2Y6VA

Peroxisomal alpha-beta-hydrolase lpx1 (yor084w) from saccharomyces cerevisiae (crystal form i)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
379
structure length
351
Chain Sequence
QNRFKKETKTSASWPRAPQSTLATDRLELTYDVYTSARRSRTATRLNLVFLHGSGMSKVVWEYYLPRLVAADYAIDKVLLIDQVNHGDSAVRNRGRLGTNFNWIDGARDVLKIATELGSIDSHPALNVVIGHSMGGFQALACDVLQPNLFHLLILIEPVVITRKAIGPPDSPQIPENLYNSLRLKTDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKGPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWPPQNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPLQSSPQLTLEERAVMFDRAFDSFKNEALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PEROXISOMAL MEMBRANE PROTEIN LPX1
publication title The Unusual Extended C-Terminal Helix of the Peroxisomal Alpha-Beta-Hydrolase Lpx1 is Involved in Dimer Contacts But Dispensable for Dimerization
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 118
structure length 351
sequence length 379
chains with identical sequence B, C
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y6vA01
2Z8XA 4Y7DA 2OG1A 5KWIA 1Y37A 3G9UA 5HQ3B 2XQJA 1NU8A 2XQFA 4BCCA 4WJLA 2AJCA 2O7VA 2ONCA 3O0DA 2HHAA 4AB1A 5BWBA 4MYSA 1YASA 3DQZA 4UBIA 3A2NA 3CCBA 4Y2YA 2ZYSA 3AZOA 2HM7A 3FBWA 2RI6A 1CUEA 3ZI7A 5AKXA 5CXXA 2B4KA 2XMBA 3F8SA 5E4TA 1L7AA 2XLCA 2WQZA 2C0QA 2HA7A 1WHSA 3MVEA 4CG3A 5ALHA 3IURA 3K9BA 2HFKA 3F97A 2HA2A 1CEXA 3IDAA 3N0TA 4LHEA 3KSRA 4Y2SA 1QIJA 4ZXFA 4B81A 5ALUA 3ZV7A 4AO6A 3O9VA 1XZDA 2ZYIA 4CIBA 4E46A 3C6YA 2PX6A 4A5SA 4K6GA 5ALQA 1GPLA 5AO9A 2HL6A 1XQXA 4PO3X 1YA4A 2AJBA 4UBOA 4WFJA 2VJDA 1U65A 5LYYA 2JEZA 3F96A 2QOEA 1TRHA 3HZOA 2BJHA 2V9ZA 1TQHA 3DCNA 3PF8A 3GA7A 1X70A 4DMKA 2LIPA 2WJ4A 5A2GA 5ALYA 1QIHA 3ICWA 4WY8A 2P8SA 1CLEA 3Q0TA 3BXPA 5AHXA 1R3DA 1CUSA 1UFOA 1XZJA 4Y2UA 2BGNA 2RAUA 5AKKA 5K5EA 4LXIA 1FFEA 3WJ1A 4WFIA 2VJBA 4H7HA 1UKAA 3VJKA 4OU5A 4BRSA 3OC0A 5T4FA 3G0CA 5K3EA 2G5TA 3IUQA 2DSNA 5DTIA 5ALVA 4J0HA 4N8SA 4H7EA 4HS9A 1EDEA 2OGZA 2BKLA 4QDUA 4WCVA 4X71A 3I6ZA 4PV7A 1EX9A 4ZRDA 1R9MA 4MJ3A 1DQZA 4EB0A 4WY5A 4AO8A 3H2JA 4U2GA 4MXDA 3VVMA 4KE8A 4UFNA 5EIAA 4TVKA 3WZLA 5LZ4A 3CN9A 2XI4A 5HKBA 1YA8A 5K3BA 2CUTA 1MNQA 4A23A 4JNCA 2WHRA 3WKDA 1AMNA 2RHTA 4X90A 4QDTA 4YX9A 4H18A 5CH3A 5AKEA 4JH0A 1UK9A 3FLBA 4FLMA 5E4YA 4EY4A 4OPMA 4DGQA 5CT4A 1UK8A 1UOOA 3G8YA 1DT5A 3WKCA 3AIKA 4HTAA 1DX4A 3STYA 4G8BA 1LPOA 5LLSA 3DYIA 2DHEA 5CT9A 2CJPA 1AUOA 2FX5A 4C6HA 3QBJA 1XLUA 1N1MA 2GYUA 3FNBA 1QZ3A 2VAXA 3SC2A 3FOBA 5ALWA 5BV7A 3KDAA 4J0KA 4XJVA 4QWMA 1TCAA 1Q0ZA 4DMFA 5D6OA 3ESBA 2K2QB 5ALDA 1ZD2P 3FYUC 2OCKA 3PE6A 5JZSA 2OCGA 2EDAA 2XLBA 3GROA 2X8BA 5D3KA 2Y6VA 1XZAA 6YASA 4DNFA 2QJRA 5CXUA 5LZ5A 4X91A 2J3QA 2XMRA 4BDTA 4NZZA 1CQZA 4AX4A 5HF9A 2ZJ7A 3K2IA 5CT8A 5LZ8A 3LIIA 3FYUA 2OCLA 4Y2VA 1QGED 4V2IA 3D0KA 4OB7A 4G8DA 2JGIA 3VVLA 2WHQA 2OXEA 4P92A 1UT6A 3HJUA 4F21A 2WTNA 1TKRA 4INZA 3PF9A 1ORVA 2X5XA 5T4BA 4B80A 2XB6A 3VKFA 2ZVDA 2EEPA 4BATA 1A88A 3I2GA 4MEAA 3DDUA 5AKLA 4H0CA 2WJ6A 2XUOA 2VJAA 4DIUA 4BVKA 2XMGA 3W9BA 4FFWA 2XE4A 3M82A 5FXMA 5LZ7A 5AICA 2WIGA 3O95A 2WFZA 4N5IX 1FJ2A 2PM8A 1XZKA 4B7ZA 4B0PA 1P0PA 1AURA 3DYVA 1P0IA 4H7DA 5DNVA 3AUKA 4C4XA 4YK7A 1AZWA 5AKYA 2QR5A 2RIPA 3AZPA 1E5TA 2C7BA 3OM8A 3UMJA 3M81A 4NMWA 5AIBA 3G0BA 1YS2X 3FLAA 5JAUA 1JMYA 1TCBA 4K6HA 2XUJA 1FFDA 1UKBA 4P08A 2XUAA 1CUUA 3C8DA 3EIOA 4BAUA 4Y2XA 3BIXA 3R3UA 4BZZA 3OG9A 4BRZA 1J1IA 4KE9A 5JAPA 1FSSA 4CFSA 3G9ZA 3C6XA 4J0DA 2VT7A 5IH7A 4ZV9A 3CXUA 4BTLA 3JW8A 3R3XA 4IO0A 4RGYA 4GECA 1LPAB 4H35A 4Q1VA 2EDCA 5D7BA 5AK4A 2CMFA 2G4LA 3D2CA 4KACA 3SK0A 1DWOA 1DWPA 1QIEA 1XRMA 4C89A 4Y9SA 1B6GA 4QZVA 3U1TA 5CT5A 1LPPA 1DQYA 4N8DA 5ALZA 3I2HA 2I78A 3QMVA 5CH8A 3WK4A 1HPLA 3FLEA 3H1BA 1F8UA 4OSEA 2VJCA 4KR0A 5JD6A 3F9CA 4QE3A 1W75A 3PI6A 5EI5A 2BCEA 1U2EA 4B9AA 4CCWA 4Q3OA 2B9VA 1W52X 4LYEA 2JBWA 4KE6A 1T4MA 3H0CA 1CV2A 1EHYA 3C5VA 4DMHA 2Y6UA 4GBGA 3IUNA 4I4CA 5AJHA 1QIDA 1DINA 1MTZA 2ACKA 3FCYA 3WYNA 5JASA 3FYTA 3FVRA 3T4UA 3H19A 2QMQA 1E8DA 3H2HA 2WM2A 4FHZA 3STTA 4W9RA 3DL7A 2V96A 2JF0A 4BTVA 3KWJA 4BE9A 4OB8A 5D3ZA 1K8QA 4ZWNA 1CUXA 3TJMA 1JT2A 4EY5A 4N5HX 2FJPA 4EY7A 4EHBA 2WUDA 3NUZA 2XMSA 2PBLA 5HCUA 1YR2A 1EVEA 3DOHA 4C87A 2XUGA 4IQ4A 1DX6A 5EIEA 4H7JA 1MAAA 2XMQA 1JU4A 1DU4A 1UKCA 5DWDA 5FOQA 2WUEA 7YASA 3WWOA 2OCIA 5YASA 5ALNA 2PUJA 1CQWA 4AXBA 1C4XA 5AOAA 1XLWA 2XUQA 1BN7A 2VF2A 2XT0A 3KD2A 5AK6A 5AKJA 1H22A 3S2ZA 1IUNA 4DSAA 5AOCA 2XQKA 4U2CA 4OYYA 4FFVA 1D07A 1H2WA 5AM3A 1FFBA 1E66A 1ZGCA 4L3WA 1LZKA 5I9IA 1YS1X 5ALRA 3I2IA 3BF8A 2HA6A 5J3JA 3BDVA 3WK7A 2PU5A 2ZYRA 3FSGD 2HA4A 5FPPA 2J4CA 1E3QA 3WA6A 1MX5A 1YAHA 1VA5A 4QEKA 2XUFA 2Z3ZA 5CMLA 4IH4A 5FV4A 1LBSA 4J03A 1MX9A 1N5RA 2ZSIA 4PF1A 3R40A 5CT6A 1U8EA 3SWWA 2J3DA 2AJDA 1MAHA 4LYDA 1CUWA 4D9JA 4X92A 4B9EA 4HXGA 1XZCA 2WUFA 3EQ7A 4L72A 4RE6A 2H9YA 5AK5A 4EA6A 3STXA 2CB9A 2PUHA 2W22A 3WI7A 2I3DA 4ARBA 1XROA 4B84A 3BJMA 3H2KA 2JGMA 4NVRA 1BCRA 3WK6A 3FCXA 1UOQA 3IA2A 1I6WA 4I3FA 4PSUA 1LPBB 1ZD3A 3JYHA 1OXMA 2HDWA 1PJAA 1GKKA 4QLOA 5CRIA 2QTBA 4AMYA 1YSCA 4BBZA 4EUSA 4FLEA 4HZGA 2GBGA 1CUIA 3RKSA 2PL5A 4QDXA 3ZWQA 3QVMA 1X2EA 1YB7A 3DLTA 1BCSA 3A6ZA 1QE3A 2WSLA 3VXKA 2DCMA 1ODTC 5AI5A 5A7HA 5AM2A 2ZSHA 1CUVA 3B5EA 5CH5A 2CZQA 3AIMA 3E3AA 3BE8A 3CCCA 1IUOA 3E1GA 3WIBA 2B61A 2VAVA 3HXKA 3MUNA 1QJ4A 4H77A 5AI0A 2WKWA 1Y7HA 2RHWA 2PKYX 3WLAA 2I3ZA 2WIKA 1HKHA 4GEGA 1HBJA 1AKNA 5CURA 3GELA 1A8UA 5SYNA 2WILA 1JFRA 4AN1A 4A16A 1A8SA 5HK9A 1BEEA 2C0PA 4KAAA 1ZJ5A 3T52A 5DNWA 3MUOA 1KU6A 1K63A 3ESAA 3IULA 3HACA 4G5XA 3P2MA 3C8HA 5K3CA 5LKRA 2ZJ6A 4DSZA 3QITA 3HLKA 1RP1A 2QKYA 3DD5A 2HU5A 1FFAA 4Q34A 1OCEA 1R9NA 2PSJA 3H17A 3E4DA 3BJRA 5LIPA 2DFPA 4W1PA 2DQYA 3HI4A 3ZPXA 4UFPA 4ZGBA 4FMPA 5KBYA 4J0IA 3I2FA 2JGKA 1K4YA 2PVSA 3LLCA 2WIDA 1GZ7A 1LGYA 1QONA 1XZGA 1UWCA 1SFRA 2HRRA 4XIIA 3WL5A 1QO9A 1EH5A 1ZOIA 1LLFA 3AILA 4Q05A 5DNUA 1ISPA 1IZ7A 4WDQA 3VDXA 3AZQA 1CUYA 3IUJA 2XUIA 3W06A 4DNOA 1J06A 5AI8A 4HXFB 1MT3A 1ETHA 3PDCA 4KAFA 4HRYA 5I7UA 2B20A 4LKOA 3F67A 1HQDA 2O2HA 4LIPD 4HXEB 3WL6A 4L9AA 4UFOA 2GYWA 1HLGA 4QLAA 1XLVA 1LBTA 4KJXA 3ZLVA 4W1RA 5LP1A 3HC7A 2PSHA 5F4ZA 4UUQA 1DWQA 2O2GA 5EHZA 4EY6A 2BAGA 3R3ZA 2CBGA 3N2ZB 1EDBA 1VLQA 1A7UA 1SC9A 2JGFA 4EY8A 4U2FA 1O6GA 4FWBA 4FNMA 4KRYA 2Z8ZA 4JYPA 2VT6A 2I03A 2IIVA 1IMJA 2YXPX 1F0PA 4MWTA 5FP0A 3WWEA 4M0MA 5K3AA 4C4ZA 1WB6A 1ORWA 3G0GA 2FUKA 4J3JA 2BGRA 2QUBA 3WMRA 1CR6A 4BYMA 1LPMA 4GXNA 3U0VA 4W1SA 4U2BA 4OUKX 4Q3KA 2XQGA 5AKGA 2IX9A 3WA7A 3M83A 1WM1A 3C87A 3TEJA 3BIWA 4GI1A 4UHBA 2DR0A 3TRDA 2XMCA 4AZ3A 1XKLA 2WG0A 5HKAA 4BCBA 1TIBA 2C58A 3V1KA 1W6RA 2ZYHA 5ALLA 3W2TA 1QTRA 1R4ZA 2D5LA 4IH1A 1ODCA 4Y2PA 4HRXA 3ICVA 2Y2VA 4OYLA 4RPCA 5FKJA 1MU0A 2QJWA 1XZFA 2WJ3A 4X7BA 4UHEA 2Y2UA 1K6EA 4UBJA 3PFBA 3G0IA 2CKMA 2VEOA 1AX9A 1QIMA 4KAJA 3C6ZA 3O4GA 5K3FB 2Z5GA 2DQZA 5EGNA 3DEAA 4KEAA 3BWXA 1L7QA 4M0EA 1W1IA 3RK4A 4Z49A 4ZI5A 3B3QA 5JIBA 1MPXA 1THTA 1G42A 3D2BA 3QPDA 2UZ0A 3WKEA 2GBIA 3VJLA 3LCRA 5E2IA 1XZHA 1XRPA 3GBSA 4J0GA 3QMWA 3WWDA 4NS4A 2QZPA 1CFJA 2V98A 2JIDA 3WZMA 4JUIA 2XMZA 4G9GA 4Y2TA 4F0JA 1MJ5A 3S8YA 4BZWA 4EBBA 2ORYA 2RONA 1XZBA 2BUBA 3QPCA 2QXTA 4IHAA 3WKAA 1UK6A 2WIFA 4G8CA 5AKHA 2H1IA 4ARAA 2JGLA 4XWGA 3KOOA 4E14A 1VKHA 2WFLB 3G0DA 4DM7A 3M3DA 4Q3LA 1ZIYA 4FOLA 5ALXA 5A6VA 2ACEA 4CIAA 3FSGA 1XZLA 4XX1A 5AKZA 4X6UA 2QXUA 1XRQA 2G63A 3ED1A 1E8MA 5ALPA 5AI6A 1WCYA 3FYUB 5SYMA 5AH0A 5EHNA 1NU6A 2HFJA 4FLFA 3AFIA 3D3NA 4B85A 4W1QA 1IUPA 1ZI8A 1CUHA 1GGVA 4MQMA 2QVBA 2BFNA 4UHCA 4XVCA 5C8XA 1EINA 3V1NA 1XZEA 2ECFA 2G5PA 1R1DA 1EB9A 4UHFA 2R8BA 5IVDA 5ESRA 2PSEA 1FFCA 3D5EA 1F6WA 4JYMA 4X6YA 3RM3A 3DNMA 1ZI9A 1CPYA 4G4GA 4MWSA 4UBNA 2RGUA 1T2NA 5JARA 2VA9A 5LZ9A 5JD5A 2QUAA 3RARA 3DS8A 3R0VA 4M0FA 4CI9A 3W9UA 3TGLA 3FAKA 3RLIA 5CBKA 1CUDA 5JYCA 3V9AA 5AM1A 1BE0A 3QMMA 4UPDA 3ZLUA 5AOBA 1TK3A 3A70A 3YASA 4QA9A 3OURA 5HQ3A 1JJIA 1JU3A 1BU8A 2YH2A 2AJLI 3ANSA 2XUKA 4GWLA 5EHXA 1GQRA 1THGA 2H7YA 5DTJA 4B82A 1GKLA 5T4HA 4JEIA 1G4HA 3EBLA 1ZIXA 1XRLA 1JKMA 4UBKA 3OTQA 5FLKA 3ILSA 3L1JA 3ZLTA 1ZJ4A 3V1LA 3WYDA 5HFAA 3UUEA 4X93A 2WHPB 3IB3A 1B41A 4WFKA 2R11A 4W63A 3WK5A 4KE7A 3AIOA 1QIKA 3I2JA 2Y1KA 5JANA 3IBTA 1QOZA 4G1FA 4FTWA 3O4IA 1KU0A 1MN6A 5AI4A 1DTEA 1SCKA 4ZV7A 4TPKA 1CUAA 5ALGA 1WPRA 1CUFA 4B6GA 5IVIA 2AJ8A 1E8NA 3EF3A 4Q82A 1GPNA 1ZD5A 1ZD4A 5ALFA 4X6XA 1ZI6A 2ROQA 3HRHA 3QM1A 2FJ0A 3I28A 4BP8A 5AM0A 4Y2RA 4BC0A 3ESDA 1H2YA 1VOTA 5BWCA 5JZBA 1ZICA 4OCZA 1LZLA 3A2LA 3EQ8A 2QT9A 1VE7A 3IIIA 2QM0A 3HYSA 5C8VA 5AP9A 1QO7A 1GXSA 4OD0A 1SCQA 1QIIA 4J7AA 5AIAA 4AQDA 4QDOA 5T4EA 2O7RA 1GT6A 1H23A 2Z3WA 4B0OA 3WIOA 3L1HA 4MQLA 2D0DA 1XQWA 2GZSA 1G66A 1BEZA 3BL8A 2WG1A 3H2IA 3G7NA 1ACJA 5HK8A 4YASA 5JZ9A 4AZ0A 1YAJA 4E11A 1UK7A 5AKIA 1WPXA 1XRRA 1A8QA 3C45A 1J07A 2NW6A 4K5QA 4BCDA 1UOPA 1AC5A 3L1IA 5AI9A 3ANTA 2OAGA 4ITVA 1GPKA 3GUUA 3IVMA 1CIJA 4TGLA 4BVJA 4F60A 1EDDA 3GFFA 5A62A 4FBMA 4Y2QA 3H18A 4F5ZA 5LKAA 1MO2A 2GBCA 1VXRA 2W6CX 4UHHA 4LXGA 3WJ2A 5LZ2A 1Z68A 1X2BA 4ROTA 1TCCA 4AMZA 2VSQA 4GDMA 1QFMA 1RYYA 5AM4A 4L0CA 1LNSA 1ACLA 3W05A 5JAOA 1ODSA 4X3CA 1NX9A 3D2AA 1L7RA 2YYSA 4U2EA 2WIJA 2VQ6A 2WU4A 4X97A 4OU4A 5K3FA 3WK9A 5HZGA 4EZIA 3PFCA 4J0JA 4BAZA 5C7YA 1O6FA 2PPLA 3KXPA 3WL7A 1SCIA 4DNPA 2C5FA 4ZREA 4E15A 3LP5A 3D4LA 1UXOA 3FVTA 3G9XA 4CCYB 1CUCA 1Q84A 3OPMA 1K5PA 1XQYA 4X94A 2E3JA 5C81A 2JGJA 3O4JA 4GHWA 3X3HA 4P93A 3FWHA 1Q0RA 1H2ZA 4Y2JA 2ES4A 4KRXA 4DLNA 5DJ5A 1VXOA 4BAGA 4BC1A 4DYHA 3SX4A 5K3DA 3R3VA 5AM5A 5ALEA 3DL4A 1VE6A 3QH4A 4UBLA 4GLBA 1MX1A 4PSCA 2ZJFA 1PFQA 1W76A 4WDRA 2WFLA 1VZ2A 5FUMA 3NGMA 2XUPA 2C5GA 2OGSA 2VTVA 4AO7A 5IVKA 1WOMA 1OILA 3STUA 1P0MA 1BN6A 2HU8A 2PSDA 5JAHA 2OGTA 1QTIA 3I1IA 1AGYA 5E4JA 1M33A 4N8EA 5H3HA 1JJFA 3DKKA 3JWEA 2JEYA 5HF5A 2BUCA 3G02A 4C88A 5JADA 2WU3A 4I19A 4UHDA 1DT3A 4MYDA 2VATA 3MGAA 4HAIA 3BF7A 5ALTA 3IUMA 1HL7A 3STWA 2OQVA 1S8OA 2XUHA 4G9EA 2OPHA 3CN7A 1XFDA 2JGEA 1TAHA 3QZUA 1JI3A 4PSDA 3D7RA 1R88A 1P0QA 1QIGA 4C4YA 1YCDA 1EA5A 3O9MA 5JATA 4CG2A 5ALIA 5FDFA 1SOMA 3WL8A 4P9NA 3OOSA 1ZGBA 1CUZA 2OAEA 4S0XA 3W04A 4QNNA 3KWFA 5JD4A 5CTAA 2V97A 5DYTA 1QLWA 1U4NA 2OLEA 4GW3A 2X76A 4X85A 4X95A 1EVQA 4AN0A 2AXEA 4FNGA 3WWPA 2IITA 1MNAA 1XZMA 4FBLA 5HF8A 5DYWA 2XDWA 3V1MA 2GBFA 3C70A 3O4HA 4RNCA 5EHQA 4QDZA 1VJ5A 3NOXA 4PW0A 3I6YA 1BS9A 3DJYA 3EQ9A 3PUIA 2H7XA 3I6MA 2OQIA 3VISA 2WHPA 1CRLA 1JMKC 3B12A 1EI9A 3DKRA 5EFZA 2HRQA 5ALOA 2GZRA 1EXWA 1RWQA 3C43A 4BVLA 1BROA 2BUAA 1EB8A 1IZ8A 2HA3A 1EK2A 1CVLA 3C6BA 3UUFA 1F0NA 3H04A 3E0XA 2WLSA 1H2XA 1R50A 3ESCA 1USWA 3DOIA 5I8PA 4YPVA 4CG1A 3LS2A 1C7JA 5ALMA 3AJAA 4KYVA 4UBMA 1WHTA 2WFMA 3PICA 2XQIA 5BOVA 3R3WA 3Q8WA 4DMCA 5KREA 4MEBA 3QPAA 4K6KA 5ALKA 1EK1A 5IKXA 3HEAA 1Y7IA 4B83A 2HU7A 3NWOA 2HADA 2QRUA 1C7IA 4FKBA 4X00A 4BB0A 3WQHA 1XKTA 3STVA 2WG2A 5A7FA 3QYJA 1G5FA 1XQVA 5EIHA 2CEKA 3R41A 2YASA 1N5MA 4BDSA 2DHDA 5HFNA 1CUBA 3HABA 4PNZA 5ALJA 4H7KA 3R3YA 2GYVA 4J0CA 2WUGA 4LXHA 4U2DA 3G9TA 3HSSA 2HA0A 5KWJA 5FRDA 4FDMA 5A71A 5ALSA 5CW2A 5HF6A 3V48A 4K2AA 1QIFA 5C8ZA 1XZIA 4DNQA 4IH9A 1CUGA 1GQSA 2PSFA 1JJBA 1W4LA 1J2EA 4ETWA 3K6KA 5JALA 2PU7A 3F98A 1IVYA 3WWCA 4BE4A 2HIHA 3I1YA 4RE5A 3WKBA 3H2GA 3PUHA 5IVHA 4HVTA 3WK8A 1HDEA 3C5WP 5AK3A 3D59A 4H7IA 4PQEA 1UZAA 5A7GA 3GZJA 3LIPA 5DLPA 1LPNA 1KEZA 5FPQA 4C01A 1QFSA 3BDIA 4BP9A 1VZ3A 3AINA 4G4JA 1AQLA 2C4HA 1WB5A 5DYYA 1BRTA 2O2IA 4DTCA 1VA4A 4G4IA 2XUDA 3A2MA 4QWWA 2H7CA 4OB6A 3H1AA 4H7FA 2HA5A 2J4FA 4CCYA 1YB6A 1XRNA 2Q0XA 1PV1A 5ISMA 1LPSA 1N8SA 1CUJA 1WB4A 2QS9A 3I2KA 2XMDA 4O08A 1E89A 1Q83A 2WTMA 3VJMA 2DHCA
chains in the Genus database with same CATH superfamily
1QFJA 1ZL0A 2B1GA 2D1SA 3NT5A 1Y37A 3FOFC 2C77A 5EVJA 2CNBA 1X1DA 1ARZA 4HAUA 5AYVA 4KW7A 4DPLA 2LNDA 3BB3A 3TZEA 4OHMA 1OGJA 5IYZF 2EKLA 1YCGA 2ONCA 3GRUA 3HYCA 5FNVF 5JCPA 1YASA 4B48A 2Q2VA 2XGJA 1A9XB 1R4AA 3AUAA 5ELMA 3VU3A 4EJ0A 3D8RA 4DDMA 3GPLA 3OU2A 3CCBA 1GY8A 1E4VA 4JLSA 2ZYSA 3AU8A 4TZTA 1G3IA 2HM7A 1HDZA 3AZOA 4I66A 3FBWA 2Z2JA 5KS2A 2YHSA 2REBA 2TMYA 2VF5X 2WU8A 5FA6A 2B4KA 2XMBA 3I0ZA 3ZWDA 5KNBD 1L7AA 2XLCA 4KOAA 1K7FB 4CW7A 1XCGB 3T5BA 2ZUDA 5E95A 4I1OA 1BYIA 2QRLA 2O8VA 3LFUA 2FZKA 2AN3A 4QQ8A 1H8ED 1YUMA 2L69A 3HA7A 4FS3A 1TQDA 2YJTD 4RIFA 3H9CA 4ER0A 2R1ZA 4D9MA 2UYYA 4Z7JA 4K3UA 1VRVA 1E9AA 1FE8A 5EP4A 4P0QB 4MEJA 4FGZA 3UTDA 3VHXA 1AK2A 3KSAC 1T8UA 1XCOA 3RROA 1O6CA 1SQ6A 2QL6A 1MB0A 3C3MA 3HI6A 3QPWA 2OCBA 4GKBA 2HA2A 3M2TA 1BWSA 4J0FA 4XGRA 4Q3DA 3FBTA 4XR4A 4ZD6A 3IEKA 4R2KA 5KI6A 1PJ8A 3KSRA 3THRA 1OQAA 1QIJA 1ESEA 4N3GA 4ZXFA 4B81A 1WDTA 1ESMA 3ZV7A 4AO6A 4AKIA 4UM9D 1FX0B 1T6NA 1UZMA 2GPTA 2I6UA 2P4HX 2NXNA 1NLFA 3LPAA 3PZRA 3ROEA 3H9GA 4BRUA 3AHIA 3BFKA 1XZDA 2VEDA 3RAGA 3LGSA 2OB2A 2ZYIA 3K7EA 4Y3UA 3ENVA 2FR8C 4W5HA 3W5IA 2FGKA 3CSUA 4FFBA 3GT3A 3NC4A 5CGQB 1R16A 2C42A 1U2GC 4HJXA 2SKCA 1P9NA 1AHIA 2EYQA 3LUCA 3PUZA 3VNSA 3A6DA 4QNRA 4QPPA 2X0RA 3TZBA 2HL6A 1XQXA 3GRVA 4EL0A 2Y8EA 4DV0B 1YA4A 4R8MA 5L51A 4LTNA 1EFDN 3QA3E 3HJBA 4R1NA 4RA9A 1B0AA 3RTGA 3ZD9A 2NPOA 2GYYA 2A5GA 2RFLA 1SUBA 3JATA 4PZAA 4JSYA 3JCZA 4KX5A 1ISRA 3WMGA 1PR2A 2VDMB 1OXVA 1N0HA 3P26A 4OQDA 1SUAA 2JEZA 4BNXA 5F7OA 1BW9B 3TIFA 2QOEA 4CU5A 2FR8A 3ZE8A 5HCIA 3QG5A 4AUMA 2X9VA 1USGA 1DMSA 5DNCA 2BJHA 2V9ZA 1TQHA 4HVAA 2IIPA 2Y1GA 3GA7A 1BIFA 4V3BA 4ZVMA 3WTBA 3I01M 3IIJA 1G2PA 1RI1A 2QVCA 1PL0A 5FYDA 1ORRA 1YD7A 2I3BA 3T06B 2ZJZA 2V7TA 4LDPA 1Z5WA 3TH5A 5KC9A 1UMBA 1WWKA 2BDTA 5ALYA 2PSSA 4O8CA 5E2AA 1RLOA 5AW9A 3S7ZA 1DV1A 1J2TA 3W7VA 4N1AA 3GGGA 1FOEB 1T9HA 3AF2A 1TYZA 3C3AA 1Z15A 2WVAA 3H9JA 4X62B 3Q0TA 1USVA 2BFMA 3NWBA 4R68A 3L6CA 5F64A 5IAOA 2HOQA 2JH9A 3SZMA 5AVWA 2PUDA 5AHXA 3VPFA 4AM8A 3WGYA 1R3DA 1YB1A 1EFPA 3LY5A 4XB2A 3C1TA 3U39A 1JB9A 2WSSD 4MIKA 2R5WA 2X2OA 4JL6A 4RWZA 1XNGA 1XZJA 3I5UA 3NNDA 4MKRA 4Y2UA 3ROGA 4D44A 4ECAA 3GRZA 3B6JA 5BWLA 3Q9NA 1LK5A 2QTVB 5K5EA 1U2PA 3T1OA 2BMWA 1TA9A 2JCBA 4Q12A 2QX9A 4DBVO 5KOJA 1IOLA 1FFEA 4M0CA 3K53A 3WJ1A 1YRHA 2VJBA 3QMPA 1REQB 1W93A 4KGDA 3RWMB 3VJKA 3PRYA 3JVIA 1JWLA 1PVOA 5JECA 4ESHA 1I8TA 1G6HA 6GPBA 1E2FA 3I4LA 1PJ3A 2P65A 1SELA 1QVWA 2G5TA 2GCGA 2ZSJA 4KBFA 3LA8A 2XZLA 4IXDA 5ALVA 3PJFA 5KQPA 4DJDC 4MMYB 2BGMA 4H7EA 5E6UA 2C7QA 4NESA 2ZKLA 3INYA 3KE8A 2R6JA 1PVVA 1JQJC 4I1YA 5I48A 3IIEA 1GRCA 4NV1A 1H0HA 2GEDA 1FTWA 1IB6A 3R9XB 1U9IC 2QN6A 1L4BA 3PDIB 1MQSA 4HDMA 4JNKA 3U4DA 1CEEA 4F85A 3OHMA 1YZHA 3GGPA 3K0CC 3I6ZA 2OM6A 2C2YA 3T0IA 3THXB 2IYYA 2HKIA 1KJQA 1MH1A 2WZBA 3AFHA 1OWLA 4LZNA 1IAVA 4K40A 1KP3A 4M0DA 4ZT5A 4V02A 4WY5A 3V4OA 3H2JA 5DIFA 2ZRLA 5AVYA 3ESXA 4U2GA 1HE1C 1E9CA 2HSDA 2YWXA 4PS0A 2KW5A 3UAGA 4H59A 4LFBB 5L4SA 4MXDA 4REQA 1QF6A 2EX1A 4IG4A 2R7KA 3QBDA 3HYRA 1AUPA 5EIAA 2IGTA 1BWRA 3ETCA 3QKRB 2VWPA 4LNHA 3CN9A 1U9IA 1YOVB 2F1HA 2GRUA 1DBIA 3FI9A 3QUCA 2EIXA 2Q5FA 4MQEB 1E2BA 3IAM6 3URMA 3K0CA 3L07A 2GEJA 3NRBA 3PUWA 1GT91 1Z5ZA 2O0KA 2MMCA 4PWYA 5H4GA 4WZBB 3MHTA 4OP2A 3A1UA 1MNQA 4JKYA 4QKQA 2AQ8A 5TQJA 4HZUA 4JNCA 4O3FA 3VTKA 4IHJF 1IMOA 1YL5A 4X90A 5H68A 4LZJA 2OVBA 2O8NA 3RC3A 3CM0A 3OUZA 5EXPA 5K0SA 3P9KA 1M8FA 3D8NA 4LX8A 2QORA 1TF5A 5HM6A 1YT5A 2H1SA 1XDZA 4JY7A 3FLBA 3TDNA 2FEOA 2QR3A 1SXJC 2A84A 2AMFA 2WZDA 5E4YA 1VHTA 1NIPA 1SY7A 2P7HA 2YHBA 2YICA 3GNTA 4YQEA 4YMVA 5K0JA 2IEBA 2NT3A 3ON5A 2REQA 1V8DA 1WL8A 2B7LA 2NZUG 1UXIA 2UVQA 2QLNA 4U8HA 3W5VA 3SZ3A 4YMLA 4RQTA 1E1MA 3A28A 3G8YA 4EGSA 2OD2A 3Q2OA 5LL6P 2PUEA 4DADA 5C5DA 1YFKA 5KYTA 1O77A 1NJFA 3B6ZA 3LDAA 5IAEA 4BMVA 5JZOA 5LWHA 1DT5A 1WXQA 1X8LA 2CCJA 1T0IA 4RTPA 1KEKA 1G1MA 4G4SO 5DBIA 3ZXSA 4JJKA 5LP6F 4IVPA 4EO9A 1O9HA 4FIZA 4CLOA 3G0HA 1SXJA 1JLLA 3S44A 2RGNA 1EMDA 1CY1A 5C31A 3RHZA 1E3MA 3IVAA 4KNVA 2ZI3A 1V96A 4PC6A 3OX4A 4JYCA 2FX5A 2YWGA 2J87A 4UCFA 1KR2A 1FLAA 1YKSA 4WRRA 2Q9BA 2GBPA 1DOZA 1R37A 3IE2A 1QNLA 4RABA 4YDQA 4D82A 1I6MA 1PCXA 1QZ3A 3QUBA 4LN1A 1F20A 2VAXA 5ERGB 1WMBA 3LOPA 3PI7A 4AK9A 1AUQA 5CHYA 1E5QA 1TCAA 4ALMA 5DCWA 1Q0ZA 2JIPA 4RY8A 3IDQA 3BXGA 5D6OA 1KFKB 2DM6A 5ESWA 1JJVA 3ESBA 2VRWA 4U9HS 3CMMA 4W8GA 3GFPA 3EDOA 3M5WA 5ALDA 1XWIA 3GLKA 3KZCA 4X54A 4P2GA 5KYXB 4YRJA 4KR2A 1I5RA 4NWIA 4B4DA 1E9RA 3FYUC 2QROA 7MHTA 4V0MA 4ZP1A 3EYAA 3MJEA 4G5OA 2DVMA 1ZD9A 4XIYA 3HBFA 4UKDA 2XLBA 3K96A 5P21A 1ZOSA 1CQPA 1CC1S 1V16A 5D3KA 3UOAB 1IIBA 3WDSA 3A2KA 4OGWA 4Y7CA 1XL0A 1QNFA 4XM0A 4S24A 3W1WA 4XTRA 3TD9A 3UW1A 1SCUB 4CM9A 1R0XA 5LZ5A 4ANFA 3AETB 5HW0A 3GF4A 1U63A 3DUFB 5B3LA 3CF4A 4AX4A 1ZA2A 5JH7F 2ZIEA 2VZLA 1ZBDA 3Q7IA 4G86A 4OMFG 2VDJA 3FYUA 3IUEA 3ZY6A 2ZSFA 1F6BA 3F6EX 4RVCA 5KQSA 1SZJG 1W0CA 2OCLA 2PGDA 4Y2VA 4ZANA 3S99A 2F43B 4G8DA 1O08A 2C82A 1TDJA 2QZ9A 2BTQA 2H4XA 4ONEA 2F1JA 2YUIA 4FXOA 3LVRE 3VSEA 2JANA 2XEDA 2IWRA 3WGKA 5AD1A 3KELA 5B3KA 4PC1A 1KDRA 4GL4A 3KZ1E 5KUTA 1UT6A 3R44A 5C8YA 2Q49A 1H4TA 2WTNA 4L6CA 3CE6A 3ZHZA 1PG0A 3CBGA 2R6CA 2VBGA 2BV3A 1T0HB 2HV8A 2IC5A 3HRIA 5AXCA 5A4JA 3NTRA 5JSKA 3S5UA 1A1VA 4CQNA 2YYAA 3HB7A 2JHPA 2WT9A 1T2UA 4P4SB 1B0PA 3DV9A 1MKYA 4NX2A 4PIPA 421PA 2H6EA 3TJZA 1W96A 2YIDA 3IBYA 4I1RA 1E94E 2ZVDA 3VZCA 5CAEA 1R6BX 1J8DA 1IBRA 2Y0CA 3V4ZA 4DCPA 2OQRA 4IDNA 4YQYA 3QV2A 3HYTA 1DWUA 4N41A 4PTYA 4UM7A 4KQEA 1OC4A 3RYFB 5H9WA 1EUCB 3KJNA 1E1NA 4DSOA 2C2ZA 3BWVA 3GG2A 3ILHA 3UMMA 3DOUA 4KR6A 5BV0A 4X7PA 3K9HA 2FLWA 2QW0X 4IS2A 1YQGA 4TYQA 1FDOA 2AXPA 4Y9TA 4BVKA 1LDBA 4OOFA 2NAPA 3Q3HA 2VZ9A 2NV6A 3OAAA 1QPZA 1WDLA 2HCRA 2HNAA 4ZJUA 3H2YA 1SHLA 2IHJA 2Y1LA 3NAMA 4AULA 4NCBA 3AL0C 2BRUC 5GPBA 3KPVA 1E4YA 4K05A 1P4GA 3ZCSA 1IN1A 1Y3FE 3GCXA 5KYWB 4LC9A 4LHSA 3ZWOA 3AY3A 3KG2A 5A3JA 1RTTA 3N0VA 1K5GA 1NBHA 3FPAA 3P94A 3H1TA 4OXNA 3IAFA 4MV5A 1RYHA 2P35A 2HDOA 3UQZA 1YVUA 1Z2PX 2OBLA 4DC0A 4RJKA 4RTQA 3FTQA 3WGVA 5BRJA 1MF7A 5AQ1A 1E98A 3KUUA 2RGWA 5DZSA 4D8XA 3DXZA 1C14A 3NWPA 4QVKA 5JWOA 2HF9A 1YDGA 3PGMA 5JYDA 1YZLA 3GIWA 3IBSA 5C3UA 1VL1A 2BKXA 1PS9A 4NZMA 5J4LA 4H4EA 4OH7A 1E1DA 2BRUA 4DLRA 2Q2OA 4YK7A 5FIUA 2PZGA 4HAOA 1I24A 5A5DA 3W5HA 5HM8A 1QAQA 3BB4A 3L6BA 2FQWA 4AN4A 1D2AA 4GFDA 1AZWA 2O3QA 4TMWA 1GSOA 4DARA 1U0RA 2RIPA 3AZPA 3HCAA 4CKCB 1I1HA 4BBAA 4E31A 1RAEA 5CLJA 5CW1A 4C7OB 4FGWA 1KO1A 3T35A 1DOHA 3T9CA 3UMJA 1RZUA 3M81A 2C2XA 1O7JA 3EVNA 2BMVA 1H9AA 4D5GA 4UNNA 5AIBA 5JBNA 4C7VA 4GOOD 3LX8A 3KQMA 1W73A 1NONA 1JMYA 5BN3B 1SG9A 1QH9A 1FFDA 2XUJA 4P08A 2MHCA 4O0LA 3C8DA 4BAUA 4CKWB 4EA7A 5DRYA 4BFXA 3MT0A 4JN6B 4WK4B 2F8LA 2JJ8A 5KYYA 2WF6A 1EUDB 3PHBE 4OJNA 5KQGA 1WY7A 2HD4A 2OZKA 3ZIAA 2NNLD 1C7FA 5L95A 3AKYA 1ZISA 3GA5A 3ELBA 3DDWA 4IGAA 2DUNA 3ICPA 3MQFA 3W7AA 2FZ4A 4RIIA 2G67A 1JMVA 5K8CA 4Z99A 5ICCA 5E9WA 1J1IA 3WFJA 4O2AF 3ZZ0A 3NKFA 3P0RA 3W6NA 1FSSA 4MO9A 3W6UA 4CFSA 4P81A 3E6AA 3EGVA 3HWWA 5AVKA 2C2WA 3C6XA 2AOTB 4BE7B 3C4QA 1OX6A 4XJXA 3DBOB 4J0DA 3L8GA 2VT7A 3LY8A 2JLXA 2NO4A 3RC1A 5IJXA 5LD2C 3VZBA 2A9RA 2IYEA 2GEUA 3LXMA 3RRJA 3S2SA 3A36A 4LNUB 4J7XA 1TT5A 3WBKA 2WPNA 4MUGA 5F4BA 4WWHA 1IBLB 2OK7A 4H35A 4Q1VA 1VDMA 4L0QA 4N5DA 2RC5A 1XHLA 5D7BA 2G1PA 1L6RA 2CMFA 3BGVA 5EPOA 2X19A 4H1TA 4HT3B 2I91A 1A97A 5GGXA 2CFRA 3SK0A 2I6QA 2PG3A 4KAXA 1FFXA 2O07A 4DUYB 4IIFA 2ZRFA 4Y9SA 3K0EA 1EWTA 4BJ3A 4C0HA 4C89A 3EA0A 3SE0A 4D8YA 4FDTA 1B6GA 4C6TB 4OKIA 4ARZB 3LHKA 3NONA 4NNPA 4CUKA 2VQ3A 4CM6A 4PFSA 1EQUA 1L4KA 1SKAA 4HGRA 2Q21A 2P79A 2P62A 5E6SB 3VPDA 1ZK2A 2ZRIA 4EMBA 1JU9A 4EB6B 4GPTA 2ATCA 2AH5A 4QHTA 2WA2A 4DWWA 3CLHA 3Q1LA 3E27A 5A3QA 4LXTA 1XK7A 1FP7A 2I78A 2ZRGA 1V71A 1U1GA 4MWBA 4KVFA 1HPLA 3FLEA 5K2MA 1FSFA 1VBKA 5A1JA 1B2RA 1PFKA 4YRFA 3DT6A 3JSXA 1WDWB 3RSQA 1QS0B 4ZI7F 4JLVA 2Z08A 1QZTA 2NAFA 1Q2XA 4JLJA 3W1VA 4ODIA 4L5IA 1S9DA 5EEHA 3DV0B 2I1QA 1H2RS 4KNWA 4OQLA 3H6GA 1SUWA 3B7PA 3ER6A 3JQRA 1P1KA 3H3JA 2RBEA 2VH5R 1N6OA 4MVJG 1U2EA 3QVWA 4V39A 3ZHUA 4JV5B 1M10A 3AI3A 4QQNA 3TSAA 2EOAA 1P8AA 3DDNA 3DBRB 4IFBA 2B9VA 4PNHA 3QUAA 2WF7A 3BXFA 3DMTC 3QVJA 5EJFA 2WI8A 2VHEA 4UUNA 5BMVA 1RADA 4NXMB 3DB1A 3CT4A 3MCTA 3NXSA 2W70A 5LPNA 2JIBA 3Q6MA 4ZO7A 4CHTA 1X7XB 3I45A 1JQAA 2JBWA 2X4IA 4IDEA 5GONF 1GZ6A 1WZUA 2ZRMA 4RH1A 1G8YA 2DT8A 2ZBVA 2X14A 4RXUA 4YUAA 2AN9A 2VPXA 1CV2A 1EHYA 2B99A 2CFCA 3EA4A 2PANA 1WU7A 2VWHA 2A0FA 3PC3A 5F2OA 2R1TB 3WFIA 5AJHA 3TR0A 4F2DA 4BNMA 3K4HA 3CEMA 1QIDA 1DINA 3FCYA 1JE0A 1YQ9A 4D0NA 3ZS8A 3DLCA 5ARBA 3WMEA 3I8XA 1KQGA 3I0MA 1KDZA 2GA9A 4H1VA 1QH0A 5G1PA 3H2HA 3S81A 3H99A 1BXZA 2WM2A 3NIDB 3OIUA 2O59A 1U4OA 3T7DA 4FHZA 4WAUA 1KWKA 2C00A 4W9RA 1QYVA 1GNQA 4KRGA 2G4CA 4XGQA 4JB3A 2Z04A 2V96A 2IYLD 5FOXA 1ZVKA 4B3HA 4KQ6A 3EIXA 3UIEA 4XSHA 3VKHA 4JVNA 4ZQGA 4PZ9A 2XWSA 1XVAA 2PX8A 4M9UA 4ZWNA 2YXEA 4ZCTA 2LE0A 2I8AA 3LGXA 4M37A 1CUXA 1P9RA 2YYZA 1EHIA 4Z3DA 3ETGA 1RJGA 4L8LA 3V4FA 4GMDA 4ZDJA 1JT2A 4II3A 4EY5A 1DS6A 1I4LD 2VUHB 3ZIDA 1FVOA 3T9BA 5IKEA 3IDZA 2XB9A 4N5HX 1RRMA 3HJNA 3VC1A 3BIJA 3X0DA 4F86A 1OXUA 1VLHA 3FDZA 2AN5A 5LMZA 1V37A 4LF7B 4QBIA 3DDSA 1QYWA 3MTQA 2W6QA 1IY2A 1VBFA 3G79A 2ZR7A 4B44A 2ZYGA 3BMQB 3UC9A 4LXUA 2ZYWX 1YR2A 2DTEA 1EVEA 2XUGA 1JYSA 4MI6A 1DX6A 3DWEX 5A9TA 5A3SA 1JHAA 4PRLA 1MAAA 4EG1A 1UKCA 2JFFA 1WSWA 2RHBA 2UVPA 3C4JA 2JDIA 3TTTA 2J7PA 1XOIA 4ICIA 1XO1A 4NFLA 3ZHOA 3E22A 5FOQA 1JGTA 1NXXA 4KMSA 3H3XA 3MCWA 4FFDA 4H1WA 1E0KA 4ZQIA 1KJIA 2OOSA 4NBNA 2R6HA 4D5EA 2W93A 3AP2A 1QUEA 2VNHA 1XTZA 2PUJA 2AOVA 4NBRA 4AXBA 1C4XA 4C7BA 1ZUNA 3OLZA 1NRWA 2JC3A 1QB8A 1MO4A 4Q4LA 3ROZA 1O94D 2VF2A 4CNBA 5B5SA 1YBMA 3KOZA 4H15A 1V2GA 2PUBA 4XYGA 3S2ZA 2JASA 2DY0A 4EW1A 1KO5A 4HBGA 3WV5A 1UAYA 2X2FA 3BEDA 5GAJA 4GGMX 4GKVA 3WLQA 1D07A 1BE6A 4XDHA 2AEJA 1T25A 3KKQA 3HVRA 3KJQA 5IK2A 4QGAA 4QICA 1RXSA 3CRNA 1EGQA 1EP1B 3QJGA 4PYNA 5K8UA 1N34B 4YYZA 2XY4A 1X9IA 1NW3A 1FFBA 1R6VA 3H5OA 4YP9A 4DREA 3PXGA 2YV1A 2GXUA 3GPDG 2X0FA 4ZDKA 3C7KA 3ZW7A 4QT4A 1BXGB 1T8PA 3N3AC 1W4AA 1W9MA 2I33A 1OI3A 2Q1XA 1BA2A 4DDKA 2QRPA 4F8YA 1KK3A 1OBHA 3GLRA 3PPWA 3VOAA 3J81k 4WCFC 1T4DA 5GV8A 1GU0A 1FCJA 1UMDA 1K27A 2O4UX 5ALRA 2Q8PA 3I2IA 1EKXA 3REQB 3PX2A 3BF8A 3OOJA 2O2ZA 3HR7A 2QQEA 3BDVA 16PKA 2ZRAA 2J9ZB 2ZJ2A 2ZYRA 1GSAA 2XWJI 3L7JA 1T3SA 2JBAB 3NASA 4AY6A 1JYEA 4L50A 1RRVA 2J4CA 1E3QA 2QLLA 1VE1A 2GPSA 1DCMA 3OESA 4MCIA 4YGXB 5KQMA 1YAHA 2H4WA 1VA5A 1BTOA 4Y67A 5AXBA 2Z3ZA 3PT9A 5CMLA 4O4JB 4JR1A 1RI3A 4G1CA 2BLLA 3RH0A 5B7GA 3Q3JB 1K68A 4K9MA 2AEEA 4M55A 5JD3A 4XOUA 3CLKA 2TMGA 4CDRA 1X1QA 2EZ8A 2L17A 1BYUA 2WWVD 2NTYC 1N5RA 3OIDA 1OASA 2ZSIA 4HYQA 1KMHA 5D84A 2Y4OA 3Q1KA 3R40A 5C1OA 4JWTA 3CZCA 1M74A 3JQ8B 1U8EA 2GOYA 4CM7A 3KQHA 4X63A 1RXVA 1F51E 2P0YA 2FX3A 3PGJA 4CN8A 2GNOA 1NVBA 3CNEA 2GJ4A 4H6WA 3ZWPA 5F3DA 2H65A 4D9JA 5IMBA 2YY6A 4II2A 1VMEA 3C7DB 2XYHA 1FXUA 4ZCRA 1ZM2A 5H8WA 1NW5A 1VGVA 3RS3A 3FJ1A 4OXXA 5KAPA 4BNNA 4CEIA 2ZAMA 2HSEA 3M2PA 1H6BA 2H00A 1WJGA 3OOWA 6REQA 1JX6A 1LLDA 3SDSA 5J2TB 2F17A 4RE6A 3ZUGA 2AW3A 1PRYA 3HB0A 4QWWA 2IYRA 1KJYA 4EA6A 3STXA 3EXEB 1AZSC 3KBOA 3ZBTA 3G2JA 2QY6A 3O03A 4ZO6A 1B76A 4L4RA 4X8LA 4EABA 1OI2A 5EQFA 1PQYA 2R44A 2YZ7A 3H2KA 2JGMA 4ZCQA 3GEMA 5EMJA 2ZIFA 4D9BA 4NVRA 2O4CA 5AK0A 3WK6A 3H2SA 2DUJA 1UXJA 3FCXA 4TYPA 3RSZA 3IMKA 3VNQA 1YTUA 5E2BA 2G7ZA 2LP4Y 4NJOA 4EHDA 1I6WA 3ID6C 2J6IA 3LW8A 4RHFA 4CIYA 1JIUA 4J76A 1X3SA 2GR9A 3RU3A 2FKNA 4A9AA 2QDKA 3K8QA 4GRAA 1TZMA 3CWZA 3M4ZA 3VR3D 1XELA 2X8JB 3V8VA 3PFIA 5DV9A 3WB1A 3PFFA 3ZQKA 5B4UA 2A35A 4KLRA 1J6UA 3NBYC 3L49A 3OMWA 4AMYA 1LI7A 4TV9A 1XNRB 1WZNA 4B7XA 4IF4A 2GXAA 3I5AA 2C3PA 3CUTA 1CUIA 2O0MA 1MH9A 3E15A 3OCCA 2VDPB 1GGFA 2J0UB 2IU6A 1QVZA 4Z53A 3MWYW 2WD8A 1O96B 3UHJA 3WDMA 1VCMA 3RC2A 1DDGA 1HOTA 4ZTZB 4S04A 2F55A 2J4DA 2RHGB 3AGQA 1BCSA 5AHKA 5AUPB 4MHTA 2JIQA 4GMGA 4R6XA 3WQRA 1KO4A 1K4KA 1D7OA 3FYHA 3HN6A 2BONA 1ZJJA 4CL2A 1C3LA 2YN2A 2WWRA 4DC9A 4TYYA 1WW8A 2XEXA 4UTZA 1FXSA 1E62A 2W11A 1E5LA 2A59A 5A7HA 5AM2A 2XCTB 2I3GA 1KMIY 3B5EA 5CH5A 1ODJA 3CLSD 2QSUA 1XVLA 1VLZA 4PG6A 3RSOA 4JJZA 3JRXA 4P35A 5F3RA 4BFCA 5LXTA 4O02B 1J56A 2X23A 5LYJB 5IPFA 4AURA 2VHQA 2FOLA 3OIYA 3WIBA 5I3CA 4IEEA 1QTNA 2Z1DA 1L5KA 1Q3TA 1VYTA 1YS6A 1PDWA 1SG6A 2VAVA 3QI2A 4WADA 1LU9A 2OGWA 1IY9A 3G6KA 2PNFA 4JLNA 2IS2A 5JFTA 4KFTA 5ICMA 2P9TA 4TTQA 4LXQA 3IPCA 5EPUA 1Q21A 4BLTA 4NKRA 2BEVA 2C1EA 4I99A 2RHWA 2X0KA 4NCJA 4EJSC 4EI9A 3K6SA 4UE3S 1H0KA 1GHTA 2OCYC 3UYKA 4QBTA 4YMUA 5KVCA 3GUZA 3U9LA 1W47A 3Q3GE 1HKHA 2PX0A 4D4JA 2G0TA 1JLSA 4GEGA 1HBJA 1HE3A 2QMEA 1AKNA 3C3PA 1L4HA 1ZHFA 4HD8A 4PZLA 5ERYA 1N3LA 3FHLA 3N2NA 2A9VA 2PJDA 2BFWA 2PXHA 1QH8A 5KJEA 4E13A 2WTXA 5KNDA 5ULLA 3TLMA 3HLYA 1YQWA 5BQXA 5CJ2A 3NYRA 1R10A 1RAFA 2J59A 2JGNA 4HN4B 4MINA 5CVTA 2IYFA 2QP9X 1ZHOA 5CBPB 4EJSA 1ZC3A 4BMNA 3JZIA 1F8YA 2V4ZA 2FWPA 1JXOA 3AW8A 1VMAA 3TOVA 3WL3A 1ZM7A 3F74A 3R7FA 4H3HB 1K63A 4J6EA 3VKUA 1ZPDA 3SIRA 2XCOA 3OM1A 3VM6A 2O48X 3IULA 1KI7A 2W6OA 1MVNA 2K7ZA 3HACA 4AMUA 3OZBA 1J5XA 2CY0A 2FUCA 2ID7A 3OKCA 3H11A 3PKJA 4QREA 3DE3X 1YR3A 1OZAA 3O8OB 4HQKA 2ZJ6A 4DSZA 2L0XA 1FS6A 4YAKA 4JDPA 2WTAA 3RS9A 1SOWA 4F6RB 5I7EA 2OBYA 4U2KA 1ZITA 1OCEA 4NYJQ 3REFA 3X1DA 1PT6A 4EG4A 5KX5A 4B3RB 3QVGB 2D5IA 2H57A 2XHZA 1DC6A 1Z5UA 3EEFA 5GQSA 5JYEA 3M4NA 1II8B 2V1XA 4PC3A 3OA0A 1XVVA 2J85A 3BJRA 4ITUA 5JPIA 4BP1A 4YIKA 1T6YA 2VN8A 1U3FA 1FJXA 4J0IA 3E5HA 1EBBA 4RZUA 2R87A 4C08A 1E2HA 3PD0A 3RS4A 4DQKA 4ESOA 2Z6UA 3C74A 1FJHA 5JS2A 2H1WA 3ZG6A 2WVGA 4FYXA 5C5IA 2GLTA 2G8LA 1E99A 1E9EA 1JG3A 1T2DA 2P6MA 1OKKD 2XECA 3LZDA 5I9TA 4F04A 2XD4A 3W6OA 4URVR 5F1PA 1UWCA 2ZYAA 1A2KC 2HRRA 3DMHA 4AJ9A 4PPFA 4QX6A 5L45A 4HTFB 4KLNA 5DCUA 3ZHVA 3EAGA 1JHDA 1PS8A 1IUKA 4Y9RA 5AWFC 1LLFA 5JY6A 4Q05A 2FWRA 2ODPA 4Q9LA 3U61B 1ISPA 2H1VA 3S1SA 5IFKA 3ZN2A 3TR5A 1IZ7A 3KTAB 3PG5A 4I8XA 4ZC1A 4ZGGA 3PGXA 3VDXA 4QYSA 5H5JA 3GW8A 5LP6C 2W2LA 3AZQA 4NS1A 3KQKA 4GP7A 2V3VA 1J7KA 1JXAA 1U0JA 1XCLA 1F2TA 1J06A 1TFRA 4QM6A 4K81B 2NO5A 3TBFA 2XT6A 1N6KA 2JRCA 4HXFB 5DXAA 2C7RA 2BSXA 1TFUA 2NPIA 2XVYA 2V5AA 4UULA 5A5EA 3K1ZA 4QQRA 3OPXA 3SS9X 4OIFA 1UXHA 3X2FA 3GL9A 1CBUA 4YCSA 2N75A 3FYDA 4LHZA 1QRAA 3PDCA 3OJOA 1MDFA 1PR1A 3CUUA 1XI2A 4GUAA 4OOEA 1VJCA 1T8TA 2FKAA 3WVNA 1MG5A 1M2KA 4TLCA 3EVBA 4BNFA 4ZOQI 1EK6A 1A69A 3FVQA 1J0EA 2AYXA 1GTVA 2OV6A 4R2HA 2O2HA 3HFRA 3SLRA 3INTA 1WP4A 3PIIA 3O92A 1EIWA 1U31A 3FETA 2D2IA 4HXEB 1Q0LA 2EFGA 1CRZA 2R84A 3P0EA 2K6GA 1XR3A 2ZWOA 3O5AA 1KRHA 3VZQA 4F5YA 4ARIA 3FNGA 1AGXA 3D6HA 1ZK0A 2O3JA 1NVEA 2XNSA 4HX5A 4QARA 1XPJA 2R6FA 5JAIA 1ZGJA 2A7QA 3FIJA 2QD1A 3L79A 2PZFA 4CRWB 1II0A 2AI2A 2CFTA 3UWMA 5LP1A 4FSDA 4PICA 4W99A 3KL4A 4I5EA 3HCPA 3G59A 3OC6A 5G1NA 4ILKA 4BKPA 4YRBA 1U81A 1SBNE 3LBYA 2J3KA 2BAGA 4CT4B 1R6XA 2CBGA 3CH5A 1DI0A 1EDBA 3QTLA 2IA5A 2UZ1A 3NVAA 3REOA 3CRVA 4CEJA 3E9CA 1BGXT 1D2GA 4UVEA 1ZCBA 2BZGA 2XDAA 3Q40A 4QELA 2WE8A 3OQPA 3U7FB 3QPVA 3CVOA 4A8PA 3ZDDA 4OHCA 4UMEA 1N5DA 4DEVA 2P2GA 3AF6A 2I76A 2Q9AA 3RWBA 2BHNA 4FWBA 1M2EA 4KRYA 3HKDB 5DHPA 3PHGA 5A6SA 2B82A 4QQKA 1NBME 5KTTA 3OT5A 4TQUS 2X6QA 3D1JA 4RQUA 5SZHB 1UZUA 5TF4A 2M1XA 3D0OA 4MDFA 1LBIA 4TM8A 1ZVMA 3E7DA 4WKCA 3B2EA 3DVRX 1GXSB 1M6HA 1RQLA 2JS7A 3C0KA 3D8UA 4YP0A 1B00A 3H2BA 5FP0A 1M66A 1V4BA 1CRQA 3MXOA 5CFRA 1LQ2A 1K0UA 1V4NA 2Z58A 4V24A 3AK4A 1LV7A 3DA8A 2GHQA 3CZQA 3DFMA 4PM4A 1WB6A 3G0GA 4JIGA 1SU8A 5C7IO 1IBKB 1LCIA 4HEA1 4XWAA 1ML4A 5FL3A 4LK3A 4KRFA 2ZI4A 4HO1X 4IZ6A 1Q1QA 4YRQA 4LBYA 4Z9AA 3OVMA 2IYUA 4C3ZA 2HQSA 2RGAA 3GDWA 5ICFA 1SBHA 3CA8A 5LVAA 2B4AA 1OIVA 3RU9A 4AZ0B 1NDHA 3H4VA 1M8JA 3FWYA 3L0DA 1YHNA 3ONNA 4BQQA 3K6JA 1UMBB 3E5NA 2WM9B 4M0UA 3TLAA 4OQYA 4Y6SA 5AUNB 2F3UA 3PFGA 3VHLB 3WA7A 4LZAA 2B83A 1JSZA 3Q3VA 3M83A 3FTEA 3KJFA 4HHEA 3WOHA 1Y6FA 2M6SA 1BSVA 5BN4A 3RIXA 2H08A 2IKQA 3IR6A 2J9FA 1ES9A 1A9RA 1RWMA 3ZY2A 4KB5A 2Q0SA 4D4LA 3OZTA 4NE7A 4WUVA 3LKBA 4AP5A 1L7EA 3LRPA 2H48A 2WJGA 1XKLA 5BYAA 1NXQA 2QRKA 3RSFA 3LQQA 3CRRA 2JGDB 4I5FA 4L76A 4BL5A 3SVTA 1F2UA 5KOJB 3TI7A 5J9FA 4AXXA 1MZPA 3L7BA 5CJPA 1KZ4A 5BSRA 1N2GA 3WNQA 3I39X 4TSKA 4L9SA 1QTRA 4N3BA 1C1DA 4EG5A 3UHPA 4DY6A 1Q1ZA 4DNQA 1HMPA 1E69A 2YJNA 1CQIB 4Q9DA 1G8FA 1JJAA 1WBJB 5K99A 3AHDA 4ZMRA 3D6JA 2EBUA 3OFJA 5FKJA 2B6NA 1JA1A 1T1GA 1YMVA 2RH4A 3BJEA 1KVRA 2P4UA 1N7JA 4K6MA 5AVJA 4DLKA 4E5NA 1NAIA 5JZMA 4DR5B 2R85A 2Q3FA 2BLNA 2OZVA 3F6YA 2WAYA 3O8DA 5TJ9A 5JNVA 2DC1A 1NBMD 1WVMA 4WLNA 3LC2O 5K3SA 4KQXA 1P7YA 2Y2UA 3N2GA 1RYNA 1QANA 3CRMA 1C81A 1KP2A 3O4FA 4AQ7A 2IS4A 5GTDA 3GYGA 3UCEA 2AMJA 5THXA 5L3VA 4X65B 1ITZA 3PEYA 4UUOA 4QOSA 3Q0EA 4IM7A 3CU5A 1KE2A 1H2HA 5EXDA 2PKXA 4EPXA 2QL5A 4RD4A 3ZWYA 3WLJA 1FQOA 3NAZA 2BMDA 1GDDA 1Z28A 4L5YA 5J47A 1YQDA 1ECFA 1ZU5A 3P8ZA 1WF6A 4ER6A 1Y3CE 4CF5A 2P8JA 2Z5GA 1VMDA 2C4VA 5FLYA 1UFKA 4LF8B 5BWOA 3BWXA 1L7QA 3RAJA 3RDPA 4DHWA 2YCBA 3LYHA 1Q19A 2GFQA 1XK6A 3H7IA 2JA1A 1HRDA 4ZI5A 3RK4A 2DF8A 2HBZA 4Z49A 2IHBA 2VDWB 3B3QA 2C4WA 3QU7A 1K1EA 4KQ1A 1Z22A 3IVCA 5P8WA 5JIBA 1EVJA 3TZCA 4OX9B 2NP7A 1G42A 4KPEC 2CNOA 4JELA 1HY3A 3BRWD 3P2OA 4O4HA 3C3BA 4L8FA 5A5GA 1BVRA 2AEFA 4K6CA 5LQNA 1D0SA 4UMFA 4TUYA 1HZZA 5IS2A 3LK6A 4F8EA 2NZJA 3MTAA 3WKEA 2GBIA 2LR0A 4EENA 1XE3A 3LCRA 2J6BA 5KJCA 1QX3A 2XGGA 3GH3A 2BEUA 4OHWA 4MA4A 4N3CA 1J8VA 4NPHA 3JYLA 4EF4A 4Q4JB 1WW3A 2REQB 1XRPA 1S2GA 1F12A 2WD7B 3GBSA 4OXIA 4WECA 3I52A 4G8JA 2OV1A 3WWDA 5I7WA 2Q28A 3RI3A 1UPXA 5I5GA 1V5FA 2XWQA 3G2MA 3B6IA 3W77A 2ERCA 5JQWA 2GJSA 1FNDA 1VTKA 3CLTC 4KL8S 2Q6VA 1JR3E 2RBGA 4ZCMA 3R8FA 5DHSA 4MPRA 3ELYA 2YQZA 1BH6A 1ORHA 1G0NA 1J99A 4FGJA 4KQMA 5JVDB 1OT3A 2I8LA 3MAJA 2MYNA 4H4CA 1SXJB 1W88A 3NR2A 2HQOA 3KR1A 4Y2TA 4N76A 1L5QA 2AE2A 2IEYA 3E9DA 4IUBS 3USCS 4RNDB 1R0YA 1ABFA 1D4OA 5HMMA 1ZCJA 4K9RA 4A03A 1JHXA 4QXAA 4IHAA 4Z6KA 3ADBA 2WJHA 3LQRA 5LA6B 1GCGA 1QKKA 1UK6A 2HMWA 4ZCLA 2WIFA 1T15A 3K3PA 2R1VB 3R4VA 3ABOB 1ZRMA 3AUTA 2L2QA 3F6CA 4BUZA 4G09A 1CEQA 2H1IA 5AKHA 4QOJA 4QGHA 3AH8A 1YMQA 3ZOZA 5IEJA 1A3CA 4TS9A 4NSNA 3LHFA 1PD0A 4R5HA 4OLJA 621PA 4V1CA 2O7QA 4QEDA 1PJZA 1QVAA 2WFLB 3BILA 1R4NB 2DPXA 3RBXA 3M3DA 2CJWA 4LRWA 2CT8A 2P2LA 1K2VN 1RKBA 1J97A 3LJKA 2XADA 1D2RA 2Q5HA 2B8NA 1EWVA 3FSGA 3KS9A 3N76A 3EUFA 1G17A 1XZLA 4IJVA 4LCEA 5JQGA 1Y98A 5AKZA 4CM4B 1XN1A 3QJYA 4A91A 3U7HB 2G63A 3DM5A 4BVAA 3X1WA 1V6CA 1NFQA 2W37A 4UUAA 3S4YA 3IALA 4IFTA 5JHHB 1XD8A 3KQPA 1SPXA 3U80A 4NDZA 4BV8A 3DZDA 1TUBB 2E9SA 2H16A 3FCEA 4R1QA 1I3CA 2HMVA 3FYUB 1O4VA 1Y6RA 2PRZA 4LOLA 1W48A 2IHNA 1XTBA 3NUQA 4Z9XA 4DCJA 2W0MA 4DR7B 3NCTA 2BTQB 2DWUA 5EHNA 5FFNA 3RWOA 5CB4A 2OO5A 1QO0A 1D4AA 1QBKC 1BX3A 3RTAA 4J91A 3ZE0B 2A0UA 3OJLA 1N2HA 3D3NA 4B85A 5FCDA 2B3DA 1CUHA 3LK7A 2QM7A 1WPQA 1SXHA 1TW3A 2ZKIA 2IDMA 2ZU0C 1JR3D 4AI6A 3SQOA 2MINB 2GN1A 4UHCA 3OQ1A 5IBRA 3U7JA 4C7MA 4XVCA 3FGPA 5C8XA 5I9BA 2BOVA 1EINA 1XZEA 4O2BB 3N7TA 3TD6A 1ZP6A 4AUNA 1EB9A 3T94A 5KDLA 3SEZA 5AW0A 3C14C 3JQBC 2B4YA 5EXXA 4F2HA 5D1NA 2ARKA 1KTVA 4LC0A 1DAIA 2PSEA 4JYMA 5K4GA 1K6IA 2JLUA 2R6AA 1E2EA 3PC6A 1XMQB 3DHWC 1QV7A 3GU3A 5CLLA 4X1KA 4MWSA 4ZHQA 2FMTA 2A9KA 2PD6A 2IUYA 3OZRA 5TIIA 1Z5GA 2RHDA 4YONB 2QHXA 2DPHA 1ZIPA 1MO3A 3OM0A 2O5EA 1X9HA 2ZBUA 4WZ6A 4P31A 5DM0A 5JD5A 3A9VA 2QUAA 5IXSA 1OREA 2XCIA 4HUJA 4PINA 1PQPA 5EIOA 3K09A 2PLWA 3TOCA 3TGWA 1UXKA 1YKFA 2LUOA 3DS8A 1A8PA 3AT1A 1ZH8A 2CMGA 1RS0A 2EGGA 3JQBA 1DKUA 4KQ2A 4M7WA 5TDHA 4CI9A 3WS7A 1GL3A 2JIZD 3P9SA 2BH2A 4OHFA 3BWBA 4GYJA 5H1YA 3TCXB 5B64A 3FAKA 2HCBA 3WDKA 3S2IA 3GJ8A 4IDFA 5EMLA 1ZMTA 2M6RA 1C2TA 1XD2B 4ZZ2A 3BAFA 4H6XA 3SYKA 1BMTA 1VE5A 5E6RB 1EPUA 3RLIA 3ABQB 5BW4A 1C3JA 2W2XA 3JQPA 4J9UE 3VTAA 4E3ZA 5A4AA 5I8WA 4ZC8A 4DR1B 3QWFA 2PZLA 3OEYA 4HEJA 3ZLUA 3HDGA 3RS5A 4KMRA 2XB8A 4I1SA 1AS2A 2G70A 2QD5A 4M49A 3MB5A 4PYQA 2W6JD 1UDBA 4LZWA 3T4EA 4BJ1A 5A4KA 2PN1A 1RVDA 2AJLI 3HJAA 4L4XA 3D0RA 3VH1A 1Q6ZA 2O8DB 3EMVA 4GWLA 3ZQJA 2AOUA 1GQRA 1N5KA 2C29D 3BJIC 2RCNA 2E7ZA 1S2IA 3MTIA 5B30A 4QO8A 1E5VA 1ULBA 3LPDA 4P33A 5LMUB 3ABZA 5K20A 4OJMX 2F1KA 1RKVA 1UZLA 4JEIA 1AQJA 2ZE7A 2VUIB 2XTAA 3ITDA 3NHUA 4HSEA 4TKUB 4ZZ0A 1RYBA 1W5EA 1E6UA 3RUHA 4YCLA 1DAEA 1QYXA 3MJ4A 4Q37A 3SFTA 4UZEA 4ZOLB 3WMFA 1D1QA 1LTQA 1ZIXA 1O8BA 1YIAA 4UBKA 1L5MA 1BRMA 1WULS 3ILSA 5F76A 4CMIA 1IXYA 4FXPA 5CVJA 3V1LA 1N2IA 5KYYB 5JBIA 2B1JA 3WIDA 3DQQA 1N6PA 3GD7A 2GEBA 2Z4TA 3TQIA 5BSKA 1A77A 4MAMA 3IUSA 2GEKA 1NKSA 2A1IA 4L4SA 2Y1KA 3CINA 3OJFA 5C51B 5EWMB 1MJNA 1QOZA 3IBTA 5HS4A 3WRWA 2ZTUA 4IWXA 2XF2A 1Z8NA 4F3TA 4EELA 4TROA 4R0VA 3S2GA 1SCKA 4I4IA 2CNWD 3SPXA 2E4XA 3TG2A 1M8KA 3GZNA 5KHOC 5ALGA 4R5MA 5B58C 2RMKA 3ZGNA 4B6GA 3K0SA 3PVZA 4NK4A 3T61A 1A0OA 3AV0B 1Z9BA 4Q3AA 4URFA 3U62A 4I50F 3KHTA 1Z7YA 2FWAA 3MWLA 2Q5LA 1TUGA 3U13A 4JITA 4NNOA 1FLNA 3O47A 4YAJA 3FJYA 2EAUA 5B53A 2ROQA 3QM1A 4EUFA 2FJ0A 4IV8A 4AY5A 3NEJA 3I28A 4BP8A 5AM0A 1F9AA 4Y2RA 2NIPA 2QU8A 4YP5A 3EFEA 1XVUA 1VJGA 2HO5A 4BO3A 1V5WA 721PA 1PQ4A 1ZICA 4TMFA 1FFXB 1RXUA 3AHHA 5CIWA 1FYWA 1DDIA 1MGOA 1S3FA 2XOXA 1LSSA 2D5CA 5K6AA 3NHMA 1VE7A 1M75A 3FPSA 3M4JA 3Q9SA 3OU7A 4CUZA 5LD2B 4KWEA 1DCFA 3PUJA 4K9OA 5LXTF 2J33A 5IX8A 3JAKA 3EEOA 2WTUA 1J4AA 4OHBA 1GPMA 2OXFA 3M5PA 4NPAA 4Z0PA 3C85A 4GX2A 2ZWPA 5IJ0B 2ZQYA 2ZCUA 1N25A 2M98A 2C20A 1NVKA 1PJ2A 2WOOA 3L1KA 4LISA 1A96A 3PLRA 4CLRB 8ABPA 4BNLA 3UAVA 2RHRA 4FZ3A 4QJ4A 2P2CA 1CJUC 3BEOA 5LQRA 1B43A 5T4EA 1HC7A 5CUQA 3IJRA 3G89A 1LDEA 1GGMA 5TRTA 5FL7D 4B0OA 4JGGA 2ZSDA 5EZQA 1WV1A 5EJ7A 5DISB 5J5CA 5LMCA 2GZSA 4E5PA 2FSHA 1VSTA 2NUBA 2BFBA 3TQHA 2EZTA 3MCZA 3GCGA 2Q4DA 3H4IA 4J2TA 4G0PA 1U8AA 3DE6X 1G9XA 3ZDEA 1MC8A 3MPOA 4UDNA 5AKIA 5IT0A 3W8NA 4F4CA 1XRRA 1Z13A 3QUQA 4NCNA 1A8QA 3UJ7A 1VE9A 1QAOA 4RS4A 3UB2A 3VI4B 4YYEA 3CFYA 3DO6A 3TRKA 1F8XA 2FSVC 5A05A 2OXCA 1TKAA 3RG2A 2DLNA 1HI9A 4CJXA 1E3DA 1HLDA 1UOPA 5AOVA 1AC5A 3P27A 4AC9A 1IRXA 1WXIA 3T9AA 3L1IA 4CVNA 2BL4A 4KK4A 4PLFA 1HFJA 4BQOA 1DAKA 4AMGA 1L3CA 1ZW1A 3ANTA 3RIYA 4CQMB 2PLRA 5BT9A 4ITVA 3LY7A 1DPFA 5AVRA 4Z4CA 5EMMA 2ADOA 2DCUA 1RLMA 5E38A 1UPUA 2YJ3A 3L7LA 4TGLA 1H65A 5AJVB 4QBHA 1JBQA 3E82A 3KP1A 4B8YA 3GJ5A 4OM7A 3PE3A 4BBPA 4OHZA 1RBMA 3CX4A 4KXQA 3F4KA 4FBMA 4R1SA 1Q1BA 2ORIA 1PK7A 3IMFA 3TTWA 4EW2A 4F72A 5IARA 1GUFA 2X7XA 4EA9A 2CV0A 5G4KA 3V8RA 2OO3A 3D4IA 4G1VA 2EKQA 1VXRA 4Q4CA 3SBOA 4MVJP 5KNCA 3G5TA 2PPVA 1X2BA 1JG7A 3DZFA 2WHYA 3I2YX 4ROTA 2X1LA 4Z4GA 3A32A 4GDMA 3CVJA 4FJ2A 4FMCF 3IAAA 4LRXA 4R3UC 3ZK7A 2O0HA 5M2QA 4X7RA 5AM4A 2BISA 4D3FA 3RSLA 3FDZB 4Z4IA 4NEGA 1GNTA 5JUWA 4JFAA 4MRMB 4LYAA 3QFTA 2G9NA 4CIWA 4MLCA 1N2SA 2IBSA 3BA6A 3D2AA 3ELDA 4HNGA 3ROQA 4CLHA 5BO5A 1M5RA 1L7RA 2JVIA 1VB5A 3AHCA 3BUSA 3P0FA 4K9NA 1R64A 3R20A 3V6LA 3WQQA 2FEPA 4FGLA 5SZJA 5CXQA 1Z7EA 5EKDA 4MP6A 1O5TA 3DLAA 1KK0A 2VCYA 4P84A 4URXR 4US1R 3LRXA 4YRGA 1VJRA 4CV3A 3NLLA 1I5EA 1LNZA 1ZA1A 4Q1EA 1QP8A 1IPEA 2GK6A 4QT0A 4YJ3F 1MAVA 1TA0A 2E6UX 5K3FA 1MFZA 1JKFA 4J29A 2ISSD 4ZU3A 4B3XA 1V7ZA 3IEUA 1QGZA 2HQBA 2VAPA 3EY4A 3K20A 3EVCA 4JHLA 4MW4A 2R00A 5I7RA 1FQKA 4LOKA 4MZDA 1RE0A 4Z86A 3KXPA 3IODA 3AUSA 1XNJA 5J4VA 3IGFA 3WL7A 3IEVA 1FPMA 5FUQA 5KZMB 1P72A 4G0UA 3AFOA 3QFSA 2C5FA 4DLTA 3DOOA 4ZREA 4IIJA 3RTEA 1OB5A 4E15A 4R98A 2C2MA 3AUFA 1TJ4A 4HNAA 2GARA 2QVZX 4MPTA 2COKA 2YOGA 3K0AA 2V7PA 1CUCA 5F77A 5MGNA 1WCIA 2B37A 2IYZA 3TNJA 1WTCA 4D4MA 3LCCA 3OPMA 4FFOA 4GR4A 3RFXA 2BSQA 1YOBA 3WYGA 5HMLA 3HFGA 2IL1A 1C9DB 3PHHA 2QX4A 3SM3A 1CY7A 1JVNA 2G25A 3O4JA 1RLJA 4KPUA 3NJ4A 1O03A 1RQRA 2DB3A 4JP1A 5IC6A 5C46F 1LWNA 5HQTA 1YZKA 3NKLA 4M6WA 1ZRSA 1PG5A 2OSVA 3RIGA 5H70A 3QKUA 3QXJA 1XDSA 1JIIA 2YMLA 3KZNA 4MITA 3ROMA 4BLSA 5GJCA 3UBTA 4DMLA 1ZM3A 4OHOA 1GEGA 1EJ2A 1Z6PA 3KEOA 3G2QA 5KB3A 2JJ2D 1KRXA 2WWYA 1R0LA 2P9CA 3HLTA 3DJFA 3IT3A 4RWEA 3GP8A 1TTPB 2BFCA 5HOEA 5KSWB 1Q0RA 2ECOA 4F2WA 5HUJA 4KRXA 2HWKA 3TQSA 1NUUA 4Q47A 2C5EA 4JJ8A 2AX4A 4BAGA 4Z1MA 1GGEA 1FLVA 3UWDA 1NRIA 4WCFB 3LCMA 2D59A 3T4PA 1M6YA 3K0HA 4H3VA 5FTKA 4ZJPA 3IELA 1M6VA 1KZ7B 4B7UA 3Q9LA 5F23A 3L4KA 1OPXA 4YECA 2QMUA 4KKVA 1MX1A 2FP4A 1MO6A 2L42A 5H16A 4CMCA 1KMHB 2CLEB 1SXJE 3KT8A 3GLTA 1PFQA 1GNSA 4LRUA 5FWAA 4L8WB 4N0EA 2QTZA 2QI9F 3HUUA 1JAZA 3DFUA 3PGA1 1JTFA 4BKRA 1OA0A 2CJXA 5FUMA 3GFGA 2O2JA 4KV7A 1EE1A 4BLRA 4KI0A 4YALA 3MLAA 2VF8A 1RI5A 2QQFA 3FPCA 2YWBA 1T5LA 1TL7C 3DMYA 3QBVA 4IEIA 1S7GA 2HJ9A 1OILA 1U94A 1PZMA 4ARVA 4Q18A 4KODA 3STUA 1JZQA 4IZOA 2Y68A 2C92A 3CX6A 1GTRA 1YRWA 1HLFA 1R4MA 2BN4A 4J4TA 1LDGA 1W2GA 4PAWA 4RENA 1BN6A 2AZXA 2XGMA 4MGEA 4WVLA 1U3VA 4ZVKA 5JWHA 3AESB 2PRSA 2FRDC 4JJIA 4B3IA 1QTIA 3KQWA 1NVWQ 1M1NA 1P62B 4I46A 4TMXA 2AG8A 3I1IA 4GZMA 4O4LA 4ZCSA 1HNXB 3ZDYB 2W4MA 4LZZA 4NJEB 5E4JA 2R1UA 3D43A 3F7OA 4R1LA 2IV7A 5A9SB 1T2CA 2C94A 2C99A 3VZRA 4V0ME 3BIFA 4QOHA 1C80A 2NTJA 2YBDA 1KMMA 3VVBA 3O7MA 1TAUA 2IHTA 3CS3A 4P7GA 1IJBA 5KO2A 1G2QA 1NVFA 3FOCA 2AOWA 5IC4A 4OLBA 5M3BA 3ML1A 4YV7A 3I9OA 2ZSUA 3KB1A 3MGGA 2BUCA 4QUAA 4X84A 5D5QA 2IE0A 1M9NA 3P2JA 2VHTA 4D92A 1R8YA 3EH2A 1DO2A 3G02A 4RK0A 4YB8A 4C88A 4UPEA 2FRDA 1UKZA 2XRYA 1M34A 3I9JA 4MYDA 3U2QA 2LW7A 4HAIA 4KMOA 4O25A 4OLHA 4DMRA 2DQKA 1O87A 2GD1O 3IUMA 3UJBA 2D2EA 3TVTA 3UMCA 5F51A 4YRKA 4FCWA 1FC0A 5E3JA 3UT6A 4D26A 3X2SA 1DAFA 3NHRA 5EJMA 2OQVA 4TQAA 1Z6TA 1E2NA 2C4UA 4C1NA 5KWEA 5INTA 4EO4A 3ZV5A 1GCAA 4J1NA 3CN7A 2ZZMA 1FNNA 3VQTA 1MZVA 3IMGA 5AW8A 3HO1A 2SKDA 4LYYA 2KI5A 1BVHA 4CMAA 2YS7A 4F3YA 4S2UA 1Y4ZA 2JHFA 1XNQB 1MOQA 3QXGA 2A4KA 4M1YA 1P3DA 1RKUA 4QBFA 3RU2A 2Q5CA 1P4JA 4XGNA 3WB9A 2C2KA 1HF3A 1SUFA 1BCSB 1EA5A 5LQSA 2H4FA 4ON9A 4JKIA 4JODA 4Z1OA 4JLBA 2A0YA 3NTUA 1OIWA 3LZ6A 1Q16A 3PVSA 1YQQA 2QMZA 2PJRA 2NGRA 1MB2A 1SXJD 3L6RA 4PGHA 5DBOA 5H83A 1R9JA 3D2LA 3WL8A 4YCDA 4P9NA 1I51A 5L7WA 3IEXA 3TGPA 1B7GO 3KUXA 1ZSYA 1JTVA 1A76A 2B36A 1Q11A 1U28C 2POQX 2HK7A 1A50B 2ODAA 5KOHA 3K0FB 1C3OB 4V0RA 1I1OA 4R4JA 4OREX 3TAUA 5KVAA 5LOVA 4KSYA 4MUIA 1IOVA 4NQRA 1JEQA 4W5JA 4CHGA 1ZAKA 2VNKA 3H4MA 4COKA 3O3CA 1Q74A 1SIOA 2OCAA 3B5JA 3FRIA 4QRIA 2B1IA 4RZ3A 3SDBA 2O1WA 2YDYA 2YJGA 2FPOA 2V97A 4NCKA 1HYBA 3CF6R 4S1OA 5CTAA 4LJYA 2GSWA 3SXUB 4JUAA 3U4GA 2ZTMA 3MG9A 2O8EB 1SK8A 3W7BA 2C96A 4ZU1X 3P2EA 4WCDA 2MIIA 3I3SR 4EGFA 4WK6A 3K6SB 2OA0A 5CDUA 4OP1A 1DKMA 3JZAA 3WADA 1EFKA 3IO5A 3ZTYA 1U28A 3HGQA 1V48A 1YCHA 3CPEA 3I83A 3QIAA 1I32A 3W2EA 4BYGA 4YRNA 1Z2EA 4S1NA 3MMZA 4YJKA 5HF8A 4CF7A 2EJBA 2W8BA 1UJ5A 4J1TA 3AVWA 1LX7A 3AFNA 4PX3A 1NE7A 1HDOA 1ZNWA 1NA5A 1O97C 1P4SA 3N6RA 4PG5A 3E9RA 1HTBA 3NTQA 2GMWA 1ZOOA 1N5IA 4I9NA 1PJTA 5ED0A 1TJ5A 2IY7A 1HGXA 1TM4E 2EARA 3AP3A 1DRWA 2JIOA 2WTEA 1VJ5A 2VHJA 4EJSB 3QLTA 4KXWA 4Z9FA 4JJ4A 3ZU5A 3PUIA 2YWEA 2H7XA 4LJ9A 3VZPA 3MS7A 1Q7BA 3UWOA 2WHPA 4RLSA 4QTYA 5G02A 3AXTA 5I9SA 2P9YA 3TRIA 5JFOA 1JMKC 3B12A 1V5IA 1L9XA 1ONSA 2QRVB 3AW9A 3DKRA 3FKQA 3FRHA 3GN2A 3L7AA 4HG2A 2E82A 4NAUA 4Q1AA 5JNUA 4DTIA 2MT9A 2HRQA 5G3ZA 2RHLA 4L3OA 1U0HC 3GJ6A 4RO0A 1O95C 5I9LA 1CEYA 1T1EA 1EXWA 3VNBA 5JSFA 1VSBA 1AKQA 3AF3A 4I1UA 4DMGA 1NJ8A 2C2HA 3W3ZB 3WZ2A 3EHEA 4DR2B 2B21A 5A03A 3TCNA 2HK9A 3L7IA 1MABB 4Q7KA 1CS0A 3N1UA 4O4IF 1ZOPA 2C8JA 3TX6A 1IZ8A 2YRXA 4D3SA 1ZINA 3EG9A 1ZLXA 4YJGA 4OQZA 2Q1WA 3HG7A 3QUTA 3IA7A 3RLFA 1P7CA 3N7AA 3JU3A 3NBQA 4IIXA 4CDMA 1F0NA 5C35A 1CYDA 4M89A 4A82A 2CLIB 2NO7A 3QI7A 2CD9A 1D7AA 1DAPA 1G5IA 1O95A 2X58A 5I8ZA 1GAXA 3PDUA 2X2EA 1E5XA 2HZ7A 2JFUA 1NSFA 4KH1A 4QUEA 2FB9A 1R50A 1HKUA 5FFFA 3OAAD 2GF2A 2JLYA 4I55A 1XBTA 3KNZA 3SYMA 4E51A 4MLZA 1EVKA 4HLNA 2Q1SA 3VPAA 1F4PA 1DBQA 1L4LA 3OX1A 3TNFA 3TRFA 4HN2A 2F3RA 3TECE 2JFHA 4GBJA 3NV7A 3AVPA 1XALA 1AQNA 1FRVA 1Z0UA 3OFSA 2OZLA 2C54A 3P1JA 4FGKA 1EXMA 1G38A 1WHTA 4H1UA 1D09A 3HBLA 3PICA 1I80A 1WF3A 3SC2B 5DXJA 4AAYA 3SQXA 1MB9A 4WNYA 1V35A 3Q8WA 4DMCA 2BP7B 2FE1A 3PT5A 4BGVA 4J1QA 2J9XB 4Q7EA 4XUEA 2QY9A 1M2OB 4LC1A 3GP5A 5CYOA 2I6GA 3TI9A 4X64B 4B3BA 4PX9A 5KREA 1P0CA 4Z4FA 2WYIA 2ZBPA 2F1IA 3MUEA 4NZ9A 5ALKA 3KHSA 2HY7A 2E1RA 3HEAA 1EFRA 4K28A 2HLHA 1HDRA 2FEXA 3KOYA 1T1SA 3QVVA 2HADA 1P2VA 2H2WA 3AOEC 3KPUA 4TXJA 5FR2A 2H4JA 1JLRA 4LEIA 1YK1A 2FUG1 3U7EB 2P75A 2IXFA 4BPRA 2F2TA 5LP6B 3HO8A 1UPFA 1H6DA 4QUIA 1GQYA 3KVVA 3F1KA 1N7IA 2BI4A 5C52B 4PTZA 1JEDA 1ZLYA 4DIKA 3P45A 3ZGLA 3ZK9A 1FNCA 4TTAA 1R66A 1KFEB 4RLFA 1ZHHA 4HPJB 2IV3A 4ACAA 3FY4A 2BFFB 2OP0A 4LRSB 4LYGA 4B3FX 1UDXA 3CNHA 3AB7A 1E3WA 1S02A 2XUZA 1G5RA 1TF2A 4DC1A 3T5AA 3TMYA 1UBGA 4I6JA 4KIFA 3W5SA 1LSJA 3AG6A 3B1WA 4LWPA 3TLCA 1BS2A 3ROKA 3AOEA 4F1WA 1QHEA 1OWOA 1OI7A 2EFEB 1MCZA 5TQ2A 5HFNA 2NQ2C 3TINA 4DOMA 2OO7A 4PNZA 4ZEVA 5IAKA 1ZH2A 1SA0B 2GYVA 4RADA 1WIWA 4EGJA 3K94A 1JE1A 3L82B 2CXQA 2DY1A 4D9KA 2ZW9A 1TK2A 3B3JA 3EIQA 5LU8A 1J9EA 1NF3A 2UZ1B 3HSSA 4YJFB 4CEJB 1VC2A 2W6ZA 5DSTA 1R0WA 3QLJA 1D2NA 5KNBA 3B5IA 4TV8F 1G6OA 3ZWAA 2PTHA 3HR4A 3QLUA 5CW2A 1NMQA 4K2AA 1VJTA 4PIVA 3IOEA 5C8ZA 5LN1A 2OK8A 3SKVA 1SHUX 2VPWA 1KXJA 1VSUA 4R7GA 4F6CA 4IH9A 2XCSB 4ZEXA 1PNRA 1JJBA 4H0NA 4DR6B 6AT1A 5JR3A 2YMPA 3QF4B 1IBSA 5E9JA 3PHCA 3T8YA 5KTNA 4FZVA 4GXQA 3NM6B 3TM5A 1LLUA 2ZRQA 3F98A 4LY3A 4MUNA 1SQGA 1USUA 2PE5A 4ABTA 3WWCA 1Y7TA 2Q45A 1T6ZA 2CLMB 3GFOA 2VTKA 3BTVA 3GLFA 5ENZA 4LX0A 1WUIS 3I1YA 4BE4A 4RE5A 4PNEA 2HLNA 1UQRA 1T36A 5CP8A 3DXYA 5DN9A 3KB8A 4HVTA 1DZ3A 2WYOA 4PLPA 1Y5MA 3T7KA 5EHIA 2PUCA 1VHLA 2AWOA 2C4TA 3RRZA 4IL5A 2IQ5A 4H7IA 4QTUB 1UZAA 4IIGA 1N33B 2QBYA 1QRTA 4RTMA 1Y5LA 3LIPA 1Q92A 2P0AA 3AM5A 4ALLA 2E5FA 2G88A 1YBVA 3I3OA 3D7NA 3F71A 3UWKA 4P82A 3HVUA 2CBZA 3ZWNA 4G0WA 4MR7A 1VKRA 3ZE6A 1RRKA 2PT5A 4NULA 1XTTA 1ISHA 4IJWA 5DGXA 2AJTA 3ASYA 2GCOB 4YPOA 4YT8A 3TXYA 1OYWA 3I76A 1RIFA 1KPHA 5IDVA 3L0YA 5DYYA