3L43A

Crystal structure of the dynamin 3 gtpase domain bound with gdp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
242
Chain Sequence
QIAVVGGQSAGKSSVLENFVGRDFLPRVTRRPLVLQLITSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the dynamin 3 GTPase domain bound with GDP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dynamin-3
total genus 69
structure length 242
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l43A00
2AD1A 1WQ1R 1Z28A 3CBQA 5BYKA 1DBSA 4F92B 3DKPA 4DHEA 3GLIE 2R6FA 2ZYWX 4Q48A 1R0XA 2G3YA 2W2TA 4RFSA 1BO6A 1DOAA 5KNDA 3GJ6A 1XMJA 2JJ1A 5FPTA 3T1QA 1S4QA 4JKIA 2QQEA 2XTZA 1AZTA 2IYRA 3GLFB 2WWYA 2V8OA 2ZVQX 2R62A 2RHMA 3AVPA 1NIPA 2WIBA 5EXPA 1KO4A 2Z83A 3EA0A 4M9XA 1E4VA 3KXLA 2ATXA 1E2IA 2CDNA 2FGKA 5TV2A 1VYVA 2FNAA 4LV6A 4AIIA 1R0ZA 4YMSA 2QTHA 3U44A 3IQWA 4FMCF 2J41A 3L8ZA 3O8RA 5TB5A 1G21E 5DH9A 1YRAA 1WE2A 1IY1A 3TW4A 4ACBA 1X1RA 1XP8A 4BASA 5E4FA 5B30A 1MV5A 3NEJA 4NP6A 4BFTA 3U5ZB 3GCGA 1G8GA 1Z83A 3LXRA 4OI0A 4JKYA 1YZKA 1D8TA 3AVXA 5DI3A 2QZ4A 2F1HA 4JLVA 4YDSA 3QF7A 1P62B 2EYUA 1UJ2A 3C4JA 3ZD6A 4DUGA 4HEJA 2LWIA 3TNFA 3CF6R 8OHMA 2FA9A 1SXJB 2DR3A 5DHAA 3BH7A 4NBSA 1D2EA 4B32A 4ERNA 1D5CA 4HDOB 2ZRMA 5H1YA 3R9IA 2PT7A 4LGMA 2ZRIA 2D4HA 4LYAA 2O0KA 1P9RA 2WKQA 1AQYA 2F43B 4Q7LA 4QJ5A 2JLSA 3LBIA 4EJSA 5DHFA 3NBFA 4EPRA 4JL8A 2CL0X 3SJAA 5KYKA 4B3GA 1OV4A 4YMUA 3TSZA 3W90A 2JIZA 2QL6A 3IGFA 3UIEA 5BW8A 4B74A 4U5XA 1R2QA 1GTVA 4B35A 3L8YA 2ORWA 3X2SA 1MO4A 4MKIA 2ZI9A 1Z6AA 2Q3HA 5FTJA 4AI6A 1O3YA 4OHWA 1FP6A 2ZSDA 4A1FA 2XEXA 1JJ7A 1TF7A 1KK2A 1ZU4A 4IDNA 4KYIB 5LD2B 3THWA 1P2UA 1GP2A 4C0SA 2REXB 3KDSE 4N0DA 2J45A 1AK2A 2X1VA 4JL6A 1KJYA 2IYVA 4A9AA 1E0AA 2WKRA 2B8WA 2BCGY 3QKRA 2O8BB 5TMPA 1UKVY 1OH5A 2W6ID 5FI0B 3K9GA 5J5CA 1MRSA 4ZDKA 5HR5A 2QPAA 2RGCA 2VF7A 1E9AA 1S1CA 2GBLC 1XJCA 3QVUA 2L0XA 4DRZA 1W0JD 3P4YA 3TAUA 1KI3A 1YR7A 1TMKA 4Z54A 2J3EA 1YR9A 3EG5A 5CLLA 2Q3MA 1GSIA 4TMXA 4MRVA 5CLQA 5F2EA 5CJ2A 3U3OA 4D82A 3CX7A 2XNDD 1OF1A 2GHIA 3Q5DA 1FOEB 2B6HA 1VYUA 5JLJA 3PUWA 4EAQA 2QMOA 2CLCX 4LV5B 1F60A 5CJPA 3GLHE 3V4FA 5FOTA 1RC8A 3REFA 1E2PA 3RRNA 1X86B 4K46A 4R71A 5JECA 1RRGA 1FNMA 5HKKD 1WA5A 2MSCB 1VHTA 2I1VB 721PA 4ACAA 1KDTA 3EPJA 2E9SA 4PQYA 1T91A 5E7IA 4BGDA 4C0KA 4D80A 4IW3B 1TPZA 1F2UA 4QBGB 5G3ZA 1G291 1MO5A 1IOZA 4XTRA 1S9DA 4B6FA 5TVKA 2FGJA 4Q01A 4TL7A 1EGAA 5FOWA 2KBFA 1UBFA 1SULA 2CK3A 4OL0A 5K8TA 2XXAB 1NIJA 4S2EA 3ZGXA 4HB4A 4G0NA 3LO5A 4HUQA 4TTQA 1ZC4A 2DWOA 1AQUA 5EXXA 4Q9IA 1M7BA 3TUZC 2GXUA 2ZAOA 3IBGA 4FN5A 1E94E 2K5UA 6Q21A 3SFVA 3T1VA 2HLDD 4B47A 5AK0A 3EZFA 3FWYA 1Q0UA 2IYTA 1OFHA 2FSGA 4D0GA 1NG1A 3LVQE 2FZLA 4EPTA 2NQ2C 1RYHA 1XWIA 2W0MA 3WMFA 3TH5A 2QT0A 1C4OA 3RRZA 2IXEA 3LV8A 2Y8EA 3QUSA 3W9YA 1E2HA 1GRRA 1W4AA 3CPJB 4IEEA 1XD8A 1E9RA 4EQ6B 4XSHA 2G0NA 1WRBA 2ZJ8A 2IUTA 1P2TA 1EFUA 1DE0A 1UF9A 4D4KA 1BYUA 4JT2A 3ZS8A 4MGZR 1RVDA 2AD5A 4Q00A 4Y0VA 5KSZA 3PENA 1JXMA 1Z5ZA 1X8JA 3ND9A 2NO7A 2ZS8A 2GWHA 5CYOA 5J40A 2NZJA 4AWXA 2WAYA 3NIBA 3Q8XB 3C8UA 1W4CA 2VHUA 3SBDA 3K0SA 1FUUA 3ICEA 2W6JD 1GITA 4MYHA 3I3SR 5EZ5A 1J2JA 1YJ5A 3H1TA 3TK1A 1G18A 1R4AA 4AKGA 1ZJ6A 3REGA 1U8AA 5FPKA 2ZYTX 2HYIC 4JZKA 1G1MA 2CHVA 4URXR 2O8FB 821PA 1KHTA 3R8CA 1DS6A 1XX6A 5G40A 4IFBA 5L3RA 5JJLA 2NTYC 2OCPA 2GTPA 2JJ1D 2O0JA 3AF2A 1HUQA 2GESA 3FKQA 2H92A 3ADBA 4LOAA 3RABA 3IEVA 2BC9A 1G9XA 3ZVLA 3NH6A 1OLOA 1XD2A 3CWQA 2RGEA 2AHOA 3TLXA 5JZVA 1E32A 3EPLA 1XMVA 2JLQA 2IYWA 3OEHD 4Q9HA 2XZPA 1II0A 1P9NA 1YZLA 1DAKA 2JAQA 2KE5A 1GKYA 4D81A 3UMFA 4NL4H 5KDOA 4GP6A 3CZQA 2DFLA 3GEIA 3LBNA 4A0FA 2O8CB 2AFIE 1MRNA 4OKSA 1Q1QA 2ZJZA 4MGYR 1U90A 3CONA 3DVLA 5DGXA 2ZRHA 4XD7D 3PVSA 4LI0A 2ZUDA 3GP8A 2AXPA 2XNSA 2ZRJA 3W6PA 4DXAA 3K1JA 3LNCA 2QRNA 3U3KA 2VSFA 4DJTA 4JSTA 3B9QA 4QGAA 4C0AC 4PO9A 1ZD8A 2N42A 2RGDA 3BD9A 3SNHA 3WNDA 2ODEA 3QSYA 2NPFA 3L0IB 1OIWA 5FUYA 2ANCA 1XEWX 3QKUA 2PZFA 3MJRA 2ZITA 2JASA 4ILEA 4PANA 1YR8A 1Q22A 1DAEA 3ZIAD 5FR2A 1OIXA 2ZR7A 3C5HA 4ITRC 1BH2A 1LVGA 3C5CA 4BFWA 1TQ6A 4CEIB 4PPQA 1EESA 2OSBA 3K0AA 1BMFA 4Q4AA 2BV3A 2Z4SA 5TDHA 1SGWA 2GILA 3D6TB 3V9PA 2X8AA 2I3BA 1FQKA 1M2OB 4RFVA 1HE1C 1NBMA 3QXCA 1N5JA 4M1TA 3GMTA 4TQUS 2OZEA 4L15A 2IUUA 4G5OA 5IK2D 1KK1A 3U7GA 4CEJB 1Z0DA 4ZDJA 2AK2A 3WMEA 1AS3A 4LHXA 4B6EA 4HAVA 1BS1A 5KNBA 4PSAA 1VCNA 4WZ6A 4ZCIA 2IWRA 2FSFA 2IW3A 2QSYA 3FFAA 4IDHA 3DL0A 5H68A 4DEXA 4AKEA 5AUPB 4BLPA 1LF5A 4Q66C 4BLTA 3GLHA 3U7FB 4MGIR 3WRYC 1XTQA 2FOLA 1I4DD 5K8LA 4TYYA 1ZD9A 2OE2A 2P6UA 2ZRPA 1HE8B 1H8EA 2OT3B 4TZ6A 1PZNA 2W0SA 2ZI6A 4JSYA 2OAQ1 3W5JA 3N2IA 1E2DA 5CB6A 2JDID 3GLGA 3RSLA 2W00A 4HB0A 2QRZA 1G8YA 3KJIA 3ADCA 1CULC 2O8FA 2DY1A 1TU4A 3PITA 1GILA 2FPLA 1HQCA 1IN8A 2BMEA 4UXHA 1OB2A 1UDXA 2IEYA 2WM9B 1J8YF 3I92A 1ZRHA 1GNRA 2ZUCA 3H2YA 1Z0FA 3S1AB 1UBCA 2GEDA 2J0QA 2PCLA 3PIRA 3DEFA 4Q1AA 5SZIA 3SHFA 2DFNA 2FJUA 3EC2A 5EP1A 2RGNC 2C98A 2D7DA 4GP7A 2JJ2A 3QENA 4C30A 1QVAA 4EIWA 2CLSA 4TYNA 1XXHE 4F91B 4G5GA 4LY6A 1IAQA 4QJ4A 3QVVA 2CCGA 1U0LA 2ZSAA 4Q4LA 3ZD7A 1T6NA 1ZNXA 3CH5A 3QOFA 3SR0A 4DDWA 2PLFA 1L7VC 5E95A 3FB4A 3OZXA 4P3YA 1G16A 2FPKA 4OI1A 2ZRFA 1NBME 4MDFA 2XX3A 3EIEA 2OFOA 4OBEA 3VQTA 2IC5A 1P60A 3FVQA 3SJBA 4GBMA 3WNBA 1XCGB 4LUCA 1EXMA 1OE0A 3B7GA 4RZ2A 1NI3A 2R2AA 4HDCA 2GXAA 1VECA 4QL3A 4RSGA 1XTIA 4KODA 2ONKA 3VR4A 2CJWB 4OJKA 3FDIA 1EX7A 2A5GA 2ZR0A 1ZC3A 3ZZUA 3KKOA 2QAGB 2Z4RA 1XF9A 4S35A 4B73A 1XXHB 2XB4A 2DHRA 3CW2A 2AWOA 2YC4C 4JBXA 2WWIA 4LJ5A 4TTPA 4ZCLA 4QHSA 1T0JB 5G53C 4DSUA 1R8QA 1NKSA 1XU4A 1ZM7A 4TMWA 1F5NA 2FFQA 2OCAA 2RAPA 1U99A 4ON9A 2FWRA 1DAMA 1IBRA 4G01B 4TL8A 3H84A 1JNYA 3RAPR 3OAAD 3JZMA 3T1OA 3SQXA 1Z6TA 1L4YA 4RFSB 3RS0A 3GPLA 1HQYE 3X1DA 3SDZA 4HLUA 3EPHA 2ZS7A 1ZW6A 2V3CC 3SI7A 1VDZA 1SXJE 3HPQA 3QPVA 1KIMA 4Q4HB 2WJVA 2FU5C 4IOKA 1Z2AA 2D3WA 5IRCD 4JVMA 2P2LA 3L0PA 3OIVA 1DG1G 5FL7A 1G4UR 4B3DA 2YVUA 4ZPXA 2DFTA 5GJBA 4B3BA 4TLBA 3L82B 1XEXB 3QBTA 1GL6A 2X19A 4NPHA 1CLUA 1RJ9B 3B82A 2ZTSA 3AM1A 2GEUA 3I72A 3AVQA 3GFTA 3UMSA 4GOXA 5BXQC 3LRPA 3OEHA 3SZRA 2CXXA 2GCOB 1KDOA 2GKSA 5ELXA 3DMNA 3VHXA 1U94A 2WV9A 2WOJA 4UNSA 1CEEA 3KTAB 1HURA 4C0QC 3FKSA 2EQBA 2C9YA 3VHLB 3UPUA 121PA 3PXGA 4KBFA 2QI9C 2IYYA 5JWOA 3T34A 2C9OA 2FF7A 2PEYA 3HYRA 1N3BA 3RSOA 2WMNB 4DWJA 2D2EA 4KFUA 2QAJA 4IXNA 4F38A 2OXRA 5EP4A 4HZUB 4CEHB 5HPYB 4RD3A 1UPTA 2JLWA 4HLQB 1E2LA 1T4GA 5EP3A 3EZ6A 4F4IA 4W5HA 4HSEA 2XTMA 4ARZA 4BFXA 3CPEA 3WYAA 3OIWA 5JRZA 1CIPA 1EFRA 1NJGA 3B78A 5BN5A 4XTCS 4W5JA 3P27A 1DARA 1NNEA 3LWNA 2FMXA 1TEXA 2YWHA 2V1UA 3PR1A 3CB4A 3THWB 2BEJA 1KKMA 3PUVA 4IVRA 3NBYC 4LRWA 1HT2E 3EARA 1E69A 1Z22A 5D3MA 1AZSC 2SHKA 3THXB 1LFDB 2IEZA 1ELOA 2RB4A 3BGWA 4NYJR 4HDQB 1TU3A 1N6HA 1FQJA 5FL3A 1GUAA 1WXQA 1XRJA 1T9HA 1IQPA 1XTJA 3F5FA 4XVUA 3U7HB 1N6IA 1CRPA 1AGPA 1OW3B 4URWR 1OXSC 4Q7JB 3CF0A 3D7MA 5FTMA 4B76A 4Q18A 3ZZTA 2EFEB 3IPYA 2NPIA 1NSTA 3IHWA 4M9SA 4V0NA 2UZ3A 1M8PA 1E2FA 4GI7A 3TMKA 1QDEA 5GJCA 2VHJA 3Q85A 3CX6A 3IO5A 4JMPA 1CF4A 5C4MA 4URZR 1Z47A 2GVDC 4QBHA 4XWOA 4CEJA 1GNQA 2OLJA 1KJZA 4RZ3A 1HH4A 4M2LA 3KTAA 1KSJA 4KFRA 4OHVA 4Q9LA 5JRJA 2XZOA 3TSWA 2JJ8A 2PX0A 1FW6A 2VHQA 5JSZB 2JLYA 1Q44A 5J4KA 2HDNB 3HDTA 2ZQ5A 1US8B 1KK0A 1QG4A 5G41A 3PEUA 5FPYA 3GLGB 2UVQA 3KZ1E 1II8A 2AX4A 3PV0A 4BFVA 5F3WB 2ZAMA 4DB2A 1UKEA 4Q1DA 5EE9A 3PCRB 3TVTA 4EJSC 4EFLA 1OKKA 1FP7A 1E6CA 1QF9A 4B3CA 1M7HA 1JALA 1ZNWA 2V7QA 1TTTA 1XNJA 2QP3A 4D0NA 2EVWX 2BWJA 3AF4A 3QNUA 4GFDA 3SFZA 4QM7A 3NH9A 5K8IA 1WBDA 1U2RA 3EPKA 3OEED 4Q4HA 1KO1A 2O8EA 3QKRB 1XBTA 3LD9A 2FEMA 2YOGA 3CR8A 4LC0A 3I5YA 5FOSA 1Z0KA 2ZI7A 4QBIA 3S1AA 1MH1A 3JZAA 3DMDA 3AEZA 2ZRKA 4RD2A 3T61A 3WBKA 2H7VA 3CRW1 1KMHB 4UNPA 5TY0A 3B1YA 3NG1A 1JECA 3ZS9A 1O87A 4YXWA 2C2HA 1AKEA 4P4SA 3EWAA 5B2ZA 2EFCB 1XFAA 1AJEA 1L2TA 3ADKA 3L2OB 1W0KA 2F7SA 3RS5A 5LDDC 3ASYA 2JIZD 3I1FA 5FOVA 2QG6A 5CM9C 1IY0A 2YWGA 3N5CA 1XD2B 2QT1A 2ASEA 1RRPA 2J0VA 1PLJA 4HB3A 4ESVA 3WYFA 1W5SA 2O5VA 3RDPA 1KI1A 4G1UC 1OH6A 2D7CA 4I1UA 1NG9A 3SEAA 4Q1CA 2RCNA 2F1JA 2VP0A 3C15C 1BOFA 4TQAA 3BE4A 4QNRA 1AS0A 1C1YA 4WZAE 3GLIA 2G0TA 3E2IA 4KI0A 4P0TA 4Z8XA 1I4TD 5JHGB 5DN6D 4D6PA 2FSIA 1NY5A 2ZE7A 4GRAA 3IHLA 2BIFA 3K9NA 1CR0A 1OHHD 1EFTA 1CJTC 5IF9A 1WP9A 3MRSA 3NEYA 2ZR9A 4OHXA 1BYIA 1KMQA 4C0LA 1C9KA 4I4LA 1QRAA 4E07A 3L0OA 3MUFA 1SVOA 2VO1A 1NLFA 1PVOA 1E2MA 2G77B 2XNDA 2I4IA 3X1XA 4F4JA 2PH1A 1E2KA 2OAP1 1E2GA 4HYYA 3UG6A 1IN5A 2PCJA 4PSVA 2WWXA 2GK7A 1Z0AA 2A5DA 5BN3A 5E7JA 2XXAA 2YWFA 5HE8A 1VCOA 2VP4A 3B9PA 1G5TA 3QIAA 1SZPA 4MDEA 4O2LA 5HKKA 3BS4A 2O8DB 2C8VA 2CJWA 1R7RA 1E2QA 3AKYA 3VKWA 2QM7A 3ZZ0A 4FWIB 1UBEA 1RW4A 2HUPA 4ZIRA 1A1VA 1SKYB 4EFMA 5AJVB 4IHQA 2B7BA 2R65A 3LLMA 1G3MA 3BFVA 4TYWA 1XTRA 1RKBA 3NDBB 1NBMD 4Y0AA 2WSSD 4OQFA 1R0YA 2G6BA 4KBGA 2ZRGA 1YU9A 1OT3A 2GCOA 4WXRA 5CDFA 4U02A 3B13B 2ZIAA 4NCKA 1NP6A 4FXPA 3K09C 4QNMA 3GLGE 2NMVA 2IYQA 4HUTA 2VPPA 1DVRA 5TARA 3AVTA 2HF9A 2Z6VA 4MYCA 3GLHB 2ONJA 1B23P 2DYKA 1XXHA 1JR3E 3A4NA 4L9SA 1X1SA 2MMCA 3MGCA 3HU2A 4O0MA 1GVNB 1D6JA 2C96A 1NVUQ 4N0EA 1XZQA 5DLQC 3U44B 2GF9A 4N3NA 1E9DA 3Q7PA 4DCTA 3KUCA 1Q21A 4FMBB 2EYQA 4E5UA 1KMHA 3UATA 3AV0B 1UADA 1RPZA 5B64A 2RH5A 2YC2C 5DIFA 3QXJA 1L8QA 1CP2A 2UKDA 1F6BA 2CE2X 2WWGA 621PA 1Z06A 3CIOA 4L16A 3WP0A 4ZO4A 2CCJA 2ECKA 1K6MA 1VG0B 3WYGA 2R6DA 4R9UC 3P32A 4HAYA 3KUDA 4KSBA 3T5GA 3TSOA 4BRWA 4CEHA 1K5DA 4GMXA 2O52A 3G82C 4F7WA 2H5EA 4CEIA 1QBKC 4TWZA 1KTVA 3LBHA 3X1WA 4US0R 3IKJA 4W7SA 4A36A 3CLVA 5IT5A 3EWSA 4E09A 4QXAA 4AG5A 4H9GA 2F6RA 2XOKD 2VLIA 5J4HA 4KSCA 1DG3A 1KSGA 3B1XA 4Z1MA 3A1WA 1G64A 4D26A 3MLEA 4BZXA 5IK2A 1DAHA 1N5IA 2J59A 3C41J 4ASUD 1N6PA 3HR7A 1OH7A 3B6EA 3Q72A 4TL9A 4FMDF 2YOFA 4JJKA 4DUGD 2AN9A 2D74A 3ZIAA 3VKHA 2G1JA 1U8ZA 2E87A 1LF0A 1KI2A 5KTYA 2ZS9A 4RKFA 2HJVA 2QENA 2WHXA 4FCVA 4CT5A 1SVSA 5EXTA 2O0HA 2OHFA 4W9MC 4OQLA 1VG1A 3KFXA 3WXMA 3TBKA 3SOPA 4M22A 3CO5A 2B92A 4FINA 2CK3D 5LBIA 1QHNA 4PSKA 4YQFA 4MITA 2QUZA 2F1RA 3U7EB 1KI4A 3N2EA 4UQOA 3BXZA 4PTLA 2RGAA 1NL3A 1ZM4A 1ANKA 3FMOB 1KI9A 1P2SA 3BOSA 3MG9A 3K53A 2OUKA 1QHGA 1J90A 2CBZA 2YZ2A 2QBYA 2QQ0A 3CNNA 4XVQA 1KDPA 2F3RA 2VP6A 2ZE5A 3IEUA 4D4JA 3B2EA 1ZCAA 2WSMA 5EE5B 1OIVA 3MWLA 2VSXA 2IHYA 2Q9AA 3A4MA 2VL7A 3LQQA 3WP1B 1JI0A 3OAAA 1P75A 5EP2A 1QHHB 3ICQB 1X6VA 3EZ9A 3THXA 1ZYUA 5H70A 1JJVA 2OBMA 4ZDWA 2XB2A 4IOJA 2AKYA 2ZM5A 1JQJC 4ARZB 4I81A 4JLDA 1G19A 1KYIA 4YMTA 2GF0A 1UBGA 4B3XA 2WMOB 3BB4A 2ZU6A 2QORA 2ORIA 2IK8A 5HCIA 2VA8A 1E1QD 4KHZA 3OIUA 2Q0HA 1KKLA 4E03A 2QE7D 4LJ8A 5JCZA 3AVUA 1SHZA 1XPOA 4PXAA 1RJ9A 4POAA 5JS7A 2XGJA 1COWD 1K5GA 3LXXA 4L5BA 5CM8B 1Q3HA 4IJMA 2AR7A 3SYNA 2ZRBA 2NO1A 3K09A 3M6AA 2QMHA 1VKJA 2PMDA 1W44A 4D2IA 2ZETA 3RC8A 3ZYCA 3MJHA 3W6OA 2FPMA 2H16A 3KB1A 3U3JA 3THYB 1TEVA 5KSPA 4JVNA 5EQTA 1XTKA 4A15A 4JYBA 4KITB 1CS4C 2Z0MA 1SQ5A 4B3FX 2OFXA 3AVVA 1XPUA 2QNRA 4A2QA 3I4LA 5CYPA 2X77A 1X8LA 4DKXA 2LKCA 1AIPA 5KPDA 5E7MA 2JDIA 2G88A 4WVFA 1PLLA 1U9IC 1JPNA 2P0EA 4GOJA 1KNXA 1FFHA 2VRWA 4QC2A 5C1BA 1UEIA 1JPJA 3AKEA 2YINC 3K8YA 1LV7A 2EWWA 4MYUA 4P4UA 4Q1BA 2CHQA 4LJYA 1S96A 1TAGA 3B1ZA 2IF2A 2IYLD 1CJVC 2FEOA 3TUJC 4CF7A 3AF1A 3DZDA 1EG7A 4PFSA 5TXGA 3K0EA 2FFHA 4C0JA 1LY1A 3NTUA 4B71A 4NTZA 1BKDR 4O3MA 2N46A 3W3ZB 4A4DA 5L3SB 2CE7A 4MYTA 2CMKA 4TTRA 2CLDX 3QF4B 2X2EA 1FUKA 1ZIOA 4NHOA 4TMTA 4A8JA 2O8EB 2GJ9A 4XJXA 1ZVQA 1MO6A 4TLDA 1A5TA 1V43A 4YMWA 2XJ4A 1G8PA 4LHWA 1OXUA 2WJHA 2XZLA 2FG5A 3NXSA 1WDTA 2WPDA 2JLZA 4CDGA 5JI3E 1W0KD 1G5PA 1S3GA 2ZXUA 2JLRA 3IQXA 3DM9B 1W36C 3WRXC 2OBNA 2W6JA 4GDFA 2JCSA 521PA 5KO2A 2H1LA 3DZ8A 2V6JA 2H8KA 4JBYA 4DCSA 221PA 3CPHA 4EPXA 1B0UA 4I99A 3P20A 3HPRA 4TZ0A 1CR1A 4QOSA 2D06A 5D3MB 1GFIA 1TADA 3EW9A 4ZI3A 5GADl 5G3YA 1KGDA 4B75A 1G7CA 3ASZA 5SZHB 2ZRCA 4B48A 3HU3A 2FV8A 1JEDA 5FI1B 1EWRA 1VIYA 1EFRD 5LB2A 2OESA 1BIFA 3RS4A 4DEYA 1CJKC 2BJWA 4AC9A 3TR0A 5J4YA 2IXGA 2ANBA 3BFKA 4B34A 2P5SA 2F55A 1PLKA 1VYTA 2FE4A 1GNPA 3NKVA 2V54A 3EX7C 1SVWA 1G7SA 2GJKA 4UNNA 3K70D 4M4SA 4LHYA 3HR8A 1PUIA 3MWJA 3R9XA 2HCBA 4MKGA 3AP1A 2FX3A 2GDJA 1VPLA 3M4YA 3SJCA 5HCNA 3TR5A 2FH5B 3AKDA 4BRUA 2C5LA 1VMAA 4KLZA 3GJ3A 1E4YA 2IL1A 4LJ4A 4NKRA 2EFGA 3CM0A 5CK4A 4OYHA 1NVWQ 2BBWA 4L9WA 2Q3FA 2VIIA 4MH0R 3U3RA 2A5JA 3WMGA 1N2CE 2C9CA 3K9LA 2R9VA 1HV8A 3FHOA 5L8VA 1LS6A 3VTKA 1NVXQ 2JJ2D 2CL7X 1HYQA 1SVIA 3QQ5A 4HUQB 2NO6A 2RHDA 4Z51A 3IIKA 1QG2A 3Q5EA 1F2UB 4DBLC 4MRSA 2JLUA 2R6AA 2P65A 3CNLA 1CU1A 3R7WB 2HCJB 1XDBA 2ZI5A 4OQXA 4M1MA 5DO9A 3SBEA 2CL6X 5FUWA 3E1SA 4LX0A 2ZROA 4KO8A 2ZE8A 1SHKA 3MFYA 4J0QA 1MR3F 3IBYA 2YWEA 1E3MA 3BERA 3H86A 3KKMA 4KJZA 2CVHA 3VNUA 3DOFA 3FKSD 2WKPA 5JWRA 5LPNA 3FOZA 1RIFA 2NGRA 4JL5A 4URYR 2ERYA 2NO9A 2P6NA 4HAWA 3EC1A 3LQRA 4JLJA 3VR2A 2ZJYA 1MKYA 1YZGA 4XSGA 1KI6A 1NY6A 4KVGA 2ZRLA 2BCJQ 1RE0A 3AVOA 4OI2A 4BFUA 2BKEA 2GZDA 2JGNA 3M1IA 1HTWA 2QN6A 3GEHA 3MWKA 4V0ME 2J0SA 1W46A 4XOIA 1VTKA 4GNKA 3QI2A 1KO8A 1P2VA 3TUIC 4UNRA 3G5UA 4YONB 2PJZA 4LJ9A 1NSFA 1E79A 2HV8A 1L4UA 4RD6A 5SZKB 4TLCA 4LC1A 1ZIPA 2P5TB 4YLGA 1Z6GA 4AK9A 3ZVMA 3KKPA 4KYUA 5JSZA 2HT1A 1JR3A 3GLFE 1XCMA 3P4XA 3MD0A 4BFYA 2WIAA 5FUVA 1DAFA 3DDCA 2RGGA 3O8BA 4BFSA 2QE7A 2WTUA 5C2JB 4PO8A 2WWWA 3K70B 2JEOA 3OF5A 3BJIC 4BLOA 3BAFA 1OKKD 4B33A 3EZ2A 4UXJA 4Z1MD 2KBEA 2W83A 5KSOA 4AKIA 2WJGA 3MSXA 3FYHA 1W1WA 1R5NA 4KFSA 4NCJA 1AN0A 1U9IA 4LZZA 4LYFA 4RD4A 3VKGA 3K9HA 2C99A 2YKGA 4FIDA 3CR7A 2HEIA 2HF8A 2QPTA 2QM8A 3BB1A 1YRBA 1G7RA 2IHBA 4NDZA 4QGHA 2ZRDA 2QAGC 4QHYA 5FFMA 4IVQA 1N6LA 1Q1BA 4TQ9A 2F9MA 2J0UA 1LNZA 1NJFA 2RGBA 1T8TA 1N6KA 4Q4JA 3E70C 4C2TA 4BUJA 1XEXA 5AUNB 3TIFA 3FE2A 4BWYA 3VAAA 1S9HA 3SU8A 3GEEA 4B43A 3WHLA 2R6CA 2AWNA 5B58C 4M53A 5HTKA 4TSFA 3A37A 4JT4A 4PPNA 3QBVA 5FBRB 2JATA 1R6BX 1ZAKA 2PT5A 4OJQA 1SXJA 2MSDB 4F93B 2V55B 2IS2A 5DNYB 2REOA 4LYJA 1LB1B 2WVJA 5DYGA 4Q5IA 2CNWD 4DLUA 4HLDA 3ZQJA 4M21A 2YNMA 3LY5A 4DC9A 2CCKA 1A2KC 1EX6A 2ODNA 3W8NA 4PHHA 2O8CA 4LBVA 1YVDA 3W6NA 4EPVA 3K0AB 2V7QD 4V0MA 4ZKDA 3T5DA 3GFOA 1OHHA 3B1VA 3T12A 3CUEF 3TGPA 3OEEA 4M9ZA 3C7KA 3RWMB 2IYUA 1N6RA 1N6NA 4CRWB 4BZPA 2QA5A 4BE7B 2J7PA 5BQ5A 5J47A 1ESMA 2IS6A 1UM8A 1JAIA 3AQ4A 3GJ7A 4KV9A 2ZYVX 4QFMA 1U81A 2G83A 1W5TA 1JQLB 1YZNA 2NOAA 4PHTA 4Q47A 1ZU5A 2C04A 1YR6A 4A92A 3PUYA 2P67A 4LK2A 4R7ZA 4YXWD 1COWA 4TMKA 4TL6A 1GM5A 4C7OA 4HLUC 4KU4A 3ZDQA 2BHRA 4DDTA 1Y3AA 1G20E 2D62A 3B8HA 4HI0E 4A2PA 3NBZC 1KZGB 2XAUA 3LX8A 4DCVA 2ZJ2A 4IVPA 5JS8A 1U98A 4Q9JA 4LV8B 1P7CA 3W5IA 1WBBA 4C9BA 3PJRA 2ZRNA 1G5RA 5DSZA 1YQTA 5DE3A 1OSNA 4DLXA 2BDTA 4R2IA 2DBYA 3DKVA 3SC3A 2XITA 3KQUA 1MABA 2KB0A 4XVRA 2VSOA 2VP9A 3VNVA 5L3VA 3HWSA 1YHNA 1CTQA 3AGPA 3UK6A 1NMZA 5D3QA 3FMFA 1N5LA 2V1XA 4DSNA 5JBQA 3QXXA 3ZH9B 1E0KA 2B21A 5L3SA 1NF3A 1QHIA 2G1KA 3FFBA 1QHSA 3CRRA 4LDJA 4RJLA 5EZ6B 4BLRA 2GZHA 4HZUA 3BC1A 4BFZA 4JVLA 5CB8A 1M7GA 2OM2A 3I61A 4KCGA 4E22A 3BBPA 4RZXA 5C18A 3PQCA 3W8RA 4QGFA 4GMDA 2QSZA 2XJ9A 3SHWA 4ABYA 3AVWA 4OHZA 1M6NA 2PEZA 1R5OA 2A9KA 4WBSA 2MSEB 2D2FA 4FMDB 4AY2A 1GOTA 1QHXA 2RKOA 5J4VA 4M1WA 4EKDA 1OFTA 2BBTA 4JLMA 2GVZC 4ZV4A 4HAUA 1GKUB 3OESA 4PZZA 1E9BA 1QHYA 5GJWC 4LPSA 4R2HA 2XOKA 4DDVA 3IIJA 1UAAA 3BB3A 3SJZA 4XWKA 4BQSA 1NRJB 4A0RA 4LYHA 1RRFA 2GK6A 5KUTA 4R98A 4FCWA 1OJLA 2QMUA 4Q1EA 1KAGA 3RLFA 5JJKA 2IUSA 4GZMA 1TX4B 4LSGA 5FPSA 3J81k 1YZTA 3BH6A 2GJSA 1HEIA 2QROA 5FUXA 3TVDA 1G3IA 2OO7A 4IOMA 1W49A 1G7TA 3CRVA 1MOZA 4M1OA 3VMFA 4WAUA 1OXTA 1W2GA 4NYIQ 3ZQ6A 5C46F 5JEEA 4OHYA 2QGNA 3QKTA 2YJTD 2VBCA 4DT1B 3PEVA 1OFUX 1T3SA 3ZVRA 4Q21A 1H8HA 1UEJA 3HP1A 2BM0A 2Q6TA 1KDRA 3U3MA 2XTNA 1A82A 4PHFA 3BIFA 4DIDA 3LVRE 2XSZA 2HXYA 2Z5FA 3CZPA 4JLBA 4WOPA 3TQCA 4LWZA 3A36A 2AFHE 3CRQA 1FMLA 4CYMA 3QEJA 2IS4A 3U2QA 1D9XA 3VU9B 3R9WA 1DAGA 3RS7A 2UZIR 2KSQA 1WCV1 4BZQA 4TMVA 4PQFA 5EUMA 5CITA 1XMSA 3I62A 4G3XA 2F3TA 3OFNA 2OILA 3T1TA 4BPBA 1ZUIA 2IT1A 4NCIA 5GJVC 1K8RA 4P4TA 2J87A 3FHCB 1DELA 1GRNA 3K70C 1Q20A 4NYMR 2W2XA 3WHKA 4ZCMA 2IS1A 5FTLA 3GQBA 5KOYA 2VQSA 1Z0JA 4AD8A 4GPTA 4EPYA 4U7DA 1VG8A 5GVSA 4WIAA 1OXVA 1QVRA 3NC0C 2GETA 4DCNA 2BMDA 2TMKA 4LBYA 3B60A 2H57A 2ATVA 4JLPA 1F2TA 4MUAA 2WBLC 1E98A 5A5GA 1TQ4A 3OIYA 2OFWA 2J46A 2ZJOA 4PC6A 4DLVA 3Q9LA 2FDCA 4ASUA 1P3JA 3O47A 1IN7A 1IN6A 4Q7MB 1I2MA 1XJQA 1SXJC 4NMMA 3KFVA 5A0FA 1P72A 2KJQA 4FW9A 4QJ3A 1M34E 1OFIA 1YZUA 2J7KA 1A7JA 3GJ4A 4PZLA 3KQHA 3THYA 2LKDA 3F0TA 1R0WA 2PZGA 1KI7A 1R8SA 1ZINA 4A6PA 4DT1A 5HZKA 1W4RA 3KXKA 2ZREA 3BRWD 2ZU0C 1ZUNB 1E0SA 3CWZA 5LD2C 4EDHA 3TKLA 2FN4A 1SXJD 5BN4A 3B1WA 4A8JB 3UMRA 4AG6A 4US2R 5FBVB 2EU8A 4QBFA 3B85A 2HYDA 4AKHA 2O8DA 5A4JA 4IOLA 2ZSFA 4AURA 4W5WA 4LBZA 1Q3TA 4GOKA 4C4PA 3DM5A 1NLZA 3QKSB 5L3QB 4IXMA 2WAXA 3UWOA 3LAWA 1AM4D 3PEWA 1Q1ZA 4HB2A 1Z08A 4NYIR 2ZI4A 3ADDA 1VHLA 3B5JA 3P26A 1E9SA 1TF5A 5FR1A 3QG1A 3AUXA 1E1RA 1XZPA 3NWJA 1JAHA 1DADA 1KO7A 3EIQA 5DN6A 3VR6A 3QY0A 4IFEA 4I1SA 3QF4A 5BYJA 3KQNA 2GXQA 2DWPA 3QXSA 3U6BA 1SKQA 1J70A 2F1IA 2OXCA 3AUYA 4I1VA 2A30A 4LHVA 4ESHA 3OE7D 2ZJBA 4B2IA 1E99A 5EE3A 1G6OA 3D3QA 4TT3A 1N0UA 3ONWA 5LB4A 3KB2A 1KK3A 4KXFB 4EUNA 1E1QA 2ZYUX 5E3HA 3KJHA 4DSTA 1WF3A 1XEWY 1Q1EA 1T5IA 4M1KA 4DZZA 4MKHA 1E2JA 4IRUB 1SVMA 1UDWA 4D4LA 2R8RA 4O25A 1IN4A 1EFHA 3EXAA 1F3OA 1IJFA 2BVNA 3A4LA 1WB9A 4US1R 3OHMA 4V0LA 2R44A 1E9FA 5AUQA 4CVNA 1XPRA 4NONA 4FCTA 1VIAA 3HJNA 5AUOB 3MWYW 5JWHA 2WPDD 3FPAA 3P1JA 1Q57A 1ZD1A 1FTNA 2GNOA 4DLZA 4DVGA 3BWDD 2QAGA 3LW7A 5FTKA 3FMPB 1KY3A 3RC3A 3JVVA 4TMZA 1NN3A 3TRFA 2WSSA 4RCYA 1HT1E 3U4QA 2QU8A 1KY2A 3I8XA 4MKFA 4ZI2A 3GFPA 5IDVA 1VCMA 2A78A 3QE0A 1I2DA 4BECA 1W36D 4Q1FA 3AF0A 1MT0A 1T3HA 3O8CA 4RVCA 1QZXA 1E2EA 4HAXA 3AKCA 3RRMA 3FTQA 2YV5A 4I1OA 4URUR 1G3RA 4DB4A 2AKAB 2F43A 2V4ZA 1T3LA 5K8UA 3EA5A 3H0KA 2FFBA 2W6IA 1ZM3A 2H17A 2JA1A 4PC1A 1H65A 3SN6A 4X8MA 2VHTA 3G0HA 4PPFA 1US8A 2OBLA 2GZAA 2GJAA 2RGXA 1D9ZA 1KNQA 1CXZA 2IF0A 1CRQA 2VTKA 4ZDIA 5J4LA 3LW8A 4B2LA 1PUJA 2A5YB 3FHTA 1N0VC 1ONBA 5BWMA 3SYKA 4B2PA 5KDLA 1N5KA 1WMSA 2V9PA 3IUYA 2EW1A 3UXMA 2QBYB 3WY9A 1D2NA 1OYYA 1Z2CA 1RFLA 1MO3A 2FSHA 1N6OA 5DISB 3L43A 3MAAC 3FMIA 3RANA 4M0LA 1E0JA 3DOEA 4KFTA 2PZEA 4DDUA 3FGNA 5AJXA 3QPWA 4GZLA 4UJ3A 4RD1A 2VHCA 2P3SA 1CKEA 1EWQA 2NZ8A 3NDPA 4NCHA 4Q4JB 2GRJA 4PPGA 2GBLA 2IBMA 3QXHA 1G41A 1II8B 3IPXA 5KU1A 2ODBA 3IDQA 1VCIA 1H8ED 2H18A 5AWFC 3K0FB 5SZJA 5DI9A 1MABB 3KKQA 4IKEA 4F4CA 5JI2E 3R8FA 1OYWA 4PC3A 2FZ4A 2QEQA 4WXPA 4TYPA 1U0JA 2ZVPX 4LPKA 3LDAA 1OXXK 1AKYA 4JLAA 3K0CC 4C3ZA 4IDPA 2PLRA 5AR1A 1PV4A 2N1BA 1KI6B 1W0JA 3AVYA 2C95A 3TJZA 1IJEA 1GWNA 2Q9CA 5CDFE 3N70A 4II7A 4TN1A 1J7KA 1U8YA 3QJYA 1P6XA 3E5HA 5HZHA 4NH0A 4DLRA 4DCUA 4QM6A 2OCBA 1Z07A 4FD2A 4RZUA 2HJGA 1M74A 4IEIA 3TQFA 2LCFA 2IXFA 4WA7A 3NBXX 3VX3A 1GL9B 3RS3A 1GL7A 3CF2A 2DPXA 1Z63A 5JFGA 1Q12A 1Z6YA 2I1QA 1ZCBA 2ZUBA 5FBWB 1BMFD 4ZIRB 3HU1A 1DO0A 2R6GA 4AYXA 3MMPA 4RKEA 4TLEA 2YHSA 1NN1A 1YKSA 4PAQA 4FMCB 5FBLB 3CNOA 4XWAA 1FL9A 2GJ8A 1JBKA 3VR1A 5EUQB 4HAZA 3RHFA 2WZQA 1T5LA 2ZSBA 3Q3JB 5IHPA 4TYQA 4URVR 1E96A 4OK3A 1DO2A 4TSFD 1DEKA 3R20A 4C2UA 2FFAA 4HATA 2BBSA 1J99A 1JXOA 4LJAA 4BLQA 4MRPA 4TLAA 1GDDA 3C16C 1IM2A 1NN0A 2ZJ5A 1CJMA 3K0CA 3NC1C 3OFND 3A1VA 3VU9A 1RZ3A 2VP5A 1W47A 3A1UA 3PEYA 3TE6A 1W4BA 2GCNA 4DLYA 4AYTA 2QP9X 3GLFA 1ZNZA 1E1RD 2ZRAA 5F9HA 2BKUA 4XH9B 3VX4A 1JR6A 5CK5A 4HLCA 2IWHA 1W2HA 1XD9A 3NHAA 2BMJA 2KWIA 2KI5A 2RMKA 1NMXA 1Z3IX 1DAIA 4NYMQ 5FTNA 1UKZA 5EE1A 2DFKB 3KJGA 4A8JC 1OPXA 2ZSEA 4M8NE 1G17A 2QPOA 2QTVB 1TUIA 5FBQB 2RGNA 2GAOA 3AF3A 1EK0A 5DI3B 5HE9A 4QG7A 4ZKEA 1GIAA 2HLDA 1P5ZB 1FMJA 3THOA 5KNCA 5CIQA 4QHTA 4X8OA 4BEBA 1NVVR 5JEDA 4FWTA 2B8TA 2J0UB 1P61B 2NG1A 2PX3A 2WOOA 3HYTA 4PR0A 5FL7D 1T8UA 2E1RA 2BEKA 4KAXA 4V03A 4WW0A 2Z43A 4EQ6A 4V0KA 5JJIA 3A1TA 4MRRA 4EJSB 4D4MA 3BFXA 1SKYE 2ZJAA 4EPWA 1P4SA 3IILA 3UKDA 1TNDA 1GZSA 4MGKR 3U6KA 2WICA 4PQRA 3VR3A 5AJZA 3SS8A 3M0EA 5F98A 3T35A 4UJ5A 1KOFA 3U60B 1AGRA 5FOUA 1II9A 2QMEA 5JMTA 1HA3A 1XJ0A 2J7PD 421PA 1E9CA 1KI8A 4DLSA 5UKDA 4KLNA 2GXSA 4PAOA 1TUEA 1A2BA 1ZBDA 2J9RA 4IDOA 3WNCA 1J8MF 4K81B 2WJYA 4M1SA 1X3SA 3GLIB 3TW8B 4A82A 2HXSA 3F3YA 1N25A 5KPJA 4JBWA 5AJWA 1ZMXA 4BEJA 4DLTA 4EFNA 3Q7QA 3VR5A 3W34A 5H8WA 2J1LA 3CRMA 1HY3A 3IIMA 1CBUA 4LCBA 1YZQA 3BK7A 5JCPA 3V4RA 5KDDA 2ERXA 1S0UA 2ZEJA 3F8TA 1CR4A 1R10A 3EASA 4GSYA 4NCNA 1CR2A 2Q21A 2Q9BA 4YC7A 1G4AE 4C0HA 2QY9A 4GT1A 4P4SB 3I73A 3GJ5A 4WZBE 1JB1A 2ZI3A 2QTFA 2BM1A 4A0GA 4LJ7A 1E9EA 4PC2A 3LH5A 2A3RA 2V6IA 3T06B 1OB5A 1W36B 1XB2A 4C7OB 3EAQA 3RVBA 1ZNYA 3ND8A 1ZM2A 3L0SA 2ODWA 1IXZA 1KAOA 4NE2A 4JLOA 2ZE6A 2WWHA 4Q4AB 3RYTC 1IONA 4XD7A 3AP2A 2IYZA 2BBOA 2ORVA 2VEDA 1E79D 3AGQA 3D31A 3H4MA 1M1YE 3QKSA 5L3QA 2DCUA 5DYIA 4RY2A 2WJIA 4PHGA 1OH8A 1F48A 2PL3A 2W58A 3KJEA 3PFIA 4G5RA 2AK3A 3ZVNA 3KKNA 2BOVA 3BH0A 2OG2A 4PC7A 4C0BA 3CX8A 3X1ZA 2QGZA 2VF8A 4Q9KA 3U4QB 2O8BA 1Y63A 1ETUA 1S3SA 3UANA 4D0LB 5B57C 3QG5A 2WWFA 4IDQA 1G3QA 2BJVA 3R7WA 2DWQA 4D25A 3ECCA 4H1VA 3KXIA 1Z8FA 1I4LD 3W3AA 4U00A 1AA9A 2VYFA 5EXSA 1RYFA 1TQ2A 4JYCA 4OQMA 5C4GB 1FPMA 4JLKA 3SE0A 1YE8A 1FZQA 3RNLA 5JHHB 1XEFA 4Z8YA 1NMYA 1FX0B 1XCPA 3A1SA 2C03A 1ODFA 2PBRA 3DPUA 1IY2A 4YDHB 4K8OA 3RWOA 2IYXA 4CZ2A 2JLXA 4AYWA 1KSFX 4DSOA 3MCAA 1LTQA 3DHWC 4A0HA 4MRNA 4X8HA 2GCPA 3UWKA 1D2MA 3DO6A 2ZPTX 2CVFA 3TAHA 3RS2A 2PMKA 2QP4A 4QRHA 1JEEA 2CEAA 2IA5A 3LLUA 1GKIA 2AXNA 2XSZD 1ZUHA 1RRCA 1DTSA 5KHOC 3K0FA 4KVAA 1QHHA 2YOHA 4PO1A 4JS0A 4LJ6A 1Z6XA 1U0HC 1S2MA 4LBWA 1EFCA 4NYJQ 4P32A 5FOXA 1UFQA 4GL2A 3WBJA 2OCYC 5AJYA 2CNWA 1GAJA 2C78A 1V5WA 2EFDB 4M9QA 1E2NA 4FI3C 1ZM9A 3D8BA 4B44A 1N0WA 1R5BA 3CKLA 3I32A 4Q7KA 4H1UA 2C77A 3GD7A 1ZP6A 3O8DA 4JJZA 3IO3A 3NVAA 1FTSA 5FPHA 1LW7A 4X8LA 3GJXC 1XTSA 1IXRC 1NLYA 3OE7A 1A4RA 4CIDA 2OEPA 2REBA 3PUZA 1PJRA 2NIPA 1SVKA 1P73A 2OV2A 4A6XA 1Z29A 3VFDA 2A5FA 1T0HB 3PUXA 3X1YA 1Z0IA 1JR3D 3KQLA 2B7CA 1F2TB 3LX5A 3KQKA 2CHGA 3V00A 1GG2A 3SYLA 1FX0A 3AH8A 4G5QA 2VP2A 3A8TA 2X2FA 4OQNA 4NU0A 2MMGA 4N1AA 1KJWA 4DLWA 2G9NA 3GJ8A 4PAMA 2OLKA 4M1YA 4CW7A 5M04A 3ZLJA 4HZIA 4RCZA 2A7QA 4Q02A 3U61B 1KZ7B 1TL7C 2JLVA 3A6PC 3KX2A 4PX9A 1IXSB 4OI4A 4MUBA 4MQBA 2VH5R 4MA4A 1NN5A 1X8KA 3EIHA 1G3UA 1NKTA 4JIMA 4NZYA 1KSHA 3CH4B 1TQDA 3A58B 3UG7A 1KO5A 1FNNA 4P31A 4O2RA 1AS2A 3I5XA 3BORA 5P21A 1TF2A 1CJUC 3EZ7A 4QGGA 1UKYA 2P6RA 4A2WA 4DIEA 2GA8A 4L4UA 1W7AA 2EFHB 2GAAA 5KSYA 2W2VA 5EJEA 5FH9A 1VG9B 3RRYA 3I8SA 4G5SA 2IX3A 2GEVA 1DPFA 4V02A 2NO0A 3ZJYA 5ANRB 1NVVQ 4JLNA 4OK6A 1ESNA 4P33A 1S1MA 5F9FA 3JVUA 4UNQA 3KL4A 5CIWA 2YYZA 1W48A 3QEOA 4Q03A 3T15A 4PZYA 1S8FA 3NHBA 1SVLA 4RD0A 4BLSA 4JVSB 4QKQA 3C14C 4YMVA 3GJ0A 3LFUA 4L8GA 3QPUA 1G8HA 1P9WA 2ZANA 1XMIA 3LA6A 2EWVA 4OK5A 1IHUA 2WJJA 4TT3D 4V0OA 3PG5A 3SQWA 4LHZA 2J5XA 1G8FA 1GRQA 4Q19A 4UXIA 4XIGS 4UKDA 2BMFA 3AB3A 2A2ZA 3AP3A 1G6HA 2F9LA 2PJRA 5EE0A 2HT6A 1LS1A 5GVRA 3ETLA 2IYSA 1H8HD 4CGZA 2AL7A 4CT4B 2DB3A
chains in the Genus database with same CATH superfamily
2WD7A 5DBGA 1RYZA 4Y18A 1E3DA 3LU1A 2QXTA 4KE8A 1U65A 1SBNE 3CBQA 3JYOA 2OAEA 2OV8A 1EP2B 1P1IA 2JGLA 1A96A 2VDWB 4OKNA 5ARCA 2E4YA 5KTPA 1TPYA 2G3YA 3O8OB 1BO6A 1GV0A 4ZTBA 3RHTA 1P0FA 3EMVA 4BMXA 5KNDA 1NU8A 1Y3DE 3O4RA 3KNZA 3LZ6A 1ZVVA 1RKXA 3B1JA 3M6FA 4JKIA 4OM8A 3KBBA 1UAGA 1DJMA 1DBRA 2ZVQX 2RHMA 1L4LA 5L7YA 3OHPA 5EXPA 2WIBA 4YGXB 3B5IA 3FKJA 4V0QA 2Z83A 3QFSA 2CLEB 4M9XA 4P08A 1E4VA 5H81A 3V1KA 1NR5A 1NULA 1Y34E 2ATXA 4GMHA 5HDQA 3L9XA 4JNCA 2FNAA 4LV6A 1R0ZA 3O9VA 4NVRA 3U44A 4ER6A 2OO3A 1QGDA 2XZTA 5DOVA 1KOLA 1B8OA 3L8ZA 4P1ZA 3HABA 4A73A 5TB5A 1G21E 5DH9A 3CZ4A 3A3NA 2C7BA 2C8JA 4BWFB 4UUPA 2ZBQA 1XP8A 4CIXA 6GPBA 5EXDA 4Q05A 1MV5A 3RAGA 3RUCA 1DXHA 1LPSA 4DYDA 4ZI7A 5JVDB 4AS2A 1M2EA 3LXRA 1AT1A 3L92A 5BN1A 3AVXA 1O9GA 2A14A 3KZKA 2QZ4A 1K8YB 2G80A 2G67A 4BU0A 1Y9JA 3QF7A 4ESEA 4ZMSA 2YN2A 1M0TA 3T3NA 1BD4A 3CUVA 1M8GA 4KXXA 2J3JA 1YGPA 3S1LA 3ZD6A 1R0RE 1T15A 4ID9A 4BV2A 4DUGA 2GO1A 1DRVA 2Q46A 2QM3A 2RGYA 3CF6R 4D5EA 1L5FA 1X0VA 5DHAA 2FZEA 8OHMA 2W6CX 4QOEA 1DQSA 3BH7A 4MOWA 3PL5A 4B32A 3UZUA 5AVUA 2XUJA 1D5CA 3WIOA 1O58A 2JHCA 4ZQCB 1V8BA 4LYGA 4LGMA 2H48A 5EPOA 5L6MB 3ITKA 5B1EA 1JEAA 2XODA 3N0RA 2WKQA 2WKSA 2XLCA 5TQ0B 1IBLB 2C7GA 5EJAA 3DF7A 1QZTA 3LBIA 3UJCA 1GKKA 5JISA 5DHFA 4GEGA 4L0QA 5EIFA 3NBFA 3ZY6A 2WYWA 4CF5A 3E81A 4P2GA 3SJAA 5DNCA 2R97A 5KYKA 4LVNA 4G0PA 5BW8A 2JIZA 2QL6A 1Z7BA 3IGFA 5IC4A 3ANLA 4U5XA 3V7NA 4R8RA 4S12A 1E4OA 2QRJA 2QW1A 1ZA2A 3WJAA 4AJNA 1HWYA 1MO4A 2ZI9A 4WGFA 4WA8A 1P4RA 4OHCA 2HGSA 1JWLA 2ZSDA 1KS9A 3PX2A 5T3UA 3TLGB 4AS3A 1JJ7A 1L5VA 1V4NA 5LD2B 1GP2A 4KIFA 4OAQA 2IYFA 4RX1A 1TZBA 4W4TA 5HNKA 2XUKA 3Q3VA 5KYWB 3BQNB 1SCKA 2X2PA 3PPVA 1IQ0A 2BEVB 3AL2A 4IY1A 3SM3A 4EGJA 2B8WA 2P9QA 4GQBA 4NK4A 4RVOA 1Q74A 3PD7A 4YUWA 2W6ID 5MGBA 1DZ3A 1DINA 1FFAA 2YS7A 4HYTA 1U1CA 2RGCA 4QBTA 4J03A 2VF7A 5CYFA 1YHYA 1R3UA 2GBLC 3KR2A 2QF7A 1XJCA 4FHFA 2L0XA 3ZH2A 1YULA 3GNSA 5BV2P 2ZYAA 2PBZA 4XEHA 3TAUA 3WKAA 1CIVA 3EG5A 1D1QA 5CLLA 3MJEA 1UOOA 2VDPB 3LKVA 4MRVA 5CLQA 2AUTA 2BGTA 1P8JA 1XDGA 2PWBA 5CJ2A 5EJFA 2W37A 3K96A 3CX7A 4FI3F 2I7XA 1OF1A 2GHIA 1L4EA 3ZU3A 2F00A 3HJUA 1JTVA 1VYUA 4JLSA 2CLCX 3OOWA 2SKEA 1F60A 5CJPA 2GHTA 3GLHE 3ER8A 3Q10A 4X6LA 3OE5A 5FOTA 3VV2A 1E2PA 1SY7A 1X86B 4K46A 5JECA 4EMTA 1FNMA 2JFOA 1V8PA 1YVEI 3NHJA 4OX9Y 1NMQA 3VVCA 3NIDB 2QX6A 3U40A 3ZX5A 3GRKA 1EE9A 2FW8A 3HB4X 2C2XA 2BFMA 1TMGE 2DLDA 2ZB7A 3C3JA 1KDTA 2CWWA 5DHPA 4DA8A 4PQYA 2WUWE 4TX1A 2PNJA 1XO1A 2AF3C 3ENQA 1AB6A 1T4BA 5J63A 4GEKA 4D80A 1TPZA 3V32A 3FPKA 1O0SA 3AQIA 4RORA 5HKLA 4XTRA 4B6FA 3U0BA 1GGNA 2Y1WA 1VGQA 3LG2A 4QTZA 1PJAA 4CR8A 3DCNA 1TEZA 2KBFA 4EI7A 1PSWA 1ZMRA 4CMHA 1UBFA 5ENVA 3LM8A 3W5CA 4GSKA 5K8TA 3WGHA 1WETA 2FUCA 1NIJA 1DBIA 4S2EA 1GQ2A 3C8ZA 2FJ0A 3FWZA 3P97A 4G0NA 4HUQA 3IP5A 4RZHA 4Q9IA 1ORDA 3LYUA 3OT1B 5DGTA 2VA9A 3HJRA 5GV8A 1FK8A 5CB4F 2J3LA 2V58A 3QIVA 3G9UA 3EZFA 4QGBA 3SMVA 4NOLA 3EB9A 3GLKA 5DGHA 5H7XA 3IP3A 5B37A 1QKJA 1OFHA 3BMCA 4H1HA 2HHAA 4NU6A 3UQZA 4UOEA 5A6VA 1NG1A 1V7CA 4GPBA 3SYRA 2W2PA 3LWBA 1RYHA 3HKCA 1FX1A 1Y1LA 4JXJA 2W0MA 4U9IS 1L5SA 2B5WA 1OLXB 3GVHA 3LV8A 9MHTA 2WB2A 3QUSA 3W9YA 4DCMA 4PG4A 4TTAA 1E9RA 1E3TA 3K2BA 3OLZA 3RRBA 4JYMA 3OECA 5AKJA 4PIMA 1EXWA 3M6LA 1SRQA 2IUTA 2AS0A 1P2TA 1NW3A 3ZHUA 2C4VA 2Q6OA 3VGJA 1DE0A 4U7WA 2BFBA 2QLMA 1TTHA 3SP1A 2ZTVA 1UF9A 1XA4A 1TCVA 4JLWA 4JT2A 4YPVA 1E7SA 4BP1A 5JSKA 5KTOA 1EUYA 4Y0VA 5DT2A 3DQQA 2AGVA 3PENA 4H7JA 1IYZA 2ZS8A 2V03A 4AWXA 3T7JA 5EHNA 3B6JA 3GBSA 3Q8XB 1M2WA 1W4CA 3OJLA 3BTSA 3K0SA 1QF6A 1HTBA 2C58A 3BJRA 5DLYA 3EZLA 5HF9A 4QDTA 3ICEA 2EV9A 2PGNA 2R1VB 4K9DA 5MFPA 1V0JA 2EX0A 4AZWA 4MS1B 1ZJ6A 2ZT8A 3WJ1A 1CW2B 4F9GA 1YJBA 4BTVA 2ZYTX 1JBEA 1SPXA 1PFUA 1SXHA 1ZOPA 5FWDA 1G1MA 2CHVA 5LP6C 3U3DA 5GWXA 4NF2A 4D9HA 821PA 3R8CA 4URXR 1DS6A 4CM1A 1TGYA 2XCIA 2YZGA 2BFDB 1W9MA 2NTYC 1I3NA 3VI4B 2C5HA 2VJBA 1KRHA 2HRZA 3AF2A 4J90A 5AH0A 1XPRA 2H92A 3ABOB 3G9TA 3IE2A 4LOAA 3FDZB 5FEMA 2NM0A 3O2QB 4WFQA 4TWRA 3NH6A 4YV7A 3CWQA 3UT5A 4AUMA 3DNMA 2O6HA 5CRIA 4WFIA 1E32A 1XMVA 2FOXA 1H2ZA 4BJ5A 3D6FA 4OGLA 2GPYA 1DAKA 2KE5A 3VPHA 4NL4H 4PZDA 4C3VA 4R81A 1XQ1A 3K6SA 3RAEC 3VKUA 5A04A 1NJ6A 1VE6A 4Q3AA 1RLMA 1GLNA 4GP6A 2X0DA 1Y1TA 3GEIA 2AFIE 3OURA 3SVLA 4MGYR 2HWUA 3R0XA 2XMDA 3OX3A 2ZQZA 1ODCA 2QR2A 4PLHA 4R8SA 3U16A 1VBFA 1JYSA 2ZUDA 4LX8A 4MS3B 5BSVA 1GT6A 3GP8A 1FRQA 2J9FA 3W2EA 3UMCA 3WWEA 5E2BA 4ARUA 4MK4A 3M5WA 4DJTA 3NJRA 2PX4A 3A3OA 4XZ3A 1ZD8A 2N42A 4MA5A 5GONA 1U2SA 2B4QA 4BIIA 5A9RA 1DQNA 5A02A 5A7HA 5I7SA 4BKPA 3ZZ1A 2YV2A 1OIWA 1XTVA 1XEWX 3KE8A 3JX9A 5IKPA 2N9UA 2ZBUA 5GOZA 3ZCUA 3DQPA 4QYXA 5KYNA 5FWAA 2R2GA 7MHTA 3U62A 1JR4A 2RH4A 4CTMA 1GN8A 1P91A 5FR2A 1OIXA 3ILHA 1CFZA 1XKQA 3CLSC 3R0IA 4JD5A 4BFWA 1NQXA 1TQ6A 3KQVA 3ZXSA 3LT5A 4MP3A 4Q4AA 4IQ0A 3R0QA 2BV3A 3AI2A 1AQNA 1QIGA 1ZSNA 5TDHA 4JP3A 3D6TB 3V9PA 16PKA 2QG9A 4RQTA 6ABPA 5COQA 1SD5A 2DPHA 3QI7A 4M1TA 5B58T 1L8XA 1B93A 3GMTA 4PGMA 4J7CA 4NATA 4ZAYA 2OZEA 2VT2A 3C3KA 3OUUA 3KD2A 4L15A 2P6PA 1J1ZA 4UEJA 3W7VA 5IK2D 2E5FA 3HP4A 3WMEA 4RA6A 5KAMA 1U2PA 3PNPA 5A71A 4HADA 1BS1A 3L8GA 1LXCA 1W29A 4PSAA 1J0BA 1TZ2A 2Y0DA 3QRWA 1TZJA 2IWRA 1YUBA 3TQRA 4DJAA 3FFAA 4J0IA 1V11B 2QL5A 3DL0A 3M9WA 3V8NA 1TMYA 2AZTA 3E35A 2IP2A 4YJGB 1MQ8B 1JG4A 3PIIA 4Q66C 2UVPB 1XVLA 3GLHA 2DJ5A 3WRYC 3M3PA 3IUNA 5CFOA 2OE2A 3JVEA 4TKUA 2J9YB 2P6UA 2ZRPA 1P0CA 5KVQA 2XT0A 1T1RA 4FZJA 4KPUA 3L7BA 2FZKA 2RIRA 1UJ6A 1LPOA 1GV1A 4LOJA 2WTNA 3LDHA 3MVEA 3E4DA 3N2IA 5CB6A 3GLGA 1SKMA 1VLJA 3WO0A 4Z7JA 2W48A 2QRZA 4AAYA 4O2BB 1T6YA 3LVFO 1B6GA 3CNQS 2W7TA 3DUWA 2CKMA 4AP5A 1GILA 1WX1A 3FCYA 3VJRA 1QOQB 2D8MA 1RI5A 2QHXA 1OI7A 4RVFA 3VISA 3WMXA 3DVAB 3LP5A 2Z2KA 1ZRHA 4OBWA 1GNRA 2ZUCA 1E18A 2ROQA 3IAHA 1QUFA 3IR6A 2CSXA 4XYGA 1JEQA 2NT3A 2QGFA 4Z9XA 5K0NA 1B6RA 2LW7A 4HFJA 4ODIA 4U2CA 2GYWA 1ML3A 3DEFA 4EUKA 4JI8B 3CF4A 1EEXB 1R37A 3F3KA 1NMEA 2DUUA 2IP4A 5ESWA 2YNMC 4H0FA 5SY6A 3RQSA 5ALGA 2C98A 4KB5A 3CVOA 2NXCA 2LXNA 5THQA 1KGSA 2AI3A 3QENA 1QVAA 4KLCA 3SBOA 4F91B 4G5GA 1IAQA 1TUBA 5D8DA 1BROA 1U04A 1U0LA 2CCGA 2ZSAA 5AM0A 4QYSA 3ZD7A 4P22A 1BRMA 3HB0A 3ZGYA 4CM7A 5I48A 4B5LA 4EVIA 5F21A 2Q6VA 1DUVG 4X1KA 1XK7A 1KJJA 4TMYA 3BX1A 3ET5A 1RYEA 4YRRA 5E95A 1KF0A 5BW6B 3R8XA 2VCHA 3OZXA 4P3YA 4C29A 9LDTA 2ECQA 1QHEA 2X5XA 5I9LA 1WLYA 4OMFG 4EVSA 5HS4A 4BATA 2OFOA 1NYTA 2Q1SA 3IHTA 3VQTA 4DIFA 3PE4A 3N9IA 5SY4A 1F17A 1XC7A 5A2GA 3U31A 2XUZA 1EH5A 1FDRA 4R6XA 3P2EA 4LISA 2WF5A 4LWOA 4RSGA 3VV3A 4PSCA 2HCRA 1QZZA 2A5GA 3CUKA 2Y77A 2GBIA 3K6RA 4CQNA 3N7UA 3FA2A 5E6RB 3HKDB 1QKIA 2WG0A 4MQEB 1UZUA 1FYEA 4OY3A 3S7TA 1EJ0A 2E4UA 4B73A 4HDKB 1YOBA 1XXHB 2DHRA 4LJ5A 2AWOA 4JBXA 4QUHA 4NENA 4UAJA 3D7KA 1W6UA 4HX9A 3PE3A 4IIUA 4NZMA 5GINE 1EVZA 4WJLA 3AG6A 2GX6A 3QWBA 4PCUA 4DSUA 4EHIA 1F5NA 2CFIA 3QK7A 3UAZA 3DMTC 2RAPA 1JX6A 1U99A 3STTA 1XZLA 5IWCA 2FWRA 2BSXA 1BQEA 2ES4A 3EJWA 1IBRA 3H2ZA 3HL0A 4TL8A 1RQXA 2F64A 3H84A 4P82A 4WUTA 5T3YA 2FP4B 5DNAA 2RAVA 4JEHA 2WTXA 4OXXA 4ZT2A 4DV0B 3FI0A 2C83A 1PT5A 3W1WA 3EN0A 3OZFA 3NCTA 3LKDA 3H2SA 4Z9AA 3ORYA 4L28A 3SMQA 2R0QC 1ULHA 3Q9UA 1OWNA 4YT2A 2V3CC 1NPTO 2GN0A 4KIWA 2AJLI 1KIMA 2FXVA 2ZLBA 2FU5C 1RJGA 1C3VA 3AYXB 4IOKA 4DWOA 1Z2AA 2D3WA 3FTDA 2XB9A 5JBIA 2EIHA 2VJNA 4IH4A 5CA1A 1AUVA 1QWSA 4B3DA 2DFTA 1H0RA 3DO5A 3NASA 4FK8A 4QXOA 3FZQA 4ZYUA 4JDUA 2DLCX 1PX2A 1OQAA 2CXSA 5LLTA 2ODPA 3NYIA 3QBTA 3OEYA 4BBPA 5HOEA 1AHNA 1J25A 2Q3LA 1CLUA 1RJ9B 1U1EA 3B82A 4EY7A 3AM1A 4CM6A 2ATEA 4MI3A 2Q5LA 4R1TA 4B84A 3AVQA 3GFTA 5LBUA 4DQLA 1GN9A 1XYGA 1V6SA 2CNLA 1RLTA 2DECA 2I4TA 4GOXA 4Z2AA 2I55A 1Z4QA 1PHPA 2GCOB 5BXQC 3WAJA 4JNKA 1DHRA 2CY0A 3DMNA 4ZOLB 5BV0A 5I4IA 1HNNA 1U94A 3ABQB 5I47A 1WQ4A 5A3VA 1U0FA 2WV9A 2NYRA 1ES9A 2WOJA 3ZBUA 1Y4SA 2FW7A 4EA9A 1YCGA 2QQFA 5MHTA 1Y4DE 2R6JA 3BMNA 2ATIA 4FIZA 2PU7A 3SG0A 4JAVC 1BE8A 1KWGA 5H3CA 5F23A 2ZBVA 1RXCA 5IH3A 3PXGA 4QLOA 1CF9A 1HQDA 4KBFA 4BMVA 4ERXA 2Y3IA 5JWOA 2RI1A 2D59A 2C9OA 5C5CA 3KDAA 4IQ8A 2PEYA 2XGSA 3D64A 3ELYA 4NK5A 5F4ZA 3CXUA 1RHKA 1RXIA 4TZTA 5EQFA 4UDXX 4EHHA 2WMNB 4RL6A 4F3NA 4LDPA 2QAJA 1Z5VA 2GCIA 1BXRB 3N3BC 5D85A 4EJMA 4IZ6A 2UZ0A 5CLJA 1JL3A 3DTVD 4NENB 3ZWCA 1ZKMA 2ZVDA 3F5MA 2XCSB 1UQRA 3NC4A 4IIJF 4DMLA 4ZAXA 4HLQB 2JLWA 1T4GA 3GLVA 3BQMB 1UUFA 3EZ6A 4XB1A 5EYPA 4HSEA 2XTMA 4DLBA 4F4IA 2ENWA 4EKYA 5JY6A 3EGXA 1EFRA 3VR6H 3VSBA 4HVLA 3OM1A 1X92A 1YS9A 2FQ1A 3LQ2A 2FG6C 1L5GB 1YT5A 3P9XA 3H2IA 1W0CA 3V34A 1J7JA 1UP4A 2H4JA 3OSUA 4R54A 1XQ6A 1NNEA 5CLHA 1E7MA 1Z5PA 4HY3A 4JU8A 4Y6OA 3PR1A 3VH3A 2XD4A 3CB4A 4RK5A 1P2FA 3RBXA 1VB3A 3KCQA 5GIOE 2R86A 3C7AA 1U31A 4LRWA 1J23A 1J6UA 1E69A 3EARA 1FUIA 1NBHA 3BE6A 1ZS9A 2SHKA 4YYEA 3ESZA 1ELOA 3WO1A 3MHPA 2BHLA 2OWEA 3OLCX 4HDQB 4NYJR 1D7OA 3DVRX 2I9PA 3BRQA 1MEJA 4P83A 5JZBA 1N6HA 4YRCA 2IZ6A 1R6UA 5FPQA 3PS9A 4RVGA 4CKBA 1WXQA 2ZBPA 1P29A 4RJJA 1IBKB 2B0JA 4TRNA 1TW2A 3IMKA 4Q7JB 4OQYA 5BVGA 2CUNA 5BURA 1EE1A 1RMYA 1JDJA 1T9AA 1C4WA 3NLLA 3F5DA 4B76A 2FFJA 1OWLA 2F9FA 2P2SA 2PGOA 3IHWA 3IPYA 3LWZA 2UZ3A 3ODGA 1M8PA 1X7HA 3ZW9A 4ZO8A 2PSHA 1Y98A 3SSOA 1QDEA 2Q6IA 1ARZA 1PJCA 2EBFX 4GZ6A 3IO5A 4JMPA 5H9VA 1V48A 2XAAA 5DHUA 5C4MA 3P96A 4ZOCA 3RYFA 3I9JA 1IDOA 5ITVA 4X1IB 2VQ3A 4DQ0A 5IT0A 1EGVB 2FQQA 3LT0A 5T7BA 1GXSB 1H4SA 3DXYA 4P7GA 1KJZA 1R9GA 2CXPA 2Z08A 5FEUA 5JRJA 4KFRA 3FOBA 2Y67A 1ZISA 2XZOA 5DM60 4BMNA 2PX0A 3I2GA 1FW6A 3GFQA 1K0FA 1MF7A 2P9CA 2VJLA 3JAWA 3QH4A 4WLUA 3R3ZA 4D43A 5G41A 3REQB 3PEUA 3BWEA 3KU1A 3PQFA 4N9QA 3GLGB 3G9ZA 4UASA 4Y9UA 4AMUA 4BFVA 5BOSA 1AUPA 4R84A 3IJ5A 3PQDA 4KPUB 4R2JA 3O95A 1ZFNA 2Q07A 3DEAA 4UZEA 2FMTA 2XMSA 1N9KA 1UKEA 5EE9A 2VPQA 3MLBA 1QF9A 3L8HA 1SQSA 1AUOA 2XT9A 1CEQA 1GPLA 2GN1A 2VYVD 1N57A 4L27A 1W88B 2EVWX 2ZIGA 4D0NA 3SFZA 3WHIA 5ER6A 2X58A 2YUIA 1XVUA 1WBDA 5K1ZA 1N3LA 3DAFA 3S44A 3IUBA 3VHQA 3NO4A 5A1JA 1BJRE 4YP0A 3JQRA 5AM5A 4LC0A 4RPCA 3Q8WA 2ZI7A 1NYQA 4Y0NA 1KDVA 2HHCA 4E21A 2OGWA 4WXMA 3IAS1 1K8ZB 3JZAA 4BAUA 1NP3A 2VFAA 1TZMA 4J94A 3H4VA 4YEDA 7GPBA 5CVUA 2RHHA 4IPTA 3B9BA 3LCJA 4N03A 1GQOA 1SVNA 4UNPA 4MNTA 3RSCA 5A4DA 5JS2A 2BGNA 3ACDA 3EWIA 2I3GA 3CKMA 1GD1O 2VAVA 4YXWA 1FP4B 3G1TA 5FADA 4D6XA 3QE9Y 1QCDA 4J0DA 2FMUA 2Q5IA 4S2UA 2R7LA 2XWJI 1X0XA 1CUZA 1L1RA 1L2TA 2XH8A 3AI3A 3CUTA 1I6WA 2VYCA 4PPYA 5K8CA 1JJAA 4KRFA 3UAOA 3G13A 4QSHA 4LWPA 3I9LA 3MC1A 4HX2A 3DDNA 2PU5A 5CM9C 3IXMA 2YWGA 1UBOS 1Z36A 2QT1A 1FYFA 1RRPA 4NBWA 2J0VA 1PLJA 4HB3A 2AMFA 4ESVA 1K6XA 1Q0PA 3Q3CA 3RDPA 4AUKA 4G1UC 4BNDA 1OH6A 2I71A 1Y81A 3SEAA 5ALMA 2AC4A 3O92A 4ROSA 2F1JA 2EAUA 3C15C 4ENQA 2AN1A 4QNRA 3KLMX 1C3XA 1REQA 2G0TA 2PUJA 4Z8XA 3U7QA 1E1NA 3JYQA 3N53A 5AD1A 5FQOA 3O7WA 5DN6D 5JSUA 5LMNB 4BKRA 4F06A 4K6OA 2ZE7A 4RO0A 2EKZA 3E5MA 4W7IA 3IHLA 2RH9B 3ZN2A 4BNMA 4DY4A 3L1HA 1EEHA 2HBQA 1LPAB 1MC5A 4LZJA 1E3WB 2WJZB 3K9NA 3LT1A 1EFTA 2D0DA 1Y48E 1W88A 1RLUA 1VM6A 2K2WA 3V3TA 2CT8A 3TPZA 3TTSA 1WSDA 3NEYA 4OHXA 2WYOA 1O5TA 3GT0A 3WDLA 4JI0B 2HNAA 1QRAA 3ZE0B 1FYDA 5JNRA 2P90A 3PLRA 4FHCA 4LXHA 2VO1A 1DKQA 1RYYA 1GCIA 1OYOA 3BMXA 1DFIA 3MGGA 1E2MA 2G77B 2XNDA 3X1XA 3S40A 1P18A 1NVBA 4J49A 1FDSA 1EI9A 2NTVA 2PANA 3UG6A 1YONA 2GOYA 2W6PA 2Y0CA 3L6UA 3U3XA 5KCMA 1GGVA 2GK7A 3GYBA 5AHXA 5DXAA 3A6EA 3W77A 3UK7A 2BRUC 3GXBA 4ZOLF 4ZJZA 4MUYA 5MN6A 1NBAA 3AKYA 1Y8ZA 3VKWA 2QM7A 1PT9A 3L7NA 2PYDA 1RW4A 4CJXA 3RADC 2ZIUB 1WU7A 1M83A 1A1VA 1E66A 3PA6A 2I5PO 3U80A 1EUDA 5JRDS 2ZPUA 2GK4A 5AKIA 3WWZA 1PP4A 1AQLA 1CX9B 1UPBA 1RRKA 3HMKA 3LLMA 1P7ZA 3BFVA 4WXYB 5AP9A 4TYWA 4RHTA 4RKYA 3ZBQA 5EJ7A 4HNAB 4RMNA 4YCAA 3WS7A 1I4EB 1YSCA 3BIJA 4Y0AA 1B76A 4XLTA 3V7FA 2WSSD 4FT2A 4Y7DA 4KBGA 4BVKA 1YU9A 1OT3A 3P9KA 4JWTA 3U09A 3OC6A 4GW3A 4FXPA 4IILA 3K09C 4LDAA 2GZMA 2I34A 4QNMA 3WGMA 1CUJA 2VPPA 4LMPA 2F90A 4L76A 1P5HA 5TARA 3TBFA 2XHZA 4D8TA 4MYCA 1K7EB 2SCUA 4RF5A 1Z12A 2UVPA 3GLHB 5E6SA 5LP6B 1FNBA 1JR3E 1ONSA 1QAOA 1XXHA 3GGOA 1VPDA 4MWOA 3A4NA 5ALOA 2AG8A 4JJIA 4XIYA 1TO2E 3HKDA 1GVNB 2NZ2A 2C96A 2W90A 1XZQA 2X8LA 1LVUA 1MB2A 3OPQA 2P9FA 4JX9A 5CJJA 5AW7A 5F2KA 3KUCA 1A5ZA 4FMBB 1JPUA 3RWBA 2V5VA 4P5EA 1SG9A 3W2TA 2BR5A 1KWKA 3JRXA 5AESA 4Y30A 4OP1A 4F1KA 1K7YA 1SUBA 5DIFA 1L8QA 1RI3A 2HCTA 2QW8A 1Z06A 4BEWA 5HKBA 4DNOA 5CXUA 5CXQA 1N8KA 2HPZA 2ECKA 5EJ5A 5EYPB 4WNAA 2OHGA 1UH5A 3P32A 1JE1A 4HAYA 4RHEA 3UCFA 1ZLXA 3KUDA 4FZ3A 3TSOA 3DCJA 1C3EA 4BRWA 1QFXA 1C1XB 3NRBA 3GEDA 2H5EA 1NXTA 3ZPXA 2Q2OA 3CS3A 4RV9A 4US0R 2WTMA 2AA3A 4A36A 3CLVA 2HTEA 3DDOA 1M3SA 4E09A 1T6XA 4WN9A 4KR3A 1P0PA 3AEQA 2F6RA 2VLIA 2YIDA 5J4HA 4C4YA 4I66A 1BG6A 2O2JA 2C59A 2RGUA 2HA4A 4G6ZA 1MA0A 5DNVA 3E7WA 4AY6A 3ETEA 3NGMA 5D1HA 4KNVA 1I14A 3EVTA 1D4FA 2VHYA 1J8DA 2HWKA 2X40A 3CN7A 4QATA 3B6EA 3Q72A 1Z9BA 4FMDF 1OH7A 5E9JA 2GB4A 2ZDGA 4JJKA 4DUGD 4ZA2A 2NVUB 3NTOA 1RJFA 4B9EA 1A04A 1HFWA 1U8ZA 1LF0A 2VDKB 4MLZA 4BEVA 3IVCA 5IKEA 4RKFA 2HJVA 2PZ8A 4IF4A 1PKXA 3BVPA 3LPLA 1USWA 2J0EA 1TGVA 5M3BA 1QGAA 4U0JA 1UC9A 2OHFA 4RCVA 2GZ3A 2LIVA 5HFAA 5TMEA 1VG1A 3H65A 3KO8A 5CEFA 5L7WA 3H8WA 3AB7A 4K6FA 5CA0F 3G5MA 2EJWA 4KQ6A 1GFSA 4HDRA 1UBMS 3KB6A 4GKVA 4EB0A 1O94D 2B92A 2IZ0A 4QAQA 4GX5A 5FA5A 4CIBA 3L0DA 1Y5MA 4GE0A 4PSKA 4UTVA 3TLJA 4QEZA 4DMUB 3DWEX 1ZGHA 2IDJA 2RGAA 1ND6A 4BN5A 5IKMA 1NL3A 3OLWA 1YTUA 1T2NA 1OUMA 1A98A 1KI9A 1P2SA 3BOSA 1QV7A 1ULBA 2XDQB 1Z4KA 1QHGA 2OUKA 3S2YA 4ZZ2A 5DBOA 4QQKA 2E4ZA 5A3QA 1Z0SA 3DBOB 3FVRA 3R7SA 1KMNA 4QG3A 1WOMA 4BUZA 5HUQA 1E64A 4CM5A 3R7BA 3CZCA 3K30A 3MTBA 2VP6A 4RSHA 4NAVA 2C07A 4LYDA 5K3CA 5JMOA 3B2EA 1ZCAA 2IZ7A 4U7TB 3MWLA 4RIIA 1NW4A 2NYVA 2I6TA 3R6WA 4L2IA 2BGLA 2SBTA 1IATA 2V96A 3V4PB 2NXWA 4D4IA 5I3ZA 3WP1B 1H4TA 1UKBA 2V4MA 3ZY2A 1JI0A 1JFSA 4UDYX 5EP2A 1QHHB 3BPSA 3ICQB 4C06A 1UKCA 1XP5A 2XB2A 4BAGA 1BVHA 4IOJA 1ORWA 3DLAA 2AKYA 3MQ2A 5DTQA 1JQJC 3TYXA 2PL5A 4JLDA 5DCWA 3V1MA 4AJ2A 3ZWBA 4YMTA 2UXDB 3DE3X 3I2KA 5HEKA 4WV3A 3QNWA 5DKFA 4DJEC 3S68A 4MTCA 2R00A 1E1MA 3RRXA 5L45A 4JR1A 4FHZA 5IZ4A 1MT3A 5BVGB 2G04A 1P44A 5KJCA 4XGIA 5H3LA 3HFSA 4LJ8A 1UT6A 4YJHA 1BA3A 3LOUA 2J9ZB 1UANA 2NV2B 3WTBA 4PXAA 4C87A 1M6WA 5KKCA 5JS7A 3HA3A 3DZBA 1K5GA 3CKYA 2E89A 3LXXA 4L5BA 4MO9A 4M8KA 1NX9A 2CXHA 1E62A 5BQOA 4IJMA 1PJLA 4HP8A 3SYNA 1SAYA 4ALMA 4U2FA 4PONA 2J5QA 2P9HA 1YWGO 1GG9A 1W44A 5AK4A 3E0QA 4OAOA 2QR3A 4V0RA 3W6OA 4AXBA 5DVZA 1LBEA 3D6JA 3U4MA 1NR1A 4MS1A 1TEVA 5KSPA 2C2BA 4E2FA 1FFBA 3LDFA 1YZFA 5I4BA 1X7WB 3S81A 3N2KA 4PLWA 1NT4A 4BRZA 1DOZA 2OFXA 1Q95A 2RK3A 4WZAA 2IZ5A 4A2QA 3CT6A 3O03A 1UM9A 1FUEA 3P9SA 1DCMA 1HQKA 1X1BA 1XELA 2AT1A 4BNFA 4DKXA 5C7LO 1FMFA 3WISA 1NXXA 3I2YX 5KPDA 1RHQA 5CAEB 1VLVA 5JNVA 1YACA 3RGGA 1ADYA 4GOJA 4H31A 1KNXA 1FFHA 2VRWA 4MVJP 5C1BA 1K6IA 1JPJA 1UEIA 3AKEA 4L95C 4OJYA 1UXGA 1LV7A 2MIIA 4R2WA 3PC7A 5DCYA 4P4UA 3ZHSA 4Q1BA 5FLYA 4JQYA 1PTJC 1S96A 3VTZA 4PZEA 4AVYA 1TAGA 3B1ZA 2IYLD 2IPNA 4DM4A 4JB8A 3KLOA 3DZDA 4OLBA 1OLSA 2BR4A 1EG7A 5KIAA 1B16A 1DIRA 5TXGA 2GN9A 2BTQA 2PXAA 2MDTA 1JH8A 2FFHA 1SIBE 3FDJA 5BR1A 1HDGO 5EIEA 3NTUA 4NTZA 1BKDR 2MR6A 4AZ3B 1UXHA 4DF3A 1FVXA 1UBKS 2HHLA 3FFWA 4RPKA 1DUSA 3K05A 3PJEA 2OVFA 1G8JA 1DLJA 2YVKA 3N8KA 3Q7EA 1RHMA 4O3FA 2CMKA 4TTRA 3I62A 2WE8A 1MOQA 4KN6A 1FUKA 4ALKA 4NHOA 1IVNA 3BTVA 3WLRA 1G20B 4H17A 5D5HA 1AMUA 1GT91 1C3JA 1VJ5A 4P36A 4YMWA 4M0FA 1H6BA 2GI4A 3N0WA 4HQNA 2XJ4A 4DSZA 1G8PA 1SHUX 1W59A 5KYUB 1E59A 3NXSA 4YK7A 1UBTS 4E6PA 4FBLA 5A0TA 1W0KD 3LDGA 3PYMA 4OQPA 3WLNA 3COWA 1EBFA 2JLRA 3IQXA 5DTIA 5K0FA 3FUWA 1N7IA 1ZCFA 1L0BA 5AK3A 2W6JA 4M7WA 4LC9A 2YZ7A 2WV7A 521PA 5JO9A 3DFFA 1M2NA 1ZK2A 2VHVA 2I2CA 1KP2A 2QZ9A 3DZ8A 4I5IA 4RK4A 3UK1A 3G7SA 1YB7A 5CAEA 1WPXA 3P20A 3VU1A 5I7OA 4ENWA 5IDWA 4MWCA 1G0NA 3EW9A 4TZKA 5I7RA 3GBPA 3REOA 5DIZA 4KL8S 4YLYA 3ZUPA 3H05A 1Z0UA 1IEXA 2CMHA 3WWCA 3M6VA 1Y6JA 2IJGX 2ZRCA 1F06A 3LP8A 3QU5A 4BGIA 4YCMA 3ZC3A 2NTNA 4EH1A 2F1OA 2PWYA 3AERA 4EY4A 4QECA 5FI1B 3ER6A 1EHYA 1PQUA 2PZKA 1BIFA 2OK7A 3NQ41 4N6NA 1CJKC 3EGXB 1UDRA 2C3MA 3QUQA 3BWXA 5DNEA 5FFNA 2NUPB 3BFKA 2ZOSA 1QQ5A 4V2UA 5P8WA 1ADFA 3V42A 2ZFUA 3VHRA 1VYTA 1X80A 2B1IA 2F55A 3FCAA 3MILA 2YDXA 5TGDA 2GJKA 4JB3A 4BO6A 4EY5A 3INNA 4AO6A 1GFWA 4LHYA 1PUIA 1Z62A 2OPBA 1T4CB 2RJOA 4I50A 3EMKA 2GDJA 1V8ZA 3JD0A 1T10A 3M4YA 2CF6A 3OI7A 1CWUA 4LGYA 1TW3A 4RZQA 5J1SB 1K1EA 2BGUA 3M2PA 4YAOA 3G7NA 1AOXA 3I01M 2R79A 1NURA 4NKRA 2Q62A 3IXLA 5F5LA 5G0WA 2EFGA 3CM0A 3NORA 4YLEA 2G1PA 4OYHA 1NVWQ 1L4MA 1ULTA 3Q7RA 2PBFA 3AEKB 3R23A 2Q3FA 4IG9A 3U3RA 5M34A 2A5JA 4OOEA 4RVUA 4NNPA 3KTFA 1ZIDA 1AG9A 3AR5A 3ZLVA 5H80A 4MWBA 1XRPA 2HA6A 3MM4A 2W6ZA 4DPKA 3WIBA 1ISIA 3S2EA 1YRLA 3K0BA 5LXTA 3R9KA 2RHDA 3SLKA 3UHOA 5KWSA 3K2EA 2H31A 4GUDA 3F6SA 1C14A 2JLUA 2EXXA 2E21A 5B1HA 4O4LB 1DWOA 3HJGA 2PGIA 2R6AA 3CNLA 4ZI5A 1SA0A 3R7WB 1XDBA 1R5JA 1G1AA 1UBSB 4M1MA 4KHPB 3E1SA 2HK7A 1DL5A 2OD9A 2ZE8A 4MMXB 2OXIA 4J0QA 1C7QA 1ESZA 5E2IA 3ORHA 3KKMA 2H08A 3L01A 3TX2A 4H7HA 2LD4A 2KS6A 2WKPA 1SOWA 2QLJA 2NXJA 3KV3O 3N0VA 3OHSX 1PR9A 3A9RA 3MD9A 2P6NA 4HAWA 4JLJA 4U6NA 3VR2A 4XGQA 5JJ5A 3DOOA 3GUCA 1HE3A 1MX9A 1KI6A 3VA7A 2A9RA 4KVGA 4DCGA 5T4HA 3ZHTA 2QMYA 2OKCA 2H0AA 3W9UA 1N2CB 3V1UA 1RE0A 4WD3A 3AVOA 4OI2A 3OQ6A 1J56A 4OH7A 4YRNA 2BKEA 2P62A 1HTWA 2XVXA 3DWGA 1JTFA 3SXUB 1M73E 2DGDA 4OLAA 3EF0A 5JVDA 3DFZA 4YJDA 3OIGA 1D4AA 3HSSA 3ZDYB 1NI4A 1W46A 4C1NA 5BSHA 2CBGA 1CUCA 3K5HA 1VTKA 4HL6A 2VSQA 5HJ5A 1KPGA 2CVZA 2PSDA 1P2VA 4H60A 4KK4A 1S6YA 1T9ZA 2FWPA 1W34A 2PNFA 1NSFA 1BWRA 2HV8A 3C6ZA 3HUEA 3P9ZA 4FP9A 5SZKB 4B6PA 3AJ8A 1OWOA 5AK6A 3SQNA 5KTRA 3ZVMA 2QXUA 5AW0A 5JSZA 3WOHA 5AVJA 3GLFE 4X5OA 4BFYA 1NC3A 5IXYA 1VKNA 1NLMA 2RGGA 2QVCA 2C2WA 2QLNA 3ZU5A 1JB9A 2P30A 5ALXA 3K70B 3KTOA 2C82A 2JEOA 4EEXA 1RBZA 4N65A 1VI6A 3D3JA 3IDZA 2UYQA 1WKVA 4MPPA 3BWMA 4CI9A 1NXQA 4HMOA 4E5NA 3DQZA 2PR7A 1HI9A 4HMQA 3OKCA 3DNPA 3DZFA 3L8MA 3MQ4A 4DM3A 1ZN2A 4J75A