3PFCA

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with ferulic acid
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl esterase
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
total genus 88
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pfcA00
5CURA 2PSEA 1PJAA 3UMJA 3V48A 1A8UA 1LBSA 4KE9A 1EX9A 4F0JA 2XQGA 1XLUA 3KDAA 1QIEA 2QS9A 3GELA 2QR5A 1LZLA 2QZPA 3I6MA 2CKMA 2WFZA 4X3CA 1EHYA 3B12A 3H2HA 1EA5A 5A7FA 5A7HA 3H1AA 2QM0A 1GT6A 2R11A 2JEYA 5LIPA 4AB1A 3DDUA 5DTJA 1CEXA 3PUIA 1QO9A 4BB0A 2WIDA 4G9GA 3W9BA 5CT9A 4G8BA 2X76A 5ALOA 4A16A 1VE6A 3L1IA 4FKBA 3K6KA 3FCYA 4CCWA 4UFPA 4PV7A 2ZSIA 3ZI7A 4KAAA 3STTA 1XZMA 4OCZA 4K6GA 4GDMA 4HS9A 2CBGA 3O9VA 1BN7A 3KWJA 2V96A 5LP1A 2WUGA 4RNCA 3BL8A 2PVSA 2PKYX 3MUOA 1JI3A 1QTIA 1ZD3A 5AM4A 1U4NA 2OG1A 3V1KA 3C45A 2PM8A 1RWQA 5AO9A 1XZAA 4DNFA 3RLIA 1K63A 2GYWA 4H18A 4X92A 4UPDA 2OCKA 3V1LA 4ARBA 1CUIA 1NU8A 2XUGA 5JD5A 3T4UA 5CXUA 5D3KA 4G5XA 3SK0A 5EHNA 3M82A 5CRIA 4CI9A 2X5XA 2OQVA 4MYSA 2XQIA 3IUMA 5HKBA 3G0CA 1N5RA 4N5IX 1ZI8A 4DIUA 3N2ZB 1XRLA 4JEIA 4Q82A 1ODTC 2JGIA 2OXEA 5HFAA 2WFLA 2D5LA 2XUQA 1UOOA 1IUNA 3DEAA 2PSFA 4Y2YA 3WL6A 3FAKA 4AO8A 1JJBA 1AMNA 2V9ZA 5JD4A 4DSAA 3EBLA 4CIBA 2RGUA 1GQSA 2VTVA 3WLAA 2WHPA 4AX4A 4QEKA 4J7AA 3EIOA 4U2BA 4KJXA 3L1JA 2WUFA 1LZKA 3FYUC 4G8DA 3C43A 1J1IA 1MJ5A 5AM0A 5IVHA 4RE6A 3QPDA 1Q0RA 2LIPA 3WWOA 3DLTA 1E8MA 1UKBA 2XMQA 1XKLA 3WKCA 1WPRA 2OQIA 1CUEA 4QLAA 4EA6A 2W22A 4Y2RA 5HZGA 4X90A 3PE6A 4BZZA 3R3VA 4IH9A 2WIFA 2QXUA 4PNZA 1Y37A 1LBTA 5IVKA 2PUJA 4P08A 4WDRA 3WMRA 3F96A 4KE7A 5AJHA 4G4GA 2XMCA 1LPPA 1H2YA 4BP9A 2WIGA 2OGTA 1P0MA 1XZHA 1BE0A 3G9UA 1DX6A 1L7QA 5CT8A 5CXXA 3C8HA 4GXNA 1CUAA 1FSSA 4FMPA 3C70A 3OOSA 1MAHA 4G8CA 2WILA 4GWLA 2WHRA 1YA4A 4C4XA 5A71A 4HXFB 1QIGA 4W1PA 4GECA 2WTMA 2HA6A 4A5SA 3ZPXA 1ACJA 3ZV7A 3R3WA 4N8EA 1UZAA 1EVQA 2I78A 3WKEA 4C01A 1W76A 4V2IA 4QDUA 5DLPA 5AM1A 4Q34A 4KE8A 2WJ4A 2PX6A 3L1HA 3GZJA 4Y2JA 1UKCA 1EDDA 1QGED 2RHTA 3H1BA 1EDEA 4UHHA 1G4HA 4RE5A 5EHZA 3WK7A 1X2EA 3WK8A 2CMFA 1UK7A 4A23A 3YASA 2VJAA 4BAUA 4X97A 4BE4A 4X7BA 4WY5A 1EB8A 4L72A 3S2ZA 5EIHA 1YA8A 1C7JA 4ZV9A 5EFZA 5ALYA 4MEBA 4XJVA 5AP9A 1EH5A 4HRYA 1VLQA 2QOEA 4QLOA 3G9TA 3IIIA 5AOAA 3VVMA 1CPYA 1L7RA 5AIBA 4B81A 1W52X 3H0CA 2FX5A 1XRMA 3H2JA 2E3JA 2DCMA 1BN6A 3AIOA 1HKHA 4HVTA 1AGYA 4X91A 5CTAA 3IDAA 1F6WA 3A2NA 5AK4A 1PFQA 2C7BA 1SCIA 3STYA 4BE9A 3QM1A 4X6XA 1BEEA 3WA6A 1CUSA 4E46A 5IVDA 5LZ8A 1Q83A 1CIJA 3G9XA 4MQLA 1UOQA 2FJ0A 5HKAA 1P0IA 1QONA 1U8EA 3PFBA 4CFSA 3I1YA 3GROA 3QMMA 3NOXA 1CQZA 2J4FA 3AIKA 2QRUA 4WFKA 4DNQA 4G4JA 3AZQA 5IH7A 4MYDA 3I1IA 4DM7A 3F97A 1W75A 5F4ZA 4IQ4A 3H17A 3R3UA 5AM5A 1TQHA 1H2XA 1ZI6A 2BCEA 1N8SA 2BUBA 2WTNA 1S8OA 3WK5A 2OGSA 4DMFA 1CUDA 3ESDA 3PI6A 5E4JA 3HJUA 2H7YA 5LZ2A 4KE6A 1G66A 3G9ZA 1XLWA 1XZKA 2J4CA 4FFWA 3WZLA 4BP8A 4IH4A 2RHWA 5IVIA 1ODCA 1XKTA 1XZDA 2VT7A 1EK1A 1YS1X 4KAJA 4U2FA 5LZ5A 3CN7A 1XROA 3DYIA 3BDVA 2VSQA 1BRTA 1ODSA 2XUKA 1K8QA 3ESBA 1ZD4A 4J0CA 4J03A 4UBMA 5AKHA 3G02A 2PU7A 1CUVA 3VKFA 2J3QA 4J0DA 1XZCA 2XUPA 3STXA 4Y2TA 3OG9A 2Z3WA 4DSZA 3VJKA 4ZGBA 3EF3A 2PUHA 3R41A 2AXEA 2WFLB 2GZRA 3DCNA 1GKKA 3FYUB 2WQZA 3RKSA 5AKKA 3O0DA 6YASA 4C87A 2JBWA 3EQ8A 4M0EA 1ZIXA 3ESCA 3M3DA 1MTZA 5EI5A 4KRXA 3A6ZA 4KAFA 1IZ7A 4MJ3A 4P93A 1LPOA 4RGYA 4KACA 4INZA 5ALJA 2WHPB 2PSHA 5T4BA 4BDTA 3EQ7A 1ZGBA 4M0MA 1HDEA 4HTAA 5ALHA 4BZWA 5DYYA 2AJDA 4QZVA 2WG0A 2IIVA 4I4CA 5ALMA 3D2CA 3QH4A 1TKRA 4LXIA 5HF6A 4HRXA 4DMHA 1JMKC 4ROTA 4X85A 5ALPA 3DL7A 5K3FA 3O4HA 3C6YA 5A62A 3KD2A 2HU7A 2Y6UA 3E3AA 2B20A 1O6FA 4UFNA 3SWWA 1TCBA 3FCXA 1XQVA 3ICWA 1UFOA 4U2DA 2HU5A 3SX4A 3D7RA 4AMYA 5JAUA 1VXRA 2YH2A 5DNWA 4H7DA 4YPVA 4PQEA 4B85A 4S0XA 1WB4A 2PL5A 3C6BA 5K3BA 4N5HX 1R50A 1TIBA 3WL7A 7YASA 1QIFA 1WCYA 5D3ZA 4W63A 2QKYA 5EHQA 3G8YA 5CT6A 4X93A 1VA5A 5AKZA 4TPKA 2XUHA 4C4ZA 2V97A 4FBMA 1W1IA 1J06A 1VXOA 3N0TA 3WK6A 1AUOA 1QIHA 2BGNA 1J07A 3UUEA 2HU8A 2VAVA 2JGEA 5CW2A 5AKJA 3C6ZA 3I2IA 1JFRA 5JIBA 4HZGA 1YR2A 2WUEA 1IVYA 4ZRDA 4TGLA 4UBKA 2OAEA 2AJBA 1F0PA 1L7AA 1QJ4A 3F98A 5K3AA 1A7UA 2HL6A 2WG2A 3QMVA 3A70A 5AKIA 4MWSA 3WKAA 5FXMA 4AMZA 1DINA 1GPNA 1OILA 1YAHA 2G5TA 4JH0A 4Y9SA 3GBSA 4WFJA 4MXDA 4DMCA 1N1MA 2XQKA 1B41A 3G0BA 3M83A 1GPLA 1CFJA 5AKXA 4F5ZA 1CUJA 3BJMA 3DYVA 2ES4A 2OLEA 1U65A 5AKYA 2EDAA 1CUXA 5CMLA 1XLVA 4B9EA 4AQDA 3VDXA 2XMSA 3I2KA 4J0KA 4N8SA 3E0XA 1ETHA 1X70A 4YK7A 2HA3A 2WG1A 2XMDA 3ZLTA 3IULA 2G63A 5HQ3A 3KSRA 3WK9A 4AXBA 1C7IA 5FP0A 1BROA 2VJDA 2XUDA 4H77A 4WY8A 1DT3A 1JT2A 2XMGA 3W06A 2ACEA 5AI0A 1BCSA 4L0CA 1WB5A 4UUQA 1D07A 5K3EA 3Q0TA 2GBCA 1LPSA 4B80A 1ZD2P 4X00A 1UK6A 3STUA 3I2GA 4MEAA 4G4IA 1CUZA 2ONCA 4QDXA 5JADA 5ALLA 3LCRA 4BVKA 1UKAA 2VEOA 1QZ3A 2VJCA 5HK9A 3AJAA 3D2AA 2QUAA 3V1NA 2Z8XA 3C87A 3IUJA 3F8SA 4RPCA 1T2NA 2HRRA 1WM1A 3HEAA 2QT9A 4K6KA 2BUCA 3FYUA 2WKWA 1EI9A 2C5GA 4YX9A 1CUGA 3OTQA 4U2GA 3AFIA 4BYMA 1KU0A 2XE4A 3BF7A 2HFKA 1T4MA 3A2LA 2VAXA 3JW8A 1AKNA 4LXGA 1H22A 5CBKA 3DJYA 4I19A 3TJMA 1XRPA 5ESRA 2I3DA 2ZJ7A 4QE3A 2OPHA 4OPMA 1YCDA 4H7KA 4J0HA 3FLEA 2O7RA 4JYPA 2WJ6A 3VXKA 4KEAA 2VF2A 4C4YA 2GZSA 4B7ZA 1ZD5A 4UHDA 1FFAA 1P0QA 4NS4A 2AJCA 3WKDA 4GI1A 2HA4A 5AIAA 4BVLA 4LHEA 3WWDA 2WM2A 2O2IA 3KOOA 3WYNA 2AJLI 3PDCA 5JZ9A 2XLBA 3DD5A 1BEZA 1XQWA 2BFNA 3R3XA 5DTIA 4G9EA 4FNMA 4H7JA 3WIBA 4F21A 5JYCA 2C0QA 3H2KA 1J2EA 3HSSA 4EZIA 1LPMA 2EEPA 1USWA 2HHAA 1H2ZA 1DQYA 1XZGA 3KXPA 1UK9A 4E11A 4Q1VA 1G5FA 1EDBA 2HA5A 4K5QA 4CG1A 1LPBB 1ACLA 2BGRA 1ZJ5A 3RARA 3WYDA 1XZJA 3WJ1A 3QPCA 2C58A 2WUDA 3QITA 3BWXA 3OPMA 1OXMA 1RYYA 1A88A 1WB6A 3RM3A 4H7HA 3WJ2A 3V1MA 2OCIA 3WL8A 2HM7A 1YASA 5ALZA 1XQYA 1IZ8A 3IVMA 3O4JA 5KWJA 2DFPA 5FPPA 5A7GA 1DT5A 4BBZA 4O08A 1Y7HA 5E4TA 2ZYIA 4AO7A 2XUFA 5K3FB 2HA0A 3FNBA 3JYHA 5HF5A 5C7YA 1HPLA 5ALNA 4LIPD 2YXPX 2H7CA 1RP1A 2WHQA 1E89A 5DYTA 1C4XA 1THTA 3KWFA 3T52A 4DGQA 1WPXA 1QIJA 2Z3ZA 2RI6A 1YB7A 2CB9A 3HLKA 1UWCA 4FNGA 3VVLA 4E14A 4TVKA 4H7FA 5AKGA 4IH1A 4ETWA 4ZV7A 1HBJA 1ORWA 5AI5A 2PSDA 2QJRA 4XX1A 4EY8A 5BV7A 2DHEA 3ILSA 4Q3LA 2C0PA 4KYVA 5AK5A 4L3WA 4OB6A 2I03A 4ARAA 2WFMA 1WHSA 3LP5A 1TK3A 2G4LA 3W04A 5K3CA 1R9MA 4UHBA 4DMKA 4F60A 1GPKA 5AI6A 1AC5A 2JGMA 3IUNA 3G0GA 4WDQA 2IX9A 5AOBA 1G42A 5ALEA 3AINA 2ZJFA 5EIAA 4I3FA 1XZEA 3LLCA 5FUMA 4UHFA 1QIMA 4ZXFA 1SC9A 3FLBA 4ZI5A 2H7XA 1AURA 4P92A 4OUKX 3TEJA 3D4LA 4X6UA 4Y2UA 1CLEA 4Y2VA 4AN1A 5EGNA 1PV1A 4UBIA 1IMJA 4M0FA 1CUCA 3WKBA 1VOTA 5DJ5A 3BDIA 3FVRA 5JANA 2GBIA 4EY5A 3IURA 3C5VA 4BCCA 1EVEA 5AICA 4BC1A 5JASA 5ALXA 4BTVA 2JEZA 1EK2A 2RONA 5A2GA 5HQ3B 5DNVA 1AQLA 1TAHA 1E3QA 1CUYA 3GA7A 5AHXA 3D0KA 2ECFA 3BXPA 4UBLA 4ZREA 4GW3A 3IBTA 3AUKA 2CZQA 5T4FA 3HYSA 3WL5A 1HL7A 5CH3A 4X94A 2Y2UA 2RIPA 3ESAA 3U0VA 4QA9A 4YASA 3I2HA 2QJWA 4LXHA 4W9RA 1YAJA 3TRDA 1YS2X 3DNMA 2XB6A 2DQZA 1DU4A 3IUQA 1W4LA 3WK4A 4FWBA 1FFEA 2XQFA 3X3HA 4EB0A 3MVEA 2ZYSA 3QZUA 2BKLA 3VISA 3V9AA 1CRLA 3QMWA 2JF0A 2G5PA 3STVA 4XWGA 3ANTA 4UHCA 5ALKA 5FDFA 5C8XA 2FUKA 1MT3A 1BS9A 3A2MA 3PUHA 3EQ9A 5ALIA 1H23A 2BAGA 3SC2A 4BATA 1R1DA 3AIMA 4Y2PA 4J0JA 4BAZA 2ZJ6A 3DOIA 4DNPA 3BIXA 4MWTA 5AK6A 3ICVA 4BRZA 5ISMA 4FTWA 1VA4A 1KU6A 4OU4A 2QTBA 4B84A 4X95A 4GHWA 5YASA 3C8DA 1DX4A 4UFOA 1XZIA 1TRHA 1B6GA 5K3DA 1R9NA 3DKKA 3R40A 5HF8A 4WCVA 1A8SA 1K5PA 4CIAA 1K6EA 4WFIA 1DWQA 3E4DA 3JWEA 5ALFA 4JYMA 3D2BA 2CUTA 3OM8A 4EBBA 3R0VA 1E66A 5CT4A 1JU3A 2IITA 1YSCA 5BWCA 5T4HA 5BWBA 4WJLA 5IKXA 3ZLVA 1A8QA 5ALWA 1I6WA 1MNQA 2QUBA 5ALTA 5I7UA 4X6YA 4B0OA 4HXEB 4KR0A 4B9AA 4FOLA 1QIIA 2ZYHA 1ZOIA 4KRYA 2DR0A 2XUAA 1VJ5A 5LKAA 4CG2A 5EIEA 4K2AA 3HRHA 4OYYA 4PSUA 2WLSA 3WIOA 1M33A 3FVTA 2J3DA 3PF9A 4FBLA 1WOMA 5JAOA 1XRQA 3I2JA 4UHEA 2QMQA 2GBGA 1VKHA 1W6RA 3C6XA 5FV4A 3G0DA 4PF1A 3H19A 3R3ZA 2GBFA 3FBWA 5CH5A 3DKRA 2XUJA 3WI7A 1VE7A 3O4GA 4B82A 1SFRA 4OD0A 2CJPA 2O7VA 1Z68A 3FLAA 2JGJA 5ALSA 2RAUA 3BF8A 3IB3A 3O95A 2DHDA 4W1RA 1EB9A 3DL4A 3QBJA 3ED1A 1FFDA 3C5WP 3HXKA 1XZLA 5AK3A 1H2WA 3WWPA 4PSCA 2HFJA 1WHTA 4QWMA 2PU5A 3DQZA 4BTLA 5LLSA 5T4EA 4P9NA 1QLWA 2YYSA 2VQ6A 2YASA 1CUBA 5LYYA 1IUOA 2PSJA 3UUFA 1TCCA 3HACA 4NVRA 1P0PA 5AKLA 2OGZA 3WQHA 2HRQA 2XMBA 4XVCA 3WZMA 3QPAA 5KWIA 4GLBA 4J0GA 3B5EA 1LPAB 4CCYA 1UT6A 4FDMA 2PBLA 4K6HA 1LGYA 2WJ3A 1E8DA 1N5MA 2WU4A 3H04A 1CUHA 4JNCA 5C81A 3H2GA 1AZWA 3K9BA 3NGMA 1JJIA 5K5EA 4CG3A 1XZBA 2QVBA 2JGLA 5AI9A 4Y2QA 2DSNA 1ZIYA 5HFNA 3OURA 2QXTA 2XLCA 3G0IA 4ITVA 3HC7A 4EUSA 2XT0A 3GUUA 1BCRA 3O9MA 4H7IA 5EHXA 3GFFA 1R3DA 5BOVA 1CQWA 1GGVA 1JKMA 4GBGA 4ZWNA 1CUFA 2XI4A 3BE8A 5AI4A 3QYJA 4X71A 1AX9A 2DHCA 5HF9A 2JIDA 1JJFA 1XZFA 3Q8WA 3LIIA 3W9UA 5J3JA 1CV2A 2JGKA 5JZBA 2H1IA 4FHZA 2VATA 4LYDA 2NW6A 1UOPA 1GQRA 5JARA 1MX9A 3S8YA 3ZLUA 2Y2VA 2B4KA 2C4HA 3WWEA 2ZVDA 4LYEA 5AH0A 3F9CA 4BVJA 4B6GA 5HK8A 5JALA 2UZ0A 2VA9A 4BCDA 2OAGA 2P8SA 5AKEA 4QWWA 2FJPA 5ALUA 4D9JA 5SYNA 2ZSHA 1XRRA 1SCKA 2O2HA 3NWOA 4N8DA 2D0DA 5I9IA 5KREA 1LLFA 1GXSA 4DLNA 3PICA 4Y2XA 3VJMA 4H0CA 3CCCA 1VZ3A 4W1SA 2C5FA 5JZSA 3HABA 4Q05A 3WWCA 2XUOA 3FSGA 3D59A 3LIPA 5D6OA 1XQXA 5ALVA 5ALQA 1X2BA 3R3YA 2HIHA 1MX5A 4IHAA 1O6GA 4C6HA 2XDWA 2WIKA 1QE3A 4U2CA 3F67A 2O2GA 3NUZA 4G1FA 1QIDA 4DNOA 4FLMA 1U2EA 4XIIA 1UK8A 3W05A 5DYWA 3G7NA 3D3NA 1QIKA 4QDTA 1EINA 3CXUA 2VT6A 1EXWA 4EY7A 1MO2A 4QNNA 4BRSA 1BU8A 1MN6A 2WIJA 4DYHA 2GYVA 4IO0A 1ZI9A 3AZPA 2HADA 3U1TA 1Q84A 4AZ3A 5AM3A 3E1GA 5C8VA 1ORVA 1MNAA 4NZZA 2HA2A 1E5TA 1VZ2A 1CR6A 4QDOA 4UBOA 3FWHA 3CCBA 4U2EA 1Y7IA 2ACKA 2Z5GA 1CUWA 4J3JA 3QVMA 5I8PA 1IUPA 3HI4A 2VJBA 2OCGA 1QOZA 3MUNA 1JMYA 3I6YA 5FLKA 5FKJA 4PO3X 1XFDA 3I2FA 5ALRA 2XUIA 2Z8ZA 3IA2A 4JUIA 3ZWQA 3VJLA 3FOBA 3H2IA 4B83A 5LZ9A 1QFMA 1MU0A 5E2IA 5SYMA 3O4IA 3P2MA 5LKRA 1HQDA 4C88A 4HXGA 4FFVA 4DTCA 4OU5A 1YB6A 1QO7A 2AJ8A 3STWA 4AO6A 4BC0A 3PFCA 5JD6A 1FFBA 5DNUA 2WU3A 1MPXA 1HLGA 3K2IA 1MX1A 4Y7DA 1F0NA 4GEGA 3W2TA 4EY6A 1OCEA 2HDWA 5LZ7A 4UBNA 1XRNA 3PF8A 2Y6VA 5C8ZA 5A6VA 4EHBA 4QDZA 2ORYA 5CT5A 1DQZA 1DWPA 2H9YA 3H18A 4J0IA 1FFCA 5FRDA 4BDSA 1UXOA 4OB7A 5KBYA 4UBJA 4OYLA 1DWOA 3BIWA 1NX9A 4NMWA 4L9AA 4FLEA 1FJ2A 3ANSA 5ALDA 1LPNA 3HZOA 2DQYA 4CCYB 2B61A 1ZJ4A 1CVLA 1GKLA 1DTEA 4BCBA 3M81A 1JU4A 4Q3KA 3AILA 3BJRA 1NU6A 3DOHA 2V98A 2K2QB 3D5EA 2ZYRA 5DWDA 1Q0ZA 1ZICA 4OB8A 4MQMA 1K4YA 1E8NA 3LS2A 4H35A 1ISPA 1CUUA 2OCLA 4Y2SA 3FSGD 1QFSA 2GYUA 3OC0A 3WA7A 5AI8A 5H3HA 4W1QA 4Z49A 1R4ZA 2CEKA 3AZOA 1F8UA 5JAHA 2ROQA 3MGAA 2PPLA 1LNSA 4PSDA 2R8BA 5D7BA 4AN0A 1QTRA 4AZ0A 2HA7A 2I3ZA 2WSLA 1KEZA 3B3QA 4LKOA 1R88A 3CN9A 2Q0XA 3RK4A 1SCQA 1THGA 4PW0A 5FOQA 3TGLA 3I28A 2BJHA 5JATA 5HCUA 4C89A 1SOMA 1ZGCA 5ALGA 5FPQA 5AOCA 3I6ZA 5CH8A 1MAAA 3DS8A 3FYTA 4HAIA 2BUAA 5E4YA 4B0PA 4EY4A 4OSEA 4BAGA 1GZ7A 4H7EA 5LZ4A 2JGFA 5JAPA 2EDCA 4FLFA 4Q3OA 2XMZA 2W6CX 4E15A 5AM2A 2X8BA 2XQJA 2XMRA 2B9VA 2Y1KA 1TCAA
chains in the Genus database with same CATH superfamily
5CURA 3BXZA 2D1SA 3R7LA 4GM1A 4DLZA 3HJTA 4M6WA 4WOBA 4PFJA 3BEDA 1Y1TA 1ENYA 3EPRA 2C42A 3K1ZA 5ED0A 4KMOA 4RKEA 1A8UA 1LBSA 4KE9A 4NZMA 1MRZA 4DJTA 1E2PA 3PXGA 2RHGB 1D7OA 1MA0A 4ENWA 2PRYA 2F7SA 4YBRA 1BWRA 2VDOB 4Y9DA 4A4DA 4YDHB 5DM4A 3KU4A 5JJ5A 1TEXA 4G84A 4NEQA 4MW4A 4MQ5A 4GYKA 3HXMA 4MUIA 3C1AA 1P4SA 1FFXA 4MDHA 3THYA 1AF4A 2IH4A 1P9WA 2QS9A 5HG0A 1EQUA 2I34A 3GELA 3HJFA 3S1AB 1AQNA 3LF2A 4CTOA 2BMVA 2R6FA 4MS3A 1G8YA 3I6MA 4NU8X 4AG5A 2BM8A 4G09A 4TKZA 5JCOA 2GD1O 1S2OA 4LJ7A 4JL5A 3VMFA 3UJNA 2AZTA 2GJKA 1V1RA 2BM0A 2O48X 3C3YA 3EVCA 3AP2A 1EHYA 2OY0A 3B12A 1I1HA 1EA5A 3KR2A 2Y1LA 4CCSA 1GGJA 2BTQA 4NYMQ 2DBQA 4UVIA 2GAJA 3C98A 3ANMA 3FPAA 3RIGA 3JQFA 3PC2A 4JQZA 4D1YA 2V55B 3UGTA 3GCDA 2YICA 1A5ZA 4N5MA 1NMZA 5FUVA 4Y67A 3S5UA 1OH6A 1K5GA 2I4TA 4JP8A 4MUFA 1M7HA 1VHLA 4OI4A 1Z07A 1E0JA 4PZ0A 4QBHA 1DQRA 3FPGA 4UJ5A 1IG0A 4EKNB 5LIPA 1OX5A 3FF1A 1CEXA 1RLJA 1T15A 3U19A 1E2KA 3VFDA 4BWGA 1QO9A 2NXCA 4K03A 3AYXB 2XVAA 3IJ5A 2RAFA 1TA4A 4OATA 4P5DA 4WXYB 4G9GA 2I7VA 3HUFA 4FYVA 3GLGE 1PQUA 3EGDB 4IDCA 5A03A 3B3GA 1CEQA 4JCOA 5BSWA 1C9KA 4O4IF 1JDPA 1JN0A 1GSIA 2KQUA 3BKXA 1YRBA 1JVSA 2AOWA 3FGOA 1O54A 2X76A 4NICA 1S3IA 4A8TA 5HRUA 1YONA 2F55A 1IWOA 3AJ8A 1I9GA 5K0TA 2CXXA 3O1IC 1I7DA 3R20A 3KQMA 5KHOC 1P0FA 1NG1A 2XITA 1ISSA 4D92A 1C3OB 1J5PA 1CCWA 3KXLA 3FYHA 1OXXK 4UFPA 5D5PA 2NO5A 4FSHA 1Y8RA 3WNQA 2ZSIA 4P83A 3S99A 3UPTA 3SZOA 2RJNA 4XDZA 1N9KA 4KAAA 1BRMA 4HOYA 5F1PA 4KMMA 4EHNA 4EFDA 2BHSA 4KMSA 2SCUB 4PFSA 3L77A 1ZESA 4K6GA 2JLWA 1KZ1A 4GDMA 4BNIA 1WV0A 3QU4A 2YL2A 4JLMA 3VPAA 2FX3A 1O5OA 4LXYA 3D0RA 2P3OA 3QEJA 2H1OA 3RU3A 3HJNA 1QRRA 2R8EA 1BH6A 1G7TA 2VVTA 1FYFA 4WBNB 1FUEA 4C7OB 4C20A 1D9ZA 2ETXA 3ZCSA 2P9TA 5C1PA 3IPLA 1Y1QA 1XTPA 2FFBA 4P3OA 1TQ8A 1GNTA 3W2GA 4JXXA 1A3CA 1TTQB 1YHYA 1AO3A 2G6BA 4JLKA 4P4SA 4BKOA 2OPBA 2PKYX 4F4DA 2D6FA 4XWWA 2REBA 2P9FA 4M1OA 2YS7A 5IC6A 3D2LA 3INRA 1MABA 1PWXA 3OCJA 4JC4A 2GH1A 3ICEA 4IDHA 1P73A 2XNCA 3MWJA 3ECSA 1Q0HA 2ZRNA 3LY5A 1DCMA 3SZRA 1PWZA 3RLIA 4RY2A 3ZVNA 4F6LA 3GFRA 1IG3A 4AMGA 2OZLA 2ODBA 3EH2A 1O0SA 2YXEA 3H5AA 4ZGGA 4D56A 3HQ4O 5A6SB 3A14A 1G8GA 4BQSA 4ZAZA 3GBPA 1U2GA 2JCGA 4P80A 2JD0A 5TJHA 4COOA 4ARBA 1E7QA 1J8MF 1CUIA 4JUBA 1A9ZA 3DAOA 5E6RA 5JD5A 3LDUA 1H69A 1YB4A 3BD6A 1TQ2A 2CL0X 4MUHA 4RK0A 4DJ5X 5C1OA 5CCDA 3S68A 2CV2A 1MJNA 3T4UA 3W5CA 3H0EA 2FP4A 2UVPB 5D3KA 2QX9A 5LIRA 2WF7A 3V7UA 1DXQA 2QZZA 4CI9A 1UMKA 5LD2C 2CHEA 4EY3A 3WDSA 4F1JA 5E9AA 2C59A 4HQ6A 3GOQA 4EYSA 3LVQE 1FY2A 3JRWA 3G0CA 3EEBA 2NZVG 1HL3A 1H66A 1XRLA 3KR1A 2GAIA 3M34A 4MW9A 1OH7A 5JROA 4DV5B 1M66A 2HEGA 4JLBA 1XTKA 4Q82A 5IM5A 2HHHB 1ODTC 2OXEA 1E6MA 2HXSA 5DYIA 5BRNA 3ZHQA 5TQ0A 4JBLA 4PINA 2QMEA 4NRDA 1XYGA 3QHAA 3DEAA 4JZKA 2PSFA 3MAJA 4X64B 1TEZA 3WL6A 1O6BA 3FAKA 4C7JA 4TMKA 1G8FA 1G8AA 1GZVA 2G83A 4JVMA 2B1RA 1Z56C 3RJZA 1AMNA 1OHHA 1P81A 5JD4A 1L1RA 4MI1A 4CIBA 3TLEA 1A27A 1SIUA 3GJ6A 2RGUA 4DRXB 9ATCA 1J9ZA 1MPTA 5FCDA 3UTDA 2X42A 3S28A 1KY5A 1G8KA 3WLAA 3RAEC 4QPDA 3TMYA 3O26A 1Y3HA 3QFTA 3SYRA 2PMFA 1P7VA 3PDIB 4J7AA 3FOAA 4KFSA 4LWZA 4B87A 1CJSA 2C4VA 3AO0B 4PYMA 2GZMA 2R4TA 3AQIA 4TRMA 4XYMA 1ML3A 3KD3A 5FQNA 4I1IA 4B3DA 3O0TA 1YHZA 4U2BA 1CTQA 1G8JA 2FTKE 4CN9A 4M1MA 1LY1A 1YBHA 2C07A 5L7WA 3L1JA 1HM5A 1R0WA 2O0JA 2X4LA 2FZWA 1LZKA 2WUFA 3VDRA 4RDXA 2BC9A 1Z9BA 4IV0A 4YAEA 2BFFB 1MJ5A 1VMEA 4TMZA 5IVHA 3QEKA 4DZZA 3DT8A 1CWUA 3G5TA 2QG9A 3I45A 1GV1A 1OT3A 1XZ8A 1WLSA 4UU1A 1LK0A 4BQNA 5C32A 4X1YA 2JCVA 3LW7A 1XTVA 3GLIA 2O2DA 2PWZA 4TT3D 1H6AA 4LOAA 3UMGA 5H7XA 3THOA 1NFFA 1UKBA 2AE1A 1H3EA 1A82A 1RMYA 3EAQA 3TR5A 3ENQA 1STOA 4QUIA 1M0EA 4DR7B 3QTTA 3UJPA 4XUGB 2CUZA 2OQIA 2RJOA 1P6UA 1JH8A 3LYAA 4DV1B 5ESWA 3ZVMA 4QX6A 2W22A 2IYNA 2JDID 1XEXB 3AV3A 1SXGA 3ITEA 4E5SA 3HU2A 3PE6A 3KX2A 4PLYA 2H18A 4BQPA 4BN5A 2C7RA 5JZVA 1EVIA 3G82C 1CY4A 2FOLA 5IM4F 4JUDX 5KQSA 2QX6A 4WASA 5K7SA 5JMWA 4XQ0A 3SMVA 2CW5A 2PUJA 1N2EA 4IZOA 1PNRA 4Z86A 1C3VA 2ZJBA 4HH3C 3V7WA 2BW0A 1ZVVA 3EHEA 1XZQA 1ZVQA 5BSTA 2ZZKA 3MSCA 4TTRA 3BE6A 3U4DA 3GN2A 2QV7A 4IQ8A 2XMCA 3GYBA 4YREA 1E2DA 1FDIA 2ZI7A 2OGTA 4KIGA 5DWVA 4YIHA 1DX6A 3EAGA 3TZLA 4BO8A 1L7QA 1E2HA 3FDFA 5ERGB 4N0MA 1MB3A 3INTA 1GWNA 1FSSA 4GXNA 4MW2A 3PEYA 2A0WA 1NM5A 2C8JA 1HE3A 4Y6LA 2KM1A 1KMQA 3ZHZA 2BEUB 4B6RA 1MAHA 3WHLA 1JJAA 4U7WA 1IJEA 1JYFA 3VPXA 2WWXA 3PZRA 3GQVA 2P11A 4F4UA 3LUKA 1M6EX 1H6DA 4ALMA 4D9KA 2ZM6B 3S1AA 2D7CA 3ZVKA 5A5EA 3AR6A 2BM9A 3T41A 2A9PA 2CVFA 1YA4A 2IF2A 3E5RA 1QR6A 4C4XA 4ADSG 5JXHA 1Q44A 1N2CE 1Y6ZA 2ZT5A 3BC1A 2QTWB 3K2BA 4W1PA 1SVKA 1IBKB 2DQSA 1E7MA 1IZZA 2DT5A 4Q02A 3V8RA 3KVVA 3VI3B 5K0SA 3PT5A 2J6BA 3AF1A 4P33A 4X7RA 1CNFA 3AX6A 3M4NA 4C9BA 4J4BA 2YRFA 1UF9A 3N8KA 5K3OA 1ACJA 2W8BA 5C4IA 1D09A 2IZ1A 2A94A 3IAAA 4DCUA 5L3SB 5KKNB 2I78A 3P0RA 1YJ8A 3DR3A 3ESQA 3WKEA 3PGVA 2HCRA 1VBKA 2D0OB 3NBAA 2I55A 4V2IA 3UNXA 4LYAA 2UYYA 1T4CA 2XGOA 5DCYA 1RBYA 1CR0A 3KLMX 4R7ZA 4XPZA 1JHRA 4D8UA 1UBKS 1ENZA 1Y82A 1LBIA 1SXJE 1X14A 1RWVA 1UKCA 1JFFA 1LTQA 2ZRPA 1VYHA 3KEOA 4E5YA 1AQ6A 2R48A 5F7OA 5IAAA 5KNCH 2EYUA 2A0FA 2RHTA 3H87A 4P86A 3ZWCA 4I5FA 2ZDHA 4UDXX 5FB3A 4ZDKA 4QGBA 1JV2B 3BKWA 5EZSA 5KYGA 5DBOA 2D1YA 4UREA 3IAXA 1G4HA 1U2RA 2B30A 1B3BA 1E98A 3WK7A 1SQ5A 3I05A 3LK7A 1X2EA 4RIFA 5AW8A 2JHCA 1G21E 3N5CA 2QRKA 1K4MA 1UK7A 4CM4A 1ECCA 3C3BA 1ARZA 3E3OA 3BTOA 1IVNA 3EY4A 3R5TA 4A23A 2K5UA 3ZHCA 1AS2A 2O59A 3RSGA 1RWWA 1HYGA 4L72A 4ZODA 2W5UA 5BSMA 1ULAA 3ZQUA 1SD2A 1FX0B 2SCUA 3KK0A 3Q3VA 2P2CA 5I9MA 3AEXA 1G55A 3M5WA 4CKCB 1U1GA 3I6BA 3F1KA 4JP3A 4KLAA 2Q46A 3CCFA 4B6QA 1CJCA 1BO6A 2JK0A 3ZW7A 4HXYA 3K73O 1VIVA 3IOEA 5FHRA 5FPTA 2RKBA 1OVGA 3O7WA 5I8ZA 1F12A 2QT0A 1Q6ZA 4PVDA 1WW8A 3I5MA 2ECQA 2G80A 1YR7A 1PZFA 5D84A 3DFFA 1BYUA 1OFTA 4FXPA 4LA4A 4WN9A 1PLLA 4XD2A 1JP7A 2XWJI 2DYKA 3GG9A 5AOAA 5C5CA 5LWQA 4ALIA 1ADGA 4RULA 2QRHA 1NQOA 3KUUA 3OZFA 3V8EA 3R5HA 2GDZA 1Q20A 2CLEB 5MN5A 1L7RA 1Q14A 1S4MA 2M6LA 2PZMA 3SCZA 3R9XB 3CUSA 2ZE5A 1R7RA 1SA0B 2HJVA 1IBSA 1W52X 2F59A 3O93A 1DOHA 4MARA 4AP6A 5LUAA 4NCHA 2VOEA 1OROA 2NVBA 4MP3A 2QD4A 4WGGA 1ESNA 2FX5A 4V02A 4CKZA 2O1EA 2DCMA 1TZMA 4KRFA 2W0MA 3TTYA 1GNPA 1UBGA 3HVUA 3PQ7A 2EC5A 4RJKA 1AHPA 1BWPA 3D3WA 1OWPA 3OEYA 3C0KA 4QUKA 2G1AA 3C6QA 3E7DA 5TIIA 1J70A 2VQFB 3IDAA 1F6WA 1QOQB 1J2YA 2J30A 3DB2A 3M8KA 2RGBA 4JITA 4NZOA 3A2KA 2YIDA 2VK8A 2KBEA 3JQCA 4YACA 4CLOB 2X3UA 2WAYA 5FBVB 4IIXA 1OYYA 4BJ3A 3KKNA 4X6XA 3ZWWA 3WA6A 4YV7A 3ORQA 4D82A 1RXVA 4JEUA 2HWKA 2LKDA 3IEIA 4YUAA 5B1SA 1PNVA 5PNTA 2H6EA 3NDIA 5DU2A 5IVDA 5IDXA 4DR3B 1H0RA 2B1IA 2R1VA 3U7QB 1ZVMA 2ZIUB 3MMNA 4RK7A 3OD1A 1XNGA 1I7QB 2QY6A 2ZTVA 1U94A 4N39A 3ZIAA 3G9XA 2YDXA 4DBVO 5CCEA 2PV0A 1FQWA 4KN9S 1T4GA 1UOQA 4CV1A 2JEOA 5HKAA 5BV8A 4YCDA 1OHHD 3U2QA 3LXUX 3SZUA 3IEMA 2PS3A 1QONA 4JT9A 1U8EA 1CDZA 3VU1A 1T8SA 4CFSA 3I1YA 1SQSA 3GROA 2C2XA 1HTBA 4A8HA 3AIKA 4BASA 5IC5A 2B94A 1CJKC 4HAYA 4TOIA 4Q4JB 3UY4A 4WFKA 4CM9D 4OQMA 1Q2XA 4AL4A 4ON9A 1PHPA 4R68A 4BKRA 4YRZA 5KDOA 4E31A 2GM9A 4IWYA 3NBYC 1E92A 4G0XA 4K28A 1WZCA 1SXJC 3U5ZB 3GMTA 4MITA 1XALA 4UZFA 4XASA 5TXGA 3SF8A 3MQ4A 4EG3A 1VIYA 3PGLA 1LKZA 1W5TA 4RMIA 1UPAA 5BUCA 2PGJA 4FCCA 4N5LA 1OX4B 2CL5A 2FPXA 2FQWA 2R8PA 3FSEA 4HUJA 1PYOA 3FETA 4EUKA 1JIJA 4BGIA 4BVHA 4IP0A 5AM5A 3RUPA 5FLXA 1N4DA 2YQ5A 4CTJA 1Z6TA 1KK1A 3RK1A 3R9WA 1AUQA 3T5GA 4Q12A 3RUIA 3GEBA 3BG5A 4I5DA 4QVKA 5EOVA 2QTFA 4BNXA 1T0HB 3GO4A 3LY9A 5BMVF 3NHBA 3R77A 1RE1A 5H70A 3FIUA 4MVJD 5EE1A 3PI6A 2JANA 1T24A 2WQ6A 5E4JA 2NX2A 4YALA 4GG1A 2PUTA 3HNRA 5LZ2A 5COAA 2RBEA 3LUHA 5TR9A 4D80A 5CB4B 3ZZ0A 3O8QB 2J41A 2O50A 3DOJA 3EXEB 1GKIA 1P0CA 4LYYA 5BSRA 5KWEA 4BP8A 4PG6A 2XNDA 3G2PA 3CNQS 4IH4A 2VRNA 4FR5A 4J16C 4O4LA 4BO9A 3A37A 2YYYA 2H2WA 1XKTA 2OFOA 4JU9A 3KBOA 4N54A 1YS1X 2N1MA 2ZAYA 4MA0A 4XA8A 3BHJA 4TL8A 3E1SA 2I6SA 4Y18A 4AXXA 4C0WA 4TRRA 1CU1A 3ESBA 1WR8A 2PIAA 4JUAA 5AKHA 2N46A 4R4JA 2CXNA 2Y67A 4JQYA 1RXYA 1YBAA 1NF9A 2PU7A 9MHTA 4JHXA 1ZCZA 5HZMA 3O92A 3VKFA 4ZXPA 2A1TS 1P4JA 3ROMA 1GPH1 1Q7EA 5DM1A 2OXRA 4ATNA 3BERA 2J3JA 5EP4A 4LNAA 1J90A 3QNUA 3E58A 4BJ5A 3PFHA 4HNSA 2ZM5A 2CDCA 3NR2A 3X0DA 1WXQA 3OG9A 3GFQA 1CRWG 1T2EA 3QLJA 1OKKA 3VH3A 4F06A 3WMFA 8ABPA 3L04A 3EF3A 2PUHA 4ZGBA 3R41A 1MT0A 3DZFA 4MS1A 3RBXA 2GZRA 2D0IA 2PZJA 5FA8A 3QPUA 3FYUB 2GARA 2WQZA 4QHYA 3EIQA 4WZBE 2FFJA 3RKSA 4GOMD 4QREA 3EQ8A 3LLUA 1KI6B 3M3DA 1MTZA 4Q1BA 5EI5A 1ZK3A 4NE9A 1RZ3A 3A6ZA 4KAFA 4DW8A 1YJCA 2ZB3A 1F7UA 1RHUA 4NCIA 4DBZA 2Q4BA 4PBRA 1LK7A 5BNFA 3KS9A 1LPOA 3KU1A 3ORFA 4RGYA 3PE3A 2JARA 1XQ9A 3GLUA 4BEJA 4YMVA 5EE0A 1MEJA 1Z33A 1IL0A 2ZJ4A 4TWJA 1OLUA 4CRWB 3KETA 3RS3A 2WHPB 2BH2A 3GAMA 5JZOA 3I5YA 5T4BA 1WAMA 2E4UA 1B76A 1P18A 3TKYA 4G23A 4KL8S 4BLVA 1PV2A 1UWVA 3HU3A 3KTAA 4OUDB 3TVDA 5KJCA 1GUBA 4R2WA 4TV9F 5DYYA 1VJGA 1KY4A 1Z8NA 2AJDA 3NOVA 4RVCA 1DDOA 5CLIA 5ILGA 3SSNA 5DT2A 3ZX5A 2W9XA 3N2LA 2WG0A 3VO2A 4AIRA 4WOKA 1QBKC 3RIXA 2ASVA 2JCXA 5ALMA 2RI0A 3D2CA 3H5NA 4G24A 3QH4A 1TKRA 3TLGB 1Y9AA 1T3TA 7MDHA 4K88A 4WD3A 4WUVA 1W5BA 2OLKA 1QYRA 1ULZA 3U3RA 1Z74A 2DRIA 3A9TA 1AE1A 5LBUA 1VG1A 4GPZA 5AD1A 4IWNA 4US0R 2DPMA 1ZGJA 3CRW1 4J49A 2J4DA 4KGZA 3R3SA 3KD2A 2HU7A 3I5UA 3PR1A 4WY2A 2AF4C 2I4IA 3F7OA 3KWLA 4YGYA 3SZLA 5JAMA 4LK2A 1TCBA 4TLDA 5TSDA 3FPKA 2D54A 4X54A 1E3LA 1U0TA 2ADFA 4HP8A 3HKDB 5EIWA 4EEZA 4JI0B 1KXZA 4CQLB 1Q0PA 4AMYA 1QOPB 1VXRA 3FWNA 3IJRA 2YH2A 3IPCA 3CNBA 3PFNA 4M1TA 4ND6A 1XO1A 5DNWA 4H7DA 5LDGA 1UJ4A 2LR0A 4YPVA 4A3SA 3M6UA 5IKOA 3HCWA 1WB4A 4INOA 3RYHB 4LJ4A 1Z4MA 3W5SA 2PL5A 1IOZA 3MCTA 1WVIA 5K3BA 3ZWKA 5EJ5A 4I1PA 2H4ZA 1ZRMA 2JKYA 2NN3C 3FMOB 3MAAC 1PR0A 1T0BA 3EEOA 1TIPA 3U7EB 5DASA 4RIGA 4BYGA 1G6HA 2ZIEA 2JH9A 3WWZA 3GUVA 1Q7BA 3GVHA 1Z7BA 1Q3TA 3LCJA 4QPZA 1KH1A 1QIFA 1WCWA 4EQ6A 4WHMA 1A5SB 1DKRA 1HR0B 1CW2B 1KMHB 1TYEB 1JDBB 3FHLA 4Y6SA 3UH0A 3AEYA 2QKYA 3SQDA 4HQOA 1IATA 3H7IA 4X8LA 5EHQA 1RFLA 4G26A 3W1WA 1AUPA 1KJ9A 3PL1A 2XA9A 4QUHA 1L1EA 5CT6A 5C2JB 1BFKA 3AQ4A 1TL7C 2AG6A 3KZCA 1B6RA 4TPKA 1NPDA 1E4YA 4JAVC 1A4RA 2XUHA 3NFRA 3SG0A 2B25A 4LY0A 4R3NA 2CLSA 2C1ZA 1JS1X 1W1IA 2X9NA 3B3JA 3EG5A 3GZTB 3LYLA 4XJSA 2VJLA 5L7YA 3ZEAA 3ZIAD 1Z2CA 1U2QA 1Y8AA 3ECAA 2VZ8A 1SURA 4FZJA 5IJAA 2Z0MA 2VJPA 3T61A 2AA3A 5ECGC 2K4MA 4ZYLA 2QQ0A 1AJEA 1JW9B 1CVRA 1TJ5A 3F5DA 3IDOA 4MTLA 3LT1A 3CIFA 3SI7A 2IXTA 4MV3A 1J24A 1V39A 3N2YA 4KQ1A 1FLVA 3SXJA 5DM2A 4Y2HA 5SY6A 4Q37A 5KKCA 4WZAE 5BO5A 2J0VA 2EXXA 1VM6A 5EEHA 4H1WA 1KJIA 3PB3A 4BNLA 1ZAYA 3R8CA 1DRUA 3UV3A 1SK9A 2GK3A 1DLJA 2FVYA 1JA1A 2DLNA 2NO1A 2WUEA 4UUPA 3LQQA 3RRMA 3SJCA 5K6RA 5K8CA 1MHTA 1E1RA 3AV0B 2AJBA 2QW1A 1F0PA 3VPDA 3EC2A 3HV0A 3HYTA 4XIFA 3W90A 4RSHA 3ZBQA 4N41A 1G7CA 1RMQA 1ZM9A 4DIEA 4EB8A 1ZAKA 3ADBA 3ZU5A 3IV6A 1JE1A 2QU8A 2XAAA 4FBGA 1SZCA 2YMQA 1YOBA 4BQRA 1VRWA 4LJ6A 4DCOA 2POQX 1FQOA 4BVFA 3O2JA 2FDCA 4L4SA 4HZUA 2RD2A 1YR9A 1IY9A 4JLPA 5C7OO 2A78A 1B6SA 1GPNA 5BUSA 4Y9SA 4OHMA 2ZRCA 7MHTA 3GBSA 2EWMA 4WECA 1L4FA 2E82A 4MXDA 1GU0A 3GZNB 2IPOA 3G7SA 3R0IA 3GLFA 2CT8A 1DQSA 1PGOA 2E6KA 1G18A 2Y4OA 3G0BA 3KT3A 1Z5OA 3M83A 4IPTA 4J1TA 1FBNA 3T5DA 3WGJA 2PIDA 4RESA 4ZI2A 2QDKA 1W4BA 2JLUA 1OTYA 4DCCA 3DLHA 1BVYF 3DYVA 2X1MA 4IZIA 3X1WA 2ES4A 1DELA 3K05A 1Y8CA 2OLEA 3UICA 3U49A 2I7XA 5E1BA 5AKYA 2GZHA 1TM4E 1XLVA 1YRWA 5EJ9A 2OTCA 3R7DA 3VDXA 1FYDA 1XB2A 1BHQ1 1F51E 3LRPA 4M8KA 4OXYA 4QSHA 1KKUA 1R10A 1NLUA 1UC8A 2QR3A 3AHFA 4GX5A 5L95A 1IVSA 3OQHA 4ZALA 2FR0A 4J0KA 3E0XA 4YK7A 5GOTA 3UHJA 2EJUA 2PX0A 4KTVE 2HA3A 1CE8B 1BKSB 3GYGA 4YI5A 1L8QA 1NDHA 4E2XA 2WM8A 2VK1A 3OHSX 5CB4A 2JJQA 3ZJVA 1IHYA 2FW8A 1TDJA 1V3QE 3U7HB 2QL5A 4GKVA 4ZDWA 4ZEMA 1DBWA 1NBOA 2GK6A 2GWRA 3E6AA 4QBKA 4WV3A 1LBQA 3RRXA 2X2FA 3WK9A 2PUFA 2CDRA 3PU6A 3NHUA 4B3HA 1QJCA 4PU0A 1ZQ1A 2XVXA 2VJDA 4H77A 5J4YA 1CDDA 3CUUA 1DMSA 4D96A 2XMGA 4DYDA 1DWUA 4U2KA 1L5KA 1SUWA 5THKA 1RYDA 2PL1A 5AI0A 3T3OA 2F8MA 4PAWA 5C8YB 2PUWA 4R8RA 4ZVLA 3PR2B 3TRIA 3KL4A 4BEBA 1JB9A 2BHLA 3E22A 1U6IA 2YOHA 4YLYA 3ADPA 5K3EA 2PGXA 3ND5A 2GBCA 1VKNA 4PLFA 3AU9A 3I2GA 3NH9A 1R6DA 4KIFA 5EUBA 1PDOA 4TTIA 1OKKD 1R5BA 2V7XA 1QHYA 4MW6A 2V7PA 3PBKA 5EEGA 1HZJA 3QKSA 4BVKA 4CL0A 4DHWA 5CFRA 3NC0C 2XVMA 4B3IA 2HCJB 5K05A 3OKPA 1Z2DA 2P5TB 3AEUA 3IUJA 1WJGA 5G53C 3G0HA 1S2GA 3AEQA 2HRRA 4RIIA 3NJRA 3L4BA 3TIIA 4B3TB 3AVQA 2MIIA 4R8KA 1ULTA 3OPYI 1ILWA 5FAXA 1DRVA 4K6KA 5KC9A 4KQCA 4ZQIA 3VKGA 5IBCA 2BUCA 4D8YA 1K9VF 3FGNA 3FYUA 2EZ8A 3MT9A 5DHTA 1XLTC 4D45A 1DRJA 2W6NA 4RXUA 3QVJA 1O0CA 3LC7O 4U1RA 1OPRA 1SN7A 1J9EA 2G9NA 5A3RA 3G6KA 3OP4A 4O2BF 4BEVA 3COYA 1E20A 1EP9A 1QWOA 1KERA 1V9SA 3IE2A 1UL1X 4PAQA 2HDNB 5IDQA 5LQDA 3GRKA 4NPAA 4PBSA 2NO0A 3GDOA 3DBRB 1QVRA 1TKAA 3ST7A 1TT5B 3AFIA 3X1ZA 2XX3A 3W5AA 5TY0A 5C7IO 1YFZA 3BF7A 1AA9A 1XJ0A 1P17A 3TNJA 3DE2X 3AR3A 5IWCA 3V1TC 4C04A 3DAHA 4YY3B 1DX9A 4G3XA 3B1VA 1NZJA 1H22A 1QYDA 4JY7A 1T9CA 4I19A 3OX1A 2IEAA 4ZVNA 5CBKA 5ESRA 1X3SA 3K9LA 3KAJA 1O89A 4B74A 4JA0A 3IIMA 3D31A 3HKCA 3T9AA 5MN4A 5BP7A 1S5PA 2R8RA 2XB8A 3OCCA 4FR2A 1Z3CA 2O05A 3LBIA 3LSTA 1TZBA 3OPNA 4WK2B 3R7SA 1VL0A 3Q1KA 1DP4A 3M9LA 5CLLA 3GCGA 2FV8A 3ET5A 3JQ7B 4HH1A 4IIEA 1DKUA 3FLEA 2O5RA 2O7RA 5B3JA 2ZPAA 2BRUC 1KJZA 5SZJA 3ZWPA 4Z0HO 3AESB 3NYWA 4NAVA 5AW3A 4WKBA 3JAWB 5CCBA 3L7DA 3HVJA 2TS1A 4QDKA 1XXHB 3A6PC 3SIWA 1FSZA 2W11A 1RHKA 1NN5A 2JI8A 3I04M 2IBSA 1UCFA 3WIUA 4S1TA 4YDSA 3SJAA 3VTZA 3ZC3A 3EK2A 3EVNA 1ZD5A 2OC4A 2ZTMA 1TK9A 3IMEA 3LUJA 2ZFUA 4TXNA 4UHDA 3RSOA 2VS1A 4KVZA 1K08A 2IQIA 1KPIA 1ZVKA 4IRUB 3WR5A 3VR5H 2PD3A 4JV5B 4D8VA 1WSAA 3HKDA 3BD8A 4IF6A 4RLFA 4BOYA 3H8SA 1N0IA 3PNQA 2A2ZA 3WKDA 1QO0D 3CKMA 3DV0B 2G04A 3H97A 4GI1A 2HA4A 5AIAA 4EECA 4YXWA 2QTTA 3B1FA 4BVLA 4EFLA 4YYZA 2Q5FA 2C4MA 4KXQA 4UTVA 3OE4A 3VYRB 2QTVB 2WM2A 1YZLA 1C9NA 4O4IA 2NO9A 3PDCA 3E3NA 5COBA 1MORA 4MRMB 1JEDA 2BZ1A 3B7PA 4OMDA 2BGWA 3GLHE 2A5JA 3V1YA 3BGDA 1KEVA 3JYNA 1LU9A 3ETHA 4BNTA 4O6VA 4RV5A 1XQWA 3BK7A 5IBQA 2B1JA 4N6NA 3R3XA 2AFVA 4FUTA 4LYFA 2B5OA 4FNMA 4UM7A 3WOHA 2C31A 2AFIB 1WNFA 2C2OA 4JLAA 1RAEA 2WEKA 5AMXA 4ZPXA 3S29A 5CCXA 3BWMA 2ZROA 1HQYE 1ATZA 2JFVA 1LPMA 5I48A 5JLJA 1ORIA 4BNDA 2GN1A 1I10A 1USWA 3IAS1 3SC4A 4GRIA 5KJ6A 4HVAA 1DQYA 3KXPA 1TMGE 2IELA 2QVZX 4QGGA 4BNVA 1HFEL 3HGQA 3HLYA 5FR2A 2YWJA 2Q8PA 3HFJA 2YV2A 3BCHA 1EDBA 2HA5A 1LPBB 1G17A 4JZYA 1ND6A 1YJAA 4QOGA 4UE6A 1ZJ5A 3RARA 4PPYA 2Q99A 4PYJA 4MR7B 5IC4A 1XZJA 4M9QA 4YJ3B 4CN8A 5JNLA 5KYTA 3BUSA 1MQSA 1JHQA 1A7KA 1ZXBA 1F4LA 1GPBA 2NQ2C 2OENG 3QPCA 1XUOA 2DC1A 1KKLA 1VIAA 2V6GA 3BWXA 1YXMA 2Q4OA 3PUJA 1TLFA 4WIAA 3KQOA 4GXQA 1KRWA 4CBVA 2VNIA 1QF6A 1F3OA 1A88A 1HE1C 4R2HA 3AR5A 1SUPA 4A2WA 3IQFA 4EPRA 2G88A 1PBTA 3DBHA 2XA2A 2MINB 1V4BA 2JC3A 2Q5IA 3FMIA 3ZD7A 4Q1EA 4FFDA 1DEOA 1SEVA 5FWXB 1FNBA 1L5ZA 1M1UA 1WP9A 1YASA 1HLFA 2XMPA 4HTFA 5ALZA 3ROGA 3EPKA 4JB8A 1N3BA 3EZLA 1L5RA 1JPJA 3SLGA 4AU1A 4BFLA 4BMDA 5KWJA 2BH9A 3BBLA 3CRQA 3U26A 4PVCA 1L4UA 1X1DA 3M9XA 2DFPA 2GZ2A 3M6FA 5CR9A 5FWAA 2J0QA 1KAQA 1QH1A 3OCVA 1X74A 2B3DA 2AEJA 3P1JA 4AURA 3S55A 1V1JA 3ORSA 2ZBEA 3KHSA 1P7PA 4KNWA 2MSNA 1QUFA 3KPVA 4QGSA 1L5WA 1PT7A 1X7ZA 2IHTA 1ESMA 3OETA 1ZMOA 3UM9A 4BX2A 4F5EA 2ONYA 2ZYIA 3LHFA 2N75A 3ND7A 1E77A 2P6NA 3BTUA 5K3FB 4MKGA 4DEXA 4GBJA 1ZM3A 4YAUA 1GTL1 1E3IA 1TFRA 1Z88A 1RBMA 1WCV1 3E9NA 1E58A 5HF5A 4C0AC 5C7YA 1WXIA 2CXTA 3KAPA 3H11B 4HX5A 3SNKA 5IZCC 3MCWA 1PQWA 1Q3KA 2N3ZA 4HB0A 4FKZA 2OKGA 3R0ZA 1KRHA 4NNJA 1E89A 4JS0A 4TL7A 1AXGA 2VA8A 5CLHA 3KWFA 4PPFA 1MW8X 1GOTA 4WINA 1TYZA 2VRWA 2ZTHA 3IQZA 4LDNA 2BHNA 1WPXA 1EX1A 3DD1A 3H9JA 5DTQA 4JI6B 2BMWA 5IABA 3CFYA 2A57A 3EYAA 1JAXA 2CB9A 2R3SA 5JBIA 5KOHB 5GP1A 2UVQA 3EGEA 3VO9A 3VVLA 3FN4A 1Z8DA 4DNXA 4TVKA 3GH1A 4IH1A 4ETWA 2FMXA 5EE9A 4ZV7A 4PCLA 2DF8A 2PRSA 3Q98A 4YDQA 4AYTA 2P0YA 3RG8A 2J3LA 5CBPA 4I50F 1W73A 2NQ8A 4FNOA 1L4EA 5LP6C 3RFTA 3OA0A 5IPFA 1H8EA 4IV5A 2AQKA 5FV7A 3NEYA 4E6EA 3QY0A 5HYVA 4RS3A 4EJMA 2QJRA 4XX1A 5KYYA 3M1LA 4PN3A 4IFTA 2ZJOA 4EY8A 4A0HA 4ABYA 3LPLA 4EVSA 1Y80A 3TQRA 5AK5A 4L3WA 2R62A 4Y1RB 2ZCVA 2ZRHA 2JJ2A 2HGZA 4MPDA 3W9SA 4DY4A 4E4TA 1T0JB 3MK31 2GPYA 1C7ZA 4ARAA 1H6CA 1U9ZA 3E03A 1JMVA 1ADYA 1UJ2A 2FA9A 4KC0A 4NONA 1IHUA 2CHFA 2VT2A 1TK3A 2YBDA 3IQEA 3PCRB 4K9MA 5KNLA 4OLBA 2ZRKA 1E5XA 1FUYB 1F38A 2ZG6A 3O73A 4K81B 4L5IA 1IQUA 4E2YA 1PRYA 5JNSA 1GFWA 4ZEXA 1GPKA 1CJTC 1V3VA 2P6MA 4E88A 1GRNA 3IBYA 4I2VA 1WMAA 1BYIA 2JGMA 2XHEA 3IUNA 3G0GA 4LRTB 4B71A 1POWA 2QU7A 4EG8A 4TKUA 3CUTA 1AKEA 3NPAA 2GDJA 5CB6A 4CR7A 2WOJA 3AINA 2EW2A 2R4QA 1YNOA 4GYYA 2NYRA 5FUMA 2A1UA 4KQ6A 1V5GA 5F73A 2AUNA 3UFXA 4OYRA 2HWYA 2XDYA 1QIMA 2D8AA 3F3YA 3QQ5A 4LHXA 1PFWA 4WMLA 4XYBA 1QR2A 5IM4A 5JS1A 5I3CA 4ND2A 2PRIA 1EFLA 2HAEA 4ZI5A 3RC2A 3I12A 4MAMA 1GTG1 4GUAA 5FLYA 3L1VA 1YKFA 4HHEA 2PHZA 4KAXA 1L7MA 4HBGA 3JZAA 4OUKX 4BP3A 1HMYA 1V8OA 3D43A 3EZXA 4ZA2A 5FNVF 4UTXA 2ERXA 1TAUA 3BH7A 4X6UA 3QXHA 4MCHA 2C95A 1CZKA 2CYBA 2IPNA 3I39X 4OG2A 4S0ZA 3ZI0A 3AERA 2VDUE 1CLEA 1JLRA 3FCCA 3QVLA 5DLQC 2B4RO 2ZUCA 1YV9A 2O5VA 4TT8A 3M6AA 3GB9A 3DXXA 3TWOA 1XJCA 2P1ZA 2OT3B 2O6LA 3NIDB 3TXAA 4HB4A 4M0FA 1CUCA 2B78A 2IU3A 1GHTA 3DHYA 3NNDA 2F1IA 5CM9C 3REQA 1NASA 1NVGA 1Y4ZA 4XCVA 1KQ3A 4D98A 1XDUA 4B3GA 1M2EA 4DDTA 1IM5A 2R5FA 3BDIA 3NO4A 3OMWA 3Q3JB 3SJBA 5JANA 1BJKA 1U81A 2RHDA 4PHFA 3MHPA 3T34A 5GINE 1UPUA 3IDZA 3JTEA 2Q7OE 3RF6A 4EY5A 3RVJA 5TPWA 1A76A 2YWRA 2ZUFA 1CS0B 4YJ2B 4P8RA 4QOSA 1HDZA 3GCWA 3GGGA 3LAWA 4M7PA 4YHHB 2IA5A 3OEHA 4QSMA 2F9FA 1LS6A 4L1KA 4P0TA 3LOQA 3USES 5D85A 2CGEA 1QP7A 3T1OA 3QLVA 4NAHA 1ZUHA 2WE8A 2Q5CA 4LZAA 3DFZA 1Z47A 1RQRA 1R0XA 3ZJYA 4XEHA 1YJ5A 1EK2A 1CY8A 1R16A 2AKAB 2HF2A 3CW8X 3B85A 4LTDA 3QLTA 5TNXA 5A2GA 3T5PA 3GRCA 3L8HA 2O8BB 3CONA 3AJRA 1OFVA 1AQLA 1P2TA 1A50B 1Z83A 3NTOA 4LMRA 4PYRA 4BWVA 4YXWD 2Q6IA 5AUNB 2PJUA 1XR3A 3LGAA 2ZB2A 3D0KA 2NOAA 3GFPA 1M2VA 2C98A 2I1QA 4URWR 1W47A 4BHTA 1NQ5A 3FNRA 1NLMA 2A5GA 3BL6A 2J5XA 3PXEA 2CZQA 3K6SA 5T4FA 5DI3B 3WL5A 3P9CA 1TUBB 1HL7A 2YY5A 4IRXA 5CXSA 2MYUA 4HCJA 3W4IA 4JKIA 2HMAA 4X94A 4F9GA 3MERA 3E23A 2AKYA 3HVKA 4I4TF 1ZX1A 2M1XA 2ZP1A 4XDGA 3DVAB 1SCUA 3OBIA 3U0VA 3KHKA 1XPJA 5JSFA 3NM5A 5LQJA 1T5OA 3Q9LA 5J4LA 4JIMA 3I2HA 2FK8A 4R1MA 2AFIA 4W9RA 1A8PA 3TOSA 2GCPA 4IMJB 1WQ1R 3UB4A 4EFMA 2YXDA 3TRDA 3H8WA 4O1MA 2QL7A 4YJDA 3DNMA 1TVKB 1DAFA 2HSWA 3H1FA 1ODIA 2Q2NA 2DQZA 2FE4A 1SGWA 4JJAA 2Z9DA 5EL0A 2FN8A 1JG4A 2G1KA 3QU7A 2Q5HA 2QIOA 4MMZB 1H2HA 2AXNA 2IHZA 3RUDA 3TIGA 3IT1A 3K0SA 3OQIB 1DKNA 3TIFA 5SZKB 4UAVA 4KR7A 3AUXA 2WTEA 4E12A 3KYJB 5CIWA 2XQFA 5DW3A 4RIEA 3MVEA 2ZUWA 3NHFA 5GM2A 4A7PA 4FC6A 1XKQA 3OJWA 3QZUA 4MR7A 3OMLA 4Y6RA 5IT9A 5TVKA 2AFRA 4NG5A 3RR2A 4EW1A 5KYNA 3LZDA 4IHJB 1N6IA 4ZO4A 2JF0A 4D4GA 5EJ7A 2WQ7A 2G17A 3NDBB 4LQDA 4KVAA 2B36A 2Z2KA 3QKRA 4YP1A 3QE4A 2DMRA 4E32A 4YMLA 2QJTA 2NO4A 3WB1A 1XVAA 3W3AA 1FB5A 2ZT7A 1KO5A 2EZ9A 1D2GA 1Z39A 2VDJA 4X44A 3WGKA 4AIIA 4F7WA 1UDBA 1K92A 4KPFC 4O2AA 4K9SA 1PF7E 4UHCA 2OXIA 2GPBA 5DKFA 5FDFA 2WD8A 1Y4SA 1F8YA 3PGA1 8AT1A 3KJQA 3SS9X 4JKYA 4FMCB 3TI7A 1F5NA 1Z82A 1PX2A 1UMBB 1I30A 2ZJYA 2WT4A 4YRLA 1IY1A 3AJ9A 4DDWA 1HDCA 3SC2A 3R5KA 1Z4QA 1SVNA 3AIMA 1ZKMA 4Y2PA 4YC7A 1XMVA 1IN6A 1ZJJA 2Q5JA 5ELXA 4FYHA 2MYPA 1Z13A 2OBXA 4TLAA 2BEVB 3U40A 4DNPA 5D7NA 4EX7A 3HA3A 3ESYA 1JR2A 1N3YA 1XAHA 3MMXA 5AFSA 4G1BA 4GZ3A 4V0SA 4S1VA 2IY8A 2NZJA 3NM6B 4UVDA 1J0CA 2DFLA 2YX1A 1NNLA 1Y3BE 2VDLB 3F4BA 3ZDAA 4FTWA 3J7TA 3NNSA 2FLKA 5A4DA 3JYLA 1B8VA 3E9MA 5HKKA 4D26A 4DLBA 3CO5A 3T38A 4AJEA 4PHGA 2XJ4A 1O0BA 5E3HA 3VR2D 1T1RA 1TGYA 4G65A 4X95A 4CTKA 1Z22A 3R5JA 4FFSA 4QBTA 4QOFA 3ZDYB 3C8DA 2ZI3A 1ZMRA 2H4WA 2ZE8A 2ORED 3I9V6 1B8NA 5KYWB 2JGNA 1RDFA 3SR4A 1VP9A 3TSYA 1VHQA 2FP3A 2OAQ1 3KOXA 4KUGA 5CEJA 3R23A 3RTDA 5JQGF 1W4AA 2CLLB 4N65A 5FQOA 2C57A 1FU4A 4OK3A 1SU8A 2IPLA 3Q9NA 1B0ZA 3MGBA 1X19A 3KR9A 5EP1A 2P6PA 5HUQA 4B3JA 4BNHA 4DIFA 4KIJA 2Z1MA 4CU2A 1H8ED 3A04A 5BW8A 4D6PA 4GOOD 4BY9E 3G1TA 4HLDA 4BMVA 2DWOA 3WO0A 3JWEA 5CA1A 1JLMA 3H9UA 1N78A 1U63A 3L3BA 4LZPA 1ZBQA 2VCEA 2BKUA 4TS4A 5LQKA 5EXTA 2PSSA 4WK4B 1T8UA 5HMMA 3TNYA 4CWAA 2JJ2D 3SAJA 1I4LD 1S8AA 2FCAA 2FZCA 2PZFA 4PRZA 1TX4B 2OORA 3AEKA 5JWOA 1QCYA 2CUTA 2GXSA 4OQEA 5BSVA 5J5AA 1J99A 1TA0A 4MROA 3VKWA 5AVUA 1E66A 3NHJA 5CT4A 4ER0A 1GADO 5B7GA 3IDQA 4INJA 3NBXX 5CYGA 1RYZA 4FGLA 2FXIA 3GFOA 1PR2A 1YSCA 3TSAA 4L4YA 5BWCA 4AECA 3CVWA 1BMDA 2AW5A 2QUIA 1EG7A 3IA7A 3IODA 1YGYA 1AKVA 2E9SA 1MNQA 1PG2A 1E7WA 1QYXA 2WYWA 3BWVA 2IODA 4NE7A 5ALTA 4EL0A 1F2TA 3MJ4A 3Q8KA 2HD4A 2OEPA 4JB2A 2ZGVA 4PLZA 2H1LA 5T41A 3T1YB 2TMDA 4TYYA 1B23P 1GKUB 2DR0A 5FOTA 1B74A 1DTWA 3W2EA 4JI7B 2XUAA 1FLAA 3PWTA 4E09A 4UZEA 2XYGA 1DG1G 1N57A 3EZYA 5ITZA 2Q9CA 3QK7A 1KJQA 2QVYX 3OFSA 3M5DA 3ASUA 4GR9A 5T8KA 3SMQA 4F3KA 1ZU4A 3ZHXA 5LKAA 1UQTA 2GHQA 3LO8A 3M2TA 4D4IA 5I7WA 2JFOA 3G89A 1LQ2A 1T1GA 3GD7A 4L50A 2WLSA 4ZYVA 4DMMA 3H5LA 4L8YA 3WIOA 1M33A 2EWVA 1K6MA 4IGAA 4QNRA 4W7SA 4S04A 1DJMA 1WUYA 4OBXA 1U8AA 2IIPA 2BFPA 4IHKA 3WLLA 3L6DA 1GZ5A 3LPDA 1O9GA 4E13A 3M7IA 1QHHB 4YXFA 3JQAA 3RU7A 1H9AA 2PVPA 1W6RA 2QI9F 2CLMB 2TSYB 2VQ3A 3MOIA 3C6XA 4GP6A 3HMQA 4P3YA 2NPIA 4JIGA 4CHTA 4PR3A 4C0BA 3G2MA 5F78A 5H4GA 1I4DD 2VQSA 4K8RB 3KQVA 5JCOC 4LF5B 2OHFA 1E5DA 3NC1C 1OF1A 3H3XA 3T7SA 3HV2A 2V03A 3OEHD 3P4XA 3QTBA 4QXPA 4UTOA 5FA5A 1VHJA 5EWMA 1RRMA 1E96A 1F17A 2HGSA 2YFQA 3DKRA 3AYZB 3LVBA 1S1CA 3IR6A 4B3BA 4PANA 2Q49A 1VE7A 3K5IA 2NUPB 3O4GA 4IXTA 3ZUGA 4DV0B 1F7VA 4GMFA 4U0JA 1Z68A 4C43A 1NY5A 4IAOA 1T8WA 3UXYA 2JGJA 1PZHA 2RAUA 1SXIA 4IL5A 4DEYA 2H8GA 2K6GA 1YCFA 5E2AA 2CMHA 4F4CA 2H8KA 4K0RA 4UNSA 4L08A 4C76A 2ONJA 1RPTA 4MVJH 3LLMA 4J07A 1PK7A 1FDTA 4PO9A 4UPVA 2A6PA 3PXDA 4Z0PA 1X1EA 4AF8A 1Z0UA 4YRMA 3TNLA 4MMYB 3C4JA 3P8ZA 3RRBA 3UK7A 1MW9X 3A1TA 1XZLA 4M0KA 4NNPA 1RPZA 3IEXA 1R0ZA 3JQBC 4ZAYA 3SPXA 3WWPA 1X87A 2YMLA 3MW8A 2O8DB 1YQDA 3MIIA 3BMOB 3OF5A 4EGSA 5TT0A 4K86A 1MO4A 4TWAA 4YJHA 2OOKA 2PU5A 4GPEA 4JYCA 4TUYF 1V5FA 4JT4A 4F9EA 5DI3A 4YCJA 5LB2A 2VQ6A 2YASA 3ZNQA 1HRKA 1ZXLA 5IKPA 4IIJF 1H0HA 2ZSAA 3EISA 1WHSB 3ZBPA 1N0VC 2IPMA 1AK9A 3DPIA 4EDHA 3MT7A 5DRYA 2XHZA 3U9SA 1L8LA 2GPTA 4JJ4A 5JE8A 2GVNA 3DUFB 3G7UA 2ZT8A 3PA8A 3DEFA 4DCPA 3BMCB 5E1MA 621PA 3AUYA 2QXYA 3PEWA 1XI2A 4EJ0A 2BGIA 3QPAA 3B5EA 2KLHA 1LPAB 121PA 5FUQA 3CT4A 4ODIA 2EATA 4MVJE 4OJMX 1DAPA 2V74B 2CHGA 3H04A 3HM2A 2QM3A 3I83A 3KO8A 1CB0A 3H2GA 3GAFA 3PRHA 3FTQA 1UBUS 2WTXA 1EE9A 4MLDA 4MULA 4MVJI 2IV7A 3NGMA 3QE2A 5EVCA 1Y5IA 2FWAA 2JATA 4G97A 4IINA 4MS4B 5K5EA 1NJ8A 4QQRA 3N8HA 5LBTA 3DONA 3LDAA 3W3AD 4CG3A 1XZBA 4ZV4A 4H7PA 2JGLA 4Y2QA 5JDCC 1RI3A 3KUKA 3PKIA 2PS0A 2QRZA 2XZLA 4QUGA 5BQ5A 5IUNC 3T6KA 3ZBTA 4B17A 5BN3A 7AT1A 4LI3X 1XEWX 4BV8A 3KCQA 4BX0A 5K0CA 4AZTA 5JH7F 2EP8A 2XLCA 4KQJA 4OHCA 1OZHA 3E8XA 2ENWA 2EAUA 1MJHA 4DARA 2LP4Y 1AB5A 1GN9A 1QH0A 2J59A 3DMTA 1SIOA 1VKZA 1JGTA 3CBQA 3G0IA 5EAIA 4EVRA 2XTZA 1NW4A 3GUCA 4TKLA 4EUSA 2HF9A 3MT8A 1QVWA 1ZGAA 3V2GA 2I6GA 3JSAA 3LQ1A 1C1YA 3VTAA 2VLIA 3GUUA 3GH3A 5BW6B 4PQGA 2WJIA 3TS1A 4D43A 2NU8A 3LFHA 3O9MA 1Z62A 3O47A 3EZ9A 5EHXA 2QN7A 1I01A 1V41E 1M74A 1R3DA 2CDBA 4BMXA 4YCCA 1U7TA 4EHLA 5I7OA 1CQWA 1GGVA 4KV9A 4G0ZA 4BB5A 4GFDA 2GX6A 3JX9A 2L17A 5HKKD 3O1HB 4Q01A 2XI4A 1CY1A 4I1UA 1KDRA 2G9RA 3QYJA 4G86A 4MPJA 4P4UA 5HKLA 2X77A 1Z0ZA 2QHXA 3GUHA 3QYFA 4KXWA 2ZS7A 5HF9A 4K9DA 3VKUA 3A05A 3KCNA 4HG2A 1GA6A 4JP1A 4N5NA 4KBYA 2JAWA 3RVNA 1D1SA 4R5MA 3HXPA 1UDWA 1ZMXA 4IDDA 4ZOQI 1U7HA 3I76A 3DHNA 1NBMA 1D1QA 4IO1A 3PR3A 5JZBA 2JHGA 4KXYA 4K8OA 4MYCA 2Q6VA 1RQXA 3SDSA 2ZE6A 1YTLA 1O03A 3GQBB 4FHZA 3DBOB 3U39A 4BXOB 4LYDA 3W5JA 1XF9A 2C2BA 4JR2A 1WD5A 4M21A 4E5MA 2NW6A 5MFZA 1IULA 3CC8A 2Z98A 3RYTC 1RW4A 1IN4A 1HGXA 4FFRA 5BQFA 1M7GA 4DG5A 2O3TA 2VJYA 2DPYA 4EYQA 5DNCA 2QK4A 1MX9A 5JARA 5JMOA 2AN3A 3K6SB 1HI9A 2Y2VA 2QMYA 3P45A 4FQ8A 5KMGB 1DDGA 3LP8A 1VPWA 3CWCA 4HWPA 1KL7A 3P20A 1XC7A 3DGEC 4R1SA 1ZONA 2B99A 2R86A 2ZDGA 3GBVA 4LYEA 5EWLA 4BVJA 4NJOA 4B6GA 2RH5A 2BE7A 2GRJA 3LX4A 4J1SA 5HZHA 3GAAA 4K6MA 4TL6A 5EGSA 5HRAA 3VYSB 1Y1KE 5BSEA 2W83A 4JT2A 4MB0A 4URVR 1KBZA 2IP2A 4G1EB 5HE8A 4PLGA 4OH1A 2FJPA 4G1CA 3V8VA 3C4QA 2AOTB 4CKWB 1QPBA 2QR2A 2H7VA 2PWAA 5E7JA 1XRRA 3BHMA 4Q7EA 2XE6A 4XR9A 4R5HA 4X8OA 2IUUA 4QJ3A 2FVXA 4WVFA 3CLKA 5CK5A 4GQBA 4A9AA 2ESRA 1P1CA 3L1KA 1MQAA 5KSOA 2EQAA 2J7PA 2F3PA 1QG2A 4MB2A 1EBBA 3UAVA 5K6AC 1Z2PX 4DYVA 2ECPA 1L1FA 3VJMA 4H0CA 2MSEB 4XVQA 3ZKWB 2XY4A 1JAHA 1E9DA 3AHHA 3L49A 3PFIA 4DCSA 5A5DA 4MDEA 1RYNA 4J4TA 2V6JA 4CI0B 3OTIA 3CO0S 2OA0A 3N2EA 5A0VA 4DREA 1SQGA 4YAKA 1AA6A 4FQ7A 2QJOA 3P52A 2BTOA 2FFRA 1WCIB 2YJGA 2WDZA 3Q5GA 3R7WA 2OECA 3U31A 4QU9A 3PQ3A 2ZUDA 3HABA 4Q05A 4JK3A 4XQCA 3MWDB 1E3WB 4DUGA 2OO5A 4MQBA 1KOJA 3G0OA 1E6CA 3CSDA 3LIPA 4IILA 4R3WA 3ROZA 3KT0A 2V1XA 5D6OA 3UT0A 2O4CA 1WDLA 3JQAD 3C74A 4F8EA 1LB1B 2CFOA 4OI0A 1X2BA 3BN3A 4MCAA 3IELA 4I55B 2FQXA 4P7BA 4LX0A 4XIJA 4ALLA 5KOIA 1JQLB 2H2DA 2NXWA 3H5TA 3JRNA 3R3YA 1O1YA 3S2SA 1EEHA 2HIHA 3UGKA 1G9SA 5TMPA 2B8TA 3RJ5A 2QN8A 1MX5A 2DFNA 2I9PA 3I2YX 4C6HA 3G88A 4F1KA 5FX2A 2EERA 1H05A 1Z0FA 2FSFA 1SUCA 2WZQA 3P9QA 4JGIA 4XGIA 3HUDA 2PKQO 4QPCA 3CJRA 3ITDA 1E59A 3T5BA 4UM5A 5DFAA 5EMKA 2GM5A 2CZCA 2BI7A 1CRQA 3OCUA 1Y5NA 3E5MA 5IN4A 2QYHA 1N2BA 3EGXB 3F67A 4R2MA 1H4VB 1JSXA 3QVTA 4A36A 1FSPA 1YRLA 2IBMA 1QQAA 3COJA 3N2GA 2ZJ0A 4DNOA 2F9MA 1IOWA 1T5LA 2R7NA 2C78A 2W6ZA 3TZKA 3K2EA 4J6FA 4IMPA 4MKHA 5AR1A 4M1QA 4EMBA 1H5NA 4WPGA 1F6BA 4QYXA 1IZ9A 3IXQA 4YMWA 1DNPA 5DYWA 3G7NA 3OIVA 2GMWA 1S8NA 3KOMA 3VBCA 4UATA 4CV3A 4XCQA 2P5YA 4EYKA 2AI3A 1F0KA 4Q47A 2O06A 4AKHA 3RTCA 2HIAA 2ODWA 2WA2A 3RDPA 3TTSA 3ZTTA 2Q5QA 5JNUA 2IL1A 1H9CA 3GT3A 1XMOB 4NV3A 3CSSA 1MN6A 2VJMA 2GCEA 2XB4A 1P8JA 4KQ9A 4YP6A 4AFNA 3LE8A 2BTEA 4BLUA 3Q87B 1FP6A 2G7MC 2SKDA 3DLCA 2WKQA 1NIPA 1DZIA 5E8RA 4EX6A 2QD1A 4PBTA 1K06A 3Q11A 3RVSA 3U1TA 5CG1A 2HQ1A 1TYDE 2G9ZA 5BN5A 4HEA6 1J20A 5D01A 1G3UA 2YWHA 2R96A 5AM3A 2GPSA 2UVDA 3E1GA 3LM8A 3CUYA 3L7NA 5G4LA 2XKAA 3UAWA 2ZI5A 4M1KA 5B3KA 1MENA 4MRSA 2G6TA 5HTKA 3HK2A 2WB4A 5AT1A 3TRJA 1E32A 1CR6A 2P6UA 2QW8A 3FDJA 4MKFA 4CMJA 1TIKA 4B31A 3GFBA 3ZY3A 2JAQA 4ZZ1A 3BS4A 4LF6B 4Q66C 1DHTA 2VHJA 1A9XA 3AY0A 4NE2A 4RL6A 3ZCTA 1ZU5A 2WSYB 2YY6A 3JD2A 3F78A 5ILQA 1FX1A 1Z7YA 5B1YA 4MYUA 1L5FA 3FF4A 3ONFA 3ZG6A 4HADA 2IW3A 3HADA 1NDUA 5KS2A 2J3IA 3GWGA 5A1TA 1XCBA 5AUPB 4Q9KA 1WQ3A 4PZUA 4ZO9A 5KSWB 1ZA2A 3MQ2A 4JJEA 4I8DA 3BRSA 1PQPA 3VBEA 3FR7A 1YDMA 3I6YA 1TJNA 1P7ZA 2J5BA 5DNEA 4PO3X 1C29B 1VLZA 4YP7A 4BBJA 1Z6XA 3PT9A 3P27A 2H08A 2O07A 2VHXA 2XUIA 3VU9B 1HH4A 4DR4B 4CODB 1RC8A 1R0RE 3TUIC 3TKLA 3C41J 3ZWQA 5SZIA 5IUKC 4I3HA 2IX3A 4O0MA 1WBJB 5ENDA 1BGVA 2VYCA 3NTVA 2FGKA 4L8LA 4Q15A 5D1NA 1XPOA 3FOBA 5LZ9A 2PD4A 1H2RS 4HDOB 1MU0A 1LC0A 2DPLA 3L05A 4O4HB 2VBFA 4KN8A 3KZXA 4WLNA 1IAVA 3EBOA 2IH5A 3O4IA 1LXCA 1U1DA 5K0JA 5DV9A 5EJEA 4W5JA 3KFXA 4AP5A 4DEVA 3PJDA 4FWIB 3QOFA 1G9TA 1VKJA 4RENA 5BUQA 3NHZA 3G5AA 1EGQA 3VC3A 4U8GA 4DTCA 2ZSDA 4WH0A 5F77A 2VBCA 4KQKA 2I33A 5TGDA 4AO6A 4UASA 4BC0A 4N1AA 1PT8A 1K5DA 1Y6JA 3T9EA 3BB1A 1XN1A 1NVKA 4M0DA 5JDIA 5JD6A 1GCIA 2KLBA 1FFBA 3B48A 5DP1A 3RWOA 1MPXA 3FWKA 2GSDA 3GLRA 1JHUA 3L7JA 1C9JA 3HEMA 1OIXA 1EWRA 1MA3A 2C3OA 3NEPX 3PC7A 4Y7DA 5EIFA 1RABA 2DFKB 1XNRB 1ZLYA 3RV3A 1D8TA 4FSDA 3UJCA 2ZWOA 4R1NA 3L6BA 4W6QA 3BSWA 3JPWA 1U2DC 1PNTA 1P2BA 2X0IA 3BHIA 3EQ2A 3CNEA 1QM5A 1W2WB 2AYYA 3VQTA 3BE5A 3LHIA 1EUDB 4ZAFA 5C9ZA 1ZKDA 1GCAA 1EIWA 2HO4A 3DAPA 3VKVA 4CR6A 3DCIA 3CA8A 5FOWA 2CKDA 2QVXX 3JRXA 5CT5A 5FO0A 4RW0A 2BMJA 4BMZA 1L6RA 3H4IA 4QU0A 3H18A 3N3BC 4HFMA 1NL3A 4RYDA 4ER7A 4RMGA 1BXRA 3GQBA 4YRDA 5FRDA 2CL7X 2PO7A 2QX8A 3U1VA 4BMPB 1U5BB 4GVPA 1WHTB 4HQKA 4QUDA 1P77A 2RHMA 3P32A 3I8SA 5CK4A 1DEHA 3RT9A 5CA0B 4G5SA 1I0ZA 1YTUA 1D0IA 4MW0A 1R6VA 2ZYTX 5JTUA 4M1YA 4OYLA 5JJKA 1FDRA 3RE1A 5ICCA 1VCMA 2ATCA 1U7WA 3VC1A 1APBA 1T9GS 2O3RA 4NBWA 1H4TA 2HJGA 4I1VA 1FJ2A 2CXHA 4BBPA 1RQLA 4ZYTA 3HXLA 1WDWB 1X1SA 4UMDA 4RBNA 3LVRE 5ALDA 4KJZA 2HK6A 1OY1A 2AZMA 3WGLA 1VGQA 2AMYA 1RHQA 5H4HA 5TMEA 3RODA 1QS0B 4XWYA 4BTEA 4D97A 5JSYA 1EUYA 1MAVA 1HMPA 2V8BA 3F74A 3T54A 2ASEA 2YUTA 3BCUA 1DTEA 3R6GA 4G37A 3VI4B 3PNBA 3KP1A 3M81A 4XXHA 1IQRA 1HZZC 1RPJA 4HJXA 1NSFA 3FZGA 4HDRB 2J7PD 3B9QA 3BJRA 3V97A 3COPA 1B0AA 3HNPA 2XCLA 2V98A 3LXMA 4R7GA 3T95A 4LHWA 2YXBA 2C00A 1PGQA 1BWQA 2FPLA 1KFCB 1YS4A 2H3EA 1QRAA 2ZJAA 3AUAA 4EGJA 2P9EA 1GPDG 1ZN9A 4F2GA 2YQ4A 2V4UA 3DA8A 1W4CA 4ZO7A 1K4YA 2R66A 5TF0A 5E4FA 3CXRA 3UJDA 4Z7QB 3L7LA 3GIDA 4R51A 1W9MA 1TM7E 3JQ9A 2I91A 1IEQA 4H35A 1ISPA 2E4WA 1E2QA 2VOJA 1PT5A 3DLPX 3E2PA 3KOWA 4HWOA 1PD1A 3ZYCA 5FEUA 3WYFA 1QCDA 4YAIA 4GMDA 3OC0A 3WA7A 3U4CA 2JAOA 3QX7A 4ZCRA 4BZPA 5BMOA 1E64A 1IDN1 2XYRA 3TSZA 5AVYA 1UBMS 4I50A 4HLCA 3KT8A 1FEZA 3W5HA 1BCRB 3CH7A 2C7GA 2X7XA 2CEKA 3L6UA 3TW4A 4BPRA 1F8UA 4CHGA 3K70B 3M3HA 4NECA 1ESDA 1YQXA 3SQNA 2PX8A 2P77A 2HB6A 2I2DA 3X2SA 4W9MC 4F6RB 1COZA 4XWAA 1NVBA 1X3LA 5KTSA 2R8BA 4HVLA 3G68A 3ER8A 5D7BA 4ND8B 1QTRA 3ZU2A 2HA7A 2I3ZA 3GGCA 4RC9A 5DVZA 2JVIA 5K0GA 2UYCA 2YKGA 2WSLA 4ZIRB 3O31A 1ZFNA 3NIBA 1KEZA 1VSVA 1J56A 4JMPA 1PJZA 1NUTA 2EFJA 2PKWA 3I9JA 1RBQA 2AD5A 2HBYA 1R88A 2M6SA 2VXCA 4ZT6A 4B4UA 3CN9A 2KMLA 3OH8A 4HWGA 3R7BA 4LSGA 1YS7A 2I6UA 3WQQA 1N5DA 4JCCA 1I5RA 1THGA 2FN7A 4DR2B 1UDRA 2AYZA 1V3UA 2FHSA 3B9RA 4PW0A 3BWYA 1ABFA 4U9HS 3VHLB 1WCXA 1GTMA 1V1MB 3CUVA 4JDPA 1ZN7A 5E0OA 4QKQA 1GV0A 1XL1A 2PFGA 4GDFA 1OXTA 1GAWA 5CYOA 4QFBA 3QJYA 4GVLA 1TU4A 3A26A 4AZVA 8LDHA 2H92A 5IX8A 1QAQA 2FMFA 5FLEX 4ETMA 5ALGA 1AGPA 2JFZA 2ZSUA 1BVUA 2OV6A 1HXHA 1UKZA 1XCGB 4Q3AA 5FPQA 2VSFA 2ZJ8A 3VSBA 3WNZA 3ZXSA 4DR5B 1YUMA</