3KUKA

Trapping of an oxocarbenium ion intermediate in up crystals
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
293
structure length
290
Chain Sequence
DLVQLCNPHIAAMKEDILYHFSLSTSTHDFPAMFGDVKFVCVGGSPSRMKAFIKYVAMELGFAADYPNICEGTDRYAMFKVGPVLSVSHGMGVPSIAIMLHELIKLLYHAHCSGVTLIRIGTSGGIGLEPGSVVITRQAVDPCFKPEFEQIVLGKREVRNTDLDEQLVQELARCSAELGEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQDYLRAAYAAGIRNIEMEASVFAAMCNACGLRAAVVCVTLLNRLEGDQISSPHDVLAEYQQRPQRLVGQFIKKRLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycal formation in crystals of uridine phosphorylase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 96
structure length 290
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kukA00
1ODLA 4I2VA 1Z39A 1NW4A 2QDKA 2HWUA 4TXLA 3KVVA 3E0QA 3E9RA 4TXNA 3OZDA 3K8QA 3UAXA 4YJKA 1B8NA 1OTYA 3OZCA 1Y1RA 1TGVA 1A69A 1TD1A 1SJ9A 2H8GA 3NBQA 1JDUA 4TYMA 4P54A 1CB0A 1VHWA 5ETJA 1PW7A 3O6VA 1T8RA 4MARA 4L6IA 1YRYE 2XRFA 4BMXA 5IFKA 1Z37A 2GUWA 3ONVA 4EARA 2QTTA 4PR3A 4ECEA 3OOHA 4QEZA 5I3CA 4GLJA 4L0MA 3FNQA 4M3NA 1NC3A 4L5AA 4BN0A 3EMVA 3OOEA 3MB8A 1Q1GA 1LV8A 1TGYA 1U1EA 1OVGA 1PR1A 1QE5A 4L5YA 1N3IA 1Z38A 1U1CA 4D8VA 4MCIA 2PGAA 3O4VA 4H1TA 1K3FA 1PK9A 5CYGA 2I8AA 5F76A 1JYSA 1FXUA 4R2WA 4WKOA 3OCCA 2A0YA 2A8YA 4JWTA 2Q7OE 1U1GA 1K9SA 2ON6A 1JE1A 1PBNA 1RXCA 5KB3A 3ODGA 1A9QA 5F73A 3T94A 1Z34A 1RYZA 5CXQA 4OGLA 4YMLA 4E1VA 3NM4A 4LDNA 1Y1QA 3UT6A 1RFGE 4TXJA 3OPVA 4DARA 1Y1SA 1A9OA 4QARA 1XE3A 3OF3A 1JDVA 1RT9A 5CYFA 3GB9A 1V3QE 1U1FA 1Y6QA 1SD1A 3BL6A 3K8OE 5F7XA 4M7WA 4IP0A 1Z5PA 4D9HA 3FB1A 4TS3A 4F3CA 3LBAA 1OUMA 3FUCA 2IQ5A 1PK7A 4RJ2A 3DP9A 2HRDA 4LNAA 3C74A 4TS9A 3E9ZA 1A9SA 3NM5A 5CXSA 3TL6A 1G2OA 3KVYA 4JP5A 4BMZA 4G8JA 3ENZA 2BSXA 3BSFA 5F78A 1JDZA 3QPBA 3BGSA 4G41A 1I80A 3DJFA 4F2WA 1RCTE 3FWPA 3PNSA 1ODKA 1RXSA 5JPCA 4OEHA 4DA0A 4KN5A 1A9PA 2OECA 2HN9A 1C3XA 3IOMA 1JE0A 3DF9A 4QATA 1OV6A 4DA8A 1RXUA 2AI2A 4LZWA 2B94A 2OC4A 1PR5A 1JPVA 3KVRA 1Z33A 1T0UA 4F1WA 4OGKA 3EEIA 5F7OA 3KU4A 3D1VA 1OU4A 1ZL2A 3KUKA 3EUFA 3U40A 4WKNA 1LVUA 4YNBA 2QTGA 4WKBA 1RSZA 5FAKA 4D98A 5EPUA 1V4NA 2AI1A 3LGSA 1V41E 1ECPA 5DK6A 2AI3A 1LX7A 4TTJA 1ULBA 5B7QA 3GGSA 4TXMA 4DANA 1JP7A 5F7JA 3OZEA 1SQ6A 3UAWA 3BJEA 5EUBA 1JDSA 1VHJA 2QPLA 4NSNA 1ODIA 1V45E 1YBFA 1YQQA 4M1EA 1NC1A 5B7GA 2OC9A 1TCVA 4PNPA 1PF7E 2P4SA 4L5CA 1ULAA 1PWYE 3PNPA 4WKPA 3FOWA 2OXFA 4TTIA 4LKRA 3PHCA 4MCHA 1ZOSA 1YQUA 1A9TA 5B7NA 4X24A 1Y6RA 4G89A 4GLFA 5K1ZA 4QAQA 1CG6A 3UAYA 1PR0A 1VFNA 2I4TA 4GMHA 4F2PA 2HSWA 2RJ3A 1T8YA 4OF4A 3P0EA 1Y1TA 4TTAA 1M73E 1Z5OA 3KHSA 4NY1A 4R2XA 4DA7A 1SD2A 2ISCA 5B7PA 1PR2A 4OY3A 4DABA 1U1DA 4YO8A 1RR6A 3LA8A 5F77A 1Z35A 3IEXA 1RXYA 3UAZA 1VMKA 4EB8A 4NS1A 3DPSA 4K6OA 1YR3A 4TXHA 1V48A 3MMSA 4BMYA 2A0WA 1T8WA 1TCUA 1A9RA 5CCDA 3F8WA 4R31A 5IU6A 1K27A 1V2HE 4LNHA 3OZBA 3DDOA 4OJTA 2AC7A 1JDTA 1OTXA 1PR6A 1Z5NA 2QSUA 2A0XA 1B8OA 4F3KA 4D8YA 3EUEA 1Z36A 4QASA 4DAEA 4WKCA 4FFSA 4DAOA 1ODJA 1WTAA 5F7ZA 3P0FA 3SCZA 3INYA 4JOSA 1T8SA 4UC0A 5CCEA 5C80A 4QFBA 3UAVA 3PHBE 4U2KA 4DA6A 3FAZA 4GKAA 3NM6B 1PKEA 1PR4A 4D8XA 5EFOA
chains in the Genus database with same CATH superfamily
1FS5A 3PXDA 5YASA 5TPZA 4UUAA 4Q9DA 1CUBA 4FN4A 3GU3A 5DHRA 2VZ0A 3WNVA 3RGGA 4CDMA 1V11A 4KX3A 3HV2A 1R7RA 3DUFB 4G2TA 1PUJA 1L4HA 2IE0A 3LPLA 5KWSA 2WAOA 2GPWA 3WKDA 3R9XA 5MGBA 3DOUA 3E0QA 3T7JA 5DN6D 4TMTA 2XWSA 2I4LA 2JFWA 2OUKA 4JYAB 5C34B 2C2KA 2JI7A 4C0LA 3C85A 2JI8A 4W8HA 1ZIXA 2WV7A 4I5EA 5FOXA 2UUBB 1PD0A 1S8NA 5IX8A 4HI0E 1WB4A 4JBNA 1B8NA 1CTQA 2ZTMA 2QTBA 4OUDA 5B2EA 1W0CA 3AI2A 4H7IA 1QHYA 1YT5A 2PO5A 2HUPA 1IDOA 2V58A 2HWKA 2PIAA 3ILHA 3KTOA 1GPWB 4IH1A 3W5VA 2IPAB 3T7DA 2C8KA 3GLGA 3MS7A 1TD1A 4UZFA 2B8JA 4V0MA 1YNOA 4MS3B 2POCA 1USUA 4FFMA 5BV8A 2RGCA 3WKCA 3R3VA 1CJBA 1JA9A 4P80A 2JCXA 1XA3A 2ZB3A 1A27A 2CDCA 2WYVA 2WT8A 4BMSA 5JY6A 1J2TA 1RXWA 3QZUA 4DMFA 2AN1A 2C9ZA 1YR9A 4YMUA 1WLSA 1ZIOA 3GF4A 4I4IA 3COSA 2OD2A 3R3HA 4K9LA 3IJ5A 4ND3A 3W3AA 1GRVA 2I71A 3W6PA 2FJ0A 1SIWA 3GVPA 3WIDA 1PW7A 2QD4A 3A2LA 3U5TA 2XQJA 5ANRB 1M7GA 3CXUA 1E3QA 3FGPA 3L6EA 2DKNA 3NGMA 1W36D 2GAJA 1TVKB 1T0HB 3OQVA 3EGEA 4BNUA 2YHIB 3H16A 2O1WA 3BFJA 2J3KA 3NNDA 1MHPA 2IDKA 3KXPA 4IGFA 4NYJQ 4BEVA 2B25A 2YWDA 3RV3A 3GFRA 3QPCA 4D4IA 3CINA 4H3KB 3UQYS 2X7JA 4MUFA 4ERXA 4RK6A 4HQNA 1ISPA 1SXGA 1QR2A 4NYIQ 3NUZA 1PK8A 3KSUA 3ZWWA 1NURA 4GLJA 4UEWA 2NU8A 3KB1A 4H18A 3TXYA 1OZHA 1JDNA 2J5BA 3U26A 5FFMA 3D6UA 4CN9A 2VF5X 1NQVA 1FVOA 4JVMA 4QQKA 3HKDB 1DKOA 1SB8A 1DOAA 3PD0A 2BR4A 3B6KA 1P9NA 1IK6A 3AHEA 3DTVB 3Q7SA 4O2BF 3ZY3A 1EX9A 3ESBA 1US8A 1XQXA 4R2HA 1I5OA 5EQFA 5FI3A 1IHUA 3R0VA 3GD7A 4EFMA 1VGRA 3KXLA 1XYGA 5A3VA 3ROFA 1H85A 2CKMA 4B80A 2JC3A 4ML3A 3X1ZA 4BGEA 1IATA 5TQ0A 1U7PA 4AQDA 1ULSA 1VCIA 3IOYA 2PA0A 2C0CA 5KYXA 2B98A 2H52A 2WTUA 4BKUA 3N8IA 1TFRA 1L5FA 4N5LA 3TW8B 1ZQ9A 3DGEC 5TT1A 1IM5A 2YQ5A 3D8NA 4IHQA 1XQWA 3VPSA 5KTMA 4LJ8A 2HYIC 2J5KA 2EBFX 4XIGS 1NIJA 1O95C 1T9CA 1ZJZA 3HCFA 1NULA 4LIPD 4MVJP 4ZRNA 5A2QA 1LTHR 1NNI1 2JHPA 1UJMA 4QWWA 1E63A 4TWZA 4WKOA 4YV2A 1G59A 1GGNA 3FGOA 1EDOA 1N2CE 2PZ8A 3LT2A 3VPHA 5SY9A 3AFMA 1Z0AA 3M4JA 5EE3A 2N46A 1K8RA 4EI7A 2C3OA 1PZGA 1QVRA 1T2UA 2LRHA 2AMJA 2WM2A 1SVIA 3QKRB 4Q3BA 3HBNA 3IR5A 4I8XA 4TYYA 1Z17A 2R00A 2O2YA 4NPHA 4WX2B 2ZTLA 3OCZA 3VR5D 4CWAA 4LV6A 4O4HB 4OBBA 3ZBTA 3QSYA 1TM4E 2A9VA 2LZ0A 4MUMA 4OHBA 2AJ8A 1UXOA 3I09A 3L4BA 3OP4A 1KJNA 4IAOA 1I7PA 1QRRA 3U0BA 1G0OA 7ABPA 1U9IA 3Q8LA 4KJZA 5DSTA 2JGDA 3TEJA 3H0EA 3P2KA 5TGTA 2P91A 3ZHBA 5I9IA 1RPNA 3N58A 4K0KB 3HN7A 1E2UA 3G2MA 2GM9A 2NZ2A 5A04A 4DDHA 3PWSA 2PH7A 4N03A 3U9SA 1CS0B 3L5OA 4Q7QA 4QOHA 1P4HA 1SMKA 4B6QA 3OECA 1TYBE 2PDAA 2EX1A 4EYKA 5F33A 1B3RA 2HQRA 3RKUA 5DXAA 4IOMA 1J0CA 1IXKA 2A9FA 2WTNA 3SG0A 3TMKA 3ESRA 1FFXA 5CB8A 2RHRA 1JDVA 3MTIA 3ITEA 1TRKA 4FQ8A 4QO7A 2ZQYA 3QYAA 4RPJA 2PUBA 4AF7A 1SPXA 1U1FA 1ZK4A 1TMGE 1QO7A 1JXOA 1MC5A 4R1OA 5L4NA 3MWKA 4AS3A 2R11A 1TVKA 1HTTA 4CLOB 1TKBA 3C7TA 5JYDA 4O2BA 4R5MA 1NX6A 2Q5OA 4JYBA 4LHEA 2P9CA 4W82A 4XB2A 4V0NA 4AS2A 1C5KA 3FB1A 5CK5A 4A8TA 3A31A 1IN8A 4AMVA 3O8RA 2IS4A 1S4MA 4DEXA 4CTOA 5HE9A 2G1UA 4NKRA 3KZ1E 4EF6A 1RI4A 4R7GA 2WABA 2CKDA 3W5IA 2HR1A 1K6JA 2X8JA 1N2XA 3FCOA 4MUIA 2B69A 2XNSA 4HVTA 2WJJA 2YICA 3WZLA 3IXQA 1XP5A 2X6RA 4GSYA 4JUIA 2Y27A 1HNWB 1YE3A 5MHTA 5CFLA 3STXA 3R5TA 1YQTA 2QQGA 2AN5A 2VT7A 3O91A 2GFIA 4HWRA 4M0DA 2BGWA 1UPCA 4YRKA 4C5AA 3I2IA 4CEHA 4DDUA 4XSVA 3AZPA 1FA9A 3V4FA 3TIFA 1F2TA 2CL0X 4LHVA 2D1FA 2CFCA 2JARA 3H8SA 3JARB 3TZQA 1POXA 2F2TA 1Z74A 1TT5B 3OLZA 1QQBA 1E2KA 4PX2A 4YLYA 2PGDA 2NVUA 3FPJA 2OQ2A 4M9XA 1HG0A 2XB8A 1I80A 2A84A 3M83A 4X1OA 4RZIA 2JI4A 2CE7A 1QH1B 3KZMA 1KJZA 3BX1A 3DTNA 2GRAA 3DMDA 1JB1A 3RVMA 221PA 1U2DA 2P30A 4H3VA 2B92A 4FC7A 1U2ZA 1DHTA 3AU9A 3P97A 4OLJA 3VAAA 4XEUA 4OJMX 1MX1A 2C95A 2G76A 3DLTA 5LU8A 4JLDA 3VZDA 3PDWA 1Z25A 1IPEA 1C3XA 1GQOA 3FCEA 3G2KA 3D7MA 3DF9A 1VCHA 2WG1A 4KWHA 4QATA 4XLLA 3L7BA 4E11A 1XA4A 2I7VA 3KL2A 1KOGA 4EYOA 5CDHA 4J3NA 3V97A 1Q0TA 4RDCA 4US1R 5H0IA 2OC4A 4IFIA 1WU8A 2NX2A 3PJFA 3UK6A 3MRXA 2A5FA 4PWZA 3W2TA 3RSSA 2O23A 1Z33A 1NJ6A 1CVRA 5F23A 3C14C 1SBHA 2QSYA 4CL8A 3UV3A 3DVAB 3GVIA 1N9GA 3EIXA 3KKZA 3Q6IA 4MVWA 4CRWB 4F97A 2FKNA 2OHOA 4J75A 3OM8A 1FY2A 4FEAA 4GUDA 3V8MA 5F7OA 1F17A 2H18A 4O2AF 2HLNA 3GJYA 3AFGA 4JR0A 2NNLD 1FDIA 1ZO8A 1WCV1 3CZ5A 3OQNA 3AR9A 4UHJA 2V1XA 3EXAA 1SC9A 4HFNA 1TZ2A 2J07A 1R3DA 2DVMA 4PTYA 3USCS 2SECE 5LOVF 4O4IF 5EJ9A 1AGNA 2HK8A 4Q05A 4FZRA 1SG6A 2L0XA 5CLQA 3SC3A 5M04A 3V4RA 4M9SA 5AH0A 5HKKD 2AH5A 1YH3A 1YL6A 5JJKA 4GMXA 1OXVA 4HS4A 4PBSA 4NPAA 3PUWA 2Q9UA 2BW0A 1D4AA 3TLKA 3KSBC 4B74A 3DDWA 2AXPA 3PDJA 1D2NA 3AB8A 4MUGA 4II3A 1UBRS 3PUHA 1M1XB 2GPBA 1JQKA 4GEKA 5J58A 5K0TA 1QAQA 6AT1A 3KR2A 3C7CB 1ONBA 3NP7A 4GPZA 4L5IA 4TXMA 4WACA 5KYUB 4TV8B 1GSHA 2I3GA 2OR3A 4CL0A 5K09A 3QITA 3K0FB 3IILA 1TFUA 1M0WA 3BAFA 2ZJ4A 5C4IA 4FYYA 1N57A 4N48A 1CUYA 4FKBA 2YJ3A 4G1UC 2AFHB 2YZMA 4JQSA 1D4FA 1G291 3BRSA 5E8JA 3ZYCA 3PD1A 1JHVA 4ZHQF 3WLIA 1CNEA 2ISQA 2GK3A 1R8JA 1ITZA 1XTRA 2AFRA 3O2JA 5AM5A 4QVGA 5SZHB 2CK3D 5TEWA 2MSWA 4BXOA 2FR0A 1QO0A 4FYMA 4PO9A 3BWCA 2B78A 3JRXA 2VWHA 4P3NA 4HNVA 3I2JA 3CPJB 4M1EA 4C1BA 3GP5A 2ZZMA 4NCKA 5FWYA 1ORIA 3CCCA 1F2UA 4EB6A 1SQ0A 3PUYA 1Z8DA 2C57A 3FROA 5CH8A 3I83A 3R41A 1EGMB 2A58A 3VI4B 1JA1A 2IXAA 1LJ8A 2WPNA 3PNPA 4IQ0A 4RESA 2FWPA 5J2TA 1NV9A 2AJLI 3R3SA 4FZVA 2VP3A 1CJMA 5AXAA 5B4UA 1YRAA 4YV7A 4ARBA 5BSVA 5I4IA 3WHIA 1US8B 2IYNA 3NIWA 3R6DA 2RH5A 5AHKA 1VCOA 3H8WA 1MFZA 3AHCA 1WZNA 3JWHA 2Z2XA 5D84A 8ADHA 1Z4MA 3IR6A 3DR3A 4H15A 5ALMA 2HA2A 1QIGA 1GITA 2X0FA 1Y6RA 4Y18A 4F4JA 4W9MC 3TPZA 2FF5A 3N2LA 2SKEA 4RACA 1KVRA 3VH3A 3ELBA 2VF4X 3LL4A 3TINA 4JFRA 3K8ZA 5I7RA 2EBUA 1TJ4A 4JK3A 3V2UA 3PGA1 1E9DA 1JQEA 2GZAA 3V33A 3SS8A 2ZTSA 4Z3KA 4BXOB 1E4VA 4D2IA 1LS6A 3BD7A 4Q1FA 5FULA 4CHGA 5CA0F 3P52A 1ZA2A 2ZR7A 4HB2A 4B5LA 1Y1TA 3HO8A 3OIVA 2GVDC 4DG5A 4AF8A 1T5HX 2Z4RA 1E7MA 3CU5A 1NUUA 1OFVA 2IOQA 1OC4A 1P17A 1UFKA 3E5HA 3BS4A 2WUEA 3MTGA 1B6TA 1MVNA 2HSJA 4H7JA 3UOGA 4DR6B 4RUKA 1AKVA 3ZZTA 5AVRA 3WMGA 1T5LA 2YN0A 2ZXEA 4MUEA 2VHYA 1L5NA 1N9KA 4JZYA 3M6IA 4UBIA 5AVUA 4DJAA 5KKAA 5B7PA 3WRWA 4NH0A 2BE9A 3EXEA 4L15A 4EDHA 5J43A 3F49S 4NS4A 5I6DA 1NVAA 2PL1A 1LBIA 4PQFA 4L22A 3EGCA 3GA0A 3G3EA 4FK8A 2C4KA 3N0RA 4H4EA 4PANA 2BFEA 3PPXA 3WGZA 1M2GA 1KQFA 3NVAA 2ZWOA 2JCGA 3ZW7A 5JNRA 1RR6A 2O8EB 3LKVA 4NV0A 4IDGA 4ZOLB 2WWVD 3L79A 1X2EA 3L7NA 2XT6A 1YQXA 3KS9A 5KQRA 1EG7A 3VOAA 3S27A 1R3UA 1XZJA 5LVAA 3CN7A 1AIPA 4KL8S 2BMVA 4TZ0A 1EWQA 1FP4B 3RYIB 1QQAA 5CT8A 1SUAA 4POOA 1G7TA 1FP2A 2Y9MB 1DXQA 1RC1A 1W49A 3A4LA 4YJDA 4DXHA 3GWZA 1Z45A 3LO5A 3OQIA 2VTBA 2ZRQA 5CCDA 1EFLA 2R1VB 1DARA 1WWKA 3L0BA 4JC8A 3EISA 4KQIA 1XYVA 3B2QA 3KM0A 3RIXA 3AT1A 2F8MA 3ONFA 4BVFA 3PJRA 5H02A 1J5EB 3A1CA 4Y2HA 4HAWA 3L7JA 4JSRA 4R05A 1LPNA 1O8CA 1QRUA 1M67A 1Y3IA 1SBQA 4FP9A 1Z8HA 2FX3A 2OL4A 3M6FA 3ODPA 5HCIA 5JMPA 2VQFB 2I6SA 4PCUA 3W7AA 1W34A 1G21E 4GR9A 4BZWA 2BJWA 2PJZA 3CH4B 4FBMA 1AQ6A 4MQEA 2X5KO 4G23A 5JDCC 1B8OA 1Y8QA 4RK7A 5IC6A 3HJGA 3O83A 3S8MA 1R0RE 2DTXA 2R8OA 4YUVA 2F55A 4D8YA 3S7TA 1U0GA 1I7QB 1FFBA 2PHZA 2P9YA 3HR4A 4S1VA 2Y66A 1RYYA 4L75A 3BN3A 4OLBA 2FPPA 3L7IA 1YQGA 2DQKA 4BCDA 4J16C 2UYCA 3F6CA 3KX2A 3TLGA 2I03A 2P5UA 5TGDA 5HQ3B 2QWXA 2R87A 2FMHA 1IUKA 1CDEA 1VKNA 4K9RA 4U8GA 3TXXA 3W06A 1RTTA 3JZAA 3VR3D 3EXFA 1OFTA 3WL8A 4UAVA 4U1RA 4V39A 3RIGA 5TDHA 1AKRA 3QX3A 3RVNA 2IX9A 2C7VA 2J45A 2FRDC 2A1IA 2VYNA 1SWWA 1U0JA 4C78A 2CYAA 2CZGA 3LECA 2NIPA 4RMGA 5ICMA 1JWLA 4GM1A 1M8JA 4OFZA 3DVRX 4WD3A 5E7IA 4Q1DA 5EVJA 2H2DA 3G0IA 1Y9ZA 1XVLA 5G2OA 3GJ6A 3Q3IA 1Y3HA 4ZDWA 1Q6YA 5T41A 3SJCA 2QVLA 1U99A 2V4UA 5TJ9A 2O8BA 2O2EA 3ZX5A 1MORA 2ZYWX 1A8SA 1XLWA 4Y7CA 4RD3A 3OQHA 3WA6A 1IOLA 3TVTA 4L8GA 3ANNA 1XCMA 4N82A 4ALLA 1FW6A 5BSWA 4Q1VA 5KOJA 2CNWD 3I6QA 3IP9A 4I4LA 3RSHA 3MOGA 3EF0A 3S2SA 3OQBA 2H5LA 2TYSB 5JEDA 4JQZA 3V4LA 2EZ4A 2XOKD 1E2LA 4MH0R 2IHUA 2H7VA 3BG5A 1W85A 2FZ5A 1VIMA 2VUIB 1XO1A 4L27A 4UM7A 4EW3A 3L8HA 2AG5A 1N6IA 3ZOZA 1HRKA 3PUIA 5EA2A 1N6HA 1ZIYA 3LHKA 2BDTA 4AKEA 4Z7OB 3THWA 1AU9A 3KJIA 2BYTA 4FFBB 3OZCA 4A8JC 3ZGLA 3DLBA 3VC7A 2P4QA 4HWSA 5GGYA 4QOSA 2AOTA 3AUYA 3GRKA 3UJNA 4F6CA 3MT0A 1A88A 1L1FA 3NAGA 2NVUB 2QTCA 3LMKA 4I4NA 4J1SA 5E7MA 3SU8A 2DFTA 2XUPA 4MKIA 4BMVA 3HJBA 3PRJA 2G6TA 5EMKA 2HK6A 4C76A 5ICGA 2GBLC 1MJHA 2CB9A 2OZLA 4IDEA 5BSGA 3VKWA 3ZDEA 4GPAA 4P82A 5BRAA 4FGLA 3PGMA 1XTIA 4QEDA 4EGJA 3LHIA 3PI6A 2KBFA 1GKUB 4KPEC 1W8DA 3C43A 2JH9A 2ZE6A 2ZBEA 3HZRA 2FPOA 4MICA 2H3EA 4HH3C 1FBNA 3LVQE 1QH9A 4NEQA 4R2LA 4M76B 3AUTA 1V26A 2HK7A 1NHWA 1LUAA 4P7BA 5K99A 2XYVA 2D54A 5EE5B 1ZR4A 4QO8A 4PR3A 2QRKA 3GLSA 4ECEA 3A3YA 4PYJA 1JEYB 1IY1A 4YC7A 1F60A 5LA6A 2EGHA 5I3CA 2XECA 3M8KA 1E2IA 4EZIA 1KH2A 4L5JA 4WGFA 4FVTA 5JMTA 2FZKA 5LP6A 3FHCB 1YI8A 4JMPA 2ECKA 3KZCA 1UP4A 4O4JF 4ZAWA 3AF1A 3NHSA 4R68A 3DLAA 3LRXA 4GL4A 1IONA 4XASA 2GESA 2VP2A 5KX5B 1Q2XA 2W22A 3NRCA 3L46A 4WBNF 4MAFA 3RWOA 1E1DA 1O87A 3KQYA 1GVHA 1HBJA 2W6ID 1IK4A 1QGUA 2VFAA 3PL5A 3UHFA 1U0HC 3LTEA 3ML1A 3L02A 5EI5A 1YQDA 2REQB 2C07A 1N1EA 4Q7JB 1XTJA 2XE8A 3ZN2A 4IIEA 4AUKA 3CF2A 3MILA 3I1IA 2ONJA 4ESEA 2FN3A 2WJGA 3PDUA 1JWBB 1CUHA 1YU6A 3TTSA 2ZJ5A 3IODA 4BNLA 3A2KA 1VPLA 4TSKA 2AWOA 4PSUA 4UTRA 3EXHA 4CMEC 5JDIC 1MF7A 1G2PA 4QT4A 4JFAA 2BH9A 4GE0A 3R7NA 4OATA 2J33A 5A6SB 1VB5A 2C7BA 4IXWA 1HMYA 3ESYA 1JYSA 2VJQA 1FMJA 2JGAA 4JKYA 4KR9A 2PN1A 4ZAFA 2GEDA 4I46A 1MBZA 3O95A 3UCXA 3A1DA 4TT8A 2D7DA 3HCCA 2OD9A 2C92A 2R6GA 3Q10A 3SHQA 2JFXA 1EVJA 2Z2ZA 4FW8A 3QLUA 4YHBA 1Q77A 3AIOA 4JLWA 4XRRA 5KVSA 1ODTC 1L7MA 4GPEA 1KORA 2OWDA 1SA0A 3QA9A 1N2OA 1U2PA 3ZVMA 4BNZA 5KB3A 3D8HA 4BUCA 5F2KA 3LT0A 4E22A 3GHYA 2PUEA 4QU0A 5ILQA 1RADA 3ZWKA 4DMRA 4GRAA 4HX9A 4MR9B 3CH5A 2I76A 3GEEA 1Q0SA 3HZOA 3QKWA 2D2EA 4UE2A 1L5HB 2ONKA 4OMDA 1VLMA 3MMZA 4GOXA 5SYNA 2GBIA 4LBZA 2BEUB 5DN6A 1OBVA 2O8NA 1GU0A 3ZDYB 1QE3A 2EJUA 4CXMA 1Z63A 2RG7A 2HTEA 2OGSA 2IYTA 1WZEA 5HF5A 3SZOA 3PCXA 1KP2A 1Z0JA 2YJGA 2CK3A 1QBKC 2CVQA 1WQ4A 4DDVA 2QM7A 3O3OB 4RMIA 3ETEA 2DCMA 4J0QA 4J6FA 1HK7A 1Y1SA 4MWCA 2XT9A 3LLVA 2AG1A 4BCBA 3RYTC 5FWXA 5JYBA 3CNHA 2X1MA 3QPAA 2XUFA 4G0ZA 2D59A 4GX5A 2A0UA 3TD9A 4IEFB 2C5FA 4A0FA 3BGIA 4J7CA 1UQRA 2C7RA 1PKXA 3CFYA 3P9XA 4D9CA 3LCJA 4OKIA 5EC8A 1L5ZA 2RK3A 5L6LB 5F7XA 1R16A 3H9EO 1Z47A 2SKDA 4A8JB 1DEOA 4LJ7A 2ZIFA 5GJVC 5LP6F 1GCOA 1C4XA 1PZEA 1XCOA 2EFGA 1QVZA 1X1SA 2XA2A 3AINA 3BHMA 2JL1A 1OUMA 3AFIA 4RFVA 3AQ4A 3VOBA 1P8AA 2CD9A 2H08A 3DNMA 3GJQA 4OXIA 4MQUA 4MW9A 3QKTA 4TYQA 5LB4A 5IKOA 5U9CA 4NWIA 1P44A 3U62A 3UIEA 1CFZA 4ARUA 1UMCB 4U2GA 2QYTA 1DWOA 4M60A 1N2SA 1X87A 1PNRA 1RW4A 2XYHA 4CR7A 2QVYX 2Q46A 2G1AA 4RFSB 3FCUB 4HDAA 4KQ2A 2V8BA 2X0DA 3RARA 2AZDA 3NM5A 5CFRA 1ESCA 2O8CB 1XZDA 2YJ4A 4KE8A 4AZSA 1AK9A 3F46A 3IIKA 5FJJA 1UBOS 1EM6A 1FP1D 2YUTA 3D8RA 1LBTA 1NBEA 2BFFB 3STYA 5FWXB 2GN9A 1M83A 3OQJA 1E5QA 1SY7A 3ZNNA 3RYIA 2QZJA 5FFFA 3VOTA 2R1TB 4TQAA 4R3UC 4C88A 3WGIA 2EC5A 3R0IA 4P93A 4IWYA 4KE6A 3VNRA 1KI6A 1O89A 1RCTE 1J20A 1BKYA 1SOMA 4L0DA 4MWSA 5DGHA 4A2QA 2VTBB 4JYZA 1VIVA 2ZTUA 3PFBA 4C6HA 5FPKA 3PKZA 3RTDA 2OENG 4OEHA 2OFWA 1I0LA 4G63A 4XGKA 5K0CA 3DE2X 1YACA 3UGKA 3JRNA 1C14A 2ZYAA 3KPVA 2QG9A 5LXTF 4GKJB 2GETA 1MRNA 1SVMA 1U4NA 2J5QA 1W5BA 4MIYA 4N6OA 4A92A 1COWA 2FSVC 1TQDA 2PMCA 3RVQA 1E60A 3I58A 5LMCA 4BX9A 5ERGB 5JTTA 2H7CA 2IXFA 2IPOA 3L4EA 4JBWA 4DM3A 1KYYA 1OPRA 1SUPA 1GRNA 5L3ZA 2W6NA 1RKBA 4FXOA 5ESXA 4DC9A 4BB9A 4ZALA 4GLLA 4M9UA 2LDBA 3ROPA 1ZNYA 4PG5A 5DBGA 2YIJA 4IBOA 3G6KA 2GO1A 3PENA 4XIYA 1PSDA 1ZJ5A 1TTHA 1THMA 1RKQA 4PX5A 1LPSA 1I4TD 4B17A 1K5GA 4D41A 4QQRA 3N6RA 3OCXA 3KU4A 1GPAA 3HVKA 3G9XA 4TUYB 4J0HA 2NZWA 2FWJA 3NTXA 1NQXA 2J0EA 2ZRAA 3KD2A 2RH4A 4BQSA 4YRRA 2E6KA 3MMPA 5DHAA 1MEEA 4TL9A 4CKWB 2IHTA 3U40A 4B6SA 4DQLA 1UK6A 4N76A 1NR5A 3H99A 2Y2UA 4HWPA 5E4TA 1NYLA 4O4HF 2JJ1A 1W94A 1RLMA 4AK9A 3WWYA 1YV9A 2G83A 3QW2A 2E6UX 1YUNA 2H5EA 4YN3A 2X40A 1YFKA 1MVLA 3IT2A 4A2PA 3G2IA 4O5OA 5EJ6A 1U80A 3COZA 5L7TA 3LGSA 4ZZ2A 4G0WA 1RC8A 3DHWC 4C2BA 5A4AA 4LPKA 1O6GA 2GZHA 4N8SA 3IRUA 4R16A 5F1OA 5JC8A 4R2KA 5K5EA 1JF8A 4E4RA 4DSTA 4G5QA 1G0NA 1TNDA 3PK0A 3LUGA 1BH6A 2I2XB 2G3YA 2J3LA 4KIGA 1QFMA 1SUDA 3G9QA 4OXNA 4C4RA 3OZEA 5TX7A 2G77B 2LBPA 3BD6A 4EI8A 3RUPA 5CA0A 3F73A 1XPUA 1TIPA 1M8PA 3HI6A 4M54A 1IRXA 2ZDHA 3IQXA 4KWEA 4A5SA 1ORTA 5EUBA 2ZBDA 4PBRA 1C29B 3Q1LA 721PA 1M0EA 3GH1A 6PFKA 2EDCA 3U6KA 4PC1A 4Z4IA 3FA2A 1O4WA 5B1HA 1DCKA 1NF3A 1YS6A 1L7PA 2XSZD 1T6YA 1XRSB 2IEIA 2ZUWA 2NXJA 2F3RA 5IAJA 1I5RA 4YMWA 3VTKA 4HNTA 2CBGA 3R9IA 3HYRA 1IY9A 3CGGA 3HWWA 1R0YA 1ONOA 4Q9AA 1N3YA 1BS9A 1IQPA 1SIOA 1HTWA 3VYWA 4L4UA 4ZAZA 4FE7A 3AM4A 1QH1A 1LJLA 1HE2A 5GIPE 4NV3A 2FVYA 1R6BX 1QHFA 4UHCA 1G2IA 4IXMA 1TT5A 3N5CA 3PICA 4Q9JA 3SAJA 3BAZA 3ZCQA 4MCHA 3OICA 2P1ZA 4KXYA 3N8DA 1N0UA 4KXLA 4K40A 5COQA 4YHHB 5BMVA 5BUCA 1JIXA 4ZGWA 4MQ6A 5A5DA 3BSWA 2OP1A 4L8LA 3NBAA 3OOJA 2FETA 1GQQA 4GS5A 2W0MA 3ACCA 1SUSA 2G36A 4OBXA 3K09A 2YL2A 1PR0A 4M88A 1MO4A 4WL0A 1U8CB 1QZTA 5LDHA 1E4YA 5AKJA 2CLMB 1Z6AA 4GOMD 1EK0A 3HNRA 4HDCA 3NH9A 4Y6PA 1K7CA 3R0JA 1Q91A 3GRZA 2YY6A 4QJBA 4OHKA 4II2A 4WXRA 2O2GA 3PX3A 3CIFA 3V4ZA 1YZKA 1K9VF 1SUFA 3WNDA 5AQEA 2BKEA 5JJLA 3PFIA 4Q7LA 2O14A 5JD6A 4HK4A 1GAEO 4OLFA 3HK2A 4DCVA 3KAJA 4TUYA 1HNXB 4OL0A 3GFTA 3CLSC 4OY3A 3THRA 1NU6A 1SN7A 2B4YA 2EJTA 5HTOA 2C5HA 3UB4A 4ER5A 1JAHA 4UTZA 5AR1A 1AX9A 2IZ0A 2XGGA 3H9BA 4E14A 5ALVA 2RGBA 4HQOA 2PX8A 4NE9A 5JECA 4L3WA 4BE9A 3IP8A 4RSGA 3C5EA 1KS9A 2YNMC 2DQ4A 1Y48E 3T9BA 3FJOA 4L95C 1G8FA 3SFTA 1ABEA 2M2IA 4QTZA 3JY6A 5AK3A 1QF7A 3RUAA 4NK5A 1E3EA 3NBUA 4C6RA 4DE5A 1JHZA 3M4XA 4WMLA 1YR3A 3FRJA 4Y9TA 2XPCA 2IX3A 4ND2A 1KMIY 3IVGA 3IO3A 4YLEA 5BOSA 2DX7A 3S2YA 1DIBA 4BMYA 2JHCA 3SZGA 1AY0A 2F6RA 1VP9A 3C2QA 3DMHA 5JXHA 3LG2A 2WFZA 3WRXA 1A9RA 1XL0A 4Q3LA 4QZVA 3CEHA 3A1FA 1UAGA 2WSBA 2WWRA 5HQJA 3PIIA 4BNMA 4FD2A 3DAPA 4AKHA 2JLUA 3UMGA 3FSJX 1XQYA 2X8BA 1VE3A 2XWPA 2OUIA 1PL6A 3CSSA 1G9TA 1H2AS 2PRJA 5EVCA 4Q9IA 3RSCA 2G9ZA 2GPTA 3EN0A 1X7GA 4CKXA 3GXBA 3HO1A 4P4TA 5AJUA 3KALA 1BGWA 3TG2A 1ISGA 5BORA 4DMGA 1YS9A 4N5NA 3C24A 4ZQBA 3RUCA 1NVVR 1NXSA 3PC8C 4D56A 1I2DA 5ESWA 3ZUGA 2V7VA 4OM7A 4D45A 3A05A 1VI5A 3NAMA 2YZGA 1U3FA 1TD9A 2JIZA 3JVDA 4HXFB 4K1XA 5D1HA 2HLDD 1HRDA 3OEEA 4LF7B 5DLPA 4HP8A 5KTNA 3WY9A 2REOA 4WFJA 2YQ4A 1W581 4M9QA 4P34A 4X7BA 4CF4A 5C8VA 2EFEB 1RC0A 3OX3A 3X2SA 1AV6A 4MR9A 3F96A 4MP8A 4ALIA 2WJ3A 5JV5A 1YK0A 3EASA 2VHZA 2VTDA 3FOFC 1I4LD 3KWJA 1EB8A 4AIRA 1D9ZA 4D82A 3TG8A 3UMFA 4QLAA 4JOSA 2XRMA 1EK5A 3K2EA 2QZPA 1JFRA 3RANA 1P0IA 5T7BA 1TZCA 1Q7CA 1P1IA 1XHLA 4LXIA 5LLDA 1JAIA 2IYSA 4BO1A 4DA6A 4L4XA 1V3VA 2XF8A 4GSKA 1MT3A 3CB4A 1ZC3A 4YUXA 2NUBA 2PS1A 5EHGA 5GP1A 3RS0A 3I01M 4O0MA 1ZJ4A 1ZN7A 2OESA 1QO0D 3QM1A 4NIMA 3K0AB 5IKMA 2IXEA 4BB5A 3ZBPA 5ALPA 3HBAA 2HU2A 5JAIA 2X0JA 1LK5A 1TEHA 2C61A 3CR3C 4IDNA 4DBVO 4D0GA 5LNK1 3DFUA 2IT1A 4PO8A 1PJ2A 4I2VA 4OOEA 1GG2A 5F35A 1WR8A 1Z2OX 2XB9A 2XKBA 2YHAA 4OSOA 3PC4A 3OQOA 3TQIA 4XFJA 4EZBA 4WLFA 2VDVE 1UBFA 2GEJA 3HNPA 4JLKA 1IEVA 2GF9A 4BYGA 1GGHA 2X9NA 3A6PC 2GPSA 1P1CA 3ELUA 3WLLA 1I94B 4W5OA 4C22A 3HB1A 1WUTA 1ZITA 3OCYA 1XEXA 1N0IA 2IWHA 1NRXA 3OZDA 4H4DA 5EZYB 1QGUB 2WE7A 2WG0A 4H59A 4UU1A 5K3AA 1VL6A 5SYMA 4ZYZA 3J7AC 3WAKA 3LQ2A 3LUJA 4YIHA 5IZ4A 2AA3A 3ORHA 2OHHA 4GWGA 2HHJA 3EBPA 1WXWA 3DOOA 3PFNA 4RMNA 2IV7A 4CF6A 5CA0B 5DM4A 4DTCA 1DLIA 5CEEA 3QFCA 3AFOA 4FR0A 1VE1A 4GX0A 4IUDS 1P4GA 2WY2D 4CQLA 3DZCA 4I5IA 2YBEA 4NLLA 1IJBA 1FLDA 2XD9A 1F8FA 3DDZX 4QPPA 2XRZA 3QELA 3QK7A 3N0XA 3T5GA 2XT0A 4E5SA 4OYYA 1A98A 3NBQA 3ZXIA 3ZCTA 1PZNA 3DM9B 1PGOA 1I7LA 4RCYA 1H2WA 1CUVA 2Q28A 2GCNA 1A5SB 1ST3A 2BCEA 4NOLA 2F17A 4IILA 1BDBA 3KETA 2R62A 1KI3A 2YJTD 1D8TA 3MA0A 4JJKA 1QHHB 2P9HA 4BQPA 4DILA 1KO1A 5T5QA 4MARA 1TT7A 3NP9A 4XYMA 1CJUC 3MRSA 4DCCA 1ZLXA 5E38A 3A4VA 1F0YA 3JU3A 4EBFA 4LVCA 4C2AA 1OFGA 2CY0A 1C9KA 4OQEA 2WLSA 2O0KA 4TT3D 1GV1A 4OB7A 1RBZA 5DM0A 5FJIA 4J3FA 1LNSA 1KH1A 2YXDA 3HCPA 5BW8A 2ZT8A 1ZGGA 2OBXA 1ZK3A 4XUCA 4M9RA 3FWNA 1E64A 4IH9A 3X3HA 4NU0A 2B20A 3Q7EA 3HXLA 4M3NA 4WA8A 5F1YA 4C4TA 4W7IA 4L5AA 4ZI3A 4MPRA 4UUPA 3TZEA 3OJWA 1KU6A 3WIEA 1CNFA 5ILGA 2R4QA 3MHPA 3OTOB 1TMKA 1OI2A 4ES6A 2IZ1A 1D09A 4B75A 4AKGA 4MIOA 3W2GA 2PKYX 4RK5A 4Z1MA 3BERA 3P27A 4OXKA 5HIJA 3VPDA 1TUIA 1QRDA 5FUQA 1IXYA 4ARIA 1XXHA 2CXSA 1W0KD 4X1KB 5EWJA 1VTKA 2ZVDA 5H7XA 3GRPA 3NS7A 2VEOA 3E8MA 3G23A 4R71A 2J8ZA 3ANXA 3HFSA 1W35A 1ZS9A 3PKJA 3WJ7A 1JIJA 4BHTA 2Q1UA 4GYJA 2QVCA 4PZCA 5JOQA 1WXXA 4B3JA 4M89A 4ESHA 3ZLTA 2DR3A 1DWPA 3WTCA 5LKAA 3JRWA 5KNBA 5BMVB 4R9UC 4UBOA 2ASEA 2PKQP 2G9UA 5IF3A 1ETHA 3A1VA 4OHFA 4MV3A 2GEKA 4MP6A 4WGGA 2MCFA 4BNVA 1Q50A 4OP3A 4U2BA 1LTKA 2J3JA 4YP5A 3ZJYA 4TMYA 4ZTZB 3JQ9A 3L6BA 4KAAA 2CNBA 5D3MA 3MCVA 1NI3A 3IAUA 1JE1A 2CNNA 1UQUA 2D1SA 3JQ9C 4RPLA 3KQSA 4CG2A 5LKRA 3ZV6A 2W2VA 4IV0A 4L2IB 1DT3A 4EGFA 1G17A 4OPMA 4B46A 3GJTA 2M6LA 4A5OA 3TKLA 4ENQA 5MN5A 4U3JB 3SKXA 1I33A 2B7BA 1B43A 1GQYA 1JR3E 3D0OA 4X44A 3SD7A 4ZDIA 1C1DA 3A2MA 3LC1O 4E1VA 3NM4A 1CDOA 2BELA 4JUFA 4GNKA 3S2EA 2NQ2C 3VM6A 5KINB 1SBZA 1ENYA 2P6OA 1NNLA 4IMPA 5HGJA 2R751 2C1XA 2PT6A 5JR3A 4L9SA 4HNGA 1HZJA 1MQ8B 2W2OA 4IS2A 4A6EA 3DT9A 1JR4A 4DNOA 3RDPA 4BPBA 1ZCZA 1ZSNA 1GCGA 3B1YA 5JZVA 1CSEE 2O3TA 1RI3A 3QVTA 1L5MA 1FZQA 2CLFB 1UBJS 2WWFA 3HFJA 4L5BA 4UPDA 1OXXK 4ZYWA 1ODSA 3TR0A 4JH0A 1TM2A 1W73A 4N01A 1UMDB 4X0EA 1RM5A 2V3WA 4N7MA 4J4HA 4WRRA 4EEKA 2IU4A 2HMYB 3LIPA 2OO7A 2VH5R 1H1LA 3NIFB 3O82A 3P2OA 4LFBB 4N9QA 4BZQA 1JECA 1YRHA 1SVOA 1ZKDA 2C5BA 5CX1B 3RREA 5A5EA 1XAIA 3OD1A 1NT4A 2JJYA 4QGAA 5B57C 1T1SA 2WU4A 4EDFA 2UVPA 1F4VA 3GJSA 1WY7A 3FVQA 3U4GA 3WLPA 1P4AA 4F3CA 3DLCA 4PPQA 5TSDA 3CTPA 4Z86A 4BE7B 4MVYA 3NMUF 3OHPA 1OFHA 1IG0A 1G64A 3GCDA 3AEYA 2GM4A 5LQCA 2HBQA 3N8GA 4URZR 4DUGD 3B20A 1ZCFA 4S1OA 4QU5A 3FUTA 1GQSA 3GJ5A 4EY8A 2OLJA 4OA8A 4RPHA 3C74A 1J0EA 1KP9A 1VCNA 1OMOA 1GPJA 1W30A 3OO1A 5LYYA 5GY7A 4H7FA 4BMZA 3DAOA 4CQMD 2P65A 2WU3A 3OQ1A 1E3TA 4L0CA 5IJ9A 3KDPA 3L6OO 2WIGA 5CHYA 4RL4A 4PPGA 1EP3B 5ELLA 1PAUA 1SQSA 1XU9A 3GHHA 4MGKR 3RC8A 2XMCA 1YBVA 2ZU0C 3Q87B 2G80A 1HYQA 3NBFA 4UD6A 3FSGA 3OLXA 4TTPA 4YQEA 4D99A 2UXCB 4QUGA 5ECWA 1VJTA 4DGQA 1YB5A 2YN2A 1BN6A 1E7WA 4HNAA 2N1MA 3F8SA 4KLNA 2QZ9A 4KODA 3KAQA 4BP3A 3KOUA 5CW2A 4DF3A 1SU8A 5CTAA 2G28A 2ZPTX 2H9YA 1T10A 3IE0A 3L7YA 2C4TA 2GUGA 3EPRA 3BF8A 3U48A 3K1AB 3PTAA 1N92A 1RYHA 2O2DA 2OECA 4E33A 1UDWA 1EVLA 3FG9A 5EIHA 1GTL1 2Q2NA 1DKQA 4KX5A 5BN3A 2XKKA 3PJDA 4QBKA 1YOVA 3VSEA 3K0HA 4I1IA 1IQUA 5JNTA 3GRVA 3Q98A 4GBGA 1CW2B 1H4TA 3RAGA 5JAPA 3UPTA 3AESA 2UV8A 1HKHA 1PT9A 2CEAA 2HEGA 4LOIA 5DOVA 5JCOA 3DQPA 4E5MA 4QM6A 1I2ZA 3NU1A 4C7JA 3LRPA 3AR2A 5EE1A 2O0MA 1T6ZA 3JCZA 4AMYA 3N7TA 2N75A 4G6ZA 4CMCA 4ZV4A 1Z26A 1I1NA 1Z8NA 2VRNA 5IUJC 2DHCA 1TYCA 2VC2B 3ZE9A 1CEXA 1M8FA 4DCTA 4QYIB 2GBGA 2B34A 4LISA 2BEUA 4JLBA 3OJXA 5AK0A 5TNXA 3WV5A 4F9FA 4DJ5X 4H27A 4WW0A 5K4HA 4GKKB 4AJ2A 4BYMA 3O21A 5AMXA 3NO4A 3ADCA 3UB3A 1PT6A 3DV9A 4A4DA 1KRWA 4QDXA 4Y30A 2JBHA 3DO5A 3QFRA 1UBMS 4N3NA 2WP8J 2QXYA 3GXOA 3NCHA 4LC0A 4MRMB 3KUKA 3R6TA 4LRYA 4UU0A 4EQ6B 1F6DA 3QEBZ 1BDMA 1U9JA 1W2HA 3PFFA 4EL0A 4WKNA 4FNOA 4JBXA 3GCXA 3C97A 3VZSA 4UEKA 3CLHA 1L5YA 2XXAB 1UKZA 2L18A 2RHGB 4JROA 4QC2A 1GL9B 3NHWA 2MSCB 4FLMA 3UC9A 2FPRA 1ONPA 2PGNA 2VHEA 2XMBA 4YXWA 3TK1A 3ZHOA 2RI0A 3TKYA 3CJRA 5BWNA 4M1KA 1DJNA 1NQOA 3H75A 1ZUNA 2GYYA 3A4IA 3LCMA 1Z2EA 4OQYA 2W6JA 3H7AA 1XZIA 1YZQA 2CFIA 4L8YA 1PZHA 3LRTA 1JLKA 4MVJI 3I04M 4ZAXA 5FQOA 2DR2A 2DEUA 1ZN8A 2GARA 2H4JA 3T5BA 1Q3TA 2QTRA 3F5DA 3GBVA 3F5FA 1MO3A 3T3MB 4FGWA 3ZYZA 4DMCA 5KQPA 1AHHA 2TMKA 1XROA 5C1DA 3VVBA 2ZYVX 1U7WA 4PXSA 1I10A 3FFAA 3WDSA 2VA9A 2QRMA 3EEQA 4RK4A 4OFXA 5EP2A 1P2UA 3IQEA 2PD3A 4OI1A 2F1RA 5IBRA 2Q1WA 1DC4A 1VKHA 2CDAA 3IS3A 2PV7A 3UAWA 3FLMA 3KD3A 2PLRA 2Y99A 3UEOA 1L7EA 1TAHA 4N54A 5AVWA 2RHJA 1RE0A 1BG6A 3W2IA 2IS2A 3T7RA 2C77A 1UZMA 5E0KB 3QLJA 1MH9A 3SXUB 1EQAA 1IWPB 3DLPX 2Z57A 2PRIA 2ARKA 3AJRA 4BFVA 1Z6TA 1Z6QA 1ADGA 2FAXA 3IKVA 1R6VA 3NTQA 1OAOC 2JFNA 2CHFA 5AD1A 1TCVA 1T4CB 2B3TA 1NTOA 3EAFA 3I0MA 4UATA 4QM7A 3EQZA 3NEYA 3RJ9A 2H1SA 3V3KA 3P2MA 3A4YA 5FA5A 3UGJA 1OFUX 2XXJA 4W1QA 3CZQA 3ESAA 2R6HA 3MWDB 1SHUX 1W48A 2Z2JA 3NANA 1NM5C 1ULUA 1YHYA 5DLDA 5JRZA 4PZLA 1CHDA 3UICA 1W2GA 1SVLA 7MHTA 4H7HA 2F1KA 4BWFB 1VHLA 2V6JA 2B0JA 3BWXA 2QI9C 3GPDG 4IVNA 3PFWO 4OP1A 5IH3A 2WIFA 1HT3A 2Q3EA 3LCVB 3MUFA 3UT5A 5BT8A 1WB5A 5AKYA 3VKUA 2JW5A 3QUSA 2H1VA 1R66A 4M21A 1CS0A 4NDZA 3WO1A 2X5JO 4RTJA 4DYVA 3P19A 4F4CA 4IOKA 1GG8A 5JARA 3CRVA 2Z9BA 1JEYA 1NUTA 1V4VA 3BD8A 3GQBB 3KQTA 5EZ6B 1WF3A 1YOVB 1XJ5A 4B3CA 4BN5A 4ZHSA 4H16A 3SE7A 3SXUA 3OVMA 2C00A 2Z1MA 5BVGB 3ITKA 1S2GA 1Z4IA 3HU2A 3T38A 2C59A 4PW0A 4TKVA 5A02A 3ESXA 3ZCUA 4RH3A 1EJ6A 1SOWA 4INPA 4KOEC 3C3MA 2HCTA 1P62B 4MVJD 5CCBA 2WTMA 1FX0B 3BZBA 5A0FA 4FUQA 4ZOAA 3W3AH 2DBQA 2MINB 2ZIGA 2FRVA 2P78A 3DFIA 3LHSA 1FVFA 2GO7A 3PFHA 4GE3A 4IJMA 3VX3A 3A6DA 3U4MA 2EQ5A 4GVLA 2DH6A 4H0CA 4UVDA 2O8DB 5T6MA 1W96A 5FCDA 1Y3AA 5J9FA 3VC2A 3DB1A 3H8VA 1L8QA 2WJPA 2WPDA 3PWZA 2WF6A 5I7AA 4UBNA 4CEHB 4IVPA 1RZRD 1XNRB 1L5RA 2P5YA 3TD2A 1WZIA 2AG6A 5EHQA 2J85A 1BVHA 2BGIA 1A4RA 4MEBA 2O0HA 5IABA 3FCAA 4BQFA 4RY2A 4C89A 4G2NA 2BM8A 1K08A 3VR2A 3LA8A 2WSLA 1L7DA 5EPOA 4UHBA 1PYDA 1Z35A 2IK8A 2KMLA 4ND4A 2X9QA 4CEIA 1MENA 1M75A 2O9JA 4S12A 1CXZA 2JLVA 3LQQA 2BOVA 4UM8B 4BFXA 3QU4A 1MV8A 2H1LA 1G21B 1EZ4A 1YDGA 1NLMA 1OVMA 4C9BA 2XWJI 1TVCA 2Q0XA 1VHTA 3BIWA 3LH5A 4Q4JA 3CF4G 3EVNA 2QLFA 4JJGA 1HDEA 5IJXA 1P1HA 5IANA 1RAFA 3OLYA 4A36A 5KYVA 1CZRA 1WQ3A 4NE2A 1LGYA 1RRPA 4ZA2A 3ROTA 3CZ4A 1FYVA 3JAKB 1SZCA 4MW6A 3VPGA 1RS0A 2OEPA 2WI8A 4P3PA 5BWCA 1T35A 2H2WA 1SHLA 5DYNA 5JXGA 4DHWA 3RRYA 1G7CA 3EXEB 3A36A 4ETMA 3O5AA 3D4NA 4M9CA 3HH8A 5DHSA 5KSOA 1UJCA 1S3GA 3UW1A 4OQFA 2P9FA 4GPD1 1IJEA 1CX9B 3CX7A 1UFVA 2DLNA 1KC3A 4R40A 1EVYA 1IIBA 1V6CA 5C81A 1EVEA 4ZMRA 2IS6A 6YASA 1RZ3A 2B6NA 1KDYA 2BH2A 4BNTA 3EPHA 3AMVA 5DMXA 1IYZA 2OBFA 1RI1A 2PQ0A 1SXIA 1FYWA 4O08A 1Z62A 3MINB 4NARA 5CH5A 4FOOA 4X7PA 2YOHA 1COWD 5G0VA 2DHRA 4P33A 5CNIA 4U7DA 1YZGA 1J09A 1B1CA 2UKDA 3ND8A 1FC0A 3ZZNA 5KCZA 2FFJA 3I9LA 3VSAA 4UPEA 3ZK9A 4LJYA 1J9GA 4OK6A 4XQEA 5JJBA 3PR3A 1JHRA 2ZSFA 1NKTA 2EZ8A 3INYA 4N65A 4LDZA 1X7YB 1Y3FE 4OOFA 3IELA 1RACA 4QYIA 2FFHA 4MS3A 4C7BA 3FLAA 4U7WA 3E22A 1LQUA 1KVUA 1ATZA 1WMEA 3PHBE 4LYFA 4AUNA 2IEBA 4J4BA 4U2KA 4G1BA 1Z22A 4N7BA 1X1AA 3TNLA 3CN9A 3ETHA 2P0EA 1S1MA 4UE3S 3NM6B 2D7CA 1EUDA 2L82A 1SXQA 1PKEA 4BFWA 2V9PA 4QGBA 2JHFA 1KIFA 2JAUA 3Q8XB 1OWNA 4FOPA 4NFHA 1Z7BA 4ZVLA 3RIYA 4LECA 5A5VA 2ZBFA 5BYJA 3ZCSA 2EXXA 4ZVTA 2XDQA 1GL3A 1XCPA 2AIRA 5CG1A 1P5FA 1VB3A 2C8JA 4IUCS 4PXAA 1KK3A 1TVMA 2NVWA 4WJKB 2V54A 5ALXA 3HA2A 3UH0A 4US2R 2PIDA 3CUVA 4X41A 3IJEB 2FRDA 3EVDA 3L92A 4DBZA 4EKEA 1W5TA 4GT1A 4CZ2A 4ZCIA 4E5VA 2WG2A 2X42A 3PFGA 2O8FA 1CUSA 3B70A 2WILA 1DG3A 2ZI9A 1ZDMA 4WUVA 1MZVA 2YIDA 3TCXB 2YXEA 3Q7QA 2DPHA 3DW1X 4RKRA 3WAJA 1WY5A 5ENDA 2V03A 5G4LA 2GSWA 5I7UA 1KEWA 1PUIA 2I6FA 1X1BA 1A69A 2II6A 2YC2C 1YDMA 2A30A 3EVEA 3A9UA 3TI7A 3BB3A 3LPMA 2Y0PA 4JMLA 4KZPA 3W3ZB 4BQNA 5IT0A 3GFOA 1XRMA 4HWTA 2YS6A 1DX4A 1P4RA 1OT5A 1U3GA 1A7KA 4D26A 3G0GA 3IGFA 4CIYA 1LPBB 2UZAA 4I55A 2GCOA 2BC9A 4G3XA 4TYMA 2JGKA 1KKMA 2B8EA 1ARZA 1G20B 1KP3A 2I9PA 2MT9A 2VT6A 1SZPA 4F3NA 5TMEA 5CFZA 2XNJA 1L6RA 3DLIA 4AG3A 2RBKA 1RRGA 3QF4B 4AP9A 4OQNA 3UXHA 1EVKA 1IHDA 4A8JA 3V8NA 2VDNB 1QE0A 4TMZA 2HM7A 5IVKA 2ODPA 2WWTA 1AB6A 3KAPA 4RF3A 3X1MA 1Y8ZA 4UBKA 4FSXA 2RGGA 1B41A 3U4HA 4OMCA 1P29A 4EPVA 2KBEA 1GPNA 1W5FA 3GLRA 4FOTA 3OJFA 4PSVA 4M0MA 3B78A 3TFWA 4IIGA 1XFDA 1EWYA 3VR3A 1OWPA 1YDWA 1GZSA 4N7JA 2EQBA 2BI4A 1PL8A 4KFUA 2HRCA 3WGVA 3CT4A 1RAHA 1RHKA 1Z0UA 2IW3A 4ALKA 2PG3A 3OE7D 1U31A 3H0CA 1WZUA 5ADVA 3T06B 4UNNA 4ZVUA 1W47A 2IU3A 1GPH1 5AOBA 4JQCA 1KAEA 2FHSA 2IYVA 4C0XA 5C9ZA 4MI1A 2X0IA 2CDBA 5ES3A 1M2NA 5IBCA 5EYPB 3H4IA 1SBTA 1ZSVA 1DKPA 2RHMA 1VKOA 1EFPA 4TLMB 2DJ5A 2PJUA 5G1OA 4BMOB 1JEEA 3B7GA 1BA2A 4EX6A 2BI8A 2O8BB 4ZT3A 2Y1EA 2ZI3A 2VK1A 1Z08A 4BEJA 1ZMBA 3KJGA 3OPNA 5TF0A 5C4MA 2HDHA 5AI4A 2L17A 1QIFA 3ETNA 3D02A 3DBHB 1NRWA 2YFKA 2NXCA 1ESMA 1QAOA 1P45A 2HRQA 3QWHA 4WIAA 5DYTA 2FB9A 4XLTA 1Z4LA 4O2AA 5DJ5A 5J3JA 3EIEA 3L7OA 1XZ8A 1C50A 2YDXA 3LA6A 4UQLA 5LM3A 1BGVA 1SHKA 3HU5A 4NENA 5JFGA 4D9IA 3R3XA 5KHLB 4JGBA 1DG9A 4HSEA 1AKEA 2D5CA 2E49A 2NAPA 4KXVA 3CVYA 1L7XA 4WKGA 3G59A 1IZZA 2PL3A 2PA3A 4A26A 1QLHA 1XWFA 4ZI2A 1PVOA 4NMLA 1GZDA 4QUHA 3RVJA 4RJTA 1I51A 2H1FA 4TL6A 1MC8A 2ERCA 3JWJA 2PSDA 4F45A 5B2FA 3GARA 1TF7A 1MAWA 4UE6A 4W9NA 2ODNA 3N74A 3VR5H 3ZXXA 5E6RA 2UYYA 5MGNA 3MYYA 4OMUA 4YONB 3TRDA 1I3KA 1FS4A 3KB6A 1U8AA 2HDWA 3IJRA 2QN2A 3O4FA 2WZQA 2RONA 1U9CA 4BNKA 3FY4A 4EHJA 1KHHA 4JODA 4M1ZA 1C1YA 4O4IB 3RE1A 2V96A 3T15A 5C32A 1HEIA 1I5EA 4BVJA 1E3JA 1SKUA 1QTRA 2JVKA 4ZMSA 4FMDB 3GLFE 2R6R1 3HP1A 4E21A 4PTLA 1IWOA 3HDGA 2DHQA 2AJCA 2OMEA 2YFYA 3CBQA 3EF1A 4MR8A 1K2WA 1E94E 1OF1A 2X13A 1AOXA 4EW1A 3SYLA 5K6RA 1PN3A 1J1UA 2GKGA 2C58A 3AIKA 3I3OA 3TIIA 4HT3B 1YFLA 2ZRKA 1B14A 4PS1A 3PQ8A 4FEEA 5G53C 1DINA 4YAWA 3R7SA 1NVEA 1IXZA 4J03A 1JIUA 2PMBA 3GNSA 1YQEA 1T9GS 1V37A 1OLXA 4RD1A 3VUFA 1K7FB 1GO2A 3T4EA 3LVBA 3NTOA 2QLMA 3IUEA 3OF3A 3VR6A 4Q4LA 4R8MA 2HXGA 3VJLA 4MZXA 3K0CC 4NDAA 1PS0A 4JBHA 2VZEA 1E18A 4U63A 5DX1A 3T0GA 3ASVA 4UAJA 5JMOA 1BAPA 2JCYA 5TE9A 3P5SA 3GA5A 3T5TA 2GGSA 1PJ8A 3AR3A 4NTZA 4Q02A 4TV9F 4A10A 3GLHB 3QU5A 1C9DB 4IXTA 1FNNA 1YJBA 1C9YA 2CLEB 4FJ1A 2HU5A 1KXJA 4BFYA 1KZHA 4ABTA 4P4SB 2PUFA 4KKVA 4Z99A 4KLRA 1GTG1 2IHNA 4PBTA 2C42A 3HYLA 4QJIA 4HXYA 3TSAA 3V32A 3VNAA 1PV1A 3IQWA 3FDZA 3EDRA 3G2NA 2Q29A 3HWX1 4MWTA 5FRDA 3OKPA 1RYBA 1P3JA 2PEYA 2LCFA 3CIOA 3AERB 1K86A 3OD5A 4P2GA 2YVUA 4QDTA 4RXTA 4TS9A 1X39A 1KJWA 1P7VA 1J7JA 4ZKEA 5KNDH 2XDWA 2IRWA 2D5IA 4Q37A 5LPNA 3QBVA 2V6GA 5DX0A 1UK7A 3ZQJA 2GTIA 1Z4QA 2EW8A 2PKEA 5CNMA 3R74A 4E32A 4AZ3B 1G5RA 1I3MA 4WZZA 2C5GA 2Y68A 3MGAA 2VNSA 1X0XA 3FZEA 2W2XA 1Z4KA 1X13A 3PUJA 4JC4A 4ECAA 4EM6A 1M0TA 1JDZA 1OBCA 1E9EA 2Q8QA 5C1OA 4EFKA 2Q5LA 1A2KC 4G0OA 1FLAA 2ZI7A 4G41A 4J9UE 1RQ2A 1MW8X 3N76A 4J0DA 1ZAYA 2F64A 3HUDA 1ZVJA 1HF3A 1QCCA 2GCPA 2GD1O 2PXAA 1MA0A 3FBGA 3HZHA 3LW8A 1QV7A 4QYXA 4RHYA 4BNXA 5HUJA 2DBRA 1AS2A 3BDVA 4OXXA 5J2UA 5CD1A 3U37A 1GCUA 1CIVA 1JKJA 2BBSA 1YRWA 4Y7DA 4BVLA 1XEWX 2P9QA 3A6FA 4G0MA 1XDBA 3P0IA 4UNRA 2O1SA 2PCLA 3GLHE 4HAOA 3HBJA 3G2OA 1SVNA 3L8FA 4NBKA 1A9PA 3GAAA 3BMNA 2PRYA 1Y5IA 2H59A 2EG9A 1EKXA 4MO9A 3T7IA 4RULA 4DRZA 4B85A 1OFUA 4PF1A 3ECCA 2YY7A 1M2OA 2XW6A 2FYTA 3EEFA 2YWCA 1FUKA 1J6UA 5DT9A 3W9SA 4OLAA 4M4SA 5DN9A 1DXYA 4KXQA 1ZXBA 4GXTA 3QUAA 2W2QA 4TQ9A 3AVTA 2PANA 2JBAA 3K8YA 1GP2A 4I1SA 1JIKA 1OD6A 2IJGX 1L5GB 2JAXA 3E8SA 4RQAA 4R1TA 4R51A 5KWJA 2HF8A 4FSDA 5KTKA 1VKJA 4DXDA 2DF8A 3AUAA 2GCGA 3OUUA 3RODA 5JALA 1H2BA 5FO0A 3AJDA 4DV5B 3O84A 1IB0A 3NALA 1H6AA 3HCEA 4C3ZA 4PN3A 1ZL2A 1SUBA 5AVTA 1OGJA 2JRLA 2W9XA 3DAFA 1OW3B 1RJ9B 4J0GA 5HGXA 1JXQA 1BD4A 3NTRA 3QU2A 1C4WA 5CG2A 4RTKA 4N0PA 1BS1A 1PZMA 3FVWA 4LDRA 1THTA 4GZ3A 4ZEOA 3TW6A 2VLIA 1Q14A 2CVOA 3IAXA 3KV1A 4M1SA 5B1DA 4YV1A 1E9RA 1P19A 2V97A 3Q3VA 1PVDA 2WHXA 2C5SA 4AZVA 1I6MA 3PPVA 4PRKA 3PR1A 3WDMA 1O97D 1ECPA 2AD5A 1FB5A 1RWNA 2YHBA 3TRIA 5B7QA 2AN9A 1GARA 2AUTA 5CR9A 5FUXA 1MEOA 4L3OA 2PUCA 2EWVA 3BKXA 4QAJA 1E6CA 4DIKA 5KYGA 1IN6A 2VT3A 4LJLA 5EN4A 2WVHA 4CLOA 5KDDA 3PEFA 3TIVA 4EHIA 3OM1A 3BMCB 1AA6A 2WKWA 5GONB 1IPHA 1SQ6A 1W88A 3LY7A 4HFJA 1SXJB 3MLAA 4JJFA 1X74A 4MVJM 1C0LA 2V6BA 3VC1A 1E5DA 1ENZA 2VHQA 4TKZA 3X1KA 3M4YA 4DG8A 3DAHA 4YCMA 2OCGA 3VPXA 3VNUA 1Z6XA 1VHJA 1Y5MA 2HRZA 3G1WA 5IAKA 4M9ZA 3SLGA 4II7A 4M8NE 4MUKA 3TDKA 1SG0A 1ZAKA 4HDKA 4NFSA 3GLFA 4H9GA 4XRGA 2C8LA 4KNYA 3I32A 1SVWA 2HMSA 5DDIP 2IHZA 5AICA 4ENUA 2FR8A 3BCRA 3PFKA 2WTEA 5ALZA 3S7ZA 2B4TO 3URMA 3H18A 4ZOCA 4B3RB 1DCMA 4IQ4A 3I45A 2P4SA 1ND5A 3SR3A 1PLLA 2H2HA 2WMOB 4IQ8A 1MO5A 2JAOA 1WBBA 3RABA 4CQJA 1UKCA 5TMBA 1YO6A 3VDRA 3KZNA 3R7FA 1FUYB 1NVMB 2CV0A 2PAFA 1G6OA 1P1RA 1Z6GA 3PQ4A 1C0EA 5IDWA 5FQNA 4CT0A 3WSWA 3H11A 3HL0A 3G85A 1NP3A 1N2CA 5FTKA 3ZHRA 3HUFA 3LP6A 3PQ2A 4P5EA 4CU2A 5KAMA 4NCAA 3QNWA 4KFTA 1C7RA 4NNOA 3QLUC 1CG6A 2D1YA 2XVZA 2ZW9A 1E8DA 3OY2A 4JR2A 1R8QA 4LDPA 4C4PA 3NWJA 2F3TA 2ATCA 1Y6GA 3RSFA 1XZMA 4GMHA 1VJDA 3GRAA 4WASA 5BMOA 2CVZA 1R6AA 1XN4A 2R79A 3JQ8A 4P0QB 4F93B 1O9GA 1F06A 1PEYA 2CFRA 5KZMB 1T2AA 2Y71A 3FKSD 3WSTA 1EHCA 4RF2A 4XJXA 1YVPA 2HF9A 2A1TS 3DWEX 3P9QA 1J5PA 3ZZMA 1E2GA 2VNHA 5FB3A 1LBHA 4B8ZA 2R5WA 3ZWCA 3FR7A 4DR5B 3R7LA 4LE1A 3DEHA 4TYNA 2WQ6A 1EHYA 1WUYA 4NCJA 3HCAA 2MHCA 3D5QA 3ENKA 5ENVA 1BWRA 1OX6A 3DOCA 1MPTA 1U4OA 2I8LA 3G7NA 4YUWA 1BKSB 2FUG6 1XELA 5KI6A 4B4VA 4BGVA 4LE2A 1P7CA 3AETA 2IQIA 1MN6A 5B55A 4B3MB 4I2NA 4LHZA 1U7XA 1OBFO 1IH8A 2POQX 1RWOA 2Y0EA 4JOQA 5AJVB 3WIOA 5EJMA 3L4KA 3DH0A 3K0CA 4G5RA 2AC2A 4DWOA 4JC0A 3CVXA 2FX2A 4KR0A 4AO8A 3WBFA 5JH7B 2EARA 3QQPA 1L4EA 4GLOA 1M6EX 4IOLA 4AZWA 1DRUA 3O4IA 3PG5A 4DMUB 4DIOA 2LCIA 2JKZA 1F0PA 5KQSA 4JASB 2GKSA 4QGSA 5K8JB 5B37A 2XVXA 5GJCA 3WK8A 1NGSA 3E2MA 3AKZA 3TVYA 1NPYA 1DRJA 4NOKA 1NG1A 5JHHB 2OWEA 5AI0A 3U4AA 1GXSB 3IUJA 3OAAD 1S89A 4FJ2A 3E48A 3LI2A 1A9ZA 3CG0A 1UOPA 1HQCA 1XG5A 2RHTA 4LGVA 4CLHA 2RGXA 3J7TA 4A03A 3BB1A 3DEKA 3EX7C 1GN8A 5LCXA 3AUFA 3S5JA 1KEEA 3H5AA 4L2IA 4GWLA 1WCXA 5JE8A 2NV0A 2UVQA 3M6VA 4FR5A 4MI6A 3S6JA 4C4YA 2X6QA 2GZ3A 1C9EA 3HPQA 3HLKA 4NCIA 2KW5A 3MLBA 3PE6A 4WOKA 2HWYA 3L1VA 4GRDA 2FZEA 3BFVA 5KCMA 2FN4A 1E59A 1AURA 2JFOA 7YASA 3LQRA 3ZHQA 3CTMA 4HDNA 2Q9CA 3C3WA 2BDEA 4P08A 4DG9A 4FR2A 4C30A 4E08A 1ZEMA 5THQA 2VPTA 4DQXA 4AXXA 1XTVA 2WVJA 2YMMA 1VA4A 1ZH8A 2WYWA 3GLQA 4TRNA 2PVPA 4IGKA 4MDFA 5FLYA 5K0LA 5D1NA 3PWTA 1B3BA 2I5PO 2W58A 4TSRA 2W48A 4YDQA 3MSXA 4O25A 1NASA 2JZNA 3ESZA 3M4ZA 4BCCA 2F67A 2HMAA 3GDOA 1PNTA 4B3FX 1U0SY 3SQMA 3MJTA 3P0FA 1FFYA 1DAHA 3U0VA 2HHAA 1H1LB 4OQMA 1T8SA 4Y1FA 5BR4A 5DM70 16PKA 4MGYR 1V8FA 3DZ8A 1XA0A 2ZUSA 3TPFA 1JGTA 5C80A 5FKJA 1Z7WA 1Y80A 4TROA 2B2CA 2NADA 4I4CA 4O4LF 3EAQA 3HCBA 2QF7A 3BRWD 4FHGA 4QXOA 4HN4B 1I1HA 3KO8A 2BBWA 4D9FA 4GOND 4UNIA 1B8UA 3UWDA 3D59A 3SSNA 3VVLA 1RLUA 1ZGHA 1UDAA 3RS5A 2J08A 2NNWB 5EFOA 5FWNA 4DCGA 1V6AA 3KEQA 5IG2A 4FKMA 4EG8A 1QWOA 4JI2B 3GV0A 4KQ1A 4MR7B 1GTZA 4EPYA 1EUYA 2X86A 3SSAA 2P2LA 5JFTA 1YB2A 1NW4A 3P71T 4F85A 5ADHA 1FU8A 3FF4A 4P7GA 3PPYA 5HF6A 4C20A 5HJ5A 1B26A 4CCWA 1G8SA 2G07A 1RJWA 1VG8A 4NEGA 2NU6B 5LQNA 2QXTA 1E3LA 3S8EA 1QPZA 2OAP1 1FTQA 2Y4OA 3M3HA 1JMKC 3S5UA 3HYTA 1FDWA 3M6MD 2RJOA 1R10A 1Y42X 4X64B 5F1KA 2CNLA 3PIDA 4J94A 4C6TA 2WSSA 3DE4X 3C6MA 5GONA 1IHYA 3FF1A 3GMDA 2ZSBA 1BU8A 4LE0A 3QA3E 4WLUA 4R1UA 2VO1A 2BGKA 1OTHA 4ARCA 1AXRA 3NGLA 1MIOA 1SCNE 4K5QA 4Q3OA 4R1PA 5LIPA 2VYVA 5A1TA 3BUSA 3VTAA 1DRVA 3ZJUA 2NUAA 2D2VA 4XDGA 4OU4A 3LOPA 1BRMA 1XWWA 3PQCA 5CVEA 3P96A 4FSHA 1U2DC 2C97A 1J8YF 2HUNA 5A3JA 1EX1A 1EGAA 2ZAMA 2JHAA 4RTMA 2FR8C 3M3DA 1D1TA 1FUEA 4BKMA 2VHUA 3QHPA 1U3UA 2QTTA 2QRUA 2XCIA 4MIKA 2QEQA 4E4YA 3D31A 1P9WA 4NAVA 3QV1A 4GKBA 1DCFA 2IZ7A 2B1JA 4H60A 3F6SA 5AVOA 3D6FA 3LSTA 5AQ1A 3NDPA 2R6AA 4P6VF 4ZP1A 2DKOA 2XDYA 1ZGCA 2NYVA 3AHGA 1X92A 3GDHA 1T15A 2GOYA 1WCIA 3HV0A 2D7JA 2G63A 1TM1E 1AD2A 1YB4A 1SWVA 1U94A 4BN0A 3IIJA 1FSSA 1NW5A 1T9HA 2BFBA 2QYOA 4IEEA 5TGZA 2YRFA 2WICA 1VLZA 4HGOA 5TF4A 1F2DA 4PQEA 2XVMA 2FLWA 1JHQA 1JQ3A 1F8UA 2ILTA 1JIQA 3DKVA 1SQGA 1IHPA 1NR1A 3DQQA 1MTZA 3ICWA 3DFZA 2IY8A 1T2VA 2ZSJA 1HLFA 3CZRA 3MD9A 2OM2A 5E9QA 5I8ZA 2JG3A 1U1EA 4AULA 4DW8A 2F3QA 4XR9A 2XB2A 1OVGA 1NE7A 3JQ8B 1DO0A 1T5DX 1RE1A 3BH7A 3T41A 1B8PA 3VJKA 3HXQA 1H6CA 2JATA 1N3IA 1QHHA 3OJEA 4KWCA 4BIMA 3A27A 2VJCA 4KZKA 4QU9A 1NW9B 4HNHA 1DOZA 3C1TA 4JIGA 1EP9A 1SXJA 1ZFNA 1R0KA 2FV8A 2AG0A 2QAGC 3ROKA 1A2BA 4BFSA 4S04A 3OKCA 1UBSB 2WJVA 3AOGA 3C70A 2C9YA 4D81A 4DB2A 4HDMA 2ZAYA 3MIIA 2B82A 4I50B 4WADA 5D2CA 2VHJA 3U1VA 2GF2A 3H2GA 3ZG6A 4MRNA 2A33A 1X7ZB 3P9RA 5CFOA 2BKVA 3RJMA 4MUNA 2B35A 4CODB 4BRUA 5JUWA 3KJNA 3RBXA 1PWHA 2FPMA 3REOA 2XGSA 3OCCA 4ACAA 2OMKA 5HF8A 3U3ZA 4DL9A 1Z6PA 2P8SA 2Q7OE 3RVKA 4CTMA 1KYQA 3TB4A 2QX6A 3JYNA 4DIMA 3CNBA 3AH8A 4PZPA 2GYUA 1J24A 5DU2A 2R1UA 2MIIA 5EY5B 4QFDA 4MPDA 2K2WA 1Y3CE 3FGZA 2HQ1A 2KM1A 4PGHA 3P0JA 5JCJD 4UTOA 5EIOA 3NBKA 4MTCA 2HMWA 2Q9AA 3JQEA 4BX3A 2WJ4A 3DMNA 4ZYVA 5BPFA 4LTMA 2LW7A 3FPSA 1KK2A 2D0PB 3A1EA 1GTJ1 2WJYA 3COYA 4ZOBA 4UDNA 1E7RA 3ANLA 2OGUA 2AMFA 4G5SA 1P2DA 3TGPA 1H3EA 2EYUA 3D3WB 2PH1A 2WTAA 4KV7A 2CMKA 4UBJA 2IP4A 4DTIA 1U7DA 4XFKA 3JS5A 3FNFA 3RK0A 4MRRA 2ATEA 1G3IA 5F64A 5JHGB 1PL0A 1YGYA 1NX9A 3KYIB 5KQMA 2MSLA 1WBJB 3L0OA 4PRLA 1QIDA 4QG3A 3N86A 5FH9A 1OYYA 1QIJA 3B8EA 3KT3A 2CJYA 3BL6A 3D8UA 1UBKS 1IM8A 3UJHA 3O1LA 1GLNA 2G1JA 3N87A 4L73A 4PYRA 5HJEA 4ZANA 3AZQA 4TZTA 1DBSA 4PSDA 2HHCA 3RTAA 2V3VA 1SCDA 3N59A 4QLBA 2H07A 4KQKA 2RGYA 3PRKE 2G67A 4BO6A 1K7YA 1SU6A 4I9FA 1SHTX 4IZHA 5L4LA 2V98A 1LPAB 2G72A 4IXDA 4LEIA 5D51S 1ZM9A 4LQLA 3SFVA 5LA6B 1HETA 3B1VA 3HU3A 4Y2UA 3DHEA 2XLCA 2XLBA 3GPBA 1K6EA 3IBGA 1NW3A 3PCRB 3RC9A 2HA7A 4CEJB 1GTSA 3DNFA 3CC8A 3OQ6A 2E4YA 3K1ZA 1NW8A 2HRDA 4KQMA 3LBHA 4MAMA 3ZNQA 3G17A 3ZWQA 5JBIA 1K7EB 2P4EA 1YU9A 1YJ5A 4JXKA 4HYYA 3NVMB 3SIRA 1UADA 2CXUA 2QVGA 5CXSA 5FR2A 2HQOA 1KERA 1WUIS 3QHAA 2BFBB 4RPKA 1LCIA 3E3NA 3NHZA 3LDFA 3QBTA 1E1CB 1C2TA 5L7YA 4AWBA 3UA3A 1XF9A 4P92A 2O4UX 2GERA 4OHUA 5D6NA 4DLRA 1P33A 2H4XA 5I5EA 3DZHA 1R4ZA 1CDZA 3W8NA 3FKJA 1Y5LA 4QSMA 2QGNA 4XEHA 2ZBVA 4OHPA 4R2MA 2YYAA 3T3DA 1RXVA 2QW8A 2CF6A 3IULA 4RY9A 5PGMA 3RC2A 3W77A 1PGJA 2C2ZA 2QN7A 4GWKA 1KETA 1ZUHA 1JI0A 1R4AA 4JNKA 2OK8A 3GNLA 3TUIC 5CB4A 4B2LA 4C2TA 1UT6A 4YAEA 2ZCUA 1Y5RA 4XPIB 1Y8RB 3SZLA 4N3AA 4PQRA 3UV6A 2C3YA 3CNEA 4U9IS 4CIDA 1CQPA 4DIUA 4DQDA 5HQ3A 4DUYB 4KFCA 4Z2AA 2X9VA 1MHTA 1D7AA 5IN5A 4WJLA 1YL7A 3RVOA 3FCSB 3TVDA 4WWHA 4FMCF 5CVUA 1JFTA 1OLOA 4D4GA 2BEJA 1GHTA 3RBZA 4YR7A 1RBMA 3TSZA 4KJXA 4QL3A 2OP0A 4GDMA 4B6JA 3VU8A 2X7XA 5JJCA 2I6TA 4HZUA 2D0IA 5EERA 3L1KA 3ABZA 3G7UA 3I30X 4FDTA 5DTRA 4PAWA 3T7SA 3OHSX 3GZ4A 3EH1A 5J2UB 2VQDA 4UNPA 1ZBQA 1XMIA 4LJSA 3H9UA 4F4UA 1OB5A 3W8FA 2QAGB 3KAKA 3RRXA 1MB2A 4J0KA 1GCAA 1VC2A 2Z0MA 4PZAA 5FOWA 1Y4ZA 5E8RA 3TRJA 3FYCA 4IJ5A 2O2HA 1QK3A 1L2TA 1Y7IA 3J81k 4DA9A 2Q3DA 4QGGA 1CB7A 1C0PA 3G5MA 1YSCA 3HCWA 1SCUB 5A4FS 1TL7C 2XZLA 4HB3A 3R8XA 2FI1A 5E7JA 1QFXA 2IA5A 3FZYA 4EGSA 4GVPA 3DL0A 1WXFA 2QTGA 2VATA 5EAIA 1MDBA 2B8WA 3N9IA 4U4AA 5JLJA 1QRSA 3WWOA 3W9BA 2EZTA 3ENWA 1RFLA 4LBYA 2LIPA 4JJ7A 2XITA 1XK7A 5TEVA 3ROXA 1QHEA 5LUAA 1TZMA 3JD3A 3K1YA 3ESDA 2RK4A 3FVVA 1Q1AA 2BLNA 3HN2A 3KJEA 2WLTA 1U28C 4YP7A 4TTJA 1XRRA 5LUBA 2MTBA 1J0AA 3GFGA 3AKEA 5IT9A 1PIWA 4KMRA 1ECJA 2J4DA 1QAMA 1UFRA 1SXJC 1G41A 1JP7A 2BF7A 4R2JA 1PT5A 3LFHA 5F52A 2FEMA 2I2CA 4EUKA 3NIDB 1BOFA 2J3QA 2OB1A 2XYRA 3DCJA 3UHAA 1UZAA 4DLUA 4DCUA 3PZBA 4Z1MD 2WA2A 1NA5A 3U31A 4P86A 1E9AA 1WBDA 3SJUA 1OX4A 2XMSA 3LC0A 3OEED 1YR7A 4KP7A 3RU7A 3U3XA 4ZYTA 5AKXA 3RJTA 2Y93A 4G24A 3ONWA 1FNDA 2NT4A 1CYDA 3H9GA 3QLVC 1OJLA 5IHPA 4AURA 3OFND 5AVYA 3E7PA 1NC1A 4I1OA 2ZWAA 4LJ6A 3HVRA 4FNAA 4FS3A 3GT3A 4FZJA 2X22A 3BE8A 3J81A 1P2GA 2WM9B 1EFTA 1L4YA 3F97A 1A3CA 1PWYE 2IYRA 3ICOA 1WG8A 1ZA1A 3IP5A 3P0RA 1RYFA 4HCJA 4ZQFA 4ZC8A 5EIFA 1W29A 2AZ4A 3EVGA 1ZGZA 1SCBA 1ZYUA 2J48A 1U81A 2X4GA 3EPPA 5JSZA 4OHWA 1H94A 1WB6A 4OXQA 4QREA 3RS2A 3RI3A 3AR6A 2AW3A 3O8QB 1CK4A 5KTRA 3H5VA 3F5SA 5AYVA 2NO1A 3RWBA 2P9JA 4BQRA 2GN4A 2WAAA 5A62A 1A9TA 1KF0A 1S8FA 4IHAA 3RYHA 4GZMA 4QDOA 3LDAA 4EB6B 2Z98A 3T9DA 4EHKA 5EJ5A 2C29D 5J4HA 1ABBA 1U9YA 2KSQA 4I6JA 4JLMA 3TYXA 1P7YA 4YAIA 3BXHA 5J2TB 1HT1E 1EE1A 2EKZA 4KMMA 1UMBA 4DGSA 1K8QA 1LPMA 3MQ2A 4QPJC 4X6YA 5C35A 3R3UA 3L84A 3B6JA 2Q6VA 4NJMB 3UYKA 5JNLA 1I6WA 1MC1A 1J8FA 1M2VB 1YONA 2JK1A 1XNGA 4CMAA 2Y0DA 4KVAA 3DFKA 4W1SA 1DKLA 3H2HA 4MKGA 4P83A 5F5LA 2HIMA 2RKBA 2W37A 4I0WB 1T6NA 3QH4A 1CZHA 2IBMA 2P2NA 2XA1A 3EGXA 3FLBA 2GCOB 3F67A 2P62A 1XVTA 3KVNA 3LYAA 3QTBA 1U8XX 1LFAA 2JD2A 3FWHA 3GG2A 3KUXA 5B36A 4IJQA 3THYB 1QPBA 3PNVA 4KI0A 1OBHA 1CJKC 4YAGA 1G7SA 2DY1A 3LT5A 3D43A 3NTUA 3HLYA 4KO2S 4L72A 4YUYA 3KP1A 1YS2X 1KE1A 4LS3A 1YCFA 2UZ1A 3IDAA 2NM0A 2PT9A 2PKRA 3KTAB 2CE2X 3LOQA 2IEYA 4YMTA 3EXHB 3QXSA 1KWKA 5IH7A 3TB6A 1HE4A 2C4UA 2PVSA 4ENVA 1CY2A 1FFAA 2AR9A 2HRBA 1CY1A 4AX4A 4HO1X 4NZNA 1DADA 1L7AA 1EK1A 2WVAA 2GEUA 4LFAB 1DJLA 1OWLA 2NSYA 2QENA 3R3JA 1U04A 1L5HA 3TSWA 2Q07A 1VMKA 4NS1A 3DEYX 4EQZA 3AWDA 3SC4A 4E30A 1MH1A 3JSXA 2VRWA 4ND5A 2ZT5A 1NVXQ 4FS8A 3KQKA 3MAAC 1MEJA 5SY6A 3V8VA 5P21A 2X4IA 2Q4RA 2V4ZA 3IAS6 4E2ZA 4HRYA 1WETA 3JALA 4EHFA 4N0MA 2NZVG 3OEYA 2EGUA 5BQXA 3S29A 2C2MA 1GGMA 3LZCA 4TVBA 1SBYA 1B8VA 4R31A 5IU6A 3R1IA 5JTUA 3MUEA 1GY8A 1N6LA 2FMFA 1RP7A 4K7JA 2Q4TA 2VQSA 3LYHA 5CB6A 3BCUA 5LQRA 2EFDB 3P9ZA 4CFSA 3ZV4A 4CLRA 3NHFA 1BXRA 3PC2A 4DJJA 1E92A 2ZRCA 3BE5A 1SVUA 1DV2A 2RBGA 5GZ3A 3UKJA 3E81A 3OKAA 4N5IX 4ZU6X 1DTWB 5KS2A 2VR1A 2ZSDA 2R2GA 3RQIA 2XSZA 1BVUA 5KYYB 3DQZA 4TWJA 5E0OA 3W4KA 1BXKA 5GJBA 2WTXA 1GT6A 3CYFA 1GXSA 1I9GA 3INTA 5JD5A 2YV2A 3T3NA 3CKMA 1E2BA 3TQSA 1QMGA 1SUWA 1KKLA 3GEGA 4WN3A 3VSCA 1OILA 4BC0A 4UFPA 4YY3B 4F56A 3A6LA 2ES4A 4FE4A 1R2QA 1Q21A 2NPOA 5F3DA 5T6BA 3SM3A 1ECFA 3WP0A 4YCCA 5EIEA 1Y89A 2OV8A 3W90A 3L8ZA 4C7XA 2E82A 4RO0A 3RG2A 4FB4A 2I55A 3WZ2A 1LW7A 1NI4A 2W8ZA 3GMSA 1DKRA 3DDUA 5TR9A 5J1SB 4F04A 5K3BA 1EFDN 1QP0A 2PTGA 2TSYB 2I8CA 1UOEA 1U2GC 2H7XA 3E27A 4Q4DA 3VYSB 2RAPA 1FMTA 1HYEA 3EMDA 5DYIA 1H1DA 4ENRA 4HNQA 1KJYA 1XTSA 4W5HA 5AI8A 4JLAA 5CCEA 1GKLA 3IBTA 4GX1A 3RTGA 1NW7A 1ORWA 2D8MA 2QV7A 2QIOA 3LW7A 4R9RA 2I3DA 4TV9B 4GG1A 2VAVA 2FK8A 3VC3A 4N6GA 4ARZA 2IYOA 1NYTA 2MYTA 4LOJA 4E6EA 3JQRA 3ELWA 2X76A 2WSMA 1IQRA 4IGEA 1IJKA 4M0KA 5DCLA 4LAFA 4ZO8A 5DCYA 2VBIA 2W6ZA 5AJWA 1SKQA