1W2HA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with azidothymidine monophosphate (azt-mp) (2.0 a resolution)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
190
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE TMK
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title The crystal structure of Mycobacterium tuberculosis thymidylate kinase in complex with 3'-azidodeoxythymidine monophosphate suggests a mechanism for competitive inhibition.
pubmed doi rcsb
total genus 73
structure length 190
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w2hA00
3P4YA 3QXSA 4POAA 4Q9IA 3SYKA 3Q5DA 3F0TA 1XMIA 4V0OA 2ZJZA 4I81A 5FOUA 2UZIR 2D7DA 3GLGE 2EYQA 1QVRA 2ZRJA 4WZBE 4K46A 5E95A 1KI1A 5SZJA 2ODEA 1CR4A 1Q57A 5AWFC 5TDHA 1UKYA 1DADA 2DCUA 2FH5B 1CR1A 2A5YB 2SHKA 4MKIA 1EESA 2G9NA 1Z6XA 3SS8A 3UIEA 2QT1A 1P2SA 4A4DA 1F5NA 4RZ2A 3EAQA 3DKPA 3AVVA 1E79D 2O0KA 2OFXA 4PPNA 1ZD1A 4JKYA 4YLGA 1RE0A 1YZUA 2ZRPA 5J4YA 4V02A 2WIBA 2X19A 4P32A 1P73A 4FMBB 3WMGA 4A2WA 2VA8A 3EZFA 2REXB 4GMXA 3C15C 4US0R 5DI3B 3TIFA 4AURA 3GLIB 5GVSA 1Z08A 2BKEA 4D26A 4GMDA 2ZRKA 2IS1A 2DYKA 2YHSA 2ZSDA 2RGNA 2HCBA 4OL0A 2ZS9A 1CJVC 1JAIA 2A7QA 1GRQA 1NKSA 4LI0A 2VF7A 2WAYA 3OFNA 4BUJA 4NMMA 1JI0A 4RD1A 3ZIAA 3DO6A 3WBKA 4PHTA 5HE9A 3ND8A 1GAJA 3GCGA 1X1RA 3MD0A 4L9WA 4D82A 4US2R 4C7OB 2EFGA 3TE6A 4B2LA 1PV4A 1GILA 4ILEA 1M34E 1YZTA 3IO5A 3M0EA 1TF5A 4EJSA 3NC1C 2A9KA 4P33A 4P4SA 2GJKA 3I62A 2FPKA 2ZYTX 3OIUA 2CBZA 4PO9A 1KK3A 2ATVA 3FKSD 4TTRA 2V55B 2VF8A 1MV5A 1P7CA 2FX3A 4ZO4A 2F7SA 1E2NA 4WXRA 3U3MA 2N1BA 2XOKA 1CR0A 1OXVA 5GVRA 3WY9A 5C4MA 1E9AA 3QF7A 1NIPA 3THXA 1G6HA 2IUUA 1ELOA 3MJHA 1X86B 3KQKA 4LHWA 3PUXA 1XX6A 1XWIA 3QOFA 2W0MA 4QGGA 1N6OA 1NSFA 4DDTA 1H8EA 2DFTA 4JL8A 4KJZA 4RKEA 1I4TD 5J5CA 2C9CA 3OAAA 4US1R 4PC6A 1KO4A 1FP6A 4EAQA 4Q21A 2KBEA 1C9KA 5LB4A 4AC9A 2O8FA 3MGCA 2FFHA 3SJZA 4YXWA 4KHZA 2ZJOA 4K81B 1MO5A 4M53A 4N0EA 2JGNA 3AM1A 3AVPA 4N1AA 2A2ZA 3BH7A 3RRNA 1G8FA 1ZD9A 1DARA 1WF3A 1IONA 1XEFA 3LBIA 1YQTA 3RYTC 4NYMQ 3AVWA 1NF3A 2Z6VA 3SBDA 3BS4A 3W5IA 2JJ1D 1KDOA 2IUSA 2QGZA 1SVSA 1GP2A 1F3OA 4DLXA 4HATA 4M1YA 4R9UC 1EFRD 1U90A 4IDPA 4BWYA 1T6NA 4CZ2A 1E1RA 1KKMA 2EFEB 1XTJA 4FMCF 2NG1A 1WXQA 1Z0DA 3VNUA 5FOTA 3H1TA 4IVQA 5L3QA 4H9GA 1NSTA 1W44A 1PLLA 2NQ2C 3TBKA 4EUNA 2ZI4A 2IF0A 2ZJAA 2ONJA 2WSSD 2J1LA 2RAPA 2AKYA 1KO5A 3DM5A 1AM4D 2JLQA 1ZD8A 5FPTA 1NRJB 1N5LA 2HEIA 1ZYUA 2CE7A 2KBFA 1SVKA 3OFND 2I3BA 4HUQA 2ZRBA 4YDSA 3SN6A 1LF5A 3TR0A 2JLWA 4Q7LA 4TL8A 1OV4A 3T61A 2GCOA 2CEAA 3O47A 3A4MA 3RRZA 4RD4A 4EPYA 2WWHA 5KHOC 5L3RA 3KKNA 3U3RA 3VAAA 1FNNA 4OI4A 3FHTA 3ZQJA 2IYQA 4BZXA 2VL7A 2C2HA 4DRZA 1XBTA 4M21A 5AUOB 5J4HA 3U44B 3SHWA 1DG1G 2NZ8A 2VYFA 1ZW6A 4JBWA 3GMTA 2DB3A 4Q7JB 4DJTA 1M7GA 2P0EA 4WXPA 5EE0A 4LJ6A 1QVAA 2CJWB 2WKQA 3I92A 2ZQ5A 4NPHA 1K5DA 4GNKA 5TARA 1Q1BA 3WMEA 5BYKA 1MT0A 1ZUIA 3BERA 1M8PA 3W5JA 2CMKA 4Q01A 2EFHB 2FJUA 4BLOA 4HLDA 2YVUA 3NWJA 4C9BA 3BC1A 2D3WA 3AQ4A 4LBVA 3N5CA 3VX4A 2BBWA 2QAGB 4QFMA 4OBEA 5EP2A 1IY2A 2CDNA 1CULC 2ZRFA 2W2TA 1HQYE 1W4BA 4B35A 1ZM9A 5HKKD 5FOSA 1BYIA 1JALA 3QY0A 3I5YA 1EG7A 3OE7A 5BWMA 2ZRHA 2LKDA 2N46A 5DSZA 2FSIA 1XFAA 5JJKA 2EU8A 3X1WA 2QAJA 3PQCA 2WJYA 2WKRA 2QMOA 3C7KA 1M7BA 1ZMXA 1T0JB 5J4KA 4HB0A 4QBGB 3IO3A 3WBJA 2ORVA 3K53A 1U9IC 2DWQA 1CJUC 1QRAA 2CL7X 2IK8A 3IPYA 4G5RA 3CRMA 3SBEA 1XTKA 3QUSA 1IJEA 1Y63A 1IHUA 2RGEA 1E2FA 1O3YA 3CPEA 2W00A 3HU2A 2F6RA 4JVLA 4A1FA 4C4PA 4RD6A 2XITA 3EARA 1PLJA 2X2FA 3MWYW 5D3MB 3Q7QA 3ZVLA 1VG0B 1E96A 3CF6R 4KLNA 1E9CA 2O8DA 2BDTA 3EXAA 2GXUA 3LQRA 2A30A 3REFA 4CVNA 1S8FA 1XXHE 4WVFA 2BKUA 2C8VA 3ASYA 2EFDB 4FI3C 4G0NA 3UMSA 2Q6TA 4GOJA 1KNQA 4KV9A 1E2KA 4RZUA 2ZI7A 1W46A 4BFZA 2XTMA 1KK2A 2ZAOA 2NIPA 3RVBA 4NCIA 4ASUD 2EYUA 1LY1A 4D0LB 3QKSA 2WJGA 1VKJA 2HXSA 4AD8A 1MH1A 2F3RA 2VSXA 3BORA 4B43A 1N3BA 1DVRA 2C98A 3DOFA 3HDTA 1OYWA 2ZU0C 3RLFA 3U4QB 4QXAA 1TUIA 1F2TB 1N6PA 1UPTA 1Z0FA 1W36C 1NN3A 2BMFA 3T5DA 5H8WA 2Q9BA 2VP0A 1R7RA 4P3YA 5B57C 2F3TA 4OYHA 1D9ZA 1W48A 3T12A 5FPSA 4DVGA 1G20E 3TR5A 1NLFA 1OFIA 4D81A 1YRBA 1NVXQ 1T3SA 1FMLA 3AVXA 3N2EA 5AJWA 3OESA 3ADKA 3AB3A 4LOAA 3I8SA 2CHVA 4DCSA 4TWZA 2QMUA 1OKKD 4IDNA 3IKJA 5CYOA 4BEJA 4JIMA 2ZI5A 1V5WA 4HAXA 4YMSA 4LHZA 1NN5A 3GD7A 5FPYA 5G41A 1OJLA 1G3QA 2IYUA 3Q3JB 1UJ2A 4B76A 4XTRA 1GSIA 5EE9A 1ZIPA 2CE2X 2G83A 4NCNA 4BFVA 4NHOA 1XMVA 421PA 4F4JA 2ZR0A 3AH8A 4HB4A 4CDGA 1S3GA 1SKYE 2QMHA 3KKQA 1AS2A 1ZU5A 2KSQA 4Q19A 1LVGA 2GF9A 3QG5A 5FBLB 1TQ2A 3SOPA 2PJZA 5CYPA 2JEOA 3KTAA 3DM9B 3SFZA 2ZSBA 1T3HA 1E2HA 1VPLA 5HZKA 1FZQA 3CF2A 2QSYA 3AF0A 2OO7A 1QG4A 4O2RA 3ZVMA 1VTKA 1NN1A 4XVUA 2JJ1A 3R20A 1PLKA 2ASEA 3TKLA 1RIFA 1XPRA 4JLNA 2UZ3A 3IHLA 1KMHA 2GBLC 4UNRA 1EXMA 4P4UA 1S96A 1RYHA 2GVZC 5FH9A 2GAAA 3LA6A 1E9BA 4L8GA 1CEEA 3EC1A 2AK2A 4GT1A 4LHVA 221PA 4Y0AA 2P67A 4Q1FA 3U3JA 1TQ6A 2NTYC 4UNQA 2P6RA 2ODNA 1GUAA 3H4MA 3T15A 1CF4A 3EZ6A 2BBOA 4Q9LA 2ZANA 2ZS7A 3KJHA 1G5TA 1ZJ6A 5KTYA 1KNXA 3KXKA 2CNWA 4QBHA 1K8RA 1G9XA 2BJVA 5KPDA 5FTJA 3GLGA 2YINC 3SC3A 2A3RA 3QVUA 4DLRA 4BZPA 3GJ8A 5TXGA 3PUVA 1G3IA 1AJEA 4DLYA 2WV9A 3KB2A 5FTNA 2G0NA 4UJ3A 1NJGA 3KFVA 4BECA 2JASA 3ADCA 1K5GA 3CBQA 4RSGA 3A58B 3QPUA 3MWKA 2QNRA 2PEZA 4AY2A 4Q66C 2V7QD 2C9OA 2PZEA 3AV0B 1YZQA 3MWLA 5AUPB 1XCGB 4A8JA 4B6EA 2FG5A 2XX3A 5JHHB 1I4DD 1KO7A 4ZKDA 2O8CB 1E79A 4UNPA 2O0HA 3FMIA 3IGFA 4LJ4A 2Z5FA 1ZU4A 2Z0MA 1E2JA 5BN4A 2GK6A 2WWXA 4UNNA 1NI3A 2IWRA 4KI0A 2YJTD 5EXTA 2YZ2A 4URXR 3MMPA 1YU9A 2P6UA 3IIMA 1OIXA 5TVKA 1MABB 4YMWA 5J40A 3CZPA 1WDTA 4DT1B 3A1VA 3KTAB 2GK7A 3BGWA 3FWYA 4LBYA 1N6LA 5K8LA 2UKDA 3QI2A 3TSOA 3R9XA 2QENA 3DEFA 2ZYUX 3EWAA 5E7MA 4DDVA 5KUTA 3DHWC 1RRCA 3UG6A 4GP7A 2GBLA 4GZLA 4I1VA 1C4OA 3A1TA 3CRRA 4QGAA 3AUYA 3Q9LA 4Q1AA 3EW9A 1Z06A 2QPOA 1MRNA 2WHXA 3RC3A 4NBSA 4PC2A 3W6OA 4CT4B 4M9QA 1HYQA 3AEZA 1A2BA 5E7IA 1LNZA 2AXNA 3FFBA 3KL4A 1OH6A 4P4SB 5CJ2A 1N6KA 2OBNA 1DAIA 4JT4A 4IRUB 2V1UA 3IEVA 2JDID 5FPKA 3B85A 3FHCB 4QHTA 4Y0VA 5L3VA 1HE8B 5KNBA 4OI1A 3RSLA 5CLQA 2GZHA 2QP9X 3VR5A 5JBQA 1U8YA 1XD2B 2PX0A 3BFXA 1ZVQA 5JJLA 2VLIA 4LJAA 2OESA 4PPGA 4FMDF 1SKQA 4R2IA 3UWKA 1F2TA 1JEDA 2OEPA 5HCIA 1S4QA 1P60A 1ZBDA 4XVQA 3SQWA 2ZI9A 1KSGA 2V54A 5DE3A 5FI0B 4F4IA 5G3YA 1Q22A 2VEDA 4IFBA 3I32A 5DI9A 3K8YA 2F55A 1E2EA 1KY2A 2FPMA 2FNAA 4BFTA 1UDXA 1LS6A 2NO6A 2RGDA 2ZVPX 2F1JA 2RCNA 3K9LA 2F1IA 2IXGA 3SJBA 3ZD6A 1DE0A 2WWYA 3D31A 1YKSA 1EWRA 2P5TB 1NNEA 1II8A 4UJ5A 4E22A 2J7KA 3A4LA 1UEIA 2XJ9A 2Q21A 2ZYWX 2D2FA 3SEAA 2QPTA 4UKDA 2NPFA 2IWHA 4ASUA 4DB4A 3AVQA 2CK3A 1NMXA 3KZ1E 1KIMA 2HYIC 4TLCA 5L3SA 3BWDD 1SVWA 3I4LA 3CZQA 4JYBA 1JAHA 5GJVC 2J7PD 2GDJA 3UWOA 3VQTA 2MSCB 1QHHB 2ORIA 3WXMA 4TQ9A 3OIWA 5C2JB 3F3YA 3BBPA 2KJQA 4RD2A 3THXB 2QN6A 3PUZA 2WMNB 3DOEA 4BLQA 1A4RA 4HSEA 2ZI3A 1JQJC 1OE0A 1YR9A 1F2UB 1OB2A 5LD2C 3TSWA 4B73A 2TMKA 4CF7A 4AKGA 4XWAA 3QXHA 2FV8A 4TZ0A 1XF9A 3P20A 5AR1A 1OIVA 1U98A 3BB3A 4DXAA 2AR7A 4IHQA 4GSYA 1E9RA 2ZE5A 1Q0UA 5CIWA 2G0TA 2ZM5A 1XXHB 4PPFA 3RS2A 1W0KA 3BB4A 2VSOA 2ZJ8A 5KOYA 4MKFA 4Z1MA 4OQLA 5TV2A 2HF8A 1MR3F 3THWA 5C18A 4TN1A 5CM8B 5FR2A 4YONB 3ZH9B 3QXXA 4PO1A 4DZZA 2GCNA 4L5BA 1J8MF 5FUVA 3U60B 3UMFA 2QQEA 1KZGB 1TTTA 5CK4A 3KXLA 4O3MA 2QSZA 1FW6A 3KQHA 5C1BA 1LF0A 2AK3A 2ZRGA 3P32A 3CONA 4FWTA 3L0SA 2RHDA 4GBMA 1JXMA 2FMXA 5SZHB 1YR7A 3RHFA 4CT5A 1SXJC 2P65A 4R98A 3X1YA 1HEIA 2R9VA 4RVCA 1VIYA 4B47A 1W1WA 1JEEA 2OUKA 1ODFA 1GL7A 4OKSA 4LSGA 2NO1A 1ANKA 3X1XA 1YZLA 4FIDA 3WHLA 1SVLA 2HDNB 4BLPA 2CL6X 3VU9B 3HYRA 5HZHA 5JEEA 4DHEA 3FTQA 3C5CA 4OQNA 3V4FA 3ICEA 3T35A 3CH5A 2R6DA 3GFTA 1E9FA 2AHOA 2QQ0A 1D5CA 2GHIA 2QRZA 1UBGA 1G6OA 1XXHA 3NBFA 4JLVA 3CNOA 1CP2A 1JJVA 1W4CA 2DFLA 1NBMD 2ZRDA 1FQKA 2VHQA 4AYTA 1VECA 1KAOA 1CRQA 1AQUA 2A5JA 3B5JA 2XSZD 1KO1A 4TMXA 1UBFA 2DFKB 4HLUC 1Z47A 4LYHA 2J46A 5AJVB 5FI1B 4RFSA 2B8WA 3LNCA 3ZGXA 2WWFA 4DDWA 1BMFD 2BEJA 4DCTA 3SFVA 1UBCA 1F60A 3QKTA 4R2HA 2IYRA 2IC5A 2FGJA 4B3CA 5KSPA 2W6IA 2H7VA 3ZZTA 8OHMA 1ZP6A 4TMZA 1OYYA 6Q21A 3HYTA 3BRWD 5FOXA 3WRYC 1TL7C 4ON9A 3VR2A 4Q1DA 2AL7A 4C2UA 1E0KA 2LCFA 4G1UC 2ZRAA 3E2IA 1CTQA 4XOIA 3REGA 3SDZA 2E1RA 4PHGA 3AGPA 4IDHA 2FN4A 4M22A 3IILA 3EZ9A 5F2EA 2VPPA 4LYFA 2R6AA 4GFDA 1Z6AA 2ZAMA 4WW0A 4MYCA 2DWPA 2AD1A 3AVOA 2GEVA 4KCGA 4MGIR 5LDDC 3K0FA 1P3JA 5FTLA 4NONA 2PCJA 3QXJA 3K70B 4I4LA 1OH8A 2RGNC 5TMPA 4I1OA 5DH9A 4DDUA 3C41J 2J3EA 2ZEJA 3MJRA 3U7FB 2YWFA 1AQYA 3W6NA 3NBZC 2NGRA 1UKZA 4OHXA 4DLZA 3IDQA 1W2GA 3WYGA 2RGAA 2OHFA 4DCUA 5KU1A 1NLZA 4FCWA 1N0VC 4NCHA 1Z22A 4MRSA 5L3QB 4D25A 2I1VB 4LPSA 3ZJYA 2XTZA 4QL3A 4HAZA 3OEHA 4BLRA 4F93B 4CEIB 3ICQB 1MO3A 3Q5EA 5IT5A 1KI7A 2IYLD 1NLYA 4NZYA 4LUCA 3R7WA 3TUJC 4HB3A 2MSEB 2WM9B 4Q1EA 1VG1A 2J7PA 4NCJA 1NY5A 2QY9A 1TPZA 4O0MA 4Q47A 1W5SA 4LZZA 1HV8A 5JI2E 2FFAA 2G6BA 3OZXA 1XCMA 3D3QA 1KMHB 1NKTA 2Q9CA 4ARZA 1GVNB 3B60A 2Q3HA 3K9GA 5HTKA 4UXHA 4HLQB 2IX3A 2X77A 1VCIA 3M4YA 4XD7A 1N0WA 1J7KA 3ZDQA 4CRWB 4IDQA 3B2EA 1DAKA 2RH5A 1TNDA 3I72A 3KKPA 1W2HA 4Q7MB 2QROA 4EQ6B 1LV7A 3GFOA 2OE2A 4R71A 1AS0A 1DO2A 1AZTA 1XD9A 4LJ8A 3VHXA 4ABYA 2AFHE 1R0XA 3VNVA 3KQNA 1DPFA 3Q85A 1E0AA 2QM8A 3N70A 1KSHA 3W6PA 1OXSC 4TTQA 1G3MA 4ITRC 3B8HA 4C0KA 3B6EA 1G3RA 1Z0KA 4OJQA 1ZNXA 2ERXA 4KAXA 3AP2A 3W3ZB 1KI6B 4D6PA 4FMDB 4QNRA 2FWRA 4CEHA 3NIBA 2OBLA 4FINA 1M6NA 2OLKA 4PZYA 4Z54A 3PEUA 1RPZA 4JBXA 2B92A 3CX8A 4QJ3A 4QM7A 2GXAA 4F4CA 1D9XA 1KJZA 2O0JA 2V3CC 4EFMA 3LD9A 4NDZA 4DBLC 2J0VA 4YDHB 1G64A 3SYLA 4HZUA 2QG6A 2IXEA 3GEHA 1N6NA 4MDFA 3QPVA 4TLDA 4L15A 1E3MA 1U8ZA 3K09C 2QU8A 1G7RA 1U99A 1VYTA 2XEXA 2REOA 3FMPB 3S1AA 1T0HB 2DY1A 5KYKA 2WIAA 4HDOB 1HTWA 4Q1BA 2WZQA 3HU3A 2GXQA 3DZDA 3I8XA 4GP6A 3EIEA 3PITA 3EG5A 1G7SA 3A37A 1T3LA 1WQ1R 2WPDD 1OHHD 1KKLA 1IJFA 1CBUA 2QI9C 2WVJA 2WOOA 1IY0A 1RW4A 1ZM2A 1LB1B 1CIPA 1DAEA 2RGXA 4JL5A 4BLSA 1Z29A 5J4LA 4PHHA 2RMKA 4MDEA 3U6BA 4D4LA 3EZ2A 2FFQA 4KYUA 4D80A 4AYXA 4L4UA 1CKEA 4AG5A 4HDQB 4HAVA 1RC8A 2ZRMA 4WBSA 2YC4C 2B7BA 1S1MA 5FL7A 2NPIA 3KKOA 5LPNA 4FCTA 2WSMA 2OSBA 3OEEA 5EZ6B 4U5XA 4OI0A 4PQFA 3AF1A 3UG7A 4BFYA 2DPXA 2XSZA 2QL6A 5JRJA 2JLVA 1ESMA 3TVDA 3RWOA 4DSTA 5JZVA 3KX2A 3EC2A 1YZNA 1YRAA 4JJKA 3AKYA 1ZUHA 4M1KA 4FW9A 3EWSA 2GJ8A 3IBYA 2FSHA 2AKAB 3MWJA 3B1XA 3GJ5A 4LY6A 821PA 3ZD7A 1P9RA 1IN6A 1IXSB 4D4JA 2OG2A 2G77B 3QIAA 2GZDA 5CLLA 3CIOA 4A82A 4AYWA 1X6VA 3RABA 3IIJA 2PMKA 4HI0E 4NYMR 4ZKEA 2DWOA 2GEDA 5A4JA 2IS4A 3PVSA 4W5WA 3K0AA 4BFUA 1E9SA 5EUMA 1LS1A 4I1SA 3TUIC 2FDCA 4CEJA 3LLMA 3VR4A 1EFUA 1E4VA 3GLFB 2DHRA 1ZCBA 2FE4A 1GTVA 5BN3A 1KK0A 3GEEA 4PTLA 4D4MA 1P5ZB 3LRPA 1P9NA 4IVPA 4X8OA 2MSDB 3NEYA 4HZIA 5JMTA 1XTIA 1FX0A 4G3XA 3PXGA 2ZXUA 3RRYA 2C77A 2GJAA 1E6CA 2BEKA 2DR3A 3B78A 1G8PA 2H57A 2J9RA 2R8RA 3FFAA 3B82A 1EWQA 4LHYA 3GPLA 2CLCX 1QDEA 1KO8A 4IKEA 5IF9A 1JR3E 1FUUA 1L2TA 1OLOA 4TSFA 4PC3A 3LBNA 3FE2A 2PBRA 3NDPA 4LBWA 1P72A 3LVQE 1XB2A 2OFWA 3IUYA 1SKYB 2IS6A 1A82A 3KUDA 4J0QA 2O8DB 1VCMA 2Z83A 1N5JA 4RD3A 4MRRA 3SU8A 4Q03A 2V7QA 4XSHA 3FHOA 1XP8A 2NO0A 4LV6A 2KE5A 1R10A 1JR6A 2QTVB 2F1HA 4LCBA 1IAQA 3THOA 4B33A 3TUZC 3AP3A 4ZDIA 1VMAA 1KDTA 1HY3A 4KFRA 1FQJA 4LV5B 4RCZA 5UKDA 4A0GA 5EP1A 5FBWB 2ZRCA 1E2GA 1W0KD 2WWIA 4AI6A 4RCYA 1KZ7B 5JWOA 3BJIC 5F98A 2WOJA 1KAGA 2OBMA 5JCZA 2OLJA 4QJ5A 1KJWA 2JIZA 3LH5A 4EIWA 4BEBA 4JS0A 4BRUA 3GLHB 4LHXA 1BYUA 2GZAA 5BQ5A 5SZKB 3GJ6A 1R2QA 2GILA 3LAWA 4IXMA 2VP2A 4LWZA 1GRNA 2OILA 1LTQA 1M2OB 2CL0X 1BIFA 1SGWA 4IEEA 4LJ9A 1N0UA 4M1WA 1AGPA 2HCJB 3GJ0A 2YKGA 1HT2E 3PR1A 2PL3A 4G5GA 3G0HA 2O8EA 3EX7C 4DLVA 1XTSA 5CM9C 3HP1A 3VKHA 3AKCA 3VX3A 1OF1A 1P9WA 4XWOA 1T4GA 2PJRA 1Z2CA 3L82B 5KSZA 5ELXA 4F92B 1TU4A 3NDBB 2WKPA 1KJYA 1D8TA 5B30A 4IVRA 4XD7D 1IY1A 3PENA 3QKRA 3V00A 2NO7A 2VP4A 2VHJA 3LX5A 4TL6A 4KVGA 4LYAA 4FN5A 4QRHA 2XAUA 4IXNA 4Q4HB 3NHAA 4M9SA 4TMVA 2FEOA 5E7JA 2NZJA 2ZE8A 4CYMA 2ZI6A 2B7CA 5EUQB 5BXQC 3CB4A 1XJ0A 4GPTA 1BOFA 5J47A 3OF5A 4NU0A 4LJYA 4Q4AB 5DYIA 4GL2A 2IUTA 4QHYA 4M1SA 4D2IA 4CGZA 1HH4A 3DZ8A 4HAYA 5JS7A 1ZM4A 3PFIA 4TT3A 3NBXX 2C5LA 4URZR 1GG2A 2C78A 3CX7A 4B44A 3T34A 3CRVA 2XNDA 121PA 2ECKA 3HU1A 4X8LA 2IHBA 3PEVA 1OW3B 2XJ4A 3WNDA 4RZXA 4JLDA 1P61B 3CWZA 4XSGA 1WMSA 1KY3A 4URUR 2HF9A 4TMTA 3KKMA 3H84A 3EPKA 1R0WA 2JDIA 4A8JC 5IDVA 4DLSA 2AN9A 1E0SA 4DLWA 3K70C 4DEYA 3RS5A 1CJMA 3A1UA 1DS6A 2K5UA 1XCPA 1BS1A 1X8KA 2V1XA 4HUTA 1S1CA 1E32A 4V03A 3K0CC 2R6FA 4I99A 3K1JA 3T5GA 4EPVA 1ZRHA 5G53C 2XXAA 5IHPA 2X8AA 4DSNA 1W36D 2N42A 3NEJA 5KSYA 3AVUA 3JVVA 5EXSA 4EFLA 1SULA 3EPHA 3NC0C 1I2MA 1JQLB 1TQ4A 5G40A 1ZCAA 2ZR7A 3K70D 3FMOB 4I1UA 5DHAA 4DIEA 1S9DA 3C5HA 4ZDKA 3BFKA 3CW2A 4GOKA 5CIQA 3AF3A 1IOZA 2REBA 3DVLA 2H5EA 2VRWA 4NYIQ 4PXAA 4M1MA 2XGJA 1XPUA 2CHQA 1IN5A 1TQDA 4BLTA 4ZCIA 3BXZA 3IHWA 3TW4A 3LW8A 5KDDA 3LXXA 2RGBA 1G5PA 4PO8A 4A0HA 5JECA 3LX8A 4MGZR 1E1RD 3K0AB 3SHFA 3FVQA 1U81A 1R5BA 5P21A 2WJIA 4MYHA 2C96A 1G1MA 1S3SA 1OFUX 5CJPA 1HURA 1T9HA 1W0JA 2J0UA 3UATA 3MFYA 5CDFA 4A2QA 2AWNA 1FFHA 2Z4RA 4PAOA 2YV5A 4IOJA 4CIDA 1FP7A 4JVSB 4B48A 4E07A 1DAFA 4Q4HA 5DISB 1U8AA 4LPKA 3AF2A 5HCNA 4KODA 2YNMA 4KVAA 1JJ7A 4WIAA 2B8TA 3WYAA 3DKVA 2X2EA 3AVTA 2H1LA 3VR6A 3R9WA 1B23P 1XMSA 1VYVA 3QKRB 1QHNA 4KXFB 1ONBA 1NIJA 2WWGA 1KI3A 1AZSC 4MKHA 2ATXA 5L8VA 2VP5A 1XTQA 2P5SA 3WNBA 1UADA 4B2IA 4AIIA 3AKDA 2OFOA 3L0IB 2HT6A 3AP1A 4QGHA 1KI8A 1L7VC 5E4FA 3L8ZA 3QXCA 2O8EB 1EX7A 1DTSA 2ZSAA 3FKQA 3SYNA 1KI2A 2IS2A 3MUFA 4TYWA 4OK5A 4PPQA 2FEMA 2J0SA 1FUKA 3KJEA 2W6JD 3IEUA 3GEIA 1N2CE 1JECA 1J99A 2EVWX 4WA7A 4A8JB 5FUWA 4OI2A 1DO0A 1EGAA 2XNDD 2QM7A 1FNMA 1E2DA 2G1JA 4X8HA 3ND9A 4TLBA 3MCAA 2E9SA 1TADA 2Q0HA 3AGQA 5JJIA 1Z3IX 2BCJQ 3ADDA 2ZREA 3B1YA 5B58C 3S1AB 1XZPA 2BIFA 4CEIA 3O8RA 4B3GA 5FBQB 3T1QA 4IOMA 2QORA 2G3YA 4IJMA 5J4VA 2XTNA 1XEXB 4IEIA 4ZIRA 1RZ3A 2I4IA 4KSBA 5AJYA 3TW8B 4EDHA 3I1FA 1DBSA 2EW1A 1G8YA 2GEUA 1N6RA 3T06B 5FUYA 5K8UA 3QJYA 3QPWA 1EFTA 1G8HA 2GJ9A 1VG8A 5JFGA 2ZE7A 4E09A 1NG9A 4Q4LA 1QBKC 3ECCA 4OHWA 5KNDA 1MKYA 2VHTA 2R44A 1U9IA 2GF0A 2ZVQX 4RJLA 4B2PA 3C14C 1J2JA 1Z07A 2CK3D 4TTPA 1XJCA 3BH0A 4HEJA 2CXXA 4GZMA 4ACAA 4BQSA 3BK7A 3P1JA 4C0BA 2IW3A 3QBTA 2HV8A 5JWRA 1OH7A 4FMCB 1RRGA 2NMVA 1SHZA 2ZRNA 5EQTA 4LC1A 3LW7A 1QZXA 1MO6A 4JYCA 5CK5A 2WPDA 2PT5A 2OCAA 4LBZA 4BFSA 2OZEA 3CNNA 1NY6A 1L4YA 4O25A 1MABA 4Q7KA 1CLUA 3JZMA 4MH0R 2J0QA 1W49A 3IBGA 4LJ5A 1NN0A 5IK2A 4LV8B 5DN6D 1MO4A 1IN8A 4ZPXA 2G88A 3BIFA 4GI7A 1KGDA 2B6HA 2WJHA 3OHMA 5H70A 1DOAA 5DO9A 2NOAA 1OB5A 1NP6A 3D8BA 1D6JA 1PVOA 1Z28A 5JSZA 3EPJA 2ZJ5A 4C0LA 4TMWA 5AUQA 1W0JD 3PIRA 2GNOA 2QTHA 1GKYA 3TMKA 4NYJR 2ZRIA 1FPMA 2O8BB 2H18A 3ZVNA 1X8JA 2PX3A 5KNCA 1W47A 1COWA 3NH6A 3A8TA 4LC0A 3ZS8A 1XZQA 3CUEF 4JMPA 2W58A 4KFTA 4X8MA 2XZOA 4BZQA 2A5DA 4DC9A 2C95A 521PA 2MMCA 2OCYC 1II8B 1VCNA 3GLGB 2HXYA 4PAMA 1VG9B 1VHTA 4Q48A 1JPNA 1KI4A 1Q1QA 1ZC3A 5HKKA 3W3AA 4KBGA 1IN7A 3RS0A 1XU4A 4XJXA 2A78A 4URWR 3F8TA 4QNMA 3IQXA 4NKRA 5K8TA 4Q5IA 1I2DA 3CX6A 1FX0B 3VFDA 3PEYA 2VO1A 4DSOA 4JLOA 3ZQ6A 3THWB 5DGXA 1UKVY 2FA9A 3PCRB 1Z0IA 4MQBA 1CJTC 1E4YA 2ZRLA 4HZUB 4PC7A 4QC2A 3M6AA 1N5KA 1Y3AA 4RY2A 3CLVA 4JL6A 1J8YF 1OXXK 1YE8A 3HPQA 5C46F 3I5XA 4WZAE 1NMZA 3GJ7A 2F9MA 2PT7A 3ETLA 1E2LA 3I3SR 1KDRA 2EWWA 5LB2A 3X2SA 5IRCD 2OT3B 2QGNA 4NE2A 4JLKA 2ONKA 5EJEA 4HDCA 3TNFA 1Z6TA 3TLXA 1UF9A 2PH1A 3LVRE 3RAPR 1T91A 2I1QA 4C2TA 2ZSFA 2L0XA 2YYZA 5B2ZA 2OCBA 5BYJA 1DAGA 2IL1A 3GJ3A 4QHSA 3SZRA 3KDSE 2H92A 1MRSA 2WSSA 4Q02A 5JS8A 3JZAA 2J5XA 3OIVA 3LLUA 1AIPA 2Z4SA 3L0OA 1G3UA 3RDPA 2ZR9A 5CB6A 3KQUA 3FOZA 2YOGA 3NHBA 5GJCA 3T1OA 3IQWA 2QP3A 2QEQA 4RKFA 5LBIA 1C1YA 3RS4A 1NJFA 2W2XA 1R4AA 1GM5A 3QG1A 1Z5ZA 4DT1A 3AF4A 3VU9A 3QNUA 2D4HA 3LY5A 4II7A 2D06A 4PHFA 2ANBA 1GRRA 1II9A 3J81k 2ZETA 2XZPA 3N2IA 2JLXA 3CR8A 1GNPA 2OV2A 2W6JA 4M4SA 1E9DA 5EE3A 3UK6A 2O8CA 2O52A 3U44A 3O8BA 3MG9A 3PV0A 3ADBA 2AWOA 3U7GA 3NTUA 2BJWA 5FOWA 3EIQA 1E94E 5FTMA 2OCPA 3R7WB 4PZLA 2VSFA 1UM8A 3ASZA 4Q4JB 4A2PA 4ESHA 1ZNWA 2DBYA 1XD2A 4H1VA 4JVMA 4QG7A 5HPYB 1FOEB 3WYFA 1KOFA 1TX4B 3LQQA 1E2IA 1BMFA 3M1IA 2IA5A 3FKSA 4RFVA 4N3NA 4A92A 1KYIA 4ZIRB 1T5LA 3AKEA 2BBTA 1VIAA 2J59A 3NH9A 2BCGY 3QE0A 4A36A 3SJAA 3ZS9A 2FGKA 2QBYB 5DYGA 2XOKD 5B64A 2A5GA 1XPOA 1QHYA 2BBSA 4IDOA 4WZ6A 2JLRA 1BH2A 4Q4JA 4G5OA 1EFRA 4OK3A 3NG1A 4KFSA 2B21A 3GJXC 3DL0A 4E03A 1US8B 1F2UA 4FWIB 3MSXA 3WP1B 3TGPA 3PG5A 4MGKR 1VDZA 4HLUA 5AJZA 4ZDWA 2JA1A 3TAUA 1GWNA 1JB1A 5JSZB 3SJCA 3Q72A 2ERYA 3HPRA 3H86A 2GESA 4MUBA 1CR2A 1A2KC 1OXTA 5JI3E 3E5HA 1JR3D 4EPXA 1W36B 3KUCA 3VKGA 1IXZA 2RGCA 3C16C 1Q1ZA 4TSFD 3QF4A 5L3SB 2PEYA 4NH0A 3IPXA 1NVVR 1S2MA 3SR0A 4Q9KA 3CKLA 5C4GB 4PQYA 2OM2A 2YWHA 4OQFA 2ZSEA 4D0GA 2JLSA 1ZINA 4YMTA 3CPJB 4F91B 1P62B 1Q3TA 2YOFA 4EQ6A 2QE7D 1D2MA 1SVOA 4Q9HA 1Z6GA 2J45A 2CLDX 4ZI2A 2BVNA 1YZKA 4G5QA 3CH4B 5FR1A 1TEVA 2DFNA 4AKEA 1ZM3A 4G5SA 1X8LA 2WICA 1OH5A 4U02A 2ZJ2A 2IYTA 4ARZB 3MRSA 2XB4A 3GLFE 1DAMA 1A5TA 3B1WA 4KLZA 1GFIA 1ZM7A 3OAAD 3VTKA 2IBMA 2Y8EA 2JIZD 4GOXA 4M2LA 1FL9A 2JJ2A 4BE7B 2BV3A 2HLDD 2QBYA 1WE2A 2FSGA 3E70C 1DELA 3QSYA 1RJ9A 3U5ZB 2QZ4A 4HLCA 1G19A 4NYJQ 3TSZA 4O2LA 4MRPA 1SXJE 1M74A 2GAOA 4TQAA 3KXIA 2AD5A 3EPLA 3KQLA 1GZSA 1UEJA 1WCV1 621PA 1XEWY 3BB1A 5EXXA 3TQCA 1SHKA 2ZUDA 4C3ZA 1G21E 4WAUA 1EK0A 5JCPA 1DG3A 2IYYA 1E9EA 1A7JA 3T1TA 1DEKA 2ZYVX 4KSCA 1E2MA 1KTVA 3EA5A 1G17A 4ZCMA 5K8IA 3OEED 4E5UA 4JJZA 1OFHA 4LYJA 2ZE6A 2BOVA 2BWJA 3RS7A 5F9HA 2IYVA 2QAGC 3V9PA 1ZAKA 2CVHA 2FZ4A 2RHMA 5HR5A 2A5FA 1Z63A 1E1QD 4KU4A 1JR3A 3LDAA 2GRJA 2W6ID 1W5TA 1P2VA 2J41A 2HJVA 4TZ6A 3LXRA 1AKYA 1G16A 1XJQA 3CRQA 1KHTA 1GITA 1PJRA 1B0UA 2H16A 3C4JA 4XTCS 1RYFA 3FPAA 5D3MA 2WJVA 2QRNA 2IYWA 2O8FB 3P27A 1L8QA 1OT3A 3A1SA 4DUGA 1ZNZA 4V0KA 3QF4B 4DWJA 1FTSA 4TMKA 1GKIA 4ACBA 2PLRA 1G7CA 2QUZA 4W7SA 2QPAA 2YOHA 2IEYA 4OHVA 4DCVA 2O8BA 5F9FA 3A1WA 4JZKA 2YC2C 3U3OA 4CW7A 2KI5A 2VH5R 2R65A 3CR7A 3I73A 3SE0A 1US8A 2BHRA 4JKIA 3U61B 2WJJA 1E69A 5EP4A 1E2QA 4TLEA 3QVVA 3FDIA 1HT1E 4N0DA 3UANA 1ZNYA 1SVIA 3ZZUA 2AX4A 1MOZA 5KSOA 4URVR 4Z8XA 2W0SA 4ERNA 1ZIOA 5AUNB 4FCVA 4BFXA 4L16A 3SI7A 3TK1A 4C0QC 4YMUA 3DDCA 2JLUA 2FFBA 2HUPA 4M0LA 3U4QA 1WBDA 3QEOA 4QBFA 1JXOA 1Q20A 1UKEA 3ZLJA 3ZYCA 2BMDA 2AXPA 1SXJB 1H8HD 1OFTA 4DIDA 3QENA 4HYYA 4NL4H 1GDDA 2CJWA 1RVDA 1XNJA 3FB4A 3LV8A 4JSYA 5DLQC 5FOVA 5SZIA 3W8NA 4M1TA 4ZI3A 2V9PA 3EIHA 3GLIA 2WBLC 4W5JA 1BKDR 1Z83A 4PX9A 1Z6YA 4Z1MD 3WP0A 2JLZA 3QKUA 4G01B 2OXCA 2H17A 4KFUA 2ZJYA 3K0EA 1G291 1R0YA 3EASA 3L2OB 5GJBA 1SXJA 3KJIA 4LRWA 2VP6A 4TLAA 2V6IA 1LW7A 3TH5A 1J90A 2VHCA 3TQFA 1KSJA 4HAUA 4IW3B 2VP9A 1GKUB 4EPTA 1IM2A 1RKBA 3EZ7A 4PSVA 4QGFA 3TRFA 5JHGB 3GLHE 3LO5A 1OSNA 1RJ9B 2RB4A 2XNSA 4U7DA 1D2NA 2J87A 3BAFA 4M9ZA 2Q3FA 1IN4A 1GL6A 3QQ5A 4JLAA 4R7ZA 5M04A 5LD2B 5JRZA 1ESNA 1NL3A 1G5RA 2YWGA 4RD0A 5EE5B 3L8YA 2CCKA 2ZUBA 5TY0A 4IFEA 2LKCA 1AGRA 2GTPA 5FBRB 4B3XA 3CPHA 2GCPA 1GOTA 3BOSA 5EP3A 2BMJA 2F9LA 2QA5A 1AKEA 2CNWD 4A6PA 2ZPTX 1N5IA 2VHUA 1XTRA 2RKOA 1QG2A 2P3SA 4IOLA 4TYPA 4ZDJA 2BC9A 3W8RA 2Z43A 1QHHA 4AKIA 2FOLA 1IQPA 1IBRA 1OHHA 3P26A 3BH6A 1CS4C 4P4TA 3K0CA 2XB2A 1PUIA 3ONWA 1LFDB 3CF0A 2EFCB 4D0NA 1G41A 1D2EA 1GNRA 3NXSA 4PSKA 4TL9A 4C30A 3VKWA 4PR0A 3GJ4A 1S9HA 1KSFX 2FSFA 4L9SA 3LWNA 2V6JA 3A4NA 2ODWA 1Z0AA 1AN0A 4DCNA 2ORWA 3QKSB 1X1SA 4B71A 4WOPA 2HT1A 2YWEA 3RRMA 2ANCA 2PMDA 5FUXA 3TAHA 3U6KA 4BASA 4B75A 4P0TA 4DLUA 1CU1A 2F43A 2JAQA 2X1VA 2R6CA 4QOSA 2QTFA 5JLJA 2PZGA 1GIAA 1H8ED 1TMKA 3PEWA 3UXMA 1OIWA 4ZCLA 1PUJA 1FTNA 2ZU6A 3RANA 1F6BA 5KDLA 4QKQA 1XEXA 4ESVA 5H1YA 4B74A 4V0MA 5AK0A 1AK2A 3GP8A 4B6FA 2CHGA 4MUAA 3OE7D 3RWMB 2EQBA 2R6GA 2RGGA 2V4ZA 2W83A 1Q12A 1YVDA 3CNLA 2JCSA 3EA0A 4EPWA 1O87A 1AA9A 4GRAA 5A5GA 4MYTA 2HLDA 1ZUNB 2G1KA 1KDPA 3B1VA 4AK9A 1ZC4A 4JT2A 4PC1A 3W90A 2IHYA 4B34A 1QHIA 1YZGA 2BM1A 3QEJA 3Q7PA 1H65A 4U00A 2GJSA 4TYNA 3Q8XB 4C0HA 3WRXC 1JBKA 3DMNA 3A36A 3RNLA 2C04A 1EFHA 1M1YE 2HYDA 2R2AA 2P6NA 5DIFA 3H0KA 4HB2A 1HA3A 1VYUA 4MRVA 4MITA 3AUXA 3KFXA 1NVUQ 4S35A 4URYR 2R62A 2QAGA 5EE1A 4EKDA 3NBYC 2WTUA 1WB9A 2C9YA 1GL9B 2AFIE 4RZ3A 4PSAA 2WAXA 1XMJA 1WP9A 3QBVA 4NP6A 3MLEA 5E3HA 4YMVA 1GNQA 4KITB 1TF2A 4W9MC 4LGMA 1SVMA 4OQXA 1EFCA 1W4AA 2VQSA 3H2YA 2PZFA 1Q21A 2C99A 4OHYA 2GA8A 2C03A 2WMOB 3LBHA 3G82C 2ZJBA 3E1SA 1EX6A 1P4SA 3BD9A 4DEXA 1T8UA 4Q00A 4MGYR 2J0UB 3W34A 2D2EA 1WBBA 1JPJA 4LJ7A 1Q44A 2KB0A 2GKSA 5D3QA 2QMEA 2EWVA 5FL3A 1RFLA 4YQFA 5KDOA 1KI9A 2OAP1 4KO8A 4TL7A 1YHNA 4DB2A 2JATA 1T8TA 3CRW1 4PZZA 5EZ5A 3KJGA 2CCJA 4OHZA 4YC7A 2P2LA 1JNYA 1TUEA 3GQBA 3D7MA 2ZS8A 5TB5A 5GADl 3BFVA 2UVQA 3B1ZA 2LWIA 1P6XA 2IYSA 3SNHA 3PUYA 4EPRA 1NBME 1P2UA 5A0FA 4PFSA 3L43A 1OPXA 5ANRB 4YXWD 3UPUA 4W5HA 1OXUA 1NVWQ 1S0UA 3B9QA 1G4UR 1IXRC 4BPBA 3HJNA 1YR6A 5DNYB 3O8CA 2D74A 1HUQA 1TU3A 2IT1A 4HAWA 1U0LA 4MA4A 4PQRA 1UDWA 1M7HA 3K0SA 5DI3A 4A9AA 3PJRA 1P75A 2WWWA 5KPJA 3THYA 1QHSA 2XXAB 4M1OA 1E2PA 4FXPA 1TAGA 3WNCA 3VHLB 1L4UA 2QP4A 4TQUS 3R9IA 4C0AC 1VHLA 2Q3MA 2FU5C 4OJKA 3X1ZA 1N6IA 1H8HA 1NMYA 2O5VA 1SZPA 2ODBA 4OQMA 4NCKA 5GJWC 4XWKA 2CCGA 5H68A 1W7AA 3TJZA 5DHFA 4MYUA 3T1VA 4C0JA 3GLHA 4XVRA 4V0NA 3U7EB 2VBCA 4BFWA 4Q9JA 1U0JA 1DAHA 2V8OA 4B3FX 1E99A 1F48A 3RC8A 1XEWX 1K6MA 1N25A 1U0HC 3DPUA 2PCLA 2QT0A 3P4XA 3NKVA 2ZROA 5FFMA 1BO6A 1RRFA 1QHXA 4F7WA 4LX0A 2W2VA 1U94A 4BGDA 4MRNA 4EJSC 4TYQA 2ZIAA 3R8FA 2IXFA 3PUWA 4NTZA 1V43A 4B32A 1ETUA 1XD8A 3K9NA 1NVVQ 4LDJA 3R8CA 3UMRA 2KWIA 4XH9B 2ZITA 4TYYA 2D7CA 4B3DA 3W9YA 3C8UA 1NBMA 2PLFA 4Q4AA 1XDBA 3V4RA 4EJSB 3DMDA 5KO2A 4QBIA 3FYHA 4KYIB 3TVTA 3HWSA 4C7OA 4NYIR 4A6XA 4DKXA 5CITA 2F1RA 4Z8YA 4CEHB 2CLSA 3B13B 1Z0JA 1I4LD 4FD2A 1U2RA 1CRPA 2Q9AA 1G7TA 3HR8A 5FL7D 1KI6A 4Q1CA 1E98A 3U3KA 4Z51A 1CXZA 2IEZA 3ZVRA 1R5NA 3GLIE 3KB1A 2QE7A 3RS3A 1A1VA 3ZZ0A 4AWXA 1YJ5A 4JSTA 3CO5A 3GFPA 4PANA 3VMFA 1QHGA 3U2QA 4UNSA 1UFQA 1WA5A 5BN5A 1R0ZA 4OK6A 5HE8A 4CEJB 4JLJA 1SQ5A 3FMFA 4GDFA 4AKHA 1YR8A 4UXJA 1G18A 4AG6A 3O8DA 5JWHA 3AVYA 2VIIA 4HUQB 4P31A 4PAQA 1WRBA 1G4AE 4MKGA 4UXIA 5FPHA 1E0JA 2FPLA 1KMQA 4TT3D 2BM0A 2NO9A 4RFSB 4C0SA 2ZUCA 721PA 3SQXA 1COWD 1NG1A 2HJGA 4QJ4A 5AJXA 3B9PA 3X1DA 4JVNA 1R8QA 4D4KA 2D62A 2OXRA 4V0LA 2JJ2D 3LFUA 1J70A 3NVAA 2ZTSA 1TF7A 1RRPA 2JLYA 4Q18A 3ZIAD 1Z2AA 1R8SA 4K8OA 1II0A 5FBVB 4DLTA 1W4RA 3G5UA 2FZLA 3JVUA 4UQOA 2IYZA 2OAQ1 1OKKA 1HE1C 3FGNA 5JEDA 1SXJD 3VR3A 1Z8FA 2IF2A 4V0ME 3BE4A 2E87A 1Q1EA 5FTKA 4A15A 1X3SA 3D6TB 3THYB 1N6HA 3OIYA 2VTKA 3U7HB 3I61A 3CWQA 3K0FB 5G3ZA 1R5OA 2F43B 4KBFA 3UKDA 1HQCA 2JJ8A 5CB8A 4DUGD 5F3WB 2GETA 2GXSA 1XRJA 3L0PA 3B7GA 4H1UA 4ZV4A 1E1QA 1UBEA 2IYXA 3WHKA 2FF7A 5CDFE 4S2EA 2H8KA 3K9HA 4B3BA 3CM0A 2BMEA 1TEXA 1AS3A 4F38A 3WMFA 4DSUA 3IIKA 4JLPA 1UAAA 2GVDC 4EFNA 4QM6A 1T5IA 4M8NE 1FMJA 1G8GA 2GWHA 3GLFA 4LK2A 4JLMA 3MAAC 1R6BX 3RSOA 1QF9A 4JBYA 2XZLA 4BRWA 2GCOB 2MMGA 4IOKA 1PZNA 3A6PC 5EXPA 4XIGS 3VR1A 2CVFA 3HR7A 3OEHD 4A0FA 5BW8A 1Q3HA 4A0RA 3F5FA 1CJKC 5DN6A 1KK1A 3K09A 4M9XA 5IK2D 1VCOA 4JLBA 1P2TA
chains in the Genus database with same CATH superfamily
3QXSA 1XRMA 3ZBPA 3X0DA 4CQMB 5CBKA 1EI9A 1FJGB 5G4LA 3A6KA 1XMIA 3BULA 1X38A 3GBSA 2OM6A 4GP9A 1JSRA 3N39C 4H7PA 3T7DA 3LUHA 4NS4A 5FOUA 2D7DA 1LSOA 2B5WA 4ZEOA 4KPFC 4I9HA 1DHTA 1JHYA 4PNPA 4XYMA 2GAIA 2HXGA 1Q57A 5AVTA 5KS2A 1Y7HA 4OVKA 4EUEA 2A5YB 4UM5A 1E3IA 2BKVA 5KTPA 3WWPA 2E49A 3BFJA 3P2OA 3RT7A 2VWQA 2G9NA 4CLDA 3M5PA 2BFDA 4A4DA 3R77A 1F5NA 4DJDC 1GLVA 4P9NA 3G8AA 3RPEA 1AQIA 1IG0A 5BOSB 1QIDA 3R7LA 2EHJA 2FYTA 4BO9A 4CKWA 1ZD1A 3RK4A 5TT0A 1UDRA 2PTGA 3M89A 1JHQA 1YZUA 2ZRPA 4DPMA 1TLFA 4ZEXA 5GPBA 2WIBA 1Y33E 4Q39A 1SK9A 1P73A 3EVBA 4FMBB 4ZAYA 3WMGA 1AKMA 1V6SA 3GEDA 1LXCA 4GMXA 1SOMA 3UMMA 4YRJA 5DI3B 3TIFA 3L0BA 3OMLA 4Z5XA 1YRHA 3R3HA 4EUHA 3GLIB 4YRKA 5GVSA 2CLMB 3FOFC 2ZUEA 4KH1A 1TKAA 2IEBA 2OZKA 3G2NA 4GX5A 2HMVA 2IS1A 1I0LA 3C6MA 1RXWA 4MWEA 1JHMA 4OL0A 3COPA 1CJVC 3TNLA 1VPWA 4ZYWA 2RDMA 3H1FA 5AW1A 4O4LF 2WAYA 2NXEA 4QPPA 3KVVA 4YGYA 4QASA 3TCXB 1DU4A 2JFUA 4BB5A 3EA4A 2VZ0A 5IAOA 2OBBA 4UUQA 5A9TA 3WBKA 3MWDB 3Q41A 1T5TA 1DLJA 1GAJA 1X1RA 2IUEA 1R1DA 4L9WA 4NH4A 2EFGA 3COWA 1R9JA 3MWGA 4EY5A 4ILEA 7GPBA 2BKLA 2NNWB 1PV4A 5EIHA 1M34E 3HRIA 3IO5A 2UUBB 1LLUA 3MINA 1TF5A 3W5UA 5JPIA 3ANSA 3KEGA 3L1HA 1K8ZB 1YQXA 3NC1C 4P33A 1P7PA 4P4SA 5G4KB 2GJKA 3ZI0A 5C5CA 5JO0A 3ZV4A 3L6CA 4Q9DA 4LXYA 1ESDA 4PO9A 3IEXA 2I2CA 1KFBB 2FEPA 1T9GR 2ATVA 3FKSD 3HA7A 3M2TA 3L84A 1L5GB 4MO2A 3S27A 3ABIA 4AF7A 2F7SA 3T5AA 4C29A 2ZVJA 1ZIXA 5F2KA 2XOKA 3W5CA 1F4PA 2P9FA 2RIRA 3DEAA 5GVRA 1HLGA 2O2JA 3MUOA 3X1KA 4K9NA 2G5TA 1EHCA 2MJLA 2O7NA 3PUXA 4YVFA 4CMCA 3SZLA 1XX6A 5IDXA 3QOFA 1ZA1A 1H8EA 2DFTA 5JY1A 4KJZA 1ZK0A 2A9OA 3WDLA 1B3RA 1NHGA 4ECAA 1X19A 2P62A 3OAAA 1Y9AA 1G21B 1JE0A 4TOIA 4ADSG 2W8BA 4HH0A 2KBEA 4YRRA 5HDBB 2O8FA 2X6QA 2B4TO 2NZWA 4KHZA 2YN4A 5A02A 1SD5A 3IYLW 1NQUA 2ZJOA 4EKYA 4D0SA 5LOVB 2W22A 4M53A 4GBJA 2BMWA 4IZ6A 2HREA 2JGNA 5AKXA 1Q0SA 1XKXA 1C0EA 2GD6A 3DO5A 4RTNA 2J6IA 3MEQA 4WOKA 3PQ2A 1WCIB 1DL5A 1WF3A 1IONA 1FPQA 2HK8A 4GG1A 1BZYA 1NF3A 4ENTA 2BEUA 1UKBA 3SBDA 5JNSA 4ZT6A 4R8LA 3UFXB 2OQIA 4D4GA 1AQJA 2PLWA 3EOZA 4DLXA 1LU9A 1Y8RA 3FX2A 4HATA 4M1YA 1U90A 3IQFA 3P2KA 3BE6A 4BWYA 3BZBA 2NG1A 4KXLA 1RE1A 4WY5A 5BV0A 1AKRA 1W44A 5CMLA 5FD8A 4IFIA 4KN9S 1MEJA 4DV1B 4V0QA 1XZGA 2HDWA 3C5EA 4EUNA 2PK3A 2C2OA 1PU2A 4QEKA 4CUJA 2ZJAA 3LLVA 5L51A 1NFFA 5DTMA 2WSSD 3K6JA 2RAPA 2WU0A 4D6YA 1UC4B 4LI3X 2XQKA 2IPNA 3ANLA 4D3FA 3DM5A 3SBOA 1GN9A 2JLQA 5FPTA 1NRJB 1NX9A 2QN9A 3UMVA 4KQXA 1ZYUA 3SN6A 3C3PA 1SVKA 4YDSA 3LY8A 3HKEB 4U7JA 1G60A 4MO9A 1SXQA 2JLWA 1E5LA 1NFQA 1ZEJA 4QAJA 2DTEA 4TL8A 2ROQA 2GCOA 3LHFA 1U4NA 3AHDA 3GJRA 2JFVA 3H04A 3K1AA 5CNIA 4JEHA 3U3RA 2R7KA 3VAAA 3ZGLA 1FNNA 2KX7A 2C54A 1ORTA 4N49A 2DPHA 4C1BA 4JP8A 1O58A 2VQDA 3K1ZA 2C2HA 1QE5A 4YK7A 4DDHA 3O84A 5AUOB 5J4HA 4I4TF 1JU4A 2UVDA 4RPIA 1M7GA 2EX1A 2NZ2A 4RZQA 2DFDA 4V39A 1VXOA 3RG2A 1SNYA 1AKNA 1QVAA 1I30A 2QLNA 3B38A 2X58A 2ZBEA 3AZQA 1QQ5A 3RVOA 3AEKB 2O2SA 1Q1BA 1I51A 4YCCA 3OZBA 5CYFA 1ZUIA 4LIPD 3BERA 4WBXC 1T2EA 1EVKA 4YJ3F 1LK5A 2PKRA 2CMKA 1NX6A 1B2LA 2YZ7A 4Q01A 1J7JA 3I5UA 3ZHZA 2WD7A 2XD4A 1H4VB 5FA6A 4EGCB 2YVUA 2Q6KA 4CIBA 2C0QA 3BC1A 5I7FA 4LBVA 4MS4A 1Q0LA 3LOPA 2O2HA 4F9EA 3FAKA 2UUAB 1DHRA 2CDNA 3N7TA 4ZV9A 5F4ZA 3TECE 1R6TA 3FNRA 4TWRA 2ZRFA 2W2TA 4RSMA 1OZAA 3N07A 1PL6A 4BUCA 3MELA 5FOSA 4CT4B 5HKKD 4D44A 5CXQA 2LKDA 2N46A 4P82A 1XFAA 4Y9DA 3A3PA 5JJKA 2CFCA 1WHTA 4RS4A 2WJYA 2WKRA 2XYQA 2QMOA 2I5PO 1Y4AE 2OMEA 1VGQA 4P5PA 2QL7A 4BDSA 4MWTA 4QD3A 1Q2XA 3NASA 2CSUA 1EB8A 4TLLB 3IODA 4IJ6A 3ROTA 3URKA 2P8JA 1ZUNA 3PNLA 3L6DA 3B1JA 3IO3A 3VKUA 4DG9A 1IVYA 3K53A 1U9IC 2DWQA 2ZUSA 2QLMA 4Q05A 3NEAA 4QEZA 4WLFA 5B4VA 4D9IA 5A6SA 2Q6OA 2H63A 3P45A 1IHUA 2RFLA 1E2FA 1O3YA 3TLJA 1H2HA 4TV8A 2WG2A 2NN3C 4C4PA 1X77A 4UUNA 5JD4A 2XITA 2QZZA 3JWEA 4UVDA 1RJEA 2PNJA 3VI4B 2I71A 4IWXA 1KY5A 3EARA 2BHNA 1EB9A 4DILA 5D3MB 3ZVLA 1VE3A 2ZAYA 4DS3A 4NDNE 1E96A 3CF6R 1NLMA 4BX2A 1P33A 4OXRA 4Q37A 3LQRA 1KRXA 2A30A 3H2HA 3NIWA 3PNKA 5U4XA 1XXHE 4XDYA 4JJAA 2C8VA 4FI3C 1ZAYA 2YWDA 3KZOA 1NC3A 2F2TA 4XEUA 3EOBI 5JXHA 1XO1A 1I9CA 4QQRA 2ZI7A 4TWAA 4X85A 3UCEA 3VDRA 3QK7A 3VV2A 3ZTWA 1Z15A 4NCIA 4ASUD 5IULC 1DWPA 3LI2A 1LY1A 5C7OO 1WB4A 2FUG1 2JI9A 2WJGA 3NYIA 1T1IA 5ESWA 3F2VA 3BORA 1GG5A 3VR3D 2CL5A 5ESRA 3CMMA 2I2BA 4PX2A 1IBMB 1TKBA 2CJYA 2JBAA 1Z0FA 3EGOA 3TTVA 1NN3A 4E94A 5H8WA 1XRPA 1N92A 1C9EA 1TVCA 3T1NA 4Z4HA 1W48A 1F6WA 3FPEA 1BSVA 4FS3A 5FPSA 4AY3A 1GD1O 1PR9A 3QJ5A 2PBLA 1QRSA 1KJJA 3WWEA 1CNFA 1AB6A 1IEVA 1OFIA 3QMVA 1K0FA 2R6R1 3G5TA 2FAXA 3AEUB 4FE7A 1M6EX 2FOIA 4FONA 1N8NA 1N0HA 4HC4A 4ED9A 1GL3A 2VUSA 4MRAA 3AB3A 4YJGA 3I8SA 4MWBA 2CHVA 3D4LA 1XAIA 4G1VA 2W6QA 4H77A 4B6SA 4OB8A 2GEBA 1JYFA 2QMUA 3GEPA 3U56A 3CLTC 5LQKA 3HDYA 4L9RA 3CVWA 1TYEB 1OKKD 4IDNA 3IKJA 5CB0A 2V0GA 1AUQA 4BEJA 4JIMA 3TOCA 1W19A 3GD7A 2VJMA 3Q11A 3MXOA 1FNBA 4TTTS 1I6LA 4NCBA 3Q3JB 4M88A 5KBYA 4NTZA 1GSIA 4XTRA 3UA4A 5EE9A 1A50B 5K3FA 3S7TA 1DEXA 3AH8A 2M1XA 4HB4A 4GLJA 4UEKA 3HZOA 3C5WP 3PFNA 1AH2A 1N2HA 4Q19A 2AMJA 1WNFA 3SOPA 4Y6RA 3GAFA 3OU6A 2J6BA 3UHJA 2RHCA 2H2AA 2P2DA 2JEOA 4R8RA 2CXRA 3DM9B 5CYPA 3SFZA 1T3HA 5JASA 2Q27A 2PY6A 3MGKA 3EVZA 4O2RA 2AI3A 1QG4A 2G7MC 4OUDA 3TKLA 3VR4D 1FLAA 4IIHA 4UD2A 5KAMA 3T0GA 2PV7A 2L18A 2UZ3A 2FG6C 2ZB2A 2GBLC 4J2OA 1EXMA 4H6XA 1EJBA 1S96A 1SBIA 1PS8A 1SG0A 2GAAA 3O8NA 4G9EA 1E9BA 3O4JA 2WC1A 5FH9A 3PB3A 4IIBA 9GPBA 5AW4A 3ZHUA 3JWJA 4MV4A 1RLMA 1M1YB 3EC1A 3VH1A 2AK2A 4GT1A 4LVUA 1UKCA 2X0DA 4Q1FA 3U3JA 5C5DA 3HVUA 4H0NA 2H1FA 3KR0A 4IWNA 2P6RA 2X15A 1GO2A 1HMYA 1D1QA 4Q9LA 3JY6A 2DHEA 3KJHA 2AN3A 1EFAA 1FS5A 4F3CA 3R7NA 5K6AA 4KR7A 2D0OB 5KPDA 1B1CA 5FTJA 3ZWKA 1ZSNA 4HQRA 4FNAA 1DKRA 3ONDA 4LGYA 3I9NA 4D6XA 1C30A 1WXDA 1J33A 2DFPA 4DLYA 3FY4A 3STHA 5IDWA 2RHTA 5LYJB 5E6UA 5DKFA 3DGFC 1QNFA 2WV9A 4K3VA 2A1UB 1C0IA 3KB2A 4WBNB 4UJ3A 5FDFA 4G0OA 2JEYA 4O8CA 4MUIA 1YRWA 4RVSA 4BECA 5KWVA 5DOZA 3J81A 4HNSA 5JVDB 1Y6FA 1V3TA 3A4VA 5ES3A 1N2OA 3ONEA 3OOJA 1Y1SA 4L28A 4WHMA 1ND5A 1Z4OA 3IOMA 4Q4CA 1VHQA 3ES9A 2C7PA 1PZFA 4JEIA 2PZEA 3HO6A 4DANA 1YZQA 3MWLA 3QHPA 4ZHQB 4GX2A 5D1HA 1XCGB 3ZZ1A 2W2QA 2FG5A 4B6EA 1V1MA 3ZHRA 5JHHB 1I4DD 1MX3A 3NCHA 2O0HA 1P5FA 3BWVA 3IGFA 5F3RA 1E5XA 2PE5A 1FMCA 2X22A 2WYIA 3KS9A 2JJYA 4RHFA 4KI0A 5HILA 3WOHA 4QQFA 2VCEA 3HRKA 3KLOA 4LZJA 2XUOA 4H08A 3QVGA 1WDTA 5KNDH 7ADHA 2AZTA 5GGXA 3OZIA 1D5WA 4HDSA 4LBYA 4WI1A 2J3LA 5FWXB 3ABRB 5JO9A 3TSOA 3R9XA 1QE3A 2FPXA 5E7MA 1PJZA 3INYA 4DDVA 5JOQA 4TS9A 2CFSA 2FDXA 1XZJA 1RADA 3RS8A 4GZLA 3JATB 2I7XA 3LCUA 2VUTA 1CLEA 4BKQA 3Q9LA 4Q1AA 4EA6A 3EW9A 2EZTA 1TZBA 5TE9A 2X3FA 2NXWA 3MCWA 3OZDA 1MRNA 4JR1A 4YJ3A 4CM5A 2X3YA 3NIDB 3QVJA 1IOWA 3QP9A 3ZXIA 5E8JA 3M4ZA 3M6IA 5DTJA 2VDVE 5F5LA 1C7RA 2D1SA 4WERA 5ELLA 4Z0NA 2YN2A 3IUJA 5HF9A 1BFUA 1QVWA 3FJYA 4WKNA 2ILTA 4G1CA 4P4SB 1E7WA 5G4KA 3QEAZ 3EH1A 2B2XA 3PXUA 4GVXA 2O50A 2V1UA 3IT1A 3IEVA 1RI2A 3IERA 1FFWA 1LNQA 4S04A 1UMKA 2OPBA 5CB4B 1XE3A 3B85A 3FHCB 3L1IA 2JGLA 4QHTA 1C41A 4QARA 1HE8B 4Z7OB 5KNBA 3TZHA 1W6RA 2HMSA 3IJ5A 4YV0A 2E3JA 1E3SA 3NTXA 4QPNA 4D4HA 3BHNA 1U8YA 1ODIA 2P9QA 3O7WA 4N3AA 4ZU6X 2VLIA 5I5EA 1JMYA 5JJLA 1UH5A 2OESA 3I5MA 3O03A 2WF8A 1M54A 3B8EA 5EWLB 3UWKA 1H9CA 1LJLA 2OEPA 5JD3A 5DLDA 4DV7B 2VXYA 4I1YA 1UT6A 1ZBDA 3MQ2A 4OQZA 4RV4A 4NICA 2V54A 1KSGA 4GRIA 1ACLA 3AMVA 3UCXA 4F4IA 5FI0B 3FOEC 4REQA 5G3YA 1Q22A 2VEDA 3PQFA 1RHKA 4IFBA 1YS4A 4L3WA 2JFNA 3GUYA 2HTFA 4EB3A 1MQ8B 2CLOB 2F55A 2HF2A 1MENA 1ISPA 2F3PA 1KY2A 2A8YA 4HQ0A 5CW2A 4BFTA 1UDXA 1LZKA 2NO6A 3N05A 4XRGA 3PHHA 2RCNA 5F1OA 4F2HA 4L2IB 2IXGA 2XT9A 5I4BA 4OXKA 4PYKA 4I66A 4PS1A 3BYZA 3GW8A 4Y7DA 1YKSA 3UJ8A 1EWRA 2P5TB 5TR9A 4BN4A 4CM1A 4GO1A 4R84A 3O95A 1T4BA 1ZUD1 4D1YA 2XJ9A 3R2JA 1PN3A 4BMPB 3K9FC 4QXRA 1DIBA 1DX9A 4R31A 1L7OA 2ARKA 4B6JA 4DB4A 1E59A 1NMXA 5HBGA 4WJLA 2HYIC 4ZCPA 1CUJA 1U5BA 4ENWA 4YJFB 4CKEB 2FI1A 3WKEA 1RWXA 3VQTA 1IZZA 1MV8A 2MSCB 4CN8A 2ORIA 2AEJA 3DQQA 3OIWA 5AIBA 1XFDA 1VA4A 3CUKA 3T4EA 4BO3A 4BLQA 4QT0A 1FXSA 4II2A 4I3HA 4X54A 1JQJC 3PDWA 1H1TA 3PTLA 3I9OA 3RO7A 5LD2C 4H31A 5DFAA 4B73A 4KQWA 1BMTA 2TMKA 3M1LA 1RP1A 2CNLA 3C1TA 4HEA1 4UMFA 5HIMA 1G66A 4EF4A 2Y1WA 4AKGA 3QV2A 1PX0A 3P20A 5AR1A 4DV0B 5HQJA 4ZQCB 3BB3A 2A0UA 4KQGA 3ITEA 1Y7PA 3IAM6 1G8AA 4D9BA 3D7RA 1TYCA 2VSOA 2ZJ8A 4IM7A 4MKFA 1KFJB 3Q8WA 2HF8A 3WRVA 2ONYA 4MUNA 4YDQA 3AOGA 1KYZA 2AQIA 3OA0A 1VC2A 4BWGA 1ZCFA 3ONNA 1XKLA 3FCEA 3A6EA 3PNBA 2HPZA 3AFOA 4WOJA 3MJDA 5EYPA 1R88A 3AOEC 1V4NA 2QG4A 4GOLD 1VA5A 3H4TA 4LWOA 4WUTA 5TQ0A 4Z7NB 4O3MA 4QZVA 1FW6A 5J59A 4ZZ3A 4TPKA 1UXGA 4FWTA 4GBMA 2FMXA 1SCNE 4MR9A 2YMPA 4DRYA 2IEAA 3RHFA 2P65A 5KJFA 3LO8A 4RVCA 2R9VA 4BVGA 3P8ZA 1ZHOA 1W1WA 5CG2A 1DDIA 1HRDA 4OHKA 1GL7A 3B1KA 2KLBA 2QN3A 1FCJA 3MT0A 1ZDMA 3F6SA 4HHEA 5F1YA 5J3JA 5EYPB 1D4ZA 2A33A 2IPXA 3R6GA 5AHOA 3SF8B 4G0MA 3VU9B 5L7TA 3W7VA 2Z8YA 2FPIB 5DK6A 1CHNA 3E7XA 3C5CA 4TV8B 1EVJA 1LLFA 3V4FA 3W7BA 4DHEA 4DPKA 5L45A 5CNKA 3CH5A 2R6DA 1BN7A 3PIDA 1DJQA 3GGJA 4NOLA 1UMBA 1RLJA 2QVCA 2WSLA 4IHJF 1XUOA 1G6OA 3VTZA 4JOBA 1NOIA 2YASA 4U5QA 3OPYB 4AZ3A 1J0CA 1XKQA 1CP2A 3RTGA 1D8AA 1VP9A 3BN3A 3ZOZA 1W4CA 4BNVA 2C2KA 2L42A 1Z4IA 1CRQA 4TRJA 2A5JA 2XSZD 1Y5IA 3EGWA 4MQMA 2JH9A 4C01A 2RC5A 1WHSB 1JWBB 4XW2A 4F1KA 2RHBA 4QUIA 3HL4A 3OZTA 4RFSA 4ZVUA 3TKYA 2B8WA 4CG0A 5K0ZA 4XR4A 1MP0A 3WKBA 1DC5A 3L41A 2WWFA 4DDWA 2UYHA 1PL8A 4CTMA 3NM5A 3C7CB 4LF9B 2O5CA 3SFVA 4RPJA 3ZCTA 1KZ6A 4GKJB 4R2HA 1TECE 3STXA 2IYRA 4OYYA 2R25B 5JZ9A 4W5QA 3VYWA 2W6IA 1ODTC 3I05A 1X9GA 4RA6B 1AXEA 3GGDA 4K2AA 3FVTA 3WL4A 1CFZA 1E4EB 4NAVA 1OYYA 3G0OA 1GGMA 5LCXA 4EITA 6Q21A 1KFCB 5DGDA 1QFYA 4KH0A 3IAAA 2WMDA 4UBMA 3R8XA 3A6HA 2Y4OA 1TL7C 2GUWA 4TUYF 4G0WA 4XYGA 2AL7A 2JIDA 4O3FA 4WNAB 1OLUA 1RMYA 1E0KA 4XOIA 4DZTA 1W4ZA 1YB2A 1CTQA 2JD1A 2QTAA 3GGPA 4GDMA 2OECA 2FF5A 2OTCA 1Z3CA 1IAVA 1PHPA 2W6OA 2IU3A 2YBDA 5AW5A 4EI7A 1BJRE 3OCUA 3EMKA 2C58A 4MCIA 5F2EA 2Z95A 2HAEA 3ZHXA 4F4FA 4H6WA 5JADA 3BQ9A 4WW0A 1C3OB 1ORIA 4IMJB 4GBGA 4PQGA 1LSSA 5FTLA 1J8FA 4ZK2A 3UPTA 4NONA 2J85A 2P78A 4GPZA 1P4GA 2RGNC 3EQZA 4MQ6A 4GQBA 1L5HA 4GMFA 4P83A 3B3QA 4DDUA 3MW8A 2C84A 1MAHA 1U2EA 2CDAA 2XRFA 3OQMA 2IOFA 3NBZC 4NJMA 4OHXA 4PLYA 4R8MA 4RF2A 5AXBA 1OYVA 1W2GA 3IDQA 4BVJA 5TQJA 2I6UA 2PNFA 2COUA 1U1IA 2ZJFA 3CKKA 4CI0B 1PQ4A 4XFJA 5GONF 1FFBA 2ENUA 1ISGA 2YXDA 4IWYA 1EP2B 4WN9A 3UK2A 1F9AA 2H31A 2OA0A 3TQTA 2X40A 3I9LA 4HAZA 3FW1A 3G1UA 3IRVA 4F93B 5IN4A 2W6NA 5AVOA 3VPCA 5KOJA 1USGA 2E21A 2ID7A 3N0XA 5IT5A 4GWKA 4NX2A 1P2BA 4KFCA 1NQVA 5AYVA 1AKWA 1RXYA 5TIIA 5IF3A 4XIJA 8ABPA 5BW4A 3DCIA 1SUIA 1GKKA 5K6RA 2VJQA 1O6BA 1JQEA 1L3BA 4W9NC 1U31A 3QWHA 3W8DA 1VKOA 3PX7A 1UXIA 3CZRA 2OD7A 2OGWA 1HV8A 3B1FA 3M33A 4MI9A 2G6BA 5DBIA 3SEFA 4QICA 3V8EA 2R5NA 3JTEA 3OZXA 4U4AA 1XCMA 4RVHA 3D3QA 3NTVA 1NKTA 3TAUA 3PYMA 1JBQA 1YQWA 2I4NA 1NBAA 2Q3HA 2B34A 5HTKA 1YVUA 4GYYA 4BJ6A 3FNQA 1FQOA 1U3FA 3SZ3A 4C76A 5CG1A 3UJHA 3JATA 3M4YA 4UCWA 4XD7A 3WK7A 1N0WA 2QMQA 3LE8A 4FNOA 2O7RA 1G21A 2X86A 3DVRX 2ETVA 4HDMA 4ARIA 5IBPA 1J09A 2IZ0A 3AI7A 1TNDA 4KQIA 3RH0A 4Q7MB 5C37A 3C87A 3GFOA 4JX9A 1O96B 3IXMA 1AS0A 4NESA 1AZTA 5LMUB 1NURA 4LJ8A 4ISBA 5WRFA 1MO2A 2CHEA 3EEFA 3EBOA 3KQNA 1K08A 4YDRA 5REQA 4YMLA 3LWZA 4KO3S 4XX0A 3L3BA 2WZDA 4MGEA 3RCBA 4CM4A 1THMA 4DL9A 2PRSA 4TTQA 4C0KA 1CZUA 4FSXA 3V2HA 1E7YA 2QTMA 2JLCA 4INAA 5DNUA 1OMOA 4KAXA 2HF7A 4BVFA 1ZXXA 4JEUA 3GQBB 1R64A 1KI6B 1WLSA 4D6PA 4LRUA 4RL4A 4FMDB 1MHPA 1BG6A 2I4MA 4X3OA 1ZEMA 2HJHA 1C7EA 1CQJA 2FWRA 1I2ZA 4L85A 1XK7A 5B58T 5MHTA 1GPAA 2OBLA 4G81A 2OLKA 4PZYA 2VJOA 2YRWA 4YCNA 1GSHA 2EAUA 1RPZA 4QJ3A 5JZOA 2Q46A 3MWDA 1QTQA 1GPKA 2C94A 3HFGA 3W9UA 2O0JA 1TCVA 1G64A 4HZUA 5DNWA 4B87A 1N6NA 3BGSA 1KPHA 4L15A 3REOA 4WK4B 1U8ZA 4X1IB 1NR1A 5D2CA 1HE2A 3CINA 1BMQA 2QU8A 2VOEA 4M89A 3ANXA 3ZU3A 3OIGA 3IP8A 3FTNA 2ZIUB 2W4IA 1VYTA 2REOA 1YBVA 1TQHA 4HLNA 1LH0A 1ESZA 3DR5A 3MT8A 5IM4A 4MRMB 1EVZA 3PNYA 4Q1BA 5M2QA 2GXQA 3DZDA 4HQLA 4GLOA 4NFSA 4GP6A 1L7MA 3A37A 1T3LA 1WQ1R 4RMHA 4UCFA 1QB7A 2WPDD 5CAEB 1NAHA 2YFHA 2YV2A 3R9KA 3AKZA 3OJOA 2WOOA 1RW4A 2IHTA 2L19A 2R8PA 2GEJA 1ISHA 3REQA 2E0IA 1LDMA 1Z16A 1FYEA 2D4AA 4FNMA 4J0HA 1Z29A 2E6KA 3CT4A 4PYIA 3GEGA 4WCVA 4BLSA 5EJ8A 2RMKA 3HM2A 4MDEA 3SMVA 3U6BA 3BMCB 4OV6B 4D80A 2FFQA 1R6DA 2IY7A 2B0JA 1YTUA 2AG6A 3F1LA 4RIFA 4G9GA 4L0QA 5J5AA 1ZJJA 4ENSA 4W99A 4FCTA 1V71A 1XA0A 2OSBA 3TLGA 1USIA 4DADA 5CLFA 4PQFA 3UG7A 4UUOA 2FPWA 3CW8X 3DW1X 4QA9A 4LECA 5JZVA 4PX5A 3BT7A 1KPGA 3PCXA 1WPGA 1YZNA 2HIGA 1YRAA 2Y9PB 3H7IA 5KNDD 1U7PA 2E4AA 4JJKA 4HEQA 5BOVA 3LQ2A 1ZUHA 4M1KA 5HM8A 2W48A 3S1LA 3D6AA 1MDFA 1G42A 4FW9A 1RHRA 2DKNA 5I9SA 3L1UA 4X1IA 4UPDA 1IY9A 3T1YB 4QUHA 2Q4TA 5IS2A 4EO7A 1JDBB 4D4JA 4FEAA 5ALYA 3QIAA 3D5EA 2IITA 5LLTA 2C42A 5CLLA 1QYIA 4AYWA 4YQEA 1X7YB 1JG6A 4ENQA 1K8XB 2PMKA 4NYMR 2DWOA 1S2NA 3QOYA 2ID8A 3S5JA 3FPSA 2G28A 1V7CA 4J07A 4W5WA 3OTGA 4BFUA 2PGIA 4MVWA 4R0NA 5EUMA 3PUKA 1PFYA 1HO3A 2I4RA 2EXXA 3AL2A 3ENWA 4AF6A 3GLFB 3VR4A 2XODA 1KH1A 2P8SA 1Z12A 3DE3X 5EMJA 1ZMOA 2ZIEA 5HZMA 1N77A 5IKXA 4PTLA 2V7PA 5K0EA 3AEXA 2FW0A 3FVWA 5IKMA 1P9NA 2XHZA 3A0UA 1THGA 3ZWAA 5LU9A 1XTIA 4RK4A 1FX0A 2IYNA 3PXGA 3RRYA 3IQZA 3T4UA 4JYAB 4MR8B 4QSMA 1XTPA 1XOIA 3FFAA 3DUFB 3NM6B 5CDHA 5FA5A 3UAZA 1KO8A 4AL4A 1PR2A 1FUUA 3ICPA 3EAGA 4GYWA 4TSFA 5G1PA 1YJXA 3FE2A 3BICA 1V37A 3EW7A 2PBRA 3L01A 1JLKA 3LBNA 4LBWA 4G4SP 1BQEA 3OZVA 4C6RA 1S7GA 3LVQE 2OFWA 2QD5A 3D6MA 3EFEA 3IUYA 1NVBA 1GU0A 2VDQB 1QSGA 3GNLA 1C1XB 3NHPA 3N8GA 1HTTA 2EJTA 4J0QA 4MUEA 4ZRNA 3VAYA 4DRXA 5ITZA 4RD3A 1TCUA 3KYIB 3DE5X 4ZQIA 2FWPA 4MRRA 4Q16A 3ZWOA 3PLAE 1H42A 1K6XA 3DR3A 2M6KA 2ZBGA 3K4PA 5U9CA 1RI3A 4XSHA 4D99A 1XP8A 4FGJA 3OMWA 1YVPA 2Q1TA 3LZCA 4D98A 1R10A 4ZHSA 4RWEA 1JR6A 2A9QA 3TUZC 4B33A 2JH3A 3Q2KA 3LVBA 1KQ3A 2ORYA 4EHDA 2VRBA 1HY3A 4G8JA 4LV5B 5UKDA 4A0GA 3K9BA 5EP1A 4E11A 1R9GA 1J5PA 1J23A 3IV7A 4WH0A 5CXSA 3VNAA 3AXTA 4CN9A 2O3JA 4ENVA 3BSFA 2WOJA 1KAGA 2UYOA 4O4JB 4YCBA 2NUAB 4O5AA 4UTVA 3IQDB 3LH5A 3TCKA 3ZKWB 1T9GS 4R3UC 5LQSA 4BEBA 2NU6B 3PJGA 3W8FA 2GQ0A 1ZRMA 4BNMA 4U39A 3RSHA 5AXCA 4K9LA 1T1RA 2IU0A 5CVUA 5LKAA 1VL0A 4K8RB 2OBYA 3F4BA 3F3MA 3CRZA 3H11A 3LAWA 5SZKB 2GPNA 2NLOA 2VP2A 3OLCX 3USCS 3TNYA 4IEEA 2GZMA 2ID9A 1JIIA 1N0UA 4KIFA 2V58A 4S0XA 1JIKA 4TRRA 2X5OA 4HK4A 3KG2A 4RQBA 1EP3B 2YJ3A 4WJZA 2PL3A 2Y1OA 1I80A 2YYSA 4Y8VA 3PR2B 1GJRA 3L7BA 3ZDZB 4DLVA 4HH1A 3OO0A 3HP1A 3ND7A 1GSOA 1RAAA 3ENNA 5EJ9A 2DLCX 3LWDA 1P9WA 5HKBA 1C9MA 3RS9A 1WZCA 3RKUA 4C0XA 3V4VB 5KSZA 4HH3C 4HX9A 4NCXA 3HM9A 1DKUA 2I7VA 2WKPA 2YHUA 5B30A 4YPVA 3BJEA 4A2CA 4DN6A 5JAZA 1QU2A 3HJBA 4QNNA 3V00A 1PK7A 2C3UA 4QUAA 5A3VA 5FKJA 2XAUA 5JE8A 5K03A 2Q28A 3L6RA 5AI8A 3BA1A 3SGLA 2QVGA 1VBNA 3C45A 2VBIA 2NZJA 1KGSA 1MEOA 1ZLYA 1T0UA 4Q34A 2B7CA 4RMGA 1RWQA 2WNIA 1XJ0A 4GPTA 3TX2A 3ROEA 1TVEA 2FLKA 4IV0A 4OLHA 1H2YA 2VS1A 3C3DA 4RLSA 1UXJA 2GSWA 2JZNA 3CH6A 3ICWA 2Y1LA 3PNMA 3VNQA 1JDZA 2J30A 1EUDA 1Z5PA 5E1OA 1HH4A 1ZHHA 4HAYA 1QH9A 4UUMA 3TINA 3PFIA 3AJRA 1W85A 1Y6ZA 4JYMA 2WIDA 4URZR 5SYNA 1GG2A 4AFNA 1DDOA 3PS9A 3NYRA 3QY9A 1A9QA 1RWOA 2AF4C 3CRVA 121PA 3GBVA 5EMNA 3WL6A 2IDJA 4LXGA 2RGYA 1L5SA 3PEVA 1U04A 3EXFB 3R5KA 3VU8A 2PKWA 5TSDA 1IUPA 1D0IA 3O2NA 3C4QA 1E4OA 1SHJA 2XJ4A 3V8BA 4DWVA 2R97A 3OI7A 3WNDA 1EZ1A 5LDGA 3RRXA 4XSGA 4V0SA 2NTNA 1WMSA 1KY3A 4XEHA 2V6FA 4XSVA 4TMTA 4NU8X 2L69A 3RI3A 1ZMRA 3KR9A 4AMGA 1Q15A 1XRRA 2R11A 2YWBA 4IQFA 8ATCA 1AX9A 1V3QE 1I3OA 3HB7A 1HDIA 3P9IA 2VHZA 4DLWA 5IABA 5KYGA 3WLIA 5KTTA 3RS5A 3A1UA 5C3UA 1XCPA 2VUIB 5GZ3A 4MX8A 3ENZA 2OUIA 2QT9A 1CETA 1A9RA 3ZU4A 1W5EA 1HFJA 1ZRHA 5ED0A 5G53C 1RXEA 2I6SA 3N0WA 2WVHA 2X8AA 4DSNA 2N42A 2XVAA 3NEJA 4QEDA 5H9VA 5B1SA 2R1TA 5D7NA 2AMVA 2HA2A 4YROA 3RNOA 3HN7A 3N2LA 3S29A 3NBAA 4DNFA 3WA7A 4YLYA 4MB2A 1BKYA 8MHTA 1TQ4A 2FP4A 2WV7A 5BSWA 3NFRA 4HD8A 5LR6A 1Y42X 4IH1A 3CHYA 2DMRA 2Z1NA 1VJ0A 2G76A 1S9DA 3C5HA 1TM1E 1NM5C 3R3XA 1L4BA 5TGTA 5CIQA 1YDMA 3TNDA 1DJNA 3IVGA 5FBHA 4MRMA 2REBA 1SG9A 4CGYA 3CUYA 2H5EA 4PXAA 4NYIQ 3C6BA 4M1MA 3W5SA 2CHQA 2AMYA 2E4ZA 5JDCA 1TQDA 1EAYA 4NZNA 4BLTA 1Z5VA 3BXZA 1FFXB 4TRMA 1Q1NA 3AUKA 3PWTA 1EVYA 3TW4A 4EABA 5DRTA 2FPPB 1U3GA 5JECA 1QXSA 3LX8A 4MGZR 1FE8A 2AEFA 4D43A 4YY3B 3FCYA 4DA6A 3K0AB 3FVQA 1U81A 4V1CI 5HW0A 1J9EA 3LF1A 3P5BA 1U0FA 1G1MA 4G5YA 1S3SA 3BE5A 3DTVA 3GIWA 1PR0A 3FTDA 2GDZA 1AQLA 1W0JA 2XBLA 3QZUA 4A27A 3UGJA 2REQA 4BNDA 2G36A 1DBPA 1FFHA 1XSEA 2CUKA 2HZBA 2YV5A 4FYHA 4IOJA 4IXWA 2AIRA 3WLKX 4B48A 1LLQA 1DAFA 2QLFA 5DISB 2O2YA 1Y4SA 1JJ7A 4R6WA 3WYAA 1S5PA 3VR6A 2Q1SA 1MVOA 4XUGB 3IE1A 3R9WA 1Q95A 1ONBA 1OGIA 3OZFA 2BGMA 1QIGA 3MTGA 3C3YA 2GD2A 1RYMA 3A3YA 2B78A 4CQMA 1KI3A 2JVKA 1BX1A 3IP3A 1BROA 5F77A 2ATXA 5L8VA 4WY8A 3GVPA 4AN4A 4GRDA 2WJWA 3BDAA 1VRWA 3KJQA 2H00A 3TLGB 1N2JA 1AKUA 3I1JA 4H1TA 4MCAA 1KI8A 3FPCA 3L8ZA 3QXCA 4D4IA 1D2GA 2QRUA 1A95A 2YY5A 4RYDA 1RP7A 4ZK6A 5KVVA 4OHRA 1SWVA 1X70A 1XN4A 3MUFA 1OVGA 1LTKA 4JN6B 2FEMA 2ZUWA 3FSJX 3N2GA 3OTWA 2PMWB 1FUKA 4E51A 3KJEA 2W6JD 4RK1A 5GY7A 3GEIA 1N2CE 4K6GA 4WA7A 4A8JB 4O1HA 4OI2A 2QQGA 2XNDD 3D7SA 5ER6A 4HPJB 2AH5A 1TUBA 4EG0A 1G20A 4ER6A 1CUYA 1GTL1 3NHZA 1N9ZA 3ND9A 4TLBA 5IAEA 2ZSJA 4PN7A 1N9GB 5J9FA 1Z3IX 2ZP1A 5U4QA 5ER9A 3SFTA 4FNGA 4BNZA 2ZB7A 3B1YA 2CWDA 2EJUA 4FDMA 1XZPA 2FQYA 5D84A 3M4JA 4CF5A 2A7XA 2V6GA 4IQGA 4KWCA 5TT1A 2XTNA 4GI1A 4W4TA 5ERGB 3IVCA 1V8ZA 2XF2A 4RCVA 3RVKA 3FOWA 3X44A 4YRMA 2JGKA 3BXOA 5EIAA 3I1FA 1NPYA 1DBSA 5KOJB 4EG5A 3UJCA 3V3TA 2XNCA 3T06B 5DX8A 3LYHA 5JSYA 2FQ1A 4RELA 3UGKA 5KOHA 2EW8A 2R5WA 4NU5A 4RVNA 3FF4A 5JNUA 5BSTA 2Y68A 3N8NA 1PE0A 4KMRA 4OHWA 1M2WA 2XVYA 4A5SA 4AN0A 4AROA 4GWLA 4GEKA 1EDDA 1ICEA 1U9IA 2IP4A 2K6GA 3K0BA 5A4DA 1QOPB 2GHTA 3DH0A 2ZVQX 1QPZA 1SFRA 3A3OA 3C14C