3KUKA

Trapping of an oxocarbenium ion intermediate in up crystals
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
293
structure length
290
Chain Sequence
DLVQLCNPHIAAMKEDILYHFSLSTSTHDFPAMFGDVKFVCVGGSPSRMKAFIKYVAMELGFAADYPNICEGTDRYAMFKVGPVLSVSHGMGVPSIAIMLHELIKLLYHAHCSGVTLIRIGTSGGIGLEPGSVVITRQAVDPCFKPEFEQIVLGKREVRNTDLDEQLVQELARCSAELGEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQDYLRAAYAAGIRNIEMEASVFAAMCNACGLRAAVVCVTLLNRLEGDQISSPHDVLAEYQQRPQRLVGQFIKKRLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Glycal formation in crystals of uridine phosphorylase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 96
structure length 290
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kukA00
1OUMA 1U1CA 1Z38A 4M7WA 4RJ2A 4D8YA 4D9HA 1JYSA 4TXLA 4OF4A 1RXYA 3OPVA 1JPVA 1JP7A 1PK9A 3BSFA 4MCHA 4GLFA 2P4SA 3D1VA 3DJFA 1NC1A 4D8XA 1TCUA 1ODJA 4MCIA 3U40A 3IEXA 4IP0A 3BJEA 4G89A 3P0EA 2PGAA 5CCDA 4DARA 4G41A 3KUKA 3F8WA 4YJKA 1ZL2A 3FWPA 4H1TA 1JDTA 2GUWA 3OOEA 4JP5A 1CG6A 4WKCA 3P0FA 4PNPA 2AC7A 4ECEA 2QDKA 1OV6A 1LVUA 2AI3A 4OJTA 1V4NA 1Y6RA 1Y1TA 1U1FA 4EB8A 3NM4A 2AI1A 3OZEA 5F73A 3UAZA 4U2KA 1K9SA 4L0MA 1JDSA 4OGKA 3BGSA 1OU4A 5FAKA 4TXMA 3LGSA 3ENZA 1Z37A 4WKOA 3UAXA 4F2WA 5EFOA 4TS3A 5K1ZA 3DDOA 1TD1A 4TTAA 3PHCA 5C80A 4UC0A 4EARA 3O4VA 3NBQA 1CB0A 1TCVA 1JDUA 4QARA 1Z5NA 1LX7A 1T0UA 4R2XA 1PR2A 1JE1A 3K8QA 1ULBA 1Z34A 4TTJA 4L6IA 3EEIA 2OXFA 3UT6A 1Z33A 1YQUA 2H8GA 4WKPA 3UAWA 1JDZA 1ODKA 1A9QA 4G8JA 4DAOA 4K6OA 5F78A 2RJ3A 1PWYE 2A0WA 1Y1RA 5CXQA 4GKAA 1SJ9A 3TL6A 5CYFA 3BL6A 3MMSA 1PR4A 4M3NA 1ODLA 4OY3A 3OCCA 4JWTA 1N3IA 1U1GA 1OTXA 1U1EA 1RT9A 2I4TA 3OZDA 1RXUA 5F76A 3EUEA 3DP9A 3DPSA 1FXUA 1VHWA 3O6VA 1Y6QA 2QTGA 1PBNA 4D98A 1JE0A 1WTAA 1T8SA 2QPLA 3LA8A 3FAZA 2HWUA 5EPUA 2OC4A 1ULAA 1RYZA 1ECPA 1SD2A 4M1EA 4QEZA 1V3QE 4E1VA 1I80A 1A9PA 2A0YA 4F3KA 4FFSA 1T8YA 4DA0A 4LNHA 3UAVA 3PNSA 1TGYA 4L5CA 4YNBA 4QATA 5F7OA 1T8WA 3OZCA 3E9ZA 2ISCA 2B94A 3C74A 1RXSA 1XE3A 4NSNA 4LDNA 1RFGE 4OGLA 3E9RA 4DA6A 3QPBA 4LKRA 4D8VA 1M73E 1PR5A 1Z35A 1RCTE 3IOMA 3ONVA 1Z36A 5CYGA 4DA7A 1NC3A 1OTYA 1Z5OA 5EUBA 5I3CA 1A9TA 1SD1A 3MB8A 1JDVA 1QE5A 1V2HE 1SQ6A 3PNPA 3DF9A 4QASA 5F7XA 1PR0A 1C3XA 3OOHA 3EUFA 5DK6A 2HRDA 4R31A 4WKBA 5IU6A 4BMXA 5JPCA 5B7QA 3EMVA 5IFKA 4OEHA 3NM5A 4TXJA 3KU4A 2HN9A 1YR3A 1V41E 3E0QA 3T94A 4DA8A 3OZBA 1NW4A 1VMKA 1TGVA 1RSZA 1A9OA 3KVYA 4NY1A 1A69A 1Q1GA 1YRYE 4NS1A 2XRFA 5KB3A 2BSXA 4F3CA 4DABA 1Z39A 4LZWA 1K27A 4BMYA 3NM6B 3FNQA 1PR1A 1ZOSA 4QAQA 4PR3A 3GGSA 1T8RA 4LNAA 4X24A 5F7JA 1A9RA 1V45E 2A8YA 5CXSA 2Q7OE 1V48A 3INYA 4YMLA 3LBAA 2A0XA 1G2OA 3KVRA 3SCZA 4DANA 2QTTA 1VFNA 5F77A 1U1DA 1PR6A 3KVVA 3ODGA 4TTIA 4YO8A 5ETJA 4DAEA 4TS9A 1YQQA 2IQ5A 1RR6A 1PW7A 4BMZA 5B7NA 1K3FA 1LV8A 4L5YA 4GMHA 1B8NA 1OVGA 3FUCA 2OECA 4F1WA 4TXNA 1PK7A 1B8OA 3FB1A 3K8OE 1PKEA 2ON6A 4GLJA 4KN5A 4F2PA 4TYMA 5CCEA 3FOWA 4JOSA 4TXHA 2AI2A 3UAYA 1Y1QA 4QFBA 2QSUA 3KHSA 4L5AA 2HSWA 1A9SA 2I8AA 1VHJA 1ODIA 1Z5PA 1Y1SA 3PHBE 3OF3A 4WKNA 4R2WA 4BN0A 4MARA 5B7GA 4P54A 2OC9A 1YBFA 1RXCA 1PF7E 3GB9A 5B7PA 5F7ZA 4I2VA
chains in the Genus database with same CATH superfamily
2X8AA 4CTJA 1AMNA 2WABA 4EHLA 1Z4KA 2JFUA 3A6ZA 1QX3A 2LIVA 2ZAIA 3G23A 4F1JA 1ZK2A 3RFFA 2NZJA 1MJHA 1YOVB 1L8QA 2XMSA 2OKCA 2CKMA 1Z4NA 2Y0EA 2KS6A 1FRNA 1USVA 4OXNA 1HM5A 5AOCA 3ZNNA 1KO8A 2FR0A 3EG5A 1D4ZA 1H3NA 3F49S 3GIDA 2HHCA 1E3WB 3QTLA 1OWLA 3KZVA 4YJFA 4AY4A 5BYKA 3P5SA 4EQ6A 3QFHA 2C7RA 5L3SB 3KSDO 1M2JA 1RYMA 2WAAA 4FBMA 2ONKA 4FK8A 2K6GA 4Q18A 5AR1A 4QGSA 5ITZB 4YUXA 3M9LA 1HSOA 3VJKA 3LBFA 4GYKA 4PHFA 1T4DA 3DE4X 3GVCA 3LK7A 3BOSA 1U8YA 1ST2A 3L49A 2CF5A 3PWKA 4BNDB 1M2HA 2QN1A 2IVZA 5LLDA 3RS5A 3EIOA 2XQVA 5T7BA 4DJAA 1TCUA 4BQEA 2AVNA 1EUDB 2P3SA 3QUQA 4HQLA 3IAUA 4OXRA 3RFVA 2PO7A 3E9NA 4EJ2A 2HRQA 3RVOA 1ISSA 1QBGA 2H48A 2EL7A 4Y9RA 3USES 1UP7A 3C15C 4GX1A 1CJUC 2Z8ZA 2Q27A 4UMEA 2GZ2A 3ROZA 4G89A 4KDCA 5KSYA 2H4ZA 3K0CC 4FFLA 3ODPA 4JI6B 2ZUTA 4H7KA 1NNSA 4ZZ2A 4M0CA 3WB2A 4B0OA 3DV0B 3IBSA 1ZJZA 1R3UA 2FW1A 4P3OA 5AW0A 4BMPB 3LYAA 3MUOA 5EE1A 5FL7D 5K6AC 2GJSA 4C3UA 5JTTA 2YWCA 4BQQA 4B8ZA 1SC6A 3QJYA 3MWKA 1UJ5A 2E2WA 4WJZA 1N8TA 1F0YA 4I1VA 5AI6A 1JLMA 1UBRS 2BN4A 2NM0A 3CIFA 4MDEA 1Z7GA 3LQYA 2IS1A 3N2KA 3PRJA 3RW9A 3KALA 2D54A 2IXTA 1JVNA 1O4VA 1J2EA 2A1IA 2QVZX 1DJPA 1X7YB 3MD0A 1X7WA 4UFNA 5IX8A 5LVAA 1EINA 4MEJA 4TVKA 3S4YA 4EI8A 2X4IA 2YWGA 3WGGA 3CQ9A 3T1QA 1GDDA 2GTHA 1IPHA 1VLHA 2HUNA 3QV2A 4JLSA 1KJWA 2AC7A 2ETXA 1E32A 3I5AA 3OIWA 2B78A 2ZQZA 4A1FA 1U0LA 4ZDIA 4ZYLA 1H0RA 1QC5B 3K30A 3KB6A 3OF2A 2WQ7A 2WU0A 1P0QA 1QHGA 1UXOA 2ZJ8A 3H04A 1M8JA 3A2MA 4RK6A 4UCWA 1WZIA 5DYGA 3WQHA 5F51A 4EPYA 1PIWA 1X1CA 1ZUIA 1E64A 3IOEA 4AW9A 4H18A 3SIWA 3IVGA 1IULA 3N8HA 3V7FA 2IHYA 4RGYA 4JDUA 1KIMA 1XMJA 2E6KA 5NLLA 3OQHA 4PZ0A 5THKA 1VYTA 3MZ0A 3FHLA 1GR1A 2YYYA 2DAPA 4MKGA 4RMIA 3U7QB 4IIVA 3AI3A 3T3NA 4K9MA 3DEHA 3A2NA 4PINA 4BC0A 5KCZA 3OTQA 1SUFA 2FEPA 1YH3A 1GKKA 1GKYA 2I55A 1G8JA 3RTGA 1W5FA 4HAIA 4CV0A 5KQSA 2AFIA 2Y3IA 3VR6H 4A15A 2CZQA 1EI9A 3RARA 5JXHA 5LIPA 4KN9S 1L5HB 1KDZA 4A23A 4EX7A 2ZU6A 3UENA 221PA 3FZQA 4C4SA 3CX6A 1Y9EA 1RRVA 3EARA 3QMVA 1O54A 3V6MA 1PYDA 4DIKA 5K8UA 3H8JA 3O1HB 4HDOB 3D64A 2XV1A 4BCBA 4J1TC 4RZQA 4N48A 5H3HA 1JDNA 4DUYB 2BGTA 1C0PA 3AHJA 4NQRA 3MJCA 5CM9C 4XZ3A 3X44A 1YDFA 4F71A 1F3LA 2Z5FA 1KU0A 1TCVA 3G0DA 3KAKA 5AO9A 2I4IA 3O94A 1DXYA 1SOUA 4IFBA 2WOOA 1P4AA 4XYBA 1S96A 5ADHA 5J4VA 4PPFA 2IYSA 4FE7A 2RHMA 3S2GA 1VOTA 4I9GA 2L82A 2Q9AA 3K3PA 4KAXA 3WLQA 3UK2A 4D2IA 3H2GA 4D5GA 4M1YA 2E21A 3W8EA 4JHXA 3BG5A 3PNOA 4Z1MA 1IQ0A 1N5RA 2CUTA 5KTRA 3SSAA 4KYIB 4FKMA 4TVBA 3SICE 4QOGA 4PRLA 1II8A 1JU3A 3EEIA 5DIFA 1IB6A 2FX2A 3SVTA 1NVBA 1IU9A 4TROA 4QQNA 4WLVA 3OKCA 2H8GA 1T0IA 1FBNA 1G4HA 2NU6B 3TFWA 1BHO1 3UAWA 1FMJA 3L7YA 1QVVA 1BD3A 4R9UC 2C0CA 1SCNE 1PD0A 1SC3A 2PKYX 4RKFA 1JJAA 1OX5A 1SK9A 1Y4DE 3CZRA 1L5GB 2HPVA 2VQFB 3V4ZA 2IXAA 4D92A 3G0BA 3I12A 2D0PB 1JBEA 4GAEA 1HGXA 1XD2B 3E3OA 3GPIA 1Y1RA 1QXSA 4ML3A 3C1UA 2B8TA 3KB2A 4J94A 2PQMA 4C0JA 3SKYA 2HBYA 3EH1A 3B5EA 2HHAA 4B4OA 4ICIA 1S89A 5G4KA 3P19A 2C29D 4XCQA 2P2DA 3M33A 1G6OA 3ICVA 4PAMA 4FKBA 5JLJA 3MMSA 4NBUA 4D4JA 1JWBB 2PT7A 1XKLA 2V1UA 1DX4A 3DKIA 1BE1A 1WVGA 4I4TF 4A92A 1BE0A 2R5FA 2KBEA 2D7CA 3W6ZA 3ZBUA 3JASB 1E1DA 2C5FA 2VKTA 1OZGA 3FYUB 4RFSB 5EI5A 2X9QA 4HYYA 4JYBA 1LLUA 3SLRA 3ZUGA 1P0IA 1RHUA 3O9ZA 4D99A 1HWYA 2ZVQX 4RXTA 5CM8B 3AUJB 3RKRA 1GGFA 3L01A 4HX9A 1DLIA 1S6YA 2D1TA 2QGZA 5AJWA 3EE6A 3Q3GE 4WERA 4D9BA 3EUEA 5LP6C 3WQRA 1HTBA 4YP0A 3O6VA 4JP2A 3D6JA 1BOFA 3Q2OA 1AF4A 4NU0A 4QQ8A 5TPZA 3WFJA 1H4VB 2ZYAA 2JJ1A 4OHUA 1YUNA 3GRZA 3WNVA 2H0AA 3TCNA 1WTAA 5ALVA 1SUDA 3EXFA 1I4WA 3ZC3A 2GFHA 4TWZA 3W8DA 2X8WA 1OZFA 2NNLD 4RQBA 3KX2A 3N1UA 4GGOA 3V1YA 5LA6A 5FPPA 3OCJA 4IYRA 4NDZA 3WGKA 1PT9A 2WAXA 4FZVA 3IE0A 1JH8A 3ONDA 5EJGA 2OC4A 1PZEA 2Z1DA 2VPQA 1EZ4A 1FP1D 1H1TA 3GRYA 1XKXA 3NBKA 4G2TA 4TRNA 5EXTA 4KPFC 3VVBA 1JEEA 2GZMA 2ISSD 3UPTA 1JF8A 1XU9A 2PUWA 2VZLA 5IWAB 4YCDA 1UZLA 4LYHA 4Q3AA 4G3XA 1L7QA 3UMFA 4DIUA 2O8FB 2W8BA 1NUPA 2C97A 3LM8A 4UBOA 1TTQB 3AQIA 3BCHA 2SICE 1N2GA 2DJ5A 4NCJA 2Z9BA 3ZW9A 2H1IA 2WD9A 4KQGA 4OO3A 2P4UA 3GPCA 1K3TA 2IQIA 4AZSA 2AHOA 4BX3A 4R6XA 1J7KA 2VTBB 1ONOA 4L5CA 3MTQA 5G41A 4NYJR 4QATA 2XIQA 3A3OA 3THWB 2CNWD 4KAFA 1RKBA 3TLXA 2B4RO 1UBMS 3N2YA 1U63A 1K2WA 4LF9B 1U65A 4GSKA 1W4RA 1XBTA 2QG9A 2V9ZA 2XGSA 3HE3A 4FDLA 4FNGA 4MIYA 3MTBA 4UBJA 3TIXB 4DMCA 4GR5A 5FEUA 3U3JA 3VNVA 5KVSA 2GAOA 1DKQA 1LJ8A 2CEKA 1M7HA 3EJ6A 2RONA 2CXHA 3C6KA 1OLXA 4NCIA 4LDNA 4OA5A 3W9BA 1FFHA 5CNMA 5MDHA 1L4NA 1J6UA 1S2OA 3ZDXB 4EB6B 1Z26A 3DOJA 2VQDA 3AXSA 1GPMA 3O5AA 2PX8A 3KKEA 4PYNA 5E1MA 1OB2A 4IGAA 1F8XA 5GQSA 1IXYA 2JCVA 1NLUA 2QMOA 4Y1RB 2ZAYA 3IMFA 3FOBA 2C5AA 3PQ5A 2W2VA 1EVJA 1GCUA 1Z36A 2F9LA 1EGAA 3T7KA 4GXQA 1NUSA 4ESHA 4FMCB 3ML1A 4YBZA 3KVOA 1E5QA 1T1EA 3RC9A 5DMXA 2NYAA 1P2DA 2A88A 1XRRA 3C41J 3FZGA 3KJNA 4HJRA 4K81B 4QWMA 4WN9B 3BMOB 1NW5A 4WNAB 1PHPA 4CDMA 1YK0A 4XPIA 1JPNA 5KTMA 1GNRA 1D2NA 5AW7A 4P86A 4MV3A 3M82A 1BD4A 4U2GA 4YT4A 3DFUA 3DF9A 4HYTA 4Q1EA 4Q3KA 3IDAA 1ZD4A 1FIUA 1NVVR 4U5QA 1Y4ZA 2C88A 4C1NA 2AZ4A 2D5CA 5L4LA 3GRAA 4OU5A 3K9LA 5ALNA 4CUZA 4LYGA 1S01A 3L0BA 3N87A 2J41A 1O5IA 5EGNA 2X9VA 1MNAA 3QWBA 3D0RA 2GJAA 4IHKA 4RNDB 4U2FA 5HGJA 1HORA 3O8DA 2VP4A 2Z83A 4DRXA 3LY9A 1CY7A 2ZWMA 3MRTA 4YX9A 2KWIA 3AXTA 5AVUA 4HXFB 4NF2A 1LPNA 4GS5A 1FVXA 1OLUB 1COZA 4UASA 2FOIA 3OTOB 3B3GA 4CQLB 1G3QA 2X77A 2MWMA 4Y6RA 3KAPA 2AF3C 2P0YA 1TGVA 3TB4A 2WWRA 2IPAB 1LDBA 2HAEA 1O87A 1PLKA 4BVAA 5AK6A 2I1WA 2PR2A 5HW0A 4DF3A 4Q9DA 1TU4A 1YDWA 2QX8A 1P9RA 1U2RA 3IKTA 1FPQA 1Z39A 3QI7A 1TYEB 3Q9SA 1QZUA 4M8NE 1BXGA 3KYIB 3LUBA 4QTTB 4AMGA 3K96A 2GN1A 2X22A 3HRHA 3GRKA 3MXTA 3N0RA 2PV7A 4OH1A 2IEIA 3G2OA 5JAHA 1NATA 1NSFA 3SM3A 1EFAA 3RRNA 3V9PA 4ZPXA 2ZETA 4RV9A 4UVHA 4AURA 3D6FA 3R1IA 1UEXC 2YRWA 3N2GA 4KACA 2GPWA 5JYDA 3LC0A 4UHJA 5F9MA 4C7XA 5BVGA 1TCCA 2EXXA 2JA2A 2WIJA 2WJVA 4P33A 4D9KA 4ETWA 1Q91A 3MCTA 2ANBA 2MDTA 2FUEA 2NPIA 2D2XA 5T67A 1YA6A 3LTEA 3CNEA 2JPDA 2PY6A 1GAQA 4PSAA 1A9RA 1VIYA 3KR0A 3ASUA 3Q7PA 4XD7D 3ZIAD 4YMTA 1D2EA 1X7ZA 1V48A 2YV2A 3INYA 3LQFA 3BE6A 3MUFA 2AG5A 3HBLA 2ZE6A 4K1XA 5ENDA 4AN0A 2DXIA 5EQJB 3WKDA 1G2OA 4B40A 1GGMA 3CUEF 3F6RA 4KR7A 4OQNA 3KVRA 5SZHB 3RSHA 2OUKA 1K6EA 1Y3IA 5LZ9A 2CHGA 3KJFA 4RTRA 2C4KA 2QTTA 1K8RA 1E2MA 3B82A 1NYQA 4QD3A 3WB0A 1ZBDA 4EKNB 2PSHA 3GEPA 4PSDA 2PKCA 3GZNB 3BSWA 2GKGA 4MVJD 4INOA 1C9EA 3RKSA 4D8UA 5EPOA 2ADFA 4KW7A 1Z08A 1YZYA 2W6IA 4CIWA 1H2XA 1CNFA 2QDXA 1TAQA 4QELA 3BJIC 2R6GA 2F64A 4I3GA 5IBRA 4OP2A 4ZO9A 3MUEA 4WQMA 3NAQA 4B6JA 2CCKA 2VH2A 4FHZA 4LI3X 4NZ9A 2ERXA 5J40A 3HKBA 1X77A 3GJ3A 5ALUA 1IZ8A 2CLMB 4GBJA 3OO0A 4TWIA 1NWHA 2GLXA 5ECGC 4C05A 1JBQA 2Y0DA 4ZXPA 4DV4B 3BQNB 2DY0A 3CY6A 3L0SA 2X0DA 1B93A 5L7TA 1QWSA 4FFBB 3K5IA 3OTIA 4Z9FA 1P3DA 5ALTA 1LLQA 3RYFA 1E6MA 1U5BB 5CNIA 2IP4A 4V0RA 2ZRBA 5CLGA 3VZBA 4Q24A 2MTBA 3MJEA 3FBGA 3ZDRA 4CQMD 4KR2A 4DV3B 5I7SA 1W85A 2X6TA 2OFPA 2R60A 3CNLA 1CKEA 1AV6A 5EA2A 4K3UA 1PT6A 3PFNA 1AIPA 1RHQA 4GP6A 1NP7A 3OWOA 4F12A 1GZVA 1CUIA 4A03A 3GEDA 1KNQA 3MS2A 1OFGA 4UUAA 4ENPA 4YACA 2ZM5A 1A4XA 4OQXA 3CUKA 1H8HD 3G2QA 4DR3B 3TLEA 4TV9A 2KBFA 3SHFA 6REQB 1K89A 1OHHA 4P3XA 6AT1A 3RBVA 4XIFA 3PCTA 2C4TA 1K7SN 1XRPA 1N2SA 3IP1A 5AKEA 4C0AC 4PN7A 5CFOA 3EAQA 4JGBA 5EQDA 5ICGA 4YN3A 4ZYTA 3V4PB 1RI1A 4FSHA 2NP7A 2K4MA 1J5XA 4YRQA 4ZI5A 4FBLA 1Q84A 1I0IA 1M9NA 2CBGA 3P8ZA 5ITVA 2R1UA 4JZYA 2ZUBA 3M9XA 2XRZA 2DGDA 1KOFA 2VLBA 3NRBA 4RIGA 3WV4A 5JSQA 4J7AA 4G0UA 4BWVA 3WL3A 1JIVA 5IYZA 1JUDA 4NEHB 2FQYA 2REXB 3L79A 1TEVA 4ZOAA 5D87A 1G3UA 4EHHA 3HKDB 3EZNA 2GX6A 4B33A 5IN4A 1I36A 4X62B 1M2FA 1QQBA 1ZPDA 1HBJA 1JI0A 2J9ZB 2YL2A 3ICWA 2FX5A 4M7WA 1BAPA 2PX6A 4QTZA 4RH0A 2YWBA 3PC6A 8ABPA 5K3EA 5AICA 1GJRA 1JYSA 4P7GA 3T34A 3TTXA 4ER0A 2ZCJA 3ZE7A 4UU8A 4C30A 1OLOA 4FEYA 2QUAA 1I51A 3EFEA 3H6KA 3KTAA 3M1YA 3PC7A 4GE0A 4UE3S 3K09C 2AXPA 2VCHA 4ZVPA 5EOVA 4J3JA 1Z7WA 5JWHA 4YQZA 2Y67A 3Q9NA 1QG6A 2XWSA 5DI3B 4X66B 1Q0TA 3TVTA 4EKGA 2XMBA 1IUPA 3CSDA 4CXMA 2DBVO 2YOFA 2WIDA 3KUUA 1FU7A 3HYLA 2ODPA 3D1VA 3FWNA 1AK9A 2CMFA 3BF7A 3O1IC 4PV7A 2PKRA 3A0UA 4JJZA 1G3RA 4FUQA 4II7A 5A7HA 2G67A 2FZ5A 4YAKA 1CT9A 4Q4JA 4TTSA 4CM8B 1XVUA 1U2GA 1UMCB 1ZINA 3A6HA 2C4MA 3ZGZA 1RMYA 2BMVA 3DXZA 4Q7MB 5IAJA 4A82A 3LBYA 4L2IA 4WLUA 3VDNB 3IP6A 4IDFA 1XUOA 3D43A 3RRXA 1L4LA 4RA6B 3H97A 1JHOA 4J4HA 1MDFA 4ZVKA 3GGDA 2QBYB 1DRUA 3KKQA 1VHLA 2P9ZA 3ZR4B 2VAPA 3CN9A 5ALFA 5KZMB 4KNYA 2UYYA 3TDMA 1J33A 5FCDA 4BWGA 2NMVA 3GQBA 3K7EA 3EGIA 4BE7B 3H2YA 4Y6OA 3TTYA 3DV9A 2GLUA 2GPYA 4TWJA 3CLVA 1KK0A 1QCDA 1GL7A 2P62A 3PQ2A 4EGCB 4KR3A 2QUHA 4TV8B 5AXDA 4NDAA 2UAGA 2GZ1A 4GVXA 3OFND 4LISA 4AJNA 3FTEA 1RQ7A 4DIEA 5IAAA 1QH1A 4ZDJA 2JS7A 1WO8A 3HYNA 4BP1A 1THZA 4GWGA 1DLJA 3PD7A 3K4HA 1BKDR 3QF4A 3G7UA 5G1PA 1XZFA 3L7IA 1HFEL 2ZYDA 1N2BA 5B4VA 3MF4A 2CFIA 3ZGNA 3NDIA 2XCRB 4AP6A 3IQFA 1BMFA 2AI3A 4DTCA 1YRHA 4GZMA 1L4BA 1PEYA 1SXGA 1V4NA 2X8JA 4PSKA 1PU2A 2QI9C 2CFOA 3QKIA 4XW2A 3MMXA 3CH4B 1TC1A 1HQCA 2Z4RA 4KDFA 4NAUA 5KS2A 1NJ5A 3UK1A 1U2PA 5MFZA 2F9MA 2XMDA 3R8CA 1Y6FA 3PNQA 2UXDB 3F74A 1VE3A 3ANSA 2NYVA 2ZRQA 4QAJA 2PH3A 1D2HA 2ORWA 3CEPB 1A04A 4JQZA 4QUGA 4B34A 4DC1A 4DG9A 3UAZA 1IZ7A 1ONPA 3HSKA 3R3WA 3CCCA 4RZ2A 4DIOA 1CP2A 2VDOB 4YJHA 1ISPA 2AFIE 4M88A 4NHEA 5A2QA 3HJUA 2OCKA 1RWXA 2PX0A 2A9RA 2C9ZA 3DE7X 3HCFA 4K9DA 2DPGA 4TXMA 4BZZA 4RJKA 2BFCA 2DH6A 3I32A 1XHEA 1Z37A 3SKXA 1UC9A 4BKUA 1DRKA 4JVOA 2BM1A 1SHLA 3R7WB 3NIBA 4FQ5A 4ZDKA 3FUWA 1Y6ZA 5FEMA 5KNLA 5LD2C 1DBIA 4OBWA 4G4SO 1GYPA 1FBTA 2VUUA 4ZEVA 3WO1A 4TVSA 5F9FA 2VPTA 1E9SA 1GQFA 2XKJE 4OUKX 3D3NA 4D02A 4K9SA 3LUGA 3OLYA 4PC2A 2HF7A 3HNRA 1SZDA 4H7DA 4WADA 1YL7A 4XX1A 1C8VB 1MOPA 5JMWA 2FQWA 4CM1A 3N2KB 5JV5A 4YCBA 4IYJA 1OFUA 3TFOA 1QV9A 1EWVA 1N6IA 2DQKA 3UXHA 4XJVA 1X7WB 3U3XA 3FFTA 1Z0UA 1W2GA 1Z5NA 1SXHA 2FF5A 3DVQX 3PC3A 4PG4A 1XL0A 1DIRA 3TSWA 1OBHA 4JZKA 4UD2A 1WW8A 3Q6NA 2Z6VA 1ULBA 4LRWA 4MB0A 1OVMA 1V8PA 1Z4OA 3JQFC 4KO1S 1UWKA 4YJ3A 5IJ9A 1E3JA 2PUEA 2XMRA 2ZJ7A 3O47A 3U1VA 2C61A 4GPBA 3NX4A 2PGXA 5C5CA 5IT4A 5KYTA 10MHA 1EGMB 4B35A 2ADOA 1GNPA 1WMAA 1NFFA 3PC8A 2F48A 1ULHA 1GXSB 1WLYA 5FOSA 3ROXA 3NHLA 4PGAA 4WKPA 4FDTA 5E2AA 1G5TA 4H4EA 3B8EA 2GNPA 5CFRA 2ZSHA 5IM4A 3IFSA 4PNEA 3AUSA 2IS6A 2C42A 3K6KA 3ZXSA 2VJYA 1DADA 1DKMA 1V9LA 1XCOA 2ZYGA 3CR8A 3PKIA 4TN5A 3RUFA 1YAJA 3WWYA 1IY0A 4DAOA 3NTOA 2JHAA 3H5VA 4CE6A 4JK3A 2OZLB 4TMWA 2RJ3A 2CD7A 4YCCA 2A0WA 5TPWB 1NVEA 3D8HA 4FFPA 4BQRA 5ULLA 5JSZB 1YGYA 2AFIB 2UVQA 2IDJA 3WRWA 2QP9X 4BRWA 2OILA 1JHMA 3FWYA 3LKZA 4RTKA 3NH9A 3T9BA 5IKMA 3D3WA 4FI3F 4TKZA 1QB7A 4X1IA 1NKSA 1Y3DE 4EJSC 4NEGA 1R0KA 5P21A 2DMRA 1ISRA 2NQ8A 1Y4AE 2NUTB 4RD2A 1XDBA 5CX1A 3EVFA 4G4SP 4UHBA 4PHCA 2Q0XA 2VNKA 1A96A 1DT5A 4MP3A 1U2SA 2NAPA 1GZDA 1TQ4A 1VL8A 1XVAA 3RE1A 4QBKA 4YCSA 1IVSA 2OD9A 3BIJA 1E63A 4BB0A 2EEZA 3OCCA 1NUTA 2B4AA 1NKTA 2G08A 2RAPA 3KTOA 1E5TA 5HKKA 2I03A 4HB3A 1N7GA 2XBLA 3RVJA 1PG5A 4MA0A 3FMFA 1XN1A 3IODA 4OAPA 2HMSA 2XGMA 4GOLD 1FS4A 5BNTA 2AK3A 2Y1CA 1FLVA 5ALRA 5CB4A 3L18A 2J0UA 4UNIA 2PLWA 3F46A 1PWZA 2ODQA 1NJGA 4E70A 1NA5A 2X15A 3C8MA 1J39A 4DJEC 4R0MA 5GZ6A 2HQOA 4LMBA 4GOXA 1EE9A 4DM4A 1C7IA 4IDDA 2PIAA 4D98A 5KUTA 1ZK0A 5EN4A 1ZGBA 3ZI4A 2X7HA 3ZCPA 3S1AA 3GCZA 2CXSA 3GJ4A 3G49A 2QW0X 2CXNA 2PRYA 3JYPA 3P2JA 2O1XA 3FCEA 4GM4A 4H77A 2PJUA 3ADPA 3D4BA 2V7VA 4MMZB 4RD1A 2JI9A 5EG5A 3NJ4A 5FR1A 4Z2YA 1NOKA 1A2BA 2PU5A 2EWWA 5IP5A 1Y0BA 4TSRA 2Q5CA 4A8JC 4MICA 1AUPA 1KL7A 2Y27A 4XLLA 3DVAA 3I62A 4B7CA 3Q2KA 4JP3A 3VKHA 3NC4A 3UMJA 3O2NA 4J0FA 3MGKA 3Q5EA 3NGLA 3EVEA 4IJMA 4ZCRA 4ZVQA 5E3HA 2FPSA 1XDUA 2ECPA 3UGQA 4ZQEA 3H0KA 3SR4A 3DTVD 1KI9A 3NEYA 3URKA 5FNZA 4D3XA 1P2VA 3HFRA 4OQPA 1TFUA 3VV2A 3REFA 1HOTA 2ZSBA 2PL1A 2G1KA 4MDFA 3R0IA 1QYDA 3GCWA 1XJ5A 3OPYA 5TGTA 4CHTA 2O8CA 4WEOA 4BFLA 4ZZ0A 3KKMA 5CD1A 3I23A 1NX6A 4IICA 1T2CA 4OK5A 4TLMB 4HUTA 3B36A 1ZY2A 4UPVA 1T8WA 3E4DA 3SQOA 3RAPR 2R8XA 1A4IA 2BRUA 3MHPA 2YJ3A 4IOJA 1GUFA 3T99A 2JGFA 4YJGA 4D3ZA 5HCNA 4OOFA 4EG8A 1DJLA 2ODBA 1PWXA 3DBRB 3A70A 4CGZA 1XB2A 1LBHA 4WA8A 2NAFA 3KOMA 3LP8A 4OYRA 3Q12A 1VPEA 1SU7A 4NICA 5DX8A 2E55A 4Z1OA 1YQEA 1ZXBA 4BP3A 4JJ6A 1AQ6A 2FLKA 4G65A 4RXUA 2Q21A 3I9LA 1DV1A 3QPDA 4KKVA 3B3QA 4YRJA 2NVUB 5K8JB 3GFRA 1MB3A 1U7TA 1JKIA 4CTOA 3DDWA 4EHDA 2W42A 2WI8A 3EXFB 3LYLA 2GUGA 1VKRA 2D4AA 2VUTA 3ONVA 5JYEA 1TFRA 5IABA 1SA0A 2P78A 2VXYA 3P96A 2O1EA 5FA6A 3BORA 1RFLA 5LA6B 3USZA 4C7MA 3DS8A 4G0MA 2VCEA 3HZRA 5KDOA 3UF0A 2YHUA 1GLGA 1GTJ1 1KHHA 4QJBA 1G8GA 1TK9A 2V98A 4WECA 4D8TA 4YR9A 1Y37A 2DG2A 4QECA 3RO7A 1HT2E 4R1MA 3VOBA 4C0LA 5A1TA 3EMDA 2R79A 3B1YA 5M7EA 2VYFA 4KRXA 5EUMA 4IIJA 2NSYA 3LSYA 5LYYA 1BKYA 4OHOA 5KYXA 2B37A 4M37A 2OLKA 5T8KA 4XVRA 4LRYA 2REOA 5AFSA 3QXJA 4JIGA 1FFEA 1B1CA 2FN4A 1WPXA 2Q0HA 2XWBF 4J75A 1ZM4A 4RTNA 5IUNC 1DELA 4LUCA 5IFKA 2PE5A 1MEJA 2IZ0A 4I6EA 1OWNA 4B46A 2FETA 2ATVA 1REQA 1VYHA 3DHYA 2O0HA 3PQ7A 4CDNA 5EHZA 1E1QD 5LOVA 2WTXA 2A9KA 3FTNA 4AROA 2YS6A 1RKVA 3KJGA 3OX4A 4IRUB 1VSTA 4OJQA 5IARA 3PX2A 5DE3A 3SDZA 1BIFA 3IDOA 1OJLA 2Y4NA 1OLXB 4GX0A 4HGPA 1VE1A 2IH5A 5FI3A 4X1KB 1XJWA 4NG4A 1M7BA 3LKVA 1GG8A 1VIDA 3EXG2 1BQ3A 4MHOA 5TY0A 3QPWA 1M2WA 2BEWB 1UPTA 2GCIA 2ZT5A 3LL4A 4AJEA 2I2CA 1YS6A 2JCXA 4NY1A 5HILA 2FPUA 1NJ6A 3TDKA 3N6RA 3R5TA 1CB7A 2ZRIA 3HMKA 5KB3A 3FPLA 1I7QB 3PNYA 3K9BA 1C7JA 4R0VA 4G9EA 1H2WA 3NCTA 4KVGA 1MC4A 2QR2A 3Q40A 1I6WA 3QLUC 1OTHA 1X1BA 3DQPA 4BFYA 1WB6A 5CVJA 3OHSX 4WZAA 2PYIA 4FWBA 4L7VA 2GPBA 3V3KA 2HWKA 1QTQA 2ZWAA 2WZDA 2VF5X 2GWRA 4XVCA 2IYOA 3FE2A 3TTVA 4FYVA 5GOZA 3ROPA 2WFAA 1L7VC 3WVNA 4GRIA 4TMFA 1RDFA 3SZUA 5A9SA 5B53A 1P4JA 4MQBA 2V58A 3BH7A 2WNIA 3M4NA 2FEWB 5TSDA 4ZHQF 2QORA 4HEA1 4MKIA 3L9XA 3CR7A 1E3IA 1YJ5A 3V3TA 5FPKA 2FXIA 3HUFA 3TLAA 3CVVA 2OCBA 5K4AA 4HR7A 4LF5B 4H27A 2ZP1A 4ZZ1A 2G5TA 4C4ZA 1TTHA 1ZXXA 3DZJA 2XRYA 4BO9A 3ANNA 2DUJA 4QUKA 3OEED 4D8WA 5LZ2A 3G0HA 3I8SA 1IQPA 3IKLA 4FJ2A 4DRXB 1WDLA 1VFNA 4K40A 5F77A 1LPBB 4RL4A 2V7TA 4GOJA 4JJ8A 3RM3A 1FUEA 2J33A 3IC5A 4QYMA 4DYHA 1A1VA 3SWWA 1KH1A 4UUNA 2ACVA 4ARCA 3SQNA 2IW3A 4IIEA 5DBFA 1SKYB 3TE6A 3EWNA 3NLLA 1NI3A 3T3MB 1ZMTA 3E58A 3ESBA 4H4DA 1NMEA 1OAAA 1E2GA 1UKVY 3H19A 4NONA 1QX4A 1B16A 2EAUA 3CYFA 3U4IA 3CLHA 2P1RA 1WXIA 5ALYA 1DI0A 4M0LA 5LQSA 4L5YA 3SZ3A 3LQRA 2C3UA 3PCRB 3UPDA 3UKJA 2CL5A 2FPIA 3WMGA 5GWXA 3EDCA 4FFMA 3QKTA 3O75A 1JRLA 4YGYA 2NYUA 4MX8A 3CX4A 5AW9A 1XQVA 4I1YA 1DTWA 2BMFA 2HA4A 4MW6A 2J59A 2ZULA 3PEWA 3CX3A 1KSHA 3BIXA 5T5QA 4BB6A 3B9QA 3IVXA 5AOVA 2H2HA 4C7VA 1M6VA 3NOQA 3ZHUA 2DETA 3MWDB 4J16A 1CZRA 1SPBS 4I6GA 1UM8A 1GQQA 3JAWA 1XRQA 2XD9A 5BORA 3I5YA 1T6YA 2OBXA 4LGVA 4UU7A 5FA5A 2O7QA 4KN5A 2C1EA 2C8KA 4DEYA 4DNFA 3ZDDA 3E3LA 3MWFA 3L4JA 1EAMA 4PBSA 3O8RA 5GM2A 3IUJA 3CWCA 1ECCA 1TOAA 2HGZA 2Q0QA 3AYZB 3EZFA 1FL9A 3KHSA 3PUJA 1T5OA 5DNAA 3TVDA 1IH8A 2I6GA 3BEDA 3INRA 1XPOA 3FYUC 1K7XB 5A4KA 3CO0S 5E1OA 3H5LA 1UAGA 1B42A 1Z4JA 2WVGA 3TIVA 2GBPA 2BISA 4AF7A 5D1NA 1T8PA 1CR6A 2JJMA 4A10A 5ADWA 3LVQE 1SO8A 2VDPB 5AW4A 2XBUA 1POWA 3AM4A 4JL6A 2DQSA 4ACBA 1SUEA 4CMGA 4B5KA 4ZP1A 4BECA 3DBHA 4N5LA 3DH0A 2HCFA 3ZJYA 2RKOA 5B2EA 3IELA 2FPLA 3G5MA 1ZESA 3GT0A 4U7TB 1TMYA 2CLFB 4P3PA 1FU8A 4ISCA 2B99A 3MXOA 3A7EA 1YJCA 1OMOA 5T64A 1Q57A 2BGJA 2N46A 3T41A 1WHTA 5CLJA 1N2XA 4A6DA 4E12A 3F6YA 1RCFA 5HFJA 3VJMA 4FLEA 1MORA 3HJCA 1K8XB 4RDCA 2IY7A 2ZSAA 3I42A 3RRMA 4BZQA 4QBGB 3NCHA 3PNLA 3UC5A 3AHHA 3HK2A 1QDEA 3MOIA 1Z68A 4UNPA 3GLFB 2D1YA 3E7WA 2QZPA 4LSWA 3HEBA 1E4OA 2ZYTX 4CLOA 3TRIA 3P32A 1OX6A 4W8OA 2FH5B 4DNPA 5D6OA 4LQCA 3BHMA 4CMHA 2ZUVA 4LZPA 3W2TA 4DILA 1RHJA 1DKLA 3L0DA 2A14A 2VT6A 3LBHA 4LMPA 4GO1A 1PFKA 1LRJA 3F4BA 3RYFB 4RKEA 5HM8A 4JOCA 1HURA 2B7CA 2PSJA 2BSAA 1XCGB 4Q3OA 1ETUA 5AD1A 1CQXA 3SQXA 1NW9B 2E82A 3TGPA 1QVAA 1T1RA 1RC1A 1ZK1A 2AH5A 2AN5A 2E3JA 3FWZA 4S24A 1N9GA 1ATZA 4M1SA 1R6BX 1UEJA 2GA9A 2PAFA 5B37A 1XI2A 3EZGA 4F96A 4QOSA 1BRTA 2A9PA 5A3VA 5ESXA 3GL9A 4D8XA 4BEWA 1RC0A 2XXJA 1J0DA 2C7GA 5FR2A 4BBJA 5IVKA 2XYPA 2VUHB 4MWZA 4TSFD 4CLEA 1TM4E 4MJXA 3WZLA 1BMTA 2HSJA 4C1BA 4HVLA 4LHWA 1IG3A 1VXOA 2Q5QA 4DLNA 3DL2A 3AVUA 1E9DA 2OO7A 4OBXA 5AVRA 4NZOA 5FPSA 4E30A 3KQKA 2RKWA 4KX3A 3UMRA 1ISHA 3EZ2A 3ZI0A 3NH6A 5CCDA 2FE4A 3ZBTA 2VH5R 4BLQA 3THRA 4F5YA 3INGA 4B7ZA 3FR8A 4FP9A 3NB0A 1Y9AA 4PGFA 2R1ZA 4PTZA 5FNVF 3TCKA 4BL5A 4C7OB 1OASA 3H4VA 3NETA 4I4NA 4QUHA 1PJLA 4W6ZA 5K6TA 4XFJA 5KIAA 2YJ4A 4UVGA 3SBDA 4JP5A 2XBMA 2G1UA 3G89A 1GM5A 2OHHA 4JKYA 2C04A 1L7DA 4K1LA 1JYFA 4BDSA 4FHFA 3ZK8A 3KSAC 1FW6A 3N2IA 4G25A 1D6SA 1ZEJA 4U0JA 1W49A 4H6VA 2CXXA 2HNKA 4M83A 5C8YA 2XGGA 3KTAB 1Q0HA 3KIPA 2XKAA 2VWQA 1UJBA 2IUYA 1M2VA 2RDMA 4MKHA 4AJ4A 2XQFA 3NJ8A 3PDHA 2QR3A 5HCUA 1Y1TA 2CN1A 4PO3X 2HPHA 1SEVA 5E1BA 3T15A 3OJ0A 1HC7A 1PP4A 2B83A 3HGQA 4C22A 1TC2A 4HF7A 2JIPA 5E3IA 1U2DC 3QEOA 5L8VA 1SCJA 1WUHS 2GM4A 5TS2A 2PFGA 4OHBA 4X8MA 2GK3A 5JPDA 5BVHB 4PYQA 4FSDA 3OQIA 4Q4JB 4HBZA 5K0GA 3WGIA 2P6UA 3EGCA 2YDYA 1SULA 3OICA 2C54A 5G02A 1XZNA 3NBFA 3K0KA 5FYDA 2GFIA 1JAIA 4TZ0A 1PO7A 2WZQA 3IBYA 3LBNA 4YP5A 3B2QA 1IG0A 2HI0A 4NYMQ 4KNWA 1K0UA 4QDZA 1PTJC 3IR7A 4IZIA 1WPQA 3RT1A 4AXBA 1MIOA 3CVOA 3JVUA 3QWAA 1QHNA 3KO8A 1R8JA 3FPHA 4S0ZA 1L5QA 3V32A 2HYIC 1C7ZA 2FZEA 2BV3A 4HJXA 5I7UA 3COVA 1R4ZA 2OV8A 2FK7A 3PXUA 3QVOA 1BCSA 3QPUA 4KI7A 4NR0A 3BIOA 2A1UA 3OLQA 2BDTA 3T9CA 3W5HA 3WMWA 1U6KA 2JAHA 2RBGA 2XGJA 1KETA 3M6LA 2IXDA 1MC1A 3DUFA 3W4KA 1ZM3A 5MHTA 2C77A 1PK8A 3CNHA 1VCIA 2XZLA 4NOJA 3A6GA 5DGIA 1P75A 4IJ6A 3QHQA 5FOQA 2V7WA 3B6JA 1NPDA 2PGLA 3NYWA 2RGCA 4CM7A 1VHDA 3D31A 4KQKA 2O2HA 4ZJPA 1TKRA 3OE5A 2OA0A 1FRZA 1KMCA 2O7SA 2UVPB 3B6MA 3LX8A 3QKSA 5GV7A 3WFIA 4D57A 3I4CA 3HXMA 4AULA 2WJJA 3I4LA 4HGYA 2GM5A 4GRDA 4HO1X 2AEMA 1E3SA 2OCYC 2Q6IA 2XF2A 1GUYA 4IDBA 4K6GA 3Q98A 4M1KA 1K1EA 1Y7HA 2PRJA 1Q0ZA 3EFBA 3R2JA 1C9JA 2RHCA 3HJNA 4FC7A 4AQDA 3TKLA 2QTZA 1FDIA 2DWOA 3EAGA 1WVIA 3HDGA 4U9HS 4U63A 2AG6A 3MW8A 1CR1A 3R75A 3RSGA 3RS2A 1TZKA 2XNDA 3T3DA 1JZSA 4AJOA 2FSIA 2LXNA 4XUGB 5CXQA 4CIYA 3HJTA 3RV4A 2MYPA 3R41A 4NNJA 3TDNA 3S8YA 2XEXA 3E61A 2A9VA 1G42A 3RYIA 4FGLA 4I81A 2C9CA 4JFAA 4JB0A 4JI1B 2RMKA 5CYFA 1WMSA 4XWWA 5TXGA 2HQ1A 2VAXA 1TUIA 3UWSA 2FR8C 4F5EA 3HZZA 5ISMA 3QOYA 1CY8A 3OKAA 4WY2A 5L3RA 4A0GA 2OTCA 4S1WA 1DC6A 3GNLA 5KYGA 1QKKA 1IEWA 1VYVA 4HUQB 4PFKA 5AW2A 1ODLA 1KYYA 5AUOB 1JMYA 2VHVA 1AV7A 2FEXA 4H31A 3PXGA 3AIIA 4GEKA 4QSMA 4CEJB 1G63A 1L8LA 1M34B 2F59A 3A32A 4PTYA 5E6RA 3W1EA 1ICEA 1PZXA 2A4MA 1MG0A 2DF8A 2RHLA 1JTFA 3IE1A 2X3YA 3UMYA 2WMYA 2Q1SA 3E1SA 1RT9A 4PC6A 3WGZA 2A3NA 4B3DA 3ANXA 4ZVTA 3JX9A 4ZO8A 4BAZA 2NGRA 3RS9A 1XG5A 4M9QA 4UU1A 5ARCA 3OHPA 4WKGA 4KE6A 3WX0A 1N0WA 1HE2A 1VG9B 3GUUA 2VZ8A 5KSOA 2Q3LA 1TF5A 3BMXA 3BWXA 4OYLA 1XO1A 2Z8YM 4WFJA 1NM5A 2ZT7A 1EDBA 2FFJA 1COWA 1AUXA 4CL3A 2EZ9A 1JXQA 3FJ1A 4POAA 2J6IA 3MAJA 3EPRA 4O4HF 1SNYA 1CJCA 2C1XA 1KGDA 3ZE1B 4BB9A 2YFKA 4KWTA 1S2LA 4M9CA 3JV7A 4YQEA 4N8EA 5JALA 2HOQA 1ZD2P 2CBXA 5A06A 5BMVF 4XUEA 1TZJA 2FB9A 3Q3IA 5CT9A 1TRKA 2DERA 3CLRC 2OXRA 3C3KA 2PUHA 3KD3A 1IOLA 1JH9A 3BB4A 1M6EX 4BFTA 1WZ2A 3FUUA 1CUXA 2Z5VA 2QZZA 4GC5A 5C8VA 4OFWA 3F71A 4QEZA 4X71A 4DCUA 1S1CA 5BT8A 4YMSA 2CLDX 3CPSA 3I52A 4LBVA 2ORED 5AJHA 2JJ2A 1OH8A 4COOA 3THSA 4LIPD 4TMVA 3D3WB 1T8YA 3ROTA 2PJRA 3A9TA 5ICFA 4X1IB 3EMBA 4IUYA 4ZV9A 3QVJA 3TTTA 4CKEB 2ZPUA 4MI1A 4KI0A 1QHEA 3P9YA 2JANA 4ZYXA 2O8DA 1FMLA 1USWA 2VDRB 1E79A 1DIHA 3K5HA 1OYWA 3DHNA 3QVTA 4BFZA 3DHWC 2B36A 2V9CA 3OCZA 4JA0A 1Z15A 3E9ZA 4NK5A 3MERA 5AUQA 3BA1A 2W6MA 1UKBA 4RULA 2FHPA 1UBNA 3EZXA 4OI2A 5FADA 5BV8A 2J0SA 3NVKI 4X3CA 1KO5A 2NU8B 2BMJA 2O8NA 1T1JA 5GPBA 3DAPA 1GSAA 1K86A 1DIBA 4QNNA 3IV7A 2RHRA 4K6FA 1FMFA 1ZH8A 1EUYA 2WUFA 3IGFA 3TO5A 1G3MA 1E3QA 5IFLA 5HR5A 2PLAA 2IITA 4NBWA 4I50F 5SYNA 1WCWA 1WHSA 4ZRNA 4QPNA 1B6TA 4B6QA 1L5MA 1PSZA 2O2JA 2B4TO 4PQGA 4E22A 5EJ5A 4HMPA 4U7JA 3ESCA 5EP2A 2OXIA 3S1AB 1IUOA 1RI5A 4CUKA 4ZK2A 2FMIA 3JQ7A 3H2HA 1JV2B 4G97A 2LUOA 3FGNA 1EU1A 1J2TA 2EATA 1NC3A 3PFIA 1UPBA 2W22A 2WICA 3D0QA 3MYRA 4JLKA 1SBIA 4KR0A 4TT3A 3T95A 2J45A 4RJIA 2YJGA 3QUTA 3UHOA 1T0BA 3G5LA 3HI6A 4B44A 5JJLA 1PJBA 4BFXA 1A9TA 1T3ZA 5FWAA 1NUUA 1P81A 4MULA 4RCZA 3VU8A 4FN5A 2CVHA 4CLHA 3UHPA 1UKYA 2DP4E 2OHFA 3VFDA 2WSSA 1A2QA 5C1PA 4YALA 2ONZA 1RQRA 4I4TA 2NV6A 4DCTA 1E1YA 3BF8A 3KKLA 4ZV7A 2BSQA 2NLOA 1QNFA 1USGA 3WKEA 1L7PA 4HQRA 1O08A 3LPAA 1U90A 1H2EA 1TLTA 3X1KA 5FI0B 4U1RA 4Z9BA 3ZY5A 3A0RB 2YXBA 3NHSA 1RC8A 1N6NA 1QMPA 2OM2A 3IAM1 4ITVA 2OGWA 3GW8A 4EVIA 5JW6A 3AP2A 1J9ZA 1R18A 1RLTA 1UWCA 2O4CA 5IK2A 4ZYYA 4ZTZB 2YV3A 1VSBA 2J3HA 5GP1A 4DT1A 3IBFA 4G8BA 2HN9A 4TYQA 5KNBA 3PXDA 5M04A 5E2IA 1L8AA 5EHXA 3PNMA 1NMZA 2VP5A 1BMQA 2CT8A 2WFZA 1WPRA 1FX0A 3NVMB 3OZIA 5CR9A 5BN1A 3SLKA 4MWGA 4DA8A 3THYB 3AVYA 1NW4A 2FGJA 4GI7A 2IOFA 2OXEA 2BCGY 5AW8A 5GJCA 3VTZA 1QCZA 4DLAA 2OP0A 4JLNA 3UG7A 2G25A 1JA0A 1HQKA 2PLRA 2Q5EA 4K9PA 2OPBA 3DMTA 3V4OA 1E20A 3G1WA 3E5MA 1KOLA 3TQIA 2AWNA 2MSDB 2GYYA 3NOVA 1NVMB 4QRHA 1RM3A 1UDAA 2D5LA 2B92A 3G88A 1QG0A 2PBFA 3D2CA 1QRAA 1X8LA 2JD2A 3HBAA 3IKJA 4I36A 3SJ7A 5EJEA 5FFFA 4TLAA 3BJRA 3CPEA 1KARA 1X94A 5EKSA 3OM8A 5ALSA 3S2FA 3CF4G 4P5EA 1XMOB 5A6SA 1J8MF 3DDSA 4WZAE 3VC7A 1DG3A 4RCVA 4X95A 2Q5JA 4E5YA 1S2IA 5CB0A 2HR1A 4RA9B 3EFOA 4R8LA 1DHRA 3ABIA 4D9EA 3WA7A 1Q0LA 4MEBA 3ENWA 1CLUA 2KSQA 2WJ4A 1WBBA 2RH9B 2I1LA 2Q1XA 1B15A 2LCQA 2AD1A 1FOEB 1JDPA 3OOJA 4PQFA 5D3ZA 5CAEB 5B4TA 1D4FA 5IJXA 5EZYB 3ZXXA 2C7BA 4L0CA 4FLMA 1MX9A 3ZCSA 4BP9A 3AP3A 3GV0A 3RLFA 3R8FA 4ER3A 1XQXA 3SXJA 2UZ4A 1M6WA 1Y8ZA 1KRWA 4JLJA 4O08A 3EIEA 3UVEA 4IMRA 4ND1A 3RRBA 3UOWA 3U6BA 4QODA 1GCIA 4JLOA 2JZOA 4HZUB 4TTVA 1VLJA 1ZQ1A 5CMLA 3WO0A 3OLXA 1DQSA 1XFDA 1Z29A 3LLVA 3DD1A 5E8JA 4BO3A 4NCXA 5LOVB 1GL3A 1L7MA 2WBLC 4ZEOA 5J47A 1IXKA 5A5FA 4X7RA 2OWEA 3T3GA 5DNDA 1UUFA 5HHTA 2WWVD 1K6XA 2A0UA 2WHXA 3AB8A 2AG8A 2FRXA 2NUBA 1N8SA 5ALMA 3W5UA 3DL0A 5KKCA 5CLFA 3TOXA 2AYXA 4BLPA 1FLDA 2LP4Y 3RWBA 1MO5A 3RU7A 2P27A 1R4MA 1M1ZA 1MLDA 1SXPA 1TIBA 2YHBA 1GZ7A 2LVBA 5KSPA 3AKEA 3I53A 3QXHA 3ZTWA 4TL6A 5I7OA 3TECE 4OHYA 1IPFA 2ET6A 1KDPA 3EAFA 4ZJZA 4R8KA 4I1UA 1SELA 2CF6A 3FCCA 4KYVA 3REOA 2R1VA 2EF0A 2QQ5A 4J4TA 4UEQA 1JFVA 1E7MA 2W2QA 1NL3A 3KS9A 1V25A 4MVJH 2EJVA 1R9GA 5BOSB 3OEWA 2QX6A 4DFDA 3IR6A 4PBRA 4NPAA 5WRFA 1JQ3A 2WG1A 4AYWA 2PX2A 4WZAB 2QNBA 4ZRDA 1H2AS 1WTCA 2M2IA 4WCFB 4Q4HB 3MMPA 3TXAA 4BCCA 1HE5A 4QM7A 2C96A 2A5JA 4KH1A 1ELOA 2JFQA 1Z4IA 4ON9A 3W2HA 4M1MA 4PYLA 1U0SY 1VJTA 4FT2A 4J2TA 5A9SB 5IRCD 1UDXA 3EGXA 4ENQA 1IVNA 1L7XA 4IDNA 4JJ7A 4TXHA 1AOXA 2VL7A 2V3CC 1FUIA 1G8SA 4PLYA 3AR6A 1NASA 4PX9A 5F5XA 1YFJA 1H0KA 3QUSA 1SCBA 5HMMA 5K51A 4U6QA 1G7RA 2YNMD 3H4TA 3ZJTA 3P0JA 5ERGB 1P62B 3WE7A 3F5SA 1CRPA 2VNHA 1DO8A 1PWHA 1FP4A 4B3HA 4DDMA 3PJRA 3TSAA 4DCGA 2BW0A 4N03A 2EW1A 3MBOA 4RIHA 5DNWA 1YCHA 5I7AA 3URMA 4FKZA 1K63A 1SZCA 2ZSIA 1P33A 1Y7TA 4P9NA 4UHEA 2GZHA 1ZK3A 4XQ9A 1W47A 2TMKA 3UWKA 4CR8A 1UR5A 3OF3A 2VYVD 1NI4B 3T5AA 1Z4MA 1HYEA 2PGIA 4GYJA 2I2BA 2EGGA 1WP4A 3MJFA 2YXLA 3KLOA 4KQIA 3ICOA 3VSEA 5LKAA 1JMKC 5JNWA 3HJFA 4LQ4A 4D4MA 5TGDA 4Q1DA 1YR9A 1N6OA 4MLZA 3EYAA 1R0YA 5CVCA 4G56A 1PZNA 1ZG3A 4TTRA 4EPXA 4MQ4A 5B7GA 2I22A 2WYOA 2JFVA 3R76A 1YT5A 4DKXA 4B82A 2F4NA 4H7FA 1P7PA 1MO6A 1OI4A 2FPIB 2H52A 1H4SA 1QIJA 5ALQA 2DM6A 3Q7IA 3QWFA 1G1MA 3BTSA 4ER7A 2JBAA 1DTWB 3U5TA 4V38A 4DSTA 1HSZA 1KHTA 5KKAA 1QIHA 4UARA 1E0JA 1OXBB 4H0CA 4KFUA 3SS7X 3T7EA 3V00A 5FV4A 2YVKA 3EVTA 1F1JA 1I1NA 2P5TB 2BKAA 2NXEA 1V9SA 3M4ZA 3TIGA 2HXSA 1HLPA 1RXYA 1ZOIA 4G63A 4ZT4A 5HMLA 4AJ1A 4DMFA 1IC6A 1WU8A 3IEVA 2O52A 3DYBA 1GRCA 1ZJ6A 3KZNA 3JRWA 1O6BA 4HGOA 1JR4A 4TTPA 3SBEA 2WU4A 1KVRA 3TNYA 1N5IA 5LMCA 4MPRA 4A16A 3FRIA 3IT3A 4NEQA 5AWFC 3MCUA 2AUTA 2ZYWX 4MCHA 4MS1A 4IHJA 1WLSA 3JW8A 1SXJA 3QVVA 5BNWA 2B21A 1DEXA 4JSRA 3WBFA 1NC1A 1DNPA 1KK2A 2PVCA 1SGWA 3RTCA 1ODJA 3FDZA 2VRWA 2ZUCA 1JKJB 1V37A 2QZSA 3DKVA 4O5AA 1LLCA 2PWZA 4MCIA 2BGRA 3PUHA 1N3YA 3R6LA 3X2EA 5GADl 1A7UA 1YJAA 5DM60 1GTG1 4GLLA 3IEXA 2I3GA 1POXA 3VZCA 1ZONA 2I4MA 2HCJB 4LOLA 3MPUA 2GN8A 5CNJA 3EGWA 1CIVA 2YY5A 1EVYA 4HLQB 2CZGA 4PLCA 3JSXA 5HQTA 1NF9A 3AESB 1PTKA 1PJ3A 2ABWA 2B4KA 4W9NA 5AM0A 2Q4DA 1X1DA 1GV0A 1M83A 2QUIA 4MJ7A 3ZD9A 4HNGA 3YASA 1B7GO 3JQAA 1NBWB 4LE2A 4LDQA 2XUHA 4J0EA 3W5AA 2C4HA 3R3HA 4UNRA 1HI9A 3TPZA 1T6XA 4XUDA 4UUMA 2Z30A 4KUGA 3LRTA 5EPEA 3OPYI 4LV8B 3NV7A 4JT2A 3P0FA 5F9HA 1YIDA 1U7UA 5IS2A 3GUYA 3AFIA 5HUQA 1FFDA 2XVMA 5KVVA 3RIGA 2OP1A 3LK6A 3UW1A 2BFAA 2ZI7A 4FXOA 4HN9A 1E7QA 5M3BA 5UKDA 5JATA 5IDVA 1BVRA 3H4IA 3A31A 1E92A 4Q9IA 1E3LA 2CJXA 3AT1A 3IULA 2WF5A 3SC2B 4J0DA 1H3EA 1TEXA 1QFJA 1W29A 4BLSA 1LDNA 1Y3AA 2FJPA 2K7ZA 5L9AA 2D6FA 1J2UA 2ONCA 4BRUA 3B70A 4LNUB 4M60A 4QBFA 2ZR9A 1PZHA 2Y6UA 2WKSA 3HCWA 1Q12A 2OV6A 5I9NA 2Q7XA 4G9BA 4W63A 5LUBA 5JSZA 4N6GA 5FT9A 4E2FA 4U2KA 1R6VA 2XLBA 3KXKA 3WQSB 3DZHA 4J2OA 2R6R1 4PFSA 4E4YA 4XDZA 2J07A 3RHSA 3ESXA 3T4XA 4IZOA 1H2YA 2UYHA 1C4XA 1H6CA 1Q6YA 1MB0A 2D4HA 2G3YA 2IE0A 3HYRA 3WICA 5IBQA 5EFOA 3KP1A 4AZ3A 4HI0E 1P5ZB 1ZOLA 4NX2A 3WWZA 2VT3A 4Z4IA 4OQDA 2H7VA 2XYQA 3H18A 5JXIA 3F97A 2JGRA 2POQX 3GIWA 4ZVRA 2P2YA 1WXHA 3ITEA 1MJGM 4Z1MD 2FCAA 3B9BA 3BCUA 2BZ0A 3T6KA 3ZLBA 4IIXA 3RUAA 3ZIUA 1MX5A 1JIUA 1J42A 1FYVA 1KSJA 2R62A 2R6HA 2ZBDA 2G4LA 4EARA 4QQRA 5AM3A 1OH5A 2GK4A 3PDUA 4IJQA 3SSOA 1GTL1 1L8OA 2ZJ4A 3KJEA 1J70A 4BGIA 3DE0X 5E6SA 4Z4HA 3R9WA 2PMCA 3JU3A 4Z7JA 7REQB 1UIRA 1SCIA 3FZNA 4GQIA 2O07A 1VLQA 4Y2SA 5IF3A 3R3UA 4LFAB 5E4FA 4BX2A 2D3TA 4QM6A 4N6OA 3BD8A 1BWSA 4O4IF 4I2NA 1BWQA 4DLUA 1IHOA 4WSOA 5DNUA 2WJGA 5HX7A 2MINA 4QPJC 5DASA 2A58A 3R3XA 3O0DA 1TRHA 4PM4A 3WHKA 3P94A 4GX2A 4PE5B 2Y9MB 4DJJA 3BD7A 1U0NA 1UWLA 1JNYA 2H57A 2CCGA 3NANA 4J9UE 5DNYB 3T3OA 1AKYA 2PO5A 4FOOA 4OM8A 1UBFA 3K1AB 5J58A 5CK4A 1S2NA 3H11A 4QQKA 4YUAA 3BHJA 3PDWA 5A5EA 2EWVA 4WBSA 2QRZA 2EIXA 3L7MA 4RAQA 3VUEA 4B2IA 3AEKB 4JENA 3RQSA 4BNFA 3WWDA 3JR7A 2I7DA 1W52X 2EVWX 2QHXA 3OQIB 5DB4A 4NCAA 1CZHA 1EWRA 2PMWB 3EZLA 2OXCA 1SHUX 2IYUA 5AKXA 3LKBA 2XT0A 2IWHA 1WY5A 2QAGA 2FZVA 1O97D 1XD9A 4N3NA 1UFQA 4RKYA 2DR2A 1F1BA 1P9WA 2ZBFA 1Y7LA 2CFTA 2X4DA 2ZBRA 4F4UA 4U02A 3QVKA 1U4NA 2JCSA 1H66A 2WC1A 3CZCA 3QLJA 4UDYX 4H35A 4R1UA 1Q22A 4DL9A 2FMHA 5TPZD 1H0HA 2BAGA 5DGTA 3PQEA 2M6RA 5C34B 2JJ1D 2J3JA 4H6PA 4B2LA 4ZI3A 5I45A 3QQ5A 3GEEA 4RE5A 4Z6KA 1CQJB 1BCSB 3FHCB 4PEVA 1YS7A 2A1UB 5BN5A 1D8AA 1EDZA 3EXG1 4FYPA 1U1EA 2AJLI 2JH8A 2FSVA 2JI4A 3ECAA 2O06A 4YRTA 4G01B 2DPXA 5E0OA 3R74A 2XSZA 4NCNA 2YY7A 3VU1A 2GPSA 5LQAA 4KXYA 3E1GA 4TYWA 4HDNB 3IAS1 2VPYA 5BSWA 2ZIFA 1F20A 4DW8A 3DT6A 1JZTA 3BRQA 4CKXA 1BU5A 3S55A 3ZY6A 4EPRA 3FWKA 5EE0A 4G0NA 1C1YA 1P7VA 2QE7A 3NTVA 1N1EA 1W2HA 4LWQA 1DJMA 1KZ1A 1TAHA 3CISA 4CYMA 2XUGA 3EODA 4BNIA 2ZREA 1R6UA 4ME6A 3OPXA 4RORA 3VMMA 1C8LA 1XEXA 3KYCA 3BERA 4XLTA 4Z0NA 2I3BA 2QAIA 1IL0A 1BYUA 4G84A 4YB8A 5LB4A 2HZ7A 4G5YA 4WDRA 3TZCA 3WKCA 1QP0A 5L4NA 4OFBA 4RTLA 3K9WA 2HK7A 2X9NA 5HP4A 1IIRA 2FHSA 1R6TA 3LS2A 1IY1A 1V3QE 2XNKA 3BXEA 4PAWA 4PFQA 4DBLC 1QGZA 1XXLA 3ZWBA 4AI6A 1HFKA 1I80A 2ZW9A 3O26A 3SPXA 1MJFA 4CLRA 5SZIA 5A4FS 4XIYA 2ASEA 3SQWA 1XMIA 4BDTA 4FYHA 2XF8A 3BYZA 1ZH6A 1DAGA 2PSDA 3FLBA 1BZYA 1Z16A 3LWNA 2Q9CA 1E2IA 1Z5UA 5TEWA 3T7DA 2G1PA 4KIJA 3DNMA 3VAZA 1LNQA 3DAYA 3NT2A 2Q8QA 1V5IA 2PV0A 2IUEA 4L4UA 1KI7A 2ISCA 3QITA 5JZSA 4U7WA 2PH5A 3NIWA 4E5MA 2VBCA 3TSYA 2IYVA 1G38A 5DPMA 1MQAA 4ZT5A 1H2ZA 4ZKEA 2F8LA 3OCWA 5BUSA 2YICA 4HNAA 4ZVLA 3F9RA 4JCOA 2X2FA 2H8KA 1LPMA 4LN1A 1AXGA 1M73E 3JQCA 5AKLA 4S0XA 4Y1GA 3GLIB 4J49A 4I9HA 1AGYA 1PR5A 3UB4A 2QLMA 4DCSA 4B6RA 4Z0HO 1O9HA 3UWDA 5DSZA 4MK4A 4JQOA 1PL0A 3A9RA 2WWIA 2W5UA 3G02A 1NLYA 4FS8A 1Y5MA 3PHLA 3GGJA 4IXNA 5G0VA 3SSMA 1LBSA 1VJ0A 2CXQA 2V7GA 4AWBA 1MB4A 1V5WA 4QC2A 5DGXA 5E6UB 1NT2A 1X80A 1N0VC 2PQ2A 3BULA 3UWOA 3ITDA 5I3CA 4IXMA 4CODB 4KO4S 1KYTA 2QTAA 3O9VA 3ECCA 1P0FA 2ID4A 3FCXA 3QQPA 1AA9A 1FE8A 2PD6A 2YWHA 1KOJA 4HPWA 4JQYA 4KK4A 2L0XA 3C3AA 5CIWA 1L4EA 3S3TA 5KOYA 1JL3A 4QTXA 1AM4D 3PXAA 2IHBA 2BFDA 4OOEA 1YKFA 5FJJA 4YMIA 1GITA 2NO0A 2GEVA 4KFSA 1C3XA 1EVLA 4LZLA 2VNAA 4N12A 2XUZA 1JHUA 3IO3A 1NXSA 3TN7A 1XCLA 3A8TA 3IEMA 1RABA 1WM1A 4QEDA 3AVXA 3C7KA 1MZVA 2YZMA 3DONA 4B3RB 2OUIA 2VSYA 1ZCFA 2XDQB 4R3NA 2O8DB 2QU8A 1VHTA 3H2JA 3OZGA 3UJDA 4CRWB 4F04A 4IS3A 4UW9A 4CCYB 1J24A 3WS7A 4OEHA 1SR8A 2WTMA 2OFOA 4FDMA 5DXJA 3KKNA 4X8HA 1X86B 3FFWA 4EHJA 1DINA 1NJSA 2JC3A 4FGSA 1FK8A 5JADA 1LB1B 1D4OA 2HF9A 2Z58A 2OO5A 3B5JA 3FVRA 4EGJA 1E1RD 2BPOA 1G7SA 4IDQA 1GFWA 1E60A 4N3BA 4GL4A 4QDJA 2FDCA 4L08A 2AMVA 2ZUUA 2IUUA 3UMCA 3LAWA 3G2PA 2WD8A 2P6PA 2JH9A 1LV7A 3I01M 5K20A 1A69A 1SUAA 2O2IA 2WPDA 2Z5LA 3M81A 4AN1A 1Q1GA 1CY0A 3PI7A 1EKXA 1KY4A 4C2AA 3VJLA 2AJDA 3IT0A 1EWKA 1MO3A 2WHPA 3A4NA 3PRYA 1I1OA 4KMOA 5L3QB 1P80A 3H8WA 3RWMB 5GONF 3ME5A 2FFQA 1E9AA 1W1IA 3PUWA 4PYOA 4HDRB 3TQQA 1U2GC 3BKXA 5TT1A 2FYTA 1ZSYA 3KUXA 4KPGA 1TEHA 4TRRA 1OLSB 3KV1A 4Q5IA 4AECA 4KOEC 4FPXA 3I92A 3E0XA 1IVYA 2DLNA 3OE7D 4UU0A 4C43A 4I4TB 1QGUA 2XCOA 1PT7A 4NPHA 2FZWA 3B51X 5EHGA 1HETA 3ANLA 2P9HA 1IAQA 3CBQA 4YDSA 2P4EA 4PLHA 4DOMA 2JFWA 4RHCA 1IN1A 3GGOA 1ZH4A 2ZLBA 3OJWA 1TQHA 4C0SA 5GJBA 2W6ID 4D4HA 5SYAA 2QK4A 4RH3A 4EP1A 4YRKA 1A9XA 2GSDA 2HZBA 1MP0A 3W4IA 4S05A 2X1LA 2HJGA 1VG1A 2ATEA 2NO5A 3ANTA 3DEAA 3CZ9A 5AJTA 2HLHA 1GN9A 3RC7A 3KTFA 5EQTA 4QYWA 1F7VA 5JH7B 1N5KA 1RKQA 1SC9A 2ZYRA 4BNJA 1J00A 2B8EA 5JNUA 4QNRA 1TVKB 4LRTB 4OSOA 1BW9B 1C8BA 1VGVA 4CTMA 3IA2A 4O3MA 4RK4A 4OK6A 4AP9A 1O94A 1ZNZA 3MTGA 3M5CA 4ZIRB 1VKZA 2EX1A 2QKYA 1JXAA 3O8OA 3P0HA 3DA8A 4GOND 3CW9A 3MYYA 4TS9A 4XQGA 521PA 5EKDA 3T5MA 1YFZA 4ZN6A 5CCBA 4IBOA 4RKRA 3EEFA 2JGNA 1VJRA 5CLLA 4N3CA 3FGZA 4ALJA 4UEWA 5K01A 4J0KA 2GXQA 3DZIA 2QL9A 4LF6B 4G5SA 1N0UA 5REQB 3ETJA 3PIIA 3RSFA 3AHIA 3CZ5A 4Q21A 3G5UA 5IW8A 2JLAA 2O0MA 4X97A 1KAEA 3WGLA 2IBSA 4KR6A 2WJAA 4OA8A 3MT8A 3WL5A 3BD9A 1Z0IA 3RSSA 2XOEA 2DTEA 3BICA 2CFCA 4LZNA 3ZHRA 3JYQA 2E87A 3UIEA 4WIAA 3UMGA 2G4VA 4G4IA 3VU3A 1QM5A 1Z8HA 4EEKA 4YMUA 4YV1A 5L53A 2VG8A 2ODAA 5KAPA 1ZKMA 4RE6A 1WB4A 4TWBA 2CVOA 3IXLA 2VJNA 2QLFA 5JO0A 1BFDA 1U0GA 3AG5A 4QU8A 4N54A 4EYSA 3FVQA 2H2AA 4YHBA 5LNK1 4W5OA 1V16B 4BTLA 4IH9A 4QRIA 5AM2A 1TVCA 1B3BA 1Z9BA 3DE5X 2VZ0A 1JZQA 3M1AA 1D9ZA 3WNQA 4C3ZA 5FLXA 2DBYA 1IOVA 3EPLA 4YAUA 3VZQA 4DA4A 4LF7B 1VCOA 5TJ9A 2XKBA 2YN4A 4NV0A 3PRHA 1JQ5A 1VGRA 2YH2A 5EJ6A 1BYIA 4K9LA 2H1OA 1E3TA 3SOPA 1JX6A 2IW1A 1Z75A 1ZVJA 4P83A 4UNNA 5AXCA 4QXAA 2J9FA 1K6MA 3FDFA 4R2HA 4R2WA 4RADA 4V02A 3PC8C 3VBCA 1R4MB 3EHEA 1MPXA 5HZHA 4XWYA 2O2XA 4D81A 3DAGA 4V24A 4KFTA 3I76A 1G20A 3JATB 1F8YA 4XUCA 1SEPA 2NV0A 4WD3A 2PMEA 3IS3A 1PL7A 3FMOB 1IJKA 4IHAA 4LWOA 3CVXA 1T9ZA 2QTLA 2VJMB 3DDZX 5HF8A 3F73A 1Q6ZA 1ADJA 4PIVA 5A2GA 2OV4A 5HUJA 3GUCA 3CVUA 4OLFA 5KWIA 5IKXA 3D8RA 3PEFA 2V7XA 1R0CA 4LBZA 1U7WA 2X7XA 2C98A 3RROA 3BUSA 5KTYA 4MUIA 2VJCA 1W46A 1G64A 4MTCA 4MV6A 1KBZA 2ZIAA 4N3AA 3W04A 1Z2PX 4YDQA 3WL7A 1X70A 4HGZA 3GPLA 3B6EA 2EIHA 2V5AA 5EE9A 1R66A 6Q21A 2J46A 3R40A 2IHVA 1S9HA 2G71A 2HV9A 4AQ7A 1GPWB 1C4WA 3VOTA 2FZGA 2YXEA 1H69A 3NNSA 3QYAA 4IQ8A 1SXJE 3NWOA 4MR7B 3N2LA 1FP4B 1ZAKA 1WBJB 4OM7A 3VPSA 4B17A 5IWCA 1NBHA 3TRDA 1J90A 4AK9A 1SOAA 3H05A 3OAAA 1G21B 3T1OA 4CEHB 4OQZA 1ANKA 4J6EA 1N2CA 1YRAA 3D2LA 4R8MA 4XD2A 5AW5A 3C5HA 1DIOB 3PXEA 3H1TA 1GPKA 4CHGA 4IZ6A 3MPOA 4B09A 3EWSA 4S1VA 4XB2A 5M29A 4IO0A 1QR6A 4GF5A 2RHOA 2SBTA 1G6KA 1UJ2A 2EGHA 2GVDC 2HSDA 3DOEA 3IE2A 2QT0A 2VNJA 3QIAA 1HE4A 3ORHA 3K0CA 2XMGA 2X6RA 3NYIA 2GAIA 3PDJA 4MRMA 1PX2A 1E66A 3D3KA 1BMFD 3TM4A 1ODCA 4B75A 2AF4C 3EN0A 4HDQB 3T0GA 3A4VA 2I0FA 5JD6A 5K6AA 5NULA 2VK2A 4WW0A 4YP6A 2Q07A 4OL0A 2GCGA 3B2EA 1AHNA 4OP3A 2FPOA 3WGQA 4ZJYA 5DCLA 1XVTA 3CRRA 1YS1X 4LE1A 1M0TA 4FD2A 1QMGA 1R27A 1NQAO 2GEJA 2R751 3PYLA 4PCAA 4QU5A 1WNFA 3V2GA 3Q15C 4Q1AA 1YULA 4OUDB 3O2QB 1Z6ZA 1ACJA 2RC5A 4DSOA 2O2ZA 1WD5A 1RE1A 1TZ2A 1VBMA 4FMBB 3CNOA 1C41A 2FR1A 2G63A 4MS1B 4RHTA 1QOPB 2C5GA 2BRUC 2C99A 1P6UA 2DFVA 3P20A 4P5DA 1JR6A 4XWKA 2XUPA 1ODTC 4CN9A 3ZU3A 2ZK7A 2ZXFA 4WESB 1JMVA 3ELYA 5TJHA 4UE2A 2V6GA 4MRNA 2O8BA 1IHXA 1JALA 2M98A 4ZO6A 2UDPA 1EFTA 4ATNA 1K9SA 1LRKA 1CDOA 2BEKA 2JK0A 2OAGA 1JDSA 3D3JA 4RVOA 3BGSA 5E38A 1DRJA 2Z95A 1W9MA 3AHCA 4ZWNA 2YBEA 4HN4B 2DFLA 3CPJB 4DQ0A 4WKOA 5DEOA 4P93A 3IUMA 2BHSA 4OB7A 2NU7B 3ZLUA 2JAXA 4F2WA 1CEEA 1NXOA 3MQ4A 4UAVA 3L8MA 4ZOCA 3ZXYA 1VIVA 1BHQ1 1RWQA 4Z4GA 2GRJA 1JR3D 1YOBA 2CYAA 4KXVA 4X92A 3ZZ1A 3HHPA 5AVWA 3OQVA 4GPIB 1OFVA 1PW5A 1LQUA 2VR1A 3EIXA 5DM0A 1ENPA 3JQAB 4RHYA 1HT0A 3NWPA 4AT1A 3ROGA 2PYZA 4MW0A 3OBBA 4PLWA 2HNBA 1NN1A 2CDAA 1U8TA 1DG9A 2EJTA 2PBZA 2RB4A 3D5QA 3E27A 4GKVA 4PQYA 3STWA 3TD9A 4J1TA 1JDUA 2A59A 3EISA 3KSZO 5HRCA 1A98A 3GOQA 3CE6A 1Z6PA 4NH0A 4O2BF 4LGCA 3X2FA 4D0LB 2O7VA 3O83A 1XV5A 1MRZA 4HN2A 3CRMA 4PCUA 3NEAA 2WNHA 2IV2X 5B4UA 5FQNA 2Z2ZA 4YFYA 1XWWA 1O9GA 4F85A 5K99A 4H60A 4P1ZA 5DGDA 4PWYA 1R4AA 4WL0A 4IXDA 4DLWA 5FRDA 4X64B 1RP7A 4MIOA 3SGLA 1HF3A 1KMMA 5B12A 1H2RS 3QY0A 1DX6A 3M6WA 4QQFA 5HIAA 4BYMA 4AICA 2X42A 3BILA 1NQ5A 3KC2A 1RM4A 4X1YB 4Q6BA 3C3WA 4V2IA 1KWGA 1EFUA 1G8FA 1IM2A 3COWA 3HV2A 2EP7A 4Y2XA 5ELMA 3WG9A 1FTGA 3FSEA 2XWPA 2A9FA 2AEEA 2FRDC 3B5IA 2G4CA 2ACWA 3HFGA 1FTQA 1QCCA 3IEPA 4XTRA 3BSSA 5FB3A 4BFCA 4BVBA 4CFYA 5GJWC 4POOA 1QDUA 1UQUA 1DCFA 5JC1A 3AC0A 2VPWA 3B1JA 1M1NB 4BVKA 4F7WA 5AQ1A 5EMNA 3DULA 2P77A 3KXLA 1NULA 4K26A 5EP4A 4ID9A 4WXMA 1ABEA 3E6AA 3SQLA 4U6SA 3ZLTA 5C4GB 2ZI3A 1HY3A 2GZDA 1C9DB 3NOOA 3SU8A 3B60A 2JGMA 4FE3A 4M89A 4BNGA 3H9EO 1KDTA 1PV2A 3M34A 3GNTA 4FS3A 1ZQ9A 3GDGA 3GLRA 4C20A 5FWYB 4H7JA 4DR1B 3GHYA 4GEGA 1LZKA 1R8SA 1BXZA 2B2CA 2ZRAA 2ZBQA 4R1OA 2PEYA 2GD6A 2XW6A 3GLQA 4P22A 4WCFC 4XVUA 3DZGA 3ETCA 4YRGA 3PJDA 3S99A 4YIKA 4DR4B 3T1HB 1X14A 2WJIA 2EHDA 1W59A 1FLAA 1XVLA 4QUDA 5E6SB 3ECSA 4BATA 1VE5A 4DM3A 5J3JA 1G8YA 2WMNB 1P9LA 4A9AA 1W7AA 1CRQA 2FG5A 2PFSA 1Q1AA 1V8BA 1YFLA 4EF5A 3BAFA 1YR7A 3SHVA 4GBMA 2RGNC 2MMCA 2MINB 1FSSA 2O0KA 4TQGA 4OLJA 2XTZA 4MLPA 3ETHA 3BK1A 1ADGA 2PKXA 3ZGLA 4I8DA 4FGJA 2YMLA 1K8QA 5JZBA 4LXHA 1U02A 2CLSA 1UBJS 4ENUA 1M0SA 4ZCIA 5DTMA 3WQQA 4NMHA 2H2IA 4WEQA 2RH4A 3AHGA 1YDHA 4BNYA 5EJ2A 2NVBA 2JLXA 2X1HA 3DHEA 4ZODA 2Z6AA 4MHTA 2W2NA 4DUGD 1Q1NA 5SYMA 2I66A 5CXUA 1M6HA 5K03A 2H59A 1JFFA 3AI2A 3GDHA 3H5TA 3IUSA 2J0EA 4QOIA 4Y9UA 5DLPA 2X14A 3T7RA 1W6UA 4D3DA 2PKEA 2I34A 3QP9A 2AQKA 5CRIA 5TRTA 1XCJA 4KPEC 2Y1LA 3HLYA 3W1WA 2E5LB 3LZ6A 3ZS9A 1ECLA 3NXKA 4LNHA 1UH5A 3UAVA 3BTVA 3ABQB 2JKZA 2X0IA 4RIEA 2FUCA 1XJQA 3WMEA 2QTVB 2W90A 3GLHB 9GPBA 4FR0A 5KX5F 5MF6A 3SZRA 5TLSA 1AMUA 2M9MA 1T5BA 1TM5E 3V2IA 4EW2A 2BGUA 1EDOA 3ASYA 1KJQA 4LXGA 1AZLA 1N5DA 1THMA 2D74A 1LNSA 2G09A 5A4DA 4K9KA 2ZI6A 3QPBA 4M0KA 1DC4A 4I4IA 1US8B 2BJHA 1UFKA 4M0MA 2NTNA 5INTA 4BXOA 5EXXA 4W5TA 2XUQA 2E5WA 2ENWA 1QF6A 2DWQA 5AYVA 3WNCA 1AHHA 1RCTE 2O7RA 3U4QA 3U60B 4QVIA 3E81A 4IQ4A 2XJ4A 1WQ3A 3TJRA 1BO6A 2HMUA 5CYGA 2ID9A 3RFCA 1XEXB 3ZE2B 1QYRA 4IDCA 4UM9D 1XMVA 1YI8A 1P77A 3WNBA 1PV4A 4FW9A 3GVHA 2HWYA 2QN3A 5DBOA 2R2AA 4HYQA 5J9FA 3UO8B 1JYEA 2G04A 1CS0B 2C8JA 5FV7A 2B69A 1BH6A 2JB9A 1YDGA 1KQ3A 1WAMA 2QTHA 4RQAA 4RY8A 1U2QA 1P72A 2AN3A 4PO8A 3BGDA 1UJMA 1A7KA 3PGVA 3CX8A 2BE9A 3TOCA 1PJQA 1QE5A 4TKUB 3PPWA 2QQEA 2X1MA 3FR7A 2GLTA 5F7XA 3IQZA 1DAPA 1P19A 1HDZA 4XJSA 5K0LA 3WSWA 1PL6A 3FA2A 4NIMA 1VMAA 2AFHB 3Q8XB 4MUEA 4URHA 2XB8A 4DLBA 4LCBA 1QLWA 1P39A 2W2LA 1ZUNA 2X5OA 4ZO7A 2Q28A 1UANA 1XRSB 3HO8A 2C4WA 4L15A 4L9AA 2VK1A 1HNNA 1PS9A 3MT7A 2P9CA 4MQFA 2QN8A 3IPYA 4G23A 2HIMA 4AYTA 2BC9A 3H13A 1AK2A 3T5DA 1QDLB 1DC7A 3GX1A 4KIFA 4KK3A 4LYJA 4NHOA 3STTA 2Z8XA 5FULA 1K6JA 3JYHA 1ADYA 2H9YA 3OEYA 4K8RB 3ZE8A 5KJ1A 4TYPA 4O4HA 2W2TA 5B1DA 1YB1A 3MCZA 1PWEA 4JB8A 3GLSA 4C0QC 4C01A 1OFHA 3R0VA 1A9OA 1D0IA 4EJ6A 5BMVA 1GVHA 3B3AA 1NVDA 2ZTSA 4OXKA 3CU5A 5KSWB 2XNJA 1Z0JA 3AL2A 3OX3A 1TJYA 5AIAA 1QAQA 2JKVA 3JYLA 3OM9A 1KP9A 3DPUA 2P9FA 4F3CA 1QS0B 4PF1A 4IWYA 2NX2A 3F0TA 4G4GA 1LSSA 1R0SA 4YVFA 1WXFA 4ZANA 3UT0A 4EKEA 2H18A 1L5YA 4WFKA 4UFOA 5I6DA 1X80B 1LW6E 5TE9A 5CFLA 3V4RA 1T4BA 3B6ZA 4AS3A 1PR1A 1APBA 1R50A 4JITA 4RF5A 4OQYA 1MKYA 3SEFA 4QAQA 3CE9A 1WKBA 1FW8A 4C0XA 2J7PA 2QJFA 3ER8A 4GPD1 3TAUA 2J0QA 3AZPA 5KHLB 3NWJA 2ZI4A 1K4KA 1OT3A 1PNTA 4LV6A 3G6KA 5G0TA 4CU5A 2QR5A 1PJRA 4K9QA 4X9XA 4HC4A 3RUDA 3UG6A 4F4JA 2WHEA 5AOBA 4B5LA 4YMLA 2DLCX 4GI5A 1WX1A 2P2SA 4E11A 2PEZA 3SHOA 5BR4A 1ZLYA 2CMGA 4JGIA 2Z3VA 2MIIA 2XUFA 4BMCA 4CR7A 3LDUA 3BX1A 4WHMA 1R8QA 1FZQA 3KPUA 1XR3A 3O91A 1HZZC 1NXVA 3SCZA 3KUDA 4URVR 1OBVA 2UYGA 3DXFA 1VBNA 4OHVA 1K6IA 3V8PA 4D43A 1G5PA 1RWKA 1U5CA 5GY7A 1U1DA 5ALDA 1VM6A 5LQKA 1E98A 3PR2B 1X9IA 1J99A 4YTEA 4PLFA 2ZIUB 1CYDA 2EJCA 4G36A 1JEYA 3LL7A 2QE6A 2F1OA 3LX4A 1ZA2A 5FAXA 3I9V1 3UA3A 1PI3A 2KLHA 3HKEA 5LP6F 4HVCA 5CGZA 3F90A 3K72B 3KG2A 3PDIB 5COQA 3PFFA 4TLLB 4XQ0A 3T9FA 2EDCA 4ENVA 1DHTA 3HUEA 4BMZA 3QHAA 1QGDA 5BNIA 4P32A 5KYWB 3GU3A 2QNIA 3FUTA 3TZQA 1WB9A 2QLLA 2WHPB 3I6YA 3IAFA 4N7MA 2IV7A 1OV4A 3V1LA 3GAAA 1VA5A 3EOBI 1U5AA 1I7LA 2X5JO 4N01A 4GRAA 1LX6A 2PX5A 4JOQA 1O03A 5CFQA 3EPKA 1OVGA 1GGKA 3UQZA 5I48A 4CM4B 3CIOA 1SCQA 1RTTA 1GDTA 4PS1A 3DBLB 1P2SA 1ZJYA 2FX3A 5TGZA 1CVLA 2AXEA 3P27A 3UAGA 5GINE 4CF3A 3K5WA 3CVYA 1RZUA 2ACEA 2BEJA 4KWIA 3COYA 1U7XA 4GI2A 4K6MA 4MRPA 5JNRA 1Q77A 3OIGA 1KO1A 3G9ZA 3ORRA 3OT1B 3Q85A 5F21A 2H1CA 2PT5A 4IMJB 5K3BA 3KEQA 1F9AA 2PJZA 4GM0A 4JOSA 3SS8A 1D9XA 4ZI2A 3CVWA 1Y1QA 2HSEA 1EIWA 4GBGA 2QSUA 3B1FA 5JJIA 4IR7A 4L5AA 1GG9A 3I2GA 3O1LA 4YYEA 4PPGA 5L40A 2K5UA 2LBPA 4UE6A 2IYLD 3SG0A 1ZIYA 2HO4A 3ZHCA 5L51A 4MVJF 1K5DA 5JYBA 1C7RA 4JT4A 4M1QA 5HJ2A 1CCWA 3PHBE 3FI9A 3SXPA 4Z9YA 1A71A 3SOZA 4URUR 4JI3B 2DFTA 3AWDA 3Q7RA 4DY6A 5JWOA 1ZGZA 2IU6A 2VZ9A 5FBQB 3HCPA