3L43A

Crystal structure of the dynamin 3 gtpase domain bound with gdp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
242
Chain Sequence
QIAVVGGQSAGKSSVLENFVGRDFLPRVTRRPLVLQLITSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Dynamin-3
publication title Crystal structure of the dynamin 3 GTPase domain bound with GDP
rcsb
source organism Homo sapiens
total genus 69
structure length 242
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l43A00
2ZE7A 3S1AA 1W36B 1SVOA 4IOJA 4IFBA 4JLMA 3U4QB 3EXAA 4LBZA 3U6KA 5LB4A 2ASEA 2VSXA 4QJ4A 1VYUA 5P21A 3LXXA 3BORA 3QQ5A 4PX9A 2O8EA 4WXRA 1Z22A 4JVSB 4BLPA 1TF5A 4HZUA 3K0CA 1LV7A 3VU9A 3U44A 1KI7A 2MSDB 3FGNA 4DCNA 4KAXA 5BXQC 1Z63A 4BLOA 2CL6X 5HTKA 1Z29A 3AF4A 1II0A 2F1HA 2CE2X 3KXIA 3TUZC 2IEYA 2G83A 2XJ9A 3D31A 5C4GB 1NRJB 1BMFA 2LKCA 5HCNA 4QG7A 3LLUA 2KE5A 1OYYA 1T3SA 2RGXA 5AJXA 4BFVA 2IT1A 3CWQA 3QXCA 2IUSA 4NCKA 2BEJA 5EE5B 4I81A 4PC7A 4AD8A 4AKGA 4E09A 2O8BA 1JB1A 4HEJA 1JPJA 3SC3A 4AI6A 2ZYUX 2BM0A 2BM1A 1FQJA 4M1KA 3U2QA 5FTMA 1DAEA 4ZKEA 4Q1DA 1E1RA 1G20E 1YKSA 4P4SB 2XTMA 4QXAA 4JLKA 3L0OA 1G16A 4WXPA 1S0UA 3A1UA 3LV8A 3K09C 4GPTA 4JT4A 4I1OA 2IW3A 2V3CC 3GFOA 4LHYA 4MRSA 5FTJA 1E2NA 2Z4SA 1G3UA 4FMDF 2OE2A 1AZSC 4NCNA 5J47A 1E2EA 1XBTA 2I1QA 4HUTA 1J2JA 5FOSA 3K0FB 2AR7A 3WP0A 2C95A 3CPJB 4LHWA 2ODBA 1UBEA 2F1IA 4D25A 2O8FA 1XTJA 3X1YA 2DWOA 1US8B 1EFCA 3TAHA 3X1DA 2QMEA 2DB3A 4CEIB 2J0UB 3ZVMA 2J45A 1FW6A 2ONKA 3K0CC 2ZUDA 1MT0A 2A5GA 3A4MA 2XZOA 1Z5ZA 4A9AA 4PFSA 1A7JA 1A2BA 3I8XA 3W6NA 2G6BA 4UJ5A 2IXFA 1LF5A 2O52A 3O47A 2JJ2D 2ZAMA 4P4TA 2GESA 3SJZA 4EDHA 5C4MA 3LO5A 1N6RA 1OIXA 2DFLA 1EFRD 4RFSA 3AB3A 2WAXA 5CDFE 2H7VA 3LDAA 2DFTA 2RAPA 5CB6A 5CLQA 3ZDQA 4KHZA 1MV5A 1DAIA 1F2TB 3EIHA 1W0JD 3JVUA 5FTKA 1QHXA 4DKXA 2P67A 1OH7A 4XJXA 2MSEB 5G3ZA 4PPQA 3WRXC 4CEHB 2P6RA 3LW7A 2ZS8A 4LJ4A 4M9ZA 2HJGA 4HZIA 1II9A 2W2XA 3UKDA 3IDQA 1E96A 4Q4HA 4ON9A 4TSFA 1W5TA 2A30A 2F43B 2PBRA 5E3HA 1W0KA 2GCPA 2WOJA 3TQFA 1HA3A 2VSFA 2OESA 2YWEA 3JZAA 3R20A 4URUR 2BEKA 3Q9LA 5GJVC 2Z43A 5JECA 2G0NA 1Z06A 1Q12A 3GEEA 5DO9A 4PSAA 3FHOA 4MGZR 1EGAA 3AKEA 4M1TA 2WPDA 1NKSA 3CRW1 1CLUA 1QHHB 1DAHA 2JCSA 1U0JA 3QIAA 2BMEA 2GAAA 5L3QA 4EJSB 3KFVA 1KJZA 2GF9A 1XXHE 1YZNA 3KKOA 1ZM2A 4MYTA 1FUUA 1QHSA 2QPOA 3QPUA 4B34A 1NMYA 2N46A 1XPUA 5DHAA 1XEWY 2IYLD 2BMDA 1SQ5A 2ATXA 2J7KA 1ZC4A 1RVDA 1Z2CA 2IHYA 2WMOB 4AK9A 3M1IA 4OI2A 2HYIC 2JA1A 3GP8A 1DOAA 1WMSA 1N3BA 4MUBA 1RC8A 4TL8A 3THWA 3RC8A 4BFTA 1BMFD 4KYIB 5EJEA 1Z0DA 3I5XA 2REOA 2QMUA 4OBEA 5FUWA 1ZD8A 2DWPA 1EFHA 1KDOA 4R98A 1E4VA 3I5YA 2QN6A 3SJBA 1NVXQ 4U5XA 3ZQJA 4R2HA 1UPTA 1QDEA 1E1RD 1AGRA 4MYUA 2D62A 1OXXK 4OK6A 5SZKB 3AGPA 4US1R 1S3GA 2Z5FA 4TMZA 3VHXA 4DLZA 2ZJOA 5C18A 1F60A 1LTQA 1XX6A 1ZRHA 2Q0HA 2WSSA 5H70A 1U99A 3BK7A 4PO1A 3GJ4A 1IBRA 4A1FA 2G88A 4V02A 1HTWA 2OXCA 3TSWA 4TMVA 1CJMA 1OT3A 3GCGA 1HE1C 2DHRA 3H86A 3GD7A 3OHMA 1Z28A 3EPLA 1AQYA 4OYHA 3UANA 3P4YA 3N2EA 1ZUHA 4A36A 4MRNA 1JEDA 4AURA 4AWXA 1TU4A 2ZRFA 3KJHA 2C77A 1M34E 1E9SA 4W5JA 1OH5A 1UEIA 3T5DA 5K8LA 1I2DA 1LF0A 1E9BA 1E2QA 1SZPA 2BVNA 1KK2A 3VR4A 5GADl 1NJGA 2B21A 4KFUA 1KMHA 1Z0AA 2J1LA 2YJTD 3H1TA 2Y8EA 2AKAB 1GFIA 1W1WA 2A3RA 2FDCA 4MDFA 3WMFA 3W8NA 3U6BA 2ZE8A 1SXJE 5EE0A 2VHJA 2X19A 4Q66C 2NOAA 5JRZA 2PEYA 3BFXA 4PSKA 1Z6YA 1KK1A 5K8UA 4Q02A 1DVRA 1R5OA 4TSFD 1LVGA 1VKJA 3QXSA 3K70C 1DO0A 1W0KD 1ZW6A 4JL8A 4EQ6A 4R71A 3PCRB 2FE4A 1CTQA 3SDZA 2G77B 4D4LA 4RD0A 3W5IA 4Q9KA 3AP1A 4YMTA 3H2YA 3ADCA 2WPDD 4DCTA 1XPRA 3DVLA 1GKUB 2WJJA 1T0HB 3TVTA 2VHCA 3UATA 4PANA 1VG9B 4AG6A 1RPZA 2VP2A 3C5CA 1EXMA 1DADA 4ZCMA 1R2QA 2JLUA 4G3XA 2GDJA 5AUNB 1QHYA 2DR3A 2P2LA 3D6TB 4P4SA 1M1YE 3P26A 4UJ3A 4PZYA 5HR5A 1YVDA 2ECKA 4HUQB 2GXAA 2VBCA 2YYZA 4TLDA 3B1XA 1Z6AA 4G1UC 1W4CA 1GL9B 5EP4A 4C7OB 4PZZA 4WZAE 1JAIA 4TMWA 2QTFA 4LZZA 1NIJA 4MRPA 4QBHA 5JCZA 4XD7A 1U0LA 5EXXA 3D3QA 3RAPR 2E1RA 3PIRA 3B1YA 3OAAA 4CEJB 3UXMA 4IVRA 4GRAA 2PMDA 4DCUA 2HT6A 4LJAA 1W36C 2BKUA 1AS0A 2ZRKA 1MO3A 3NXSA 5J4YA 2N1BA 3WYGA 1XMIA 2XNDA 3HDTA 4WA7A 5LB2A 1US8A 3CLVA 3LA6A 1KZ7B 1NI3A 1JJVA 2F1RA 4IXNA 5JI3E 1N6PA 3AVTA 4CEIA 3B6EA 2J0UA 2BMFA 4RJLA 2XITA 2GXUA 2AFHE 1KO8A 4XOIA 2PL3A 4RD1A 3CR8A 2RHMA 4QHSA 1FMLA 2ZI9A 4BWYA 3K70D 4NBSA 3VMFA 3RHFA 4C0BA 1NF3A 1P5ZB 1Z47A 5DE3A 1IY2A 2HYDA 3KJIA 4TMKA 2WSSD 1QHGA 4PAQA 4Q01A 4PPNA 4EPTA 3R9WA 2W0SA 3NBZC 1A82A 1PLJA 3BD9A 2J59A 1SVIA 2QMHA 3CONA 5CK5A 4C0LA 2LWIA 3R9IA 2D2EA 2F9LA 2UVQA 2Z83A 3CIOA 3KKNA 3PEUA 3EZ6A 3N5CA 4GOJA 2G1JA 1NP6A 4L5BA 1F2TA 2ZRAA 4M1SA 4CEHA 3LBHA 2O8EB 2YC4C 1YZUA 1P2VA 4V0LA 3IBGA 4LYJA 4V0OA 4P32A 1N25A 1HURA 1OKKA 1OYWA 4GT1A 3A1WA 1IXZA 4QC2A 5FL3A 3LAWA 5SZJA 5JEEA 3OEEA 4WIAA 3LXRA 2CHVA 1RKBA 3CH4B 3DKPA 3CPEA 1XTKA 4NONA 4OQLA 2ZUBA 4E03A 1C1YA 2AKYA 2D74A 4JT2A 4TL9A 4BFYA 4ZPXA 4LX0A 2IL1A 2QGZA 2WVJA 1OLOA 3ADDA 2C96A 2FSGA 1E1QA 1R7RA 4P33A 2KWIA 4NDZA 2AXNA 2HLDA 2GK7A 3L2OB 5EE9A 2WIBA 2GEDA 4DEXA 2ZJ2A 4PHHA 1KI1A 3W8RA 1QHHA 4LCBA 2VP5A 1G19A 3GLHE 5J4KA 4EJSA 1NVVR 3QY0A 4D0GA 2O8DA 1PJRA 1UBFA 3EZFA 3QUSA 4LOAA 4PXAA 5B57C 1ZIOA 3KTAB 3CF6R 4XWKA 3FVQA 5HZHA 2JAQA 3B8HA 2CEAA 1XZQA 2KI5A 3AVPA 3VR2A 1GUAA 1NBME 2CVFA 2C78A 4N1AA 1VMAA 1Y3AA 4NPHA 3PUYA 1FX0B 3HP1A 4FMCB 4OHVA 3PUWA 1IHUA 3TRFA 1FQKA 3LVRE 2D2FA 4PSVA 4D4KA 3QG5A 1YRAA 1DG3A 1FMJA 1E99A 4IDPA 2JIZA 3HU1A 4C0AC 2ZUCA 3HU2A 4JVMA 4Z8YA 4ZCLA 1OH6A 1R4AA 4HI0E 2IWRA 5IHPA 4TMXA 2AK2A 1JQJC 4N0DA 1U9IA 3UMSA 3NH6A 3U60B 3SFZA 4ZDIA 4M21A 2B7CA 1FOEB 4AYXA 5FPSA 4EFNA 3DZDA 3QXHA 5KNDA 4DLSA 5FBQB 1YJ5A 1HY3A 3UG6A 3GLGE 1TQ2A 5FOTA 4B3GA 2W58A 3WRYC 3LFUA 4XWOA 1G9XA 1S2MA 4URZR 4XD7D 1G5RA 1W4BA 3OAAD 1E2PA 1IAQA 4G5RA 4US2R 1RYFA 3AQ4A 3GJ0A 3M6AA 1QVAA 3LLMA 1JJ7A 2IXGA 2AD1A 3A36A 2JLZA 1JEEA 3A37A 3VR1A 4B74A 2WSMA 4ZIRB 1TUEA 1E9RA 1ZU4A 2XNDD 3EARA 4A2WA 2XX3A 5KPDA 4GFDA 1N6LA 4KFSA 1XJ0A 4YMVA 1IONA 1UDXA 2QL6A 5EQTA 1XMSA 4EJSC 1D5CA 1VYTA 4Q4HB 1PVOA 3RS7A 2WAYA 4PZLA 1L7VC 2ZROA 1JXOA 3SN6A 4UXJA 4GNKA 1X3SA 1H8EA 2FH5B 4DC9A 2QP9X 4RD2A 2CBZA 4FIDA 4R7ZA 1E2FA 4ZO4A 1XF9A 1XEWX 1KDPA 1E0AA 4BLTA 1T8UA 4IVQA 4QGAA 4NYIR 1J99A 1F5NA 4UNQA 2A5FA 2BJVA 2GCNA 3NKVA 3DOEA 3SBEA 3X1XA 1TMKA 4II7A 3AUXA 5KYKA 5DIFA 2V8OA 1S1CA 1B23P 1LFDB 1TADA 1R0YA 2YKGA 2NO9A 2FNAA 1IY0A 1VECA 1XCGB 2PX0A 5L3QB 1S4QA 2ZYWX 4F93B 2OLJA 1G6HA 1U9IC 1TUIA 1OKKD 1RJ9B 3CF2A 1ZM3A 3L8ZA 4Z51A 2VP6A 4DLUA 1L4UA 4HDCA 5FBRB 2FSHA 3SQXA 4RVCA 1KK3A 3OEED 3MWJA 4LHZA 4LV5B 4GP6A 4HB0A 2CE7A 4A92A 4NE2A 4CGZA 2W6JA 2R65A 3FPAA 4EFMA 1GILA 4KXFB 3ZVNA 1Q20A 1KTVA 3FFBA 3BH7A 4JLOA 4JIMA 1E1QD 4QJ5A 3TR5A 1Q3HA 2QMOA 1BIFA 3C7KA 1AN0A 1OXUA 3EA5A 3OIYA 4FMCF 2HLDD 4XWAA 4F91B 2GZDA 3GFTA 2KB0A 3C41J 3VNVA 2BV3A 4HB4A 2R44A 3K0AB 4JZKA 2IYTA 2W83A 2QQEA 2TMKA 3A8TA 1CU1A 3CRVA 4TN1A 3KQLA 3MJRA 1RRPA 2GZAA 3BXZA 3KB2A 1UKVY 4URWR 4HDQB 4IVPA 2E87A 4Q1CA 4BFWA 2QI9C 4B75A 2J5XA 4C7OA 3RWMB 1KI9A 3DEFA 4JKIA 4G5QA 3ZZUA 4DLVA 3VX4A 2YHSA 4Q1AA 3UWKA 2ZRPA 4DB4A 4TQAA 1U98A 2J0QA 4FWIB 4A0GA 2X8AA 3ADKA 4EIWA 4P3YA 3FWYA 2CMKA 3PUXA 5KO2A 1XPOA 2JIZD 2Q9CA 1Q1BA 3EPJA 1KIMA 2OUKA 4L16A 4UNSA 1IXSB 4Q03A 3SYLA 1P3JA 1W2GA 3LH5A 1G6OA 1U8YA 5IF9A 3ZS9A 2ZM5A 2FPKA 2HF9A 3CB4A 3AVWA 1CXZA 1U0HC 2QPAA 4JLDA 1AA9A 3GLFE 3KXLA 4TLEA 4M0LA 3N70A 1SHZA 4IDNA 4BZQA 3I3SR 2DWQA 3NDPA 3RDPA 3VFDA 3T12A 2ORWA 4QGFA 3MUFA 3CX6A 1UADA 3MWKA 4UXHA 5F9FA 3QOFA 4M9SA 4PAOA 1QBKC 3ZD6A 2RGDA 2YOFA 4DLRA 1M7HA 5HZKA 4S35A 3TSOA 3WY9A 1S96A 3ASYA 3X2SA 1P60A 2ZSAA 1CP2A 2FWRA 5KUTA 5F9HA 3B7GA 3FKQA 1W47A 4D0NA 5AR1A 4CRWB 3QBVA 3CF0A 3E2IA 4KODA 4AG5A 1EWRA 1T4GA 2XNSA 4QM6A 2J46A 3KX2A 3SS8A 4EQ6B 1CR0A 4CYMA 1H8ED 2CVHA 4DHEA 1G291 3QKRB 1G1MA 1R6BX 3THYB 3VTKA 4Z54A 2XOKA 3I61A 3WNCA 2XZLA 2VF7A 3IHLA 4OK5A 2IK8A 1G18A 2VHUA 2FEMA 1N0WA 2A2ZA 4PQYA 1P2UA 4QM7A 5FPHA 5D3QA 1M6NA 4LDJA 4DWJA 2ZJ5A 1QZXA 4RSGA 2JLYA 2FGKA 3RS0A 2ZJYA 3WYAA 4U02A 2OZEA 3LVQE 2IYYA 3QKUA 4OJKA 1UBGA 5AUPB 1NY5A 1Z3IX 5AK0A 4JYBA 2ZI6A 4ZI2A 1R0XA 3KTAA 2DPXA 1GITA 1VCMA 2HV8A 4HB2A 1SVMA 2OFOA 3OESA 3BB4A 2A7QA 4EFLA 4HLUA 1NN0A 3TNFA 3KZ1E 2W6JD 1FX0A 3IQXA 1IJFA 1RIFA 4LPSA 4QOSA 2YWHA 3EIQA 4JBYA 2PX3A 4RCZA 5JMTA 4YONB 3MSXA 1WB9A 1OHHA 4GDFA 1Z83A 2XAUA 1T8TA 4M9QA 1OFIA 1OFUX 2GVDC 1IN7A 2JLVA 4V0NA 1G8HA 2FJUA 1VCNA 2HEIA 2R8RA 1HQYE 2ZSFA 4D6PA 5TMPA 1C4OA 4TLCA 4ACBA 2PLFA 2B8TA 4YMWA 3U7FB 3DPUA 4PO9A 1N5JA 4PQFA 2ZRBA 4ZI3A 1UKZA 5KSZA 1ANKA 1SKYE 2J87A 4ITRC 2V6IA 3PJRA 1KSGA 1NVVQ 1XWIA 3ZS8A 2ZI4A 5HE9A 3E5HA 4B3XA 4YMUA 3HU3A 1G8FA 1AJEA 3GJ6A 2B8WA 2QNRA 3W5JA 1TL7C 4AY2A 1SXJB 4ABYA 1CIPA 3WYFA 3RWOA 2A5DA 2KJQA 1S9HA 3QKTA 2VRWA 1XEXA 5B58C 2QAJA 2FV8A 2ZJAA 3GEHA 4FXPA 4X8HA 4ZIRA 2IS2A 2GJ8A 2PCLA 1W4AA 1KSHA 2FZLA 3AP2A 3C15C 4L9SA 4TYYA 1DE0A 4PPFA 1Z6GA 4LV6A 3MWYW 3V9PA 1Q1QA 2GEVA 1S8FA 4GP7A 3X1ZA 2HXSA 1T5LA 2EU8A 1E0SA 4P4UA 1NMZA 3CRMA 1ZM9A 2AN9A 2QP3A 1EG7A 2WKQA 3ND8A 4RD6A 1XD8A 4D4MA 1TU3A 4WAUA 3OIWA 5FBVB 1G3IA 2V55B 2ATVA 2VHQA 3AKCA 3GJXC 3EAQA 2PZGA 2V1XA 1PV4A 4C0QC 4HLUC 1BS1A 4L15A 4LBVA 4KYUA 2VF8A 4GZMA 1XNJA 2GZHA 4DJTA 3W6PA 5KSOA 2ORIA 4LJ6A 3H84A 4M4SA 4MQBA 2BOVA 2RMKA 5DI9A 1R8SA 1KYIA 2PT7A 1Q57A 5KTYA 4B48A 4BRWA 3KDSE 3DMDA 5C2JB 4BRUA 1TTTA 4PC6A 1CKEA 2ZRNA 2ZRJA 5BN5A 1KO5A 4ESVA 2O8DB 4IEEA 4AKIA 2C9OA 3BOSA 3SJAA 3I32A 5JFGA 3FHTA 4AC9A 3PVSA 4F4CA 5JJIA 1SHKA 4TQ9A 1RJ9A 2EFHB 3IIMA 1NSFA 4MUAA 3NEYA 4KLZA 1VHLA 1NG9A 3ADBA 4LC1A 2ZRMA 5LDDC 2NPIA 4UXIA 1GIAA 3Q8XB 2KBFA 4CIDA 2OV2A 2W6IA 1JAHA 2XOKD 3AF0A 3DMNA 1Q44A 3QG1A 5J5CA 3ZD7A 2Q21A 2AWOA 4QL3A 2IF2A 1E2IA 4Q7JB 4KSCA 5G40A 4B3BA 2OILA 1F6BA 3QJYA 2XZPA 1KNXA 3IO5A 2EYUA 3VR6A 2ZITA 1DAKA 4NYIQ 4DB2A 1KKMA 1K6MA 3GQBA 4DT1B 1G5TA 2PCJA 5ANRB 4NZYA 3K0AA 3LY5A 1R5BA 5EZ5A 4HDOB 4X8LA 4B73A 3NEJA 1G64A 3QXJA 5IT5A 4AIIA 4K81B 4AKEA 1EK0A 4A4DA 2GEUA 1FFHA 3GJ7A 3CNLA 3I8SA 1UKEA 5G53C 2ZRCA 4X8MA 1IN4A 1Z08A 3I4LA 5CDFA 5SZIA 4ARZB 3FMPB 4MITA 4EPYA 2QRZA 1GNQA 4JMPA 2GTPA 2R6AA 2JDIA 5FOVA 4YDSA 4CDGA 121PA 1E9FA 1N5KA 4LV8B 3EZ7A 3MGCA 1D2NA 3AKDA 1OHHD 4D82A 3RABA 1M74A 3P4XA 1ZNXA 1VIAA 3C16C 4MKGA 4P0TA 4PQRA 3DKVA 4RD4A 5DI3A 3BERA 3AVUA 1DELA 1OXSC 2IBMA 4OQXA 5IK2A 2F7SA 4ILEA 1CR1A 4EPRA 1SGWA 1UM8A 5G3YA 2ZS7A 1CBUA 2DBYA 4M1WA 1EESA 3B85A 1KGDA 1LW7A 3DM5A 4IOMA 4B43A 3PITA 4PR0A 4RD3A 2IYVA 1NIPA 3AEZA 5C1BA 2RKOA 4PAMA 3BGWA 4A6PA 2MSCB 5EP3A 3GLHB 3DOFA 2ODNA 5EP2A 1XXHA 5DH9A 2D7CA 3MJHA 3KUDA 1P9WA 1YRBA 4LJ5A 2R2AA 4LJYA 3CR7A 1ZU5A 4ERNA 2L0XA 4A0RA 5EXSA 3TUIC 1FP7A 1LY1A 3UG7A 4TLBA 5H68A 2VA8A 4OHWA 3SYNA 1CR2A 1EX7A 4RY2A 5FOWA 1GNPA 2ZI7A 2Q3MA 3AV0B 3QKRA 1T3LA 3GFPA 3THYA 3GLIE 2WOOA 4QFMA 4D0LB 2A9KA 2J0SA 3WMEA 3L0IB 2IYXA 1YZLA 4HLDA 3FMIA 2NO6A 4RZUA 4NYJR 1GSIA 4DZZA 3P27A 5KPJA 5FH9A 2VTKA 4JBXA 1AS3A 3K53A 1E9AA 4FD2A 3IUYA 3LX5A 2HXYA 1RRFA 2FFBA 3QSYA 2IS4A 2QBYB 3RYTC 3WNDA 1NLZA 4LYAA 3NC0C 2B7BA 3GLGB 2IS6A 4BUJA 5E7IA 4A82A 3KJGA 2H17A 3KQNA 2H1LA 4TYNA 4KV9A 4TZ6A 1N0VC 3Q3JB 3Q85A 3WHLA 5TARA 1D2MA 2YV5A 4JL5A 3A4LA 2OCYC 3QF4A 2PH1A 4TQUS 3G0HA 2W6ID 1E32A 2WHXA 4AYWA 4UNRA 1ZVQA 1FUKA 1KSFX 3W90A 1JPNA 2FN4A 4Q1EA 1QG2A 1K8RA 5JHGB 4QKQA 4BGDA 3RNLA 3NVAA 4HAYA 4ASUA 3OF5A 1GRQA 1XMVA 3LX8A 2DYKA 3UMFA 4AKHA 4QHTA 4R2IA 2ZRIA 2QTHA 4MDEA 2ZPTX 4KFRA 3T1TA 1OF1A 1OV4A 1RFLA 3FDIA 2D3WA 2WWHA 1YZKA 2DCUA 1WA5A 2GILA 2VP0A 2WV9A 2YNMA 3NTUA 4U00A 5CYPA 3D7MA 1KI3A 2WICA 2AHOA 2O0KA 4E22A 1GP2A 5J4LA 4URXR 4I1UA 5DNYB 2YINC 3REFA 1CRQA 4WOPA 2IYUA 4BLQA 1Q22A 2J3EA 4JLBA 621PA 2AL7A 1SXJA 2QRNA 3EA0A 3KB1A 3Q5DA 4DRZA 2VEDA 1QF9A 1V43A 2IS1A 3F0TA 1MABB 2JDID 3TSZA 2GWHA 1XDBA 3EASA 4TTPA 4DDWA 1W44A 3T5GA 2C5LA 4B3DA 4IDHA 1DEKA 1CJVC 3VNUA 1WXQA 2ZJ8A 3KFXA 2FFHA 1GWNA 3T61A 4DSTA 2RHDA 3DZ8A 5CYOA 4HLCA 1GL7A 1WRBA 3J81k 3PEYA 4E5UA 1OSNA 1U94A 5GVSA 5JRJA 2EQBA 4RZ2A 3SZRA 2IEZA 1VG8A 3MCAA 5IK2D 1JR3E 3C8UA 2P65A 4FI3C 1YE8A 2FEOA 3W3AA 4Q18A 4IEIA 3SE0A 2GETA 3W3ZB 1E2MA 1S1MA 4OI0A 4OHYA 4GBMA 3IEVA 4D80A 5FOXA 1ETUA 1R5NA 4WW0A 4D81A 3U7HB 2O5VA 3IQWA 5FI0B 3B5JA 4G01B 4D4JA 1IXRC 2IX3A 4QBIA 4QNMA 1AGPA 3LW8A 4NL4H 2EFGA 1ZIPA 2GCOB 4MH0R 3FE2A 2GKSA 1FL9A 2OO7A 2OLKA 2ZJBA 3O8DA 5F3WB 3PEWA 3U3KA 5J4HA 1M7BA 4NCJA 1YU9A 3H0KA 5FL7A 2FF7A 4B47A 2ZANA 3KJEA 4Q4AA 4LSGA 1NN5A 3TW4A 4TMTA 1Q3TA 4POAA 2QE7A 4ZDJA 1FNMA 1G4UR 2YOGA 2WKRA 1CR4A 4P31A 4GZLA 1X1RA 2UKDA 221PA 3HJNA 3PXGA 3IPYA 3O8BA 6Q21A 3WHKA 3L43A 4OQMA 1SXJC 4JLPA 1EX6A 3KXKA 4B2LA 1BYIA 1VIYA 4BFXA 1U90A 4DUGA 3BH6A 5SZHB 4M53A 3IO3A 4NYMR 3LBIA 1OH8A 2I1VB 821PA 2NMVA 5B64A 3K1JA 2H18A 1PUJA 3CZPA 3GLFB 4DT1A 5J40A 3AVOA 3DM9B 2F1JA 4NP6A 4NTZA 1E79A 1G5PA 1JQLB 3AF2A 3LQRA 4V0ME 4B71A 3QI2A 4U7DA 1HH4A 5JJLA 1SVKA 5FFMA 1MH1A 1ONBA 2JLQA 4Z8XA 2JLRA 3AP3A 2P6UA 3VR3A 2YWGA 3T35A 3LQQA 1OB5A 3UIEA 2ZI5A 3CW2A 3EW9A 1KNQA 3CX8A 2P0EA 3T15A 3RS5A 4ARZA 4KI0A 3THXA 4RKFA 1DG1G 3TH5A 3NG1A 2JASA 3QEJA 4GMXA 1B0UA 1XEXB 5AJWA 2JJ1A 2FSIA 2ZVQX 4ASUD 1Q1ZA 3ECCA 4FCWA 2F9MA 4XTRA 2C9CA 2P3SA 4RFVA 4TYQA 4ZKDA 4OL0A 4QGHA 5HCIA 4FWTA 4E07A 4W5WA 3QPVA 3G82C 2AXPA 1N6KA 1P61B 1Z0FA 3AF1A 1P73A 4DCSA 1CJKC 3BFVA 1E9DA 1OFTA 2EWWA 3OEHA 1E69A 2HCJB 1KY2A 1KI8A 2ZE6A 1AZTA 1XB2A 1EFUA 3D8BA 3IIKA 3ND9A 4NH0A 1XCPA 2QEQA 4LBYA 1MOZA 3BE4A 3A1VA 3IHWA 3NC1C 3VHLB 5HPYB 3B60A 3CRQA 3B13B 1JI0A 4I99A 1E3MA 2DFKB 1SXJD 2HDNB 5UKDA 4GI7A 3CRRA 2CCGA 4IFEA 5B30A 3MAAC 4Q9JA 5G41A 1GAJA 1WP9A 1KI2A 1XD9A 2GJAA 2ZETA 3GLHA 4M2LA 2Q3FA 3ZYCA 2BKEA 2E9SA 3SFVA 4PO8A 3FKSA 3UMRA 1KI6B 2WM9B 2HF8A 2VIIA 1WE2A 5DISB 1PLLA 2GBLA 2Z0MA 2QSYA 2XB2A 1ESMA 1AKYA 3NHAA 4IOLA 5LBIA 5KNCA 1A5TA 1L2TA 4WZBE 4ZDWA 4BEJA 1U8ZA 2ZI3A 1J8YF 2VH5R 4MRRA 3CH5A 1E0JA 1NBMA 4LPKA 3RC3A 2GJSA 4UKDA 3SR0A 2RGNA 1KHTA 2VLIA 4LHVA 4Q4LA 1XCMA 5TV2A 2RGGA 1ZCAA 3MFYA 1W4RA 1W5SA 3KKQA 1IY1A 2R6FA 1W49A 2QY9A 1ZJ6A 1YR8A 2RCNA 2Q9AA 4HB3A 2YWFA 3ZIAA 2NTYC 2C98A 2WJVA 1F2UB 1N5IA 1UF9A 4V03A 5KHOC 1ZYUA 1XD2B 4US0R 1V5WA 2CLSA 1Z6TA 3EWSA 3O8RA 2VO1A 5EXPA 3GJ8A 3DDCA 4MA4A 4EKDA 4FW9A 2ZREA 2QBYA 2PJRA 3GLGA 1PLKA 1XJCA 2BBWA 5FL7D 1T6NA 2OCBA 4F4JA 2W00A 3K9HA 4JBWA 1UBCA 4OI1A 3BAFA 1G3MA 5FOUA 1RRCA 3B1ZA 2QE7D 3A4NA 1MO5A 1VCIA 1KKLA 3U3RA 2OT3B 4FN5A 4N0EA 2XXAB 3K9LA 1T91A 2P6NA 2EYQA 1AM4D 4TLAA 1NY6A 4IKEA 1NG1A 1W46A 4B3FX 1FPMA 1E2LA 2R6CA 1D9XA 4DUGD 1TPZA 1XZPA 2IUTA 5FBWB 1Y63A 1FTNA 2XSZA 1IN6A 3L8YA 5F2EA 4JLVA 1TX4B 2V6JA 5E7MA 3R7WB 3RS4A 1GM5A 2I3BA 3CZQA 4OQNA 3X1WA 4NYJQ 3SOPA 4F92B 2GBLC 2WZQA 5DI3B 1E79D 5JCPA 1A2KC 1UAAA 2RGBA 3IKJA 5D3MB 5E95A 4URVR 4EUNA 4A8JA 4DSOA 3SI7A 2JLWA 3HPQA 2RGNC 4TZ0A 1AS2A 2GHIA 1SVLA 2AX4A 4L4UA 4Q7LA 4WVFA 3WMGA 1NNEA 3F5FA 1AK2A 2ZVPX 4BLRA 4DCVA 2KBEA 3FYHA 4F4IA 1TF2A 5EE3A 4URYR 1D6JA 3C4JA 5EUMA 5JS7A 1P9NA 1E2JA 2JJ1D 3C14C 1MABA 2QAGA 4IDOA 4KFTA 2N42A 2WWIA 3GJ5A 4NCIA 2Q9BA 2CHGA 1KAOA 2GVZC 4KSBA 4Q5IA 1N0UA 3IPXA 4I4LA 1XXHB 1TAGA 2LKDA 1HV8A 2ZU0C 1DS6A 4HAUA 4EPVA 1I4LD 2OSBA 4DLTA 4Q4JB 1J8MF 5KDDA 2UZIR 1DAFA 3U61B 2YZ2A 2SHKA 2IXEA 1OJLA 5J4VA 4O25A 3OE7A 2ONJA 5DGXA 5CLLA 1YR6A 3OEHD 4TTRA 1Z0KA 2XJ4A 3JVVA 5JHHB 1QHNA 1R0ZA 4A15A 4MKHA 3QKSA 1YZTA 1QRAA 1I4TD 1PUIA 1VTKA 4KVAA 4LK2A 4JKYA 1Z6XA 3FMOB 4ZCIA 2OHFA 1TQDA 1Z8FA 5FTLA 1TQ6A 2GCOA 4OJQA 5DN6A 3QVUA 4NKRA 2EFEB 3I62A 3ZH9B 4JVNA 2X2EA 3AVYA 2AWNA 3BJIC 4OHXA 4XIGS 4YLGA 3SNHA 1VDZA 3VKWA 2RGEA 3FKSD 3QVVA 5EE1A 3ICQB 2O0HA 4DVGA 1WBDA 2ZYTX 4R9UC 5FPYA 1SVSA 3KQKA 3EIEA 2OEPA 5CJPA 3OFNA 1U2RA 4RZ3A 3GPLA 4BFSA 2R6DA 2ODEA 4K8OA 1NBMD 4O2LA 3R8CA 4A8JC 2XGJA 2IYRA 5TY0A 1QHIA 3BIFA 1G3QA 4YC7A 4O2RA 4NMMA 3QF4B 4S2EA 4XSGA 2WIAA 4N3NA 1MKYA 4YXWA 1XEFA 4F7WA 5AUOB 1U81A 2CL0X 4M1YA 1CF4A 4MGKR 3W34A 1CS4C 1GKIA 1XTIA 1YZQA 2BC9A 2QQ0A 4C4PA 5FTNA 1T9HA 3CPHA 3ZIAD 1T5IA 2QAGC 4UNNA 2WBLC 1WBBA 3AUYA 1E2HA 2EFCB 3V4FA 1U8AA 2WJGA 3PENA 4TL6A 3GLFA 2ZU6A 3WP1B 1EWQA 3MLEA 4HATA 3SYKA 2ERYA 1NMXA 2MMGA 4TWZA 5FPKA 2CLCX 3T1OA 1S3SA 1I4DD 1Z07A 3U7GA 1LS1A 5GJBA 1GRRA 1ZINA 4C2TA 1GTVA 3SU8A 3PV0A 2IUUA 1SKQA 5L3SB 3K9GA 1DBSA 2ZIAA 5JEDA 1IN5A 1WQ1R 1JR6A 1COWA 4PHTA 5JJKA 2ZE5A 4A0FA 1D9ZA 1E9EA 2J7PA 3NHBA 1J7KA 2J9RA 2WJHA 4JLJA 1X6VA 4I1VA 3PUVA 1PZNA 2C04A 3M4YA 4IRUB 1MO6A 1Q21A 2XSZD 4BZXA 4C3ZA 2D4HA 1NLYA 1H65A 4C0JA 2QGNA 2R9VA 2CHQA 2ZR9A 1OFHA 4GL2A 1TF7A 4NYMQ 3DL0A 2BJWA 4V0KA 2NPFA 5EUQB 1RRGA 4QBFA 5KSYA 4KCGA 3GLIB 1XTRA 3CM0A 5BYJA 1LNZA 2BIFA 2OBMA 4FCTA 2OFXA 3CO5A 3KUCA 3TW8B 1ZD1A 4OQFA 3UWOA 3C5HA 1BO6A 4PPGA 4OHZA 1D8TA 3P32A 1ZM4A 4DLYA 3HWSA 2QORA 4Z1MA 2IA5A 3QXXA 1J70A 8OHMA 3LD9A 2ZSBA 1KI6A 2CCKA 1L4YA 1Z0IA 4M22A 2ANBA 3EC1A 4Q4AB 2FZ4A 5TB5A 1G8GA 1KZGB 1E94E 1CULC 5KSPA 3QE0A 2ERXA 3OE7D 2QA5A 1F3OA 5K8TA 1IM2A 1WCV1 2GA8A 1XTQA 2VP9A 5C46F 3TE6A 2VHTA 4WBSA 2V7QA 4C0HA 3K0EA 5H8WA 2GJKA 4K46A 5F98A 3KKMA 3WBKA 5H1YA 1LB1B 5KDLA 1GRNA 1TQ4A 5TXGA 3ZZTA 4BPBA 4Q1FA 1ELOA 2WJYA 5EXTA 5DN6D 4NCHA 1NLFA 1UKYA 4CVNA 1J90A 1F2UA 2QM7A 3U7EB 2K5UA 3SQWA 4IW3B 1XD2A 1YR7A 5DLQC 4HAVA 4LY6A 5DSZA 2W0MA 3MRSA 1N5LA 1DPFA 3PG5A 2C03A 1GNRA 2DY1A 2YVUA 5A4JA 4W5HA 3AGQA 4PC2A 2A78A 5AJVB 4NHOA 4JYCA 1K5GA 1IOZA 2A5YB 3RRMA 3BB1A 3CNOA 3OFND 3SJCA 3R8FA 1P62B 1T3HA 2I4IA 3SBDA 5L3RA 1JNYA 2X77A 3TLXA 2A5JA 2XXAA 4HAXA 3OIUA 3ZVLA 3T1VA 3THXB 4LWZA 4QJ3A 4YXWD 1II8B 3LWNA 421PA 1H8HA 1HQCA 4FCVA 1ZMXA 3RSLA 2Z4RA 3T06B 5JS8A 2O8CA 3I72A 4BFUA 1YHNA 1NN1A 2QROA 3R7WA 1XFAA 2BBOA 3NIBA 1W7AA 3B78A 2XTNA 4GSYA 1O3YA 2B92A 4HLQB 4F38A 1DTSA 3ETLA 5JSZA 2IYZA 1XU4A 3E1SA 3ICEA 4C2UA 1N6IA 3QNUA 4ESHA 2WWFA 2P5TB 4C30A 3NH9A 2H92A 2NO7A 1KO7A 3CUEF 2REXB 1YR9A 3HYRA 3BRWD 5D3MA 4BE7B 4LYHA 1A1VA 1G17A 1NL3A 1Q1EA 2H57A 4IHQA 4EPWA 5IRCD 5AJYA 2CJWB 2ZSDA 1G7TA 2HCBA 3NWJA 3VX3A 1COWD 4QRHA 5GVRA 1MRNA 4B35A 2B6HA 5BW8A 2J7PD 5IDVA 5FUVA 2JJ8A 2OBNA 5GJWC 5TDHA 5JZVA 1P2TA 4XVUA 3Q5EA 1CJUC 3MG9A 3AF3A 4MYHA 3IEUA 3U5ZB 3NDBB 2WKPA 3KL4A 3L0SA 4KLNA 1OE0A 3IBYA 4B2PA 1K5DA 4TYPA 1E2GA 2FA9A 2QPTA 5LD2B 4Y0AA 1CRPA 3EX7C 2ZRDA 2ORVA 2GJ9A 4BECA 5JI2E 5KU1A 4Q4JA 2PT5A 3BS4A 1EFTA 2QZ4A 1TEVA 2GRJA 2ZQ5A 2ZYVX 4H1UA 4W9MC 5K8IA 1NJFA 5JWRA 3GMTA 4HAWA 3U3MA 1E2DA 3U4QA 4CT5A 3RANA 3NBXX 3B9QA 4BLSA 4EAQA 2ZS9A 2GNOA 4J0QA 4HAZA 3RRNA 2V54A 2CK3A 2OM2A 4OK3A 4Q9IA 3KQUA 1KOFA 1NN3A 2KSQA 3TUJC 3IILA 1X1SA 4Q48A 1HT2E 3JZMA 4QBGB 3LBNA 1FNNA 3P20A 1RZ3A 2QU8A 1P72A 4G5GA 3I73A 2Q6TA 4IJMA 4YMSA 5FPTA 5BN3A 2PMKA 4Z1MD 4Q47A 4RZXA 3TIFA 4PTLA 4JSTA 3Q7QA 2IHBA 1P7CA 5CM9C 4DSUA 3SHFA 4HYYA 1ZNZA 5JWOA 3QEOA 1E9CA 1HE8B 2VP4A 3WBJA 2CLDX 2V1UA 1L8QA 2IYWA 3VQTA 5CK4A 4JLNA 3WXMA 5A0FA 3LRPA 2GXQA 5HKKA 2VPPA 4Q19A 1N6HA 4Q9HA 721PA 2X1VA 4DBLC 3P1JA 1R0WA 3L0PA 3SHWA 4TYWA 1KO1A 1E4YA 5CIWA 4DEYA 2CNWA 5CB8A 2V7QD 5FR1A 4JJKA 4M1MA 2ZR7A 2FFAA 2QM8A 2PZEA 2XB4A 1VHTA 3K8YA 3F8TA 4G5SA 3HR8A 3U3OA 1G3RA 1T0JB 4AYTA 2W2VA 4O3MA 2WJIA 4TT3A 3MMPA 4JSYA 2CL7X 2YOHA 5EZ6B 5KNBA 4BEBA 3B82A 1XJQA 1YQTA 2FU5C 2IYSA 1NVWQ 2ZRHA 1CEEA 1X8LA 2GAOA 2WWWA 3CBQA 3QENA 1GDDA 1M7GA 4B3CA 3B1WA 3CX7A 4M8NE 4CW7A 3GEIA 4ZDKA 4A8JB 2FPLA 2OFWA 3DHWC 3K0FA 2GK6A 2QSZA 4MRVA 4Q21A 4B6EA 4DSNA 2F55A 4Q7MB 2AFIE 3IGFA 3VAAA 4BASA 3W6OA 5L3SA 3ZZ0A 2XTZA 5DHFA 3UK6A 1TNDA 4KJZA 2R62A 1MO4A 3HYTA 3BWDD 3BFKA 3BC1A 2CCJA 1HYQA 1KAGA 1VG1A 2EVWX 3TGPA 1RW4A 1H8HD 2QAGB 2WWGA 1KJWA 1UEJA 3ONWA 1BH2A 4RKEA 4W7SA 3A1SA 4XSHA 3O8CA 2D7DA 3F3YA 3M0EA 4LI0A 1KDRA 2REBA 2JLXA 5L3VA 2G3YA 3T1QA 2C9YA 2ZEJA 4DIDA 1A4RA 3FB4A 1OIWA 1P6XA 1GKYA 5HE8A 4DDVA 2LCFA 2OAQ1 5JWHA 1S9DA 3RRZA 5FBLB 4OI4A 3CKLA 1Q0UA 3S1AB 4DDTA 3V4RA 3GLIA 1DAMA 1Z0JA 1MRSA 2GXSA 4TTQA 1XTSA 3AVQA 2FX3A 1VCOA 2ZAOA 1WDTA 2O0JA 4Y0VA 3W9YA 2ZXUA 1BYUA 2JLSA 3TJZA 3BH0A 3QKSB 5L8VA 1C9KA 1OIVA 2WMNB 3PEVA 1M2OB 4FINA 1ZM7A 2C8VA 2QP4A 3B2EA 3FMFA 2BDTA 1G41A 2BMJA 1N6NA 4HZUB 4PHGA 3U44B 3VU9B 1OW3B 4EPXA 1R10A 4DIEA 5FI1B 3NBFA 1KO4A 4XVRA 4C9BA 2F43A 3L82B 4KO8A 2GF0A 3H4MA 1D2EA 3GJ3A 1I2MA 4CT4B 2F3TA 5FUXA 1P9RA 5E4FA 1VG0B 1G4AE 1TEXA 3A1TA 5AJZA 1GVNB 2OBLA 2F3RA 5AWFC 4DXAA 4GOKA 1W36D 4HSEA 1AKEA 4G5OA 4LJ8A 2ZRGA 2QTVB 5FUYA 4CF7A 5KDOA 2CDNA 2FGJA 2NZJA 1W48A 2HJVA 4MYCA 1VYVA 2O8BB 1ZNYA 2H8KA 5A5GA 4JVLA 3G5UA 3DO6A 3MD0A 5TVKA 4B6FA 3R9XA 1NSTA 4LJ7A 1ZNWA 2HUPA 3TBKA 1FZQA 1E98A 2CXXA 2CK3D 2ZSEA 3E70C 2FFQA 3ASZA 5CIQA 4DDUA 1KY3A 3QF7A 5M04A 4JJZA 3WNBA 1JBKA 3RS2A 4IDQA 1XP8A 2G0TA 2G9NA 3ZLJA 3EZ9A 2BHRA 4LYFA 4MKFA 2J41A 2EFDB 1Z2AA 3AM1A 4JLAA 2QG6A 3SEAA 3EG5A 4ZV4A 2ODWA 3Q72A 2PZFA 3U3JA 2NIPA 5HKKD 5ELXA 3VKGA 4KVGA 3I1FA 5LPNA 3PR1A 4LHXA 2NZ8A 1GG2A 1QG4A 1DARA 2OG2A 1XMJA 2O8FB 3T34A 2CNWD 4GMDA 1FP6A 3TK1A 1G21E 3TQCA 2Z6VA 1KSJA 1II8A 2UZ3A 1P2SA 2VSOA 2BCGY 1OXVA 2IYQA 4IOKA 3NBYC 2AK3A 4Q7KA 3EZ2A 5CJ2A 4BZPA 4A2PA 1ODFA 3CNNA 1DO2A 1RYHA 2ZTSA 1UFQA 1JXMA 2MMCA 4LJ9A 3RS3A 4TT3D 2QUZA 5E7JA 5AUQA 4DLXA 2WTUA 3FOZA 3QPWA 4JS0A 4C0KA 2W2TA 1JR3A 4G0NA 1G8YA 2YC2C 4CZ2A 4A0HA 3A58B 4B76A 1R8QA 2G1KA 2ZRLA 2ZR0A 3FHCB 1N2CE 3UPUA 2BWJA 2PLRA 1ZAKA 4RFSB 2NO0A 2DFNA 4M9XA 3ZJYA 1G7RA 3REGA 3TR0A 2JGNA 2WWXA 4UNPA 2IWHA 1DAGA 1FTSA 521PA 2CJWA 2V9PA 4IXMA 2EW1A 2R6GA 1VPLA 4D26A 1GOTA 1OPXA 2RGAA 2RB4A 4Q00A 3QBTA 3AKYA 1M8PA 4Q1BA 4UQOA 3V00A 2IC5A 1UJ2A 3BB3A 1SULA 3A6PC 1GZSA 1JALA 1HT1E 5GJCA 3TVDA 2C2HA 2HT1A 4M1OA 3EWAA 4PC3A 3ZGXA 4BQSA 4KITB 4O0MA 1NVUQ 5CITA 4OKSA 3AVVA 1G8PA 1KK0A 4QNRA 2IF0A 1E2KA 3RVBA 2NG1A 3EPHA 3I92A 3FFAA 3TMKA 3HR7A 4ACAA 3KQHA 1AQUA 3VKHA 2F6RA 4JL6A 2FPMA 2FMXA 2PEZA 3OIVA 2ZJZA 1X8KA 1KI4A 4GOXA 4B2IA 2X2FA 4LUCA 4B44A 4PHFA 3TKLA 5DYIA 1ZCBA 2C99A 3K9NA 3ZQ6A 3TAUA 1LS6A 2WWYA 4LGMA 3EPKA 2V4ZA 4KBFA 1OB2A 4MGYR 1ZBDA 3N2IA 2BBSA 1GL6A 2OAP1 5BYKA 2OCPA 4V0MA 1O87A 4DLWA 4LRWA 3PQCA 4L9WA 4I1SA 2NGRA 1SKYB 3BBPA 1G7SA 2OCAA 2QT0A 4A6XA 4A2QA 4BFZA 4RCYA 2OXRA 3THWB 3PUZA 2P5SA 1OXTA 2FG5A 1E6CA 3EC2A 4QHYA 5JLJA 3VR5A 2EWVA 2NO1A 3HPRA 4NU0A 1MR3F 1ZUNB 3ZVRA 1HUQA 2AD5A 4YQFA 1P4SA 4D2IA 1WF3A 5KOYA 1G7CA 1ZD9A 3RRYA 3LNCA 1KJYA 1KMQA 2JATA 3KKPA 4KBGA 5JBQA 1ZC3A 2FOLA 3PFIA 1E0KA 3OZXA 4TL7A 3B9PA 1SVWA 1RE0A 4PC1A 1W2HA 2NQ2C 3FTQA 1YZGA 2VQSA 1X8JA 1BKDR 1UDWA 2O8CB 5FR2A 2J0VA 4HUQA 1P75A 2H16A 4FMDB 3K70B 3K0SA 2RH5A 1BOFA 5LD2C 1KDTA 5JSZB 1IQPA 2JJ2A 4LBWA 1X86B 3B1VA 4Q9LA 3AH8A 1HEIA 4XH9B 1ZUIA 4CEJA 2JEOA 1EFRA 1AIPA 2ANCA 2FSFA 2PJZA 2XEXA 4YDHB 5EP1A 2Q3HA 2BBTA 2H5EA 2VYFA 4B33A 3THOA 1W0JA 1ZP6A 3AVXA 4KU4A 4MGIR 1QVRA 3RSOA 3RLFA 4QGGA 4X8OA 1IJEA 5CM8B 1F48A 4MKIA 4C0SA 1NKTA 1ESNA 4H1VA 1IN8A 5DYGA 2D06A 3MWLA 4B32A 5BN4A 1CJTC 1XRJA 3K09A 5BQ5A 5B2ZA 4L8GA 4LC0A 4XTCS 5BWMA 1N6OA 2VL7A 2QENA 3CWZA 4H9GA 1JR3D 3IIJA 3Q7PA 2QT1A 4XVQA 1JECA 1KMHB 2BCJQ 4WZ6A 4FMBB 2RGCA
chains in the Genus database with same CATH superfamily
1UMCA 1PT9A 4QARA 3S1AA 3KOWA 3OCWA 2P7IA 2Q41A 5AHXA 4WNCA 2MU1A 4WVLA 1SVOA 1VPTA 4ENWA 1CRLA 2QJTA 5ADWA 1EK6A 3T9CA 3U6KA 2BDUA 2FP4B 2ASEA 4QJ4A 2EKZA 1T9KA 2QD5A 2XTJA 5EWLA 1KHHA 2QV7A 1B0ZA 2NZWA 4WCVA 4ZD6A 5GTDA 4WXRA 1Y1PA 4ZAXA 4ZV9A 4BS9A 4IJ6A 4C89A 3HUDA 4Q3LA 4YBRA 2NU8B 3H4IA 2MSDB 3FGNA 1ZVVA 1ZGAA 3PD7A 4KAXA 3UEOA 1Z29A 1RYEA 5B58T 3X0DA 1V1MA 2P2CA 1PR3A 3DYIA 2GAFA 4HDMA 1II0A 2QE6A 2AR0A 2CMDA 3KXIA 2BELA 2FKNA 4GPAA 4HEA1 5H82A 4J0FA 3N0VA 2IEYA 2XJ9A 1V7PC 2EG9A 3HXLA 3RVKA 3KXPA 2X2OA 2V3WA 3KZXA 4LNUB 4CMGA 4QUJA 5HCNA 3PP8A 2AC4A 3D3JA 4KN9S 4F3RA 5NULA 2IT1A 4RA6B 2SCUB 4CR8A 2QTVA 1JTFA 2BEJA 1JJAA 1KYZA 4I81A 4AD8A 2M32A 4YJ3B 3OKAA 4WOBA 5C5DA 4LISA 4GXQA 4HEJA 2IHJA 5FV4A 5IHXA 5KNLA 2XB9A 3NOOA 1Z45A 4MS1A 4D43A 2FZCA 3B3FA 4M1KA 5G0WA 4CG1A 1P7WA 4Q1DA 1E1RA 1R66A 4KDCA 3L92A 2XTMA 2R1UA 1WD7A 3FVTA 5DWDA 1JU9A 4MR9B 1GCGA 3CUVA 4RGYA 2OD9A 3K09C 1Z4LA 5C3UA 1XVTA 4GPTA 2VPXA 1H05A 1NASA 4MRSA 4PXYA 4YT2A 2P6OA 2E1PA 3FFXA 3W05A 1E2EA 2I1QA 3ETCA 1Y7LA 1GNVA 4V2IA 1GA1A 1ZUWA 3FJ1A 2PUVA 1ORVA 2AR7A 2OORA 2X8JB 3ZTTA 3PF9A 3WP0A 5LZ4A 4LHWA 2FG7C 4IIJB 3K6SA 2G8NA 2ODBA 3H8JA 3UJHA 4FYHA 4D25A 1BU5A 3EMDA 1CR6A 5ALTA 5BO5A 1T5HX 2DWOA 1US8B 2ZBQA 1TJPB 1TZ2A 4UTRA 1CUWA 1U0GA 1FK8A 2CJFA 3OQIB 4M87A 5EGNA 4HDSB 1CUBA 2BONA 4OKIA 4BEWA 3RS9A 4RFLA 5J1TB 2D0DA 4OXYA 2I3GA 4MAMA 1YI8A 4IDCA 5EWJB 2EKDA 4ZAZA 5CW1A 4CF4A 1CUVA 4YB8A 5I5EA 1QGUA 2C4NA 5L45A 1H4QA 3UT6A 2O52A 5ICEA 4FFBB 2JJ2D 2ZAMA 2FI1A 2ZWMA 3SYRA 1N6RA 3H9UA 1QRSA 1N8NA 2YZ7A 1TMOA 3E2PA 1DB3A 2O20A 3CV3A 5CDFE 2H7VA 3LDAA 2DFTA 5CB6A 3IALA 1LBSA 5E8RA 1O6ZA 2HD4A 5IKOA 3N87A 1PSZA 1VPWA 1F2TB 4XZ3A 2ILVA 1QHXA 3ABZA 4DKXA 2P67A 1AGNA 1OH7A 2MSEB 4CEHB 3VNSA 4AJNA 2FN3A 3PEEA 4DQ0A 3DE0X 4LJ4A 4UOQA 5TGTA 4O5OA 3FNBA 4HZIA 5JAMA 2AKEA 1II9A 2W2XA 3R7FA 3NEAA 4QOJA 3B1KA 3UV6A 4FE7A 1UJMA 2BYTA 4BXOA 4D0SA 1VMDA 2YTZA 3H9CA 4FT2A 5LP1A 2IDJA 2QRJA 1VFNA 1T1EA 2O2HA 1AB5A 1RLUA 3HCDA 1J07A 3R20A 4URUR 3Q9LA 1ISGA 3V3TA 2AOTA 4B5KA 4CM3A 5GJVC 5JECA 1UZUA 1ORIA 4MZXA 2NUBA 3DO8A 4X3OA 5CURA 3ZH2A 3AL0C 3GEEA 5DO9A 4DPMA 3DWEX 1O95D 2ZCJA 1EGAA 1Y7TA 4ZZ1A 1E1DA 3JSAA 1CDDA 4XDGA 3ECSA 3YASA 4BWFB 1LZKA 1R6XA 3I4FA 2OZLB 5ALWA 2OPBA 5E3JA 5B58C 5AP9A 1QHHB 1DAHA 2OK8A 4L8LA 4BX9A 4YJ3F 1MJFA 5BSFA 2WG0A 1FP4B 4BUCA 1NBWB 2DSTA 4KQ1A 2BMEA 2WFZA 4MWZA 4YGXB 5L3QA 2GF9A 2HDOA 3GLRA 1XXHE 1YZNA 2B83A 2OHIA 2GI4A 3IL2A 3ET5A 3G1UA 1G8KA 1NMYA 3BQ9A 1XG5A 2N46A 1PFKA 2F1KA 1ZI6A 5FNZA 2J7KA 4BJ5A 5JSUA 1Z2CA 4PS1A 2IHYA 1JAYA 1KGSA 1KYXA 1RC1A 2J9GA 3M1IA 4KZPA 5FNVA 4FUTA 4DREA 1DC8A 2QQGA 4D4HA 2E5WA 1CX9B 4I2VA 3IR5A 3O74A 4TL8A 3THWA 2X6QA 1LUAA 4B09A 3SXUA 2PWAA 1Z38A 2XQGA 2YIVX 4KYIB 4P8RA 4A8TA 4D3YA 4F3YA 5JNSA 4X1YB 1Z0DA 3U9SA 4Z7NB 1ZGZA 4RVHA 1H5UA 2PLNA 2V5AA 2REOA 3FM9A 2QMUA 1ZD8A 4PLTA 4HFMA 3GRCA 3HY4A 1KDOA 1LI7A 1D7OA 4IIJF 2UYGA 4RORA 1M2GA 1RM0A 1ULBA 1R9MA 3SHVA 1JKFA 2ISCA 4OFXA 1NVXQ 3DG9A 1NR1A 4U5XA 4R2HA 1B2LA 3PIDA 4OSPA 4J4TA 5ENDA 3SK0A 1GQRA 1YE3A 4I6GA 2ZUWA 5A1TA 1JW9B 4XGIA 3HNRA 4OU4A 4PFKA 2VT2A 3RFTA 4TMZA 1D03A 4DLZA 4OXQA 2QZSA 5C18A 3DZCA 5G0TA 4AZTA 5KQGA 4RTKA 1LTQA 1K4YA 2H2DA 4Q3NA 4YJGB 3RYHB 2CB0A 5D85A 2HMSA 2I2AA 3ITDA 4MA0A 1FFAA 1A8IA 3HUTA 1IPHA 5DHTA 2W8BB 4YCMA 1Q17A 4A1FA 4QWMA 2G88A 5K2MA 1Z62A 3KSZO 4FONA 3KUXA 3OX3A 1MC1A 5FYDA 4C1BA 5KMGA 2RGRA 2Y1CA 3H8WA 1O94D 4J43A 1QX4A 3BMCB 2JS7A 4OO3A 4XIIA 4B46A 4RANA 3ZE9A 3K1AA 1ZLYA 5I7VA 1Z28A 4JAVC 3PVZA 2YWXA 2ZFUA 1H0KA 5IG2A 2I76A 2SECE 2JIQA 2AN3A 3GMDA 3PKIA 4CQLB 8ADHA 4AURA 3ND7A 3SIWA 1BA3A 4LXXA 4TOIA 2WU4A 4OHFA 5HKLA 1UMKA 3KJHA 2C77A 4G4IA 4W5JA 2VCEA 3LUCA 5GV7A 4IRXA 4AJOA 4I9GA 3NZEA 4QUEA 3QWAA 3P9IA 5CA0B 3AIOA 3VI3B 2A0XA 2W6NA 2JBWA 5BOSB 2N0SA 4CFSA 1TFUA 2B21A 4G9BA 3S68A 2CFOA 3H1TA 4L22A 2FR8C 3PXBA 1E60A 1TCCA 2PYDA 4Y3UA 1Z8NA 5FQNA 4D8YA 3M6LA 2E0IA 2FDCA 5LUAA 3Q40A 4MDFA 1U7ZA 4HGNA 3W8NA 5CCBA 4J16A 5EE0A 1O97D 2YBDA 2G9RA 4HBGA 4UVEA 4Q66C 1G2OA 2Z09A 2CJXA 3FCUB 1GLNA 2X5KO 3A6JA 1XHFA 3UJ7A 4KQ6A 1CZHA 1Z6YA 1B41A 4D9CA 4DJDC 3ROQA 4ENVA 4P36A 4H7PA 4YVFA 4D3SA 1A72A 1L5QA 5EZSA 1DVRA 5KYNA 4TSFD 3S2EA 3B3GA 1DX6A 2BHTA 1VKJA 4PAWA 3IPLA 2YJZA 3HA2A 4YAFA 3I12A 3ZE8A 4BNKA 5HNKA 4JL8A 2IOYA 2GASA 2YV4A 3PB3A 4R71A 2B4AA 2OFFA 3HU5A 2F8TA 1CTQA 1WB6A 2CBGA 3DAYA 4HVAA 2G77B 1JKMA 5SICE 2P9ZA 1XSEA 5IJZA 3W4IA 1A69A 1NQ5A 2HQRA 2Q1TA 3AOEA 4ROSA 3I2HA 5DGCA 3HLKA 4YMTA 3H2YA 5JNWA 3DBVO 3IP3A 1AG9A 4UVDA 1FUIA 5KQLA 1XPRA 4H6WA 5JSYA 4ND8A 5E38A 3E4DA 1VG9B 1Q6YA 3IPAA 4K6GA 4AG6A 5BUQA 4W5NA 4C2BA 2BKVA 3K2QA 5CX4A 1EXMA 2ZTHA 1T35A 4ZCMA 4RELA 5F76A 2JIRA 2HMVA 4UZFA 1Y9EA 2AEEA 2GDJA 2JLUA 2P2LA 2RGWA 4UCFA 2ISQA 1M1YE 1GG5A 4IYJA 3DDWA 2E4VA 1WX1A 1ENOA 1M1XB 1YVDA 2ECKA 2JFYA 1QV9A 3UAYA 1ID8A 2REQA 1GQOA 4HNQA 1HYGA 2P3LA 1L5MA 1U9YA 2HRQA 1KRWA 4LC9A 4PZZA 5JALA 1HDZA 3F2IA 3IE0A 4TMWA 1UXKA 3DZKA 4YALA 3QKWA 4LZZA 3VUEA 2GMWA 2VDWA 4MQ6A 4J0HA 4LMPA 1P6QA 5CVVA 4RE6A 5D1HA 4IVRA 3ESRA 5FA6A 2FZGA 4GRAA 4A03A 1D1TA 2HT6A 3L04A 1XXLA 4JBLA 1M6HA 2FETA 5KWVA 1ORDA 1DIGA 5LVAA 4I4NA 1MO3A 3X1JA 2WTBA 2N1BA 3OCXA 1GO2A 1PHRA 4JGIA 3WYGA 5TQ2A 3GWGA 3PQEA 1U5BA 2ERCA 4FMPA 4WA7A 4P6VF 3CLVA 3AWDA 4PHCA 3LT0A 3V8VA 7REQB 1BGXT 1KZ7B 2I8CA 1JJVA 4IXNA 4JSRA 1E7MA 1N6PA 4E33A 5HKAA 4CEIA 3ELBA 2WG1A 2VHZA 5LIPA 2GXUA 2XOXA 5T64A 5AKKA 1U0EA 1ZH8A 3CR8A 3GPBA 2ZI9A 3K70D 4NBSA 4NSNA 4P7JA 2I6GA 4TKVA 4CMBA 1NF3A 1Z47A 2AZDA 3A3YA 3EFBA 3HBAA 5DE3A 1RZRA 1V41E 2WSSD 4Q01A 3R9WA 4EPTA 5BN1A 2W0SA 3IOCA 3DBLA 2CEKA 3IBSA 5DGIA 2QMHA 3SS9X 4M36A 5BUZA 2C1EA 2X6TA 3X2FA 2Y9PB 2LWIA 3OPYI 2DSNA 3R9IA 4UBKA 5IH7A 2O2YA 3O2QB 3O8QB 2UVQA 1YB6A 2VRBA 3CIOA 5B7PA 1E4EA 3N5CA 4GOJA 5D8DA 2QR2A 3JPWA 1PEDA 2E4AA 2I33A 2O2GA 2CXPA 5MN5A 1LW6E 4TMFA 5BYAA 2Q4EA 1IM8A 3PQ7A 3RV3A 3AJ9A 3O1JC 3FNGA 2EJUA 2I1LA 3WZMA 1PT7A 3IERA 1OYWA 2ZXEA 2X3UA 2HLNA 2DC1A 4MKZA 1PD1A 3PDIA 4QC2A 1IXZA 5FL3A 4M8KA 3AILA 3LAWA 1U4NA 3T0IA 3CUWA 2KMLA 3A2MA 4KFCA 2BM8A 2IOFK 1D6SA 2HZ7A 2FEAA 3O8NA 5HK9A 5KYUB 3CPEA 1RBYA 3VR4D 1C1YA 4AUNA 1QYVA 1WZCA 4FSHA 1LFAA 2EFJA 3ADDA 2FSGA 3AR3A 3LVFO 3E61A 3PLNA 1TGYA 2BKXA 1R7RA 5JPIA 1B8UA 2KWIA 4NDZA 2AXNA 2CXHA 4YFYA 3AI3A 5EE9A 3TM5A 5JQWA 2GEDA 3H2IA 4PHHA 1MIOB 4RJIA 5I9LA 3NIDB 2M6LA 4QDXA 4LE1A 1W85B 4ZQCB 4LCBA 5IMSA 1ISHA 1D4OA 1G19A 3OFJA 3S70A 1GSAA 3L0ZA 2I91A 3MTJA 2ZIVB 1NVVR 3MMXA 4HMOA 3FOCA 4LGYA 3MZ0A 1SC1A 3EE6A 3HDVA 4YAGA 3R7BA 4DDHA 4N54A 4LOAA 5BWLA 4PXAA 5B57C 3WGMA 4QUDA 2XF2A 1ZIOA 3C70A 2PGOA 4DCJA 4XWKA 5C9ZA 1ECLA 3FVQA 4UAUA 2C7RA 2IGTA 2JLAA 4ZCTA 2VF5X 1PL8A 2CEAA 4JFAA 3QU4A 3PRHA 1YZHA 2WVAA 2I2FA 1XTVA 2NW6A 3AVPA 3TCXB 1E8DA 1NBME 1JKIA 2C78A 2AFIA 1VMAA 2I2WA 1Y3AA 2YW2A 4KAAA 5CH3A 5DP1A 2GM9A 2WZCA 3A9TA 4ZN6A 2IY7A 2QN3A 1IHUA 3K92A 1FQKA 4J3JA 4LVUA 3PUKA 3SC4A 3TRFA 4XYBA 1XA4A 3SEZA 4TV8A 4Z9AA 4D4KA 1E4OA 3S2UA 3W5BA 2FK8A 4YNBA 2I7VA 2R5NA 1XZMA 1OFGA 4BEJA 2LR0A 1NW3A 1TU0A 2PUEA 3TB4A 3T5BA 5JATA 1R4AA 2FWBA 3D4NA 4TMXA 2PMWB 2IXAA 2Z8XA 3UMSA 1E62A 3U60B 4E2WA 4WTOA 3SFZA 2YJGA 1TMYA 4MI6A 3UBMA 1RLTA 3QXHA 2YHIA 3JARB 2OV6A 1C9MA 5DBHX 4PF1A 3I1YA 1YJ5A 4AUEA 3UG6A 1R50A 3GR6A 3R1IA 4J0IA 1I1HA 3ODPA 1NFQA 3OZVA 4ZXPA 5T4FA 1E3SA 2W43A 1XZBA 2IZOA 3LFUA 4ZCQA 5B1EA 3LY9A 1TK3A 3DVSX 4W8GA 4XD7D 3C24A 4WCFB 1W4BA 3OAAD 3KR2A 3U3XA 4G5RA 4U7JA 3AQ4A 3ZHYA 3GJ0A 4TM8A 5EVJA 3R3JA 2GLTA 5KTRA 3A9WA 3DL7A 3SVTA 4HQLA 2VQ6A 3ZZNA 2IXGA 2AD1A 3A36A 3AY7A 5CT9A 2JLZA 3A37A 1FMFA 3VR1A 1DHTA 8LDHA 4DLBA 2BEUB 3UV3A 4RTQA 2XNDD 2Y1FA 3UMVA 3GGJA 2WUGA 2XX3A 4A2WA 4EATA 2HSZA 5SV2A 5DOZA 1UDXA 3PUHA 3RO7A 5ICSA 5GWXA 4EB0A 3H9EO 5HFJA 4ZVKA 1XMSA 1NUQA 5E3IA 3NR2A 5CLHA 2EJTA 3D59A 3GO4A 4IO0A 2FQYA 1VL0A 4RBNA 4S0ZA 3FFWA 1Z17A 2E4YA 1S89A 1Z2DA 2QF7A 4NESA 2NUTA 1HG0A 1HDXA 4ISCA 2B36A 1TVEA 3HN6A 5AIAA 3SN6A 1H8EA 4TXLA 4DC9A 4IPTA 4RD2A 4V24A 2FSVC 4LFAB 5D5HA 3R9KA 4R7ZA 4MV6A 4ZRDA 5HVNA 4ZO4A 1XEWX 3TLGB 4BLTA 3A1EA 1FP2A 3FUWA 1P0PA 3CINA 4QGAA 1X8XA 1MVNA 4DZRA 3G0CA 1WQ4A 5DZSA 4ZVVA 1VC2A 2MYNA 3SBEA 1GUBA 4G41A 3X1XA 3AUXA 2MINB 1ZICA 2H06A 2V8OA 4IYRA 2PKYX 2Z5GA 4HDKA 4QXOA 4WD3A 3OURA 4JI6B 1L5ZA 1FDWA 3Q9NA 5JS1A 2AJ8A 4EYKA 5GONA 5B55A 1YXMA 2ZUVA 4HDRA 4B0OA 2BGMA 2BFOA 1RAGA 2DHEA 1G6HA 2OLJA 1TUIA 2P6MA 2WUWE 1OKKD 3QWBA 5CX1A 3E22A 4M7WA 2F9FA 5AJHA 1R8JA 3Q6NA 1P7VA 5FBRB 2FSHA 1EHYA 2WPNA 4RVCA 3OEED 4LV5B 1SC9A 4LHZA 1C7ZA 3UA4A 1BQ3A 4GP6A 4JP3A 6REQA 4P5EA 1V1JA 1R4NA 1WPQA 4WINA 5KWSA 1RAIA 1CUUA 1YCDA 4R05A 5I4CA 5KHAA 4X60A 4JQZA 1AGXA 3EMBA 3FPAA 1JIXA 3RUIA 1BRMA 4JIMA 1KTVA 4S24A 1T4CB 1E1QD 1T5OA 3PQ3A 2ZYDA 3HXQA 2QMOA 1G21A 3BMOA 1BFKA 3FNEA 4FEAA 3SC6A 3ZC3A 3R0IA 1OXUA 2CZCA 3L7MA 3S2IA 2HLDD 4FYIA 5F9MA 2IH2A 2I67A 1C3OB 3GEMA 2VK2A 2BV3A 4FHGA 2E85A 4Y30A 5ALQA 1IK6A 1RXEA 4O4HF 5IWAB 3G6WA 2C61A 3O7WA 1AZWA 4HB4A 4U0KA 5E6RA 2WRZA 5F51A 1QRUA 3M34A 1ZGBA 2X7JA 3QE2A 1VJ1A 1SNYA 2RH4A 2II6A 3K5WA 2XQVA 4HDQB 4URWR 4Y7CA 5EERA 4NEHB 1XAIA 4DN6A 3M5WA 4EG7A 2J5XA 2NAPA 1EM6A 4C7OA 5AI8A 3RWMB 4N7RA 1KI9A 1FP1D 3QTLA 4JT9A 3BKXA 2VYCA 3VH4A 3TQFA 4G5QA 3ZZUA 4IWXA 5IZ4A 2X41A 3KEFA 3L1UA 1ATZA 2XUJA 3O0DA 2VJDA 3LM8A 5IDYA 2DUUA 1U8XX 4RACA 1U98A 2V6FA 2CXUA 2YIJA 1EDZA 4MO2A 3ADKA 3FWNA 1VKOA 3ORQA 4YPOA 5LMUB 4OBWA 2JFXA 1XPOA 2IU3A 3ZHRA 3DDSA 3HMKA 5BWOA 4JZYA 4ZVTA 3T7TA 3WAJA 1R0CA 2BGRA 3IYLW 3SYLA 3NWPA 4TVKA 1IAVA 3ZCPA 2W2MA 4FYKA 1G6OA 1U8YA 2VWGA 4RKRA 1SUPA 4GE0A 1QRDA 2HF9A 5IF9A 1QTNA 4CU5A 1JX6A 4YQZA 2BD0A 1I0ZA 1AA9A 1U0NA 3GLFE 2A9JA 4KXUA 3DUFB 2WE7A 1OXMA 3N70A 4BZQA 4ZCRA 2ORED 4JROA 5JVDB 1JF8A 1QQ6A 3RDPA 4HH1A 2DUNA 4UEKA 4UHDA 2QOEA 3T12A 1HDEA 3R4VA 1N34B 1VZ3A 4F8YA 3GN1A 2VSQA 5ICMA 4E13A 2NT4A 3T7JA 3C3KA 2QX4A 1V8ZA 1UADA 1YL6A 2X9VA 2CGEA 4UXHA 2DKOA 2R7MA 3GF4A 3QOFA 4E51A 4MS4B 5K51A 3VPXA 1JIUA 4E1AA 5FHRA 5CRIA 2CUKA 4RNCA 4EITA 4YRMA 1UC9A 3WY9A 4TS9A 3X2SA 2X9LA 3Q12A 4K26A 1CP2A 1CRZA 2FWRA 4KNWA 4Y9TA 4XLTA 2WWTA 1K7YA 1R3UA 4XLZA 4D0NA 4QVIA 4UARA 1IZ0A 2RFLA 1OI4A 5FQOA 1DQPA 1ZONA 4FZ3A 4I1YA 4KODA 3CLTC 5K2OA 1QGOA 4M0PA 2XNSA 2DULA 1J5EB 3M9XA 3SS8A 3WC4A 4X00A 3VO2A 1G291 2P8JA 2V4UA 1G1MA 2XA2A 2XZLA 2I3AA 2XOKA 4L5IA 2QN7A 4GSKA 1T9ZA 1A9YA 3CUKA 4CL2A 1U3CA 1XZ8A 2XE7A 5LNK6 1XMOB 1CE8B 2GGSA 4P5PA 1Z74A 4KIJA 2JW5A 4CTJA 3Q9SA 1N0WA 2A2ZA 4KG7A 4MQ5A 3V46A 5IS2A 1P2UA 4QM7A 5FPHA 1YVPA 2G71A 2J4DA 3Q2OA 3R3YA 3HUFA 4ERXA 4ZZIA 3EQ2A 2FGKA 3OX2A 4NFHA 1QONA 3VZBA 3IUEA 1NNSA 2PKQP 3OT1A 4PRYA 1NP7A 4WOJA 5GV8A 3LVQE 3CUSA 3Q41A 10MHA 1LX6A 3EH1A 3NM4A 3QKUA 4OGWA 1UBGA 2VXOA 2ZBEA 3I4CA 4P82A 2H2HA 1L4MA 5AK0A 5AUPB 4ZI2A 1R0XA 3P9PA 1ZOIA 2DPXA 3V4OA 4LSWA 1VCMA 1Y34E 3TX6A 4FGKA 1MG0A 4HB2A 3OESA 5AIBA 3BB4A 4HSGA 4R0MA 1HX7A 3A1DA 4F3TA 4P0PB 1VSUA 4Q3OA 1EVEA 3KYDA 5F78A 1NN0A 1DNPA 2O3TA 4OFZA 4RPHA 1T2NA 1YOVB 2W6JD 1IOWA 5CA1B 4IMRA 4QOHA 5EPEA 1FSGA 2FZWA 2IE0A 1NW9B 5FO0A 3LUJA 4JBYA 1UBHS 4FDMA 1SUAA 1QR6A 2RB5A 1Z83A 2Q3CA 4HRVA 3LFHA 4ZZ3A 5AVZA 4XB1A 3RVDA 1GXSA 5CEEA 1UPXA 3HBLA 2NYAA 4ZEWA 5HGXA 2IV3A 1H0RA 3L4BA 4JBHA 1G8HA 4D6PA 3JALB 3MM4A 4AP9A 1C4OA 3CMMA 2H3HA 2NZVG 3WDSA 2HTEA 1SQ6A 2WWRA 3QMWA 5F4ZA 4G0PA 4H35A 1PZHA 3DPUA 4PO9A 1VBMA 4YMWA 1N5JA 1V5IA 2ZRBA 4PQFA 5ULLA 3EZNA 3PQFA 4H31A 4ZI3A 1V37A 3D3WB 2XMRA 1SKYE 3DW3X 2J87A 3VJKA 1GAXA 1RMQA 3ZBPA 3PJRA 1P29A 1NVVQ 4QAQA 3IHTA 2Z9BA 1XWIA 3ZS8A 5HE9A 4B3XA 5E4JA 4GBGA 5TMEA 2B8WA 5JVDF 4G0UA 1A71A 1PBNA 2PH7A 3Q8LA 2VUTA 4HJXA 2O19A 2A5DA 2PK3A 2WF6A 1HDOA 1NDUA 1XEXA 2VRWA 3QKTA 2QAJA 3WOHA 2FV8A 1XLUA 2WEKA 1XF1A 4MLPA 2ZJAA 2D2IA 4KWTA 2DECA 6NULA 9ABPA 1YQXA 1XT6A 2OKCA 1HT0A 1OCEA 4F7DA 3F47A 5AHWA 5KYWA 3MK31 5KYXA 2R60A 3PFGA 2J3LA 3AP2A 2IHUA 4FKZA 2ZDGA 1Z6GA 4F2PA 1ECFA 1Y3DE 3QEKA 3MWYW 3ZQ4A 4DMKA 3TOSA 1Q1QA 2HRCA 2GEVA 4Q4DA 4C4ZA 4DUZB 3KYIB 1G98A 2HXSA 3A9RA 3CKMA 2B1GA 1E0SA 2J33A 1ZNQO 3AR8A 1IC6A 2AN9A 2OC4A 3PNVA 3ND8A 1P4RA 2PGNA 1XD8A 3PD1A 2PU5A 4F72A 2CNOA 2I7TA 5EJEA 1VMKA 5BUSA 3LPMA 4EA9A 3A9SA 1GGFA 4BMCA 4C0QC 1BS1A 4G23A 4IIDA 1EJBA 1MG5A 2R00A 3WWZA 3CW8X 3UICA 3KTFA 4GZMA 2GZHA 4MTLA 3ILVA 3OTOB 1AVTA 1QYIA 3VXKA 1ZI9A 2ORIA 3R5XA 2XBMA 1P19A 4I3GA 2HPZA 1P1HA 3BXPA 4M4SA 2OYRA 2BOVA 2RMKA 4J4HA 3UJPA 1G20A 1PWEA 3P9KA 4J90A 2PT7A 1Q57A 4B48A 3KDSE 4LXUA 4BRUA 2O2IA 3IOBA 4WNIA 4O4IA 3OQMA 2O8DB 5FKJA 3SJAA 1TW3A 3ESYA 3I32A 5IH3A 4AC9A 4F4CA 2IQ5A 1KP3A 1PIWA 1SHKA 4W1RA 1L3IA 3IIMA 3Q6IA 1NSFA 3W1EA 3IAM6 3L7YA 4KIGA 2OK7A 1NG9A 3ADBA 4JI1B 3ANLA 3FD8A 4WDRA 4IZOA 4MQFB 3OQOA 2NPIA 2W2KA 3BCRA 1GIAA 3FPHA 4UXIA 3C85A 5M5BA 1YA8A 1KJIA 2DEUA 2JHCA 3DMNA 5C37A 3PFBA 4WCFC 1B0AA 3KJQA 3R3XA 3DYVA 3QG1A 1WTAA 2O3JA 1JVNA 2Q21A 2VH1A 1E2IA 1QYDA 3CKKA 3CWCA 4Y6RA 5DXJA 1F6BA 3QJYA 2XZPA 1KNXA 5CA1F 2O07A 1RWPA 1A7KA 1K7FB 3VPFA 1PL7A 3EDCA 2AXEA 3MRTA 4ZGGA 4LCJA 4BV9A 4NZYA 2YBEA 4G5FA 3LY5A 3BQNB 4MB0A 3FAKA 3FCCA 5EZ5A 1UT5A 4QICA 1R5JA 1DQYA 5HS4A 5IT5A 1DKPA 1RYZA 2TYSB 5DNWA 4K88A 3R7DA 1C9YA 3DSRA 4AKEA 1M33A 2AHRA 4MUHA 4KQ2A 4HNRA 1UKEA 2AXQA 4KR0A 4EFKA 1Y42X 3W2IA 3GD5A 4X8MA 2IUYA 1P7ZA 4GWGA 5AW9A 4ARZB 5IDWA 2Z3WA 1I24A 3IMFA 3WL3A 1XWWA 3H5VA 1VRWA 4R68A 4DQLA 3OOYA 4K0KB 3L7DA 2JDIA 1VSVA 1Y80A 1Z13A 1EJ6A 5BSUA 1E9FA 3SF8A 3AZPA 1OHHD 1GA4A 4LRUA 3U31A 4D82A 1LPAB 4LJKA 2H1RA 1AUXA 3P4XA 4RVDA 1ZNXA 3U7JA 2M2IA 4F5ZA 5JNVA 2B78A 1PK8A 3C16C 2GN9A 3OKPA 4P0TA 3LSTA 3DTVD 3HNOA 4ZTBA 1C3JA 1SBZA 1DDOA 3NOQA 4JENA 3EVFA 2H4XA 2C7BA 4RD4A 2V58A 3SC2B 1ZW1A 5HDQA 3ZOZA 1FVOA 4NNPA 5IK2A 3STHA 3AVUA 1FU7A 1CR1A 5FFFA 3BDVA 3O95A 2AEJA 4TTVA 4URFA 3G6KA 1SGWA 5G3YA 1CBUA 2PQ2A 2WIKA 2P1DA 1PW5A 2QYTA 2GO1A 1G5HA 5IWCA 1KGDA 4WY2A 1LLDA 2JZOA 2OZVA 2P5UA 3QE3A 1A9XB 5AYVA 5I7EA 4Z3KA 3AC0A 3PITA 4PR0A 3GH1A 1QVVA 1RPNA 1YQQA 5AD1A 4X44A 1BKYA 2EP5A 3UAZA 2HADA 2RG7A 3EK2A 4PAMA 4LXHA 3F3MA 1VIDA 3KWMA 3KDPA 3TTTA 1MJGA 5ALIA 4DNXA 1JEQB 1EX9A 1UC5B 3L79A 1P0FA 1O4WA 1Z82A 4EX6A 3QW2A 2D7CA 4FOOA 3MUOA 3JD4A 5JU6A 2H1IA 2NPOA 3WBBA 4IGKA 3ZX5A 4ERNA 2L0XA 4BKRA 3L07A 4GKVA 2PBLA 5AOAA 3VTZA 1VLVA 1GUDA 1HRKA 5LBUA 2LCQA 3TUIC 1T1SA 1BE6A 1FP7A 5B7GA 5DTIA 3KFLA 1LY1A 3UG7A 3ZDCA 1WXWA 5H68A 3QHAA 1OREA 2IEAA 1EHCA 1C4KA 4RY2A 3TRDA 4ZREA 2Q3MA 1RFGE 3A0RB 3NAGA 4W5OA 3IUPA 2MSKA 2OECA 2NM0A 1T3LA 3H5IA 5DF1A 3ENNA 4QSMA 3GLIE 4HWOA 1GARA 3THYA 3LGAA 4WXYB 3ITEA 2WOOA 4OEHA 4EJ6A 3WMEA 1T8PA 1K92A 2HAEA 4MVJI 2BEWB 1X1TA 3IV7A 1AKNA 3RSFA 2ZIWB 4GG1A 4NYJR 3R0XA 2UYHA 5BSWA 1K68A 3WL8A 1ZPDA 4QYIA 2Z04A 3FPSA 3GBSA 3AJAA 1W5BA 3CT4A 2W6QA 4JBXA 4CMCA 3LHKA 2NXCA 1KEVA 1XELA 3PFFA 3NDIA 4MRMA 4E5PA 3I01M 2ZIFA 5DKFA 3ICOA 4NBUA 3W0LB 2PIAA 5K0TA 3WNDA 1NSYA 2IS6A 2GBFA 4CV1A 4XGNA 4BUJA 1ESZA 4BB5A 3NTQA 4A82A 4KVZA 3DPIA 2J9XB 4U2BA 1KZYC 3AM4A 2H1LA 4MS3B 3ISTA 3L8EA 3PHCA 1SURA 1E3EA 1N0VC 3F90A 4HN2A 5TARA 3MB5A 1XP5A 2YV5A 3KKLA 5G1PA 3T3DA 3A4LA 3PQ2A 1E32A 2MHCA 2WHXA 4AYWA 1ZVQA 4COKA 5F12A 1JPNA 1JHMA 2DQZA 2FN4A 3ORYA 1QG2A 5F3RA 5JHGB 3CVWA 4EYGA 4KN5A 1UQUA 4BGDA 3GBPA 3RNLA 3KQSA 2Z6QA 1UUFA 2VQ3A 4O4JF 1M5RA 1RWWA 2FFJA 4QHTA 4R2IA 4C22A 3ZCSA 1SG0A 3VR6D 1PYOA 3E81A 4MDEA 1ZIXA 2OOSA 2ZRQA 2ZPTX 1G2QA 3KOXA 2XF8A 5M34A 1OF1A 1XC7A 4F1JA 4F56A 2YH2A 2WWHA 4YJHA 1UJ4A 2YWJA 2H00A 2GILA 1KJQA 2VP0A 2WV9A 3NTUA 4QU0A 1KQOA 3PE4A 4U00A 1P77A 1HPLA 2O0KA 2W71A 3BVPA 1FTYA 3OZRA 4LRSB 4BMDA 4UVIA 5DNYB 2IKQA 1CRQA 1DJNA 1R1DA 4WOPA 2QS9A 3IELA 4BLQA 1Q22A 4F12A 4JUBA 2PVSA 1KE1A 2XNJA 2IU0A 2NU7A 3HG7A 3JYNA 4YA6A 4IDEA 4U6SA 1JDBB 3MINA 3UJ3X 1TYAE 3UGJA 1SXJA 4DRZA 2IDMA 3Q5DA 4QBTA 1QORA 1ZZGA 2WLTA 2YFYA 3FWKA 4GYJA 5DM0A 1D7AA 1QP8A 2NXEA 4QPCA 3TSZA 4EB3A 5L6LB 4DDWA 3V3KA 4AJ2A 4DV6B 5JPDA 1L5WA 1U2GC 3HB7A 4J9VA 5CDGA 1CJVC 4DBVO 5LIRA 2BRUC 1MB4A 1WXQA 2FMHA 3KFXA 4W7IA 5AI4A 5F4BA 1J5XA 3V32A 3PTAA 2AOVA 2RHDA 3DZ8A 5TDHA 5HKKA 5JAUA 4E5UA 1OSNA 1U94A 1Q16A 4HEQA 4ZQGA 2EQBA 4JCCA 3A3KA 3Q5GA 1VG8A 3IMEA 3K1ZA 5GOTA 4NBRA 3T5TA 1JR3E 3ZGYA 4ZT5A 3JQBC 4TTTS 1WCYA 5K03A 4DZTA 4IEIA 3H4TA 2GETA 1ZMBA 4AZ3A 1S1MA 4OHYA 1C1DB 1O1YA 5FAKA 2WQZA 3BTOA 3IEVA 5HMLA 4RAQA 1TCBA 4D81A 5EKUA 4AQYB 4JOBA 1EUCB 3GVCA 4G01B 1VRCA 3ANYB 4EHDA 1YKFA 3LW8A 4NL4H 3H5TA 3JQAB 5LYJB 5C3MA 4OJTA 4BYGA 1J0XO 2EFGA 1TM7E 2GCOB 2WNIA 4C6TB 4F4HA 4RDXA 3FE2A 3M6UA 3PPYA 2R8XA 1PKEA 1XZKA 2I87A 2YVLA 1JEYB 2BI4A 1SWWA 2DT8A 2GK4A 5IJ0B 1U6IA 4Y2UA 1VE9A 5EINA 1NVFA 3LWBA 3BE5A 4PYQA 1PSWA 1P4GA 1T5DX 1ZK0A 3AHCA 5IC5A 2ROQA 3RROA 1UQTA 2Q6LA 4KK3A 3D0RA 3WK6A 3WGLA 1ISSA 3TPCA 4ZDJA 3QKIA 1MPTA 4OHRA 3F7OA 1G4UR 3OPMA 5SYAA 4YRKA 4CKXA 4W9NA 3T3HA 3T8YA 2VJYA 3C7CB 4BKQA 4UCXA 3C3EA 1Z15A 3CF4G 4UTXA 1V8PA 4JVOA 4ARAA 2OO3A 5C7IO 4WT7A 221PA 3SXPA 4M0FA 2C29D 1LCIA 2GOYA 3HJNA 3PXGA 3O8BA 4GD3Q 3RU2A 4HQOA 4L2IA 5HUQA 1R4ZA 4FGSA 4YGYA 1F0PA 1UPCA 1EWTA 1UR5A 4WY5A 3IO3A 2BP7A 4IZHA 3HVHA 3DOJA 2NMVA 1ZIDA 2UYCA 4E5NA 1G8SA 1BXGA 2AFHA 2XNKA 3KQQA 4UDOA 2RH8A 4IIEA 4KV7A 4V38A 4DCGA 2BGWA 4NP6A 1A95A 1G0OA 3IT0A 1E79A 1G5PA 1JQLB 2K2QB 3LQRA 4Y2HA 3TTUA 3D5QA 4EKGA 4RZHA 5JJLA 2OB2A 2XMGA 1MH1A 1ONBA 4U2FA 1QM5A 1IG3A 2HU7A 4Z8XA 2XDAA 3ZEIA 4LNAA 3LS2A 1RHMA 3GVIA 5CFMA 4LNHA 3FZNA 1OB5A 2SKDA 1J06A 2XCUA 3OT5A 2ZI5A 3QUCA 2EZUA 3UIEA 1YJAA 1IPFA 2A35A 2GKGA 2J3MA 2F3SA 2WF5A 3CX8A 4S2UA 4WLUA 4CCYB 3CEHA 3U5TA 4FYYA 4KN6A 4RKFA 1QHEA 3TH5A 9LDBA 5LMCA 1BU8A 3FA2A 4G0QA 2QU7A 4P22A 4CMAA 1VI6A 3I76A 1Z34A 1WXIA 3NCHA 4ZI7A 2WNSA 1IRXA 4E2YA 5A4MS 1KVUA 1HE4A 5I9SA 1HG1A 3SKXA 4MP3A 3TIGA 5A9SB 4J7XA 1TEHA 2B4QA 4K6FA 4ZJUA 2B5VA 1J33A 1SCBA 2HPHA 2RK4A 2VHEA 2WJWA 4YMGA 4DR1B 4Z9FA 2WZBA 3WMXA 3CVXA 1K27A 5ILGA 2QL7A 3NVKI 1YRWA 1UM9A 1P1JA 4RF5A 1WL8A 1P61B 2YNMD