3PFCA

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with ferulic acid
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cinnamoyl esterase
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
total genus 88
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pfcA00
3VJMA 4BTLA 1XZDA 1CVLA 5K3CA 2WFLB 1ZI8A 3G9UA 3G0DA 1VE7A 4E46A 4KAAA 3W9BA 4GHWA 3BWXA 1MN6A 1AZWA 2WKWA 5LZ4A 1W75A 3AFIA 4BATA 1MTZA 4LYDA 4YPVA 4H77A 2ZSIA 2I3DA 5C8VA 5HKAA 1QFMA 3OTQA 2YASA 3G0GA 1ZD4A 4OYLA 4Y2QA 4BAGA 4CCYA 1GKLA 5C8XA 4P92A 1XZFA 2HA5A 2HM7A 3GUUA 2VSQA 3G9ZA 1QIEA 2QR5A 3F8SA 5CMLA 3W06A 2QVBA 2V98A 2BKLA 1E3QA 3H19A 4FLEA 4TVKA 5CXUA 3I6MA 1DX6A 1LNSA 4K5QA 2VT7A 5JZSA 3FOBA 1LPNA 3C6XA 1ODCA 2WSLA 5I9IA 1XZCA 2PSFA 5BWBA 2HU5A 5FV4A 1IUPA 2Z5GA 3M81A 2PKYX 4G4IA 5DNWA 4DNOA 1K6EA 4B84A 1U4NA 4CCYB 4UBKA 4ZV9A 4UPDA 1WOMA 5HF8A 3I2HA 1QIDA 3ZPXA 1GXSA 4OUKX 3HC7A 4YASA 1WM1A 2JGMA 4WY8A 4C88A 4N5IX 5FXMA 3KDAA 1N1MA 3Q8WA 1QGED 3WI7A 5ALRA 4KR0A 5T4BA 3OOSA 1RYYA 1XZIA 4J3JA 1W52X 5K3AA 1J06A 2CBGA 1F0PA 2PU5A 3L1IA 4YK7A 3DL4A 3DYIA 2C58A 2WILA 1QO9A 1WB5A 2WU4A 5HFAA 4RE5A 3HXKA 5ALNA 2H1IA 1IZ7A 2CMFA 4IH1A 1XQXA 4QLOA 2AJDA 4J0HA 2CZQA 2GBCA 3C87A 3HACA 3ED1A 1BN7A 1LBTA 4AZ0A 3N2ZB 2BUCA 3PUIA 2HA7A 1UK8A 2OG1A 1TCAA 4I3FA 5ALDA 4LYEA 1UWCA 2DR0A 3DL7A 4RE6A 3FLAA 2C5GA 2VAVA 4JNCA 4ROTA 1Y7IA 4M0FA 1YAJA 5K3DA 2BCEA 3BF8A 3UUEA 2QMQA 5C81A 4BYMA 5AM1A 3FSGA 4UFNA 2XMZA 2GBFA 4JH0A 2RAUA 1A8SA 3AIOA 4X7BA 2IITA 3E4DA 1GT6A 5E2IA 5E4TA 5EHXA 5CW2A 4U2DA 4G5XA 4J7AA 5CT5A 4NS4A 4HXGA 4BVKA 1CUBA 3MUOA 5FUMA 3D0KA 2AJBA 5CT8A 1XKTA 2QOEA 3VJLA 4BVLA 1CIJA 1VA5A 3QMVA 3VISA 1CQZA 1FFCA 3ZLUA 3IBTA 1YB7A 5CH8A 3KOOA 5EIEA 4FWBA 5DLPA 4FLFA 2PL5A 5JANA 4HXFB 3QH4A 4BAZA 2QUBA 3STUA 3PF9A 2XUGA 5ALMA 1YAHA 2HADA 4C87A 3B12A 1ZIYA 2FJPA 2PM8A 2XMCA 1EDBA 4XIIA 5AM4A 3FYUA 2VA9A 4UHEA 1XQVA 1LPAB 2BGRA 3V1LA 3JYHA 3WIBA 1FFEA 1ISPA 3KD2A 4BBZA 5EIAA 1Y7HA 5EGNA 4ETWA 3D5EA 4X93A 5ESRA 2QT9A 2W6CX 1LPOA 4FHZA 3WA6A 3AINA 4MQMA 1N5RA 3PDCA 5FKJA 1HBJA 3DNMA 1VKHA 1GGVA 4FNGA 1CUCA 1UXOA 4EHBA 5C7YA 3WZMA 4H7FA 2QZPA 3QPCA 4JYMA 3QM1A 2Y1KA 4EY7A 2HA0A 4XWGA 3H1BA 2G4LA 3I2FA 4B9EA 1ZJ4A 3DEAA 1ZD5A 3FYUB 1IUNA 5KWIA 5ALOA 4DNFA 1EDEA 3HLKA 3IB3A 3IULA 1ZJ5A 4CFSA 5KBYA 5ALYA 2B9VA 4J0JA 3H0CA 2WJ4A 1E66A 4P9NA 5T4EA 3I28A 1CLEA 4QA9A 4BE9A 1E8DA 1RP1A 3I2GA 2WM2A 3K2IA 3WKBA 1O6FA 4N8DA 4Q82A 5LYYA 2VATA 2XT0A 2BUBA 4GDMA 1YCDA 2HA3A 5AOBA 1G42A 3F9CA 3N0TA 5CT6A 4QDUA 4AO6A 4LXHA 4PV7A 2JGIA 1CUAA 5ALZA 2XUIA 4QNNA 3WJ2A 4JUIA 3FLEA 1CUWA 1UK7A 1QIIA 3AILA 1DU4A 1L7RA 1VZ3A 4ZRDA 4BZZA 4B0PA 4M0EA 1SCKA 2C4HA 3V9AA 3W2TA 5JAPA 1JI3A 4U2CA 3M82A 2WTMA 2C5FA 5JATA 3DYVA 5AH0A 3L1JA 3FLBA 1ZI9A 1DWQA 4S0XA 4OB6A 1R50A 3V1NA 1MU0A 3ZLTA 3KSRA 4NZZA 1CUDA 4GW3A 4UBIA 5LKRA 1VA4A 4KAJA 5LLSA 3T52A 3GROA 4AZ3A 3WZLA 2Z3WA 3GFFA 4Q3OA 1WHTA 3NUZA 4OB8A 2GBGA 1EINA 1DTEA 3AZOA 4G8BA 1MX5A 1JU3A 5AKEA 1LPSA 5FLKA 4BB0A 3H2KA 1EI9A 2ZYHA 3LCRA 4UBJA 2HU8A 3QVMA 1KEZA 1KU0A 3BL8A 4KE7A 2OCGA 2C0PA 1X70A 4HRXA 3K6KA 3CN9A 1XZGA 5F4ZA 3JW8A 1UFOA 3O4JA 3ZV7A 2Z8XA 4YX9A 4A16A 3O9VA 5JAOA 1OXMA 2X8BA 2QXUA 4LXGA 2DSNA 1HDEA 3MVEA 4D9JA 4FNMA 1XFDA 4UUQA 3RLIA 5AKIA 2HFKA 4EY4A 1JJBA 1YASA 2HU7A 3MUNA 1UKAA 4MJ3A 3OC0A 4MYDA 3WWCA 5AKHA 2VAXA 3I1YA 2ES4A 4UHDA 4WFJA 5HQ3A 4X97A 1A8UA 3R3XA 3E1GA 1WCYA 5AI8A 4PW0A 4O08A 4C4XA 3EBLA 4BP8A 3W9UA 1LGYA 4FDMA 4B82A 4CI9A 2E3JA 5AK3A 5JZBA 4XVCA 2G5TA 3EQ7A 1H22A 4F5ZA 3C6ZA 1HLGA 5AI0A 4PNZA 4AO7A 1M33A 4Y7DA 1DT5A 4FBMA 2PSEA 2PU7A 4UBMA 5E4JA 4QWMA 3AUKA 2LIPA 2GYVA 3IDAA 2R11A 3QITA 2OXEA 3M3DA 4MWSA 2B61A 3HSSA 1ODTC 2RGUA 5DYTA 2OPHA 4Y9SA 5BWCA 5DTJA 3WWPA 5HQ3B 1PV1A 5AM5A 2ZJ6A 2VEOA 5AKLA 2WTNA 5AHXA 4Q1VA 4EA6A 3D4LA 5AK5A 1U65A 1F6WA 1FFBA 2WU3A 2JEZA 2QUAA 2XB6A 2IX9A 1VOTA 4KJXA 5ALLA 2B20A 3G0BA 2VJCA 5AOAA 1G66A 1EXWA 4W1PA 1QIJA 3H2GA 1HL7A 4KE6A 4B6GA 3GBSA 3BF7A 1XZAA 3YASA 5I7UA 4DGQA 4X91A 3G8YA 1IUOA 4WFKA 4CIBA 1CUEA 3DQZA 1XRRA 5JASA 4QZVA 3H17A 3IUQA 3L1HA 2HRQA 5CT9A 2FJ0A 1XRLA 5JD5A 4ARAA 2HIHA 5YASA 2ACEA 1QJ4A 4HVTA 2OQVA 4QLAA 3QMMA 2WIKA 5EHZA 5JAUA 3S2ZA 2C0QA 3A6ZA 5ALEA 4W1RA 2Z3ZA 4DSZA 4BZWA 5AKKA 5A71A 2JGJA 1O6GA 3G02A 3PI6A 5K3FA 4UBLA 4V2IA 4N8SA 1CUIA 5EFZA 4P93A 3ESBA 2ROQA 2J3QA 4OD0A 1R3DA 2VT6A 3A70A 4OU5A 2O2IA 3W04A 1ZD3A 4GBGA 1JJFA 5AKGA 2QM0A 1BU8A 1X2BA 2OCLA 2O2GA 4QWWA 1T4MA 1J1IA 5IVIA 5SYMA 4I4CA 3S8YA 5A2GA 1TCBA 1WPXA 5AM2A 2OGSA 2V96A 3WK8A 3A2NA 5LZ2A 2XMQA 4GECA 5D3KA 3C8HA 1K4YA 2VJAA 2Z8ZA 3LP5A 1N5MA 2RHWA 1P0IA 3FWHA 5ISMA 1Q84A 1XKLA 5A7HA 3OPMA 1LZLA 2X76A 4LIPD 1QTIA 3FCYA 3B5EA 3G0IA 3QYJA 1JMYA 1MNAA 1XZLA 4H7JA 1XZJA 5K3FB 3ILSA 3I2JA 5EHQA 3ZWQA 5JD4A 2WJ6A 3WK6A 1CV2A 4KRYA 1RWQA 4H7IA 3PICA 3TRDA 3WKDA 1XRPA 3VVLA 4Y2YA 3OM8A 3Q0TA 1AURA 1UOQA 5AKYA 1SFRA 3FBWA 1P0PA 1GZ7A 2OAGA 3C45A 1IZ8A 2XUDA 2XQIA 1DX4A 1YA4A 4INZA 2J4CA 5JZ9A 4KRXA 5I8PA 1MX9A 3H2JA 1QIGA 1QONA 1B6GA 4UHBA 4B81A 3FVRA 2JF0A 4A23A 3IUJA 1E8NA 2C7BA 1MX1A 1CEXA 1W76A 2WG1A 1W4LA 2WG2A 1PFQA 3FCXA 3BIWA 1QLWA 1ZIXA 4OB7A 1FFAA 3ESAA 4MEBA 1MAHA 1C4XA 3BJMA 1MT3A 4BDSA 1EHYA 3R41A 3WK4A 2JGKA 4FKBA 2RI6A 4OSEA 5AIAA 1DINA 1CPYA 1GPKA 6YASA 4X92A 4X94A 4DSAA 3T4UA 3VXKA 2VTVA 1DWOA 1R4ZA 2H9YA 1E5TA 2WJ3A 3O4IA 3QPDA 3TGLA 3AZQA 1Z68A 2CB9A 4BP9A 1LLFA 4CG1A 1YB6A 2PVSA 3VKFA 5ALFA 3C6YA 5EI5A 5LP1A 1UKBA 1ETHA 1LPPA 1GQRA 3DLTA 5ALSA 1ZOIA 3WA7A 2JBWA 4BDTA 3B3QA 1R9MA 4MWTA 3R0VA 2WIGA 4MXDA 2ZYRA 3G9TA 1HQDA 1CUJA 1Q0RA 2XQFA 1VE6A 3W05A 2WIFA 4WDQA 4U2EA 4AMYA 1MNQA 3G0CA 4LXIA 3HABA 4FBLA 1FFDA 4HS9A 1TK3A 4KEAA 4IHAA 2VJDA 3UMJA 4ITVA 2PBLA 4CG2A 4G1FA 4AQDA 4M0MA 1Y37A 2QKYA 1NX9A 2R8BA 3EIOA 1MPXA 2DHEA 4IH4A 2D5LA 3QPAA 1BE0A 4UFPA 3U1TA 3IVMA 1QIMA 2I03A 1DT3A 1QIFA 1YS1X 3HI4A 1CUZA 4E15A 2GBIA 2I3ZA 2OCIA 3HEAA 2AJ8A 3KXPA 2YYSA 5ALHA 1ZGCA 3NGMA 1CUUA 1F0NA 3TJMA 3OURA 3WWDA 3STTA 4PQEA 2B4KA 4UHHA 2HA6A 3R3YA 5HK8A 2V9ZA 2RIPA 4ZXFA 1L7AA 3FNBA 3D3NA 3PF8A 2QXTA 4N8EA 2XUHA 4UBOA 5C8ZA 2JGLA 1H2YA 3H2IA 2BAGA 4B83A 1GQSA 3GELA 3G7NA 5AI5A 1JKMA 3A2MA 4TPKA 1CR6A 5ALKA 3ANTA 3MGAA 1ZICA 4UHFA 5AK6A 3D2BA 5LZ8A 2HFJA 2GZSA 2JEYA 1SCIA 2PPLA 3R3ZA 5ALQA 4C4YA 2XLBA 4PSUA 1MJ5A 4H7KA 5HKBA 3HYSA 4Q3KA 1CRLA 4B9AA 3WYNA 3DDUA 5AO9A 1MAAA 3FSGD 4WJLA 1YSCA 1ODSA 5DWDA 2UZ0A 1LZKA 3TEJA 1TKRA 1VZ2A 4DNPA 3PUHA 4ZGBA 3WYDA 1GPLA 4Y2UA 3WL7A 4J0IA 2PSJA 2XLCA 1WHSA 5AJHA 1XROA 1WB4A 2DQYA 4Y2PA 3WK5A 2X5XA 5ALJA 2XE4A 4QDZA 2H7XA 3DD5A 5E4YA 2DQZA 4XX1A 1QO7A 3SC2A 4J0GA 2XMSA 4FMPA 3DS8A 1XZKA 5FOQA 5LKAA 1W1IA 4NVRA 3WK7A 1BROA 3IIIA 4I19A 1XRNA 1AX9A 3SX4A 4W1QA 2WG0A 1IVYA 4BCCA 4G9EA 5A7GA 4HRYA 4J0KA 1UOPA 1QTRA 1Q83A 3RKSA 3WKEA 2I78A 1K63A 1USWA 3ANSA 3R40A 4CCWA 2XUPA 2XQGA 1AGYA 2PSHA 3E3AA 4TGLA 1TQHA 3QZUA 4GEGA 5CH5A 5KWJA 2XMDA 5AICA 4NMWA 2HL6A 2Y6UA 4AN1A 1G4HA 1A7UA 3I1IA 3WIOA 3U0VA 3I2KA 2OGTA 5IVKA 4EB0A 1AQLA 2WFZA 5DJ5A 3IUNA 2WHRA 4L9AA 3DOIA 2WUFA 4J0DA 5AKJA 1EB8A 2PUJA 5J3JA 4H35A 2XUOA 2CEKA 4KACA 3D2AA 5SYNA 2WLSA 3M83A 1HKHA 4U2FA 5AI6A 1ORVA 4RPCA 2G63A 4PSCA 4AXBA 3V48A 2NW6A 3VVMA 1XRMA 1UK6A 3K9BA 5DNVA 2GZRA 1QFSA 4A5SA 4BVJA 5JAHA 2ZSHA 3FYUC 3WK9A 4LKOA 4MYSA 5CH3A 3EF3A 4GI1A 3R3UA 3O0DA 1R88A 4HAIA 5LZ7A 4BRSA 3PE6A 5D6OA 2J3DA 3D7RA 4IH9A 5AM3A 3HZOA 4BTVA 5CRIA 2XUAA 4RNCA 3UUFA 3NOXA 5AIBA 2VF2A 3RM3A 2DHCA 3OG9A 3FVTA 5JALA 2JGEA 2AJLI 2QJRA 2IIVA 1LPMA 4ZI5A 1JFRA 2HDWA 3WQHA 1GPNA 2VQ6A 4B0OA 1JT2A 4J0CA 1C7IA 5CXXA 4E11A 5HF9A 2BFNA 1AC5A 1CUYA 1EDDA 1F8UA 2G5PA 4QEKA 3EQ9A 1QE3A 2HRRA 3H1AA 1THGA 1HPLA 2K2QB 4QDXA 2PUHA 1ORWA 4DMHA 4EY8A 5ALTA 1CQWA 5JARA 2ORYA 1ZGBA 4FOLA 2WUGA 5A7FA 4K6KA 4DIUA 1QIHA 2DHDA 4BC1A 4G4JA 4AX4A 2WUDA 4BCBA 3LIPA 2QRUA 3C8DA 5CBKA 3P2MA 1H2WA 2BGNA 3WKAA 4OCZA 1XZHA 1VLQA 1EK2A 4GLBA 4WFIA 5ALWA 2D0DA 2PX6A 1L7QA 2XQJA 1CFJA 1XLVA 1LPBB 4G9GA 1OILA 5T4HA 4DTCA 3AIMA 1A88A 4KE8A 5DNUA 2GYWA 4P08A 4B7ZA 4GXNA 1TAHA 1E8MA 2JIDA 2DCMA 3WL8A 3IUMA 4BC0A 3DCNA 1G5FA 3RARA 5IH7A 3WWEA 5HFNA 4KAFA 2V97A 2FUKA 4H7DA 4U2BA 1X2EA 1TRHA 1UZAA 4W9RA 4Q05A 1THTA 2ZJ7A 2DFPA 2OCKA 2ECFA 1CUGA 1EB9A 1MO2A 2CJPA 5D3ZA 2FX5A 5ALVA 4MEAA 4L72A 4UFOA 3PFCA 1H2XA 4QDOA 4HZGA 1KU6A 3G9XA 4W1SA 2WHQA 5CURA 4C89A 4FFWA 4B85A 2WIJA 4EBBA 5DTIA 1LBSA 3CN7A 3DJYA 4DMKA 3STVA 3O4GA 2ONCA 1XLWA 2XMGA 4N5HX 2AXEA 3ICVA 1IMJA 4OYYA 2Y2VA 3HRHA 4DM7A 3I6YA 2ZYSA 2CUTA 2CKMA 5AI9A 2WHPA 5FRDA 2QJWA 2HA2A 3WJ1A 5ALGA 3CXUA 3WLAA 5AM0A 5D7BA 5BOVA 2O7RA 4F0JA 1B41A 4B80A 5LIPA 2Y6VA 1ACJA 4EY6A 1BEZA 3AJAA 1DWPA 1D07A 2ACKA 1CUXA 3C6BA 2YXPX 1I6WA 5AK4A 4X6YA 4WY5A 3QMWA 3ESDA 3D59A 4ZWNA 5KREA 5IVDA 1TIBA 3IA2A 4EZIA 2EDAA 3WWOA 1P0MA 4RGYA 1CUVA 3C70A 2WFMA 3STXA 5FPQA 1QOZA 3I2IA 1JU4A 5JD6A 1R1DA 5HF5A 5LZ9A 1EH5A 2OGZA 1AMNA 4Q34A 1A8QA 1K5PA 4HTAA 1YR2A 2WHPB 1ZI6A 4LHEA 4U2GA 4L0CA 5A6VA 3CCBA 4IO0A 2ZJFA 2QTBA 5CTAA 4KYVA 4Y2TA 4DLNA 3C5VA 5AI4A 4CIAA 2XUJA 2J4FA 3V1MA 4JEIA 3I6ZA 4EY5A 3KWJA 3C43A 1GKKA 1XQWA 2YH2A 4X00A 1H2ZA 1SOMA 4HXEB 2WIDA 4G4GA 1EA5A 3GA7A 3LS2A 1QIKA 3DKRA 4PO3X 1SCQA 3H18A 4Y2SA 3VDXA 4C01A 2H7CA 2WQZA 4H7EA 4X3CA 3DOHA 3BIXA 3STYA 4KE9A 4EUSA 3IURA 3HJUA 2XMRA 4Y2XA 1NU6A 1UT6A 4Z49A 3O4HA 4X90A 3FYTA 4C6HA 2EDCA 4K6GA 3AIKA 7YASA 5CT4A 1NU8A 1EK1A 5ALXA 1BRTA 1VXRA 1E89A 2Y2UA 4FFVA 1BS9A 2PSDA 5ALPA 3F97A 4L3WA 3H04A 2RHTA 4K2AA 3SK0A 1W6RA 2P8SA 2XUFA 3C5WP 3E0XA 1R9NA 2H7YA 1TCCA 1VJ5A 4CG3A 4BCDA 3O95A 4J03A 1JJIA 5AOCA 4MQLA 4G8CA 1PJAA 5DYYA 3STWA 1UKCA 1AKNA 4FTWA 3WMRA 3F98A 3BDVA 2W22A 3WKCA 3F67A 5DYWA 1WB6A 1BEEA 4Q3LA 3FAKA 3ZI7A 3BE8A 3R3VA 5ALUA 3D2CA 3KWFA 5JIBA 2ZVDA 3ICWA 5HK9A 1S8OA 5FP0A 4WDRA 3F96A 1H23A 4DMCA 4X95A 2VJBA 4FLMA 2OQIA 4ZREA 1BN6A 5JYCA 4OU4A 3H2HA 1JMKC 5T4FA 5FPPA 1QZ3A 4ZV7A 2RONA 4E14A 2BJHA 2BUAA 1P0QA 5AP9A 4PF1A 2XDWA 2O2HA 3NWOA 4X85A 2XUKA 4F21A 3X3HA 3PFBA 1AUOA 1BCSA 4DYHA 1CUHA 3VJKA 2XUQA 1U8EA 5HZGA 1N8SA 2JGFA 4QDTA 4ARBA 4PSDA 1J2EA 2XI4A 4X6UA 4AMZA 4Y2RA 4DNQA 3ESCA 5HF6A 1EVEA 4C4ZA 1DQZA 4Y2JA 3R3WA 4WCVA 3V1KA 1BCRA 4AN0A 1XLUA 1C7JA 3GZJA 2EEPA 1T2NA 4JYPA 4K6HA 1XZEA 5A62A 3A2LA 4G8DA 1FSSA 2O7VA 3WL6A 1XZMA 4H18A 3AZPA 2XMBA 5FDFA 1UOOA 1CUSA 5HCUA 2HA4A 4AB1A 1U2EA 1SC9A 2AJCA 4H7HA 4UHCA 1EX9A 1ZD2P 1CUFA 3LLCA 5K3BA 3ZLVA 2QS9A 1UK9A 3QBJA 1Q0ZA 2WFLA 4BRZA 5JADA 3RK4A 5H3HA 4H0CA 5BV7A 1VXOA 3BXPA 4X71A 5IKXA 4BE4A 1J07A 3JWEA 4X6XA 1K8QA 2GYUA 4W63A 3BDIA 1WPRA 5EHNA 4QE3A 5K5EA 4XJVA 1XQYA 4BAUA 5AKXA 3BJRA 4UBNA 3WL5A 2Q0XA 4GWLA 4IQ4A 3DKKA 1FJ2A 2OAEA 1EVQA 3O9MA 3SWWA 4DMFA 1XRQA 3CCCA 2HHAA 1OCEA 5LZ5A 5AKZA 1DQYA 1YS2X 1XZBA 2XQKA 4F60A 4OPMA 4Y2VA 5ALIA 2OLEA 3EQ8A 2WUEA 4AO8A 3LIIA 1ACLA 2ZYIA 1YA8A 5K3EA 5IVHA 5EIHA
chains in the Genus database with same CATH superfamily
2C3OA 1P4JA 2I3AA 2MINA 5K0NA 3O4FA 3VJMA 4RMGA 2GB4A 4BNHA 4DUPA 3DEIA 4MV4A 3G13A 1A5BB 4Z1MA 2HUPA 1YR8A 1T0HB 3P4YA 3QG1A 3VM6A 4D3SA 1JH9A 3AU9A 4P2BA 5FWNA 1P0FA 1RR6A 2FE1A 2H2HA 3ZKAA 4GHWA 5ELLA 3ZQJA 2CLKB 1SCAA 3BWXA 3GQBB 4M36A 3O6VA 2VCHA 3BFJA 1Q2UA 2IDZA 4A6EA 2HT1A 4NBVA 3QWFA 1XCMA 2QNBA 2D3TA 4D0SA 2YTZA 1LXCA 1KJNA 1XEFA 3WHPA 3ITDA 2ZSIA 1M2JA 5C8VA 4K05A 5GJWC 4W4TA 5HKAA 4AU1A 4ENVA 2AG8A 1ADCA 1N25A 2BWJA 4YA6A 1J0XO 1IJFA 1A9OA 3DWGA 1K1EA 3O8DA 1DVRA 1OLUB 4PHGA 3OTQA 3ESRA 3KEMA 4IOJA 1NA5A 2WABA 3OLVA 5I9MA 1R0KA 4KQXA 2ZWIA 4E1AA 1OJ7A 4QQFA 3DXZA 3U3KA 5I4CA 2IEYA 4KQ6A 2CL0X 3MM4A 3PSAA 3RRFA 2AOVA 2PV7A 3CLKA 4KZKA 3D31A 1CNMA 1JG7A 3AQIA 2R1ZA 3IDSA 4LY6A 1GTJ1 3NQ41 4UEKA 4XE5A 4DDKA 1CF2O 4P92A 4RFVA 3K6SB 2XBLA 3HXTA 4G84A 1XPUA 2P0EA 4XDHA 5JFGA 1XTRA 1ADFA 3IRUA 3C41J 5DI9A 4Z0TA 2VSQA 2VYVD 3RAPR 3G9ZA 1P6XA 1NVTA 1T0IA 1YKSA 1PJCA 5JDCA 4FS8A 4FHDA 2QVBA 3GEHA 2R47A 2OZLB 4EA8A 2BH2A 1M75A 1G8HA 1NI5A 2F4NA 3EIQA 3Q98A 5IAKA 3RI3A 1E3QA 3H19A 4FLEA 3SJCA 5A2QA 5ITWA 1B0UA 1QX4A 2XVMA 2EZTA 1VPDA 3IP9A 3QRWA 1NQVA 3ZDZB 4XX0A 3AP2A 1GSHA 1HETA 4YMIA 1U1GA 3I6MA 5CXUA 1GVHA 2CFRA 3DTNA 1Z3IX 4D0RA 3KVNA 2MINB 1KYTA 1LNSA 3CZQA 3SYLA 2G1JA 3AR5A 4HFJA 1TMKA 4PQFA 4TM7A 1Y8ZA 1JG6A 2QUHA 5JZSA 4OGGA 2NSJA 3ZU6A 3UFBA 1OYWA 4ZCMA 4ZK6A 1QBKC 3QKRA 1OH6A 2WSLA 3V1TC 2IE8A 5F2EA 4BN0A 2A5DA 2HCFA 1M3SA 4M9CA 4MA5A 5WRFA 1E5LA 1FYWA 1P39A 1UWVA 1Y6RA 3EXFA 4LSMA 1JZSA 2JB9A 2PWBA 4UVHA 3R7NA 3TLMA 1ZONA 2A67A 1LLCA 3A4VA 1YJ8A 5DH9A 4AYXA 3DOCA 4LYGA 3NHZA 2CLLB 2PGXA 2D62A 3ZDBA 1YKGA 5HOEA 5I7OA 4GPBA 4RM2A 2F00A 2Q3LA 2Z30A 2R7MA 1BWPA 2ZUVA 4MP8A 4P4SA 4NMLA 3RODA 4BVHA 5DNWA 5GINE 1ISMA 2WPDD 3L0BA 5TQVA 3CV3A 4BMYA 4HO1X 1Y4AE 1RWMA 2E1RA 1GSOA 4MYRA 5CDYA 1EMDA 2HF8A 2YXNA 3CJTA 4QT4A 1INLA 5SYAA 4PIVA 4N39A 1RKBA 3JQBC 3W0LB 4DLKA 1QGAA 3IJPA 3GLGA 3TPCA 5EJ8A 4O4HA 3UJAA 4DB4A 4MAAA 4LTNA 4REOA 1GXSA 1GCAA 1M8GA 3P0HA 4EEXA 2BKXA 3D8HA 3DE5X 4TV8A 4YFYA 1CB0A 2ATXA 3AW8A 1JPJA 1FZQA 1E2KA 3BIFA 3OKFA 5JZVA 1OZAA 1U3CA 2QE7D 3NH6A 1VIVA 3R6WA 4B6SA 3W5UA 1HR0B 3WDMA 4CR6A 5BV2P 4TTSA 4KGDA 4XX0B 1MAWA 4Y18A 5E8RA 1Q1AA 5EY5B 4MGHA 3PKZA 1CEEA 3ND5A 1GGKA 4NMXB 3MTBA 3X1WA 3OOSA 4M8SA 4W8GA 1AKMA 1B73A 3V3KA 3VR6D 1U7TA 4QATA 3ZXSA 3EX7C 4LMRA 5C7IO 4E5KA 1W52X 5AJWA 4WKPA 3GEGA 5IAEA 3WRYC 1S7GA 4MLCA 5EMHA 4POAA 4G1BA 5IAJA 3TTTA 3QKRB 3PDIB 4YAWA 3UK6A 4Z3OA 1U80A 2PCJA 5EJEA 2W71A 5EP4A 1SKMA 3MT0A 2TSYB 4FMDB 4J8PA 3EXFB 1G21A 1WXDA 2QT1A 2JGAA 4OF4A 5K3AA 3TAXA 4CETA 1EZ4A 3FG9A 3L1IA 1X19A 1Z0JA 4J90A 1MO6A 2C2MA 5JNSA 1LH0A 1Z39A 2WF9A 3VYTB 1SCJA 5L4LA 3DZKA 5JPCA 3I5UA 3AJRA 5HFAA 5BQXA 1U1FA 1WU8A 3HXKA 3JWGA 2YVUA 2ZTMA 1IZ7A 2CMFA 2UUPA 4GPIB 1RHRA 4OJYA 5CDGA 1XQXA 3GYGA 4QLOA 5HOQA 5I48A 4ACBA 5JW6A 4KR3A 1NWCA 3G5TA 3SCZA 5A1JA 5ABPA 3C87A 2DR2A 3FKSD 1BTOA 3TX2A 3E3LA 2IIBA 4Z0PA 1EJ2A 2PDAA 4CMHA 4TYYA 2BUCA 2FHPA 2QTMA 3G79A 2C2ZA 3GLGB 1G5TA 3JQGA 4JQOA 1MVNA 2OG1A 4I3FA 3TZCA 2RGXA 4PZ9A 5ALDA 3G8CA 4LYEA 1EFRA 1UWCA 2DQSA 4O4HB 4IX9A 4R1PA 3GBPA 1WXGA 4DLZA 1GXSB 4JSYA 5DISB 4LNHA 4RE6A 1RYDA 2OLKA 2VAVA 4TV8B 5U4XA 4QGSA 4JNCA 3DDZX 1G16A 2EKPA 2X0JA 4N5LA 5K3DA 1Q0UA 4M0FA 4NAHA 2BE7A 2V9PA 1GU1A 3RS0A 3AI2A 3OMXA 4X45A 2Q3HA 3T34A 9ABPA 1FFXA 3BIJA 3I42A 2ID9A 2QMQA 1M6YA 4TKLA 1GPUA 4TQGA 2A2ZA 2FEXA 2FPPA 3FSGA 3B1YA 3CO5A 4OJKA 1LUAA 2NAPA 4TT8A 3X1MA 4RELA 2V7QA 5EIFA 3Q0EA 2ETXA 1J8DA 1QAMA 3N8DA 4GP7A 1PJZA 2ZQ5A 3OQIA 3IC5A 1FQOA 3B6KA 2QTRA 3H5OA 2JFXA 4A6DA 4JH0A 4PANA 4BP3A 3UT6A 5I9NA 3DMHA 4IXDA 2WTUA 1TMGE 3QU9A 1NM5C 1UJBA 2DBYA 2IITA 1NSYA 5FBZA 1KJQA 4NMMA 5E2IA 3EEYA 3AVYA 5E4TA 3M4YA 3KUKA 1WQ3A 1N9GA 3PD1A 1D6MA 2MT9A 3HCCA 1G21B 4G5XA 4HH3C 4OLJA 4HXGA 2V0NA 5H80A 1XTQA 3DF9A 2WV7A 4ZOQI 3GRCA 4IDBA 2B1QA 3EVBA 3OU7A 3DE2X 4KITB 3EA4A 1G38A 3MLEA 2HBRA 3FRJA 1DBIA 3PC8A 1B14A 2NZJA 2O2SA 3FDXA 3CW9A 3LHIA 1MA0A 2P9ZA 2MSEB 3C7CB 4ZEWA 4JVOA 5I9LA 8MHTA 3NWBA 3VPSA 1Z12A 3VJLA 3X1JA 2XRFA 3BRWD 3DBHA 4JR1A 5CD1A 2VHXA 3RYCA 4DIFA 1FDRA 1UJ5A 1FFCA 3G3EA 1A1SA 3D6VA 3O03A 5BR4A 3M2PA 2D6FA 1K4KA 1SOUA 1FXUA 5JAMA 5GIPE 1FYDA 4HXFB 2ENWA 2HJWA 4R6WA 3MMXA 4ERXA 2JJ1A 5J4VA 1OBHA 3LFUA 5DIFA 2I9PA 5JPDA 3IPYA 4URXR 1VRWA 3OIVA 4PZPA 3EZGA 4LJ7A 1EK5A 3D1LA 1PQUA 1T5BA 1M54A 5ALMA 3N87A 4L6IA 3RUEA 1J90A 5B4TA 1FFXB 3ZVLA 3FFTA 3LGSA 3WXBA 1I13A 1T4CA 4DLUA 2XKKA 1USUA 2HADA 2YJ4A 5BSRA 2DMRA 2BCGY 1VCNA 1X39A 2FPPB 1RYHA 3FOAA 1R0WA 1V16A 3PS9A 4FZ5A 4MCJA 1EP1B 1OAOC 4WFQA 3IXQA 3LUAA 4JAVC 3ISVA 3OQIB 5DW0A 3GW8A 3E03A 1JJVA 1XALA 2FJPA 3WLFA 3SXJA 2PRKA 5F7OA 3QU7A 2IY7A 3LTNC 3R5FA 3VPXA 3F6RA 4XIGS 1OI4A 5C1OA 4JKYA 2Z2YA 3SJBA 1JUDA 3OI7A 3SNHA 2VA9A 4YAIA 4G0VA 1N9GB 2V7WA 3EPHA 2FZEA 1V4NA 2LZ0A 1LPAB 1PWXA 2FU5C 4NH0A 5IMSA 5IH3A 3K0FA 2BGRA 4UVIA 2ZJZA 2CMHA 1U3TA 3V7WA 2QU7A 2W2TA 3WIBA 2Q5LA 3C16C 3MTGA 3HL0A 4TRMA 5FYDA 4BBZA 4TTAA 1U6IA 5JVDA 1DB3A 3W1EA 2JLZA 5EEHA 1U9YA 4CKZA 2PJZA 4ETWA 4KIGA 1H42A 1THMA 3PX2A 5IK2D 3RYCB 4BKQA 1FDVA 3OO0A 4WVLA 2W90A 4DLRA 2KYRA 3QA3E 3AI1A 4XDZA 4C5BA 1XA3A 3AINA 4MQMA 5HMMA 3K8YA 1XMXA 5JMPA 3KIPA 4DA0A 2X5JO 4C43A 5CB0A 1T6YA 1JSRA 1DLIA 4HAUA 4I5IA 2ZAGA 4TYPA 5D51S 2VC2B 3N6RA 1CEQA 4Z99A 1SQSA 2ONZA 2OMKA 4TXNA 1QCDA 1WF6A 3CZRA 1N92A 3GZ4A 3L18A 1DNPA 2Z5FA 3VC2A 4WBNA 3B6EA 1CRZA 4J91A 2OBNA 5AD1A 3ZWCA 2FSHA 1VLZA 5E0KB 4UCWA 1GQYA 1GGVA 4FNGA 3VOTA 2ZXEA 3ECSA 3HDJA 1KH1A 1CUCA 3MTQA 4DR1B 2A0KA 5FAKA 4I14A 1T4CB 1W0KD 3CUEF 4N18A 5C7YA 4PS0A 5IXYA 2QZPA 4LJAA 1DJMA 4ENRA 2VQDA 1S4MA 3KQHA 3ZCVA 1VKRA 2X2EA 5C5DA 1V5GA 4DVJA 5H9WA 4RORA 5ADUS 2G4LA 2XZDA 4B9EA 2IOYA 4JI2B 2X9GA 3SQNA 2PKEA 4QBIA 1X9GA 3BJIC 4JYAB 1BXZA 1LB1B 3MD9A 3ADBA 2J48A 3CXRA 4DNFA 3LA6A 4CZ2A 4NU5A 4EEKA 2WDZA 3K0FB 3OA2A 3SYKA 4X62B 1R16A 4MHTA 4D96A 3IB3A 4GKKB 3IULA 2RK3A 4IL5A 2COEA 4PIMA 3GJYA 4FZVA 2BOVA 4QULA 5LDGA 2ZZNA 2IYQA 2QAJA 3AF5A 3DCJA 3P9PA 4JJZA 5FOWA 5JVDB 3T3OA 2PVCA 2BBWA 4NZ9A 1F8YA 1OI7A 5T4EA 1OBFO 2CNOA 2BMJA 2A4MA 1VCIA 3MWYW 4QA9A 2RI1A 4BE9A 2ONYA 1J9ZA 3FNFA 1Q7BA 4TL9A 4HUTA 3GZNA 2WNHA 2GDJA 1A9TA 1E98A 2VPIA 4LDZA 4LF7B 4IHQA 3CRRA 3KPVA 3WKBA 3ZW8A 4E2YA 1PJRA 3EIXA 1K6IA 1T34A 4I4IA 5LYYA 2O8FA 5IT0A 4NBRA 1MABA 1RLTA 1IN5A 1UZNA 5G4KA 4E5DA 2BBTA 1KMIY 4JQZA 3KOXA 3VNSA 4B31A 2QUIA 1NQTA 1MORA 1HQYE 1ZLYA 1VL1A 3DF7A 3NETA 3V34A 5MGNA 1JKIA 2CXXA 2D2IA 4FQ7A 2OC4A 4P36A 3ILYA 5CCDA 4YRMA 1BX3A 2BUBA 1JIQA 4MJLA 1Z6XA 2HCBA 2FK8A 1L7VC 1Y3IA 2RHCA 5CT6A 3I9OA 2P5UA 2HLHA 4QDUA 1P4GA 1H9BA 2ZPAA 3S2YA 5AXAA 2XOKD 4PV7A 3CRQA 4MTLA 1TTHA 2OBLA 1MTOA 5SY4A 2XUIA 3WLLA 1CK4A 3JRNA 4Z0HO 3FLEA 4YV7A 3L5OA 4FKMA 3OWHA 3A4MA 3V8RA 1D6JA 1W96A 3EK2A 4ND8B 1KE1A 1QIIA 3AILA 3PNVA 4K26A 4TKVA 2A1IA 2Z1MA 3ZK9A 4DWOA 1ST3A 2J5BA 2LCFA 4QX6A 1E59A 1SHTX 4JN6B 5DGDA 3NV7A 1VE5A 1ZL2A 1NBMD 3MUFA 2ZW9A 1NZJA 4MKXA 3QWIA 1OGYA 1AQJA 2C5EA 4TUYA 4CUJA 2BH9A 4IIDA 3OZCA 4RF4A 4FPXA 1QTQA 1PGNA 2C4HA 4DIMA 1NKVA 3ER6A 3GLUA 2P1DA 5AOVA 3WBJA 1IM2A 4LPSA 3W2TA 5BW5A 5E6UB 1ZXBA 4O29A 3WQBA 1AXEA 1FMJA 1C1HA 3O8QA 2WTMA 5LLDA 3EIUA 4RPIA 1Z2PX 3ZE0B 2ZTVA 4GI2A 2J85A 2FWPA 2X4LA 4FDLA 1EK6A 3L1JA 3VZPA 4PLTA 1ZI9A 2D8MA 3UJ9A 2WF6A 2DETA 3B53X 3MJHA 3BH6A 3GZNB 4JXZA 3E22A 1DWQA 2AOXA 1TKAA 3KVVA 2NADA 3L7JA 2LIVA 2MSNA 4OB6A 1JPNA 4QFMA 5EKUA 4YR7A 2FR8A 2IHNA 2O8FB 1G8AA 2W2VA 3LA8A 1MABB 4G6ZA 5G0TA 3RT1A 4BEJA 5G4KB 2JHGA 4GW3A 1OLXA 2RB4A 5CR9A 1VSUA 2H8KA 1C80A 1CP3A 2GFIA 2LD4A 2Z56A 4NCJA 4QU8A 1WZIA 2F59A 2BGWA 1D5CA 2MTBA 3FXAA 4C0AC 5LLSA 3Q3GE 2Z8YM 1Y1SA 2R79A 5L3RA 2C97A 2IUTA 1G3UA 2VNHA 1Y80A 3GFFA 4TXJA 4PSAA 3HVIA 5A4MS 2ZJ3A 1QLHA 1B0ZA 2WAXA 3K1ZA 4TKUB 5JY6A 3PC3A 1LQTA 5A5FA 4Q24A 5EE0A 1QQ7A 5F2OA 4NECA 1P1RA 2GBGA 1DC6A 3AHCA 3S4YA 3N5KA 1FDTA 3FDFA 4JP2A 4PVDA 4A91A 1DTEA 3FIUA 3D6JA 4G65A 3FTQA 2V4MA 4G8BA 2PGLA 2ZPUA 1G18A 2OBFA 2BJVA 2O1XA 3N2YA 4IS2A 4BB0A 1UPFA 1RHKA 2J7PA 4ZRNA 4NBWA 4ZYYA 1I14A 2ZB8A 4CGZA 1K7YA 2ZI9A 4RAOA 1W581 2IU6A 3OCZA 4M22A 1JG4A 3U4GA 4LPKA 1O03A 4D3ZA 1C1DA 1IWBB 1G4UR 1V2GA 3MJTA 3QVMA 2NSHA 4TUYB 4YRQA 3BL8A 4V0NA 3WISA 5JNTA 4GM1A 1NV9A 1OAKA 5FBKA 4RMNA 2C0PA 1U3DA 2H00A 2PX5A 5KUTA 5JAIA 1X70A 1EUDA 3FJYA 4HRXA 4YBZA 5F1PA 3JAMA 2FY8A 1QH1A 4MW0A 4FJ1A 1KOLA 3O8QB 5FBHA 3NVDA 2QROA 2X41A 4RGVA 2MYUA 4DUGA 4XB6B 5HIIA 3QXXA 3MOGA 5JH7F 4G1UC 2Q50A 4AKTA 5B12A 3JQFA 3E22B 2E6KA 3B82A 1B74A 3FIJA 3CZ9A 2GPNA 4BX9A 5LYJB 1OBOA 2HEGA 4UUBA 4CFZA 1CZHA 2OHXA 4XB1A 3ROEA 2V9CA 3IDOA 4TM8A 1HDEA 4GVXA 1D1TA 1OLXB 4NYJQ 4D9JA 2NZ2A 4HC4A 3PKJA 2A1TS 5DBIA 4MVWA 4MPPA 3UK2A 3PR3A 4K03A 1PIWA 1U8ZA 2EFGA 5AW0A 2AL7A 5F2NA 1YASA 2DLNA 2HU7A 4CM5A 1VHLA 1MRSA 4QTYA 1Z0UA 5BSEA 1IWOA 2ZS9A 5AMXA 5EJ9A 5LQMA 4M3NA 1XEXA 3SR4A 1EFTA 4WFJA 2N42A 2VDRB 1PZGA 1RYZA 4WXHA 5EXDA 4C0KA 5HQ3A 2BLNA 2FCRA 3Q7QA 5IYZA 1JDBC 4GPTA 1TK9A 5EVCA 1HZJA 1PG5A 3ZE6A 3K30A 1ODKA 3R3XA 4MW5A 4TTPA 1QFJA 1V5WA 4IJQA 3NIGB 1TYAE 4LGMA 3DDSA 5KU1A 2ZVPX 2G9ZA 3HBAA 1JF8A 4NNOA 4R2KA 4C5AA 3JZAA 2Q8PA 1NY5A 2PS9A 3M49A 4YT5A 1N0VC 4FOTA 4H6XA 3VR6H 4CI9A 1CU1A 1JLKA 4XJSA 1JFSA 3AF4A 1DL5A 2BMWA 3MC1A 3WB9A 1NW5A 2JGNA 3WLOA 3H8SA 1C1DB 3ED5A 1WDMA 1GZ6A 3TFQA 2Q3JA 3AQ4A 1WQ4A 2UZ3A 1JTFA 3AVXA 5CEEA 1IZ9A 1W19A 1JDZA 3BEDA 3EEQA 2HJRA 1UDWA 4ZCIA 3JQDA 1H22A 3C1OA 3TIFA 3WRVA 2NUAA 1PSWA 4BJHB 1QH1B 1Q16A 1HLGA 2MR5A 2X9NA 3GY0A 4WIAA 4AD8A 1ABBA 1G7TA 4OHFA 4RLFA 1V5FA 3Q2OA 2D5BA 4Y7DA 1OYOA 3R5KA 3P5SA 3MYRA 3TL2A 4HX9A 4J1NA 2O6LA 2ZGVA 4F3NA 3ZJTA 4UBMA 5E4JA 1IE3A 4R69A 3S28A 1FNNA 1C9KA 2QR2A 4TMKA 3RYTC 4CG0A 3CRMA 2OVBA 3LUCA 3IDAA 3K8OE 2R11A 3QITA 3ORSA 3SXUA 4V0RA 2DPMA 3FI9A 3QVGA 3HDVA 2C61A 4AF8A 2Y0BA 1R0XA 4LBYA 4X6LA 4BQOA 5IBCA 1P3DA 2W8ZA 4BQEA 4WXRA 1XVIA 2YWBA 3GDWA 2N75A 1ODTC 1QDLB 4FR5A 4Y9SA 5KTKA 1XEXB 3WWPA 4MQEB 1WS6A 2H3EA 3HZRA 4FCCA 1LF0A 4YHBA 4ALLA 1USKA 1JDUA 1DUSA 1SH7A 2R751 3JU3A 4G1VA 1KH3A 1DZ3A 3ZHZA 5B64A 4H6PA 4C6TA 1HG1A 1SUCA 3K4HA 1ECJA 4IJMA 1FLDA 4IIJA 4NCNA 3MEQA 2C4MA 2WTNA 3E35A 3HSKA 4WZBA 5AHXA 5AKLA 4GYWA 2JAOA 1CJMA 1Z0SA 1SIBE 3LWBA 4Q1VA 4EA6A 5KNDD 1IJBA 2VNAA 2ZRMA 2QL9A 3K70D 5E7JA 1P60A 2C96A 1II8A 1YDEA 2XHZA 2ZI3A 4I4NA 1NVAA 1RZUA 5DIZA 2XRZA 1R64A 1SRQA 1DBQA 1F6WA 2ZBGA 4UD2A 4LEIA 1T3SA 1E2HA 1EYZA 2FW1A 1FS6A 5C8DA 3W5JA 3EC1A 4N3BA 4OLBA 2GWRA 3IP8A 4MV5A 2JJ2A 4C1NA 2P5SA 3L01A 4Q1EA 2R6HA 4TMWA 3SS8A 4Y8VA 4LF6B 4C2BA 4JP3A 4PO8A 2NUAB 4DRXB 5ALLA 1SXGA 2B20A 2C2HA 2JLVA 1RPJA 4URUR 5C18A 3KP1A 1NATA 5B1HA 4KR9A 3T5AA 5H1YA 1U0EA 5E1OA 1UANA 4KYIB 1GG5A 2WKRA 1GKYA 2C2YA 4G89A 2IZ6A 2VHTA 2QN6A 4P3YA 5EMKA 3VYWA 3ZWXA 4HATA 2HHJA 5ADVA 4L0DA 2IS2A 3WGIA 5BN1A 2C4UA 1WLYA 1AKYA 1Z18A 3TPFA 3C3CA 3SXUB 4PX9A 4FCWA 2NVUA 5L3VA 2ZTLA 2IDJA 3QVGB 1SOVA 4N65A 3PSHA 4GI7A 2IV3A 3THRA 4B6GA 821PA 1GPWB 1YQUA 1XZAA 1IUKA 2EAUA 3M5DA 3LX4A 4HEA6 3JSXA 3SZLA 3BWEA 3T35A 4ON9A 3T7AA 1QAQA 4KUEA 4MRAA 5MFPA 1IXYA 1FP2A 3DGEC 4FOSA 2FEWB 3U6KA 1N5OX 3Q87B 5JO0A 4RD2A 1L8XA 2PAFA 1I3KA 1X9IA 2GPAA 4CIBA 1CUEA 3DQZA 2J0UA 2QJTA 3QHAA 4JGBA 4BV8A 3L7OA 2G6TA 2VRCA 3JD0A 1RC8A 1J42A 2B6HA 1YDGA 3H17A 1U2GC 4QFDA 3IVGA 2GX6A 3W5SA 2HRQA 3IPAA 5K7SA 4IIJB 3MIZA 1XRLA 4U63A 5K20A 5A05A 2EQ5A 2FRDC 4WZBB 5FNZA 1QJ4A 2GI4A 1MA3A 1PZHA 2JFQA 2C0CA 4QQKA 3SC3A 1EUCA 4B3SB 1OFIA 1II8B 2PANA 1JDVA 3M3HA 2WIKA 4ZP1A 5EHZA 3RIEA 3EQZA 5JAUA 3K70C 3RYIA 4OIMA 4QQNA 1Z37A 1RACA 4KB5A 3W8FA 2XSZA 3S2ZA 3BGWA 2ILVA 2C0QA 4JL5A 1TM5E 3ES9A 4QUDA 3T4PA 3IQIX 4P7KA 4LY3A 3KTOA 3PEUA 5BYJA 1SN7A 1SIWA 3WGZA 1PTJC 3P2JA 5IJZA 2TMKA 2CSXA 2BP7A 5EGSA 5IWCA 1Y98A 5K0LA 4BLOA 2PR7A 3V7UA 2I2BA 1N0IA 5AKKA 5A71A 4DXHA 2JIZD 1H6AA 2PL3A 2UKDA 1DIGA 3OJFA 1Y8RA 2E82A 3GPLA 2BY4A 2LKDA 2R4TA 3QLEA 2P4QA 4UBLA 4ALKA 3TLYA 3QTTA 1MDFA 1CUIA 2GOYA 3PWSA 1XYYA 4WT7A 1JEEA 3FMIA 4IEIA 4D41A 1X1CA 4V0ME 4XM2A 1GR0A 1P80A 4OD0A 2J3QA 5I51A 1R3DA 2GN8A 3KQTA 4FGWA 1WAMA 2NVUB 2Y0DA 1FBNA 3GNTA 4M9QA 3BQMB 521PA 3PA8A 4BNTA 1YONA 2PXCA 2O2IA 3UMMA 5GPBA 4AKSA 3R7FA 2R6GA 4WQMA 2VT2A 5LBUA 5IJ0A 2MU1A 5CUQA 2IZ5A 2QNRA 3H4TA 3Q3VA 2QM0A 1UQTA 4D98A 2UXDB 3WIUA 1X2BA 5FFNA 1BS1A 2C57A 2O2GA 4QWWA 2VWQA 1T4MA 5EP2A 3CFYA 2HTEA 4ZJUA 2EWVA 2J0UB 3AH8A 1DFHA 4Y9UA 5AT1A 2PD4A 5M3BA 5KC9A 2HX1A 1WKVA 4I4CA 1IHXA 3CT4A 1JL3A 3MWEA 3F9RA 1PGOA 3AONB 3DYBA 2EU8A 2WK1A 5B58C 3O2QB 4X9XA 2D2XA 3QMPA 4ARIA 1HQCA 4OAOA 4AJNA 1LTQA 3GC6A 5CDSA 2JFUA 2OGSA 2V96A 1S0UA 3F2IA 2Q1YA 2XTNA 1JHAA 1SHJA 1E9SA 3EEFA 1JFFA 3V55A 2GD6A 4AX8A 4OQNA 1P2VA 3II6X 4IVPA 4M55A 4E7PA 3OQPA 1O77A 3AJ8A 1GRQA 1Z08A 3FR8A 2NIPA 3QFCA 2HJ9A 4GECA 4HP8A 4OHBA 2FWRA 3E23A 4ZEOA 4YDHB 1O5TA 1IBRA 3RYIB 2XCRB 3IXMA 2OZVA 1ONPA 4AS3A 4KXWA 3TNFA 5ISMA 4NBUA 5IANA 1ZCZA 5C2JB 2JIMA 1VL0A 4FMCB 3HUEA 4LHXA 5FA8A 3PQ4A 4RH3A 3AOGA 4IUBS 2HF9A 5A7HA 4IQGA 1KS2A 1L4HA 2XKAA 3OPMA 4S05A 4LNUA 2FYTA 1DAPA 1LZLA 3DNPA 1IULA 2BP7B 2CXTA 4XUEA 1L5QA 3FCYA 3PTLA 1E4OA 1V7QA 1G64A 3PPYA 4EJMA 2GBLA 3JPYA 3GVXA 4RIGA 4RVFA 4I1RA 2W9XA 2A9JA 2X42A 1H9CA 2AZMA 1Y8RB 1YE3A 3B3GA 3CX7A 4C0SA 1EFVA 1XZJA 2X1LA 2XMPA 3W5CA 3ILSA 3I2JA 4TSRA 1CJVC 5AJYA 7GPBA 2FPMA 4LS3A 4A0HA 4U7WA 4BECA 3ZWQA 1IBSA 4P58A 4P31A 2NOAA 3AIIA 5AHOA 3GHYA 4ZYWA 3TZQA 1X3LA 1PT5A 1ZO8A 2D59A 3GCWA 3O1LA 3UNXA 4NICA 4D9HA 5G2OA 1E2FA 1CHNA 5H02A 4B17A 3WLQA 3HN7A 4E4RA 1W34A 4Z4GA 3VRHA 1RHMA 1AXRA 2FW8A 3I8SA 1JBEA 1UJNA 4K6FA 3PDHA 3VVLA 1XPRA 1CSEE 2L0XA 1AURA 5EP1A 2AHOA 1GA6A 2QD5A 2G1KA 4RFSA 3CURA 3E5NA 2D2FA 4GX5A 5K6AC 4PS1A 4B3RB 4RJKA 4JOCA 5LD2B 4Q4AA 2F17A 1LDBA 4XQGA 1JFFB 1P1HA 3C45A 2CLSA 1IZ8A 3FFAA 2YBDA 2XQIA 4K0KB 2E89A 3ISJA 4Q19A 2H0QA 4TT3A 4EJ0A 3EIFA 5JZ9A 1KSHA 4P83A 5JWRA 1X0VA 1WKBA 4U02A 4E32A 3FNRA 2J46A 4HQNA 4RD4A 3R0JA 4LCJA 3H2JA 1NMEA 1QIGA 1QONA 3ELWA 3F7NA 1B6GA 1C3LA 4KRFA 2R7LA 4LNUB 1JIUA 2Q4BA 4KWCA 4L5YA 2OYCA 4B3CA 1F8GA 3N76A 3BX1A 1NUSA 2C7BA 4PYNA 4U9HS 1XXLA 4DV5B 4YRDA 1KBOA 1PLJA 2J67A 1VI5A 4CTMA 3HCRA 1FNDA 3BWVA 1T3ZA 4V03A 5J1SB 3GEIA 2IYOA 1Q7CA 1W4LA 1IAQA 3JQ9A 4ZALA 1PFQA 5JY1A 2G71A 3PDUA 3GNQA 4ZVOA 5IJXA 2VR1A 4DIOA 1AGPA 1YTUA 3CTPA 2HGZA 2ZIEA 1FYVA 4IPTA 4QYMA 5D3QA 1ZIXA 2H0RA 1QV9A 4IWYA 3RTDA 2EFEB 3IT2A 4MEBA 4I08A 4KFSA 4CR7A 1GUAA 1DRWA 1U0SY 1XK6A 4ES6A 4KX5A 3ER9A 3NLLA 3AEYA 3WK4A 2JGKA 5KDDA 1IBLB 3NT2A 4J4TA 3GUZA 3G82C 3OPYA 5TSDA 5DCLA 1HH4A 3KVOA 2R0QC 3ABZA 4JSTA 5CG2A 3C3KA 1SVMA 1ZJ6A 3EQ6A 3TEFA 4DHEA 3MHTA 1G8JA 1SNYA 1GPKA 2GUGA 1SIUA 4BQNA 2BR4A 4X92A 3ZUPA 4NXNB 4DSAA 3UENA 3ZWOA 3GFQA 4ZAXA 2V7UA 5A6SA 1L8OA 1R8XA 2ZVQX 3AF2A 3AHDA 3T9DA 1ZSVA 1EU1A 1RYMA 2O3RA 2YFHA 3G2LA 2G08A 4I5EA 1IBKB 2AMVA 2CCGA 2H9YA 2XNKA 4Q4AB 1FQKA 4QPJC 4QIHA 2EGUA 1E5TA 3QKIA 4K6OA 1Q0TA 2GVNA 2WVJA 4OFBA 4Q7MB 5CLQA 5GQSA 2QZSA 3UJ7A 4IFEA 1JEDA 3LG2A 3IBFA 1NTRA 4IMIB 3CNHA 4OFWA 1QMGA 4WE3A 1LLFA 5E9JA 4CG1A 5IC5A 5DF1A 2CLIB 5T64A 4NFLA 2WMOB 2KBFA 1FRNA 3DQPA 4AY4A 1E0SA 4CF6A 3C8MA 3CWCA 3SS7X 2H1HA 1OZ0A 2KLHA 3N05A 3AUSA 4IGFA 4XRRA 3GRYA 3VKFA 3VNUA 1SZDA 1TM1E 5ALFA 1HEYA 1DC7A 3AETA 5T6BA 3E27A 5LP1A 4KIFA 4NY1A 1RRMA 4R9SA 5THQA 3RU9A 1JR2A 2W5UA 4EKDA 2ZR7A 2W6QA 3HBJA 1BFKA 1HKUA 2DPGA 2JHPA 3PVCA 3DLTA 1PR4A 3CUVA 4YUVA 3LQYA 1K98A 5C32A 4MCIA 2DFVA 2DR3A 1WRBA 3JWJA 4KUGA 3E0QA 4C1BA 2DEUA 3MA0A 4IDCA 4Q21A 1NF9A 5EINA 4DDVA 2SKEA 4BFUA 1C8LA 3Q1LA 2PX4A 4BLVA 3FD8A 4UAGA 1QB8A 2ZYRA 3G9TA 1N0WA 1V1JA 2XNDA 3EHDA 4DV4B 4D8VA 1BMQA 1Q0RA 3B9RA 4FCTA 5DKFA 3ND8A 3OPYB 2O2JA 4WDQA 1C0IA 1MNQA 4ND3A 4KK3A 3CE6A 4MDFA 3QUAA 2EHDA 4HSEA 4RZQA 1FNCA 3TQOA 5K8VA 2JI7A 2FKAA 3R9WA 2FGKA 4YAEA 1MAUA 2D3WA 3V4LA 1KZYC 4D9KA 3N3BC 1LK5A 4LXIA 1V43A 1VJGA 4KGXA 4WKCA 5CNJA 3UV6A 4HLCA 2LPMA 3UAWA 1SQGA 2E4ZA 5A6SB 1FFDA 2RHOA 1JV2B 4M0CA 2BM8A 4OHVA 4IHAA 1ESCA 2VJDA 4TSFA 1KDOA 4MB6A 1YZUA 3BICA 2PL9A 3OIUA 4C9BA 2ZIAA 1H5QA 5AJTA 3L8ZA 2XBMA 5IDXA 2H1OA 2P69A 1KEUA 2FWJA 2IEGA 3A3KA 1R4AA 1WCV1 3V4PB 2PLWA 4C0WA 3U6BA 4CEJB 3EIOA 4KDRA 2B99A 2G1AA 3HYTA 1A4XA 1E3IA 1ARZA 1NUUA 1RJDA 3M34A 2D2EA 2O07A 2PCLA 4II7A 4IOKA 4XWAA 3UW3A 5BUQA 4CM9A 8ATCA 3SJZA 1ZZEA 4GYKA 2YYAA 2EG5A 2HUNA 5IXSA 1HE1C 1E1QA 1L5OA 2OGUA 3C15C 3DKVA 4D5EA 3T38A 1W25A 2ZU0C 4TVSA 3AETB 3EEIA 3FSJX 3IVMA 1E3LA 4LOLA 3OO1A 4BNGA 1TW2A 5ARBA 3KV3O 2C54A 4EITA 1LBQA 2QI9C 4DAOA 1OYYA 2DVMA 2O2XA 2WSSD 3N8IA 4LHSA 4KXVA 3HI4A 3WGOA 4AP9A 4DG5A 1X80A 3A58B 5BSTA 2JCBA 4KQCA 2R3SA 4W82A 1KP9A 1PS9A 3IAUA 4DRXA 4XCXA 2BDEA 2ODEA 4TLCA 3HEAA 2IYWA 4MS1A 3KL2A 2FPRA 1JAIA 1PYOA 4QXQA 5KTYA 4YMUA 1TUEA 2YYSA 1TQ6A 4IV5A 4Y2HA 4G26A 5BUSA 4NHEA 4KR7A 3C3PA 1I6MA 1C4OA 3R5HA 5I45A 4K9NA 3TJMA 1AS2A 1U7DA 1GL3A 1TCVA 3C3JA 4UM9D 3ONVA 4L7QA 3NTOA 2DPYA 2HA6A 2RH8A 3EXHC 3H5WA 3OUTA 1QP4A 5ECWA 3O0TA 4ZXFA 2RIPA 3GLGE 2CJFA 3FNBA 4WLNA 1TM2A 1TZBA 3PF8A 3VOSA 3TLGA 3EIEA 3ONEA 2HI0A 4DIBA 3O1IC 3DC7A 3P5BA 4Q9KA 1EP9A 2ZYWX 1PW5A 3AUTA 1NSFA 3KEOA 4LQDA 2VK8A 3W1VA 2C82A 2EWWA 2YICA 5AESA 1ETUA 4H17A 4BIMA 2JGLA 1H2YA 2PLAA 1NYLA 1CQIA 3DP7A 1ENPA 1I4LD 4PR3A 1NOIA 2R48A 2Q6TA 3ZJYA 4CMAA 4OQYA 4B83A 1GQSA 3KAKA 1G8MA 1QDEA 1SPXA 2HY7A 3M6IA 5GONF 1WABA 1TX4B 1U04A 3PYXA 4C3ZA 2E5FA 1VPEA 2W4IA 3NHPA 3AHGA 4UTVA 2NV2B 4ZVQA 1GUZA 1W30A 3UTCA 4DXAA 3QX3A 5THXA 1ZICA 3O47A 4UHFA 4XGNA 5AJZA 5TR9A 4DV6B 5HZHA 3B3JA 3C14C 3R6GA 3LRTA 1GRCA 1QO0D 4PG4A 4BNZA 3COWA 3H99A 3WNQA 3M6AA 3H2ZA 2FXVA 2XH8A 2LXNA 1KC3A 1EFCA 1F60A 2Y66A 4N3NA 3JQBA 2XLBA 1CNEA 3PNSA 1G21E 1QHYA 4PG7A 3QX7A 3UJNA 5AW7A 3KXKA 4CCSA 2O8NA 4O4IF 1X80B 4OYRA 2I2WA 4ZJZA 1MG5A 2MWMA 3CT6A 3L82B 3N86A 2PY6A 3TEMA 4G97A 3K4QA 1LK0A 4MS1B 1WMDA 2VDLB 3L8CA 4EW6A 1E58A 2C3YA 2VYVA 4F4CA 5JHHB 3IKJA 3OF5A 4KO1S 2F3PA 5AO9A 1Z63A 4IJ6A 1D0IA 4XVRA 1RKVA 1JT9A 3IDZA 1ODSA 5TS3A 3COVA 3IIKA 4OHPA 3RVNA 5JS8A 2JPDA 3H13A 4DCNA 4NU8X 1T36A 1EK0A 1TKRA 1VZ2A 4E12A 2E5WA 1NT2A 3U3RA 1DV2A 2ZE8A 3PUHA 4UJ3A 1GPLA 4ZGBA 3RJTA 3V3TA 4F92B 1BDHA 2Y67A 4Y2UA 3INYA 4QQRA 3WRYA 4C7BA 1JWLA 4C7OA 1Z5PA 1P1JA 1TTPB 4L3VA 2ZSKA 2HMWA 3GT0A 4IJUA 4M21A 1JDPA 1R5OA 4ND1A 2IH5A 1NULA 1USGA 1WHSA 1FOEB 1XROA 4KBGA 3NHSA 3WP1B 3S0JA 3ZWBA 3WQQA 4M1SA 2VQFB 1CQIB 1K2WA 4GFDA 1M8FA 3RV3A 2QYTA 4EG5A 4URWR 5ALJA 5B2FA 2M9MA 3A3NA 9ATCA 5C35A 1NIPA 3CM0A 5TRTA 1JFTA 5BYAA 1Z2DA 2F43A 4XX1A 3W34A 5CFRA 1U8YA 3B5IA 4MV0A 3TR5A 1L5VA 4L9WA 1XQ9A 3DV0A 4BN4A 3KOUA 3AKCA 3JVVA 4LZOA 3K6RA 2VJKA 4MV9A 2DAPA 1PYGA 1UWLA 1YS9A 2PRZA 3G89A 4RJLA 1AKRA 3WTBA 1SBNE 4ZAFA 4XWOA 3HTXA 1KHTA 3GLQA 3TMKA 3RTBA 4BQIA 1Y82A 4ITRC 1QYCA 1ZISA 3PFGA 5I6DA 1AA9A 4RPHA 3SX4A 1RHJA 3OZDA 3DWIA 1NVDA 1QHFA 2YY6A 3GLVA 4NIMA 4B3JA 4EEZA 4AQ7A 2Z04A 4C30A 4BBPA 1O97D 3WC4A 4BCCA 4NV1A 4LZWA 3OCUA 1GSAA 2NACA 4G9EA 3V8QA 4CDRA 4KIUA 3KVRA 3S5JA 3KTFA 3ITNA 3K9GA 1ZLXA 2QZZA 3BZWA 3TSCA 3LY9A 5JISA 3OZSA 3A1CA 4IUCS 1UOPA 1YZKA 2P3LA 3PLRA 4J7CA 3I72A 2QE7A 1ONOA 3KOMA 4RHTA 4FM9A 3RKSA 5HUJA 2QQGA 5P8WA 4L78A 3AXSA 1KY5A 2PRYA 4N82A 5EUBA 4Z3DA 1KMHA 1X7DA 1Q14A 3AL3A 5G02A 2R65A 5FD8A 4CCWA 1OXTA 1H2BA 1XN1A 5GP1A 1SUPA 3SLRA 2NVOA 1LI7A 3FM9A 2W6ID 4NYMR 4QOGA 4OHCA 1R0SA 1U9JA 5E4FA 3VR6A 1WX1A 2G5CA 4C7OB 3A3PA 1NM5A 1XD9A 4P3PA 3NYRA 4PZDA 4AURA 5K0GA 3E3AA 3DEYX 4TGLA 3LDFA 4PVCA 4W5TA 1AMOA 4YRZA 1JDSA 1X1RA 2YOFA 5CH5A 1UIMA 3KKKA 2RG7A 5HQ3B 1UBHS 2AEMA 5CX4A 4GBJA 2H11A 4NMWA 4NK4A 4F4UA 1T9ZA 3AF1A 4TTQA 4KO8A 1ZK4A 2EBWA 2C88A 2GD1O 2HL6A 1GCIA 4OXNA 3T3MB 4ARCA 2KS6A 2Y6UA 4R2HA 1R3UA 4PLPA 2F43B 1Q20A 2VXCA 2Y0EA 3I1IA 1GTZA 4LYJA 4PPYA 5DULA 4EHIA 2PEZA 4F6RA 2NUTB 4IQ0A 2OGTA 3DV0B 2QI9F 3PD7A 4QNRA 4INAA 3ABQB 3N39C 4FE3A 4HDSB 3VH4A 3IB6A 1S3FA 1XX6A 3ETNA 4UEQA 3BC1A 3NTVA 5KPJA 4IFBA 4YR9A 1FZTA 2UZAA 5I8ZA 1JXOA 3U13A 3M1IA 1C9EA 1D1SA 2WHRA 4GSLA 4L9AA 3CB4A 2Q7OE 3DOIA 3TRJA 5JZOA 5FEUA 3EBOA 1RC0A 2ZM5A 5F1YA 2JHCA 2RMKA 3A14A 3PQ3A 4BGUA 3B9BA 3BVPA 4EG0A 3EGDA 2F1OA 4A7PA 4CLOA 2WLSA 3WVNA 2ETVA 3FCCA 1YR7A 3HV2A 3I64A 1O97C 4R8MA 1HKHA 2NXWA 4Z53A 2O8DA 1SBZA 3RC8A 3CF4A 4U2FA 4OV6B 2OHVA 2O8BA 2X9QA 1CXZA 1LVGA 1M7HA 2QVZX 2W8BB 4FT2A 1DWUA 3HA2A 3DMDA 4PRYA 3BQNB 4HWRA 5KQMA 4MI3A 3SLGA 3CVXA 1BH2A 1GDDA 1OAOA 3KT0A 3UAOA 3ZDRA 3PNLA 5K8TA 4N5DA 1UPXA 2IY8A 2H2FA 2QMHA 5AW1A 3R6LA 1FRVA 1Z5WA 3ACDA 3M7IA 4PYOA 4PM4A 4K2HA 5EJIA 3VMMA 4O5OA 4A5SA 2E7ZA 3BE5A 4OI1A 1UPTA 3PT5A 3R0XA 1T6ZA 1ECLA 5HIJA 1A97A 4BVJA 5B6JA 4FNAA 5EUCA 2VH5R 3LYLA 5KVAA 2G83A 4LJ8A 4CMGA 1USIA 3QNMA 1IOLA 3CH6A 1SG6A 3MHPA 2QPAA 3EF3A 2YVLA 4QDJA 1H1TA 3TDNA 1V3TA 3ZBTA 2FSIA 5B4VA 4H1TA 1S3GA 3OFKA 4GI1A 4MUHA 2CF5A 3DV9A 1URPA 2EV9A 4MRMA 3CZPA 3O0DA 3QHQA 4BNKA 4II2A 4MO9A 4YT8A 4LECA 3CHYA 2IODA 4CF4A 4PNEA 1P73A 3KFXA 3NAQA 1QQBA 2I67A 3JZIA 4F6RB 5FEMA 1E1RD 1QE0A 5LFAA 2FPIA 1RJ9A 4FCVA 1HNZB 1IIRA 2BL4A 1DTWA 4I1SA 1TM3E 4JDPA 2OBMA 4UREA 2PGNA 1U3WA 3HZOA 4BTVA 1ZM3A 3BD6A 1L7XA 5G0VA 4D7AA 4NH4A 4WBXC 5IABA 2R2GA 2VF2A 4OLFA 2JA2A 3EGDB 4WK2B 4CLOB 1BKSB 2XE7A 3L1UA 1PLLA 1GZUA 1K3TA 1JQKA 3V7FA 4RTMA 1QVVA 2JGEA 2AJLI 2AN3A 5TC4A 1M5UA 4ZI5A 3WGKA 2O8BB 1RYBA 2AUTA 4I1YA 1JFRA 1ZNYA 3B20A 3K3PA 3QFTA 3SBDA 3TD2A 2YVQA 2IELA 2H18A 5BW8A 2OM2A 2ZTUA 1E2EA 2YZNA 3LBAA 1VC2A 3W77A 1QKIA 2HYDA 4E08A 3PJRA 4RXMA 2WA2A 1ISFA 5FPTA 3G2IA 3LL4A 1QK3A 4AY3A 1VKJA 1DKOA 4ERNA 1AUPA 1HTBA 1XKQA 5COBA 2H4FA 3TMAA 4D9BA 4MV1A 1N2XA 4QPNA 2A4KA 5CXXA 4XOUA 1IN1A 5HF9A 2YHBA 3JR3A 1J0AA 3F7MA 2FFJA 2Q5EA 3A04A 4QPCA 3K1JA 1UPAA 1ODJA 1SUFA 1U8XX 4G4SP 3MWLA 4JKOA 4JI0B 1C0PA 1T8RA 3ZVKA 3EVNA 4D99A 1KVRA 4MR7B 3HJGA 1F8UA 4MRMB 3EQ9A 1OFGA 1OZHA 2QTZA 1IEQA 1T91A 2HQSA 1HPLA 1VE9A 3GRAA 3ZX5A 5L7WA 1DAIA 4AF7A 3T41A 3CVYA 4D9IA 5I7AA 2O52A 5DASA 2VDMB 4DMHA 2BEVA 1N8NA 2FXIA 2FPIB 4IXTA 1RJ9B 1DMRA 1GUYA 4MIYA 4OHUA 1CQWA 5CX1A 4BLRA 2G77B 5KSWB 1DTWB 1ZGBA 1KJWA 1I4WA 2FUNB 2ORWA 2JS7A 2Y1OA 2YHUA 2H29A 3KFLA 5KWSA 4A36A 1MB0A 3C5CA 3Q3CA 5IK2A 1GIAA 2E6UX 4M1KA 4TLDA 3TL6A 3V5NA 4DIUA 1Y3CE 1GUBA 1QIHA 4ESHA 3SIPA 4BC1A 1H2EA 3O21A 4AX4A 5JH7B 4B3HA 3GOHA 3SSMA 2QRUA 3C8DA 3LK6A 1P9WA 5F77A 3VR5H 3CLVA 2BGNA 1Q5PA 1SVSA 1GTL1 3WKAA 5AVYA 2ISQA 3WHIA 1R5JA 1VLQA 4GLBA 2P5YA 1ZCBA 1AZSC 3VO9A 1RTKA 3ZZNA 4BJ1A 4RVDA 1OXBB 5ALWA 2D0DA 2PX6A 1J0CA 4KQ9A 4OFZA 3AUYA 4UUOA 2XKBA 2B34A 1XLVA 2YXDA 4LJLA 4G9GA 1W0KA 1WXFA 4AECA 1I01A 5B3LA 1P72A 2M32A 1OX4B 5FH9A 4KE8A 3C3WA 4JX8A 2CXUA 3HA3A 5GMOA 5CXQA 1N8TA 3JX9A 2PT9A 2YC2C 1W48A 3U4AA 3AESB 1KH2A 4ZDIA 4JU9A 3IV9A 4ZZ2A 2BGLA 1RZRD 3V2IA 4HPJB 1JKXA 1MOQA 3BIOA 2GEKA 4PX2A 1X7YA 3IUMA 5EFOA 1SVLA 3DCNA 2C8JA 1MV8A 1ZXXA 3BAFA 1D0VA 3GN1A 5EPOA 5FR1A 4YP9A 1XNGA 5ANRB 2V3VA 2ZE7A 3BQ9A 4EDHA 3KE8A 4POOA 1T9DA 1JRLA 2CHUA 3WWEA 4E51A 3BD9A 5AJUA 4L4RA 3V42A 4EO7A 4CF5A 1AGXA 3DMNA 3Q5EA 5C5IA 2XYQA 5CX1B 1POWA 2X3FA 1OKKD 3PGKA 3J7AC 3LT2A 1TRHA 3L43A 1UZAA 4K8RB 4HL6A 3TLAA 1UJMA 1QRUA 1DDOA 1EWTA 3U40A 2HDNB 4C76A 2MHCA 5BOSA 5ICCA 5FCDA 4D8UA 4P54A 3RV4A 1XF1A 3TB6A 4IDOA 4IXWA 5DU2A 2CLCX 3QQ5A 4D8XA 2GD2A 3LOUA 2FK7A 2REXB 3AFHA 3T3HA 2CJPA 5CJ2A 2I8AA 2C2BA 4OJMX 2BMFA 1FLAA 4GMGA 4DLWA 3PIRA 1J8VA 3FDZA 4RTQA 4H1VA 3LLUA 1YMUA 5F98A 1ZH0A 2YV5A 1G2IA 1RJEA 2Z1DA 1NOJA 1P5FA 3M6VA 4CR8A 3Q4GA 2XOKA 1NF8A 3FF1A 2P6MA 5KOJA 1OC2A 3VAAA 2JATA 4E5SA 5IVPA 5CURA 4DARA 3GLSA 3B60A 1II9A 1WVGA 2OEPA 4FFDA 2JGDA 3IAS1 2GQ0A 4L5BA 2VQEB 4W6QA 4B85A 4D0NA 2HWYA 4F1KA 3FMPB 2IHYA 5CXSA 2K6GA 4ZZ3A 3NX4A 2Q2WA 4IRXA 3ZZUA 2EARA 1U6KA 2FPSA 4OQZA 4KPGA 3AEXA 4F91B 4LE2A 4FINA 2PUGA 5K09A 1X7YB 1NN3A 2HW8A 3S55A 4KXXA 4DJJA 3VSDA 4C6RA 4Q1AA 4BLUA 2ONCA 4BGEA 1FYFA 4V1CI 2EHJA 5IU6A 1ZVMA 2AXEA 2VA8A 3BK7A 2X6TA 1QVZA 3OZWA 3PPXA 4PPNA 1U0HC 2GK4A 2WWRA 4N5MA 4KO3S 2XA2A 1DBPA 5F35A 4PINA 3PXXA 4QOIA 3IESA 1WG8A 4C4AA 3CRZA 4ZVPA 2CUTA 4F56A 1VECA 3ZUGA 3QPBA 3ZOKA 1Z2AA 1NJ6A 1KEVA 2FUG1 5L53A 1GP2A 3GZTB 4GWKA 5FV7A 3P9ZA 2ZIZA 5TMBA 3RT9A 3WJ1A 3TECE 3MFQA 5BOSB 5JI3E 1I24A 4TMTA 1DJNA 5ALGA 2HGSA 1C41A 2RHHA 2VK1A 4BKMA 3CNEA 3ZVNA 3HM2A 1GNSA 2AC2A 5AM0A 5D7BA 5EE5B 4D46A 2PNFA 3OETA 4UMFA 4F0JA 3R8CA 4AWBA 1MZPA 1QQ5A 1TQDA 2JRCA 5L3QA 3L9WA 3O8RA 4C21A 3FDZB 4YN3A 3LGAA 3UMCA 3R5JA 2CE2X 2R6R1 3AJAA 3TXAA 2PD6A 1DWPA 3V8MA 1NQWA 3E8XA 4KVZA 1PWZA 3P96A 1FUYB 1DO0A 2A0UA 2XCUA 2NO7A 3FNEA 3I09A 3EULA 5LQCA 1DMSA 1QRAA 2B3DA 2XHEA 3OJ0A 3ZY2A 2DWQA 1SMKA 2WKSA 1ZVJA 3PRYA 3EYAA 4FBGA 1I6WA 5AK4A 3TTYA 4O2BA 1PS0A 3I58A 3ZKWA 4D0LB 5BQFA 3AJ9A 2JGDB 3J81A 3KBOA 3T1OA 4JBNA 3DV2A 5HRCA 1QG6A 2MOKA 3LCUA 1G9XA 3L0YA 1P19A 1WZCA 2OUIA 4W5HA 2WP8J 3UXMA 1TIBA 1VE3A 1N5JA 2P6PA 1G8YA 2OPBA 2UVQA 4OO3A 3KT3A 3V4OA 1SIOA 2X13A 4NCAA 3I04M 2LBPA 1RBMA 4IHKA 4ZAZA 3OTOB 2WFMA 2VJYA 1RFLA 3STXA 2IWRA 1Z4MA 3ICQB 3ZY6A 3I2IA 3JYLA 1PFWA 4F3KA 4JBYA 3ET4A 3BKXA 2PNJA 2VTBA 2PRJA 2HV9A 4LJ9A 1VLHA 2VPXA 2M6RA 2XXBA 1CJBA 1U5CA 4CLEA 5FIUA 5CU7A 3BOSA 4WZBE 4ZQIA 5HF5A 1T9GS 1QCYA 3D1VA 3G1TA 4MKRA 4ANFA 4DANA 1NXWA 2R7AA 2W2LD 3N3AC 1K5PA 3Q8LA 1RPTA 2BC9A 4HTAA 1T0BA 3BSYA 4R81A 1TF7A 5EZQA 1AKWA 4GM4A 5EHGA 4H4CA 2H06A 1CR1A 3NYWA 3KKEA 1JP7A 1L5NA 1Z75A 3L6UA 2A1UA 3U49A 4U2GA 1FB5A 3KYCA 4L0CA 3KFVA 4BLWA 1D03A 2W4MA 2FMHA 3MYYA 3WV4A 1YJAA 2GERA 3G5LA 4IO0A 3OE7D 5CTAA 1X42A 2EX4A 1BSVA 5JMTA 2IIPA 4KYVA 2H16A 2Y1CA 3E9RA 3NIFB 4Y2TA 4EPRA 4Z6KA 1QRTA 4G2TA 4MUFA 4DR4B 5JJ5A 4PO1A 5L3QB 2F3SA 3LDGA 3UOAB 5B55A 3QEAZ 1OIXA 1P7YA 3QELA 1DC5A 3P9CA 2XUJA 2YWEA 3Q8XB 4LUCA 3MMPA 4BQFA 1EDZA 3GCDA 1JDBB 4QXPA 5DW3A 5HG0A 1MH1A 2O5RA 1U5AA 1QYXA 1VIDA 5KVQA 3T1VA 3P0RA 4DMMA 2HWUA 4Q93A 2CE7A 1B23P 1HDCA 1JJAA 3TM4A 3UKOA 3EIWA 3GGGA 1L7DA 3M6WA 4CT0A 4U0JA 2Z8YA 2OECA 5G40A 4IUDS 4U7PB 3AT1A 3H84A 3DLHA 1B76A 4KPEC 2WIDA 4ZICA 1EA5A 2IZ7A 2P6UA 3L6BA 3GA7A 3GMTA 4LYFA 1O5IA 1Y7PA 1GUDA 1F5SA 1WCIA 3DKRA 5H83A 1FTSA 4KWIA 1VJDA 1RT9A 3U37A 5JPIA 3ZDQA 5H3CA 4YY3B 1TEZA 4PC3A 4X3CA 4U00A 1V25A 3SOPA 4EUSA 3C5HA 4BMPB 4B5LA 5A04A 2X23A 2VTBB 4FWTA 4Y2XA 1FX1A 1DGQA 2A5JA 3N6VA 1UT6A 3CNQS 2X3UA 3EMKA 3VZBA 3GLTA 4P4LA 1NDQA 4Z49A 1B6RA 1B42A 3EY4A 3UH0A 4UDOA 1H4TA 3VO8A 4C08A 3LYHA 1NZDA 3AM4A 4R98A 3HEBA 2PO7A 5K2MA 4KLAA 4LK2A 3EW7A 2BGMA 3T7KA 4JGGA 4P7BA 4QICA 1IVNA 2A1UB 3KYCB 3ETCA 5CT4A 3G68A 3ZQ4A 1EPUA 3HN2A 4N0PA 1NU8A 2O9JA 2ZEJA 2A5YB 4Y6GB 5HTKA 2VKTA 3HWRA 2D1SA 4ENTA 1RXCA 2X4IA 2ZWOA 3AI7A 4DREA 3IKMB 1D9XA 3QELB 4AK9A 1XU9A 2VT3A 3EG5A 4NI5A 5EZSA 2WT9A 1GZSA 1BS9A 1Z88A 2OCBA 1L7MA 3OBIA 4JC5A 3RF6A 1XJ0A 1UJ2A 1L6RA 3H87A 1HE2A 1RPAA 2VF4X 1U2GA 3PUWA 5E1MA 4E03A 2G7MC 2A30A 2RC5A 4PGHA 1JVNA 1QGYA 3F97A 4Z9AA 5ENZA 5GIOE 3BHMA 1COWD 2RHTA 2FRDA 3Q3JB 4K2AA 3SK0A 3VHQA 3H1FA 2IYUA 2P8SA 2XUFA 4MP6A 3SF8A 4OBEA 1ZGHA 2FDRA 4YUYA 4BHTA 1VJ5A 2EIHA 5CB4F 3N8GA 1PVVA 1ZFNA 3DDOA 4KBFA 1EWVA 4BCDA 3TTVA 3AR2A 1VJCA 4QO7A 1X74A 2QN7A 5KNDA 3O95A 4M9RA 4C2UA 1EFUA 2Q0QA 1Y7LA 1CDEA 4J03A 1WCIB 2GCPA 1P7CA 3PNYA 2R1VA 3U3JA 2V3CC 4X7PA 1XMVA 3HPQA 4MQLA 5AUQA 3ZNOA 4G8CA 5DT9A 1PJAA 4HX5A 1PF7E 4BO9A 1ZH8A 1A7JA 1PTJA 1WD7A 1W9HA 3BKWA 3Q15C 4JR2A 3STWA 3WNVA 1M2OA 1UKCA 2PZGA 1VGRA 2AMFA 3K0AA 5IM5A 1AKNA 3LCVB 4IOMA 1KZ7B 2QD3A 4HNQA 3P9KA 3BE6A 1CDOA 2BGUA 3FX2A 1PO7A 5LQUA 4LRQA 2VO1A 1T1GA 3LLVA 4PPQA 2HMSA 1QWOA 2ZBUA 4M0UA 1PBNA 2P6OA 3N2LA 4QSMA 3NS7A 2PLNA 4MVXA 4N7MA 2JAXA 1T9BA 2YQ5A 2R86A 1KS9A 3W9YA 1FNBA 4Q3LA 3C6QA 2UDPA 4PC6A 4PLZA 4HB4A 3IMCA 6LDHA 1JEYA 4KQ2A 1TU4A 3ICPA 2RGEA 2WA1A 5ALUA 2AMYA 2QW0X 5DHRA 1EGVB 1X7WB 3KWFA 3KZMA 2O50A 1BH6A 2XTAA 3DM9B 5JIBA 1MO3A 3IVCA 1Z74A 1BYIA 2XA9A 1JYEA 5HK9A 3GPDG 3E9ZA 4QUHA 3O8CA 5ULLA 2HJVA 2VPWA 1EHIA 3D2LA 3D3QA 3DBVO 2DX7A 2O5VA 3VAYA 4CM3A 5T7BA 3TNLA 4QYIB 4Q9LA 4DMCA 1QTNA 4GP6A 4NEQA 4UNQA 1UXKA 1QDUA 1UBJS 3ANLA 3AVQA 1HNWB 3ZHTA 5LMZA 3H5IA 2IV2X 1DQPA 4OH7A 4KMMA 4ZREA 1NV8A 1J5PA 4N0MA 4XQEA 3SF8B 3TR0A 1U7ZA 3AY7A 1BN6A 2HWXA 3F3KA 3M5WA 3LUJA 3MCUA 3DBOB 4GQBA 5GOZA 1V9SA 4EF6A 1TZKA 3G2JA 1KI7A 2EBFX 1Z7YA 3KHSA 3CUSA 4RZ3A 5L45A 1ZR2A 4NZPA 1PZMA 1UQUA 2EZ4A 3E7XA 4IDDA 3GUCA 4WH0A 5HILA 5DMHA 3VKUA 1I94B 4DY4A 2DKFA 5KSOA 2XCQA 2R1VB 2GFHA 5LNK1 4PYIA 2FN3A 5T4FA 3DOEA 2CLDX 4FOPA 4B76A 2XOEA 1RYNA 4YJ2F 4GOXA 4JCOA 3NI2A 4JLJA 4R2JA 5M2QA 5JT1A 1KSFX 1HV8A 3QHPA 4Q1BA 1M2OB 3HDHA 3K0AB 1O9HA 4H0FA 4RJIA 4XIJA 3WMFA 4BU0A 4YT4A 5KMGA 1RM5A 4ED9A 2EFJA 4IIVA 4JXXA 4MUJA 2Q5CA 1K7FB 2B8NA 2CLEB 4OTZA 2O2HA 3MLAA 4V0KA 4CM1A 3HWWA 3HB4X 1QZUA 3CF0A 2O3TA 3DPSA 2EP8A 1SZCA 4UXHA 3SM3A 3W6OA 1KO7A 4DW8A 1ZN9A 3NCHA 3X3HA 4GAEA 3PFBA 4C4OA 3DHNA 3GLKA 3FETA 3LPCA 1JU9A 4EHLA 4BNLA 1EVLA 4OXQA 1JEYB 2IEDA 2Z9DA 1IVSA 3NDJA 3HDGA 5HSGA 4HQKA 3PJDA 3EZLA 5HRUA 3VJKA 1SC1A 2WMDA 4CNQA 1QP7A 4UZEA 2C5LA 2XD9A 3PUJA 3LUDA 3QBVA 2HWWA 2IVZA 2I9KA 4X6UA 4OKSA 4KREA 1F6DA 1MP0A 1QVRA 3GDGA 5TS2A 3G2PA 1A69A 5CLIA 4F4JA 2X86A 1GQFA 1L4BA 2CUZA 4AMZA 1YB2A 5K6AA 4M46A 3EH1A 4GMHA 2B1JA 1A8HA 3IR7A 4RK4A 3PL1A 5HF6A 1RRCA 3NUQA 4QPZA 4C4ZA 1A50B 4L74A 1DQZA 2ZRJA 1JYFA 2D5AA 2W43A 1TAUA 3V1KA 4D6XA 1Z3CA 1V8DA 4R2WA 5CVUA 2QX7A 2BI7A 4I55F 4YRJA 2ZSBA 3ZHBA 2FOXA 1XCBA 2YINC 5GZ3A 2ZATA 4CDNA 2QW8A 3BXOA 1W1WA 3LKZA 5CLFA 3I9JA 5FUXA 5GONA 1OI3A 1YXMA 4JYPA 1N3BA 1XMSA 1V8FA 1DG9A 2BSAA 2GPWA 5FTJA 4G8DA 3DL0A 1T9AA 1PT7A 2CVHA 1FS4A 1YZYA 1UZLA 1GEGA 1FSSA 2EJWA 1JG2A 2O7VA 2IT1A 3HLYA 4S1OA 4EPVA 3M1LA 2PMEA 2Q07A 3AU8A 4K0RA 2FPLA 1C9YA 3AEQA 3I0ZA 3D3WB 3EB9A 3NVKI 2XMBA 1H8ED 4GR5A 2L17A 1HEIA 3ZWMA 4RWEA 1EX6A 1T2DA 1W93A 1QR2A 3N2GB 4MWOA 4A1OA 2J5XA 2PBZA 4NESA 2HA4A 1M74A 2FKNA 1L5HA 5DWQA 4AJOA 4BP1A 4AB1A 5J23A </