1W2HA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with azidothymidine monophosphate (azt-mp) (2.0 a resolution)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
190
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE TMK
publication title The crystal structure of Mycobacterium tuberculosis thymidylate kinase in complex with 3'-azidodeoxythymidine monophosphate suggests a mechanism for competitive inhibition.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 73
structure length 190
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w2hA00
2ZS8A 3MUFA 1GTVA 2REBA 4Q7LA 1Z0AA 1F2TB 1XMJA 3EPHA 4OQNA 4Q7MB 2WSSD 1QG4A 3MFYA 1M74A 4XIGS 4LJ8A 4ZIRA 4KLZA 4PC2A 4E07A 3QENA 3SYLA 2FA9A 1EESA 3TH5A 5CK4A 3VHLB 4BZXA 2WAYA 4B35A 1IY2A 1G3MA 1RKBA 4EFLA 3OEHD 2VQSA 4MRVA 1UKYA 4TZ6A 1KJZA 3NVAA 3SI7A 5A5GA 1T0HB 2IYZA 1WF3A 2AD5A 2CVHA 3EC1A 2ZR7A 3FB4A 2JLRA 4MRSA 3TQFA 2ZRMA 3CPHA 5UKDA 2F3RA 3CM0A 1S1CA 1ZC3A 3GEIA 3CR7A 4C0LA 2HCJB 1Q21A 1E9EA 4A2WA 1SXJD 2JIZA 3W5IA 1XEXA 2A7QA 1JXOA 2F1IA 1CP2A 4L8GA 1E4VA 4OK5A 1W2GA 3IKJA 2X2FA 3A1SA 3LW7A 1TAGA 2FZLA 1EFRD 4Q1AA 3UIEA 4IFBA 2WIBA 2AN9A 2XX3A 2IA5A 3FFBA 2WOOA 1Z47A 3BIFA 3DDCA 5AUPB 1CEEA 1IN5A 3AF2A 3TIFA 2CL0X 2GILA 3BB3A 3U6KA 1D6JA 1PUIA 1Z2AA 4BFWA 4TTQA 2WWHA 3GLGE 2DR3A 2GXUA 1VCNA 1UBFA 1VYVA 4FXPA 3GLIB 3EG5A 3CF6R 1V43A 1E2MA 1QHSA 5DYGA 3A36A 4GMXA 3LVRE 1OF1A 2EFDB 3QXXA 2GJ8A 5KSZA 3EZ9A 2O8BB 1ETUA 3IHLA 3B1VA 2R6DA 3TSZA 3AP3A 3KB2A 4GZLA 1R5OA 2BOVA 4IOKA 3UWOA 4HB2A 3GJ0A 2JASA 1KO1A 3V4FA 3IBYA 4DLRA 1P61B 1NMXA 3VX3A 4PO8A 3T1TA 4WVFA 4D6PA 1ZNWA 1ESNA 2HXSA 2QAGC 1E4YA 2TMKA 2IXFA 2FZ4A 2QEQA 2UZIR 4M9XA 2J87A 3WP0A 4CDGA 3K9LA 2OESA 1KSHA 1VCMA 4YMTA 1OPXA 2GDJA 2YC2C 2IHYA 3DOFA 2OZEA 1US8B 2BCJQ 1ZAKA 2D2EA 1E2KA 1KMHB 4PSVA 4PQFA 3SBEA 3BOSA 2VHQA 721PA 3VKGA 4MUAA 4EPWA 1JI0A 4YDHB 3MCAA 2WSSA 4N3NA 3AVQA 1FW6A 5IT5A 3MLEA 4IXNA 4JZKA 2OXRA 4QG7A 6Q21A 3I8SA 2QPTA 3B2EA 2A5GA 5EXTA 2RGNC 1GUAA 3GCGA 2J7PD 2DHRA 1U90A 2RGEA 3Q5DA 4EDHA 2R65A 1XTRA 3OEHA 1P4SA 3A1VA 4JLBA 3AUXA 2JAQA 1Q3TA 4X8OA 2DFLA 1KO4A 2B21A 2A3RA 1II8A 2ZJYA 3I4LA 2ANBA 4XH9B 3MGCA 4HB4A 3R7WA 1FUUA 3VKHA 4MGKR 4B3BA 5TMPA 2G0NA 4F38A 3MAAC 3PUZA 5FOWA 4DDVA 1OXTA 4L16A 1SXJA 4TL7A 2KI5A 4C0SA 4HSEA 4GL2A 2OG2A 1IY1A 1LY1A 2J0VA 3C8UA 3HU1A 4EJSA 1KHTA 4D4MA 4DSTA 1FUKA 3P4XA 4XJXA 2X77A 3WYFA 2V3CC 3HPQA 4BFXA 4HI0E 4KBFA 1G20E 1F2TA 2ZR9A 1NN5A 3I8XA 3L43A 1FQJA 1I2MA 3CH4B 3PEUA 2IS2A 2ORWA 2GCOB 2FF7A 2R2AA 2YKGA 2PT7A 2HT6A 4AYWA 1MH1A 1Q1EA 4D2IA 5BW8A 3OZXA 1GKUB 2WKQA 3IUYA 5AUOB 1G18A 1KZ7B 4X8MA 1SKYE 2HJVA 3LO5A 3Q9LA 1BYUA 3AF4A 3TQCA 5J4KA 4P0TA 2QTFA 1OFIA 5KSYA 3Q7QA 1JAIA 1RE0A 1RJ9A 3TRFA 4ZV4A 5A0FA 5HE9A 2FGJA 3VR2A 4ACAA 3B1XA 1NSTA 1VPLA 2MSCB 3U7GA 2CCKA 2IW3A 4LHYA 1GWNA 1ZNXA 1AS2A 4DSOA 2OLKA 1XPUA 4DHEA 4G5SA 2G77B 2QY9A 1Z3IX 5IF9A 2J0UA 4PC6A 1MABB 1P5ZB 4NCJA 2UZ3A 1XEWY 3AKCA 1NMYA 4OQFA 3PENA 4DCUA 3SHFA 3RLFA 1E32A 2GJKA 1OV4A 2OBNA 4P4UA 4C7OA 1ZD8A 3CWZA 3BORA 1ESMA 1XTIA 2CXXA 3BH0A 2IL1A 1J7KA 1NRJB 1R0WA 2IHBA 2R8RA 4OHVA 4B75A 1TF7A 2FEMA 1E9DA 4PO9A 3WHLA 1AN0A 2IYXA 2ZM5A 2X1VA 2FN4A 1HY3A 1E2JA 2JA1A 1HE8B 4A8JB 4AYXA 4U7DA 5F98A 4HLUC 1Z6TA 3IO3A 2J7PA 4TYQA 3PEWA 4D26A 1G16A 2VPPA 1GAJA 4LBWA 1EFUA 2O8BA 1DTSA 4OHWA 4YONB 4TMTA 4AC9A 3K0FB 4Z1MD 1G7CA 1T6NA 4DC9A 3U7FB 2IT1A 3CX7A 2A5FA 2WIAA 5SZJA 4LYFA 2ZRJA 4OI1A 2B92A 4B43A 4C0KA 2QL6A 1UKZA 3ZS8A 4KJZA 2PCJA 2GJAA 1G41A 5LPNA 3AV0B 3BC1A 4LCBA 3BFKA 521PA 1FPMA 4A0RA 3U6BA 3AGPA 4A6XA 1SVSA 2Q21A 2IF2A 4EPRA 5GVRA 3AP1A 1LNZA 1G291 2OFOA 4G5RA 3T5GA 2ZVPX 5CK5A 1WQ1R 2ZRNA 2WKRA 4M4SA 4IJMA 1M7BA 2OFXA 3AUYA 3C16C 2D2FA 2VH5R 3RAPR 3DEFA 1US8A 3TR0A 2ERYA 1KO8A 3LAWA 1Z5ZA 4QGGA 3U3OA 1IXRC 5K8UA 2C5LA 3F3YA 2QG6A 3ZGXA 4BLPA 4DBLC 2CK3D 3SBDA 1NY6A 2VP5A 3B9PA 4OJQA 4JLKA 1Z0DA 4EQ6B 2NO1A 3I61A 3AKEA 4LC0A 1HV8A 5C4GB 4EAQA 4DLUA 4WA7A 3IBGA 2EFCB 3C5HA 3NDPA 2ZUBA 2FSHA 3W3AA 1R0YA 4JLPA 1ZUHA 1IHUA 4M1MA 3U2QA 1XMVA 3P4YA 2D62A 4URVR 4GOKA 1FX0B 2AFIE 2ZU0C 3KUDA 1SQ5A 2FNAA 2LCFA 3KQLA 1EWRA 3K70C 5DISB 4Y0AA 1I2DA 4AY2A 2V6JA 5L3QA 2GF9A 4HB3A 2QN6A 1MO3A 1Z83A 1KK0A 3EZ2A 2QORA 1W36D 4L4UA 5EXSA 4WZAE 3IO5A 1FOEB 3VX4A 1GL9B 2ONJA 2ZSAA 4XVUA 4LHWA 1E2GA 4YMWA 4US2R 2IYYA 2BMFA 1XEWX 4B3XA 3QVUA 1W5SA 1SVIA 4ARZB 2HXYA 3EAQA 1NN0A 1KO5A 3B1WA 4LJ7A 1SGWA 4LBZA 3GPLA 3EXAA 4NMMA 4DLTA 1PLLA 2IS1A 4JT2A 2GCPA 1AA9A 4NYMR 4ESVA 2Q0HA 2WBLC 1S3SA 1ZIOA 2HEIA 2Z83A 3LDAA 3QPVA 3UMRA 5SZKB 4D0LB 4XSHA 5EP1A 3CW2A 4NCNA 4OI2A 1X1SA 4Z1MA 5J4YA 3IQWA 4JYCA 2CL6X 1CR1A 3NBFA 4MUBA 3I1FA 1W4BA 2XAUA 1KI6A 4B3DA 3BE4A 4WZBE 4IW3B 1QHYA 2FFQA 3C41J 3LQRA 2QMOA 1ZIPA 5TDHA 3LLMA 4TN1A 2B6HA 1N0VC 1CU1A 2CJWB 2WJYA 3B85A 1MABA 5DI3B 4RD1A 2VP9A 4ZKEA 221PA 1E9SA 2H92A 2Q9CA 4QGFA 2EFGA 4FMCB 1OE0A 3R20A 2WZQA 2OEPA 3CPEA 1G6OA 5B2ZA 2DFTA 1E2EA 4PQYA 3UG6A 4KYIB 2CK3A 421PA 4O2RA 2BBWA 2G3YA 2NZ8A 2AX4A 5DNYB 1E2DA 4PFSA 2DPXA 1X8LA 4HZIA 3K1JA 4A8JA 2XITA 2QGZA 3R8FA 2YVUA 3SJCA 1A2KC 2RH5A 4XTCS 2DWOA 3LY5A 2GVZC 1P9RA 3CB4A 3DVLA 1Q44A 2OFWA 3K0EA 4ZO4A 3AH8A 4AIIA 1EX6A 2PEYA 3CR8A 3FKQA 3IGFA 3SJAA 4JKIA 1LVGA 3ONWA 1XZPA 3WP1B 4YLGA 5F9FA 2ZREA 1KSGA 1N0WA 2RHDA 4P4TA 1G17A 2N1BA 2DWPA 1AGPA 3TUIC 2EYQA 5KDDA 3A8TA 5M04A 2W6IA 4R9UC 3SU8A 1XPRA 1KSJA 4MGYR 2A2ZA 2CNWD 4QBFA 2PMKA 1MO5A 2ZI4A 2IWRA 4GRAA 5EXPA 4EQ6A 5JJIA 3H1TA 3LWNA 4HAVA 4LY6A 3RC3A 3FFAA 4LPSA 4LI0A 1T3LA 1XP8A 5IHPA 4MKIA 4I99A 1O87A 3G82C 4G5QA 4B3CA 3ZVRA 3DZ8A 3DZDA 3AP2A 5D3MA 5HTKA 1L7VC 3VNVA 4M9SA 1FX0A 3H86A 4J0QA 1IJFA 4RD4A 1PV4A 4KYUA 1M34E 3VAAA 5G3ZA 2C96A 3P1JA 3T12A 1AQYA 1AK2A 1UBGA 4GI7A 2RKOA 3NC0C 4LYHA 5H8WA 2J0SA 4AKIA 2VL7A 3SN6A 3T61A 2AKAB 1J8MF 4BFTA 5FOUA 4PZLA 2ZI5A 4JBXA 4IXMA 1YHNA 4ZI3A 5FUVA 4BQSA 2PL3A 4GNKA 1VMAA 4NTZA 4URYR 4ARZA 1DO0A 4B3FX 2QSYA 1S9DA 2JCSA 4A0FA 3A1UA 3RHFA 2VF8A 3L0SA 2AK2A 5GJWC 4CT4B 2ZIAA 3SR0A 1XEFA 5EP2A 2XNDD 2QUZA 1SVKA 2JJ2D 2PLRA 2RCNA 1W0JD 2QP9X 2W00A 2ZI3A 4G0NA 3QVVA 4G1UC 4BLQA 2E9SA 1XD2A 2QMUA 4TYYA 5KO2A 2VEDA 2VHJA 3VNUA 1FMLA 1G4AE 1YVDA 1U9IA 3Q8XB 2P67A 1NY5A 3LBIA 1HTWA 2WJHA 1E6CA 4GZMA 4NBSA 1P9NA 1OIWA 4UJ3A 4C0AC 4QOSA 4C0HA 2C99A 2QRNA 3F5FA 1RRCA 3LBHA 4HB0A 1E99A 2PX3A 1IXSB 4KLNA 4DT1A 1G8HA 2YINC 3N70A 2J5XA 4M53A 3QPWA 3RSLA 4URZR 4Q03A 4OQMA 3CNNA 1U81A 2A5DA 3HPRA 5DI3A 5CDFA 3W8NA 1CS4C 2ZRLA 1OXXK 5JJLA 1BYIA 3AQ4A 2QM7A 4PSKA 1AIPA 5LBIA 1WMSA 2X19A 2GEDA 1YZLA 2WWWA 4BFVA 5L3SA 3IHWA 1L4UA 5JFGA 2ZR0A 4RD0A 4NYIR 1FZQA 3TSWA 2NO9A 1TU4A 1XRJA 3D8BA 2XTZA 2ZUDA 2ZANA 4UQOA 3KKPA 5KPDA 4U5XA 1R4AA 1Z0KA 2CNWA 4Q1CA 5FBVB 1CJVC 5HPYB 3B60A 5EE3A 3PVSA 1PLJA 4HAWA 3EA0A 4B76A 3U7EB 3KJHA 2R9VA 1XXHA 3G5UA 2A9KA 4AI6A 3GJ8A 1NLZA 2QNRA 4WOPA 1S8FA 2Q3FA 1G1MA 3FOZA 3BAFA 4UNNA 4O0MA 2GETA 1XD9A 4YDSA 3WYGA 4R2HA 4QNMA 4A82A 3K0AB 1QF9A 1SKQA 2XXAA 1Q57A 3REFA 1SULA 4KAXA 3SHWA 1ODFA 1OKKA 4S35A 1KNXA 3CLVA 2G1KA 3JZMA 4TQAA 3H2YA 1BIFA 1A4RA 1JR3E 1NMZA 1Y63A 2J45A 4O2LA 1N6HA 2WOJA 1Z08A 2P6NA 3LX8A 3ZVLA 1F2UA 1S2MA 1XJQA 3QXJA 1NIPA 4K81B 2GCNA 3GLHB 1FMJA 5C4MA 4PPGA 1J99A 2ODEA 1IY0A 4Q47A 3KJIA 1GDDA 2XNDA 2JJ2A 1DELA 1W0JA 1KDPA 3RWOA 3QF4B 5FI1B 2CHQA 3OEED 3KQHA 3BGWA 1NI3A 5FUWA 3SS8A 4AD8A 5KU1A 2ZRGA 1K5DA 4GPTA 1A82A 5LB4A 2ZJ2A 2BKUA 5IRCD 4GBMA 5E95A 4BE7B 1IN7A 4BASA 3U44A 4PX9A 3CH5A 4QJ5A 5DE3A 3EIQA 1U2RA 5GVSA 1FL9A 5FPKA 3RDPA 1E1RA 5FOSA 2QAJA 1MR3F 4M1SA 4LV6A 3TSOA 2D3WA 3NC1C 3EWSA 2R44A 2O8CB 1KSFX 2IYQA 3FVQA 1F48A 1EK0A 4G5GA 1OXUA 3LH5A 2D4HA 2CHGA 1U0JA 2F43A 1KAOA 3BS4A 2HJGA 4OHYA 3IIMA 3E70C 2GWHA 2CE7A 1EWQA 1UDXA 2IK8A 1KK2A 2FV8A 3HYTA 1YZUA 3X1YA 2IC5A 4OQLA 3KZ1E 2HF8A 3ZZ0A 4LGMA 1RPZA 1R0XA 2ZI7A 1G64A 3NG1A 3V9PA 5JECA 4LYAA 2KB0A 3LW8A 1NLFA 1Z0IA 4TL9A 3QKTA 2RB4A 4G3XA 4JSTA 4UKDA 5SZHB 3ZDQA 1U8ZA 1RC8A 5JRZA 4LOAA 1D9XA 3SJZA 3EZFA 1UKEA 1E0JA 1WCV1 3AKDA 4E22A 5DLQC 2GXQA 1OSNA 3IIJA 5A4JA 3ND8A 4TLCA 4H9GA 5AK0A 4PPFA 3E5HA 4TLDA 3THWB 4A9AA 4DXAA 2NOAA 1Z6XA 1Z07A 4PHGA 1X8KA 2P6UA 1CRQA 2QGNA 3L8YA 4CEJA 4RSGA 3TW8B 2H5EA 4HAYA 3KXLA 1WRBA 2IYRA 2Q3HA 1W4CA 5KHOC 4A6PA 3NEJA 1OLOA 3RS2A 4Z54A 4OHZA 1E2LA 4F91B 3THXB 1G8FA 1KOFA 3T06B 1SXJC 5K8LA 1UBCA 2F1JA 2FJUA 3BH6A 2NQ2C 4ZDWA 5JMTA 4XOIA 3K09C 4JBWA 2IEZA 4BEBA 4KFSA 3HU3A 4EPXA 1OH6A 4JLMA 4DLZA 2OLJA 5L3RA 2BDTA 4W5HA 3S1AA 2HLDD 2AD1A 3GD7A 1XD8A 4AYTA 1OJLA 2NPIA 1OFUX 2ZUCA 2QAGB 3LNCA 3RWMB 2IUUA 4HYYA 4BPBA 1M7GA 3OEEA 4QHTA 5F2EA 5FPSA 1ZP6A 4DZZA 5JWRA 3BERA 1EFHA 2SHKA 1T0JB 1GNRA 5L3VA 2GKSA 4P31A 4D4JA 3PUVA 4A2QA 3H0KA 3E1SA 5CJ2A 4I1UA 1QHHA 4G5OA 1E2HA 1OHHD 5FI0B 1JQLB 3WMGA 1KDOA 4RZXA 1KJWA 3FMFA 3GJXC 4CEHA 1ZD9A 2H18A 2O52A 1BO6A 1ZW6A 1NP6A 4JLJA 5TY0A 5JEEA 2FPMA 1UBEA 4JVSB 4QM6A 2NMVA 4NYIQ 2QMHA 1G5PA 4PAMA 3I5XA 4FI3C 2QMEA 1XCMA 3AVXA 4TL8A 2PBRA 2GRJA 2ZRPA 4NU0A 1NN3A 2W83A 2GZDA 3EIEA 2QPOA 2NPFA 5BN4A 3FYHA 3R9XA 1HQYE 4LX0A 2BBSA 1RW4A 2ZETA 3FGNA 3OESA 4NHOA 3QY0A 2BV3A 3GLHA 3GLFB 3A37A 2QP4A 4DB4A 4KXFB 1WE2A 3RRYA 1P60A 5AJVB 3BFVA 3B5JA 4HDOB 3WY9A 1TNDA 1VYTA 2ATVA 3QF4A 3C5CA 4M1OA 5C1BA 4A36A 1ZMXA 3TVTA 2NO0A 4CW7A 5G53C 1E69A 2GAOA 3QG5A 4BUJA 4ZI2A 3G0HA 2ZITA 5FL7D 2E87A 3MWYW 3GEHA 1E0AA 2GEUA 2QROA 4NCIA 4DUGD 3B1YA 4TMZA 2QSZA 1UKVY 4AG5A 2YOFA 1KMQA 4JKYA 1X8JA 4DIDA 2W2VA 4XVRA 1OH5A 5JSZB 1MOZA 4U00A 4Q1FA 1Z0JA 1OXSC 2QM8A 4ZPXA 1N5IA 2ZYUX 2A30A 1NF3A 5DIFA 1GIAA 1VG1A 1G3UA 5CYPA 2R6AA 1QHXA 1ZU4A 2XTNA 2ZJ5A 3R9IA 2IS6A 5LB2A 2DCUA 4LJ6A 2ECKA 4XWKA 2QENA 2QBYB 1CR4A 1OIVA 5K8IA 4HUQA 2O8EB 5KDLA 3SFVA 2ZE7A 1JR3D 1P62B 3Q3JB 4A15A 1EFRA 1L4YA 1N2CE 4LBVA 4Q18A 2DB3A 4M2LA 5IDVA 2ZE5A 3PUXA 3GJ5A 3Q7PA 5H68A 2L0XA 2WICA 2PJZA 2ODNA 4I4LA 1N6NA 1VIAA 2HLDA 2GBLC 4CIDA 4LWZA 1D5CA 4LJ5A 4Q4JB 1R5NA 2UVQA 1Q1QA 1YZNA 1Z8FA 4Q21A 2QU8A 4ASUD 4FINA 1IBRA 2O5VA 1J90A 1Z6GA 3GFPA 4LJ4A 2WWFA 5BN5A 3IPYA 4ITRC 4PC7A 2IWHA 2C78A 1CJKC 4Q7JB 4P3YA 1X1RA 2BEJA 1P6XA 1OHHA 3MSXA 3THWA 2MMGA 2ODBA 3SDZA 1GOTA 2HUPA 1KDRA 1N6IA 1R5BA 2I4IA 3ASZA 1COWD 1HEIA 1KJYA 1YR8A 4Q9LA 2IYLD 5CDFE 121PA 2FSGA 4JS0A 4KFTA 2R6GA 8OHMA 2A5JA 3AVWA 3AVVA 4TTPA 4M1YA 5DO9A 4H1VA 5FL3A 3ZZTA 4YQFA 2BIFA 3CF2A 3SE0A 2ERXA 4QL3A 4XSGA 4CEIB 2XNSA 2AL7A 2ZRDA 3ECCA 4RD6A 2ZXUA 2GK7A 2IYTA 5LDDC 1ZM7A 4LSGA 4TZ0A 4JJZA 4WAUA 4BGDA 5JLJA 4M22A 2OBLA 2YYZA 4MRPA 2G83A 1GZSA 3GJ3A 5L8VA 4BFSA 2FFBA 4TMKA 3PEYA 2ZYWX 3BFXA 3K9GA 1NBME 1PZNA 1A5TA 1Z22A 1XXHE 2ORIA 1GRQA 3GLIA 2K5UA 3B7GA 4IDPA 2JLSA 1YZKA 1Z6AA 3ZQJA 2EWWA 4NL4H 4FCWA 5FL7A 2I1QA 1KKLA 2IBMA 3U60B 4DUGA 4X8LA 3X1XA 1ANKA 4OYHA 1GNPA 3DKPA 4Q9KA 1FQKA 2CVFA 1J2JA 1SVLA 2EVWX 4M0LA 1PLKA 3BWDD 1CJUC 1HT2E 2DFKB 2AXPA 2ZRAA 3PXGA 3GEEA 4FWIB 4NYJR 1Q12A 2BM1A 2V9PA 4LRWA 2RGNA 4CYMA 4C9BA 4B2LA 3UKDA 1ZCAA 4MDFA 4XD7D 4JVLA 1HURA 1TF2A 1Z2CA 4OL0A 5FPYA 2BC9A 5J4HA 4MKGA 4C30A 2VSXA 3FHOA 3W9YA 2ZSEA 1JR3A 3KKOA 5AR1A 1DBSA 4S2EA 5BQ5A 1OIXA 3GLFA 3K70B 5CIQA 2CBZA 2GHIA 2VA8A 1KMHA 1HA3A 1MT0A 2MMCA 3RS4A 3A4NA 1N5KA 1ZCBA 3MMPA 1B0UA 1E96A 1QZXA 1JR6A 2ANCA 4ASUA 4QC2A 3B13B 5TV2A 3PV0A 5EP3A 4MDEA 4DDTA 1R7RA 1UM8A 2VSOA 1DOAA 1CXZA 4B73A 4RD3A 1Z0FA 4O3MA 2H1LA 1GNQA 1KNQA 3OF5A 4RFSB 3CONA 1M6NA 3W34A 3QE0A 1RYHA 4Q66C 3AVUA 2RGDA 1ZC4A 1FNMA 3K9HA 1G8GA 2IUSA 4MQBA 1CKEA 4LUCA 1COWA 3W8RA 3K8YA 4NKRA 3LBNA 4UNSA 5FOVA 1E2QA 4DDWA 5DHAA 4Q19A 2QBYA 2QE7D 1F6BA 3LD9A 5DGXA 3WXMA 4N0DA 1QG2A 5FTMA 2IYSA 5G3YA 2WHXA 3FMIA 4GSYA 1ZU5A 2GZAA 4Q4AB 1JAHA 2D7CA 3E2IA 1J70A 1PUJA 2P3SA 4OKSA 1BOFA 1S96A 3K70D 4KSCA 4BLRA 2ZRKA 5HKKD 1N6PA 4CT5A 3MWLA 1DAKA 4TTRA 3VR5A 4C0JA 2GCOA 5KUTA 3U61B 3RS0A 2FWRA 1GITA 2FPLA 4RZUA 2IEYA 4V0KA 5E7MA 1UADA 1ZVQA 4IKEA 2C8VA 3QBVA 3AVTA 2C9YA 4MGIR 4Q9JA 4KSBA 1AZTA 1T3SA 2OCBA 1SZPA 3W6NA 5JHGB 2BBTA 3UANA 1OB2A 3P26A 4CGZA 5GJCA 2KBFA 4MKFA 3VR1A 4AURA 3UPUA 2OE2A 4JVMA 621PA 3U3KA 3GP8A 4NPHA 2IXEA 2BBOA 4QGHA 4Q9IA 3KUCA 4AKEA 3CZPA 1KK1A 4BZPA 4TMWA 3SYNA 5FBWB 4XVQA 4HLUA 2REXB 4Q9HA 4W9MC 4FMDF 4XD7A 1KDTA 2OAP1 3EPJA 3WYAA 1EG7A 2F9MA 2XZLA 1G7SA 3RS5A 1IAQA 5FPTA 1DPFA 2Z4RA 1TPZA 2QT1A 3BB4A 1QVRA 1WXQA 3QIAA 4A92A 1E9BA 2Z5FA 3VR3A 5H70A 1S4QA 2F3TA 3LXXA 3UATA 2PLFA 3U3RA 1G7TA 2G6BA 2R6CA 3C14C 4AK9A 1VIYA 4MYUA 3K0CC 4PSAA 2LWIA 3HR7A 4NCHA 3UMSA 3FHTA 2XJ4A 5CM8B 4Q48A 4JIMA 1Z28A 5DHFA 2XB4A 4BLOA 2GVDC 2MSEB 3LVQE 2PZEA 1N3BA 1KKMA 2QRZA 2X2EA 4FN5A 4R71A 3FKSD 4IEIA 5FOTA 3CO5A 3RS7A 4TYNA 4IVRA 4DSUA 2GA8A 1OH8A 3QKSB 1CULC 4TL6A 3TAHA 3Q5EA 3TVDA 5JS7A 1R6BX 2NO7A 3M6AA 4XTRA 4DCVA 2Z0MA 3NWJA 4UXJA 4C0BA 3T15A 2HYDA 4IVPA 4DIEA 3K0FA 3T35A 4US0R 1U9IC 4PXAA 3L0OA 1ZINA 4L9WA 1VKJA 1NL3A 4RD2A 4FMBB 2ZJAA 1S3GA 4QGAA 1JB1A 4UNRA 1E94E 1TEXA 1GKIA 1T8UA 4C4PA 1OT3A 1IJEA 1UDWA 5JCZA 4ZKDA 1G7RA 2GTPA 2QE7A 1JBKA 1EXMA 1F60A 2IYVA 2ZPTX 2IX3A 1RZ3A 4TLAA 2O8DB 1MRNA 5HCNA 5EJEA 1NKSA 3GLHE 1JPNA 1VCIA 5EUMA 1YRBA 1PVOA 2G88A 4KV9A 5HKKA 2W6JD 1XU4A 2DBYA 3AEZA 2B7BA 5FR1A 1W5TA 3ZYCA 4F4IA 2VIIA 4HUTA 1NBMD 1TUEA 3QXCA 4II7A 4QXAA 3WHKA 1NG1A 4OBEA 1TX4B 5H1YA 2BCGY 4F93B 1XTQA 1E9AA 5TB5A 1E3MA 4PTLA 5EE1A 2J46A 2C77A 3CX8A 4LV5B 2JLYA 3HU2A 4PPNA 5TVKA 3IEVA 4NZYA 2ORVA 3I92A 2WWXA 3VR6A 2KJQA 3U4QB 4HATA 1B23P 4O25A 1TUIA 4JBYA 3WMEA 1MO6A 3BB1A 2VP4A 4Q4HB 4B2PA 5LD2B 4BLSA 4B44A 2D7DA 4DLSA 1CIPA 1XZQA 3O8DA 4YXWD 1BKDR 1E0SA 5CLQA 4Z8YA 3I5YA 4MITA 3ZVNA 1KI8A 2NTYC 4IOJA 4W7SA 1VTKA 1HE1C 1O3YA 1VHTA 4E03A 5JS8A 1HT1E 1S1MA 3VTKA 1T91A 1ZUIA 2C98A 2FPKA 1R10A 4DB2A 3ADDA 4GMDA 1EGAA 1J8YF 3KQNA 3KJEA 2BKEA 3FKSA 3AVPA 1X3SA 1T5LA 4URWR 5LD2C 2XSZD 1XF9A 1JECA 3D6TB 3KQKA 2KBEA 3LRPA 4ESHA 2OO7A 2V4ZA 1R2QA 4QM7A 1C1YA 1U8AA 2W2XA 1D9ZA 1NKTA 1FTNA 2OT3B 3T5DA 3AM1A 3TUJC 1KTVA 1U99A 1LS1A 1GILA 2ZRCA 2B7CA 2JLUA 2F1RA 3GJ6A 4ZIRB 3AB3A 4KO8A 4KITB 4ACBA 1VG8A 1TF5A 1LW7A 5AUNB 3B6EA 2CJWA 3IIKA 3WBKA 1WB9A 2XGJA 2JDID 4V0MA 1P3JA 1UJ2A 3RVBA 4NYMQ 5E7IA 1KI2A 4RY2A 4BRUA 1Q22A 2GJSA 1G3RA 1DO2A 1G3IA 1GRRA 1NG9A 3DM9B 3LX5A 1CJTC 4B48A 3U5ZB 2W6JA 3I73A 3SQXA 4N0EA 4C0QC 5JI3E 2RGBA 1W4RA 1W44A 3I72A 3DOEA 2YJTD 4PHFA 5F3WB 4JSYA 2OCAA 2VP2A 3NH6A 2XEXA 2W0MA 2FX3A 2ZU6A 5B30A 1NBMA 5B57C 5BWMA 3GLIE 1JPJA 1W4AA 1XEXB 3N2IA 4FW9A 5AJYA 3PFIA 1LS6A 4PZYA 1CR0A 2XJ9A 5FR2A 2GXAA 2D06A 3EC2A 4ZDJA 2PMDA 5CIWA 2X8AA 4YMSA 3TK1A 3JZAA 1W1WA 1AM4D 4X8HA 1P7CA 2DY1A 5FOXA 2AHOA 5K8TA 1UPTA 2ZSBA 4JLNA 1XB2A 5C2JB 5GJVC 4P33A 2WKPA 2F9LA 1YU9A 1E1QD 1YZTA 5FTJA 2YC4C 3W3ZB 5BXQC 2CE2X 4W5JA 3LQQA 1KI1A 4TMXA 4DLVA 4QJ3A 1AS3A 1RRGA 4IVQA 1FP6A 5J40A 3TW4A 3UK6A 2WSMA 3SOPA 1GG2A 1NVUQ 2CLCX 2AXNA 1DG3A 4WXPA 1WA5A 1TQDA 3P32A 2ONKA 4YXWA 2O8DA 2B8TA 2QZ4A 3EZ6A 3GLFE 5C18A 4KVAA 3KJGA 5P21A 2EYUA 3L0IB 4E09A 1JEEA 1G4UR 3SJBA 4NP6A 3EWAA 5AWFC 2BMEA 2GJ9A 1KAGA 4M9QA 4RFVA 4UXIA 3NH9A 1P72A 1II0A 3QNUA 2QI9C 2RHMA 4HZUB 3QXSA 2AWNA 4XWOA 5KDOA 1P9WA 2ZYTX 3FPAA 2XSZA 4PAOA 1FP7A 2W2TA 4IDOA 4PHHA 3ZVMA 1AS0A 1W49A 1VG9B 3RRMA 3DKVA 1I4DD 1TL7C 2P2LA 3RABA 2C9OA 3U3JA 3MG9A 1ZJ6A 4WIAA 2FGKA 4B32A 2Q6TA 3EPLA 5CJPA 4PZZA 1EX7A 3U4QA 3RS3A 1XCGB 4Y0VA 4HAUA 3AKYA 3JVUA 3ZQ6A 1LF0A 4P32A 2JDIA 1F5NA 2IF0A 4V0OA 1IXZA 1FNNA 3REGA 4YMUA 2ZQ5A 2H7VA 3EARA 1KI4A 4OI4A 4EIWA 1YKSA 3K53A 5AJWA 2NO6A 3VU9B 3CIOA 4LHZA 1AQUA 4A1FA 5CYOA 4TT3D 2F1HA 4FCVA 3B9QA 2N42A 4QHYA 3ND9A 3QOFA 3SC3A 1BMFD 1II8B 4D25A 1OFHA 2CL7X 5B64A 2F6RA 4WZ6A 1H65A 5CITA 2C2HA 3KFXA 2Y8EA 2CLDX 5FBLB 4PHTA 1T9HA 3Q85A 1KZGB 1SXJB 1TMKA 1W0KD 3GFOA 4RZ3A 4F4CA 1DADA 3B82A 2CCJA 3X1DA 2BEKA 3UG7A 3AGQA 1RYFA 2ZJ8A 4EJSB 2OILA 1G5RA 1NLYA 2JGNA 4YMVA 4IHQA 1T4GA 2AK3A 1N6OA 4JLOA 5KYKA 2DYKA 2WWYA 2F55A 4Z8XA 1YR6A 1R0ZA 1Q1BA 1XDBA 3PITA 3VQTA 5KOYA 4TYWA 3KKQA 1E1QA 4DWJA 3O8RA 5HCIA 1KY3A 1TQ6A 1ZM3A 3LLUA 3UWKA 1T5IA 2W0SA 2GXSA 2NIPA 2BVNA 5BYKA 4GOXA 3FDIA 3NDBB 1GP2A 4IOLA 1WBBA 3T1OA 4BEJA 4LJYA 4P4SB 1OB5A 2ZS9A 1SVOA 5KSPA 4I1SA 2REOA 3I32A 2LKCA 4EJSC 1KK3A 3NEYA 3X1WA 1Z63A 1YJ5A 1RJ9B 1XJ0A 4TQUS 2XZOA 1EFCA 3CNOA 2YOHA 4QFMA 2GZHA 4PPQA 1LB1B 2UKDA 3D7MA 5IK2D 5J4LA 1IOZA 3FWYA 3TGPA 3P20A 2H57A 5JEDA 2PZFA 3A58B 1UEJA 1TQ4A 2RAPA 4MH0R 2J0UB 3KDSE 1CBUA 3MJRA 1XBTA 4TLEA 4ZCIA 2ZSFA 1G8YA 4Z51A 2RGGA 4C7OB 2AR7A 5DN6D 4HLDA 1K5GA 4KBGA 2WPDD 2QTHA 1K6MA 1SVWA 3K0AA 1SHZA 5KSOA 4Q01A 1KI9A 3WMFA 2C03A 3LXRA 5JZVA 2FMXA 3A1TA 5GADl 4B3GA 4NCKA 1G3QA 4CRWB 1N25A 1CTQA 3TE6A 3WNBA 2ZRFA 2XB2A 1AJEA 2R6FA 1QDEA 1RFLA 3QEOA 1E2PA 4IOMA 3FMPB 4BWYA 2MSDB 2XZPA 1H8ED 3FTQA 4I1VA 5JRJA 2WWIA 4C2TA 4QKQA 2ZROA 2H17A 4TT3A 1W48A 1TEVA 1XTJA 3C7KA 4H1UA 2EW1A 1GRNA 3T34A 4DCSA 1BMFA 1TTTA 1P75A 3T1VA 1P2SA 3HDTA 1AKEA 1DE0A 2I3BA 1S9HA 3PQCA 4JVNA 5B58C 2HF9A 1GFIA 1R8QA 1W0KA 1IQPA 2PT5A 3V4RA 1VG0B 4DLXA 4HZUA 2P0EA 2V8OA 1Q3HA 2PEZA 3SEAA 1L8QA 3TBKA 1VYUA 1UAAA 1JJVA 1E2NA 5J4VA 5HZKA 4QNRA 3A4LA 1W2HA 2V6IA 2VHTA 3FMOB 3LFUA 1X86B 2EFHB 1S0UA 4PAQA 5F9HA 1LFDB 3ASYA 3QEJA 2O8CA 2I1VB 1QHNA 3MWJA 2JLZA 1D8TA 2YWFA 2ZE8A 3R9WA 2O0JA 3EW9A 2JATA 3M4YA 4C2UA 4B74A 1TADA 2XOKD 4BLTA 4LPKA 1KO7A 1JNYA 1KYIA 1E2FA 1W47A 5FBRB 3VU9A 1DS6A 4PR0A 4A0GA 4MYCA 2HYIC 3RYTC 2VHUA 3L8ZA 5G40A 1GL6A 2WJVA 5DSZA 1NJFA 4NH0A 1ZUNB 3WNCA 4D4KA 4WW0A 2KWIA 5JHHB 3HJNA 1CF4A 2ZS7A 3IPXA 4ON9A 3GFTA 5IK2A 1UFQA 3DMDA 3I3SR 2DFNA 5L3QB 2FSIA 2J1LA 5FFMA 4DEXA 2QT0A 2VP6A 3HWSA 4UXHA 4B71A 4D4LA 4F7WA 1SHKA 4BFUA 4C3ZA 5CB6A 3K09A 4FMCF 5EE5B 2QTVB 4LHXA 4HDQB 1I4LD 2VTKA 1W7AA 4R7ZA 5FTKA 1ELOA 3ZIAD 4K46A 4B6FA 2QQEA 1JALA 4Q1EA 3K0SA 5ANRB 4U02A 5EE0A 1G9XA 4D82A 3A1WA 4KFUA 2VHCA 5DN6A 4NE2A 3RRZA 2WPDA 4LYJA 2VLIA 3QSYA 4KU4A 4JL8A 4JL6A 3PG5A 2YNMA 3RRNA 3PR1A 3PUWA 4D80A 3CNLA 4TYPA 3KKNA 1YRAA 4LV8B 3ZH9B 2GK6A 1JXMA 1W46A 2HV8A 3BBPA 4IDQA 1HUQA 4B47A 4ERNA 5JI2E 3PJRA 3TLXA 5JWOA 1Q0UA 1P2UA 4K8OA 4V0ME 4DEYA 3THXA 1BH2A 2FG5A 1KIMA 3GJ4A 2JLQA 3L0PA 4P4SA 2PZGA 2YHSA 2OCYC 1H8EA 2AWOA 4D81A 3EZ7A 5FH9A 4EPVA 1TQ2A 3GJ7A 4EFNA 3QXHA 5ELXA 3SYKA 2BM0A 1Q1ZA 4QJ4A 2CMKA 2WMOB 3RNLA 4AWXA 1KI6B 4IRUB 3SQWA 2XTMA 2YOGA 2QAGA 3PIRA 3F8TA 1ZD1A 3QBTA 2FH5B 1LV7A 1T8TA 1IN8A 4Q4LA 1NVVR 3DO6A 1ZBDA 2C95A 3NBYC 4FIDA 1JQJC 2GESA 1N6LA 3NHBA 4DLWA 1VECA 4EPTA 2JEOA 1DAIA 5JJKA 3ETLA 1ZYUA 1K8RA 2WAXA 2ZSDA 1DAFA 1N0UA 4IDHA 2JLXA 1XNJA 4B2IA 1CJMA 1ONBA 2H8KA 3EIHA 2FEOA 4POAA 3PCRB 3O47A 3L82B 4V03A 2CLSA 4FD2A 3NXSA 3X1ZA 3TUZC 2VRWA 3GLGB 2EWVA 1YR9A 2QPAA 4GOJA 5KNCA 3F0TA 1DEKA 2PH1A 3CZQA 2XOKA 3EASA 3KXIA 1XJCA 2A78A 3NTUA 3OIWA 3VR4A 4WXRA 2ZJZA 1KGDA 3FE2A 3OHMA 1CLUA 3ADBA 3SNHA 2Q9BA 1TU3A 5DI9A 1WBDA 3P27A 4DJTA 4M8NE 3QKUA 1XMIA 5TXGA 1T3HA 5JBQA 4NONA 3ZLJA 1FTSA 4AKHA 3NHAA 4DCTA 1W36B 3AF3A 4JLAA 3ZIAA 4A8JC 5BN3A 2GBLA 4R2IA 4UJ5A 4LC1A 3K9NA 3MRSA 1RRPA 1IM2A 4LJAA 5JSZA 2ASEA 1MRSA 4EFMA 3CBQA 3KXKA 3QI2A 3MWKA 4I1OA 1M7HA 4DCNA 4L15A 2V1UA 1LF5A 3ICEA 4JLDA 3W5JA 4MA4A 2RGXA 2O8EA 1EFTA 2J0QA 4OK6A 4Q1DA 3OFND 5FPHA 3R8CA 2OV2A 5FUYA 1W36C 1Q20A 5D3MB 2CHVA 1KY2A 3C15C 3NBZC 2J3EA 1V5WA 1XPOA 2E1RA 4Q4JA 4M21A 1N6RA 4B34A 2O0HA 2P5SA 2IYUA 2O8FB 3CRQA 3ZD6A 1Z29A 3CRW1 4Q00A 1GVNB 1OXVA 2Z6VA 3T1QA 1NNEA 2Q3MA 4OJKA 1U0HC 1VCOA 1CR2A 2VO1A 3HP1A 3QPUA 4PO1A 4LHVA 1F3OA 5FTNA 2QP3A 4HAXA 3TNFA 4KVGA 4IFEA 4TSFD 4MRRA 1E0KA 3RSOA 3TAUA 1E79D 2W6ID 2PCLA 4L9SA 3KL4A 4G01B 3UMFA 4HLCA 5FUXA 4JYBA 4ABYA 4ZCMA 2BJVA 4Q7KA 1A1VA 4DSNA 1JJ7A 4EKDA 1MKYA 3FHCB 2RGAA 2FOLA 2ZRIA 1XD2B 2WWGA 1PJRA 4M9ZA 2J9RA 1M8PA 4XWAA 1YZQA 1SKYB 5G41A 4HDCA 4CEIA 3L2OB 3OAAD 3HR8A 3QF7A 4MRNA 2G9NA 5C46F 4URXR 4PQRA 1N6KA 4L5BA 1NSFA 1P2TA 2CEAA 4OHXA 2ZYVX 2FE4A 1XMSA 2J59A 3H84A 4DT1B 2OHFA 2PX0A 3CX6A 4OK3A 5HZHA 1DAEA 2HCBA 4LJ9A 4PC3A 4ZDIA 3NIBA 1AKYA 1ZM4A 1GSIA 4TWZA 1YR7A 2H16A 3N5CA 2V55B 1D2EA 3IDQA 3VHXA 2PJRA 3KTAB 3C4JA 3EPKA 1G8PA 2G1JA 5L3SB 1KI3A 2HT1A 3A6PC 4BRWA 1YZGA 5KNBA 1M2OB 5DYIA 4D0GA 4TLBA 4EUNA 1SVMA 3B78A 1AZSC 3AF1A 5AJXA 4QHSA 3VKWA 1MO4A 4KFRA 3GLGA 2GNOA 3BD9A 1OYWA 3BRWD 4LZZA 2ZI6A 1X6VA 1OFTA 4KHZA 1XXHB 2VBCA 4ZDKA 1UF9A 2V1XA 1U94A 2ZRBA 3OFNA 1A2BA 1GL7A 4RJLA 4KCGA 3QKRB 1RVDA 3A4MA 3UXMA 2ZTSA 1WDTA 5E4FA 3ZZUA 2ZEJA 4QBGB 3DPUA 4JJKA 2C9CA 4F4JA 1NVVQ 2ZE6A 2IUTA 2XXAB 1QVAA 3OIUA 3SZRA 3TR5A 4A4DA 4JMPA 1FFHA 1H8HD 1C4OA 5EQTA 1LTQA 2JLVA 1DAHA 4MYTA 2OXCA 3OIVA 1Z6YA 1ZM2A 3IQXA 3PUYA 2BHRA 1E98A 3LA6A 5KPJA 1N5JA 4NYJQ 4US1R 1CRPA 2WJGA 1MV5A 2VP0A 2JJ1D 2Z4SA 2ZVQX 2GAAA 1KI7A 1XWIA 1C9KA 4TSFA 2ODWA 4N1AA 1BS1A 3ADKA 4W5WA 4RZ2A 4RFSA 3AVYA 5TARA 1F2UB 3ADCA 3QQ5A 1E79A 1G21E 2ZAMA 4RKFA 2RGCA 3TMKA 4KODA 4WBSA 2BWJA 4BECA 1RRFA 2WV9A 2ZJBA 4EPYA 3NKVA 2OM2A 3CWQA 1XCPA 1HQCA 3HYRA 2ZRHA 4BZQA 2IS4A 4RCYA 3THYB 4IDNA 1P73A 4YC7A 1NVWQ 4Q4AA 4JLVA 3GMTA 1YE8A 3OAAA 2RMKA 3PEVA 3ZJYA 4BFYA 3U44B 1L2TA 5JWHA 3QJYA 1G19A 5CB8A 5D3QA 5DH9A 2P5TB 4Q02A 1DG1G 5KNDA 2V54A 4ZCLA 1IN4A 3CPJB 3KQUA 1P2VA 3DMNA 3KFVA 4A0HA 3JVVA 3WBJA 1OKKD 1SXJE 2CCGA 1U0LA 2O8FA 3BH7A 2KSQA 4GP6A 2D74A 4RVCA 4TMVA 4V02A 2OBMA 2F43B 2BMDA 2WMNB 4MGZR 2WJIA 2OUKA 4GDFA 2Q9AA 3BXZA 4B33A 2OCPA 3K0CA 1E2IA 2J41A 2QQ0A 3CRRA 1DARA 2NG1A 2NGRA 3J81k 2F7SA 2KE5A 5EUQB 3WNDA 3CKLA 3VMFA 4LDJA 2W58A 4PANA 5EP4A 3RANA 1E9RA 2ATXA 2V7QD 3KB1A 4TQ9A 2ZJOA 2YWGA 5BYJA 5CLLA 1DAMA 3KKMA 2JJ8A 4HEJA 4A2PA 5GJBA 3V00A 2IXGA 2OAQ1 5EZ5A 3BK7A 2WM9B 3N2EA 2FDCA 4I81A 3QUSA 5EE9A 3ZS9A 1M1YE 4DKXA 1OW3B 2Z43A 3D31A 1XFAA 4LK2A 3EX7C 1N5LA 4PC1A 4LBYA 4M1WA 1E1RD 3O8CA 4CEJB 2BMJA 3DHWC 1H8HA 3DM5A 5AUQA 2WTUA 2GEVA 3W90A 2JLWA 5SZIA 4D0NA 1Y3AA 4BFZA 3CF0A 3QKSA 1NN1A 3RC8A 3CUEF 1IN6A 3MJHA 3KTAA 4RKEA 3W6PA 3U7HB 2JJ1A 4KI0A 4DRZA 2HDNB 1GKYA 3D3QA 3WRYC 1UEIA 3OE7D 2FFAA 2FU5C 2A5YB 4GFDA 2YWEA 2G0TA 3I62A 3S1AB 3M0EA 4QBIA 5J5CA 2FFHA 4NDZA 5HE8A 4QBHA 1HH4A 4QRHA 3W6OA 4CZ2A 2WVJA 1OH7A 1E9FA 1QHGA 2GF0A 1G5TA 1XTKA 3EA5A 3M1IA 4URUR 3SFZA 4E5UA 2O0KA 5JCPA 5FBQB 5CM9C 821PA 3B8HA 4M1KA 3Q72A 1VHLA 1XX6A 1YQTA 4FMDB 2EQBA 3QKRA 4CF7A 1QHHB 3CRVA 1XTSA 1ZNYA 1ZRHA 4UNQA 3ZD7A 3TKLA 3WRXC 4CEHB 1ZM9A 1HYQA 3QG1A 1RIFA 2JIZD 4AKGA 1WP9A 2VYFA 2IYWA 1R8SA 5J47A 2AFHE 4CVNA 1U8YA 4OI0A 3THOA 1II9A 1ZNZA 4Q1BA 1IONA 4V0LA 3CRMA 2ZAOA 1D2NA 4FCTA 4IEEA 4B6EA 4JL5A 2QA5A 1Z06A 1D2MA 1DVRA 2P6RA 2NZJA 5HR5A 5AJZA 1G6HA 5EZ6B 5E3HA 5FTLA 4V0NA 3AVOA 2YV5A 4GT1A 4FWTA 4MKHA 1QBKC 4HAZA 3X2SA 2LKDA 1JEDA 1A7JA 3AF0A 2V7QA 4Q4HA 4DLYA 2CDNA 3DL0A 3KX2A 2VF7A 2YZ2A 3THYA 3GQBA 1NVXQ 4AG6A 3NBXX 5EXXA 1OYYA 2B8WA 4ILEA 2FSFA 5E7JA 1QHIA 1I4TD 3H4MA 4JT4A 3VFDA 2AKYA 4RCZA 1E9CA 2ZI9A 5KTYA 1QRAA 3IEUA 2BJWA 4HLQB 3BJIC 4UNPA 3R7WB 1DAGA 4MYHA 4OQXA 3MD0A 4R98A 1AGRA 2N46A 4DVGA 4DDUA 3IILA 1VDZA 2P65A 2WJJA 2C04A 1NJGA 2YWHA 3OIYA 4GP7A 2J7KA 4HUQB 3U3MA 1GM5A 3O8BA 2EU8A 3B1ZA 2EFEB 3TJZA 3LV8A 2R62A 2OSBA 3ICQB 1NIJA 2VSFA 4Q5IA 3OE7A 4F92B 4M1TA 2DWQA 1U98A
chains in the Genus database with same CATH superfamily
1C41A 3OPMA 4ZD6A 4A7PA 4G0VA 3EIUA 1GTVA 4R69A 4Q7LA 1A8SA 3MJEA 3EPHA 2XYHA 1ZOLA 4V1CI 5KWEA 1Z2NX 3KT8A 4U2FA 3HYCA 3S68A 4E07A 4GAEA 4KQHA 2RGWA 3PKIA 3SYLA 5CK4A 3DYBA 3QA3E 2BEUB 1DC7A 4B35A 2JS7A 1EU1A 3IA2A 5DW3A 3ES9A 4NBRA 4EJSC 3OEHD 1UKYA 1XSEA 1OFVA 2GARA 3TLGA 3NVAA 4WKCA 5HBGA 1ZRSA 2CLIB 2ZOSA 4KXWA 1A95A 1BRTA 1LTHR 2ZR7A 2XMZA 3FB4A 1RM0A 2ZRMA 3N7AA 3TQFA 1FDWA 1VRWA 1S1CA 3CM0A 3CQ9A 4FR2A 1DT5A 4HP8A 1R50A 4C0LA 3TD6A 1E9EA 1ZGAA 1IVNA 4PX2A 4KR3A 2ST1A 2C0QA 4G81A 1WB6A 1SXJD 3EXIA 4GX1A 5GPBA 5ENZA 4JITA 1XEXA 5E3IA 2Q5QA 4JIGA 1JXOA 3M6FA 4L8GA 3SICE 3IKJA 2X2FA 3SGLA 2I6SA 1KDYA 3LW7A 4I4TA 3HZHA 3NAMA 5IAOA 1Z4NA 3FHLA 3OQ1A 1BGWA 3FHJA 1IUOA 4LXYA 4YRJA 2H1SA 3FFBA 4FFBB 3L4BC 4MRMA 1Z47A 1KL7A 1VB5A 2R4TA 3MMXA 3WYCA 1E4EA 5K8CA 3HK2A 5AW2A 1I6WA 1XYGA 3EEFA 4Y2TA 1LSJA 2CT8A 3LT4A 1PD0A 2DR3A 1J2EA 1ND5A 3UMCA 1Z25A 2J4CA 3GCXA 4QREA 4CG1A 1ZI6A 4JR2A 4CTKA 3GLIB 4FT2A 2XQVA 3I4CA 3U3DA 1AKNA 1E2MA 3WYEA 5I7EA 3I2GA 4GMXA 3LVRE 2EFDB 4WY2A 1ETUA 1WXGA 5K4HA 3DFKA 2GAFA 2VYND 5TMEA 1ZUD1 1QV9A 3AR7A 1J22A 1C3OA 3L93A 5DXFA 2JBWA 4RQUA 1WV0A 3TXYA 2JASA 3KXPA 2W2MA 3V4FA 5JY1A 1NXQA 1T2EA 3TKYA 3W4IA 1NMXA 1BKYA 2C7GA 2HKIA 3BMOB 4PO8A 5CT6A 5BNFA 4EA8A 1ZAYA 1Q0SA 1ZNWA 5AXBA 2TMKA 4J0CA 2QEQA 2ASVA 2UZIR 2GPBA 2J31A 2OR3A 3DDUA 2HIAA 2OESA 1KSHA 4O1IA 4P58A 4P93A 3SSNA 1TQ8A 1SPXA 3HXTA 4BL5A 1ZG3A 2IHYA 3GDHA 1TZCA 2OZEA 3GGCA 1M67A 4S2UA 2PV0A 4YDRA 4X20B 4PSVA 1BNCA 4MVJG 4TUYB 2VHQA 2XB6A 1UFKA 3ITEA 3MJCA 3GJSA 4MUAA 1N9KA 2VA9A 4QJIA 3VDXA 2Q29A 4CMEA 2WSSA 3IP8A 4OUKX 1GGMA 4I50A 9GPBA 3T4EA 4D46A 4JZKA 5KWVA 2QDXA 4OVKA 3I8SA 1SCDA 2QPTA 1TYZA 4CDMA 5JR3A 1YJBA 3ZX5A 3B2EA 3H1BA 1ABEA 3GCGA 3N0RA 2DHRA 3MT8A 4I8IA 1U90A 3KTFA 3BXFA 4MWZA 5AHOA 2B25A 4EYSA 1ZN9A 3C3EA 4OCZA 2QG9A 2R65A 4LWPA 2GA9A 3RUPA 4JLBA 4CQJA 4D9GA 3ZCQA 3RT9A 4XUDA 4X8OA 2DFLA 1KO4A 1WPQA 1NUAA 2B21A 2Z5GA 3F67A 1JIXA 4OBWA 2A3RA 5AI9A 3TSCA 3UK7A 3FSEA 3I4LA 3ZWNA 1PFKA 4HB4A 1MX9A 4RTPA 3ZY2A 4D3DA 4WL0A 4L1KA 2G0NA 4F38A 1VPTA 1YA4A 3MAAC 4Y0NA 5FOWA 1PHRA 4YV1A 2FX5A 1EINA 1OXTA 3ML1A 4DDVA 1ODLA 2R47A 3RVJA 2KI5A 3MBKA 4C0SA 2OHIA 3TNDA 2Z6QA 1YB2A 3FVVA 3Q7TA 2OG2A 4GL2A 3LG2A 1GPWB 3T5CA 3P9PA 1TDJA 4JP3A 1KHTA 2WTEA 1ORDA 4R8RA 2OMKA 4WKOA 5J3JA 2I3GA 3C8DA 3RC2A 1E59A 3WYFA 4TTVA 3LPAA 2F00A 4NZNA 1TUGA 3FPKA 3VNRA 2G4VA 3D3EA 5B2EA 1M0SA 1W8IA 2C31A 4R5MA 5JCOA 5HJEA 2ID8A 4KBFA 4J0EA 4EJ2A 1J09A 1WDKA 2G08A 3AG6A 1XJWA 3AZOA 1FQJA 4HH0A 4M8LA 2ORWA 2FF7A 4K40A 2OK7A 1MH1A 3EGXB 2AIRA 3IP3A 3ST7A 2WKQA 5F64A 2XADA 2IOQA 4YUXA 2PH3A 3AU8A 2I2WA 4PXSA 5TGDA 2FW6A 3UHFA 1OU4A 2XYVA 4REQB 3Q11A 4GI5A 4X63A 4PBRA 3ABZA 3LO5A 3AWDA 4UZSA 3TLAA 1WQ4A 5GONF 3TQCA 4DLKA 5JNLA 2EFJA 4ZYXA 5KSYA 1NR1A 1OFIA 5K8UA 2ZXEA 4YCJA 3EVGA 3M83A 4V39A 4G4SO 3NVDA 4E4YA 5BRNA 2JL1A 1RE0A 4NABA 3E9EA 2O8VA 3KZCA 1CQPA 1FRNA 1BU5A 5A0FA 1WMEA 2FGJA 1Q77A 3KPYA 4BUZA 3MTBA 4TXJA 4CM5A 4PX5A 5E9QA 5H4HA 2CCKA 3FPEA 4QDXA 3SC4A 4K0KB 4OGGA 2Q6KA 4CGYA 4G5SA 3DDZX 3G1TA 1VSBA 3S6JA 2J0UA 2YIJA 4HFMA 5CK5A 3EUEA 1MABB 1ESCA 1TYCA 2H9YA 5BW6B 4OQFA 1KFBB 1XEWY 1NMYA 3AKCA 2A5LA 4DCUA 1FCJA 3X44A 3RLFA 4D8VA 1Q0ZA 3ZGZA 4A8HA 3OOEA 1IH8A 1H3FA 5IYZB 1WOYA 1EVKA 1RBMA 3KQSA 3OPYI 4N47A 1J7KA 1R0WA 3DMTC 3IAEA 5BQXA 2GYYA 1E9DA 3U0VA 1Y8QA 4BNKA 1JIJA 1ISPA 1Y1LA 1AN0A 1MC4A 2ODTX 4MVYA 3FGZA 2IYXA 5CUQA 1WEHA 1NP3A 3FOBA 3GZNB 3SC2B 3ZE7A 4BKPA 5JJBA 3DV2A 1HE8B 1YDMA 4AYXA 2RHRA 1GA4A 4WCVA 3FZNA 1Z6TA 1VBMA 4TYQA 3LE8A 4AY4A 5LU8A 3GELA 1GAJA 1ORRA 3D1LA 2BP7B 5DX0A 1EFUA 4ARUA 1LGYA 1IXKA 5BV7A 5JXJA 2O8BA 4Y2QA 4YONB 5CEJA 3K0FB 1G7CA 4MROA 3SVZA 1NJSA 4K05A 3CX7A 1MV8A 3D3NA 2A5FA 2WIAA 5IJWA 4BU1A 4AF8A 4C0KA 4ZVKA 2QL6A 4G1BA 1DJLA 4HOYA 5A6VA 1V26A 2PCJA 3GCZA 3IE2A 5B6PA 3EGEA 5JAQA 4G6ZA 2GEFA 3AV0B 3UUWA 3ZHZA 4F5ZA 5H82A 5EY5B 521PA 3L40A 2XMQA 3Q9NA 4A0RA 3DCIA 3U6BA 5MN5A 1SVSA 3EFBA 1WKCA 3H2KA 4RADA 4B3JA 5GIOE 2HQSA 4EKYA 2OFOA 2FJPA 4FP9A 1PWEA 1DIGA 4DM7A 1C4XA 4R8SA 1M7BA 1J1IA 2VH5R 3RAPR 1E64A 3VUFA 3JARA 5D00A 2NV0A 1IN1A 3KOYA 4JT9A 2XY4A 2JW5A 3KL2A 1LX7A 1XA0A 3EDMA 3FPGA 4OB7A 2I67A 3SBDA 1CQWA 5KYXA 4JJ6A 1C2TA 3AOEA 2FPIA 3B8EA 4K28A 3QJ5A 5EXEA 4RSRA 2VNAA 3L06A 4LVOA 3WIOA 4IRXA 3AKEA 2P2DA 3KQVA 3LM8A 3MQ4A 2IPXA 5BOVA 1O8CA 3HB0A 4WA7A 3IBGA 3RKUA 4MS4B 2ZT8A 3QLUA 2JJYA 3P9QA 3C5HA 3NDPA 4KACA 2WP0A 1VBKA 4G0OA 1FU7A 4M1MA 3QX9A 4ISBA 2A0KA 2VR1A 3M3HA 4K9RA 3WA6A 2HWYA 3R0VA 2AFIE 4UVDA 2ZU0C 1CVRA 3K70C 4WN9B 5J2TB 2PQ6A 2HRZA 3N2NA 4Q15A 2V6JA 3K5PA 2GF9A 5L3QA 4D8UA 4ESOA 2M2IA 2QN6A 4CFYA 5EJAA 1PV2A 3Q0TA 1MO3A 1Y5IA 4UFOA 3M6VA 3COYA 4L3OA 2PZMA 4QNNA 3D2LA 1ZRMA 2PRZA 3C3XA 4FGKA 4U2BA 3N0WA 4CQMB 1PG0A 3VX4A 1GL9B 1RXWA 5C1IA 1K4MA 1DHRA 3WLRA 3KOMA 2BMFA 2XAAA 3QV1A 3QVUA 4L74A 4L8WB 1MQAA 2HXYA 3EAQA 1N2CB 1NN0A 3LLCA 5TQ0B 2CSUA 1QORA 4LJ7A 1H5QA 4N12A 3EXAA 4L22A 4GBED 3ZZ1A 5JUWA 3DDNA 1OASA 3MQFA 4JT2A 2IZ7A 1AA9A 4NYMR 5G0TA 4DVJA 3BE8A 5KC9A 2O23A 2ZXUA 1Z4JA 3MQ2A 3O2QB 4RXTA 1S3SA 2J08A 4CBVA 1B26A 1UDAA 1ZQ9A 1I7SB 5IVHA 4GX5A 4FOSA 3JQGA 2ZIXA 4AJ1A 2IUEA 4CFSA 5SZKB 1Z74A 3O03A 2JGLA 4DZRA 1X0XA 4JD5A 5EP1A 4BNNA 4RTOA 3DTYA 3IQWA 3TTYA 3C6MA 3LFTA 1K27A 4OP1A 1U7TA 3HKDB 4MUBA 4RPLA 3K9WA 7AT1A 3I1FA 3QVTA 2F8SA 1W4BA 3PTZA 5HUHA 1KI6A 1H3NA 1EYZA 2AB0A 3BE4A 3FCEA 3EY9A 4IW3B 4PGMA 3GEPA 4WZBE 1Q7TA 2E85A 3J7TA 2IYFA 3TMAA 2Y66A 2JFOA 1CU1A 2XI4A 3HUTA 4N3BA 4GR4A 2FMTA 5CVEA 4ZKEA 4MP3A 1DFIA 1ORWA 4DHWA 2YVAA 1JJIA 3QYJA 4X85A 1ZK0A 2H92A 2ZT7A 3HBFA 2O2HA 1R8XA 1WF6A 1RKQA 1T9GS 2GN9A 2YXNA 3CLRC 4FWBA 5AI4A 2JI4A 4J2TA 3CPEA 3GGGA 3HXOA 2PXXA 3H5RA 1Z26A 5LXTF 1HFKA 3HKCB 5KVAA 2HPAA 2BBWA 3BL6A 4HQ6A 4O2RA 3C97A 3GL9A 3CNQS 3DZCA 4K6MA 2O4UX 3UCFA 5BUCA 4BO5A 3ZU2A 1OTHA 1EE9A 3OP1A 2DPXA 2I7TA 4UEKA 4XRRA 1SCIA 3G8YA 2ZIUB 4KN6A 4A8JA 2QGZA 2UXCB 1R15A 5ADVA 2CFOA 3NYIA 2YVUA 3H04A 4H4EA 1AVTA 3CGWA 3EIFA 1DBIA 4L85A 1UDBA 2WHEA 3TLZA 3NHKA 3IFSA 4GX2A 1SXIA 3H9GA 3I2KA 1SG9A 3KQOA 3IOBA 3JVEA 2WTMA 1Y34E 4BVAA 3DVLA 9ATCA 1BXGB 5F77A 1Q44A 4X3OA 1Z2OX 3PXDA 4XASA 3R24A 3AH8A 2BDUA 3CB2A 3FKQA 5AH0A 2Z8YA 4JP8A 1LVGA 2PTHA 4H7IA 1EBFA 2O2DA 2NWQA 3INTA 4YLGA 1UK9A 4G86A 1LLFA 2HADA 1VSTA 2ZFUA 3MOSA 1FRZA 3D6NB 1WU8A 3L02A 3NT5A 1AT1A 1M6HA 5FWXA 3FTFA 1GAQA 4IYJA 2RHDA 1AF7A 4P4TA 1E6UA 2C2XA 4OKNA 3HUDA 5GV7A 1KEEB 2FP4A 4AVYA 1ORIA 5K0FA 2DBRA 2FR8A 4M7OA 3KAPA 1HKUA 1IWBB 3U1VA 1OXMA 4EF4A 5E2IA 4F04A 1G8SA 4R9UC 4XQ9A 4NF2A 4C03A 1QF6A 4DQ0A 1U0BB 1QU3A 4MGYR 1GKKA 4LS3A 3EXFB 1ADYA 1OWPA 2AZTA 2CNWD 2O48X 3BA1A 1P77A 3G6KA 3LYUA 1MO5A 4E3WA 4RF5A 1CJSA 1K7FB 2ISCA 5A3SA 2J48A 3V2HA 4UQLA 5JJIA 1JE1A 3A2LA 3GBVA 1A9XB 4L0MA 2CYCA 3H1TA 4R9NA 3E48A 3IH5A 5KC8A 4PLWA 4LI0A 3S1SA 1RP1A 2X8JA 4EHHA 4LSWA 3A2KA 3DC2A 3GVCA 4J6EA 4B3CA 5HRAA 3PDCA 5PNTA 4H2DA 2ABWA 1BCSB 1JEQA 3LQ4A 4KWTA 4P86A 1CUFA 3AP2A 1DCTA 4IY1A 3AFOA 1HPLA 2IPOA 3H86A 3ID6C 3KM0A 1XCBA 4HF7A 2VTVA 4I55B 3N87A 1PV4A 2CNBA 5KTSA 2HBZA 1N2BA 2YJNA 4K9KA 4KYUA 4TXNA 5AVOA 2JKVA 1N34B 4AJ4A 2C96A 4LJSA 4W1PA 5EIBD 1UBGA 1XRLA 2Z2IA 3AEUA 3QA9A 1U2ZA 3TNJA 4IIJA 2I7XA 1FDSA 2BMVA 2VL7A 1QE3A 2NZXA 2RIRA 2AKAB 3EA4A 4UVHA 4BFTA 4YFVA 4BO9A 4A27A 4HVTA 3ZWAA 4D9HA 1VLVA 3IB6A 4PZLA 1D0SA 1V1JA 2DSNA 3TI9A 4JB8A 5FUVA 5JZ9A 1XKQA 3MAJA 4BQSA 1XWFA 5KTKA 2HUNA 2F8LA 2ZDGA 1DO0A 4J1NA 4URYR 5IG2A 2QSYA 1DC4A 3TRIA 4UFNA 3A1UA 3MTQA 4ZREA 2VPQA 1PR0A 3PPYA 1I13A 4G9EA 4ZGWA 1T4MA 3L0SA 4EJMA 4CT4B 2YCLA 3H99A 4MVJP 3M8KA 3SR0A 2QUZA 3K3PA 4LHEA 1SVKA 2JJ2D 2PLRA 2RCNA 1W0JD 2ZI3A 4EKIA 4EL0A 1EZZA 1FFBA 3QVVA 3Q2IA 4BLQA 1RQGA 3KKLA 2LD4A 1Z2DA 1CUJA 3R3JA 4TYYA 2RHCA 3BCUA 3V1LA 2IH2A 3PL5A 2IYPA 2QR3A 2VHJA 4ZTZB 1YVDA 1H2EA 1PFVA 1U9IA 4XARA 2P67A 2A4MA 4HDMB 1HTWA 1WVIA 2WJHA 3HJHA 4B4WA 5ADWA 1JFTA 1P9NA 4WDRA 3TQRA 4KO4S 2WM8A 4EECA 2EEZA 5JC1A 5HSGA 2X0IA 4UJ3A 4QOSA 4GLFA 3G2HA 4HTFA 4F5DA 1OCEA 1Q7CA 1DIBA 2C2WA 2YFYA 3D5EA 1WDMA 3F5FA 2Z1NA 5KVCA 2WZBA 4PW0A 2AEJA 2PX3A 4AQYB 4M38A 3SLGA 3N70A 2YINC 5B4TA 3D9QX 1IZYA 2QK4A 3CNNA 4OIMA 1FSZA 2NYUA 3O4GA 2A5DA 2BUBA 3TIXB 5ECWA 2W48A 4ZV9A 3RYIB 2ZRLA 2Y9PB 4K1LA 1ACJA 3AQ4A 1WMSA 2GEDA 3K2EA 4M55A 3EEIA 3ORFA 4HXEB 1OILA 1ZY2A 10MHA 1E5LA 1XTZA 3TIIA 3QVKA 3TSWA 2NO9A 4PZ0A 1XRJA 3D8BA 4WZZA 1BJKA 1DQSA 1ZA1A 2ZUDA 3MYRA 3TEJA 4U5XA 1PQYA 4RM2A 2H9AA 3T3DA 1Q0TA 4I1RA 4E5YA 2C2ZA 5ESRA 2UYHA 3KG2A 3O74A 3EC7A 1EVEA 3FDZA 1J23A 5K5EA 3EA0A 4B76A 5EHGA 4QOHA 3TTTA 4UCXA 1P8AA 4O4LA 5ERYA 1Z35A 2RBGA 4UE3S 2A9KA 4JI4B 3Q1LA 4KPFC 5TR9A 3RJTA 4KOAA 5LR6A 3HEMA 4AI6A 1IVYA 1W88A 2OLEA 4ZVQA 2FUEA 3VUEA 3ZE8A 1G1MA 1TAHA 2PBFA 4FGUA 1XD9A 3BGVA 3BD6A 2BFEB 4OUDB 4J0IA 5FTWA 5JNUA 1IOWA 1JNXX 2JFUA 2PTGA 2XCSB 1T5HX 4CL8A 1WDWB 1PJ2A 1BMQA 4QQKA 3ZGOA 1MZPA 5M3BA 1QF9A 3KALA 1VBFA 3T3OA 1Q57A 3REFA 1SULA 1R4MB 1A04A 1X77A 3A1NA 4UD2A 5A3VA 1U0GA 2AYYA 1CF9A 5DXAA 3SX4A 3V8EA 4C14A 4R0MA 1QF7A 2Q0SA 3ELUA 1RADA 1V96A 2H29A 3G85A 1M0WA 1MG0A 4TQAA 1WTCA 1Y8RA 1EBUA 3H2YA 1A4RA 4MQLA 3ZW8A 4CJXA 4EG6A 2OM6A 2HHCA 1ML3A 3A1EA 4O2LA 1N6HA 3ELBA 3DZIA 4FCCA 2PU7A 4K81B 1KPIA 1S2MA 4FZJA 3S0JA 1VI5A 1GGHA 3F6CA 1FMJA 2JVJA 3EF1A 5F4BA 4BMVA 1XHEA 3TZQA 1C8VB 1IY0A 3FCUB 3NDIA 4TTJA 1A3CA 6CHYA 2CYBA 4NFSA 1D4FA 3KJIA 1FU8A 2MCFA 4H7PA 2XNDA 4MUNA 4YP6A 4X93A 5CDHA 3QF4B 5FI1B 1W5AA 1AQIA 3GVIA 3OEED 4GEGA 3KQHA 2H1HA 3MEQA 2FSVA 1U7XA 1QYCA 1K5DA 2HK8A 3EDCA 4OU5A 5EPUA 1A82A 1Y9EA 2G1UA 2ZBVA 4YUYA 1RCUA 2F4NA 9MHTA 2BKUA 4TKZA 5YASA 2G70A 1O9GA 2X22A 5E95A 1MAWA 4HC4A 5LZ8A 1SXPA 2C3MA 2DKNA 4PX9A 3JR3A 5GVSA 4JYZA 1E0DA 5EMNA 1KJ8A 2EJWA 2IIQA 2PXCA 3OCUA 4HWTA 2XGOA 2Q7DA 2QZ9A 2P79A 4MV1A 4LXIA 3R7AA 1G0NA 4LV6A 2DF8A 5BWBA 1NBWB 1VKZA 5IAAA 3ZJ4A 1DQPA 2IYQA 4HNHA 3JYPA 3PYMA 4BLPA 5J23A 3ZHCA 1NQWA 4G5GA 1OBFO 1OXUA 3LH5A 4YQYA 4ZYYA 2D4HA 2DJIA 4FYJA 3T3IA 3GOHA 3G9QA 1XC7A 3BCSA 3KYJB 4LX8A 2G8NA 5HZMA 2YVQA 1BA3A 4OHYA 5AVQA 2NAFA 4ZN6A 2Y76A 4OHRA 1S8NA 2VXCA 2CE7A 3K31A 1RYMA 1VJCA 1RP7A 2WSBA 3RQSA 4EZIA 3CE6A 1GSOA 1N8NA 1ULZA 3MTIA 4OQLA 2HF8A 3KWJA 1MAAA 2NZUG 4LGMA 1RPZA 2OXTA 1V7CA 3PSAA 4ZAZA 3NG1A 2X40A 2GNPA 4K86A 1I1HA 2DRIA 3LW8A 4W1SA 4JR1A 2NXEA 3EGIA 4TL9A 3QKTA 3VGJA 4X1IB 1N5RA 3C3KA 1EHCA 4G23A 3ROPA 4U5QA 4D8TA 4NWIA 4UKDA 5SZHB 1RZRA 2H3HA 1RC8A 1JPVA 2EGGA 2WM2A 3BZBA 4UMVA 3DDSA 4OB8A 4WH0A 2IY7A 3TTXA 4E22A 4ZICA 2ZWOA 1JHXA 2W8BA 3IIJA 3R0XA 4JWTA 3W9BA 3QVWA 5DT9A 1JKIA 1M3SA 4IM7A 4PPFA 4TLDA 2DHQA 3CZ5A 2BEVA 1EP3B 3G2MA 4UCFA 4DXAA 3KKEA 2EL7A 3TMYA 5CNJA 3H5NA 3AB7A 1JA1A 1X8KA 1Y4UA 3DFMA 1EQUA 1TQHA 2EJVA 2GK4A 3DL4A 2XNJA 2PKQP 3EHDA 3NAGA 3BZUA 3VKVA 1O5TA 3SHTA 1L5HA 3WWYA 1JIIA 1RQRA 2P75A 3W5CA 1DWUA 3L8FA 1N8SA 5DLDA 1E2LA 2QN2A 4DWOA 3HDHA 1G8FA 1KOFA 3D81A 5GV8A 3M33A 4ZDWA 3M1YA 1LXCA 1O4VA 2DKOA 2HPVA 4RENA 4YJKA 4E7OA 3W05A 4EUSA 3U5TA 4QKQA 2IEZA 5ULLA 2CFSA 3HU3A 4BEBA 5JRDS 2Y1LA 3H9UA 3A10A 3V8PA 1KFJB 4B7UA 1YL5A 3S99A 1T10A 1EFLA 2X7HA 4GLLA 3ITKA 2D6FA 4DQLA 4KXYA 2UZ1B 1RI4A 1UIMA 4G65A 2QN3A 3O31A 2EARA 2OCGA 1OFUX 2ZUCA 2QAGB 1YBAA 2Z2KA 3ZWDA 5JCOC 5K2OA 1S7GA 3RWMB 2BKAA 4HYYA 3O7WA 3Q8KA 3PNKA 1NM5A 4DZZA 5JWRA 4IRMA 3BERA 2VAWA 5E4TA 3E7XA 4QGBA 3ZK8A 1V4NA 2E4UA 2EDAA 2GKSA 2ZTUA 3DB2A 3HKBA 4P31A 4UU0A 3V1UA 1G4HA 1YQDA 1PGJA 3TAXA 3F3KA 3I0ZA 3LHDA 4HCJA 1E2HA 3O21A 4X91A 4OXNA 1EVZA 2HJSA 2I9PA 5FJJA 2OY0A 4E6EA 2A88A 3F3SA 3OZ7A 3QWAA 2EOAA 3ZZMA 2FPMA 1UBEA 4JVSB 2A1TR 5JEEA 4QM6A 1CQIA 4BYGA 4J4BA 1PNOA 1IB0A 2QMEA 4F72A 3AVXA 3QW4B 2PBRA 2R6JA 4PCVA 3ZHYA 1TZKA 2BFBB 2QRUA 2HH9A 3V32A 4H4CA 1IM8A 1RKUA 4DV6B 2W83A 3TN7A 3TIGA 2ZW9A 4HO1X 2NPFA 4EMBA 3R9XA 3V6MA 1TXGA 4LX0A 1RW4A 2QX4A 1NJ1A 3C7TA 4HNQA 5CM2Z 4AY5A 4RTQA 3FGNA 4WNYA 4OHUA 1PWZA 4ZOLA 3GLHA 5HYVA 1XTPA 1C7EA 3A37A 1XRNA 4EI2A 1PKXA 3FPBA 4K6HA 3ZD9A 4BYMA 5LKRA 3EBOA 4FPXA 3WY9A 2ATVA 2O3JA 2TECE 1JQ3A 3C5CA 1PJ3A 1R6TA 3O4HA 1QCYA 4MS3A 5TPWB 3SCZA 4B7XA 2XD4A 3CN7A 4LQ4A 4AL4A 5C1BA 5JBIA 4A36A 4CM8B 1K4KA 4YJDA 1JDVA 2RCYA 1E69A 2GAOA 2H0AA 2HWKA 3M7IA 3VBCA 4BUJA 3G0HA 2P9CA 2ZITA 1QO0D 3GF4A 2E87A 5B5SA 5E6UA 2AOUB 4DUGD 3Q6IA 4NCIA 3B1YA 4KSYA 3ESBA 1OLSB 4MLDA 3DAPA 2P9QA 1KMQA 1YZ3A 3WLNA 3L7AA 2W2VA 4XVRA 2NYAA 3A9WA 1OGJA 4WNIA 1OXSC 3I12A 1MZVA 3M4JA 3G8BA 1EGMB 1XVLA 3CYFA 1NYTA 1I3NA 4KPUA 2EP7A 1WZUA 2I8AA 2OGWA 4FS8A 3TQOA 4LOJA 5DEOA 1G3UA 2OCDA 2R6AA 1QHXA 5CP8A 3ENVA 3KYBA 2HAEA 4ILKA 3H1PA 3U62A 2ECKA 2C7BA 2QENA 4I2NA 4XWKA 1CR4A 2PRSA 3GZ4A 4HPJB 5KDLA 4H7FA 4EFDA 1SIOA 3GARA 4M8SA 4B3DA 3Q3JB 4U7HA 3RJ9A 1UZNA 1EFRA 2ZK7A 1SA0B 1GZ6A 3FYUA 2R8PA 2X0FA 2ZE5A 5G0UA 1TO2E 2GN6A 2PUWA 3ZNOA 5D5HA 3H97A 1ZD2P 5NULA 4C4AA 1IAVA 4TLMB 4EUEA 2Y99A 1GN8A 1YCFA 1YOBA 1GLNA 1Y37A 4KO3S 3TR6A 2JFNA 3QE4A 3PQDA 2F62A 1J90A 2Y93A 1GFSA 3AOEC 2DFPA 2JK1A 3G7NA 5JPIA 4BX0A 3ZJUA 2RHGB 1FFCA 4ZO8A 3GEDA 4G8JA 3VAYA 3JQCA 2UYYA 4PC7A 2B8JA 4L08A 2C5GA 4MICA 2JGMA 1POXA 4DMFA 1R8JA 2IE0A 1SN7A 1WVMA 4H59A 4QUDA 1P6XA 4Z7QB 1D6SA 3QOWA 3U81A 4H27A 4POOA 3FBWA 2ODBA 5JAUA 1KWKA 1Y33E 2PAFA 1R0RE 1U9JA 4QOJA 1NATA 1R5BA 1N6IA 3ASZA 5EGSA 1K9SA 1M73E 1JH8A 4DADA 3H2HA 3WAJA 2X5XA 2QTZA 2XVAA 1IE3A 2BFCA 4JJGA 1KH3A 4KYVA 4CU5A 1QQ6A 3V1KA 1QRUA 2YMPA 1M2VA 3A6DA 3D64A 3R3ZA 4JS0A 4M83A 2A5JA 4NV1A 8OHMA 4M8IA 3GC6A 5I7OA 2BYTA 3G49A 4P98A 1FLDA 3PHHA 3QE2A 3W06A 5B7NA 1UMBA 5L4LA 4RXMA 4JA2A 1JQKA 4JMLA 2BIFA 3CF2A 5GAJA 2DJ5A 3L46A 2Y3IA 1BE6A 3AK4A 2AL7A 2GOYA 1ICIA 2GK7A 1KZHA 1ZM7A 4OXQA 4JJZA 2PGXA 8ABPA 3ELYA 4BGDA 3CLUC 3DUFB 4MRPA 1GZSA 1E60A 1YQXA 3GJ3A 1NT4A 3BM5A 4IIBA 4BFSA 5K6AA 5L8VA 1HDGO 5ALSA 3AOGA 4TV9B 3KFLA 1V71A 3O4RA 4E31A 5LCXA 3AR5A 1Q92A 3K9GA 1NBME 1S01A 3WSVA 3ZOZA 4EA7A 1A5TA 4EW3A 5LA6A 1EG2A 2RAUA 1FYXA 5F5XA 4B84A 1Q1AA 5KEIA 3B7GA 4RGYA 3ZQJA 4MDHA 4X92A 4D56A 1GLVA 3RODA 2EWWA 1HT0A 3NATA 4JI1B 5DSTA 1AKUA 4KK3A 5CA1A 2IBMA 3U60B 4X8LA 4CCYB 3CX4A 3DKPA 1C7QA 4QRIA 5DM4A 7YASA 1EUQA 3KPVA 1DUSA 1GCIA 1WXDA 2PD6A 2V8BA 3VRHA 4OGWA 1P7PA 2H5IA 3PXGA 2BE7A 3GEEA 4H7DA 1Q12A 1MC1A 1Y5NA 4MPTA 2V9PA 4LRWA 4MDFA 2G9UA 1ZCAA 3C5WP 3WISA 3ZEIA 1XNQB 2QDKA 2J3HA 2P2SA 3NGMA 4IXWA 2OP0A 4D8XA 4OL0A 5FUQA 5EWLA 5EIXA 2BC9A 1VL2A 4PLYA 4C7VA 4MKGA 3L6UA 5BV1A 4H4DA 5J4HA 5JQGF 4C30A 5F73A 1JR3A 4AJ2A 3R0IA 2X4LA 1X39A 5HDQA 2PPLA 1UDRA 3GLFA 1RPNA 3CRNA 2HRBA 2GHIA 3IKLA 2QL5A 4H6WA 1KMHA 2A33A 5HILA 2HHHB 4MW0A 1JFVA 3R5JA 3R6GA 1ZCBA 3BF7A 5KNCH 3RTDA 3L49A 1ZL2A 2P7IA 1F4VA 3W0LB 4NCAA 1HTBA 3DT9A 4C0WA 1QJCA 3GPBA 1QIHA 1D2HA 3N58A 2ZJ0A 1KXZA 1XTBA 1YOVA 3K8ZA 4MDEA 2V0NA 1M76A 4G5YA 1LDGA 5EIFA 1CXZA 3NDJA 5E8JA 3TRHA 3QHQA 2D2VA 3IYLW 4RDHA 4D8WA 4CLOA 5JT1A 4UBLA 1JEYA 4O3MA 4GDMA 1E8NA 1KNQA 1XN4A 1FFYA 2P62A 2MTBA 2FPXA 1L5WA 2R1ZA 3W34A 4WX2B 4K6OA 3QE0A 2GPYA 4Q66C 5AKKA 4ZHQA 3AVUA 1FNMA 4EYGA 2IUSA 3LLSA 2XKJE 1CKEA 1UWLA 3AY3A 2RSLA 3ZV4A 2VXYA 1C3JA 3K8YA 1YRHA 4YJ2F 2GD0A 2BGJA 4DC0A 4UNSA 2OO3A 2RI1A 4DDWA 3AILA 4WBNB 1TLFA 4G56A 3SZMA 1T0BA 2WD7A 1R66A 4HGQA 5DGXA 3WXMA 2VOJA 1XA4A 1RU3A 4N0DA 4Z4FA 4YAEA 1H85A 1KBQA 1I33A 1XLVA 3LCMA 2WHXA 4I8XA 4O08A 1ZU5A 2DE0X 3E2IA 1PUJA 3K70D 1S96A 2FCRA 4NCXA 1PR6A 3FG9A 3IV6A 3KEMA 4I3GA 1IB6A 4O33A 5JQWA 1CUGA 2FR8C 3ROXA 4HT3B 1QMGA 1YR3A 2EJCA 3KYCA 2B4RO 4BGEA 3KUKA 1U5AA 1DAKA 4IWXA 4TTRA 1BDHA 3GO4A 4O5AA 1B42A 3RS0A 3FVTA 2FWRA 2YYAA 3GHYA 3H9QA 1Z82A 2FPLA 2EJTA 3KRTA 1ZD5A 4I5DA 4J49A 4RZIA 4EMUA 4ZQEA 1R8YA 1UZAA 4IKEA 2VAVA 2W2QA 3ZQUA 2QQ5A 2IUFA 1GNVA 2FZEA 1ZSVA 3AVTA 1QYIA 3E3MA 1JLLB 4RGQA 4Q9JA 5FAXA 4KSBA 3X1MA 3W6NA 3CKMA 5JHGB 4CHGA 4CGZA 3FNIA 4MUHA 5FKJA 4WKPA 3OU6A 4CNQA 1JFFA 2IXEA 3H2GA 1E5TA 1MXHA 3EAGA 3G0IA 4Q9IA 1E92A 1JEJA 3CZPA 4RL4A 3INGA 4BZPA 4MVJD 3WNZA 5FDFA 4IIUA 3E8XA 2YWCA 3K2IA 3TLEA 3RBXA 2UYCA 1EK6A 1ML4A 2IZ6A 4QECA 3QOXA 4ZDJA 1Z4OA 2QT1A 3BB4A 5EKDA 1WXQA 3CGGA 2HA6A 4QQRA 3QIAA 3K15A 1E9BA 1W59A 5IMBA 3VR3A 5H70A 5EZQA 2X0NA 4LOLA 1EQ2A 3PHGA 3JASA 5ESWA 3QE3A 2YUTA 4XVHA 4ZRNA 3UATA 4PG8A 3AFIA 3PK0A 4ZQHA 3ZI7A 3W5UA 4HDRA 1QFXA 3AYZB 4Q3EA 5BPFA 1QU2A 3K0CC 4PSAA 2LWIA 3HR7A 4NCHA 5CM8B 2EF0A 1PT6A 3ABIA 4Q48A 4BMZA 1TMGE 1Z28A 2I65A 1J0DA 5DHFA 5BSMA 4EW2A 1JTEA 4JX9A 4BLOA 2I91A 2M32A 1KKMA 2QRZA 4FN5A 1RXCA 3JQPA 1QE5A 4I9HA 4IEIA 3UV7A 1WNTA 4IVRA 4PWZA 1OH8A 3CLRD 3QKSB 4ESEA 4IGEA 3Q5EA 1TUBA 3MF4A 2NO7A 3M6AA 2CFCA 4XTRA 2EXXA 1Y1KE 2XUHA 5DZSA 3NWJA 3VZCA 4N5DA 4EF5A 1OFUA 1SXGA 3RI3A 1EJ2A 1M8JA 4NJEA 4PIMA 4YP5A 5JSFA 5LQCA 1PEKE 5FWNA 2DU8A 3WV4A 3LZ6A 4TN5A 3TE7A 1U9IC 4P7FA 2ZXFA 3A05A 1K06A 1E6LA 3OZRA 1A69A 5CX4A 5D5QA 4DLBA 3W4JA 1QGZA 3C5VA 4OAOA 2VTDA 3K73O 3P19A 3FR8A 3TIVA 5C7LO 3OZAA 4UNRA 4YROA 1TVKB 3VZQA 4Z4HA 4GSKA 1UDWA 1XQYA 3SMQA 4ZKDA 4BJ5A 4X84A 3WDMA 1F60A 1T5OA 1U6JA 2WQZA 4KN8A 4NSNA 1H6CA 1B73A 3EZLA 5K3CA 2IX3A 3W7AA 3I2JA 4TLAA 2V7EA 5FOQA 2J6IA 3NYQA 1FYFA 1RAIA 2ZLBA 3BGSA 3GLHE 4IYRA 4QYMA 1QCZA 4M0KA 5EUMA 1IOLA 2GHQA 2K87A 2G88A 1M6EX 1USGA 2VDKB 1CYDA 1C3XA 3OFKA 3OQJA 3OZTA 2ZQZA 5COAA 4B8YA 3DONA 4PZEA 2DBYA 1GUDA 4DQKA 2GZ1A 3U9TA 3WLIA 1F0YA 3VKUA 3HL0A 3FOEC 5EMJA 1N57A 1JKJA 3DVAA 4EYQA 3QY9A 3NS7A 4RM3A 3WHKA 1TAQA 1X80B 1XZFA 2ZSUA 2QRMA 3MTJA 3NRCA 1GTSA 1YQEA 1E1LA 2QRVA 4OQ4A 4PTLA 5EE1A 3CZMA 3JD2A 3FYDA 2YY6A 4JLUA 2XQKA 4LV5B 4HAOA 3LQKA 3PJFA 5FX2A 3HU2A 4PPNA 1OMOA 5TVKA 3D1VA 4ZYUA 3FA2A 4TV8F 2ORVA 1DKUA 2WWXA 1L7PA 3VR6A 3PNMA 3QUAA 3U4QB 2M1ZA 4HATA 3I2HA 4JQOA 2C4MA 4QIHA 5H80A 4UHBA 1YS7A 2CZQA 5IDXA 2HA3A 1Z4MA 4QO8A 1QO7A 2Z98A 3PHIA 4BLSA 3WK4A 2PWPA 4EHNA 4IZHA 4ZJUA 3JRNA 2D7DA 1P9LA 4M7RA 4E1BA 4FNAA 3I23A 1DEOA 1BKDR 1TEZA 2R4QA 2ZIZA 2O6LA 2J3KA 4MVJH 2H2AA 2BE9A 3TXXA 2UXDB 1TKCA 1OI4A 3MM4A 4P2GA 4EEKA