3L43A

Crystal structure of the dynamin 3 gtpase domain bound with gdp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
242
Chain Sequence
QIAVVGGQSAGKSSVLENFVGRDFLPRVTRRPLVLQLITSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynamin-3
publication title Crystal structure of the dynamin 3 GTPase domain bound with GDP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 242
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l43A00
4K8OA 4A82A 1S3SA 3CW2A 4DKXA 3Q5DA 1QG4A 1E2MA 2CL6X 2AD5A 3GLFA 5C1BA 2RGNC 3FFAA 4JVSB 4GT1A 4RFSA 4G5QA 4WAUA 4PHGA 1P3JA 4YMWA 2O8DB 3UK6A 2QPTA 2FFQA 2ZRBA 4Q47A 3IHLA 1UPTA 5JRZA 2NO1A 4HUQB 4WXRA 5HZHA 2JJ2D 4ZO4A 1KNQA 2JLSA 2OFXA 1H8HA 3QE0A 4RFVA 4UXJA 2RMKA 4TTRA 1AN0A 2ATXA 3DHWC 1N5LA 2P67A 2WJGA 4GZLA 5SZIA 2ZS9A 1E79A 1KAOA 5JLJA 2QG6A 1T3LA 2W2VA 2F43B 1SKQA 5FTMA 1FPMA 1Z6GA 4B71A 2VH5R 2PCJA 3U44A 2GESA 1OF1A 1SXJA 3E70C 4IKEA 1GOTA 4C4PA 3EW9A 4BECA 3GPLA 3FDIA 2NZ8A 1BYIA 1NG9A 2VYFA 5KSOA 3N5CA 2CCKA 1A4RA 4LHWA 3EZ2A 1UBCA 2CE2X 2DWOA 2JA1A 2PEYA 4L16A 4QGHA 1US8A 2IYUA 1J8MF 5J5CA 1S1CA 4DLUA 1T8TA 4JL8A 3MG9A 5CYOA 1E98A 1AK2A 4LBZA 4M2LA 1K6MA 3EIQA 1G4UR 5FR1A 1JPJA 2HXYA 1EWQA 3AGQA 3KFVA 1XCGB 5KSPA 2BVNA 5H68A 3W5IA 3EPKA 1AS3A 3O8DA 1N6KA 3U4QA 1ZNXA 3MRSA 2E9SA 3QKSB 1GL6A 3LXXA 3NXSA 1CR4A 1FX0A 5JWHA 2B8WA 3SC3A 4DT1A 3EASA 4KVAA 1KSFX 2R62A 2PJRA 1JR3D 2OEPA 3CIOA 4OHYA 2G9NA 3C8UA 3X1YA 1KJZA 2V7QD 1ZD8A 3I5XA 4HAXA 2B8TA 4AG5A 3W5JA 4NYIQ 2HLDD 2B6HA 2FPLA 3NDPA 4ZCLA 3AUYA 2QE7A 4I1VA 2XTMA 3GEEA 1FUUA 1W2HA 2BWJA 4A6PA 1W0JA 2V54A 1ZNZA 1UBEA 3C16C 4US1R 4DVGA 5L3SA 3THYB 221PA 2RGDA 2F7SA 3FE2A 1GDDA 2BDTA 2NTYC 4MH0R 3QG1A 3THWA 4PSKA 1KDPA 5K8IA 2NO7A 2QBYB 4NL4H 2WMOB 2PLFA 1ZW6A 2BBSA 2ZRGA 4X8HA 5EE0A 1XTKA 4QBFA 4GSYA 2PJZA 2CLCX 1OH5A 4L15A 5JJKA 1S8FA 2H8KA 1U94A 2Y8EA 2A5GA 1T8UA 2V1XA 3FYHA 2DPXA 1NN3A 4G5OA 4POAA 2F3TA 2JIZD 4IOLA 3SJZA 3WYFA 1Q3TA 1W2GA 4I81A 5JMTA 3T1QA 2IYZA 1EFRA 3QXSA 1OXTA 4B6FA 4ZDJA 3CF2A 1NKTA 1VYVA 2P65A 3ZVRA 2VO1A 5H8WA 2EWWA 2CHGA 3RRMA 1Q21A 5EE5B 2ZSAA 2BIFA 1OB5A 2X2FA 1A82A 1YE8A 3BJIC 4Q4JA 4M53A 3TJZA 2D06A 2BOVA 4Z8XA 1XPOA 4TT3D 5KNCA 2WSSD 4WA7A 1KDRA 5FBRB 3VR3A 4K46A 4DLSA 1L2TA 1NN5A 1A2BA 4TZ0A 1OSNA 4L9WA 3UATA 2C99A 2R6CA 1KI8A 4IFBA 1NVVQ 4Z1MD 2YV5A 1M34E 2YZ2A 2ZS7A 3DZDA 1ZC3A 1YHNA 2VP2A 4URUR 1YZKA 1S9HA 2ZJ8A 1NL3A 3C15C 4M4SA 2VLIA 3ZVLA 3GLFE 1G6OA 2VSOA 1ZBDA 4PAOA 3T5GA 4KITB 2KJQA 3PUZA 4HAWA 4LWZA 3W9YA 2GZHA 1I4TD 3BFKA 2OE2A 2ZJBA 4DBLC 5FBLB 3L0SA 4N0DA 4NHOA 5DSZA 2P5SA 2GKSA 2BM1A 4MRRA 1QVRA 4BFZA 3B1YA 4BLSA 1D6JA 2WHXA 3EZ7A 1E9RA 3BB1A 3GLIA 4JT4A 1KO1A 4IXMA 3DOEA 1EXMA 1QHHB 1G20E 3OAAA 3FHTA 1SXJC 2J59A 3SDZA 2C8VA 3BWDD 5FPYA 1KO8A 2FZ4A 2QTVB 4LBVA 4LJ7A 2QENA 1W44A 3FFBA 4O2LA 4W9MC 1OLOA 1SXJE 4JLPA 4RD0A 4DJTA 4B3CA 2KBFA 5CLQA 3LAWA 2ZIAA 1VG9B 4JL6A 1DAMA 1HA3A 2FPMA 3BB4A 3FMOB 5FPHA 4KJZA 1SGWA 2DR3A 3VHLB 1G5TA 4HUTA 1LNZA 3QIAA 2KWIA 4LJ6A 5FI1B 5FUWA 3UANA 1DARA 2O8EA 1IY2A 3SFVA 2OZEA 3IPXA 4R2IA 3T5DA 5JEEA 3OE7D 3FOZA 4KFSA 3PIRA 1YZTA 1WB9A 3TUZC 3SYLA 5IT5A 4WBSA 4M1KA 1TPZA 2QTHA 3VQTA 4IDHA 2XXAB 1G8FA 4NP6A 4DB2A 4D25A 3VNVA 3VKHA 2ZJ5A 1Z6AA 2CE7A 1TADA 4WW0A 1IY0A 1OFHA 1CKEA 1K5GA 1HE1C 1X8JA 5FFMA 1E9AA 1AKYA 2C96A 3A58B 4G5SA 4I1SA 5J4HA 1NY6A 4CGZA 2H1LA 1ZD9A 5DN6A 3RWOA 4BUJA 5L3VA 5F2EA 2IS1A 3IDQA 3DPUA 2PZGA 3BAFA 1YZLA 1S96A 2IYVA 3OIWA 1VECA 3FGNA 2VQSA 4A8JA 1E2GA 1IJEA 2Q6TA 5BW8A 4NKRA 2DFKB 2OO7A 4KODA 4URZR 3CKLA 1TQ6A 4DDTA 2GK6A 5AJVB 1DVRA 2ZYVX 1WXQA 4QNMA 1F2UB 4HDOB 4PQYA 4UNPA 5EXPA 4AG6A 5E7JA 2QPOA 3CF0A 1N0VC 2ZREA 2A5DA 2W2TA 2OCYC 3PVSA 2VHCA 1FOEB 3IBGA 3MSXA 3UKDA 2ZITA 4CYMA 4MYTA 5H70A 3ZZ0A 2IF0A 4BLQA 1N6RA 1EGAA 1CXZA 1NMZA 2ERXA 1G7RA 2GK7A 3M4YA 4ARZB 2WSMA 2FDCA 5BXQC 2BJWA 2YVUA 3DOFA 3LX5A 3KZ1E 4Q9KA 1KK3A 3TR0A 1ZYUA 5EP3A 2GJAA 1E3MA 1G8PA 2W6JA 1BH2A 3LFUA 5HZKA 1PLLA 3E2IA 4PHHA 2GWHA 4R7ZA 4MGYR 4PZYA 4C0AC 2Z6VA 2GJ9A 2J0UA 3BBPA 2REXB 2EQBA 3EPJA 3M1IA 3CRW1 2QSYA 3CNOA 3P27A 2H7VA 4FMDF 4I1OA 3EZFA 1FQJA 1K5DA 3P4YA 3TK1A 2GEDA 2EVWX 2ANCA 1AZTA 1JR3E 2D4HA 4B3XA 2WJYA 3KJGA 4Q66C 1SVIA 4BEJA 4BFUA 2HDNB 1NSFA 2B7CA 1E9DA 4B2LA 4DCNA 3WNDA 1OIXA 2MSEB 1Z2CA 2P6NA 4A0RA 3F5FA 4Q1AA 4M22A 1JECA 2WV9A 3HU3A 3RWMB 4E22A 4QKQA 2ZSDA 5L3QB 5LPNA 3NTUA 4HLDA 1ZM9A 4MKFA 2XEXA 2ECKA 3LLUA 1KY2A 1XB2A 3A1WA 3C5HA 3WY9A 2CMKA 2EFEB 3IGFA 3DKVA 1P2UA 3ASYA 4HAUA 1U9IA 2HF8A 4RSGA 4E09A 3UPUA 1RYHA 2PBRA 1YR7A 4LK2A 2O5VA 5DO9A 5JFGA 3K9HA 3LQRA 3GLIE 2AWOA 4CT5A 2F9LA 5J4LA 2VP0A 2QAGA 4U02A 3T1OA 5EXTA 1VCNA 1IN5A 2QGNA 3FMPB 3S1AB 2C98A 2NIPA 4TLBA 2O8FB 1KTVA 4R71A 3CX7A 4XSHA 1ZU5A 2ORVA 4ACAA 2C9OA 4HDQB 1TF2A 3OFNA 1GVNB 3WBKA 5BYKA 2W2XA 1PV4A 4IOMA 3P20A 2REOA 2NO6A 1XX6A 2P0EA 4ITRC 1SVKA 4EPXA 4ZDIA 3CM0A 2X19A 5AUOB 2FMXA 5KUTA 3AV0B 1WBBA 1G6HA 3X1ZA 4OHWA 1ZIPA 2QP3A 1VTKA 1ELOA 1YU9A 1KI9A 2QL6A 3Q7QA 1OXSC 1FTSA 2I3BA 2WKRA 1MABA 4Z54A 3D7MA 3L0PA 1W7AA 1BMFD 3LBHA 1WBDA 2ZANA 1E0AA 1E4VA 3HR7A 2WJJA 3GEHA 4FD2A 3TMKA 2IYQA 3EWAA 2ZRNA 3ZDQA 3AP1A 2QRNA 4ZI2A 4M1YA 4IVPA 2HCJB 1KDOA 3CNLA 1XD9A 2PL3A 5HCNA 1P4SA 1DEKA 1JB1A 1CRPA 4Y0AA 4LRWA 1KGDA 4AKGA 1FP6A 1H8ED 3RLFA 2JLVA 2NOAA 1G7TA 1NVXQ 3ND8A 4BFYA 4B3BA 4LJ8A 2WMNB 4GFDA 1SVSA 3SJAA 5AJXA 1A5TA 4KO8A 3I32A 3K0FA 4LBWA 4X8OA 4C0JA 2V8OA 1QHXA 3SQWA 2EYUA 3NDBB 1E0JA 1Q1ZA 1XEXB 4TLAA 4P4SB 3QVVA 3BH0A 4DCTA 2KE5A 4EFMA 3VNUA 3CRRA 5IF9A 1XPRA 3KQUA 2W6IA 2PT7A 2ZJYA 4I99A 2YOGA 1E0KA 2PX3A 1HH4A 3U7FB 2JLWA 2AX4A 4FWIB 1FP7A 4M9QA 1P9WA 2JEOA 4HLUA 1CJTC 1ZUHA 2GEUA 1P75A 5EP4A 2OG2A 3R9WA 3PR1A 1X8KA 3Q3JB 4II7A 4ZIRA 1P2VA 1F5NA 1XNJA 2GETA 2V6JA 1Z2AA 2J7PD 2OLKA 1RIFA 3NH6A 4ESHA 3GFPA 1E9SA 1Y63A 3SYKA 2WOOA 3SBDA 3OEEA 2FEMA 1QDEA 2JCSA 3ZQJA 4EDHA 4IDOA 2OHFA 3ZQ6A 1V5WA 2UVQA 2WWGA 2HUPA 3OESA 3TNFA 4TQAA 3B6EA 4AURA 1CULC 4MGZR 3TW4A 2ZRFA 3Q85A 5FTNA 2GAAA 4CIDA 3KQKA 1DPFA 4JLKA 1MRSA 4EPWA 2ZXUA 4A15A 1R2QA 3NIBA 2ZUCA 1T5LA 3WXMA 4YONB 1XCMA 3AKCA 1MO6A 2HYDA 2ZSEA 5FOVA 4LGMA 1XRJA 3VFDA 2QM8A 3C14C 1CEEA 3CZPA 3VTKA 2WWYA 3RHFA 1TMKA 5KO2A 2REBA 3T35A 1SQ5A 2Z4RA 2MMGA 5UKDA 3KL4A 2Q0HA 2QT0A 1N6PA 2AR7A 1KHTA 1ZVQA 3AP2A 2DFNA 1Q1QA 2IYXA 1G8HA 3KB2A 2BMEA 1KK0A 1J90A 4IW3B 3VU9A 4B47A 2GXAA 2IYTA 1P60A 3ZIAD 4BASA 2NQ2C 3AVVA 3TAUA 4TL8A 4F7WA 1G16A 2BBWA 1DAGA 1AIPA 1LS6A 1T5IA 2C2HA 3VR5A 3BERA 3DM5A 2O52A 1MRNA 4LJAA 4EFNA 2GCPA 4TL9A 2NO9A 1ZNWA 3AF0A 2IBMA 4CEIB 1IN4A 2VIIA 4O2RA 1CU1A 1F2TB 1YR8A 4CEHB 1W0KA 3ECCA 2QGZA 1R5NA 1G64A 3V4FA 1DELA 4EJSB 1B23P 4AK9A 2OM2A 5M04A 2XGJA 2O8BB 2R6FA 3I92A 2A5FA 1NG1A 4AYXA 2JJ1D 2XOKD 2ZUBA 1E94E 1VDZA 4LHZA 4B34A 3VR4A 1JBKA 2OXCA 2J41A 4W5WA 4U5XA 1X3SA 4LDJA 1HV8A 4WOPA 4YQFA 3EPLA 4NYJR 4MUAA 5SZHB 1TU3A 2QAJA 2KSQA 1RJ9B 1YKSA 2NMVA 1NVUQ 3AH8A 4MRNA 3EXAA 3DL0A 2IYSA 2D74A 2IYRA 4BLPA 3L2OB 4OHVA 1BS1A 1TU4A 2R6GA 4YMUA 2IYLD 4GMDA 2ZI5A 5GVRA 3UG7A 4TYWA 2FWRA 3J81k 2MMCA 2AFIE 2CNWA 4EPTA 1NJGA 2V1UA 3QSYA 4IDNA 2V3CC 5CB6A 4PZLA 4GOJA 4LUCA 3UIEA 1OKKA 2A5YB 4YMVA 3LNCA 3W6NA 5BN5A 2RGEA 4Q4AB 2G1JA 4AC9A 4TQ9A 3CRQA 4PO9A 4C0LA 1II8A 1AM4D 1RC8A 4QHTA 2RGXA 3CH5A 4DSNA 3THXA 3VX4A 4DUGA 4EIWA 3R8CA 4XIGS 4TLCA 4HZUB 2LKDA 2WKQA 4RCZA 3U2QA 1MO4A 4DC9A 3AVXA 3FKSD 4MKGA 3QPVA 2IL1A 3K0EA 4UJ3A 1ZM7A 1JAHA 2CXXA 5GJWC 3K70C 2QSZA 2A2ZA 2X1VA 2QI9C 2ZJOA 4MDFA 2O8CB 5D3MA 4KU4A 3CRVA 3TAHA 3O47A 3GJ5A 5FOWA 3SR0A 4LSGA 3SHFA 4KYUA 2J46A 1DAIA 1P73A 4Q9JA 4D4KA 3NC1C 5JEDA 4LYFA 2J0SA 2QTFA 3DZ8A 4RZ3A 4DZZA 5JI3E 3GLGA 4XD7D 3VHXA 4QGAA 1DAKA 2VL7A 1OHHA 4NDZA 1H8HD 4AKIA 4G5RA 2GJKA 3AQ4A 1KI6B 3B85A 3QKTA 4LV6A 1Q3HA 3OEHD 1GILA 3PITA 2HEIA 1Q20A 3JZMA 5B57C 1XXHE 2YWEA 5GJCA 2VPPA 3ADCA 4MYCA 1G19A 2P2LA 4NMMA 5E4FA 3A37A 4GRAA 4A0HA 4TL7A 2GF0A 2W0SA 4TYYA 4PC3A 1F6BA 1G7SA 2ZRKA 4P4TA 5JRJA 3NBXX 5E3HA 3LX8A 2ATVA 5G3YA 4H1VA 1KIMA 3HPRA 1NBMD 4GPTA 1LS1A 2DCUA 4A2QA 2BC9A 1XD2A 4DSTA 2XSZD 4V0OA 3KUCA 3SZRA 5LD2C 2R6AA 1VYUA 4IEIA 2QU8A 1DE0A 3R20A 2DBYA 3ZZUA 3TGPA 3U7HB 4GBMA 4LYAA 3CRMA 2ZRCA 5KSZA 3SJCA 1J99A 4XOIA 1UBFA 1ZNYA 4RVCA 2WKPA 4B33A 3QENA 4MYHA 1IXRC 1XEXA 5KHOC 3WRYC 1IY1A 4RD2A 2QP4A 4PFSA 1GRRA 3NWJA 3PUVA 3LWNA 2BKEA 3QXXA 1SVOA 1IJFA 1FUKA 4QJ4A 2ZEJA 2G6BA 4K81B 4B2IA 4P3YA 3CF6R 3H0KA 1FQKA 3GJXC 4BLRA 4F92B 2C78A 1VIAA 3R9XA 4DLWA 3AVQA 3FWYA 4EQ6B 2OSBA 3I3SR 4Q7LA 5EUMA 1U98A 3NBYC 3GP8A 1R0ZA 4HUQA 1KYIA 4JJKA 4O0MA 1VKJA 2XTZA 3G82C 4QJ5A 2RHMA 3KUDA 4RZ2A 5JSZB 1IHUA 5FR2A 3MJRA 2ODEA 2IXEA 1U8AA 5BQ5A 2P6UA 4P0TA 1UM8A 1UKEA 4HB0A 4QNRA 1QZXA 1VG8A 4TMVA 3WHLA 2GCNA 3ZJYA 1FNNA 2D7DA 4YXWA 4JLJA 1VCOA 5FOXA 3SOPA 2F43A 4QBHA 4YDSA 2XJ9A 3TQFA 3AF4A 4W5HA 2GCOA 2W00A 3IPYA 5AUQA 1EX7A 2ZRIA 4UNSA 1Q1BA 4L4UA 4NBSA 1CBUA 2ODBA 3HWSA 3U4QB 4OBEA 2FGKA 2YJTD 4O3MA 2QMHA 3A4MA 3EZ9A 3CWQA 4M9SA 4QHSA 2FFHA 4DDVA 5FBWB 4DSUA 1I4LD 1OH7A 2IXGA 4D4MA 5DI9A 1M2OB 1XWIA 3K9GA 1N0UA 4PO1A 1CJUC 4ASUD 2FU5C 4PXAA 2AWNA 4OQNA 3MWLA 3QEOA 1EFRD 4WIAA 5CLLA 5KNDA 4HLCA 1S3GA 2EW1A 2I4IA 2Z83A 4HZIA 2AKYA 1XTIA 1Q57A 1NKSA 1JXOA 1VPLA 4RZXA 4G1UC 2YOHA 3QKSA 3U60B 4ZDKA 3FHOA 4Q48A 2CL7X 2J7KA 2L0XA 2AHOA 3BB3A 4FINA 2J0VA 421PA 2OLJA 5AJZA 2IHYA 3DKPA 4C0BA 2D2EA 4KSBA 2XB2A 4WXPA 3A1UA 4EPVA 3UXMA 1R5BA 3MWYW 1COWD 2PT5A 4LJ9A 3IEUA 3I61A 2XZLA 1GUAA 4NE2A 2BMJA 1OFUX 3WP1B 2CCGA 4Z8YA 4B48A 3CLVA 3THYA 1YR9A 3GLGE 1E2DA 2GAOA 4A2PA 1WF3A 1HURA 4LHXA 4NYMR 2JLZA 3OIYA 5JCZA 1RRFA 4R98A 3K0AB 2ZE5A 3PEYA 4FCVA 3ZS9A 2GZDA 2Z0MA 2WICA 5C18A 3MAAC 3OAAD 1NY5A 4WZ6A 4KLZA 1XTJA 3Q5EA 1JNYA 3SN6A 2WIAA 1AZSC 1JR3A 2GZAA 1IONA 3DMDA 3HYTA 1II0A 1GM5A 1DS6A 2QEQA 1DO2A 1D2MA 4M1MA 4AIIA 4G3XA 2J0QA 4PPQA 4Q1DA 3NVAA 5KYKA 2FFAA 3W34A 4ZPXA 3LRPA 3L0IB 4HAVA 4PC1A 4B44A 2CLDX 1EFHA 3L43A 3QJYA 2F55A 5AK0A 1OE0A 1GP2A 1D2EA 1Q0UA 5FL7D 1GNRA 3I62A 2J1LA 1T91A 3OF5A 4MKIA 3RS2A 4B32A 1LTQA 3SYNA 5BN4A 2C04A 1UEIA 5DIFA 4JLNA 2AKAB 2ZAMA 3BFXA 4ESVA 4B3GA 3QF4B 3OIUA 1T4GA 4PC2A 4S2EA 3WNCA 3GQBA 1FNMA 1U81A 3RC8A 2IXFA 2OILA 2G1KA 1JJ7A 3B1WA 2JAQA 2WWIA 4HB3A 4KYIB 1KI7A 4V02A 3HJNA 3C7KA 5AR1A 1GKYA 1GWNA 3GLHB 2XTNA 5EXXA 1XD8A 2JIZA 2FJUA 1X1RA 3ZLJA 4DLXA 2JDID 1G18A 1KNXA 4WZBE 3WMEA 3IIMA 2FSGA 2G88A 4Q18A 3SQXA 5TARA 4LHVA 2IWRA 3ZGXA 4RZUA 1G3UA 4PHFA 3N2EA 4BFTA 2R9VA 4FMCF 2QA5A 3RDPA 1NIPA 3WP0A 2V4ZA 2IWHA 2IW3A 2AXNA 2R6DA 3B5JA 3PUYA 1YZUA 5EZ5A 2WSSA 1Z29A 2HYIC 1RKBA 2K5UA 4DLYA 4XWOA 1PZNA 3QUSA 4Z1MA 1YRBA 3NEJA 2CK3D 1OT3A 2QQ0A 1XZQA 4NONA 1G3RA 5FTJA 1P7CA 1PJRA 5DHAA 4CVNA 2YC4C 2RGCA 1ESNA 1UJ2A 2D3WA 1KMQA 2JGNA 3H86A 4Q1BA 1R0WA 1M8PA 2G0TA 4JL5A 3B13B 3R9IA 1XMSA 4MGKR 3AF1A 4OI4A 2ZRHA 1RPZA 1ZRHA 3KTAB 1G21E 1EK0A 5TXGA 4JKIA 4FIDA 2DY1A 4XVUA 3L8YA 4A8JB 3ASZA 4XTRA 2FF7A 4Q19A 1ZC4A 4OYHA 5TB5A 2XXAA 2Z43A 5KDOA 2QMOA 5DI3A 4TZ6A 5KTYA 5HKKD 4OK3A 3O8RA 3QVUA 3O8BA 4OI1A 1NLYA 1NIJA 1Z0DA 1P2TA 4A9AA 1G291 1R8SA 2QUZA 5TY0A 4C3ZA 5FPTA 3C4JA 4BPBA 121PA 1GNPA 2GVZC 3NHBA 2BCGY 2GHIA 3DDCA 1YZNA 5ANRB 3FMIA 1CS4C 4CEJB 1HY3A 4C7OA 4IOKA 2A7QA 2ZRAA 1SZPA 3L0OA 5HTKA 4JBXA 4B73A 1IN6A 3CUEF 4OHXA 2Q3HA 2ZR0A 1G3QA 1NSTA 3EA0A 4Q1EA 3OE7A 4BFWA 4NYMQ 4DRZA 1HTWA 3BRWD 1N3BA 4UXHA 4HYYA 1Z6TA 1ZM3A 2IT1A 1QHSA 1F2UA 2QNRA 2V55B 2DFLA 3N2IA 3AKEA 4AI6A 3FTQA 1LVGA 1I4DD 2Q3MA 3TVTA 2UZ3A 1IAQA 4S35A 2XX3A 3CX8A 3LLMA 5BN3A 1ZINA 4ARZA 5FPSA 1QHGA 1YJ5A 2QP9X 5K8UA 4DEYA 4MRVA 2RGBA 2HXSA 3BXZA 2ONKA 4PAMA 4PPNA 4CDGA 3K0CC 5HR5A 4TTQA 4FWTA 4AD8A 3QG5A 1E2HA 3LY5A 1G7CA 3A1TA 3F3YA 3ZD6A 1XTRA 3FHCB 2ZYWX 1GKIA 1Z0FA 4JSTA 1RRCA 2W0MA 2BBTA 1S2MA 3SNHA 4DXAA 3RS7A 3GJ4A 5A5GA 1XF9A 4V0MA 2VP5A 5P21A 1KMHB 2A30A 1L8QA 2GRJA 3B60A 2FFBA 3I73A 5FBQB 4D0LB 4OQMA 4URYR 2IUSA 1R10A 1YRAA 5HCIA 1AJEA 3MWKA 2GXUA 3NH9A 2ZRJA 1Q1EA 2A5JA 1ZM4A 5CK5A 1GL7A 4DCVA 5L3QA 2J45A 4B3FX 4CF7A 4QM6A 2PEZA 3PEWA 4KFTA 3BH7A 5J47A 4JLVA 4XH9B 2RHDA 3REFA 3VR6A 4A0FA 2OCBA 4AYWA 3W90A 2FE4A 3GMTA 4IXNA 4ACBA 3KJIA 2ZVQX 3RYTC 1E69A 1GIAA 4C30A 3PQCA 1KI3A 5J4VA 4LZZA 2ZI3A 3F8TA 5FOTA 3R7WB 5F9HA 1TEVA 3S1AA 1DBSA 1NRJB 2JLRA 3UMSA 2O8FA 1NJFA 1HT1E 1LW7A 4GOXA 4TSFD 2BMDA 1RZ3A 2YWFA 1BYUA 2WPDD 3AGPA 3AVOA 1O87A 3PUXA 4KXFB 2JASA 3CPEA 3CBQA 1MKYA 1T6NA 2V6IA 1ZAKA 2WBLC 4QBIA 3W3ZB 2FSFA 3LQQA 4V0KA 1GZSA 1DO0A 3EC1A 2ANBA 1V43A 4NTZA 4C0QC 3WMFA 5EUQB 4CT4B 3AF2A 4RD6A 5HPYB 3AVUA 2Z5FA 1UKVY 2F1RA 1QG2A 2BM0A 2PX0A 4JLBA 4MQBA 1KSJA 1SKYB 4M1SA 1OYWA 4DLZA 4N0EA 4D26A 3KQHA 5F9FA 1QVAA 1XCPA 3WRXC 1DOAA 3MCAA 3EA5A 8OHMA 5LB4A 2VHTA 4I1UA 4WVFA 5EE3A 4OJQA 1IQPA 1Z6YA 1ZUIA 3FB4A 4X8LA 1A1VA 4D80A 4HEJA 3AP3A 3FMFA 4L9SA 1G8GA 4JYBA 5FI0B 4CZ2A 2I1QA 2O0HA 1OH8A 4XVQA 2G0NA 4HB4A 1IN7A 4JBYA 4XJXA 1N6OA 2FG5A 2OT3B 4Q4HB 3TH5A 2CL0X 4YC7A 2PH1A 1E96A 3QNUA 1G17A 1VHLA 1IN8A 2Q9BA 3QKUA 3PEUA 5AUNB 3F0TA 4XWAA 1B0UA 4P4SA 1BMFA 1IOZA 1ZCAA 3RABA 3JVVA 2Q9CA 2WWFA 4QGFA 1EFTA 2NPIA 4DWJA 1DG1G 2JLQA 4N1AA 2FA9A 4DDUA 3EC2A 2QPAA 2FEOA 1U0HC 4JVNA 3UWKA 2CJWB 3BIFA 3L8ZA 1AKEA 1KO7A 1H8EA 1KK2A 3T1TA 1H65A 2XZOA 5GJVC 4L8GA 5CITA 1XXHA 4UNQA 4XTCS 3HPQA 1W46A 2OFOA 2QRZA 2LWIA 1X1SA 5ELXA 4IDQA 1HQYE 4HATA 3AVPA 3AF3A 2ZROA 5C2JB 1C9KA 2WWWA 4NCKA 4PC7A 4TYQA 4IOJA 3KKNA 4QG7A 4BZPA 3HDTA 4US0R 1E1QD 3I5YA 4JJZA 1D9XA 5AUPB 3RVBA 4V0ME 4AYTA 3B82A 2XITA 1WE2A 3QKRB 3VU9B 1QHNA 4BEBA 4Q4LA 4NCIA 1AA9A 5G40A 1VCIA 3EAQA 3EG5A 4F38A 5CDFE 5CIWA 1CIPA 2B21A 4RD3A 1XU4A 1MO3A 1PLJA 3QBTA 4PO8A 3GFTA 1XMJA 2QMEA 2YHSA 5DE3A 2BEJA 1Z83A 4TQUS 4EKDA 1TAGA 3BS4A 1KK1A 4DLVA 2FGJA 2A78A 4TMWA 3IIKA 1TQDA 3A1VA 2VP9A 1KY3A 2IC5A 3ONWA 1W36D 1Z6XA 2J9RA 4A0GA 2ORWA 1X6VA 4URXR 2QROA 3CH4B 3HU1A 5HE8A 1E2LA 2RB4A 4H1UA 3LD9A 2VTKA 4JLDA 1OKKD 2ZI4A 3KXIA 2A9KA 1T3SA 3RSLA 1E2KA 1MH1A 3HR8A 2LCFA 4KI0A 2OCPA 1UDWA 4RJLA 4NZYA 1YR6A 1YVDA 1GRQA 3CPHA 2CHVA 3TSZA 3VX3A 1AGRA 3B78A 1KO4A 1NLZA 1E9EA 3QPUA 3UMRA 3TVDA 3MWJA 4FMBB 5DYGA 2GXQA 2CEAA 1KAGA 3D8BA 4Q01A 5JJLA 4CEIA 3BH6A 2CCJA 5IK2D 1F2TA 1G9XA 1P62B 1CR2A 5CYPA 1SVLA 3RANA 4DLRA 2GEVA 4IHQA 1W36B 4DEXA 4BGDA 1F3OA 4EJSA 1M7HA 1KJYA 3BE4A 3MFYA 4YLGA 5DNYB 4PX9A 4DHEA 4ZI3A 3WYGA 2G83A 3X1XA 1CJVC 3B7GA 1L4YA 3NBFA 3REGA 1KDTA 1VG1A 1NLFA 3LXRA 3SU8A 1ZCBA 3ZIAA 3ETLA 3IKJA 3RAPR 3CX6A 4L5BA 1U99A 1RJ9A 1W47A 3QQ5A 2XB4A 1P2SA 1KZ7B 2J3EA 2XNDD 3B2EA 2N1BA 5EE9A 4BRUA 1N5JA 4IRUB 1Z28A 2NPFA 2JLYA 2GF9A 2O0KA 2XJ4A 3CZQA 4Q7JB 4RKFA 4ABYA 2P5TB 2FN4A 2BCJQ 2GNOA 1W4RA 3SEAA 2ZAOA 3V9PA 4ON9A 1UEJA 1ZMXA 4U7DA 2ZJAA 3T12A 5D3MB 2GJ8A 3VMFA 1VG0B 2KB0A 1DAEA 2NO0A 1PUIA 2H18A 3IQXA 3TIFA 2JJ1A 4N3NA 2BEKA 2XOKA 3AKYA 5SZJA 1KJWA 1UBGA 3AUXA 4LHYA 3V00A 1U8YA 2Q21A 2OESA 2Z4SA 4HZUA 1P72A 3RRYA 5B64A 2VSXA 4NYIR 1Z0IA 3PEVA 3A36A 2F1JA 4GP7A 3HU2A 4MITA 2TMKA 4M0LA 2FSIA 2Q9AA 5IRCD 3TLXA 2NZJA 4LV8B 2GA8A 2YOFA 4TMXA 5H1YA 4UQOA 2IYWA 2ZRDA 1F48A 2WOJA 1TF7A 1PLKA 2O8CA 4KBFA 4X8MA 3DVLA 3ZYCA 1E79D 1EWRA 1E1RA 1XJQA 4FXPA 3P32A 3RS3A 4GMXA 3TSWA 1GRNA 1EFCA 1E2IA 1NN1A 1ANKA 1D5CA 1TNDA 1SXJD 1WP9A 4LPKA 5EP1A 5FUYA 5FH9A 1I2DA 4Q9IA 4DCSA 5DYIA 3FPAA 5FTLA 3GLFB 4KAXA 4RFSB 3EIHA 3W8NA 4B35A 4H9GA 4TMTA 2F3RA 1KI6A 3FKSA 1XEWX 2VBCA 2IUUA 3EARA 4OQLA 2R8RA 4CW7A 4PQFA 3IO3A 4FI3C 2YWHA 1P9NA 4UNRA 2CHQA 5A0FA 2H17A 3RC3A 1XTQA 4TMKA 5TVKA 3RS5A 1TF5A 3OIVA 3LA6A 4FCWA 1E99A 1CTQA 3AB3A 3EX7C 4C9BA 2AXPA 4MKHA 3HYRA 4D6PA 3ND9A 1QHIA 2H16A 2ORIA 3BGWA 3PCRB 1OXUA 3U44B 621PA 3LO5A 2O8DA 3PJRA 1SXJB 1NVVR 3X1WA 4JIMA 3D3QA 1N5KA 4XD7A 3B1ZA 5JBQA 2N42A 2QQEA 2VA8A 1ZP6A 3TRFA 1II9A 4Q02A 1HQCA 2YKGA 2ZE7A 2MSCB 2ASEA 2VHJA 4NYJQ 1IM2A 4JBWA 4YDHB 1TX4B 1KSHA 4OI2A 1JQJC 1OIWA 4NCHA 5EE1A 1US8B 3U61B 3OEHA 2QE7D 1QF9A 5G41A 2ZPTX 1G3IA 1Z3IX 3CWZA 1UAAA 1W0JD 4GP6A 4D82A 4GNKA 2RAPA 5EJEA 4E07A 5C4GB 2GCOB 2W83A 4B3DA 1MV5A 1FW6A 4EJSC 3QOFA 2AFHE 4OKSA 4TWZA 1G8YA 4EQ6A 5KPJA 4URVR 2IX3A 2UZIR 4GOKA 721PA 2UKDA 2FNAA 1FMLA 1NNEA 1NBMA 4DIEA 2AK3A 4Y0VA 4G5GA 2XSZA 2CBZA 5JSZA 2BBOA 1FX0B 1LV7A 1FZQA 3EZ6A 3K09C 1NP6A 4DT1B 1Z47A 1E2JA 3KQNA 1E9BA 1VHTA 2BV3A 2JJ2A 1BKDR 3CPJB 1W36C 2FH5B 821PA 5CM8B 4BLOA 3ADDA 2WJVA 2X77A 1R0XA 3P26A 3C41J 4LJ5A 4PZZA 521PA 4URWR 1M7GA 4BLTA 5B30A 3D6TB 3ZVNA 4Q5IA 1XJCA 4W5JA 4FMDB 4OI0A 2WM9B 5G53C 5L3SB 2IS2A 1E9FA 4JVLA 1Q12A 5G3ZA 4B74A 4G01B 3ZH9B 4F4IA 2QT1A 2WTUA 3UG6A 3PXGA 3THWB 1G5RA 1EFUA 1RW4A 4JSYA 2ZJ2A 4NPHA 4FN5A 3T06B 3H1TA 4LC1A 1ZUNB 3TUIC 4OHZA 4KV9A 1DG3A 2EFHB 3MMPA 3AVYA 2CLSA 1TUIA 4E5UA 1Z63A 4YMSA 2KBEA 2WWHA 3BK7A 5JHHB 3W6OA 4EPYA 2B7BA 1XFAA 2ZU6A 5DLQC 3KKPA 3GCGA 1KKLA 1GG2A 4PHTA 4TN1A 4NCJA 5CK4A 2ZI7A 3TW8B 2XZPA 3E5HA 4M21A 1E32A 1N5IA 4B6EA 1OIVA 2QBYA 5AJWA 1NN0A 3MUFA 1Z08A 2GTPA 3I4LA 4DLTA 1P5ZB 4D81A 4Q4JB 1E2PA 5KNBA 1WCV1 3RS4A 4ILEA 3O8CA 2V7QA 4PSAA 3B9PA 5IDVA 3N70A 4GI7A 1TUEA 1J7KA 4ASUA 1XBTA 3MLEA 4LYHA 2OBLA 5FTKA 2HLDA 4KCGA 3CR7A 1W4CA 3Q9LA 3DM9B 1ETUA 3QBVA 3THOA 3K0CA 4C0HA 3VR1A 2DHRA 1CR0A 1OXVA 4KBGA 3VKWA 5BYJA 3B8HA 3LBNA 4MDEA 3M0EA 2VF7A 3K0AA 5SZKB 3T15A 4JLMA 2PZEA 4A4DA 3CONA 4BFSA 2FSHA 4V0NA 5FUVA 2ZRLA 3GLIB 3G5UA 4ZKDA 4HAYA 3TKLA 3ZD7A 3MD0A 2AD1A 2ZTSA 2A3RA 5C46F 1NI3A 1COWA 2OFWA 5K8LA 3SBEA 1DADA 3W6PA 3ZVMA 1TTTA 3MJHA 3K8YA 3QI2A 4AY2A 4OK5A 1WQ1R 3NG1A 5FL3A 1JPNA 3FKQA 1IBRA 4BQSA 1KI4A 5DN6D 5JZVA 3PG5A 1KI1A 1KI2A 3AVWA 1RVDA 2ZJZA 3LDAA 3QF4A 4M1TA 3RS0A 2VF8A 3GJ3A 5J40A 2PCLA 2P6RA 4HDCA 5JJIA 3CNNA 1JJVA 2ZRMA 2O8EB 1E2FA 3SS8A 1QBKC 1QHHA 3LVQE 4B75A 4BFXA 3TE6A 4TT3A 1ZD1A 5D3QA 2C5LA 3GLHA 1GITA 3KKQA 2HT6A 1FL9A 5AWFC 1EX6A 4Q1FA 4TMZA 2VEDA 4A2WA 2D62A 4CRWB 1OYYA 2WAYA 2FZLA 2GVDC 3QF7A 2C9CA 4C2TA 1JXMA 2B92A 5DH9A 4ZKEA 4KSCA 1NBME 1Z0AA 3KJHA 5FL7A 3U5ZB 1DTSA 3VR2A 1P6XA 2F1IA 4R2HA 3QXCA 1OFTA 1UFQA 3QEJA 1N6IA 2QM7A 2F1HA 2BJVA 2GXSA 3IHWA 4M1OA 3KQLA 2W6JD 3CR8A 3KJEA 2RH5A 1TQ2A 3K53A 1NMXA 2YINC 1OV4A 4KFRA 2FOLA 1Q22A 4AKHA 1R8QA 5DI3B 2X2EA 3Q72A 3DMNA 4A36A 1FMJA 2PZFA 4LJYA 4QFMA 1AQUA 1D8TA 1XEFA 1YZQA 2XNSA 3RSOA 1LY1A 2F9MA 2ZE6A 3WNBA 4P32A 1D2NA 3P1JA 1LB1B 1UDXA 2JDIA 5JWRA 4P31A 4ZCIA 1BOFA 4D4LA 2ZR7A 2ZS8A 4V0LA 3KTAA 4C7OB 2DB3A 4ERNA 2BHRA 2ONJA 4OL0A 3M6AA 2E1RA 3W3AA 2QY9A 2BMFA 2X8AA 2ZR9A 4UNNA 2J5XA 2VSFA 4PQRA 3WYAA 1N6LA 2Q3FA 1U2RA 4HAZA 4F91B 2J0UB 1SHKA 3KXLA 5DGXA 2C77A 2CK3A 2P3SA 3EWSA 4RKEA 4B2PA 4E03A 2IA5A 3DO6A 2SHKA 2C95A 2R44A 4CEJA 2D7CA 3GEIA 4EFLA 4MYUA 3IQWA 1U0LA 4TLEA 4DSOA 4P4UA 1S4QA 2HJVA 4Q7MB 4QXAA 1G5PA 1T9HA 3K1JA 1UKZA 3A6PC 1U0JA 3H4MA 3GJ8A 3OZXA 3BORA 3OFND 1Z8FA 4J0QA 2E87A 1UKYA 2JLUA 2C03A 4YMTA 5HKKA 1SULA 1E9CA 5JHGB 2QZ4A 1MO5A 3WHKA 3BFVA 3HP1A 3ZZTA 4PC6A 5K8TA 4JLOA 3VKGA 2IUTA 4QL3A 2HCBA 5JI2E 5LDDC 5FOSA 1TEXA 4LOAA 1I2MA 2RKOA 4BRWA 1T3HA 1Z5ZA 4A92A 3ZS8A 4Q9LA 4EUNA 1RFLA 5CDFA 5IHPA 3JVUA 3LH5A 4JS0A 1E2NA 1JAIA 2BKUA 4IVRA 2DFTA 4MUBA 3KXKA 1TQ4A 1WDTA 2QAGB 3U3KA 4D0NA 3KFXA 5L3RA 3G0HA 1N25A 4UXIA 1EESA 2WWXA 2IS4A 5CM9C 4TYNA 2NGRA 4PTLA 1AQYA 2DYKA 4QRHA 1ZIOA 1N2CE 4B43A 4F93B 1IXZA 4XSGA 2IF2A 1LFDB 1ESMA 2CDNA 2HJGA 3W8RA 4BZXA 5A4JA 3CB4A 3LBIA 3CO5A 2IYYA 2RCNA 1KMHA 3DEFA 1E2EA 5L8VA 3BD9A 4Q7KA 3JZAA 1GNQA 3SFZA 5JS7A 2ZM5A 2ZSBA 3Q8XB 1W5SA 1CF4A 3LVRE 3U7EB 4FW9A 1CP2A 2O0JA 2OAQ1 2VP4A 3NC0C 2NG1A 1MABB 1L7VC 1VCMA 1VYTA 3C5CA 4KHZA 2H5EA 2WZQA 4JKYA 4MRSA 4V03A 1JI0A 1OFIA 1JALA 5EQTA 3GLHE 4LYJA 3ADBA 1XMVA 4XWKA 4M9ZA 2C9YA 2GDJA 3K9LA 3KDSE 1KZGB 2V9PA 1N6HA 4NCNA 3ICEA 4TL6A 1IXSB 2W6ID 4Q21A 1W48A 3NEYA 1ODFA 2ZRPA 2FPKA 1O3YA 3KB1A 4QBGB 4IJMA 4LC0A 4PAQA 5FBVB 2JLXA 4P33A 4PPFA 2VRWA 4Q00A 4O25A 3K70D 2DWPA 1BIFA 3R7WA 1Z07A 1XP8A 2WVJA 2YNMA 3K0FB 5AJYA 1RE0A 2ZYUX 1GSIA 4WZAE 4JT2A 4F4CA 2RGGA 4D0GA 4JVMA 4PSVA 1M7BA 4LI0A 2EFCB 4XVRA 3OEED 4GDFA 1S1MA 3RRZA 3KKOA 1GFIA 3GD7A 3T61A 4LBYA 2R65A 4A8JC 2ZUDA 3IILA 4OJKA 1S9DA 4I4LA 3GJ0A 1Z0KA 3GJ7A 5KDDA 3TUJC 1CJMA 4KVGA 3TSOA 2GBLA 3QXHA 1GTVA 4MRPA 3ADKA 3V4RA 4EAQA 4RD4A 4ZIRB 1J2JA 3K70B 1A7JA 4RD1A 5E7MA 1MT0A 2D2FA 1J8YF 1MR3F 1HUQA 1T0JB 3OHMA 1R7RA 4TSFA 5GJBA 2FX3A 3IUYA 2WPDA 3SE0A 4BFVA 2ODNA 2IS6A 4LJ4A 1CJKC 1U90A 1UADA 3LW8A 1M6NA 2R2AA 4IDPA 5TV2A 4QC2A 3EIEA 2MSDB 4C0KA 1DAFA 1G4AE 4OQFA 1KSGA 1M1YE 4Q4HA 4B76A 1P61B 1Q44A 4MGIR 1OW3B 1HE8B 2WIBA 1ZJ6A 4UKDA 1K8RA 2PMDA 4PR0A 4LV5B 5CJPA 1NVWQ 2IEYA 3PENA 4U00A 2G3YA 1R6BX 2EFDB 1XXHB 5KDLA 3IEVA 1JR6A 4HB2A 2WJIA 3GJ6A 4Q9HA 4TLDA 2F6RA 2EYQA 1WRBA 2OUKA 4HSEA 4JYCA 4NU0A 3TBKA 3A4NA 1YZGA 3PFIA 1Y3AA 5KSYA 4OK6A 1CRQA 2KI5A 4BE7B 2OV2A 5KOYA 1RRPA 4JMPA 3AEZA 1AGPA 1PVOA 1W0KD 4M9XA 2QMUA 4LCBA 3D31A 3K9NA 1P9RA 4QGGA 2ZE8A 3U6BA 3KX2A 5HE9A 1Z0JA 4DDWA 2VHUA 2IEZA 2CJWA 3U3JA 4DIDA 2AN9A 1HEIA 5TMPA 1SVWA 1JQLB 3I8XA 3U3MA 3QY0A 5JECA 1QRAA 1R4AA 5EXSA 3E1SA 5LD2B 1X86B 2PMKA 3IO5A 1AS0A 1W4BA 1S0UA 3QPWA 1JEDA 1FTNA 2GILA 4NH0A 4GZMA 2ZQ5A 5J4YA 1GKUB 1PUJA 1U8ZA 2HT1A 1Z22A 3BOSA 4FCTA 4C2UA 4AKEA 1GAJA 2WJHA 1U9IC 1ZM2A 5FOUA 3EPHA 1XTSA 2EFGA 1KOFA 2J7PA 3BC1A 1FFHA 2OAP1 1ONBA 5TDHA 2CNWD 2CVFA 5GVSA 3A8TA 1N6NA 2DWQA 2ZETA 1NF3A 3QKRA 2QAGC 3U3OA 3WMGA 3AM1A 2N46A 1G41A 3X1DA 5E7IA 2RGNA 5JS8A 5J4KA 4KLNA 3PUWA 5LB2A 1R5OA 4LX0A 1W4AA 1J70A 4IVQA 4RY2A 3P4XA 3IIJA 4DUGD 4EPRA 1KO5A 1GL9B 2W58A 4G0NA 2LKCA 1XPUA 4LPSA 3H84A 4KFUA 5C4MA 5B58C 1OXXK 1T0HB 4M1WA 5B2ZA 4CEHA 4D2IA 3H2YA 3T34A 3Q7PA 1E1QA 3SJBA 1E0SA 1OB2A 2ZU0C 3B1XA 2YC2C 2WAXA 5KPDA 2H92A 2QORA 4JZKA 2O8BA 1DAHA 1VIYA 2AK2A 4ZCMA 2OBMA 3KKMA 4A6XA 3MGCA 4IFEA 3X2SA 3K09A 2ZSFA 4TYPA 4A1FA 3SI7A 5LBIA 1II8B 1D9ZA 1TL7C 2YYZA 2JATA 3THXB 4OQXA 4ZV4A 5FUXA 1OHHD 2OCAA 1JEEA 1LF0A 3U6KA 3IBYA 1XDBA 1G3MA 5F3WB 1MOZA 3UWOA 5E95A 2GBLC 4TTPA 3TQCA 1E2QA 2ZI6A 1SVMA 3GFOA 1W49A 3NKVA 3B9QA 2J87A 1XEWY 2ZVPX 3AKDA 3FVQA 1E1RD 3L82B 4QOSA 5KU1A 2ODWA 1OH6A 1QHYA 3TR5A 3WBJA 1NMYA 1OPXA 4LY6A 1A2KC 1CLUA 1M74A 1R0YA 3B1VA 1Z06A 1ZU4A 1CR1A 4Q4AA 2EWVA 4UJ5A 4W7SA 1N0WA 4M8NE 4Z51A 2VHQA 4Q1CA 4QJ3A 1SKYE 1XJ0A 4PPGA 2GJSA 1LF5A 4AWXA 1E6CA 1YQTA 4ZDWA 1HT2E 1UF9A 2IHBA 1C1YA 3I8SA 1L4UA 3LW7A 1W1WA 4Q03A 4HLUC 3GLGB 4DB4A 1E4YA 2ZYTX 3LV8A 4PANA 3NBZC 5IK2A 5GADl 3NHAA 3RNLA 2OXRA 4HI0E 2ERYA 2G77B 4QHYA 3K0SA 2IK8A 1OJLA 3I72A 1AS2A 2QN6A 1XMIA 1KKMA 4R9UC 2JJ8A 4C0SA 1EG7A 1WA5A 4BZQA 1W5TA 3T1VA 5EP2A 6Q21A 5DISB 1WMSA 3VAAA 5BWMA 1VMAA 3A1SA 2EU8A 1C4OA 4JLAA 5DHFA 5EZ6B 1RYFA 3SHWA 1HYQA 3UMFA 1G1MA 5CIQA 1XZPA 5CB8A 1F60A 2PLRA 4BWYA 4HLQB 4MA4A 1X8LA 3U3RA 5JCPA 4IEEA 2XNDA 4QM7A 3RRNA 2RGAA 4D4JA 2VP6A 3A4LA 1XD2B 4FMCB 4GL2A 2AL7A 2CVHA 5CJ2A 3AVTA 3QXJA 2XAUA 2HV8A 3U7GA 2FV8A 1RRGA 4F4JA 4YXWD 4RCYA 2OBNA 3ICQB 5JWOA 2H57A 5FPKA 1SHZA 1BO6A 3PV0A 4DCUA 5F98A 3R8FA 2HF9A 3I1FA 2ZI9A 2I1VB 4US2R 2YWGA
chains in the Genus database with same CATH superfamily
4DZRA 2ZT6A 1A72A 1EVEA 3ES9A 1XLVA 4DKXA 1ZVMA 2WFMA 2X8JA 4J75A 1JSRA 4QLBA 3ZWXA 1ZSYA 1Q7EA 3B48A 1EBBA 3GJSA 1S5PA 2AD5A 2ISSD 2QR2A 3INGA 1L5GB 2RGNC 4R6WA 1YIDA 3ZE9A 4DUPA 1YOVA 4H1HA 4RFSA 4PHGA 3UV6A 1PNQA 4HNGA 3RJ9A 3RTBA 4WZBB 3IHLA 2XE6A 4C87A 4LXUA 5JRZA 2NO1A 4R2WA 2J3LA 4GUAA 5HZHA 3BQNB 1J22A 2FKAA 3PFBA 4ZO4A 3WJAA 3H83A 3QE0A 1U2ZA 1NUHA 1UJ5A 2Q4BA 4TTJA 3WGVA 2CJXA 2C3UA 1N5LA 2P67A 4INOA 1PNOA 2V4UA 5KNDD 2ENWA 1PG0A 5F1KA 4GZLA 4PXYA 5SZIA 3D0RA 3RVOA 5K3EA 1VLZA 4N41A 2AIRA 3NM5A 1KBZA 5JLJA 3EAGA 1BDBA 3L6DA 2QG6A 4BPRA 1UC9A 3MJDA 4KGZA 4YJDA 4YRIA 1G6KA 1SKQA 3I39X 1FPMA 1Z6GA 4B71A 4A23A 5JJBA 2I71A 1JN0A 2R7LA 3LYUA 1LUAA 3B3QA 3LOQA 2DF8A 2ZSHA 3KV3O 3UKJA 3HJGA 1V4BA 1T2NA 1NMQA 3E70C 1OLXB 4PE5B 5FP0A 4AJ1A 4C4PA 5IM4F 2NZ8A 1YQUA 5SYAA 1KRHA 2PSEA 2W8BA 3NYRA 3N87A 1XROA 2CCKA 4P4NA 3M6MD 2CE2X 4FHEA 2AR9A 1U5AA 4MVYA 2E49A 2IYUA 3EWNA 2IDZA 2OBBA 3I4CA 4W4TA 1S1CA 3DEIA 3UJNA 1G21B 5IJZA 2UUOA 3H5OA 1K9VF 3WO0A 2XMDA 2AOUB 4LBZA 4EECA 5JBNA 2VVTA 1K6MA 1Y7IA 2AYZA 1W1UA 4J7UA 4QD3A 2KM1A 5KYXB 3KFVA 1QKKA 1AGXA 4EGCB 4LYYA 4LYDA 3TEFA 2GSWA 1JPUA 3W5IA 1Y4DE 4GUDA 1N6KA 2YXNA 3EPKA 1ZNXA 3UA3A 4J16C 3TNDA 4KZPA 3NGLA 2P27A 3PQ7A 1CR4A 1FX0A 5JWHA 2VJCA 4QIHA 5CG1A 3ABQB 2WUGA 1HYGA 3PTZA 4NJOA 4AN4A 1LGYA 2FEXA 1JR3D 2OEPA 3IVXA 2QQFA 1EZ4A 3F5MA 1KJZA 1ZVVA 2I2WA 2VUIB 3CA8A 4HAXA 4U0JA 3I5XA 1Y1PA 3SKXA 1TM3E 1V1MB 4F8JA 5BQ3A 4JBNA 2H1HA 4ZCLA 3NDPA 1NATA 3AY0A 5J2UA 2CVOA 4DXDA 1HSZA 1BG6A 4HY3A 4I1VA 4RJ2A 2XTMA 1ORDA 2LTAA 1FUUA 1OMOA 1W2HA 2HSJA 4RDCA 3ONDA 4E5NA 1BQ4A 4A6PA 2OGTA 1EXVA 1JX6A 1DFIA 3LQ4A 1VE1A 3JAKA 1P5FA 1TD1A 1UBEA 1BXGA 3NP7A 4MYRA 2FWIA 3N53A 3TOSA 1DCTA 4ZQFA 2RGDA 1UDAA 4LISA 2BDTA 2EZ8A 2FHPA 3ASVA 1VGQA 3DDSA 1FMFA 3BWYA 2D54A 4GKVA 4RK6A 2QJTA 3K2BA 1PFUA 5JJ5A 4EHLA 1ZSNA 2A1UB 4D3SA 3SSAA 1WZIA 3A1EA 1EI9A 3EXHB 2FVXA 3RT9A 5D7NA 1JJFA 2JIPA 1N3YA 2D2IA 4WEOA 3GFRA 1GPBA 1IH8A 2HIGA 4E2XA 1XTKA 3G23A 2PJZA 2N0SA 1W0CA 1DRWA 3OZIA 2K7ZA 4L15A 3W4KA 5IT4A 3LPAA 2R1TB 3CVVA 3TOVA 4BX2A 4ZOLB 3WK6A 3WWEA 3OMXA 1LQTA 3AU8A 2IYZA 4D6YA 4B6FA 1O2DA 4HAOA 1TXGA 1KEEA 4DMCA 4GX5A 3T7EA 2RHLA 5H8WA 2AS0A 2V5AA 3NTXA 4N9QA 3KQSA 2O8EB 4LRQA 1DKMA 4GPIB 3RVNA 1D04A 4DV1B 5EE5B 1ORHA 1BWPA 4MK4A 4ZO7A 3OJXA 1EX1A 4N3CA 2X2FA 5JVDB 3T1HB 1UXGA 3UT5A 1EXWA 3B3AA 4S05A 2E3JA 2YWDA 4Q4JA 5DXJA 3WGIA 2D06A 1Q0RA 4Z8XA 5AI4A 2WK1A 4OQPA 1YS4A 3FETA 4MV4A 1KDRA 5FBRB 2C1ZA 1Z13A 3GQBB 3LQ1A 1NF2A 3ROMA 4Z6KA 3P0JA 1FFBA 2P3OA 3O9MA 3UATA 3TLEA 3UNXA 1XZNA 3IE2A 1GUDA 3L1JA 1JNXX 1W8IA 4FR2A 2QN1A 4IFBA 2YWBA 3R4VA 1M34E 4BIIA 3DZDA 1ZC3A 1R6TA 4X45A 3HCOA 4WVLA 1IIRA 5LVAA 3ROGA 1NL3A 4MQUA 2NUAB 2BELA 1OH8A 2HPAA 2XRYA 3GLFE 2VSOA 5I3CA 1ML4A 1NVTA 1NF9A 1ORIA 1QH0A 2KJQA 4Y9DA 2GZHA 2M2IA 3DT6A 3EXEA 4WCVA 5B1SA 1NULA 4N0DA 2FCAA 3DE0X 2EDAA 2CNOA 3JQ8B 2C83A 2NU6B 5FULA 1ZH2A 4ZU1X 1EFAA 4L8FA 2O23A 3GDHA 3X1JA 1X1DA 1V8PA 4JNCA 3QZUA 4JT4A 1WV1A 3HKBA 4UEJA 4RK5A 1BE6A 1EXMA 4XSVA 4LJRA 2VKQA 3FHTA 1CVRA 1SXJC 2FRVA 2J59A 3NZEA 3D6VA 1ZIXA 2A0UA 3EULA 4JJFA 5DSXA 2Y0PA 5FB3A 3UJ8A 3WOHA 1ABFA 3UT0A 3CLRD 2QENA 1XOIA 4Y2UA 5CFPA 4L5YA 4W9MC 3H1GA 1WSWA 5DM60 1SXJE 2NXWA 5HS6A 3O1LA 4RD0A 3HSYA 2WAAA 3DE2X 1DBRA 1SGWA 4OV6B 1TAQA 4HUTA 1LNZA 3M9LA 3QIAA 4QULA 4LJ6A 1RRKA 2E37A 3PQ5A 2QTLA 3FI9A 5JAMA 1C81A 4L3VA 4XX1A 3LT2A 4IUYA 1QYVA 1JH8A 4BO3A 2P1RA 5A62A 2BFFB 5LU9A 3PIRA 2CXRA 1WDMA 4KMRA 3STTA 3TL6A 3D7SA 3FWPA 5IT5A 4O4LB 5TGDA 3FVTA 2XE4A 4CG2A 2QTHA 3A7EA 3P2MA 4TTSA 1QNLA 3VNVA 4GPAA 3VKHA 3TZHA 3HCDA 4WW0A 1JKJB 2CW5A 2X40A 4WH0A 4IIGA 1PX0A 1XNQB 1JHYA 2C96A 4E5KA 1J33A 5JH7F 4IJVA 1BQEA 3KFLA 3TB6A 2RE8A 1Z4QA 1DXHA 1DX9A 2H2FA 3RUHA 2IZ6A 2JKZA 1RDFA 4OKIA 5DN6A 1XKTA 3BAFA 3UCFA 1IZZA 2WMYA 3OOYA 4WUTA 4F84A 1K66A 3D59A 7REQB 1WNTA 4TV9B 1F06A 2J5KA 4A8JA 3AVXA 5BW8A 5L3QB 4NKRA 3ONEA 1L1EA 2EJWA 2OO7A 4ND2A 4MUMA 4RTQA 5K6AC 2I80A 4DDTA 1TM4E 2WM3A 1ECFA 2Z57A 2PUBA 4JYMA 3KZCA 3DWGA 4AROA 4NAUA 2P6OA 4ZICA 2C29D 5HJ2A 2CNDA 4UOZA 1I30A 5I8ZA 1M2VA 3L41A 2AQIA 5CG2A 4EY3A 2QPOA 1TJNA 4ED9A 1LI5A 4BTLA 1N0VC 1I5EA 4RLFA 1IUKA 1FLDA 4O4JB 1GXSB 2W2TA 5AI8A 3G6KA 2VHCA 4BN0A 2AF3C 1NLUA 1NJ5A 1TO6A 1OFVA 2LW7A 2R1UA 2ZITA 4CYMA 1QHEA 3P9CA 4E11A 2LV8A 3MS2A 2JHPA 3SMVA 4OBXA 4BLQA 1N6RA 5IEJA 1G7RA 5H80A 2A58A 2EKLA 2WSMA 1CE8A 3DMYA 1EUCA 2QN8A 3EVFA 5HJEA 3BA6A 3R5KA 1QC5B 1PFGA 1KK3A 3TR0A 1DDIA 1QZZA 3LWZA 4PYQA 1SXQA 1YDWA 2R8XA 3KOYA 4JI7B 2F3UA 4HN4B 1XCJA 3LFUA 1IHPA 2GPSA 4BE9A 5BMVB 4DADA 4LSMA 5EQDA 2Y66A 2GWHA 4PHHA 2YX1A 4ZMBA 4C0AC 5KC8A 2Z6VA 4E6EA 4PW0A 1N8TA 3DE4X 3BBPA 4CKCA 1ZH4A 2BGKA 1IUNA 5HF6A 3FRJA 4A8HA 1OTHA 5J1TB 3S68A 3M1IA 4RLHA 4ZI7F 4DSAA 4ND4A 5BVGB 4XUDA 3S0JA 5F3DA 5EVCA 4I1OA 4DA9A 2H54A 3EZFA 1FQJA 1K5DA 4IYJA 3V4SA 4RL6A 1FF9A 1T8SA 3K9CA 3NALA 2ANCA 1JR3E 4LF9B 2D4HA 4KMMA 5LQJA 1RCUA 1USGA 4AICA 1GZHB 2FFRA 1XU7A 4Q66C 5TR9A 2G09A 5AW7A 3EVBA 3FF4A 3LLSA 4W9RA 2B7CA 4RHXA 1XKXA 3WAGA 5GOTA 5B7GA 1AN9A 4UVHA 2MSEB 2P6NA 3WNDA 4QOJA 1BHJA 2P5UA 4EM6A 5IXSA 4M22A 1U2DA 4EX7A 5I7UA 3HU3A 3ICVA 3IP3A 5AD1A 3OICA 4CKBA 1Z16A 3DMGA 4L0CA 1YFKA 4HLDA 5DNEA 5HF5A 5F7XA 2XEXA 4BU1A 1IY9A 1LZLA 3SYMA 5F76A 4UC0A 1I2ZA 4HDAA 2JL1A 3KWLA 4KTVE 1LBSA 4O02B 3DMRA 4LXIA 4D9MA 2EFEB 2HBZA 3DV0A 3H9JA 2VDQB 3NOVA 4Y30A 4EBFA 3ASYA 1TO1E 2HF8A 4OQ4A 2FW6A 5HMMA 1RYHA 1YR7A 3MZ0A 3LQRA 4KHPB 2I3GA 4UTNA 2QVZX 3ESDA 4FYXA 3MUOA 3TLKA 4H4EA 1E18A 1T0PA 3W5VA 2DR2A 1X92A 4IJWA 1NKVA 1DMSA 1U11A 4AO7A 1E6LA 1KTVA 4R71A 4ACAA 2C9OA 4W1PA 1GVNB 3LWBA 2VDMB 4XDGA 1F9AA 1ZRSA 5GINE 4C4RA 3JPWA 2F67A 2F9FA 4RF3A 4D99A 4MVCA 4DA8A 1FNBA 1S2IA 2P9BA 4XOUA 1SVKA 4WTOA 5CDUA 2YRFA 4ZDIA 3PC8C 2GEKA 3CLTD 4DCCA 3CGWA 2FMXA 1E7WA 1W87A 3AV0B 3P0FA 4AJJA 4EVSA 3CT6A 1WBBA 1C41A 2B9EA 2QP3A 4O2AF 4DV7B 1JAYA 3O84A 3H9EO 3CN9A 4IVNA 2BEUA 3H87A 3ORQA 4P5PA 4V24A 3EY4A 4JXZA 1CUYA 1QP0A 4MNTA 1TQHA 2ZAYA 2WJJA 5ED4A 3ELYA 2FG6C 5KI6A 2VAMA 2VRCA 4LF5B 3CG0A 4HPJB 3T7CA 2QRNA 4ZI2A 4ZHQA 5DT2A 1LSOA 1MFPA 2GCEA 2H5JA 2H3EA 2HCJB 3E3OA 3MRVA 4NE7A 4K9MA 1YBFA 3GJRA 5JCJA 3SJUA 3BRSA 3FGPA 3KLBA 1MAVA 2C8KA 1P4SA 3VYTB 4IM7A 3DT8A 1JB1A 4IQFA 4QYIA 4N48A 4Y0AA 2ZWPA 4R3WA 2YW2A 5DWVA 1FP6A 1VE7A 2AFIA 3RLFA 4BEWA 1CHDA 1G7TA 2QD5A 2QN9A 4GPZA 4MW2A 3ILVA 4B3BA 2WMNB 3SJAA 3G2QA 2VNIA 4KQEA 6ADHA 3GT0A 5LP6A 4NV1A 2HO5A 3I32A 3M89A 4IHJA 2V8OA 4A7PA 3NBQA 5IAAA 3IR7A 1QHXA 1BC5A 4EJ2A 4IIXA 2OMEA 1GZUA 2YMLA 5KINB 2QR5A 2WLSA 2ZUUA 2AG1A 2B1RA 1E0JA 2B61A 3BMCA 1ZGJA 3KD3A 4P4SB 3QVVA 1YE5A 1IZYA 2DFVA 2KE5A 1X1AA 1K1EA 1SU8A 2VSNA 3CRRA 1GN8A 4HUJA 3WDLA 4D46A 1XPRA 1ENOA 4ZVOA 2EZTA 1E8NA 2X42A 2PT7A 3DT9A 1UJMA 3G2HA 4B8ZA 2PX3A 4QSHA 2GYUA 5BVHA 1XNHA 1GGKA 4M9QA 1WXFA 1J09A 1P9WA 4HLUA 5JD6A 1CJTC 1XZMA 4IJKA 1ZUHA 4A03A 5JCOC 1N1DA 2OG2A 2XCTB 4LFAB 1XYVA 1X8KA 4R69A 2J9YB 2HRBA 4N5IX 4ZIRA 1P2VA 5K3FB 3M70A 5KSWB 4OIMA 3SZ3A 5ALGA 2GETA 1OBVA 1QYIA 4F3TA 5LZ5A 1E2BA 1RIFA 1VLHA 1Y63A 4KIJA 1HKHA 4LZAA 1P91A 1QTIA 2FK7A 2X3UA 3R2JA 4RHEA 3IQEA 1N75A 3U4AA 4K86A 1RM4A 3ZQ6A 4EENA 3SX2A 2BLLA 2WWGA 3KHUA 4IMRA 4AVYA 5I9IA 3TNFA 5BNIA 3B6EA 2BFAA 5F2OA 5KB3A 1CULC 1L4HA 4DMKA 2ZRFA 3Q85A 1C4XA 1L7AA 1NUAA 1X7WB 3MERA 5GIOE 1AUQA 1IHYA 3R0XA 1DPFA 2C0CA 1LC0A 4HYTA 4A15A 2MDTA 2XH8A 1TU0A 5KOIA 1QBGA 1T1JA 2OHGA 3JXEA 4Q93A 4UHCA 3U4GA 2XUDA 3I6MA 1IZ9A 4I3HA 3V4ZA 2Q5JA 1U8UA 4UHFA 5TPZA 4EB6B 3ZY6A 1DJNA 3VFDA 1GGMA 2OO5C 1S2DA 4RUKA 4E5YA 1JXQA 2Z56A 3CZPA 3VTKA 4LQ4A 3RHFA 3SD7A 2WWYA 1MW8X 3QVSA 2REBA 4WN9B 3ZW8A 1MX9A 2MMGA 1C1DA 4W8HA 4Q12A 4YV7A 2AR7A 1KHTA 1ES9A 1MPXA 4MGHA 3AP2A 1MOPA 3ANNA 2Y67A 5A3JA 4V1CB 2W48A 2BMEA 3RUAA 4B47A 5HJ5A 2WTAA 2IYTA 3VZDA 1Z38A 3AVVA 3A6KA 1G16A 1FDRA 4LFCB 5LXTF 3BDAA 2BBWA 1CJCA 5DT9A 1AIPA 1LS6A 1KOJA 1GJRA 2Q28A 1LK7A 3QVGA 2N3ZA 1IVYA 4EHKA 3OTWA 4MPTA 1NC1A 1XVUA 2XYQA 5ES3A 1U8CB 3QFCA 5L7TA 2GCPA 1DX4A 4LTNA 1BS9A 1ORWA 3N3BC 3PCTA 4XM2A 2NO9A 2AR0A 3P9QA 1BU5A 1N2GA 3K8ZA 3PUKA 2VIIA 4GLOA 1GLNA 4YRMA 1JHOA 1YR8A 2AJBA 1MMFB 3Q3VA 2GBGA 1CEQA 4LN1A 1ZDMA 5IAJA 4PYRA 5ERYA 4CDNA 4DIOA 1W0KA 4UM7A 5JTUA 2VYQA 3HDHA 1WKBA 5CT8A 1B23P 3QWHA 2OM2A 2XGJA 4F11A 2A5FA 1NG1A 3E7XA 4FDVA 3VPSA 2JJ1D 2WD7A 3D4IA 4CMIA 2ZUBA 3QUAA 4LHZA 5IYZB 4JC5A 3NP9A 1EUDA 1CVLA 1JBKA 1VKOA 4NOMA 4W5WA 4X71A 4MCJA 3QPBA 5ILQA 2NU8B 3TQSA 3WICA 4YQFA 5HJ7A 2J9GA 3EPLA 3TZBA 1JDNA 1RBZA 4FZVA 2OD9A 2ORYA 4MCAA 4RW0A 2YXPX 3GBVA 3L02A 3W04A 2KSQA 1WB4A 2ZYAA 1SN7A 3AUTA 2ZB3A 3HEMA 2BM8A 3W5CA 4P35A 3DAGA 3E9CA 1NVUQ 3NYQA 4RZHA 4L5CA 4BLPA 3N05A 4OHVA 1TU4A 2IGTA 3AFGA 4GGPA 4GMDA 5AHKA 2ZI5A 5GVRA 4YRJA 3J81k 3P9SA 3G9UA 1IDN1 3KV1A 1G55A 2V1UA 1PJZA 2ZUWA 1GNSA 2DBVO 5JBIA 3OT1A 4MQEB 5DLEA 3VSAA 3L77A 1XLTA 2BKXA 1GA1A 5JQWA 3H1AA 3MQ4A 3R0JA 3U7RA 2OR3A 5E4YA 2FN8A 3BA1A 1JEJA 4NK4A 5CPFA 4F8YA 4I4TB 3WDKA 1DIHA 2G1JA 4AC9A 1RAFA 1MTZA 1RQ2A 1RC8A 1E64A 2RGXA 3CH5A 4QAJA 3THXA 2VTBA 3IQIX 2I2CA 2XGOA 5F21A 4BVKA 2IOHA 2NVOA 2GEJA 3G2MA 1HQDA 2WWRA 2WKQA 3OJCA 3QLJA 1HZJA 1MO4A 3CLTC 4HZUB 4RCZA 3U2QA 3ZNOA 1UC5B 3CJRA 4TPKA 1UAYA 3FKSD 3LPDA 5EKDA 4JV5B 3ACDA 2IL1A 3K0EA 2JI4A 4CF4A 4HJRA 5EERA 4O63O 4WASA 2IEDA 1N7IA 5JC1A 3SR3A 4UNIA 2WKWA 3CJTA 3T0FA 4D8TA 2QI9C 2ZJOA 4MDFA 2PZLA 2O8CB 3ACBA 3C5EA 4HX9A 3T9BA 5LSAA 4ZJUA 1M8GA 4PO3X 1A9SA 3MMXA 3PE3A 4MAMA 5H3LA 3DZBA 1J23A 3I12A 4D9JA 1CY8A 1DAIA 3QWFA 5EY5B 4DQXA 1JSXA 1RACA 4M36A 4P3KA 4MTCA 2PQ6A 4KDEA 4R1MA 3HP7A 2WYUA 4EZBA 3GDOA 5JEDA 3C3JA 4KQ9A 4D57A 4CDMA 2QTFA 5DK6A 2GERA 2YMMA 4OA8A 2DT5A 5A06A 4RZ3A 3NW9A 3PQ2A 3Q7SA 5A5FA 1EVYA 2CMFA 3O94A 5ITZA 4R5MA 3L1KA 4TXNA 1CD5A 1KP9A 1OHHA 4FTWA 4LKOA 4NDZA 3ZJUA 3U0VA 4XVHA 4L6AA 1MB2A 3RQIA 4G5RA 5CCXA 4AKIA 1KI6B 3I9NA 3FD8A 1HLPA 3HO8A 3QKTA 5EHXA 1J5EB 3TQIA 1Q3HA 4L9AA 2JIOA 5K09A 2HEIA 1Q20A 5B6JA 2QOEA 4RA6B 2YWEA 4PBSA 1G19A 5E9JA 2P2LA 5E4FA 4MWDA 4KR0A 1AHNA 4A0HA 4GHWA 4HQKA 2W93A 3DP9A 5KVQA 3A6GA 4JEUA 3LF1A 1L7OA 4GVPA 1T5HX 4PC3A 1NA5A 1UCFA 5JRJA 1M34A 3H16A 2XODA 5AM0A 3NBXX 3FOAA 3LX8A 4XQEA 4NICA 5G3YA 4H1VA 4BLUA 3C48A 5LQDA 1KIMA 4ZO9A 3UV3A 2HSZA 2Z2YA 2BEWA 2QN7A 1P0CA 2BC9A 3NUZA 4INZA 4WT7A 1KRWA 2H4ZA 3JYHA 2OZLA 3NIWA 4RPIA 5G0TA 3SZRA 5LD2C 1WMFA 4KWHA 1U7UA 1BD4A 2WUDA 4UE2A 1U2GA 3NDJA 1IPEA 2FEPA 3EIXA 1DE0A 2C58A 4BN4A 3TGPA 4LF6B 3NYWA 1J99A 4FYJA 4NU8X 4NS4A 3E61A 2OPHA 4B33A 3EUEA 2XCSB 1AHPA 1DKQA 4QGSA 1M5UA 5BNZA 1IY1A 2WIKA 4ZT4A 4RD2A 2QP4A 1CDEA 1RAIA 1RKQA 1Y33E 2G1UA 3NAGA 4L5JA 4R8KA 2YFYA 3LWNA 5FEUA 4L78A 2G0AA 3FNFA 2ZEJA 1RQ7A 3HV2A 4ZVVA 1R4MA 1ZWKA 2Q3JA 3GFGA 4NF2A 3ESBA 4QREA 4P3YA 5ICMA 5EWMB 2VCYA 1PKEA 4F92B 4YO7A 3H9QA 2VYND 4X60A 3ZDZB 1X1BA 2C5SA 4U6QA 3A2KA 2OSBA 1OAKA 2PZJA 1T2AA 1EP1B 1P2DA 2WFLB 3CF4A 3MYYA 2ZG6A 3NBYC 4OMFG 2H00A 5EI5A 4MGEA 3KUDA 4RZ2A 3TSAA 3KTDA 5JSZB 3GMDA 3ZK9A 1G8SA 3MJRA 1QQ5A 1U8AA 2OCGA 5BQ5A 2P6UA 1E3IA 3AT1A 3KQWA 4TMVA 2NLOA 2YCBA 5DGHA 1E20A 3DO5A 3PQFA 4TN5A 3WHLA 3E2MA 3STHA 4AS3A 1WO8A 4HMQA 4P83A 4JLJA 3AETA 2F43A 4BP1A 3OZFA 3V46A 3NTOA 1RSZA 2R79A 4F4UA 1P4JA 3AF4A 3ZU5A 4W5HA 3AESA 4N3AA 1TM1E 2X8BA 3IPYA 5H02A 4DRXA 2FPPA 1PRYA 1XV5A 1M2EA 2QAIA 3HK2A 1YFJA 2HLHA 2O2GA 1C0PA 1H2HA 3IIIA 2JRLA 3I0MA 2X7JA 4EUKA 2FGKA 4Z4QA 2O2IA 2VXCA 5IC5A 3EZ9A 1WXWA 5JANA 1MDBA 2FFHA 4KQIA 4L8LA 5FBWB 2QW1A 4J0HA 3VO8A 5C7YA 2QZPA 4I1YA 4HVTA 5KNBD 3MOIA 4DNFA 2CNNA 5KMGA 2P9HA 3K9GA 4I5DA 1LPBB 2NM0A 1KZ9A 1ZMBA 1CJUC 3LUJA 2AWNA 3CXUA 4OQNA 3GHHA 1YAHA 3BL5A 2PVCA 3FYTA 1BAPA 4JCOA 4KBYA 1PR6A 3EQ6A 2D5IA 4R8LA 5K0EA 3D3KA 5KNDA 3PUHA 1RZRD 2EW1A 2ZZMA 1L7NA 3B5EA 3MQFA 4HLNA 3VU8A 4IIUA 1YU6A 2CVZA 4RZXA 3ZNPA 5BYBA 4MP8A 5AW3A 3QKSA 1H2RS 5HM6A 3FHOA 2DQYA 2I2AA 4Q48A 1CX9B 3VJKA 4DCGA 1EA5A 4ODIA 3SHOA 1Z75A 4DDKA 4JJ6A 2J0VA 4ZZ3A 4P8RA 1AA6A 2OLJA 2IHYA 2AI3A 4TOIA 2LIVA 3K2QA 4AXBA 5AIAA 4DWVA 3VPFA 1KC3A 3WK5A 4RESA 1XKLA 1ZUNA 3NHYA 2D2EA 1GCIA 3CH7A 3Q6IA 4JP5A 4WJZA 4X41A 4WXPA 4TV8F 4EPVA 3FNHA 2A94A 3MWYW 3SF8A 2PT5A 3IEUA 3VVBA 4EVIA 1XTUA 3H7IA 3NUQA 3KEQA 1CCWA 5ER6A 4H15A 4KOEC 4CIBA 4YAGA 1UOPA 1WDLA 2PPVA 3SZLA 1JFLA 2G5PA 1GPMA 1OYOA 3E9QA 1UOOA 2YS7A 2GFQA 1RJWA 3FZYA 1OZGA 3JQPA 2QK4A 3TW8A 1XPJA 1SH7A 2F17A 5E9QA 5I3ZA 3WISA 3KELA 4LHXA 4Q4DA 3AO0B 4UHEA 4YAUA 1L7DA 2PK3A 1GRCA 1UBUS 3RROA 3I09A 3FSJX 2ZIZA 3D3WB 1OY1A 5A4FS 1IUPA 4PAWA 2ZE5A 4EG4A 1JJBA 1ZCJA 3UJPA 1Y5MA 4MPPA 3IT3A 4AN1A 1Y5IA 2NPOA 4QU9A 1JNYA 5DHRA 3G0IA 4KRFA 1JR3A 3DMDA 2QR3A 2Q27A 2ZSUA 1YFZA 3CRNA 4JWKA 4KIGA 1DS6A 4PPQA 3H6GA 1UK8A 2DCMA 4Q1DA 2Z5GA 3RFVA 1ZHFA 3CT4A 1MN6A 4HAVA 3L0IB 4UMVA 2FMKA 2B1JA 2C4HA 3QJYA 4C4OA 2V0CA 2XIJA 3PJEA 4I7EA 1AKUA 3FCXA 1GP2A 1Q0UA 3QMPA 1M0SA 4MKIA 2DGDA 3RS2A 3DXXA 4PZUA 3I62A 4OMCA 2PLNA 2XZTA 4Y7DA 2H1SA 4CJXA 3B51X 4ESVA 2AKAB 3FNGA 3GGCA 3OBIA 4LOIA 3WK8A 3JQGA 4C7OB 1OZ0A 3QF4B 2Z95A 4DTCA 4S2EA 1P5RA 4EHAA 1JG1A 4CCWA 1UR5A 1NC3A 3RC8A 4LYGA 3QVXA 2G1KA 1JJ7A 2ABWA 2QM0A 4MPJA 3V55A 3JQDA 4I55F 4HB3A 4L08A 1Y8RA 5LQRA 1KI7A 2UUBB 4FNGA 4HZGA 4MUIA 5TLSA 1QWSA 1PFKA 2F2TA 2L82A 5CDYA 3UC9A 3NCHA 1ZOPA 3OWHA 3GLHB 1GEGA 2A92A 2QGFA 1T43A 1JIJA 2GZRA 4XRGA 5J2TB 2JFUA 3FCYA 4DJAA 3G13A 1AE1A 1N57A 1B0ZA 1QYWA 4TSRA 4P82A 1G18A 1GZ7A 4WZBE 3WMEA 3TPCA 4FS3A 5TIIA 3SQXA 1QH8B 3IMEA 4LHVA 5BOVA 3PP8A 2HY7A 3DTVD 3S28A 1NYRA 2LCIA 3IP6A 2Q0SA 4IDBA 4OHRA 4PHFA 2BD0A 3N2EA 4OBWA 3RDPA 2QA5A 2DHQA 3W3AD 5HRUA 4F4HA 5F1OA 3B5JA 1MB4A 3PUYA 2P30A 3PC8A 4FQ8A 1PQUA 1CQPA 1JEOA 1JKXA 1Z29A 1Z2EA 3GDFA 3O4JA 2QTVA 3ZX4A 1L5YA 3IAFA 1XN4A 4F60A 6CHYA 2HYIC 3V7FA 2PWZA 1PZNA 3QUSA 1FQWA 1YRBA 4PGAA 2GWRA 4E30A 1E7SA 5HBGA 3C6QA 2Q2QA 3WADA 1LBHA 1WOMA 1UJ2A 2D3WA 2JGNA 1V1RA 2H85A 4F46A 3LUGA 2GD2A 1M8PA 1ZR4A 4JL5A 3B13B 2C3PA 5NULA 2R1VA 2I4TA 1ZGGA 2XYVA 4HTAA 1G21E 1I1QB 5DM4A 4FFBA 4JKIA 5AOVA 5HGXA 3L8YA 5BMOA 5FYDA 3NHZA 5TB5A 3PD1A 4REMA 1E3TA 1P7YA 3E05A 3B9BA 3ZU3A 3DW1X 4MV0A 3U40A 4ALKA 3KSMA 3SF0A 2R751 2BGIA 2C5AA 2VNJA 1G42A 5BW6B 3UJHA 4AL4A 3QVUA 4MVJP 2DUNA 4UUPA 1NLYA 2W2PA 1NIJA 2GI4A 3L8DA 4UAJA 2AN4A 1G291 4C3ZA 1HR0B 3C4JA 2QF7A 2Q3BA 1FFDA 5LP1A 2AV6A 2GVZC 2RH8A 4MIYA 5JNSA 3DDCA 3FMIA 1HT0A 2QYOA 1FJGB 4MRMB 3IUQA 1HY3A 2YXDA 5DK4A 5B3JA 3VM6A 4IOKA 3L0OA 2JH3A 1SZPA 3SZOA 4RHFA 4EZIA 1IN6A 3I6ZA 3KE8A 3M33A 2ADMA 2GGSA 1G3QA 3L1HA 1D3AA 1QRRA 4ROTA 1UXOA 4ZV9A 5T7BA 1LD3A 2R84A 2FPRA 4PVCA 1F51E 1N3BA 4UXHA 4XB6B 2ILVA 3N3AC 3U3XA 5ALYA 4DWOA 1C30A 3EXHC 1JQ5A 1CY0A 2CXNA 3ER8A 3AKEA 3HWWA 4EFDA 2FUCA 2JGMA 4MV1A 2AA3A 2PUFA 2Q7XA 2IH4A 3W9BA 1RBQA 1NBWB 5B3AA 2Q3MA 1IAQA 4F06A 3BFJA 5H5JA 5KWSA 3KJXA 1ZINA 4ARZA 5KYWA 2QP9X 3COZA 3DZKA 1TVKA 2BP7A 4MRVA 2G4LA 3T3GA 1P0QA 1UDCA 3H1FA 4PAMA 4PPNA 2ATIA 5EIHA 1LJUA 4TTQA 3L18A 4WACA 3QG5A 4E31A 4Y9SA 2GMWA 3A1TA 2C7VA 2VK1A 4C5AA 4W7HA 4C78A 3S29A 5TQ0B 4BRZA 3W7BA 5TT0A 2C84A 1V11B 4W5TA 2QJOA 1OOEA 3RAFC 1BE1A 3W2IA 2BBTA 1S2MA 4LRYA 4WWHA 3RS7A 3GJ4A 4MHTA 5A5GA 1SOAA 3HXTA 5CVUA 2J4FA 1GQ2A 1I3LA 5AVSA 1CR6A 2J3JA 2CDCA 4UUBA 1TJYA 4KE7A 1KMHB 2GRJA 1VI5A 3JASB 3LPMA 5FBQB 4URYR 1SD2A 2MYPA 4NBVA 3ZBPA 3QU4A 1NXWA 4NAVA 3FUUA 1D5WA 1H42A 3GRUA 2XUFA 1A4IA 1FNCA 3OM1A 1W5BA 5ALMA 2GPJA 1Q1EA 4XX0A 1QPBA 5CK5A 4UHJA 4GSLA 4WNAA 1YSCA 1NVAA 4ZC8A 1WU7A 2PQ2A 3WSTA 1P4RA 2PKYX 2XYRA 5KYUA 4KO4S 1HM5A 4B3FX 1E5DA 3REFA 4BMXA 3TTVA 1CNEA 4A0FA 3HC7A 4I1RA 5KJEA 1D2RA 1E7MA 2PQMA 3OPYI 1RI2A 4PR3A 2WSBA 2QTZA 4IIYA 4V2UA 1Z0SA 1UM9A 1JL3A 2HUNA 5K0CA 1NSYA 1ZD4A 3KJIA 4S1NA 3OTIA 2ZVQX 2PTGA 3IVGA 3VTFA 5D86A 1UMKA 3VA7A 1TCUA 2DSTA 2GT1A 1JIIA 2VDNB 2YZGA 4JGBA 1LQUA 3GGGA 4NESA 1DJPA 3W2TA 4LZZA 2NXNA 4J2HA 1KQOA 2CF6A 2ZI3A 1Y1RA 1YS9A 3JARB 4UAUA 1FJXA 4Y2XA 1U0TA 1NRJB 2O8FA 3RBAA 4JP8A 1N9ZA 1MGOA 1U7DA 2V7GA 3BMNA 5L51A 1HT1E 1LW7A 3OI7A 4RGBA 1XZIA 4EKNB 4CNBA 5JUWA 2WPDD 4HDNB 3HCAA 2B94A 5DNUA 3QGMA 1UK6A 1LBIA 1CUZA 1U2TA 1F38A 1PWHA 1UBHS 1YR1A 3AGPA 1CY2A 4KXFB 1P29A 4R7GA 2DQZA 3L7MA 3UHFA 3V3TA 1CNFA 2QXUA 4ZRMA 3CPEA 1V6CA 1MC4A 5JLAA 1NVGA 5C34B 1Z6PA 3HU5A 2WBLC 4AMUA 3RYCA 4LYEA 5DXFA 2WYIA 1BXRA 4W82A 1GZSA 4RNCA 4ANFA 2ANBA 5LLTA 1V43A 4I50B 2ZGVA 4AS2A 3ESXA 5EWLA 5AM3A 1IBMB 1O1YA 5EUQB 3TSCA 4CT4B 3BTVA 2X0DA 3WL3A 2HA3A 5A6VA 4BV2A 5T6MA 5A9RA 3AF2A 5HPYB 5IK2D 1XAJA 2G9RA 3EDCA 4E5MA 1Z0UA 1QH1A 2E4AA 3QHAA 4IXTA 4MQBA 4B09A 4ZJYA 1SKYB 1AY0A 4RV5A 4D26A 3P8ZA 4N0EA 1PDOA 2I7XA 4BCDA 4DVJA 4HEQA 3S2SA 3HBMA 5L7WA 3HUFA 4PF1A 8OHMA 5C5EA 4PRKA 5LB4A 3ZU2A 2IHTA 4YJ2F 3PTAA 5FPQA 5FCDA 4OJQA 1IQPA 1JHUA 3PGMA 5TMEA 1M76A 2OHJA 1Z6ZA 3N74A 3F8SA 1RXYA 3D4BA 3L9XA 4G65A 4JYBA 4QUIA 3ZY5A 2ZYDA 2I1QA 1W85A 1PDVA 2JGLA 1PD0A 1DLJA 3BGDA 2IDKA 3HB0A 4XVQA 3SIXA 5M2QA 5LLSA 4G8BA 3O03A 4Q4HB 3LXMA 3CFYA 3WVNA 2CL0X 3IUSA 3QK7A 2PH1A 3UH0A 2I7VA 3AL2A 3IPLA 3MILA 4P9NA 1A97A 1G17A 3PL1A 4TZTA 1VHLA 1NQAO 4DDHA 5FX2A 5ILOA 2Q9BA 1IU9A 10MHA 3PEUA 4R2XA 4EF5A 1LLUA 4I14A 4XYMA 3F0TA 5CXXA 3QE4A 4BQPA 1N2EA 2C7BA 1Z4IA 4BMDA 4B9EA 1AKTA 3E53A 3V8PA 1TYDE 3ROPA 4QGFA 1EFTA 4BJ3A 1QLHA 2VT6A 3GEMA 1BMQA 4DWJA 1DG1G 1R00A 2JLQA 5IAGA 2GYYA 3SGLA 5A3VA 6LDHA 4GOLD 2PRSA 1EFVB 1YNOA 2QLNA 3AEUB 5LDGA 2IUYA 5TE9A 4DDUA 5D87A 2QPAA 2JPDA 2Y1WA 3UJCA 5A4IS 4JVNA 4YRGA 5JASA 2XA2A 3AI7A 3UAZA 1KK2A 3EQ8A 3OIGA 2PSSA 4LJSA 4QDOA 4UNQA 4V0SA 1W46A 5HIAA 5HP4A 2LWIA 3L8MA 3U26A 4MUNA 1DXOA 1HQYE 1Q1NA 1D1PA 1STOA 3AWDA 3Q7IA 4KW7A 4P3OA 4B4WA 1PT6A 4BUCA 2F3PA 3IDOA 2DJ5A 4I5GA 1C9KA 1Z4KA 5ALWA 1ZI9A 1E1CB 4KPUB 3KKNA 3KPJA 4ND8A 4YS6A 3TQOA 5BNFA 4BZPA 2HQ1A 2WD8A 5ED0A 2WG2A 3EF3A 3ORHA 4O8CA 4KWEA 4CTMA 2NUPA 1PGJA 3GVHA 4KR7A 3HMKA 1FNSA 3IKTA 4NSNA 3VU9B 4EZEA 1P33A 1ZLXA 5EJFA 4OXQA 2C5FA 1AA9A 1SA0A 1VCIA 1FUIA 2IW1A 2WM8A 4NCIA