1W2HA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with azidothymidine monophosphate (azt-mp) (2.0 a resolution)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
190
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Mycobacterium tuberculosis thymidylate kinase in complex with 3'-azidodeoxythymidine monophosphate suggests a mechanism for competitive inhibition.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE TMK
total genus 73
structure length 190
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w2hA00
3MSXA 2FOLA 3FB4A 2ZYWX 3R7WA 2G3YA 3NC1C 4HAWA 1DS6A 1N0VC 3D8BA 4OHXA 4GI7A 2ZUDA 5C4MA 3TLXA 4OI2A 5TV2A 4RD1A 3U4QA 3FKQA 4DB4A 3BD9A 5FOVA 2LCFA 3KL4A 4POAA 2QSZA 4MGIR 1GZSA 3BB1A 1M34E 2ZXUA 1UKVY 3RS4A 2QPOA 1W47A 2KJQA 4GBMA 1NIJA 2G6BA 1GAJA 1Q12A 3QVUA 1OT3A 2YOGA 2IS4A 3ZVRA 3PUYA 1KI9A 2V54A 3AVTA 4ZKEA 5KPJA 1A5TA 4I1VA 2CCGA 3MGCA 3P4XA 4A0FA 2ZE6A 4LHYA 4XOIA 5FUWA 1MT0A 4IDNA 3I5XA 3I4LA 4CEIB 4EUNA 2GZDA 4KCGA 3WXMA 1G1MA 4E5UA 3F3YA 1GL6A 4KFSA 4Q7KA 4WZBE 4EJSC 3GD7A 5AUNB 1KI1A 4EPTA 4NYMR 1F2UA 1XTSA 1LS6A 1W48A 4D25A 4BEBA 1T8TA 5JJLA 1K6MA 5AK0A 3E1SA 4R9UC 3C41J 3CM0A 2ZYTX 1W2HA 1U8YA 1E9RA 3EZ2A 2CL0X 4DLWA 2CXXA 3CR8A 1OV4A 1NLZA 1RYHA 1ZUIA 2Y8EA 4ON9A 1EFTA 2IL1A 4R2HA 5HZHA 1KMQA 3EIHA 5EXPA 3CRRA 2D7CA 2BCJQ 2W6IA 2G1KA 2W6JA 2IBMA 3AV0B 4RKEA 4JLOA 2ODWA 1TX4B 1NJFA 4WVFA 1IONA 2O8EA 4NYMQ 4BFZA 3L8YA 2VHCA 4EQ6B 1KO7A 3PCRB 4RFVA 1W44A 4PFSA 2PBRA 2PEZA 4TMTA 4DCUA 4JLAA 2AK3A 3QEOA 3LLUA 2C04A 2G9NA 2AWOA 2OM2A 1QHSA 3NHBA 1DAFA 3Q5DA 1XJ0A 2GXAA 2A5DA 2H92A 4TYPA 5CIWA 3UXMA 1FP7A 4KVAA 3VR4A 3F8TA 3TVDA 5JEEA 4D26A 2D74A 1NVXQ 2WWYA 2GTPA 1AM4D 1YJ5A 3W34A 1CBUA 2GAOA 4AKHA 3K9NA 4AG6A 1BKDR 3M1IA 2ZRLA 1H8HD 3ZYCA 2GKSA 2MSDB 4D0LB 2N42A 3E2IA 3I8SA 4RKFA 4ZDJA 3Q85A 5KNCA 3HR8A 5KSPA 1P9WA 3GMTA 4UNSA 1VCMA 4B47A 3A6PC 1GNQA 3IO3A 2J3EA 5SZIA 3GJ6A 3Q9LA 4QNMA 2J46A 1D6JA 1T5IA 5FBRB 2KE5A 1G16A 4M1YA 4OK5A 2NPIA 3A1TA 3ZLJA 2XJ4A 1YRAA 3MMPA 5HCNA 621PA 2CLDX 4GMXA 2C5LA 4BLOA 1P5ZB 4AG5A 3BBPA 1R0ZA 4YMWA 6Q21A 2VF8A 3QKSA 3QPVA 4LJ7A 2RHDA 3HPQA 1VYVA 1R5NA 1BH2A 3SFVA 3QKRB 1KMHB 4N1AA 3K0CA 2J0UB 4JL8A 3RABA 2BKUA 3RAPR 1KY3A 4AKEA 1NG9A 2P6RA 1NKTA 2KB0A 3PEVA 3PXGA 4A0GA 3MD0A 4ZIRB 2C9CA 2J7PA 3RS7A 4EFNA 1I2MA 3LBNA 2PT7A 3WMGA 4MDFA 3T15A 3M6AA 4LGMA 1TQDA 2IYVA 5D3QA 2QAJA 4A2WA 2J0QA 1KI2A 1WBDA 3TGPA 2EFCB 2O8DB 3RSOA 5DSZA 3K0AB 5KTYA 4Z8XA 3N2IA 3K8YA 4LY6A 3KDSE 2C9OA 4V0LA 1LB1B 4AY2A 1X8KA 3MWJA 5JJKA 3E70C 1RC8A 3TSWA 4G5OA 2R2AA 5BXQC 4KVGA 4RZUA 4A0RA 1H65A 4NYJR 2CCJA 3ZDQA 3U61B 3W5JA 3REGA 3MG9A 2W0MA 2NO9A 2F7SA 3Q72A 4PR0A 1BMFD 1BO6A 4V0MA 3B1VA 2FX3A 2PL3A 5A4JA 1F3OA 4G01B 1ELOA 1Z06A 1N25A 2RAPA 2JASA 4IJMA 4ZCMA 2O8BA 2FH5B 4HUQA 3B85A 1R7RA 4MRRA 3ZVLA 5E7IA 1XCPA 4V0KA 5LPNA 1T5LA 4FMCF 1EG7A 3DZ8A 3QE0A 3RRYA 3HR7A 1XTJA 2BM0A 2WWHA 3IDQA 3RANA 1EWQA 1UKYA 2Q9AA 4PQYA 2WAYA 2QGNA 4CEJA 2WOOA 4PZZA 3KXKA 4X8MA 5FPSA 1TF5A 1KOFA 5C2JB 2YVUA 4PPNA 1T9HA 1G8HA 4US0R 5KSZA 2DR3A 1DELA 2O5VA 1TF7A 1M1YE 3QF7A 1B23P 3H84A 1E0AA 4NYIQ 2J59A 4HAUA 2IK8A 3SS8A 5EQTA 1B0UA 2CCKA 2YC4C 1OHHD 4GP7A 3NXSA 4IOKA 2YJTD 1KSFX 3GLIE 2D62A 4BLTA 3IPXA 1NBME 4JLMA 1ZD8A 4EPWA 5KHOC 2V9PA 1KO4A 1OW3B 1ZJ6A 2D3WA 4BFXA 1AS2A 3O8CA 1G21E 3WBJA 4NZYA 5EUQB 1Q1ZA 5TB5A 1JR6A 2XZLA 1KSJA 1G3RA 2VP2A 2WPDA 4NMMA 5AJYA 2CHGA 5G41A 4TLEA 3TAUA 5AJVB 1QHXA 1KNXA 1II9A 1KJYA 1NBMD 2B92A 3I61A 2VPPA 4TYYA 1Z6AA 2B7CA 4F4CA 5DI3B 4IRUB 2F6RA 3LQRA 4Q21A 1HY3A 1Q44A 1NVWQ 4HDOB 4JLDA 2WPDD 5JHGB 2C99A 1SXJD 4P4TA 2AFHE 5AWFC 2FPKA 5LD2C 2YYZA 2CL7X 3ZJYA 2VP5A 1Z08A 2BMEA 4IDHA 1RKBA 3GFTA 1CXZA 2C9YA 5EP4A 1UPTA 1WMSA 1KZ7B 3FFBA 3R9IA 2Q3MA 2QA5A 521PA 2BKEA 4FMCB 4MYHA 2GK7A 3L0OA 4CEHA 5K8IA 1YZNA 3EZFA 2A2ZA 2W6JD 3IGFA 3IKJA 1G3IA 3FTQA 1KO5A 2QORA 3SYNA 3VHXA 3UWKA 2BCGY 4I81A 4OQNA 4LYFA 4KSBA 2QTHA 3NBXX 1U9IA 4LJ9A 5FBQB 3B1WA 1W1WA 1W49A 1Z6YA 2G1JA 2OBMA 2PT5A 4K8OA 4F4JA 4XD7A 1S9HA 1VHLA 4LI0A 1XMIA 3BFXA 3RSLA 2EFDB 2J9RA 4BFUA 1NNEA 4NHOA 2DFKB 4QL3A 2W00A 2QUZA 2IS6A 1FUKA 1XEWY 4B73A 3THOA 1VIYA 2HJGA 2R6AA 1FMJA 4DCSA 4CEIA 5P21A 3EZ9A 3RS0A 4JBYA 1A4RA 1BOFA 4TQAA 1GITA 4WZ6A 2EYUA 2O8CA 1NY6A 4LCBA 3KQHA 3TUJC 4NE2A 2VP0A 4AYTA 3CRQA 4LJAA 2PZFA 2ZE5A 5EUMA 4BFWA 5FL7A 3B60A 4Q03A 2ONJA 3U44B 4KFUA 4ZIRA 2WSSD 3ADCA 1OYWA 1XCMA 1TQ2A 4OHZA 1XEFA 3KQKA 1RZ3A 1IAQA 1Q1EA 3T5DA 3ZS8A 3CRMA 3BFVA 3FMOB 4W7SA 3W9YA 1T3LA 1KDOA 4DEXA 1WA5A 5JS7A 4ZPXA 3A58B 3NWJA 3UMSA 2ZITA 3T35A 1U0HC 1DBSA 2ORVA 3FHCB 4ARZB 1ZINA 3WP1B 3U2QA 3TK1A 2P67A 4LJ6A 3VX4A 3CB4A 1CTQA 3W6OA 4ZKDA 2OFOA 3GCGA 4EJSB 1T91A 2V7QA 3CX6A 2KWIA 2A3RA 2Q21A 3S1AA 3LY5A 2CDNA 4Q1AA 1UADA 4UJ5A 3EXAA 2IHYA 3QF4B 5SZJA 4NCHA 2JCSA 1OFHA 3UWOA 3BFKA 4XVQA 4Q4JA 4DKXA 1W5TA 1SXJC 1VECA 3EW9A 3OEEA 3W90A 4YC7A 2X2EA 4YONB 4B3BA 1GWNA 3CF6R 4MITA 2Q3HA 1FNNA 2OUKA 1G7SA 4MQBA 3SHWA 4NCJA 4P4UA 2QP4A 4JT2A 1R6BX 3IEVA 5AUPB 1P9NA 2QTVB 1OXVA 3C15C 1TNDA 1CR0A 4OJQA 1UBFA 1Y63A 4A1FA 2QT1A 1Q0UA 4JBXA 4Z1MA 1XTIA 1JNYA 2QEQA 4AI6A 3X1DA 2RKOA 3TQFA 2QAGA 1P6XA 1G18A 1Z07A 2BM1A 2B8TA 1RJ9B 2GA8A 2H17A 3LO5A 1BYIA 4LRWA 2BEJA 1JI0A 3K0EA 1P2UA 3IIJA 3C8UA 4RZ2A 1JAHA 4YXWD 4YDHB 1OXXK 2FEMA 3AGPA 1P4SA 2ZR0A 2FZ4A 3U3JA 4JZKA 3GLHB 3AVQA 1KSGA 2FFHA 1KHTA 1ZM2A 3B9QA 1IY1A 2O8FB 3QF4A 3B1XA 5EP1A 4CVNA 2OFWA 3QPUA 1L8QA 4LHWA 2XJ9A 3TAHA 4GOXA 1NKSA 4BQSA 1VG1A 4ITRC 4P3YA 5A5GA 4PX9A 2ZI5A 4LUCA 2WJIA 1PLKA 3K09C 3EZ6A 4PXAA 2FN4A 1M7GA 4PHTA 3VHLB 3V00A 2JLVA 1UDWA 2R8RA 4DRZA 4Q66C 4TT3D 4I99A 1TF2A 1YE8A 4NU0A 5H8WA 4HATA 2XZOA 2E1RA 4AK9A 4OK6A 2IYLD 2H16A 4B2LA 1X1RA 4OI1A 2IUUA 1NMZA 1UBGA 5JSZB 2IEZA 4MGYR 2XX3A 4US2R 1G9XA 2HT6A 1A2KC 1E0KA 2G83A 1W7AA 2VSOA 1ODFA 2ZI3A 2HXSA 4W9MC 2ZRKA 2QG6A 4B48A 4BFYA 2I1VB 4AWXA 1NLYA 3TMKA 3CONA 4ERNA 1IXSB 3NBZC 1I4DD 2EU8A 2Z43A 2GESA 4DCNA 4ABYA 3BAFA 3CRW1 3TKLA 3KB2A 4C0HA 3T1TA 2F55A 4LC1A 5TVKA 2HCJB 2ZPTX 5CLQA 2A30A 4M53A 3BS4A 5TXGA 3D7MA 1J70A 1R2QA 3L0PA 4FN5A 4LV8B 3ZIAD 1GM5A 1HURA 4ACBA 1NBMA 4QKQA 5JCPA 1RIFA 1T0JB 3P27A 3KXIA 2WBLC 3AGQA 1E6CA 1G5RA 1NI3A 4Z51A 5F9FA 3TUIC 2OO7A 4KSCA 3GJ0A 1M2OB 4LX0A 4Q4HA 2NO0A 1HT1E 1GDDA 4JBWA 2D2EA 4GSYA 4ZI3A 4Q1BA 4UKDA 5GVSA 1MKYA 4EFMA 1II8B 2MSCB 4P31A 2ZSAA 1EWRA 1AA9A 1G17A 1DADA 2A78A 2YC2C 4Y0AA 4QRHA 1NL3A 4HAZA 4MKIA 4C0KA 3HWSA 4CW7A 5UKDA 4A2QA 4O2RA 2ZRGA 5KYKA 1FX0B 2BWJA 2VBCA 1G6OA 1X8LA 4B33A 1NRJB 4OK3A 2X77A 1S9DA 2DHRA 2DFNA 2XOKD 4KLZA 3GLFA 5J40A 1KK0A 4NPHA 1SQ5A 2QGZA 4BLRA 3C14C 4GRAA 4URXR 2IS1A 1JXOA 1QRAA 2OZEA 4KODA 1N5JA 2VYFA 4WZAE 1HYQA 2P3SA 5K8LA 2ZVPX 3WNBA 1KK3A 4BRUA 3LX8A 4IDOA 2ZRIA 2IXFA 1N0UA 5FOSA 2MMGA 4HAXA 4XD7D 2BJWA 1XD9A 3UPUA 4Q48A 4R98A 1NMYA 5FPYA 1R5BA 1I4LD 4CIDA 1SHKA 2ZJYA 1AKYA 4TMXA 3K70B 2RGNC 4Q4JB 2F9LA 1QZXA 1WB9A 2BMDA 5A0FA 2P0EA 5L3RA 5BYJA 3T1QA 5DYIA 3VR5A 4EPXA 4U00A 1JEEA 2OG2A 4NYJQ 3MLEA 5DISB 4LJYA 2B6HA 2ZRCA 3T34A 3WMEA 2ZJZA 1TQ4A 5DN6D 2BEKA 3VR3A 4UXHA 3K53A 3KZ1E 4DVGA 1IHUA 4OHVA 1IN7A 3B1YA 3BK7A 1P60A 5C4GB 3BIFA 1E9BA 4JVNA 4QFMA 1AKEA 5EXSA 4M9QA 3VU9B 5TMPA 3B7GA 2WZQA 2Z83A 3JZAA 1CR2A 3NG1A 3U3KA 3GLFB 3UKDA 1SXJA 2WKQA 4C0AC 4BGDA 2BDTA 1OXUA 1S8FA 2YZ2A 5DYGA 4PC6A 1KI6A 4B43A 1OFIA 3H2YA 3FDIA 1I4TD 1G64A 1FP6A 1CS4C 3VAAA 5BWMA 1SZPA 3NTUA 1E9SA 4NONA 3FPAA 3DEFA 4A82A 4Q9LA 1ZM7A 4NTZA 2HCBA 5JECA 1SHZA 4EPRA 4DWJA 3IILA 4EDHA 1F60A 1N6OA 4KI0A 1E2MA 5KNBA 4GZLA 3CZPA 3AUYA 2VF7A 3RLFA 2JIZA 4CZ2A 2VP6A 4DIEA 1BIFA 4Q18A 5BW8A 3QXJA 4KAXA 4LJ5A 4M1MA 2BBTA 4PSVA 2VQSA 3Q3JB 3K9HA 4AIIA 1EFRD 2H18A 3LW8A 1Z0AA 2ODBA 5EE0A 4FMDB 5ANRB 4DJTA 1AGPA 4B75A 3THYA 1R8SA 1HEIA 1Q3TA 2L0XA 4X8HA 3UMFA 2G0NA 3AVYA 5EZ5A 2DPXA 2JLXA 1W0JA 3SE0A 3CF2A 1E0JA 3GJ3A 2REBA 4QGAA 1FTNA 1E2IA 1QHYA 4XVUA 2DBYA 1GKYA 3HYTA 2JJ2D 3AVPA 2P6UA 4R71A 3UG6A 5FBVB 4B3FX 2HJVA 2HLDD 3A4LA 4LV5B 4ZO4A 5LB2A 4I4LA 5H1YA 3VNUA 3ASZA 2GXQA 3KFXA 5FTMA 4DDUA 1XMSA 4D82A 1PZNA 3KQNA 3SOPA 3CNLA 1Z6GA 1QHIA 5JWHA 3AVOA 2YV5A 4D2IA 3K9LA 4DUGA 5KSYA 2YHSA 2NO7A 1AS3A 4Z54A 2CNWD 3CRVA 3R8CA 1G8PA 2BV3A 4TMWA 3D3QA 2WKPA 4LJ8A 2EWVA 2FGKA 1ONBA 2GJ8A 3NC0C 3VR6A 2R6GA 3RS3A 3FYHA 3M0EA 2Z4RA 2FWRA 4P4SA 5DH9A 1E32A 2CEAA 2W2XA 4B3GA 2C77A 1M6NA 2QU8A 1KI4A 1MO3A 3JZMA 2IYXA 1JECA 1M7HA 3CUEF 3ECCA 3Q7QA 4PANA 1W5SA 3LD9A 5J4YA 1R5OA 5HKKA 1XMVA 3X2SA 1II8A 4AYWA 2NG1A 2GJ9A 2OCYC 4NCNA 3VKWA 1P72A 3MWKA 4XH9B 2QP9X 2AXNA 3DPUA 3G0HA 3GLHA 4C3ZA 2C98A 2CJWA 4BUJA 1CF4A 1XDBA 4IVPA 3C5HA 2XSZA 3KTAA 5FPTA 1E9EA 1FX0A 4ZCLA 4LDJA 1KYIA 5EXXA 3TH5A 4MKFA 1E1QA 1SKYE 4RD0A 3TUZC 3SU8A 4F4IA 1A7JA 2IF0A 1VYTA 4Q5IA 1P75A 2OLKA 1GTVA 1AQYA 5JI3E 4DLSA 1EXMA 1L2TA 4DZZA 2GCOB 2QPTA 2MMCA 2ZE8A 1S3SA 2B8WA 3GJ7A 3ETLA 3PUZA 3OE7D 3N5CA 3L82B 2G88A 3E5HA 3WY9A 1CJVC 3T61A 2V6IA 1YZTA 2W58A 3FMFA 3BJIC 3QBTA 2NMVA 1F2TB 5TARA 4I1SA 4RZXA 4WBSA 2VHTA 3IIMA 2D2FA 4DCVA 3VNVA 2F1HA 2ZRBA 3LH5A 1Z0FA 3EX7C 2ZUCA 4AC9A 1OE0A 3TW4A 2IHBA 2DB3A 4BFSA 4DLTA 3L0IB 3K70D 3A1VA 4S35A 1MV5A 3OIYA 4Q7JB 1XD2B 4DB2A 3R9WA 1KJWA 2C96A 2REOA 3QBVA 1JALA 4C30A 4HUTA 2NGRA 4E09A 4QGFA 2JDIA 3OEHD 2QPAA 1DG3A 2GEDA 2C2HA 3A37A 1OXSC 1JQJC 1T3SA 1VCOA 2VA8A 2VTKA 3GJ8A 2P6NA 1I2DA 4L8GA 3RDPA 4YMUA 2ZJOA 4LYJA 5AJXA 2F3TA 2Z4SA 4JLNA 4A8JC 4B3DA 2BMJA 2BIFA 4X8OA 3VU9A 2ZM5A 1XEXA 4DBLC 1GP2A 3OIWA 1FQJA 2FZLA 1NVUQ 3Q7PA 5DE3A 3VQTA 2GCOA 1NVVR 1VMAA 4PZYA 3W8NA 4M1WA 3RS2A 4QG7A 5CYOA 1FOEB 3ZH9B 1NMXA 4DEYA 1G5TA 4XWAA 2IW3A 4JKYA 4IXNA 1G7TA 1SVMA 2ZAOA 2ZETA 1ZC3A 1GIAA 4DT1B 1ZIPA 2IWRA 2FE4A 2KSQA 4UQOA 1Z5ZA 1OXTA 1SVKA 1DG1G 3O8RA 1UAAA 1ZM3A 3AF4A 1IJEA 1ESMA 5IDVA 2AR7A 5AUOB 4A92A 1ESNA 3A36A 3BRWD 3RWMB 2W6ID 1MRSA 4I1OA 4FIDA 4IEIA 4HLUA 1E2PA 2QE7D 4DDTA 1XPRA 4MUBA 4KBGA 4LHZA 1E9DA 3GLIB 4QC2A 4M9XA 1G4AE 4G1UC 5C1BA 1R0YA 5M04A 4PO8A 4TLCA 4MRNA 4EPYA 5L3QB 2GJAA 3G5UA 4UNRA 3CW2A 1ZP6A 2WTUA 5G40A 4K81B 2YWHA 1JAIA 1S0UA 4F91B 2JIZD 5JFGA 4F92B 1Q1QA 1SKQA 1PLLA 4Q1FA 3ADKA 5KNDA 1K5GA 3F5FA 2IT1A 2WJVA 4GZMA 2YKGA 2CBZA 2H7VA 3ND9A 1XTQA 3EC2A 1MABB 1S1CA 2WSSA 2F3RA 3GFOA 5CB6A 3PIRA 1U90A 2ERYA 3O8DA 3TSOA 3KQUA 4A2PA 4RCYA 4C4PA 3NH9A 1ZUHA 1W4RA 2OV2A 3CR7A 4TMKA 5H70A 4DHEA 3HDTA 4EIWA 1GUAA 2PX0A 1ZM9A 1T0HB 1L4YA 4PPGA 1JJ7A 4EQ6A 3UATA 2FDCA 3IQWA 2Q0HA 1NJGA 1XEWX 5EP3A 2ANBA 4MRVA 3QI2A 1OSNA 2GJKA 4IHQA 2IYQA 3EARA 2EW1A 5B2ZA 3PUXA 1HV8A 3ADDA 3ZZTA 2OBNA 3IBYA 4US1R 3RYTC 2JJ1A 4O0MA 3BH7A 2O0KA 2AK2A 3RNLA 2DCUA 4Q19A 5EJEA 2NZJA 2WOJA 2JLWA 1RRPA 4LHVA 3J81k 2IUSA 1ZNZA 3ZS9A 1W0KA 3CBQA 2ZRJA 4JL6A 2JEOA 1AZTA 4BE7B 2CJWB 1PVOA 4A15A 5G3YA 2ZS8A 3QSYA 2V6JA 2A9KA 1NIPA 2PLFA 1N3BA 1P61B 2HYDA 2F1JA 3ZGXA 1MH1A 3ZVMA 2IS2A 2ZJ8A 1XD8A 4NH0A 2DFTA 1YQTA 3T1OA 3CZQA 1OH7A 1P62B 1UKZA 1DVRA 4H1VA 1UDXA 2UZIR 2XTNA 3ICQB 4V0ME 4P33A 1VHTA 5KDOA 3ADBA 1O87A 1T6NA 2BVNA 2GRJA 3MFYA 2QTFA 3I73A 4OI4A 1G3MA 3P4YA 2VRWA 2XNDD 2J87A 4GT1A 3U7EB 1GNRA 4TN1A 2RGBA 1E96A 4ZV4A 2XOKA 2ZRNA 3P20A 3SZRA 2AN9A 1E2QA 4BECA 2J5XA 5B57C 1ZM4A 2FMXA 2J0VA 4II7A 2GVDC 3LFUA 3FWYA 3PEUA 3R7WB 1Z2CA 1QHHA 3OIUA 3BGWA 1EFHA 1D5CA 2UZ3A 1KI8A 4EFLA 5FH9A 5LD2B 3LV8A 4WXRA 1Z6TA 4D4MA 4OQXA 4E22A 2FJUA 1E1RD 4O25A 1PUJA 4JYBA 1VDZA 4C9BA 4TL7A 3QXSA 4A8JB 5F98A 3RC8A 4DLXA 4HZUA 1KAOA 5LB4A 4BWYA 3SFZA 3GEHA 4JVLA 4B3CA 3LX5A 5GVRA 5CK5A 2XXAA 3QKTA 4TSFA 3MCAA 3HJNA 1VCNA 4UNNA 4NDZA 4WIAA 2IYRA 4QBGB 4CDGA 4DLYA 1GVNB 4P4SB 1W36D 1IQPA 1XXHA 1C9KA 3TNFA 3H86A 4JKIA 2JLSA 2WJYA 4C0JA 2RB4A 2ZU0C 1WF3A 4KV9A 1D9XA 2GHIA 4AD8A 3Q5EA 3EPHA 5IF9A 4FD2A 1J7KA 4C0SA 4JJKA 5EE3A 4WW0A 1W0KD 2PH1A 3I72A 1T4GA 4PC1A 4PZLA 1CJUC 5B64A 1TU3A 3UANA 1GILA 4TMZA 1NF3A 4BASA 4E03A 1X8JA 1ZW6A 2EFGA 4A6XA 4TZ6A 2Q9CA 1CJTC 2QENA 3EA5A 1IBRA 1KO8A 5CB8A 4EAQA 2OBLA 5EZ6B 3EPKA 1NLFA 2A5FA 2ZRMA 4M1TA 3X1XA 4CRWB 4AURA 4FW9A 3OAAA 2ZROA 1JJVA 1E2LA 1GG2A 5G3ZA 4PSKA 3C4JA 4D6PA 4TQUS 2EQBA 3N2EA 4L16A 1U9IC 4IOLA 3THXA 2GETA 1DAHA 1H8HA 1MOZA 1CU1A 1NP6A 2N1BA 4Q7LA 4EPVA 1WCV1 4AKGA 4LK2A 2QSYA 5FBWB 3QKSB 1K8RA 4EKDA 1TPZA 4PHFA 3QKRA 4HB0A 3QENA 2R6CA 4HAVA 4L9WA 4V02A 3T06B 3U4QB 3KJGA 1E9FA 3PFIA 2GCNA 5CJ2A 3BWDD 1K5DA 4KYIB 4GOJA 1Q22A 1N5KA 3PENA 1EX6A 1CR1A 1E2HA 2W0SA 4LOAA 2O0JA 1A82A 2PCJA 4M1KA 5EXTA 4QGGA 1IY2A 3GP8A 4MDEA 4TZ0A 5J47A 2ANCA 2JJ2A 3KJEA 1Z83A 4PQFA 2ORWA 4Y0VA 1P2VA 5E7MA 4MYUA 1VG8A 4JLVA 2NZ8A 1M74A 3KTAB 2OEPA 4QBHA 1G3UA 3EIEA 1VYUA 2HXYA 3I32A 1N5IA 3WNCA 1R4AA 5F2EA 2JJ8A 4N0EA 1XEXB 3W3AA 3CNOA 5AUQA 2Q6TA 4PC2A 4MA4A 1Q3HA 4OI0A 1R0WA 2Z6VA 4PO9A 3DL0A 3SDZA 4XJXA 1ZD1A 1F2UB 4DLVA 1AJEA 3GFPA 2X8AA 3AP2A 3TJZA 3SJCA 3HU1A 4R7ZA 5BN3A 1N6PA 2GILA 2KBFA 4YXWA 1OB2A 2IYWA 3AKDA 5FL3A 1YU9A 2IWHA 1YZUA 3U5ZB 1P2TA 2ZI7A 3WP0A 5HCIA 5AR1A 2WAXA 1KY2A 2P65A 2VHUA 1KJZA 1ZCAA 2WVJA 3SBDA 3CPEA 1IN8A 4FCTA 4ESVA 2O8EB 5JRZA 4J0QA 5EE5B 3WYGA 1DAGA 3QXCA 1V5WA 3A1WA 3IO5A 4P32A 1DAEA 1YVDA 4LBVA 2WICA 1X6VA 2XAUA 3QIAA 4D0NA 1RRCA 4HLUC 4GL2A 3U7FB 5BYKA 2V55B 2XSZD 4IOMA 2REXB 3B78A 1KZGB 1LFDB 1XB2A 1G3QA 1EFUA 1RRFA 3WBKA 3DOEA 5JZVA 2BBSA 3SNHA 4LWZA 2D4HA 3ICEA 1HH4A 4IFEA 1P73A 1XXHE 2Q9BA 1U94A 1SXJE 1C1YA 2R44A 2YWFA 2HT1A 2HV8A 1U99A 4KU4A 1PUIA 5DHAA 3K70C 5HZKA 1G5PA 4MUAA 2VHJA 2V8OA 2QMEA 3ZQJA 2QMUA 1LS1A 3CLVA 2GDJA 4BLQA 4CGZA 3ZVNA 4H9GA 3U44A 3NBFA 1XX6A 5GADl 3HYRA 2DWPA 3TBKA 1W4AA 4TQ9A 4IKEA 4YDSA 2FF7A 2OSBA 1GKUB 4MGKR 2CLCX 5KUTA 1ETUA 4TYQA 3FVQA 3U3MA 4A8JA 1KDPA 1DEKA 2ZR7A 5E7JA 1DTSA 5J4VA 4DUGD 1PJRA 5FOXA 4PHGA 2HYIC 1TADA 3LLMA 3MJRA 1L7VC 2JJ1D 2AX4A 1QG4A 4IW3B 2YINC 4B6EA 3OHMA 4Q01A 5FTKA 3UK6A 4C7OA 2ZS7A 1OYYA 4E07A 1ZBDA 2AL7A 2NOAA 3WYFA 2GK6A 2H1LA 4NCIA 3K0FA 1G291 4JS0A 1JB1A 3GLHE 4I1UA 2JLQA 1GFIA 2GXSA 3AH8A 4Q9HA 4B2IA 3G82C 1U0LA 3ASYA 4B34A 2IYYA 1BMFA 5C18A 1D2NA 1Q20A 2WIBA 1ZD9A 1X3SA 1N6LA 1GL9B 1P3JA 3ONWA 1G8YA 1OPXA 2GZHA 1LF5A 1E79A 2ZSFA 4DDWA 3SQXA 3FKSD 1CIPA 2CHQA 4CF7A 1ZUNB 2J41A 2QP3A 5L3QA 3OAAD 2SHKA 2VHQA 5FR2A 4UXIA 1Q21A 2GAAA 2CLSA 3K0AA 4W5JA 4O2LA 4ZCIA 4KHZA 5J4KA 1G8FA 4LHXA 2XZPA 5CDFA 1KAGA 3CIOA 1EFRA 5HE9A 3BC1A 3SHFA 4Q00A 2RGDA 1E79D 4RD6A 3B9PA 4RFSB 3QY0A 4URVR 1Z0KA 2RHMA 5KDLA 3H1TA 3CX8A 2A7QA 2PMDA 1W46A 3WHLA 4ASUA 3K0SA 2RGCA 3T12A 5DI3A 2VH5R 1XBTA 2FSHA 2IEYA 2CK3A 3PEYA 4GMDA 2P5SA 1ZYUA 4JSYA 8OHMA 1QDEA 3VKHA 3IEUA 4M22A 4D80A 1TAGA 2ZRDA 3LAWA 4U02A 5FOWA 2X1VA 1DOAA 1P2SA 2HF8A 1OIXA 3K1JA 5JHHB 4G5SA 4IXMA 1WXQA 4OQLA 3KXLA 1FL9A 2WIAA 2FFAA 2IYTA 4ZDKA 2XEXA 3NEYA 3WYAA 4L15A 4OBEA 1SVOA 1KK1A 3OFND 2PX3A 4HLQB 1GL7A 2ZEJA 3IBGA 4MRSA 1M7BA 2WMOB 4TL9A 4WOPA 5FUVA 5TY0A 3VR1A 3ZIAA 5IT5A 2XB2A 4JVSB 3SN6A 1A1VA 3FGNA 4CYMA 3C7KA 2WV9A 4EJSA 3PJRA 3BB4A 3KX2A 2D06A 2QI9C 5E3HA 1KSHA 4FCWA 5D3MA 1Z47A 2KI5A 2ZQ5A 1US8A 3WHKA 4YMSA 2IUTA 3BERA 3MWLA 3SEAA 4URYR 3A8TA 4DDVA 4QHTA 2LKDA 5F9HA 4Q4LA 1KI3A 4B76A 2ZJBA 5J4HA 1E2EA 3N70A 4MKHA 5CM9C 5TDHA 1KKLA 4Q9JA 2ZAMA 4OJKA 2GNOA 1RYFA 1AZSC 3AVUA 1Z22A 4W5HA 4ZDIA 1E2NA 4LJ4A 5CDFE 2ZJAA 1JXMA 3U3RA 1IXRC 1QHHB 3EWAA 1OH5A 1LNZA 1ZVQA 221PA 2ZRFA 4DLZA 3DKPA 3GLGE 2IA5A 1F2TA 2ZR9A 4CEJB 4Q4AB 5DIFA 1Y3AA 3TE6A 4G5GA 3I3SR 4UJ3A 3T5GA 4HZUB 4QOSA 1TTTA 1LV7A 3PITA 1KDRA 2OESA 4RD4A 3CPJB 3K09A 2AKAB 3EZ7A 3KUCA 1MR3F 2ATXA 3AF3A 2D7DA 1ZU5A 1XD2A 3AF2A 4MRPA 1N6RA 5D3MB 2PLRA 2XXAB 1KGDA 2ORIA 5JMTA 3CWQA 4LZZA 2H8KA 2PJZA 2QRZA 2O8FA 4A9AA 4M2LA 4YLGA 1E98A 3LVRE 4BRWA 2OT3B 3DMDA 2QE7A 3SJBA 2ZRAA 1OKKA 5JI2E 4AKIA 3MUFA 2H5EA 3IHLA 2J0SA 2GZAA 1KI7A 4ESHA 3LBIA 5IRCD 1IN4A 2WSMA 2RGEA 2ZUBA 2AD1A 2ZYVX 4HAYA 5C46F 4Q1CA 1D8TA 1GNPA 2FU5C 2PZGA 1XRJA 2EYQA 1JPNA 1KTVA 2W2TA 1E9AA 3CO5A 3ND8A 5FOTA 3RC3A 3GLFE 2X2FA 4CT5A 3GJ5A 5FI1B 1Z28A 1VG0B 2CE2X 4FWIB 3SYLA 4F38A 3U60B 3KKMA 1AIPA 3TVTA 4V0NA 3WRXC 1JR3D 4V0OA 5AJWA 3RRMA 4DCTA 5JEDA 4Q4AA 4PTLA 2GXUA 1XP8A 4GOKA 4HB4A 4QBFA 4LYHA 2DWQA 1D2MA 1MO4A 1O3YA 1VKJA 2OAP1 4GDFA 5F3WB 5JBQA 4HZIA 4B3XA 1YRBA 1IN5A 1F48A 3GJ4A 2NO1A 5FPKA 1DAIA 4Q02A 1FTSA 4FXPA 5IK2A 4BPBA 4U5XA 2CL6X 3VR2A 1A2BA 1TUIA 2RMKA 3KB1A 1YZKA 1RRGA 5EP2A 1J2JA 1RW4A 2WHXA 2A5GA 3EIQA 1MO5A 3SC3A 2R9VA 3QEJA 4PC7A 4KYUA 2A5JA 4N3NA 2WWFA 3B6EA 4UNQA 2C95A 1NSTA 3KKOA 5IK2D 1COWA 2RGGA 1XFAA 4BLPA 4FMDF 4RFSA 5JJIA 421PA 1LF0A 3BE4A 1L4UA 5ELXA 2BBOA 1EK0A 1XZQA 1T8UA 2WJHA 2FG5A 1FNMA 3ZZUA 5JCZA 2XB4A 4DLUA 4BZPA 1Q57A 5DHFA 2OLJA 3REFA 3QG1A 5KSOA 4IDQA 4F7WA 1X1SA 4PAOA 1AQUA 2O8CB 4DSTA 5JWRA 1CRQA 2ZTSA 5FUXA 3SJZA 4NBSA 3NEJA 3CH4B 4NP6A 2R6DA 4KITB 2PEYA 2YNMA 3NVAA 1Z6XA 1GSIA 1EESA 3AKCA 2PZEA 1GRRA 3FKSA 2FNAA 2QL6A 3P26A 2P2LA 1D2EA 1M8PA 1E2KA 3DM5A 4LV6A 4D81A 4LPSA 4F93B 1N2CE 4V03A 1HE1C 1PLJA 3VKGA 1EFCA 3HP1A 3RVBA 3CH5A 5FOUA 2EFHB 5GJCA 4JT4A 4ARZA 2I4IA 2DYKA 2GF9A 3LXRA 1RE0A 4FINA 1GRQA 3K0FB 2QT0A 4JL5A 4OYHA 1VG9B 4HDCA 4C0LA 4LBYA 5FR1A 1NSFA 3S1AB 1W4BA 4W5WA 3VTKA 5SZHB 1P9RA 2QY9A 2N46A 4MKGA 3B8HA 4A36A 2IX3A 3IIKA 3U3OA 4JMPA 4WAUA 3F0TA 2CHVA 1TU4A 5SZKB 2ZRPA 4URWR 1Z8FA 2EWWA 1Z0JA 5FTLA 4B35A 5L3SA 3LBHA 4JJZA 3W8RA 1WBBA 4MGZR 1C4OA 4ZDWA 2HEIA 1R0XA 3TR5A 3D6TB 4X8LA 2KBEA 1YR9A 1S4QA 4RZ3A 1UJ2A 1Z0IA 2HUPA 1YHNA 3ZD6A 5LDDC 4MYTA 1ZIOA 4PSAA 4KBFA 4Q1DA 2ASEA 2ECKA 4MH0R 2GBLA 4QXAA 1COWD 3RWOA 1TEVA 4MYCA 3SQWA 4IDPA 2CE7A 2WM9B 2B7BA 1NY5A 3M4YA 5EE9A 5J4LA 2HLDA 2ONKA 1E3MA 3PUWA 5FPHA 2BC9A 2O0HA 4LYAA 4C7OB 3OE7A 1RPZA 1XPOA 3ZZ0A 1YZQA 4LBWA 1HA3A 3QKUA 4QJ5A 3UIEA 1W36B 3OEHA 5G53C 2OCBA 1OFTA 1QG2A 1E94E 3AP1A 5KPDA 3A1SA 1R10A 3AF1A 4JYCA 3FE2A 3OFNA 1DAMA 5GJBA 1OLOA 1G19A 1TMKA 2UVQA 1UEIA 4D4KA 3LRPA 3P1JA 3QXXA 5BN5A 1XNJA 4XSHA 4QJ3A 5L8VA 3V4FA 1XCGB 5CJPA 3WRYC 2I1QA 1UF9A 2NIPA 4BZQA 1G41A 4M21A 3KFVA 4G3XA 2AWNA 4QHSA 3A4MA 2YWGA 3LXXA 821PA 4QM7A 3THYB 3W5IA 1XXHB 3VX3A 4C2UA 3VMFA 4B32A 3TQCA 3HU2A 3L2OB 2QMHA 4NKRA 5HR5A 4DLRA 3KKQA 1DO0A 5IHPA 5JSZA 1SULA 1DE0A 1FZQA 1US8B 5CK4A 4U7DA 3I8XA 4JVMA 2J45A 4N0DA 2G77B 4XTCS 1XTKA 3DDCA 3Q8XB 4IEEA 4LC0A 1HE8B 4DIDA 2ODNA 3O8BA 4RD3A 3SYKA 1VCIA 3CNNA 1II0A 3MAAC 5HTKA 2CVHA 2JLYA 3SBEA 4IOJA 2CMKA 4LSGA 2ZI4A 1XWIA 3H4MA 2CVFA 3BXZA 4XWKA 2I3BA 5KO2A 1JQLB 2WJGA 1OKKD 1H8ED 3L0SA 3LA6A 3LWNA 3A4NA 4IVRA 3AB3A 4UNPA 5KOYA 3AKEA 2QQ0A 1CJMA 2OAQ1 4TTRA 3AF0A 3GEEA 5HE8A 5BN4A 2ATVA 3EASA 3I92A 2AXPA 1CR4A 4RJLA 4TL6A 2RH5A 1XF9A 3RS5A 2NTYC 2WMNB 3NDPA 4TL8A 4TTQA 4TLAA 4Q4HB 4S2EA 1FW6A 1NN0A 2AHOA 3OIVA 2PCLA 4Q47A 5JLJA 1S2MA 2VSFA 4FI3C 4C0BA 1RJ9A 2OCAA 3U6BA 3TSZA 1N6NA 3ZD7A 1KDTA 1D9ZA 4HB2A 2P5TB 2FSFA 3NH6A 1G7CA 5CYPA 4YMTA 2AKYA 3PG5A 2V7QD 1SVLA 1N0WA 3CWZA 1DO2A 1KO1A 2GJSA 2GBLC 3UG7A 4PHHA 2GF0A 1OJLA 3EA0A 4D4JA 1NN3A 2V4ZA 2R62A 2HF9A 4TTPA 4B2PA 3IHWA 2JLUA 3QNUA 4BZXA 1YZGA 2HDNB 121PA 3QQ5A 3QUSA 2F9MA 1QF9A 2CK3D 3AVVA 2OHFA 2ZI6A 1ZNYA 2VP4A 3KKPA 3OZXA 4QM6A 2IC5A 1KI6B 4LPKA 3AKYA 4CT4B 2ZSEA 2XGJA 3B5JA 3R8FA 3OEED 3PV0A 5DO9A 1DARA 3TIFA 1XU4A 4H1UA 2F43B 2C03A 5AJZA 3NKVA 4OL0A 3KUDA 1ZNWA 1UBEA 2ZREA 3AVWA 3AQ4A 1ZNXA 1QBKC 4JLKA 5CM8B 2K5UA 3KKNA 2QM8A 3C16C 3THWB 4K46A 4B71A 4ACAA 1LW7A 3KJIA 1LTQA 2DFLA 1HT2E 4ILEA 2C78A 2E87A 2BOVA 3P32A 1XZPA 4TLBA 5JWOA 1CJKC 1Q1BA 2JLZA 2FA9A 2WWGA 2YWEA 1LVGA 4IVQA 3BH0A 1CLUA 5BQ5A 4BFVA 2A5YB 1SVSA 4KLNA 5FL7D 1V43A 2ZJ2A 4A0HA 2XTMA 3I1FA 3B13B 3D31A 4BFTA 3NIBA 4DXAA 4G5QA 1ZRHA 4RVCA 2ERXA 1E2GA 4TLDA 3V9PA 2FPLA 1SXJB 1NN1A 2FGJA 2WJJA 1F6BA 3DO6A 1ZAKA 4Q9IA 3FMIA 3PQCA 3CPHA 2H57A 4L4UA 4NCKA 1Z2AA 3SR0A 2AFIE 2WWXA 5J5CA 4IFBA 5FUYA 4GP6A 4QJ4A 2ZRHA 1E69A 2JATA 3LQQA 1SGWA 4M4SA 3AM1A 5DNYB 1E1RA 2OXCA 3NBYC 1XPUA 1E4YA 1FFHA 3AVXA 1CEEA 1X86B 2GEUA 2BMFA 2IF2A 4KFTA 2NQ2C 2ZYUX 3RRZA 3NDBB 1XJCA 1T3HA 3QG5A 1S96A 2IXEA 4OHYA 2QQEA 3CX7A 1QVRA 4DT1A 1NN5A 3OESA 2X19A 4JIMA 4URUR 2Z5FA 1N6HA 1E1QD 2WWWA 1MRNA 2BHRA 3W3ZB 1QHNA 4OQMA 1WRBA 4KJZA 2BJVA 4Q1EA 4CEHB 3L8ZA 4D0GA 2FEOA 3LW7A 5B58C 4PO1A 4DC9A 2Q3FA 3BORA 2RCNA 2OCPA 3BB3A 4WA7A 3U6KA 5B30A 3MRSA 1E9CA 4C0QC 5FBLB 3LVQE 2QN6A 4URZR 1YR6A 1S1MA 4P0TA 3K9GA 3AUXA 2VIIA 1OHHA 2E9SA 2JLRA 3DVLA 1WP9A 2W2VA 3MWYW 4M9ZA 3GPLA 1SVWA 3JVVA 2NPFA 5KDDA 1W2GA 4PAMA 1CP2A 4R2IA 1BYUA 1ZMXA 1AGRA 1U2RA 1YR7A 1U8ZA 2IYSA 1YZLA 4JLBA 1KNQA 4LBZA 2YOHA 1OF1A 1E4VA 3ZQ6A 2FSGA 4M1SA 1N6KA 1NVVQ 2ZU6A 4TYWA 1J90A 2LKCA 3VFDA 4KFRA 5LBIA 5L3SB 3U7GA 3PR1A 4OQFA 2JDID 1MO6A 3DZDA 5HKKD 2ZSDA 1IJFA 2XTZA 1Z29A 5E95A 1SVIA 3X1WA 5FTNA 1ZCBA 1DAKA 1U98A 1AK2A 2IYZA 4XVRA 1N5LA 1RFLA 1EGAA 4RSGA 2QAGC 3FFAA 2GEVA 4M1OA 3TRFA 1FQKA 5E4FA 4BEJA 3I5YA 4G0NA 3HU3A 3FHTA 4B6FA 3TW8B 3TR0A 3EPLA 2F1IA 2V3CC 5FTJA 3CKLA 4O3MA 1KMHA 2ZSBA 1QHGA 1TUEA 3HPRA 3GQBA 1NG1A 3X1ZA 1PV4A 1YKSA 3DOFA 1Z0DA 3JVUA 5L3VA 4HYYA 2QNRA 4TSFD 3B2EA 3EC1A 4Q7MB 1Z63A 2BBWA 5CLLA 2VLIA 2FFBA 4A4DA 4HEJA 2EFEB 3GLGA 4YMVA 4B74A 1GOTA 1JPJA 4L9SA 5FFMA 2XNSA 2YOFA 4RY2A 5DGXA 4PPFA 5FI0B 3EWSA 2IXGA 4HSEA 1TEXA 4PPQA 1DPFA 1UFQA 2ZIAA 4L5BA 1G20E 3DMNA 1GKIA 2W83A 4M0LA 1AS0A 1XJQA 1H8EA 1XMJA 4NYIR 3FMPB 4FMBB 3DM9B 2DWOA 2MSEB 1HTWA 3THXB 2XITA 3AEZA 3EPJA 2ZANA 1AN0A 2ZJ5A 1IN6A 1W36C 3U7HB 3PEWA 2VEDA 3AP3A 3QXHA 5KU1A 2PJRA 1JR3A 2NO6A 4PC3A 1YR8A 4FCVA 1CULC 1W4CA 3DHWC 4HLCA 4JLJA 4FWTA 1G7RA 1WDTA 1F5NA 2O8BB 4DSUA 4QHYA 2QAGB 1HQYE 2AD5A 1KKMA 2J0UA 2J7KA 4ZI2A 1OIVA 3SJAA 4JLPA 1J99A 4D4LA 3BOSA 1E2DA 3CF0A 3PVSA 3C5CA 2ODEA 1U0JA 1R8QA 1XTRA 1E2JA 1JBKA 3K0CC 4GPTA 4YQFA 2EVWX 3QVVA 2QBYB 4M8NE 3X1YA 3GLGB 1JEDA 3A1UA 3T1VA 3IQXA 1G4UR 4AYXA 2V1UA 4XTRA 1UBCA 1UEJA 2O8DA 2UKDA 1G6HA 2VO1A 3V4RA 1FPMA 4RD2A 2QM7A 2ZI9A 2ZS9A 5HPYB 1VPLA 4ASUD 1OB5A 1HUQA 3GLIA 2R6FA 1OH8A 5CIQA 2VL7A 2GCPA 4HB3A 2QZ4A 4Q9KA 3BH6A 1JR3E 3IUYA 1N6IA 4NL4H 1QVAA 5EE1A 2G0TA 4Z8YA 2FV8A 4QNRA 4HI0E 1U81A 2JAQA 1KIMA 3RHFA 3DKVA 4A6PA 4GFDA 4HLDA 4OKSA 3QOFA 5JRJA 3EG5A 2J7PD 4TWZA 2VSXA 3H0KA 3NHAA 3FOZA 4C2TA 3QPWA 5DI9A 1G8GA 721PA 4QBIA 2F1RA 1RVDA 2OXRA 4HUQB 1LY1A 3RRNA 1TQ6A 1IOZA 1CRPA 2OFXA 2QMOA 5CITA 1OFUX 3WMFA 2O52A 1E2FA 2QRNA 4B44A 1UM8A 2J1LA 4JSTA 1W0JD 3GEIA 4DSNA 1CKEA 2OE2A 4PQRA 3MJHA 2QBYA 2B21A 2RGAA 3OF5A 3R20A 4HDQB 2C8VA 2JGNA 4Z1MD 4UXJA 1IM2A 3SI7A 3KJHA 4KO8A 3EAQA 2VP9A 2V1XA 3UMRA 2RGXA 4XWOA 1E99A 2ZE7A 5JS8A 2XNDA 1HQCA 4RCZA 2OILA 3W6NA 2F43A 3GJXC 1J8MF 2RGNA 4G5RA 4XIGS 1J8YF 1P7CA 3KQLA 1TL7C 4GNKA 1OIWA 4TT3A 1WE2A 2FFQA 2GVZC 2JA1A 3W6PA 4WXPA 2CNWA 3WNDA 2ZVQX 2GWHA 5GJVC 2LWIA 1ZU4A 1KK2A 3PUVA 3THWA 1Z3IX 1FUUA 5GJWC 3O47A 1FMLA 1E0SA 1IY0A 3LNCA 5H68A 5K8TA 1MABA 2FSIA 3I62A 2Z0MA 4M9SA 2R65A 1OH6A 2WKRA 4OHWA 3LDAA 1ANKA 2PMKA 2WWIA 1SKYB 4DSOA 3R9XA 4KXFB 1VIAA 4QGHA 3B1ZA 3IPYA 2DY1A 2TMKA 3B82A 1VTKA 1WQ1R 1U8AA 1ZC4A 2FPMA 3FHOA 4TYNA 1EX7A 1IXZA 1UKEA 3QJYA 4PAQA 1GRNA 4TMVA 5DLQC 4BLSA 1S3GA 4XSGA 5DN6A 2IYUA 3L43A 2QROA 1BS1A 5K8UA
chains in the Genus database with same CATH superfamily
1VFPA 5MF6A 4TSKA 4Z2YA 5F12A 1CT9A 3RUDA 2G3YA 5IVIA 4OUDB 1DS6A 3HB7A 5LU9A 3DKIA 4PPYA 3S99A 5GONF 4YMHA 4S0ZA 5C1IA 4J2TA 5KOHA 4DQUA 2XDWA 2W6CX 4HT3B 5JY6A 3Q87B 5BUZA 2OCLA 4IIVA 2BUBA 2I6QA 4RVOA 2G9ZA 1GGHA 3KL4A 1C50A 5IN5A 5DM60 2WIFA 1TPYA 3CVOA 1EUDA 4BBPA 1I7QB 4UOZA 1GGNA 1UKVY 1YCDA 3RS4A 2R7MA 1CNMA 4RC9A 4ZOLF 2G6BA 3G85A 5H5JA 4BCBA 5MN6A 1RSZA 1H2HA 4COOA 4EEZA 2GTIA 1YZFA 1DT3A 1E20A 3ZVRA 4ZOEA 2BGKA 2QTMA 5FWXB 2VF2A 2P2GA 4MP3A 3UOWA 1ETHA 5IF3A 3E23A 2A59A 5KPJA 1A5TA 4ZMSA 2DERA 2KMLA 1T5DX 4OEHA 2ZE6A 4FYKA 4ZC1A 2INGX 1MT0A 3I5XA 2HO4A 1W4LA 1SQ0A 3JQRA 3O0DA 5DDIP 1YTUA 1EXWA 2Z8YA 3WXMA 1G1MA 1PR0A 2GCEA 4E5UA 4Q7KA 2E21A 2Y1EA 4IY1A 1A9XA 3PA8A 2DE0X 4XZ3A 2O4UX 1WABA 3F5SA 3OE1A 4TTIA 2BR4A 5AUNB 2H4JA 1KI1A 3JRXA 3OH8A 4DQKA 4EPTA 4QFCA 5KNCH 3STVA 1C14A 1LS6A 5BUCA 1W0CA 4CCYA 3VC3A 5LOVF 1K6MA 2EDCA 5AK0A 3EXIB 4R9UC 3CM0A 1ULZA 2ZYTX 1S4MA 1W2HA 1U8YA 3NUQA 3OM8A 2FPPA 2CXXA 3U80A 1ZUIA 2AUMA 3HU5A 4Y30A 3SZ3A 3WRWA 2LDXA 5HZHA 2FPRA 1KMQA 3EIHA 5EXPA 3ZCTA 2D7CA 2W6IA 1RKXA 2O14A 4RORA 1P31A 3FJOA 2PR2A 4X93A 2ODWA 3GN2A 1NJFA 3KLNA 1JLMA 2ISQA 3FCCA 3UV3A 4MQ4A 1TUBB 3TLAA 4BFZA 1SUIA 3L8YA 3RT9A 3BXFA 2A0XA 1KO7A 3AW9A 1KQOA 4PFSA 1H2YA 3ZY4A 3DCNA 4IGFA 4JJ6A 2B1QA 1QYWA 3H8JA 2G7ZA 4TMTA 4BU0A 4DCUA 5HRAA 5IT9A 2PS9A 1VGQA 4R2WA 1UXJA 5EWJB 3TXYA 4RQAA 2HPVA 5KVQA 1TT5A 3JYHA 2WMYA 2G9NA 4B83A 1QHSA 4R0NA 5T5QA 3GAZA 5JT1A 3COZA 3G8AA 1XJ0A 4FU0A 2A5DA 2R7KA 4TYPA 4GPD1 2R8ZA 3E9QA 4XIIA 4CKYA 4D9NA 3WIDA 1JJFA 2JBAB 3X1JA 4D26A 2IPOA 4X7BA 1KDVA 1Q11A 2PH5A 4MW5A 5HK9A 4KAJA 5A5DA 2WWYA 1UP6A 3GH1A 3W34A 4E5VA 4ERXA 2RE8A 3GAAA 2GAOA 4AKHA 2GEJA 2IV7A 2X8JA 3K9NA 3FD8A 2OHOA 4TM8A 2GKSA 2HTEA 1Q5PA 1Y8QA 4NULA 4D0LB 2EJWA 3MTEA 3Q85A 3A10A 1GKKA 4II3A 3FI9A 4K03A 4RKYA 5KNCA 1KP2A 3BXEA 3QNWA 1VCMA 4UNSA 3ZC3A 2HPZA 4Z4CA 2AZMA 3A6PC 2J3EA 2PYIA 1J9ZA 4Y9SA 3LMKA 4XEUA 3OF2A 3KYDB 4IJQA 1QX3A 2DXIA 1D6JA 4ES6A 1F8UA 1HDZA 1LC3A 1UMBA 2J4DA 2KE5A 5K0BA 4J94A 1LPNA 1XZHA 3A1TA 4L4ZA 2XJ4A 4QTTB 3ZW9A 1ATIA 1NX6A 5KTSA 2YFHA 3PWKA 2CV1A 621PA 3OZDA 3KSRA 2KX7A 2C5LA 4IG4A 4OP3A 4J0HA 4F9EA 3N05A 5A4IS 2GLUA 6Q21A 3MB8A 1Z4OA 3KYCB 1DWOA 4MV4A 5CDGA 4KXWA 3L46A 1P1IA 2WQ6A 3Q7RA 5B57C 1R5NA 1M83A 4RMGA 3GCZA 4N1AA 4BC1A 3H1EA 2FJPA 4JB3A 1U5BA 3RAPR 1KY3A 4BE4A 1BWRA 1NKTA 2WC1A 2WF7A 1I2AA 3P97A 1VL0A 4WXHA 3WO1A 3T0FA 4K6KA 3JR7A 3SLGA 2J9YB 3T41A 2C9CA 3FI0A 3RS7A 1USUA 3D3NA 4LHEA 2PT7A 4ENTA 3PJDA 4AECA 1A8PA 1JZTA 1KQFA 4BO9A 4Q16A 1TQDA 2IYVA 2J0QA 1KI2A 4IJKA 1WBDA 4ZREA 3RSOA 3OJXA 5DSZA 1XNQB 1H4TA 3D81A 3Q3IA 3LHSA 4B8YA 4BJ6A 4Z8XA 4KFCA 1L7EA 3ZU6A 1A27A 4AJOA 4KH1A 1U7PA 2XB9A 2F3UA 2Y6VA 4LDAA 3VBCA 4D6XA 1LB1B 3L7IA 4MVJE 5KTPA 1N2HA 2YN0A 2RGRA 4XIFA 3RIHA 3RBZA 3WIBA 2ILVA 4IGAA 3MWJA 3ZE0B 2VYQA 3E70C 4QXOA 3TSWA 4C5AA 5CDSA 5JJKA 1CE8A 1QHFA 2P9TA 5L7TA 1PHRA 2GR9A 1DP4A 2QRKA 3AFHA 3D7NA 3KZVA 4MUIA 4XM1A 1MHTA 2G09A 2BFWA 4N7MA 4UPVA 1IATA 2O3UA 5GWXA 3KQMA 3Q72A 4MHOA 5EIWA 5BSFA 1YDHA 1AUOA 3B1VA 4H7IA 4OM8A 5TE9A 4YACA 2FX3A 3HDQA 4RLSA 4BVLA 4V1CI 3JTMA 1MOQA 4FYVA 1N1EA 2FZKA 2GSWA 1Z06A 1PW7A 2DM6A 1ZGGA 3OOYA 5FBKA 3CVUA 4REOA 1RVV1 1VLZA 4HUQA 1RM5A 3L8MA 3ZVLA 3B48A 4JBHA 2VQEB 2ALJA 4QLAA 1EVYA 4MEJA 2LGJA 1K86A 5DWVA 1L1FA 2K6GA 4NPCA 4V0RA 3AHJA 4DMUB 3IDQA 1XTJA 5JPIA 2WWHA 1T8SA 1IPFA 4Y1RA 3M5CA 4UVIA 5DPMA 4G0YA 4PZZA 1E8DA 1P1HA 5FNVF 3KXKA 1SQ6A 1YMVA 2Z9BA 1JT9A 1RMTA 4PG6A 1VFNA 3KVNA 1TF5A 3FUTA 5C2JB 3G88A 3LUHA 1T9HA 1KU0A 3R1IA 3KWJA 4A1OA 1TFUA 2QVCA 1MAHA 4US0R 2HK8A 2I7DA 4WOBA 1L5NA 3RG2A 1PR2A 4AJ9A 1VRCA 1F9EA 4G9GA 3QF7A 4O4JF 1IDOA 2V7EA 3TQIA 2X6QA 1XYYA 3GZNA 3PI6A 4HAUA 2ZZNA 3P0RA 1PR4A 4DTCA 2I9PA 1B0UA 4QQNA 4PLFA 2NSDA 2YC4C 4GP7A 4I3FA 3NXSA 3R75A 3W5DA 4B7UA 2IW1A 4Z1OA 4LF9B 2A35A 1KSFX 3BIJA 3IPXA 4PYJA 2CLHB 1NBME 2Q62A 4JC5A 4LTDA 2V9PA 3JQ7A 1KO4A 4F5WA 1JSXA 3ZWMA 2NZUG 1FU4A 4I2VA 4B84A 4WLNA 3O8CA 4ZJUA 4FLEA 5FV4A 1AOXA 4RTNA 4F0JA 1PP4A 1Q1ZA 2XZLA 1D1PA 2X2OA 4WOKA 3EFEA 1M6EX 2OORA 4UPEA 2FWJA 3EVNA 5EKXA 1DAPA 5DK4A 5AJVB 5BOSA 3ECAA 1II9A 2HMUA 2ZULA 2B92A 3I61A 3S3TA 4H6XA 4FOTA 4XDYA 4I6EA 4NY1A 3KJNA 1F7UA 3JQAD 1X38A 3GDOA 4IRUB 1GNVA 5DI3B 4JNCA 4QGSA 2P2ZA 1HY3A 1Y80A 2WG1A 4KXXA 3I1YA 1SXJD 1K75A 4P4TA 4RPCA 5LD2C 2AC7A 1FYEA 3SKYA 1G8JA 2IZZA 1O4WA 3DBVO 1Z08A 3TRDA 2QLLA 3GFTA 3R0JA 1TVCA 4RF5A 1GZ5A 2C9YA 4M9RA 3O91A 4NJMB 2GBFA 4F12A 5EQDA 2FPGA 1XN4A 2Q3MA 521PA 3KQQA 4MYHA 5JBIA 4BATA 2QKYA 2GK7A 2YVKA 3MLAA 3V5NA 1N3IA 4ZZ3A 4QWMA 2EKPA 4CEHA 3K71B 1QPBA 2W6JD 3BHNA 4DR3B 1G5QA 1G3IA 4OIFA 3EFOB 1SVNA 2XMRA 3I5UA 4RDXA 2VDVE 1FTQA 2C4NA 3ZWNA 4M7RA 4O4JA 3NDIA 2LXNA 4NR0A 4OQNA 4KSBA 4AS2A 1QR2A 5HJ5A 3FR7A 3GRPA 2RH4A 2V4MA 3OCZA 1NUTA 1LLCA 5FBQB 2B35A 1W49A 2PT5A 4K8OA 2EGHA 1UK6A 4KQ6A 3HXLA 1EDEA 4XD7A 4WFKA 3BFXA 3DW1X 3LYAA 3I04A 1OC4A 3ROQA 1QH1B 3VZBA 4QL3A 3QLUC 3DKKA 4EAAA 2I7CA 2W00A 4LXHA 2P3QA 2QUZA 2IS6A 1CEQA 1FUKA 2ZUFA 1XEWY 2QYHA 1FBNA 4XQGA 1A5ZA 1XYGA 2Q29A 3THOA 2DPMA 3GJTA 3LRXA 3PU6A 1IN1A 1FMJA 5GONA 1NFQA 1R0KA 1ZRSA 3B5EA 1U6IA 1V4BA 3W2HA 4WZ6A 2O8CA 2IGTA 4URHA 1FSPA 4FDUA 1I24A 3PSAA 4NZOA 4AYTA 3QI7A 2VP0A 2FRXA 4R1OA 5H80A 5BQXA 1VLHA 3TRIA 2A4KA 2CNDA 3AFIA 3NO4A 4WXEA 3KHSA 2GTHA 2PZFA 4BFWA 1WPXA 1IZ7A 4H27A 1ZW1A 5HS4A 3Q98A 2DT5A 3ETGA 4R84A 3TLEA 3WLJA 3A1FA 4X62B 1XCMA 3WSTA 4L28A 2WAAA 4OHZA 1IAQA 1Q1EA 3QKWA 3T5DA 4P0QB 3G2MA 4G0UA 1WA5A 1YB6A 2AYXA 5JS7A 3TLZA 4BNTA 3ZYZA 3C1AA 4QU0A 4ARZB 4EJ0A 2Z2IA 4QBTA 3U2QA 2P67A 4LJ6A 5EMKA 4N5MA 3H5IA 4X0EA 3JQBC 3W6OA 2R11A 3GCGA 4DJEC 4EJSB 3WNZA 4LMPA 3JWIA 4X1IB 4F11A 3EZGA 4BOYA 2R2GA 4PX2A 2Q21A 4W63A 4H6PA 4I50B 4LW8A 3U1VA 1PEYA 5J58A 3HY6A 4NZNA 4B6GA 1LQTA 1SRRA 2IHYA 3HZRA 4YWHA 5SZJA 4CQLB 1JH9A 3KUUA 2C54A 1ENPA 2WIDA 3QWFA 2XKJE 3E7DA 1UXIA 1T3TA 4Q6BA 4Q4JA 1WXHA 3EW9A 1WOYA 2ENWA 2PMBA 3OEEA 3MT7A 3IBSA 1EP1B 1IEVA 2X2EA 4YC7A 3W90A 1GWNA 3MUOA 4MITA 5KYYA 2AJBA 3LYHA 5EEHA 4EMUA 4MA5A 1FNNA 3BPSA 2C29D 1TZCA 4MQBA 1QYVA 4AIRA 2V4UA 4GX2A 2NUBA 5IEBA 4ABTA 5BV0A 1QYIA 4U7HA 1J20A 2BGIA 2ZB4A 4IMIB 1P9NA 3IEVA 3D3JA 1OXVA 1BMDA 1CR0A 1H2ZA 3CEAA 4M98A 4LY9A 2HU5A 1Y63A 4A1FA 1WZNA 2QT1A 1Q0UA 3M9XA 4CT0A 3RSHA 5KMGB 3X1DA 4BHTA 1G42A 3PE6A 5FWYA 5FP0A 2VI5A 2YJ5A 5CVUA 2YRXA 2B8TA 3B53X 2GA8A 3NORA 4D41A 1FRFS 4DR1B 2AQHA 1JI0A 3OQOA 3ZGZA 1P2UA 3IIJA 3CU5A 1JAHA 4HVCA 4YMUA 2EBUA 1P1CA 2PLAA 2XGMA 1P2FA 3AGPA 1P4SA 2Y1GA 3BQMB 3UAZA 1C9YA 4EHHA 2AI2A 4JZKA 5A5VA 3AVQA 2HB6A 5AVZA 1MJGA 3BCHA 4LYYA 2N0SA 3B1XA 4PQEA 5EP1A 2P4EA 1R37A 2XF8A 3KOWA 4DR2B 3R9KA 1NW4A 4PIPA 1L5WA 3HLYA 4XDHA 2NU9B 4OOFA 1S2IA 1QPZA 3DZHA 4LTMA 3ABOB 2OSVA 4D4MA 5IZCA 3ZDDA 1X14A 1XL1A 3VPFA 1KGSA 1RQXA 1V3QE 1PQPA 2J5QA 1VG1A 2VN8A 5DULA 5A5GA 5A6SA 4C2BA 3W9UA 4W5OA 1GPKA 1T36B 1UJMA 2ZI5A 1L7AA 3CHYA 2D1QA 3I23A 4LUCA 1GZ7A 1U3GA 4PXAA 5L40A 1JAZA 1RNLA 2FN4A 3OT1B 1NJSA 1SQSA 2PU7A 1TK3A 4GE0A 1UDWA 1N2JA 1NQ5A 4RGVA 3WTBA 1PQWA 4I99A 2ZUEA 4D3XA 4I3GA 4DV4B 1C0IA 2BELA 3WA6A 4TM7A 3DZGA 2FRDC 4O2AA 3WYEA 4DOMA 2X5XA 4OI1A 1TTPB 4MGHA 2BCEA 3FBTA 1NMZA 3AM5A 3IVGA 2PX4A 1VCHA 5J2TA 4JC4A 4WKNA 1KQ3A 3AUAA 3EXFB 1C7IA 3RVOA 1E0KA 1NNLA 3F6RA 1D2RA 1USWA 1YS2X 2IHTA 5HF9A 2VSOA 4WBNB 1ODFA 3GT3A 5IULC 2ZI3A 3Q7EA 3ZY3A 2ZRKA 2FZ5A 4EHIA 3HMQA 2B99A 5AVQA 1EI9A 4GOOD 4HEA6 4AWXA 1NP3A 3C8HA 4TKVA 1IXSB 3C3WA 1BSVA 2DPLA 2XZTA 4DCNA 3TKLA 3CRW1 3ZHYA 2F55A 2TS1A 3VPHA 3SXJA 4LC1A 3QX3A 4DIUA 2Q1XA 2HCJB 1CUGA 3KOYA 5CLQA 5HYVA 1YA6A 1I7DA 1I4OA 1L7QA 3AOGA 2HMTA 1QIHA 4LV8B 3ZIAD 3EIXA 4UVDA 5DHUA 4EL0A 2ZIVB 1WS6A 1UIRA 4K6GA 5YASA 3NW9A 1T0JB 4YIKA 1MMFB 4DZRA 2BDEA 1I2ZA 3V4ZA 4YCJA 4Z51A 3RREA 2D5CA 3GFSA 4WJZA 4YRBA 3OOEA 3TUIC 5F9FA 2XWJI 1N1GA 4ER6A 4YRDA 1ADJA 3ND6A 1VMKA 3MTJA 4M0MA 4CKEB 1B6TA 1RT9A 2OM6A 2OV6A 3WLLA 1YBAA 1JMVA 1W85B 4JAVC 2WZCA 4P31A 5ER6A 4OXKA 1GRCA 2E55A 4IP0A 4KIWA 1AA9A 5DM1A 2Z6UA 1DADA 2O6HA 3OUZA 2UUPA 1LJLA 2E6KA 1XGKA 2YC2C 3OC6A 1NL3A 4LY3A 4Y0AA 4Z99A 5JAQA 3DEJA 1HDRA 3AJAA 4MJXA 3GC6A 3HWSA 3AQIA 4WNAA 4PVCA 5UKDA 3N6VA 1Z2PX 3PNLA 2V96A 4AQDA 3L4BC 2BWJA 1X7XB 4L0MA 2OKGA 2VBCA 1UOPA 3OLXA 1A76A 2PBZA 1NXXA 3ETCA 2PSEA 4N8DA 2V7BA 4R2JA 3SYRA 1UZNA 3G2IA 1NR1A 3KZOA 3PFGA 3H1PA 4GM0A 4Q93A 4BKMA 2HHHB 1PK8A 4EEKA 4W82A 1JG4A 1H0HA 2DFNA 2P8JA 2XOKD 4U2DA 5IDYA 3DAHA 1UOEA 3HDVA 3NHYA 1Q14A 3JXEA 1V3VA 2QGZA 4BLRA 4M36A 2VHYA 4DMCA 2GEFA 4NG4A 3VMMA 4URXR 5K0TA 3U3XA 2AI1A 1X39A 2PQ2A 5K8LA 2ZVPX 3WNBA 1ECPA 2QUIA 1A50B 4BRUA 3LX8A 1QFSA 2OCDA 1N0UA 3U9TA 1P4GA 1JHDA 1QCDA 4GOMD 3D2CA 4HQNA 2BJWA 4CU5A 1RQRA 3WHPA 2B9VA 5KVAA 1R5BA 1T1JA 2Y66A 1FLAA 3G7NA 5LBTA 4RTLA 2OGTA 4GI2A 5LNK6 1AKYA 4TMXA 3RC7A 3RJZA 4B6SA 4HJXA 1WB9A 5A0FA 1B43A 2QGFA 4MLDA 1JT2A 1XUOA 5DYIA 5BYJA 1N92A 3L49A 3KUXA 4EKIA 3WQHA 2FETA 3OCJA 4P34A 3MCUA 1SD5A 2RI1A 3SJ7A 1X19A 2ZJZA 1TQ4A 1NDUA 4QOIA 4BE9A 5DN6D 1M54A 2CNKA 1M34B 3KZ1E 3T7RA 1HQDA 4DVGA 2QTVA 1Y3CE 4OHVA 1QG6A 3A2LA 3B1YA 1GN8A 5C4IA 4KRYA 4O4JB 4RU1A 4PRYA 5C4GB 1E9BA 5EXSA 2WIKA 1AKEA 1YDGA 3NHPA 4M9QA 3B7GA 4BCCA 3GLFB 4F4UA 2WKQA 1ABFA 1AB6A 3JZIA 1YDEA 2BDTA 1OXUA 1P2GA 4XWWA 2OBFA 4OQ4A 4YDRA 1FVXA 2B6NA 5F1PA 4NBUA 3FDIA 1I4TD 4IS2A 3CVYA 4QQ8A 4YJFA 1XQXA 3L1JA 2Q1YA 3OQIB 4MI3A 3UXHA 3FPAA 3DEFA 4Y9UA 4XQ0A 2XT6A 3TM4A 4R81A 1YL5A 3ZKWA 4NTZA 5JECA 1WD5A 1K2WA 3H5NA 2GN6A 2IV3A 2FE1A 5JLAA 3RH0A 4BYMA 5KX5B 2Y77A 4FFVA 1L3IA 3DD1A 3NRCA 2P9HA 4I2NA 4JP1A 5BQPA 1K6XA 1VXOA 2H54A 4F6RA 5KNBD 4CZ2A 4YJDA 1GGKA 4LXQA 4RHFA 1XKTA 4D92A 4MHSA 2IPXA 4M1MA 4XA8A 5BW8A 3ABIA 5D1NA 5LQUA 3T0IA 1Z5OA 3K9HA 4TS4A 4AIIA 3DTVA 1A2QA 3U49A 4G36A 4X60A 2IXDA 1NLMA 1Z0AA 5EE0A 3ZNPA 4FMDB 5JAIA 3W7AA 4ETWA 4A0QA 1EUCA 5IDXA 4F2DA 5ANRB 3MS7A 1JKFA 1NC3A 4B75A 3JQBA 1HEIA 1Q3TA 1TZKA 2RC5A 3AILA 2R1VA 5JNTA 1ZQ1A 5EZ5A 1FYDA 3WLAA 2DPXA 4HWOA 3TW8A 3ZCVA 1N75A 1WLSA 3VKUA 2WNSA 3K5WA 4QGAA 1E2IA 3BWXA 3I5MA 2DBYA 3KCNA 3LQFA 4I14A 1HFJA 4LWPA 1N2XA 4OO3A 3HYTA 4EFKA 1ZJWA 2JJ2D 2VH2A 2B4YA 4JZYA 3AVPA 5G0SA 2PSSA 3LP5A 2PL1A 2NYRA 4TUYF 3O8NA 1VP9A 5LB2A 1MLDA 4FWBA 4WZZA 4EJFA 5L95A 2UUBB 4WGGA 1PS9A 3FUXA 2C2XA 5F23A 5FTMA 1PCXA 3ICVA 4DDUA 1BE6A 2RI6A 1J21A 2ZWMA 2Q1SA 5ELMA 3BD7A 1K7CA 3RVQA 1MOSA 2ZUTA 2WI8A 2ACKA 3NT2A 1SB9A 2ECOA 2X86A 4LKOA 1NZFA 4D9FA 2MIIA 3O93A 2R68A 4AXBA 1UJ6A 3D5EA 1C2YA 1GV0A 3CRVA 3F67A 3Q7SA 5LA6A 4EOGA 1IMJA 2XWSA 4ZVKA 4FJ2A 2ZIUB 4LJ8A 3AY0A 4ESEA 2EWVA 2FGKA 4NAVA 4RMHA 3BRQA 2GJ8A 1FJ2A 5HGXA 2W6ZA 9ATCA 1E1NA 1BNCA 3NC0C 2FWPA 3VR6A 4YRSA 3RS3A 3FYHA 4AZ3B 3CZ5A 2XVYA 1NF8A 3IQDB 4P4SA 3DHYA 2VDMB 2GHRA 1NT2A 3F6SA 3PGXA 4YALA 4ZXPA 3RKUA 1KI4A 3B5IA 4EG7A 3QFCA 1PK7A 3AHHA 3FCUB 3Q7QA 4ZOLB 4YUVA 4DDHA 4YUAA 1R5OA 4P4GA 2ODQA 2R6ZA 3QJGA 4M8KA 3ANMA 4LSZA 1II8A 2V3WA 4X1OA 4A7PA 1CVLA 2I2XB 2QD5A 4AYWA 1JBQA 4N5DA 4CQMA 5IANA 4FMPA 1P8AA 3MWKA 2YFKA 4DY4A 5D8DA 5CT9A 3G0HA 3HNPA 1XDZA 3GLHA 3QUTA 4NECA 4P8RA 1ZRNA 4ZVNA 2CJWA 3BHIA 4AM8A 3N2YA 3IIEA 3T54A 1GR1A 4JI1B 4B7AA 3NBMA 1TKAA 1SG6A 3QX9A 4MVJA 3ZD8A 4B80A 1EXVA 3ZGVA 3AR8A 4GR5A 3TH5A 3KSBC 2ZBEA 4RD0A 2WUEA 3UGKA 2F3SA 4RFLA 3JD1A 1QKIA 3WGNA 4DADA 4F4IA 2IYPA 4QUIA 4UDXX 3TPFA 4YJ2A 3C3PA 3T95A 2NUAB 3BMXA 1DBIA 1P75A 2OLKA 2Q0SA 1AQYA 3ND7A 4DLSA 1EXMA 3OBIA 3L7DA 3OJOA 2OHJA 2DKOA 3W9BA 4WJLA 4P98A 3A6JA 4LTNA 3RSFA 3M6LA 4CF3A 2Z8YM 2MMCA 3NU1A 5CFPA 2AVDA 2FFJA 1SFRA 1YB1A 3IAAA 3SJUA 3T61A 2V6IA 2Q2NA 1YZTA 4INAA 2JD1A 4TRMA 5ALKA 1VJDA 7YASA 4I1SA 3BSSA 2VK1A 3FRJA 3NHLA 4RZXA 3IIMA 2M98A 3SVTA 2D2FA 2GK4A 3BE6A 3EHEA 3SF8B 3LH5A 1Z0FA 3QOYA 4ZRDA 4CLRB 1MX1A 4WLVA 3QJ5A 1ESEA 2IHBA 5K51A 2JI7A 3H11B 4X54A 4DLTA 2ZQZA 3P2YA 2SBTA 2W5UA 2ZIEA 4BAGA 4C7BA 3GLQA 1PF7E 3OPVA 2C5SA 1XQ9A 1SC3A 2ZGVA 1ZK0A 1KJWA 5IUJC 2FJ0A 1L4GA 2VOJA 2NGRA 1MJHA 2XMDA 1N9GA 2FYTA 3LUCA 3IURA 4E09A 4QGFA 1AX9A 1MCZA 1XLTC 4QVIA 1BWQA 3ENVA 2OV8A 2ZJ1A 2IOHA 3HN7A 4P22A 1OXSC 4TMYA 2VTKA 5D3KA 1I10A 1HK7A 2GAFA 2OP1A 3G7UA 4CN9A 1XSEA 5BR4A 2Z4SA 3QKIA 4HD8A 4Y2SA 3VAYA 4X8OA 1I3OA 4XYMA 2XUHA 3VU9A 5JNVA 2XUDA 3FY4A 1JHRA 3AFGA 1XDDA 4EYSA 1FQJA 1NVUQ 4OMCA 1E66A 1CF2O 3HB0A 5DE3A 4YV1A 4BFCA 4Z4IA 2IEIA 3L7JA 4MB2A 4BRZA 2O7SA 4W8HA 4QG7A 1CRWG 5D87A 3ZH9B 1C7EA 3EZNA 4UNIA 1UXHA 2BZGA 2EKDA 3R4VA 4XWAA 2IW3A 4DUZB 5FWNA 1Z0ZA 2RB5A 3GT0A 1I13A 3T9EA 1F9AA 4J4HA 1SC4A 1G7TA 3K4PA 5IJZA 1U9ZA 2OTCA 5SY6A 1BFDA 2VZ8A 2WYWA 4YNBA 1P1RA 2C5GA 2ZDGA 4CM8B 3UKJA 2C83A 1JPUA 1K2VN 2PKQO 1UMCA 3EUEA 3TLYA 2FE4A 4U0KA 1GSAA 4C88A 3R7LA 1OXTA 3BWYA 3O92A 1T25A 2L42A 3O8RA 1ZM3A 3EBOA 5C8ZA 3I9V1 1KXZA 3ROXA 1UPFA 2AR7A 4A5SA 1NMSA 5JR3A 2HA3A 2C7QA 3IR5A 3B6KA 3D64A 4K9RA 3JARA 1BN7A 1S8OA 3BXGA 2HTFA 2QX7A 2VAWA 2VH1A 4A92A 5M29A 3BRWD 5KAPA 4IJUA 4YP6A 2W6ID 4I1OA 2FCAA 2FPIB 3OX1A 4IEIA 2O2ZA 4HLUA 3ESCA 4DBVO 4EGAA 1OGIA 1CG6A 2W4IA 4GU5A 3PXEA 3HUDA 1SBTA 4RV5A 1JAXA 2RIRA 3TNDA 3NM6B 1UPBA 1V7ZA 5F3DA 4FW8A 3H87A 4KR7A 2K2QB 5C7YA 5IWAB 4PO8A 1E60A 2AVNA 2HA4A 2GJAA 5IKPA 4OBXA 4GLJA 3ZY5A 2QTLA 4HXGA 1JAIA 1CY8A 1JQ3A 2KM1A 2JIZD 2ZTLA 4YO7A 3WV4A 5JFGA 5K45A 4F92B 1HNNA 2ABWA 1PLLA 3QVLA 2M6LA 1X7WA 4GZMA 2PMCA 4CCSA 4IF4A 5IMBA 2IUEA 3U1BA 3EC2A 1FNBA 1S1CA 4X92A 5HEKA 2ERYA 3KQUA 2N1MA 4XLTA 3B1KA 3HB5X 1S02A 2FOXA 1ZUHA 1XRNA 1YI8A 2PS1A 2ZW9A 4M89A 4WHMA 4F2WA 1DX4A 5H70A 3F71A 3MGGA 4E3WA 3HDTA 4QUDA 4EIWA 4FE4A 5J1TB 2NU8A 5LQRA 3LKZA 5ALZA 1PEAA 2FDCA 4ZMBA 1E6MA 4G8DA 5FCDA 5P8WA 2ANBA 4NMHA 3RVLA 4MZDA 1Z2DA 3WGMA 3GRCA 1GTMA 1S2OA 1TC2A 3D5QA 4IHQA 4JSRA 1CY7A 2JVJA 5B2ZA 3GRKA 1M0TA 4NK4A 1LDYA 5T8KC 4NARA 3DL7A 1JUDA 3RYTC 1GT6A 2JJ1A 4O0MA 2P11A 2F1OA 3RNLA 3N59A 1J25A 1TT7A 3R6DA 4UFOA 3Q3HA 2WOJA 3KELA 1KY4A 1AKUA 4G4SO 4L9AA 3UMMA 3H4VA 2Q5CA 3NPMA 4HXEB 5DYWA 2JLWA 3J81k 3NBQA 3RHTA 2IUSA 3RT1A 4KLAA 3ZS9A 4LXGA 2XEDA 2ZRJA 4RVFA 1AZTA 1REQA 5SYMA 3ZQ4A 2ZM6B 2JH3A 4E1BA 5KX5A 5EIAA 4DLAA 1YQDA 4GKAA 3W5CA 2ZS8A 5E6RB 3QSYA 3ZWDA 3H97A 2A9KA 3H19A 4PCUA 4G1EB 1U7WA 4RKRA 4POOA 4ZOBA 1N3BA 1P61B 2PLFA 3ZVMA 4NBWA 3CTMA 3AU8A 1F8YA 3E81A 3HN2A 4BO6A 3MINA 5HXAA 2C4MA 3I0ZA 4CMGA 3M2TA 4KO1S 3WL5A 2YRFA 1P62B 3LLVA 1DVRA 1FTWA 3JD4A 2VHEA 2BEVB 1EUYA 2UZIR 5DGHA 3TLGA 2NAFA 5BP7A 2FI1A 4YB8A 5KDOA 3ADBA 1O87A 1JVSA 4ZAWA 4CTNA 3O4FA 5FQOA 2I6XA 3EDQA 4HBGA 1KS2A 4K2HA 3UUWA 2PUEA 4IJ5A 3I42A 3JV7A 2XNDD 1LSJA 3L1IA 4Z7NB 5GPBA 1GNRA 3RRBA 1K8YB 2BI4A 3SBOA 3H6HA 3LVFO 4QPZA 2ZRNA 3S2GA 4JQZA 2AN9A 3ISVA 4CWAA 1M2VA 3W5SA 4BECA 1Y1SA 1J2EA 5E9WA 1VPDA 3CB2A 5HF8A 1ZEJA 5KNLA 4ZTZB 1W5BA 1Z2CA 2NWQA 4ZT5A 3UK1A 1VQ1A 2O2HA 5MGBA 1EFHA 2UZ3A 1QP0A 1C1DB 3SXUA 4IQ0A 5FH9A 1AUPA 1A88A 4OQXA 1YMQA 1E1RD 1HKHA 1CFZA 3IE0A 4O25A 1VDZA 4DIMA 1EA5A 1TZJA 3WKEA 4KMRA 1RBMA 4IJ6A 3RIXA 4IUBS 3I9NA 4JLWA 2GCGA 2ODAA 2AEFA 3W0LB 3WV5A 3NPAA 4G1BA 1P5JA 1QZUA 2D0DA 3CH6A 3ZWPA 5JSQA 2A7XA 1V4NA 3GEHA 4ZXFA 3OU6A 3NUZA 5EHGA 5A0TA 4MR9A 3LX5A 3HSKA 3ILXA 1P0PA 4Q4CA 3DMRA 2NU7A 4BV3A 4P9NA 2WD7A 4YQYA 1QQ5A 3E0QA 4P4SB 3R6LA 4B3IA 2PNFA 1JDUA 3K72B 1C9KA 3TNFA 5EQFA 4NOJA 3LPDA 2H1VA 2AKEA 5DNCA 2J0EA 3ZBTA 5JZSA 4P1ZA 1B93A 4RXTA 4ZAVA 1N2BA 2DWUA 2FN8A 4BVAA 4BCDA 2GHIA 5IFKA 1MX9A 3U39A 1M6YA 2Y4NA 2X9VA 1B6SA 4GEGA 2BEWA 4H31A 4Y6SA 5EE3A 1J9GA 1N2CB 3RK0A 4E51A 2HC9A 4LIPD 4O2BA 4C08A 3QQPA 4DNOA 1NW8A 2ZAGA 4G1MB 3TIVA 3I72A 4MWCA 4PC1A 4IPTA 3KVRA 1CJUC 3RU2A 1TU3A 3W1EA 4EENA 1N8NA 5F4BA 3F5DA 2ZKIA 3AXTA 2SCUA 4TZ6A 4WY8A 1S7GA 3VPDA 2Q9CA 2R1ZA 3T7KA 3W4JA 2CLOB 2VUHB 1MXHA 2OBLA 3HFSA 2JFYA 1DI0A 2JIOA 3NHMA 2A5FA 3B1JA 4KO4S 2YASA 2Z98A 3OM1A 3V7FA 3T38A 4AURA 1I8TA 2ZROA 3RIGA 1AXGA 1YACA 1JJVA 3TL2A 3C4JA 4B40A 1O95C 2FEAA 4QXQA 1ZHHA 2EQBA 2RHHA 4L16A 4IH4A 4IOLA 5JYEA 3JQPA 4UE2A 2B5WA 2GETA 3N2GA 4DAEA 4E6EA 1MGPA 3EC7A 3PTAA 2C07A 1NP6A 1D1QA 2I8AA 1GV1A 2VDWB 3D8RA 3EMVA 3HA5A 4IZOA 1QYDA 2HQRA 1T15A 4AB1A 4W5RA 1YCFA 3L06A 2PPVA 3IUEA 5ES3A 5KYXA 4DQ0A 2BFCB 5DFAA 3RYHB 2PFGA 3H6GA 3VYWA 2Z2JA 5EZSA 4PHFA 2Z6QA 4HB0A 3FROA 4EARA 2R6CA 4HAVA 3VOAA 1QLWA 4FIZA 3PFIA 1PTJC 1AT1A 1K5DA 5CTAA 3FFTA 3F9RA 3LBFA 5KINB 4U2GA 1U5CA 4K0RA 1IL0A 1E2HA 2YXPX 2O0JA 3AY3A 4M1KA 2CLKB 2DQ4A 5EFZA 1IY2A 3CLTD 3GWGA 1MAAA 3CJRA 3P2IA 5BSEA 4M76B 2IRWA 1D03A 3NYIA 4QYWA 2MOKA 1Y89A 3HY4A 3KJEA 1Z83A 5ISMA 4OBBA 4C7XA 2ORWA 1Q0QA 2NSYA 2EZ4A 1C4KA 1LPPA 1VG8A 4JLVA 4MYUA 3KTAB 2YDYA 1L8XA 2OEPA 3JVDA 5IDQA 1G3UA 3RAFC 4DQXA 3EIEA 1QX4A 1VYUA 4OHFA 5FORA 3I32A 3DFKA 5JQGA 4AJHA 3E58A 4JC8A 3CNOA 5K01A 2N9UA 5BSKA 1AF4A 1CE8B 2Q6TA 1TQ8A 3DQPA 5IH3A 1OFGA 3PQ7A 4EB3A 3UW1A 4PO9A 1J33A 4GBED 4U7FA 4DLVA 3RYCB 3L4JA 2UZAA 4WCFB 4CM8A 3OIDA 1WDMA 4GKVA 5K0NA 4Q3AA 3AL2A 1TVKA 2Q3DA 2WTAA 4LDQA 4G4GA 1WZCA 4FS8A 5BN3A 1OAKA 1W87A 2QUKA 4JUDX 5CFOA 3KT0A 1T0UA 2A0WA 3AT1A 2IYWA 2JKYA 4E0BA 3OQVA 5I7AA 1LI4A 2R87A 3PFFA 4E6PA 4YRAA 1RACA 2POQX 1XNRB 3DXFA 4EW2A 3EW7A 1SG9A 2VHUA 1KJZA 1ZCAA 3I9V6 3SBDA 3CPEA 4MJ3A 3VTFA 3HDJA 1EBFA 3CUTA 3B20A 4I9NA 5KYTA 3WNVA 3WYGA 1V5WA 3WB0A 4TXMA 1MOPA 1YVDA 3SVZA 4BMYA 2OK7A 2XAUA 4Y0NA 3HEAA 2FVYA 4RZIA 1MB4A 4HLUC 1Z0SA 1X80A 3URMA 3VR4H 4J0DA 4YVFA 3R5TA 3OKPA 4IOMA 1UC8A 3N39C 4IV8A 1XB2A 1BCRA 1TT5B 1CIVA 4G6ZA 1NULA 3ANYB 3DOEA 3Q0EA 3BVPA 4GH5A 5HUJA 3IBTA 2V5AA 3WL3A 1MJGM 1UOQA 3L92A 5JMPA 4AZ0B 4DFDA 2HHLA 4ML3A 1U94A 4FSXA 5LL6P 3Q88A 1RZVA 3H1FA 4NOKA 4F9TA 2HT1A 2IHJA 2ZBPA 1WPQA 4G65A 3S2YA 2CKMA 4E94A 3JVIA 3NHFA 4MUAA 5DMHA 2CD7A 1GG9A 2XLCA 3ZQJA 1WMBA 4X6XA 2GDJA 3GXBA 4BLQA 3C3BA 4MS3B 2AW5A 3HK2A 3DT8A 4H9GA 4AL4A 2P30A 3H8WA 3HYRA 5C8DA 3VHQA 3W5AA 2JAOA 1J22A 1OI7A 4IKEA 2WSLA 2ZSIA 1QV6A 2FF7A 2FR8C 3KTOA 3OO0A 2OSBA 4MGKR 5BNFA 5KUTA 2DR2A 1JDJA 2J31A 1R9JA 2Y92A 3EULA 3IEPA 4PTYA 2BEUB