3L43A

Crystal structure of the dynamin 3 gtpase domain bound with gdp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
242
Chain Sequence
QIAVVGGQSAGKSSVLENFVGRDFLPRVTRRPLVLQLITSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynamin-3
publication title Crystal structure of the dynamin 3 GTPase domain bound with GDP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 242
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l43A00
1EG7A 2CLDX 5LD2B 1XWIA 1WDTA 4LHVA 2FH5B 4M1MA 1FQKA 4QBGB 3REGA 3CRQA 3EAQA 4EPWA 1XZPA 4JLPA 3LX8A 1G6HA 3LH5A 4PQRA 4Q66C 1GL9B 5FUYA 3CH4B 4M1WA 4JYCA 2IWRA 1PJRA 3I5XA 1FZQA 3WXMA 1V43A 3WNCA 1GRRA 1KDPA 1WP9A 4HZUB 3AKDA 4M9XA 3ASYA 5JI3E 1R0ZA 2J59A 1ZJ6A 3NWJA 1W0JA 1OSNA 2J0QA 1II8B 2AL7A 2NGRA 2OAQ1 3BK7A 4BFSA 4JVSB 1JEDA 1M6NA 4PSAA 1ZM4A 4AYWA 3OEHD 2D06A 4NONA 4BLPA 1N5LA 1EESA 4R7ZA 2PJZA 4RD6A 1BH2A 2WKRA 4NCJA 3LBHA 4AK9A 3QEJA 4H9GA 4URWR 3CR7A 5JJKA 1VG0B 4B43A 4DSOA 4QBIA 3QNUA 2PZEA 1AGPA 3FB4A 2ZI3A 2P2LA 3UMRA 2X8AA 2IX3A 1VYVA 4G01B 2JJ8A 1Z8FA 1II8A 4U02A 2LKDA 4OL0A 3L0IB 1DAFA 5E4FA 3K09C 1NN1A 2J7PA 1XD8A 3BFXA 2OV2A 1GNRA 4FI3C 1JAIA 5KSYA 3IHWA 1N6HA 4IXNA 3DVLA 2OXRA 3FHCB 3I73A 3D3QA 4JL5A 4HUQB 3SYKA 3EPLA 1NLZA 3DHWC 2X19A 4NP6A 5P21A 4R71A 3CPEA 4UXIA 1CRQA 3MAAC 1W47A 1P72A 1ETUA 1TEVA 4LZZA 4Q19A 5CITA 3U7FB 4QNRA 5CDFE 1KK1A 3C5HA 3DMNA 4YMVA 2F55A 5GJBA 2REBA 1KAOA 4HLUC 2XSZD 4A0FA 1S3SA 5JSZA 1D5CA 3TUZC 3AM1A 1NY6A 1CR4A 2QY9A 4F4IA 3BERA 1DG3A 1EFCA 2WJJA 3PCRB 1JPNA 1G20E 1G9XA 4F93B 2ZYWX 1G291 2P6UA 2QT1A 3N2EA 4HUQA 2ZAMA 1OW3B 2RGNC 3QF4A 4MA4A 1LTQA 1U9IC 3B1XA 3VR4A 1UDXA 3BRWD 3QXCA 2IT1A 1FP6A 1RKBA 3CRVA 2IS4A 4KJZA 1S1CA 3EIQA 1XD9A 4I1VA 2A5JA 1B0UA 1XXHE 2XB4A 1SXJA 3JZMA 1O87A 2WSSA 4KODA 2ZXUA 1FTNA 4B2LA 3OAAD 2J46A 2C9CA 2NO0A 3Q3JB 3MSXA 1JJVA 4HSEA 2QMUA 4C9BA 5KNCA 3IPYA 1SVMA 4P4SB 1TUEA 3NBYC 3TBKA 1J70A 4EIWA 3B60A 3SS8A 1DELA 5FFMA 2IK8A 4LK2A 1Q57A 2JLXA 5KUTA 3ADBA 1ZUNB 4H1UA 2J87A 2WAYA 4L16A 4NYMR 3KXKA 1ZCAA 4MKIA 2O8EA 2R62A 2MMCA 2OBNA 1Q44A 1UBCA 3VQTA 3TUIC 3K70B 2ZSDA 3PFIA 2GETA 4MDEA 3ICEA 1KI4A 2QTFA 3C7KA 4IFEA 4B3BA 1E9EA 4W5JA 1FX0B 2O0KA 3SZRA 1YZLA 1P9NA 4D80A 4EPVA 2QMEA 1G19A 4K81B 1XU4A 4ERNA 3W5JA 4GL2A 3VKHA 4WXPA 1T6NA 1IXSB 3FKSD 4Q9JA 3OIWA 4P4UA 1QHIA 2EYUA 5IK2A 1NN3A 4JZKA 4EFLA 2MMGA 4NCNA 2JAQA 3WNBA 1P2UA 1RJ9A 4DVGA 3U6KA 1ZC3A 2G77B 5D3MA 4M9SA 2ZJ5A 4TLEA 4MRRA 3VKWA 1TEXA 5J5CA 1VHTA 1UAAA 4BQSA 1FX0A 1Z47A 3PG5A 1N5JA 2FSGA 3ONWA 5FI0B 1KAGA 3RYTC 3U7GA 3RC8A 4PANA 1UPTA 2H92A 4OHYA 3B8HA 4MYUA 3RRMA 1E98A 4A9AA 1N0VC 4A1FA 1NVWQ 5KSZA 2V3CC 1YVDA 4IDOA 4PFSA 4A4DA 2ORVA 4F91B 4M1YA 2BMJA 1E99A 3A8TA 2V6IA 1M74A 3GQBA 5JZVA 1M8PA 4DCNA 1AIPA 1KO7A 2Z4RA 3R8FA 2IXGA 4C4PA 4TL8A 4JVLA 4QNMA 4RZ3A 4YLGA 3UMSA 1FMLA 1Z0DA 3U6BA 3B85A 2DFKB 1WXQA 2OCBA 2GJ9A 2V8OA 3VNVA 1RIFA 1E0JA 4QHTA 2DY1A 3TW8B 3SE0A 1XNJA 1OFUX 1SKYE 4ASUD 1AZSC 5EE0A 1OIWA 2CK3D 1TF5A 2QSYA 3T15A 4CZ2A 2XOKA 1DAHA 3QEOA 2IYYA 1P9RA 3VX3A 1OKKD 2VSXA 1LFDB 2QM8A 3UATA 3UKDA 5J4YA 4P32A 3GLIA 2QSZA 5LD2C 2NPIA 3QKSA 4LBWA 4CYMA 2C98A 1SGWA 2YZ2A 3R9XA 2GZAA 1HH4A 2UVQA 3U44A 2ZIAA 3IEUA 1IQPA 1XMIA 2ASEA 2DFNA 3FYHA 1AQUA 2F9MA 3HWSA 4IEEA 4TQAA 4OI4A 4C0LA 2BMFA 2O8BA 2VQSA 1Q3TA 3T5DA 4DC9A 2PX3A 4KCGA 1OLOA 4MGIR 4NHOA 3ZZUA 3QKRA 1R5NA 3GP8A 4WXRA 1AM4D 1E79D 1X8KA 3CWQA 3CLVA 3FMOB 2Q9CA 4DHEA 1GRQA 1I4DD 2WWFA 1AZTA 2CL7X 3PIRA 3NBFA 3AVPA 1E2GA 421PA 5FH9A 4JKYA 4FCVA 3U4QB 3RNLA 3SDZA 3LLMA 2GCPA 2VEDA 4OQFA 1KI7A 3Q7QA 3KQKA 4RZXA 2VSOA 1KO4A 3FHOA 1COWA 4MITA 2YJTD 4KI0A 1NF3A 2ZI4A 4OQMA 2R6FA 4AY2A 5EJEA 1N6IA 1D8TA 5KU1A 5JJIA 2W0SA 4NKRA 1OPXA 3ZQJA 1KI6B 4OK3A 4U7DA 1OH7A 1C9KA 1NNEA 4W5HA 3SEAA 4TSFD 3AP3A 4Q18A 2O8FB 1PZNA 1DO0A 2QG6A 3A4LA 4BRWA 1CTQA 1BYUA 1YR8A 3HYTA 5JRJA 4Z54A 3AF3A 1KK0A 4AKGA 3SI7A 1E96A 2QE7D 2NZ8A 1QHSA 4UNNA 4N1AA 4OBEA 5H68A 2GCOB 4M1KA 1DG1G 4HLDA 4NYMQ 3QBVA 2YOHA 4D4MA 4BECA 3LDAA 1NVXQ 2ONKA 3LVQE 2OEPA 1KI6A 1UF9A 2AX4A 3KQUA 2O8FA 4RCZA 4JVMA 3RSOA 3A37A 3K9HA 1G7CA 4PQYA 3TK1A 3SJAA 2GAAA 4RVCA 3BC1A 4A0GA 1XFAA 4URVR 5J4HA 3CRRA 2WWXA 1GDDA 1HT1E 3C41J 5HCIA 4EPYA 1FP7A 1Q20A 2YWHA 1T5LA 1NMYA 4KFSA 4BLTA 3ETLA 1S4QA 4IW3B 3GLGA 2J0UA 4MDFA 2ZRAA 2DBYA 2REOA 4QHYA 2ZI6A 4D0GA 2BWJA 1CP2A 3ZD6A 3AB3A 1I4TD 3GFTA 2Q3FA 3RS2A 2GZDA 3QKUA 4IXMA 4KO8A 4A15A 2PEZA 1OXTA 3AGQA 4LV5B 2IW3A 4LUCA 1SXJE 3AVVA 3DPUA 1O3YA 2DPXA 4LJ4A 3L0SA 5EQTA 5FR2A 1ZC4A 2V7QD 5BYKA 4GZLA 1GL6A 1FMJA 2B7BA 4D25A 1G5RA 2ZS8A 4A92A 4JVNA 2V6JA 2ZANA 3KX2A 1Z0JA 4Q9HA 4WZ6A 4E09A 5CYPA 1G8FA 4ZDWA 1U81A 4DRZA 1GNQA 2YWGA 1U8AA 1YZUA 3WYAA 5BYJA 1OXSC 4OQNA 3RANA 4ILEA 3AF0A 5TVKA 4BEBA 3K70C 1TU4A 1J2JA 1VG1A 2WJGA 3TSOA 2J5XA 4RZ2A 4UKDA 4JLDA 1E0KA 4PSKA 1X8JA 1IOZA 4P31A 3I62A 3EIEA 4OI0A 1OFHA 2QL6A 1WE2A 1XTQA 3F5FA 4GI7A 1X1RA 4X8HA 3KJGA 4HI0E 2WMNB 3FMIA 1VPLA 2GJKA 2OFWA 3GLFA 5F98A 1J8YF 1N5KA 4B3DA 3WP0A 3B1YA 2R2AA 2IS2A 1N0WA 3RAPR 2ZAOA 4ZO4A 4UXHA 2EFEB 3RC3A 2BJWA 4XH9B 5JWOA 2NO1A 2IC5A 3ZS8A 2F1HA 3DM9B 4V0NA 3LW7A 2ZJZA 1G21E 4DLWA 2JLYA 4EUNA 1ZYUA 1M1YE 4HAVA 3M0EA 3Q5EA 1FPMA 1N6PA 2JA1A 4B48A 4DLVA 1R0XA 1QZXA 1CBUA 1KI9A 1UKVY 1ZUHA 4D4JA 1CIPA 2GRJA 4BFYA 1IJFA 1A4RA 1P73A 4Q1AA 5EXTA 5FOWA 5F9FA 1WF3A 2OE2A 1E69A 1XEXB 5K8TA 1KNQA 4MKHA 2P0EA 3BB1A 4B6FA 1XPUA 3ZLJA 4P4TA 1TMKA 3OE7D 4XWKA 2PMDA 1CXZA 4JL8A 1OT3A 2PBRA 3L2OB 4Z8XA 4AG5A 1DO2A 1NSTA 2QAGB 1OH6A 2C5LA 1A7JA 1BKDR 2OSBA 1VKJA 3I32A 4L8GA 1HEIA 1QHNA 4XWAA 3HYRA 3C5CA 5KYKA 2CHGA 3KQNA 2XTZA 2K5UA 3P4YA 4Q47A 2O0HA 3A6PC 5JECA 2X77A 2BEJA 3EZFA 5EXSA 1PVOA 3CWZA 4PPFA 5HZHA 3C14C 4US1R 2H18A 4CRWB 4DLUA 1Z0KA 4ZDKA 2FJUA 3I4LA 2JLWA 5CDFA 4KFRA 1G17A 3TQCA 3EPJA 1X6VA 3K0CC 4GP6A 2XGJA 4LDJA 1OFTA 4BEJA 1RRCA 2QBYB 3BH7A 2IWHA 4DLTA 2CNWD 2ZRFA 1D9XA 4KFUA 3JZAA 1NVUQ 2FG5A 4TYWA 4DLSA 2WKQA 4XD7D 2BBOA 2A2ZA 2OG2A 4C0QC 2KI5A 1E2JA 1NLFA 2A7QA 4W7SA 1TQ6A 4N3NA 2QP9X 3ZIAA 5L3QA 2RB4A 4GNKA 3K09A 3VR3A 2VHQA 4DB2A 3DKVA 3L8ZA 3LQQA 1NI3A 2XZPA 5JEDA 4DUGD 3QJYA 4A0RA 1P7CA 1P9WA 3MJRA 1VIAA 1E2FA 1SKQA 3OIUA 2REXB 4LJYA 3CUEF 3KJEA 1DVRA 4LV8B 2JLQA 2DFTA 2NQ2C 3NC0C 4LHWA 5J40A 4ESVA 2VHUA 4MH0R 4PSVA 4Q21A 2AHOA 2JATA 2HLDA 1MR3F 1W0KA 2JJ1A 3U3MA 4WZAE 2CBZA 4HB0A 3S1AB 4URUR 2B6HA 4B6EA 3PUZA 4X8MA 1JNYA 1QHXA 2F3TA 1YZKA 2YVUA 2ZI9A 2ZJ2A 1QVAA 2G0TA 3LLUA 3GJ5A 4HLUA 4YONB 5L8VA 2BOVA 2QORA 5KOYA 4Q7MB 2IEYA 1ZCBA 5BN5A 3NHBA 2P65A 2WWWA 2O5VA 1EX7A 2AK3A 1RC8A 1EWQA 1A2BA 3OIVA 2QPAA 4GP7A 4TMZA 4B75A 1OH5A 4KVGA 4OI1A 4B73A 1H8EA 2LWIA 2RGNA 1UBGA 4A36A 5CLQA 4MUAA 2TMKA 1KI1A 5SZKB 3A1WA 5CJ2A 5JJLA 4S2EA 1WRBA 2CLSA 3CR8A 1YR9A 4WVFA 5FOXA 4Q4JB 2ZS9A 5DSZA 2FEOA 4S35A 4G5GA 5GJWC 4Q02A 1LF0A 2WWIA 3LXRA 4YMSA 1II9A 3ZVRA 4Q4LA 3Q5DA 5IF9A 1R4AA 4NE2A 5FUVA 1RW4A 5SZJA 2BJVA 5SZIA 1XZQA 3EZ7A 3BB3A 1T0JB 2WIAA 4QGFA 1Q3HA 2HJGA 3N2IA 4B3XA 2XXAA 3EA0A 4C7OB 5TDHA 4IKEA 4B3CA 2IYTA 3SBDA 4DCVA 1HURA 2BKUA 2ONJA 4ARZA 4Q7KA 3CX8A 2R6CA 5AJYA 5J4KA 2VIIA 1MOZA 4Q4JA 3L8YA 1IAQA 3CX7A 5TY0A 1R8QA 3ZVLA 5F9HA 3QVUA 5G40A 3LD9A 1IN8A 1LY1A 1CULC 1YZQA 1Z6TA 3HR8A 1US8B 4C0KA 4KITB 3IEVA 3PQCA 3GLGE 1VMAA 2AD5A 3QVVA 5FOUA 4TQ9A 4Z1MA 2OBMA 4YMWA 1CR1A 5G41A 3DZ8A 3OF5A 4WBSA 4LJ6A 1IHUA 5TXGA 4IHQA 1I4LD 3NKVA 1W5TA 2HV8A 3V4RA 1KI3A 3TE6A 2FZ4A 3MG9A 2J45A 3CF2A 3OIYA 4FMCF 5CK4A 1UJ2A 4R9UC 5JHHB 2VBCA 1A1VA 1IM2A 4OK5A 2IYRA 3AP1A 4JKIA 4RY2A 1OXUA 2YNMA 5HCNA 4AYXA 3B1VA 5FBRB 3ZZ0A 3AUXA 4HAYA 5EE5B 1Z6AA 1TU3A 5DYGA 3X1WA 2ZRLA 1ZNZA 4LYFA 4ZKEA 2JDIA 2ZITA 2IF2A 2CL0X 4X8LA 1E2LA 1DTSA 1UBEA 5CIWA 3HU3A 1R7RA 2GTPA 3ZQ6A 4LX0A 4HDQB 4LC1A 2WBLC 4QM6A 4HAXA 1TQDA 5BWMA 1JQLB 1ZNWA 2UZIR 2B8TA 2VSFA 1E9FA 2VP0A 5FPSA 2ZE8A 2OLKA 2XAUA 2W6ID 3ADCA 1W48A 3GLFE 2GBLC 4QJ5A 5BN4A 5DN6D 2ZR0A 4US2R 1ESNA 2FPKA 5TV2A 1GSIA 3AVOA 1V5WA 1DOAA 1GG2A 3IGFA 4PX9A 4I81A 4AI6A 1KHTA 4TLCA 1NBMD 3PXGA 2I3BA 4PHHA 2CJWB 1XCMA 4BZXA 4RD2A 5DI3B 5C2JB 2VHJA 3N70A 2VRWA 2WZQA 1K5GA 3THYB 3R7WA 1XCGB 2OHFA 5B64A 2HXYA 4M9ZA 3WRYC 4DEXA 3PJRA 2ZU0C 4M22A 3T1OA 3QKTA 3B2EA 2BKEA 3EPKA 4R98A 4LRWA 3LBNA 1EFRD 4G1UC 4RFVA 5D3QA 1M7HA 5E7JA 2FSHA 1Z83A 1VECA 1VCIA 2WWGA 2E1RA 2ZE5A 1KIMA 2XTNA 3JVVA 2Z5FA 3MMPA 5E7MA 2QAGC 1VCNA 4IDHA 3ZVNA 5AUNB 1SVOA 4HZUA 1Z63A 2FDCA 1F60A 3FPAA 2CJWA 4CT4B 3D31A 3GFOA 5FBQB 1KMHB 3A4NA 5TARA 4ZDIA 4A82A 1Z6YA 1NG1A 4TL7A 4KYIB 4LY6A 1XCPA 3DMDA 3OFND 3THYA 2PZFA 4FMCB 1XEFA 1G16A 1W4RA 2G3YA 3Q72A 4GRAA 3W90A 4TT3D 3ZGXA 4DIDA 1VYTA 5CYOA 5JCZA 5L3VA 1LNZA 2MSEB 3V4FA 1Z28A 3I1FA 3BGWA 3U60B 2BMEA 2JGNA 1FNNA 4KYUA 1KJZA 1W2HA 3GEHA 1TQ2A 1NRJB 2IF0A 4TYPA 3KQHA 5DHFA 5G53C 1S3GA 2WHXA 1RVDA 3D7MA 4NPHA 5DE3A 3RLFA 1XTIA 2J0SA 1H65A 3KB2A 4ESHA 3TH5A 4LJ7A 1EFTA 2IYWA 1E2PA 2XEXA 5B58C 3IQXA 1AQYA 1G5PA 2ORIA 1P2TA 3K9GA 4OJKA 1YZNA 2RMKA 2EQBA 4QC2A 2GZHA 4JYBA 621PA 1BMFA 2PLRA 2QI9C 1MKYA 3RHFA 2R65A 1B23P 2X2FA 2B21A 2QEQA 3BBPA 2Z0MA 1E1QA 3TR5A 1R0YA 3O8DA 3SNHA 2IYVA 1F3OA 3PUWA 2BBTA 1TQ4A 5LPNA 5AJVB 3PUXA 2DWQA 1FOEB 5DHAA 1W4AA 3QUSA 2QMOA 3RS3A 1ZM3A 2Q9AA 4TYQA 2XITA 5L3SB 1E2KA 2GHIA 2P67A 3LA6A 4LJ5A 4OQLA 4RZUA 1IXRC 2ZM5A 1TF7A 2F7SA 4ON9A 1U0LA 4PO1A 3GLHB 3TQFA 1HE1C 4QBFA 3HPRA 3I72A 5JMTA 1HT2E 3C16C 1RPZA 2AD1A 4YDHB 3O8RA 2ZRDA 2J3EA 4G5RA 2VO1A 1I2MA 4PAOA 1ZM2A 4GOJA 3I3SR 3EARA 3U2QA 5J4VA 3M1IA 2QTHA 1GILA 4LBYA 2WPDD 4GSYA 1RRFA 2FMXA 4KAXA 1ZD9A 1KK3A 2AFIE 2Q3MA 1CU1A 2L0XA 2V1UA 2VL7A 1ESMA 2ZJYA 4U00A 3V9PA 3W34A 5AUOB 2WJVA 3K8YA 3P1JA 4P4SA 3NH6A 5CK5A 4GZMA 4A2WA 4EFNA 4DDWA 4XVUA 1LVGA 2F9LA 4PR0A 2P5TB 3H1TA 2EFDB 1QDEA 3ZJYA 1FTSA 2CE7A 2JIZA 5EP3A 5JLJA 2G83A 1U0JA 1W36D 4TWZA 3EZ2A 1PLKA 4B74A 2N42A 1W7AA 2BBSA 1F2UB 1N6NA 2XX3A 2YC2C 5KSPA 4HYYA 3A1UA 1FW6A 1RYFA 4TL9A 4TTPA 1HA3A 2ZVQX 3LWNA 2JEOA 1Z0AA 5ANRB 1E2DA 2NZJA 3B6EA 3SHFA 4BLSA 2WKPA 4I1SA 4AURA 1VIYA 1XJQA 2ZROA 1TAGA 1AK2A 4YC7A 1KI8A 4A8JB 1CRPA 4MKGA 4WZBE 4GBMA 2RGEA 1IBRA 1Y63A 1JJ7A 3H4MA 2ZRPA 2ZSBA 3NTUA 4UXJA 3TGPA 3LFUA 4MGYR 3MD0A 2CVFA 4KHZA 3U3JA 1W5SA 4AC9A 1OF1A 2OUKA 2RKOA 3PITA 4DWJA 3I61A 4OKSA 2RGCA 2QRZA 3OEEA 3SFVA 1Q12A 3Q7PA 3K53A 1N25A 2R6AA 4E22A 4K8OA 2DYKA 4F7WA 4CDGA 2KSQA 5E3HA 1XMVA 4LYJA 3BH6A 2A78A 3LQRA 4IJMA 4AD8A 1NVVR 3C8UA 4DSTA 4M0LA 5G3YA 4IOJA 5KTYA 4C30A 1H8HD 5JFGA 3LXXA 2G1KA 4EQ6B 1GAJA 2WVJA 4BZPA 1NY5A 2BHRA 4BLRA 2IS6A 1JI0A 2ANCA 2CCKA 1N6RA 2AXNA 4UJ3A 1SVWA 1EGAA 1EX6A 1M34E 3OZXA 4PC3A 1N6KA 4RCYA 3ZZTA 2ERXA 3CF0A 4HDOB 3IBYA 3TLXA 2ZRNA 3QXXA 4F4JA 2JASA 4CEIB 2EFGA 1G3RA 2J1LA 3WY9A 1Z3IX 2H8KA 4NZYA 4JBYA 3T61A 3G0HA 1DE0A 4M1SA 4GMDA 3EPHA 2IYXA 4B44A 3NC1C 3OEHA 3QOFA 2HT6A 2QGNA 3UK6A 4V02A 1IONA 2R8RA 3GEEA 3EA5A 5DH9A 3K0CA 1P61B 3AH8A 2MSDB 3BOSA 1JALA 5IRCD 4PTLA 4XSHA 3SHWA 3VHLB 5C4GB 5K8LA 5LDDC 1CJTC 1JR3D 1KDOA 4GMXA 1X86B 2CMKA 1NLYA 3EZ9A 5DYIA 2C9OA 2ZE7A 5CM9C 4FXPA 2XB2A 3G5UA 3PEWA 2G6BA 3AKCA 4FIDA 2ZI7A 1U8YA 2R44A 5KHOC 2VP6A 3B13B 5M04A 3AVTA 5KSOA 2JJ2D 3RWOA 2QT0A 3U4QA 4PC6A 1ZINA 1U99A 2D2EA 3CB4A 2OAP1 1XD2B 1VYUA 2HJVA 4JBWA 5E95A 4LOAA 2EW1A 2PX0A 4NDZA 4BRUA 5FUWA 4YMUA 1E6CA 4V0LA 1YRAA 4PXAA 1G7TA 2H17A 2AK2A 3ZVMA 1DAMA 2XSZA 2JLZA 2RH5A 5KNDA 4YQFA 2HUPA 4P3YA 2Z43A 4EPTA 1G18A 3Q85A 4BFTA 2C03A 3AGPA 4MRPA 5AR1A 3MJHA 4PPNA 4LHZA 4O2RA 1MO3A 2OFXA 1T5IA 3EIHA 721PA 2RHMA 2QGZA 4XWOA 4DKXA 2GCOA 5CM8B 3WMGA 1QHGA 1ZUIA 1JBKA 3MRSA 3TSZA 2V55B 4G5SA 3MWKA 4LV6A 2W0MA 4EJSB 5H8WA 5J4LA 2IEZA 1SZPA 1MABB 3AKYA 4J0QA 1J90A 4PAQA 2CDNA 3H2YA 1ZU4A 2VF8A 1YHNA 2XZOA 4OHVA 1VCMA 2F3RA 3N5CA 3OAAA 4EFMA 1TUIA 2HYDA 2IL1A 4YMTA 1OYWA 1T0HB 1KY2A 1X3SA 1T4GA 2YOFA 3A4MA 2FGKA 5FL7D 5ELXA 2WAXA 4JLNA 4B47A 4RFSB 4LWZA 1GOTA 3KJIA 3IKJA 2D4HA 2IXFA 1W36B 4JLMA 3FGNA 2GEDA 4E03A 3VU9B 4ACBA 4EDHA 2ZUDA 2A5DA 3B1WA 2F6RA 4I1UA 1OXVA 1MT0A 2O8DB 4D0NA 4DLRA 3BWDD 2ZU6A 4OHWA 1XMJA 4DZZA 4PPGA 2D62A 2CXXA 1UADA 5JWRA 4B3GA 4ZIRB 4BFXA 3RS5A 1W4BA 4FMBB 2FGJA 5GJCA 2ODNA 4PAMA 4PZZA 1SHZA 4P33A 3FKSA 4B35A 4D6PA 5FPYA 4Q7JB 4MYHA 1NVVQ 3AUYA 2OCAA 3AP2A 4JLOA 4JT4A 4DEYA 1L4YA 4TMVA 4TYYA 4M9QA 1S96A 4QJ3A 3C15C 2ZEJA 2C95A 1RRGA 2V9PA 2X2EA 2BBWA 4OYHA 4M21A 1GL7A 3GLHE 2BMDA 1DS6A 1OHHD 5DNYB 1E2IA 1E9SA 3NIBA 2O8DA 4MGKR 5FBLB 2D7CA 3ZDQA 4HB3A 5HE8A 2NO7A 4PPQA 3DOEA 4QBHA 4DT1B 8OHMA 1Z0FA 2AKAB 3ADDA 3T1QA 4MRVA 1NSFA 2NG1A 5TMPA 2KJQA 1XDBA 4RJLA 3W9YA 1CR0A 1K6MA 4Q4HB 5K8IA 4O3MA 2NMVA 4R2IA 2OZEA 4KV9A 4A8JC 4KBGA 2FEMA 1XMSA 3D6TB 3U7HB 2EFHB 3CF6R 3IIJA 2YOGA 3RS4A 2WIBA 3EZ6A 1XJCA 5HR5A 2ODEA 4GPTA 3MFYA 4NYJQ 5EUMA 1ZNYA 2WWHA 4Q7LA 3KKOA 4C0AC 4XIGS 1SVIA 2GBLA 3MCAA 4HDCA 2PLFA 3AVQA 3EW9A 2NOAA 3QQ5A 3O8CA 521PA 3W6PA 4L9WA 2W2TA 3WHKA 3AF1A 3WYFA 2GAOA 1XEWY 4Q03A 2GXSA 1Z2AA 3NEJA 3ND8A 4TLAA 1AKYA 4U5XA 1W0JD 4HAZA 1KK2A 2B92A 3T5GA 4JL6A 5GVSA 4QFMA 5IHPA 2CK3A 1DBSA 4M1TA 4DDVA 5LB4A 2QA5A 2H16A 3SQWA 1GKYA 1KMQA 2MSCB 2VP4A 4RKFA 2F1IA 4IDPA 4NYIR 1W2GA 1CS4C 2CVHA 3QG1A 1OKKA 2VA8A 1U8ZA 1UDWA 1W49A 2ANBA 4RD1A 1R6BX 3RRZA 1PV4A 2HXSA 2FFHA 4NU0A 2RAPA 1XEXA 3QE0A 2PJRA 3X1DA 4ZCMA 2C8VA 1TF2A 1GTVA 1TNDA 5FOTA 4Q5IA 2HF9A 4ASUA 2KBEA 1CKEA 2H5EA 2IHYA 3QIAA 1WA5A 3T34A 121PA 1XP8A 3M4YA 3GPLA 2QAGA 3X1ZA 4F92B 3GMTA 3J81k 1XPOA 1SQ5A 1E2NA 4ZCIA 3K1JA 3KTAB 1ZU5A 3TIFA 1E79A 2J7PD 2RGGA 3P32A 4I1OA 4V0KA 3VR5A 2ZR9A 3LAWA 1XXHB 3T06B 1LS6A 4BPBA 1DAKA 2QROA 1R0WA 4XJXA 5EP1A 4RKEA 1D2EA 4DCSA 4LC0A 2R6GA 2WICA 1AS2A 1YE8A 1GWNA 2QBYA 2QZ4A 5TB5A 5HZKA 4LJ9A 3Q8XB 4B76A 2YHSA 2FA9A 2CHVA 4BE7B 1GM5A 1NN5A 2EWWA 1F2TB 3KTAA 4TSFA 4MUBA 3BFVA 4HEJA 4OHXA 5AK0A 2C99A 1NJGA 2F43B 2RGAA 1G4AE 1YZTA 4Q9KA 4D4LA 2GEVA 1KSFX 6Q21A 4C2UA 3M6AA 4IEIA 3ICQB 1P2VA 2QE7A 1XF9A 1KYIA 2WJHA 4LYAA 1CJVC 4QGAA 4Z8YA 4KU4A 4UNSA 2X1VA 4D2IA 1T3HA 2FPMA 1JEEA 2ZUBA 4ZDJA 3CH5A 1SXJD 3LVRE 1U98A 4GOXA 3S1AA 2WSSD 2CL6X 4KXFB 1F2TA 1XTRA 4C0BA 4BFUA 1D9ZA 1HQCA 3VHXA 4POAA 4DCUA 4QG7A 5LBIA 4JLAA 2ZPTX 3IIKA 2C2HA 3FMPB 4QRHA 3WBJA 1OJLA 4BWYA 4CF7A 4BGDA 1UBFA 4MGZR 4URYR 2VYFA 3WNDA 1CJKC 1CR2A 1MV5A 4NH0A 5FTJA 5H1YA 3PVSA 1XTJA 3B7GA 3T1VA 2GWHA 3UANA 4LPKA 4G5QA 1BYIA 1NP6A 2Q0HA 4HZIA 5H70A 1XBTA 1Z07A 2G1JA 1UKEA 3OHMA 4B71A 1KOFA 2BCJQ 4EJSC 4Q48A 3QPUA 2PMKA 1XRJA 3A36A 4IVQA 3QPWA 5FTNA 2PZGA 2DWPA 2VLIA 1W4CA 2NIPA 1GKIA 4WOPA 4CIDA 2XZLA 3PR1A 1KKMA 4UJ5A 3FWYA 4BLOA 4CGZA 4OK6A 2BEKA 1GUAA 1RRPA 1KDTA 2PCJA 4E5UA 2ZRBA 2ZRGA 2ZTSA 5DI9A 2AN9A 2BCGY 2GDJA 2F1JA 4TYNA 2OO7A 5IK2D 2V7QA 2FFAA 3MWYW 4C7OA 1VHLA 1UEIA 2EU8A 2ATXA 3QBTA 3VMFA 4TZ6A 2J41A 2I1QA 1MRSA 3KDSE 1PUJA 1W36C 1HQYE 5C46F 4Q00A 1NL3A 1T9HA 2W00A 2GXQA 1WQ1R 3THXB 3PEVA 4XVRA 2PT5A 2ZETA 3CZPA 4LPSA 4OI2A 5HE9A 3VX4A 1NMXA 3MUFA 4D0LB 4RSGA 5C18A 5BXQC 3EG5A 1US8A 2W6JD 1Q1ZA 3UPUA 2GF0A 3FFBA 1TADA 1ZVQA 3RWMB 4CEJB 5DO9A 4I4LA 3EWSA 1E0AA 4LJAA 3W6OA 4NBSA 1HV8A 1OIVA 2VP2A 4NYIQ 4DJTA 2IHBA 3R9WA 1G8GA 2QTVB 1Z6XA 1KGDA 2FV8A 2C9YA 1R2QA 5JRZA 3BH0A 2WWYA 5GADl 3NHAA 2B7CA 2OFOA 3KKPA 2ZRIA 4I99A 4W5WA 4G0NA 4DSNA 4JLJA 2BM0A 1AN0A 2XJ4A 4D4KA 1KI2A 2A9KA 4HB2A 4Q4AB 4WA7A 2ODBA 2I1VB 1NKSA 3OESA 1N6LA 1PUIA 2XNSA 2G88A 3I5YA 3QXJA 2LKCA 2NPFA 2BM1A 2PT7A 1T8TA 2ATVA 2XOKD 2FU5C 3BE4A 3CO5A 4DLYA 2PCLA 3CRMA 3QPVA 2AFHE 4ZPXA 4QXAA 1U2RA 2G0NA 3HR7A 1HY3A 3UWKA 5IT5A 3WMEA 3VTKA 3DM5A 3W5IA 2FOLA 3OE7A 2FWRA 2XNDD 5EE3A 1ZAKA 5FTLA 1YJ5A 1ONBA 2GNOA 2N1BA 2DFLA 2RHDA 4Q4AA 3WP1B 1UKYA 1X1SA 3KKMA 1RZ3A 4ZI3A 2J0VA 2IXEA 2QU8A 3DEFA 3CKLA 2P6RA 2HYIC 3I8SA 2C78A 3W3ZB 4C3ZA 1SVKA 1CLUA 2EFCB 3AF2A 2ZYTX 1S9HA 5DI3A 4Q1EA 3UXMA 4CW7A 4QOSA 1T3LA 4IVPA 1T91A 1ZM7A 5FPTA 1WCV1 1Z6GA 1HTWA 5FR1A 3SN6A 3T12A 4PC1A 1GIAA 2BC9A 3TKLA 4TL6A 3LO5A 4TZ0A 2CEAA 1BIFA 3QF7A 3RSLA 2J7KA 2IUSA 4DDTA 2WJYA 3HP1A 2FN4A 2IYZA 1KY3A 4FCWA 1DAGA 2KWIA 4DB4A 4TQUS 3O8BA 1COWD 4FCTA 2CNWA 3F0TA 3R20A 1WB9A 4Q1CA 2AWNA 1KZGB 1Z29A 4FW9A 3DOFA 4XD7A 4Y0AA 4AKHA 4KSBA 1Y3AA 3HPQA 4FWIB 4GDFA 5JSZB 3U3OA 1KDRA 1E2QA 2IYLD 5JI2E 1KMHA 2N46A 3CX6A 5F2EA 3REFA 2PEYA 3QENA 1G3MA 2ZSFA 2GESA 2ZSEA 5EE9A 3WRXC 3K0SA 3CNLA 4DUGA 4IOLA 4M4SA 3QF4B 1LV7A 1LW7A 1E9BA 2ZS7A 1GVNB 2CE2X 4ZV4A 2W2XA 5B57C 1NIPA 2BV3A 4JJKA 1P6XA 5B30A 3NDBB 3RRYA 1OFIA 2W58A 4M53A 5L3RA 1SXJB 3VR6A 4LHXA 1ZIOA 3R8CA 1NIJA 2C96A 1VDZA 5FBVB 2QN6A 3B9QA 2ZVPX 1WMSA 4LI0A 3CRW1 3ZYCA 5BN3A 5AJZA 2CHQA 2ZR7A 3CW2A 1JR3E 4O2LA 4JBXA 4QHSA 4MRNA 4V0ME 3U3KA 2D3WA 2QNRA 2C04A 4UNRA 4P0TA 4DCTA 2VH5R 2ZRJA 4LYHA 4G5OA 2ZUCA 2BVNA 4JLVA 4KVAA 2O8EB 1YR6A 1CEEA 3SJBA 1R10A 1VG9B 3DZDA 2QP4A 3A1VA 1EK0A 3FVQA 5JWHA 1J8MF 1OB2A 4KSCA 1UEJA 2YC4C 1Z0IA 4XSGA 3RVBA 3TAHA 2GEUA 1SHKA 2QQEA 3CPHA 2J9RA 3L43A 3P20A 4M2LA 3SJZA 3SU8A 3KFVA 2P3SA 5A4JA 1IN4A 1G7SA 4PQFA 2GXUA 5A0FA 3K0EA 4QJ4A 4O0MA 2I4IA 5JCPA 5L3SA 5F3WB 4E07A 1QHHB 1SULA 1LB1B 5HKKD 3GLHA 3KKNA 3VNUA 4PC7A 1EWRA 5IDVA 3H86A 4DLZA 1GRNA 2GK6A 4US0R 1KZ7B 3F8TA 3DO6A 4IRUB 4TLDA 1N0UA 4X8OA 3UWOA 1RJ9B 5FBWB 5D3MB 4HAUA 2BDTA 1P4SA 2GJSA 2EVWX 2RGBA 1N3BA 1DARA 4NTZA 1TX4B 3I92A 3NH9A 3O47A 3CZQA 1Q1QA 4HB4A 2KBFA 2YWFA 3GJ0A 1C1YA 2OBLA 2GK7A 1A2KC 3SFZA 4MRSA 821PA 1VCOA 4ZCLA 4EPRA 3LY5A 4NCHA 4RD4A 1QHHA 1OIXA 5G3ZA 4Q9LA 5AJWA 3SR0A 1GITA 2B8WA 3W8RA 5JBQA 3NVAA 3KUDA 4URZR 4PHFA 2RGDA 1M7GA 1TTTA 1XPRA 1ZMXA 2GF9A 3CIOA 5CB6A 1NJFA 4L5BA 5AJXA 2YV5A 3WHLA 3I8XA 2VP9A 1R5BA 1F2UA 3H0KA 4IDNA 1G1MA 1UM8A 4NCIA 4DXAA 1F6BA 1IXZA 4B2PA 2Q9BA 1C4OA 3KXLA 3FOZA 1NN0A 2QM7A 2W6JA 3E2IA 3GFPA 4N0EA 4QGHA 4W9MC 2AXPA 3LW8A 2HT1A 3AVYA 3CBQA 1P60A 2ECKA 5GJVC 4A8JA 5JHGB 4A6PA 1E4YA 1OH8A 2VTKA 1II0A 4BZQA 2GCNA 2FSIA 2Z4SA 2GJAA 1UKZA 3QI2A 3GLIB 4TLBA 3QKSB 1IY0A 3BD9A 1AJEA 4N0DA 2WJIA 2PH1A 3K0FB 1Q1BA 4QM7A 2W6IA 4AKEA 2FFBA 3U44B 5DN6A 1OXXK 2ORWA 4K46A 4LSGA 3TAUA 4TMWA 5UKDA 2RCNA 2O8BB 1P62B 2VF7A 5EXPA 4II7A 3EXAA 1GKUB 3IUYA 3KB1A 2A5FA 5FOSA 4A2QA 1QVRA 4C2TA 1NBMA 3QKRB 3KUCA 3B78A 2IA5A 4L4UA 3GJXC 4Q1DA 2QPOA 3UG7A 4GFDA 2YINC 3TJZA 3VR1A 3VFDA 2Z83A 5LB2A 1G8PA 1IN5A 4EQ6A 5SZHB 3VR2A 2YYZA 3MGCA 3T35A 3K0FA 2WM9B 3BFKA 4NYJR 2JLVA 4LHYA 4BUJA 3SQXA 2XNDA 3L82B 4PZLA 3ASZA 1EFRA 1AS3A 2OILA 1E1RD 3EWAA 4V03A 2ZYVX 1GZSA 1EFUA 3BAFA 1L2TA 1EXMA 3LX5A 3TW4A 4TMXA 4PHGA 4CVNA 2UZ3A 2W2VA 4CEIA 3ZIAD 4DLXA 2EYQA 3L0PA 5EP2A 1KSHA 2KE5A 2QUZA 2OCYC 1XTSA 3QXSA 2A3RA 3X2SA 4AYTA 5C4MA 1KO8A 3AKEA 3CNOA 2DR3A 5GVRA 1FNMA 1PLLA 3K0AB 3TVDA 1D6JA 1T8UA 4AWXA 2A5YB 2GILA 3OFNA 3BIFA 2IBMA 4ITRC 3TRFA 4B2IA 3KZ1E 1A82A 4FN5A 4TT3A 1BO6A 3BJIC 2QRNA 1ODFA 4H1VA 2WTUA 3LNCA 4KBFA 3FFAA 2JJ1D 2HLDD 1W0KD 3FMFA 4GOKA 1E2MA 3KL4A 4KLZA 1XEWX 2ZJBA 3THOA 2HCBA 3GJ8A 1S9DA 4AIIA 1JXMA 4NL4H 2D7DA 1GP2A 5JS8A 5FPHA 3IBGA 5EZ6B 1HYQA 3FDIA 1MRNA 3K0AA 3E1SA 2ODWA 1JAHA 4B33A 2OESA 2WV9A 1E9AA 1N5IA 4L9SA 4Q01A 1U0HC 5KO2A 1GNPA 1HE8B 2WMOB 1H8ED 2Q6TA 3EC1A 3H84A 3NG1A 1P2SA 1M7BA 3IO5A 2O8CB 4HLCA 3U61B 1JR6A 3DDCA 1XD2A 2Q21A 4JIMA 1N6OA 3GLGB 2HDNB 2J0UB 5AWFC 5FTKA 3SBEA 3W8NA 2JLUA 2DB3A 1JECA 1G64A 2FE4A 1SXJC 3F3YA 1U90A 1XTKA 2FX3A 1ZD8A 1F5NA 2V1XA 3RRNA 2QPTA 1KO1A 1GFIA 5C1BA 3P26A 1ZRHA 2OXCA 2ZJAA 3P4XA 2DHRA 4YXWD 1VTKA 1W46A 4LGMA 2ZJOA 3W3AA 1E0SA 2JCSA 3AQ4A 3V00A 2Y8EA 1I2DA 3B5JA 4JS0A 2O8CA 3CONA 5CIQA 3TR0A 4EKDA 3CM0A 2ZSAA 4TN1A 4WAUA 1QHYA 4EJSA 4Z51A 4PHTA 4LBVA 2SHKA 2DWOA 1IN7A 1YQTA 1MABA 2H1LA 1RFLA 2ERYA 1G7RA 2ZQ5A 2D74A 3X1YA 3U5ZB 4DSUA 5J47A 3A1TA 1OB5A 1P3JA 2WPDA 1ELOA 1XX6A 3FE2A 3WYGA 3AVWA 2QAJA 4OHZA 2LCFA 4Q9IA 3NBXX 3SJCA 4F38A 4Z1MD 3D8BA 5E7IA 1Z2CA 2OLJA 1DAIA 4EAQA 5HKKA 1FL9A 2PL3A 1A5TA 2RGXA 3GLFB 1WBDA 2ZI5A 2ZJ8A 3GD7A 3PUYA 3PEYA 4NMMA 4ACAA 5CJPA 4IOMA 4RFSA 2CLCX 2NTYC 3NEYA 1F48A 3HDTA 1HUQA 1MO5A 4FWTA 1OYYA 3ADKA 3T1TA 4M1OA 2GVDC 3DL0A 3VU9A 5AUPB 4HATA 1X8LA 5DGXA 4F4CA 3U3RA 1P75A 3B1ZA 3BS4A 3TSWA 4HLQB 2ZRKA 3L0OA 2GVZC 1L4UA 3P27A 5DISB 2UKDA 2IS1A 1E2EA 2Q3HA 3AF4A 3GJ4A 2JDID 4ZIRA 3EX7C 2AWOA 1DEKA 1ZBDA 4ZI2A 1QRAA 1RYHA 3BXZA 1W1WA 3ECCA 2JLSA 3GJ7A 2R6DA 1BOFA 1S8FA 3NDPA 4UNQA 1KSJA 4MQBA 5KPJA 2O0JA 4PC2A 4BFWA 3A1SA 2YWEA 2Z6VA 3HU2A 1AS0A 1YKSA 4Q1BA 2ZYUX 3WBKA 1M2OB 4BLQA 1QBKC 1DPFA 1MO6A 3SYNA 3UG6A 1Q21A 2ZE6A 1YRBA 2IYQA 2H7VA 2BIFA 5FI1B 5JEEA 1E94E 4G3XA 1YZGA 1Z22A 4DT1A 3AV0B 2A5GA 4EPXA 2F1RA 4DDUA 5A5GA 3QSYA 4NCKA 2ZRMA 2VHTA 4Q4HA 5AUQA 1E2HA 3TNFA 5CB8A 4CEHB 5CLLA 2P6NA 3K9NA 1PLJA 1KKLA 1YU9A 4WW0A 1AKEA 1H8HA 3FKQA 3MWJA 4B34A 3HU1A 221PA 3R9IA 4Q1FA 3AEZA 1S1MA 2VPPA 3PEUA 1W44A 1WBBA 2G9NA 3C4JA 2YKGA 3AVUA 2AR7A 3ZD7A 1FFHA 2FPLA 1XB2A 3LRPA 2WOJA 1KJYA 1ANKA 5EE1A 3KKQA 1D2NA 3ZH9B 1Z06A 1KNXA 2ZRHA 4HUTA 1VG8A 4JSTA 1UFQA 4B3FX 4PZYA 3X1XA 5FPKA 4B32A 4TTRA 5DIFA 5EXXA 3FHTA 1ZD1A 3ZS9A 1R8SA 4AKIA 1KJWA 1NG9A 5KNBA 1G8HA 2W83A 3GJ6A 2DCUA 1N2CE 5L3QB 4CT5A 4CEHA 1QG4A 1E4VA 3GCGA 1FUUA 1K5DA 1ZM9A 3B82A 3PV0A 4JSYA 3UIEA 4A0HA 4ZKDA 1TL7C 5KPDA 3BORA 1JPJA 3PENA 4KFTA 1NBME 4O25A 2WOOA 4TMKA 1MO4A 2HCJB 3LBIA 4JLKA 4JJZA 3U7EB 4RD3A 1QG2A 1EFHA 1E1RA 4MKFA 1G3IA 3QY0A 1E3MA 2FZLA 4L15A 3Q9LA 3GLIE 4A6XA 2QENA 1KTVA 1KO5A 5JS7A 4XTRA 4A2PA 3IO3A 1YR7A 2HEIA 2XJ9A 3A58B 3KJHA 5FUXA 1Z08A 4URXR 4AG6A 3E5HA 3PUVA 1Z5ZA 1JR3A 1K8RA 1ZW6A 1U94A 4V0MA 4C0SA 3IQWA 4D82A 3FTQA 1D2MA 2CCJA 1G41A 1OV4A 2WSMA 3IIMA 5FOVA 2GKSA 3QXHA 4FMDF 1AGRA 1XXHA 2AKYA 4TTQA 4Y0VA 2IYUA 2C77A 2JJ2A 1BMFD 3ND9A 4DIEA 1CF4A 5KDOA 3IHLA 2V4ZA 3K9LA 1IY2A 1CJMA 1FQJA 3NBZC 1E1QD 2ZRCA 2EWVA 3RABA 4QKQA 5DLQC 3GJ3A 2QMHA 1L7VC 3IDQA 3LV8A 3W6NA 1S2MA 3GEIA 3VAAA 1QF9A 2NO6A 4OQXA 4IDQA 2VHCA 4BFZA 3CNNA 1AA9A 2IUUA 1IN6A 2FF7A 1JB1A 4OJQA 3THWB 1IY1A 3IPXA 2F43A 5FTMA 2XXAB 1T3SA 2GXAA 4R2HA 3AVXA 1J99A 1RE0A 4BFVA 1U9IA 4ARZB 1Q1EA 1DADA 2A30A 1G5TA 4M8NE 4YDSA 3TVTA 4D81A 1JXOA 2OT3B 1G8YA 2R9VA 2XTMA 4JMPA 4DBLC 1E9RA 3TMKA 1S0UA 2O52A 1XJ0A 3MLEA 1SVSA 2V54A 2FSFA 3RDPA 3QG5A 1Q22A 2H57A 4LJ8A 3THWA 1DAEA 4YXWA 4FD2A 1SVLA 3SOPA 3SC3A 4D26A 2JLRA 2QP3A 1OE0A 5EP4A 4PO8A 5FL7A 4C0JA 4IOKA 3UMFA 3G82C 5EZ5A 2P5SA 2KB0A 2VP5A 2JIZD 3NXSA 2ZREA 5KDDA 1MH1A 4C0HA 4IFBA 1FUKA 2GJ8A 3KQLA 4QGGA 4JLBA 1P5ZB 3BB4A 1L8QA 1SKYB 3KXIA 1TPZA 2QQ0A 4HAWA 4BASA 2OCPA 3K70D 4LCBA 1KSGA 4MYTA 2D2FA 3WMFA 3KFXA 4ABYA 4LBZA 4XVQA 1CJUC 2HF8A 5HTKA 3EASA 4XTCS 5K8UA 3IILA 4FMDB 4RD0A 5FL3A 3JVUA 2GA8A 3E70C 4FINA 5KDLA 5B2ZA 4TMTA 2OM2A 4UNPA 3SYLA 3HJNA 2E9SA 1J7KA 4WIAA 1ZIPA 1ZNXA 4IVRA 3TUJC 3CPJB 1JQJC 4XOIA 4QL3A 4KLNA 1NKTA 1Q0UA 1OHHA 2NO9A 1IJEA 3OEED 1G3UA 4GT1A 3THXA 4PO9A 1G6OA 1E9CA 3RS7A 1R5OA 2IUTA 2E87A 1ZP6A 5EUQB 2FFQA 2IYSA 1E9DA 3B9PA 4MYCA 3VKGA 1G4UR 3MWLA 5HPYB 1LF5A 1BS1A 4CEJA 5BW8A 4UQOA 3RS0A 5BQ5A 1G3QA 1LS1A 2FNAA 4JT2A 2CCGA 3EC2A 3R7WB 1E32A 1NMZA 3DKPA 4V0OA
chains in the Genus database with same CATH superfamily
2VHWA 5EMKA 2AX3A 3HZZA 2CLDX 5ECYA 1XWIA 1Q6ZA 3HQ4O 1G63A 1WCWA 1WDTA 4LHVA 4MKRA 4AY3A 4BAZA 2DHDA 2C2KA 1CUBA 5EGSA 1OFGA 1XZPA 4JLPA 5AKLA 4IX9A 1NPTO 4CM4B 1G6HA 4OIFA 4FX2A 1WQ4A 1NV8A 4M1WA 4JYCA 3DAOA 4AO6A 1JUDA 4G0UA 1PJ3A 2FTKE 2PFSA 1R0ZA 3AM3A 1ZJ6A 3ASYA 4HNRA 4CNBA 2IHKA 2FYTA 2Q62A 3V7FA 4R8VA 3IURA 2OCLA 1MPTA 2NGRA 1LBQA 3BK7A 4CMIA 4LK3A 4BAGA 3ACCA 1WS6A 5KYUA 4Y9SA 1M6NA 5DBOA 3UGKA 3BDIA 1Y6ZA 3OEHD 1NJ1A 3UT0A 1AB5A 3OQHA 5BNWA 1N5LA 3QEKA 3UJ7A 2BKXA 3KQMA 3R0VA 2OCXA 1IMJA 4C3OB 3IBCA 4IQ8A 2WMYA 3NNSA 3OC6A 4RD6A 2QKYA 2PVSA 1RZRD 2AJBA 1PN3A 1MPXA 1RXUA 3CR7A 4URWR 1M1UA 1C8VB 1J0AA 5K7SA 2C9BA 3QNUA 1AGPA 1GGMA 1Q2UA 2WIJA 3DMYA 2ZI3A 3ETJA 1HL7A 2PMEA 1BH6A 1CSEE 3UMRA 1NWCA 1TGVA 5E6SB 3CVVA 1EWTA 3GFFA 4BVJA 2FSVC 4L5YA 4U02A 1GGJA 5JR3A 3UNXA 5E4FA 2PX6A 3IQDB 3GLQA 3HNRA 1N4DA 2Q0SA 1XD8A 3BFXA 3V1MA 3V32A 3Q0EA 4FI3C 5ADHA 2YRXA 3DVLA 2YYYA 3D3QA 4FYJA 4JL5A 4QQNA 3SYKA 1NVKA 4NP6A 2X19A 3NT4A 2O7QA 4YP5A 4MAMA 1X7GA 1P44A 1JE0A 1G5HA 4FHCA 3OP1A 3AUUA 3AI7A 3SJ7A 4CDNA 1CRQA 3EE6A 4E32A 4Q19A 4KPYA 1QLJA 1FBNA 1WSAA 4IZHA 2HA5A 4QNRA 1L5VA 4Z2AA 5BW4A 4MEBA 2DUUA 1MDBA 1QGYA 2BP7B 4XUEA 3VPXA 1HLFA 1KAOA 1V9SA 4HLUC 3N7AA 4F5ZA 3OOJA 1VXOA 3NCTA 1H2WA 2L19A 4EYOA 2E4ZA 3KTOA 4MQ5A 4X3OA 4TRMA 4HK4A 4YIHA 1EFCA 4LQCA 2R7LA 2IUYA 3R4CA 1G9XA 2ZYWX 2BLNA 2P6UA 5EL0A 4HUQA 1Y37A 3RI3A 1V8ZA 2FMIA 3DW3X 5DU2A 3QF4A 2I03A 3BRWD 3QXCA 5A1JA 1RWBA 2C7BA 4ER0A 4LVCA 5KMGA 1RKBA 3CRVA 1SQGA 2ZB8A 4KB5A 3IUMA 1W59A 1CP3A 3EIQA 2VP3A 2R86A 4ZZ1A 2BH2A 1SUDA 4W5TA 4CI0B 4KR6A 3DZGA 1LRKA 4I4TA 2WSSA 3FNGA 2UYGA 1F51E 3Q9NA 1ZJ5A 2R48A 3GRRA 4DQLA 4B2LA 4Y2JA 2FG7C 5ERXA 1E6UA 1Q7CA 3FPCA 5CT6A 2C9CA 1SBIA 3VR6H 2UUCB 1TYZA 3TBKA 4P22A 3ZKWA 1NFQA 4D3DA 1DELA 5FFMA 1EZZA 1ORVA 2IUFA 4LK2A 3WMXA 2JBHA 5KUTA 3HBMA 3JYNA 3GEMA 1Y8QA 2UZ4A 2WAYA 4UULA 3HXTA 1CDZA 3ZGZA 5BSMA 3UF0A 3UCXA 2R62A 5IPFA 4ZOAA 3JQRA 1Q44A 2OBXA 2C5FA 4CGYA 3PGLA 4M38A 5JVDF 2OV1A 3G23A 3DMHA 3VKVA 1W8DA 1KI4A 2QTFA 3FI0A 4B3BA 1DC4A 3ZV6A 1E9EA 2CF5A 1FX0B 2O0KA 3DCNA 3FNQA 4MW9A 4ZO6A 1K98A 3DCJA 4K81B 3RBVA 1ONNA 3R09A 1NX6A 3W5JA 4ERNA 5JJKA 1VPVA 4P4UA 1Q7EA 3RAEC 2POQX 2ZDQA 4G24A 2Q6VA 4AO8A 4CXMA 3JAMA 1A9YA 1RJGA 1WD7A 4KQ9A 4L73A 5JDCC 3VZSA 4J07A 2O59A 1IJKA 1JVNA 1OZGA 3JQ9C 3OM8A 4LY0A 4JITA 3TXYA 3KYDA 5D3MA 3MPUA 5JD3A 1EA5A 1I24A 4G4IA 3EN0A 4M9SA 2ZJ5A 2NNWB 2E82A 3CLKA 4YRZA 4PYNA 4Z7JA 1Z8DA 3T3DA 1DJQA 1TGYA 5JG7A 1UAAA 4YUAA 4OHPA 3M1LA 4E2YA 1Z47A 2OBBA 1N5JA 3ONWA 3PG5A 4CUKA 1K1EA 1KAGA 2OV8A 2XE4A 3DFIA 1Y6GA 5DNVA 4MYUA 4G8DA 4HC4A 3R9KA 1FMFA 1XEAA 1KU0A 3E9DA 4A9AA 2IKQA 1N0VC 3MA0A 2JFWA 1NVWQ 4A4DA 4F91B 1QIKA 4E30A 5IUKC 3A8TA 2O2XA 4R31A 3GLSA 4JFAA 5BRAA 2X5KO 2QZ9A 1O9GA 4DCNA 2W71A 2Z4RA 3WWDA 1QU3A 3M3PA 4RZ3A 4YLGA 3IIIA 1FMLA 2VNJA 3KUUA 3U6BA 2C7OA 1QO9A 1SIWA 3LZDA 1FXUA 1C9YA 1I30A 5B1IA 5JXJA 2GJ9A 1SUWA 1N9KA 4OLAA 2QTZA 1T5HX 1TM3E 2V6FA 2PE5A 1E0JA 3PDHA 2DY1A 3TW8B 4XLZA 4QWWA 4NJEB 3NIFB 4R1UA 5IDXA 1XVVA 4XLLA 1P0IA 3CZ9A 1VKZA 3F9RA 3UMYA 1FFDA 5DHSA 3IKMB 3SLRA 2CK3D 1U0GA 3CMCO 1QFJA 2OO5C 2NACA 2RIPA 2YYSA 2A1TS 1DBRA 2IYOA 2QSYA 3EXIB 3GV0A 1M2VA 2Q5CA 3D7NA 4YEDA 1XF1A 2I1WA 1PHRA 2VEOA 1A9TA 5HTOA 3DE2X 4ZQCB 4DMRA 4N7RA 1P31A 2HV9A 1HLGA 4J1QA 4UZSA 3UKDA 5J4YA 1G8KA 3BKXA 4P32A 1USWA 4YS6A 2R8YA 4KRXA 3ZEIA 2XKJE 5K0GA 3IRVA 4MW6A 1UAYA 4MVJP 4NZPA 2FWNA 3IP6A 4Y2SA 4KW7A 5IKMA 1QFXA 4YCJA 3JQQA 2UVQA 5ALKA 3IEUA 1B41A 4WOJA 1F3LA 5DM4A 1XMIA 2DFNA 4FGUA 4TQAA 3HWSA 2OHHA 2HM7A 4C0LA 2CSXA 2BMFA 4ENUA 4G4SP 1DQPA 3IR7A 1U3FA 4CQNA 1J06A 4H4EA 4DC9A 3GT4A 4MGIR 4B8ZA 2GKGA 3QKRA 5K6RA 1R5NA 3DDOA 3B48A 4WXRA 1C9NA 3CWQA 4OG2A 1TJ3A 2G09A 4CM6A 3FMOB 2A8YA 2Q9CA 1GRQA 1BJRE 2P8SA 2R6ZA 1AZTA 3PIRA 1N2HA 4BO1A 3AVPA 3GVXA 1ZCJA 3MCWA 3NC4A 1A3CA 5FH9A 1ISIA 4D56A 4FCVA 3U4QB 7MHTA 4FCCA 4B4DA 1RI2A 3QMWA 3LLMA 5JVDA 4YBZA 3HVRA 2C29D 2VEDA 4JD5A 5K0SA 1MTOA 1KI7A 3KQKA 2ICAA 1O8BA 1PDWA 3BWVA 5EJFA 4Q3KA 3K1AB 1EXWA 4JU8A 4NV0A 4OQMA 4ALMA 5KKNB 4WMLA 1MRZA 3ZKAA 1M2NA 2IBSA 1SWVA 4YJGA 3LPNA 5JS1A 1I2CA 2R1VB 5JJIA 3OM0A 4C2AA 1F1JA 4OK3A 1EB8A 4UEOA 4EATA 1NNEA 1L5OA 2WC1A 3SEAA 3ZCVA 2O8FB 1STOA 4RK1A 5AXBA 4DCMA 1FB5A 4R83A 2B1GA 4V2IA 1CTQA 4NARA 5D85A 4GHWA 3F9CA 4AJIA 3HYTA 2AYXA 1KK0A 1QU2A 1DL5A 2NZ8A 1QHSA 2PJDA 3UICA 4B2YA 2VPQA 4U6QA 3THRA 3O1HB 2HH9A 3HP7A 4NOMA 4HLDA 1PYOA 3D0OA 4RA9B 4D8TA 3VNUA 2YOHA 2CHEA 5EVCA 5BRNA 4DQXA 1KWKA 4QVIA 1WNFA 3PA8A 3JVEA 2GCEA 3LDAA 4O2BA 1A27A 2PUFA 2V03A 8OHMA 4LGCA 1VLMA 3G2IA 4QTXA 3DDHA 4YIKA 2HQRA 2Q2OA 2JGIA 2BONA 2Q4DA 3PPYA 3J7AC 1UF9A 2AX4A 1TJPB 3QE9Y 4IEFB 4WACA 3R6WA 4RCZA 4JVMA 1DTWA 5PNTA 3C98A 3A37A 3T5MA 1S7GA 4K9SA 1YA8A 3QPCA 4JYMA 3SQMA 1DQZA 2Q41A 1G7CA 3LL4A 3TK1A 4BB9A 1N5DA 5JYEA 4PLFA 1O2DA 4RVCA 4A0GA 1W4ZA 4TKUB 2PWAA 3Q8LA 5KEIA 4L5JA 3ZHUA 4G85A 3TM4A 1GJRA 3KDAA 4LYGA 4EPYA 2EJTA 2Y1KA 3F96A 4ALNA 1EFVB 1PQ4A 2QZPA 5EIWA 1K9SA 3WGVA 3GDWA 1Z7GA 4AUEA 4E0BA 1EVLA 1L4BA 1NMYA 2GNPA 5DT2A 4I5IA 2ZBPA 2YYAA 4IW3B 3TEJA 1GPBA 3BPSA 4DJEC 2IEBA 2DBYA 4QHYA 4UPVA 3VTAA 2ZI6A 2XA1A 5AM5A 1E1YA 3ZOZA 3GFTA 1I4TD 5ICSA 1YL5A 2R8BA 2V9CA 4GPD1 3K9QO 4YI3A 3RIYA 3VZBA 3GP5A 1X7HA 3A70A 2H4JA 2ZJ4A 2Q1SA 4LV5B 3GF4A 4LUCA 2X9GA 3JSXA 3DPUA 3OF3A 1FTWA 5CGZA 4CMBA 4WPGA 2AA3A 5EQTA 3HN6A 1ZC4A 5BYKA 2DH6A 1V4BA 1GL6A 3F49S 1V1MA 5D2CA 2BFWA 2QVYX 1J5XA 1XLUA 1C3OA 4EK9A 2QQFA 1AZLA 1XK6A 4JVNA 2Q4RA 2V6JA 3E23A 4JHXA 1Z0JA 4MJ3A 4ND8A 4Q9HA 5BVHB 2QR3A 3FPHA 4IRMA 5AI4A 4DR1B 2J9YB 1LJLA 5JJCA 2C7PA 1HI9A 3TFWA 2QRGA 3WNVA 1UBTS 5A02A 5T57A 1J2JA 4KGXA 2WJGA 3ZWYA 3MC1A 3BK2A 1JQKA 2BFCA 4B7UA 4GYJA 2VSQA 3TEMA 1E0KA 1LZLA 2OZLB 1BXRA 2WQZA 4JEMA 3I62A 3EIEA 3BGDA 5IC5A 2DRIA 3JWPA 4JOQA 2D8MA 4OQDA 1UT8A 1XTQA 5HW0A 5ER6A 1X1RA 4HI0E 3UMBA 3FMIA 2GK4A 2WVGA 2YQZA 3L8MA 1JDNA 5F98A 2JGRA 3ZY3A 4BMSA 2R5FA 1QR6A 1W5AA 3FF4A 1GT91 3UJ3X 4Y9RA 3QVSA 4LWPA 4ER6A 2R2AA 2Z9CA 4DG8A 1N0WA 1CHNA 2BEWB 3U26A 4D4GA 4WKBA 3QWHA 2H51A 1HT0A 1R4NB 1KIFA 2IOFA 3EXG2 2EV9A 2A1UB 4MVYA 2YJZA 5C7OO 3IBFA 5EIFA 2QI9F 2YV1A 5D5QA 4G5FA 1W8IA 2NQ8A 2C9ZA 2WIDA 4V0NA 5TT1A 3IDZA 3SHVA 4BC1A 3F6RA 3KVYA 2F59A 3WLEA 3C6KA 4C6RA 3TRJA 2E6KA 1D4AA 1RWNA 3KP1A 3D2CA 1GKKA 3U4CA 3QU4A 3QVWA 5AKHA 1R0XA 3EISA 1C30B 1UKVY 5IMBA 3D3NA 4IJVA 1XQXA 2GRJA 3IXQA 4N0MA 1IJFA 4QWMA 3REQB 4HWTA 1E9VA 4O4JF 3LDFA 3SD7A 5FOWA 1XQVA 1M73E 3CVXA 3AUKA 3FPKA 3OOHA 2OE2A 1RYNA 5K8TA 3A3OA 3F6BX 3WK7A 2P0EA 2WWRA 1XPUA 2JIPA 2IEAA 1NM5A 3OE7D 3PF9A 1XTVA 1CXZA 4I4IA 4B6RA 5B3JC 2B99A 3QUTA 1ZISA 3OCWA 1GU0A 1OT3A 2PBRA 2GQ0A 2ZT7A 3L2OB 4XFKA 3AR7A 3BXFA 5T4BA 1DO2A 4OHBA 1ADBA 1NSTA 1U3UA 1V7QA 4AG5A 3JR3A 4CCYA 1TMGE 1LLDA 1YBVA 2I2XB 1A7JA 2H0RA 2ZWOA 4YVFA 5BV7A 4L8GA 4K9KA 3R3VA 3HFJA 4O1MA 1CE8A 3G2HA 3LIPA 3EYWA 3NGXA 4TWJA 5FDFA 3P4YA 5CT8A 3DE1X 5A06A 2O0HA 5JAMA 4WI1A 2BDUA 4Y6SA 4DTCA 3KQOA 2G1PA 1JS1X 1XI2A 3H2BA 4QFBA 4NFLA 2XT9A 2PUEA 2JAWA 4J2TA 4PPFA 1XCJA 2DLDA 3O31A 5HZHA 4AQ7A 3C14C 4OHKA 1AF4A 1C1DA 1XA4A 4DLUA 4M9UA 1Z0KA 3ZDYB 4DPLA 3S8MA 4C89A 2JLWA 1BD3A 1JHYA 5D00A 4EGCB 2O5RA 3RD5A 3S2YA 2FUKA 4YP7A 4CF6A 4XQCA 4GP6A 4ER3A 3KEGA 2EKDA 3RSFA 2XGJA 3WWOA 1V7ZA 5J1TB 4B3HA 2QBYB 4K9RA 3JS5A 3JZAA 1NR7A 1NVUQ 2FG5A 4IV5A 5TQJA 4X54A 4W6ZA 3B5EA 1CQJA 2WKQA 4KAJA 3WIBA 2PN1A 2OG2A 4C0QC 1JFFB 2KI5A 1FNBA 3H8JA 5T41A 2XR1A 4N3NA 4ZJUA 2FSVA 5L3QA 4NQRA 1FF9A 5BN1A 4GNKA 1BDJA 5CH5A 4GYKA 3LY9A 1JQBA 2ZWIA 3LCCA 4C4RA 4AICA 3DKVA 3RV3A 4LAFA 3LQQA 1TVEA 2XZPA 4DUGD 2BFEB 1EUQA 2HGSA 3QJYA 3ND7A 4A0RA 4ZT4A 1VIAA 3KR2A 4MV5A 2PS3A 4NR0A 1NP7A 4O4IB 1KMIY 2DFTA 2NQ2C 5J40A 1OZHA 2H52A 2GEJA 4O8CA 1ZICA 2NVBA 1U2GC 1L5RA 2AHOA 2JJ1A 3BXEA 4D97A 3TJRA 2UZ1A 3CUUA 1TLTA 2CBZA 4WOBA 2IY8A 3TL6A 4G41A 2P3QA 4B6EA 4EL0A 1NZJA 1JNYA 5D6OA 4DMKA 3U61B 2P78A 2P35A 1CS0A 1X74A 1QVAA 2WHRA 3N9IA 4N0QA 4C76A 4HLUA 4NU6A 4H77A 4YONB 3RJ5A 1U0TA 3EW7A 3OLCX 4EA6A 5BN5A 1VP3A 3NHBA 4P93A 4B7AA 3FWHA 5KREA 4ZOLB 4A8TA 3M70A 2OPHA 4ZMBA 1RC8A 1N2XA 2WW8A 5IYZA 3D6FA 1A2BA 2PIDA 4MR8B 9GPBA 4GP7A 4KVGA 4OI1A 5JZ9A 4INJA 1L9XA 1TVKB 4B73A 2B2CA 2LD4A 1TYEB 4OD0A 4BMXA 2RJ3A 2P9GA 3G49A 4A36A 5CLQA 4C2BA 1IG0A 2EX1A 4U7JA 1JSCA 3EDQA 4X7PA 2RHHA 2Y1EA 2UYYA 5LC1A 2PNFA 2C5AA 2OOKA 3EMKA 4MJ7A 1VI2A 3K73O 1QIHA 4F72A 1QQ5A 4G5GA 3NRCA 5T3UA 3AYZB 5CFOA 2G0AA 3JQAB 4DIOA 2WWIA 3QVOA 5KX5F 3ZVRA 3GFSA 4GLOA 4DV2B 4LNAA 4GVXA 5EJ8A 1R4AA 5FUVA 3DQPA 1RW4A 2B4KA 5BRJA 3K8QA 2V7EA 4XWGA 4N5NA 4FONA 1WCXA 4F3KA 4YT4A 2ECPA 4BB0A 3BB3A 5KNLA 2J85A 2OZVA 4LF9B 2Z8XA 2QU7A 1TC1A 5D86A 4QGFA 2HJGA 1DDGA 3BSFA 3N2IA 4RPJA 1KETA 5TMBA 1JHMA 4C7OB 1X9IA 2JLAA 4D0SA 1IH8A 2GK3A 5K3FB 3DT9A 1AXEA 1TI7A 4UTZA 2ONJA 3RK1A 2HJWA 3DXFA 1KARA 2YMPA 3AEUA 5AJYA 5ALNA 5LZ4A 5ITSA 3C2QA 4TTIA 2HA7A 1MOZA 2R8EA 4HDMA 1Y48E 2GZSA 4Q4JA 4HD8A 1BQ4A 3LWDA 4M0CA 4NX2A 2X6QA 1JMVA 4DV7B 1R8QA 5EWMB 4F8JA 2A86A 1XG5A 3DCYA 3C87A 1V8FA 5HS4A 3FYSA 3LD9A 3P52A 1NDUA 2PM8A 4C0KA 1US8B 1SCJA 3EULA 3TIXB 1OZ0A 1EINA 5FOUA 1VP9A 4Z1MA 2XRYA 2OBMA 2ZBRA 4YMWA 3ZUPA 4L22A 4V24A 1OWNA 3OF5A 1XLVA 1MX1A 2CD9A 4JELA 5TXGA 3X44A 2D0OB 4RJTA 1NMSA 4NVRA 1W5TA 2JHAA 3UKOA 5JDCA 3V3KA 3V4RA 5K01A 3MG9A 3CF2A 4B6GA 3TIGA 3UHFA 3FD8A 3JQ9A 2QWXA 2ZCJA 4JCOA 1J8FA 4W1RA 1K4KA 5JHHB 1JEQA 1BXKA 2VBCA 4UMEA 1NUPA 1XQ6A 3OQ1A 8LDHA 2FW6A 2EKBA 1O96B 2BE9A 5ABPA 4EUKA 3V2HA 2PGAA 3IALA 3AUXA 3GA0A 4HAYA 1Z6AA 5DYGA 5TQ0A 4L3WA 3VSBA 1ZNZA 2BZ1A 3S7ZA 2ZITA 1XDGA 2IF2A 1J8VA 3IESA 1N7HA 4I9HA 3WLQA 1QBGA 2Q4TA 3WGUA 1E2LA 1PFUA 3MM4A 2VDLB 4TTTS 4ZAXA 4OX9B 2N75A 1ECCA 1GPAA 4G81A 4LX0A 4R3WA 3VR0A 3CGGA 4HDQB 3G8DA 3EXFB 1P8AA 3A06A 4CBVA 3F73A 2I4NA 1LPAB 5BWMA 2BGKA 1T1RA 1RQRA 1QRDA 1KYWA 4R1NA 5AXDA 3TQQA 2QRPA 2SKCA 4J7CA 1E1DA 3LGSA 2MSNA 3TLGA 4EG5A 1RHUA 3IEMA 1WVIA 2OLKA 1U2SA 3ADCA 1L3CA 3HABA 1Z16A 1AKUA 1ESDA 2QTNA 5KQRA 4UMFA 5BN4A 1EIWA 5DT9A 2VVTA 2FPKA 2VOEA 5FHRA 2WDPA 3OZGA 5T67A 1PV2A 3AVOA 3SOZA 2QG9A 2YHIB 3KE9A 3DUFB 4BNXA 5AI6A 4B7XA 3HWX1 5CAEA 1ULAA 4WN9A 1CPYA 5HZGA 1KHTA 1JGTA 1FYVA 3DF7A 5CVVA 1YULA 2ALJA 4FZVA 2JAOA 5JCOA 1XCMA 2OO5A 4LDNA 3JYLA 3WLOA 4BZXA 3MLAA 4LXUA 5DI3B 3VDXA 2B5OA 3OJLA 3REOA 2VRWA 4D4IA 1K5GA 4GLJA 3H1FA 3HHEA 5DKFA 2G06A 3R7WA 1BFUA 1ZGZA 2GB4A 3FI9A 1E1KA 4LSZA 3THYB 4LRYA 2HXYA 3E9ZA 2GPBA 3WRYC 4DEXA 5L4SA 1QTRA 2PWPA 5AJUA 3T1OA 3K9FC 4N8EA 1C41A 3V1TC 5F7OA 1INLA 5BYBA 4L7QA 1OR8A 3D59A 2ID7A 3AERB 3O8LA 3G17A 4X20B 4CM4A 1AJEA 1X39A 1Z83A 2WWGA 4RV4A 2E1RA 3R7LA 2XTNA 2ZXEA 1ADCA 3ZVNA 2VT6A 4E5KA 1FDSA 2NYRA 1C7QA 1TK9A 4DMUB 3C6BA 3FPAA 1VA4A 1CQIB 3GGDA 2FAXA 1GFWA 3CXUA 3VU8A 3GFOA 3AB8A 1O7JA 1KMHB 3A4NA 2J9GA 3HDYA 4J0IA 4L85A 5E9WA 5TARA 4FUTA 4A82A 3U56A 1S5PA 3EH2A 3H7IA 1UMCA 3HCWA 3N07A 4KYIB 1GPJA 1SN7A 2MSLA 3P2YA 2AF4C 3WGHA 2PZFA 3I28A 3O74A 3C6MA 4FKZA 1LX6A 4XPIB 1G16A 5CNJA 5G02A 2QD4A 3Q72A 4GRAA 3T0FA 1J8DA 1RI1A 3VU3A 1V8OA 3ZGXA 5KBYA 4LF6B 3NAQA 5JCZA 5JAHA 3FYTA 3VYSB 3T6KA 1LNZA 4ZVLA 3V4FA 4D6XA 3IXMA 1F0NA 5CXQA 4LF4B 3U60B 3I5MA 5FYDA 5H7XA 4PGAA 4WFKA 5E1DA 4F1WA 1FNNA 5AVQA 1BDIA 4YRAA 2IF0A 4G1MB 1U11A 3PQEA 1MJGA 3R7AA 3D7MA 5E6SA 1XTIA 2WYOA 3Q3EA 1XKTA 1GUBA 4ESHA 5E2IA 3GMDA 2IYWA 1V26A 4QPJC 5DGDA 3IQXA 4QJIA 4RXMA 1AQYA 3GZNB 1U2ZA 2QUKA 4HR7A 5BN3B 2ZLBA 3K9GA 4QD3A 5CLHA 4UZFA 4UVHA 4G0OA 1U9CA 2PYIA 4JBGA 2TSYB 2EQBA 2QXTA 5C81A 2IH4A 4L8WB 2QR2A 1THTA 2YDYA 2QQGA 2YIDA 3LO8A 3ONNA 3A9RA 3PPWA 4QQFA 5C0OE 4K2HA 3DP7A 1HK7A 1ISRA 2VNAA 4GXRA 3WL3A 1B23P 2QEQA 3BBPA 3BHNA 5IG2A 2B1IA 5TGDA 4F1JA 2QLTA 1DLJA 1TMYA 4XQEA 3PT9A 1HSZA 4XQ0A 1F3OA 1KQNA 5BQ3A 4B8YA 3GIDA 2L82A 1P7VA 1TQ4A 1UJ6A 2BBTA 3GP3A 5FLYA 2BP7A 3VTFA 4DY6A 5JH7A 4NOKA 3UJPA 3QUSA 3W78A 4D0RA 1E2UA 3RS3A 1XRNA 4N8SA 2A0WA 1E5QA 4TYQA 3U7JA 3H19A 2KX7A 3MOGA 4MV3A 5AIAA 5KS2A 4KTVE 4OQLA 3R7SA 1IXRC 2ZM5A 4YRCA 4U2DA 4PO1A 4R8LA 1MNQA 3GLHB 1NBAA 4NPAA 3TQFA 3CC8A 3IEPA 4X95A 3EBOA 3I2HA 1ACMA 3EBLA 3LBAA 4FYPA 2V65A 3DZFA 2JFNA 2VTBB 1PS8A 1SXPA 4JP5A 1TAUA 4UD6A 4AJ9A 2AD1A 2V74B 1B3RA 4YP6A 1Z5OA 5F1YA 3RTBA 2I9PA 4ISCA 4JQSA 1JIIA 1YHZA 2DMRA 4MCAA 4ND6A 3IAFA 3I3SR 5J4VA 3PGKA 2HW8A 4UBKA 2CDBA 2QTHA 2H48A 4IQFA 5HJ2A 2XVMA 4HVLA 2R1UA 3KHTA 1BVUA 1HOTA 2FMXA 1RJWA 4OCZA 4LZLA 4WXYB 3DZBA 3K9WA 2CWDA 1KK3A 3OLXA 4R5MA 1T4CB 2AFIE 2W8ZA 3FLAA 1W5BA 2IXDA 2QN9A 5AUOB 2ZJYA 4NF2A 1ACLA 3K8YA 4A2WA 1A2QA 2FCAA 1J24A 2GR9A 2J9XB 3AFNA 3OT4A 3QHQA 4DDWA 4CPDA 4GOMD 4ROSA 4DLNA 4ZN6A 1FTSA 2JIZA 3GLRA 1GUYA 4RENA 4ZT6A 5JLJA 1U0JA 4XZ3A 4LTNA 1B8OA 3H13A 1PLKA 1T6YA 4B74A 3NCHA 1GSAA 2OC4A 3ORQA 1SCNE 1QQAA 4DYHA 1P5HA 3A6LA 3A2KA 1FW6A 1RYFA 5DNWA 3W8DA 5BV1A 4TPKA 1ZITA 3DYIA 1OTYA 2NZ2A 3L6DA 2BFBB 4BBJA 5D7NA 4KMSA 2YNMC 4QQRA 4PGHA 1TCCA 2WKPA 1Z45A 3E61A 2GLUA 2H1RA 4AURA 3FTDA 1VIYA 2C31A 2ZROA 1TAGA 4H31A 4HG2A 4IAOA 4DA6A 2IYEA 1PG5A 4MP3A 4A8JB 2ACKA 5L6LB 4JI2B 4WZBE 1S8NA 2MR5A 3L84A 1KH2A 3H4MA 4ZHQB 3NTUA 4E1BA 3TGPA 3F4LA 3T9EA 2MINA 3E1GA 3LFUA 3QU5A 2PBZA 4MGYR 1MBZA 3D8RA 1I6KA 2Y9MB 4W9RA 4AROA 4B31A 1HM5A 4AZ0A 2PMWB 5FAXA 2RKOA 2RJOA 1NI4A 1TM5E 1Q1AA 3LDGA 4M0PA 1RKUA 3Q7PA 1ZXBA 1N25A 3H16A 3PDCA 4FS8A 1JLMA 3MINB 4QUJA 4F7WA 4B8WA 3HKEB 4ATNA 2VRNA 3MT9A 3BEOA 5BR8B 2KSQA 4K9QA 4BMYA 1OXKB 1XMVA 3GEBA 3PQ2A 4XDHA 2Y1XA 3CEAA 2BGTA 4G0PA 1XJWA 3TQOA 1ZJWA 1V37A 3CRZA 4QO8A 1QZ3A 4RM3A 2P79A 1U6IA 2A78A 3UFXB 4HDKB 1NVVR 3EGDB 4D42A 1L5WA 2ZWVA 4HNAB 2E6UX 2ZJ1A 4IOJA 4M0LA 4FZRA 1H8HD 5G3YA 5A7GA 4C30A 5JFGA 2Q1TA 1J0EA 3LXXA 5CNIA 4DNXA 4EQ6B 3IKTA 3E4DA 3RRXA 3N0RA 3NUGA 4IBOA 1NY5A 2VHYA 1L7BA 2YVAA 3DCIA 3O1IC 1EB9A 3TVYA 4A26A 5HIKA 4BOYA 2AFRA 5T4EA 4BLRA 2IHNA 2C57A 1TM7E 2ANCA 4X92A 5B3JA 2OHJA 4JNKA 1V5FA 4PIVA 2W6PA 3IMFA 4C6TB 4ABTA 1DKNA 4CM7A 2JGLA 2X0KA 5LIRA 4RCYA 2AQHA 4B6JA 3LUBA 4NJEA 3QXXA 4KWCA 4XCQA 2JASA 3FDJA 4OMFG 5B6PA 5JAOA 1FNCA 4FK8A 3PC8A 2EFGA 3EGOA 3AOGA 4CU5A 2J1LA 2CUKA 3EVCA 3ITNA 3T61A 3G0HA 3NDJA 1W6RA 3CKKA 3IL2A 4RKYA 4OHRA 4M1SA 5EN4A 2IH5A 1PR0A 1SR8A 2IYXA 5LMUB 1YS9A 3SSAA 5CA1B 5K4GA 4WJLA 1N0HA 4RHFA 4HNQA 3UK6A 4V02A 3PXXA 1CFJA 3DTYA 2ODAA 1OFUA 3EA5A 3EHDA 2GVNA 3OLZA 1JLKA 3VMMA 2AG0A 2XF8A 4XYEA 1OAOC 3QFCA 5A3SA 1D03A 1M54A 1G98A 1MA0A 2MSDB 2ZTVA 4HFRA 5T4FA 1AURA 5IRCD 4DIKA 3GRUA 3SHWA 2G5PA 5EPOA 5C4GB 5K8LA 4MTCA 1TCAA 3H3XA 3VZCA 1KDOA 1BNCA 1M2HA 3FHJA 1X86B 1JSZA 1RWWA 1NLYA 1HDIA 4WK0B 4XEHA 5ICCA 1LPBB 2C9OA 1U0EA 3G5UA 4PZ9A 3FYCA 2G6BA 2HY7A 1TYBE 3AKCA 4MVJA 4FIDA 3T94A 5LZ5A 4BVLA 5M04A 2IEIA 3W7VA 3AVTA 2Z5GA 2JJ2D 3TPFA 1P33A 2QT0A 3U4QA 5ECDA 4FZ5A 2H9IA 2C84A 1T1EA 2OAP1 1VYUA 4JBWA 1X7ZB 1VRVA 4Z2YA 3SIRA 2HPAA 4LRUA 5LQMA 3B6IA 4BRUA 4YMUA 4I5FA 3SG0A 4D3ZA 2XHEA 1E61A 1BE8A 2GN1A 4AN0A 1SK9A 3HXKA 4EF4A 3L1VA 3T7CA 3HV0A 4Z9BA 3VDMA 4J29A 2XSZA 5HKOA 2X23A 2BF4A 1ZEMA 3KZXA 4U7GA 2IVFA 3IQZA 3NWEA 2XOXA 3E0XA 4Z9YA 5L4NA 2GLTA 3DEJA 5I3ZA 2IOFK 1QJCA 2J08A 3EOZA 1R18A 3MJHA 1H0RA 4JQYA 4BNTA 4QLBA 3F1LA 3EIHA 1VSTA 2RHMA 2QGZA 3GHYA 2YV2A 4OYRA 2PFGA 3SSOA 1JBKA 5IEBA 2BPOA 2BUCA 4WBNF 2AVDA 4DV1B 1JW9B 3R40A 4EJSB 3PLRA 3DNMA 3OQPA 3DB2A 4RJ2A 2NSLA 1NJSA 2ABWA 1MABB 1V3UA 3L93A 4JX8A 2R60A 1E5LA 4PAQA 3IC5A 4PLWA 2XZOA 5FRDA 4OHVA 2VPTA 2C42A 2JL1A 4EENA 5J9FA 4OL9A 1Y3IA 2GEBA 4Q12A 4EFMA 4PZPA 1TUIA 2F3QA 4XGQA 1U7XA 5BSTA 4YMTA 3NR2A 3IP3A 3PPIA 1T0HB 4IO0A 3BIOA 4CQMD 3WGKA 4B81A 2FGKA 1HR0B 3WMWA 3FTFA 4JLNA 4J3FA 3U13A 3QA3E 4WA8A 3D6HA 3WJ1A 3FSGA 2V7PA 3HCDA 3L6UA 3DLTA 3HC7A 4UUQA 4K9PA 4R16A 1UDRA 1EFVA 4RAOA 5CT5A 2X22A 4HDRA 5A3RA 2WR8A 4COKA 1M6HA 2ZWAA 4ACBA 4IKOA 3H5WA 1NXSA 3B1WA 4WNYA 1OXVA 1UMKA 1NNI1 4JGGA 4X1YA 1Y4AE 3B1JA 4L9AA 5ENDA 4D0NA 3ZGNA 3BWDD 3PIIA 2ZU6A 3U3XA 1TIKA 4A73A 1IFXA 1XMJA 2QHXA 3KOZA 4B3GA 2C5HA 4U6NA 1YI0A 4AW9A 4M9CA 4CMEC 2AFHB 4P7FA 4N47A 3FKJA 3HGQA 1W4BA 5JROA 4KC0A 4F3NA 1Z18A 2ODNA 3I58A 4J1SA 4PZZA 3FKSA 2CDRA 1NVVQ 3FNRA 3AUYA 3QBDA 1SBYA 2B4AA 4R40A 1GGHA 1S96A 2P68A 2X15A 2O2DA 3PNQA 5FWDA 5BO5A 4QJ3A 1JBEA 2QW1A 2C95A 2DPMA 1IRIA 2V9PA 3AUSA 3WQSB 7GPBA 5JCXA 2X2EA 1X80B 1ZXXA 4OYHA 4IVNA 1U8UA 1GL7A 1KQFA 4F71A 4J49A 3NIBA 1KAEA 3HP4A 4PPQA 1JSRA 1KVQA 4DA7A 1T9DA 2AKAB 3KWMA 2PQ0A 1VLLA 2XUHA 5J2TF 3LZCA 3RC7A 3T1QA 4MRVA 1NSFA 2BL4A 5C80A 3WGIA 2O1XA 2KJQA 2OZLA 2WKWA 2IUEA 1XDBA 5CJJA 5DM1A 5K8IA 4O3MA 1SD1A 2NMVA 1P80A 4R2IA 3GMSA 5CVEA 3U48A 1YB4A 4A8JC 2MYUA 3DLHA 1KJNA 1RHKA 4PG7A 3F5MA 3IIJA 4J8PA 4JLWA 5FBZA 3SYMA 1NWHA 3EZ6A 2NTVA 4HKTA 3RCBA 2WQ6A 2QTRA 2ODEA 4GPTA 3Q7RA 3L6CA 4KUHA 3D8TA 2BEWA 1B0AA 1VL5A 2FMTA 3KKOA 4ZVKA 1R4NA 3LX6A 3E9QA 4GMFA 2A1UA 4HDCA 5EXEA 1CUFA 5CYGA 3RW9A 2A14A 5I7OA 3F3MA 3LIIA 2P4EA 2VYNA 521PA 1I14A 1Q5PA 3WL4A 3HYCA 5CVJA 4UDOA 4M9RA 4Q03A 4ASUA 4ZCRA 3K31A 3MD9A 5AK6A 4JI4B 1W0JD 4FEAA 2B92A 4FWBA 1SCKA 4JL6A 5CEJA 4QFMA 4UBMA 4ZVTA 5LB4A 3SQWA 1GKYA 1KMQA 2VP4A 1MC5A 2NVWA 1IZ8A 2F1IA 3I2FA 4IDPA 1EP3B 3UB2A 3LUKA 1ND6A 1CS4C 1C30A 1V5GA 2CVHA 2HIAA 1TFUA 1DJPA 4P3OA 4ZYVA 1D2HA 2NV2B 3REQA 1UDWA 1W49A 3OJCA 4LFCB 1R6BX 2IU0A 5L95A 3GA7A 2FFHA 1FVXA 4NU0A 4HVTA 3G5MA 5IUJC 3EOAI 4BNLA 2HU5A 1EIZA 2M6SA 3WRYA 1YKGA 3JQFC 3RYIB 3X1DA 4WHMA 2C8VA 4ZCMA 1GTVA 1O57A 2GCIA 3LWZA 1ILWA 4GI1A 4MUKA 2H5EA 1Y8CA 1M2EA 3QIAA 4WXMA 2MIIA 3TLBA 4YMLA 3STWA 3HJHA 1JQEA 1RIIA 4HNUA 5AK3A 3GPLA 4XIJA 3UV6A 5K4HA 3GMTA 2GTIA 2OHOA 4FNOA 5EEGA 1XPOA 3NBQA 4KK3A 1HTBA 4PYOA 4G2NA 2D2IA 2X6RA 2BSQA 5I7EA 4BQRA 4M7OA 2HI0A 1SRQA 2WQ7A 2UUPA 3INNA 4BXOB 4MSUA 3N05A 4UHHA 1PEAA 4V0KA 3VR5A 1Y7HA 3T06B 1F7VA 1TPYA 2QROA 1DEAA 1ZR4A 3G7UA 3OJOA 1JFLA 2H5JA 2TS1A 4G67A 1PFWA 3N87A 2QPLA 3INTA 3K6KA 4HMOA 5EUBA 4UFNA 4CTNA 4UBOA 1U2EA 5HQTA 5AI0A 4G07A 4F2HA 3CN7A 1IEQA 3FNEA 2QBYA