJGA 4REQA 3AY0A 2NSLA 4KZPA 3PRKE 3TB4A 3LHSA 4BX0A 3Q1KA 2IEAA 2PZBA 1X19A 2C2BA 2FETA 4O3FA 2HDOA 4WZBE 1BX0A 2X1MA 4RV4A 3GCZA 5A7FA 1O94D 1Q0UA 1SG0A 3ZGNA 1QPZA 1DQNA 1EFKA 5CFQA 3EZYA 1LTHR 2FPPB 3Q9SA 2GD2A 3PF8A 3FPLA 1R27A 3BGSA 4FHZA 1I80A 3EFHA 2FJUA 4GT1A 5TC4A 1E7YA 1LDGA 2AQKA 4LMAA 2CKMA 3SYTA 5EJ4A 2FKAA 2GEVA 3GEGA 5AHOA 2WHXA 3OEHD 4QEZA 2Y0BA 4L5BA 4QXRA 1KAQA 2PXHA 4BATA 3UWOA 1XLTC 2NQ2C 3DVSX 5LIRA 5I48A 4ZO4A 3HEMA 1JBKA 5FXMA 2OZLB 5GV8A 5GJVC 4FI3F 3RG8A 5A2QA 1E5QA 2W43A 5IX8A 2Y1EA 1V8BA 4XGKA 2XMQA 5ALZA 2FPOA 3OMLA 3W7AA 3CYFA 3BMOA 1YR7A 2IDMA 3H2BA 3R6GA 4HAWA 5IARA 4BFWA 4W4TA 3D7LA 3UENA 2J9GA 3L82B 4P93A 1EH5A 4AKEA 4FYXA 2ODEA 2FTKE 1NBOA 3WBKA 4ECEA 2C7PA 4RH3A 5HA5A 4WKBA 4I50B 4K3UA 2Q8NA 3T3NA 4OYHA 2ONKA 4PAGA 1FMFA 4OFWA 1F2TA 1JJ7A 1P77A 1RWKA 3I3SR 4IRUB 1DBSA 2B4YA 1U6KA 2WF5A 3NHRA 4CKCB 4X8OA 3PRHA 5E6SB 5DHSA 3W6NA 5DLDA 5CG1A 2RGBA 1F1JA 4A16A 4CKCA 3TQOA 5A02A 3GV0A 1H2WA 4PQRA 3IKMB 4L76A 3RF7A 3DF9A 5EWJB 5D7BA 4L7VA 3MERA 4B17A 2VO1A 3ONFA 4M2LA 4PX5A 1BE8A 1DRVA 1VJ5A 4YROA 4ZCPA 1EUYA 3QA9A 1NBMA 5DWVA 2QPAA 4GI1A 1FP1D 1UOPA 4KQIA 1CYEA 3JD1A 2Q6VA 3K0AA 3A3OA 4JL8A 3FNRA 1NFRA 3GCXA 2WYUA 4BLPA 1NVKA 2H1RA 4DUGA 4MVJH 5EJ2A 2QPLA 2M9MA 4Y1RB 2LDBA 4FLEA 3WB9A 3N6XA 2I3BA 4DBZA 2PGDA 3RIGA 3TXAA 5JZSA 1E96A 1FOEB 1T8TA 1MNAA 4FFBB 4ZT2A 3RV4A 4C21A 1OIVA 2E4AA 5K3FB 3V1YA 1DJMA 2CLSA 1L5HA 2IE0A 1Y1PA 1YRHA 3VU1A 4INZA 1C41A 2Y1LA 1GKUB 1F6DA 1X1RA 5T64A 5KU1A 4ZU1X 1GZ5A 2QQ5A 3N2YA 2EW2A 3AFIA 3M6UA 4X63A 1MVLA 1P5ZB 2NUTB 4LZLA 4KXFB 2GKGA 2V9ZA 5FBLB 3VO2A 2X5XA 4AIRA 4G01B 2ZYAA 3HV2A 2YY7A 5LYJF 3HP1A 4Z1OA 4LF9B 3L8ZA 1SVWA 2VHYA 4NX2A 4ZXPA 1WF3A 5B2FA 5E0OA 1U2ZA 1XVIA 2W2VA 5JRDS 1ZEJA 4LX0A 4QICA 4UQPA 4D97A 3N53A 1OVGA 4FKZA 2C1ZA 3PHHA 2EU8A 4LE1A 3HXLA 2W0MA 5AWFC 3TE6A 2GN8A 5GJCA 1AO0A 2JNWA 3DR3A 2RHRA 2AQHA 4PQFA 2IZOA 2O4UX 5AJZA 5A1JA 2HKIA 4HNQA 3LF1A 1LDBA 5FUXA 4ZO9A 4BO2A 4CR8A 2HT6A 4BQIA 5KTNA 4RGBA 4P0TA 4DQVA 5K0EA 5MFPA 4R1PA 2QUAA 4YH1A 2YHAA 3O8NA 1EGHA 3MQFA 4K81B 1GNVA 2BUBA 1FPMA 5JSZB 4XQCA 3Q12A 5ALOA 2Q3EA 4E5KA 4PLYA 1RPJA 1JR6A 2PCJA 3Q6IA 3N05A 3E3NA 3NXSA 2WABA 2HSEA 3OE5A 2FEKA 3NHWA 1IH8A 4HFJA 3R5HA 1IZZA 4D9MA 4E3ZA 4PXSA 4J16A 5CDTA 4I1VA 2UYOA 3EA0A 4B7UA 3RAFC 5F4BA 2ZR8A 5FPPA 5HP4A 4B6OA 1BMTA 1NW4A 1OXMA 4E0BA 2PH7A 4EA6A 2ZZKA 1URPA 1DCTA 3RHZA 3RYHA 1IM2A 1EFTA 1CY1A 1M1ZA 3HS3A 3N2KA 1MVOA 4FZ3A 3CIOA 1FFEA 2Z2JA 3SC4A 3QPAA 1MRNA 5K6AA 2Q4DA 4NABA 3KKLA 1VZ3A 1PT8A 2PDAA 5DXJA 5KPDA 3Q8WA 4IXTA 4CIAA 5SY6A 1VLMA 2Q3DA 1OMOA 2YJ5A 3TM4A 3RQIA 2EATA 1TFUA 3W06A 1P3DA 3KFLA 3EG9B 1EWQA 1NI5A 4FMBB 3GZJA 3W5VA 2F1HA 2PL5A 2J30A 2ZE6A 3GJ0A 3LQYA 4IQGA 2LCQA 5A5GA 2Y77A 2HT1A 3FSGD 3HUEA 3SJUA 3SHFA 3KQUA 3K16A 3UAGA 4KU4A 4N5HX 4WXRA 2WK1A 2OOSA 3RUDA 3BIOA 1QIDA 4QYTA 2OGUA 5AXAA 1ZJWA 3MWYW 1TT5B 1L7XA 2F55A 4QBKA 3WLOA 1AGXA 4IIVA 1QONA 3O9VA 4L4XA 4MVJF 4TMXA 5B55A 1M75A 1CVRA 1C2YA 3W77A 3KKQA 3MBIA 4G1BA 2VATA 1GEGA 5JE8A 4AY3A 2WJPA 3RFFA 2WU1A 4AMZA 2ZSUA 1YQUA 4OB8A 4MICA 1GAWA 4R1NA 4PZUA 4BNGA 3STUA 4E5PA 1M66A 4EP1A 4LJ5A 3ADCA 1B26A 1PD0A 3HG7A 1I7DA 4W7HA 1T4GA 1NT4A 1M83A 1SCBA 2VDKB 4IIJB 1TM5E 4ZZ2A 4ZEMA 4YIKA 3GY0A 2R1VB 4BP8A 4QTYA 4WKNA 1Z7YA 2ISSD 4BMDA 1IWBB 1HOXA 1QTQA 3NDIA 2WZDA 3DHVA 1Q50A 2L19A 4RKEA 3R3JA 4JI7B 1LI7A 2FN3A 4IICA 5I8PA 2D1QA 3ETJA 1FTWA 3MTQA 1ZJ6A 3R9XB 4OHOA 3JYHA 4WDQA 1MQAA 5CH3A 1TJYA 4IIJF 2XT6A 2PD3A 3UAZA 2OGTA 5JO0A 4TV8A 2Y66A 4KH1A 4MK4A 3R5SA 3ZWQA 4AQYB 2ETVA 2H4WA 3HY3A 4YR7A 4LZJA 4KAJA 1MAHA 1P81A 2QPOA 3MCVA 4FMPA 4YYZA 1PQYA 3UQYS 3T1TA 3E18A 2VAWA 4JLJA 4YUWA 1FS6A 1ARZA 1GKYA 2A3RA 3N76A 3U39A 3CA8A 3DAOA 1JU4A 3I6ZA 3W04A 4PYOA 4OU4A 2EARA 1ODSA 2WHPB 4UNQA 1SQGA 2CYAA 2FPSA 5JCPA 4PLWA 3THOA 4QYSA 1E1LA 2FMFA 5K3OA 2WNIA 3QVTA 1F2TB 3MWDA 3QEJA 4HAOA 1N4DA 1VG0B 2W6ZA 3A31A 4PIMA 5TR9A 4FE7A 3AESA 3QELB 5IAGA 3N8HA 4CQLB 4W1QA 5JRZA 2C98A 1QJCA 1PEDA 4D02A 5DNVA 4DJEC 1L3IA 1Y8RB 4NPHA 1OLXB 2Q3FA 5I7EA 3V34A 4I0WB 3ZEAA 3FPKA 5JR3A 1ADBA 2BGLA 1KFKB 1TU3A 1NATA 1WMAA 2MYTA 2XAUA 3P2JA 4MLPA 5GJBA 4QGBA 1VJDA 1P18A 3NVDA 1UUFA 4AD8A 1T43A 4FLFA 4BXOA 1CR1A 3H86A 2DHCA 4IYJA 4RXMA 2IOHA 3HM2A 4UE3S 3SXUA 1R4NB 2WWWA 3AY7A 2VNAA 3DZDA 4YPFA 5H59A 4CG1A 4DLNA 1YDWA 1G3RA 1ZJJA 2OE2A 3C45A 3GMDA 1W73A 3UAOA 1NHGA 1JR3A 2FN4A 4LS3A 3RSHA 3UC5A 4W9MC 1GP2A 2RHMA 1QANA 1BVUA 1XTRA 2EERA 4HZIA 5JD4A 2JDID 4N3CA 1C2TA 2R8PA 3DE4X 1FUYB 4BBZA 5IF3A 5HF8A 4PFSA 2O1WA 3QFCA 3RFVA 1T6ZA 3MJCA 4WXMA 1WR8A 2QL5A 4GGMX 2D2EA 1NNEA 1KERA 2FUKA 4XASA 5A5FA 1BE0A 1Z2EA 3L84A 2XUJA 3KB6A 5ESXA 4JP5A 1X7WB 1A9PA 5EEHA 4G24A 1JA0A 2EKBA 2Z2IA 3O03A 2G08A 4KWHA 3ZI0A 4CMAA 1B0PA 1LVUA 1P5HA 1VE6A 2QOEA 1ECJA 3AHHA 3BM5A 3P9SA 1CJSA 3TTWA 3MAGA 1F3OA 1CEYA 2CJWB 3NC1C 5AW4A 4ZALA 4KXMA 1I5OA 4XWTA 4MPDA 2RHCA 1XKLA 1PKXA 4KACA 4ZAZA 5BNIA 1U8FO 1NC1A 3OKAA 4GQBA 4JITA 4CGYA 3TI9A 2FY8A 3IB3A 4TMFA 3MBOA 4X6LA 1BAPA 3KLMX 1T8YA 1F3LA 4MHSA 4ZT4A 4BVBA 3DC7A 2F8SA 4PO9A 5T8KA 1M0WA 2CJFA 4RVCA 3WLEA 1KP2A 3NH9A 2A57A 1PL8A 2P6PA 3P7MA 2I2DA 2FZLA 2ZCVA 1L5VA 3WGLA 2Q7OE 3C5CA 1M0TA 1GA1A 5KOIA 4DL9A 5BQOA 5E1OA 2O4CA 2AKAB 2JH9A 1CQJA 1Y9DA 3LU1A 2BF4A 3IHLA 3N58A 4FBMA 4QRDA 5G53C 3WKAA 4K40A 2VLBA 4IJWA 2WMYA 1TYZA 4R1TA 2VQSA 1XRMA 1G41A 1ZSVA 1QYDA 2QN9A 2OK7A 3ITKA 1TCUA 2P1DA 3M1LA 3YASA 2Q8QA 3SDSA 3FPBA 3UUGA 3R7FA 5M29A 1GQQA 1PHPA 2XHZA 3F8SA 4HSEA 5B3KA 1YF3A 1JRLA 3K2QA 3SZ3A 1AX9A 4BQNA 1XF9A 2BEJA 1KU6A 1Z4OA 3BFVA 4MVXA 3BL5A 3KOMA 4W8OA 3GBSA 1KTIA 4ZRMA 4AULA 1EFUA 3COYA 3ZWMA 1JQLB 2HBQA 1R6TA 1MB0A 1CCWA 1FX0A 1ZJYA 4YP7A 5AUPB 2G70A 3ETGA 4BL5A 3FA2A 2MSDB 4BFLA 4XWKA 2PKCA 1D04A 1XEAA 1YKFA 3HWSA 4GIBA 3GLFB 1YZKA 5TRTA 2H0RA 1ZD4A 4RAOA 3FNFA 4TYQA 3EW9A 5LP6F 2XE4A 2IU0A 4KR6A 4I50F 1J5XA 1LK5A 5A6SA 2VPQA 3PFNA 1FBNA 5HMLA 4MKFA 4FUQA 2VI5A 3UJDA 2XF8A 4OBBA 5ALNA 3ZHOA 2MYNA 3QTLA 1IZ0A 2M6RA 4NG4A 2GFIA 4L07A 5K03A 2CNBA 5E3IA 5DT9A 4OSEA 4RLSA 5FUWA 1Y3CE 2YINC 3BWBA 5KI6A 1LPMA 5DI9A 1FMTA 3CWQA 3V32A 2IU6A 4P08A 2PV0A 1BN7A 3R09A 3WWCA 2GF2A 3JYLA 5L45A 1M54A 4MLZA 4HAVA 4JOBA 5KX5A 1G38A 4MDFA 2H9AA 4DYHA 3QKUA 3PF9A 1HPLA 2I67A 2ZBVA 2H7XA 1S3GA 3RC9A 1KH2A 1CLEA 4ARBA 4CF4A 3CLRD 4FMCF 4NCAA 1TJ4A 4FBGA 4K9QA 4M87A 2R84A 5BSWA 1I1OA 2V5AA 2XA9A 3H5RA 5E1BA 5J4YA 3PFKA 1P91A 1A9YA 3JYNA 3HY4A 2IS6A 1C5KA 3T9CA 4DARA 2ZT5A 2H1FA 3IXMA 5LXTB 2X4GA 3PQ6A 1J7KA 5HW0A 5HKLA 4MV1A 3U80A 1K8ZB 5A62A 1DDGA 1HDIA 1UZUA 2RH5A 1AKYA 3Q7TA 3EVDA 3QOXA 4GBMA 3SI7A 2BMWA 2VBFA 1QHFA 3DP9A 1PN3A 2RGAA 1GTVA 3CW2A 3IGFA 5L3QB 1IEXA 2IBTA 2HA0A 1SMKA 1E79A 1GDTA 2UVPA 5KTOA 1P73A 1M33A 3AR4A 4G5HA 3LCUA 4IFTA 4QJ4A 4B6FA 5THKA 4Y6LA 3QUTA 5FPQA 3DVAA 2XQJA 4ENPA 2XTZA 3TH5A 1JQDA 2JVKA 5EJ8A 3E1GA 5I01A 1SUIA 2ECFA 4I2NA 4OB7A 4Z4IA 1PVOA 1H0SA 3BORA 1QFXA 3H2IA 4TWIA 2OD2A 4CM9D 2Q3HA 2YWJA 4E2WA 2CZQA 5D5QA 4R31A 4ZEXA 3CU5A 2JD0A 4Y0NA 2ZR7A 3QFRA 3BK2A 3ELDA 3K4HA 4HQFA 4ZI3A 3P2EA 3CZ9A 1GQYA 1RBMA 4TSFD 3SU8A 4HDNB 3RS0A 1KR5A 2A1TS 1EP2B 5LZ2A 5A05A 4HS4A 1KBQA 1W94A 2B1JA 1T35A 2GLXA 1G16A 3EY4A 3I32A 4OJTA 3P5SA 1M2GA 1YS4A 2PKQP 3A11A 4MUXA 5CW1A 4DCMA 4AWAA 3C3KA 3FPJA 2ZT7A 4UEJA 3TGWA 1NW5A 1SIWA 2ONZA 5DIZA 4D8TA 1D5CA 1CE8B 2G9RA 4DLWA 4KKVA 5EIEA 1B73A 3GLQA 3WHIA 4B9AA 2B4QA 1PJCA 3D4PA 4MQEB 1T1SA 4O4LF 4BCBA 5CFZA 1OVMA 2IQ5A 2OB2A 4BO8A 3MJ4A 1U0HC 5FKJA 4K9LA 4YJ2B 3IELA 4N5DA 2YYSA 2BEKA 1VHDA 3G59A 5FEUA 3GLFE 2NACA 1XZIA 2WSLA 3A7DA 1YDHA 1KDOA 2YNMA 3MTDA 4TGLA 5FJIA 2ONYA 2HUPA 4HGOA 1RBYA 1RLOA 4V1CB 5EPUA 2C94A 1CF2O 3PVZA 3C97A 4H3SA 4DN6A 2FG5A 3RU2A 1XLVA 4OF4A 1TVCA 2XJ9A 2GPSA 4YLGA 4AECA 4PF1A 4V39A 4MPPA 1XKXA 1UJ4A 3EHEA 5EUCA 4QRIA 5DTRA 3TR0A 3A3KA 5EWLA 1YFLA 2X9NA 1NXWA 2WUWE 4QDUA 3F1LA 1WTAA 2QYTA 3NNNA 3OT4A 4NHEA 1IRXA 1JB1A 3H87A 4CI0B 2V3CC 1KJ8A 1VLHA 2BGIA 4RGVA 4O33A 2H4ZA 4L57A 1A1SA 3LT0A 3TIVA 2QKYA 1XL0A 1B6TA 1N6IA 1NJFA 2C3UA 2ZIWB 4BZZA 2JD1A 4OFZA 3I1FA 4BQFA 1BZYA 4HQKA 3KWMA 1FYFA 1K4MA 1E0JA 2HLDA 2HTFA 3C3WA 1QYXA 1FTSA 2H1VA 2A0WA 1E4EB 2VWQA 3EEIA 4FHFA 4JZYA 4Z0NA 2ZE8A 2HA7A 4JI1B 3PXGA 3AJEA 5K0TA 4EZIA 1TQ2A 1U2RA 3QF4B 4DABA 2I6FA 3PHCA 4KSYA 4E5MA 4YT8A 1DV2A 5FUVA 3VPDA 2HMUA 1C7ZA 4RK4A 2ZWMA 4Q6WA 3FOEC 3IJ5A 4PCVA 1D9ZA 1ZHHA 2CMGA 2QTFA 2ZBPA 3LWBA 2CF5A 2AMVA 1MO4A 4AJ2A 3ZCSA 4OMCA 1HRKA 1TYEB 3I52A 3L6CA 4ITVA 2R7NA 1L1QA 2HNBA 2YMQA 4MYSA 4TN5A 2O19A 1ZH4A 2VF5X 2PQ6A 2XZTA 2KQUA 2B3TA 3B53X 3E70C 4QREA 3T7TA 1A7JA 4GNRA 4Q66C 4ZVKA 4NYIQ 4IMPA 1DC3A 5FT9A 1DBVO 4AYXA 4EMBA 4RAQA 3RVKA 2VTEA 5COAA 3U4CA 1HM5A 1QAMA 4ZJUA 5HNKA 5DCYA 1LC0A 1XCGB 4MULA 2DOKA 2OHXA 2GPYA 1W75A 3AF3A 5HIJA 4GMDA 2XUDA 3BTVA 4PO1A 2BKVA 2C2MA 4MW0A 3TQHA 3HXQA 1Z17A 4IDFA 1YNSA 4IKEA 1WD7A 2FR8A 2ZOSA 1LS6A 2R8YA 1MRZA 4D6YA 2H0QA 2O23A 2FA9A 3N0XA 3WG9A 4RLFA 3GLHE 1SFRA 3CH5A 2FMUA 2I8CA 4D4GA 2XUAA 1X2EA 4NZZA 1FRNA 2W37A 1FFHA 4LF6B 1WB5A 4NXNB 1L1RA 1H9CA 2XCUA 5JYBA 5ICSA 2RGGA 3JW8A 1QP4A 4KFSA 1R0SA 3MCWA 2WHEA 4I55F 1LQ2A 2VSNA 4K2HA 5REQB 1YJCA 2ECOA 2OXTA 1ID1A 4NV3A 1FVOA 3KVYA 1L2TA 1RJGA 1RQ2A 3DDUA 1NJ6A 3QVKA 4TVKA 4LJ7A 5BWOA 1ZD2P 2IYZA 1KWGA 1AK9A 3KWFA 3WYFA 3MTEA 1C81A 2PT9A 4GXTA 2P2ZA 1J7JA 1GCGA 1HO3A 2PO7A 3W8RA 1OAOA 4CMEA 3TW4A 1ULSA 3EXHC 4GWKA 3O31A 2QTAA 3BXXA 1U1EA 3H5OA 1NY5A 2WSSD 4G9GA 4JC8A 2ZUSA 3FGZA 3RODA 4GQAA 2QVLA 5I3ZA 1G6HA 2PGXA 1JLHA 3I9MA 3PR1A 4ZFNA 3OAAA 1YE3A 4K26A 3UBTA 4GAEA 3PEWA 1S7CA 3JD2A 1L7NA 1TEZA 3I1IA 2ZRDA 3WOVA 3AR7A 4DR6B 3AETB 4FJ2A 4I4CA 2PJDA 1NUSA 2NU9A 4C4PA 4Z7OB 3TDKA 1R16A 3OM0A 5H1YA 1O6FA 1X7XA 3QBDA 1QVAA 3R4CA 3SICE 4Y30A 3PVCA 1GXSA 3A4MA 2G3YA 2A84A 3A05A 3QKIA 2IYUA 4K87A 5B1YA 2A7XA 4HLUA 5EQDA 3GPIA 1E61A 3D81A 5HBRA 3U7QA 1O3YA 1O96B 4EKDA 4Z51A 2P9YA 3JD3A 5KYUA 2VDWA 4HDSB 2OXRA 5A3QA 2BFEA 3EVAA 1YJ8A 2TRSB 2AXEA 1SC3A 3EZLA 3IH5A 1HT2E 1NZJA 1LF0A 1TRKA 2C95A 3D3EA 2F7SA 4RZIA 4YBZA 1T3ZA 4DJ5X 5C1BA 5DM70 7MHTA 1JHPA 5I9SA 3II6X 5DM60 4PPYA 5A2GA 1Q0ZA 1OQAA 1EMDA 2O2YA 1JSRA 2A5LA 1QYCA 4ZREA 2HMTA 1JQJC 5SZHB 3K3PA 2O1XA 1JXOA 3KT8A 1ECLA 1W581 3BSYA 1SQFA 4C4YA 1HQDA 1UM9B 4ALLA 4ZOQI 1MABB 3IAAA 3G9QA 3KJFA 4OY3A 3KJEA 5BSHA 2BBWA 5HWSA 2PZMA 3OZ7A 4KJXA 5F7XA 4O4HB 4HLCA 3W3AH 3BJRA 3RB8A 2CHEA 3ZLBA 1XEXB 4XIYA 1VMIA 3LOQA 3EUEA 1SK8A 3P19A 4MUJA 2UU9B 2A9VA 4HX5A 1IZYA 3LKBA 4KSCA 5EYPA 1P0IA 3HADA 4BUCA 4LFBB 2BM8A 4TV9B 3GI1A 2VZ9A 4JJIA 1CC1S 1PSDA 1SA0A 5BN1A 3THXB 4RK0A 5IAOA 4XRRA 2O5VA 1CULC 2I9KA 4Z4CA 1QYIA 1DUIA 1Z37A 1M6VB 3NNDA 3UCFA 4E15A 1VSUA 2WTBA 2N46A 2ZTSA 4XCVA 3RVOA 1QKJA 3D0QA 4IW3B 3SJBA 1MR3F 4QZVA 3JQGA 4UXHA 4FDAA 3FYHA 1XTTA 4FJ1A 3N3BC 4RXUA 2BDTA 4LSZA 1M5TA 2BGGA 1EVZA 5SYMA 4F2GA 2ZGVA 4XLLA 3DMFA 1ZLXA 4OGGA 4E6EA 1KK0A 3KLBA 1PJAA 2J87A 2ZWVA 3EXHB 1LVGA 3GMSA 4OQPA 1U3GA 4QVKA 4ZAGA 1NN0A 4G5GA 4BLUA 5JC8A 4BLSA 5FD8A 5CJPA 4RSHA 5J63A 4QEKA 3VR1A 4JC0A 5LLSA 2JIBA 5F5XA 3TE7A 1WBDA 3PRYA 1QTRA 3MFYA 4YJ2A 3RRMA 4GPEA 3K5WA 1RDFA 4D6PA 1XJ5A 5CNIA 2C9ZA 1Z36A 5CTJA 5CFOA 1OWPA 3IHKA 5K51A 3QENA 3PEVA 4MO2A 1USGA 3CSDA 5B64A 5C32A 2HRRA 3N3AC 3HBLA 2IHKA 4J1SA 4Q05A 3GLIE 1LA2A 3IP7A 2QR5A 3UWPA 1RCTE 2CVFA 1LSJA 3UA4A 5IS2A 3LS2A 1NU6A 5KAPA 2F8TA 2JF0A 2DLNA 1XHEA 1T9GR 1Z9BA 5EJ9A 3MSCA 3WJ1A 2FLVA 3IOCA 4DVGA 2YH2A 1KNQA 4DTIA 3FE2A 2IEYA 5HDBB 1RWBA 1FXSA 3F1KA 4AMYA 3WQBA 3C3AA 3PFFA 3HH8A 3GP8A 1PVVA 2YVQA 4K2AA 3HP7A 2EEPA 2UZ0A 2WNHA 4O4JA 4OX9B 1ZIXA 4YRDA 4F5YA 4QLBA 5AKGA 1CZKA 3UW3A 2Z56A 3CBGA 2ZPAA 4EG7A 1CRWG 4MEAA 5SYNA 3I2HA 3VI3B 1EFVB 4LHSA 4KZKA 4BVKA 1RLUA 5HKOA 2VHCA 4FYPA 2EF1A 5JJKA 3RFUA 8GPBA 1LX6A 3MTGA 2I6QA 3OQJA 3Q7IA 1KEKA 2YRFA 4I4TA 1A8UA 3PNSA 4YYEA 1YQ9A 4DANA 1NBMD 2A0FA 1Y9ZA 2J3JA 2OB1A 2R6AA 3KVNA 1E5VA 4V2IA 5AI8A 4BY9E 3L0ZA 4QE3A 1FC0A 2VZEA 3CG0A 5D00A 3QWIA 2G6BA 4Z99A 4B44A 1ULBA 4NH4A 2PUAA 3NM5A 4N6OA 4DJDC 5DV9A 3Q85A 4LJ9A 4X3OA 5EMJA 2OZEA 2XCSB 1RAIA 1WCV1 4B3GA 4QT0A 4WNCA 1EWVA 2Q4RA 1LI5A 1G17A 1GRVA 2E55A 2W8BB 2ZI5A 3OFNA 1RPAA 1NJ2A 1K27A 1IQUA 4MCJA 1UBCA 2RHBA 1RYMA 3QE2A 3HJTA 4BN5A 4WPGA 3FVWA 5FJJA 2SKDA 2QUKA 5L8VA 1G8KA 4P9NA 3SC6A 3IV6A 1BXZA 1XDUA 2JGDA 3MJTA 1PWXA 3TPCA 1HFEL 2JK1A 4DNXA 4CEJA 1FZQA 1WA5A 5BN5A 5IZ4A 5ILOA 2QS9A 5AK0A 2B1QA 3AI7A 1VGVA 2IXAA 2QT0A 2WLSA 3DDCA 1G3IA 3MJHA 2A0XA 4F06A 3CCBA 1T8WA 4D92A 3FFBA 4C7OA 4PGFA 3H4MA 4TLAA 5J4KA 4LDZA 4B7AA 5D86A 2BMJA 3SE7A 1XCJA 3FR8A 3IUYA 2V7VA 1I7NA 1ZGJA 1YMUA 5GZ1A 4LGVA 5FADA 3RTBA 1Z73A 4XVCA 4MS3B 2IELA 1FSPA 1IPFA 4EKIA 3AGQA 1Z2DA 3NEAA 4PWZA 1Q0PA 3WDSA 2AR9A 2BFDB 1Z4NA 1XVVA 2JKVA 4PFKA 4F56A 1H2FA 3LY5A 4WESA 1F8XA 3TTXA 2OP0A 2GAFA 1XZ8A 3O7MA 1WWKA 1SU8A 3HN2A 3KTOA 1U2DA 3JASA 1U3VA 3DTVA 4KH0A 5I4KA 3MYYA 5KJFA 2OBFA 4Q5IA 5A9SA 4S1OA 4ENTA 3JTMA 3M4YA 2UXDB 2QD1A 2QX9A 4NYJR 2ZT8A 2W2OA 2C0CA 1IQRA 1XRLA 1T8RA 4XUCA 1X80A 4I14A 2YASA 3OIGA 4HK4A 4FGUA 4HNHA 4UUQA 4QUIA 4ER7A 4ZEVA 5HQ3B 1K68A 2IXFA 4R9RA 1RS0A 1TZBA 3JAWA 2XYHA 3CB4A 3DEZA 4UEWA 1VKZA 1E3JA 5LQMA 4MGYR 5C8YB 5EXEA 4CQMB 4H0FA 5CLHA 4DCOA 3M6XA 5J43A 4NEGA 1IK6A 1H9BA 2AG0A 2I2FA 2OG1A 1RM0A 2QTBA 2ROQA 1LFDB 1VI2A 4JGBA 4DLPA 1Y6FA 1W1IA 2B6HA 2UZAA 1F12A 4EO9A 4GE3A 4BBAA 4MI6A 1XPRA 4DB2A 3WIUA 2QM0A 4EABA 2BFAA 3MWJA 1T8UA 3VPBA 4ZYLA 3AXTA 3TM5A 4AJNA 4G2TA 3LXRA 2GBFA 3OOHA 4BLOA 1TO6A 3MQ2A 3S8MA 4B33A 1IEWA 3QNMA 4PEVA 2D5LA 3EB9A 3ENQA 3ISTA 1ZUIA 4PBTA 2CVOA 2JJ2D 5CB6A 3VVLA 3RLFA 5EWLB 4YP1A 3JQGB 2OY0A 4RD2A 1VP9A 2H17A 2ZWAA 4BE4A 1FYDA 3O1LA 2G07A 4H7FA 4DZRA 2D2VA 5HIKA 3TLZA 1P4JA 3RC3A 4KRXA 3M6FA 4Q7KA 5E2AA 3FIUA 4D4MA 2M6SA 2XOEA 3I4FA 2QLJA 1QQ7A 4CQMD 4ER6A 621PA 2ZCJA 3EXG2 1YDMA 3CC8A 4M38A 4QSMA 2XTNA 5CPFA 3M1IA 3CX6A 3P9PA 2C03A 121PA 1DKNA 2YICA 4RDCA 3SM9A 5JD6A 7ADHA 3S1AA 1RBZA 4S2UA 4QNMA 5EXDA 3KHKA 1IOLA 1VM6A 4L72A 1QK5A 2HMWA 4QYIA 5ALPA 1MAWA 4DIUA 1IN8A 1P3Y1 4KIJA 3KDAA 3LOUA 3C0KA 4O5OA 1WRBA 1Q7BA 1G8JA 2J41A 2QP3A 4RQUA 3L9WA 3NHJA 3PD1A 2PE5A 3B6ZA 1PR9A 5ARDA 4KWEA 3DFZA 4B8ZA 1KMCA 3CKKA 3J7TA 4GXQA 1UMDB 1J1IA 1L9XA 1KI9A 1RU3A 1WCYA 3HCRA 3VI4B 4IV0A 3JWEA 1BEEA 2X9VA 3NWBA 3NUQA 2CHVA 2VWHA 2IODA 1IXKA 2YZMA 3ZKWA 1I3CA 3QUQA 4IDEA 1BFDA 3DGEC 5BV7A 3WIDA 5DZSA 3TQTA 5I7FA 2JJYA 4RPJA 1YI0A 2VJNA 1W4RA 3GA0A 3LM8A 2KE5A 3LVBA 3N0RA 2F3UA 4M86A 4Z8YA 4ZRDA 3PB3A 1XSEA 4ZN6A 1FW8A 2NTNA 5FL3A 5D8DA 2FH5B 1L7QA 1V39A 3FWKA 4CDNA 2A9QA 3IQHX 5IK2A 3HE3A 3JU3A 3VNSA 3JZAA 5CB0A 2Z9BA 2AN9A 4ND8B 4JBWA 2WPDA 2J3KA 4Q4AA 1SY7A 1V71A 1GZSA 1SBYA 1FQWA 4JKOA 4KO1S 3MJVA 5DP1A 3WOHA 4UASA 4GSKA 5JAIA 1I1NA 4PHCA 3RBV