3L43A

Crystal structure of the dynamin 3 gtpase domain bound with gdp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
242
Chain Sequence
b'QIAVVGGQSAGKSSVLENFVGRDFLPRVTRRPLVLQLITSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynamin-3
publication title Crystal structure of the dynamin 3 GTPase domain bound with GDP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 242
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l43A00
5FOVA 2ATXA 821PA 2VIIA 3GLGE 2R6GA 4KLNA 1VCMA 2QAGB 4A0RA 1Q1QA 2GVDC 5GVRA 2X2EA 3FHTA 4LJYA 1UBGA 5JWHA 4FN5A 2QT1A 1G8HA 4V02A 2GCOA 4KYIB 4O25A 4HEJA 4Q9JA 1M8PA 3KKOA 2JJ1A 4UNNA 3CPHA 4YXWA 2X2FA 2O8EB 1G21E 1QF9A 1TF2A 2QROA 1G5TA 1YZTA 2YOGA 4RD2A 1XPRA 1ZNWA 2J1LA 4BLTA 2ZE6A 3V00A 3U7GA 3TSWA 5JS8A 3THWB 2WSMA 2ZROA 4PQYA 1GDDA 1UBFA 4NE2A 4US2R 1AGPA 5JZVA 2IS4A 1Z6TA 3IGFA 3FFBA 4ILEA 4YMTA 1DAKA 2C98A 3SYLA 4KVGA 2C9YA 4MDEA 3AKYA 2P67A 1E2LA 3VR5A 1HQCA 4NTZA 2QAGA 3UXMA 2PT7A 3B60A 3FKQA 4I1OA 4TMKA 5AJVB 1OXUA 1K6MA 2QTFA 4Q1CA 1Z63A 4PPFA 5EE0A 3W3ZB 2RGGA 1KIMA 4TLDA 5E7JA 2WICA 2HXYA 3CLVA 1QHHB 4YMWA 2RKOA 1N6PA 5D3MB 1J99A 1N6LA 2HUPA 4RD6A 4I1SA 2DWPA 3TUJC 3GLFB 1G7SA 1RIFA 1T0HB 4TQAA 1FL9A 5JJKA 3FGNA 1W4BA 1DAGA 3IEVA 1IAQA 1A1VA 1GM5A 4ZV4A 2MSDB 2V6JA 1OV4A 1DG1G 1E94E 2W83A 3KFXA 2ZRNA 2QQEA 1NKTA 1XMSA 8OHMA 4IOKA 2BEJA 3CR7A 1O87A 2ODBA 3M6AA 2PJZA 5JWRA 2OHFA 2WOJA 3DHWC 1NVXQ 3VR4A 4LOAA 4QM7A 1E9CA 1EG7A 4FMCB 2GXSA 2VEDA 5D3MA 2FGKA 2R8RA 5TDHA 1UADA 1D2NA 4CT4B 2AFIE 2JATA 3DL0A 3B7GA 4O3MA 3M0EA 2PZFA 4GP6A 1KNQA 3NIBA 5CYPA 3GJ4A 5EP2A 3T1OA 2V7QD 1M7HA 1HH4A 3H1TA 3SS8A 1DO2A 1FP6A 3B82A 1P2TA 2AWOA 4C0HA 4TMZA 1DAHA 3R8FA 1RJ9B 3CBQA 4D4MA 2ZR9A 4HYYA 3JVUA 4ZKEA 2B8TA 3BWDD 3IO3A 1ZM7A 4OK5A 4PX9A 4TZ0A 2F43A 3AF4A 5IK2D 1IXZA 1TF5A 4XIGS 3ZIAA 2QENA 3MMPA 3AH8A 1SULA 3HPQA 4M1WA 1T5IA 2RMKA 2JJ8A 4QKQA 4E22A 4TYYA 4G5QA 4URVR 2Q9BA 2ZRDA 1X8JA 3EA0A 1NJGA 2PL3A 2AN9A 4HLUC 1N6RA 2B21A 2XJ4A 2ORWA 3QKRB 5BN5A 3C15C 4IVRA 5HE8A 3DZ8A 4KYUA 1CEEA 4OI2A 2EFEB 4DDUA 2V55B 4TTRA 4NHOA 3U7EB 3A8TA 1Z06A 1J2JA 3K09C 4DCSA 1RVDA 3FMPB 4JLBA 4UXHA 2Z83A 4L8GA 4NPHA 2N46A 2BJVA 4GP7A 1MOZA 4OI0A 4HB2A 1RJ9A 4PO9A 3B9QA 4Q48A 3ZQ6A 2B7CA 4N1AA 4RD3A 5UKDA 2QRZA 2YWEA 2JAQA 2YVUA 4H9GA 4JJKA 2WSSA 2ZRAA 3FB4A 2ZJ5A 1KK1A 5G3ZA 2J0VA 3MAAC 3CRMA 1VTKA 1XF9A 2JDIA 4Q9HA 2BBWA 2NG1A 1RC8A 1KI2A 4V0LA 2GNOA 3Q8XB 3K70D 1ETUA 4F93B 3QKRA 5EXPA 3I61A 1GSIA 1OIWA 1EGAA 2ZRPA 5B30A 2EFDB 3QUSA 3L43A 5DISB 3U3OA 2IL1A 2CE2X 4JMPA 1HUQA 3KJHA 2ZI9A 4JKYA 3OEHD 4KVAA 3QENA 5J4LA 1IONA 2CCJA 4B75A 1XFAA 1NIPA 3MWJA 4D4KA 2EYUA 1PLJA 4GBMA 3VKGA 2VP2A 3T61A 3TUZC 3K0CA 2DFTA 1G8PA 1F48A 1KOFA 2Q3FA 5DSZA 1G20E 4PQRA 4PPQA 4DLXA 2WKPA 1NVVQ 2NO0A 2QE7A 3T5DA 3THXB 2ZVPX 2ZAMA 2J87A 1NN1A 2SHKA 4W5HA 1VYTA 1W2GA 3SJBA 2XNDA 4ASUA 4FINA 3UK6A 4Q7MB 4LBWA 3AVVA 1R0YA 1HEIA 1P60A 2ZE8A 3VR6A 1SZPA 4ON9A 2UZ3A 2P5SA 4FXPA 3QPWA 2WKRA 1N6KA 1XEFA 3SFVA 1AA9A 2RAPA 3AV0B 5FOXA 1XMVA 1UF9A 1VHTA 1ZCBA 4NCKA 4JL8A 2RCNA 2IYSA 4Q1DA 4M9ZA 4DXAA 2ZXUA 3OHMA 2A5YB 2FNAA 1P5ZB 2ZRIA 1M34E 3ND8A 1CULC 2JIZA 4O2RA 3PIRA 4OI4A 5FUXA 4DLWA 1JECA 3DKVA 3IIKA 3SOPA 2EVWX 2EFHB 3C4JA 4HAXA 2DBYA 2V8OA 5A5GA 4JLMA 1JEDA 2VF8A 3KKPA 3GPLA 3CWQA 3O8RA 2HT6A 1KMQA 5BWMA 4XVUA 3MFYA 4DRZA 2QMOA 1T3LA 4P32A 2NO9A 1F2UA 4WOPA 4B6EA 2VBCA 2W2VA 4ITRC 4BWYA 1ZU5A 5LD2C 3FMOB 3B2EA 5FBQB 1TQ6A 3LBHA 2DFNA 1J7KA 3D7MA 4GMXA 4EJSB 5KOYA 1W44A 3FPAA 5LBIA 2PCJA 1Z0KA 4U00A 1T4GA 1R6BX 3EPJA 5FFMA 1E1QD 2IYLD 2QSYA 3LH5A 3KUDA 3C14C 4OKSA 1E2DA 1E0AA 1CJUC 3LXRA 4Z51A 1MO6A 4C2UA 1RRFA 1S4QA 3CNLA 3N2IA 3UANA 2VPPA 2REOA 3L82B 3CZQA 1S96A 1OF1A 2OFXA 3CRQA 4PSAA 2P3SA 4FWTA 4WA7A 3VFDA 1NRJB 1H8ED 1G3MA 4IVPA 1OLOA 1VG0B 4YMSA 3KXKA 2I1VB 1HYQA 4A8JC 2H1LA 2IYRA 4TMWA 2ZS7A 4NYMQ 1K8RA 1TMKA 1TU3A 4JSTA 4EPVA 4QL3A 2J59A 1U9IC 1HA3A 3L2OB 3U6BA 4D25A 4BFTA 2REXB 4EKDA 4QBHA 1MRSA 1VIYA 4XJXA 5IK2A 3ONWA 4LZZA 1V5WA 4A9AA 2ZYTX 2OLKA 4QBGB 1US8B 1PJRA 2CK3D 3LXXA 4DCVA 1K5DA 1NN3A 3C7KA 3GJ8A 1P2UA 3MLEA 1QHXA 4KBFA 1TU4A 4E5UA 4F4JA 1BMFD 1YR8A 1S8FA 3K70B 3SQXA 4JLKA 1S9DA 3QSYA 4D0LB 1GL9B 3VHLB 5KDLA 1TQ2A 3DMDA 3P20A 1T8TA 1Z29A 2A5FA 3LLMA 1G3RA 2IC5A 5CLLA 1KO1A 2WOOA 3FHOA 4RY2A 4XWAA 5AUNB 3ICQB 5KSPA 2GJAA 1E9FA 3IIMA 2V1UA 1AQYA 1BKDR 2WWIA 1UFQA 1VCNA 2ZPTX 5C46F 3TJZA 2GA8A 1AIPA 1UKYA 2YWFA 3KL4A 1Q12A 3ETLA 1KAGA 4ZDKA 3QPUA 4Q03A 4BECA 3CPEA 5JCZA 3CZPA 1UBCA 5JJLA 1US8A 4DT1B 4L5BA 4D6PA 4M9SA 3UATA 2BMJA 1GNQA 3FMFA 1OT3A 4CF7A 5KU1A 2A9KA 4RD4A 3BERA 1F6BA 3DVLA 1GZSA 1PUIA 1AKYA 1VG8A 2ZSFA 3KXIA 4LY6A 4X8LA 5JMTA 1WXQA 1C4OA 4RFVA 1EFCA 1N5IA 2IA5A 4XTRA 1O3YA 3AGPA 3N70A 2AKYA 1E9EA 4CRWB 4HZUB 3NEYA 1W5SA 1GUAA 1S2MA 3GEIA 1U2RA 4WXRA 3TK1A 1DADA 3GD7A 4LJAA 4KFSA 1A2BA 2N1BA 2QGNA 4PPGA 3BC1A 5FTMA 1OH6A 4M21A 3BB1A 5KPJA 2O8FA 1G18A 2ZRKA 4B3BA 3W6PA 1VYUA 4KU4A 4V0KA 5AJWA 5B57C 1FMJA 4G0NA 4HAZA 4MH0R 4XSHA 4XSGA 2OCBA 2YYZA 4LYAA 3T06B 2WM9B 4CDGA 4EPRA 3LW7A 4YDHB 1UDXA 1D6JA 1HE1C 1S3SA 2WWXA 2J5XA 4PC7A 4DZZA 5J4KA 2IUSA 2FF7A 4P4TA 1TPZA 4M1YA 2ZETA 1VIAA 2W2TA 3NBZC 4OHZA 2XSZD 4Q4AB 1D9ZA 3HYRA 5TMPA 1MKYA 2HF8A 5DGXA 1OFUX 1KO4A 3H2YA 3PUYA 2P2LA 1FNMA 2CVFA 3K0AB 1QG4A 2VO1A 1U94A 3QEOA 5BW8A 2A7QA 1D8TA 1KI7A 2GXQA 5HCIA 3BBPA 1XRJA 3AGQA 2BV3A 1YRAA 2IWHA 1WQ1R 2J45A 1CJKC 1OB5A 4PHHA 1NG9A 2ZIAA 3F8TA 1SHZA 2ECKA 3M4YA 4L9SA 4D80A 4Q21A 1XEWY 3T15A 5EUMA 1KY2A 5B58C 5JBQA 4K46A 2IEYA 3WMFA 3U60B 4WIAA 3FYHA 3WMGA 4NU0A 3SJAA 3AVPA 4Q19A 1KHTA 2L0XA 1G291 1FFHA 4R7ZA 3T12A 1MO5A 2DY1A 2RGNA 3MWLA 4ZIRB 4IDPA 3RHFA 3GCGA 2BJWA 2GK6A 4BE7B 5GJBA 2MMCA 4YC7A 4LK2A 2FJUA 2AL7A 2AX4A 2O8DA 2IS6A 1E1QA 1N6OA 1JQLB 2YHSA 4URYR 4OYHA 5JRZA 1Z6XA 1Q57A 4XVQA 4C3ZA 1P62B 2WWGA 2NO7A 2FGJA 1TADA 1VMAA 3LNCA 4D82A 1TTTA 3EA5A 1NY6A 2WJYA 4Q1EA 4QGFA 1OB2A 1NJFA 5JEDA 4E07A 4RZXA 4A6XA 3E5HA 4WZBE 2VH5R 4UQOA 1NP6A 1YZUA 5H70A 1W49A 2H57A 5HR5A 2WJHA 3OAAA 3O8DA 3WBJA 2YC4C 4Q02A 4CGZA 3GJXC 3SJZA 4MGIR 4TQUS 3SU8A 2F1RA 3WNBA 4MUBA 3AP2A 1UKEA 1FX0A 1RZ3A 2QP3A 3EW9A 2CVHA 1L7VC 5TY0A 1ZMXA 1ZM3A 5TB5A 3CR8A 1G4UR 1P9RA 2CDNA 3BK7A 1I4LD 3RRNA 2GRJA 3KZ1E 1G7CA 2OXRA 2CK3A 2ZJOA 4Y0AA 1SVOA 4LPSA 1XCMA 1E2GA 1BMFA 4WVFA 1YZQA 5L3RA 4JLVA 4ABYA 4A36A 1ZP6A 4C7OA 3UWOA 3V9PA 2KE5A 1GL7A 1EFRD 1SXJC 4GFDA 1SKQA 2FDCA 1IN5A 5JWOA 4M9QA 4HAWA 4EPYA 5BYKA 5AJZA 1OH7A 3TAHA 1G3UA 3PQCA 2WWWA 1QZXA 4PC1A 3SJCA 2FSHA 4DC9A 3CB4A 4RFSB 2IW3A 4DSNA 2CHGA 3HU3A 3KXLA 3KQNA 4A1FA 1DELA 2QRNA 3QY0A 1II0A 5FPYA 1DEKA 3ZZUA 3AM1A 3RC3A 3KKNA 2ANCA 2IEZA 5FBLB 3SFZA 4E09A 2JLQA 3CIOA 1E79A 3RS3A 2QP4A 2R44A 4RZ2A 2FSIA 1Q22A 1ESMA 3CH4B 4FCWA 3G0HA 3VNVA 3T1TA 5KYKA 2QGZA 1IJEA 2JLRA 3VKWA 3C41J 2NOAA 4AIIA 2KWIA 4GNKA 1TUIA 4JLOA 3KJIA 2EFCB 5IDVA 1COWA 3V4RA 3AEZA 5IF9A 4PAMA 1Q0UA 2DFLA 4B76A 4Q66C 5FTLA 4RFSA 3OF5A 1P2VA 3EARA 2NTYC 4KODA 4QGGA 3VMFA 1R8QA 1VCIA 1W4AA 2JCSA 3NTUA 2IXFA 4DSTA 5CM9C 3K9GA 5DI3B 3M1IA 3PVSA 1QVRA 3W34A 3GLIA 1XD9A 3BORA 2J0SA 4IVQA 2ODWA 2IBMA 3EWAA 3GMTA 4P0TA 1JXMA 1Z0FA 3RRMA 3A1VA 5JS7A 4L4UA 1WA5A 3TQCA 4BASA 2HJVA 3AF1A 2HYDA 5CK4A 2FEMA 4BUJA 2IUUA 1CF4A 1T6NA 2MMGA 2XSZA 2GEVA 3MSXA 5BN3A 3D8BA 3EZ6A 4LRWA 4HZIA 3QBVA 2CHQA 4X8HA 4A8JB 4Q01A 2VP9A 4DUGA 5GADl 4U02A 4A6PA 2GXUA 1Z22A 4F92B 1SVLA 4MKHA 1GP2A 3ZVRA 1S1MA 4CEJB 1CR2A 5AUQA 3UG7A 3AP3A 2GJ9A 4OBEA 2FG5A 3RDPA 5JRJA 3VQTA 1GRRA 4KFTA 4JT4A 1MO3A 4BEJA 3LFUA 3WRYC 2PX3A 1FNNA 5CM8B 4RKFA 4KFRA 5EP4A 5TVKA 2XZOA 4M1SA 1NMXA 1QHSA 5TARA 2ZVQX 3HU1A 3IDQA 2FPKA 2OBMA 1J90A 3I32A 1W46A 5L3QA 1EESA 1NF3A 4NYJR 1KI6A 2ZE7A 2FFAA 1KI9A 4HDCA 2VHCA 3EIQA 1T3HA 4MKIA 4XVRA 2KSQA 2ZJZA 1VG1A 1UKZA 2XTNA 5FL7D 1E99A 3EC1A 2XEXA 2W2XA 3AKCA 3FHCB 1Z2AA 2Q6TA 2QPAA 4TMTA 4MGKR 4JLDA 2IWRA 2CJWB 3TSZA 3MCAA 4CEJA 2ZRBA 2A5GA 4OHXA 4TT3D 4GDFA 5DYIA 5HZKA 5HE9A 4Q1FA 4URZR 3U3JA 1JJVA 2ZS9A 4QRHA 3U4QB 3C8UA 3A37A 4RJLA 3BRWD 3SYNA 5KNDA 3VKHA 1XTSA 3AVOA 4BLQA 2JEOA 4OQMA 1ODFA 4PPNA 4NZYA 2WWFA 3BFXA 4DKXA 4EQ6B 1OFIA 3WMEA 3F3YA 1JAHA 1N0UA 2QAJA 5FTNA 2PJRA 3G82C 4IKEA 1A5TA 3SQWA 1ZM4A 4FW9A 1W0JA 3MD0A 3UIEA 1G64A 1MRNA 1FPMA 1DBSA 2CJWA 1YR6A 3MGCA 4DHEA 3I1FA 3JZAA 4JLNA 2CCKA 3GLHB 3PEYA 1Q1EA 4YDSA 2WPDD 3RS2A 1EFHA 3U6KA 3QXXA 3AB3A 3OEED 4UNPA 4A2WA 2ZUCA 1KK2A 5DN6D 3R9IA 4RSGA 1E2IA 1EFRA 1E2HA 2F6RA 1VECA 4W5JA 3GLIE 2NZJA 4KHZA 1JB1A 1G19A 2IK8A 4PSVA 2PZGA 1ZNZA 4LHVA 4EQ6A 4B43A 1GWNA 4OI1A 2EWVA 2E1RA 4J0QA 2A30A 2ZR7A 4IJMA 1KZGB 1G5RA 3A1WA 2OFWA 4P33A 2GILA 5J4HA 1PLLA 1N2CE 1JQJC 3VAAA 1Z2CA 4AYXA 2O8EA 2I1QA 5EP3A 1TF7A 3IQXA 5TV2A 1AJEA 3LWNA 5CK5A 4RZUA 1VYVA 3KX2A 1FQJA 3THWA 1NKSA 4L16A 1RRCA 5J40A 1G6OA 2BMDA 4PC6A 1YZKA 1XJ0A 4E03A 1OYWA 2D2EA 3UMFA 1R7RA 2D62A 1W1WA 1IHUA 2CCGA 1LTQA 3VR2A 2PLRA 3TBKA 1N0WA 3T5GA 1E2NA 4MYUA 3MJRA 1M6NA 3EAQA 2GTPA 2O52A 4JT2A 1D9XA 4RCZA 5JEEA 3IIJA 1EX7A 1XP8A 3H86A 1W0KD 2PCLA 4FWIB 4DSOA 1QHHA 5AWFC 4GL2A 4JZKA 1FUUA 3E1SA 3HU2A 3GFTA 1NNEA 1E69A 3GLFA 5J4YA 1NL3A 2BHRA 5GVSA 1CJMA 2MSCB 4NMMA 4IDNA 1MH1A 5JSZB 1IN7A 4DLRA 5ELXA 2XOKD 3AVXA 4G5SA 1AZTA 3SI7A 3HJNA 2BCJQ 1XEXB 2HJGA 3TE6A 4EAQA 5CYOA 1E9AA 5FOUA 3PR1A 1YRBA 3QF7A 4UJ3A 2C96A 2E9SA 1VHLA 4UNSA 1E4YA 1KDPA 4LX0A 2AD1A 1HURA 2C95A 4XH9B 1SHKA 4TZ6A 4FI3C 4OHYA 1E2JA 3L8ZA 3SHFA 2OUKA 3EXAA 3SHWA 3AUYA 1G8FA 3A36A 1TEVA 3AUXA 1TL7C 3WYFA 4TSFD 5FPSA 2D06A 2ZTSA 1CP2A 3JVVA 4HAYA 1ZIPA 2P65A 1GAJA 1CXZA 4HLDA 5E95A 1GKYA 4A82A 5EE9A 5KNCA 4LHXA 4BFUA 4V0MA 2XX3A 2J41A 1G3IA 2O8BB 4LC1A 1XEXA 3I3SR 5LB2A 2CL6X 3X1XA 5EE1A 4TTQA 5FL7A 1SXJB 3KQHA 5AR1A 2UZIR 4N3NA 2P0EA 2B6HA 4Q5IA 4MGYR 3D6TB 4B32A 2XXAB 2C2HA 1QHNA 2F1HA 1J8MF 1OFTA 1YKSA 4TT3A 4XTCS 2BM1A 1MT0A 4JVSB 4Q7KA 1P6XA 2FOLA 4NYIR 5FR2A 1KMHB 2W0SA 3B9PA 2ZI5A 3QKTA 3O8CA 2W6JD 4Z8XA 2Z43A 3GLHE 2C9CA 4A0GA 1T9HA 3SBEA 4LBZA 2FPMA 2C99A 2FFQA 2JLSA 1G4AE 2VF7A 1EWRA 3H4MA 1E6CA 2ZSBA 3NXSA 4B34A 1R0XA 4TN1A 3ICEA 1ZVQA 1DARA 1AN0A 2H8KA 2VP4A 3NBFA 4FCTA 4P4SB 1KDTA 1II9A 3IHWA 5HPYB 2REBA 4HDQB 3ADCA 4DSUA 2JLXA 3WHKA 1XXHB 4HLCA 2GZDA 3OE7D 4V0NA 5EJEA 2XXAA 4OK3A 2JGNA 4MRNA 1P3JA 3U2QA 1KGDA 1XWIA 3IBGA 3QG5A 3RSLA 2O0KA 2WPDA 4UNQA 5HCNA 4Q9KA 5AK0A 2H7VA 1KJZA 1KMHA 2FZLA 1S0UA 2ODEA 3NWJA 4FMDF 3CWZA 1KSJA 4CEIB 1P72A 4TQ9A 3ZZTA 3GLFE 1R8SA 4FMBB 1SVWA 1P9WA 4ZI2A 1R4AA 5H68A 3RAPR 4HB3A 3WNDA 1OHHD 1YZGA 3JZMA 5SZJA 3RWOA 2QSZA 4OHWA 1NMZA 1ZC4A 2BMFA 4PC3A 1WF3A 4KCGA 3THXA 4B3GA 5G3YA 3MJHA 1XXHA 3EZ7A 3SR0A 4DCTA 2DYKA 3C5HA 4NCJA 1SVSA 4DEYA 4XWKA 1L2TA 2ZYVX 4EFNA 2V54A 1IOZA 1GRQA 4B2LA 3AF0A 4BLOA 4TWZA 2OILA 2W6ID 1IN6A 1LS1A 4Q4JB 1DAFA 1XMJA 2YZ2A 4W9MC 3BD9A 3K9NA 2WBLC 4PANA 4CEIA 2F9LA 1Y63A 4JLAA 4ZKDA 1TUEA 2NPIA 3W6OA 2YOFA 421PA 1Q21A 1Z3IX 1Q1BA 3BOSA 1FUKA 4BLPA 2AFHE 1WBBA 1X1SA 1Z0DA 4V0ME 1W36C 4OQFA 1IBRA 1XU4A 1Z08A 4M8NE 1KK0A 2GJ8A 1LY1A 1NI3A 4TTPA 1W0KA 3IQWA 4NYJQ 3BJIC 3CKLA 2YOHA 3ZD7A 1V43A 4YONB 2Z6VA 2WJGA 3LBIA 1Q3TA 1Z0JA 2GBLC 5F9HA 1HTWA 1Y3AA 3B78A 4IOMA 2O0HA 4D0NA 2Y8EA 4O2LA 2WKQA 4PZZA 2V7QA 1Q3HA 3VX4A 2XOKA 5GJWC 3A1UA 4EJSA 1R0WA 2DCUA 1C9KA 2WJVA 1KDRA 1G17A 3QXCA 3BE4A 4JVLA 2FE4A 3P4YA 4GZLA 4EIWA 2QI9C 3A4LA 3AVYA 5GJVC 1JJ7A 2QMEA 4LJ8A 4LJ5A 1N5LA 3TGPA 1NSFA 1T91A 4IXNA 2R6DA 3B5JA 3GEHA 2TMKA 1UJ2A 1SKYB 1ZC3A 5G41A 1BH2A 4QHYA 3QEJA 5FBRB 5L3VA 1GG2A 1G9XA 5H8WA 1NG1A 2GETA 4PHGA 3AF3A 4WBSA 4UXJA 4TSFA 4AKHA 4XWOA 1KSGA 4A2QA 2AR7A 1M74A 1W4RA 2QUZA 1RFLA 4US1R 4W7SA 2IYYA 2R2AA 2DPXA 1BS1A 2C8VA 3TMKA 1MO4A 4B3FX 1JNYA 2NGRA 4WAUA 1FP7A 1VKJA 2RGBA 2XJ9A 1VPLA 2G1JA 3ZLJA 3F0TA 4QJ5A 3TVDA 5IRCD 3QG1A 4LI0A 3FKSD 1U0JA 1N5KA 1CBUA 4KXFB 1HT2E 5EZ6B 2ZYWX 3CX6A 2C77A 2F1IA 1BOFA 4KFUA 2WVJA 1G1MA 4TL9A 1TAGA 4MUAA 4OHVA 4S2EA 3ZVMA 4II7A 1IY2A 3GJ5A 4DWJA 5TXGA 2XB4A 3BS4A 5JJIA 4IEIA 3RRZA 5HKKD 1XXHE 1QDEA 4IDQA 3GJ6A 3E70C 3TIFA 2HDNB 3OEHA 1GVNB 1Z0AA 2QP9X 2W6JA 2IXGA 3ASYA 2A5DA 1P2SA 3KQUA 5P21A 4Z1MD 1E2MA 2OCPA 2OE2A 4EUNA 1RRGA 1KO8A 3A1SA 3WYGA 3OIUA 1Z8FA 4Q9LA 3QXSA 4CZ2A 4OQLA 1KY3A 1OE0A 4LSGA 3WY9A 2BBOA 4AD8A 2GHIA 2IHYA 3CRRA 2VHQA 3QKSB 3EC2A 1QRAA 4IFBA 3R7WB 2RGDA 3OE7A 3CF6R 4DT1A 4ZCLA 4PAQA 4UXIA 4URWR 2Q9AA 2QAGC 1XD8A 5AJYA 5DHAA 4PZYA 4DB4A 2H92A 1R5BA 3H0KA 2W00A 3R8CA 3X1YA 4M53A 4MA4A 2FWRA 4TLAA 4CVNA 3QPVA 1GKUB 2OCAA 2OT3B 5EE5B 1G8GA 3PFIA 4QNRA 1E9BA 4HAUA 4GOXA 4HZUA 2RGCA 4B3XA 1EXMA 1ZUNB 2MSEB 1X8KA 1A2KC 1MABB 3OESA 5E7IA 1ZUHA 1KI3A 1RRPA 1ZYUA 3VR1A 1E98A 3QVUA 1BYIA 3DPUA 2JLWA 4B47A 2XTMA 3EASA 4LJ4A 1YZNA 3EZ9A 3REGA 1KTVA 3QKSA 3R7WA 4DEXA 4CW7A 5FBWB 4R98A 1ELOA 3CX7A 4PFSA 1QBKC 1JBKA 2R9VA 1P61B 4FMCF 4MRVA 4TLEA 2GAAA 4JVNA 3WRXC 1DG3A 4LV8B 4TYNA 3TVTA 3W8RA 5KHOC 1BIFA 1DO0A 1KI4A 2B8WA 2NZ8A 3TSOA 1OXTA 2OBNA 3NDPA 3GJ7A 1XNJA 2EFGA 4Q4AA 3QQ5A 1X1RA 1ZUIA 4URUR 2XAUA 2P6UA 2FZ4A 1MABA 4PQFA 3LBNA 4YMUA 1S3GA 1DS6A 3K0AA 3LX5A 2FX3A 3DOEA 1KDOA 3T34A 1E0KA 3QF4B 4NCIA 1QG2A 3L0SA 3AVQA 3X1ZA 1G7RA 621PA 1LF5A 1IXRC 1EX6A 3FDIA 4LJ7A 2WAXA 3X1DA 3U44B 3DM5A 4N0DA 3ZD6A 4IRUB 1F5NA 4IW3B 1H8HD 4NCNA 3KTAB 1KI1A 4LBVA 3X2SA 3GJ3A 2LKDA 3NHBA 1H8EA 1OFHA 3ZS9A 4ARZB 3Q5EA 3PG5A 2V1XA 2ZJYA 3HR7A 3QIAA 4DBLC 5JFGA 4C0JA 5KUTA 3R9XA 3W6NA 4HLUA 4TMVA 4BLRA 2XZPA 2CXXA 4B71A 4ZIRA 2ZU6A 1LS6A 2JLUA 2DWOA 2QY9A 3HPRA 1E2KA 3K09A 3U3RA 1G41A 1R0ZA 4NYIQ 4ZPXA 1JR6A 3W90A 4HB4A 4D4JA 1GNPA 2OESA 3HYTA 2Q21A 1X6VA 3CO5A 4POAA 5C1BA 4URXR 5D3QA 1AZSC 2CLDX 5FUVA 3U44A 3ZS8A 4BGDA 4FD2A 4GOKA 2Q9CA 2V6IA 4P31A 1LNZA 1FQKA 2UVQA 4YMVA 3KQLA 1SGWA 3FOZA 3G5UA 4ARZA 2VYFA 1JI0A 1FZQA 2YV5A 4FCVA 4JKIA 4TLBA 2V3CC 2GXAA 4R2IA 3IILA 4B33A 1YJ5A 4LUCA 2K5UA 3LVRE 2GDJA 2G77B 1JPJA 2YJTD 2JJ1D 1OW3B 1M7BA 2ERYA 4YXWD 2KB0A 5JHGB 3EPLA 4F4CA 2JLZA 3NHAA 3NBYC 4EPTA 4IDOA 4BQSA 1KJYA 1DE0A 1KO7A 2ZRJA 1AS3A 3TUIC 2JJ2D 3FWYA 3RYTC 3W5JA 2ATVA 5EP1A 3K0CC 2A2ZA 1OIXA 1FW6A 5H1YA 3AVUA 3NDBB 3AP1A 2IUTA 4MITA 3PUWA 4BRUA 2F3RA 5FR1A 4JLPA 4A2PA 5HKKA 3ZDQA 3ADDA 1I2MA 3SC3A 2RB4A 5F3WB 3RVBA 5SZKB 3FMIA 4DLSA 4BFVA 4KAXA 1GILA 2A78A 5IHPA 5CITA 1S1CA 4Z1MA 4CT5A 3BXZA 1U90A 3EX7C 5FOTA 2PEZA 5LD2B 3DM9B 2NO1A 1MV5A 3IEUA 1ZNXA 4O0MA 1OIVA 4A15A 3PXGA 4OK6A 1QVAA 2JA1A 2GCPA 3ASZA 2D4HA 4PR0A 3ZVNA 2J3EA 2OEPA 5AJXA 1CU1A 1L4UA 1FOEB 2WHXA 3KKQA 2ZSAA 5AUPB 1XX6A 2IHBA 3U5ZB 2VSFA 3I5YA 4C30A 5LDDC 2CE7A 2OM2A 3R9WA 1GOTA 2FN4A 3RWMB 3LV8A 4PO8A 4PTLA 5IT5A 1P7CA 1OYYA 3UPUA 5KSYA 5C18A 4Z54A 2QQ0A 2WWHA 2ZSDA 2BIFA 4C0AC 1Z47A 4KITB 2D2FA 2QL6A 2XTZA 3CW2A 3TRFA 4EFLA 1WDTA 4A0HA 1W5TA 3QJYA 3MG9A 1XZPA 2KJQA 2IS2A 3WP0A 1NLZA 4XOIA 3S1AB 2GEDA 3QVVA 4D4LA 2ZITA 3AVTA 1R5NA 1ZINA 1ZIOA 2F3TA 4IHQA 1CLUA 2OAQ1 2ZRMA 1T5LA 1WBDA 3TR5A 2B7BA 2RGAA 5DI3A 2YC2C 3LQRA 3N2EA 2QEQA 1A4RA 3B1XA 3DDCA 3NVAA 1EFUA 2EW1A 1PZNA 2QMUA 3TW4A 1GKIA 2ZR0A 1WRBA 1TQ4A 3FVQA 3PITA 4GZMA 2I4IA 4QBIA 3DEFA 3LLUA 4M9XA 4GI7A 1ZD1A 5FPHA 2W0MA 3ZIAD 4AG5A 2ANBA 1LFDB 1P4SA 2OSBA 2Z0MA 3SYKA 5FTKA 4NH0A 4A8JA 1II8B 2R6AA 5DLQC 3I73A 4B48A 3CNNA 1DAIA 4Q4LA 3SZRA 1U9IA 2ZAOA 2EYQA 1UEJA 3HR8A 1Z6AA 1YVDA 1UBEA 1AS0A 3UKDA 1X8LA 2VA8A 4JBYA 1ZBDA 4RD0A 3I62A 3L0OA 4IEEA 4GT1A 1H8HA 3EIEA 3ECCA 3WP1B 1XMIA 1R10A 4IXMA 2ZS8A 1GL6A 1E0JA 2YWHA 3W8NA 1XPUA 3A6PC 1XTRA 5F9FA 5SZHB 3L0IB 1JR3D 2FSFA 3K1JA 4G5GA 1RYHA 2PZEA 4BPBA 3FE2A 2WJJA 2WSSD 2CHVA 1L4YA 2FU5C 5G53C 2HYIC 2ZRHA 1P9NA 4QGHA 4HI0E 4NYMR 1DAMA 1PUJA 2OFOA 1E4VA 3SN6A 1SXJD 1II8A 3U7FB 1N0VC 3TKLA 2EU8A 1NIJA 3OIWA 3A4MA 2GJSA 4NL4H 3LW8A 4Q18A 4WXPA 3LRPA 3NC1C 4C0SA 2G6BA 2VHJA 3KJGA 2WV9A 2WZQA 3HWSA 3CRVA 4HUQB 1G3QA 4JL6A 4BFWA 2DHRA 3U4QA 4BZQA 1XBTA 5LPNA 4NKRA 4HATA 4PSKA 2X77A 1DOAA 1VCOA 2QA5A 1Z6YA 3EZ2A 1I4TD 4EPWA 3HP1A 2ZJAA 4WZ6A 2QE7D 5CDFA 3K70C 3MWKA 1CRQA 2GF0A 4C0LA 4AKIA 2ZJ2A 3ZJYA 2IXEA 2XNDD 4MRSA 5LB4A 4ASUD 2ZUBA 4JVMA 1XPOA 1OH8A 1I2DA 1SVKA 2ZU0C 1XB2A 1DVRA 4U7DA 2ZM5A 5KSOA 4CIDA 2J46A 2JJ2A 4XD7D 2QPTA 5JCPA 2HLDD 2XGJA 3U61B 2FH5B 4AG6A 1N6HA 4B3DA 1VG9B 3THYB 4G3XA 3Q5DA 3UMSA 4M1KA 1U8AA 3GQBA 3ZYCA 3GLHA 2ZSEA 3WNCA 4HUQA 1G5PA 1XTKA 4PC2A 2FFBA 3RRYA 3KJEA 3CX8A 2JIZD 4ESHA 4QHSA 2GCNA 4PHFA 2BBSA 3A58B 3NH6A 3CUEF 1IY0A 3IO5A 3D31A 3RLFA 1BO6A 2ONKA 3IKJA 1N6NA 2WWYA 3U7HB 4LC0A 3VTKA 4GPTA 1W7AA 3IPYA 1OJLA 1ZAKA 3I4LA 1YE8A 2QMHA 4DDTA 3EPKA 1OKKD 2NO6A 2IYXA 4M4SA 3RABA 2AK3A 2DFKB 3X1WA 2VLIA 3LD9A 1QHIA 2Q0HA 3THYA 4UKDA 4Q00A 2WIBA 3QI2A 3CNOA 2LWIA 3I5XA 4OQXA 1CKEA 2V4ZA 5B2ZA 1GRNA 1M2OB 2Q3HA 4QOSA 2F43B 4CYMA 4AWXA 3BAFA 2GESA 4MYCA 5FPKA 4BZPA 1P73A 4B2IA 1DTSA 4V03A 1E32A 4JYCA 1KKMA 4Q47A 1U98A 4B2PA 3GFOA 1Z07A 2OV2A 5F98A 3QBTA 2OCYC 3ZZ0A 2GVZC 1SQ5A 2RGNC 1TNDA 4TMXA 2CLSA 3LVQE 4KSBA 1JALA 1W4CA 1L8QA 1N6IA 2VHTA 3IHLA 1YR9A 4Q7LA 3TNFA 4B35A 4V0OA 5DIFA 3LA6A 3BGWA 5CJ2A 3Q7QA 4NDZA 5JSZA 3LX8A 4AY2A 3KDSE 1J8YF 3TR0A 1ZNYA 2IYWA 1G7TA 1IN8A 2QPOA 3ZQJA 5CB6A 3TLXA 1NSTA 2QTHA 5CJPA 4LGMA 5CLQA 1NBMD 4N0EA 4OJKA 1XEWX 5CDFE 2B92A 3RC8A 2BM0A 1GNRA 3MUFA 4BFXA 2IYZA 2NIPA 4KI0A 1CJVC 3OFND 5J5CA 1LV7A 3MRSA 4B44A 1E1RD 1ZD8A 4A92A 4D0GA 4RD1A 1F2TB 4QBFA 2J0QA 2BVNA 4KBGA 5G40A 2VQSA 4HAVA 2PEYA 3R20A 4QC2A 4NONA 1FTSA 1UEIA 2VTKA 3AVWA 1JR3A 3U3KA 3NEJA 4DLVA 2PX0A 4GOJA 3ZGXA 4DVGA 1E2FA 4DB2A 4Q4HB 4AYTA 1T3SA 1CJTC 4JJZA 2O8BA 4YLGA 1FTNA 3GP8A 4AI6A 3Q7PA 4G1UC 4JYBA 4S35A 2A3RA 1AM4D 4B73A 1U8YA 1SXJA 1ZJ6A 2Z4RA 4G01B 4IOLA 3BFKA 3BIFA 2CL0X 1XJCA 3ZH9B 3THOA 4C2TA 2XB2A 4JBWA 1E3MA 5F2EA 4QJ3A 3K53A 1UAAA 1LVGA 1R5OA 4TYPA 1WB9A 1DAEA 5AUOB 1F2TA 1KZ7B 3CM0A 3VNUA 4RCYA 521PA 3BB4A 4I1VA 3FFAA 1AGRA 2FV8A 3OEEA 5K8TA 1Q44A 2BC9A 5DN6A 4LHYA 1NN0A 4P3YA 2ZEJA 4KV9A 2FSGA 4RKEA 5KTYA 4Q4HA 2VL7A 1Z28A 3KB1A 3QE0A 3TAUA 2EWWA 1A82A 5FI1B 2W58A 4MDFA 2G9NA 3RANA 3WBKA 5JECA 1XTIA 5EE3A 1G8YA 4P4SA 4A0FA 1F2UB 1A7JA 1U81A 4MRRA 2QU8A 4XD7A 2HLDA 1E9SA 4TL8A 4H1UA 3BH7A 4TL7A 4RVCA 1UM8A 4ZI3A 3QOFA 2KI5A 2ZQ5A 4LJ6A 4A4DA 3B8HA 3L8YA 5CIWA 3Q9LA 3VHXA 3T35A 4LBYA 4AK9A 4LHZA 4LV6A 3HDTA 1OXVA 1ZCAA 5FTJA 3CF2A 2IT1A 1N25A 1UKVY 4C0BA 1AS2A 4C0KA 4ACBA 1KJWA 1YHNA 3RS0A 3IBYA 4H1VA 2FEOA 2CEAA 5KPDA 5K8LA 3W5IA 3VR3A 2IYVA 3QXHA 1CR4A 1OKKA 2QM8A 5EQTA 4LYHA 3OIVA 3PUXA 2J7PD 1DPFA 2F9MA 4KJZA 1TQDA 4C0QC 4QXAA 3BFVA 4CEHB 2LKCA 1X86B 2ZJ8A 4I99A 1EK0A 1I4DD 2FFHA 4DIDA 3DKPA 4QJ4A 3BB3A 2BCGY 3AF2A 4UJ5A 4K8OA 2GK7A 2V9PA 3PENA 3ADBA 1NLYA 4Q4JA 2AD5A 3KB2A 4I81A 1N3BA 3P27A 4HSEA 5FI0B 4TYQA 1MR3F 3KKMA 1AK2A 3I8SA 4OJQA 2D3WA 1JR3E 2IF0A 1PV4A 1KYIA 4LJ9A 1KI8A 1IY1A 2NMVA 4DLTA 3NBXX 2X19A 3QKUA 1D2MA 3U3MA 2BMEA 2PH1A 1LW7A 2VSOA 4Z8YA 1T8UA 2QNRA 3CF0A 4IDHA 5K8UA 1SXJE 3OAAD 2ZJBA 3V4FA 5J4VA 2BOVA 1ZM9A 2GWHA 5DH9A 5EUQB 5KO2A 4CEHA 5HZHA 2FA9A 2G0NA 4QNMA 1ANKA 4WZAE 4ZCIA 1XJQA 4HB0A 3H84A 1SVMA 5A4JA 3RS4A 2C78A 1UDWA 2ZUDA 2OZEA 1N5JA 5GJCA 1KK3A 4B3CA 2H17A 3CRW1 3A1TA 1U0LA 1NMYA 1CIPA 4QM6A 4ZDJA 2N42A 4BFZA 1IQPA 2QT0A 2YNMA 3GEEA 3K9HA 2XNSA 1NN5A 1WE2A 1NBMA 2IF2A 2ZI4A 4M22A 1Z6GA 1TEXA 2AK2A 5KDDA 5DHFA 1HY3A 1J70A 1XTQA 3OFNA 3ZVLA 1E1RA 4TL6A 2IX3A 1OSNA 3Q85A 2VP5A 2CNWD 1OXXK 3WYAA 1F60A 4RZ3A 1E0SA 5BXQC 4F91B 4LWZA 1M1YE 2BKEA 721PA 2H18A 2O8FB 2O5VA 4M0LA 3Q3JB 4EFMA 3DMNA 4Q9IA 2RHMA 3LDAA 2C03A 4R2HA 4W5WA 1X3SA 1G16A 2CLCX 3PUVA 1KNXA 1CS4C 5EZ5A 2ONJA 1XTJA 4C9BA 2AXNA 4KO8A 3LQQA 2X8AA 1HT1E 1E79D 4LDJA 4AKEA 3A4NA 5HTKA 1HE8B 5DI9A 3T1VA 3I92A 4TLCA 3RSOA 4ZDIA 4Y0VA 2G1KA 2BKUA 4JIMA 1KO5A 1U8ZA 3K9LA 2LCFA 2JLYA 2ZYUX 3GJ0A 2O0JA 1KKLA 3QXJA 2QZ4A 3LO5A 2BBTA 2GF9A 1COWD 4GRAA 2CMKA 2CBZA 2D7DA 3K0FB 2FPLA 4QGAA 1Z0IA 1HQYE 2PLFA 3O8BA 4AKGA 1PVOA 4X8OA 5FUWA 2ERXA 3IPXA 3VU9B 1NLFA 2AXPA 1OHHA 3K0SA 2H16A 2X1VA 4Q7JB 1QHGA 4R9UC 2GZAA 5KSZA 3NKVA 4KSCA 3P4XA 4IFEA 3BH6A 4IOJA 3C16C 3AQ4A 3SEAA 2ZRGA 3DO6A 2QBYB 3AKEA 2QG6A 2ZI6A 1KAOA 2DR3A 2J7KA 2ZE5A 1W36D 3CONA 3PJRA 2VSXA 4MYTA 2ZRFA 4MKFA 3MWYW 1E2QA 5EXXA 2W6IA 5FOWA 2O8DB 2QN6A 2R65A 2RGEA 4DUGD 1QHYA 1WMSA 3Q72A 4I1UA 2WMNB 2HXSA 2OG2A 1XZQA 3K0FA 4ZO4A 3K8YA 5C2JB 3B13B 4BLSA 5CIQA 2EQBA 2PBRA 4LV5B 3VU9A 2GKSA 4DDVA 5CB8A 2CL7X 5FPTA 4NCHA 5BN4A 3DOFA 4UNRA 2Q3MA 4HUTA 2J7PA 2Z4SA 3EG5A 3SBDA 2DWQA 5EXTA 3OIYA 121PA 3W9YA 3CPJB 2QBYA 1NBME 4BRWA 1UPTA 1RE0A 3RNLA 3OZXA 4BFYA 4BZXA 4D81A 4TYWA 5FUYA 3B1WA 3UG6A 1XCPA 1TX4B 4EDHA 1YQTA 1SKYE 1FX0B 3LY5A 4K81B 4DCUA 2R6CA 2JASA 3P1JA 1WP9A 4JS0A 5DO9A 1Z5ZA 5SZIA 1Z83A 3RS7A 2VP6A 1JEEA 4LCBA 3WHLA 2OLJA 2R6FA 1OXSC 1JPNA 2RHDA 2GZHA 4BEBA 4ERNA 5B64A 3PV0A 4P4UA 5C4MA 4JL5A 4ZDWA 3GFPA 1RPZA 2OAP1 2F55A 1IM2A 3KQKA 2IYQA 2Z5FA 3QF4A 2BDTA 4BFSA 2F1JA 3REFA 1XDBA 1ZD9A 2ZANA 3B1ZA 3C5CA 4C7OB 1W47A 3L0PA 1H65A 2HV8A 4ESVA 2ODNA 2AKAB 2ZI7A 3KTAA 3BH0A 6Q21A 1P75A 2ZRLA 3I8XA 4HDOB 1E96A 4M1MA 3T1QA 4QG7A 1D5CA 5JHHB 2D7CA 2WAYA 5FOSA 1W0JD 4AC9A 2E87A 2G0TA 3LAWA 4G5RA 2YWGA 3O47A 2AHOA 2GEUA 2OXCA 3B1YA 2UKDA 2ZI3A 4NBSA 5DNYB 3FKSA 3B1VA 1M7GA 3ND9A 2GAOA 2VRWA 4M2LA 3TH5A 5A0FA 5FL3A 4DLUA 1IN4A 1G6HA 4Q1BA 5BQ5A 1E9RA 3GLGB 4QFMA 3UWKA 3NH9A 5DYGA 2QM7A 3DZDA 5JLJA 2CNWA 4YQFA 5L3SB 2DB3A 4PHTA 1VDZA 2J0UB 5FBVB 2G3YA 1NVWQ 5KDOA 5J47A 4DLZA 2QORA 4U5XA 2WJIA 1SVIA 4JLJA 5DE3A 2D74A 4LHWA 1U99A 1ZRHA 5ANRB 3UMRA 3PEWA 1FMLA 2P6NA 4QHTA 2PMDA 3IUYA 2YKGA 3KUCA 1U0HC 1BYUA 2IYUA 2O8CB 4HLQB 1E9DA 4OL0A 4M1TA 3GLIB 1WCV1 2XITA 2C9OA 4JSYA 1OPXA 4MKGA 2PT5A 2FMXA 1B23P 4L9WA 3GLGA 5JI3E 2HEIA 4F4IA 2IYTA 4FMDB 1NVVR 3CH5A 1W36B 3K0EA 3NG1A 1ESNA 1W48A 4JBXA 4DDWA 4EPXA 1F3OA 1E2PA 1KSFX 4WW0A 5L3SA 3P32A 3EIHA 1AQUA 2J0UA 2VP0A 3TW8B 3PUZA 2ZREA 1S9HA 2OBLA 1NY5A 1LF0A 2KBFA 1IJFA 1NVUQ 1XCGB 2OO7A 4MGZR 4NP6A 1PLKA 4Q1AA 5FH9A 2QTVB 3EWSA 4ZCMA 2WTUA 1K5GA 3WXMA 4MQBA 1JAIA 3N5CA 1ZW6A 2YINC 1YU9A 1YR7A 2P5TB 2O8CA 2HCBA 1HV8A 1RW4A 4F7WA 3KFVA 2BEKA 2P6RA 3B6EA 1GTVA 1OH5A 4R71A 4D2IA 2XZLA 1E2EA 4G5OA 2G83A 2IS1A 2C04A 3AKDA 4C4PA 5L3QB 1CR0A 2HT1A 1KI6B 1T0JB 1YZLA 4I4LA 5KNBA 4PZLA 5K8IA 4F38A 3PEUA 4GSYA 1GIAA 4LYFA 3P26A 4MYHA 3RS5A 2AWNA 3EZFA 4OQNA 2WIAA 2R62A 2ZRCA 1CTQA 3B85A 2C5LA 4L15A 2GBLA 4AURA 2NPFA 1GITA 1EWQA 1ZM2A 2RGXA 3VX3A 2J9RA 1D2EA 1ZU4A 2HCJB 1RKBA 2KBEA 1Q20A 4DCNA 1EFTA 3I72A 1XD2B 4PO1A 2WMOB 2HF9A 4LPKA 5BYJA 4AYWA 1JXOA 4PXAA 3S1AA 3TQFA 4PAOA 2ORIA 4M1OA 4EJSC 1C1YA 1ONBA 2VHUA 4FIDA 4ACAA 2RH5A 3FTQA 4US0R 2A5JA 4B6FA 5M04A 1CRPA 3W3AA 1KSHA 2H5EA 1Q1ZA 4D26A 3NC0C 4MRPA 2I3BA 4DJTA 1B0UA 1RYFA 1W2HA 3PCRB 5C4GB 1CR1A 3E2IA 221PA 2ASEA 5EXSA 2ORVA 4DLYA 4DIEA 3SNHA 3PEVA 2GCOB 2JLVA 5E7MA 3SDZA 1LB1B 1R2QA 3EPHA 2BWJA 2JDID 1AKEA 2G88A 4LYJA 3F5FA 2NQ2C 5E4FA 4X8MA 1GFIA 1XD2A 4KLZA 4B74A 5JI2E 5L8VA 3QNUA 3ADKA 3J81k 2GJKA 4GMDA 1IXSB 3D3QA 5E3HA 2PMKA 2F7SA 3SE0A
chains in the Genus database with same CATH superfamily
2ID7A 4JXJA 3WXBA 4Q7QA 2ATXA 3IB6A 2VIIA 3GLGE 3ZGZA 5G0UA 2BE7A 3IKVA 3NDJA 3U17A 1SUBA 1Q1QA 1TCBA 2GVDC 2JCYA 1ULHA 4XWTA 5JZMA 2GSDA 3ZY6A 4PVCA 2C59A 2QT1A 3LX4A 2YH2A 1EDOA 1T4MA 2NM0A 5KTOA 5EMNA 2NU9A 1XYYA 3OE1A 5AOCA 5K8VA 2VZEA 3IRVA 3KAJA 2A14A 2XUFA 1KTIA 3H3XA 3ZLTA 3T5MA 4D8UA 2OPBA 4RA6A 1U1FA 5K0GA 2B2XA 1SOMA 1NXQA 2QROA 1HTTA 4HC4A 2J1LA 2DWCA 3G2KA 2OCXA 1U7XA 3THWB 2ZROA 4NE2A 2XBLA 1O0BA 1HF3A 3FFBA 5M2QA 1DAKA 2X9VA 4JENA 4FW8A 4FNAA 2HSDA 4Z9XA 1E3JA 4N3GA 4XYLA 4N0QA 1KF0A 1HRKA 1DWQA 2GYWA 2HMWA 1JLLB 2WPNA 3O1IC 2Y77A 3ANTA 5FWAA 3FKQA 1VKRA 1EQUA 1ORVA 3TTTA 4B4OA 2NSJA 4BCDA 1OXUA 1MG5A 1K6MA 1P5RA 1ZRNA 3IAXA 5HOQA 3AY7A 3F5QA 3MGBA 4YREA 4X1YA 3W3ZB 1AN9A 3PIDA 2AE2A 3V32A 2RGGA 1KIMA 3C4VA 5E4TA 3E05A 2HSJA 2WICA 3CLVA 2GUGA 1QHHB 4YMWA 4BQFA 5EHZA 1M8KA 1N6PA 1KARA 2PRKA 3M9XA 5D3MB 2C94A 3H9CA 5DIZA 5DLDA 5A02A 3AM5A 4S1TA 5TGZA 2DWPA 1BN7A 5KBYA 1PP4A 3AJDA 1G7SA 5AM1A 5IWCA 3GLFB 3NORA 2I22A 2QL5A 3PGMA 4MVJA 3IERA 1FL9A 5JJKA 1V39A 2TMGA 4CE6A 3EVNA 3BL5A 2DQKA 3KFXA 1DG1G 3PHIA 5AKEA 1G20A 3PPXA 4KR7A 5ULLA 1I4OA 2OHOA 4GRDA 2D1FA 4QFCA 5LLTA 3NR2A 4AN4A 4MQ5A 5J4HA 5JWRA 1ZGJA 1J2YA 2OHFA 3GF4A 5K0LA 1TLFA 2CJFA 2PZMA 1R00A 5B55A 1KH3A 1T5TA 3ZWOA 4F8YA 4ZOQI 2PS3A 3OLCX 1DINA 1PEYA 4GZ5A 2GHRA 1EG7A 1HLDA 4FMCB 5LN1A 3AJEA 1PGOA 1CP3A 5IFLA 3MPUA 1THMA 1LK7A 1Y34E 1UP7A 3F3MA 2H6EA 5ALXA 5TDHA 1UADA 1DQZA 3W5CA 4W63A 2FVXA 3EGVA 4LFCB 2C1EA 4BO6A 1AK1A 4I66A 2CXRA 2PZFA 1WG8A 2XD4A 2QTRA 4PZ0A 1VL0A 4WDQA 4AJHA 1NP3A 4AP6A 3NV7A 1EK2A 1T5DX 2AFHB 4KIFA 1DAHA 4JLWA 3WIBA 5BV0A 4KO4S 2J9GA 1ZUWA 4L6CA 2JZCA 2GCIA 1E59A 2BSXA 3D1LA 4ZD6A 3G5LA 1Z4QA 3JVUA 3RM3A 3IO3A 2HTFA 4BMYA 3CISA 4ICIA 5A04A 5KNCH 4F5ZA 3N2KB 1EE9A 1GAEO 1TF5A 4ZQEA 5LZ9A 3AH8A 1SULA 1UBJS 2A9JA 4O4IA 3T52A 3UGJA 1T5IA 3N2ZB 5ELMA 5JDCA 4NFSA 4QKQA 1LFAA 1E6LA 1K7XB 1REQB 1NE7A 3I5UA 4FMPA 4F4HA 4URVR 2ZRDA 1X8JA 3S29A 4EF6A 3QLJA 4HLUC 2XJ4A 4GKKB 4A27A 2XF8A 1U0SY 1H85A 3VR0A 1IHOA 2I8CA 2IFTA 2ZYGA 4IVRA 1J5PA 1IPEA 4DDUA 3KWFA 4JXZA 1DUSA 2R7LA 2RAVA 3SXUB 2ZIZA 5DM60 4TTRA 4NHOA 2H2DA 3NBKA 3SWWA 3M6XA 2OHXA 1XTUA 5CW1A 4BNZA 2Z83A 1M10A 2JI4A 4L8GA 2B1QA 2HHHB 3T4EA 3LF2A 3TM4A 1L5YA 4U7FA 2VQEB 3KZKA 4PO9A 4C08A 3KQVA 3UFXA 1C0IA 2BFEA 3KPWA 3TB6A 4DNFA 2M6LA 3TNLA 1FFDA 4N1AA 4RD3A 5FEUA 2QRZA 3EVEA 5AKJA 2PV0A 4H9GA 3DONA 1A7KA 1N57A 1PJBA 2CLLB 1AHNA 2ZJ5A 1KK1A 2XRZA 2GCEA 2D5AA 2J0VA 3MAAC 1PJAA 4RF2A 2H06A 4BMDA 4OSPA 1A9ZA 3MWEA 4IMJB 4KRGA 2IODA 3L46A 2QYOA 4V0LA 5BURA 4B4KA 2CUZA 3Q8XB 1B0AA 3BGVA 4GGOA 4N4AA 2EWMA 3GRZA 5EXPA 3E8XA 3QZUA 3N3AC 3SMVA 3I61A 1NVEA 1GLNA 1SHLA 2ZRPA 3QUSA 4ETWA 3SM9A 3LUGA 4NJMB 2ZI9A 3HKDB 1CX9B 3QENA 3A9SA 3PHBE 1IONA 4DCOA 2YX1A 3PGLA 1DRWA 3NBUA 1NIPA 4WNAA 2J08A 3RPEA 2EYUA 3OOJA 3TUZC 3FCAA 1DC5A 1GEEA 2DFTA 3K0CA 2EZ9A 4LY9A 4AUMA 2Q3FA 1PT6A 1DCFA 4KQ1A 4F60A 1UMDB 5IKEA 3R6GA 4CMCA 2CF5A 3A6JA 2O8NA 2WUWE 1NN1A 1Z4LA 1MAVA 4W5HA 1VYTA 4ZEWA 3B6KA 1FRNA 3SJBA 1RXVA 4FINA 5B1HA 3NANA 3UK6A 4Q7MB 2FK8A 4LBWA 3AVVA 1P60A 1WCIB 2CVPA 4IRXA 4PRKA 3N9IA 1AOXA 3QPWA 4FXPA 3LG2A 1B8UA 4ZOBA 3LL7A 3GWGA 3I6ZA 5A62A 1ZCBA 2NYUA 4MRMA 3R6WA 2CXUA 2R8OA 1XA4A 5DFAA 5ALRA 2RCNA 4KR9A 4Q1DA 4B8WA 2A5YB 3SJ7A 2FNAA 2NUBA 2QF7A 5DNAA 4AFNA 2ZRIA 2CDRA 4RYDA 4HDNA 2G82A 3ZR4B 3S2EA 2W5UA 1QU2A 4O02B 3F5DA 3IIKA 3QFTA 1RR6A 5K99A 2OZKA 5CDHA 3Q1LA 4Q93A 1WULS 3X44A 2UZ0A 1F1BA 5LP6B 3O8RA 1QGED 3FYTA 4JA2A 4NNOA 3B70A 2N9UA 1BTOA 1M66A 1UPUA 3MFYA 1NVTA 2HPAA 1VI5A 3P5SA 5JU6A 1WTAA 2Y93A 3E5NA 3DG9A 1MEJA 2BHLA 4WOPA 4PEVA 3T54A 4BWYA 2W2VA 4ITRC 4CFYA 3LZCA 1GTRA 3LJKA 2OCGA 3AEQA 1EHIA 5FBQB 5AYVA 3I2YX 3ICVA 3ZQUA 1T4BA 3ZD8A 4UBMA 4UBLA 1W44A 1IU9A 1T36B 3VVMA 5ICCA 2I2BA 2V45A 2I8LA 3EIUA 3NDRA 1ZUD1 1T4GA 1R6BX 2CLOB 2DH5A 3P9ZA 3FVTA 4QTUB 2Y0CA 4WJKB 3LH5A 3A28A 4PFKA 3EZYA 3D2BA 3S55A 5A9RA 5DT9A 1CJUC 1NV8A 2IH4A 3LXRA 2FZVA 4UCFA 5ECDA 1V37A 1YF3A 3MELA 4C2UA 1Z5NA 4BMPB 1S4QA 3CRZA 4ZAFA 5JXJA 3UANA 2AA3A 1C1HA 1VE9A 1SA0A 3L82B 4RIGA 1NW3A 2PKWA 2XGMA 1RHMA 3JW8A 4YUAA 2JANA 4Z49A 4PSAA 1XROA 2PZBA 4XIYA 3H9BA 1GGVA 2AOWA 1ACLA 1H8ED 2X23A 4HGYA 4WKBA 1M76A 1VG0B 4JQYA 3OBIA 4YMSA 3WL8A 5L7TA 1RBQA 1GN8A 2O1WA 5HF5A 5IYZF 5KVQA 3RADC 3R24A 3INTA 5AK5A 3O84A 1KPIA 3ACBA 3TZ6A 5LOVA 1B6SA 5K2OA 4TMWA 4CLEA 4NYMQ 3AL0C 1TMKA 5KYVA 4QL3A 4GLOA 2H5JA 3L2OB 3U6BA 1XZ8A 1QJ4A 1XDGA 4QBHA 3A7DA 4X3CA 4MW2A 3L40A 1EFVB 4RVFA 4YMIA 1CIJA 3IL2A 3U7QA 3NATA 3RC2A 4NFHA 1LPMA 1W29A 2CK3D 2Q8NA 2M1XA 4URFA 4KRXA 1RAAA 3ZCVA 1NN3A 3ABRB 1DKQA 4CL8A 3MLEA 3TJMA 2AH5A 1GAXA 2CJXA 3RV4A 2A94A 4EG7A 1OAAA 4TYMA 3K70B 1GTJ1 4JLKA 4OGWA 5F64A 1S9DA 3VZPA 4D0LB 3WO0A 1IOWA 1C3LA 1JSRA 3KPJA 4TXMA 3GUYA 3KAQA 1G2PA 3GUCA 5K3SA 4K86A 1T8TA 2A5FA 1C9JA 3KZNA 1NUUA 1T43A 2W2KB 4AZWA 5B1YA 1KH1A 2COUA 2WOOA 4L9RA 4YMHA 1Z7EA 3RGGA 5AUNB 1TMGE 2R5NA 1JLRA 4I55B 3URKA 1DJQA 4ZT3A 3EBPA 2KLHA 3O7WA 3IMCA 3E1GA 2ACWA 3FOBA 4IV5A 5HQJA 1E8MA 3GH3A 1AIPA 1KAGA 4ZDKA 1N7JA 2QW8A 2X1HA 5JCZA 1UZNA 4U7TB 3VYTB 5JJLA 3UNXA 1Q0ZA 2W2LD 1FYEA 1ODIA 4M9SA 3WGVA 2BMJA 3GRRA 4IS3A 4RJJA 2QVCA 4CCWA 2A9KA 3RIEA 1I3LA 4C04A 2GKGA 3GJZA 1F6BA 2ACEA 4IQFA 1AKYA 1VG8A 2O2EA 2ZSFA 4LY6A 4X8LA 5GP1A 1A8QA 5HA5A 3EZLA 3W2TA 3P2OA 4EMTA 5JADA 3TECE 1VGRA 1AKWA 4RPJA 3GGJA 2I6TA 2IA5A 3JVDA 1VJTA 2HA4A 3AGPA 3N70A 4MVJF 5AVQA 2BSQA 4Y9RA 4N5HX 2FPSA 1IVYA 1H2AS 1S2MA 1UPXA 2IPLA 1ZXLA 2XXBA 1DADA 4LOIA 5FA8A 3TK1A 2XIQA 3WRWA 3GA0A 3OZDA 3ITNA 1ZMOA 4R2WA 4X1IB 1ZD4A 5FTMA 4OP3A 1G6KA 4DMKA 4CF3A 1BX1A 3T41A 3U19A 1I2CA 4OH1A 3AZOA 4HRVA 4ND3A 1Q0RA 2WJ4A 1LDEA 1WV0A 4KU4A 3W6PA 4B3BA 4ND8B 1T6XA 3BFPA 3VVCA 1C1DA 4DMUB 5CFNA 4XSHA 2OCBA 1V7ZA 1D2GA 5L9AA 1UFVA 4P7FA 2QKYA 1UDXA 4ZAZA 4OXXA 3UY4A 4H4DA 3VOBA 2J5XA 4L0QA 4YRFA 5T4EA 1LZKA 4DZZA 5IJWA 5J4KA 5KJ6A 1VA5A 1SG9A 4RJKA 4F21A 3R3YA 4M1YA 4EM6A 1VZ3A 1IC6A 1VIAA 2W2TA 3NP7A 3NBZC 4DR7B 2FPPA 2HK8A 3HCEA 1D9ZA 4OO3A 3D0QA 2EX1A 2A0WA 4GVXA 5DASA 2BL4A 1SIWA 2QG4A 1KO4A 3AEKB 2V4MA 3PUYA 1E8DA 2P2LA 3LTEA 2CVFA 3K0AB 3UAZA 4FB5A 5LYYA 1JVSA 3RROA 5B7QA 4CQMB 1U8XX 1V45E 2XOXA 2XTJA 1T8WA 3LGSA 5FWNA 1PVVA 2EIHA 3AB8A 4FKZA 3BDIA 3T7AA 1JIJA 4D7AA 2CL5A 1F0YA 1I30A 4OHFA 2X9NA 2R8BA 5G1NA 4MUXA 1T15A 1AKTA 1TJ4A 2H11A 3R09A 4PHHA 4WNIA 4YJ3B 1N1GA 1W35A 3MRXA 2ECKA 1GQQA 4B8ZA 4D80A 1G4HA 4Q21A 5EUMA 4ZJPA 4HNTA 2V6BA 1MW8X 4G0XA 4G84A 1NQ5A 3PGA1 4JC5A 3NC4A 1CPYA 1SCJA 2CZCA 4OGKA 3CNQS 3DEJA 3SJAA 1OILA 4M46A 4MVYA 4D79A 4F6RB 3VJLA 1E9VA 2SKCA 1P4JA 5H82A 1L4FA 2RGNA 3DVQX 4IDPA 1DZIA 4DS3A 1U0RA 4O6VA 2ARKA 4C3VA 3EVDA 1V7PC 3AR3A 2MMCA 2G04A 3HNPA 3UHAA 4EHBA 4HN4B 2OENG 1TAHA 1CRZA 1SCDA 1N6OA 1U7TA 1SPBS 1X7WB 4NBTA 4URYR 3EVCA 1Q57A 4XVQA 4C3ZA 1P62B 2WWGA 3CH6A 4DR1B 2NO7A 1TTTA 2QK4A 3IMEA 4V1CA 5JEDA 4CM5A 3GGDA 3N2GA 1GGKA 1KEEB 1O6FA 1UUFA 4RZXA 5FQOA 4A6XA 1QU3A 2OVFA 1WB4A 4L5IA 2W6ZA 2XF2A 1O89A 4GYJA 3AV3A 4FDTA 2OZLA 1NP6A 4DBVO 4DF3A 1M0EA 1W49A 2H57A 5JDCC 2WJHA 3N76A 4R51A 5AVUA 5KNDD 1BJKA 2ZCUA 4Q1VA 1QE3A 2GHQA 2XMZA 3WBJA 4V0QA 4CGZA 1EUDA 5U4XA 2WYHA 2IOFA 4TQUS 2VDRB 3MTJA 3QU4A 2F1RA 2W2PA 3SU8A 1QP7A 3WNBA 4MUBA 1I1NA 1UKEA 3AP2A 1H9AA 1RZ3A 1QIGA 1XN1A 3PDJA 4DJ5X 5EFZA 5CURA 1S2NA 4EHKA 2OTCA 3TDKA 3ZI7A 1QAMA 3ETHA 3GBVA 3SQOA 1BS2A 3CR8A 3HO6A 2IOYA 2OZVA 1G7CA 2BFAA 2CZQA 2CK3A 1UBSB 2ZJOA 4XDHA 4Y0AA 1O2DA 1SC9A 1SVOA 3KBBA 3E6AA 2PLAA 4KMMA 3CGWA 4WKPA 4HAOA 4B7ZA 1KYXA 3P71T 3PI7A 4MQFB 3JQ9A 5IJ0A 1HFWA 2OYRA 4ABYA 3D2LA 1ZP6A 4C7OA 4JODA 5DSXA 4MDHA 5LXTB 3VVBA 2OY0A 4ALJA 4U2KA 3QVKA 4ER0A 1EFRD 4DR4B 2XGSA 3AETB 3X1MA 2FSSA 4KB5A 3TBHA 1M5RA 3TSCA 1IN5A 1XDSA 5JWOA 3OKCA 3VBCA 5AHRA 4EPYA 5AJZA 2WAOA 1OH7A 1J5EB 1NV9A 3AI2A 4MWZA 1RPTA 1QZXA 1TYDE 2WWWA 4C22A 4PC1A 3SJCA 3BD6A 5BRAA 2FSHA 1QM5A 2Y66A 4XXHA 3CB4A 3NNSA 4RFSB 1N92A 2IW3A 4I46A 4DSNA 2Q1WA 4GYWA 1C3JA 1LBTA 3CHYA 3KQNA 2W2LA 4GUAA 4A1FA 1DELA 1IEVA 2IPNA 1H6AA 3AM1A 1DEKA 4GEGA 4FXOA 2IU6A 4KAJA 5BSMA 2NXWA 4BC0A 3RC3A 4NEHB 1GKKA 4QQFA 3KKNA 1ZHHA 2C0CA 2SBTA 1BCRB 1KJNA 2WTMA 5ALQA 2JLQA 4FNGA 3SFZA 1NYQA 5DYYA 3CIOA 4LA4A 4CM8B 2R1ZA 3HO8A 3PXUA 1QO7A 1SCNE 3VH2A 2RIRA 3GRCA 1Q22A 1IIBA 5JSKA 3WYEA 5E4JA 3C3KA 1X70A 1V8PA 3T1TA 3Q7IA 2QGZA 3VKWA 5BN3B 2AEEA 3TRDA 4MQ4A 2PUGA 7MHTA 1O8BA 3IPRA 4EH1A 1SHTX 2CNOA 1TUIA 4UE2A 4ZZ2A 1QAQA 3RVNA 2UYQA 2PQ6A 2W11A 2XQKA 5CCXA 3LYHA 2QTGA 2CLFB 4IGIA 5D5HA 2HHCA 2DFLA 3V7WA 4F5WA 3C43A 1LI5A 4B76A 1ITZA 1P2VA 3EARA 5KTMA 3TG8A 3NTUA 1W4AA 3WA7A 4I2NA 5CM9C 1LLUA 5JXHA 3IP8A 3IT3A 3TZCA 4CIWA 3NHRA 3PVSA 1QVRA 3GUHA 2IV2X 2J0SA 3OZGA 2IBMA 3GMTA 4P0TA 1JXMA 1DG9A 3NHKA 3L0BA 4L4UA 3HGQA 4D9MA 1EVEA 4B31A 5CK4A 5BOSA 1EAMA 3UJCA 3N2YA 1U8TA 4M6WA 1ISGA 1CF4A 2WE7A 3M2PA 1IDN1 5I8ZA 3D8BA 3VJKA 5T3YA 2PLNA 5LOVF 1U3CA 2DR2A 2CHQA 2D0OB 1OBFO 5CBKA 4EITA 4MZXA 2OYCA 3C3PA 4XB1A 5EIAA 4DUGA 5EOVA 4U02A 4A6PA 3GGPA 1D5WA 2QX7A 1CUHA 3ZW7A 1SVLA 3VSBA 5AW1A 3ZVRA 1S1MA 3ZGNA 4CEJB 1X94A 5AUQA 3CG0A 1BVYF 4IH1A 5JRJA 2WZCA 4KOEC 3DE0X 1MO3A 3AXTA 2ET6A 4P83A 3LFUA 4PQGA 5HCUA 4BEJA 2Y71A 4PX3A 4RKFA 4OQPA 2D1TA 5TVKA 4DYDA 3H42B 1X38A 4EVSA 2WQ7A 2NUTA 3FNIA 3WL3A 1J24A 4YUYA 2ZVQX 4CF5A 3DNFA 3HU1A 3FSEA 1GT91 3ZK9A 2FPKA 2OBMA 2PZLA 5DGCA 1W46A 5KNCD 2RHJA 3DMYA 2FFAA 2WUDA 1D6SA 5CH3A 1QF7A 1DC6A 2X5KO 2VHCA 3ITKA 4IM7A 4XQ9A 3U80A 2H1OA 3QX3A 1IOLA 4XVRA 1BDBA 4P7KA 2KSQA 2ZJZA 1UKZA 5FL7D 4A6EA 1E99A 5CEFA 2XEXA 3P0JA 3JY6A 1HC7A 1T4CB 2QPAA 2Q6TA 3N3BC 4TRNA 1GPJA 3ZGYA 2IWRA 2J4CA 3F7MA 1XZBA 3TSZA 1UOPA 2QOEA 3TEMA 4A91A 2RI6A 3IUBA 2A5GA 3UQZA 2HOQA 5EHQA 3WO1A 4EKEA 4HQFA 5DYIA 4GDFA 4I4NA 4NDNE 4URZR 5HZGA 5T6BA 3HHEA 5ICMA 2P40A 2WFAA 1YONA 3C8DA 4AZSA 3U4QB 1XALA 3EOBI 4G5FA 5BNWA 4N9QA 5KNDA 5SYNA 4UVGA 1B6GA 1R0LA 2NTVA 1ODFA 4OY3A 5JOQA 3OCYA 5KTPA 3SXJA 1N2XA 2WWFA 4RXUA 1K66A 1OFIA 3IE2A 3WMEA 3ZBQA 4EQ6B 1N0UA 2F64A 4MV7A 3TOZA 1GYPA 3JS5A 3UTCA 4ZYWA 5BNZA 1MGPA 2CZGA 2YYSA 3UIEA 1CF9A 3E7WA 3MD0A 1QIEA 4FZVA 2F3UA 1V5IA 3THSA 1PWXA 1UANA 1FPMA 1U8EA 1W96A 3H4IA 1KORA 2EBFX 1PNOA 2CJWA 3LCUA 1CUWA 1T34A 3MGCA 3L1UA 3HBAA 5I9SA 4DHEA 2Y1GA 4MHOA 3JZAA 3NOOA 1GTMA 3H2IA 4IGAA 2ZIXB 3H83A 2EV9A 4GPEA 2OHIA 1YQXA 5AI9A 3RFCA 2I2CA 2BEVA 3QXXA 4WK6A 1YMQA 3AB3A 4YDRA 3GN1A 4GQBA 1XJWA 4ABTA 1EFRA 2F6RA 3GLIE 1VECA 2QXUA 5A4FS 1K8XB 1JB1A 1KYWA 2IK8A 3GZJA 1VE7A 3MD9A 2A1IA 3H9GA 3H5TA 1YC2A 4LHVA 4UDYX 3QU5A 1BGWA 1FU7A 1UXIA 3GAZA 3NWBA 2R5WA 4OI1A 1L7MA 1VPDA 4DSAA 2E1RA 2ZJ1A 1K0FA 2J3HA 3ST7A 3DWIA 2A30A 3PDWA 2ZR7A 3BHMA 3I4FA 2OFWA 1CW2B 4P33A 1WD7A 1PLLA 1N2CE 1QV9A 1YDWA 4G1BA 4AO8A 1GG5A 2JH3A 5CCDA 1F9EA 5JBNA 1YNSA 4FNMA 3KZMA 2O1SA 3TGWA 2FUNB 1U7DA 3G2PA 2I1QA 5IHXA 1N3LA 4LCJA 3RYHB 4Y7CA 1FQJA 3THWA 4L16A 2ISQA 1K8QA 1VMIA 3DZKA 2BTEA 4OX9B 3NCTA 1YZKA 3A1NA 5AKGA 3TNJA 1E4EA 1KGSA 2PUHA 3HWRA 3PUKA 1R7RA 4RMGA 2E4AA 4CM9D 2ST1A 3NHJA 2NV6A 3ZY3A 2X86A 1XSEA 2YDYA 5ALEA 4BRZA 4C3OB 4JJ6A 1N0WA 2QR2A 4FI3F 3T5GA 3LRTA 3KJXA 1UT6A 5EQFA 2JW5A 3AM3A 1TKCA 5M34A 2QTMA 2HW8A 2O52A 4KZKA 1D9XA 4ZALA 3ZGLA 3IIJA 1EX7A 1WD5A 1ZICA 2F1KA 4RIIA 3E8SA 5AVTA 4ZI7B 1QHHA 4GL2A 1RAHA 1AGYA 2HK6A 1FUUA 3E1SA 3JAWB 4H31A 4D4HA 2DHEA 4GSLA 4QVKA 5L4NA 4OAOA 1YB2A 5LM3A 3KDAA 4H1HA 3GLFA 5EMHA 1EVJA 4FR2A 4ZHQB 1C7IA 3GLUA 4X6LA 4L78A 4CN9A 1IN7A 2NYVA 2DU8A 2PLWA 3I0ZA 2NZWA 4M0EA 4OHOA 5ELXA 4ZT6A 4Z7OB 2AZ4A 3PFFA 4YA6A 3PTZA 3SI7A 4LZJA 3TQRA 3OCCA 1AURA 3D3EA 3OZUA 3QOXA 4GI3A 5CYOA 1VPTA 3MHTA 5EAIA 5KINB 1E9AA 4KWTA 3PR1A 4Y2RA 3LDGA 3D8UA 4UAGA 3WGNA 2C96A 2XYGA 2HA6A 1YCFA 1HURA 2C95A 4WADA 5IS2A 4KACA 5DTEA 3PWTA 8ABPA 3BL8A 2XCTB 4CMEC 5JC8A 4FI3C 2VSNA 4U1RA 1TDJA 5AHOA 3DKKA 2NU8A 4LJLA 1AG9A 2NN3C 2W2OA 2CW5A 5AKXA 4A36A 3FCXA 2D06A 3JR3A 1CP2A 4AN1A 4I5GA 3RC9A 2PZAA 2P65A 5ITSA 1HK7A 1GAJA 3EQ7A 2JI6A 5E95A 3OTOB 2I33A 1Q6ZA 2WNHA 5KNCA 2AFHA 2C5EA 3T0IA 4V0MA 4FYXA 2IHUA 4QU9A 4OJYA 2J41A 4NOMA 3LP8A 4E21A 4JFAA 3I3SR 4FZ5A 4PYQA 4ZAWA 5KMGA 4OFZA 1FRVA 1LJUA 5FL7A 4AY6A 2OV3A 1I2AA 5AR1A 3EXIA 3E3OA 3N2KA 4OQQA 3EIXA 4WECA 2B6HA 3FZGA 4Q5IA 3BRCA 4YRZA 8AT1A 1JDVA 3L01A 1EG2A 3OUUA 2CWDA 3PC4A 4MW0A 2C2HA 3P0FA 2Y4NA 5EUCA 1J8MF 4TKUB 4CLDA 3FRHA 3OEWA 4MV3A 5IM5A 2EARA 5LZ7A 3JYOA 5BYBA 3VGPA 4Q7KA 3SEFA 1ZA2A 2FOLA 3AW9A 4P4NA 3WLJA 2DTXA 1R88A 4EHJA 2VYNA 2QTWB 4E4TA 1M6VB 2ZI5A 4LTMA 4UVEA 4BZZA 4O63O 2IH5A 1XCLA 2Z8ZA 2C0PA 2C9CA 2JIDA 1DUVG 1T9HA 4WTOA 4Z8XA 4BJHB 4LBZA 1T2DA 3E2MA 3FJ1A 1FMTA 2GERA 3DFFA 3AG6A 4RA9B 4MS3A 3IT2A 4G1VA 2A5LA 5H3CA 5KYNA 1XDWA 2BF7A 2I29A 4K6GA 1UQTA 4EKNB 3TB4A 5HQ3B 1Y82A 3ICEA 1ZVQA 3NBFA 4QX6A 4F46A 3GIDA 4FCTA 3C74A 5LC1A 5HPYB 3D6NB 2REBA 1W5FA 3D6UA 1J97A 1ZCFA 4GI2A 5BOVA 4DSUA 3ZE0B 3CW8X 1E7RA 4HLCA 4QOIA 4YK7A 1VQ1A 4EECA 2XXAA 1OWOA 1TD9A 4MRNA 4XA8A 3KUKA 1Z37A 2B1GA 4MVJG 1CE8B 3QG5A 4YHHB 4J0IA 4UAJA 3DTYA 2O0KA 2GX6A 4PG6A 4R0NA 4UNQA 5DW0A 5HCNA 3F8SA 3I4CA 2B1IA 1SAYA 5AK0A 5ALYA 5G2OA 5EJ7A 2HWKA 1P17A 2B6NA 3WWZA 2C4HA 1BMDA 3RVLA 1N2SA 3KSBC 3HVIA 3CWZA 1KSJA 2FPUA 4Y6RA 3OA2A 4PCLA 4U2GA 3ZZTA 5FX2A 3NKLA 1NYTA 5IAGA 4FMBB 2CF6A 1JQBA 4ZI2A 1W5AA 1Y5IA 4OOEA 3GCWA 3WNDA 1OHHD 2J9FB 1U1GA 1YZGA 3JTMA 3IE1A 3ZDCA 3Q8KA 2QSZA 4OHWA 3FR7A 4PC3A 4P9NA 2HRCA 5F1YA 2BR4A 2EDAA 2OXEA 5K3AA 5K45A 3C3EA 3FCSB 5G3YA 4UPEA 2R87A 4B3GA 3EZ7A 3EQ9A 1KS2A 3CLSD 1NXVA 3EULA 5E0KB 2X0DA 3VHQA 2C3UA 1SVSA 4W5QA 3P9RA 4DEYA 1L2TA 3IH5A 2V54A 3MT9A 4XGKA 1IOZA 5FRDA 4P34A 4B2LA 1KEKA 1KHHA 5KIAA 1BE0A 5AM5A 4K0KB 3I83A 1KJJA 2QI9F 1WOMA 2JFWA 1K7SN 2GFQA 4Q4JB 3B6JA 4RORA 4XASA 1WZ2A 1B1CA 2VOJA 2IITA 4C03A 2F9LA 3OOSA 4LQCA 3DR3A 2BH2A 2DT5A 2GUWA 2JFNA 1NI4B 4W7HA 1FS6A 4BQPA 3LF1A 421PA 4E08A 1XWFA 3CTMA 4EG0A 2DOKA 3OWHA 2DHCA 3BOSA 1BVRA 4F2PA 1WBBA 1Z0DA 1KIFA 3NUQA 4G8JA 3T3DA 3RRBA 1JH8A 1AXGA 2FPXA 1JT2A 4DV0B 2ZG6A 5A6VA 5LP6A 2YXDA 2F8LA 3CKLA 4N18A 5FFNA 4JJEA 1COZA 4U5QA 3R7SA 5U9CA 4Z53A 5EHGA 2WJGA 2J0EA 3PQFA 4I19A 1GSOA 3OTQA 1Y3AA 4EA9A 4RBNA 3SVZA 2O0HA 2Y8EA 1ST3A 4LVUA 2Q5JA 2H54A 3H9UA 5KVAA 4RE5A 4PZZA 4H17A 3TLBA 2ZPAA 1FRFS 3VX4A 1I6KA 3L93A 3AIKA 1N4DA 1C9KA 2JK0A 4IR7A 1I7DA 4C20A 1CEXA 3AXSA 1VIDA 3TXXA 4CDRA 1CD5A 4BNUA 2NQTA 3L8EA 4BWVA 2PWAA 2QI9C 1KKUA 3A4LA 3MINB 4DV2B 3AVYA 1FZTA 1NYLA 3HRKA 2QMEA 4LZAA 4EY8A 1S2OA 4NLLA 4XJSA 2ZTVA 1HYEA 3RG2A 1NSFA 4IXNA 1Y1TA 1BDJA 1DL5A 2TMKA 3CF4A 1CUSA 2G1AA 3ROGA 3V1MA 4R16A 1ZC3A 4DXDA 1L4KA 1UK9A 2BFNA 4JU8A 4YJ2F 4TV9B 3QEJA 4QOGA 2C20A 2Y0PA 1G9XA 1Y7IA 1HDEA 5H8WA 1NG1A 5DCLA 3IVCA 4PHGA 3KXDA 3VUFA 3ZHVA 2RHCA 3MS7A 5EMJA 4XWOA 3D6JA 1GPWB 2G9ZA 4U39A 4A2QA 4US1R 1T8PA 1RFLA 1VL6A 2FUG1 1PR4A 4W7SA 5IVIA 3W6ZA 1VOTA 1MO4A 3O1LA 3LT0A 3K30A 4WXYB 2RGBA 2BZ1A 3F0TA 4KXWA 3KB6A 4UCXA 1XK7A 2Q5OA 5DJ5A 5IRCD 4ZQBA 3KSMA 2V9CA 4V38A 4AMVA 4BVHA 3FFXA 2R6JA 2PFSA 2XB9A 3PQDA 1C7ZA 3W78A 1U0JA 4DV4B 3ZWMA 1N5KA 2WIGA 4H3VA 1CBUA 2FPRA 5AK4A 1EFVA 2GASA 3FDJA 3CURA 2FMFA 2O2GA 5G0VA 2HIMA 2XA2A 1T1EA 3W5UA 1AH2A 1YSCA 1TIKA 4B9AA 4MUAA 1E6UA 1RQ7A 2IHVA 2PUVA 3U9LA 1RKUA 4II7A 3SR4A 1Y8ZA 3KSDO 3O31A 2LVBA 5IC4A 1XO1A 2YJ4A 4X7BA 3DVSX 5JJIA 2X9QA 5F23A 3O92A 3WZMA 2YFYA 4FHEA 1BX0A 5LQUA 5C1OA 2XA9A 1SQGA 1BWPA 3SG0A 4LOHA 2XMBA 1CUXA 1VRVA 1FFBA 4AB1A 4GI5A 3ICCA 2EZUA 4P93A 4KL8S 4CLXA 4CNQA 3JVEA 1SBQA 1P2SA 2IRWA 3U16A 1LSJA 2RJ3A 4MV4A 3RVKA 4DYVA 4EGCB 3IR5A 4EUNA 5IP5A 4I55A 3G88A 3CW9A 5CNMA 1G59A 3PDCA 1D09A 4Q9LA 3O3NB 3QXSA 3KUUA 2HHLA 1KY3A 1OE0A 4OQLA 2EEPA 3WY9A 1I2ZA 2BBOA 4AD8A 2GHIA 5A6SA 3VU8A 5F2NA 4Z4IA 3QKSB 2XBMA 2Q29A 3TS1A 2RGDA 1C3XA 3KJNA 4ZCLA 1QK3A 2C0QA 2XI4A 3PXDA 5AJHA 1D03A 1P7PA 1PIWA 3LHKA 3NTQA 5FT9A 4O8ZA 4BIIA 3CO0S 4IILA 1QTQA 5I8WA 3VDQA 1PS8A 4PZYA 3IDZA 5C32A 4L0CA 4DB4A 3PA8A 2DQ4A 1PR9A 5M5BA 2IE8A 3ZCUA 2J30A 4EUSA 4M53A 1A3CA 1UJBA 3LNTA 4MA4A 5J1TB 1SBIA 4EQZA 3IEPA 1U7HA 4OJMX 4CVNA 2R7MA 1SUFA 3SC2B 1G8GA 3PFIA 1E9BA 5AM0A 5HS6A 5JH7F 1C7RA 1TMOA 2QLBA 2ZAGA 3M49A 4Q15A 3QW2A 1A2KC 1MABB 1V9LA 1KOJA 1ZUHA 1OI2A 1KI3A 3DMPA 1W85A 3RC7A 4EX6A 3VR1A 4I5EA 2RHGB 4X1IA 1BYIA 4M87A 4B47A 4DMHA 4LJ4A 4BP9A 1V71A 1KTVA 1FFGA 3H05A 4ND8A 1OZ0A 3R7WA 1G2QA 1Z75A 3V1TC 4CW7A 3LQ2A 1ELOA 3O1JC 2IHZA 2DE0X 4MRVA 4FMCF 1P61B 4RF4A 4KPYA 4QDJA 3EJWA 1N7GA 4JVNA 1RQPA 4LV8B 4WERA 4COOA 2VUSA 1L1RA 5HVNA 2QL7A 1XVVA 1T9DA 4U2EA 1WZEA 4XFDA 4J3NA 2Y1LA 4KOAA 4QOJA 1P2GA 5DF1A 1GARA 1YL5A 3GJ7A 4JU9A 3C3CA 2VBFA 4WLOA 2EFGA 1G98A 4ID3A 3KETA 1ZUIA 1XTVA 2XAUA 4Q05A 4WUVA 2P6UA 1VLQA 4OQZA 3TMYA 1MB2A 3QVXA 4ALLA 1NJ8A 3AEKA 1Q0TA 3LBNA 4YMUA 1CK4A 2GRAA 3K0AA 1SXQA 2AJCA 3HE3A 1POXA 1KDOA 1XPJA 3HJCA 1H69A 1ZZEA 3K4HA 3NHWA 4FU0A 4HWPA 5CVTA 2C82A 3BGDA 4NCIA 1JGTA 1VHJA 1O6ZA 7AT1A 1RJWA 3KZOA 2PA0A 5DTMA 3IEMA 5DWVA 1P5HA 2E49A 3Q2IA 2WAXA 3X1DA 3U44B 3DM5A 4N0DA 3JQQA 3QIVA 2GN2A 2YRXA 1H8HD 4NCNA 4EENA 4NAHA 1S5PA 2PKXA 3KAPA 3PHHA 4YJ3A 3W5SA 5H9WA 4LBVA 5K01A 5J3JA 3HXQA 2XDQA 3SZ3A 1GR0A 3HJBA 3Q5EA 3PG5A 5HGJA 4RW0A 5JFGA 4TKVB 1Q50A 3L8GA 3W6NA 1DQSA 2AYZA 2G1PA 4YJGA 3SSMA 2GFIA 4BLRA 2AMYA 1QV6A 3PFNA 2XZPA 2YQ4A 4B71A 4CV0A 3OPYI 3WQBA 2FJ0A 1X87A 2DWOA 3UMGA 1J22A 5AOBA 5BR7A 3K09A 4UHEA 1E92A 3U3RA 1EGMB 5DB4A 4WN3A 4X62B 2CLKB 3DDNA 4NZNA 3K2IA 2PPLA 2QGFA 4B6OA 1JSXA 3HYTA 5LYJA 3RVRA 3STXA 4CCYB 1UJ5A 5HDBB 2BFFA 1PO7A 1KEEA 3QSGA 2Y27A 2IYEA 3TTYA 1MOQA 4S2UA 2OGWA 2Q6LA 1R8XA 3OU6A 1YHYA 5EIHA 5IAKA 4MMXB 3VHRA 4KPGA 3KB8A 2FPOA 1LCIA 2EGHA 1V1MB 3GVXA 4ZVMA 1SGWA 3TOVA 4ARZA 2VYFA 1FZQA 3Q4GA 4JKIA 1XG5A 1MRZA 4HWSA 2V3CC 1PT5A 1T0BA 1NBOA 1OFVA 3IILA 3JPYA 4B33A 5CU7A 2K5UA 2ZUTA 2YJTD 1EUCB 4UVIA 1V9CA 1UBNA 1BXGA 1X9IA 3AF5A 3ILHA 2ODAA 3IMKA 3P45A 5DWDA 3FLAA 2GSWA 1TYCA 2JLZA 1JZTA 3ORHA 1L5VA 4DADA 1I4WA 3F6YA 1AS3A 2MINB