3L43A

Crystal structure of the dynamin 3 gtpase domain bound with gdp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
242
Chain Sequence
QIAVVGGQSAGKSSVLENFVGRDFLPRVTRRPLVLQLITSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the dynamin 3 GTPase domain bound with GDP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dynamin-3
total genus 69
structure length 242
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l43A00
2FFAA 4PQYA 3LXXA 1XMIA 1D6JA 2VP0A 4KAXA 3G5UA 2RHDA 1ZNZA 2O8FB 1VCOA 5H70A 2E9SA 2O8EB 1OJLA 4DDWA 2GZAA 1N2CE 3MG9A 2GXQA 4PO1A 2GJKA 1QHHB 1N5JA 4NYMQ 4X8OA 3QEJA 2YNMA 3K9GA 1G6OA 4QC2A 2JA1A 4LC1A 4TLAA 4OHXA 4TMTA 4JIMA 4OQXA 3WRYC 5AUQA 4KLNA 1LVGA 4MGIR 4NDZA 1G3QA 1E0JA 2ODWA 1C1YA 4X8MA 5L3QB 1DAIA 4S35A 3NBYC 2IYTA 1TF5A 1NI3A 5L3RA 3UANA 1GVNB 2LCFA 2XZOA 3KDSE 2IXEA 3I8XA 2ZRLA 5FR1A 3WNDA 1QF9A 1SVOA 2ZUCA 1XDBA 3OFND 4B33A 3DKPA 2GJ8A 4YXWD 1B23P 1CR4A 3QJYA 3PUXA 2A9KA 2K5UA 5DSZA 1UADA 4ACBA 2GVZC 1J8YF 2XEXA 3BGWA 4EJSA 3EZ7A 5FL7D 1E79D 3WYGA 3FTQA 4O2RA 2WICA 5KSZA 4C0BA 2HCBA 1PJRA 2GZHA 4ILEA 1Q1ZA 3MCAA 3SHFA 621PA 5GJVC 4DUGD 4URUR 1XF9A 3R9IA 3NHAA 2XSZD 4FMDB 4WVFA 3D6TB 4OK5A 1LFDB 1YR7A 2HT1A 1CEEA 4BFYA 3GCGA 1JI0A 4C2TA 1UBGA 4ZDJA 4RJLA 3ZS9A 1PV4A 3LAWA 4QM7A 1RYHA 2CLSA 4IDOA 4Z8YA 3EAQA 4IEIA 1HE8B 2OILA 4V0KA 3QPUA 4KSCA 1YRAA 3KUCA 5FTMA 4LX0A 1E9DA 2J0UA 3DKVA 3GMTA 4QJ5A 4A8JB 1W36D 4TTQA 3I5XA 2ZJOA 2F6RA 4CEHA 2QORA 2CLCX 4CDGA 5C46F 1X8JA 4AYWA 3PCRB 1GNPA 5FTJA 2PH1A 4EQ6A 1MOZA 2VP2A 1J7KA 2WJVA 3RSLA 4TL6A 4BFVA 1GRQA 4DDVA 1JQLB 2D06A 5TB5A 3ND8A 3NC0C 1XJQA 1KI3A 5J40A 2AHOA 3RS5A 2WMNB 2WWIA 5JFGA 1IY2A 3BH6A 4QOSA 2J5XA 1TUIA 4NHOA 2PCLA 2FPMA 3T35A 4OHWA 4A9AA 2EFDB 3TVDA 2DB3A 3SJZA 2PX0A 1Y63A 3C8UA 3KUDA 3RANA 1CKEA 1ZJ6A 4GMXA 1XBTA 2YZ2A 4TLDA 4XWKA 4XVRA 4KCGA 1D8TA 1NVWQ 1P4SA 4KJZA 4POAA 3DZ8A 2QTFA 1A4RA 1ETUA 2FDCA 4AD8A 1R2QA 2A78A 3NC1C 4P33A 4ZIRA 3X1ZA 2NG1A 1E98A 2IK8A 3U61B 3B9PA 2V9PA 2RCNA 4BRWA 1BIFA 2ZRFA 4U7DA 1NG9A 1II0A 4C7OB 2CHVA 4U5XA 2ZE8A 2F55A 1RIFA 1WP9A 1US8B 3F0TA 3ADCA 1Z6TA 4AWXA 4DT1A 3THXB 5BYJA 2JJ1D 2OLKA 4MA4A 1SKQA 2XZLA 3U4QB 3KKOA 4AIIA 5L3VA 5KSOA 4HZUA 3MRSA 2CNWA 4DCNA 4E07A 1VG0B 4DLRA 1DPFA 4D25A 4Q4AB 1Z3IX 2HJVA 3KX2A 2QAGA 2GCOA 3EIHA 4V0MA 3KZ1E 3LBIA 5B30A 4B44A 1XU4A 1D9ZA 3EC2A 4BLQA 4GOKA 5LD2B 4AYTA 3WBJA 1E0KA 3GLHA 2BMDA 1MRNA 4DLUA 4JVMA 3CONA 1OB2A 1W1WA 4A2PA 4RD2A 2FNAA 1GKUB 4GDFA 2EFGA 1RE0A 5KTYA 2QBYB 1E0SA 3CH4B 4Q1EA 4U02A 2GDJA 4QGHA 1E1RA 1L4UA 3LWNA 1R0YA 3PUWA 3R9WA 4PC1A 4RKEA 2IHBA 4JT2A 3KKMA 4Q18A 4GZMA 2VP9A 4D4KA 1HE1C 4MUBA 4TMXA 4US1R 1DO0A 5HKKD 3WNBA 3QIAA 4YMTA 4MQBA 1T5IA 2BKEA 1QVAA 1V43A 2OCPA 1Z08A 2WAYA 3M0EA 4RVCA 4PR0A 1SHZA 2JDIA 4WXRA 4M22A 2DCUA 3UWOA 3CRQA 3NDBB 1D9XA 4LUCA 1II9A 2IWHA 4Q19A 4ZKEA 8OHMA 3IILA 1CULC 1Q57A 3K0CC 4ESHA 4ZI3A 2BEJA 2JLXA 1S3SA 2HYDA 1WBDA 2AFIE 1XEXB 3HR7A 2GK6A 4WOPA 2OBLA 1XD2A 2OBMA 1I4LD 1RRPA 2RH5A 2W2TA 4PSKA 4YMVA 3T06B 2CMKA 1SXJE 2ZPTX 5BW8A 5KHOC 3K9LA 4QJ3A 5HZKA 3B1XA 3U3OA 5E7JA 1E0AA 2C99A 2HCJB 1XZPA 3JZMA 3ONWA 4M1KA 2ODBA 5J4LA 2WWWA 4PZYA 2C78A 1GL6A 1RJ9A 1H65A 1JXMA 1JEDA 2QSZA 5KPDA 4M9ZA 4D0GA 3IO3A 1T0JB 3LH5A 4HB2A 3QI2A 3RRZA 4HYYA 4MGKR 1EX7A 4PAOA 5FOSA 4XVUA 2OFOA 3H86A 1RFLA 4I1VA 2F9MA 4B3CA 3FMIA 4EPVA 2IEYA 1NIPA 2J46A 1G291 3KJEA 3PEYA 2V8OA 2J0QA 3KJGA 3GJ8A 4US2R 2AD1A 5FOWA 1HA3A 1M1YE 2AKYA 1KO4A 4NPHA 3A6PC 1RW4A 4CZ2A 3OEHA 4KBGA 4NCKA 2XTZA 1W4AA 4QG7A 4M9QA 4Q4JA 4JMPA 2EFCB 2X2EA 3ZS8A 3GLFA 1G8HA 1DAHA 4JYCA 4EFNA 4LJ7A 1G5PA 3CF2A 5J47A 4DCTA 4XIGS 4N0DA 2X77A 4PZZA 4LDJA 2DHRA 2Q3MA 2J3EA 3RRNA 3CX6A 4Z1MD 2FFBA 5P21A 5JSZB 3AP1A 2ZAMA 4F91B 2LKCA 1RYFA 4MRNA 5DYGA 4DLSA 3GLFE 2ZRMA 1R5OA 2WWFA 3NH6A 2G9NA 4HI0E 4D80A 3QSYA 4LJ4A 1GIAA 1ZAKA 2QENA 2B7BA 1VCNA 2KSQA 1JR6A 3OEEA 3BC1A 2I1VB 2CJWB 3KQKA 4OI2A 2YWFA 2DFLA 1H8HD 4B74A 2VQSA 4OHYA 2ODNA 2WKQA 2X1VA 2UVQA 4LV8B 1PUJA 2C2HA 1SXJA 4DSUA 4DLWA 3CNOA 2GJAA 3RS7A 5GJBA 4LGMA 2JASA 3BB1A 3THXA 3B7GA 1H8HA 4G1UC 2VSXA 4BLSA 3GLGB 4NYJR 3PEUA 2HF9A 4M0LA 1IONA 1IXSB 1TMKA 1MABB 2F7SA 5E7IA 4AC9A 5JWHA 4JKYA 4JSTA 3B1VA 2IYWA 1G3MA 1HYQA 2W2XA 5KOYA 2EFEB 4NYMR 4DLVA 4Q02A 5FBQB 2ZRPA 3LXRA 4V0OA 1JR3E 1BH2A 3U6KA 4QBGB 3CWQA 3GJ3A 2W0MA 1U94A 4UXJA 2FU5C 2ZR9A 4GP6A 4Q1FA 5LBIA 4ARZA 1Z63A 1NP6A 4A8JC 2FPLA 5AWFC 3R7WA 3SDZA 1IJEA 3IGFA 1W0KD 2XAUA 1I2MA 4RZUA 2OHFA 3KJHA 3LW7A 1RJ9B 1ZUIA 1ZRHA 2ZU6A 3BFKA 3CRMA 2B7CA 1JQJC 4RFVA 3SC3A 2REXB 4ZDWA 4Q48A 5JWRA 3K0FB 2Y8EA 1FTSA 2FSIA 2N42A 4YONB 4JLJA 2C95A 2QRNA 2ZS8A 5KSYA 2IYSA 3G82C 3GPLA 4OQNA 3RSOA 1FFHA 1OB5A 4BLRA 2H16A 1FOEB 3N5CA 2BMJA 1Q3TA 4D26A 1KY3A 4PQRA 2DPXA 2BWJA 4JLAA 5JS8A 1R4AA 3SOPA 1AA9A 5DI3A 1OKKA 5EP2A 5KDOA 1O87A 4BFTA 1CJKC 3M1IA 4PXAA 4C0LA 1TQDA 3TBKA 1BYIA 1ZC3A 3K0AA 3RHFA 3P26A 2QY9A 1TU3A 4JT4A 1S1CA 2Q9AA 1YJ5A 1ZVQA 2KB0A 4Q9JA 2IX3A 3RC8A 2ZJYA 2GJSA 5HTKA 1BMFA 4DVGA 1NN1A 1ESMA 3JVVA 4JL5A 3CX7A 4EPWA 2HF8A 1XWIA 4CF7A 4F4IA 1W4BA 5C18A 2REOA 4TZ0A 5ELXA 1NMXA 2GTPA 1T4GA 1TQ6A 2OBNA 5H1YA 1XNJA 3N70A 5TXGA 2QPTA 5FUYA 1UEIA 1P2TA 1KSJA 3DM5A 3IBYA 2R6AA 4C0JA 2R6FA 2V4ZA 3R8FA 4FW9A 4Q47A 3VKGA 4Q4HA 3SZRA 4OYHA 2D3WA 1QG2A 3AF0A 3RNLA 5G3YA 1G64A 4WZBE 3I61A 1DAGA 3NTUA 3H84A 2MSCB 3SQWA 1R5BA 1G7CA 3GEIA 2XNDA 2CL7X 3FMPB 5FH9A 4OBEA 2W0SA 4NYIQ 2GESA 4IFBA 3RC3A 1SVSA 4PQFA 4WA7A 2ZROA 2CDNA 2ZEJA 4M4SA 5EP3A 1RRFA 1ZIPA 1IN5A 4C0KA 4GRAA 1E2KA 1PVOA 2DBYA 2P65A 1KDTA 1ZU4A 2I1QA 4CEIB 1B0UA 5SZHB 3U60B 4M8NE 3ICEA 1LF5A 3NEYA 1AIPA 1GTVA 2GVDC 2QT0A 1P62B 1YZLA 3IPYA 3HYRA 3OHMA 2ZE7A 4M1OA 2H1LA 2W83A 2ERXA 2OLJA 1E2LA 3A36A 3K0FA 1UDWA 4ZDIA 1E4YA 3NVAA 4IVPA 1KY2A 4GZLA 4IVRA 1E9FA 1OFIA 3A4MA 4OQLA 3AKEA 2AR7A 4AKGA 1KSHA 2WSSA 4LOAA 4JLOA 1MO6A 3K0CA 3PENA 5F98A 1QDEA 1JECA 2F9LA 2O0KA 2V6IA 4MKIA 3MUFA 4AG5A 4WIAA 3ZZTA 5DE3A 2ZRHA 2CEAA 5HZHA 1CJUC 1FL9A 4LJAA 3I72A 3LNCA 5J4KA 3JVUA 3THWB 3MWKA 3ZYCA 3CW2A 2D7CA 3KXIA 1TAGA 2OV2A 2X19A 2Z4RA 3OF5A 1G3IA 3C5CA 4Q01A 1SVWA 4M9XA 221PA 1W4CA 1Z47A 4C0QC 1FPMA 3U3MA 4F4CA 5CYPA 2FJUA 2AFHE 1TQ2A 4HAUA 4QHSA 3UWKA 3A1WA 1EFRD 2F1JA 2VPPA 3GEHA 1KI2A 3SJAA 1GSIA 3T1VA 2P6UA 2QP9X 2FFQA 5HCIA 1MH1A 4OI0A 5KUTA 4P4UA 2ZRCA 4RD0A 1G1MA 1TQ4A 1D5CA 1W2GA 3M6AA 1N0UA 2MMGA 3PEVA 3ZVLA 1N6OA 4EPTA 2GKSA 2P5TB 4URZR 2P3SA 4NTZA 5D3QA 5BN5A 4TT3A 1ANKA 1FUUA 1FUKA 4PZLA 5JEEA 1E2PA 1ZM4A 1SHKA 3V00A 4URYR 2G77B 3L2OB 4XWAA 4LJYA 5KNDA 4OK6A 1KNXA 1ZC4A 5IT5A 1E2NA 1M8PA 2D74A 3BB3A 5A4JA 2QP4A 3PUYA 3W6PA 1G9XA 3PEWA 2ANCA 4BFXA 3Q85A 3B1ZA 5CIWA 3L8ZA 5BXQC 5F2EA 2WJYA 4HUQA 1OHHA 3LLUA 1ZCAA 3I4LA 1YZTA 5HKKA 1XX6A 3A37A 1N5KA 4E09A 3FVQA 2O8DA 3EARA 3THYA 2G88A 2J9RA 3HP1A 1OE0A 4AURA 1QHSA 3BH7A 4B47A 2WPDA 2OFWA 5TDHA 4W9MC 1CBUA 2JGNA 5EQTA 1WRBA 2BV3A 2Q3FA 4P0TA 3NWJA 3ZZ0A 1MRSA 4KFUA 3GLIE 3BBPA 1VECA 2IWRA 5LPNA 2P6RA 1XTKA 2ZUDA 2QPAA 2GETA 3LLMA 5JEDA 4LHZA 2CHQA 4BZQA 4YC7A 1G3RA 1KHTA 4GFDA 3T5GA 4A2QA 3QKTA 5JZVA 4DB2A 4IOLA 5FBWB 4B76A 5JLJA 1MR3F 1Z22A 2AWOA 5J4VA 3W6OA 1S1MA 4LHVA 5KPJA 2W6JA 2YHSA 4LBYA 2CBZA 2VHCA 4FMBB 4XD7A 2IYRA 1R0ZA 2JCSA 1AKYA 4LPKA 3HU1A 5KU1A 1E2JA 1IJFA 1OH6A 3DPUA 1Z29A 1KK0A 2CK3A 2QAGC 5CJ2A 3RS0A 1II8A 3ZDQA 1IXRC 3CZPA 3LDAA 3NHBA 4UXIA 1UAAA 1SKYB 1W49A 2ODEA 4HZUB 2X2FA 2NOAA 4CEHB 5CK4A 1F2UA 2GCPA 3OAAA 1BYUA 3TSWA 1KGDA 2CK3D 3MGCA 4V0LA 4PO9A 2XZPA 1ZD8A 4BZPA 2KI5A 1NVVQ 3Q5DA 4URXR 4RY2A 2DYKA 1Q1EA 2GEVA 4DZZA 1X8KA 3OEHD 4H1UA 4HATA 4BUJA 3LY5A 1EFTA 2YJTD 4GNKA 3SS8A 3RVBA 1W44A 1X86B 4CEJA 1YZQA 4G5SA 2IYZA 4KSBA 1GG2A 1KDRA 3P20A 1Z5ZA 1XMSA 3E5HA 1NF3A 1VKJA 4WXPA 4BFZA 3REGA 3QKRA 421PA 4NBSA 2D2FA 4R9UC 4EFLA 4Q9HA 3SQXA 4LJ6A 1E9BA 4E03A 2C9YA 1P72A 2P2LA 4PC2A 1NVVR 1K6MA 2BMFA 2Z6VA 4PC6A 4R98A 4LYJA 2G0NA 1E2QA 2QEQA 5DO9A 4HUQB 1X3SA 3W3AA 3VX3A 1QHYA 1ZM7A 4C0AC 5F3WB 1JJ7A 3WYFA 2OZEA 5ANRB 1UBFA 1JR3A 4JLNA 5JJLA 1KI6B 1COWA 1CXZA 2BMEA 4E22A 5KNCA 3EIQA 3FFAA 1P73A 2XXAA 2O8BA 3VMFA 1US8A 3PJRA 3QUSA 4LYHA 2FMXA 4M21A 2QE7D 1JALA 4Z8XA 5K8IA 1P9WA 4EQ6B 2R9VA 1CJTC 1OV4A 3I5YA 1W2HA 1GFIA 3LQQA 2GXSA 4OK3A 3GJ0A 1NRJB 2ZTSA 1E69A 4TN1A 4NH0A 4NL4H 1OFUX 1CF4A 1J2JA 1NVXQ 2VHJA 2QAGB 1KSGA 4BFUA 3TGPA 3T1OA 2EQBA 1JJVA 4F4JA 4FWIB 2BOVA 1JPNA 2AXPA 1QG4A 3QEOA 2GXAA 1TX4B 4HDQB 3WMGA 4LC0A 1HURA 1GZSA 4TYWA 1IN4A 2A7QA 4Q1BA 4OHZA 4CT5A 1KJYA 1ZBDA 4IDPA 2AD5A 4K46A 5EUMA 3EZ6A 2VA8A 1UDXA 1Z6XA 2HXYA 4DIEA 2XJ9A 2FN4A 3KQNA 4B34A 4HDCA 4JLDA 3AGPA 521PA 2PZFA 2PMKA 3RWMB 2JLQA 3ASYA 2RGGA 3W34A 4ZI2A 5AUPB 4IDHA 4DIDA 1CU1A 1JAIA 1VDZA 4BFSA 1KZGB 3B5JA 1UEJA 5E7MA 3UK6A 5KO2A 3CNLA 4HAXA 2OXCA 3CRW1 4ZIRB 6Q21A 3VNVA 4BRUA 5TARA 1G7TA 3FYHA 3DL0A 1R6BX 3R20A 3SHWA 5C4MA 1S9HA 4M53A 1CRQA 3SFVA 3GJ5A 1NSFA 3GJXC 3GLFB 3Q72A 2J7KA 4FN5A 2QN6A 4QNMA 4B3FX 2XITA 3QVUA 2BIFA 3DO6A 4QGAA 3J81k 4L9SA 1XMJA 2ZR7A 4O3MA 3K70C 3NG1A 2IF2A 4JJZA 5FI1B 1NSTA 1U8AA 3RWOA 1OW3B 3Q3JB 4YXWA 2ATVA 4B2PA 1NBMD 4D4JA 2QA5A 4F38A 2ERYA 2CVFA 4RSGA 3GJ4A 1E6CA 4TQAA 4PSVA 3SN6A 5FL7A 3TNFA 2BHRA 1E99A 5H8WA 3W90A 3UATA 4PC7A 3EPLA 2Z43A 4TMKA 5H68A 1MO4A 3IHWA 5AUOB 1SULA 1P3JA 1SVMA 2FZ4A 3CZQA 1KAOA 4HAYA 5AJVB 4NMMA 2V3CC 3TUJC 2ZYUX 4D0LB 2VHQA 3KKPA 1E2MA 1OLOA 2NIPA 4JS0A 1GNQA 1U0LA 2B8WA 3DDCA 1UBCA 3IQWA 3BFVA 5JBQA 1PUIA 2J87A 3P4YA 4II7A 3LFUA 1N0WA 1EESA 2DR3A 2ZYTX 5B57C 2C96A 3QXHA 3ZLJA 3WXMA 5LDDC 4AKIA 2DWPA 1FX0A 3TQCA 4Q4JB 2BBWA 3T12A 1W47A 4PHGA 2FEOA 1N5LA 3PIRA 3LQRA 5F9HA 2C8VA 2WOOA 2XB4A 1Q44A 4IW3B 1Z06A 4P4TA 4YMWA 4DSNA 4IXNA 1WE2A 1L2TA 4YMUA 4B2LA 1NVUQ 1PLKA 2OSBA 1N6HA 4RCZA 1P5ZB 1XPUA 5F9FA 4LHXA 4TL9A 5L8VA 3CBQA 2A3RA 3CLVA 1KK3A 3PFIA 1MV5A 4L16A 1OH8A 2B92A 2GILA 2C5LA 1XXHB 1FNNA 3FOZA 4RKFA 4B6EA 2VH5R 1LY1A 3WNCA 5CIQA 2IW3A 2ZUBA 4GMDA 5EP1A 3PQCA 3I1FA 1EGAA 4PSAA 2VO1A 2V1XA 2RGAA 1UF9A 4JKIA 4FINA 2WSSD 4AYXA 1VYVA 5DIFA 1ESNA 2IUTA 5G41A 1JB1A 3C15C 1AS2A 2D62A 1NJFA 1VG1A 1XP8A 5CM8B 2EWWA 2IS2A 4KVGA 2F1RA 3VR6A 4XH9B 5G40A 1CTQA 4C2UA 1MABA 1K5GA 2AL7A 3VHXA 1ZIOA 1G8FA 1UKZA 3GD7A 4JLVA 1R8SA 4N3NA 4MGYR 5L3SA 4KFRA 1NLZA 1Y3AA 2Q9CA 1XD9A 5HE9A 1IN6A 4FI3C 3BFXA 3ZH9B 4DT1B 2OEPA 5EE3A 4DUGA 4PHHA 3MWLA 2ZS7A 3CWZA 4QKQA 2PJRA 2JJ1A 3N2IA 5BN3A 1KKLA 5FUXA 1E9SA 1A1VA 1GILA 5BN4A 3B8HA 1CR0A 2I3BA 2WJJA 5J5CA 4OL0A 5FTNA 3SNHA 4BASA 1PZNA 121PA 1CS4C 4ARZB 4DEXA 2NGRA 3AF2A 1U0JA 3CF0A 5J4YA 4FMDF 4TYPA 2YV5A 5GJWC 1S4QA 2JLWA 1CRPA 1OFHA 1Z6GA 1E2HA 1DEKA 3RDPA 5JECA 3CPEA 2WHXA 4JLPA 3BJIC 1EK0A 2J7PD 2QGNA 4M1WA 4Q66C 4Q1DA 4Q4HB 5DH9A 2OT3B 1N6LA 3IIJA 3UG7A 2ZRJA 3EW9A 5JRZA 1AGPA 5D3MA 3UXMA 3WP1B 2ZJBA 4JLBA 1JBKA 2QG6A 2ZI6A 3AVVA 3TRFA 4C4PA 4P32A 2F43A 2ZJ2A 3VX4A 2ZI7A 1IXZA 4YMSA 5BYKA 2Z83A 4Q21A 5SZKB 3X1WA 2XTMA 4BGDA 2OO7A 1ZU5A 3TR0A 5K8UA 1XJ0A 3AUXA 4FIDA 1E94E 1VTKA 2PEZA 3X2SA 4EJSB 4B43A 3NXSA 1KAGA 4I1SA 3DVLA 2ZJ5A 2IYVA 2JDID 3IEUA 4DCSA 1OHHD 2DY1A 4DRZA 4MYTA 3W8RA 4Q1AA 2PEYA 1J70A 2NO0A 2ZI9A 2ORWA 3O8RA 5FBVB 4IEEA 4OI1A 1NLFA 3ECCA 4G5RA 2ANBA 1FMLA 4YLGA 3TMKA 1N6KA 2QTHA 4I1UA 2HYIC 3LRPA 1QRAA 2PLFA 2WJIA 1XD2B 4A0HA 3EA0A 2P5SA 3CR7A 1Q21A 2CHGA 2JLUA 4CIDA 1G19A 2REBA 2H17A 1U2RA 5AJWA 3U7HB 3Q7QA 3ADDA 4GOXA 1NL3A 1KMHA 4UQOA 2EFHB 3UG6A 5C1BA 1NNEA 2HEIA 1OXTA 4G5OA 1A2BA 1P61B 3L43A 1A82A 3WYAA 3HWSA 2GAAA 2O8EA 1XB2A 4JVLA 5KDDA 3QXJA 5AUNB 1NKTA 1Z28A 2QROA 3QKSB 4NYJQ 4QL3A 1NJGA 3P27A 2QL6A 1E3MA 1W48A 2ORVA 1KI6A 1OYYA 2FF7A 2RHMA 3CO5A 3H1TA 1P9RA 4UKDA 1BOFA 5EXXA 1T9HA 3TQFA 3AP2A 3LX8A 3LBHA 1MO3A 1W36B 3HDTA 3HJNA 4TSFD 2OCBA 4Q4AA 1N6IA 3LVRE 4QJ4A 5A5GA 3I8SA 4LV5B 1GKYA 1UKEA 5KSPA 1I4DD 1XXHE 2OESA 4ASUA 1OIXA 2WTUA 4V03A 4B48A 3KQUA 2FV8A 3AM1A 2QMEA 2WIBA 3V4FA 4MRRA 4GBMA 2NTYC 1Z6AA 1ZMXA 2AX4A 2GXUA 4JVNA 4MYHA 2JLRA 1IY1A 4I4LA 3VR2A 3DHWC 4B3DA 2O8CB 1RZ3A 4HB0A 2BBOA 2A5GA 1FW6A 4MRSA 1XXHA 4EDHA 4MUAA 4KITB 2WWGA 2OM2A 3IQXA 3UMRA 4N1AA 4IRUB 4UNRA 3U44A 5JCPA 2FWRA 1I4TD 3TSZA 4OJKA 2YWEA 5CDFA 4C9BA 2GF0A 1NMYA 3UKDA 4B35A 4W7SA 3K70B 4TLBA 2BEKA 5EXSA 1DADA 2Z0MA 5EE1A 1M34E 4LHWA 4L9WA 2WWXA 3NH9A 4DWJA 3H2YA 3GLIA 1G21E 4CVNA 1TNDA 2YOFA 3OEED 1G5TA 1X1RA 3K9NA 4AI6A 2BBTA 4LK2A 3RYTC 3RLFA 3Q9LA 1NN0A 4AK9A 1YR8A 1IBRA 1ZYUA 1XJCA 1FQJA 1DE0A 3U4QA 4BZXA 2QAJA 5A0FA 2J41A 3EZFA 5FL3A 5L3SB 3V4RA 5AJYA 4B73A 1UM8A 5FPHA 5B2ZA 3ZJYA 1GAJA 3AVOA 4IJMA 1M7BA 1N6RA 3I3SR 4P31A 4NE2A 4JVSB 3O47A 1U81A 1VHTA 4J0QA 5FOVA 4LBZA 4JLKA 5IRCD 4B3GA 5HR5A 3QF4B 3MWJA 4ERNA 3K1JA 1S2MA 2O52A 2ZR0A 1G18A 1UKYA 3OE7D 4HLQB 5CM9C 3LA6A 2EYQA 1RVDA 5JMTA 1JXOA 1U8ZA 4H9GA 4B71A 2IHYA 4MH0R 3BXZA 3FGNA 5CB8A 1R10A 3IHLA 1E2FA 4S2EA 3ZQJA 4NP6A 4W5HA 1KK1A 1JPJA 2WJHA 2X8AA 3IDQA 4TTPA 4D4LA 2N1BA 1YQTA 3AKDA 1KI8A 2OAP1 3WHKA 1OH7A 4AKHA 3MMPA 1M6NA 4KODA 1AZTA 1PLJA 4KYIB 1HY3A 4KXFB 2PX3A 2ZSFA 2GCNA 4DBLC 4QBHA 5E3HA 3BWDD 2WWYA 1W7AA 5B58C 5FPYA 2VIIA 1WXQA 4QFMA 4FXPA 2BKUA 4NONA 3QY0A 4P3YA 4C30A 4LZZA 4GOJA 3ZVRA 1E9CA 2ZAOA 1XCGB 4BEJA 1YR6A 4OHVA 4FMCF 2DFTA 1M7HA 3BD9A 2P67A 2WSMA 3GLHE 1AZSC 3CB4A 1RRCA 3P4XA 2GHIA 4TMVA 1LB1B 2GEUA 4AKEA 3ICQB 5EXTA 2AKAB 2CL6X 2E1RA 1ZM3A 1OXVA 1G8GA 4ON9A 2VSOA 3S1AA 4A0GA 2BM1A 4XOIA 1ZNXA 2R44A 5GVRA 2BJVA 3R8CA 5E4FA 5CDFE 4JLMA 5EZ5A 2IYYA 1Q22A 3T1QA 3BORA 4MKGA 3I32A 4D6PA 3U6BA 3L0PA 2IS1A 3BIFA 3K0AB 1EG7A 3VU9B 3ADKA 2QPOA 3FDIA 1XEWY 1T6NA 3CIOA 5DGXA 1CP2A 1HEIA 4UJ3A 1AS3A 1GUAA 2CCKA 2Z4SA 4HLCA 2PZGA 2IT1A 1E4VA 1T8TA 2C03A 2BJWA 2G3YA 2GCOB 2P0EA 1E79A 2R6GA 2JLZA 3BERA 2EU8A 1NG1A 3HPQA 4TYQA 2DFNA 1OIVA 5FUVA 3KTAB 5G3ZA 2CXXA 1OPXA 5UKDA 3DMNA 4PANA 3K09C 3NBFA 5LB2A 4KO8A 3RRMA 1IN7A 5FOUA 2XSZA 3EASA 3P1JA 1OFTA 1NLYA 1MKYA 1TEVA 3FHOA 3MSXA 4D82A 3ASZA 4RZ2A 2AK2A 2ZVPX 4E5UA 1M7GA 2P6NA 1GRRA 5BWMA 4HDOB 4PAQA 4MRVA 4B3XA 2VBCA 2VP6A 1DBSA 2XX3A 2A2ZA 4TQ9A 1GOTA 1Q1BA 4PX9A 1GDDA 2C98A 4IXMA 2J45A 3QVVA 1X1SA 2DWOA 3ND9A 2YOHA 4XVQA 1Q20A 4FCWA 1RC8A 4IDNA 4X8LA 1NIJA 2JIZA 2ONJA 4R71A 3D8BA 2ZRNA 1DAKA 1W0KA 4M9SA 2EVWX 5IF9A 4WZAE 1NMZA 3PVSA 4V02A 1KDOA 2OUKA 2ZE6A 4FWTA 3ZD7A 2QT1A 1G3UA 2NPIA 1TF2A 3FHCB 4LI0A 4ZDKA 2GWHA 1XMVA 3CNNA 3IKJA 1W5TA 1JEEA 2PL3A 2CCJA 1QHHA 4FCVA 3UMSA 2IS6A 2O8CA 1G7SA 1W4RA 4R2IA 5FBRB 3EPHA 4IHQA 1AKEA 4DEYA 3CPHA 3TIFA 2QU8A 3A1TA 1VIYA 2IC5A 2KE5A 2V54A 3HPRA 1W0JA 3V9PA 4DDTA 3U5ZB 4K8OA 4OJQA 2Q3HA 1QHNA 4TMZA 2NZ8A 3K9HA 2QBYA 1II8B 3AEZA 1SGWA 3KFVA 4Q4LA 3L82B 2BBSA 2D2EA 5JCZA 2AXNA 1KJWA 2NO9A 4I99A 3WHLA 1W0JD 2Q9BA 4A0FA 2XTNA 3QXSA 4Z54A 1Z0IA 2FE4A 1T5LA 2ZJAA 4Y0VA 4OQFA 1GRNA 4UNQA 3QKSA 5CK5A 3MJRA 1L8QA 3MWYW 1KIMA 3BB4A 4KYUA 3WMEA 3W3ZB 2YOGA 2YVUA 4I81A 4HEJA 4RFSA 3GLGA 1FMJA 2PJZA 2VHUA 2VF8A 2C04A 2WBLC 2ZSBA 5FPSA 2QMHA 1N6PA 1TL7C 3N2EA 3U2QA 4A2WA 4MITA 4DLXA 2PZEA 3U7GA 3PITA 3SBDA 1E2EA 1Z0DA 4IOMA 5JWOA 2OCYC 4OI4A 3QF4A 3UMFA 5IDVA 1R7RA 4KFSA 3DZDA 5SZIA 2GA8A 3L0SA 4MDFA 3EXAA 3KFXA 1M2OB 5CB6A 1NN3A 1OH5A 1IHUA 3CR8A 3NDPA 2XOKA 1EFRA 1VPLA 2ZXUA 2OG2A 3A58B 3REFA 2PLRA 2CVHA 4UXHA 1KMHB 1DG3A 3SYLA 2WAXA 2ATXA 4EIWA 3CUEF 3GLHB 5KNBA 4FCTA 5SZJA 1U90A 4QM6A 2QGZA 4UNSA 2XOKD 2KJQA 3IPXA 5FTKA 5TV2A 3SFZA 2CE7A 3KKQA 3MFYA 4LJ5A 3AVTA 2H57A 5FFMA 1F2TB 3TH5A 4URWR 3B2EA 3ZZUA 4EUNA 2DWQA 4TT3D 2BCJQ 5FPTA 3A1UA 4BEBA 1AJEA 2RMKA 2VEDA 2O0JA 5CJPA 1N3BA 1LF0A 2OXRA 4OKSA 1AS0A 5JHGB 2LWIA 2WOJA 3AVYA 2Q6TA 1E9EA 1OXXK 3TJZA 1YU9A 2HXSA 5DI3B 1KNQA 3VR5A 1QHIA 4DC9A 2EYUA 2PT5A 3QENA 1TF7A 3K0EA 1C4OA 3ZQ6A 3OESA 4EAQA 5K8LA 2XXAB 3TE6A 1HT2E 1OSNA 2QP3A 3PXGA 4IFEA 5CLLA 3AVXA 2IS4A 3RS2A 4RD1A 3AVUA 3B13B 3GFOA 1GNRA 2JJ2A 2PCJA 3K09A 4IDQA 4RZ3A 3VTKA 2QMUA 1XEXA 4BFWA 2OE2A 5K8TA 4V0NA 3K70D 2WWHA 1W46A 1XTJA 2FG5A 2RGBA 2WPDD 2WJGA 3U3KA 1ZW6A 4MRPA 1ZNWA 2JJ2D 3EZ2A 3QXXA 1IM2A 1NN5A 3FWYA 2AK3A 1OIWA 1XD8A 2WM9B 3SE0A 2JLYA 1HH4A 2V7QD 3L8YA 3CX8A 4HSEA 2B21A 4MKHA 2N46A 4RD4A 1XPRA 1L7VC 1HQCA 2UZ3A 4BQSA 1DOAA 2HJGA 1YRBA 3R9XA 3ETLA 4M1TA 4KI0A 4YDHB 5AJZA 2V7QA 2W58A 2W6JD 5HPYB 4TL8A 1XCMA 2CNWD 5EJEA 4KU4A 2ZRDA 1TUEA 2XJ4A 3EIEA 1XTIA 1Z83A 2IBMA 2QMOA 1LW7A 3SJBA 1XEFA 2F3RA 4ZO4A 2SHKA 1EWRA 4QGFA 3Q5EA 2BDTA 4LHYA 4C3ZA 4A6PA 2IXGA 5TMPA 3OIYA 1XTQA 4DSTA 3QE0A 2QM8A 2FH5B 2LKDA 2UZIR 4FMCB 1VIAA 3BH0A 2BM0A 4MGZR 1C9KA 2W00A 2ZRBA 1F60A 3AP3A 3GLGE 1SKYE 1U99A 2ZRAA 3EZ9A 3LW8A 3KB2A 1AN0A 1DTSA 1X8LA 5IHPA 2C9CA 2CCGA 3U3JA 2ZM5A 5JJIA 4XJXA 2FFHA 3C16C 2CL0X 3KXKA 1P2UA 4EPXA 4F92B 4F7WA 3FFBA 5IK2A 2G0TA 2O0HA 2EWVA 2WKRA 4D81A 2QQEA 4ZCMA 2A30A 3QKUA 3LX5A 2H8KA 4A6XA 2BCGY 2ZREA 1XTSA 1UBEA 2HUPA 3NBZC 1ZP6A 2W6ID 2YC2C 4FD2A 2MMCA 3THWA 4JL6A 1S8FA 1KDPA 2CJWA 3MAAC 1DAMA 3TLXA 1ZUHA 3IBGA 4JL8A 4W5WA 2RGXA 1S0UA 5EP4A 1VCMA 2JJ8A 1T8UA 4BLTA 2O8DB 2RGDA 3EPKA 5HCNA 3EC1A 1YE8A 2ZSAA 1SXJD 2R6CA 2ZYVX 3C7KA 3EA5A 3ZIAA 3EPJA 2QTVB 4GL2A 2QZ4A 3CM0A 3GFPA 3SR0A 1FX0B 3B9QA 1IOZA 3TR5A 2ORIA 2QM7A 3WP0A 1DAFA 2B8TA 3GP8A 4TWZA 3DM9B 2FOLA 4NZYA 4Q03A 5AJXA 3FHTA 3CH5A 3BS4A 2QRZA 3H0KA 3SU8A 3E1SA 4PPQA 4KFTA 4DB4A 1G17A 3RS3A 4LRWA 1KO8A 5LB4A 5JI3E 3FKSA 3HR8A 4U00A 3GJ6A 2XGJA 2Q21A 2J1LA 2B6HA 4Q1CA 2JLVA 3AVQA 1IQPA 4XD7D 3AF1A 4PPFA 2ECKA 1J99A 2ZRGA 2OCAA 1ZINA 3DOFA 4NU0A 4R7ZA 3MJHA 4EPRA 1VHLA 3F3YA 5DHAA 1WDTA 3H4MA 1AK2A 3AGQA 3X1YA 2CE2X 1KO5A 1TPZA 3CF6R 1Z0JA 3BAFA 2F1HA 1N0VC 3B1YA 4DSOA 1E2DA 1I2DA 2WV9A 5DI9A 1NBME 1Z2AA 4TQUS 2VRWA 4XTCS 1N25A 3G0HA 1U9IC 1GL7A 4ITRC 2R2AA 3UPUA 4Q7JB 1D2MA 4QGGA 1IN8A 3B60A 3CKLA 2J0VA 1E96A 1SVIA 1XPOA 2V55B 2RAPA 2YWGA 1GKIA 2ZYWX 3GFTA 3K8YA 4NCNA 4HLDA 3TW4A 1T3SA 4Z51A 1W5SA 5JS7A 5GJCA 1OKKD 1Q1QA 3SJCA 4DLYA 2ZETA 4N0EA 4CEIA 5CLQA 2FX3A 3ADBA 4G5GA 4JBXA 1U9IA 1S96A 1XEWX 2RKOA 2BVNA 4IOJA 4XTRA 5BQ5A 4HUTA 5JJKA 2ZS9A 2ONKA 1NKSA 1HT1E 4MKFA 2NO1A 4QHTA 3A1SA 1V5WA 1KI7A 4LYFA 4X8HA 1E32A 2YKGA 2ZSDA 3T61A 1YR9A 1KZ7B 4M1SA 4EPYA 1KI9A 4PPNA 5KDLA 1R5NA 3ZVMA 1XZQA 4W5JA 2ZI4A 1ODFA 4JSYA 3WMFA 2G1JA 3GQBA 4ABYA 4DLZA 1KK2A 1YZKA 2ZANA 4M2LA 4XSGA 2GBLA 5FI0B 5EE5B 721PA 2FA9A 3QBTA 4WBSA 2O5VA 4GP7A 4ESVA 1G5RA 3ZD6A 4ZV4A 1JR3D 1OT3A 3KB1A 3HYTA 4TTRA 2AWNA 2MSEB 3VFDA 2WMOB 4G0NA 1F2TA 2MSDB 3PV0A 2GBLC 1GP2A 3F5FA 1S3GA 5DN6D 1KI4A 2BC9A 2YINC 3IO5A 4NCIA 2WZQA 2FGKA 2WKPA 2J0UB 2F43B 2YC4C 4QRHA 1T3LA 4CYMA 5HE8A 2NPFA 1VYTA 1Z0FA 3O8BA 3U7EB 2VL7A 1LV7A 3B85A 3QPVA 1KI1A 4D0NA 4QXAA 1OXSC 1TADA 1GL9B 4G3XA 5EE0A 2XNDD 2ZU0C 1KSFX 2JEOA 4L5BA 2FSGA 2TMKA 5C2JB 4AG6A 4XSHA 3Q7PA 3B6EA 4KLZA 4Q00A 3W5JA 2JIZD 1XRJA 2V6JA 4F93B 4MDEA 2E87A 4TYYA 1CJVC 4R2HA 1RRGA 1LNZA 5AK0A 3W9YA 3OIVA 2VHTA 1YZUA 1IAQA 4CW7A 4TZ6A 4M1MA 1DVRA 1ZD9A 2IA5A 4UNPA 4D2IA 2VYFA 3A4NA 2NMVA 1ZM9A 3TW8B 1PLLA 1CIPA 4JBWA 1E9RA 3JZAA 3OFNA 5EE9A 4URVR 2H5EA 3AB3A 2HLDA 4Y0AA 5FBLB 3LO5A 3QPWA 1BO6A 5AR1A 2AN9A 5FOTA 4HLUC 3GEEA 4NKRA 3ZGXA 4LBWA 3I62A 1JNYA 2FEMA 1AM4D 4V0ME 4A1FA 1DARA 1JAHA 3VNUA 4QNRA 1EX6A 1BMFD 4ACAA 3THYB 1FP7A 1F6BA 1FQKA 1NBMA 2HLDD 2A5JA 4CGZA 1G6HA 2C77A 2IUSA 3AV0B 3SYNA 1CR1A 5B64A 2Z5FA 2JLSA 4O25A 1QHGA 1OYWA 3LBNA 1XCPA 4PPGA 4HLUA 4LWZA 4Q5IA 4TYNA 2KBFA 2G83A 1CR2A 2RGNC 3AQ4A 2IYLD 3GJ7A 821PA 2ZITA 4I1OA 4BPBA 3A1VA 4HB3A 4LSGA 4H1VA 1CJMA 2D4HA 3CRRA 1OF1A 3LVQE 5DISB 3TKLA 1G20E 4A4DA 3T15A 3WY9A 2XB2A 4DLTA 2R6DA 4JYBA 1VYUA 2YYZA 1XFAA 1D2EA 1KKMA 1UFQA 3KJIA 3KKNA 3GLIB 1Z07A 4BECA 2HT6A 3EG5A 1F5NA 4NYIR 3AF4A 5EZ6B 4UNNA 2IYXA 2GRJA 2OFXA 2J7PA 1ONBA 1SVKA 4HZIA 2IUUA 4DKXA 5LD2C 3AVPA 1OXUA 4ZCIA 2NO7A 2A5DA 2F1IA 4DDUA 1F3OA 3FE2A 1WA5A 2GF9A 4DJTA 3BK7A 3S1AB 2VP4A 2DFKB 2QUZA 1WCV1 2A5YB 4MYCA 2ZJZA 3X1XA 1FP6A 3QG1A 1KTVA 1QHXA 1YHNA 3AH8A 1ZCBA 1A7JA 3TVTA 4JZKA 3CPJB 3DEFA 3KL4A 4QHYA 4LBVA 1KO7A 2GJ9A 2W2VA 3C41J 1LS6A 4CEJB 5DHFA 1Z0KA 2F3TA 3NIBA 1YKSA 3VR1A 5KYKA 3QNUA 1P75A 2FPKA 2RGCA 2V1UA 3AKYA 4DXAA 3QKRB 5G53C 2NZJA 3VQTA 3O8CA 4LJ9A 1UKVY 2ZI5A 4Q7MB 3BE4A 3WRXC 1P9NA 3VAAA 5CITA 2ZQ5A 3U44B 1L4YA 4KV9A 3W8NA 1RPZA 1EXMA 2RB4A 4EJSC 3HU2A 1G8YA 5L3QA 4EKDA 3ZVNA 3MLEA 4TL7A 1R0XA 3RS4A 2R65A 1SXJB 1SZPA 2C9OA 2A5FA 1SVLA 3RAPR 3NEJA 1N6NA 4HB4A 1QBKC 2OAQ1 2JATA 3TK1A 3QG5A 4O2LA 3VKHA 2O8BB 5DNYB 3SEAA 1AGRA 1AQYA 1Q12A 1U98A 4Q9KA 3VKWA 2PBRA 4EFMA 1YZNA 1J90A 3EWAA 3FKQA 1M74A 1G41A 4L15A 1U8YA 1Z8FA 4OQMA 5C4GB 1EFCA 3F8TA 1G8PA 4LYAA 4C0HA 1E2IA 4DHEA 2VF7A 1SQ5A 4US0R 5FPKA 1F2UB 5FOXA 1ZD1A 3FB4A 1GITA 2J59A 1TEXA 1XTRA 2ZI3A 5DYIA 3AF3A 3TSOA 4P4SA 1DAEA 2ZRKA 4A0RA 3UIEA 3R7WB 4L4UA 5TY0A 1N5IA 2H92A 4PC3A 4YDSA 1Q0UA 4ASUD 1BKDR 4Q9IA 2XNSA 2G6BA 4L8GA 1E1RD 3PUVA 3TUZC 2FSFA 1ELOA 1WBBA 1KYIA 3HU3A 3OZXA 4PO8A 2ZE5A 2GZDA 1P2SA 2IL1A 5TVKA 1W36C 1G7RA 3T34A 1HV8A 3I92A 4G5QA 2O8FA 3KXLA 4LY6A 2NO6A 3C5HA 1VG9B 3Q8XB 2GAOA 5FTLA 3KTAA 3VR4A 2J0SA 1KJZA 2G1KA 1VG8A 1LTQA 4BLPA 1Z0AA 1T3HA 4LJ8A 3QXCA 2RGEA 2QQ0A 1UJ2A 5IK2D 1P2VA 3LD9A 4KBFA 5EUQB 4GPTA 4JBYA 3SBEA 2RGNA 1NY5A 2W6IA 1QVRA 2YWHA 3B78A 3OIWA 4K81B 2R62A 4PFSA 4TLCA 3D31A 4RD6A 4TMWA 1DG1G 4Q7LA 1P6XA 1GWNA 5CYOA 3VU9A 1COWD 2ZVQX 4CT4B 3EX7C 1SXJC 2JAQA 1ZNYA 5JHHB 4WW0A 3ZIAD 4PAMA 2FSHA 2QE7A 4ZPXA 1TTTA 3AVWA 4B2IA 4RCYA 2QNRA 2H18A 1IY0A 1A5TA 2QI9C 3T5DA 1UPTA 2VTKA 1HQYE 3AUYA 4HAWA 1FNMA 2Q0HA 4B3BA 3FMOB 5E95A 3QOFA 5GVSA 4G01B 3SI7A 3NBXX 1EFHA 3QQ5A 4JJKA 1WF3A 3OIUA 3DMDA 2FGJA 1CLUA 3TAUA 3D3QA 3W5IA 4A82A 1O3YA 3FKSD 4A92A 4BLOA 3RABA 1Q3HA 2VSFA 2GK7A 3K53A 4TLEA 4XWOA 1MT0A 1E9AA 2EW1A 4A15A 4ZCLA 2HV8A 4GT1A 4YQFA 1P7CA 2VP5A 1EWQA 4KVAA 4A8JA 4NCJA 1D2NA 1VCIA 2FZLA 2IYUA 2ZJ8A 3OAAD 3QF7A 4HAZA 2NQ2C 4TSFA 1DO2A 3U3RA 2KWIA 4RD3A 4Q9LA 3RRYA 4QBFA 4IKEA 3P32A 3U7FB 1U0HC 2VLIA 2GEDA 2GNOA 1BS1A 2HDNB 1TU4A 1WMSA 1QZXA 3BOSA 4AY2A 4BE7B 5DLQC 3KQLA 4Z1MA 2IYQA 2KBEA 4LV6A 4PTLA 5FR2A 1E1QA 1KMQA 3FPAA 3PUZA 2ZSEA 4LCBA 4DCUA 5J4HA 1HUQA 3VR3A 1G16A 3TAHA 3L0OA 1YVDA 3A4LA 1FTNA 1R8QA 3B1WA 3VHLB 3WBKA 4HAVA 4B75A 3A8TA 2IXFA 2CLDX 3FMFA 3MD0A 4WZ6A 3SYKA 1E1QD 1P60A 4CRWB 3IEVA 3E2IA 4KHZA 3PR1A 1H8ED 3AKCA 4GSYA 4UJ5A 4O0MA 2WIAA 1Z2CA 1WQ1R 5EXPA 1G4AE 1ZM2A 1T91A 5JRJA 1GM5A 1FZQA 2UKDA 3W6NA 2L0XA 2H7VA 2ZIAA 4RZXA 4BWYA 4MYUA 3THOA 2D7DA 1H8EA 4Q7KA 3X1DA 4WAUA 1DS6A 3BRWD 1MO5A 2ZRIA 2IF0A 1ZUNB 4QBIA 3I73A 3L0IB 5JI2E 1KOFA 2IEZA 4D4MA 4C7OA 1J8MF 4B32A 1K5DA 3TUIC 3LV8A 1HTWA 5D3MB 2ASEA 1G4UR 3E70C 3IUYA 2I4IA 2PMDA 2PT7A 3O8DA 4PHFA 1Z6YA 1EFUA 3OE7A 1A2KC 1X6VA 3PG5A 1DELA 4RFSB 1LS1A 3IIMA 3IIKA 1KO1A 3B82A 5GADl 2QSYA 3K0SA 3QBVA 4LPSA 3CRVA 1F48A 4ZKDA 5DN6A 4NCHA 4A36A 2WVJA 1WB9A 3C4JA 3C14C 4IVQA 4P4SB 1VMAA 1NY6A 1K8RA 3T1TA 4DCVA 3M4YA 3DOEA 4B6FA 4M1YA 1AQUA 1S9DA 4IOKA 3EWSA 4GI7A 2R8RA 1T0HB 5FUWA 3KQHA 1E2GA 3NKVA 1R0WA 1YZGA 3D7MA 5M04A 4C0SA 4PHTA 5JSZA 1RKBA
chains in the Genus database with same CATH superfamily
3EDCA 2CEKA 3LXXA 2VP0A 3CMMA 2P4UA 3N1UA 4H27A 4KAXA 2Z8YA 1ZNZA 1HDYA 2PSSA 2PAAA 1KZYC 4LZAA 3RJZA 2O8FB 4HQFA 2ZULA 1LSUA 1M8JA 3DR3A 2GZAA 3VGPA 2FPIB 4FHZA 2WHQA 3SYTA 1L7BA 3H3XA 3BSSA 1ISSA 1FLDA 1N5JA 2P1DA 4G65A 4TV9B 3S3TA 3Q8LA 3EHEA 1O58A 4M0PA 2GAJA 4QC2A 5IULC 2PX5A 1CUVA 2XUHA 3OCYA 3PNPA 4HVAA 4OHXA 4OQXA 4MVXA 5A71A 1IATA 2Y1OA 4P4TA 1M1NB 3WGJA 1KU6A 1E6WA 1EWYA 4REQA 4PLCA 3FNBA 1KAQA 3B51X 1VFPA 1K9SA 2OOKA 4J1SA 1P1BA 3KJQA 4MPJA 1QIGA 4OGWA 4RMIA 3ZK8A 2IYTA 3NR2A 1BCRB 2XYGA 4AECA 5JDCC 1K86A 2ZTVA 2EV9A 4B3TB 2G08A 2ZWOA 3KDSE 4ZV9A 5AJTA 1XKLA 1VPEA 2PL5A 3I6IA 1B23P 4NG4A 3QJYA 3ZY2A 3WLTA 3HA5A 2ZCVA 3MTDA 3WQHA 4ZTBA 4EJSA 2A84A 1LJ8A 4RZIA 5KX5B 3EZ7A 4YPVA 4KQGA 4QLOA 1D1QA 4EH1A 3ZCVA 3PHHA 5A5EA 4O2RA 5EJIA 4DQXA 5DLYA 3VUEA 1G21A 1GCGA 2P68A 2GZHA 4L2IA 1Q1ZA 1GV0A 2E4YA 3ZI7A 2OAEA 3ZXXA 1L7RA 3PFFA 4DBZA 4DUGD 621PA 2XVAA 1OBOA 1Z2OX 3LCVB 5AHWA 3ZUPA 3D6TB 3PS9A 2HT1A 2B69A 1CEEA 1U7OA 4BFYA 1M10A 1YOBA 2B8JA 3GCGA 4EF5A 4QU5A 2W4MA 2XW6A 4EEZA 3ZS9A 1PV4A 1LX6A 2C0PA 2R8XA 3ZUGA 1RYHA 2CLSA 2A5LA 1CZKA 2BZGA 2FQQA 4IEIA 5EHNA 1PX2A 1XRSB 4ZQCB 4YWHA 4F8YA 2VTEA 3QPUA 2YV1A 3R3HA 1YRAA 5LJLA 1OX4A 1E9DA 2J0UA 3ZZMA 4QJ5A 1IWOA 4A8JB 1W36D 4TTQA 3COVA 2ZJOA 1CZOA 1D4AA 2QORA 3IURA 4CDGA 1X8JA 1U0RA 1UPFA 3LF1A 3EMKA 1JG4A 4OATA 1D2HA 3ZCRA 3GA5A 2JHAA 4LRXA 1F8FA 4MUGA 4U9UA 1TC1A 9ABPA 2WJVA 3H2ZA 4YK7A 4TL6A 1Z5GA 4BFVA 2AOVA 1GRQA 4Z4IA 3K16A 5DNDA 5TB5A 1P2BA 1ZK4A 2BE7A 3L6UA 2O6HA 5HQTA 3AI7A 1H0RA 1Z4OA 1LPSA 2EJTA 2YCBA 1S02A 4QRIA 5K2MA 1Z88A 2IOYA 3FOAA 4F8EA 2IVZA 1Q1AA 2WWIA 2OC4A 3KELA 3BH6A 4K9OA 4QOSA 4Y6PA 2ZB8A 1VXRA 5EQDA 1DP4A 4N49A 2H1SA 2PCLA 1H6CA 4LAFA 3X43A 3DE2X 2Y68A 3P9ZA 3SJZA 1C9EA 2PX0A 3TVDA 4L7QA 5KVCA 2WC1A 5I9MA 4HDKB 3RANA 4EG3A 2XCUA 1QORA 2JJQA 3DUFB 4GMXA 1XBTA 1L5HB 1L5LA 2YZ2A 4EMTA 1ACJA 2Z3VA 1D8TA 1PKXA 1DIRA 3DZ8A 3LYLA 3H5AA 1NDHA 3U09A 1ETUA 3HXPA 3EZGA 4AD8A 3NC1C 1D04A 4ZOEA 3UAVA 3WL7A 1Z5UA 1BCRA 4L76A 3AFOA 2A94A 2UZ1B 3IRVA 5CX4A 4U7GA 4N0QA 1VL8A 5K3SA 3U61B 3B9PA 2FQYA 4EY6A 1NI5A 3WDLA 3ZU3A 4C7OB 4U5XA 3DZFA 3GYGA 1U7DA 5LOVA 1WP9A 2V7EA 3VUFA 4YUAA 1IZ8A 3DYBA 3IP8A 1SCQA 3Q2OA 1BOOA 1ZG3A 4WGFA 3V4OA 5JBNA 1AV7A 1O95C 3N2YA 4QX6A 5DHSA 3EXG2 1ONPA 4RH1A 2O7VA 1QPGA 2C7VA 1DXOA 3A9TA 5LXTF 5C7LO 4HZUA 3CLHA 1Q5PA 3JZFA 6ADHA 3D9QX 2CNWA 3QNWA 3IV6A 1EP3B 4E07A 4PRYA 5JC1A 1YL5A 3A9SA 2FWNA 2X3UA 2RGRA 4ZRDA 5TJHA 3PXDA 3KX2A 3IJRA 4V0MA 2YJZA 4MVJD 1M76A 4QATA 3MWFA 5CH3A 1W5EA 1C7QA 1RYNA 3JATA 4JJEA 4EHHA 2J6CA 3EEOA 2DQYA 2SKEA 4ZAFA 4D74A 4QPNA 5J9FA 5JIBA 4JLUA 1OB2A 1W1WA 1AK9A 2YN4A 1DRVA 4RD2A 3TLMA 3A6LA 1IAVA 4EARA 5HS4A 1YFJA 1AO3A 5CCXA 1RE0A 1J4AA 1FXUA 3LUAA 4EB6A 3GA7A 1E89A 4YUZA 4MULA 4BXOA 2Q62A 2QBYB 2V96A 4EGJA 1E58A 2HEGA 1E0SA 1XNHA 1N7HA 3CH4B 3B6MA 4YH1A 4U02A 3T0FA 1H4VB 4ES6A 4DL9A 1R0YA 3JSXA 3PUWA 5PGMA 4HDNA 3R9WA 2H4ZA 4JT2A 1T6ZA 1MJ5A 4CU2A 2C5SA 1RMYA 4R8RA 1SBIA 3GMIA 4MUBA 5A3SA 3WGQA 3ASUA 1DO0A 5FWXB 5HKKD 1YF3A 3H6GA 5FLYA 4RADA 4XM0A 5KNDH 3U13A 4CF4A 3KZCA 1S2DA 1VLMA 2VQ6A 3AFIA 2VJQA 5AHXA 1Z08A 2HHCA 4D9BA 3S29A 4YRGA 4ZMSA 3FSJX 1QAQA 2VDJA 4M22A 3ESXA 4XR4A 3O6VA 2RHCA 4K9MA 1GPKA 2VAMA 3C0KA 3HKCA 5ALZA 2D00A 4IZOA 4BBZA 4Q19A 1B6RA 8OHMA 5JNVA 1XMQB 1CULC 1JG3A 3K0CC 4ZI3A 2JLXA 2BEJA 3SZMA 3UJCA 2YR0A 5ALLA 3L84A 4HYEA 1WBDA 1YJXA 5CD1A 5ILGA 3K5WA 3ED5A 2AI2A 3ZDZB 4WOPA 1XD2A 3WSVA 4KRGA 2W2TA 2Q07A 4XFJA 4R1QA 2PQMA 1Y81A 2EJBA 3D8SA 2XUFA 3EVBA 5KHOC 1ECPA 2HGZA 3KZXA 4MV4A 3VYUB 3OLZA 4LC9A 3NHWA 1WP4A 3D3EA 3ZQJA 3VJMA 3DDUA 4AJNA 4TKZA 4CQNA 4KO1S 2HK7A 1NXSA 2ZIZA 3SX2A 1JDBB 2D5IA 1Y6QA 3QQPA 3TIVA 3Q9NA 1JLRA 3RAEC 4PCLA 4DR6B 2QG4A 3AESA 3UXYA 1JMKC 5IEJA 2O3SA 3X1JA 1KFCB 1FUYB 4M9ZA 1NWHA 2VLBA 3LH5A 4HXGA 4BN0A 3OOEA 1ZGAA 4HYYA 4XVUA 5E2AA 3QVTA 3CW8X 2OFOA 2R8OA 2GCGA 3UMCA 1QC5A 4WK0B 3SHTA 3PZBA 3ILSA 3G2IA 4DXHA 4EPVA 1QANA 2RGYA 2QUAA 3DMHA 3CLUD 3KJEA 1N32B 4KQXA 2WD7A 2J0QA 1I1NA 4EB0A 4UPEA 1MTZA 2P9ZA 3KOOA 1ADJA 5FOWA 1HA3A 1M1YE 2AKYA 1KO4A 4R2LA 2GARA 5AOCA 1N9GB 4YQEA 2CXPA 4CZ2A 4S1NA 3OEHA 4AB1A 4CM3A 4HGPA 2WJ4A 2XTZA 1GFSA 2X41A 2J4CA 1LLQA 1OFUA 4LNUB 2G25A 4E3WA 1BCSA 4KX3A 3ZS8A 3Q12A 2FPSA 3KQWA 5CDUA 1DAHA 3JD0A 4UHBA 3C8HA 2J08A 3CF2A 2WT8A 5GZ3A 4XIGS 4L0CA 4LSMA 4RLQA 3UHAA 4OLFA 1ONNA 2DKOA 2XVZA 3H5WA 2DHRA 1K75A 3FR8A 3HKEB 4MJLA 1TTQB 1RYBA 5AI0A 3VYRB 3M5PA 1ECLA 4NF2A 5FI3A 4WCDA 4F91B 2ID4A 5DYGA 3GJQA 2QSUA 1R5OA 4JJ6A 1RSZA 4HI0E 4D80A 3RC9A 4LJ4A 3H1EA 4DIOA 2OB2A 3SKVA 2XDQA 2AG0A 4CTNA 2O4CA 1ZAKA 3LC7O 2HPVA 3VYVA 7MHTA 2VNSA 2Q1YA 3M6FA 3BC1A 3AM4A 4HRVA 1P0PA 2QZSA 4ZO7A 3JAMA 1YSCA 4OI2A 2VRCD 2DFLA 2A67A 4EZIA 4XWGA 2VQSA 3HKDB 1EM8B 4HVLA 3WQQA 1SD2A 4OHYA 4MVWA 4BNNA 4MCAA 3MMNA 2X1VA 4ZT2A 2UVQA 4I4CA 1SXJA 2RH4A 5EIOA 2FZWA 4ZWNA 2X7XA 5CXQA 1IXYA 1QS0A 4EHAA 4XRGA 4EI9A 1JEYA 2JASA 1HL7A 4MVJI 1H8HA 3MMZA 4DHWA 2BR5A 1RLTA 2VSXA 3BWVA 3JQGB 4EYEA 5LSAA 3VI4B 4HGYA 1B8NA 1W581 2GPJA 2X3FA 3MQ2A 3PEUA 4NYJR 3FHJA 5ALJA 4IAOA 1TMKA 3PSAA 4L50A 4NBTA 4AC9A 1NJ1A 5JWHA 3RNOA 2XUPA 3EXIA 1H6DA 1BVUA 1N5DA 3G5TA 4DR3B 1GQ2A 1Z45A 2LE0A 3B1VA 1J6UA 1O96A 2CDCA 2HJHA 4II3A 5SY4A 1BH6A 4HVCA 5KOYA 4Q3EA 3C85A 4Q02A 1GYQA 4FHDA 3D6HA 2BFCA 3LXRA 4V0OA 1JR3E 2G82A 3R3ZA 2I3ZA 4GP9A 3WL3A 2C5BA 2CV2A 4BKOA 2X76A 1D0IA 1NDUA 3K4QA 2ZR9A 3PPWA 4Q1FA 5DZSA 4CCSA 2FCAA 1ADFA 4DRXB 5AWFC 3P9CA 3GCWA 1DJQA 3LQ2A 4MUFA 2RAUA 2PGNA 3RHSA 2OHFA 3KJHA 1XSEA 3ZV7A 4C4ZA 1A5AB 1F6DA 2H51A 1LVUA 5JNSA 2HA2A 2O2GA 2ZU6A 2XHZA 3BFKA 4ONEA 1V2HE 5DK6A 3OUZA 4LXYA 4EABA 4B2YA 3FB1A 3TE7A 4FYPA 1BEZA 3O8OA 3K0FB 2EJUA 2H7CA 4L6IA 4ZN6A 4JLJA 2QRNA 4GYYA 3QIVA 2ZRQA 2V9ZA 4P36A 4WBNF 4OQNA 3RSOA 5BMVB 1ODKA 1OB5A 2YJ5A 3WL6A 4CKYA 3N5CA 4WVLA 3ANXA 3X2FA 1A9XB 1BN6A 2DETA 1V25A 4K2HA 2P78A 4Z99A 1AKRA 1C80A 1QFYA 5DHTA 2BWJA 1NOKA 3VJRA 1RYYA 3DONA 1A8UA 3KQQA 3PC7A 2W93A 3BSWA 1GAEO 1QIEA 2OD7A 2QTRA 3BRSA 1ZA2A 1OKKA 1RKQA 1J21A 5HDQA 3SMQA 4ETIA 6LDHA 3QXGA 5EP2A 2O3TA 4YCJA 1O87A 2LZ0A 2VVTA 1TDJA 3FNHA 2X9LA 3G9XA 1C7IA 4MQFA 3H0CA 3RHFA 2I9PA 5C8YA 2QY9A 4O3FA 5F2KA 4FNOA 1ZPDA 2BMWA 4RDXA 1PL7A 3MD9A 4G4SO 1YJ5A 4Q9JA 1FCJA 2GX6A 1GQFA 3NXKA 3FWHA 4HPWA 1IPHA 4JQYA 4N03A 3N87A 1XEAA 4DVGA 1OZFA 1ESMA 2ZYHA 3QTTA 1DLJA 2B25A 2XDQB 1D8AA 1XWIA 3WLMA 3FYUB 3VDQA 5IMBA 5AW7A 2P6RA 2Y93A 4TV8A 2MWMA 4L7VA 1QO9A 2F67A 4WLUA 4CQMD 4TZ0A 5G02A 3W5UA 2OHJA 1PJ2A 2I8AA 1HYGA 1FTGA 5KIAA 2IIQA 3G5MA 4OH1A 5H1YA 3ZY3A 3HI6A 1JQBA 4LFAB 3B9BA 3FDZB 3N70A 3W4JA 2Z09A 1Q84A 5FUYA 3SF8A 3QE9Y 4HWGA 3ZTYA 1TIPA 2EFYA 1SG0A 3KALA 3VOTA 1KVUA 2R6FA 3T3EA 4FGZA 5IT9A 5BVGA 3HP7A 3TLJA 4YCNA 3E9EA 3R8FA 2AQKA 3A14A 4FW9A 2WPNA 4Q47A 4WK4B 4IG4A 1XZKA 1RU3A 2PXHA 4OYHA 4R0MA 2BYTA 1E3WA 1QG2A 3O8NA 3KAKA 2WQZA 4RIHA 1LDNA 1G64A 3PKIA 1X7WA 3I61A 3NP7A 4RQUA 3EZXA 5ES4B 2GEBA 2LXNA 3HO6A 4IV0A 2MSCB 3QLUC 4WY8A 3RFTA 1L4HA 1ZLYA 4HTFB 1M9NA 4GLFA 2IUFA 2CL7X 1QG0A 1J2YA 1HF3A 1VE3A 2XNDA 2YRFA 1MNAA 4QICA 1SU8A 2NU8A 3RC3A 1HDGO 2EF1A 4WA7A 2ZROA 2CDNA 2GT1A 3RWBA 5ETJA 5EP3A 4LHEA 2C00A 4MHSA 3E8SA 3ZWYA 4DARA 6YASA 3DFUA 5JQGB 4Y2RA 1KDTA 4QE3A 1WXIA 1ZU4A 2D5AA 2OZKA 1B0UA 4D5GA 4M8NE 3ABIA 1H2BA 4WASA 4XARA 3NEYA 4Q24A 4QFBA 2B1JA 1ZN2A 5E3IA 5EHXA 1WETA 3MK31 1BTOA 1VL1A 3GUHA 4F2PA 3PJGA 1T8SA 1P0MA 4I1RA 4S1OA 4WESA 4C22A 3OCJA 1DLIA 4DLKA 3WE7A 1THTA 1SIWA 3DKIA 2NP6A 2DBQA 2XA1A 4GZLA 2DHQA 1E9FA 4CLOA 3NHLA 2UDPA 3B53X 3I39X 4PLYA 3A4MA 3A2LA 3AKEA 4OQLA 4AKGA 4UC0A 4LOAA 5CJJA 5CVCA 3WMRA 2B4RO 1K7CA 4TWBA 1V6CA 1DINA 5AK6A 4QGSA 1UXKA 1ABEA 3BF7A 1NXPA 1QDEA 4OQEA 5K99A 2QX4A 1EFPA 4M9UA 4Y6LA 1YCDA 4AG5A 2FUCA 3HZHA 4I8XA 2C2KA 2V97A 3GRVA 3NAMA 5HZHA 1MN6A 2RFLA 2BSXA 1NBIA 4LJAA 4YIKA 2COKA 3UN1A 2CSXA 2IOHA 2YUTA 3THWB 3IIEA 2PVCA 3O1IC 3TKAA 1TAGA 2Z4RA 4YJFA 2QVLA 1BKYA 2GA9A 4D0RA 1G3IA 3C5CA 3JAWB 5FEMA 4HNUA 1TUBA 4M7OA 3EYAA 5BQOA 3RU9A 1K3UB 2XMSA 4RV5A 5L6MB 3MEQA 3PQCA 1SVWA 4M83A 4X93A 1Q1NA 3GJRA 1YA4A 2X13A 2YXBA 5LQDA 1P77A 4F4CA 2AFHE 1RXSA 2ZDQA 3E03A 2A6PA 2GPTA 3GB9A 4ND7A 3FMGA 2BFFB 3QEMB 4NBUA 5KYWB 4K9PA 2VPPA 4C0WA 5A4DA 2WE8A 5GM2A 5LU8A 5AM4A 3GEHA 4ABTA 1CUDA 1OLSA 1H5NA 1DJNA 1PEKE 1YUBA 1YASA 2P6UA 1PEDA 3ZI4A 3H16A 4GI3A 5EWMB 4OI0A 2XIJA 1DBIA 4LRQA 3GAMA 3ZNOA 4RLHA 1W2GA 3I1JA 2YZKA 4O4JB 4AJLA 2XB8A 3HYCA 3PEVA 4CMGA 5AVRA 4X65B 1HNWB 1NR5A 5ERGB 2CXOA 1H22A 1V5IA 4JQOA 1IN1A 3BILA 2P3SA 4IVNA 2LPMA 4NTZA 1JLSA 4HXEB 4F9EA 3MWEB 5BN5A 5KVVA 4DMGA 1ANKA 3JWIA 1FUUA 2P62A 1E2PA 5ULLA 2DTXA 4UM7A 1PT7A 4NWIA 1C7EA 1GTMA 1ZIYA 1KNXA 2OZVA 2PKXA 4R1TA 2REQA 2PLAA 1G60A 2YYAA 3PQ6A 1P9LA 3WLEA 1XR3A 3IOBA 1FLAA 2D74A 3LWBA 3D3WB 2QN8A 3VR5D 3AHCA 1TT5B 2EGGA 3CLTD 1B42A 2VYND 4Q15A 2CHEA 1FE8A 3KWJA 3NEPX 5CIWA 1DC6A 5BXQC 3VXKA 4H1TA 2O06A 1B1CA 3BL6A 1SXHA 1YZFA 1VM6A 1K8QA 1Y7LA 1ZCAA 2G36A 2JK0A 3I4LA 1NBEA 2GEKA 3QM1A 3ZCPA 4GI2A 1R9MA 4YRNA 2FW0A 5K45A 1E4EB 3EBOA 1JEYB 4INZA 3LPLA 1YACA 5FXMA 3L7IA 2JAUA 2ZDHA 3CJTA 1JH8A 3EARA 2G88A 4ZYTA 3HP1A 3NJ4A 3CLSC 1GRCA 1XVIA 3BH7A 4AMGA 1VMDA 1Y5IA 2OQRA 2BV3A 1UMCB 2IYPA 5EIBD 5FHRA 3VR0A 4CFZA 4PCAA 4RKYA 1VECA 1IUKA 4E5DA 3H99A 2IWRA 4D8UA 4KPEC 2P6OA 2CNLA 1I01A 2IXTA 2Y6UA 2QPAA 2GETA 2XUQA 1ZI8A 3D0RA 3FA2A 5HXAA 5K3FB 4BZQA 3T5GA 2EBUA 4A2QA 1C50A 2YIVX 3QKTA 5DT9A 1ZCZA 3AHFA 3VZDA 2JFUA 2V7XA 1OWNA 3AI2A 3OKAA 5FBWB 1DFGA 1OOEA 3PQ2A 4ND8A 4BMNA 4YP0A 2AWOA 3KQTA 3QELB 3W6OA 3VI3B 1S1MA 5CDHA 3GOHA 5KPJA 1RS0A 2YHSA 1ECFA 3IMGA 2XE6A 2O1WA 3F73A 3G8DA 5P8WA 3NHKA 5FDFA 5KTKA 5COBA 1DO8A 1A4UA 1IWPB 1W85A 3VPAA 4RU1A 4BV2A 5EESA 2YXLA 4IRXA 1Z29A 2CK3A 3BKWA 3OZFA 3GWZA 4GL4A 3ZDQA 2C3PA 2YV4A 1IXRC 2O4UX 4Z4QA 2MTBA 2P90A 1RQPA 5JD3A 1Z4QA 2JCBA 3VBCA 4HZUB 3NO4A 2VATA 2X2FA 4R1MA 2Q6OA 3KETA 1N5MA 3B6KA 3EOBI 5DYYA 2WTAA 4MV6A 2C3YA 5JT1A 1OU4A 1TO2E 4R8MA 5CB4F 1KL7A 5J43A 3QPCA 1M2VB 1FDSA 2ODQA 3DWIA 4CV3A 3IOYA 3HA7A 2OV8A 1QLWA 2HSZA 3KEMA 2XNJA 2D2VA 4IXTA 4WLVA 5DNCA 2I2DA 4UMFA 1FYFA 4PZ9A 1ODLA 2PYZA 1NVVQ 1VKOA 3IQEA 3K2EA 3LT4A 4NE9A 4LOKA 4DCCA 2GEVA 1ZOPA 1HZZC 1GTL1 2BR4A 3SQDA 4H1UA 2X0KA 1JV2B 3QVGB 1EGHA 3LY5A 4FKBA 3LX6A 4J0KA 4JZYA 4DILA 3IVMA 3OBBA 5F21A 2WWVD 1W44A 3SQNA 4TS1A 2AYYA 5KYXB 4CEJA 4WCFB 1N36B 4C4TA 2PRZA 1GG2A 3N8HA 2VQ3A 3JVDA 2HJRA 3REGA 2CZGA 1FFXA 2ZW9A 3ZGYA 1W29A 1G8MA 5JXGA 3JRXA 4Q9HA 1QYDA 1WX1A 1HC7A 1VI6A 2Z9CA 5AI6A 1I2BA 1FFWA 1XTUA 2E49A 1K1EA 1F12A 1H1DA 1T1IA 1WM1A 1HT3A 3I5MA 4OGKA 4E5NA 1ZA1A 4PC6A 1W1UA 4FFDA 4LYJA 4BP3A 5F4ZA 4JR0A 3B5EA 5A0TA 2JC3A 4CG2A 3FWNA 4AT1A 1V8PA 3HBNA 3H6KA 2V7UA 3KQMA 4J2OA 5DO9A 2W2KA 4RVNA 5KTSA 4M3NA 3BD6A 3ACBA 1UODA 1QHYA 1ZM7A 3VX3A 4C0AC 3SS7X 2C59A 5JZOA 1JJ7A 5F3WB 5CUQA 5JADA 2X4IA 1AURA 4LMBA 1BROA 2KW5A 4H4EA 2H7YA 4I19A 4YQYA 5ANRB 1UJ4A 5THKA 3X2EA 1V4VA 3USES 3VO8A 2PFSA 4TWIA 4JLNA 4MV1A 1KI6B 2ZUWA 1COWA 2BMEA 3DH0A 3H3JA 3EIQA 1OT5A 1FQWA 1US8A 1X74A 4Q3KA 1Q0QA 4LYHA 4OG2A 4OXQA 2RGWA 3VHXB 2PWAA 2R751 5ALMA 1V45E 3RTCA 3ZWVA 1FSPA 4R2XA 3KJXA 2E3JA 3KUUA 1CJTC 1QK3A 2C1XA 4YO8A 3I5YA 4GX0A 4XASA 1MJGM 2JIQA 3O4JA 2C4NA 1PZHA 2PFKA 1X2EA 3LQQA 4OK3A 3KHTA 3GJ0A 4WK6A 1NRJB 2ZTSA 3WAKA 4BNMA 4NL4H 1T6XA 2XI4A 5IAOA 1DBWA 1IB0A 2JG3A 1LPPA 3MAJA 3TGPA 2MSLA 2EQBA 1JJVA 3AHIA 2O2JA 5B1YA 1JPNA 2P7HA 1NXXA 1GZVA 2Z3ZA 4WJLA 3O9VA 1GSHA 3WMGA 4HDQB 3BIXA 2MYNA 4Y9TA 1Z0SA 2VOEA 1GZSA 2WMYA 2A7QA 4Q1BA 4CT5A 1KJYA 5CT5A 1ZBDA 5AK3A 5EUMA 3DTVB 4WTOA 3UT5B 3EZ6A 2CYAA 3M6IA 1WULS 4B34A 3IHKA 5LN1A 5TGDA 1SOMA 2PZFA 2PS0A 3P9NA 4JEHA 4CBVA 3NT4A 5CMLA 4BKPA 3DOHA 3O4HA 3OF2A 1JU9A 1WY7A 2JFZA 3TOSA 3TPZA 3AFHA 2QLLA 2YHIA 1UP4A 1E61A 4ZT5A 1NX6A 4Q9AA 1SVUA 4W9NC 5KO2A 5EZYA 5TPWA 5HX7A 3CRW1 4MXDA 4BNZA 1PYOA 2J32A 1AQIA 3ZKWB 3CKYA 4WXHA 1TIBA 3VR3D 1S9HA 5CXUA 1CRQA 5JW6A 3GJ5A 3GJXC 3GLFB 1WD5A 4IYRA 4DZRA 1VA5A 2J7KA 1A5ZA 4RGVA 4FN5A 4GQBA 2QN6A 3DOIA 4KIGA 1T13A 1FLVA 3DTNA 3DO6A 4BU1A 4GC5A 3J81k 3HHEA 1THMA 1XMJA 4L9SA 4GHWA 4O3MA 5LZ9A 1SC1A 3NG1A 1W52X 2W37A 1NSTA 5T6BA 1PG2A 3QMWA 3FVWA 5D2CA 3ZDRA 4BJ3A 3QUAA 3Q3JB 4AF7A 4RVGA 1Q0ZA 1RAEA 2F3UA 3N2LA 4EUKA 1UWCA 2CVFA 4RSGA 1QR6A 1IU9A 1P4GA 1ZWKA 2I1WA 2COEA 1R6DA 3D54D 3FFWA 1WZIA 4O33A 1E99A 1NW7A 3KQPA 3C3PA 3TLBA 4IR7A 3UATA 4WY2A 2PZJA 2TSYB 4TMKA 5H68A 5JYDA 2Y05A 3L4BA 3NDJA 5FIUA 1PSDA 4M0EA 4ZYUA 5AUOB 2OORC 3NVDA 1P4HA 5H5JA 1KAOA 1YQWA 1UZUA 4I14A 1J0AA 2YUIA 4G0XA 3TUJC 5I9IA 3CWCA 1MIOA 2QVYX 3IQHX 3NHRA 2JGFA 2PWBA 1UBHS 3LKDA 4JP3A 5EIBC 1U4OA 1NYTA 3WKDA 4KO2S 2I6TA 3BFVA 4GPIB 4A5SA 5JBQA 1Z7EA 3CT4A 3LFUA 3NTRA 4MW6A 2WUFA 1SFRA 3G2KA 1XZCA 3DQZA 1BHSA 4HNQA 1H5QA 3D4PA 2OA0A 3K5HA 2QZ9A 3N8NA 1C5KA 4FEGA 2H85A 4B8WA 1RHUA 1FX0A 3O8LA 5LDDC 1U28C 3FG9A 3OTGA 2DHEA 3UZUA 1IMOA 2I6QA 4BJ1A 4DPLA 2A1IA 1K7XB 1UOPA 3GEBA 5F9HA 1Z5WA 4J3FA 1IUNA 1BNCA 2P2YA 3QWHA 4MRMB 5JSYA 3UMVA 3RYCA 3U3ZA 5BUCA 4OLAA 4DSNA 3QFHA 1L2TA 2HBRA 4I2VA 4MQ4A 5I7RA 1NVUQ 1AA6A 1PLKA 3L3BA 1P5ZB 3G89A 3U7QB 3ZWPA 7GPBA 5FYDA 1NRIA 2HWWA 3CBQA 2NZVG 5JJCA 1GSOA 3CLUC 3PFIA 3OZDA 2AJ8A 1O6BA 2B92A 4Y2VA 2QI9F 2C5LA 3PA8A 4PGGA 4TT8A 3DG9A 2DSNA 4MV5A 4YRKA 3UJHA 3QVKA 1MAUA 3KCNA 3L9WA 4RKFA 4AMBA 4B6EA 5HUQA 1ADGA 3C97A 2VA9A 3LGAA 2OHOA 1UC8A 1PNVA 1ADCA 3NGLA 3WNCA 1JE0A 2JLCA 4DG9A 3S81A 2C4UA 4JA0A 1EGAA 3PQDA 4WKOA 1U9CA 2JH9A 2V1XA 3AEUB 2DH6A 2PQ0A 4FINA 3DZGA 1CUBA 1Y6ZA 1XP5A 4D56A 2A0XA 2J9GA 4PV7A 5CFRA 1ZIXA 2M98A 5JDIA 4RNDB 2GLUA 4IZIA 1AS2A 4BNXA 1SOAA 1XT6A 3LTEA 1JG6A 3PHJA 5CM8B 4MVJM 4HHEA 2H08A 4KAJA 4KVGA 4UQPA 1QF7A 2Q8PA 4G0QA 4N3AA 4XH9B 5IJ0B 5K9ZA 1GGEA 3I37X 4C2UA 1K5GA 2BEUB 5AYVA 1N2HA 2XOXA 3HC7A 1A50B 1Q91A 2A92A 1SHUX 1AMUA 4BNHA 3FTEA 4PSDA 4MOWA 1FMTA 2P9FA 2QVXX 2EZ4A 5F76A 3ND5A 4RE5A 4CKZA 4FI3C 4V2UA 4HCJA 4M1QA 2BL4A 1G21B 1N8TA 1TZBA 1D6NA 1XZLA 3E53A 1RKUA 1MQSA 3V1KA 4B4UA 1H3FA 2PJRA 5BN3A 4XWTA 4BQNA 2CFIA 5DEOA 3NALA 4ID3A 2VDVE 3CZAA 3PIIA 1FJHA 2WJJA 2JKYA 4OL0A 3G7UA 3I6YA 1PL6A 3AR9A 3K92A 4MI3A 3H2IA 121PA 4TKUA 5TF4A 1H2FA 2NGRA 2Q99A 4ETNA 3TGLA 3IP9A 4L9RA 3DDOA 2BE9A 3WKAA 3ICPA 4BP1A 2OFFA 3J80A 2YV5A 3U37A 5GJWC 1S4QA 4JXKA 5K8CA 2NYVA 3QLUA 3VOSA 1Z16A 2QL7A 4EY5A 1Y4AE 3C8DA 3RS9A 2AF3C 2WHXA 4JLPA 3G2PA 2J7PD 3M9XA 4TM8A 2PL1A 1RIIA 3FWKA 1G98A 4Q1DA 2GN8A 5FO0A 1JMVA 4KL8S 3IIJA 3VPCA 2MJLA 1JIVA 3C87A 5JRZA 4LDPA 3D43A 3SM3A 2ZYRA 3DEHA 2QTTA 3VNQA 3WP1B 3P2JA 5LBTA 2ZI6A 5ARDA 1HFKA 3TRFA 1M6EX 3B12A 4P32A 2F43A 2PKQO 2ZJ2A 4RJ2A 3REOA 3REQA 3VX4A 4JUDX 3N2GB 5BYKA 1HWYA 3X1WA 1ZZGA 5LJIA 1ZU5A 2ZJ1A 1ZRNA 3TR0A 1Y1RA 4ZCTA 5K8UA 2K7FA 1M54A 4MQ5A 1E94E 4FEAA 4N01A 1RPNA 4P7JA 2MINA 4C20A 3T5BA 1FJ2A 1HI9A 1Z68A 2ZYDA 1Q7BA 1R66A 3VZQA 1HORA 2HF7A 3FNEA 3OX1A 3IEUA 4HX2A 2ZG6A 1F3LA 3P4UA 3KVYA 3W8RA 4AJJA 2YXPX 3GC6A 3OPMA 1P1KA 1Y1TA 1J70A 2ZI9A 1W19A 2EBFX 4LK3A 4Q1AA 1MFZA 4IEEA 3ROQA 3ZHXA 5LNK1 1NLFA 3ECCA 3V7NA 3TMKA 1ZD5A 1FMLA 3P9PA 4ENVA 1RQ2A 1RCUA 3HEAA 1DC4A 2E7ZA 4JUFA 5DX8A 4D97A 5K6TA 1JPVA 4A0HA 2PLFA 1ZGBA 3SVLA 2CHGA 1X7XB 4LX8A 4JC4A 4NJEB 4ZT6A 3RI3A 4XM1A 3ZU5A 2JLUA 1RNLA 2CXUA 3SXUA 5IPFA 3G2OA 3V1MA 2GZSA 3PEEA 1DKOA 5EFZA 1JEQA 1K08A 2MIIA 1NL3A 5KCMA 5C1BA 1RQLA 2HEIA 3V8BA 5CCEA 4H7FA 1OXTA 4G5OA 1U28A 3KU1A 1UC5B 1Y8RB 4FOTA 2JFQA 4LDAA 4OSPA 3HWSA 4OQ4A 1H2EA 1Z4KA 2NZXA 3COZA 3EVAA 2A0WA 3QXJA 4AJ9A 1FIUA 5LKRA 4XAQA 1Z28A 3UWMA 3A2MA 4CTOA 1NJGA 5F2OA 2RG1A 3WGOA 3P27A 1MB4A 3FH0A 4LHSA 1W48A 2ORVA 4COKA 2FF7A 3QOYA 3D2BA 3JQBA 1TTPB 2Q5HA 5EXXA 3NAGA 1T9HA 2SCUA 4WOBA 3GD5A 3AP2A 3TQFA 4BZWA 1MO3A 4PLZA 2EX0A 3UAZA 2VT7A 4QJ4A 2DBVO 2R5FA 4FJ2A 3I8SA 4LV5B 1GKYA 1UKEA 4KACA 4OH7A 4XM2A 5DLDA 1Z6QA 5I8PA 4ARIA 1XXHE 2VWHA 3EH1A 1QYXA 4AJOA 4OREX 4B81A 4CLEA 2JIBA 4B48A 3M49A 3OC0A 2G1UA 3AM1A 2QF7A 2O20A 3IAEA 3S40A 4YROA 4CE6A 4F04A 3QBEA 4MRRA 4MA5A 5CA1A 1FYDA 2AX4A 4JVNA 3AB7A 1IY1A 1DIGA 4H3SA 3ZCQA 3EFOA 3DHWC 3VR2A 1RZ3A 1TJPB 1X19A 2A5GA 2PMFA 3U17A 4ALJA 1UXGA 4G24A 4JT9A 1XXHA 4EDHA 3T38A 5DNWA 3RS8A 5DSXA 1QFJA 2JANA 2FX2A 2GPSA 4ZAYA 5GONA 4MV3A 3UMRA 3EMBA 3HCOA 5ER6A 2O3RA 1OTXA 3H0EA 1COZA 4MROA 3DSRA 3I1IA 3EVFA 4D79A 3F6BX 3EQ7A 3PXEA 5GONF 3WV5A 4C9BA 4G8JA 4CKWB 4E88A 1NMYA 3R23A 1B8OA 3K70B 4AP6A 1ZH6A 1WWKA 2BEKA 4IUBS 1M34E 1N4AA 3BZUA 4LHWA 5ESXA 4HX9A 3I3OA 3AL3A 4L9WA 3NH9A 3DKRA 4P5PA 4Z86A 1M1NA 1M8KA 1G8AA 2Z5VA 3BULA 1O2DA 3H2JA 1KQGA 2WZDA 3K9NA 4L5JA 4JK3A 3RYTC 4RHYA 4YI5A 3SJ7A 3RLFA 3TQOA 2APJA 1YR8A 3K7EA 5B58C 4HNRA 5K1ZA 2QAJA 5FL3A 2I3AA 1MJNA 2I76A 5AJYA 4AS2A 4D9IA 1OFVA 5ERXA 1FP1D 3RK4A 4UEJA 1N6RA 4DC1A 1XF1A 5MGBA 4NE2A 3EXG1 3LXMA 1VHTA 4WN9A 4DCMA 4JLKA 5DASA 4MEJA 1W5AA 4HRYA 3M3DA 4F4FA 5LBUA 1FUEA 2OGSA 1S2MA 3N76A 3F7TA 2GFQA 1PR5A 3OE7D 4HLQB 4OOFA 2GN4A 2J3QA 4GG1A 2NU8B 2VXOA 3ZHOA 1K06A 1NLMA 1PR6A 4H9GA 4R1UA 1N0HA 4KPUB 3WL4A 4MH0R 3V3TA 2X9GA 1R10A 3IHLA 1E2FA 1Q7CA 1UBUS 4TSRA 2HQOA 1TA0A 4D4LA 1FEZA 1YQTA 2VS1A 1KI8A 3AKDA 4X1YA 3WHKA 1IFXA 2HMTA 3OLWA 5IDXA 3MMPA 4IHJB 4KODA 1ZUD1 4KRXA 4KYIB 3KSAC 3PQ7A 4MMXB 2FETA 1TLLA 4IIDA 4F6CA 2GCNA 2YH2A 4DBLC 5ALEA 4QPPA 5E3HA 3CVYA 4MCHA 1RPZA 1FNCA 2FXIA 1WXQA 4HDKA 1UK7A 3I9NA 4P3YA 2CVZA 2W11A 3O2SB 2ZAOA 1KZHA 4H17A 2WZCA 4JOBA 2Z08A 2J9YB 4L75A 1G42A 1P18A 4IO0A 1M7HA 4JENA 1OWPA 1ENOA 5EJ8A 3DBHA 3G5AA 4IZ6A 3AINA 1RC1A 3MHPA 3F9CA 1MOQA 3O2NA 1X3LA 1ZCJA 2D3TA 3PNKA 3DT8A 2A86A 1TE2A 4TSFD 4RHTA 1NJ8A 5EXTA 2AKAB 3CLTC 1IOLA 1VPDA 1ZM3A 1G8GA 3JQCA 1YS1X 2VSOA 2GN6A 2GPBA 3CVXA 1XU9A 4RY8A 3C6XA 4MR8A 5GVRA 2Y0CA 1UZAA 2UYGA 3R8CA 3STTA 1QP4A 2XRMA 3H13A 3BMXA 3EQ8A 2BEUA 3QNMA 2IYYA 4YT5A 1Q22A 1AC5A 4ZRNA 3U6BA 1ORIA 2H1HA 3BIFA 3LFTA 1YBAA 3W5AA 4OUKX 1YVEI 1XEWY 4DLNA 1J5PA 1CP2A 4O2BF 4WXYB 1NJSA 2X3YA 1IY8A 2C20A