1W2HA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with azidothymidine monophosphate (azt-mp) (2.0 a resolution)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
190
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE TMK
publication title The crystal structure of Mycobacterium tuberculosis thymidylate kinase in complex with 3'-azidodeoxythymidine monophosphate suggests a mechanism for competitive inhibition.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 73
structure length 190
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w2hA00
1Z2CA 2FH5B 1J70A 4I4LA 4X8LA 1W36C 2C04A 3FFAA 2C5LA 4K81B 1Y63A 4QHYA 3IIKA 2XTZA 3PUWA 5JS8A 2YYZA 3LX8A 2IC5A 5DHFA 1G5TA 1JR3A 1F2UB 2ZYTX 3TRFA 1RPZA 1G7RA 1T6NA 4ZV4A 3J81k 1X1RA 2V1UA 2F3RA 1G7CA 1MV5A 2WWGA 2ZAMA 1S9DA 2ZAOA 4UXJA 2A3RA 1U99A 3G5UA 3CH5A 3GQBA 2GJSA 4DB2A 1E0KA 2EFDB 3OFNA 5BQ5A 4V0MA 1AGRA 4B74A 3TE6A 3EPJA 1E96A 5LD2B 4O2RA 1XEWY 1A5TA 1X1SA 3E70C 4M1KA 1GDDA 4LSGA 4QGHA 3WP0A 3GLIE 1G3QA 1ZVQA 3IO5A 4JL5A 4II7A 4WOPA 4OHYA 4CEJA 1XZQA 4MA4A 4AKHA 1E2GA 3LFUA 2XJ9A 1IJFA 2VYFA 3RANA 1GTVA 1T3SA 3RLFA 5FOUA 4PC6A 3V00A 3TAHA 2FSFA 1DOAA 3NBZC 2FJUA 1HEIA 3P27A 4R2HA 4BFTA 2BM1A 4MDFA 3WNDA 2P5TB 4KFSA 1E2LA 1Z3IX 4D0GA 1NVVR 2HJVA 3B1ZA 1KGDA 2GJ8A 1FQJA 3GLHA 4K8OA 4BLRA 3SBEA 3U4QB 4MITA 3VKWA 1OXUA 1R5BA 4E5UA 3IBGA 2PX0A 5HKKD 3UATA 3MWLA 3SYNA 3DOFA 1QRAA 1W36B 2JJ2A 1E9RA 1ZC3A 1NBME 1J7KA 4LJ4A 3M6AA 1U2RA 1IXRC 1VHLA 4URUR 3RRNA 1XJCA 3SHWA 2RGEA 1WE2A 3GJ8A 5L3VA 2ZR7A 2O8FB 2BCGY 3K9HA 4R71A 1H8ED 4LYJA 4RZUA 3AKYA 4P31A 2QPAA 3RS2A 1ZUHA 1R5NA 5J4LA 3MRSA 1E94E 4MKGA 4Q5IA 2GXUA 3QKUA 3KJGA 3W3ZB 1IN7A 1YZTA 1TTTA 4BFZA 4NU0A 4DT1A 2VO1A 1VG9B 2VF7A 1YQTA 2CK3A 1V5WA 3TIFA 3AEZA 3F8TA 5TB5A 4DCNA 5F9HA 3I72A 4MYCA 1SXJA 1G6OA 3QPVA 1N6LA 3R8FA 1VCIA 3AQ4A 5IK2A 2VSFA 4HAVA 4LRWA 4B6FA 4QC2A 4NYMR 5DI3A 1UDXA 1KKLA 1KSJA 2F1HA 1JALA 2JDID 4QNRA 4HI0E 3GJ7A 1A4RA 3QEJA 4IDQA 4C0JA 5FUYA 3K53A 2IYUA 4B3GA 2J7PA 2E9SA 2HDNB 3K8YA 1TU3A 1Z0DA 2Q3FA 4PHFA 2VRWA 3A4LA 4PPGA 1CLUA 1QBKC 3A8TA 3H86A 5FTJA 3LBIA 1BIFA 1HURA 1OYWA 2Q6TA 4IOJA 1BS1A 1FW6A 2F6RA 1NJGA 2I1VB 3CR7A 3P4XA 4OBEA 1NN5A 4HLDA 1UAAA 4QNMA 3P32A 4TYYA 3EC2A 2AN9A 3M0EA 1AK2A 4NCJA 1T0HB 4JLMA 2AWNA 2QSYA 4MYUA 1OKKA 4P4SA 3MCAA 3UIEA 1W0KA 2CMKA 2WM9B 1E9SA 3PFIA 4DLWA 2JIZD 1XTKA 1BYUA 3B1XA 1S0UA 4BFSA 3QVUA 5JWRA 1ESMA 1NKSA 2CDNA 2CL7X 1IN8A 2HF9A 1OF1A 3C5CA 3FVQA 5DYIA 3THXB 3OIVA 2VBCA 3CONA 1IBRA 2IYYA 2IYLD 3QKTA 4DBLC 3QI2A 2FF7A 4JSTA 2OCBA 1EX6A 4B44A 2O8DB 1NMYA 4EFLA 2O8BB 2C8VA 3H4MA 3GLFB 1EGAA 4ESVA 4CZ2A 5J40A 1R10A 1KK2A 2UKDA 3S1AA 4EQ6B 4GMDA 5FI0B 3I5YA 1O87A 4D0LB 5JRJA 2ZE8A 2W2XA 2HYIC 4TQAA 3RSLA 4B3XA 2ZI4A 5C46F 4M21A 4UNNA 4ACBA 1CR0A 3Q5DA 2R8RA 4KSCA 5H70A 2UZIR 2KSQA 1Z2AA 1WP9A 3FKQA 4BLTA 1Q1BA 3IQXA 1ANKA 2ONKA 3UXMA 4DHEA 3HU3A 1TADA 4KO8A 3ZVNA 1NVXQ 1VCMA 1DAFA 1QVAA 4Q19A 3WYFA 3LH5A 4PTLA 1KI2A 2QM8A 1AQYA 2RH5A 4GPTA 1E32A 1K5GA 2QAGA 1G8PA 3OHMA 1M7GA 4AC9A 1G6HA 4TMTA 1Q20A 4EPWA 4TYWA 3P20A 4V02A 4TZ6A 5B2ZA 2WJIA 4EDHA 2ATVA 5C2JB 4WZAE 2QTVB 3HPQA 5A0FA 1RRFA 2QMHA 3X1XA 4YMTA 1NLYA 2ZE6A 8OHMA 1A2BA 2W00A 4LBZA 3ASYA 4URZR 2QMEA 4PC1A 3CRVA 1Q3HA 4HDCA 4TLAA 1KMQA 3BB1A 4JJZA 5BN5A 5KTYA 4BE7B 5L3SA 4EPXA 4LC0A 4JBYA 5G3ZA 2JLYA 2AR7A 1LB1B 1MR3F 5AJXA 3PUVA 2IS2A 4D81A 4M1TA 4A2PA 5DGXA 2ZQ5A 1P5ZB 5JLJA 1XJQA 4URXR 3QKRA 3NIBA 4XVRA 2ZROA 1KI1A 1U8ZA 5FUWA 2IYXA 1Z22A 2EFGA 4NBSA 4V0OA 3C8UA 3AP1A 1CU1A 3KUDA 5K8IA 1FQKA 1RRGA 1ONBA 4KHZA 2IWRA 2NZ8A 4D82A 1QHNA 2WVJA 4NP6A 5GJVC 3NWJA 4AKIA 4Q7LA 2CNWD 4GNKA 2Q9AA 4OQLA 3CRQA 4KU4A 4RVCA 1IJEA 2WSSA 4HB3A 4B3FX 2IS1A 4JLBA 4PC3A 4WBSA 2BMEA 2EQBA 2V8OA 3NG1A 2FPKA 2B92A 1FL9A 1DAHA 2CCKA 3FPAA 2P0EA 4PAMA 3VR2A 3ZZTA 3LNCA 2G88A 4DLSA 2BMFA 3OEHD 5JEEA 2JLVA 5CK4A 1NY5A 2XXAA 1F2TB 4M22A 3IO3A 4US1R 1Z0FA 4V0NA 1VYUA 4KVAA 1E9EA 1U0LA 2Y8EA 3HJNA 1DAEA 4ITRC 3SE0A 5FBVB 1AKEA 4R9UC 3JZAA 3BS4A 4IOMA 2BM0A 4RY2A 1II0A 1NF3A 1MABA 2V6JA 5DH9A 2IEZA 2OM2A 2GTPA 3GEHA 3TW8B 4D6PA 4L15A 4V0ME 4C9BA 1QHXA 5LDDC 2OCYC 3EAQA 4XVQA 2UZ3A 2HT1A 4UJ3A 4YC7A 1F3OA 1JAIA 1R8QA 1Z6TA 1CP2A 4LBVA 5FPTA 2FZ4A 2ZI9A 1M8PA 1JJ7A 3DKPA 3QG1A 3DMNA 1QZXA 4KFTA 2WMOB 4RFSB 2GAOA 521PA 4DUGD 2JLUA 4I81A 2Q0HA 1DG1G 3TBKA 1HE1C 2QE7A 2PEZA 1EWQA 1OSNA 2J0UA 4KI0A 3U5ZB 2P3SA 2R6DA 3WRYC 3PEWA 2ZYUX 4FN5A 5DN6A 1QHSA 2QI9C 1YZQA 2BWJA 1TL7C 2ZRCA 3FFBA 2GEUA 1SGWA 3CUEF 4TLCA 1KMHA 1KI4A 2W2VA 2BBSA 2OLJA 4POAA 1P3JA 4TQ9A 4BLSA 3KXKA 1DO2A 1FUKA 1KOFA 4OHXA 5AR1A 4I1VA 5BN3A 1DEKA 1OH6A 1ZM4A 1XTIA 4DIEA 2QEQA 4AI6A 4E22A 1R8SA 3NC1C 2ZRGA 1N6IA 4JLJA 4DCSA 3IHLA 2N1BA 5D3MB 3TUJC 4BZQA 3KKPA 1OB2A 4Q4AB 4CT4B 1UBFA 3Q7PA 1ZUNB 4B33A 2A9KA 2CCJA 4QHTA 3R9XA 3NVAA 3PV0A 1P73A 4W5WA 1S1MA 4HAXA 3W5JA 1OV4A 3L82B 1R0WA 1T3HA 1YHNA 3WYGA 4OI2A 5EUMA 2JAQA 5EZ5A 1OFTA 1SHKA 3KB2A 3MFYA 2P2LA 4BRWA 4DSTA 3TLXA 3NBFA 1WF3A 5GVRA 3ZQ6A 2GHIA 1US8B 4Q01A 3VR5A 1SXJE 2DFKB 4UXIA 2GWHA 2OXRA 5L3RA 3IEUA 4NMMA 5FI1B 3V4RA 721PA 2REBA 1KJZA 1C9KA 4NYJQ 4CYMA 1GZSA 3KQNA 2VTKA 1QG4A 2WAXA 1QHIA 1QVRA 1ZM9A 4B75A 1AZTA 2IA5A 1ZP6A 1LFDB 1XTSA 1S9HA 4C7OB 1N0UA 1KNQA 2JATA 3FGNA 3C15C 3QG5A 3KQHA 1N6HA 2QMUA 2OILA 1JAHA 3QKSB 3GCGA 4NKRA 4P3YA 1W36D 4RD0A 2HLDA 5L3QB 5B57C 4KBFA 1BMFD 4Z8XA 4AD8A 2ODBA 3GFPA 2WJGA 1G8GA 3L43A 4JLDA 2HXYA 1KDOA 3BD9A 1I4TD 4IEIA 2FDCA 2CHQA 1EFCA 2GJAA 3LRPA 2QSZA 5AK0A 4A92A 3EIHA 5HPYB 4DC9A 1S1CA 2C77A 4XSGA 3QVVA 3A6PC 4OL0A 3L0IB 4A0FA 3V9PA 2HF8A 3Q85A 2NZJA 3U6KA 2ECKA 1H8HA 3HPRA 4JBXA 3ICQB 4A2QA 5GJBA 4LV8B 4MQBA 4EFMA 1MOZA 3CRRA 3TQCA 1YR7A 4JKYA 1KI3A 3P4YA 2B6HA 2YNMA 2AWOA 1S96A 3THYB 4A36A 1KY2A 1NIJA 3TKLA 5G53C 2ZYWX 2QTHA 2WBLC 1VDZA 4BASA 1Z0IA 1JJVA 2DY1A 2PMDA 2WJHA 4NCNA 4A0GA 3OEED 3KJEA 5G40A 5JCPA 4Z8YA 4ZIRA 3WBJA 1U0HC 4DSUA 1BYIA 3W3AA 4JVSB 3RS5A 2RGCA 4TMVA 3SJBA 4TLDA 1WRBA 2XB4A 3SS8A 1XNJA 2D2EA 3T06B 1XPOA 3BIFA 4B47A 1KYIA 3K9GA 4C0KA 4Q1EA 3AF2A 1QF9A 4PXAA 4OI1A 2ZXUA 2A2ZA 2XSZA 4ERNA 3ZS8A 1WB9A 4KVGA 1LS1A 3EZ9A 5FTKA 2O8EA 5F3WB 3CNLA 1L4UA 2EW1A 3KX2A 1QHYA 2F43B 1EK0A 1EFRD 3AM1A 1G9XA 3KXLA 3OE7D 1G3MA 4OK5A 1RE0A 1NL3A 3QF4B 5GJCA 5FPSA 4B2LA 4N0EA 1U0JA 4PHTA 4TL9A 5KNBA 4TN1A 1CR1A 4OI4A 1MO5A 5KSZA 2KBEA 2ERYA 3GJ0A 1VG8A 1ZC4A 4WZBE 1SVKA 2FA9A 5FH9A 2MSDB 3GD7A 4O2LA 4BFUA 1E2IA 4OQNA 3QQ5A 1KO8A 1PLKA 1KK1A 2QPTA 2ZJ8A 5J5CA 1GUAA 2GZHA 4B3CA 4Q4HB 3CRW1 4YQFA 4WZ6A 2ZJ2A 2KWIA 4QHSA 2X77A 1JNYA 4MGKR 1YRBA 3A58B 1P9WA 3BFXA 1KI7A 3CIOA 4AG5A 3FHOA 3VAAA 3R20A 2WMNB 2QRNA 4IFBA 1G41A 4LK2A 5FL7A 4LX0A 4FMDF 1D8TA 2ZSAA 2VQSA 2V3CC 4ZDWA 1GSIA 1W44A 3KUCA 5JMTA 3OAAA 1IHUA 4PPNA 4ZCLA 3RHFA 1FX0B 4A8JC 2BKEA 1CR2A 4ASUD 1VHTA 1R0XA 1TEXA 2OFWA 2W6ID 3O8BA 2VP0A 4MH0R 1CF4A 4Q4LA 1GAJA 2RCNA 2PZFA 3A4NA 3TR0A 2HT6A 2GVDC 5BYKA 1N6RA 3VTKA 4LCBA 1JBKA 1G291 4C0BA 2D2FA 1P2VA 4N1AA 4BEJA 1DVRA 3EASA 4TTPA 3K9NA 4F7WA 2QZ4A 3P1JA 2ZRLA 4NH0A 1K5DA 3EXAA 1RW4A 4QOSA 4GOXA 2Z5FA 3AV0B 5EXTA 1W46A 5DIFA 3WY9A 1RYHA 3FOZA 2VLIA 3QIAA 4M8NE 4Q9KA 1I2MA 2UVQA 1LW7A 3ZGXA 3NBYC 4A6XA 5KNDA 4FMDB 1YZGA 1NLFA 3KFVA 2D06A 3DDCA 2IX3A 4BWYA 3PJRA 1VCOA 2IXEA 4AY2A 3SJZA 4DKXA 1KTVA 4S2EA 1OHHA 2FGKA 3LX5A 3PR1A 2WZQA 2IHYA 5BW8A 1SVLA 4TLEA 1NIPA 4A2WA 4PQRA 4DVGA 1COWD 3KKOA 3QE0A 5EE9A 4OHWA 4Q7JB 3T5DA 2ZI6A 4LHWA 1ZNZA 5DNYB 2GA8A 1LV7A 4LY6A 1FOEB 2IWHA 1M7BA 4F92B 4TTRA 3IEVA 4B35A 3AVQA 4NYIR 3L0PA 3U60B 4LPSA 3TAUA 1N0WA 1UDWA 4OI0A 2G6BA 4A8JB 1LNZA 4URVR 4BFVA 3ONWA 1CJTC 5AJVB 4OQMA 2ORWA 4DDUA 2VP4A 1TUEA 3ZQJA 1HYQA 3VU9B 4D4JA 4OK3A 1YR6A 2PCJA 3HWSA 3OIYA 2VPPA 1EFHA 4LJ8A 2IS4A 3GJ3A 4H9GA 4LPKA 4JLKA 2RAPA 2OFOA 4LJ7A 3SNHA 5FUVA 1LY1A 5E95A 2G1JA 1GM5A 2WJJA 4DLRA 2Z0MA 1J8YF 3CNOA 3IIJA 2GBLA 1KNXA 3LY5A 4G01B 5KDOA 3KQKA 1E2HA 2GCNA 4PO8A 3VR4A 1UJ2A 3EZ2A 1EXMA 2ODEA 2YWEA 2A5GA 2XOKD 5SZKB 4R7ZA 2E1RA 2IUTA 3QF7A 2JLSA 1XPRA 1DARA 1T91A 1AZSC 5UKDA 3FMIA 1NSTA 4I99A 5FTLA 2FEOA 2NOAA 2ZUDA 3CRMA 5C4GB 2G83A 4GI7A 3I5XA 3BE4A 2EVWX 1ZNXA 4JLOA 5KU1A 3K0AA 2G0TA 4NL4H 3JZMA 4C0QC 4L8GA 5JJLA 2X8AA 4RD2A 4YDSA 5B30A 3A1TA 1W4AA 3CM0A 2BKUA 5HKKA 5DI9A 1ZNWA 2VHUA 2ORIA 1Q0UA 3CPJB 2ONJA 2AFIE 2WJVA 1DS6A 1XXHA 3ZH9B 3CX7A 2ERXA 2BC9A 3GLIB 1NKTA 2O8CA 4LYHA 5F98A 3GJ4A 2HV8A 3L2OB 1C4OA 2IYTA 4Y0VA 2H8KA 4KFUA 4FWIB 1X6VA 3ZDQA 4D4MA 4M9SA 1JECA 4MKIA 5EXSA 2AK3A 1M74A 3UG6A 1XTJA 3K0EA 3OFND 3ICEA 4Q4JA 1H8EA 1JB1A 1KK0A 2FSGA 4JKIA 4XTRA 4ZI2A 2J3EA 5D3MA 2P6NA 4CEHB 2GK7A 1NP6A 4IEEA 2YZ2A 3TVDA 3KJIA 1MRSA 1OJLA 1KSGA 3U3RA 3BJIC 5G3YA 3RC3A 3QY0A 3M1IA 3QENA 2R44A 2WPDD 1KO4A 4EPYA 4Z54A 3GLGA 3SN6A 5C1BA 3ZVLA 2HCJB 2EWWA 2JA1A 2NGRA 2Z83A 3F3YA 4LJ5A 2JDIA 1KO5A 4U02A 3T61A 2RB4A 3K0SA 4MGIR 3AF0A 4YMVA 1A1VA 3VR6A 3OF5A 1CJKC 3T1TA 1FTNA 3CNNA 4KAXA 2EWVA 3SU8A 2PH1A 5JI2E 1UKZA 4MUAA 4HLUA 3NHAA 1VG1A 4PSAA 4Q9JA 3D31A 1LF5A 5KDDA 5CYOA 2V54A 2KJQA 3I61A 2BDTA 2WTUA 3PITA 3SFVA 2YOGA 1N6OA 1YKSA 2AD1A 2IHBA 4AK9A 3N5CA 1EG7A 3C4JA 3QOFA 3AP2A 4QRHA 4NONA 2ZE5A 3LBHA 3VKGA 3UPUA 2JIZA 4L5BA 4BQSA 2OAQ1 1W49A 2VEDA 3MJRA 3QNUA 4B3DA 3EW9A 2GEDA 1FTSA 4GT1A 4QGGA 2FPLA 2PZEA 2IUUA 3TH5A 5KSPA 4PQFA 2CBZA 4KYIB 1P2SA 2CEAA 2ZRKA 2JASA 4GOKA 3NC0C 4TYPA 1XCPA 4RSGA 2Z4RA 3KKMA 1XP8A 1GRNA 1VECA 2J46A 1FNNA 3FWYA 1DE0A 2IK8A 2IT1A 4MGYR 4M1MA 4IVPA 3UG7A 1T8TA 1YZLA 4ILEA 1XEXA 5AUQA 3SZRA 1X86B 3FB4A 3ZS9A 1T8UA 2QL6A 2DFLA 1QHHB 1VKJA 2VHQA 1LTQA 5JSZA 4DWJA 4C0AC 1XD2B 1YR8A 5K8LA 3AVVA 2W6JD 1B23P 2QAJA 2F55A 2D3WA 4M9ZA 1DPFA 4NE2A 1KI8A 3IDQA 3RRMA 2REOA 3SI7A 3DZ8A 3U44B 1HQCA 3RRYA 1OXXK 2XTMA 3OIUA 2VIIA 1VYVA 2RHDA 1G21E 1L2TA 1ZIOA 3M4YA 2CLCX 3THWA 1E9DA 1OIWA 2ZETA 2H5EA 1RJ9B 3QJYA 2YVUA 4LJ6A 3ZIAD 4ZCMA 4QBGB 4C0HA 2GJ9A 2F1RA 2OV2A 3RS0A 4RD6A 2YC4C 3Q72A 5K8TA 2WKPA 1WDTA 3RS7A 3TSOA 2J41A 3UWOA 1OKKD 1OIXA 5FPKA 2GZAA 1G5RA 1W5TA 1XMSA 3BXZA 3I92A 4CRWB 2QBYB 1SKYE 3R9IA 3PUXA 4MRNA 4PPFA 5A4JA 2GCOA 5M04A 121PA 4MUBA 4W7SA 2O0JA 4QM7A 5TDHA 1XMVA 1U98A 2ZREA 2FEMA 3TMKA 2ZPTX 4OJKA 1P72A 3AVOA 2REXB 3PXGA 5HZHA 5CDFA 5JEDA 2ZR0A 4KXFB 3PUZA 2DPXA 3LA6A 2FN4A 4LWZA 2ZEJA 3BH6A 3KQLA 4Z51A 3FMPB 1G8HA 2QP9X 4JZKA 4B32A 3LW8A 1SKYB 1Z6AA 1YE8A 4BZXA 4PANA 2D7DA 5EE0A 2PEYA 4FCVA 3DKVA 3L0SA 3DHWC 2GEVA 2OEPA 1YZUA 4OHVA 3BK7A 1CEEA 2J9RA 4Q4HA 4GDFA 3AVXA 1U9IC 2IYVA 1T3LA 4CW7A 4V03A 2JLRA 4PR0A 2Q9BA 3GMTA 3WRXC 4LC1A 2PL3A 3CX6A 2VSXA 1R7RA 2QENA 4PHGA 1N3BA 4F93B 3I4LA 3CZPA 3U3MA 2CL6X 5GVSA 2H17A 2GVZC 1DAIA 4LDJA 5ANRB 1E4VA 4DJTA 2R2AA 4IVRA 3DO6A 5JFGA 5BYJA 3QXHA 4M0LA 3DM9B 3B7GA 3AB3A 3MAAC 1D6JA 4TMWA 1F60A 1XCMA 2FNAA 4CEIB 1GG2A 2CNWA 2B21A 3ND8A 4HZUB 4UNRA 1E2PA 3SOPA 2OBNA 2Z6VA 1ZBDA 1KZ7B 4UNPA 1E2MA 3WHLA 3A4MA 1Q1EA 3C7KA 4JVLA 3HR8A 4LZZA 2FU5C 3B6EA 4XWAA 4B76A 3NH9A 4LBWA 3FMFA 1X3SA 3AKEA 3AUYA 1A2KC 4XTCS 4B48A 5CB6A 2C99A 2C9YA 3CW2A 1ZRHA 1ZM3A 4RKEA 5EXXA 1KJWA 2BBWA 3QEOA 5EP1A 3TUZC 3U61B 3EPHA 3SR0A 3MWYW 3IPYA 2XTNA 2D7CA 2GETA 1PV4A 4CF7A 3LWNA 1ZCBA 3ADBA 2PBRA 2ZRJA 3K0FB 2L0XA 2ZI5A 4LHXA 4LI0A 2NO7A 2YWHA 2JCSA 2ZR9A 4FW9A 4XWOA 4B6EA 2DYKA 2VHCA 3VMFA 5EP2A 4FXPA 1E2FA 2ZRBA 1IY0A 1S2MA 3LAWA 1B0UA 3ASZA 5F2EA 1JR3E 4ZDKA 2H16A 4XD7A 4PPQA 1II8B 3CF0A 2TMKA 4FWTA 3FE2A 1GNPA 4IW3B 3EC1A 2FMXA 4IFEA 2XNDD 3L8ZA 4KLZA 5H1YA 4DUGA 4HUQA 4TT3A 2R65A 5KSOA 4G5RA 5KUTA 1Q21A 4QKQA 3LLMA 2CJWA 2BEJA 2IYQA 1MO4A 1YZKA 3R7WA 3AF4A 3AVTA 2Q3MA 1VCNA 1VTKA 3SYKA 4M2LA 3NH6A 2OO7A 1AS2A 2H92A 2BJVA 3MLEA 3A1UA 2NO9A 2NMVA 1CS4C 2JLZA 2EYUA 1XX6A 3KTAA 4D80A 5DISB 2WOJA 4QG7A 1OFHA 3N2IA 4Q9LA 1E69A 4MRRA 3U6BA 1TQ4A 1OIVA 2ODNA 3HR7A 1XFAA 3AH8A 3TUIC 1XXHE 1W47A 4S35A 2ZI3A 2VHJA 4ABYA 2FFAA 2WHXA 2GESA 3QSYA 5CB8A 1KI9A 1HA3A 1GL9B 2JJ1D 1XB2A 1F2UA 2IXFA 4AKEA 4Z1MD 3GLHE 3FHTA 2QU8A 2GAAA 2IEYA 4DEYA 1WCV1 1SXJC 2J5XA 3G82C 1GITA 1W48A 2ZSEA 4X8OA 1UBGA 4URWR 2ZUCA 3DL0A 3K0CA 4JLNA 1G18A 5D3QA 1KK3A 2FWRA 3H2YA 1F48A 1NVVQ 3I73A 4UNSA 2YOHA 3MWJA 2H57A 2FFBA 4NZYA 3A1SA 1XWIA 3HU2A 2KB0A 1Q1QA 2OBMA 4EUNA 2GF9A 4GZMA 3GLHB 2AHOA 4ON9A 1TQ2A 4Q1BA 4RD3A 421PA 1OE0A 1H65A 1UPTA 1KI6B 3GLGE 4W9MC 1JR6A 2R6GA 1HV8A 4M9QA 2R6CA 1ZU5A 2X2FA 1GILA 1S8FA 2A5JA 3WNBA 4HYYA 1E2NA 5TMPA 2WWWA 5J47A 2J45A 2FG5A 3U4QA 2FOLA 3C41J 2W83A 4G5SA 1IXSB 1N5LA 4G5GA 4QXAA 4TWZA 4Y0AA 3VNUA 1MO6A 1EFTA 4C0SA 4E09A 2Q9CA 5IT5A 3MUFA 4MRPA 4CIDA 1GL7A 3TSWA 2ZITA 1D9ZA 1UADA 2AFHE 1AN0A 3WMGA 5KOYA 4DT1B 5SZHB 4QJ3A 2H1LA 4RZ2A 4DDVA 1BMFA 2OAP1 2JJ8A 1K6MA 2VL7A 4HLCA 4M4SA 5EZ6B 5FOTA 4A82A 1XPUA 4LHZA 1ZMXA 1UEJA 3IKJA 4NYMQ 4D4KA 1SXJB 4RFVA 4TTQA 4E07A 2ZRPA 2O8FA 1RRCA 1E99A 2IUSA 2ZU6A 2EFEB 2GXQA 2ZRDA 5HE9A 4DLVA 3ZD7A 3U3KA 3K09C 2BMDA 5KDLA 3BORA 5DI3B 2VHTA 4PQYA 2OESA 2W0MA 1HQYE 2P5SA 4TSFD 3BH7A 1ZW6A 4WW0A 2ZSFA 4LHYA 4A0HA 1AIPA 2XAUA 4NHOA 3VNVA 2EYQA 4DIDA 1W0JD 4BFYA 1OFIA 4HAZA 2QA5A 4QGFA 1UKEA 2LCFA 3HYRA 3RAPR 4A4DA 2WJYA 2LKCA 3O8RA 5P21A 4RZ3A 1UFQA 3QBVA 4L16A 1TPZA 4DCUA 3U7GA 2ZANA 1J90A 3OEEA 2AKYA 4UQOA 4WAUA 1SVMA 1NBMD 4ESHA 4IXNA 1W2GA 3DEFA 1NN1A 3EWAA 1Z06A 2QAGC 3KKNA 4P4SB 1A82A 2IW3A 4DEXA 4ZCIA 4E03A 2F7SA 2ZRHA 1PLLA 4FCWA 1HUQA 4F4IA 2HLDD 1KSHA 3A1WA 3ND9A 1EFRA 4HAUA 2XJ4A 2A5DA 3OE7A 3ZZ0A 3W5IA 3TW4A 3EA5A 1FFHA 5ELXA 1Q12A 2C98A 4CT5A 1N0VC 5FBLB 2YINC 5KPDA 4RKFA 1IM2A 1KDPA 4ZPXA 4AYWA 3JVVA 2DFTA 2IYZA 4PC2A 3LW7A 1LF0A 1E0SA 2NG1A 2ZJZA 3NDBB 3ZLJA 2DWQA 2X2EA 2FPMA 3X2SA 5LPNA 3GP8A 1OH7A 4M1YA 3S1AB 2RGNC 3I32A 2NPFA 3W8NA 1DELA 4HUTA 5FFMA 3THXA 4TMZA 3FKSD 4D2IA 3KB1A 1CR4A 1A7JA 2A7QA 1NI3A 4BUJA 3WBKA 2WICA 2IYWA 3IUYA 2G3YA 2RHMA 1M7HA 4P4UA 3EA0A 5BN4A 1OLOA 1CBUA 3WNCA 2O8DA 2O8BA 4YXWD 3K9LA 1KKMA 1W4RA 2HUPA 1DBSA 1IXZA 1XU4A 2IBMA 3D8BA 3IHWA 5J4HA 3GLFA 3CH4B 2PJRA 4EQ6A 4HATA 4Q02A 2WOOA 1RYFA 3BRWD 4JT4A 4RD4A 1RJ9A 1NN3A 4MKFA 1NMXA 4I1SA 4PC7A 1E0JA 4PZLA 1J99A 3WHKA 2QAGB 3SJAA 4BECA 4EJSC 2W2TA 4ASUA 2P65A 2CLSA 2NO6A 1FP6A 2A78A 3PIRA 3QXXA 2EFHB 2N46A 2QT0A 5JZVA 3AGQA 3LLUA 2ZJ5A 5JJKA 4KBGA 4PO9A 1UM8A 2NTYC 1U8AA 4MKHA 5KYKA 1TF2A 4X8HA 5AUPB 5E7MA 2OG2A 3RWMB 4PZYA 1OYYA 2CHVA 2X1VA 1E1RD 4QFMA 3EZ7A 4KLNA 1EWRA 5IRCD 3PCRB 1ZD1A 3VKHA 2RGXA 4ZKDA 3G0HA 4QBIA 2RMKA 1E2JA 2XNSA 4PSVA 3HYTA 1WMSA 3ETLA 4F4JA 2OT3B 4JBWA 3UMRA 4PSKA 2HYDA 5JJIA 4MDEA 1W1WA 4MYTA 1BO6A 5AWFC 1S3SA 3AUXA 1N6PA 4Q00A 1E1QA 2HCBA 2ATXA 1CULC 1AQUA 3N2EA 2I3BA 3Q7QA 3RRZA 1TQDA 4DB4A 4F91B 2OFXA 3EPLA 2PLFA 4BLQA 4D26A 5B64A 1FMJA 1FUUA 3QKRB 4TYNA 2IXGA 3T1VA 3U3OA 4K46A 1COWA 2WSMA 5CIWA 5FL3A 3QXCA 3N70A 1Z0KA 5LBIA 4HAWA 1XJ0A 3VHLB 2DB3A 2G9NA 1DO0A 1AJEA 1M1YE 2OCPA 5EXPA 1WBDA 3X1DA 2DFNA 2H18A 2QROA 1GIAA 2R9VA 2IYRA 3CZQA 1Q3TA 3EIQA 1XTRA 3B9QA 4PHHA 1P6XA 1HH4A 4BZPA 1IN4A 4C30A 4EJSB 3LVRE 4C2TA 1GKYA 4B2IA 2V7QD 1NRJB 4HB4A 1JQLB 4QL3A 4Q7MB 4ACAA 4I1UA 4WIAA 3OIWA 3CR8A 4FD2A 2AKAB 2O0HA 2DWPA 5E3HA 5JECA 2BIFA 4IRUB 3D7MA 3LD9A 4NDZA 2IF0A 4KYUA 3SJCA 5EE1A 3X1ZA 5IHPA 2XXAB 4ARZB 2B8WA 1YJ5A 3W6NA 1N5JA 2HJGA 3REFA 1OXTA 1E9CA 3GPLA 5TXGA 2QUZA 4KV9A 1GNQA 3PENA 3T15A 1VIAA 5HZKA 2LWIA 3NEYA 1MABB 5JRZA 3SQWA 2A5YB 4OKSA 3C5HA 4OJQA 1XD9A 3DPUA 1RIFA 3KJHA 3RNLA 2OCAA 1NVUQ 1TX4B 3B1YA 2XOKA 1SVSA 5JI3E 1TNDA 4Q9IA 1N5KA 4QJ4A 1XEFA 1F2TA 4OQFA 1BOFA 1AKYA 3WYAA 3BAFA 2G0NA 3QXJA 3I1FA 1UKVY 2AX4A 1YZNA 5CJPA 2XB2A 3T1QA 3NHBA 5CM9C 1HE8B 3DOEA 2J0UB 2KI5A 5C4MA 1ZD9A 2DHRA 4DLZA 4B73A 3GEEA 2GKSA 2CL0X 1AS3A 5KNCA 2H7VA 1MH1A 1E79D 5AJWA 2V4ZA 5CM8B 4IXMA 1G3IA 2V1XA 3AVUA 4LV6A 1KMHB 4RFSA 3UKDA 4A6PA 4H1VA 4HB2A 4YONB 3IPXA 1U90A 3CLVA 2SHKA 2B8TA 2E87A 4UXHA 2C95A 2AD5A 5HE8A 1W5SA 1Z0JA 3CWZA 2K5UA 4OYHA 5FUXA 4NPHA 2C96A 3CB4A 2DWOA 3A37A 2WIBA 4LOAA 3ZVMA 3CPHA 4EAQA 1NLZA 1XMJA 1IY1A 4OHZA 2ZUBA 1JR3D 2VA8A 2G77B 4R98A 4F4CA 2PLRA 4DDWA 4B43A 3W6PA 4HLQB 3A1VA 4JS0A 4DSNA 1QDEA 3AP3A 3VHXA 5BXQC 1NG9A 4HEJA 3CWQA 4P33A 1XD8A 2WPDA 1Q1ZA 2BOVA 3REGA 2ZJAA 2Z43A 4YMSA 1G16A 2V9PA 1NVWQ 3C16C 4PZZA 4Q4AA 2JGNA 4KJZA 5DO9A 1Z83A 4GOJA 4DRZA 3X1YA 5LB2A 3NEJA 4L9SA 5GADl 2FFHA 4FCTA 1KO1A 4RZXA 4JYBA 3AGPA 4FMBB 4GZLA 5J4VA 1JPNA 4P4TA 1KI6A 4DLXA 2FSIA 4DZZA 1GWNA 2R6AA 2P6RA 4HDOB 3X1WA 1RKBA 5EJEA 2ZVQX 3LBNA 5JS7A 5E7JA 5JWOA 1KY3A 2CXXA 3ADCA 1US8A 5HTKA 5FPYA 1M2OB 3O8CA 4IDOA 4FI3C 1XEWX 2WWXA 2ZSDA 3CBQA 1E9BA 4CGZA 3FYHA 1GL6A 2J87A 1Z29A 3AVPA 3LXXA 1NSFA 4XH9B 4GL2A 821PA 4Q1DA 4U7DA 4BPBA 2JJ2D 4LBYA 2ODWA 2BCJQ 1GVNB 3CF2A 2OHFA 1XMIA 3IILA 4NCHA 1ZM7A 2VP6A 1EX7A 5DSZA 2B7CA 1ZU4A 2ZRFA 4NYJR 4V0KA 3T1OA 4C7OA 1W7AA 221PA 1RFLA 2CHGA 2ZRMA 1DAMA 2FE4A 4EFNA 3B82A 3QKSA 2I1QA 2CVHA 2BV3A 4TL7A 4ZKEA 5L3QA 4G1UC 3AVYA 1OXVA 2CK3D 2ZYVX 2W6JA 3TVTA 1ZIPA 3THOA 1ZINA 3CKLA 3DVLA 4RJLA 2EFCB 1P9NA 1SXJD 2PJZA 4XIGS 4BFWA 1PJRA 2MSEB 5IK2D 4UKDA 1G8FA 1T9HA 5BWMA 3PEYA 1FMLA 3CX8A 1ZAKA 4PX9A 1UKYA 3RABA 1E9AA 2V55B 4AYXA 2WIAA 2QY9A 1GRRA 1C1YA 4LUCA 5LB4A 3SBDA 2AXPA 4ZIRB 3UANA 3Q3JB 4EPTA 5CITA 1G19A 3L0OA 3ZIAA 2D74A 2XGJA 4TL8A 2FV8A 3A36A 3R8CA 2J7PD 3THYA 3B2EA 3VR3A 3PUYA 1JI0A 5AJYA 3BWDD 3U3JA 1VPLA 5FBRB 3RVBA 1XBTA 3B1VA 1WQ1R 3GLFE 1L7VC 2BBOA 1W4BA 1CRPA 2BJWA 4DCVA 1HT2E 3LXRA 2IL1A 2O8EB 1E2EA 2ZE7A 3ZJYA 2B7BA 2C78A 4ZDIA 2ZJBA 1G5PA 1YR9A 3BGWA 2IF2A 1W0KD 3GFOA 5TARA 3WP1B 1P9RA 4OK6A 3AF1A 1FNMA 1EFUA 1T4GA 4N3NA 3ZZUA 2YOFA 2OE2A 3K09A 4H1UA 2WKQA 3LVQE 1Z6XA 2F43A 4FMCF 2EU8A 1M34E 3QF4A 4IOKA 4UJ5A 3B8HA 3T35A 1SVWA 1PVOA 4BGDA 3MJHA 2QGZA 1FP7A 3BC1A 3T5GA 3EWSA 4IVQA 5EUQB 4JT2A 1DTSA 1W4CA 2D4HA 3KQUA 5JHGB 2F1IA 2FZLA 1E2QA 2AK2A 2C03A 1U81A 3KL4A 1X8JA 2RGDA 2XITA 4TMXA 2MSCB 1IY2A 3B85A 2WWHA 2ANBA 2J0VA 2CVFA 1T0JB 4GBMA 1FPMA 1MKYA 3K70C 5FOSA 1T5LA 2R6FA 5TV2A 4W5HA 3IIMA 1SVOA 2ZS9A 1HY3A 1IONA 2C2HA 5E7IA 1G7TA 4TZ0A 3GJ5A 1R0YA 2BHRA 1E2DA 4XSHA 3W34A 3EPKA 4FMCB 4M53A 2RGGA 4GSYA 1HTWA 2XX3A 1NY6A 4QJ5A 4JVMA 3R9WA 4A1FA 5CJ2A 1E98A 1DADA 2PCLA 1FX0A 2W0SA 1U94A 2NO0A 2O52A 2KBFA 1N2CE 3P26A 3W90A 2PZGA 2GILA 1SZPA 1E9FA 1Z5ZA 2GCPA 1G3RA 2AXNA 3E1SA 1DAGA 1NG1A 4B3BA 2GBLC 4IDPA 4Q47A 3FTQA 5HCIA 2OLKA 1MO3A 4GMXA 1G4UR 1P4SA 4JVNA 4PO1A 2RGNA 3RSOA 1FZQA 2QG6A 3SFZA 1OW3B 5C18A 1IN5A 1N5IA 3OEHA 4JLVA 4YDHB 4C0LA 5L8VA 3FHCB 1UF9A 3RS4A 3RWOA 1CKEA 1R0ZA 2OXCA 3QBTA 1IQPA 2FX3A 2VH5R 2AL7A 2CE7A 4MGZR 4YMWA 3BFVA 1HT1E 3C14C 1TF5A 3L8YA 4NYIQ 2PMKA 1OT3A 2YC2C 1J8MF 3U2QA 2XNDA 4M9XA 4HDQB 2ZJOA 1G3UA 4TQUS 2ANCA 2QPOA 3B13B 5CYPA 1E4YA 3AKCA 4WXRA 3T12A 5FR2A 3TK1A 1JEDA 3K70B 2QQEA 3CO5A 3O8DA 1MRNA 2JLQA 3ZD6A 5HR5A 3QPUA 5EE5B 1CXZA 3BH0A 4EJSA 1NJFA 3TR5A 3LDAA 1II9A 4IKEA 5KO2A 1AA9A 3F5FA 1KAGA 1UBCA 3Q8XB 3ZYCA 3WMFA 1E2KA 1Z0AA 4AKGA 4QGAA 4D0NA 1P2TA 2I4IA 4B71A 1Z47A 2G1KA 2ZSBA 3I3SR 4A9AA 4US0R 5A5GA 1K8RA 2FFQA 1VYTA 4FINA 4JLAA 3VFDA 2A30A 2F1JA 4A8JA 3TGPA 3B9PA 4ARZA 2P6UA 1I2DA 1SKQA 2D62A 2WSSD 2WV9A 3FDIA 5DLQC 2DBYA 5F9FA 4XJXA 2QTFA 4DLUA 2JJ1A 2Q3HA 3VQTA 4WVFA 3MSXA 4HSEA 3LV8A 4Z1MA 3BB3A 3EX7C 4LJ9A 4G3XA 2DR3A 2VF8A 4LHVA 5GJWC 3VU9A 2QNRA 4NCIA 1P61B 3ECCA 2VP2A 1D2MA 3KDSE 2QN6A 2PT5A 1KDTA 1P62B 1GKIA 621PA 1Y3AA 1L8QA 2CE2X 1SHZA 2QORA 4EPVA 4U5XA 4QM6A 1T5IA 2ASEA 4XD7D 3V4FA 2BEKA 3NTUA 4CEJB 3HP1A 1N6KA 3K0AB 3E5HA 2XZLA 2WKRA 3TQFA 4G5OA 5J4YA 2YV5A 2Z4SA 4TT3D 3SDZA 4YLGA 4M1OA 3BFKA 4HLUC 4O0MA 3EG5A 1ODFA 2JEOA 6Q21A 1P2UA 1AGPA 1W2HA 2NPIA 2LKDA 2ZRIA 1DG3A 1Z28A 3B60A 4V0LA 1J2JA 3NXSA 1XXHB 2J0SA 1Z63A 2ZS7A 1TMKA 1PZNA 4IJMA 4KFRA 2O8CB 3PEUA 2GJKA 4YMUA 3E2IA 2WWFA 3TJZA 2MMCA 2V6IA 5B58C 1ZNYA 4D4LA 2QE7D 2XEXA 1YRAA 4O25A 5SZJA 4DLTA 1E6CA 1QHGA 2BMJA 3PQCA 4Q4JB 5DN6D 1CJMA 3B1WA 2OSBA 5FOWA 1Z8FA 2VP9A 4TLBA 3GLIA 3K1JA 1ZD8A 2NO1A 2OZEA 2WWIA 4HB0A 1XRJA 2YWGA 5AUOB 4WXPA 4B2PA 4IDNA 3AVWA 4LV5B 1ETUA 3D6TB 5TY0A 3AKDA 4QBFA 5CIQA 1SULA 4LGMA 3NKVA 1VG0B 1YVDA 2WAYA 4R2IA 3GLGB 2QT1A 5JHHB 3ADDA 1U8YA 5AUNB 1CIPA 2YWFA 2J0QA 2GF0A 4CEHA 3NDPA 4DDTA 3QXSA 4RCYA 3SHFA 3RS3A 2KE5A 1GOTA 1XZPA 1ZUIA 1IN6A 1R2QA 4TSFA 4TYQA 3QUSA 4ZO4A 4J0QA 5FBWB 4GP6A 1W0JA 4G5QA 1LVGA 1UEIA 2RKOA 1YU9A 2GXSA 4ZI3A 3SYLA 2O0KA 1G8YA 3UMSA 1OFUX 2ZVPX 4B34A 2VP5A 3H0KA 2ZS8A 3DZDA 2MMGA 1DAKA 3IQWA 3CPEA 2ZU0C 4Q1FA 1NBMA 4PFSA 1CJUC 1OH5A 2FSHA 1R4AA 4C2UA 2PT7A 4GFDA 3MG9A 2X19A 1KO7A 2C9OA 3LO5A 1NN0A 1OPXA 4XWKA 4G0NA 1F5NA 2GDJA 2P67A 1JPJA 3F0TA 3MGCA 3IGFA 5IDVA 1R6BX 1Z6YA 1Z6GA 2QBYA 4O3MA 4RD1A 5K8UA 4HAYA 5KHOC 1BH2A 5TVKA 3Q5EA 4GP7A 2WWYA 1ELOA 4URYR 1EESA 4L9WA 2ORVA 3OZXA 1IOZA 1WXQA 2A5FA 5JWHA 3KZ1E 2ZTSA 1Q44A 3PEVA 5E4FA 5KPJA 4PAOA 2F3TA 4DLYA 4KCGA 2FGJA 3JVUA 1XEXB 1KSFX 4WA7A 1OH8A 4Q21A 4NCKA 4LYFA 4Q18A 4W5JA 4P0TA 5JSZB 1SVIA 3B5JA 2ZIAA 4LYAA 3FKSA 3WXMA 1VIYA 1ESNA 1JXOA 4Q03A 4Q7KA 3LQQA 5J4KA 2QP3A 3B78A 4TL6A 1PUJA 3OESA 3WMEA 4AWXA 3GJXC 1P7CA 4BFXA 3O47A 4KSBA 4BEBA 1F6BA 4MYHA 1NNEA 2XZPA 2ZJYA 4YXWA 4D25A 1H8HD 4IDHA 2PX3A 2C9CA 5JBQA 3THWB 2OBLA 1QHHA 1CRQA 1TEVA 2F9LA 1Z07A 2Q21A 2F9MA 1S4QA 3KXIA 1XD2A 5SZIA 1JEEA 1TQ6A 4FIDA 4JL8A 1KHTA 3T34A 5CDFE 2QQ0A 2VSOA 3BOSA 5EP3A 3UK6A 4EIWA 2J59A 1WA5A 2ZI7A 2XZOA 2QMOA 2GXAA 3U44A 4CVNA 4BLPA 3QPWA 2RGBA 2GCOB 4P32A 4Q66C 3EZ6A 2GRJA 1PUIA 1ZCAA 4DSOA 4JYCA 1GFIA 2QP4A 5CLLA 1GP2A 3SC3A 1ZM2A 2BVNA 1TU4A 3DM5A 1S3GA 1XDBA 1O3YA 3GFTA 4Q1CA 1E1RA 5DE3A 5AJZA 1AS0A 1GRQA 1G64A 1BKDR 1G17A 4AYTA 3Q9LA 2DCUA 2XSZD 1D2NA 1G4AE 2J1LA 1G20E 2RGAA 1G7SA 2W6IA 3I8SA 2QM7A 5KSYA 3CF6R 1PLJA 4LJYA 1KAOA 1TF7A 1XF9A 3EARA 5EQTA 3VX3A 1AM4D 4N0DA 3ZVRA 3AF3A 4LJAA 2GZDA 3MD0A 4JIMA 4KITB 1IAQA 3LQRA 5FTNA 3EIEA 3NBXX 3FMOB 2JLWA 2IYSA 1LS6A 1RVDA 3W9YA 4IHQA 2HEIA 5FBQB 3MWKA 1Q22A 3KFXA 4MRSA 3BBPA 2CLDX 4US2R 5L3SB 3RC8A 4M1SA 1L4YA 2CCGA 1R5OA 2YJTD 1Q57A 4AURA 4DXAA 1QG2A 1P75A 4MRVA 4U00A 4UNQA 4AG6A 2QGNA 4F38A 2IS6A 3TNFA 4KODA 2HXSA 1P60A 4Q48A 4Q1AA 3GJ6A 4GRAA 5IF9A 1UBEA 5CLQA 5FR1A 2GNOA 1N25A 2OUKA 2V7QA 2GK6A 4HZIA 5FL7D 1ZJ6A 2NQ2C 2O5VA 1D9XA 5JCZA 4XOIA 3W8RA 4A0RA 5CK5A 4JLPA 1I4LD 3OAAD 3PG5A 4JSYA 2J7KA 1I4DD 3U7EB 3D3QA 3I8XA 4CDGA 4CEIA 3GEIA 4HZUA 4EKDA 1GKUB 1KDRA 1GNRA 2N42A 1OB5A 3HU1A 3IBYA 1ZYUA 5FOVA 1SQ5A 1Z08A 4C4PA 1CTQA 3BB4A 3VR1A 4QBHA 3SEAA 3TSZA 4Q9HA 5EP4A 4M1WA 3K0CC 2YHSA 1E0AA 3BERA 1E1QD 2JLXA 5HCNA 4EPRA 5LD2C 1KZGB 5FPHA 2YKGA 1KJYA 3RYTC 3W6OA 4PAQA 3UWKA 3KKQA 5EE3A 1G1MA 1TUIA 4OQXA 3U7HB 5H8WA 3EZFA 4BLOA 4AIIA 4BRUA 1D2EA 2ZRAA 4I1OA 5DYGA 4JMPA 5FTMA 1D5CA 3UMFA 3K0FA 1N6NA 3PVSA 2ZRNA 5DHAA 4A15A 4NTZA 4HUQB 5H68A 4JL6A 1E3MA 5FOXA 1RZ3A 1VMAA 1X8LA 2QRZA 1M6NA 2W58A 2CJWB 1OHHD 1XCGB 1RC8A 3R7WB 4L4UA 3ADKA 4IOLA 4TMKA 1U9IA 1WBBA 1TAGA 3DMDA 1E79A 1MT0A 1KIMA 4XVUA 4JJKA 4X8MA 4ZDJA 3U7FB 2ZM5A 1II8A 3VX4A 3RDPA 1CJVC 3H1TA 1JXMA 1V43A 3H84A 4RCZA 4DCTA 3HDTA 5G41A 1JQJC 1NMZA 3KTAB 1RRPA 4C3ZA 1XTQA 2NIPA 2R62A 1X8KA 3MMPA 2BBTA 1OXSC 3I62A 3SQXA 3K70D
chains in the Genus database with same CATH superfamily
2VI5A 3PCXA 1PBTA 1JTEA 1JTFA 2FH5B 4X8LA 4I4LA 1Q16A 1W36C 2DSTA 2VWHA 2NU8A 4S3MA 2C5LA 5EUCA 1Y63A 4JYMA 4KP7A 3QUTA 4EVQA 2YYZA 3LX8A 5DHFA 1ZGJA 1G5TA 2GQ0A 4DA0A 1RNLA 4WUTA 1KZ4A 1G7RA 1XO1A 1ZVKA 2DJ5A 4ZV4A 5I4IA 3V1TC 3BGVA 2BSXA 2J3KA 2VBGA 5KQPA 2I76A 4CI9A 3S8YA 1U99A 3DBLB 4NE9A 1K66A 1C14A 3MTGA 1Y7LA 4QEZA 4RY9A 1E0KA 1J1ZA 4DB2A 2QIPA 4EHNA 4V0MA 1AGRA 3GP8A 3TE6A 1TM1E 3UK1A 1RYNA 1E96A 3EGIA 4O2RA 1IXKA 1A5TA 1CY1A 1MH9A 1T9ZA 2C4NA 3E70C 4QGHA 1L7DA 4TLLB 5A71A 5GIPE 2DU8A 2CSXA 4TMFA 3IO5A 1LNQA 5KI6A 4II7A 3EEFA 4D9CA 3GPCA 4ZGWA 4WOPA 3ORSA 3WGQA 1N9ZA 3ETJA 1W30A 3NM6B 1XZQA 4GPD1 1A69A 3GQVA 4AKHA 2QF7A 2I4TA 4OM8A 4AZ3B 2MT9A 2W43A 2B25A 2JAXA 1VKNA 2XJ9A 2VYFA 3H5AA 4POOA 3HXPA 1JJBA 3BEOA 2J9XB 3QTLA 4P7KA 3JS5A 2V5AA 5EIOA 3WL7A 4C7VA 4G0MA 4HYQA 4COKA 4BFTA 5CA0A 1MX9A 2BM1A 2E4VA 4N5LA 2P5TB 3ROPA 3ENKA 3COSA 4KFSA 2PT9A 1Z3IX 3QW2A 4UDXX 1NVVR 1N7GA 3B1ZA 4J8PA 5THXA 4D0GA 3ZCPA 3R3WA 2ZTHA 3K9FC 1FQJA 1J2YA 3PICA 4ZREA 1GV1A 3WAKA 3U4QB 2RAUA 4F21A 1R5BA 4E5UA 4ZJZA 1LLCA 2PX0A 3KDAA 5JS1A 2K2QB 4J1NA 4IICA 5FBHA 1GZUA 1WKVA 3MWLA 3WYEA 3VKVA 1W36B 1CVLA 4FEYA 1KZ9A 2HEGA 3RTDA 1N0IA 2G08A 2OD7A 3U16A 1E9RA 2Z2KA 5KTNA 2HWXA 1G63A 2ZBGA 4GVXA 4JI2B 1W0CA 1DKPA 3GI1A 4I36A 4O1MA 3M6AA 4EZIA 2TMDA 4N39A 3FUWA 4J7AA 5K20A 1M72A 1X74A 1XJCA 2O6LA 3GJ8A 1WE2A 3DHVA 3ICPA 4M7WA 3S8MA 2PPVA 4U2DA 2C4MA 2O8FB 3CPSA 3K8QA 4AJLA 1G66A 3FMGA 1RE1A 4LZWA 1H6DA 1T29A 3I9NA 2IJGX 5J4LA 3MRSA 1E94E 3L7JA 4Q5IA 2GXUA 2VYCA 3KJGA 4K0RA 5FTWA 1IN7A 2A1UB 1QRTA 1CUHA 1EEXB 2FX5A 1Y80A 2VO1A 1VG9B 2WTXA 4RLHA 5D6OA 4D57A 5AW8A 1NF8A 3F8TA 3FCEA 4IGFA 4PFQA 1QC5A 1KRWA 3LX4A 2P1ZA 5F9HA 3I72A 3Q1LA 4MYCA 4GC5A 2ID8A 4G85A 3H2GA 1N6LA 2ZT6A 3G9TA 2DTEA 3S2IA 2VSFA 1MAUA 1C4KA 2P4EA 5CXUA 3C3PA 1T8SA 4NYMR 3ILXA 1UDXA 1KKLA 4LZOA 5F1YA 1PO7A 4ZXFA 1GRCA 1WB5A 3IMFA 4Z4EA 3LYHA 1VIDA 2PL5A 3S99A 3T5MA 4C07A 4CCAA 5HWSA 1U0RA 3KWLA 3FTNA 3EGXB 3FCXA 4CU2A 2C7GA 1TO1E 4IDFA 3VR6D 2IYUA 2FP4B 2V7GA 1OVGA 4MR9B 4CNQA 2J7PA 2HDNB 2A0XA 5KB3A 2OBBA 4RUKA 3K8YA 2PVCA 3TR6A 2IIVA 4I55F 1YJXA 1QBKC 1MVNA 3BCSA 3KIPA 4CMAA 4BAGA 3FWKA 4LXTA 2CT8A 1B26A 2ECPA 2I22A 3V4SA 1BS1A 2Y1CA 5BMOA 1FW6A 1ITZA 2IKQA 3LYUA 2I1VB 5EXDA 3P4XA 5EJ2A 1NN5A 1BSVA 3VR4H 1X7WA 3LHKA 4DE5A 3P32A 3KJZA 4L1KA 1NF9A 2COKA 1NW3A 3GNQA 3M0EA 1XTPA 3T0GA 4IL5A 3EC7A 5HKBA 1YC2A 4YCCA 3M49A 1QTRA 2DT5A 2HIMA 5LYYA 4S1WA 3A26A 4OXNA 1MG5A 1E9SA 4ZOLA 3OJLA 3HJUA 1Q11A 5IWAB 1XTKA 5DTQA 4PO3X 2CXOA 3FVVA 4M0UA 2P2GA 3C3EA 1WR8A 1ESMA 3VYWA 4LCJA 2PYDA 1NU6A 3QA9A 2IZOA 2VWQA 4N8EA 1U3TA 4EJMA 1RC0A 3C5CA 3FVQA 2NTNA 3OZRA 5CXSA 3THXB 2G0AA 2PTGA 2VBCA 1IBRA 2CVZA 4UE6A 1IHPA 2V9ZA 3EIXA 1LZKA 1ZK1A 3QKTA 5F64A 1TQ8A 3SMQA 1P1IA 1KAEA 3WGGA 3NHKA 3L8MA 5EIWA 4E30A 2O8BB 1VMEA 2EZ9A 4PYLA 1X1DA 3N05A 3WTCA 1H1LB 4X1OA 5J40A 1R10A 2IU3A 4CL2A 5KWJA 2UKDA 3S1AA 2QQ5A 3OX3A 5G0TA 4DM3A 4ETNA 4O2BA 5JJ5A 4ZAWA 4DV7B 3FVWA 1JTVA 1O87A 3HGTA 1EYZA 2L2QA 3ZBPA 4TQAA 4EOGA 3GAFA 4B3XA 3O3MB 5C46F 5IVHA 1FLAA 1QF6A 3F6RA 3D8RA 2YHAA 2VDPB 2POCA 4DANA 4BNLA 4W99A 3Q5DA 4XUGB 4KRFA 3EUFA 4MULA 2IY9A 2QTBA 3CX3A 3IERA 3MJTA 2VK2A 1UK8A 2JB9A 1Z2AA 5LOVA 2FQ1A 3GP5A 5EINA 2G5CA 3IQXA 1I7QB 3GEDA 3TRIA 4JGIA 3KD2A 5K01A 2ETXA 1K89A 2R5WA 3AHIA 3COYA 5KAPA 3MJDA 4FC6A 1NVXQ 4PYIA 2E5FA 5FUMA 5E4TA 4EMSA 3LH5A 3AFHA 1M34B 3OA0A 4WX2B 5FQNA 1J21A 2C1XA 2QM8A 3MMNA 2W2LD 1UM9B 2A9OA 4GPTA 4IGKA 1K5GA 2PUEA 4RHEA 3CVJA 1FS4A 3K1ZA 1G6HA 3LUCA 5KO2A 4TMTA 4U9UA 3LIPA 1Z2DA 3P20A 5CURA 2Q6IA 2HH9A 1DJMA 5AVKA 1SM4A 5H83A 3W1WA 1F8GA 3HPQA 3LC7O 3AZQA 2O3SA 2E5WA 1QJCA 2Q49A 3H9GA 1PQPA 1UR5A 2J8ZA 4PGMA 5TIIA 2UU9B 2PGXA 1H3EA 2BFWA 3ONNA 3L93A 4G5FA 5ALLA 3X1XA 3LC2O 2WUWE 2QRMA 4JUCA 4A3SA 4YT8A 1T5SA 4EGJA 1RWOA 3VSDA 4CF4A 4LBZA 1ES9A 1JNXX 5JYBA 1L1EA 1MA3A 3ZOZA 5BN5A 1MC5A 1VKZA 1C9YA 1NW8A 1TCVA 1ZD4A 3GOQA 4BO3A 5EKUA 5FKJA 4E5MA 4I4CA 4LDAA 5TJ9A 2B4TO 3IULA 1XAGA 2LCIA 3DMGA 3OWOA 3QFHA 4DR7B 3ZWBA 5DGXA 1MRZA 1VIVA 2GYVA 2XDQB 2R1UA 4LYEA 2YVKA 2ZQ5A 1N2CB 1P5ZB 2DY0A 2WTAA 3KPVA 3L7DA 3NIBA 3QKRA 4XVRA 5JT1A 3B3QA 1KI1A 2IYXA 4A0QA 1GZ5A 4KWEA 2I6TA 2A4MA 4L2IB 4UTOA 2OBXA 4KHPB 1Y8RB 4K9LA 2ATIA 1FDRA 1ONBA 2HSGA 4KQXA 1DEXA 4H4DA 4MR7B 2WT8A 1WDLA 3NIWA 4P7GA 4B3IA 4Y6RA 3A3OA 2NZ8A 2NZUG 1QHNA 4NP6A 1J97A 4BTEA 4B8WA 2WIGA 1MCZA 2X1MA 1SOWA 5CR9A 4B4WA 4HEQA 1E3TA 2DR0A 4GNKA 3O0TA 3QU2A 5I9SA 3CRQA 3PLRA 2FXVA 2OTCA 3KYBA 4B3FX 4CTNA 5LVAA 1ZX1A 4JLBA 2V8OA 4DGSA 4HUJA 1M67A 1FL9A 4D74A 1WAMA 3W8EA 3L8EA 3BE8A 3N2ZB 1I5OA 2HMSA 2NQ8A 3T9AA 1A9ZA 4DLSA 1WMBA 2BMFA 2PIAA 1P29A 5KYXA 1P0MA 1EWYA 4UEWA 4C05A 2QB5A 5HVNA 1H9BA 1WNTA 5KTPA 3CHYA 3LM8A 3UYKA 4C4YA 4M22A 3SHVA 4KVAA 4ITRC 2Y8EA 3LQKA 1W87A 4R5HA 1EFKA 1UANA 2EC5A 3K6JA 1AKEA 4Y2YA 4GYJA 1RAFA 4IOMA 1JH8A 1SCQA 4RY2A 4R8VA 1NF3A 5B3AA 1LJUA 3GEHA 3AR8A 1CUZA 1QPBA 4WV3A 1Y6RA 2H31A 2VF4X 2QD5A 3KZVA 3R3HA 4L3WA 2CLOB 3TLBA 1OCEA 3I1YA 2C31A 1U7OA 4QUDA 2EP5A 1O6FA 1YA4A 1R66A 4HPXB 2UZ3A 3R5TA 5JMPA 1USIA 2W9XA 1F3OA 3UB3A 3D3KA 4LBVA 1C7RA 5FPTA 1X1EA 5K0NA 3QNMA 3PQ8A 4NU6A 3IOYA 4B1FA 1X38A 1TLFA 2BD0A 2FEAA 2HWUA 1D4OA 2WMOB 4KFTA 5GMOA 3IESA 1ORRA 1J5PA 1PJSA 4IWYA 2P4SA 2BTEA 2NSHA 2QE7A 2PEZA 1SC1A 2NZYA 3O21A 1EP2B 1M6HA 4PS0A 2QR2A 3EIFA 4NZOA 3WRYC 3EDRA 2MJLA 1TB4A 4QGSA 2YCBA 4FN5A 5DN6A 1AUXA 1RADA 3TQTA 3R6GA 2QI9C 1YZQA 2LDXA 2VZ9A 3FFBA 2GEUA 4TOIA 2H51A 5BYBA 1FYVA 3F67A 1KMHA 2W2VA 3CZ9A 4E5KA 2OLJA 3V1KA 3G2HA 4TQ9A 3HJHA 3KXKA 1JKJA 2W8BA 1PT7A 1KAMA 4ZOBA 3ZDYB 1FRZA 4YRPA 3FLAA 3AEKA 2C7RA 1F12A 2MHCA 4R2WA 4MVWA 3LFHA 4UDOA 3WB2A 3OOSA 2TMGA 4G0YA 1FSPA 3NC1C 3K73O 2ZRGA 2FVXA 2Q8QA 2L69A 4DCSA 3IHLA 5DBFA 4YRTA 3JQEA 1Y1KE 1WLSA 1C30B 2FOXA 3GEBA 5ALGA 1UBFA 3C3WA 3Q7PA 4N7MA 4UCQA 3PNSA 4B33A 3TSAA 1BWSA 3TQHA 3WIBA 3OVMA 4JC4A 4PXYA 1CCWA 1KIAA 2XRYA 3NVAA 4GEGA 3V4PB 4HAXA 1TM4E 2ASVA 4N03A 3W5JA 1R0WA 2W6QA 3BWCA 3R6WA 4RVDA 2CXNA 2YQ5A 3P9YA 5K3SA 3WYGA 2DZDA 1ADJA 4TXHA 4EGSA 2JAQA 2HMVA 4OOFA 3KB2A 3FYCA 3E3NA 4BN4A 4BRWA 3ZE7A 5GVRA 5AIBA 2I3ZA 3QVLA 1TCBA 3ZQ6A 2C9MA 2ZRQA 2GHIA 3PPWA 4L85A 1YJ8A 4ID9A 3VR5A 3IAS1 5TT0A 1D8AA 3LA8A 4IYJA 1SXJE 3RADC 4BQEA 2QN2A 4YR9A 1AT1A 4JUDX 4MLDA 3BN3A 3IEUA 4H0NA 3T95A 4ZZ3A 3MGAA 1XVUA 721PA 3JAWA 4WWHA 4YQEA 4MB6A 3QX7A 2CC2A 1R1DA 2P9JA 4K9DA 3PHLA 4NYJQ 5K0LA 2EHJA 4RMGA 3W5AA 4CYMA 1MIOB 5J43A 1ULSA 3E7FA 4LHEA 3R0VA 3KQNA 4J0IA 4XPIA 2WAXA 3NHZA 1HORA 1CHDA 5EJIA 1O89A 1DV2A 3TEJA 3BDVA 1ZP6A 3FDZB 1P8JA 1U6IA 1YZYA 3G0GA 1EZ4A 2WU0A 1Z4PX 3C6MA 3K96A 2J9ZB 2HDHA 2AN1A 1PGPA 3BGDA 3M89A 3D3JA 4MXDA 5I7FA 4HXEB 1HFWA 1V0JA 3FGNA 2OP1A 3C15C 3QOYA 4UHJA 3IQZA 4WEQA 3WR5A 4W1SA 4YUWA 1YS2X 4FCCA 2HLDA 4LXXA 3RE1A 1EK6A 5L3QB 1BMFD 4JUBA 4RENA 1XZMA 4XW2A 4O4JB 3M6MD 2FG7C 3NW9A 3INGA 5K99A 3BFPA 5DJ5A 3KSZO 1QU3A 3ENNA 1KDOA 4FE7A 4HEA6 1I4TD 3IEXA 4XARA 5FDFA 1EFCA 3GY0A 5HQ3A 2FDCA 5AK0A 3JAKA 4A92A 1ACMA 2VVTA 4NOJA 4NY1A 1S1CA 4PSCA 4XSGA 4DC9A 5AP9A 5FI3A 1QQ6A 4A0FA 4P9NA 3FBWA 3GJZA 4BKRA 5CFOA 3I04A 1JX6A 2GFQA 3LPCA 3LO8A 3VC2A 1TYBE 3SOZA 4A2QA 4GE0A 2X1LA 2WU3A 4MR8A 4RV9A 2B1IA 2DBQA 3ZNPA 3TQCA 4JKYA 2PGIA 2ZIZA 2QR5A 2YNMA 1LLQA 4HMPA 2A5LA 5JXJA 1NIJA 2R6JA 2BW0A 4R7TA 3OZIA 5EJAA 2VNJA 2Y6VA 2FZVA 4JU8A 3QWIA 1JDZA 3TKLA 3WKCA 2DMRA 5G53C 1PFKA 4C3UA 4ML3A 3PE3A 4QQKA 4BASA 4EHAA 1Z0IA 1JJVA 2ZSHA 1GEGA 5HQTA 1M1NA 1HYHA 1W6RA 5G40A 4EW3A 5JCPA 1NV8A 1Q77A 4F2HA 3WBJA 1U0HC 1T25A 4DSUA 4EG5A 4ZHQB 3SJBA 1SHUX 1A7KA 2H07A 1I2ZA 1WRBA 2XB4A 2ZBFA 3OI7A 2OSVA 1XNJA 3TQSA 1X9HA 3WHPA 1KFKB 2D2EA 2WDZA 5FNVB 2J3QA 1SB9A 1I6LA 1MO2A 3N39C 4YV1A 1T2EA 1QORA 3OSZA 1QF9A 3MQ2A 4Q1EA 5IDWA 3MS2A 2ZXUA 1GJRA 4WK0B 1NZDA 4ERNA 3ZS8A 3IDFA 5C80A 4H3VA 1SXPA 1WB9A 1LS1A 1XR3A 1SO8A 2XHEA 3AWIA 4FDLA 2GJ4A 1O1YA 1VHDA 2OO3A 1J0DA 4WJLA 2AYZA 2EW1A 2HA2A 3KX2A 3F8WA 3RNOA 2C5BA 2F43B 5DX0A 3KXLA 3L7MA 1PFVA 1G3MA 4OK5A 4NQZA 2CWWA 4DV1B 1NL3A 5GJCA 1J2UA 4O4IA 1L7NA 4RJTA 4JN6B 2XVYA 1BMQA 3RRXA 4X20B 2SCUA 4HQRA 2I8LA 4U2GA 4DR2B 3PE6A 1MO5A 1GZVA 2KBEA 2CD9A 1KJNA 1MPXA 1ORWA 1U6KA 2OUIA 3FB1A 1VRVA 3ENWA 3GJ0A 4OAOA 4XCXA 2MSDB 4RF5A 2XIQA 2OWDA 3OZBA 4BFUA 1DBIA 4BEVA 4CV1A 5IP5A 1RKXA 1Z75A 1PLKA 5J5CA 2I5PO 1EK1A 1QRRA 1GUAA 1NUTA 2GZHA 3CRW1 4WZ6A 5TLSA 2NACA 3L1IA 1OBFO 2GKOA 3BK1A 4ZTZB 2AOTB 2XF2A 4MGKR 1MTZA 2DVMA 1YRBA 2ES4A 4O0LA 5AHRA 4AG5A 2FCAA 2P68A 4OQQA 1BCRA 4YQYA 2QRNA 1MFPA 1G41A 4A0SA 4LSZA 4FOLA 1EFAA 4FBGA 2Y1DA 4LX0A 1MB0A 1D8TA 1AZLA 1UPUA 3FSGD 4FMDF 4ARZA 1XVAA 2C1EA 2CLMB 1FEZA 2VQSA 1MLDA 5F52A 4D42A 2JGIA 4D5GA 4JI8B 1JAXA 1GA6A 1QYVA 2FSUA 3OAAA 1IHUA 4PPNA 4ZCLA 3RHFA 1XVVA 3VPXA 3ZCRA 4UCFA 5JZ9A 4A8JC 3JZIA 1CR2A 1SC3A 4ZMBA 3OE4A 2I6FA 4XM2A 1BX3A 1R0XA 1K6JA 3AXSA 3HZHA 4YCNA 4ZAYA 1QKIA 2PN1A 1NXTA 3C2QA 1Z6QA 1M2GA 3L0BA 3O8BA 3PQEA 4M6WB 3RSQA 4MB0A 3TR0A 3OOJA 2BI7A 1IUNA 1CF4A 2C0PA 3W6UA 5B4VA 1JBKA 3FUUA 4JLWA 4OFXA 4C0BA 1J56A 5LQSA 3UEOA 4TTPA 2DUJA 1DXQA 3O8QB 5IT9A 4WLVA 1CDDA 1FVFA 2KQUA 1WM1A 3CUYA 5KQMA 4FHEA 2YKGA 4GOXA 2Z5FA 3HA5A 3FOZA 4Z3KA 1EWVA 1KOJA 4M8NE 3TJRA 3FMVA 2BF4A 1A88A 2FWJA 1LW7A 5KNDA 2VJBA 3JQDA 1ZUWA 1HEUA 1V8DA 3Q6MA 4BAUA 3CNHA 3DDCA 4ZYVA 2JVKA 3ZUPA 3I23A 5EHXA 2IX3A 1ENOA 1AKNA 1NV9A 3COWA 5DK4A 1VCOA 2IXEA 3TIVA 4YCBA 1PEYA 4P5DA 4C78A 1OHHA 4ZZ0A 3PR1A 4MV6A 2WZQA 1L4EA 5BW8A 5K6AA 1SVLA 1XL0A 4TLEA 4YNBA 1A04A 2PUFA 1EI9A 1DC6A 3NEPX 5DOZA 3NC4A 5EE9A 3V8RA 4G97A 4H15A 3RYIB 1Y1PA 4QE3A 1ZNZA 2YY5A 1YMUA 3NBQA 2QNBA 5AHOA 4J1SA 2GN8A 4LY6A 2CZQA 1FOEB 2VQ6A 1R6TA 4Y2GA 4YRNA 4C2TA 1M7BA 1A4IA 1Q5PA 4TTRA 2QD4A 3NT5A 1P74A 2QJFA 2ZB4A 1N0WA 2P75A 5BMVB 1YULA 1HPLA 4OI0A 1FPQA 1PL0A 2WD8A 4A8JB 3WGMA 4CFYA 1P80A 4EHKA 4EG4A 1ODLA 1WXIA 1KAQA 1A5AB 3FW1A 4L8LA 2P4UA 2ORWA 3NJ4A 3BWVA 1TUEA 8ATCA 2X0NA 2XWJI 2YV3A 1T1RA 5LA6A 1Z56C 3HWSA 3KTFA 3UOWA 4BVGA 2VPPA 1EFHA 4BWFB 5C4IA 2Y66A 3GJ3A 4LPKA 3ZW7A 2BY4A 4IY1A 2B0CA 1Q0SA 3NEAA 4YJFA 4RLFA 5FUVA 1IZZA 5HGXA 2ARKA 3KQOA 3RSZA 4X61A 3CRZA 2WJJA 1DKOA 3CNOA 1W29A 2XW6A 1UMBB 1Z2NX 4YLYA 2P9QA 3R74A 3U4CA 5I7SA 4RW0A 1PEDA 1WKBA 5DM60 2JG3A 1E2HA 1EH5A 3V8EA 4X1IA 4AO7A 3R77A 4DA4A 1POWA 2D0OB 2OZLB 4QECA 1GUDA 3TRFA 4AMYA 3PJGA 2XOKD 4DPKA 3C1UA 2GPNA 3E18A 1D07A 1P9OA 2E1RA 2XCUA 4R7ZA 4BL5A 3QF7A 4MW0A 5HOEA 3PHCA 4GR4A 4I99A 1NSTA 2O2JA 2X8JA 5FTLA 5M5BA 2ZUDA 4I19A 4KUGA 5IDQA 2G83A 2A0UA 2OV6A 2G4VA 3CZCA 4RANA 2IYOA 1CWUA 3K0AA 2C9ZA 1T9KA 2G0TA 4NL4H 5EZYA 2IS4A 5FADA 5HRAA 2PKQP 3O9VA 3HSSA 4ERXA 3UFXA 2X8AA 4CCWA 4RD2A 1IRIA 5BV7A 1CNMA 4RQTA 1W4AA 2V45A 4RPLA 2BKUA 4FGZA 2VHUA 2Z30A 4TQGA 1E7RA 1Q0UA 4UFPA 2AFIE 2HA3A 1XXHA 3C5WP 4D79A 3RR2A 2A9RA 3EBOA 5H82A 2FPRA 4MV5A 5HKLA 1RM4A 4MVJE 5F98A 2EP7A 1ISMA 3VUEA 1Z4QA 4X7PA 1MENA 4XM1A 2FPGB 5EYPB 1PHPA 2H8KA 4CF3A 4FWIB 2DCMA 3ROXA 2I0FA 3ZDQA 2I8AA 4M9SA 3STHA 2EJVA 1TZJA 1V48A 2ZR8A 3QA3E 1P0FA 2M6KA 3ER9A 3KEFA 3QEBZ 5CX1B 3SC4A 5INTA 2RHJA 5P8WA 1JPUA 1R74A 1YKFA 3WICA 4EO7A 2FSGA 1N8SA 3MPUA 3PGVA 1YH3A 3ZE6A 3ZY3A 2H6EA 4F0JA 5IM4F 5DHTA 4XTRA 3HABA 3UJ6A 4CEHB 1NP6A 3RU2A 3TVDA 2AG1A 4OAQA 3KJIA 3AY3A 3GELA 4OSEA 3WSWA 3PXXA 4D9FA 3OSUA 1SU4A 5IX8A 1LK5A 4CDMA 1X9GA 4MS4A 1Z12A 1LRJA 4FB4A 4IIBA 2VPYA 4M89A 5EWJA 5G3YA 3RC3A 3IP9A 4MKXA 3L1HA 4R69A 2Z2XA 3H5IA 1DEAA 3IHTA 3QENA 2WPDD 4N6OA 1COZA 4RV4A 4OP1A 1AC5A 4JWKA 2Z08A 2PO5A 4LJ5A 2HPVA 3ZU2A 3LWDA 2VJNA 3FPSA 3F4KA 2RB4A 5K3FA 4YAGA 3K0SA 1B8VA 3GLRA 4JBGA 1C7IA 1CJKC 3U0VA 2QK4A 4KKVA 1OBOA 4PINA 4RE5A 2PH1A 2HRBA 2ZTLA 5JI2E 1C8KA 3V1UA 1YRQA 2XECA 2VKQA 3QU4A 5F5LA 5B37A 1NRIA 1VG1A 3F6SA 1LBIA 4XQ9A 3FTFA 3EFHA 4Q05A 5KDDA 3RODA 1MGPA 1E4EB 2WTUA 1ML4A 3SFVA 2F00A 4MUGA 4EBFA 5H81A 2CHUA 3QBDA 4PEVA 2HAEA 2AD1A 2WYUA 4P54A 4Q3AA 1SUFA 5LZ5A 2NTEA 7MHTA 2IHBA 4AF6A 4AK9A 1Y1RA 1KAHA 3DOIA 2A8YA 2G9ZA 1O08A 4ER7A 3QOFA 3NNNA 4R1MA 1I1OA 1WVMA 3LBHA 3VKGA 4O4LA 3PDCA 4QXMA 3E2PA 3GRAA 3NYRA 2NNLD 1JL3A 4BFLA 4OTZA 4MV4A 2JC3A 3TVYA 2A9FA 3QNUA 4FGWA 5ALNA 1XN4A 2FZCA 2OV1A 2FPLA 2YFKA 2A0YA 3ESQA 3HYSA 4GT1A 2I7CA 4KTVE 5KSPA 5WRFA 1X14A 4F96A 1TZBA 3QLTA 4LF9B 5A0VA 2DOKA 3E8XA 3HKEB 4KYIB 2VUUA 4M0MA 3GNTA 2JASA 4HCJA 2FPIB 2QX8A 2LNDA 4RSGA 4BNDB 4BO5A 4BB9A 4DREA 4PN3A 3SBOA 4N4AA 1VECA 2ZLBA 3QJ5A 4EO4A 3FWYA 5KKCA 1XDGA 4N3AA 3UG7A 3T3IA 1ZSVA 3RSFA 4KX5A 2GLUA 3TBHA 4QTYA 1SH7A 1A8IA 5AUQA 3SZRA 3FB4A 3ZS9A 3SFTA 1M2KA 2GAIA 2YXLA 1ZN8A 4C0WA 5JSZA 2XMBA 1YR8A 2ZSUA 1ZZGA 2QSUA 2W6JD 1ZDMA 1R6VA 3LUKA 4F84A 5JYCA 2FRDA 2AC4A 4LSMA 4M9ZA 2PWPA 3IAUA 2NXCA 3EEIA 3FHJA 3TDKA 2DFPA 3WKAA 2IXBA 3ZV3A 1WSWA 3RRMA 4B5LA 3W9SA 1RWBA 1I3NA 1TW3A 4PBTA 2QXTA 3AI7A 4V1CI 1TFUA 2ZB7A 1NNI1 2AQKA 2VIIA 4BNVA 9ATCA 1NLUA 1ZIOA 3M4YA 3B9BA 2CLCX 3AEUA 4UC0A 3ZC3A 4DMRA 4IGIA 1M2WA 1C7QA 3L77A 4V1CB 3LVFO 1OIWA 2Q8NA 2XGOA 2GEKA 3QM1A 4JV5B 1RJ9B 2N75A 3QJYA 2JCVA 2PS3A 2JLBA 1XOIA 4RHCA 4F2GA 3SS9X 1CERA 2OV2A 5JALA 2PXAA 4RD6A 1LPSA 1G9SA 1NYRA 2E21A 2WKPA 3LXMA 1WDTA 3RS7A 3E7XA 1WETA 4DSZA 3N1UA 1OKKD 3G7UA 4P81A 4E08A 3M4JA 3LT0A 2IHTA 4TRMA 3UT6A 2F8LA 121PA 3I9V6 5TDHA 2R68A 3BCHA 1PL7A 1Z13A 1T0UA 2NTJA 2WM2A 3HA7A 5G2OA 1ODKA 3T3DA 3HCPA 2ZREA 3GJRA 4OJKA 4KXQA 1P72A 2IBTA 4P38A 1Y5NA 3QUCA 4Z3DA 3DKRA 2JFHA 3HYLA 4MTLA 1U0NA 4UTXA 5LYJB 2QP9X 4MV1A 5EHQA 1J5XA 4JZKA 3WNQA 4B32A 4CKBA 4HH4A 5HP4A 1C29B 2XYVA 4F4UA 2Y1XA 3BT7A 2O3QA 4BZXA 3OMLA 4QREA 3RIYA 3UMBA 4YHBA 3CNQS 4FCVA 1NI5A 1X7XB 2O4CA 4Q4HA 4KN8A 4CXMA 5CG2A 3FRJA 3T52A 5AK4A 1JYSA 2DPHA 3GMTA 3IAM1 2JFBA 4J29A 4PR0A 3GAAA 3WRXC 5JQGB 4NF2A 2CSUA 4LC1A 1QH0A 1ULBA 2PL3A 4M3NA 2EKBA 4Z86A 5D5HA 4JEIA 4DY4A 4F2DA 1B3RA 1VSQA 1Y4DE 2R8ZA 3ACBA 3PDJA 4KL8S 1L7OA 1L9XA 2J6IA 4L7VA 1IU9A 1DAIA 3MA0A 4DYDA 4UUOA 2IV7A 2YWDA 4GVLA 5JFGA 1VI2A 4QUIA 4WZAB 5JYDA 2JBHA 3DM9B 1E3WB 3B7GA 3AB3A 3MTQA 3JCZA 1D6JA 4G37A 1F60A 2HQSA 1N92A 1UMCA 1Z16A 3OPVA 4IIXA 2BHLA 2HD4A 3RF6A 3IR6A 1E2PA 4WINA 2Z6VA 3WGJA 3RFTA 5L4SA 3IE1A 4KN5A 2HN9A 1QFXA 2JKZA 1C3OB 3H5VA 5E38A 3WHLA 1FRQA 3ONEA 3VYUB 2ZAYA 3HR8A 2GN2A 4BGIA 3DBHA 2GEJA 3GVIA 3L6DA 3NH9A 2GNPA 4A5SA 3FMFA 6ABPA 2IZZA 1X3SA 2G7ZA 3O83A 4RC9A 2VQFB 1XU7A 3FZYA 1XQWA 3FPKA 5EXXA 2IHNA 2BBWA 3A27A 9MHTA 2BR3A 2VFAA 3NGXA 4TS4A 4QPPA 3D0KA 4B81A 1ZA2A 2COUA 4EYKA 3UJ7A 2GETA 4MOWA 3MCZA 2GB4A 3SIPA 2O7SA 5GPBA 1PFYA 3TZEA 4PN7A 5I8WA 3ADBA 1HDXA 4YIKA 2GZSA 3HFRA 4M54A 3VOBA 2FSVA 2EW8A 3C8ZA 5J1SB 4LI0A 4XVHA 2NO7A 2ALJA 2YWHA 3LK7A 5CDTA 1E3JA 1HRKA 2Y1FA 5LQKA 3IA2A 2ZR9A 4QYIB 3ASVA 3RRJA 4DR6B 1P81A 1P33A 4WL0A 4HP8A 4RYLA 2GRUA 2HPHA 5IYZA 1Y34E 1IY0A 8ABPA 4YRAA 1ND5A 4IINA 2O05A 2H16A 1IL0A 2FK7A 2WI8A 1H4VB 4XD7A 3W4IA 2IU4A 2TMKA 1VMIA 4QJBA 4P2GA 1TAQA 4ZOAA 3H2BA 3W7VA 2XNDD 4Y9RA 1MT3A 5G4KA 3S27A 4AQYB 1NVKA 4X64B 3U62A 3OT1B 2WF5A 1OT5A 2X13A 2I3AA 1R6XA 2NAPA 4HGPA 3A3PA 1A50B 1CY8A 2CVQA 3K6RA 3JTEA 1V1JA 2YUTA 4HYEA 4X91A 3RVJA 2Q3MA 1E3SA 1LSSA 3FYSA 3AF5A 1F9EA 3DVAB 1VGQA 4M2LA 3RIHA 2ZYAA 2XUHA 1U0EA 1NBWB 1G8SA 3R5HA 2H92A 4M8KA 3K70D 5FAXA 4WA8A 1A5SB 3HUFA 2DETA 2NO9A 1T4BA 2Y9MB 3UHAA 1DAOA 3PK0A 4P3OA 5BV2P 4FKBA 4D80A 5FI5A 2IOFA 2WOJA 3MJSA 1JEQA 4RZIA 3P0IA 4X1YB 5JE8A 3GQBB 1TQ4A 2YIJA 3LK6A 4HVLA 5JH7F 3HR7A 4UATA 4G5HA 1B6RA 3TUIC 4TXNA 5IAAA 2R1TB 2LRHA 2FFAA 1OAOC 2XUQA 2PKWA 1WUIS 3KB8A 3OY7A 1B4DA 3VO8A 1FU4A 1LJLA 1BJTA 4Z1MD 4HN4B 2IIPA 2QU8A 4M7RA 3TL3A 5HIAA 4Z53A 2OR3A 2IEYA 5TJHA 4UBNA 1WCV1 2BR5A 4FYVA 1Q0TA 3DBLA 4OHBA 5LNK6 3RJZA 1L6IA 1QIDA 3WLAA 3E05A 1Q1GA 1G18A 2J3MA 4AJOA 2O57A 4BVFA 2EKDA 4S1TA 1F48A 4FYYA 3R0XA 5AVQA 1ESCA 1JLLB 3MWJA 3PP8A 3VOSA 4RXUA 3D4LA 2ZYSA 1B43A 1YR2A 3HU2A 2KB0A 4K6FA 3B1KA 4EMBA 1WPQA 1PNQA 1T6YA 4J1QA 5JUWA 4UPDA 3H65A 2ECQA 3JR7A 4J7CA 4GZMA 2DHDA 4ON9A 4E51A 1TQ2A 1PU2A 1Q0LA 4D3DA 4ESOA 2MIIA 4AZ3A 4AJJA 1A27A 1OE0A 2GEBA 2VOJA 3HL0A 3EIOA 5CVDA 3HNRA 4QLOA 1A72A 2C94A 1JR6A 4W9MC 5KVAA 4EY6A 3ZGVA 4EW1A 2PH3A 2X2FA 3EVGA 4TVOA 5K0BA 3U5TA 5FUBA 1GILA 1S8FA 3E2MA 3L79A 1R9GA 3HNOA 3WNBA 4OHOA 5LQRA 4G07A 3GJTA 3Q8MA 3D7NA 1E2NA 5TMPA 2RAFA 2P30A 1DNPA 2GD6A 3DV9A 4E1BA 4ZI7F 1I9GA 2J45A 2JK1A 3R6LA 3TF5A 3U4QA 2E85A 2W71A 2X4LA 3C41J 1WW2A 3RUPA 5LKAA 1IXSB 5J2TB 3ZCUA 4QXAA 1C50A 1ETHA 1GSHA 2QPLA 1EFTA 3BEDA 4MUFA 4EX6A 3KHKA 4C0SA 5HA5A 4JB2A 2YXNA 1NQWA 3ZXUB 4YP6A 3KU1A 1SQ6A 4W8GA 4CIDA 2K87A 4YFYA 1KVUA 1D9ZA 2ZITA 3OLZA 1V3TA 3SZGA 1T2AA 1C80A 3LZ6A 4KLCA 5KOYA 4RTKA 2XQFA 3ECSA 5I4BA 4RZ2A 4HLCA 2VK8A 4KE9A 5EZ6B 3V2HA 4DG8A 3L6CA 5FOTA 1NYTA 5KKAA 5THQA 2Q3JA 2PWYA 2C4WA 4LHZA 1EJBA 4Q6BA 3DEYX 4TXMA 1UEJA 3NAMA 5E0KB 1RWXA 4E07A 5DNAA 2O8FA 2H3HA 2ZU6A 3I39X 1L4BA 2LV8A 3KBOA 5HE9A 1D6NA 2HA0A 1TO2E 5F77A 3NOQA 3K09C 4Y98A 3N6XA 5KTMA 5HJ5A 2FDRA 5DI3B 1ZRMA 3ZWWA 2XEDA 3UKOA 5DEIA 2A1UA 4ZD6A 4DZTA 1DBPA 4OIFA 5D84A 1U1CA 3M70A 1SUSA 1X0XA 2P5SA 4TSFD 3BH7A 4JGBA 1HDOA 4IR7A 4QYSA 4S2UA 4A0HA 4NHOA 2X3FA 3KYJB 2ZTVA 3O9ZA 2B1RA 3VNVA 1R50A 1ZR2A 1SWWA 2J5RA 1B73A 2QA5A 3GA0A 1XA0A 1ISIA 3KPWA 3RAPR 5JQWA 2DM6A 2LKCA 3EWNA 5P21A 4WECA 3U7GA 3QBVA 4L16A 1TPZA 5KTRA 3MHTA 3M6FA 3IJEB 3W2FA 3I2JA 1SVMA 3SIXA 3EGXA 3UUEA 3FNFA 5LQUA 1W2GA 4GLFA 5K0GA 3DEFA 4AL4A 2GBIA 3FHLA 3UOAB 1SR8A 1O8CA 3P2YA 1C1HA 4EYEA 1KHHA 1TD1A 1ZL2A 2NYAA 1JWBB 2C3OA 2ZRHA 3CUVA 4B5KA 3ABIA 2ZM6B 4CQNA 1GNLA 1AD2A 1L5YA 1V39A 2D5BA 5EXEA 4MHTA 1HUQA 3BL6A 3I0NA 5EFZA 1XF1A 1YGPA 1U2DC 4I4TB 1GGHA 4UCWA 4G0UA 3B6ZA 2I2BA 1EFRA 3AV3A 1V41E 2XJ4A 3D4IA 4I3GA 4JI6B 1UAYA 5E6UB 1AQNA 4GR9A 4QNNA 2ZZNA 4Y2RA 1FFHA 2C98A 1QRSA 4JI3B 3FNGA 3GFRA 1PTKA 2O4UX 5B3JA 4PRLA 1VSBA 3PNQA 3JVVA 4TKUB 2IP4A 2IYZA 3LW7A 4WPGA 3TW0A 3DP9A 3EQ6A 3KQTA 3CMMA 2WC1A 3LVBA 4KWCA 3ZTYA 4M1YA 4EATA 3ZOKA 1P3DA