2Y6VA

Peroxisomal alpha-beta-hydrolase lpx1 (yor084w) from saccharomyces cerevisiae (crystal form i)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
379
structure length
351
Chain Sequence
QNRFKKETKTSASWPRAPQSTLATDRLELTYDVYTSARRSRTATRLNLVFLHGSGMSKVVWEYYLPRLVAADYAIDKVLLIDQVNHGDSAVRNRGRLGTNFNWIDGARDVLKIATELGSIDSHPALNVVIGHSMGGFQALACDVLQPNLFHLLILIEPVVITRKAIGPPDSPQIPENLYNSLRLKTDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKGPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWPPQNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPLQSSPQLTLEERAVMFDRAFDSFKNEALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE PROTEIN LPX1
publication title The Unusual Extended C-Terminal Helix of the Peroxisomal Alpha-Beta-Hydrolase Lpx1 is Involved in Dimer Contacts But Dispensable for Dimerization
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 118
structure length 351
sequence length 379
chains with identical sequence B, C
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y6vA01
3R40A 4LHEA 3Q0TA 3EF3A 3C8DA 3UUEA 1UWCA 3JWEA 3ZI7A 2Z3ZA 2VEOA 1HBJA 5ALMA 3UUFA 4G1FA 3OG9A 4OYYA 2G4LA 3DKKA 1DWPA 3G0BA 5CMLA 2V9ZA 1NX9A 2WTMA 1YB7A 1DT5A 3L1IA 4BAUA 4FBLA 1JFRA 4JYMA 2HM7A 2BKLA 1QIEA 5K3FA 3DS8A 1W75A 4RGYA 3WJ1A 1EVQA 5CT9A 5EHXA 4DLNA 4BC1A 1BCRA 3ZWQA 5A71A 3F98A 4DMKA 1LPMA 4UFPA 3F97A 4YK7A 5AI6A 2OLEA 4WJLA 1ISPA 1XZMA 2BGRA 1BCSA 3OURA 1UKAA 5DWDA 2WG2A 4C4YA 5D7BA 1TCAA 1CFJA 3C5WP 4H35A 2CJPA 4Y2TA 3O95A 2XMRA 3Q8WA 1Q0RA 4TVKA 1QO9A 2VQ6A 3H18A 4B9AA 4ZREA 1GPLA 3H2GA 2VAXA 4EY4A 2PSJA 1K5PA 1ACJA 4KE6A 3BXPA 4X97A 3HJUA 3E4DA 1GXSA 2PSHA 2Y2VA 5A62A 2PL5A 2WUGA 4KE7A 4H7JA 1BE0A 1E8MA 1VZ3A 3CCCA 1DWOA 3IIIA 3I6MA 4UPDA 4LXIA 2OPHA 5C8VA 3P2MA 1A88A 4DSZA 2WHPB 1LPSA 5IVIA 3SX4A 3D59A 4FWBA 1JU4A 5HFNA 4K6GA 4U2BA 2OQIA 3VDXA 1A7UA 1AURA 1FFBA 2JBWA 5AM2A 3VJMA 5FRDA 1BEZA 4IO0A 4N8SA 1QZ3A 4WFJA 2UZ0A 4X00A 5J3JA 1CUDA 3DYVA 4U2EA 1NU8A 4WDQA 4CCWA 3IBTA 4H7FA 5HCUA 2EEPA 4X6XA 5C8ZA 4XVCA 1MX9A 3EQ7A 1SCKA 1UK8A 4PF1A 5HKBA 4J3JA 4BAZA 1BS9A 4I4CA 4EHBA 2PM8A 3WKDA 3BDVA 1ZOIA 4NVRA 2VJBA 3BJMA 4FNGA 3ESBA 2WU4A 1YAJA 3WIBA 5EHNA 3S2ZA 5H3HA 2ECFA 1IVYA 5JZ9A 3QMMA 3HYSA 3DOHA 2PSEA 3ANTA 2Y2UA 1JKMA 5D3ZA 1JU3A 2XUAA 3WA7A 1FFEA 5KBYA 3AIKA 5A7HA 4P9NA 4EY6A 3IA2A 5AOBA 4BRSA 3BF8A 1UKCA 3FNBA 1GKLA 2XLCA 2XMCA 2XI4A 2Z8ZA 1R88A 2PVSA 4C89A 3RK4A 3V48A 1F0PA 3BE8A 5ALXA 5FPPA 5KWIA 2XQJA 4ZRDA 2P8SA 2Z3WA 3WK6A 4J7AA 1CUXA 3C6YA 4E15A 4BZWA 4LXHA 3C8HA 5DTIA 4B9EA 3HI4A 3W06A 5EI5A 3D0KA 2G5PA 5LP1A 4GEGA 1EK2A 6YASA 3LP5A 4JUIA 2ZJFA 3WKAA 2HADA 1RWQA 1ZIXA 1EDBA 1G66A 4Y2JA 4M0MA 5ALYA 1CUYA 3OM8A 3I1YA 5LKAA 5IVHA 2XQKA 1ACLA 1N5MA 2B9VA 4BVKA 3IVMA 3VISA 4KAAA 5CBKA 2ORYA 4UBOA 4PSCA 1JMKC 5AKKA 1P0MA 1Z68A 4EB0A 1R3DA 1O6FA 3RM3A 3SK0A 1MTZA 3T52A 4BDSA 1SFRA 5ALEA 2IIVA 1ZD2P 5ALNA 4B6GA 5EHZA 4Y2PA 1D07A 1K6EA 3QVMA 3JYHA 2VTVA 5ESRA 1ODCA 4DMFA 1XZAA 2QVBA 4L3WA 2XMBA 1CUGA 4KAFA 2JGMA 1YAHA 4YX9A 3WYNA 3WZMA 1JI3A 2WKWA 1GPNA 2WU3A 1QTRA 3WLAA 4C01A 1BU8A 4KACA 1IUOA 5IVDA 3I1IA 2G63A 1KU0A 1BRTA 4PW0A 5AHXA 1DX4A 5AOCA 2B20A 3O9MA 1UOOA 4QDXA 2WFLB 5CT5A 4Q1VA 1JJBA 2VJDA 2ACKA 5KREA 1QGED 1EH5A 4ARBA 4YPVA 2Q0XA 3IURA 2PU5A 4C4XA 1DINA 1FJ2A 5FUMA 3DLTA 1QIJA 1BEEA 1F8UA 5T4FA 5JAHA 2OGTA 1YR2A 4UHEA 4BE9A 4RPCA 5AKYA 2O2GA 4W1QA 2AJDA 1J2EA 3V1LA 3S8YA 3HACA 2Y6VA 4QNNA 4X7BA 2C4HA 3W9BA 3A2NA 3WK7A 5BV7A 1TCBA 3G8YA 2AJ8A 1MAAA 3EIOA 4QWWA 4E11A 2DQZA 3AZPA 4BZZA 3H19A 1EB9A 4XIIA 1B6GA 4OB7A 2WIJA 3DOIA 3DYIA 3AILA 4AO7A 5AI5A 2GYUA 3GBSA 2XMQA 1ZJ4A 4Q05A 1YA4A 4BVJA 1ETHA 2WFLA 4J0GA 2C7BA 1QOZA 4G8CA 1R1DA 4UBIA 2QZPA 2XMDA 3FWHA 5IKXA 3PE6A 4LIPD 3AJAA 2DSNA 2DHCA 3D2AA 3B5EA 2HIHA 4UUQA 1X2BA 4PNZA 3ZLTA 2BGNA 2OGSA 4IHAA 1XRMA 4CG3A 3AZOA 1QIDA 3DQZA 3A2LA 3BWXA 3M81A 3MVEA 3WKEA 2IITA 2GYWA 2WUDA 1AQLA 1Q83A 5ALOA 4J0JA 2WM2A 5DJ5A 4QDUA 3PF9A 3IUNA 4GECA 1VXOA 1MT3A 4NZZA 5K3CA 2HA5A 1HLGA 2J3QA 4OUKX 3E0XA 2H1IA 3TJMA 1S8OA 3HC7A 4M0EA 5JZSA 2BUCA 3FLAA 3LLCA 4MQMA 1GQRA 2GBGA 3F67A 4CIAA 2OAGA 3D2CA 4A5SA 1N5RA 3PICA 3VKFA 1UT6A 4OSEA 3C43A 3W05A 4ZXFA 3WKBA 1CUHA 1CUVA 3I6YA 3B3QA 1PV1A 4FNMA 3WA6A 5A7GA 1IUNA 3LS2A 2WIGA 1UK7A 3CN7A 5LLSA 4X91A 1TK3A 2XUKA 4EY7A 3KD2A 5CRIA 3H0CA 3ZPXA 5ALWA 1EVEA 1WB4A 4QA9A 1UOQA 5CH5A 1XRLA 4L72A 1JMYA 2ES4A 2VAVA 4BDTA 4MXDA 3C45A 4X94A 3WK9A 4S0XA 5C7YA 4IQ4A 3LCRA 5AI0A 1XZGA 2HA7A 3D5EA 2GZRA 1GQSA 1XZIA 2XE4A 1VE6A 1CVLA 5SYMA 2RGUA 1WHTA 1CUJA 1W76A 3ICWA 2HFKA 2B4KA 3CN9A 1WOMA 1ZIYA 2JGFA 4QDOA 5A7FA 3E3AA 2CZQA 4FTWA 1CUSA 4KJXA 4B84A 4G9EA 4HXGA 5ALJA 1ORWA 2HU7A 3STWA 3ED1A 4JEIA 1R9NA 1UK9A 1XFDA 1T4MA 2JEZA 3HABA 5AICA 5ALDA 3KSRA 1XZHA 4H77A 2JIDA 5I9IA 5JADA 4AO6A 1CRLA 1QJ4A 4UFOA 3QBJA 4ZGBA 1M33A 5E2IA 2VA9A 3PDCA 4J0KA 1U8EA 4AQDA 3GROA 1YASA 1PJAA 1CUEA 1O6GA 3O4IA 4FOLA 4N8EA 5FKJA 3WJ2A 3A6ZA 2GBIA 3QPDA 4EUSA 3VXKA 1VZ2A 3H17A 5ALFA 2HFJA 2IX9A 5CT8A 3T4UA 4U2GA 5CXXA 1TAHA 3DCNA 3C6XA 1AMNA 1GKKA 2C0QA 1I6WA 2Y6UA 4DM7A 3EQ8A 1EK1A 2DCMA 2RIPA 1AX9A 1CV2A 4Y2QA 2PUJA 5HK8A 5AM0A 4F5ZA 4B81A 3BL8A 4MYDA 4DNOA 3FVRA 1XZKA 2QS9A 3SC2A 1PFQA 4LKOA 1MNQA 4BAGA 1XQVA 3FYUB 1E3QA 3QPAA 4U2FA 1R4ZA 5JAOA 4WFKA 2WILA 5K3BA 5FV4A 4QZVA 1CUIA 1G5FA 3STYA 3BIWA 5AIBA 2C5FA 2CUTA 4X85A 2JF0A 2DHDA 1CQZA 5F4ZA 2FUKA 1T2NA 3G9TA 2O7VA 1RP1A 4FMPA 3R41A 5LYYA 4ROTA 1CUBA 4X95A 2AJLI 2WIKA 5AK4A 2QMQA 5I7UA 4H7IA 4ZI5A 1HL7A 2WFMA 2ZJ6A 1OXMA 1K63A 3HXKA 5CW2A 2G5TA 3WIOA 1VA4A 1H2YA 4BTLA 4OCZA 5EIEA 4E46A 4X93A 2JGKA 1ZGCA 4DNPA 2QKYA 2QTBA 5JALA 1VJ5A 4UHFA 2X8BA 1H2XA 3FYUA 5HF8A 1XKLA 3G9XA 1EDDA 1WB6A 4J0CA 1WPXA 2WJ3A 4KRXA 1XQYA 1L7AA 4GDMA 2WUEA 3W2TA 3GA7A 4B0PA 5FP0A 2DQYA 4P92A 3RKSA 1XRNA 5AKHA 4MWTA 5LZ5A 3CCBA 2EDCA 4HAIA 3OTQA 2ROQA 1JJFA 5FDFA 2XUPA 3QH4A 5AKXA 5ALVA 3AINA 1C7JA 1DQYA 4H7HA 4F21A 3DNMA 1AZWA 3R3XA 3H2JA 5LZ7A 5AKJA 1QIIA 1MX1A 1AGYA 4P08A 1F0NA 1H23A 1U4NA 3WWCA 4CIBA 3WI7A 5K3EA 1RYYA 2VJAA 1U2EA 1XRPA 2WHQA 5JAUA 4WCVA 3WWDA 4HTAA 1SC9A 4DTCA 5IH7A 3FOBA 2XUGA 2PU7A 5AM4A 4JH0A 3PFCA 3STUA 4AN1A 1QIMA 4WFIA 1AKNA 4OU4A 4QEKA 3MUNA 4TGLA 2QM0A 1JT2A 3CXUA 2C58A 5JD5A 1GT6A 3AIOA 4I3FA 4W1PA 3ICVA 1P0PA 4Q34A 4OB8A 4AX4A 2E3JA 3O0DA 5JD6A 1QIKA 3MGAA 1XZFA 1XLWA 2OCLA 2X76A 4PQEA 4GLBA 4K6KA 3C87A 1XQWA 1ORVA 4GW3A 4BYMA 3YASA 5JAPA 1VA5A 4RE6A 3NUZA 2WIFA 4UHBA 4F60A 1IUPA 1LLFA 3H2IA 3ESCA 4BP8A 1FFAA 5A6VA 3QMWA 2QXTA 5CH3A 5ALLA 1ODSA 4JNCA 5JASA 4J0DA 3I2KA 5AKGA 1ZD3A 1AC5A 4UHCA 1C7IA 4B7ZA 4FLFA 3F96A 3D4LA 2YYSA 1IZ8A 3HRHA 4UBNA 3RLIA 3OOSA 1EXWA 5DLPA 2FX5A 2OCKA 3FSGD 5EHQA 4BRZA 3DL7A 2PPLA 3D2BA 4A16A 1DQZA 2YH2A 3NWOA 3X3HA 3B12A 1SCQA 4Y2VA 5BWCA 2PBLA 1FFCA 1YB6A 1XZLA 3IUJA 4ZV9A 1EX9A 4LYEA 4V2IA 1QO7A 4EBBA 4MWSA 3R3VA 5CT6A 2JGIA 2HU8A 2H7YA 4PSUA 4CI9A 5K5EA 4K5QA 3R3UA 3WKCA 1WM1A 4B80A 2V97A 4N8DA 3TGLA 1LBTA 3IUQA 2XMZA 2QUAA 5T4EA 1J06A 1HPLA 1QFSA 1XZDA 2W22A 4G8BA 5FPQA 5AO9A 1E8NA 4HXEB 5LZ8A 1MU0A 3FYUC 3I2HA 4WY8A 2H7CA 2V98A 5LZ4A 1Q0ZA 2PUHA 2HA2A 1SCIA 2R8BA 2RONA 5ALTA 2QRUA 1YA8A 3TEJA 2RHTA 3GELA 2Z5GA 2WG1A 4UFNA 2DFPA 1BN7A 1LPOA 4Y2YA 2J3DA 5EIHA 3BJRA 4HZGA 5AKIA 1LPAB 3M3DA 2R11A 4U2DA 3H04A 3KDAA 4MJ3A 3K9BA 2ACEA 5HQ3B 4C6HA 4HXFB 2O2IA 4QDTA 5FXMA 5JIBA 2ZSIA 3C6BA 2I3ZA 3G0CA 5DYYA 3PF8A 4Q3KA 2V96A 5D6OA 4H7KA 4MEBA 1USWA 4ZWNA 3G0DA 4IH4A 5AKLA 4BP9A 3I2FA 1QONA 3WYDA 5DNWA 1XZBA 3K2IA 5JYCA 1B41A 2VSQA 5AM3A 3JW8A 4B83A 2DHEA 1QIFA 4BATA 3ILSA 5CT4A 4Y2SA 5EFZA 1FSSA 2XT0A 5DYWA 3R3YA 1XLVA 4X90A 1VE7A 4W1SA 1ZI6A 2O2HA 5DNVA 2I78A 3FBWA 2OG1A 4NS4A 2WSLA 3V9AA 3NOXA 2XMSA 5CH8A 4Z49A 4G4JA 5HQ3A 4H7DA 1ZI8A 1NU6A 1K8QA 1N8SA 4KE9A 3C5VA 5C81A 1J07A 1QTIA 2VATA 5C8XA 4YASA 3PUHA 5AH0A 4OU5A 3I2GA 2PSDA 1UXOA 1W4LA 1XLUA 1F6WA 1CUWA 4AN0A 4LXGA 2XB6A 4K6HA 3WMRA 5FOQA 4BVLA 1CLEA 1LNSA 4PV7A 1ZGBA 3WWEA 3WL8A 4A23A 2ZYSA 2XLBA 3V1MA 4FHZA 5CTAA 3D3NA 2XMGA 1XZCA 1W1IA 4DYHA 4G4IA 1UZAA 5ALIA 1VOTA 3C6ZA 5T4HA 1VKHA 4BTVA 2CKMA 1WCYA 2C0PA 5YASA 1R9MA 4XWGA 1ZI9A 1W6RA 1ZD5A 1UK6A 3O4GA 3TRDA 5JD4A 1G42A 1IZ7A 4HRYA 3QYJA 5EIAA 4DMCA 5FLKA 5ALHA 2XUJA 4OB6A 5EGNA 4G9GA 5DTJA 4JYPA 2BFNA 1EHYA 1TQHA 1XRQA 4PO3X 3HZOA 5K3DA 4KAJA 1QFMA 3QMVA 4J0HA 3R0VA 3LIIA 2D5LA 2X5XA 1Y7HA 2ZYIA 4L0CA 4X6YA 4K2AA 2HA3A 2VJCA 2ZVDA 2VT6A 4X3CA 5I8PA 2AJBA 3ZV7A 2BAGA 3W9UA 4QDZA 5AJHA 1QIHA 3I2JA 4CCYB 1N1MA 5BOVA 4D9JA 5ALRA 1KU6A 4AZ3A 2JEYA 3I6ZA 3QPCA 4B0OA 2FJ0A 1R50A 1CQWA 2HL6A 2CB9A 2J4CA 2XUIA 2GBCA 4C87A 5ALSA 1WHSA 3M82A 1YSCA 3QITA 1EB8A 4AB1A 5LZ2A 2OCGA 4UHHA 1CR6A 3LIPA 4LYDA 5IVKA 1MAHA 1OCEA 1CUFA 3WL6A 3PUIA 4Q3LA 5ALPA 2BCEA 2FJPA 5AI9A 2J4FA 3FCYA 5LZ9A 3WWPA 4UBLA 1WB5A 4F0JA 4W63A 1A8QA 4BCDA 2LIPA 3O4JA 2HHAA 3ESAA 1JJIA 3QM1A 1CUUA 4N5IX 2Y1KA 1CUZA 4NMWA 3HLKA 4KRYA 3ANSA 4CCYA 2AXEA 4AO8A 4KE8A 2OQVA 1CUCA 3AUKA 3UMJA 3EBLA 5D3KA 4B82A 1GPKA 1DT3A 4GWLA 5AP9A 5JATA 4BC0A 1BROA 3HEAA 1L7RA 1MX5A 3QZUA 5SYNA 4QLOA 1MN6A 2PSFA 1QLWA 5AI4A 5ALZA 4H18A 4CFSA 3DEAA 1C4XA 5HF5A 2O7RA 2XUHA 4EY5A 3HSSA 5LIPA 3KWFA 5E4JA 2OCIA 4W9RA 2ONCA 4H0CA 1MJ5A 3IULA 1UFOA 4MEAA 3KXPA 4O08A 4BE4A 4C88A 2WHPA 1CEXA 2QJRA 2GYVA 1YS1X 2I03A 4MQLA 1EA5A 3STXA 3STTA 3G02A 4DSAA 4KEAA 2QXUA 2WQZA 3R3ZA 3FAKA 3G0IA 4G4GA 4XX1A 1XRRA 5HKAA 3FSGA 3ESDA 5CURA 4IH1A 1H2ZA 3H1BA 3R3WA 3C70A 3W04A 4WDRA 4X71A 1E8DA 3WL5A 5CXUA 5KWJA 5ALUA 2WG0A 5AK6A 5ALGA 4HS9A 2WLSA 5JARA 2CMFA 3WL7A 4Y2RA 4Y2XA 3GFFA 4CG2A 4X6UA 1DWQA 1ODTC 5AKEA 2JGJA 1LBSA 3G9UA 1IMJA 2ZJ7A 2GZSA 4DMHA 4ZV7A 5JANA 3KOOA 5AM5A 4WY5A 3F9CA 2H9YA 2Z8XA 2YASA 5BWBA 2WTNA 2YXPX 1K4YA 4EY8A 4UHDA 3A2MA 4PSDA 1VLQA 1EINA 4H7EA 2GBFA 4ITVA 5AIAA 1H22A 3FLBA 3U0VA 1L7QA 4Q3OA 1CIJA 5K3AA 2HA0A 2VF2A 4J03A 1TCCA 3G0GA 1A8UA 5JZBA 4IH9A 4KYVA 4UBJA 1ZD4A 2QT9A 2QOEA 2CEKA 3DL4A 2PKYX 1SOMA 3OPMA 4INZA 1A8SA 4G5XA 3BIXA 1X70A 4UBMA 1WPRA 4P93A 2HRRA 3G7NA 4E14A 1U65A 3DKRA 2D0DA 4FKBA 4Q82A 4BCCA 2HA6A 2XDWA 2DR0A 1THTA 5AM1A 3NGMA 3N2ZB 4W1RA 4QE3A 2XUFA 2WUFA 1TRHA 4RNCA 4GXNA 1EDEA 1OILA 2HRQA 3GZJA 1YS2X 1XKTA 1CPYA 2XQIA 3I2IA 1DX6A 4QWMA 1HKHA 3RARA 2XUOA 4EA6A 4I19A 3KWJA 3L1JA 3VVMA 1Y37A 2XQFA 2BUAA 1GGVA 4M0FA 2HU5A 1TIBA 4BCBA 3I28A 3L1HA 3FLEA 3H2HA 2NW6A 2PX6A 2C5GA 4OPMA 1DTEA 3EQ9A 2WIDA 3H2KA 1E66A 1MNAA 4MYSA 1MPXA 3FCXA 1HDEA 2QJWA 3FVTA 2QR5A 4FLMA 3IUMA 4FBMA 3SWWA 1G4HA 1LZKA 4FFVA 1LZLA 5ALKA 7YASA 5AKZA 1THGA 4DIUA 2I3DA 3G9ZA 2ZYHA 4AMZA 1KEZA 3AZQA 1XQXA 3ZLVA 5ALQA 1LPPA 4U2CA 4AZ0A 4DGQA 4AMYA 1X2EA 3F8SA 3O4HA 1P0IA 3M83A 4FLEA 4Y7DA 2XUDA 1HQDA 3PFBA 4G8DA 2WJ6A 3WWOA 1XZEA 1ZJ5A 5E4TA 3U1TA 2RHWA 1E89A 1DU4A 4UBKA 3ZLUA 3STVA 4BB0A 2WJ4A 3WK8A 2WHRA 5AK3A 4OYLA 3VVLA 3BF7A 2ZSHA 4Y9SA 1J1IA 1QIGA 3WK5A 1BN6A 3E1GA 4XJVA 3MUOA 4GHWA 2OGZA 3VJKA 5HF6A 4AXBA 5ISMA 4EZIA 5E4YA 4FDMA 2AJCA 4ARAA 3DD5A 4CG1A 4C4ZA 2XQGA 3WQHA 5HF9A 4QLAA 5LKRA 3PI6A 1EI9A 1UOPA 1Y7IA 3H1AA 2K2QB 4BBZA 1LPNA 4GBGA 4DNQA 3K6KA 3WZLA 2WFZA 3IDAA 2JGEA 2OXEA 5DYTA 5HFAA 2H7XA 4RE5A 1CUAA 3D7RA 2ZYRA 3FYTA 1TKRA 3GUUA 3N0TA 5AOAA 5DNUA 1XROA 4N5HX 1FFDA 5T4BA 4DNFA 3VJLA 1MO2A 3IB3A 1QE3A 4FFWA 4GI1A 4J0IA 4L9AA 2RI6A 3V1NA 1Q84A 2CBGA 3OC0A 1E5TA 2BJHA 5A2GA 4B85A 1W52X 5HK9A 4TPKA 4HRXA 5HZGA 4Y2UA 1LPBB 2HA4A 3DDUA 3WK4A 4HVTA 3AIMA 3V1KA 1YCDA 5K3FB 3A70A 2RAUA 4KR0A 4X92A 1H2WA 2QUBA 2EDAA 2W6CX 2B61A 4OD0A 4ETWA 1LGYA 1ZICA 2HDWA 3AFIA 5AI8A 1XZJA 2OAEA 3DJYA 1UKBA 3BDIA 2JGLA 2XUQA 1VXRA 2VT7A 2BUBA 1AUOA 1GZ7A 3O9VA 5AK5A 1P0QA
chains in the Genus database with same CATH superfamily
3VZPA 3UKOA 3ZY5A 1UDCA 2GPAA 2V7XA 1YJBA 1ECBA 2AMYA 2HPHA 2PJZA 1WKCA 1KH3A 3Q0TA 1V5IA 4N7MA 4OFZA 1XE3A 4F2HA 3UUEA 2IP2A 1RMQA 2VHCA 4L3OA 4EUHA 1OC4A 4Y8VA 5A4JA 2QYTA 5ADHA 1U8FO 3C3YA 1XJCA 3DZIA 4J29A 4ND5A 2ZVQX 1GADO 3ND8A 4RD2A 2ZTMA 4TWRA 2C9ZA 2PQ0A 2UU9B 3E81A 3T5CA 1PVOA 4KSCA 3CEMA 1Z47A 2B30A 3M0EA 2NU8A 4UEJA 4HNTA 3P2JA 3K5HA 1FQKA 4LWPA 1BMFD 2VNAA 4PZEA 3VNBA 3G0BA 1X7WB 1J22A 5TLSA 3OICA 1NX9A 1GXSB 2NACA 3D0RA 1ESEA 2WJPA 5EXPA 3A6HA 3KG2A 4E2WA 5KQRA 2E7ZA 4JI7B 2V7QD 4YIKA 5AXDA 1XNRB 1YOBA 4IJ6A 4NMMA 3L7AA 5KOJA 1OYYA 1F1JA 4HAWA 3RVQA 4BAUA 1JFRA 1S2LA 4AX8A 3R6DA 4RDCA 3RC9A 2ZUEA 1EJ0A 2I8LA 2Z09A 3WS7A 2BKLA 3OAAA 3WYCA 5F7OA 5K3FA 3DS8A 3LT4A 1BWPA 2D5CA 3HNRA 4LOJA 1GPH1 4YRDA 4KQXA 1GFZA 4RGQA 1GTJ1 2XXBA 2ZWVA 4RLHA 4BC1A 3ZWQA 5A71A 3KL2A 3OIYA 3B53X 4WLNA 2ZG6A 3PYXA 4U6NA 1CE8B 4A9AA 4ATNA 1XU4A 1GA1A 4K28A 5CVJA 4KMRA 1C0EA 1NGSA 2IF2A 4QUBA 1XMXA 3IP8A 5FQOA 1NRWA 1QDLB 4N65A 4YK7A 4G5SA 1K5HA 1CQPA 5LZ4A 4LYHA 1ISPA 1XZMA 1U0OC 2BGRA 1BCSA 4DPLA 1F4PA 4W5WA 5E9QA 1QHGA 4UCFA 4DARA 1XZQA 2ZYTX 4S35A 3ZCTA 4JOBA 3FN4A 2WF8A 3AEZA 3E53A 3M6XA 1F8XA 1TCAA 4P1ZA 2QN9A 1M2JA 5KPJA 2AZDA 4H35A 4B46A 4EQZA 3NFRA 1XU7A 1I9CA 1Z75A 4OKSA 4PANA 1ABFA 1Y3HA 4Y2TA 1EWVA 4XWOA 1EUYA 2PGIA 1TC2A 5G41A 4RD4A 1M83A 4QU0A 2EU8A 4TVKA 5I4CA 1CQIB 5CB4A 4RUKA 2QAJA 5FJIA 1BMTA 4ER0A 3FUXA 5JNWA 5AOVA 4Q7QA 3RIMA 5KMGA 2OD9A 1XL1A 1C1XA 1EWRA 3ETDA 3MJ4A 2PMBA 2W6ID 2PSJA 3MLAA 3ZH9B 1DQRA 4EY4A 5TX7A 1ATIA 2Y1LA 1K5PA 4ZYYA 3S1AA 1ACJA 2QL9A 1E2QA 4D56A 1T9ZA 2XHZA 3QFTA 2P4SA 2F1OA 1V48A 3SYTA 2JLXA 3E4DA 4FFBA 4R1TA 4RKFA 3BB4A 2AI2A 1N7IA 2ZI6A 2PGNA 1H4TA 2IV7A 4N6OA 4JI8B 4IFEA 3DUFA 2CV1A 1JR3E 3CLKA 2DAPA 4GM1A 3TW6A 2AH5A 3N3BC 2A1TS 4H7JA 1L7EA 4YJGA 3VC3A 1NHGA 2QX4A 5JXWA 4Q03A 4DN6A 1BHSA 3CCCA 1FXWF 1M1XB 4BEJA 3PC8A 2QSUA 3OOWA 4MVJF 2V0CA 5JSKA 3GW8A 3WSWA 4G0ZA 3V8BA 1U7PA 4P3NA 1UJ6A 2A35A 4LCBA 1NM5A 4ZPXA 1WULS 4UPDA 1KO7A 4E6EA 5C80A 2H5IA 3RS0A 1S6YA 4GPEA 4Z0PA 1Z0KA 4RENA 5H83A 2OPHA 4RTOA 3MLEA 1YR8A 4D0RA 4KR7A 1BW9A 4CJXA 1A88A 4HO1X 4IWYA 2NO4A 1A9PA 1EE9A 1TEVA 3PPVA 3PP8A 1QDUA 4XR4A 5E38A 1J99A 1P4GA 3VI4B 2ADOA 2WHPB 4WW0A 5IVIA 3SX4A 5AW1A 2V0NA 2Q49A 3HBAA 3OE1A 3AUAA 4RCZA 2KPOA 3HCDA 4FYXA 5HFNA 4TL8A 2QLMA 4IHJB 1RRVA 3CKYA 4K6GA 4LJSA 1RC1A 1HNNA 2QQ0A 4U2BA 4B3XA 1U0HC 1GN8A 2BMFA 2OQIA 3MCTA 3EDYA 4V0MA 5KAMA 1DDGA 2V0GA 3TI9A 2NU7A 3FWYA 3L1UA 3NR2A 1FDTA 4NTZA 3T1TA 3SS9X 4RPLA 1ZWLA 3ZU3A 1J0BA 3EYWA 4FFPA 4QFBA 1P62B 1PQYA 5AM2A 2AYZA 4XARA 2WE8A 1GZ4A 2QGZA 3BMCA 1CETA 1G63A 3NH6A 4BVGA 3PQCA 4IO0A 4N8SA 1CEYA 4U1RA 4NFLA 3KZNA 2HV9A 4ZN6A 1U02A 4WFJA 3A0UA 2QRPA 4O1MA 3DYVA 3I1FA 5CJ2A 4U2EA 3HZHA 3OQIA 5CLJA 3K9NA 2WD7B 3KVNA 4I8IA 1ZVKA 2CDRA 3NYQA 2OUKA 2OHOA 1YQQA 3B1WA 4BFSA 1QRRA 3T7EA 5K8IA 1BVRA 1P3Y1 6PFKA 4BWYA 1BDMA 1RLIA 4NF2A 1V11A 1YXMA 4FYPA 1NKSA 3FGOA 3A9WA 4QTYA 1CY8A 3WGYA 5FWYA 1NMQA 5LYJF 1Y5LA 3ELDA 3R9XA 2HN9A 4EA8A 4YACA 4E08A 3LPLA 5L3RA 1UPUA 5IDVA 1J9GA 3HXLA 5CNIA 3UF0A 1G38A 3AQ4A 5CIYA 1UBOS 3KC2A 2NSYA 4HLQB 4O4LA 4AWBA 2HMSA 1DHRA 1KJ8A 1LTHR 3EGIA 1FJXA 4PF1A 1E5VA 5BWNA 2I1WA 5HKBA 4LMBA 4OIFA 1UBJS 4F5WA 3RBVA 5SY4A 2VH1A 4BAZA 2XWSA 1RCUA 3W5AA 2I4RA 2OYCA 1TE2A 3I9JA 2RHRA 4KFSA 4EHBA 1N2IA 2CJXA 5FL7A 1JQLB 1OBCA 2ZS8A 2PM8A 3NDJA 4UU0A 5KEIA 4NVRA 3OPNA 3BJMA 1I0LA 2HRBA 1JV2B 1JEQA 2FW0A 1BS1A 2Y77A 2ZUBA 3OLZA 1EGHA 1PUXA 2NLOA 3KDPA 4JJEA 3RRJA 2Y9MB 2DLCX 3AL0C 1G5TA 1T2VA 1BE8A 2AEFA 2ODTX 4M7RA 5SZJA 3L7JA 1PBNA 4KO2S 3UATA 5EG5A 4A6PA 3SAJA 1OYOA 5REQB 3GLUA 1U98A 4W8HA 3LFHA 2WW8A 5EHNA 3X1YA 1IWOA 1YZVA 2BGTA 2JJQA 3N05A 1P2SA 1L5RA 1V25A 4BQSA 4JT4A 1GUZA 1I7PA 4UTVA 1D4AA 4HDMB 4BQEA 3T38A 3U61B 1COWA 2VK8A 2PXAA 1P2FA 3K53A 5JE8A 3TN7A 1RJWA 1DUIA 1WE2A 3BD8A 5ELMA 3VPHA 4ZAVA 2ORWA 2P9JA 2VP2A 2FMUA 4AMGA 3TLJA 2B8NA 4QEDA 3WVNA 1A72A 3F6PA 3AVVA 5C3MA 2AG0A 5K8TA 2H31A 1F8GA 9LDTA 4MJLA 5A05A 3CVUA 4ZQEA 2XB8A 3MWDB 1KI8A 1NN0A 4MSUA 5JCPA 4OQZA 4TS3A 4HGOA 2A86A 2IYUA 5A4AA 1RD4A 3FTEA 1V8FA 2P4QA 4HCJA 1GKLA 5CB0A 5CDTA 3BXOA 3O1HB 4LRWA 3FPCA 5C8YF 621PA 1J25A 4HDOB 3AU8A 2J0QA 3WG9A 1R88A 3P26A 4DPMA 3JQAA 2WTEA 1VSVA 3AQIA 3Q9UA 4I1YA 3D7LA 3ZEAA 3HK2A 3OQOA 2DBYA 4GH5A 4TUYF 3VPXA 3LQ4A 4IIDA 1PEKE 4JP5A 4BX9A 4JBXA 5HRCA 1G6OA 4DXAA 3ZDXB 1PS9A 1SKUA 1GFIA 1F0PA 2B6HA 2CJYA 3MWLA 4JC8A 3ZBTA 1GKUB 5KINB 1Q91A 1UP7A 2E55A 4EYEA 3C7DB 2GCOA 3OLYA 3JQGB 1Y5RA 3DPIA 1NSYA 1QM5A 1NATA 2JI4A 3C41J 2C2OA 2JD2A 3C1UA 1XVAA 4FCWA 2JVJA 4JQCA 4NYIR 1ZCBA 4ZRDA 1PZHA 2P8SA 4GOKA 2QD3A 1YZQA 1AGNA 1S3IA 1DCKA 3IDOA 1JZTA 4CFZA 2IS1A 2XB2A 3I37X 1O89A 3IVCA 3ZQUA 5SYAA 2QVZX 3EY4A 4LXHA 1IYZA 2HUNA 3RVOA 2YTZA 3C8HA 3UOGA 1N57A 2HSDA 4JLUA 1A76A 3OFNA 5I47A 3OCVA 3KEOA 4Z0NA 4QKQA 3CPHA 4O2AB 3D0KA 5DX1A 1ZN9A 3TG8A 2HO4A 2ZWMA 1LJLA 4F7DA 1Q6YA 1XVUA 2AN4A 2Q29A 2JIRA 2PGOA 3CLUC 3O2JA 3LT1A 4FMCB 5E1MA 2ZDQA 2PX0A 5C31A 1IVSA 5DBOA 3RVBA 3RAPR 4PYOA 1GG8A 5TT0A 3GLKA 4GEGA 4ZHQB 1JFFB 3H8VA 2PTHA 4M9RA 2F00A 4MA0A 1SD5A 1E3WA 1EK2A 1ZUIA 4MUMA 5IJXA 6YASA 1ULAA 3UT5A 1XA4A 4UXJA 1BXZA 3T1HB 5EINA 4FIDA 4AJNA 3U9TA 2IXDA 3KZVA 2HADA 2PS3A 1BNCA 1ISJA 1RWQA 4IGAA 2QY6A 1J39A 3PE3A 5DSTA 4A5OA 3FRJA 4U0JA 4C30A 1SELA 4L4XA 3E5HA 3PCTA 2IZ5A 1JLRA 1M2KA 3HADA 3K9HA 3V9PA 5K99A 2WU0A 2ZRLA 4X8OA 3PXDA 1G66A 5FFNA 3P2IA 4KZKA 5FUQA 1CUYA 2A9JA 3IKLA 1II8A 2DTEA 2DUJA 3AG5A 3N2IA 4OBBA 4XQEA 1HE2A 1XOIA 1VL0A 2B7LA 3HXPA 4N3GA 3V8RA 2AC4A 2ZS9A 3IXMA 3NHBA 3GEMA 1TM3E 1UWVA 1EFDN 3PTLA 4KN8A 4RL4A 1WCV1 3EULA 4QVIA 4WL0A 4IDFA 3VISA 4QJ4A 4OBWA 2CXQA 4GD3Q 1U0SY 3RVSA 3DKIA 1T8RA 2R5FA 3SF8B 4UBOA 1T34A 3NC4A 1Z2EA 4RMIA 3AFGA 4CQMD 2PKWA 2JI9A 1LCIA 1QRAA 3DFMA 1P75A 2C3PA 4G5FA 4MUBA 1R3UA 2PRJA 4IOMA 4JOSA 3W6PA 3CGWA 2UYCA 3VHXB 3GD5A 3BZWA 3T7IA 4BDSA 1H0KA 2AHRA 4TX1A 4IQ8A 2FPLA 3WP1B 1J8DA 4J8PA 1MC1A 3CA8A 4KXVA 4QPCA 4BLTA 5IF9A 1F1BA 2GS9A 3IPRA 3H11A 4ZODA 3V6MA 4JI3B 1F7UA 4AKIA 2ZLBA 2F9MA 1D07A 3ILVA 4LYAA 4RZUA 5AUQA 2WHXA 3U56A 2BTOA 1RYNA 1AQJA 3PD7A 4IICA 1CQJB 4Z3DA 4E2FA 5ESRA 3TTYA 3PEYA 1XZAA 1M75A 4FDVA 4L3WA 2NGRA 4V0KA 1U0BB 3KR9A 1RQPA 1QJCA 4LV5B 2C07A 1JQEA 3AKDA 3BMOB 3BWVA 2XOEA 4M1OA 3SBOA 1YMVA 2A33A 2Q5EA 3GR6A 4Q0MA 1YAHA 5L95A 1UBUS 5CR9A 1Y3IA 3WYNA 3PUKA 1J09A 1GUAA 5IYZB 4KQ6A 3EDMA 1T9AA 3OZAA 3WNDA 3EY9A 5EQTA 3DEJA 4BPRA 1JI3A 1P31A 2YHIA 4AL4A 4DRXA 4EJSC 4ZZ0A 2NXWA 1GPNA 1IY0A 3AT1A 3KLBA 5DCYA 2FV8A 3IBSA 4HEJA 1QTRA 2VBFA 5CW1A 3FDIA 1I24A 2GZ3A 1T35A 4MS4B 1IUOA 3M6UA 2AL7A 3B85A 1YL5A 4ZCMA 2G63A 4I1VA 5ICFA 5D85A 5JYBA 4A8TA 2OL4A 1NTOA 1TTTA 4LMRA 1KU0A 1EM8B 2C7PA 2FPPA 3LCVB 3QHAA 3HVJA 4W6QA 3A27A 2GARA 2B20A 1L5OA 2CVZA 3IPXA 3O9MA 4PPFA 4G0UA 2FSIA 3DG9A 1KZ1A 3GJQA 5A6SA 3UJ8A 3SE7A 2WFLB 1D1SA 3HJBA 5FD8A 3LVFO 1SXQA 5CT5A 1P39A 2C2XA 5KO2A 2QUKA 4NFHA 1YI0A 4X8MA 1L5QA 1EQ2A 1W5EA 1YULA 2SKCA 3KJFA 4GT1A 4IDGA 2P0AA 4JL8A 3VNSA 3KQHA 5JQGF 3N1UA 1QGED 1QCCA 3GAMA 1IQ0A 1SC1A 3PNSA 1B0UA 1EH5A 1M66A 1OGJA 1WBBA 2ZZMA 4B2PA 4YPVA 5H7XA 3G2OA 4B4OA 2Q0XA 1SBQA 1UPTA 4DCNA 1WDLA 3EVFA 4LRXA 4WKCA 4C4XA 5I9NA 2ZUTA 3JXEA 3SMQA 1FJ2A 3LLVA 5FUMA 1UADA 4DS3A 1BEEA 2XNCA 4OXKA 2O8BB 5T4FA 2BELA 2H5JA 2RB5A 3FZYA 1YK0A 3LQKA 5EYPB 3SQNA 1FMJA 3T41A 3UMBA 1OZGA 3AKYA 3TGWA 2DG2A 3H4IA 2YOHA 4OL9A 3LFUA 4UHEA 4MV8A 3CTPA 3FIUA 3K5WA 2ZDHA 4H3SA 4JZYA 1ONPA 4OFXA 4GMDA 4RKYA 3ZW9A 4C0AC 4YRGA 2FPKA 2W0SA 4GIBA 5KVQA 2NO5A 1B0ZA 1JQDA 3TL3A 4G4SO 4B3CA 3UW1A 2GEFA 4L4SA 4UNIA 2BZ0A 3HACA 4HEQA 2Y6VA 3FDZB 4QNNA 3KQNA 4RDIA 2CLLB 4G4SP 2A0WA 2B3TA 2X7XA 4PZAA 3U1BA 4AJ1A 3W9BA 1FZQA 5BYAA 2YXBA 3QFSA 4GOLD 3UG7A 3DLBA 3F6SA 1H2BA 1W0CA 3V3TA 4BMCA 5KS2A 2BBWA 1SBZA 1JLHA 2VHYA 3MINB 3S2FA 1SQ0A 2PJDA 3U81A 1WF3A 4H08A 4DHWA 3O47A 3O8CA 4EFKA 2A7XA 3AF4A 5HQTA 2W42A 3PFHA 2QQEA 1ONSA 5GVSA 2P3OA 1A77A 1ZSNA 3KQLA 3UTDA 3JSXA 3LUBA 3VNRA 3EQ2A 4C0SA 3CONA 5IVPA 3EC7A 3GN1A 2BMAA 421PA 3ZHXA 8OHMA 3E9EA 3RRXA 4ZVQA 3UKJA 2PS9A 4AY6A 1WUJS 1Z5OA 2K2WA 2GHRA 2GYUA 3GA0A 3FI0A 3I76A 3JD3A 3KX2A 3PGA1 3UA4A 1QG0A 3QF4B 3TTVA 1FBNA 4ESEA 3O26A 2PA3A 3DP7A 3LNTA 2VRNA 1TW2A 2EGHA 2O50A 2V7QA 4DLWA 5IHXA 1UDAA 2W2TA 4B2IA 2ZJ8A 4BVFA 2E6KA 1G3UA 2IZOA 2W8BA 3OOEA 3DBRA 3EVEA 2VDOB 3PKJA 1TTPB 1VECA 3PE6A 5KOHB 2GJ9A 2RKWA 2C2WA 2Q21A 3ZCQA 3MOIA 9LDBA 3DTNA 3AVOA 2DP4E 2PZLA 3UAVA 2DHCA 3DMGA 4UHKA 1FCJA 2V54A 3ZDDA 2P1RA 2JFHA 3RS4A 2JVKA 3TXXA 4RLQA 1Z28A 1XRSB 1A98A 1I30A 1LRLA 2NO9A 1MB9A 1SKQA 3SP1A 5K2MA 1C4WA 2XOKD 3BFVA 2UV8A 1D2RA 3PC4A 3S7ZA 2GJ4A 3UXMA 3ZDRA 4OGFA 3G5UA 1QIDA 3DQZA 1OIVA 4UKDA 1PD0A 1A4XA 4MICA 5EKSA 3ZLBA 4II7A 5JC1A 2BSAA 2ZQ5A 1IE3A 2P5UA 4MP8A 1AF7A 3EVCA 2Q5JA 4NAUA 3RIXA 5B36A 1JHMA 3PENA 3C6QA 2WUDA 3Q7IA 2VI5A 3L8GA 2FQWA 3TBKA 5FPSA 3AHCA 3GJ5A 1PLKA 1XTZA 1GV0A 2YR0A 1KK0A 1U9IA 1VGRA 3F5FA 2XYPA 3NOQA 4RQAA 1G20A 2GASA 2GESA 4WKNA 1ESCA 1ZAKA 2E48A 1HFJA 2PXCA 1QZXA 3PKIA 2C5HA 3OE4A 3PF9A 4N0EA 3N58A 3KKQA 3W5SA 3IUNA 3EXHA 1JPNA 3ZDZB 5C7IO 3ZNNA 5K3CA 2HJWA 1GTL1 3T0IA 1GP2A 2O0MA 4UD6A 3HA3A 3WR5A 1HLGA 1CJKC 2FLKA 3K0HA 4TV9B 2J3QA 2VTBA 4H9GA 2BISA 1JEEA 2DR3A 3BCHA 4YA6A 1RLTA 1V8DA 4HWKA 4G0MA 2W6IA 2OTCA 3WLFA 3ZZ1A 4PZ9A 5I45A 1S8OA 1W85B 5BN1A 3M6MD 1ENZA 3NTRA 2TECE 2X9QA 5K51A 2ECQA 4MPTA 3LHFA 3N2YA 3FLAA 3WISA 4JUFA 3KOYA 3LO5A 3IEKA 5KQGA 2CF6A 1TVEA 4F9TA 2OZLA 4O02B 5THXA 1Z37A 2IE8A 1KIMA 3UFXB 1CK4A 4AZVA 2GBGA 3REFA 2EJCA 1SRQA 1OLSB 4CIAA 3ASUA 3KRTA 3OLXA 5KOJB 4XCQA 2C8KA 2OCPA 2OK8A 4BE7B 1KMHA 3EYAA 4WZBA 3OD5A 2YWRA 2W58A 3ZKWB 4A5SA 3M6FA 4GKJB 5EOVA 3WV5A 1XMIA 2A1TR 1AKQA 2E4YA 2I6XA 4J2TA 4LRSB 4MQEA 4WK2B 3T7SA 3VKFA 4EG3A 1UDXA 1JNXX 5H1YA 5JU6A 1CU1A 1HSOA 3K2EA 4Q4AA 3I9MA 4MCAA 4DV6B 1RI2A 2A9FA 1UFVA 1GY8A 3GT3A 3I45A 1ZBQA 3Q5DA 3FUVA 2CHFA 4C04A 2BCJQ 5TQ0B 4TL7A 4PLZA 1JHQA 3FFAA 1ADGA 3MBOA 3GLIE 1CUHA 1CUVA 3F78A 3I6YA 3FF4A 5TRTA 1D4ZA 4NYMQ 1IOZA 5JS6A 2QPOA 5TR9A 5A7GA 1IUNA 3CVJA 4Y9TA 3LS2A 1VE5A 1LC0A 2OGWA 1C7QA 1UK7A 2FGKA 4M7WA 4WUTA 1DRJA 4GAEA 3GLGE 3DE1X 4JVOA 3DOCA 4PG6A 4EK9A 2JHFA 2BW0A 3V8QA 5LLSA 3UAGA 4X91A 4EFMA 3CKKA 4JWTA 3ADCA 5IAGA 4GMHA 5LBIA 4I3HA 3OCWA 1YQWA 3H0CA 4G67A 3BFKA 1L1FA 3PIDA 2GZ2A 2P5TB 4MR9A 1EVEA 4YMWA 1SC4A 4QA9A 3NYRA 3NEPX 3IXLA 1GZ5A 1PEYA 2G71A 1XQ6A 2JC3A 3E5MA 3CS3A 5CH5A 3A4LA 4IUCS 1A3CA 3ONEA 2V3WA 4D42A 4QASA 3KOZA 4DJEC 1UFQA 2CXOA 3NBKA 2YFYA 3S1AB 4RZQA 3VHRA 4MXDA 3C45A 1Q92A 4P4GA 1R8SA 4Y67A 2QLJA 3HR7A 4H2DA 3N2EA 2DU8A 4WT7A 1NE2A 5DM4A 3U7JA 4AYTA 4DBLE 2BSQA 1XZGA 3EARA 3QLTA 5KJ6A 4IY1A 2CFIA 4HFJA 1Z0UA 2EX1A 2ZUWA 3G2NA 1NYTA 1ISFA 1P9OA 3DLCA 1G17A 5DISB 4YI3A 1BTOA 1GQSA 4KVGA 4RIGA 2YV3A 3C3MA 1MW8X 3NEAA 2HSJA 4D9NA 2FK8A 2P9TA 1SUIA 3INYA 2AFIA 1E9RA 1T5SA 1XCOA 4B1FA 3K6RA 1YJ8A 5GM1A 1ZK3A 1XMJA 2FF7A 5TC4A 2RGUA 2OHHA 2RIRA 2BF4A 2AXQA 3ICWA 5BPHA 2YJGA 1OVGA 1OWOA 2CSUA 2WB4A 1U9ZA 1GZVA 2B4KA 2QW1A 4RTJA 4DIFA 2RK3A 4DR6B 1M0SA 1K0UA 1WOMA 2OKGA 1ZIYA 2JGFA 4QDOA 2X0DA 1JKXA 3U44A 1AQUA 2ZRHA 3G85A 5A7FA 3WTBA 3G5TA 3HXOA 1EX7A 3HP7A 2ODBA 1Z88A 3M3PA 2EKPA 3KJNA 3K8OE 3PNBA 5ALJA 3DR3A 2HNAA 3VZSA 3OECA 1CNFA 5HKOA 2W2LD 1R9NA 1XFDA 2H6EA 1T4MA 3HABA 3K09C 1Z0IA 3DEFA 4H6XA 4YROA 4QG3A 5ITZB 1XZHA 3U4QB 3OSZA 3NAGA 1T1IA 2VHEA 1AKRA 1JN0A 2NU7B 3GJ0A 1NURA 2I22A 3HB1A 3I32A 4UFOA 5FWAA 1N2JA 3N6XA 4HB2A 3I04A 3IBYA 3SC2B 1KQNA 4DLPA 3ZHTA 3ORSA 5M34A 1P17A 2DPMA 1LJUA 2CGEA 1HUQA 2BHNA 1RXEA 1NXTA 3DZFA 2H08A 1NL3A 3GROA 3IQGX 3MAGA 3VJRA 1KK1A 1YASA 3TZQA 3H2ZA 4XWTA 3W7VA 1JB1A 3N3AC 1BXRA 1H9AA 4QQKA 1A4RA 4R0VA 5E6RB 1M5TA 5AW9A 3ZVNA 3H6HA 1KQPA 3SR4A 4KPEC 3D6TB 5C46F 1U5BA 2NTYC 3AF2A 1I4OA 3NKLA 5KYNA 1M1ZA 2DT5A 1NUSA 3WJ2A 3LF2A 4JP2A 3EPJA 1JR4A 2GBIA 3D6VA 3KKMA 3QPDA 1VCIA 5JS1A 4AWXA 3OPYA 2BFDB 2HMTA 4XYBA 1M8KA 2WNIA 2BRUA 2QZZA 4NMXB 4AUKA 4J1QA 1VZ2A 4U7FA 5ALFA 1Q2UA 2Z1DA 3JATA 3HY4A 1TFUA 1U1FA 2RCYA 3KR0A 3O2SB 4HLDA 1B4DA 5D5PA 5EP4A 4CKCB 5HSGA 2FUG6 1A71A 3UVEA 1YZGA 4IJWA 4JX8A 4NBRA 3VDRA 3IOYA 1SG0A 4XM2A 1O2DA 4PQRA 4Y98A 1Z4LA 4RPJA 3ZU2A 2JEOA 5AJVB 6NULA 3GJSA 1JEYB 3FHCB 1QQTA 1HE1C 1RAHA 1R5BA 1XDZA 5EZQA 5FI1B 4BMYA 3A1WA 3OKCA 1V8ZA 1JSZA 3CRW1 1RXCA 5FR2A 1PG2A 3VC7A 1E9DA 4WE3A 4ZI2A 5L3QB 2VZEA 1GKKA 2WM3A 1O94D 3AI2A 3NWPA 1QWOA 3LV8A 1T1EA 3LQ2A 4K3VA 3TSOA 3GRUA 3SOPA 4CQLA 3A4NA 2Q8PA 2DCMA 4O4HB 4MS1B 2FRXA 5FHQA 4MB2A 4Y2QA 4QQRA 4CIDA 4JVSB 3UWMA 2PUJA 4LBZA 2IUEA 5HK8A 2CFRA 3C8ZA 5AHRA 3X1ZA 4CFYA 4EDFA 1XT6A 3NX4A 4RVOA 5AWFC 3C48A 4DNOA 4QO8A 4F1JA 1PQUA 1S2DA 4C05A 4XOIA 3S3TA 3OT4A 3NBYC 2P90A 4P58A 4D99A 1X1QA 3K9FC 2IZ7A 1E9EA 1MNQA 5B57C 1TM1E 3U13A 4OXNA 2JFQA 4AI6A 1E3QA 1I4EB 4NS1A 3H5NA 5CFNA 2VUHB 4LISA 3VFDA 2FOIA 1YBFA 2JCSA 3AVPA 4FHDA 4MQFA 2QTGA 1CUIA 1G5FA 3C3AA 1GTVA 3W5UA 4D9MA 2CLEB 3NEJA 5A0TA 5DGIA 1O6BA 3BIWA 3ID6C 3B1XA 4KHPB 2C5FA 5TMBA 1NW7A 3GXBA 4XVUA 1EP3B 4X1IB 1ECGA 2JF0A 3ELYA 4B48A 1U2GC 1DV2A 1CQZA 1JNYA 3LXMA 4MV4A 1X7YB 2XTNA 5F4ZA 5I9BA 2NWQA 3F90A 2FUNB 5B7GA 3HKEB 5CJJA 4Q9LA 3R7NA 3TQSA 1SWWA 1ZJ6A 2BMEA 2BONA 2WIBA 2G67A 3G23A 3KYBA 3G9TA 4NQRA 2O7VA 5J2TA 3LUFA 2W48A 3H5VA 4CV1A 1ZH6A 4BJ1A 3ZWKA 2IJGX 3NIBA 1GAQA 1USVA 2P79A 3O4VA 5KWEA 3RG8A 1QVVA 2WAMA 2HK9A 1R0YA 2WIKA 2JLZA 5AK4A 1IAQA 2HNKA 2QMQA 4CQMA 1VGVA 3LT5A 3LYAA 1M6HA 3I5YA 1W36B 2Q6LA 1SUBA 1SOAA 3HBMA 4CMEA 2EQBA 3S44A 4H7IA 4ZI5A 3I0ZA 5LIRA 3L4JA 2ZJ6A 1I9GA 3LT0A 1YVUA 1SCUA 1SNYA 4FNAA 2WP8J 4B6PA 5EAIA 2G83A 4TMFA 1TMKA 4WEOA 1E1NA 2Z4RA 2CL5A 5COAA 5DRYA 4EELA 3TPZA 2JFBA 2D7JA 5CW2A 4J0QA 3E48A 4MI1A 1VA4A 1H2YA 2VZLA 4GP6A 1HKUA 4MJXA 2B5VA 5EIEA 1I01A 1J7KA 5U4QA 1UBGA 2XCRB 2P8JA 4JJKA 4F2DA 4X93A 1KOFA 3CMMA 1ZGCA 2E4UA 2ZIUB 4QXRA 1BVHA 2MOKA 2OVBA 2C9MA 7REQB 1NNEA 3ZU5A 2IIPA 3Q2KA 3WYFA 2E5LB 2IU6A 3ZR4B 1VHQA 5F2EA 3HR8A 4MR8A 4JL6A 4WLFA 1NA5A 4IJ5A 4YJHA 4YRTA 1EA7A 3GEEA 1RHRA 4CKZA 2GRAA 4DBVO 2NV0A 2OQ2A 4ZDIA 2PRZA 1I2CA 1RQ2A 3FCEA 3UT5B 2IUFA 3WGKA 3COYA 4REQA 5KYWB 2O1EA 1EDDA 2FWIA 1WB6A 2A67A 2IHVA 3T4EA 2JAQA 4WCFB 1XQYA 4IGKA 2WTAA 3HHPA 3OQVA 2G9QA 5CG2A 3W2TA 2AFVA 1SC3A 3DV0B 2O4UX 3EZ6A 3ZZ0A 4WVLA 5FP0A 4KR6A 5IZCC 1E1DA 3RASA 5IEJA 3NVAA 5B1SA 1M2VA 2G1UA 1XRNA 1GPDG 4E31A 4D4IA 3VZDA 1W6UA 4IDDA 1VI5A 3B1YA 1JVNA 2QXYA 3RUIA 3P9RA 2EYUA 5DT2A 3CCBA 2CLIB 2QHXA 4UE6A 2JH3A 3E70C 1UR5A 1X74A 1PJTA 3BXZA 3PDWA 4AROA 4WVFA 3VPBA 4UTRA 1AGPA 1K3FA 2TMDA 8GPBA 2A3RA 2V5UA 5DHPA 4R7GA 3FMFA 4IMPA 3LQFA 1KY2A 3GK3A 3PXAA 1NFQA 1RW4A 2FI1A 5IT9A 5C5DA 3E9RA 4XSVA 1ELOA 4Z2AA 4BMNA 1BIFA 3S6JA 3CEPB 4FZVA 1WNTA 4IPTA 4RF3A 3Q11A 3SXPA 4YIHA 2YVLA 4H6PA 4MWCA 5ALVA 2OQRA 1GCIA 3QKWA 3DMTC 2ZYUX 5EMMA 5JHHB 4C4AA 1WXEA 1USIA 1DQYA 1C3XA 4KWTA 5HYVA 3DNMA 5KNDA 1AZWA 4IF6A 2EGUA 3N2LA 2RJOA 3A1DA 4LJAA 1JWLA 3G2IA 1QV9A 3OUUA 1KKMA 1LC3A 1H23A 4JLSA 4L7QA 3ZCPA 4G5HA 2PQ2A 4B47A 4BJHB 1CWUA 2D2IA 1ZNXA 4QLBA 3HZRA 3HVRA 4MIYA 3CVVA 2W98A 1A5ZA 1CJTC 5KDOA 2IHBA 1KORA 5K3EA 3JVVA 1U4OA 1U2EA 2YOGA 3CZ9A 3A37A 4ZZ2A 3LWBA 3N8NA 3PC7A 5B37A 3FOEC 5DI9A 4PFQA 2ONZA 1EX1A 3FOBA 3LKBA 1RKUA 1MENA 1YBMA 2I54A 1U0JA 2XUGA 3CT4A 4LOAA 2PU7A 2H1RA 4P0QB 1PQ4A 1T9CA 4A73A 5FNZA 1KOGA 3IMGA 3OIDA 3DXZA 2Q6OA 2AN5A 1H66A 1JR2A 2J3MA 3TAXA 3QV2A 2EF1A 2VJNA 3TJRA 4YRIA 1ZRNA 2KM1A 3EEQA 3DEHA 1F2UB 3GRVA 4BV2A 5HBRA 1NF9A 3F47A 1Y6QA 1CS4C 4NU5A 1AK9A 1PTKA 3DDZX 4MV9A 2V7VA 5JS7A 3P2YA 1N2EA 2C61A 2NXCA 1TTQB 4TGLA 1JFTA 3A1FA 4XJXA 4AG5A 2QM0A 4O4IA 3K70D 4MW7A 1JT2A 2FG7C 4ZOLF 1ULUA 4EH1A 1WVIA 1Z16A 2BMVA 4CTKA 4TTIA 1G55A 1F60A 3EJ6A 3FX2A 1GT6A 5FB3A 4HN2A 4I4TA 1DJPA 3UMVA 3GFRA 3GRAA 1KJYA 1ZD1A 3OQPA 4X3OA 1NWCA 3T5PA 1SCAA 4PRZA 4RHYA 1KE2A 3U3MA 2GTIA 3OPQA 2H48A 1P0PA 2FFRA 4MVJE 3RU3A 3QE2A 2P4UA 5K6RA 3ROEA 3IEIA 1QIKA 2VHJA 4J1SA 3OJXA 1XLWA 2OCLA 1XKXA 2VHXA 4ZAFA 4DBLC 2I4TA 4TS9A 1AK2A 4BLPA 3PEWA 3NORA 4HS4A 4HOYA 1J90A 3NHYA 2DGDA 2XOKA 3HM2A 2WICA 3LQYA 1ORVA 3H9EO 3VPFA 3TFOA 2EFHB 1E7YA 1Y6FA 1VE3A 2I76A 5DW0A 4BYMA 3YASA 5AVWA 4RE6A 3KXDA 4ZYXA 3NGLA 3FMPB 2HT6A 3B13B 1DZIA 2VJOA 4UHBA 4F60A 1MIOA 4ARIA 2PGDA 3KEMA 3ZW8A 3H2IA 3D3WB 3SIPA 1YRAA 3ESCA 2X2FA 1LNQA 4LRQA 4UBLA 3VC1A 5JWRA 1O8BA 1N0WA 4YBRA 1MOPA 1HG0A 1W2WB 1F0KA 3M4XA 3QMWA 1VCNA 1ENPA 4X64B 3HCEA 4Q16A 4ZAZA 1C9YA 2W71A 1GAJA 1I1OA 1MEEA 3EGXB 4UAGA 3U80A 3QXGA 1R0ZA 1M2OB 2YFHA 4XDHA 2QUZA 4EGCB 2NP6A 3I5UA 5C0OE 4J0DA 3I2KA 1BWQA 4GSLA 4F71A 4F8JA 1JH8A 1LRJA 1J70A 4I5GA 2AFHB 4NH4A 3B1FA 4KH1A 4HB3A 2D59A 1AE1A 2QNBA 3AXTA 3H1GA 4CF4A 1PTJC 4FLFA 4I5FA 4J1TA 1IZ8A 1TC1A 1VG9B 2GA8A 4J3FA 4TYPA 5FOUA 3MAAC 2AX4A 4BO3A 3VMMA 1FNCA 2CFSA 1OYVA 1R8JA 3DBHB 2APJA 2YWFA 1PGJA 2VH5R 2WV9A 4HYEA 5T64A 4MWBA 5K6AA 5BV2P 2IQ5A 3SLGA 4L9WA 3VTZA 1V7PC 2PJUA 1VLZA 3O93A 5DLEA 3T7AA 3QP9A 1WMEA 1DC5A 3QOWA 4Q4JB 1Q20A 2FX5A 4ZA2A 4M1KA 4BFVA 1T1RA 3ISJA 4ZAXA 4BNNA 5C32A 2OCKA 3K0BA 1DE0A 4JC0A 3V42A 5LUBA 1IEWA 3D2BA 1WTCA 4C20A 3U19A 4IIUA 2Y93A 1IIBA 1CJVC 3QWBA 3DHVA 3FPKA 3HZZA 3IT3A 3L2OB 3V4RA 4DT1B 1QP0A 2O8EA 2X0RA 2IU4A 2AOUB 2DWPA 4NCXA 3W9SA 4Z7OB 3ZXYA 4ZOQI 1G6Q1 3GH1A 4OLJA 1N1DA 5BWCA 4UJ5A 2MSKA 3IOBA 2AR9A 4IS3A 1YB6A 4XX0A 3JWGA 4AKHA 2QNRA 4W5HA 2ZRDA 4Q7KA 1H3NA 1K2WA 4B6QA 2OFWA 1PS8A 3HDQA 4O2BB 2A7QA 3K0AA 1B8PA 4KI7A 2B92A 2CUKA 3FVQA 3I9V6 1UXGA 3G68A 1VSUA 4HLUA 1JA0A 1SQ5A 2BTEA 2OCYC 1JPUA 2R97A 5T8KC 2JGIA 3EZFA 4M3NA 4MOWA 4RK6A 2H7YA 4A26A 2PUAA 5TQ2A 2IDZA 4WASA 3UNXA 3KR2A 3KKLA 5KWSA 5IXJA 2D1SA 4BLSA 4RM2A 5KTRA 3JZMA 1JU9A 1Y1TA 4FXOA 3PJFA 1C14A 1KPHA 3OZUA 3R3UA 3NHJA 4WXMA 3WKCA 1EUCB 2O8CA 4DNXA 1F2VA 2C7VA 2LIVA 1EFRD 1SKAA 1AO3A 3LBIA 3UWPA 4B80A 2WLTA 3CH7A 4ITUA 2GTPA 4KHZA 4WZAB 1VMAA 2YINC 3G2MA 1LBTA 1U11A 1WZEA 2PZ8A 2TS1A 1JPVA 1MQ8B 2XMZA 2QUAA 3CB4A 3HKDB 4QVKA 4FSXA 3MHPA 4KITB 4C6TB 4B3TB 4HX2A 1QFSA 1XZDA 1PI3A 3F7MA 5BNTA 2W22A 1NLUA 2P0YA 1IN4A 1GIAA 4K40A 4TXLA 1IU9A 3TW0A 1TA9A 1EIWA 1YS9A 4G8BA 3AP2A 1VL5A 3N86A 3P94A 3VKVA 5BN3B 5LZ8A 4NJEA 1MU0A 2YJ6A 2PD3A 2YVKA 2H7CA 3EIWA 2WY2D 3TDMA 5JCXA 2JCBA 4I55A 3VI3B 1SVUA 3RIHA 2EKQA 2FQQA 1G8AA 2IDJA 2V98A 3O1IC 2PUHA 1AHHA 1NWHA 1SCIA 2RONA 5B3AA 2VP3A 4D2IA 1FF9A 4XJTA 1U8XX 3AH8A 5DHTA 4DCCA 2A88A 4M87A 3UQYS 5BMVA 3VOSA 4HFRA 1YUMA 3QVUA 4IXMA 2Z5GA 3PA6A 3QQPA 1SXJB 4OMUA 1DI0A 3UY4A 1DKLA 4IINA 5IMSA 1ULZA 1BN7A 1GARA 3TB4A 1TYCA 1LJ8A 1N3LA 3AEKA 3IPCA 3QLEA 4QPJC 4UAJA 2Q0QA 1A82A 4Y2YA 5EIHA 5EJ9A 5AW0A 2G5CA 3QWHA 4BXOA 4URZR 2PZFA 3LXUX 2ZRNA 3TPCA 4D0SA 2I1QA 4XWYA 1GUDA 2QLNA 2YHBA 1U0FA 3WB1A 4XVQA 4D3XA 1TUBB 4EB6B 3KDAA 3LYLA 1DC4A 1C7RA 3RANA 4MHTA 3A04A 4B4KA 3ZOZA 1Z2AA 1N0VC 3B9QA 3ORYA 4HXFB 4PLVA 2G9VA 5F9FA 4BHTA 4O2LA 3QEBZ 3WY9A 3LLUA 1PFYA 4KLZA 4YPFA 1KEEB 1UXIA 4ZVUA 3TX6A 4KI0A 4N7JA 4X3PA 1CP2A 5JIBA 5JXHA 3ETHA 3HCBA 2ZSIA 2C4MA 2J5KA 2XNKA 5DYYA 4Z9XA 4CR7A 5K4HA 4RTMA 3K9GA 1TT5A 3QWIA 4O6VA 3BE6A 3QOYA 4OHYA 2EFJA 3WRVA 1IB0A 1MG5A 2IXAA 3BSFA 1PD1A 5FLYA 4OGGA 3DFKA 4EW6A 4IUYA 4A8JC 3GLFA 3ZJTA 3IX7A 5L40A 2DECA 2OC9A 2PMEA 3K0FA 3LWNA 3P32A 4RTKA 4KPUA 1OROA 4BU1A 2F3TA 4ZWNA 2R62A 1R6TA 4IH4A 2IU0A 1K4MA 4JEMA 4I66A 3FZEA 3A6LA 3AY0A 2GOYA 2XAAA 2FETA 1QBKC 3WYDA 3JQ8B 3GV0A 5FWNA 4ZICA 1T8TA 1GEEA 1N3IA 4B83A 2DHEA 4MNTA 1B93A 1KYWA 1QIFA 2CEAA 3L04A 2FPGB 2VXBA 2WK1A 3LCMA 3Q1KA 5E1OA 3WLEA 4XM1A 2XOXA 2XT0A 2G7MC 4FOTA 4NNJA 4XGRA 1I2AA 4D92A 2I2WA 4MTLA 4X60A 3R3YA 2DFTA 1OBFO 3DMYA 4GFDA 2O19A 2H16A 4Y6OA 5LNK1 3FVWA 1W47A 1X8XA 5CPBA 2D7CA 3JYOA 3BS4A 1IDN1 4YAJA 2C9OA 3H0KA 5AW3A 4IIVA 4HNRA 4PS0A 3VKGA 3ICPA 1VE7A 3IA7A 3QVXA 3VU9A 4W1SA 3SDBA 1NQXA 1CY7A 3CYFA 1TAGA 3CNBA 4FJ1A 1OH6A 3TH5A 2O3RA 3DBLB 3FBWA 4A6EA 1O94A 1AHPA 3NJRA 1EZZA 3BWDD 1L7OA 1P1CA 3E15A 3I2YX 4YV7A 1IRIA 5E2BA 3EHEA 2CHEA 2NTNA 1DBSA 2IXTA 2XMSA 4G4JA 3OF5A 5CH8A 5HQ3A 3KZCA 2H59A 3TSAA 2X19A 1RC0A 2Q9UA 3MILA 4XXHA 4D0GA 5A02A 4HDRB 3N74A 4MDHA 2EW8A 4U8HA 4WLUA 1S8NA 3UUGA 2AC7A 2IEAA 3C5VA 3W5HA 4OTZA 4IZHA 4Z4GA 2J5BA 1J07A 4EHIA 2CNWD 4I99A 1H94A 2ID4A 2JIOA 3JWPA 1R0LA 1E3JA 3PUHA 1UM8A 3QU5A 2R8EA 5AH0A 3T61A 3Q8LA 4OU5A 1EESA 1SU7A 4ZYZA 2ZI4A 3KKNA 4OHVA 4ZPJA 5FORA 2JZNA 5CXQA 1SEVA 2BFEA 4LY6A 1UJ2A 1GUYA 1EGMB 2VNJA 4RVUA 4RVDA 5K4AA 1MKYA 4MWDA 4DABA 2QF7A 1E4OA 4UOEA 2P4EA 5FBVB 4JSYA 3LK6A 2WVGA 1QS0A 4DANA 4AN0A 4DA8A 3DOUA 1GN9A 5JCOC 3LUJA 3CNLA 1KH1A 3UH0A 4J4TA 3UZUA 5CDSA 3Q10A 4NZNA 1RZRD 4IVPA 2R6CA 4A23A 2R96A 1G21B 3CZCA 3KQMA 1UBTS 2ZYSA 3V1MA 3W4IA 4RAQA 4X7PA 5CTAA 5C5IA 2IS2A 2XMGA 4A8PA 5DYGA 5DP1A 1XZCA 3B70A 2CT8A 4CTMA 4EYKA 1U0LA 4OMFG 1E60A 1CS0A 2W2XA 4GVLA 3CJRA 4M9SA 4RABA 1I14A 4YDHB 2BGGA 3ZC3A 1W1IA 3QEKA 1EFTA 1JDJA 4JYBA 3HO1A 2PVCA 3INTA 4G4IA 2HUPA 3MIZA 3U6KA 1L7DA 3GJ4A 1PZGA 3ASVA 4X5OA 2DFDA 3L7CA 2YV4A 2QMYA 3PVCA 2CKMA 1KPGA 1PIWA 1WCYA 2C0PA 4IDEA 5DCLA 4ZQCB 5YASA 5BNZA 4DFDA 1QVWA 1ZI9A 3RAEC 4F9GA 1FFSA 1ZD5A 4LCEA 2ZAIA 3BPSA 1WMAA 1L7PA 3O4GA 3R44A 4N3CA 2AQIA 1UBRS 1E5QA 4IJUA 2IYLD 3WFIA 5EIAA 1O95C 4DMCA 1Q19A 3LUCA 1U2QA 3E1SA 3E8XA 3HI6A 4C4TA 4ZTZB 1WDKA 4PC2A 1SU4A 2XUJA 2RG1A 4G9GA 4R83A 3ROZA 4AF8A 5DTJA 4K9LA 3KELA 5KWVA 1JA9A 1NLZA 3U6BA 1O5TA 4P83A 1BE6A 1EHYA 2BGJA 2P2YA 4DKXA 1IULA 2BBSA 4F3TA 4Z3KA 1SHZA 3HZOA 5K3DA 3MCVA 1SZJG 5KQLA 5B7QA 2FDRA 3CE9A 3M6AA 4RXMA 1TZJA 3DDHA 3ZCXA 3QX3A 3AONB 5G0VA 1FS5A 4QBGB 2HGZA 3S8MA 3KUKA 4B3DA 3MRSA 3RI3A 1NUHA 1SVLA 1BH6A 2D1QA 1CY4A 1ZJYA 4AG3A 2BT4A 2G0TA 2X5XA 2XCOA 4GMKA 2FSHA 2F3UA 1Q1GA 2LKCA 4PR0A 1ZUWA 4L0CA 4WI1A 5LJIA 4S04A 2H1SA 3VSBA 2HA3A 4LTDA 5I8PA 3TE7A 3VOAA 4H1TA 4FMCF 3RD5A 3W9UA 3HY3A 3NEYA 2A3NA 5E1DA 4H60A 5FBZA 2O1WA 2Q1XA 2QTRA 3EVZA 3PWSA 1SUCA 4OJQA 4RNDB 5D6NA 1RP7A 3BWYA 3ZHZA 3ZWPA 4CCYB 4ZHQF 3IHTA 2X2EA 3NXSA 3ZZMA 2NYUA 3D8RA 3WGJA 2BEWA 4OUDA 1ZM2A 3R23A 1KU6A 3BD9A 4FI3C 5ALRA 4CL0A 5BT8A 4AQYB 4E5MA 5BSGA 3KOXA 3IP6A 4KX5A 3O75A 1CIVA 4JA0A 3GPBA 1R50A 2B1IA 3K35A 1CQWA 3DULA 4JLWA 4RLSA 3PUYA 5D3MA 5EUQB 3WO0A 1S89A 3H97A 3HUDA 4WLOA 1B76A 5MN4A 1EP1B 3QJGA 1F4VA 1RYMA 1E64A 3GA5A 1U3GA 3DFUA 5JCJD 4C22A 2ZTLA 5KYUA 2ADMA 3R5XA 2VAMA 3VNQA 3I23A 2GBCA 4GX5A 3SI7A 1ADBA 3ZVLA 4FGKA 3DW3X 4GVXA 1E5LA 1WHSA 1X19A 3FPAA 4C87A 1V47A 1OBVA 2ZKIA 1CR6A 3ZY6A 4GXQA 4M9XA 1U3UA 4OJTA 3RNOA 1R16A 3AEUB 1R4NA 3MMXA 1TD9A 4DWWA 3FDXA 4PQFA 5IVKA 4JITA 1I4LD 4EGAA 1MAHA 5FO1A 2VSXA 3X1WA 4C4OA 5I4IA 1WPGA 3QFHA 1T9BA 1VPEA 4IXTA 3H5AA 5LZ2A 4TZ6A 3CRQA 1NBAA 3D8NA 1WTAA 3AHFA 3L6OO 4BBJA 4HJXA 2JLCA 1TGYA 4TQGA 5LDGA 1YNOA 2VF5X 2BCEA 3TD2A 5C7OO 3SVLA 3U16A 5LZ9A 3TKAA 5K0SA 3FLMA 4LI3X 3EIHA 3H87A 1WB5A 3ILXA 4CM7A 4DJFC 2FW8A 3GHYA 4G0YA 4F0JA 1D4OA 2NT4A 4D80A 1AQNA 5BQ3A 4FHGA 1NG1A 4OATA 2NUAB 4BCDA 2KLBA 3EF1A 4OK5A 1T5LA 1OX6A 4M49A 4MV7A 5DFAA 3T15A 3QM1A 3E61A 1ZXBA 4XDGA 5EIFA 4UVHA 4N40A 1V1RA 3PLAE 4H0FA 1QF7A 3LZDA 3D1JA 1J1ZA 1L4YA 1E58A 4N5IX 4LI0A 1R8QA 3CLHA 4RMHA 1FW6A 1TA0A 4Y18A 1N0UA 3ANSA 4LJKA 3VZBA 2AXEA 3SC6A 2ZWOA 1RHKA 3SDSA 4AO8A 3IIJA 3ZLJA 1CUCA 1OZFA 4HP8A 1EUDA 5IYZF 1EVKA 1KJZA 5DGXA 2WVJA 4OKIA 3B1KA 4JB2A 1U8CB 5IDWA 1DAOA 4EUKA 5IBRA 1YS4A 2HF9A 4QBFA 4RF2A 5E6SA 1MMFB 1Q16A 1ZQ9A 4CNBA 1CIPA 4OBEA 4LZNA 4HH1A 3VC2A 1UPBA 3F1KA 3IP1A 4BN4A 5I51A 4DV3B 3RYCB 1MZPA 2C7RA 4PG4A 4COKA 3FUUA 4NZ9A 2VQFB 3BMNB 1ZKDA 3BHJA 1HT0A 1HZZC 1X1CA 3PDJA 3TOXA 4LSGA 4A8HA 5GJVC 1ZHHA 1NBMD 2AIRA 4R98A 1PFVA 4WXRA 4X54A 4A1OA 1L7RA 1MX5A 3QZUA 4AFNA 4EKGA 4QLOA 5KC9A 2JH9A 1N33B 1Y4UA 2JCVA 1QLWA 1D9XA 2OHXA 4H18A 1UWLA 4LJ9A 2ZBGA 4OA8A 3SYMA 3AVUA 2D1FA 3T7JA 4MUAA 4L2IA 2AV6A 1YHYA 4LKRA 4XGKA 2O7RA 3LOQA 2I5PO 5BT9A 4F2PA 4YJ2A 3EBPA 1IXSB 4G1MB 2XUHA 1UC8A 2O0LA 4EY5A 4C03A 1GPWB 4XCXA 2Q0SA 2VYFA 2GAIA 3M33A 4Y3UA 4W9RA 1QCZA 3OWOA 5KTPA 2MU1A 2EATA 5U1PA 1HK7A 3PGMA 4E5KA 4OLBA 1ZHOA 4PXAA 2QLLA 4QX6A 3IULA 4MV0A 3IPAA 5CYOA 1GLGA 4YV2A 4Q3BA 3NBXX 4C2TA 4MEAA 3D1LA 4R8KA 2Q3BA 4HK4A 3WBBA 5TJHA 1CEXA 2HQRA 5AFSA 2YDXA 4CF7A 3IMFA 3OTGA 1Y7LA 2SNIE 1R7RA 1ILEA 3HRKA 2YHUA 1JPJA 3PDIB 1CZRA 4UCQA 4XGNA 3RRZA 1C8VB 4M9QA 3WV4A 3G02A 1GZHB 3O03A 1E2KA 4DV7B 2C3MA 4LF8B 1BEUB 1KYZA 2J9GA 3IKJA 3L07A 5JC8A 3RYTC 3OU6A 3QA3E 4BNWA 3GFSA 1A2KC 3MWFA 3VTAA 5CFPA 2J87A 2WQZA 1SKBA 1O97C 2H1FA 4O4JB 4NBLA 4XB1A 2RK4A 1HQYE 4CIVA 2XCSB 3OTHA 2EL7A 2IH4A 2F8TA 3EEYA 2RGBA 2NU6B 1XRRA 4MA5A 5FF9A 4WZZA 1QGAA 5EP1A 3QFFA 2VNSA 3EZGA 2V59A 1UBSB 3N2KB 4LVOA 4GZ3A 1E4EB 3KB1A 3ZV4A 2Z5VA 4YMUA 1ZU4A 4M2LA 1WBJB 5SZKB 4C7OA 1E2MA 2Q99A 3DZGA 3W04A 1C9EA 3LYHA 3WL5A 1E8DA 4OOEA 5K8VA 4BV8A 3O4FA 5KWJA 1KDPA 4KPGA 4PN3A 2A6PA 1RHMA 4CT5A 2QM8A 4URUR 3IQDB 4JBWA 2CKDA 4FUTA 1R18A 2AVNA 2QRMA 3HCRA 4BNIA 4CYMA 4DUPA 4KWIA 2WLSA 3MWYW 1AA6A 2A0XA 2WZCA 3S2EA 3L6BA 3AVYA 1MORA 5DBEX 4MMZB 3IFSA 5KTNA 2F8LA 4MLCA 4RHXA 1ODKA 3CWQA 3L84A 4KQ2A 5EE1A 1Q0LA 2PUCA 4AECA 4N0PA 3MRVA 1M34B 1PSZA 3H3FA 4E13A 1KYXA 2JGJA 2O8DA 3TLXA 2D2FA 2QX8A 1XZNA 2UXDB 1IMJA 4RHEA 5AVZA 2WWXA 3FRIA 4HX5A 1LSUA 1RKXA 1DL5A 2GZSA 1H6DA 2QPAA 3ROKA 1B26A 2ORVA 3PFFA 1LD3A 4HB0A 2PFSA 4QXAA 5CX4A 4WY5A 3RNLA 1LV8A 4ALNA 1F4LA 3PNMA 2Z8XA 2GM9A 4M4SA 2ZPAA 4R2IA 1EFRA 1TO6A 1NJ2A 2WU8A 1AY0A 2HNBA 3V2GA 4HDCA 2REXB 1MV5A 2WTNA 3RAJA 3ZDFA 2H63A 1Q0UA 2AG8A 2OYSA 4RW0A 1HT3A 4EGQA 3E82A 3PRKE 1FFHA 3ZV3A 1J20A 3TRFA 5TMPA 3WGTA 2JJ2D 3KVOA 4PSDA 1VLQA 2CDCA 2H3HA 2KX7A 2XDAA 4HHEA 4MKZA 4R05A 5DYIA 5GINE 5KYYB 1SQ6A 4EG1A 3BCRA 1LDYA 3FTDA 5B3JC 1ESZA 4L6IA 4PU0A 16PKA 1WD5A 2OZPA 2Q5LA 3RWMB 3A6JA 3UXYA 3QE4A 3VSAA 4K8RB 1SBHA 2DT8A 3B78A 5K0GA 3FLBA 5AJUA 1Z73A 3R6GA 4OYRA 1U1CA 2FZVA 5IT4A 3KU1A 2Y1OA 1CIJA 5B7PA 4GYKA 4ZVLA 2VF2A 1BO6A 2C4TA 3BH6A 3G0GA 3FFBA 3MT9A 4G89A 5J2UA 2ZAMA 1A8UA 2OP1A 4IFTA 3T3OA 1ZSVA 4I4LA 4NPHA 5D1HA 3GAZA 3HU5A 4OLFA 4RA6A 4EABA 2P9YA 1DFHA 1Z0AA 4PX9A 4EO9A 5J9FA 1J8YF 3KWMA 3GPLA 5JMWA 5JXIA 2F2TA 3DL4A 3L01A 2IT1A 1WA5A 3VR1A 4B73A 1QMPA 1HLPA 2R48A 1JR3D 2YDYA 1I6LA 4INZA 1ULTA 2IH5A 3TMYA 2OV1A 3GOQA 3K1ZA 1Y1QA 4G5XA 3W90A 1G8GA 1NN3A 1WPRA 5CFLA 1ZL0A 4P93A 3WSVA 3I58A 5JNRA 4Z9BA 3G7NA 4E14A 1PYGA 3LC1O 4YCJA 3K1AA 1UKYA 2INGX 3F8WA 5AR1A 1W96A 3TOZA 3WL3A 4GR4A 2C1XA 4FKBA 1T24A 3NFYA 5DNAA 5GONA 3QUCA 4YR9A 2ESRA 2WJYA 3PCRB 3T3IA 4D6PA 4ETMA 4PFJA 1RRPA 1DXOA 1GPUA 2XDWA 3C3XA 1IHXA 2V45A 3TW8A 5LFAA 1CXZA 4C21A 1OGYA 5EMJA 2IV3A 2JLYA 1THTA 4YHHB 4RK4A 2FZCA 2FAXA 2O8FB 4E5UA 1MJHA 1X42A 3EK2A 4H17A 3ZCVA 2O2SA 4U5QA 3VR4H 3O3NB 3NU1A 1K9SA 2W2KA 3L5KA 4XLLA 4RK0A 4AZ0B 2XUFA 2WUFA 2YBEA 3RIGA 2GD6A 3HFRA 4GXNA 1OILA 5KJCA 1OAOC 1HNZB 2LW7A 5K03A 1X15A 4HTFB 4D9FA 5LQMA 3PNLA 2RGNC 4ERNA 4PYMA 1S02A 5KYXB 4OREX 1HETA 4CV3A 2LDXA 4JLBA 1EHIA 2X0EA 1MX3A 1HKHA 2X4IA 4JSTA 4QOSA 3RARA 3UOAB 3MIIA 4X84A 3WIVA 4ZMBA 1A5SB 3IJEB 4JBYA 1G7CA 3BXEA 3KWJA 1AXRA 3AYZB 3L1JA 4FN4A 4MPDA 4GZLA 4OI4A 4D74A 1UDBA 2XQFA 3K05A 4DQDA 2BUAA 3AHEA 5A4KA 4QODA 2GK3A 3U60B 2V7PA 3EOAI 3F6CA 4GU5A 4ZYLA 5L6LB 1XIVA 3N28A 2G3YA 1Y8QB 4NOLA 1D1TA 3EG9A 2VZ9A 3NPAA 4KB5A 2J7PD 2AUMA 2RH8A 3H2HA 2OBBA 4OV6B 4QU5A 3TL6A 2PX6A 3EHDA 2A1IA 1K7FB 3I04M 4D8YA 4RK7A 3D3EA 3GRYA 3RLFA 1XCMA 1DTEA 5EQDA 4EW2A 2HMWA 2XMPA 2WAOA 2V4MA 4I9HA 3L05A 2VXYA 3OBBA 4W7IA 1UP4A 3OZWA 3WGMA 5LN1A 3UGQA 3CNQS 3O8DA 2Q46A 3TZBA 4BQFA 4NIMA 1M5UA 3H2KA 1MNAA 1JLLA 3L49A 1U99A 2E5WA 3QVGB 5ECDA 1L4GA 1UZUA 1ZVQA 4COOA 5AMXA 4ND2A 1Q50A 4CQNA 3T1QA 1XDDA 3OKFA 3IUMA 3SWWA 2D3WA 4DLYA 2E9SA 1G4HA 1Q74A 2OO7A 1T9GS 2YW9A 1RIIA 1K7EB 2YW2A 1K7CA 2FWNA 3DBIA 2C1ZA 4HD8A 2DCUA 4KQWA 4NK4A 3F6RA 2GN6A 5ALKA 3ZDQA 5BURA 5KYTA 3SZOA 2DVMA 4G85A 4DIUA 4P86A 2CNWA 4AMZA 2I71A 2GRJA 2JK1A 2JZOA 3DE3X 4L5JA 4V2UA 4PZPA 1TT5B 1JKFA 4ZU6X 3RVPA 3AZQA 1R5OA 3BIOA 3KPJA 1I2BA 3CX4A 4QIHA 3TDKA 1A1VA 2AX3A 2REQA 4IKEA 4U9HS 3GGSA 1JBKA 1SD2A 1L4NA 1RHQA 1FK8A 1VJCA 3DAPA 3IAS1 3MLBA 3RRMA 1LPPA 2RGAA 1NMZA 4EKEA 3ZPXA 3L41A 4JBHA 1AQIA 1D5WA 1UBFA 1P44A 3F8SA 1UBKS 2C5SA 3O4HA 3GXOA 3OHSX 4KPUB 4P7KA 3K96A 3RS8A 1OH8A 2LCIA 2EXXA 1Y1RA 3MBIA 3O7MA 4MGEA 3A9RA 5JLAA 1RZRA 1FDRA 2TMGA 1FJHA 1YDWA 1UJNA 2QJTA 2C31A 1KI6A 1XR3A 1KMQA 1O58A 1YQUA 1Z17A 3ZI0A 2FZWA 1WMBA 3TQFA 2B37A 4LBVA 3TBHA 6ADHA 5EXTA 5C4IA 1G18A 3A9TA 4MVYA 4EHKA 1LBIA 1JEAA 4OXIA 2DX7A 4WNAA 4P81A 2MR5A 2V7EA 4RPKA 1E9VA 2F1KA 5JSUA 2HLNA 3WBKA 5DASA 3TNFA 5B6IA 1BFUA 4R2LA 5CA1B 2HK8A 4HDKA 3RVLA 2AF4C 2HLDD 4HRAA 1DIRA 4NJOA 4V38A 3H9GA 3S2GA 4TL6A 1XLTA 4JBNA 2WZQA 2R86A 1DU4A 1JHOA 3LI2A 2VAWA 3U7QA 4XI9A 5HJEA 5I9LA 3OU7A 1V39A 3TM5A 5IT5A 3U3RA 4L5BA 2WHRA 1P18A 4UU8A 1RAIA 5AK3A 2OZVA 2PYDA 3H4TA 3TAUA 2FRDA 1WUKS 4I4NA 3W5IA 3JVIA 3QBVA 4BOYA 1NR1A 1SCNE 1Z82A 2AN3A 4YRFA 4B3IA 2GD2A 1G3MA 3QKRB 4AUMA 1XXHA 3CPJB 3FJ1A 4DWJA 2VBCA 2DY0A 3GJ6A 2OGZA 5LBTA 4E5NA 4ES6A 3JALB 1JDSA 3C97A 4AXBA 1IXZA 3TNJA 3QYPA 1FC0A 1G7SA 1KR5A 1T6BY 1MA3A 1QH8A 4QFMA 2JFFA 1YHZA 5GADl 2D06A 3OH8A 1DEAA 1GV1A 4FDMA 4MVJH 2AJCA 3VBEA 3G2KA 3OY7A 4F45A 4EFNA 4PHTA 1I6KA 2JS7A 5HF9A 3EEOA 4ER6A 4QT4A 4B7CA 4JQSA 2OKCA 4D3ZA 4B79A 3KTFA 1W5AA 4XSGA 5K3OA 3N5KA 1EI9A 1KO4A 1NOKA 4LSZA 2UYHA 2X14A 4M38A 3MK31 1J21A 1NR5A 3IAM1 1M6WA 4E4RA 3H1AA 2FP4B 3HN7A 1VHTA 3PEUA 4XIJA 4O4HF 1GGKA 4IIFA 4BBZA 1HFEL 3FOFC 2I0FA 3ZZTA 3E9ZA 2M1XA 1N0HA 1PG0A 1ZMBA 1J49A 2DJIA 1FRZA 2CXHA 4N6NA 5EMNA 4CUJA 2ZR9A 3PWTA 4DNQA 4F46A 4ENRA 1ODJA 2GGSA 2WFZA 1D2CA 3IDAA 3THSA 3F8TA 1JG3A 1FDIA 1H0SA 5DYTA 3UC5A 3T9EA 1N32B 3WXBA 1CUAA 3UUWA 4HWGA 1CYDA 2BJVA 1IBMB 2N75A 1WXWA 2M9MA 3HH8A 3RDPA 3ZXSA 3LWDA 3ER8A 4ZU3A 1U7UA 4N5HX 4FNOA 4YCAA