2Y6VA

Peroxisomal alpha-beta-hydrolase lpx1 (yor084w) from saccharomyces cerevisiae (crystal form i)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
379
structure length
351
Chain Sequence
b'QNRFKKETKTSASWPRAPQSTLATDRLELTYDVYTSARRSRTATRLNLVFLHGSGMSKVVWEYYLPRLVAADYAIDKVLLIDQVNHGDSAVRNRGRLGTNFNWIDGARDVLKIATELGSIDSHPALNVVIGHSMGGFQALACDVLQPNLFHLLILIEPVVITRKAIGPPDSPQIPENLYNSLRLKTDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKGPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWPPQNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPLQSSPQLTLEERAVMFDRAFDSFKNEALVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE PROTEIN LPX1
publication title The Unusual Extended C-Terminal Helix of the Peroxisomal Alpha-Beta-Hydrolase Lpx1 is Involved in Dimer Contacts But Dispensable for Dimerization
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 118
structure length 351
sequence length 379
chains with identical sequence B, C
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y6vA01
4IHAA 3QZUA 1C7JA 1AX9A 5LKRA 1WM1A 4H18A 4FFWA 4OCZA 3RM3A 5LZ9A 3AZQA 1UK9A 3I6YA 4WFKA 1UWCA 2WG1A 1Y7HA 2X76A 4BAUA 2VSQA 4N8SA 3FYUA 2W22A 4LIPD 2HA6A 2DQZA 4Y2TA 1LPOA 5JD4A 1B41A 4OYLA 1K6EA 1A88A 5E4JA 1W76A 3W06A 2R8BA 4UBOA 2RIPA 4WDRA 1AQLA 1UKBA 2W6CX 1VZ3A 1MTZA 2OCGA 3F98A 3AIKA 3VISA 5HQ3A 1EB9A 4UHEA 5KBYA 1R3DA 4DNOA 1W4LA 4U2CA 3W9BA 1GKLA 5J3JA 4BCBA 1CVLA 1VE7A 4WFIA 1XRQA 4EZIA 2J4FA 4RGYA 4X6UA 2C5GA 3K2IA 4ZV9A 3FCYA 1QE3A 1WHSA 2VF2A 4FWBA 5DYTA 3L1HA 3ILSA 5HKAA 4H7IA 4U2DA 4KJXA 2ZSHA 1JJBA 3CCCA 2WFLA 5ALEA 5ALHA 4DYHA 2H7XA 1LPBB 4D9JA 3LIIA 4FBMA 3ESBA 1CUXA 4GWLA 3D4LA 1ODSA 3HYSA 3FLBA 4J0HA 4HAIA 2PPLA 1PV1A 4AMZA 3DJYA 3FVTA 5AIBA 3ZI7A 4AQDA 1ISPA 5LKAA 3WWOA 2NW6A 1JMYA 1UK6A 3OC0A 3MUOA 1R50A 3FNBA 4ARBA 5AKLA 2ZYHA 1ZI6A 4E14A 3BIXA 4QZVA 5FDFA 2FJPA 3VJLA 3DYIA 3EBLA 1KEZA 2HM7A 4HXEB 5AO9A 3F97A 2VT7A 3K6KA 5HF5A 3LLCA 3WIOA 4X91A 3WI7A 2QT9A 3D5EA 4P08A 2CBGA 2ZJ7A 1GQRA 1E89A 4UBLA 1K8QA 4UBNA 4UFPA 2ONCA 5ALNA 1QZ3A 3QPAA 1X2EA 3STYA 4C4XA 3DLTA 5AM4A 4I19A 5AHXA 3SK0A 2IX9A 2VAXA 3C6YA 5AI4A 2O7VA 1AZWA 2WFMA 4RE5A 2GBIA 2RGUA 2WTMA 2BFNA 1TAHA 3BJMA 1R4ZA 3E3AA 2AJDA 2OCLA 2PM8A 1MNAA 3AILA 4BB0A 4NS4A 5C81A 4KE6A 4DSAA 1XRMA 3R3XA 5EHXA 1HDEA 2GYVA 3RARA 2G5TA 5E4TA 4QDTA 2JGJA 3F8SA 4U2FA 4BC0A 3I28A 1CUDA 1BCRA 1UKCA 4W1SA 1CLEA 3H18A 3NWOA 1VA5A 2FUKA 1O6GA 2OGTA 1PJAA 4BRZA 2EEPA 1VKHA 1DT5A 4FTWA 3ESCA 2JEYA 2LIPA 3AINA 1SCIA 5T4BA 1GZ7A 4H7EA 2XDWA 4BVLA 2C58A 2B61A 4U2BA 3HC7A 1EHYA 1WOMA 3Q0TA 5EHNA 2ZSIA 5AICA 3W05A 3V9AA 2HU8A 3I2IA 3V1LA 2JF0A 4KRYA 4MEBA 1YA4A 3BF8A 3KD2A 5FOQA 4B81A 1XKTA 2XMBA 4CI9A 4MEAA 3AZOA 4H7JA 2DSNA 2QRUA 1UT6A 1TIBA 1YAHA 4UBJA 5CT5A 1BEZA 2JGFA 5I9IA 1BU8A 5KWIA 2YYSA 1SC9A 3IVMA 4B84A 2FJ0A 4FFVA 2ZYSA 4CCWA 2QUBA 2I3ZA 2XUFA 4E15A 1THTA 4BATA 4BE4A 4BYMA 1QO9A 2BJHA 5DNVA 5T4HA 5AKIA 3W9UA 1THGA 1QLWA 4UHBA 2WFLB 3EF3A 4HTAA 3H2HA 1BEEA 5KWJA 1XZHA 2QTBA 4FHZA 4ZWNA 4AN1A 4FMPA 2PSEA 5CT8A 5ALJA 1UOPA 2H7YA 4GECA 4J0GA 1N1MA 3WKBA 1HL7A 1XRNA 3E0XA 1UZAA 1WB6A 4EA6A 4DMFA 3BF7A 1MX5A 3U1TA 5LZ2A 3WL6A 3TGLA 2WJ4A 1LPNA 3O4HA 4B83A 1ZICA 3M81A 2IIVA 2CJPA 1YS1X 2UZ0A 2OQVA 5LIPA 3QM1A 6YASA 2XE4A 4BVJA 1DX6A 3H04A 3DCNA 1XZBA 2AJLI 5DJ5A 2OQIA 5LZ8A 3IULA 4Y9SA 3G9TA 1R88A 1XRRA 3F9CA 1LPAB 3IUNA 4B85A 1AC5A 5ESRA 3PI6A 2HA0A 2WUGA 3D59A 2ZYRA 3WKAA 1EI9A 3HJUA 2DQYA 1XZLA 2XUOA 1IMJA 1A7UA 3ZWQA 1YS2X 2WU3A 1AUOA 3Q8WA 5ALVA 1T4MA 3ED1A 4AXBA 3AZPA 5HK9A 4P93A 5EI5A 5AK5A 1EX9A 3I6MA 4BTVA 2B20A 3N2ZB 4E46A 4H77A 3WK7A 1FFAA 5ALPA 4AZ3A 4PW0A 2VEOA 4QE3A 1QFSA 2ECFA 2I78A 4PNZA 5AKZA 4Y2RA 3O9MA 2QXTA 2CUTA 4X3CA 2WILA 1MJ5A 4HRXA 3DL4A 4K2AA 4Y7DA 5JASA 5JZSA 2CKMA 4CCYA 1HPLA 1H22A 1BS9A 2JGKA 3IUQA 1N5MA 1GT6A 5JALA 2QUAA 3KWJA 5C7YA 4XX1A 2K2QB 3WKDA 5AKKA 4A16A 5JYCA 2XI4A 2Y1KA 4XVCA 5K3AA 1G4HA 3I6ZA 2HFJA 4H7DA 5HKBA 5K3FB 5AKGA 2QVBA 2Z8XA 1A8UA 1EK2A 3ICWA 1DWPA 1U2EA 1W6RA 1TKRA 4G8BA 1H2YA 3DS8A 5JAHA 4KE9A 4LHEA 1H2ZA 1HQDA 4C88A 1XLWA 4QA9A 4QDZA 1SCQA 1B6GA 4JEIA 1MAHA 2PU7A 4DSZA 2WIJA 4X95A 3LCRA 3FAKA 4C4ZA 5HZGA 4ZI5A 1QTIA 1EDDA 2V9ZA 1LPPA 3H2KA 4W63A 1LPMA 2XMDA 1XZCA 4MJ3A 4PV7A 2PSJA 5D3KA 1U65A 4J7AA 1E8DA 1MPXA 3VJMA 5ALLA 2Z5GA 1U4NA 1CPYA 5A7HA 5JAPA 2I03A 3PE6A 5JD6A 4GEGA 1L7RA 2WHQA 4A23A 1YB6A 3VDXA 5CT6A 3GROA 5LYYA 3WKEA 2GBCA 4PO3X 1EK1A 3V1KA 1ZJ4A 4G9EA 2PUJA 1ZD2P 4B82A 4DIUA 4HZGA 3WWDA 2PBLA 5E2IA 2BGRA 5JAUA 2QR5A 4UHFA 3WL5A 4OSEA 4LKOA 4BCDA 1WCYA 1CUCA 2XMZA 2B4KA 3KOOA 1USWA 4Y2YA 5ALDA 5AI6A 3S2ZA 2XMCA 4W9RA 3OOSA 5JZBA 1CUGA 2WHPB 1XLVA 1CFJA 5AI0A 1EVEA 4Z49A 4HXGA 1ZD5A 1H23A 2DFPA 5A6VA 1SOMA 2HFKA 1MNQA 1VOTA 1YCDA 3STWA 5DYWA 5ALFA 4L0CA 3IUMA 4EY4A 4KEAA 3EQ9A 1UK8A 3G9XA 1XKLA 2WIDA 4BAGA 2ZJFA 1JU4A 4CG3A 2ZYIA 1ZGCA 2QOEA 5BV7A 2Q0XA 1CUYA 1KU0A 4WJLA 3LS2A 5FP0A 2XUAA 4EB0A 3G02A 1YASA 5IVIA 4X90A 5FKJA 4N8EA 5AI9A 3TEJA 5LP1A 1UOOA 5D7BA 5AM1A 1TCAA 4XIIA 2RHTA 2JGLA 1BCSA 4GDMA 4KAAA 3E4DA 3BDVA 4FLEA 4RNCA 2EDCA 2C4HA 3QMWA 1QO7A 4G1FA 1ZGBA 5CT9A 1FSSA 2WLSA 4FNGA 1DQYA 5AOBA 4N5HX 5DNUA 4BZWA 2X8BA 4ROTA 4CIBA 4KE8A 5ALQA 3I1YA 1ODTC 1N5RA 2XQFA 1C4XA 5CMLA 3DNMA 1L7AA 4KAFA 1BE0A 5CH3A 4MQLA 2XMSA 3UUFA 1UK7A 3H2GA 4CCYB 3O9VA 2V98A 2DR0A 3STTA 4K6GA 3G7NA 4C4YA 1XZKA 4AZ0A 3O4GA 3GA7A 3A6ZA 5AK3A 2XUDA 1I6WA 2VTVA 3BE8A 5A71A 1SCKA 4FKBA 3WYDA 3BL8A 1O6FA 5IVHA 2PX6A 1ZD4A 4AX4A 1ODCA 2DCMA 3G0GA 1QIJA 3WZLA 4QDUA 4JUIA 5CT4A 1E8NA 4YPVA 1GPLA 2PU5A 2VATA 4FBLA 1CUJA 1QIKA 4F21A 1FFEA 1KU6A 1K5PA 3E1GA 3IDAA 1VA4A 2PL5A 1ZOIA 2X5XA 3YASA 4AN0A 3PF8A 3W2TA 1Q83A 1UXOA 3H1BA 3KXPA 3HRHA 1OILA 1CUEA 2BUCA 4AO8A 5FPPA 1DWOA 3OG9A 5BWBA 3HI4A 1ORWA 2XUPA 3VXKA 3U0VA 4S0XA 3W04A 4DLNA 4WY8A 1MN6A 4JNCA 1C7IA 4BDSA 2P8SA 1XZDA 2PSHA 1G66A 2D0DA 1HLGA 4NMWA 1K63A 5CW2A 4J0KA 4KAJA 1MO2A 1NU8A 2XMGA 3OPMA 3WWCA 1DWQA 5EIAA 1A8QA 5HFAA 2J4CA 3R3YA 4TGLA 3C6BA 3HZOA 3GBSA 4OB8A 4K6KA 2WJ3A 3QYJA 3JW8A 1LNSA 5ALMA 4BE9A 1BRTA 4M0MA 4TVKA 2WU4A 4X92A 1H2XA 4G5XA 1QTRA 3OURA 2H7CA 4DMKA 4L9AA 7YASA 2VJDA 1N8SA 2O2HA 3GZJA 1BN6A 5EHZA 1WB4A 1EXWA 1E66A 3NGMA 1XQXA 1VXRA 4UUQA 1LZLA 3FSGA 4AB1A 2CB9A 1NU6A 3FYUB 3IB3A 1GKKA 3ZV7A 4PSUA 1JFRA 1XFDA 3F67A 1IZ8A 1QIEA 1UOQA 1VZ2A 1FFDA 4UHCA 4CIAA 1J1IA 1L7QA 1VXOA 2JBWA 3QMVA 1CUHA 2XQGA 2OCKA 1T2NA 1TCBA 2PUHA 3D7RA 5HQ3B 3WJ1A 4J0IA 1DT3A 2OPHA 1RWQA 4BVKA 4LYDA 1QIHA 3HSSA 4B7ZA 2WQZA 1J07A 5SYMA 1LBSA 1LPSA 4Q3OA 1VE6A 2Y2UA 5IVDA 3OTQA 5C8ZA 3C5WP 5A62A 3D2AA 1F8UA 4G8CA 3VJKA 3PFBA 4RE6A 2OGZA 5AOCA 4OPMA 1E8MA 2VJCA 4QLOA 1BN7A 2O7RA 5CRIA 3HACA 1X70A 4UPDA 1P0IA 1CEXA 2ROQA 2ACKA 5LZ7A 3V1NA 1AURA 2I3DA 5HCUA 5AKXA 4ZV7A 4BCCA 5AI8A 2WUFA 1CUWA 1GGVA 3GUUA 4G8DA 4Q82A 4AO7A 5FLKA 2OAEA 4TPKA 1P0QA 3TJMA 3WK8A 3WK4A 4BTLA 4DNQA 1GPKA 2XUJA 2YH2A 1YB7A 5ALXA 1EH5A 1EINA 3CN7A 1XZEA 5IVKA 2RAUA 1VJ5A 5AKJA 4PSDA 3WJ2A 2G63A 5ALOA 2XUIA 5FV4A 1Y37A 4QWWA 3DEAA 2QS9A 2R11A 1YSCA 4IQ4A 3WL7A 3QITA 3MVEA 3TRDA 2ES4A 5JIBA 1QIDA 2BUAA 4ITVA 4FDMA 1CUAA 3JYHA 1CQZA 2DHCA 1JJFA 1W52X 2AJCA 4DM7A 1QIMA 2IITA 2AJBA 1EDBA 1FFCA 3B5EA 1S8OA 5A2GA 3MGAA 2CZQA 3D0KA 3QVMA 3G0CA 2EDAA 2WFZA 3OM8A 2RONA 3V48A 3WA7A 1LBTA 3BIWA 3IURA 5D3ZA 3A70A 4AO6A 5AJHA 3WYNA 3GELA 1YA8A 4X00A 2YASA 3C6ZA 3B12A 1A8SA 2VQ6A 5JADA 2B9VA 5H3HA 5AOAA 4ZXFA 4W1QA 1AGYA 2H9YA 3WIBA 1CUBA 3WLAA 2GZSA 3I2GA 3M83A 5ALSA 4FOLA 5KREA 4J0JA 1WPXA 3VKFA 3QH4A 1NX9A 4KACA 4UBKA 3K9BA 1ACJA 1J2EA 2BUBA 3H2JA 5A7FA 3WQHA 5AM0A 4FNMA 2PVSA 5IKXA 3H1AA 3G8YA 5AH0A 1AKNA 2PKYX 1UFOA 3G9ZA 4B6GA 3C6XA 4OB6A 5HF8A 3STVA 2XLBA 1HBJA 5K3CA 1LGYA 3LIPA 3F96A 3ZLTA 4ARAA 4BRSA 3QMMA 5T4FA 3KWFA 1XROA 4PF1A 4LXIA 1MX9A 1DTEA 2FX5A 5CURA 3L1IA 3JWEA 4LXHA 4AMYA 2C7BA 3R3WA 3H0CA 5EIEA 3DKKA 2G4LA 2HL6A 3C87A 2C0PA 4OU4A 5CBKA 3FLEA 4I4CA 4BDTA 3C70A 5ALYA 4CFSA 5ALZA 3M3DA 3R41A 1XRPA 3T4UA 1QIIA 3HXKA 3DKRA 3BWXA 3FLAA 1ORVA 4WY5A 1MU0A 5CXXA 3WZMA 1U8EA 1CV2A 3I2FA 1IVYA 3ICVA 3ESAA 3I2JA 4LXGA 1G42A 2Y2VA 3H17A 4H0CA 4Q34A 2DHEA 4YASA 1CIJA 4QEKA 1RYYA 2VT6A 4X85A 5AM3A 3CXUA 4YX9A 2HA3A 3EQ8A 5K3DA 3R3UA 1VLQA 4KYVA 3WWPA 2WUDA 3HABA 5ALUA 4B0OA 4IH9A 4EY8A 4G9GA 1D07A 4N8DA 1UKAA 3MUNA 5D6OA 3DD5A 2VA9A 3BDIA 5JATA 2BKLA 4DMCA 2ZVDA 4Q3KA 1CUVA 3G0BA 1JT2A 3C8HA 5E4YA 4M0EA 4P9NA 2G5PA 4J0CA 2HIHA 1Q0RA 5AI5A 3AIOA 4CG1A 1ZI8A 4BC1A 1GQSA 2WSLA 2OLEA 1XZFA 4HRYA 2VAVA 1HKHA 4B80A 2JIDA 2PSDA 5AKEA 2GYWA 3DQZA 2O2GA 1QFMA 3ZLVA 3AIMA 3VVMA 3STUA 2CMFA 3DL7A 4DMHA 3D2BA 2QZPA 5JAOA 3QBJA 1JJIA 1K4YA 4JYMA 5AK4A 5ALKA 4F5ZA 2AXEA 1ZIXA 3A2LA 5EFZA 3FSGD 1WB5A 5FUMA 3CCBA 1IUOA 5JARA 2BCEA 3HLKA 4INZA 5AIAA 3IUJA 4X6XA 3FBWA 4EHBA 3DOIA 3R40A 2QKYA 1XQYA 5CH5A 5CTAA 3FOBA 1E5TA 4ZGBA 3NOXA 4U2EA 4Q1VA 2QJWA 1ZJ5A 4Y2VA 3BJRA 3B3QA 3SX4A 1DINA 4IH4A 2J3QA 4BZZA 2XQJA 2XQIA 4M0FA 3IA2A 2VJAA 3O95A 4OYYA 2XMRA 4N5IX 4GXNA 1W75A 3ANSA 2VJBA 3M82A 4BP9A 1ZD3A 5FPQA 4Y2PA 1CQWA 4NVRA 1MX1A 2OXEA 1DQZA 4B9AA 4MWTA 4ZREA 5ALGA 3BXPA 4QDXA 3IIIA 5DYYA 5K3EA 2HA5A 3UUEA 3R3VA 1AMNA 1Y7IA 1SFRA 4H7KA 3VVLA 1LLFA 5CXUA 4U2GA 2Y6UA 2ORYA 5AP9A 4FLFA 2O2IA 4J0DA 3ESDA 4GI1A 3P2MA 1CUIA 5DLPA 3H19A 3L1JA 3IBTA 4X93A 3R0VA 5ALTA 5C8VA 5BOVA 3PF9A 4F60A 3AJAA 3FVRA 4UFNA 1QGED 3N0TA 2AJ8A 2JEZA 4B0PA 3RK4A 3G9UA 4HS9A 4WDQA 3O4IA 3GFFA 1JKMA 4GW3A 1ACLA 5CH8A 5ISMA 1JMKC 4KR0A 5YASA 3D2CA 4G4IA 2V96A 2ZJ6A 3FWHA 1TCCA 1ETHA 5ALIA 1G5FA 3KDAA 4X94A 4MYDA 1E3QA 3SC2A 3WWEA 5I7UA 4C87A 4Y2QA 1TRHA 2QJRA 4PSCA 4KRXA 3HEAA 4Y2XA 4XWGA 4J03A 5K3FA 4FLMA 4EUSA 1IZ7A 4L3WA 3WA6A 3WKCA 1CR6A 3RKSA 4MYSA 3G0IA 3S8YA 2Y6VA 4X97A 5AM2A 2WJ6A 5I8PA 2XT0A 5LZ4A 1EB8A 1P0PA 1XZGA 4K6HA 3DYVA 3PFCA 1CUZA 4UBIA 4P92A 3FYTA 4W1PA 4W1RA 2GYUA 1WPRA 2BAGA 4Y2JA 4BP8A 5AM5A 2GZRA 1XZIA 4H35A 4Y2SA 4G4GA 3H2IA 4UFOA 5HF6A 2J3DA 2RHWA 4BBZA 4X7BA 2XUKA 4NZZA 5ALWA 3PUIA 4E11A 1XLUA 3AFIA 2QXUA 1RP1A 1Q0ZA 3PICA 4BAZA 4DNFA 5DNWA 2WG2A 3STXA 1F6WA 1R9NA 2C5FA 3X3HA 1GPNA 2HHAA 4JYPA 4C6HA 3FCXA 1F0NA 3WK6A 2V97A 3LP5A 4HXFB 1CUFA 1DX4A 1EDEA 1OCEA 2CEKA 2C0QA 4X71A 4QLAA 3C45A 5ALRA 5JZ9A 1FJ2A 2XUGA 4QWMA 5AKHA 2ACEA 4OUKX 5F4ZA 2OG1A 1YR2A 5K3BA 2WM2A 5DTIA 1H2WA 1R9MA 2WHPA 4QNNA 2HA4A 3NUZA 3QPCA 3DDUA 2OCIA 1XQVA 2WUEA 3C8DA 2HRQA 4OB7A 2WG0A 2YXPX 1X2BA 1QOZA 4EY7A 1FFBA 1QIFA 3PUHA 4QDOA 1CRLA 3R3ZA 3T52A 1BROA 5LLSA 2H1IA 2XUHA 4ETWA 1M33A 2WKWA 4HVTA 4WCVA 5HF9A 1GXSA 5LZ5A 4J3JA 2HU7A 1ZI9A 4X6YA 5JD5A 3WK9A 2HU5A 4GLBA 1XZJA 2HA7A 2XLCA 4C01A 4EBBA 4K5QA 2QMQA 1PFQA 3G0DA 3D3NA 2WIFA 4H7FA 5EIHA 5BWCA 4Q3LA 1JU3A 1DU4A 1TK3A 5HK8A 3CN9A 1P0MA 3WK5A 1TQHA 4UHDA 4EY6A 2WIGA 1XZAA 5K5EA 3DOHA 4ZRDA 1IUPA 1MT3A 1OXMA 4O08A 3C5VA 2WIKA 3AUKA 1JI3A 1YAJA 5A7GA 4OD0A 2E3JA 4C89A 4DTCA 4G4JA 2HDWA 5AKYA 3WL8A 2OGSA 4IO0A 1R1DA 1W1IA 1EA5A 1EVQA 3ZLUA 5C8XA 5AK6A 4IH1A 1IUNA 2JGMA 5T4EA 2XMQA 2Z3ZA 3I2KA 2XUQA 3WMRA 1MAAA 2XB6A 3O4JA 4WFJA 3KSRA 4L72A 1J06A 4CG2A 4DGQA 4UHHA 2HA2A 5EGNA 1XZMA 3EQ7A 1WHTA 3C43A 4PQEA 2JGIA 4A5SA 1QIGA 2GBGA 1XRLA 1ZIYA 3O0DA 1QONA 3I1IA 4LYEA 4GHWA 4JH0A 5HFNA 3ANTA 4YK7A 2WHRA 3QPDA 2HADA 4H7HA 3RLIA 3SWWA 4MXDA 1F0PA 1CUUA 4Q05A 2GBFA 1QJ4A 4V2IA 4XJVA 4EY5A 3ZPXA 4Y2UA 4KE7A 2HRRA 4UBMA 4OU5A 1LZKA 3EIOA 3V1MA 2DHDA 3A2MA 2XQKA 5JANA 4F0JA 5FXMA 3FYUC 3PDCA 3UMJA 5EHQA 4DNPA 2JGEA 4MQMA 1Z68A 4RPCA 1CUSA 2OAGA 3I2HA 3A2NA 5SYNA 2QM0A 5DWDA 2PSFA 2D5LA 1Q84A 2BGNA 4B9EA 5IH7A 4I3FA 2Z3WA 2WTNA 2Z8ZA 4GBGA 5FRDA 2RI6A 5DTJA 1XQWA 4MWSA
chains in the Genus database with same CATH superfamily
3H5OA 3EG9A 4CKXA 1SHJA 3UOAB 5AVSA 2NZXA 2XDQA 1AX9A 2I34A 4AIIA 5B64A 3ECSA 4EI8A 4ZDJA 2A9FA 4YREA 2GN8A 1FQWA 1W88B 1WM1A 3A6FA 4MQEA 5LD2B 4H18A 4FFWA 5T8KA 3PTAA 5FTJA 1IJFA 2X0FA 3Q7QA 4RZHA 1UK9A 2I4MA 3F2VA 1GYQA 3CZQA 2OD2A 5ENVA 3TQHA 4AJOA 3H11A 1I1NA 1G5PA 3FMOB 2QL6A 4WINA 1ZG3A 3VC1A 4H0FA 4Y9UA 5JSYA 4BBAA 3RC8A 2YCLA 2OHHA 3AR9A 3Q7PA 2TSYB 2WJIA 3E81A 2W22A 2YZ2A 5CFRA 2VSNA 2XB9A 4LI0A 3LF2A 1IY9A 3VTAA 1FY2A 2DQZA 2DMRA 3C6MA 1QQAA 1LPOA 4GPBA 1HLFA 2FPPB 4FMDF 5FTKA 4KXUA 4OYLA 1Q16A 3V6LA 4AQ7A 1PK9A 1X7XA 3ED5A 1T3LA 4LHXA 5CJJA 3WYGA 5I9LA 3PC4A 4R2IA 5CJPA 5LPNA 3R75A 2M6SA 4AWBA 2J0VA 3E53A 3EVTA 2BDEA 1ORTA 3CX8A 4H3HB 4WDRA 1O96B 3U61B 2IYVA 1YNSA 2GPJA 5LOVB 2Y66A 4PG4A 2W6CX 3MXTA 4IUBS 4U3JA 4P3KA 3F98A 3AIKA 1G2OA 3PUKA 4GVXA 2EX1A 4YR7A 3NU1A 1NI3A 3H75A 4X1KB 3SS8A 2MT9A 3WYBA 1RM5A 3T61A 4ZI7F 3ZVRA 4AMVA 5ADHA 1S7CA 2AMLA 1KEWA 2GZMA 3G49A 1W4LA 3P20A 4FZ3A 3SR4A 4DNOA 1KI4A 2EG9A 1XDBA 1GKLA 1K9SA 2VT3A 4QOSA 3ID6C 4WFIA 3DO6A 3QY0A 4I8XA 3P5BA 4D25A 1KAQA 1KAOA 2RGAA 2XNCA 1KDZA 4EI9A 3P96A 3H5IA 4EZIA 2F9MA 4Y18A 5JWRA 1QDLB 4RGYA 4D8YA 4OIFA 3ZI0A 4R5HA 1PUIA 2YY7A 2ISQA 5CB6A 2HV8A 3BOSA 3FCYA 3VX4A 2L42A 4G85A 3RC3A 4C9BA 3PZBA 5DSXA 1C14A 1SAYA 1U9JA 4QYIA 5AMXA 4D3SA 2FE1A 1GN8A 5C5EA 5HKAA 4Q3BA 1JQ5A 4H7IA 1J0DA 1Q0TA 5THQA 5IJ9A 2BBTA 3AR2A 2ERXA 3CCCA 2PQ2A 3ND5A 4Z9XA 1U5BB 4URZR 5ALEA 5ALHA 2GNAA 4S1NA 2V0GA 3NONA 1AV6A 1IOWA 2YMLA 1WQ3A 2DWOA 3VV3A 3ER9A 5FWYA 16PKA 3IVXA 2BI4A 3L7BA 4PR0A 2IV2X 4B6QA 4S24A 4N3AA 2TS1A 4UE2A 5HE8A 3PP8A 4GX5A 1IMOA 1P7CA 1B14A 3KDPA 4NQZA 4QUKA 4TX1A 3ZY4A 2AZDA 1S3IA 2J3KA 4P0TA 4PNHA 3ZHVA 2CCJA 3VU8A 4FIDA 2HQOA 3L7IA 1T9DA 1ULSA 3KJZA 4BMZA 1DRUA 3DJYA 4BB6A 4KVGA 3FMPB 3WGVA 4RESA 4IDGA 2F1HA 1M0EA 5KSPA 3GK3A 1TU4A 4H6XA 2HPZA 1GT91 1NVDA 3ZI7A 2GRUA 2R84A 2NW6A 1NG9A 1TVKB 5E6SA 4EG4A 3QF4A 2FW9A 2O2YA 2ZVJA 4FWTA 1ZOPA 1ORHA 4IPTA 2IOHA 4WN9B 3S6JA 1GVHA 4GWKA 4JI3B 3K9FC 3DPSA 5JMOA 2X3YA 4BLTA 4YAGA 4EZBA 5FDFA 5TV2A 3DMPA 3DZFA 2F64A 3HV2A 4MQ5A 2QQEA 5KNCH 3DYIA 3OZGA 3OZXA 4NYIR 3EBLA 5SYAA 2HJWA 3UB2A 2WK1A 2NO7A 1O95D 4OQNA 2QZJA 4PZPA 3D4IA 1JLKA 1MO4A 3IBCA 4HDNB 4L73A 4U02A 3F97A 5G3ZA 1E1RD 4NPAA 2AC7A 2VF8A 3RASA 2H92A 4BLVA 3H8WA 3OQBA 3WOHA 3WIOA 4YP0A 4DBVO 4QKQA 2C7VA 3QK7A 1MGOA 5LMZA 2QT9A 1NUPA 1QVVA 3D5EA 2A84A 4MUKA 4RHEA 2NXJA 4LYAA 2PAFA 3LPLA 5INTA 4W8OA 1K97A 1LH0A 2ZJ7A 1GQRA 1U1DA 2C97A 4RHYA 2RGBA 1E89A 3DV0B 2BLNA 3RS7A 4UBLA 4EI2A 1Z5OA 2J3IA 2GEDA 3PRHA 2BFPA 4UBNA 4UFPA 2E2WA 4LHYA 5I45A 2JANA 3O21A 2PRSA 2EFHB 2YWRA 1UDBA 4XB6B 5BPFA 4C2TA 3FTEA 4LZJA 3HU1A 1TJPB 2I9PA 2EERA 3FYCA 3G3EA 1U7PA 3VDRA 1R27A 4MGKR 4CLRB 3UMMA 5AM4A 3AP1A 2R8EA 4WBNB 5AVTA 2QQ0A 5AHXA 1Z0KA 3W78A 2ZRJA 5IDWA 3CMCO 2VAXA 2AN5A 4JWTA 3T3DA 1QH1B 3B78A 1Y7PA 3Q5DA 1U2RA 1Y8QA 1KRXA 1AZWA 3K1YA 3RJ5A 3HKEA 5GV7A 3QXSA 3ZWKA 3FPLA 4RTOA 5F3RA 2DUNA 1VBNA 2R65A 4G0UA 3L0YA 2GBIA 3NYWA 1HEIA 3IJ5A 4O0LA 5HCNA 3SY8A 1ECPA 3MOIA 4PO1A 2VEDA 2WJPA 4N18A 3U60B 1VHJA 3B3AA 3LL4A 3W3ZB 3I8SA 2E18A 3QU2A 1Y4DE 1TAHA 2OPBA 2ZJYA 4K6FA 3PX3A 4Z7JA 4ZQHA 3D8TA 3FNIA 3FCEA 1O3YA 3KYJB 4M60A 4RKRA 5F35A 2A0FA 4EPTA 1R0BA 1OXVA 4RH1A 4JUDX 3AILA 4BB0A 4ZAFA 1Z07A 5K6AC 1ZBQA 4NS4A 2VYQA 4DSAA 3CH4B 4IEFB 4MUIA 3O8NA 5FT9A 5DGHA 4AN4A 4OXKA 2A59A 1VL0A 1X7ZA 2G5TA 5E4TA 4YT2A 4QDTA 2JGJA 4BEVA 1LW6E 1YDMA 2EJBA 3QHAA 4I5DA 2RB5A 4YDSA 2VHVA 3F6BX 2J9GA 1KYXA 2F1KA 2FMKA 2ZRAA 5BN1A 3PNOA 4HX2A 3PNKA 3PRYA 4X62B 1J25A 3GH3A 3H18A 3OJCA 1M2VB 2P6RA 3I01M 2FK7A 3RNOA 3OCWA 3OE7A 3ZU3A 5I8WA 4FK8A 1I5EA 2IUSA 4H15A 2OGTA 2QRNA 2WZBA 1T9KA 4W9MC 1FUIA 1KYIA 2NPFA 1K2VN 1QX3A 3HVUA 3GRRA 3NV9A 3H83A 1JN0A 4IRMA 5LB2A 1P8JA 3DGEC 1V3TA 5L8VA 4TVOA 2GM9A 2LIPA 3RSZA 3NYIA 3GEEA 1AT1A 3AINA 1V3UA 4FKMA 4F4UA 2ZYVX 1NURA 5I3ZA 1ZD8A 2B8NA 3EBOA 3GUYA 3E9EA 4F5EA 4K3UA 3OCJA 1UL1X 3ABIA 4WKBA 1ZH0A 1Z8NA 2OY0A 3AR6A 1CYEA 4YJ3F 3B89A 3GLGA 4BVLA 3WZ2A 3WLKX 2ZIUB 1P5ZB 4P3NA 5GV8A 2C03A 4HF7A 5BSFA 4DWJA 1QTNA 1MTOA 2AZXA 3W6ZA 2IU0A 3HC7A 3RG8A 1SO8A 1UR5A 3R0ZA 2DY0A 3Q0TA 5BURA 3B7PA 3E48A 1H2RS 1YB4A 4M9UA 4ZDWA 4AJ2A 3G0HA 1ADYA 3UIEA 1R6TA 2YC2C 4QC2A 4RHXA 5FWNA 1UC5B 4U63A 4TYYA 2SECE 3GQBA 3TTXA 4ZGGA 1MA0A 5EWLB 4AJHA 4V0RA 3SSNA 1J20A 3KD2A 2XXJA 3AU9A 5TLSA 3ANXA 2CV1A 4QOHA 2WC1A 4FU0A 4N0DA 4I4TF 1URPA 1NY5A 4PXAA 1XKTA 4ASUD 2XMBA 3QUAA 2VJMB 2YHIB 3KQMA 5BSGA 4MEAA 3CZMA 1FP2A 1W581 4TL9A 2C5LA 3RF6A 1FQJA 1TF2A 4PG5A 1XTJA 1YC2A 4XWKA 5KTKA 4TROA 3ZTTA 1KQPA 2DSNA 1SUFA 3EDMA 4D6YA 1TC1A 1KI2A 4K6MA 1HC7A 1TIBA 3EF1A 4UBJA 1U8CB 4M8LA 2ZJ4A 4C6SA 1E92A 1FFHA 1H05A 3OT4A 5JH7A 3DWEX 4QT0A 5D6NA 5KOJB 3U5TA 1XTUA 1A27A 2B6HA 2JGFA 3Q7IA 1HM5A 2R6AA 4GVPA 4C5AA 3O0TA 1AHHA 3PD0A 4O2BA 3K9CA 4LFCB 4YCCA 1EUQA 1M2KA 1UJBA 3JQ7B 3JATB 4KR7A 2J31A 3L0PA 4MUYA 3DKVA 4EPVA 2BH2A 3KEQA 3CT4A 1D09A 2H1RA 1KYWA 1YL7A 1YUBA 3PPXA 2QSJA 2V0CA 2ZYSA 1GQFA 1HFKA 3U3KA 2QUBA 4CCWA 3AR8A 2BELA 5CEJA 2W2LD 1NN5A 3DW3X 5LYJF 3H16A 1A4IA 1YH3A 2P67A 3NUQA 1ESCA 2A7QA 3B9BA 4MULA 4HLQB 2NN3C 3MTJA 4BMOB 4BE4A 1WZCA 5ED0A 5M29A 2QZ9A 5T41A 1FMLA 3KOXA 5JH7F 4P98A 5DNVA 4IIBA 1C2YA 2C4UA 3ELWA 3EVFA 4O2BF 5AKIA 2QI9C 5CFQA 4W5OA 2OAP1 5FFNA 4X8MA 1THGA 1Z47A 4A26A 2XVYA 1QHHB 2D62A 3E9QA 3OIYA 3SI7A 2X5OA 3CF4G 3V4SA 4P7GA 3EF3A 4UHBA 1Z56C 2RD2A 3ANNA 2IPNA 2RJNA 2KW5A 4NYIQ 3BAFA 3G2PA 2QTBA 3KOZA 4QQNA 4Z3DA 5TEWA 1SXJC 4AN1A 1OVMA 5ITZB 1M1NB 3CIFA 4Q7QA 1T2FA 3CRNA 3L1VA 3TG8A 2PSEA 4I08A 1UOPA 3R0IA 1N1MA 1GGMA 2P3LA 3KP1A 5JMTA 1Z7BA 1NNUA 2CB0A 3LT1A 2BW0A 1F06A 1PJTA 4EL0A 4C43A 1AHNA 4JR1A 1EVLA 4O8ZA 3H99A 1UT5A 4ZP1A 1RC0A 2VK2A 1WB9A 3BF7A 1ND6A 3NKVA 2VJKA 1IK4A 3GI1A 1E9VA 1PSDA 1RYBA 4R40A 5E7IA 3WL6A 3BWDD 1HYHA 4C06A 3EXIA 3NLLA 3PHBE 3PNQA 3O3OB 1WZEA 4GPIB 3GJYA 5I9BA 1D2CA 3SSMA 1OB2A 2GH1A 2VDNB 4PS1A 4W5WA 1EBUA 1DV1A 3PNVA 3X1ZA 3B9QA 3HBAA 3K5PA 3ASVA 1J56A 2CJPA 1DO2A 1HF3A 2DPYA 2JVKA 3F3KA 4LDQA 3QVOA 2FHSA 5H9WA 3D6VA 2OQVA 3WLLA 4OLFA 6YASA 4BLRA 4GM1A 3TMYA 3ZLJA 2K5UA 1O94D 4L75A 4DREA 4DR3B 4ND7A 1DX6A 3H04A 1ST2A 1KBQA 2GTPA 4RADA 1LC3A 4RV4A 1NM5A 1U3DA 2AFHA 2ZQYA 1C3JA 1GKUB 1KI7A 3GVXA 3KU4A 1RYZA 2PL3A 2PVPA 2QNRA 3HFGA 4R0NA 5DJ5A 3SZLA 4YCNA 2ZAYA 4P82A 4PLTA 1RKUA 1NFQA 4AJKA 4RA9A 2V4UA 4Y9SA 4LFBB 4MV8A 4YEDA 1NYQA 1N5LA 5CFPA 5JZMA 3WGIA 5ECYA 2GAFA 1JI0A 5AESA 2VHXA 1YF3A 2B4QA 3QLUC 4FXOA 5C31A 1Z0JA 1TZ2A 1EFUA 3L0SA 3O03A 4BX3A 1M8GA 4HVLA 4BNIA 2Q2OA 4A4DA 4B85A 4N76A 2GR9A 3MS7A 2DBZA 2AF3C 4GPTA 4O8CA 5F9MA 5BRNA 5GJBA 4X5OA 1J2TA 1MZPA 5AJXA 1BX0A 5CB4B 5DHPA 4H9GA 5T64A 2YINC 5F33A 3PUZA 4MUJA 1CF9A 4ZOQI 3EGOA 2H4WA 4KFSA 2Q4OA 5J2UB 2GTHA 1RAGA 4NBVA 3IDSA 3WKAA 5FBRB 2DUJA 2RGEA 2BR3A 2VHZA 3T1OA 4CKBB 5C8YB 2DQYA 4N03A 1XZLA 4FFBB 1LDMA 3QKIA 4J7XA 2FX2A 3GL9A 5TE9A 1A7UA 3ZWQA 1XEWX 5UKDA 4KGVA 1YS2X 2WU3A 2PYIA 1HOXA 2F62A 4L5CA 5ALVA 1T4MA 3KTFA 4JGGA 3PXAA 4MS1A 4YAUA 3ED1A 1GU1A 1X7DA 4RVCA 4YFYA 3ZE2B 5BV2P 3RTEA 2D1SA 1V1RA 4CGYA 2JFYA 4I7EA 3V46A 2PKCA 1S2LA 2HTFA 2R6CA 3FFTA 3LFTA 5EI5A 5AK5A 1EX9A 3OHSX 1EUCB 4R8SA 3HA7A 2B4YA 2PZKA 2B20A 3NB0A 5FR2A 4E46A 4CKWA 4L5IA 5ALPA 4YMGA 4YV0A 3VKGA 3IB6A 5IJXA 1QFSA 1DIBA 1Z4QA 2I78A 4BXOA 5F9FA 3TVTA 5JFTA 3WFIA 2PJUA 2QTMA 1TDJA 1F2UA 3KZKA 2QXTA 2GHRA 2YJTD 1H65A 4P8RA 2OGUA 1FRFS 1JB1A 4B2IA 4WLFA 3RREA 2VPIA 2JIZD 2OBYA 2CXSA 3F0TA 4CM7A 4E4RA 2ZAGA 3V8BA 1DTWA 1BXZA 4C4PA 4GICA 4Z86A 1OH8A 2W7TA 3DL4A 4L02A 3LL7A 5TT1A 3IKTA 3FB1A 5FIUA 5JASA 1JDBC 2BFFB 1YDWA 4A91A 4OHXA 1A72A 3A4TA 4K1XA 5JNLA 2P7HA 5IP5A 1HPLA 1RCTE 1BS9A 5E9QA 1DAKA 1MLDA 1FZQA 2C29D 2QUAA 5D51S 1M75A 4RA6A 3PFIA 3GFQA 4XPIB 3KG2A 4XX1A 4ESEA 3RBAA 2I4TA 2L19A 2YIMA 3EYWA 3KTDA 4IZ6A 4RF4A 5LCXA 5AKKA 1IQUA 1TK9A 3NBFA 2IV3A 4Q00A 4BO0A 3H3FA 2XI4A 3PYMA 4MAAA 5AJZA 4XVCA 1AZSC 5AVWA 1G4HA 5LLDA 2P5SA 3RU7A 4MVWA 1WUYA 3PGMA 4LZAA 5K3FB 1A2BA 1WL8A 5HKBA 5AKGA 5HJ5A 2ZIGA 4NDZA 1A8UA 3QKSA 4RD6A 2VQFB 4TWBA 1W94A 3ICWA 4OHZA 5F9HA 5IAEA 2C9BA 2BEWA 3W6UA 1U3WA 2PBRA 3A1NA 3MWLA 2MINA 1Y6GA 4CM8B 1RT9A 3D6MA 3IPRA 5IYZF 5ANRB 2ZANA 2YZ7A 2ZZKA 3BMQA 2AWOA 1WXFA 2O2ZA 4KU4A 3WMEA 4B4VA 5JAHA 1JKJB 4KMRA 1SELA 4C88A 1XLWA 3SHFA 3KALA 5M34A 2B34A 2BF7A 2V8BA 1ESNA 1W1WA 4KMMA 1B6GA 4NYMR 4Q1BA 2V3CC 4HQNA 2HQRA 2DULA 4XB2A 4JEIA 3W1EA 4YV1A 1MAHA 1SPXA 3BFKA 4MPPA 1YZVA 3GDOA 3Q2KA 1NHGA 4KUGA 1VQ1A 3WFZA 4DLWA 4TKVA 4TYMA 4EEKA 3BHJA 4E6PA 2HDOA 3BXGA 3T54A 3MILA 2PGAA 1RMYA 5FL7A 2PLFA 2YV3A 5KOYA 5IWCA 1MV5A 1RWNA 2VA8A 4PYKA 2QVXX 4JB2A 2CNWA 2GQ0A 1TA0A 4ZCQA 5A5GA 4AICA 2WSMA 3R3SA 1A4RA 1C9EA 3H2KA 4G5GA 1ORDA 1HDRA 2YOGA 1XZCA 4CM5A 1QGUA 1TM2A 3LKVA 4RTKA 1T25A 4ZFNA 4EKGA 1Q2XA 3SF0A 2WHEA 4NCNA 2OGWA 3I76A 4KGDA 5AJVB 1N78A 2D2EA 2MMCA 3E22B 1OLUB 4OK5A 1GEEA 5CA0F 1A97A 5E1MA 2BEKA 5IKOA 2OCBA 1MHTA 4A9AA 5MGBA 3E3MA 3IJRA 1E3DA 3G8BA 3K5HA 3HYRA 1A2KC 1KORA 1SD5A 4GP9A 5J2TB 2J6BA 5KSOA 1E1LA 3OZRA 2JDID 1NT4A 3JZMA 1R6BX 5B3KA 1ISRA 4GEGA 1D6MA 4BO5A 4DG9A 4A23A 3HHEA 3H1PA 3KQHA 3C6KA 4KLAA 4DABA 2G80A 1W1UA 4NEHB 4YLEA 1OFIA 4BU0A 4GUAA 4L27A 3U4IA 4MWOA 5F78A 3K70D 4U39A 4BFSA 2JLXA 2Z2JA 2B3TA 2O0MA 3WB2A 1QORA 4ZT6A 1FUYB 1C4KA 2HNKA 2Y1CA 2DJIA 5DULA 2NVUB 5B5SA 1L4NA 3SJCA 3GROA 2PA3A 5HTKA 2OZEA 3VKHA 1PVVA 2Y0PA 3PGJA 1FFWA 2ID8A 4MKFA 2O7QA 1UBJS 3IE0A 4FDVA 3VZPA 3EPJA 1FXUA 2VTBB 2J0QA 1UMBA 3I62A 3EZ9A 3BULA 4IV5A 1J39A 5C0OE 2WWIA 2XNDD 4PO3X 5B1YA 1E1MA 3S1LA 3V1KA 3PPWA 2WNIA 1RHMA 3H0EA 3RS9A 2O2SA 2G4VA 5GONA 4UTOA 3T06B 2WVGA 5IJAA 4TXJA 2BD0A 2AEMA 4QJ3A 3N7TA 1IY0A 1OZ0A 2CUNA 2P62A 2QP4A 3IMCA 3OY7A 4IG4A 4UEJA 3U4GA 3UXMA 3VH2A 2CFSA 3HBFA 4PLZA 4YMHA 2IXDA 3RANA 4EFLA 3QXGA 5DRTA 4YP7A 1W29A 2BHLA 5K0TA 3FF1A 2BGRA 4D6PA 1BW9A 2NZUG 5CCDA 2I8LA 3T6KA 3AI3A 3BICA 3UNXA 4ZOCA 4BJ3A 1EAYA 3GLSA 4OSEA 4HNVA 3E7PA 4IXTA 2CUZA 1WCYA 1JECA 4L8VA 2XCTB 1MV8A 4LISA 2XMZA 1JDZA 2H2DA 3D6AA 3E70C 1KOJA 2B5VA 1JR3E 5H82A 1K98A 2GRJA 4F3YA 1LSOA 1LLQA 3JQ6A 5ALDA 5BV0A 3BWMA 1DCMA 5GONF 3EZ2A 2QTAA 2XMCA 1KJWA 4O1HA 3Q98A 3OOSA 2DLCX 5SY4A 2P5YA 2WHPB 4RPGA 3WIUA 1PO7A 3PX7A 2E4XA 2XHEA 3IAHA 3S29A 2F9FA 3EYAA 2XJ9A 4R51A 3EZLA 3H4VA 2HT1A 4Z49A 2EG5A 3GRKA 1VGQA 5E9JA 3UH0A 1QRTA 1WVGA 1R8YA 3SYRA 3HM2A 4D42A 3WRVA 4RHFA 1TVMA 1NUUA 3TXAA 1N77A 4POOA 4AKEA 1FLAA 3RK1A 3K30A 1VHTA 5A6VA 1DC7A 3LT4A 3HVJA 4S2EA 4Y3UA 3G2NA 5L3QA 1VOTA 1WEKA 2Q3FA 5GAJA 4OQYA 4C7JA 1JQEA 5DYWA 5FOVA 3GN1A 2XXBA 5ALFA 3BGOS 1JHZA 5A9RA 3TLCA 2R6DA 3HBJA 2V58A 1LVGA 3DAFA 4WZBE 2FSVC 3G9XA 3I64A 5A03A 4RX1A 2H1WA 3QELA 2IOFA 1L8OA 1XMQB 1UFVA 4MGEA 2CMHA 3ZDXB 4MHOA 4LF7B 3WGNA 3W79A 3QU4A 3LD9A 2YDYA 3PWTA 1V16A 4RMNA 4DAEA 1KQ3A 2Q0XA 3QBTA 2PYDA 4PAWA 1SB8A 2ZRCA 4HR7A 3HP7A 5FP0A 1BXRA 3FOWA 5FQOA 3AOEC 4OBWA 3QLVC 1ABEA 4LOJA 2HIAA 5FNVB 4EB0A 5IVIA 4AM8A 4DLSA 1B0PA 4X90A 2AVDA 3PKIA 2QAJA 2IY9A 3W7AA 2IF2A 4TMTA 3M4YA 1E94E 5FV7A 3DHNA 2C96A 3TEJA 1J8DA 1C9JA 3G17A 1RQGA 1H5UA 4QSMA 5LP1A 4GOJA 1C50A 1PE0A 1Q21A 1VCMA 4WWHA 5AM1A 2W6MA 3GHYA 4XIIA 1HEYA 4C0KA 1HFEL 4J6EA 1A9XB 5DLDA 5ECDA 3ONNA 4AKTA 1EE9A 1SBNE 2JGLA 2Z6QA 1BRMA 3TCKA 3WJ7A 1SOAA 1CW2B 2AGVA 3ETNA 5IBCA 1LS1A 2RGYA 3E3NA 2EDCA 4RNCA 2Q6LA 1JQBA 3DKIA 1XD9A 3UFXB 1ZGBA 4B3SB 5CT9A 2A4KA 3VUFA 3ANMA 4IZOA 2EP5A 3HR8A 5GJVC 1BDJA 4YV7A 1F9AA 1FDOA 2VQEB 1YR6A 3HN7A 3WSTA 1RQRA 4M1SA 3B1FA 4CIBA 4RM3A 2YIDA 4KE8A 5ALQA 3AM1A 1Z82A 1ITZA 1DV2A 1PK7A 1IXRC 4K0RA 3LSYA 2XQFA 2JL1A 2P6NA 1C4XA 2HNBA 2C98A 4TZ6A 2D06A 3W4KA 2HCJB 4L6IA 4YT5A 2HHHB 3K92A 1OZGA 1H9BA 3I30X 1NHWA 2QRLA 1OE0A 3DEYX 1RWMA 3FLMA 4KAFA 1X7YB 2PS1A 4F9TA 1WDKA 3NHWA 3OE4A 2V4MA 4NYMQ 3D6TB 3KT8A 3RFVA 2NZ2A 3EASA 1SBHA 3PR2B 1RDFA 2HUPA 1AS0A 1O9BA 2AYYA 2IUEA 4FT2A 3ZCQA 3L7NA 3GV0A 2QL9A 4WQMA 3Q8MA 3DTYA 1IZZA 4CCYB 2Z1NA 2DR0A 2G5CA 5K20A 4JNKA 2G6BA 3CE9A 2W48A 2HQSA 1T1SA 3MJFA 4GWGA 3D5TA 4MW5A 5DU2A 2MYNA 3MTGA 4XKJA 2I9KA 4LDNA 1IJEA 3VSCA 2Y77A 5AK3A 3N28A 2R68A 3HA2A 5LDDC 5CX1B 1I6WA 3BE8A 5DIZA 1ONOA 2PHZA 2CVQA 5A71A 1SCKA 2QJOA 4GE0A 4FKBA 5K0EA 1BDMA 3BL8A 1W2GA 2C57A 4YUWA 5IVHA 3RVDA 1WMFA 1FSFA 2F4VB 2PX6A 3HB9A 4XCVA 2G08A 2ZJOA 2XXAB 2VF5X 4V1CA 2WR8A 1BJRE 1CP2A 1GZ3A 3JQ8A 3MD0A 4DM3A 2C2XA 2EJUA 1N7GA 4NP6A 1KK2A 1U80A 3L0OA 1QIJA 3RRYA 5H0IA 3TSWA 3JASA 1W19A 4X63A 2VUIB 3CLKA 2QVYX 1XKXA 1CR4A 3R5SA 4JUIA 5IVPA 1EX1A 4X44A 3GT7A 3Q0EA 5CT4A 5B1EA 3RFTA 2H1SA 3TIGA 3CEMA 3V4PB 5LWQA 3NHJA 3INGA 3GXOA 2J7PA 3UMRA 3AYZB 4FSXA 1JAHA 4FBLA 1JBQA 1TM4E 2HJVA 5EUQB 4YXFA 1Z5WA 3TLMA 4F21A 1FFEA 5HK9A 2PWPA 4K88A 4CMJA 3OFSA 3KJEA 1FRVA 1NQXA 4K9NA 1FU7A 4R0MA 4OX9Y 3LWBA 3JWJA 5B6IA 4JX9A 4GRDA 1VA4A 1Z83A 2PL5A 2E21A 3I32A 2PT5A 3UGJA 2ZT5A 3TK1A 1F8YA 2X5XA 1VM6A 2XCQA 3RNLA 3SQXA 3OQNA 3ZD8A 4ES6A 3VH4A 3B8EA 2DKFA 3FXAA 4RV5A 1VE1A 2RH5A 1ZJWA 5JO0A 3PTLA 1CIPA 2JHGA 2N0SA 1JA9A 1GPBA 3Q9UA 1CQJB 1UXOA 1HNNA 2JH9A 1H3EA 2O05A 1UBSB 3UK6A 3HRHA 1OILA 2Q0QA 3CUSA 1NPTO 3FWKA 3P27A 1KTIA 4YJDA 4MQ4A 4XDGA 3HXTA 4OHPA 1AKQA 4PXSA 1Y1QA 1FLVA 2XSZD 3LGXA 4AO8A 5CFMA 3WHLA 4A15A 4ETIA 1FTSA 5AVUA 4RMIA 2ON6A 2ZJ2A 3WRXC 3SC6A 2CHVA 3H4IA 1T15A 5BWBA 4LMPA 1KYYA 3QXXA 5F2OA 3NGLA 2CT8A 3EXAA 3UAOA 1ORWA 1LRJA 4UTVA 5E3JA 4S0XA 4PZLA 3W04A 2VK1A 4CYMA 4BGVA 1DO0A 2YNMA 4QAQA 4RTRA 3K5IA 3FETA 1N34B 4NJMA 2O0JA 1UJ5A 1YQ9A 5DEOA 1YACA 1EBFA 4LAFA 4LVUA 1JLRA 1OXBB 1WNFA 2EXXA 2O48X 3P7MA 3AJEA 3CQ9A 4YRBA 2R8ZA 4I55A 8ATCA 5EIBC 1ZHFA 5PNTA 1N7HA 1XZDA 3BMXA 3HUTA 2KS6A 3N6RA 4YB8A 4PN7A 3UPUA 5FUQA 1HG1A 4YR9A 1HLGA 2ZSEA 3I0NA 1ND5A 3GOQA 3OEWA 2ERCA 3BMOB 1JGTA 4C21A 4L5YA 4N3BA 4QUIA 2FNAA 4RTSA 3ZIUA 4OA5A 4KAJA 4B73A 4J0QA 1N3IA 1ZUNB 2Z4SA 3L7YA 4IKPA 4MP6A 4D8UA 1DWQA 1N33B 3QMPA 4YP9A 2C8JA 4QTZA 4YCJA 5EHGA 4H1WA 2G9ZA 1KK3A 1ZVJA 5AXBA 2GS9A 2CXNA 3NHLA 1Q95A 4HDQB 4IP0A 4JLMA 3R6GA 4OB8A 1GPYA 1TLFA 4I55F 1HK7A 3EY4A 3MINA 5EZ6B 4ECAA 5J5VA 4AECA 3D64A 1FE8A 1IDN1 1LNSA 1ZJZA 4I36A 2YX1A 3UZUA 2XKAA 4BUJA 4BE9A 4E03A 1BRTA 1X7WB 5IC6A 5B2ZA 3WAGA 4CRWB 3NH6A 1Z8HA 3DE3X 2I0FA 2AG6A 3RI3A 1GUZA 1NLMA 2HY7A 1KTVA 1NBOA 1NZDA 3KDSE 4G5XA 4P58A 2Q2QA 4WUTA 1E69A 3A58B 2RH4A 3ABRB 2GZ1A 1QKKA 1D2NA 4B4OA 3V7UA 2Z4TA 4OY3A 1T4CB 2FUEA 2VOJA 5JSZA 3EVBA 4U7GA 1LNZA 4YRRA 1P1KA 4QTXA 5KNBA 3GVCA 4CF6A 2HXYA 2C4TA 3HCFA 4KPUB 3GZJA 4FZRA 4OHUA 4QGBA 1P4RA 3MMPA 3B5IA 4WOKA 3L4SO 5CFZA 1DBWA 2Q6IA 4EABA 4QJBA 4D81A 1XU9A 4CMEC 1E4EB 4KXYA 3RADC 1BIFA 3IJEB 1PYDA 1W34A 4UUQA 5JMWA 2BKEA 1EWQA 2BP7B 3LY7A 4EMUA 1R8QA 2ZUCA 1RXCA 2BHNA 421PA 2BE7A 4YDQA 3IB3A 1GKKA 2FF5A 3K1JA 5C5IA 2CXRA 2LCIA 3S81A 4TTVA 1T1IA 1YR7A 3OKFA 4OHBA 4ZZ2A 1AZTA 1LLCA 2C07A 2D1RA 3C0KA 3IYLW 1AF4A 1Z22A 2A35A 3K8ZA 4EH1A 4KX3A 3F67A 3LUBA 1PR1A 4M46A 1IZ8A 2AFIB 3REOA 1VE5A 5AVJA 1VZ2A 2IYWA 2R4QA 1U3VA 4FGUA 3ZG6A 5F3WB 1X9IA 4G3XA 2O1WA 1VXOA 3MEQA 5IKMA 3RWBA 1SN7A 1P0CA 2XQGA 3VU3A 3IMKA 2OCKA 1NYLA 1T2NA 1NJ1A 1TCBA 3VPCA 1BD4A 2R6ZA 4BTEA 3I9MA 4KO1S 2O8EA 5HUJA 2C4VA 3CMMA 1J9GA 1J0AA 4GZ6A 5DWQA 4E12A 4ZYZA 3AF0A 1NMYA 2X6RA 4Q7MB 4OJKA 1GUYA 1U90A 4PFKA 2VFAA 2VDLB 3DQPA 4N3NA 4BNTA 4CMCA 5K7SA 2OV6A 4M88A 1BZYA 4J75A 2C2BA 3HSSA 5ES4B 3TDKA 1QZXA 4UOQA 3K73O 1EMDA 3CVUA 3A1CA 1Z15A 1SKBA 2BISA 3PNYA 2H18A 4LV5B 3MWEA 2CCKA 2P9GA 1DKPA 2GARA 2UVQA 3HDJA 3I9FA 2G28A 3DBHA 4CKEA 5K05A 3KL2A 4URXR 2WQZA 1ILWA 1BCSB 1PFUA 2QW0X 1N6NA 3D54D 5DGIA 5FOUA 1LPSA 5H4GA 2HHCA 1U81A 3BFPA 1DTSA 3OLZA 1XDSA 1KE1A 3SR0A 5IVDA 3JALB 2NTJA 2QTVB 4LXTA 3HRKA 4PTZA 5TQ2B 3RVSA 3SNKA 2R7AA 1JA0A 3CZPA 5C8ZA 1RCUA 3OPNA 2NXCA 3G8CA 1Y8CA 2QMEA 3H1EA 1QYDA 3FUWA 4DIFA 4J49A 3OLWA 3GW8A 4RE6A 1TQ4A 1ZPDA 3IR7A 3L8CA 2CJWB 3KSAC 2OGZA 5AOCA 2WPDD 3AR4A 1JWAB 4R98A 4F4CA 3OPYI 1E8MA 1H4QA 1HMYA 1DAIA 1PZGA 4TLAA 1IHOA 2ACVA 5AQEA 2X1VA 3X2SA 2VJCA 4NNPA 3ZE9A 3HL4A 3IH5A 2IGBA 4Q15A 5JS2A 2OUIA 4ZCSA 3D4NA 3KQUA 2AOUA 3OETA 4D0GA 5JI2E 3O90A 1Y9AA 2ET6A 1R4MB 4UPDA 4LSWA 2IH5A 1BMFD 3EFOB 1JSLA 3JQBC 1TA4A 4PZYA 1GSAA 1SUAA 2V7QA 1N5OX 4JOBA 2P9JA 4RW0A 2JIOA 3NDJA 5HCUA 1AJEA 1XNJA 2O8CA 1DXYA 1K4KA 3A05A 3BD9A 4IIGA 4NATA 5EE0A 2VXCA 5BR7A 4LJRA 5KB3A 1L4FA 2WUFA 3ZTWA 3NPMA 4P4SA 2X0DA 4AZ0B 1POXA 2IZOA 1GGVA 3BZUA 3OCZA 4KV7A 3KELA 3RSCA 2WM8A 2JA2A 3SD7A 3TZEA 1QO0A 2NXNA 2QY9A 3AJ8A 1XF1A 5JY6A 4NCAA 2ATIA 2Q29A 4RYDA 3GP5A 4TPKA 1KWKA 4H16A 3MTEA 3CG0A 3H5LA 1KFJB 3DL2A 1YBAA 2VN8A 2X8AA 3GLHA 4LRSB 5A6SB 2R6JA 4V2UA 3TFOA 3IP7A 3OT5A 4FCTA 4DQ0A 1GVNB 3B6ZA 1HZJA 4FE7A 5EE3A 4BTLA 3OCUA 3G7UA 5A06A 1YB7A 1OV6A 2RBEA 1OAOA 1U7XA 5ALXA 3V8RA 3VGJA 1PR6A 4E6EA 5K4HA 4NSNA 1W88A 3K20A 3WYEA 3MUFA 2F2TA 2RAUA 2X8JB 4D9MA 2FA9A 5AD1A 2P2DA 5KTTA 1ZM2A 3EZYA 5AKJA 1ECJA 4MV9A 1NRJB 3R5XA 1U8TA 2VPXA 4PSDA 3ETEA 1XE3A 4Q39A 1AHIA 4MLDA 1K9VF 1V8ZA 4PYMA 1ANKA 3DF9A 1SXJA 4YGXB 6ADHA 1ZNQO 1DADA 4QVGA 4LK3A 5G1PA 4AY3A 5JECA 2WJZB 5JW6A 1J0BA 3GRYA 4MQ6A 1DRWA 3EXG1 2Y68A 1IEQA 4QWWA 2FPPA 3DZCA 3HG7A 5E8RA 2R11A 3MTIA 1EDZA 2V6MA 4JBWA 5CPBA 2ZRNA 3RSFA 3OU2A 2OENG 3DMHA 4X8LA 4AJIA 2IQ5A 4DMLA 2IPAB 4WY2A 2ES4A 3DE6X 3TRDA 5JIBA 1F4PA 2QI9F 2B8EA 4IQGA 3TW8B 4FCWA 3TUZC 2PX8A 4FP9A 4HGRA 4MLZA 4F2WA 5LOVA 1H9AA 1PG2A 4QOGA 3AK4A 4X1IB 1A8HA 3V42A 1K7EB 3FN4A 4R71A 1NUSA 4PS0A 1CUAA 5FD8A 4BZPA 2M6KA 4BP3A 1H1LB 1PQUA 1SVLA 1KH1A 4FW9A 2CZGA 3B8HA 1ORIA 1PT7A 3LOUA 4HB3A 4MVJD 2QD1A 1VRVA 3RF7A 3VZRA 3ZIAA 4X1KA 1QIMA 3ZK7A 2IUUA 5KC9A 5LQJA 4MR7A 3WB1A 4KPEC 4GNKA 5A2GA 3MT8A 1QGDA 3MGAA 3OUTA 1DEOA 1JHOA 2YN0A 2CZQA 4HWRA 4QVIA 3D0KA 2JHFA 2Y4OA 2Q1TA 4FFNA 2HPAA 4PZAA 1VRWA 2AD1A 4KR2A 3G0CA 3WQBA 3C3YA 3ZQ6A 3IQZA 1C1HA 2PQMA 4M6WA 1GRCA 3OM8A 4XLLA 4A8TA 2RONA 4GOLD 5K0SA 1QQ6A 4UDNA 1SNYA 1VE3A 3EPLA 4ETMA 1GQ2A 3GDHA 4CM3A 3L4EA 5D3ZA 3QLUA 3JD4A 4X0EA 1RAHA 3VU1A 3WBJA 5I6DA 4OSPA 3UF0A 2A0UA 1U3GA 1KR2A 5CLFA 3L40A 2CJXA 5AJHA 5EWJB 3JQGB 5LU9A 3OZVA 2YJGA 1GV0A 1S7GA 3PYXA 4A36A 3GELA 3OBIA 1YA8A 5EJ2A 1P18A 2P1ZA 4L5JA 2ZE7A 1EUDB 3B12A 1B2LA 5C34B 1MD9A 1JVBA 2AEFA 5GVRA 3DVLA 4FGKA 3ORYA 1Z13A 2PZEA 2B9VA 3GFRA 2JG3A 4HDAA 3QX3A 3KVYA 3W5JA 4P86A 1ZMBA 3RSQA 3JZAA 4W1QA 1AGYA 1Y1SA 3N0WA 1P6XA 1S96A 2PKQO 2GZSA 3A26A 3ZXUB 1AMOA 2GPNA 3U3OA 3W8EA 3CVXA 5BSMA 3WIEA 1N2JA 4LOHA 4BKOA 3MJDA 4I14A 4ZVOA 4J0JA 5HJEA 2RE8A 2V8OA 2GA9A 4HZUB 3PWKA 1NX9A 2P79A 2IS4A 1Y4AE 2R25B 5A3VA 3NHBA 4C4AA 1B8UA 1TEVA 4PYQA 1X9HA 5B53A 2R9VA 3G59A 4AG3A 1CZLA 1EXMA 4L3VA 3RYIA 3AQ4A 4UJ3A 5AM0A 1JDPA 2EZ4A 4J4HA 4FNMA 2C9YA 1TVKA 5DB4A 4Z0HO 1KJ9A 1FNMA 3E03A 4HDMB 3G8YA 3T12A 4GR5A 3T7DA 5BXYA 2PKYX 5KVAA 5A04A 3QU5A 2W6QA 2YW9A 4O4HB 3HB0A 3OEED 3A25A 1VLZA 2AKAB 3OC6A 2G7MC 4UEKA 2BFBA 1ZNYA 3V7WA 1SBYA 2QPTA 4XE5A 2BMJA 3KJGA 2XLBA 1T9HA 1ZGJA 5DMXA 1HZZC 3PEVA 4IMRA 4C4SA 3OOEA 4QQFA 4L0MA 5K3CA 4B79A 4HDNA 4ALMA 1ZK0A 1CRZA 2EC5A 1GGJA 3ESXA 4QM6A 3LIPA 2PGDA 1G1AA 3BGWA 4ARAA 1SKYB 4GPD1 3V1UA 5EJ8A 3QMMA 1R0SA 1NVMB 3KWFA 4RZQA 2AF4C 5TS3A 4IHJB 3BMCB 3ZGVA 4R7TA 1ZQ1A 1QPGA 1SBIA 1DTEA 1I7PA 2C84A 3M70A 5DXFA 1Z75A 5BQPA 3PTZA 3WMGA 1TFUA 1UJMA 2REBA 3DV0A 3GNSA 4G07A 5KTNA 2PWAA 4XTCS 3T1NA 4PINA 1NR7A 1XNQB 4BJHB 1RRMA 2HX1A 3DHEA 4LXHA 2CVFA 3P2EA 3AB7A 5A5DA 1ADCA 2J08A 3HWSA 4IDOA 2J5XA 3R3WA 1OWOA 2QTZA 1JJAA 1EWKA 3RUCA 4OU4A 4LXXA 4MUXA 4R1UA 2HMVA 3ZBPA 1E6WA 4P36A 2CHUA 3VAYA 4I4CA 4DJJA 2E4ZA 9ABPA 5EIXA 3SQWA 2F8TA 4QASA 2ABWA 1MF7A 4ERNA 1GNSA 4JP8A 1G6OA 4CFSA 2Z08A 4EQ6B 3M3DA 1Z5NA 3VR6A 2ATXA 3H2SA 3R41A 3PEUA 1QH1A 4N5DA 2H08A 4DXDA 1RXYA 3AFOA 4HH1A 2YIJA 4JKIA 4EYEA 2ZXEA 1J2RA 1E9EA 1ESMA 1KJQA 3NAZA 2Z4RA 2PO7A 1EVIA 3FGPA 2D2VA 2ZR7A 4GT1A 1VBKA 1XCPA 1KQFA 3AYXB 2UUAB 3A06A 5EXPA 3LUPA 3FYSA 2GWRA 5F2EA 5LBUA 5DO9A 2IOFK 2F3QA 2WJYA 4KUHA 4U6NA 2Q7OE 4MIEA 4RPKA 5M7EA 4IUDS 1EBBA 1C3VA 3MD9A 5DTMA 2QLJA 4BPRA 4RETA 4DG5A 1U8EA 3AR3A 1VSQA 4HFRA 2IH4A 1II8B 1UFRA 1L5SA 3KKEA 3ESAA 4ENRA 4PRLA 2JARA 4H0CA 3H17A 4D3XA 2ZU6A 1HFJA 2DHEA 4BIIA 4XIJA 5CPFA 1CIJA 1UJ2A 4YMIA 4TM8A 1F51E 3C74A 3CPSA 4UJ5A 4CKYA 3ZQKA 2W83A 3ZVKA 4C7OB 1DDIA 4NCXA 1DC6A 3RB8A 3RFXA 3V4OA 4ND8B 1A98A 1XZ8A 1SJ9A 1PDOA 2W8BB 3QBDA 1M2VA 1U5CA 1BGWA 2J32A 4KYVA 5EXDA 3WWPA 1C8VB 4MA4A 2X3FA 3IODA 1NBIA 2YRXA 4TM7A 3SLGA 3ABSB 3P9CA 4WK6A 1VI5A 5JXJA 2X13A 1WSBA 1QB8A 1WMBA 2ZSDA 4FWIB 1ZZEA 4EY8A 2YWXA 4ZJZA 3D4PA 4NE7A 5LXTB 1JHVA 3DWFA 4RXMA 5FBHA 5JNRA 3IP9A 2BMEA 2OHIA 1EDOA 1KEKA 4C30A 1J21A 3ZD7A 4DN6A 1JEDA 4YS6A 3NEYA 2AWNA 2CBZA 1ZAYA 1HGXA 4S1TA 3RUFA 4CF5A 2DWPA 3Q9LA 3CKLA 2UUCB 1ULTA 3WLIA 3IQIX 5JATA 1O1YA 3N8GA 1UKEA 3CJTA 4Y1FA 2ZRDA 4DCJA 4EL5A 1ZXLA 4R8RA 4AL4A 5HDBB 4BFLA 2XTJA 2ZR9A 4URUR 3LZCA 2H9IA 3NEJA 4IBOA 2B0CA 3ZD9A 4Z2AA 2GN0A 3NBQA 1RBZA 1SZDA 1L9XA 1ZBDA 1K4MA 1CUVA 4ZHQB 5BP7A 4UTRA 5AVZA 3EODA 1X3LA 1JHAA 1JT2A 2X1HA 2FZGA 3C8HA 3DT6A 3F47A 3JPWA 2WMDA 3R0JA 4IEIA 4KVZA 5EP4A 2CXXA 3NTQA 5JRZA 3LRPA 4FYHA 5G0TA 3DE0X 4P9NA 2P2LA 5B2EA 1YZKA 3W9SA 3UJ8A 4RBNA 3KKOA 1Q0RA 4Q6WA 4Z0TA 1HY3A 2QSYA 3ETJA 2HC9A 4EJSC 4U8GA 4PZUA 4F8EA 1FUKA 1NFRA 3KE9A 3LUFA 3ZV3A 4EFKA 2DEUA 4BC1A 2D5CA 1XU7A 2ZQ5A 1G5IA 3RBXA 3VPXA 2WSLA 4J6FA 3T1TA 2AE1A 2VJMA 4URWR 1DJLA 5KVVA 1GM5A 3VR5A 2NO6A 1GNLA 4MKGA 2RGDA 2VQ3A 3T4PA 1RTKA 4B6PA 1NWCA 1ZO8A 3PKZA 5B4UA 3ICEA 1AE1A 2GYWA 1Z62A 3E8MA 1HXHA 2VHCA 3SZGA 1P3JA 3BC1A 3H1GA 1ODKA 1M1XB 2OLJA 3KJXA 3L6EA 1Z6PA 1OAKA 4RKQA 4TL7A 1W5AA 2O3JA 3GEDA 2CMFA 3RU9A 3DL7A 1N2BA 5KOJA 1JQ3A 3O8QB 4QGAA 3D2BA 2QZPA 5B57C 1FRNA 4Q7EA 3QBJA 4L50A 5JAOA 2BGJA 1G16A 2QRGA 3CJRA 3EZXA 1V7CA 4BX8A 3KYCB 1YHNA 3PQDA 5ALKA 1UBUS 1YFZA 2F1JA 1EFRD 3JWIA 3L77A 3RW9A 2XODA 2YRWA 4BLSA 1OASA 5GQSA 1KFKB 3UXHA 4NY1A 5CRIA 1Y8RA 1BH2A 3JAKB 3GUHA 2DERA 3THOA 2RHCA 1S9DA 5B3LA 4AZ3B 2I66A 3WL3A 1UAYA 5FCDA 1LFAA 2Q3HA 2P2SA 3SQOA 4NHOA 1GITA 5EWMA 3EIEA 3W4IA 3RS3A 3VYTB 3EVZA 1TF7A 3DTVA 5HUHA 1U0NA 2PS9A 2ZBVA 2QKYA 2BGIA 5C4IA 3KAPA 3DOJA 3PPVA 1CD5A 4YQFA 3FJYA 2XZTA 1OPRA 3NJ8A 2WU0A 5CH5A 5K0CA 4PC3A 5JTUA 3QV1A 2HI0A 3KXKA 5KNBH 4WCFB 2KBFA 5FWAA 1UH5A 4EYSA 4FMCB 4ZGBA 3NOXA 3G0OA 2XR1A 1P1FA 4FOSA 3MGGA 4GQAA 2Z09A 4M0LA 4Q1VA 1T91A 1ZJ5A 4Y2VA 1M6VA 2QRZA 2TRSB 4JK3A 3EAGA 5K8JB 2HWKA 3MHTA 4KQXA 1I7DA 1NQOA 4FGSA 2JLVA 2LXNA 4GKKB 4N3GA 5F7JA 4X66B 4OMFG 4QLBA 1DG1G 3PLNA 4M0FA 1QRSA 1G2IA 3IA2A 3P2YA 3L7AA 2DKNA 2IS1A 5EP2A 2R1TB 4OYYA 4L57A 3ILXA 1IWOA 1S1CA 3FWPA 2I4RA 4F85A 1X15A 3PXGA 4JCCA 1KGSA 1TFRA 4GXNA 1X1RA 1BEUB 2JZCA 3ENKA 4U5XA 1GAEO 2C3UA 1S6YA 5EIWA 3M9LA 3M82A 3W5UA 1DC3A 3NEAA 4Z9YA 4EMSA 5BVHB 1MHPA 4DCGA 2FOIA 5AFSA 2EW2A 3A6KA 1E2EA 2IA5A 2JJ1D 3OJWA 2IDZA 3HN6A 4OUDB 5AW0A 2GO7A 1TYAE 1M7BA 1JTFA 1I2AA 1D9ZA 2VRCA 4UU0A 3CNEA 2UYYA 3ZW9A 5BNIA 1JSRA 4RDXA 3LVRE 2ZM5A 3A36A 3PE4A 3ACBA 4HFJA 4JQCA 4Q18A 2A2ZA 1DX9A 5DYYA 1YZ3A 1Q12A 3WNQA 5K45A 1YA6A 3NM4A 1U0EA 3EVDA 3TR0A 1NONA 2DFVA 4FOTA 1IYZA 1AMUA 3EVCA 3R3VA 1KEUA 2YYZA 2GJKA 4OOFA 5BSWA 3GAFA 4DWOA 5IAGA 2GT1A 4PPFA 2H29A 2Q4BA 3M9XA 2QR2A 2CVPA 1F2TA 1BKDR 4RABA 3S2IA 1KFBB 2P6OA 1SFRA 3HSYA 2QE7D 4UTXA 1EK5A 5BMVB 3ECAA 2PVCA 3AHHA 4Y6QA 1E79D 1L5MA 4QG3A 1G3UA 4FN5A 5TQVA 3LF1A 2WP0A 4ZT5A 2HWYA 2JIQA 2C94A 3A6HA 1UP7A 3EIUA 2Y6UA 1SKUA 4O4LF 1R0CA 5CB4A 5ILQA 2OV2A 1AXEA 4HQOA 4IQFA 1XBTA 2WTAA 3MT9A 1T1RA 3NI2A 5DNEA 5CM9C 3NVAA 1FSZA 1G7SA 2AN9A 1N5JA 3S2GA 4BQFA 3L46A 4G1UC 4EB6B 4ABTA 10MHA 2VDJA 4DR6B 1X9GA 2WT9A 1NXSA 2DT5A 3GT0A 3HCEA 1RE0A 2QXYA 1PU2A 1OXXK 1X19A 3IBTA 4CKBA 2H4XA 1WXQA 1NQUA 3U3DA 3O7MA 2KBEA 2ATCA 2B25A 3R0VA 2XPCA 3TWOA 3F5FA 1XK6A 4XR4A 2WMOB 4KWIA 1T13A 3DZHA 4OM8A 3PLRA 2N75A 5EP1A 1THMA 1K7CA 1E3SA 2DVMA 3AJAA 3EXHC 2VNJA 3FVRA 5KUTA 4QO8A 3F3MA 5CB4F 2G9UA 4HOYA 4ZVSA 1Z4NA 2FUCA 4QM7A 2WIBA 5FBKA 4DXHA 1JFSA 3UWPA 4QT4A 1EUCA 1Z2NX 5DM70 3RK4A 1S0UA 5D2CA 4IW3B 5HM6A 2X6TA 1GTJ1 5KX5B 1I4DD 1JT9A 2OO7A 1KHTA 1V5GA 3GFFA 4B3IA 3TSOA 2X0EA 2JRLA 1FDVA 1ACLA 2O1SA 4GW3A 3AVTA 3KWMA 3ONWA 1BWPA 2G0TA 2Z04A 3CRVA 1KOLA 1JILA 3SC4A 3CFYA 2WDPA 4QYTA 4BQEA 4C7KA 4L28A 1YQWA 2QN8A 5KS2A 4JXZA 2P2NA 1XALA 1PI3A 4MZXA 1S2DA 4PWZA 5BSHA 3PC8C 1GUAA 2D00A 3RRXA 1XVLA 3NAQA 1T2AA 5K6RA 4Q9LA 4E4TA 2NUAB 3JD3A 4MRRA 3JQAB 1WBBA 1ZW1A 4LJYA 4LGMA 3ZQ4A 3TD2A 5C7OO 4YCSA 1VBMA 1J1ZA 3GC6A 4PSKA 4BRUA 5BSTA 5A0TA 1ZL0A 3MWJA 2BFDA 4AUMA 3KETA 1P4SA 1BKYA 1E3QA 3AERB 4IGKA 3SC2A 5DXJA 5JYBA 1HTTA 4E13A 4MWDA 2G1AA 1CIVA 1NJGA 2QJRA 4D26A 2OCAA 3K35A 3HEAA 3IDFA 3KKPA 2ZP1A 5K3FA 5FTWA 1UKZA 3IPXA 4X41A 4JLSA 4QL3A 1C8KA 3H9BA 1CY6A 1NI4A 2ISSD 2R0QC 4R1SA 2OP1A 1CS0B 1VDZA 1XXHE 4MYHA 1GR1A 4IXMA 1AH2A 3D0QA 4A1FA 2Z2KA 3NKFA 3RS4A 3ZN2A 4CM8A 4EJFA 3MQ2A 3JVEA 2B7BA 3ND7A 4OEHA 3PFNA 3TZKA 1JZQA 3HVKA 1JKJA 3G0IA 1YK1A 4R6XA 4X97A 4BV2A 2COKA 1PWXA 1O95C 1X1DA 2NTVA 2WJ6A 2X0RA 2EGUA 3A9VA 3COYA 3PDUA 4HDSB 5AVVA 2X0JA 4YBRA 1J90A 4YGYA 3ZDDA 1DEAA 4CDGA 2W00A 1RJWA 2Q6VA 1WQ1R 1MXFA 1YD7A 3NW9A 5K4AA 4EMBA 1T8TA 3GRAA 5DM2A 1WBJB 1PR5A 1Y5RA 4Q1DA 4EFDA 5K01A 2IY7A 2VS1A 4RVDA 4I5EA 4LBYA 3VZCA 2QVZX 2FSGA 2Q46A 2RCNA 2K2WA 4RJIA 1Q77A 2EHJA 1CUZA 1ZNXA 1X0VA 2X9NA 2YS6A 3E5MA 2Q3JA 4JJKA 4LJ4A 4UBIA 4FNOA 1USIA 1A9RA 5CUQA 4B74A 5CCBA 1N6OA 1TJ5A 1W5SA 2CFTA 3KKZA 1KMMA 2R79A 3Q7RA 4LC1A 1HI9A 1T5SA 1KEVA 3AX6A 3IO5A 4W1RA 2JK0A 1L5KA 1PJZA 4R2HA 3W8DA 1P3Y1 1B0ZA 2W2KB 3I58A 3ZXIA 2GD0A 4EHNA 3E22A 4ESHA 5BV1A 2GZRA 4EVSA 2ZRHA 4FYWA 4L6AA 4QBIA 4G4GA 3GJTA 2TMDA 3HY3A 3EEYA 2VAWA 3W8NA 4RYLA 4MUEA 4UFOA 2OG2A 5B6JA 3PUJA 2RHWA 5DASA 2NU8A 3QVTA 3IUYA 4OHYA 3UJAA 2HJ9A 3SOPA 3MGKA 2F90A 1AGXA 1TYCA 2IPOA 5ALWA 3BZBA 2JFFA 5HEKA 1P33A 5CDYA 1XCOA 1AZLA 5IUNC 4Z4EA 3M3HA 4D2IA 2FEAA 2JIRA 3FSJX 1LVHA 1ZH4A 1QQBA 2JLUA 4M7WA 4DV4B 2C7OA 1GLGA 2FMIA 3URKA 2CE2X 4JUCA 5FAKA 1U2PA 1SUSA 1RSZA 1HDIA 4YRDA 1GDHA 1W8DA 4M86A 4ZVLA 2BL4A 4DV5B 1D6JA 3FOAA 4R7GA 1I3OA 2JIMA 1SRQA 5CHYA 2VTBA 1G2PA 4WFQA 2GXQA 1AO3A 2WNSA 4HJRA 4JYPA 4N9QA 4QQKA 4PFJA 4C6HA 1F0NA 1IOVA 1KH2A 1W0KA 1B16A 1K1EA 2G6TA 2V97A 3P9ZA 4IDCA 4QARA 3X2FA 2EZ8A 2H1VA 2YVLA 3R5JA 3U09A 3K6SA 3WTBA 2FXVA 4W4TA 2X0KA 1XA3A 1BC5A 4QUHA 4RGQA 4YAOA 1ID1A 1R5NA 3DG9A 2N46A 1VGRA 3GHHA 3C7DB 1MG5A 4QLAA 3NATA 3UTDA 4I1SA 4N1AA 5JQGA 1C81A 1RXSA 2JEOA 3CZ4A 1HDXA 4B4UA 5KQPA 3IIEA 1E2DA 5F5LA 5JZ9A 1Z17A 5DBEX 1FZTA 3R1IA 3HV0A 3FGOA 4QWMA 2QUIA 5PGMA 3VTFA 4FS3A 5EUMA 2C8KA 2QD2A 3HFRA 5KVCA 1YB5A 3QJGA 4HMOA 621PA 4ZT2A 4UHKA 1JDNA 2CSUA 2OZLA 3VNSA 1H6BA 4J91A 1TJ4A 1KY3A 2ECKA 2KB0A 1VG9B 4FJ2A 3WGGA 3ZJ5A 3D31A 4HRVA 4EEZA 4BUCA 1R9MA 2Q1UA 1AKRA 2WHPA 3TPZA 3WBBA 4E1BA 1XHEA 1E9AA 2AR0A 1SC3A 1U4SA 4ZIRB 4KQHA 4H17A 1SCBA 2NV6A 4JKYA 1BE1A 4XB1A 1PT8A 1NUTA 3DLPX 2G17A 3H9CA 3F9RA 1XTKA 1C30B 4MVJG 4KBGA 3DE4X 5JQGF 4ZQBA 1IM5A 1QLHA 5GJWC 2YRFA 2JATA 4DOMA 3HMKA 4MDHA 4OB7A 1O8CA 4EFMA 1UMDA 1OIVA 1RI5A 1DHTA 1E64A 2OBXA 1KRHA 2KHZA 2P35A 3INNA 3LUJA 3TSZA 3ZDYB 4G01B 1C8BA 1NJ8A 1IONA 1E58A 3PUHA 3HGMA 1PFGA 2ORWA 4W6QA 2B7LA 1PGOA 2PH3A 1TW2A 2CDNA 1DKRA 1FX0B 1SBZA 1Y5MA 1YOVA 3PXUA 2ZTVA 4OHFA 4FSDA 4HFNA 5TPWA 1M0WA 1FQOA 3B1JA 4A6EA 1DOHA 3CY6A 3L9XA 3VR6H 1M33A 4PLCA 4RLFA 2C2YA 2Y1FA 2AN3A 3LLUA 4KWEA 1KDPA 2C4KA 5GWXA 2WKWA 4HVTA 3EPKA 3DVQX 1WDLA 1H8ED 1L7XA 3L79A 4LOIA 4WCVA 5GOTA 5HF9A 2W2NA 5KHLB 3W8RA 4TRRA 5LZ5A 1J7KA 1G3QA 1I3MA 1T9ZA 1DMSA 4QUDA 3SKXA 4AUKA 4X6YA 3WK9A 3JWPA 1EXNA 2HU5A 5FNVA 3B9PA 4DS3A 4RDIA 4IR7A 2O7NA 4NG5A 2BGTA 1CFZA 2HA7A 2RC5A 2ZUBA 5L7TA 2C2GA 2XLCA 5KTPA 1YQDA 4X9XA 3U39A 1AGNA 3H97A 1BVHA 5BVGA 2OSBA 1HTWA 4WNYA 5ER6A 2FPIA 4AP9A 2ZLBA 1VL8A 3AO0B 1AKEA 1MB9A 3R9XA 4GL4A 1IZYA 1YNOA 5EIHA 2VTDA 3CVOA 4HWSA 2IPXA 1VG1A 5JJCA 3AVQA 4XQCA 1A9XA 3FUTA 1U7UA 5KMGB 2A1UB 2VDPB 1YZYA 2RKWA 3QW2A 3SYLA 3F74A 1M6WA 1P4AA 3FDZB 3RS0A 1JG6A 2OD7A 4CUZA 5C32A 3CN9A 1NW7A 3DZ8A 5IAJA 1NNEA 4CLHA 1P0MA 5LQNA 2XA9A 3RTAA 1Y89A 1VB5A 2W2OA 5H68A 5U9CA 3UFXA 4AKIA 3M89A 4Z0NA 1DAFA 3CZ5A 3DDZX 3O4RA 3TIVA 5CNJA 4I4IA 2XOEA 3UAXA 5I47A 1GD1O 1XOIA 2QT0A 5DM0A 5HS6A 2CV0A 3RSHA 1QVRA 3IQFA 1JR2A 2KE5A 2WIGA 1XZAA 2XWQA 5EL0A 4DA8A 4JITA 2ZCJA 2IKSA 1U9ZA 4JVNA 4LZPA 4RKWA 4RSMA 4S1PA 3K71B 4JASB 1ZXXA 4Z9AA 4O08A 3EVEA 2WIKA 5IAAA 3TW0A 1EFHA 1JI3A 5IKXA 2WRZA 4CR8A 5A7GA 3BWCA 1WEHA 2FW7A 2XGMA 2C1EA 1G7RA 3DAOA 2LUOA 2I4IA 1OWMA 4Q66C 2PL1A 3GR6A 2QUZA 2VH2A 3P0FA 1T36B 5H8WA 3OE1A 1LQTA 4KZKA 221PA 2Q4TA 3FKQA 4DMRA 1EA5A 4YRGA 4Z3KA 1ZKMA 3U3MA 3O1JC 4KSBA 4F8JA 4WK2B 4NAHA 1CLUA 1U8FO 2I7XA 2QG6A 2RBKA 2XEXA 3EA5A 3IV9A 4DA7A 2BE9A 3H5AA 5ILGA 4YXWD 4DLLA 1IUNA 3PQ6A 3OJXA 4HG2A 2V6GA 3VR3D 2GPBA 1MEOA 5DOVA 3UWOA 1I80A 2JFXA 1XEWY 2Z3ZA 5CX1A 1H4TA 1VHQA 1KYQA 4RIGA 4LWOA 5F2NA 2HSJA 3WB0A 2I22A 2XB6A 3CRRA 3EW9A 1M76A 2X2PA 4DARA 1JRLA 5B12A 2XXAA 3VH1A 3M5PA 1P1RA 3DPIA 2AN4A 3UM9A 3NAGA 2VWPA 2H63A 3TCXB 1ZP6A 1T8RA 4Q9HA 3R7BA 2G71A 3GUZA 4UUNA 5D85A 3V34A 3W2GA 5IXJA 1J06A 1WD7A 3CF6R 2ZZNA 1Q6YA 1OYYA 5JQWA 4CG2A 3IQGX 4UHHA 2W70A 2XCUA 3W7BA 4DGQA 3V2UA 1E0DA 1O08A 4Z4QA 2O5EA 5JPDA 3C43A 3U0BA 1JIUA 5H5JA 2ZTUA 4MPDA 1KA9H 3TLBA 2GBGA 2ODAA 3UATA 1WSDA 2FMUA 2AZ4A 2YJ3A 1EA7A 3NBXX 4RIHA 4PIVA 1ZWKA 3SBXA 4RHUA 2XVAA 2B37A 4MB6A 2PMKA 4DLBA 1RRVA 2Q9CA 2BONA 1Z6GA 2UVPA 2BMFA 2VZ0A 2KQUA 1QONA 2AQHA 3RSGA 4AG6A 2P9QA 4BECA 5KTOA 1EFLA 4BFVA 2V7UA 1JLSA 4YRJA 2Z9DA 2G4CA 3TRKA 1EHCA 1UPFA 3T5AA 1PCXA 3OT1A 4TLCA 4ER3A 1TQ2A 4DCPA 4XWWA 1PN3A 4B3MB 1CQJA 2IHVA 4HTFB 1PKEA 3DDOA 3NWEA 1W93A 3B60A 2HADA 3K0SA 3I8XA 3URMA 1PQPA 3QLEA 4XLZA 3PPIA 5JFOA 4KPGA 1GG2A 3A04A 3ENVA 3OICA 1JDJA 4WJLA 4MS4B 4N0EA 2WD9A 4Z4HA