3KUKA

Trapping of an oxocarbenium ion intermediate in up crystals
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
293
structure length
290
Chain Sequence
DLVQLCNPHIAAMKEDILYHFSLSTSTHDFPAMFGDVKFVCVGGSPSRMKAFIKYVAMELGFAADYPNICEGTDRYAMFKVGPVLSVSHGMGVPSIAIMLHELIKLLYHAHCSGVTLIRIGTSGGIGLEPGSVVITRQAVDPCFKPEFEQIVLGKREVRNTDLDEQLVQELARCSAELGEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQDYLRAAYAAGIRNIEMEASVFAAMCNACGLRAAVVCVTLLNRLEGDQISSPHDVLAEYQQRPQRLVGQFIKKRLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Glycal formation in crystals of uridine phosphorylase.
pubmed doi rcsb
source organism Bos taurus
total genus 96
structure length 290
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kukA00
3P0FA 1Y6RA 4GLFA 1G2OA 4TXJA 4DARA 4PNPA 4M1EA 4PR3A 4ECEA 1JYSA 5CYFA 3K8OE 1V45E 4WKCA 3PNSA 3PHCA 3UAYA 3C74A 1CB0A 1V4NA 1V3QE 2P4SA 3DP9A 4F3KA 1K27A 4RJ2A 3TL6A 1RXUA 1U1FA 3BL6A 1JDTA 3MMSA 4BMZA 4TXMA 3EMVA 4MCIA 5B7GA 3EEIA 4DA0A 1PR5A 1NC3A 4L5AA 1OV6A 4TXHA 2AI2A 5EFOA 1T8SA 4L5YA 4D8XA 4R2XA 1RXYA 4G89A 2AC7A 1T8WA 4P54A 4U2KA 3UT6A 1ULAA 4F3CA 1I80A 1Q1GA 3FOWA 2HRDA 4E1VA 3UAWA 4BMXA 3D1VA 2QPLA 3DF9A 3KVYA 5C80A 3P0EA 5F78A 3E0QA 5F77A 3LGSA 2QTGA 3GB9A 5B7QA 2BSXA 3EUFA 5F7JA 5B7PA 2A0XA 1CG6A 4TTJA 3K8QA 1M73E 2A0WA 2PGAA 5IU6A 3NM5A 1VHWA 1OTYA 1A9PA 1YQQA 4H1TA 1A9SA 1Z38A 3IOMA 5EPUA 4OGKA 1YR3A 4X24A 1A9QA 5B7NA 4L0MA 1LV8A 1OTXA 1YQUA 3DDOA 1Y1SA 1JDVA 3KUKA 1A9RA 1VHJA 1U1EA 3DJFA 3OZDA 1JPVA 3PHBE 4WKOA 1PR0A 4DA7A 4QAQA 1RSZA 5F7XA 4NY1A 4LNAA 3NBQA 5F76A 4EB8A 1YBFA 1Z36A 1A9TA 4JWTA 4OF4A 4D8VA 1TD1A 3MB8A 2ISCA 1T8RA 4NSNA 3OOEA 1U1CA 2RJ3A 1RR6A 1RT9A 3ONVA 4TS9A 3ENZA 2QSUA 4DA6A 2OC9A 4UC0A 4YO8A 4OEHA 4TTIA 4K6OA 4YNBA 3OZEA 1LX7A 1SJ9A 1V2HE 1N3IA 1RXSA 3LA8A 1JDUA 3OCCA 3OZCA 4JOSA 1PR4A 1V48A 2XRFA 1ULBA 1K9SA 1ODLA 4L6IA 1Z39A 1ECPA 5FAKA 2I8AA 4DAOA 1PBNA 4D98A 5ETJA 2I4TA 1XE3A 5KB3A 3BJEA 2A0YA 3QPBA 2QTTA 4WKBA 5IFKA 2ON6A 4QEZA 3OZBA 1RYZA 1PR2A 1U1GA 1A69A 1TCVA 4LNHA 3OOHA 5CCDA 4QATA 1NC1A 3O4VA 4YMLA 3BGSA 2H8GA 1JP7A 3KHSA 1ODIA 1RFGE 5F73A 4MCHA 1PK7A 5DK6A 1Z37A 1RCTE 4TXNA 3E9RA 4DAEA 4WKNA 2AI1A 1YRYE 2HN9A 2IQ5A 1JDZA 5F7ZA 4QFBA 4KN5A 3OF3A 5CXQA 4DA8A 4EARA 5JPCA 3T94A 4OY3A 3EUEA 2Q7OE 3FNQA 3INYA 1T0UA 4OJTA 3U40A 1Y1TA 2GUWA 1Y6QA 4JP5A 4G8JA 3E9ZA 4QASA 3FB1A 1VFNA 1ZL2A 1Z5NA 1SQ6A 3DPSA 1JDSA 5CYGA 3NM6B 3NM4A 1U1DA 2A8YA 3ODGA 3FAZA 4I2VA 2OC4A 2QDKA 3KU4A 1TGYA 1SD2A 3UAVA 4F2WA 4TTAA 1K3FA 1WTAA 1OU4A 1RXCA 2B94A 3GGSA 4YJKA 4DANA 1PR1A 1Z33A 3OPVA 1SD1A 4D8YA 1PR6A 1Z5PA 2HWUA 1FXUA 5I3CA 1LVUA 1V41E 4D9HA 1ODKA 3UAXA 3FUCA 4F2PA 4R31A 1VMKA 1ZOSA 4GKAA 4MARA 4TXLA 1PWYE 1PF7E 1Y1RA 1NW4A 4L5CA 3UAZA 4IP0A 4TYMA 3FWPA 5CXSA 4BMYA 4GLJA 3IEXA 1B8OA 4M3NA 3BSFA 1OUMA 1TGVA 1T8YA 3SCZA 1PKEA 4G41A 4OGLA 3KVRA 1A9OA 4QARA 1ODJA 4FFSA 4GMHA 1QE5A 4LKRA 3PNPA 3F8WA 3LBAA 1B8NA 1PK9A 1JE0A 4LDNA 4LZWA 1Z35A 5F7OA 4TS3A 5CCEA 1Z34A 1Z5OA 2OECA 4DABA 1C3XA 4M7WA 1OVGA 5K1ZA 4WKPA 4NS1A 1Y1QA 4BN0A 2HSWA 1JE1A 2AI3A 5EUBA 3KVVA 4F1WA 1PW7A 2OXFA 3O6VA 1TCUA 4R2WA
chains in the Genus database with same CATH superfamily
1LFAA 4YMIA 2E21A 3WLHA 2F4NA 2FPWA 4M0DA 2HREA 4LV5B 4MWBA 3MJ4A 1QQ5A 3UG6A 1Q1AA 4DARA 4EHKA 3S29A 1V11A 2W6JD 2B1JA 1F8XA 3T7CA 4M1EA 4GZMA 721PA 5IK2D 2Y05A 2GTIA 3JQQA 4ZAXA 1J20A 2DPYA 2JGFA 1HURA 4XB1A 1YR8A 2P2NA 3GOQA 5E0KB 1AQJA 2QA5A 3CZ9A 4AFNA 4Y2SA 1I4TD 3MRVA 3WSTA 1Q7EA 3EXFB 3AB8A 4MIEA 1NR5A 3EISA 3ZQJA 4AZSA 3LXMA 4R1SA 4ZOLF 4XCVA 4WESA 1E2KA 3KTOA 5EA2A 3EXHA 4YXWD 4NXMB 2D1YA 1C5KA 1HXHA 3DMFA 3EF1A 2ZRCA 5IWCA 2NZXA 1DG3A 2O2SA 2GF9A 1ST3A 4CM8A 4DMHA 2ZJ7A 5HUJA 1XZLA 2RMKA 5LWHA 4G5OA 2H1SA 2ORWA 4HQFA 3W5BA 1GYPA 3ISTA 1L3IA 1GIAA 3VOTA 4PU0A 3E3NA 3AONB 2OYSA 3FGNA 2XMRA 4BQOA 4Q1VA 2OBYA 4G6ZA 4GIBA 2I33A 3UHJA 4EY7A 1DIRA 1KETA 2DPHA 3RO7A 4E21A 5DMHA 2GHRA 3F71A 4OAPA 1G4HA 1VSTA 1JG1A 4OQDA 4K6FA 3UYKA 1F20A 2HJVA 1QDEA 2VSYA 1Z5UA 2I6QA 2HPVA 2J6BA 1TTHA 4FX5A 4H77A 4HR7A 4EGJA 4HNTA 2F1KA 5A3SA 2MT9A 2FVXA 4FPXA 3WYBA 4EGSA 4W6ZA 2G1KA 1Q7RA 1IWOA 5K3SA 4CLOB 1WX1A 3K73O 4TTVA 1HH4A 4QPJC 2R6HA 1GZUA 2VQEB 5FWXB 3GD7A 4EFLA 4DR2B 4RABA 5AJUA 4RDXA 3L1UA 4ND6A 1LLFA 2DC1A 4MIYA 4ISBA 3LY9A 3ZDYB 2CCGA 2RGUA 2X9VA 5FPHA 2QVGA 1EHYA 1IM2A 3LW7A 4PBSA 1FPMA 2DH5A 2O4UX 3ZGOA 2HYIC 1RXYA 3GVCA 1ZUHA 4RF5A 2AC7A 2BT4A 2QKYA 3OWHA 3T5CA 3PD0A 4WZAB 6PFKA 1VM6A 2GVZC 5FTMA 4D42A 2AK3A 2QMYA 1XMSA 3CX3A 1DAOA 2A84A 4K9QA 5F5LA 4ZXFA 4DLRA 3TIVA 5B2EA 2RBKA 4GPBA 3KLPX 5BN4B 1PUJA 2ABWA 1FLVA 1NVKA 5BR1A 2BEKA 4JZKA 4E1VA 3HP1A 1YB5A 2H07A 1KVRA 5HKKA 1HX7A 3UEOA 1J49A 4JGGA 5C5DA 4DV5B 4MMXB 1SUWA 1Y4DE 2PV0A 3A3PA 4J16A 3R7DA 2ZJAA 4Y8VA 3V1KA 2YFKA 4CCSA 2G36A 1SEPA 1S2IA 3KKKA 1F3OA 1E77A 3Q2KA 4JCCA 3G49A 4C04A 3QVGA 4AXXA 3GD5A 2UYHA 4L7VA 2PUGA 3FBTA 5B3JA 1G6OA 4EEKA 4EKNB 1L9KA 1VMIA 5AIBA 1S96A 1TJ4A 2IY8A 5DYWA 5LLSA 4JFAA 3EIWA 2A0XA 2JVJA 2BLNA 3E1SA 4HQNA 2W0SA 4DSZA 4HVCA 3RBVA 3BVPA 3C6ZA 3AUJB 1ORRA 3L06A 4FBMA 1PL8A 4YRPA 4EG6A 3IO3A 1HFWA 5F2EA 1IXZA 2FPRA 2XKAA 3IOMA 1YQQA 3HB1A 2FPMA 3H0EA 4WOKA 1E7YA 1FYEA 1PFVA 3GA5A 3S6JA 1UP7A 3C8DA 1EK5A 1H3EA 1A9QA 1GFZA 2IU6A 2ZUWA 2HPZA 1KE2A 4F4CA 4JYAB 4FYPA 3E61A 1XQXA 1IN1A 3UJ7A 4MS1A 5IDVA 5JOQA 2GD6A 5JAZA 1GKIA 2GPAA 4JX9A 5D7BA 1YDHA 1T8PA 3CUWA 4LQ4A 3ZGXA 1RLJA 1Q6YA 1TVCA 3L02A 5KJCA 4BQNA 4YAFA 4XIIA 4WBNF 3DJFA 1SG0A 2GN9A 2OQIA 4QFDA 4RHTA 3L7AA 4S35A 3B2QA 4B0PA 4BATA 1QV7A 2PGOA 2BFBA 3BF8A 1XTVA 3D4NA 2W93A 4E08A 5HR5A 1P6QA 5D3QA 2C2KA 5EXEA 2DM6A 4NY1A 5EQJB 1WKBA 3NBQA 3HFGA 1QH8A 1UMCA 2Y6VA 4UFPA 1KMMA 1QWOA 4G09A 2N3ZA 3FZYA 3F3KA 4M60A 4EY4A 5CG2A 2WAOA 4KO8A 2AN3A 3M4ZA 4MI6A 3TXAA 3ITKA 5BV2P 1GV1A 1QQ6A 4H7IA 4W9NC 2FCAA 2OAGA 4GSYA 4OL0A 3U60B 2K4MA 1RR6A 1TE2A 5KNCH 1QE0A 3N2ZB 3SXPA 2DYKA 1OLXA 5COQA 5GTDA 1RT9A 1Y7LA 4UVHA 3HY6A 1RJ9A 3WAJA 1KK0A 4E5VA 3AF4A 5SYAA 3TCXB 2KWIA 4CQJA 2X77A 5J5CA 5DGHA 3V2GA 3U44A 2ONKA 4KV7A 2B8EA 2Y6UA 4QC2A 3GFBA 5KQMA 2I0FA 4D4MA 3D3EA 4DQDA 3KZ1E 4N8SA 2H9AA 2O7SA 3DOCA 3IJPA 1N3IA 3GI1A 3O8OA 4FFDA 2HRBA 4OL9A 1FBNA 1BOOA 1UPXA 1M34E 3N28A 1I0ZA 4LJ5A 1COZA 1QC5B 4L16A 4S0ZA 3RTBA 3UANA 5G1NA 1DLJA 4Z9FA 5DVZA 4JNCA 3FD8A 1JF8A 1ZCAA 2FLWA 5F2KA 1YK0A 2HJ9A 3FKSA 1MXHA 2JIZD 3LHDA 1BHSA 1RXWA 1PFWA 2HWWA 3EZXA 3V33A 4L3WA 2EKDA 2EKPA 1SXIA 1WY5A 4H16A 1GL6A 1Z0SA 4KFSA 4WLEA 5DHAA 1CHNA 5FP0A 2WJVA 3AOGA 3HXPA 4QYXA 2XQJA 1XG5A 3NNNA 2W5UA 3A2MA 4IY1A 5BW6B 5IULC 1Q0TA 2H4FA 1T9HA 3K32A 2LCQA 2WQZA 3FGPA 4WXYB 1XE3A 2WVAA 3FPGA 4Z5XA 3DUFB 1Q6ZA 4YUZA 4NC9A 3VH2A 1Z4NA 5THKA 4F6RA 4X8HA 5FFFA 3TIGA 1W88A 1WMSA 4Q18A 1IM8A 5CGZA 4C29A 1RP1A 4UM9D 4IIUA 2IS1A 4G84A 4OQYA 3G9UA 4XR4A 1NXVA 2V5UA 1WMEA 1WUJS 4Y6SA 4ZAGA 3S5JA 4EMTA 1P2VA 1IJBA 1XZIA 2QR5A 5CGQB 1P3JA 2HUPA 2ONYA 4ZCMA 2VTKA 1VKHA 4HSEA 5FCDA 5H1YA 2ZQYA 2W42A 3H2YA 1BOFA 1JQAA 1RHUA 5K8LA 1U2DC 5A05A 4K28A 3TDMA 2GJ4A 2EBFX 4KO2S 2E5LB 1GKLA 2OQ2A 4XWAA 2ONJA 2QD4A 3G9XA 4G0NA 1YVPA 1YTLA 3PC4A 4UMFA 1ZLXA 2PL3A 3P5SA 3JAWB 2QLJA 1R2QA 4EGFA 5JS6A 4LPKA 1K5PA 1ZKMA 4NDZA 1Q2UA 4WZBB 3E22A 3GAFA 4MKIA 2PUAA 3JQ8A 4N48A 5FTJA 2YWGA 2EJUA 5F3RA 3SFTA 1Q22A 1JYEA 1GU7A 3HM2A 1AK1A 2WM2A 1PKXA 1R0BA 4BGVA 5BSEA 5AVYA 4DAEA 4A2CA 3L4EA 1CP3A 1VMDA 1OKKD 3PGLA 1KS9A 2HN9A 4NI5A 4R54A 1M9NA 5CMLA 4QEKA 3FPBA 4ETWA 1UWLA 2PGJA 5I47A 1KH1A 2OA0A 4BAZA 3M1AA 1DVRA 1GDTA 1D4AA 3DT6A 3EG9B 4LXQA 4S2EA 3L5KA 4MQMA 4RVGA 2QBYB 4A03A 3ZQ6A 3R0IA 4JFRA 4KE7A 4EA7A 1OV4A 5AHWA 4BQSA 2DQYA 2PZ8A 1QQAA 3T0IA 5SICE 5BSGA 2X4IA 1U3VA 1LRLA 3L7MA 3IKVA 4MV7A 4Y6QA 4BN5A 2LUOA 3RAPR 2HOQA 3BH7A 2HI0A 1D8TA 4W7SA 3TLEA 3RADC 2V74B 3H2HA 4WA8A 1EGMB 3PJRA 1DC7A 5AQ1A 1R66A 1AV7A 4UZFA 4WDQA 3OKPA 3G5TA 4FFOA 2I3AA 1BO6A 3V8VA 4G0ZA 4MB6A 2H4HA 1NM5A 2YQ5A 4HEA1 3O93A 1NMYA 3CPJB 1EUZA 1T0HB 1TVKA 2DY0A 3D4LA 1UKCA 5KTYA 2ZRAA 1GVNB 1XLTC 2OXRA 4M1WA 1VA4A 4DMKA 1GM5A 3RKSA 3VNAA 3D9QX 3V3TA 5L3SA 1FP4B 1Z3IX 3G5UA 1O96B 4G8JA 3E9ZA 5FUMA 2PGIA 3DDZX 1O7JA 2O05A 2ZYHA 4G9EA 3WYFA 5IH3A 1ORWA 3ZCSA 1KRXA 3BMOB 2WQ6A 5IBCA 3N2GB 4EP1A 1O87A 3LWNA 1L4HA 2P90A 1OJ7A 3IUQA 5G0WA 4IJMA 2B34A 4O4LB 2OGSA 3CX8A 4FR2A 5CYGA 5WRFA 1VZ3A 3MUNA 2JLVA 3IV9A 1TIKA 2DQ4A 2JFOA 2VAXA 1EVKA 4XM0A 3WWYA 4ZOQI 2X0KA 2H0AA 3B85A 3KS9A 2PQMA 3LVQE 4X8MA 5FUVA 4PTLA 5CURA 4D81A 4ECAA 2ID8A 3C7TA 2WD7B 2BHNA 2WD9A 3H2SA 4PXYA 5TPWB 3LP5A 3RSQA 3NTUA 1XU7A 1L8QA 1J1ZA 4DV7B 1QV9A 1T6XA 4LC0A 3UK1A 3W04A 3IT3A 4B3FX 1VGRA 4C3VA 1Z0AA 2JI6A 1VYTA 3WJ1A 1JAXA 2GKSA 1XZCA 1K3FA 1M1UA 4EZEA 3JAKA 2BRUA 4KYUA 4RKFA 4AJJA 4R5MA 1BMFA 3PHHA 1ZUIA 4JLDA 1K6MA 1CJBA 3CURA 4GEKA 4HG2A 2WWVD 3ETJA 3GGSA 5FBLB 2R4UA 5IAEA 1PTKA 2CVHA 3CLRD 1IN5A 2XWQA 5EVJA 4BIIA 4RXTA 5EOVA 1YJBA 4U2EA 3KYDB 2C3MA 3G68A 4QOIA 2NUAB 3SEQA 5EP4A 4OUKX 4BTVA 1PN3A 2EEZA 5FL3A 3M4YA 1AZLA 2ODWA 4WD3A 3K7EA 4DPLA 2WJYA 3GVXA 3R5TA 3ETLA 1NHGA 3GCZA 1Z5PA 3MWEB 1E92A 3EGWA 3NBXX 3OOJA 5CUQA 3OT1B 4DV6B 4HWKA 2QP9X 1PEKE 3F47A 1AS0A 4YRMA 1XJ5A 1FXUA 2A3RA 2AJTA 2O0MA 1SVOA 1V1MA 1XT6A 4HPJB 4XWOA 2Z1DA 1JQ3A 1SVKA 3HLTA 3T52A 4F2PA 2BDTA 4HWRA 4TKVB 2ATXA 3I4CA 1OBVA 1PWZA 3OU7A 4R31A 5AW5A 1NUPA 1U3DA 5LUBA 2M6LA 5ALNA 2ZRNA 2BFDB 3GQBB 4IGKA 2IU3A 2P9QA 1A4UA 1CETA 2CLDX 4GKAA 3S8MA 3SBOA 3EDRA 2CXOA 2J4DA 3CZ4A 2NQ2C 3SQLA 4E5DA 5BNIA 1KOFA 4EHLA 3TRKA 1I1OA 1ZM2A 2KI5A 2NUTA 4EJ2A 5E4YA 3TMYA 1K1EA 2JLRA 2WG1A 4TS4A 1Y1RA 1O5OA 4BLRA 2VSNA 1B4DA 5CXXA 2FSIA 4WK2B 1BNCA 5AR1A 4O4JA 4IDOA 1L6IA 3Q5GA 1IRXA 3ND7A 4URXR 9ABPA 3UATA 2NO7A 4H7EA 2DUJA 2O3SA 2XW6A 2ZSFA 1AZWA 2VOEA 4FGWA 4KR9A 5L7WA 1AH2A 4WL0A 4KXUA 2KM1A 2CVZA 4GL4A 4IDCA 5BURA 4YI5A 5HIKA 2R79A 3KT3A 3FUXA 5U9CA 2XSZD 3IXLA 4P2BA 3QLVA 5GONB 1DHTA 5A9TA 4FYXA 4JUDX 4E6PA 5ALQA 1JG6A 3AZOA 1THGA 1YVDA 2P41A 2UVQA 3QXJA 5E4TA 5E95A 1NKSA 3AR5A 4NENA 1TQ8A 3PPWA 4BFVA 4TRJA 1WMAA 1II0A 4RJLA 2COUA 1SCKA 3H1AA 2NWQA 3TNDA 4Z3OA 2WAAA 3LYAA 4JUFA 3SSAA 4D3XA 1OVMA 1RNLA 2IW1A 3V55A 3JD2A 3C7CB 1PVDA 1RLMA 1Y8CA 4BLUA 4DZRA 1MLDA 1S0UA 3TFQA 5E9JA 1UFRA 2VJOA 5AVUA 1N92A 2C2OA 2ZWOA 3BFXA 2HA2A 1E1QD 1G19A 2F3QA 3K0AB 1N8SA 1VMEA 1KDVA 4DBLE 1A9OA 1BWRA 1PV1A 4JEIA 3R40A 4RH3A 3RYCB 1TK9A 2ODTX 1PDVA 2QROA 4ZOLB 3RANA 1K2VN 4FYIA 2KLHA 4Z4GA 3PXAA 1CFJA 3KLBA 4FFPA 5A03A 1DXQA 1P5ZB 4UEKA 4M37A 1GPDG 4K1LA 2GM4A 4KO4S 4L8VA 2I2FA 3O75A 2AC4A 4FR5A 4KTVE 4PFKA 4TMWA 5CVVA 5TJHA 2O8EB 1W34A 2H1RA 2NTVA 2Q6IA 3A9SA 4RIGA 1R8JA 5AIAA 5F12A 2AD5A 4E31A 3G0GA 5F7OA 5K0BA 1HDOA 5ICSA 3QXSA 1N2CE 2CL7X 1PGQA 3KQVA 1XAIA 5D6OA 1Z34A 3OM8A 2BC9A 1QZUA 2ZUTA 4MTLA 4Q4CA 5KCMA 4ZQBA 5SV2A 2BCJQ 4DRYA 2PWBA 5JSKA 1UFKA 5MF6A 2YWFA 1GQFA 1RLIA 2AJLI 4BN0A 3S81A 1XQ6A 5KTKA 2YHAA 1EIZA 4OHXA 4UPVA 4A3SA 5LXTA 1UKEA 1ECJA 4C6HA 2M9MA 2RB4A 2AI3A 1U2RA 1J4AA 2JBWA 3QG5A 5E6UA 4EEZA 1VA5A 4MB2A 4RA9A 3TNJA 5C7LO 4HYQA 4MQBA 4HS4A 4NCHA 4LW8A 1B3RA 3TAUA 2H59A 4YBRA 2NM0A 1XR3A 3IA2A 3P0FA 4J9UE 1CJVC 1JLHA 1PL6A 1CD5A 2ZJ6A 3EY9A 4U8GA 5B4VA 1Y6RA 3COZA 3I2FA 3A4YA 4MS3B 1NUUA 5DCWA 2X1LA 1DBQA 1MRZA 3MGGA 2UZ3A 5KYNA 3ZHXA 5DBEX 5JADA 2VJKA 3ACBA 4BFZA 2NSHA 4FFLA 3TE6A 4U7DA 2CVQA 4EEXA 1CCWA 4F72A 2ZT6A 2GEDA 3OQJA 5C5IA 4DE5A 5D3MA 2VL7A 3ET4A 3S3TA 3FWKA 5F21A 5LN1A 1M2FA 1LSJA 4P22A 5HF6A 4DWOA 3ZX5A 1DJQA 1J8MF 5AJZA 4EYQA 4ZYLA 2GRJA 1GPYA 3G5LA 4CW7A 1ZOLA 4GVXA 3NEPX 1SFRA 1KJ9A 4IWXA 4XI9A 3M6WA 2JHPA 3OIDA 2JIRA 3SLGA 5JCPA 2B5WA 3OBBA 4JBWA 3CEAA 2E49A 1QVVA 3FYUB 3NHSA 4HDKB 2R47A 3EDCA 4QBKA 4BXOB 1Q1QA 4NCIA 3QH4A 5K09A 3Q3VA 2J5QA 1G20B 2BGRA 1KEWA 3ROEA 2QLTA 3IA7A 2IP1A 1KP9A 2B0CA 4QODA 1E5QA 3MJEA 4GQIA 4I14A 4EQ6A 1JZTA 5CR9A 3VNQA 2OE2A 4FW8A 5DNAA 1GGVA 1F7UA 1NPDA 5AQEA 2P91A 2N46A 1L7OA 5D01A 3BXOA 1EFHA 3LX5A 3PFGA 3CRMA 1IULA 2XB6A 2PCJA 1GYRA 4G24A 4MYHA 4N7JA 2XWPA 4FNOA 4F56A 2WFLA 4UVDA 4UTVA 5K5EA 1V5IA 5KJFA 3ZVLA 4C0JA 4CV3A 4D8UA 1CT9A 3C97A 3EPKA 3L7YA 3MJTA 2X2OA 4R2XA 2ZSDA 1IUPA 2JIQA 4YH1A 1Y7HA 2NVOA 1DELA 4Q1EA 4OB6A 1Y98A 5FOSA 2W6MA 3A0UA 4X44A 4DV1B 3BG5A 3BREA 3WKDA 1HDEA 3NBKA 4KN8A 4DIFA 1IN4A 1M7HA 4EJFA 3VJRA 4WBNB 1UPTA 2JIDA 4OP2A 5J40A 1R9NA 3RQIA 1SXJB 5A2GA 5K3EA 6REQB 4JC8A 3O26A 2YZ7A 2PN1A 3LDFA 4HS9A 4Q66C 2DSNA 1SURA 3BRWA 3AR8A 1PQ4A 2FR8C 1WXIA 4LOLA 5LP6C 4BNUA 2G82A 3LXXA 4FT2A 3U2QA 1DMSA 3ZWPA 3PVSA 4R84A 1REQB 4WSOA 4X8OA 1M1YE 1EUDB 1CHDA 1P7WA 3GUYA 1X80A 1EFKA 4P08A 4PZUA 4ESVA 1XK6A 2FY8A 3OE4A 4NBLA 4PLHA 4Y0VA 3A1VA 2EKLA 2BKUA 3KO8A 5E9WA 4M0UA 2NTJA 5IMBA 5KYUA 1QYVA 3MINB 3OTGA 4UTOA 2RG7A 2VHTA 3NAGA 2O3UA 4JUAA 1UM9A 1YDFA 3CUSA 5J59A 4B8ZA 4B3DA 4F04A 4R2LA 1US8B 3W5JA 4IIHA 2PH5A 1K68A 2Z8YA 2HJWA 2I2AA 1JJBA 4QXOA 3WYEA 3E5NA 4C5BA 3IP7A 4RM2A 3FPKA 2E1PA 3GP3A 1LF5A 3L3BA 2EZUA 3OM0A 4NH4A 2MJLA 3D2CA 4UASA 4B3MB 2Q6KA 4PRYA 5BWBA 4RAOA 3AKCA 4FUTA 1OPRA 4W63A 3TOZA 3P45A 2GASA 5FA8A 1PFKA 1Q0SA 2EIXA 2UVDA 1F9AA 3BD8A 1EK1A 4Q34A 4ZQHA 3RG8A 1W35A 1YA8A 4MGIR 3IEPA 3D8NA 5IJ0A 2BDEA 1BXRA 3DFFA 1SR8A 2H52A 2XUPA 3N8IA 1BE0A 2VXCA 5CBKA 1YOBA 3GLVA 4Y6RA 4YMGA 2Y1GA 5ENZA 4EA9A 2ZRIA 2NT4A 3KT8A 4AZ3A 5HZMA 3T1HB 1XEFA 2D2XA 5CM2Z 4PO3X 3IXQA 2HIMA 1VHJA 2ROQA 1WMDA 2VDMB 2CXQA 3SZOA 1GNPA 1GA6A 3AT1A 3JQDA 5HZHA 3IL2A 3B20A 3RJTA 4EKYA 4OQXA 3DEFA 4OKNA 4KYTA 1A9XB 4DXDA 1KZ4A 5B7NA 3BKWA 2XQGA 2WWWA 2JA1A 3PHBE 5E1DA 3F73A 4N8EA 4CKZA 2I4LA 4HX9A 4LC9A 4FNGA 4GFDA 2KB0A 4Z99A 2P5UA 3KZXA 2Z2ZA 4IRMA 4ENWA 2GBPA 2LVBA 3ZJVA 2X3YA 4EKGA 2GAAA 4BKPA 1ORTA 3FFWA 2OBNA 3SDBA 2C1ZA 1N1EA 2IDKA 2A5FA 1TPYA 1ZVQA 4JWTA 3S28A 3OLYA 3B8HA 3RARA 2NXCA 3PNOA 1NVBA 4MDEA 1XRJA 1ZMOA 4HOYA 5DNEA 1SCQA 4D3ZA 3OOEA 3R5XA 4ETIA 1HTTA 2C5FA 2C42A 3N2YA 3D3WB 5I5GA 3UIEA 2V3VA 5CFQA 2I7VA 3B1FA 5J2TF 3MSXA 3PGVA 4Z4HA 5IKPA 3ONVA 3TN7A 3TMKA 3VISA 2OC9A 2DHQA 1G6KA 3KVOA 3EZ2A 1G5IA 4KKXB 3OZUA 1T29A 3DBLB 3G0DA 4YQZA 1W0JA 4XYGA 1EDOA 3W9SA 2WUDA 4JI3B 4XUCA 3VNRA 3SFZA 4TVSA 3KKEA 3LF1A 5CAEA 5JFGA 2WU0A 4OLFA 2NU7A 2GD1O 3I2IA 2Y71A 2IHKA 2Z8ZA 5LIRA 4EW3A 1WLSA 2PIAA 2D7CA 2IXEA 4MMYB 2PBZA 2YN2A 2Q2VA 3DZ8A 3HBNA 3LG2A 4EB6B 5IRCD 3IHWA 4Q02A 4ZVTA 1ODLA 1SIOA 4L6IA 2YMPA 4NFYA 1FDUA 3FE2A 1KY5A 1QZZA 5BQFA 3BORA 3JWGA 1YQWA 3C6XA 3GFPA 5TF0A 3SLKA 3X1DA 4A8TA 3TE7A 1HLDA 2ODEA 2WHXA 1KIFA 3FDIA 2P2SA 3JASA 5IDXA 1WB9A 2RKBA 2C5LA 2C9DA 4O25A 1M5UA 4HFNA 1KK3A 1C8VB 2SKDA 2R1VA 3L6DA 3PS9A 4ALNA 1DWUA 1T3HA 4CF3A 2V55B 3VPBA 2OV2A 1RQNA 4CCYB 3QA9A 3EXHC 5FNVF 3WYDA 3D3NA 1W0KA 1S1MA 4EL0A 1ZNZA 3B5EA 1DXYA 1XFDA 1ZS9A 2C2ZA 3EMDA 4BDTA 2NVUA 5JU6A 2OMEA 2IPNA 3LOPA 5CLJA 3HK2A 3H3JA 5IEBA 1TZMA 2B61A 2HCBA 3ZHTA 4B31A 3KJHA 5K0FA 4UKDA 3DVSX 4BGIA 1WHTB 3UGJA 1ICIA 3P9XA 5TB5A 1U1GA 4IDFA 2CSXA 2OO7A 3QOYA 1XN4A 2YYSA 1H65A 4QXRA 1BW9B 2IYFA 3KL4A 4OHFA 1U0JA 5FULA 3CISA 2VQDA 3RU9A 1BDJA 4QDZA 1UBFA 5ESXA 4AD8A 4DBZA 1RE1A 1HA3A 2HA4A 1Q84A 1UT6A 2CXUA 4UPDA 3SDZA 1Y7TA 2I78A 2QM7A 4OQLA 1TTQB 2V4MA 3L4SO 4MGHA 4JH0A 3RUHA 3BXXA 3U61B 2Y0EA 4RD2A 5GVSA 5H81A 4MV9A 3WHKA 4RLHA 4Q48A 2XMCA 3R75A 4MCHA 3QV1A 1BA2A 3HCWA 4MQ6A 3V7NA 3GAMA 2PG3A 4N1AA 4E2FA 5JDIA 2HB6A 4EG7A 1RCTE 3WBKA 4XQGA 3GRRA 5JQWA 3PKJA 3RKRA 4AMYA 1VPVA 2MYPA 1G7SA 5BMOA 1L7AA 3K3PA 1FLAA 2GB4A 4HDRA 4F9TA 2FG7C 2H1LA 3AVVA 4ZVPA 3DDUA 3U9LA 4CT5A 2EGUA 4XRRA 3QEBZ 2B7CA 1Y8QB 3CNHA 4P35A 1XRRA 2H18A 3EZ7A 4N5MA 4CM1A 5ILOA 1C1XA 1GGJA 1EX6A 1AM4D 1QHFA 3G5MA 4CDMA 1HEYA 4KH1A 1CC1S 5JD4A 3CUKA 1ZI6A 2XNSA 4CDGA 2W4IA 5DSZA 5EL0A 2FP3A 4OY3A 1MH1A 2AK2A 3N2KB 4IWYA 4OREX 5BMVA 3P0RA 3RIMA 4EZIA 2WC1A 2I7TA 3FNQA 2MSLA 4J16C 1LNSA 2H0QA 3M2TA 1RKQA 3PQ4A 5DMXA 2FEWB 5HJ2A 4UDYX 1OXVA 2OGWA 2R65A 3B36A 4K6HA 3OCZA 4KX5A 2ZB4A 4RNDB 3TW6A 4D2IA 3RREA 1T0UA 2VBIA 3H86A 3F5MA 5IJXA 3BHNA 3I9V6 5GGXA 1GU1A 2GXUA 2OK8A 2GR9A 4YDRA 3PYXA 1SRRA 5IKXA 1EXNA 4HB3A 4UD6A 5JMWA 1XD9A 1PSZA 3KB1A 1W87A 4P7FA 4RLFA 5KYGA 1EBUA 4Q7KA 1MJGM 2FFJA 4QASA 1T5HX 1JEYA 1FFSA 1FNCA 2I4OA 5IDYA 5JJBA 3HL0A 4CKWB 2QZSA 4Q1FA 1AHPA 4NMMA 5ALVA 3SSNA 3REOA 4DC1A 4IINA 3CLTC 1V5WA 1ZWLA 3MQ4A 4O0LA 3FVRA 2V03A 4Z51A 1D2AA 1UOOA 2VK4A 4KXLA 2MYUA 2WAMA 4RGQA 3RU7A 1HOTA 2QYHA 5JAIA 3DOFA 1QU2A 1H8ED 3CGGA 3GLHA 4BRUA 4Q21A 2PWPA 2HAEA 4IDHA 1WVMA 2QDXA 4UCFA 1J0BA 1NBIA 5FPQA 2EF0A 3AJ9A 1ZH4A 3V7UA 2NUPA 1LK5A 1DAFA 3D2AA 4D0NA 4IDEA 4NLLA 3DA8A 4Z9XA 1ESZA 1PTJA 1YIAA 4J6EA 4TTAA 4UUNA 2G17A 3HM9A 3KSZO 2FPIA 4IEFB 2VDJA 4CGYA 4H4CA 2BR4A 3LYLA 4R7ZA 1JB1A 4F5DA 4QA9A 4YRBA 2VDPB 3ED5A 1P7PA 2HM7A 2ZDGA 3Q12A 4HDAA 4WGFA 2V54A 4TTPA 1I2ZA 4X6XA 1CTQA 3RUCA 2C4HA 1FTNA 2F3RA 4D02A 4IZHA 3ZS8A 3QKRB 3WX0A 4DANA 1Z33A 1JLSA 2V0CA 4BNYA 2WVHA 3BAZA 4RE5A 3EY4A 1C30A 3AJDA 3D8TA 4FNMA 1BD4A 4KOAA 4O59O 4FOSA 4XLLA 5DCYA 4ZAZA 5M2QA 2BEVB 1CY1A 3GMTA 1CNMA 3RRZA 3AF0A 3N76A 1HLPA 5JYEA 5JEDA 3DE3X 3DOIA 3I39X 4TV9A 5EJGA 4ARZB 3NWPA 1NASA 3MD9A 4YT2A 4AWXA 4BMDA 5KOHA 3ZLTA 2KW5A 4TVKA 5EVCA 4GX0A 4BVBA 3ZE1B 2AE2A 2CHVA 1VMKA 3R23A 4IDAA 3VA7A 3RIGA 4H08A 1UBNA 4U6QA 2BISA 1EUCA 3PKIA 4MUNA 1DIAA 2XDAA 3VI3B 5EQDA 3LKDA 5HTOA 3QBEA 1GKUB 3LLCA 1E99A 1U3CA 4C07A 2UZAA 3FJOA 3A6JA 3ZWAA 3F7TA 4YA6A 1CIVA 2W70A 3OF2A 2OPBA 3WQBA 3IEKA 2Q1YA 1RZRA 1JDBB 521PA 4AKHA 1ADCA 3EGVA 5DGDA 4XPZA 2O2IA 3D43A 2IJGX 4FOOA 3D31A 1J07A 4DZZA 3OTHA 1JHZA 1N8TA 1IBMB 1L4FA 3JVIA 4LVCA 4D9JA 2GD0A 3VI4B 3A37A 3M5PA 1D3AA 1ZSNA 4CMIB 1HWYA 2HMVA 1Z74A 5K3DA 3RYHA 4AN4A 4K26A 1EXVA 1W29A 4C3OB 2AOUA 2ZI6A 3OJOA 4MR7B 1XRPA 3DFZA 5J4HA 1KTIA 2B1IA 2FUNB 3RKUA 4BNNA 2YHSA 3A6GA 1N3YA 5SZIA 4UNRA 3KETA 2YRWA 4BV3A 2C5HA 4U9IS 1P18A 3WV4A 4KIFA 1Y5RA 3THXA 4OYYA 4YJ2F 1JMKC 3IBTA 3IAS1 1COWD 3NIDB 3UOWA 4FYWA 3CVJA 1SXQA 4HSGA 2O2CA 5CDYA 2Q9UA 3A6FA 3EWSA 4DEVA 3QENA 5K9ZA 4O4IF 5CH5A 3ZHQA 3JQAD 1TAUA 4U3JB 2VPXA 3TQHA 3L0CA 4O8CA 5BY2A 1EVJA 1M0SA 1R0CA 3ANMA 3KX2A 5AVQA 1QE5A 1T35A 2CNBA 3O2QB 4JDUA 3GBPA 1X39A 3KJXA 3O9MA 1DJMA 4X8LA 1N7GA 1ADGA 1F38A 1PL7A 1ZBQA 2VVTA 2B2CA 1KZ6A 3FUUA 2O3RA 2CBXA 2YY6A 3L93A 1JXAA 3PNPA 4MAAA 5CH8A 1U63A 3WB2A 2Q5OA 4QGHA 1O9BA 5L3QB 1Y34E 2YHIA 5HEKA 3ZPXA 5E7QA 4BNWA 1AGRA 2GYYA 2NXNA 2B21A 1CW2B 1E5VA 1ADFA 1P0PA 5AJHA 2NPIA 5IYZA 4BQPA 5KSYA 1NXQA 2F4VB 2PRKA 4Y98A 4NAVA 4QBHA 3ZY6A 3FZEA 1XKLA 3VHLB 4AKIA 4UHFA 1R4MA 3TJZA 1IFXA 2XTMA 3LLSA 1I36A 2WR8A 4KODA 4ZVLA 5DM60 4AY5A 1N36B 1DCKA 2RGYA 3M6UA 2C84A 2VIIA 3EAQA 4L9AA 2F3SA 4QT0A 3HKCA 4QUKA 5ESDA 3CPSA 3M5WA 4N3GA 2GDZA 2VN8A 3MPUA 4PIPA 4TS1A 3ND6A 1YMVA 2VDQB 4B3XA 3QBVA 4ZDWA 3ZV6A 2IP2A 4ESHA 2HJSA 3OVMA 2QS9A 3DM9B 4FINA 5J9FA 3FMIA 1KO5A 1ZK1A 4M6WB 5FJIA 3AI3A 1NM5C 4G5FA 1PWXA 4J0FA 2VPZA 4CU5A 3I04A 1H0SA 4TT3D 3EEOA 4KXMA 4AWBA 4TXJA 5CW1A 4QTUB 1XWWA 2I7DA 1WVGA 4YWHA 2TECE 2W6ZA 3AEKB 4Z7NB 2PS9A 1NWHA 3CM0A 3I6QA 4KBGA 5GAJA 2UUCB 3BJIC 3D1LA 4IIJA 4PN7A 2IWRA 2QZPA 4RETA 3TOCA 1YIDA 3N9IA 4KQXA 1TA4A 3OPYA 4I1IA 4B6PA 2VDOB 4EVSA 3EE6A 3QVVA 4AS3A 4JI1B 1VXRA 1WB6A 3GAZA 2PH3A 3JQRA 1VJ5A 1DCMA 4RDHA 1GA4A 4B3SB 2BFNA 1E4EA 4KKVA 3SC2B 3RRNA 1A97A 4C6RA 4CV2A 3M4JA 1ZN2A 1DBPA 1GGKA 4OH1A 3R7WA 5KX5F 5KTTA 1XOIA 3CF4G 1ZK0A 4M0EA 3PUVA 5DLEA 4I4TA 2H1OA 2BTQA 2R86A 2IYEA 5IT0A 3PUJA 1NP6A 3WWEA 4CV0A 5K0SA 2Q6OA 5CLIA 2Q5IA 2Q29A 1N1GA 2IYAA 1L5ZA 4JKYA 4X3CA 2QTWB 4EYSA 2QL9A 2FN4A 2A30A 2V3WA 3MMSA 3VGJA 1XTZA 2QT0A 4PAQA 1TB4A 3BKXA 4PSAA 2BRUC 3GVPA 4XD2A 4NU5A 1SQGA 4DV2B 2QN3A 1IY8A 1T9GS 3TTVA 4DIBA 1LDYA 5FBRB 2DLCX 4KMSA 2FPXA 3BGWA 4TQGA 1VKRA 5IAKA 1N4AA 2WJ3A 2XGMA 1L7BA 2A6PA 4TV8F 2WWXA 4EKIA 3EIXA 5E8JA 3WZ2A 4GBED 4EI2A 3W8DA 4EFMA 4U2FA 1QYCA 1U3UA 4NV1A 2W2KA 2H3HA 4UCXA 2G7MC 1KNQA 1XZQA 2GSDA 3GEPA 1F06A 5C3UA 1WBDA 2ZWMA 1JKXA 1C80A 2J08A 1J8DA 2ZBRA 3D7NA 3ZU6A 2GERA 1XDSA 2JD0A 1H1DA 2R1TA 2F43B 2G09A 4MSUA 5JNSA 3BPSA 1JJFA 4QPCA 2HGZA 3I8SA 4DKJA 4U7WA 1P4JA 4DUGA 3A3YA 3EARA 4CKCA 1WV1A 2WJZB 4ZXPA 2BEJA 3D8HA 6LDHA 1C3EA 3OT4A 3ZHRA 2QGZA 2VPIA 3UAWA 4C0HA 4FKBA 5FB3A 1O97C 1C4OA 2JBAA 3I9LA 3OJEA 4RIEA 2GBCA 5KYXB 1YMQA 4EELA 1UANA 1YT5A 2CXNA 4L02A 1R0XA 1DZIA 3IE1A 2BI4A 3DHYA 4GE3A 2XXAA 3BFJA 1FP7A 1L5MA 5FL7D 1FYWA 2FNAA 2OL4A 3AEQA 4CL0A 1U11A 1RQLA 5BRNA 3D7MA 1Q50A 2NU6B 3RS3A 1Q7TA 1QG2A 3EUFA 4X71A 3VKWA 4GXRA 2XI4A 5F7JA 4YR9A 1R18A 3Q98A 5FIUA 1ZC3A 4MUBA 5J2TB 3AVXA 2N1BA 4I3HA 1O5TA 4HGQA 4JLSA 3I6IA 3W6NA 3V8BA 4ASUD 2W2XA 1WOMA 3IAFA 1M74A 3NB0A 4I5GA 1VHWA 1O54A 1R4ZA 4YY3B 3E18A 1X1DA 3QLVC 3GYBA 5EPUA 1FJHA 2X5XA 5JFTA 5GADl 4WXMA 3HKEB 5YASA 3D6FA 1BMTA 1BROA 4OJMX 1DRWA 3B3AA 2AHRA 4MOWA 1NJSA 3NHAA 4P4UA 4F4DA 5IKEA 3TLXA 2EL9A 3DMPA 3RVSA 3WB1A 1ESMA 1MNQA 1BE1A 2JIPA 1I3NA 2PPVA 2DT5A 5HIJA 4BP9A 1E3DA 3ORFA 4AJOA 2ES4A 1JGTA 5B57C 3F9IA 4IR7A 1DV2A 2BJVA 3SLRA 1E69A 4E5YA 4LE2A 4RC9A 2XMZA 3SXUB 1AG9A 1VP3A 5AK3A 4ZDJA 1XXLA 4GI1A 1SBCA 4KFTA 1NW9B 1QP8A 3AR2A 1X8KA 3F6RA 3Q40A 4G2NA 3PUXA 3ANSA 2J0VA 1O2DA 5TVKA 2C00A 4KITB 3PWKA 4L51A 4B8WA 2R66A 3BL8A 4NICA 4PHCA 1ZMTA 1U28C 2P9HA 4CL2A 2OCKA 1A72A 1WXXA 1W85B 3R7BA 4B2LA 3GNQA 3DXXA 4G9GA 2B2XA 4LI0A 5IC5A 3CW8X 3ZWDA 5EQFA 3LZDA 4LV8B 5SZKB 3I6ZA 3UPTA 1DE0A 2Y77A 3PQEA 1SA0A 1CS0A 4OCZA 1NAHA 3W05A 5COAA 3T1VA 1IG3A 2WJ4A 4IMIB 4TS9A 3NVDA 3W2FA 3L01A 5H82A 3UT5B 2GBFA 4YO8A 4V39A 1T4MA 5LQMA 4RVSA 4QJ3A 2A35A 4OEHA 4MS4B 1KYYA 4CMBA 4YP0A 3I0ZA 4X6UA 1L7NA 4IVPA 4A5SA 4F12A 4TMFA 2QG4A 5HILA 3TLJA 3A1CA 2X5NA 2W2MA 4XLTA 4BQRA 1R3UA 2O5VA 3ZI7A 4OQ4A 1PJCA 2RH5A 3V80A 5EJIA 5LKRA 3AFOA 2G63A 1BE8A 1BXZA 1Z5GA 2HH9A 2Q6LA 3H16A 3K1YA 4TRNA 1QAQA 1V48A 3A27A 4QHYA 4NTZA 5KVVA 1OBOA 5L95A 2GN0A 2AS0A 4X1YA 1E61A 4DILA 4HZUA 1L5FA 3EEYA 1J70A 5F1PA 5EP1A 4ZJYA 2R2GA 1Y8RB 2R6AA 4IXDA 4BYGA 1B1CA 4ZYTA 2J3LA 2C2MA 2MSNA 2BZGA 4S1PA 2JAXA 2BH2A 2Z1MA 3ABZA 2AFIB 3IBCA 3LQRA 4AU1A 2WDPA 3UA4A 5DP2A 5C8XA 3DE0X 1I4LD 2GXSA 2RGNA 2XOKD 3CTMA 3GGCA 3IRVA 4WN3A 4JJ7A 3V2HA 4F85A 1AHNA 5B4TA 2OY0A 3HA3A 5T7BA 2H48A 3E4DA 1RYEA 1XQ9A 2ETVA 1EJ2A 3GLUA 3IKTA 4OJKA 2H63A 2P8JA 4WKBA 1Z4IA 2VZ9A 1R15A 4JI2B 1TKBA 4PIVA 1U7WA 1KYWA 3MERA 1H2RS 3DSRA 2F64A 5HKKD 1YZTA 3ZDBA 1W1WA 4W8HA 3H6GA 4MEAA 4C6TB 1IQ0A 4I50F 4PLWA 3ZU5A 3VDQA 2XCLA 1VSQA 2FEMA 3TCNA 4DADA 1VFPA 3N75A 2IRWA 1Y82A 3WGZA 3DKIA 4P8RA 2GRAA 5BPFA 2VDKB 3KQLA 3ZHSA 2QW1A 5DF1A 4R98A 4EUKA 3N8KA 1MUUA 3BGSA 1QDUA 4YMWA 1JZQA 2FU5C 4MPDA 3USES 3ZKWB 3R3UA 4WKGA 5EXSA 3WKBA 2YOGA 3KHSA 3EXEB 4OD0A 1FXSA 2GN2A 1J5XA 1J8YF 4K3UA 3VR5A 3W90A 2YV3A 3KJIA 4JS0A 5BYAA 4OYLA 1L5VA 1EFLA 1N5JA 1W76A 4FK8A 4ITRC 4NWIA 5AYVA 1D1QA 3IUJA 1QMGA 2XYVA 2IYOA 4C4PA 1ZHFA 2WU3A 1DEXA 3D4IA 3BZBA 5U4XA 1VB3A 2CMHA 5CFZA 1N32B 4OMDA 1P4RA 2HQOA 2YV4A 1Q12A 4LYEA 1G60A 3AMVA 4L4ZA 1U8TA 2GS9A 1JU9A 1R6UA 4WY5A 1JLLA 3P9KA 3CT4A 2JKZA 4C7OA 2ZSEA 1C41A 1R37A 2ZB2A 2XIJA 1UMKA 2JI4A 3BGOS 3OEYA 5AM4A 5H3HA 1DKMA 3MRSA 3FTDA 4J07A 3WLQA 1E1MA 3EA5A 3P8ZA 4EARA 2E9SA 1JHVA 3WLJA 5HIAA 2BW0A 5KSOA 2PVPA 3A2LA 4JWKA 3PEWA 4YMUA 1JTVA 1QIMA 4P5PA 5AI5A 3UH1A 4WUTA 3ZDAA 2PE5A 3EUEA 1W44A 1A7JA 4YT5A 1GLVA 4UE2A 1Y6FA 1KY3A 2IYYA 4B83A 4FONA 3O7WA 2D0OB 2ZBEA 9GPBA 2J48A 3H2ZA 1I01A 1LEHA 1XHEA 2GUWA 4MWGA 4PQGA 3LIIA 4DDTA 3IV6A 1MX9A 4EKEA 4A1FA 3JQPA 4A8JB 4RVOA 5GIPE 2ZTSA 3VNBA 3PGXA 5H83A 2Q5FA 1GRQA 3IBYA 1PGOA 4UNPA 4YYEA 5LD2B 4Y2HA 3NOOA 4RZXA 4ZQGA 5I9NA 1CRPA 2G80A 1TD9A 4K87A 2ZQZA 2ZR9A 3FB1A 5T4BA 2WM8A 4C6SA 4R0MA 3KJZA 1ULHA 3ZY5A 1YUNA 4CBVA 1NN0A 1F6BA 2GEUA 5ITZB 3U39A 1IB6A 3FMGA 4F5WA 5CVEA 3IHLA 4H0CA 5JXJA 2WY2D 2RAUA 2VBCA 4LDRA 1AKEA 1SZDA 4DCGA 5B6IA 2O19A 2JFWA 2WU4A 2P40A 4IFIA 3IURA 2ORYA 1IUKA 2Q50A 3PFKA 4MR8B 2R87A 2ZJ5A 3H2GA 4KH0A 2QDKA 4MZDA 3T41A 1POXA 2QRZA 2ZETA 2JFQA 3BRSA 3C6QA 1VYVA 3GLQA 3MJDA 4A26A 1MPXA 5JSZB 3KIPA 4G4IA 2IZ1A 3P9NA 3P0JA 3ZGZA 2Q2NA 4I0WB 3UENA 1T3ZA 2E4ZA 3KOXA 3PPIA 1YJAA 4PG5A 3PIDA 4KDCA 4D6PA 2AYZA 5GGYA 2D2FA 3FOAA 4AO6A 3KQKA 4BNKA 4ERNA 2PUDA 2PYZA 2A5YB 1XZKA 5B1YA 1A8QA 1NTRA 3L7JA 2CL5A 4H6PA 2LNDA 4KWHA 1Z5ZA 1OTHA 3GVHA 4WFQA 5AI0A 4DY6A 1PR1A 1RYBA 2AUTA 3COYA 3E8XA 3ELUA 3K2EA 3PJGA 2XQIA 1PQPA 3UB2A 1E6CA 1UJ5A 5F51A 5AW7A 1U0NA 3EGXB 3IRUA 3PXEA 4MPTA 4KK4A 4X6LA 1WV0A 2PO7A 4YJ2B 4EA8A 5HQ3B 1U8YA 4TLBA 5JC8A 5B64A 1M83A 2X1MA 2LD4A 3AUSA 5MFZA 1MO2A 1OWNA 2R8OA 1RAIA 4P7JA 1JB9A 2ZYWX 2G4CA 3QWFA 3HY3A 1ZXXA 4O4IB 2WJ6A 2WHQA 4L73A 4W5HA 4NU6A 1NRJB 1HQYE 3O8QA 2D5IA 4F4HA 1HDIA 3Q3EA 5IF9A 4M89A 1YA6A 2P65A 3X1ZA 1XIVA 3ZCXA 5CBPB 2DTDA 1JS1X 2O2DA 3VM6A 1Y3FE 2AB0A 2JHAA 4FN5A 3WLMA 2ZUVA 4PGMA 5E3IA 2XCRB 1ZGBA 4MUMA 1RMYA 2G71A 2QQGA 1CZHA 3KEQA 2EX0A 3QVSA 1UQRA 2PJDA 4I6EA 4FMPA 3LRXA 3EX7C 1TTTA 3EXAA 2VG8A 1XRLA 2E7ZA 3QVLA 1XTRA 7MHTA 2G6TA 1ZONA 5AUOB 2UV8A 2JNWA 2XVYA 2XGSA 4TL9A 1NP3A 2HO5A 3RU3A 3V7YA 4G8CA 2W2QA 3E81A 3WFJA 4RTJA 3LRPA 3QBTA 4Q1DA 1PZHA 1PJAA 1XXHB 5B6PA 1YZQA 2WSBA 5I7VA 4IP0A 4EG3A 3VKUA 3TG8A 4KZPA 1HO3A 3D64A 3P9SA 4IJQA 1MB9A 3PE6A 1SNYA 4KLNA 1NVFA 5KYKA 4KN6A 2O3TA 4OYHA 4D8TA 1GSOA 4LF5B 5AOAA 3CWCA 3FWPA 5JD5A 1ZRMA 2JIMA 4BFWA 2DQKA 2QAGA 4U7FA 1YU9A 4L5IA 3FMOB 1W30A 3FCSB 3N87A 4EQZA 5JI3E 5K0CA 3IJ5A 2VDNB 3TUIC 1V2GA 4CUZA 4JR2A 4Y9RA 3T7RA 4E46A 2ZSAA 4Q05A 1KZHA 2UU9B 1B0UA 1BS9A 1DEOA 3ORHA 3FDFA 3NWJA 2H2WA 4OQEA 4PLTA 3UW3A 1RI5A 1F1JA 2AMYA 2OHHA 2G9ZA 3RABA 3UN1A 1OGYA 5I7EA 4KYVA 4D4KA 4B2YA 2DHCA 4N18A 4NS4A 2YRXA 3T0GA 1Z7YA 1AB6A 4RELA 2L69A 3OE7A 4WCFC 5BNTA 5GZ1A 3HABA 1C3LA 4G2TA 1PI3A 2XUOA 4RDIA 1I6LA 3HGMA 3KKPA 2BHLA 3OJ0A 3RV3A 2IDZA 1Y37A 2ZXEA 4BX3A 1P81A 4QG7A 3CMCO 2HC9A 3FI9A 3HKDB 5EINA 1FFEA 1QGUA 5JDIC 4FILA 5KMGB 1UK9A 1Q95A 3RASA 3RC9A 5KX5B 4IKEA 1VJGA 1ZOPA 3SSOA 3CUYA 2GN4A 4FIZA 2DR2A 1OB5A 4J29A 1R6XA 3A06A 3B6EA 3SEFA 5HRCA 4U9HS 2JATA 1D7OA 5LBIA 3TQFA 3AEXA 3D6MA 3HUFA 3H9UA 1SBYA 4LCJA 1MB3A 4YDHB 4EDFA 5BOSA 5JS7A 3GUVA 1ZMBA 4BE4A 4CMGA 2WB2A 2WIJA 3GCGA 3MLBA 4LV6A 2N9UA 3T5MA 1R5OA 4D82A 5JY6A 4C2AA 1GGNA 4MRAA 3RJZA 1EFAA 1OYVA 3C14C 1FS4A 3COSA 3NHLA 1OZ0A 1W4BA 4M9ZA 5KDLA 3S40A 3SKVA 2Z09A 5FT9A 3OKAA 1F51E 4HMQA 3BBLA 3H17A 3GDWA 2H2DA 2H1IA 3BJZA 3ZWKA 1G8MA 1BMFD 1TCUA 1RRGA 1V8FA 2C9BA 2YC2C 3FSGA 4H0FA 4TV8B 2IUEA 4MVXA 3ZGVA 3GUZA 1N5OX 4YJGB 4A0RA 2JF0A 1GZDA 2W2TA 3G2QA 1CP2A 2VCEA 3GV0A 3BM5A 1P61B 1WHSB 2FX2A 3MXOA 3CYFA 4Z4IA 2O48X 4PRLA 4PFJA 3USZA 3KJNA 1V16B 1XEXA 3LQ2A 4HDCA 3G3EA 1GG8A 4XFDA 2Q4RA 2FQQA 3SQDA 2DR0A 1TUIA 1ISRA 4QNRA 3CR8A 3PG5A 2VJAA 2PUFA 2VKTA 3SD7A 3WJ2A 3GX1A 4D43A 2ACKA 1QIKA 4WUVA 4WK6A 3L8EA 1CE8B 3DZKA 1RE0A 1W5FA 4JT4A 3BFKA 4JT2A 2WYIA 1PJLA 2G72A 3C74A 3U4MA 2Y8EA 3KSMA 1MIOA 3K8ZA 3Q8WA 1N7IA 1EMDA 3HCBA 3QYPA 3DBOB 4BBJA 4FDLA 3NR2A 5EMHA 4NCKA 1QPGA 5TPZA 1VPWA 3P9CA 1O97D 1ZGCA 4RH0A 4LVNA 5GVRA 2OILA 5L7YA 4DNFA 4ZYVA 5FQOA 1NRXA 1DOZA 1E96A 3HBLA 2AZTA 4MYCA 4OP3A 2YV5A 4EBFA 4XOUA 1HDCA 4GM1A 4A0FA 2XT0A 3KSRA 3W3ZB 3BWCA 4CG1A 3RQSA 3Q7PA 1PTJC 2F3PA 3O47A 4D0LB 3TSWA 4GXNA 2PANA 5AI6A 1XQWA 1Y81A 4S12A 3FNGA 4ESOA 1CF9A 1ZGHA 1CUUA 4OXNA 3S1AB 1FZTA 2BE9A 1WDWB 2BEWA 2D3TA 4KGZA 4MUJA 3B6JA 3VKVA 4A15A 2QTMA 2R00C 4RMNA 3HKBB 4YAWA 3EN0A 1B73A 4HAYA 4RPIA 3GLGB 1M6WA 1OV6A 1Y3HA 3MMZA 4M2LA 1OX4A 3MBKA 4RS3A 4DM3A 3AXTA 2XA9A 1M2OB 1MCZA 3VVMA 5JXGA 4F8JA 1JDPA 2OORC 2DKNA 2P8SA 3CEMA 4YB8A 1RWNA 3ZZ1A 1W0CA 2V9CA 3UFBA 3E7XA 3G13A 2UXCB 1DQRA 1HE8B 2BVNA 5CJPA 3DZIA 2NV2B 1GY8A 1XVVA 2WD8A 2WG2A 2XNKA 3MT9A 3VTFA 3WYCA 1IB0A 2YJ4A 2XUKA 2EJWA 1GAWA 1Z29A 1T5IA 3SS9X 3FRHA 4YC7A 2ZANA 1TU0A 2ZPUA 2FFBA 1HYQA 1WE2A 1T9AA 3KXDA 4CLRB 1XRSB 4LWPA 3W6ZA 3E2MA 4JBHA 2IU0A 3TRJA 1S2NA 4Z2YA 4L8FA 5HDBB 1Z0IA 3P0EA 4WLOA 4D4GA 5F77A 3GT0A 3T95A 3K35A 3EPLA 2JS7A 3W8RA 4BMOB 4FDTA 4DR3B 1D4ZA 4R8VA 1Q1NA 1WMFA 3NTRA 4ZVUA 5B7QA 1NNEA 4L28A 1GCUA 4WJLA 3L8DA 4RK7A 2FF7A 1KQ3A 4R16A 1N1MA 2B4YA 3MW8A 5AJYA 4LFBB 1NNSA 1UZAA 1DTWA 4LJ7A 4BFXA 4Z9AA 2WU1A 1ZBDA 5LQDA 3K70C 4BP8A 1KC3A 2PX6A 2YH2A 3PFNA 5IU6A 4TLCA 2IU4A 4MVJH 3OETA 2WWTA 3B38A 1LKZA 1ZIDA 4L8WB 1BEZA 2A78A 4XUGB 3RG2A 1E5DA 5C2JB 1E7QA 2FN7A 1NVMB 2FE4A 1WXHA 2HZBA 3CLUC 4IJ5A 4RS4A 2CLMB 4X41A 3WC4A 1N0UA 5AHRA 3QU5A 1GYQA 1PD1A 1Z6ZA 4B44A 2RSLA 1N2ZA 3ZXIA 1D2GA 4D46A 4NBNA 3NJRA 1XB2A 1OXXK 3IQDB 4HXFB 5CT4A 3NOVA 5LZ7A 4RCYA 1DNPA 4EPTA 1U0GA 3TL2A 1VP9A 1G5TA 3X43A 2OSBA 2BTOA 3SC4A 2ZUCA 2CLHB 3KUKA 2CV2A 3D8UA 3HZZA 2DRIA 4L75A 1MVNA 1MVLA 3V8EA 4UTXA 1U5BA 2XODA 3EUAA 3KKZA 3G88A 4RKEA 1DKLA 1MIHA 2ZR0A 2ZULA 4RF3A 4B7UA 4BX2A 3F6YA 4Z4FA 2C8VA 1IY0A 3CVXA 3BIFA 4BUJA 2PMBA 3FW1A 3VHXB 2OLJA 4D6YA 2RB5A 5BW4A 5K8VA 3ND8A 1A50B 1BVYF 1VCOA 1Z75A 2ZI9A 3O21A 3QU2A 1Z88A 4LJ9A 3VOBA 4PN3A 1C4KA 2JAOA 4LNAA 4MWTA 2W6QA 1Q16A 4HV4A 3WGJA 5GOTA 2XUHA 4UVEA 1K8RA 4Q7EA 1MA3A 2CYCA 4LAFA 4LPSA 4UHDA 3FOCA 1TD1A 3R0VA 5LIPA 1C9YA 2V96A 3O3OB 2RH9B 2GZ1A 3KNZA 4IUCS 1LTKA 2VH5R 4I1SA 5IT5A 4LNUB 2YJTD 5I7SA 4I50B 4M9UA 4I4LA 4DFDA 4DR6B 3BQMB 3Q11A 3IP5A 4J2OA 5TDHA 3KPWA 2JB9A 1J6UA 2PYIA 3A2NA 4DYVA 1IVYA 1M6VB 1QRRA 1UBGA 4C2TA 1HL3A 1KVSA 3DO5A 4OQZA 4QBTA 4LISA 4LJ6A 4LTMA 4YNBA 1OA0A 2JGIA 2X4LA 3RVOA 3DWFA 2W83A 4CKXA 4Q00A 1RXVA 2VRCA 1LC0A 2CE7A 1SOAA 4MMZB 1BX3A 2Z2KA 2AW3A 1CY2A 3HVHA 3SPXA 4HEJA 4J7XA 1PYDA 2IEIA 2OBFA 1SCBA 5AUQA 3T3IA 2XRFA 2FZ5A 1QYXA 3LTEA 1QH1B 1SVNA 1SUAA 4XX1A 4PLZA 4GKBA 1VLLA 1IATA 4LMRA 2JD1A 4DLPA 1MJFA 1S9DA 4RKQA 1QKKA 3C43A 5JMPA 2NPFA 3H2JA 3BQNB 3ZNQA 4BLOA 1XPUA 2FSVA 1MT3A 1ECPA 2QLNA 3EXFA 4I5DA 2DFPA 3RYIB 4P4SB 5F4ZA 3VR2A 4ZGBA 4NU8X 5CHEA 4KE9A 4D98A 1DAGA 2IHYA 2W43A 4EO7A 1QGDA 3DEHA 2O4CA 5DXAA 3ROQA 4W9RA 4YCLA 1AMNA 3LX4A 2AFHB 3H11B 3T9DA 2XNDA 4OK6A 4U0JA 1K3UB 1KGDA 2QTLA 4IIYA 1YXMA 2WUWE 3DWIA 3M6MD 3LQKA 3PKZA 1T2FA 1Q0QA 4A7PA 4W9MC 4ZTZB 2ON6A 3BRWD 3F67A 5FOUA 4AMUA 3M6AA 5C32A 3DFUA 3C3KA 1AKMA 3IMCA 2E4XA 2Q07A 1IL0A 1J2JA 1DFGA 4EHJA 1CUGA 3JS5A 2FOIA 1A69A 1KEEB 2QOEA 4PQRA 1TADA 1CR6A 1TCVA 3CX7A 4RZSA 4YCAA 4E4TA 4E7PA 3WA7A 1K92A 1QVZA 3Q9NA 1UC8A 4QTTB 3FPFA 4IRUB 4BLTA 3FPAA 1N9KA 2CVFA 2Y0DA 2PJUA 3LL7A 4R83A 2RBEA 4RQAA 3WBJA 2H06A 2RGBA 1X8XA 5IJAA 1POWA 1DAEA 3T4XA 3W5VA 4BL5A 3A8TA 1TAGA 3FNRA 4CLOA 5KJ1A 1RLTA 2A57A 5HPYB 3REGA 2FH5B 3B51X 3OJXA 3CVOA 2P9YA 4YQFA 4YCJA 3BH0A 4LQLA 4AX4A 5DK6A 1KEPA 2I1QA 3KKOA 2WM3A 4M8SA 3FOEC 2IW3A 3JD1A 1UDBA 4GMGA 1RQGA 4K5QA 4WZAA 2D7JA 2PWYA 3E3OA 3QMMA 4ZZIA 3ECSA 1HI9A 1KI2A 4HN4B 1Z4QA 1DEKA 2GF2A 1JAYA 1XMQB 5BN4A 3N7UA 3DMYA 1P2BA 1H0KA 4RACA 1SK9A 3P32A 1B8VA 1IM5A 1EFPB 1VKJA 3HWX1 1G3IA 5FBKA 5JR3A 4OBBA 1ZD1A 1G8YA 4W1QA 3I6YA 3KJEA 1UKZA 3DZBA 2ZWVA 3O4RA 5ICEA 4HUQB 4ZO6A 3TNLA 3BIJA 1C0EA 5CDFA 1INLA 3TTWA 4ROTA 2X14A 5FR2A 3D6HA 1DRUA 1GNLA 1N6HA 4JR1A 2A9VA 2RC5A 4QTZA 2CXRA 4BKQA 4K8OA 3E70C 4F4IA 3INGA 2FETA 2GETA 4BLPA 4CN9A 4YUYA 4DLTA 2N47A 4RKYA 1QCDA 1TQ4A 1Y6QA 1E9VA 4JP5A 3QVUA 4QJIA 5AVJA 3G02A 4Q3EA 3G79A 3VU9B 1N6RA 4KSBA 1V5GA 4PLCA 1WETA 4KAAA 2J67A 4KVGA 2W2VA 4Z0NA 5A71A 3ROFA 4KVFA 4FZJA 4YCNA 2LTAA 3U7RA 4I9FA 1PSDA 3NHKA 3V4PB 2FPPB 5C8DA 1JVBA 4TKZA 5FA5A 1EE9A 3ZXXA 4Y1GA 5HUQA 2IITA 4D99A 1MAVA 5C37A 2UUOA 2Q9AA 2PSJA 3NM4A 3PFHA 3ZQKA 2GFIA 3KE8A 2WJWA 2JFNA 4WXHA 5HE9A 2C8LA 3KDSE 3VR4A 2YICA 3V2UA 1K7YA 4JUCA 4RMJA 1IHYA 1ORHA 2RGEA 3GGGA 3IAM1 3NI2A 3TVYA 1A04A 2BJWA 1JECA 5J4LA 4IQGA 5E6SB 2FN9A 1UP6A 2BKAA 3F3YA 2CNOA 4FB5A 5J63A 1ZJWA 1V9LA 4EB3A 3E9MA 3LQQA 1G17A 3DR5A 5T4HA 1WUTA 2TYSB 5BSFA 4URHA 4MRPA 2EP5A 3ICEA 3LFTA 2QX7A 2QE7D 1HYHA 1N9ZA 1O58A 1XCMA 3AESA 1PFUA 1N9GB 3A4NA 3QFCA 3QFRA 4K9NA 1VL0A 1BGVA 4WQMA 1RYNA 3II6X 2O50A 1KI9A 1RHMA 4ADSG 2ZRLA 2RI6A 2WUGA 1V96A 2J3QA 2VHQA 4TMKA 1O6GA 1DOAA 3I09A 3L9WA 2J32A 3WXMA 3NS7A 5ALIA 3VKFA 2D5CA 3EJ6A 2ZUSA 3WRWA 5CFRA 3CZQA 3JQ7A 2G4VA 2BFMA 1SRQA 3NETA 5EIHA 1DIBA 2HMSA 3U4IA 1PR6A 5LU8A 1UC5B 5BNFA 1CQZA 1DC6A 3OZ7A 4J7UA 4GVPA 3CX6A 5F98A 5KTPA 3WMEA 4HAZA 3HR4A 3GJTA 4WI1A 1F4LA 3ZDQA 5K20A 1V47A 2QSJA 2ZT7A 4PSVA 3RUAA 2XRZA 2V0GA 2BL4A 2WA1A 2WUVA 3FUCA 3RYFB 1PG0A 4MI3A 5C46F 1GTRA 2FUEA 2P2CA 4FTWA 4LHZA 4YRAA 3GLHE 2B35A 2HRCA 4KRYA 1IIRA 3A9RA 4B4OA 3CY6A 4E03A 1C0KA 1E7WA 1Q83A 1QC5A 5D2CA 5KYVA 1FJXA 2AMVA 2KMLA 1KHHA 5KAPA 1IY9A 5G0TA 1K89A 2Z6UA 3S44A 1ZSYA 2HA3A 1VPTA 2C07A 3DXZA 2D0PB 3AY3A 1PFGA 1SZCA 1BFDA 1GEGA 1KIAA 3AOEC 5JW6A 3K1JA 4DR1B 3AV0B 1ZU4A 1FSGA 4ZEVA 4A2WA 4BP1A 3CF4A 3KOZA 5FR1A 2Y99A 1JA9A 4FDUA 5HF8A 3TMAA 3HV0A 1GTSA 4PANA 1OH6A 3AERB 5M34A 1X8JA 2W2LA 4HATA 4WINA 4XJTA 3PVCA 3OOSA 4YP6A 3PEYA 2FMUA 2G1UA 3NP9A 3OX4A 3QV2A 4GUDA 1P1CA 3C3WA 1USWA 4H7PA 2YHUA 4KDRA 4PLFA 4F11A 5AVWA 1C7EA 1LV7A 2QJRA 3NBYC 2ZJ4A 4BVJA 3ERCA 5AK5A 5EPOA 3WMWA 1S1CA 2WWHA 2Y1XA 1V5FA 2J5RA 2V7QA 3FTPA 4Q4AB 3HB7A 4MWEA 1Q2XA 3EWIA 3G8CA 2J33A 1B6RA 2GK3A 3U7IA 3OU2A 4WOBA 4Z6KA 1DV1A 4IGFA 2N1MA 2OT3B 4JBGA 2VNHA 5H3LA 3NJ8A 5CFOA 1VJ1A 4DR5B 2NP6A 1G7CA 3BD6A 5AJVB 2FEAA 4AMGA 3K0CA 2QX9A 1PDOA 4GH5A 1W2HA 4JLUA 2G5GX 1TGVA 3I23A 4GZLA 4FGJA 5LCXA 1XD2A 4WZZA 1E3QA 4WGGA 1RWMA 1ZIPA 2IYZA 3GU3A 4REQB 4V2UA 2D1SA 3PXGA 2ZRFA 5AKJA 5D3KA 3UOGA 3GELA 3C6KA 4TQ9A 5F9FA 4C7XA 3NATA 4WZBA 2I4NA 4LKRA 5EIAA 5EP3A 5FA6A 3FJYA 4Q4HB 2INGX 4TUYF 3WRYA 1WKCA 1YRHA 4IZOA 4AAYA 3Q3GE 3FPEA 5JVDF 3LBAA 3ZNPA 2ZLBA 4BX0A 3LPCA 5DTQA 4ESEA 2XKKA 2AGVA 4PVDA 3T7KA 1GRCA 3TTXA 3QF4A 1QRUA 3I1IA 4HQLA 1FQJA 1N2GA 2GPWA 3EG9A 1CIJA 1H2ZA 2AV6A 2GPSA 2OMKA 4TS3A 5EWMB 4ZD6A 2OYRA 1RPJA 1AX9A 3UHAA 3HRKA 2QBYA 4QUDA 1LPSA 2EFCB 3SIXA 1DBWA 4HF7A 2H4ZA 5HVNA 4MCJA 3FNHA 1JEQB 1QYIA 3PWTA 4OJYA 5AO9A 4DDKA 3MC1A 4E6EA 1XO1A 5EMNA 2X0IA 1CUSA 4IDGA 2FWPA 1JEEA 1FYVA 1NIPA 4F45A 1AN9A 4PRKA 4EY5A 1JE1A 4EM6A 1L8XA 2IYPA 2D0IA 1XNJA 1Y9EA 1G66A 2HNKA 2Z5GA 1JMVA 3PRHA 4NEGA 4G4JA 2JCGA 2PXXA 3IVRA 1P62B 3F8SA 1USVA 5P21A 5FLKA 2C9ZA 3O6VA 4GOOD 3TVTA 3EGIA 3SYLA 3D4PA 3EDYA 4JSTA 3EDMA 3FDXA 2HTFA 3IPLA 4N5NA 3S5UA 1TAQA 3AVUA 3HXQA 1WSAA 3UMYA 3EH2A 5LZ5A 4TL6A 4P0PB 1JPNA 5EJ7A 5CCBA 4K3VA 1E2PA 3WLLA 2HNAA 3BMOA 4CIVA 1ZYUA 2J0EA 4MNTA 3K8OE 3N2GA 4RD1A 3OZWA 5LBUA 2XTJA 3DKKA 4YTEA 4O4LA 3Q8KA 4WKCA 2XCOA 4HLUA 1XVAA 3MWKA 4IGAA 1T6BY 1Y1PA 3SJZA 5DBFA 1H4VB 2FF5A 1LX6A 3KR0A 3UMBA 2Z5VA 3MCAA 3PA8A 4H1WA 4NDAA 8OHMA 1GG2A 4OI2A 3DH0A 1ZESA 4V2IA 1Q7BA 3X3HA 4A2QA 3K9QO 1FLDA 1APBA 1ULTA 2WD7A 3G0IA 4AB1A 1JEJA 2QZZA 1QTRA 5DGXA 1YB7A 5TPWA 2RHRA 2GZMA 2QR2A 1CDZA 2CLEB 2LWIA 4FD2A 4H3SA 1TJ3A 4P80A 1DO8A 4R01A 1RAEA 3AQIA 4HBGA 3IHTA 3ZIDA 2Q1WA 1YI1A 1ZVKA 3H5IA 3QG1A 5A3JA 3OUUA 4HDMB 4M0LA 3QE0A 3PJFA 4XVUA 4DM4A 1DKRA 3KWMA 4MQ4A 4OXRA 2XWBF 4UM9B 1HNWB 1ONOA 2JDIA 4BMZA 1D4FA 2C94A 4G97A 5DYNA 4DIUA 1RRMA 1RZRD 4EH1A 3PTAA 4YCDA 1JWLA 2F1JA 2BFOA 1RM3A 1L1EA 1HFEL 2NUAA 3KYDA 5HW0A 3FR8A 3KQNA 3FLEA 3EODA 3VC7A 3CH6A 3T8YA 3J7AC 3OJFA 3EGDB 1XZ8A 1ZGJA 3IDZA 1ZI9A 2BGWA 2UUBB 3MWEA 2TMDA 1GXSB 2QT1A 4R1LA 5EJ6A 2VAVA 3OT1A 3CBQA 1OROA 2GN6A 3CLUD 4MRNA 1WPXA 2VH1A 1T5DX 1P45A 4CMKA 1GFIA 3MS2A 4QOGA 2FB9A 4BOYA 1YAJA 3T3EA 3FGZA 4NIMA 4F3CA 1QBGA 2PZJA 1F9EA 3B12A 3FPJA 3FY4A 5AVRA 2JI8A 4ICIA 1M54A 2PS3A 2YCBA 3JYLA 5J1TB 4LXIA 3GQBA 2BFDA 1YB2A 2VRNA 3HDTA 3IIJA 3Q6NA 3N07A 3UHFA 4DQKA 5J58A 1JDNA 4PYNA 3WFZA 3O8CA 3CONA 2YNMA 3L8FA 5I4IA 1HQCA 3LY7A 1X9HA 1HR0B 2C54A 3RLFA 4BJ6A 1CEYA 3OM1A 2C2BA 3QNMA 4LMPA 4Y2XA 5A3RA 4B1FA 2PQ2A 5AK4A 3UH0A 1JR3A 4J0GA 1Z4KA 3VYUB 2OG2A 1GGMA 1KARA 1ULSA 3P9QA 4FJ0A 3KLMX 4LWZA 1OA1A 3L0SA 4JOQA 1PX2A 1B2RA 2JJQA 3JR7A 4BWGA 2ZTVA 3TGWA 4D5GA 2CV1A 3JZFA 1RD4A 4NZOA 3TQSA 4CV1A 1P91A 3JZIA 3I64A 3DCJA 3QVTA 2R62A 1J1IA 2XVXA 4H9GA 3HYLA 1W7AA 1OXBB 2A0WA 3ZBPA 1UT5A 4N41A 1M8PA 2OHIA 2J6CA 1T25A 2XJ4A 1PT9A 3CR7A 5CRIA 5GONA 3IMFA 1A9SA 1NNI1 3UKDA 4DG5A 3SF8A 4BEBA 1GU0A 2AR7A 1YSCA 3QLUA 3RSSA 4WT7A 3AL2A 2DUUA 3BK7A 5TARA 1DAKA 5CJ2A 1DHRA 1RAFA 3N58A 5THQA 2FPOA 4JOBA 1MD9A 3NU1A 2A9FA 2DVMA 2RONA 3WKCA 1O8CA 1KEVA 1L8LA 2FLKA 4U6NA 4C4TA 1BGWA 1AC5A 2X5KO 5GMOA 3HJRA 1NBMA 1W1IA 4B7CA 3D8SA 3C3PA 3IAUA 4JP1A 3KHTA 3U3MA 4DSTA 4OHRA 1GTVA 5KCZA 2RAPA 4ZQFA 3FFTA 1C50A 2RHHA 2XYRA 3DXFA 1KR5A 1KSFX 4ZOLA 1O0SA 1SZJG 2NV0A 3CJRA 1OWPA 2R3SA 3LLVA 1KOLA 3Q8LA 1OILA 1YRQA 4JQSA 1E60A 3AF3A 3MTDA 3LO5A 2O8EA 3PB3A 3GDGA 1Q0LA 1FUEA 4E1AA 1KZGB 2P5TB 5K0ZA 4XYLA 3AW8A 1SCIA 3RT1A 2VH2A 5TNXA 3L1VA 4B6SA 3DE1X 1RTTA 5DTMA 5MDHA 4MYRA 1T8RA 1PZXA 4QEDA 4QYMA 4M8LA 1MXFA 2YIMA 4F8YA 1XTIA 4DNQA 1E5TA 2VXYA 2GWHA 2MYNA 4KMRA 3AUYA 2OP1A 2C4WA 1U9IA 1CZNA 3NUZA 4FJ2A 4RE6A 2ET6A 1UP4A 4GMKA 2B20A 4YCCA 3UWOA 3VU1A 3K0EA 3M33A 4IJWA 4ND5A 4TTSA 2FPGB 1PW5A 4TTIA 5LQRA 4S1WA 1HTWA 3NEJA 4RORA 5L8VA 3R9WA 1WF6A 2VF7A 3SJCA 1IOZA 1ISFA 1NAIA 3RC8A 2RAFA 1Y89A 3PGJA 2GFQA 2O0LA 3HDJA 3VQTA 4ZI7F 1DX6A 5EP2A 3WV5A 2O7QA 4FEEA 2OXIA 1X9GA 2IEBA 2ZIZA 3GCDA 3PQDA 1HUQA 4JOSA 4R1NA 1N4DA 4P86A 4UUMA 4NULA 4UBKA 3D81A 4MS3A 1GQSA 2CF5A 3TOXA 3F1KA 4RADA 2BTEA 2NZ8A 5G0VA 1DUVG 3AC0A 4BO6A 5KQSA 2BGJA 3LWDA 1YOVB 3A4LA 1HYEA 4X20B 3SR0A 3TOSA 1Z62A 1EP2B 4JX8A 1CZOA 3R41A 1WXEA 1W4AA 4KG7A 2YCLA 4K1XA 3ANNA 1FFHA 3H9CA 5EFZA 1R7RA 2I8AA 3I58A 4DCCA 2L18A 5FAKA 2IYTA 3VYWA 1FVOA 3AB3A 3AVWA 1O77A 3LYHA 3DR3A 2FR0A 4IJ6A 2QN6A 2VHCA 4JCOA 2WIKA 1RLOA 3BJEA 3ETHA 3HACA 4XIGS 5A4FS 1FW6A 1Z16A 1KERA 3FDZB 1YJXA 1H3FA 3CLKA 2W4QA 4H60A 4DUGD 4KHPB 4DMLA 3UK2A 1I2MA 4BWFB 3MFQA 1P39A 1E8MA 1QIDA 3WGIA 3BHJA 4PEVA 5DM2A 2ZTMA 4V03A 3CUEF 4DTIA 3F90A 1QJCA 2HU2A 4J7AA 2WTUA 1A9YA 3FYUA 1S4MA 5DHPA 4HDKA 5DLQC 5BRJA 3RVKA 4Q82A 2G4LA 2OVBA 4EZBA 1OB2A 1DKOA 1FVXA 2DSTA 1FP1D 1IBCA 3HCOA 3Q8MA 1G20A 1TEHA 4KIGA 4OLBA 1DZ3A 3D1JA 3IP3A 3WK7A 1TK2A 5ESWA 2QRLA 3SHVA 3KKQA 1D6MA 2BEUB 5J43A 2QTAA 3L7LA 4MK4A 5D51S 3N53A 1L4EA 1ZPDA 3GROA 3PDHA 4PBTA 3TOVA 5KQRA 5KWJA 5IXYA 1U7ZA 3CU5A 2GAFA 3K5IA 3OE1A 3VUEA 3UK0A 3ZY3A 1W36C 2UDPA 2HPAA 5CIWA 2O8BB 3KBBA 2VSQA 3M2PA 5TRTA 1BDHA 1GADO 2Q8QA 1L2TA 3O0TA 5A5GA 3DTNA 1XCBA 5EZYF 2X8JB 4KBFA 5TIIA 1A2BA 1LLQA 4WK0B 2ZS7A 1OD6A 2RK3A 1FDOA 1YL6A 2YQZA 4WNAB 1ZIXA 4WBNA 1P9WA 4LRTB 1JEOA 1SXJA 3LHIA 3L6UA 6REQA 3KZMA 2D6FA 1RCFA 4GW3A 1X1TA 2PLNA 4I5FA 3UM9A 1EUQA 3MYRA 2G3YA 4YMHA 4I9HA 3CRQA 5CDUA 2CZGA 1YZUA 2OR3A 3UJPA 2W6NA 2ZJ3A 1GGHA 5CCXA 1REQA 2B5VA 1LLUA 4J0IA 1LXCA 2OXTA 3SKXA 3PSAA 4MICA 1Z7EA 2O0KA 5IAGA 4LDZA 4DCMA 5JJLA 2V6BA 3DLBA 2RC6A 3EVBA 4LHEA 4TMYA 1HNXB 4DYHA 3MINA 1CZRA 3U40A 1QV6A 3RHZA 2IELA 4D8WA 1US8A 2F7SA 4MP6A 3MGAA 1XRNA 3LUAA 5JBQA 3J80A 2PS0A 5FV7A 4ZT2A 2V7PA 5LQSA 4P1ZA 1NDHA 4KFUA 3ZEIA 4ARCA 2HQRA 3DCYA 5CLLA 1JA1A 3AGQA 1JT2A 2ISSD 3DQQA 5EJ9A 1CQWA 3GWGA 1GAXA 3GA7A 2FW8A 4OBXA 1JDSA 1JIKA 1RWQA 3FKQA 4GC5A 4L4XA 4TWAA 2IC5A 2V97A 1M7GA 4Z49A 3ROZA 1PJ4A 3MN1A 2UZIR 1GUYA 4MINA 4Y2UA 2PUBA 3O3CA 4ZRNA 1AQUA 4NFSA 1QO0D 4IICA 2QE6A 3W3AA 2HW8A 4INOA 1P74A 1K0UA 2JLQA 3AX6A 4DS3A 4KDEA 3TKLA 5LZ2A 4OO3A 3RHFA 3ZHYA 5I48A 1MX3A 2GAIA 4DIKA 1EVZA 4GT1A 5BPHA 1E1DA 1K2WA 3IX7A 3ZD7A 1RWVA 3HB4X 3ZYZA 1GT6A 3LQ1A 1GKYA 1A9XA 1FX1A 5BSUA 2BBWA 2KX7A 4INAA 2XZLA 3FFAA 3LSYA 4NG5A 1G7RA 2I67A 1NBWB 1S02A 2XUQA 3E48A 2AZ4A 8ADHA 1NW3A 1NN3A 3H9GA 3WK4A 1PE0A 2P68A 1OLOA 1EX7A 4IYRA 1GWNA 3EIFA 4H59A 4KQHA 3ADBA 4LA4A 3DWEX 4EJMA 4D3YA 3I9V1 1FDWA 3A70A 3ADCA 2JLSA 2PMKA 3AUUA 2Q3HA 1O5IA 1UZUA 2Z3WA 2PX3A 3MMNA 4PQFA 5EZ5A 1QM5A 2NO0A 2XE8A 3D3WA 3LCCA 4IOJA 3P9RA 3Q7RA 3WKAA 2NOAA 3MJHA 4XVCA 3H5LA 5A6SB 3I6BA 4B5KA 4Q39A 1KRWA 2FDRA 3EZFA 4DCJA 1LVUA 1V41E 3EPRA 4HNRA 1ZLYA 2FXVA 3TBHA 2V3CC 4PLGA 1JBQA 3DBLA 1DINA 3QKIA 4DSNA 5JAMA 1AS2A 1JHUA 4BQEA 1Y3DE 3PYMA 5CLGA 1N78A 4RF2A 7MDHA 2QORA 3IAHA 4TUYB 3T1QA 2AQKA 4Z7JA 3R44A 4H31A 4IXMA 1RYDA 3U4QB 3N8GA 3BMQB 3GFGA 2QTFA 1W4LA 4X95A 3LX8A 1PWYE 4WJZA 3S2UA 1BS1A 1MC1A 3EOBI 2JLBA 2ZE5A 3FWHA 3IOBA 4EW1A 3BZWA 3ED1A 3VR5D 4L5CA 5CK5A 1F48A 5HG0A 1FS5A 4YR7A 3MHTA 5H9VA 1T0PA 2QRNA 3QVMA 1HG1A 1K6IA 1TM4E 2C5AA 3RWOA 2YMMA 3MOIA 4N3BA 3R7SA 1T5OA 2FWRA 4GE0A 5CVUA 3WNZA 4DC0A 4R69A 2HJGA 2VYVD 3CIFA 4Z7QB 4YVFA 3WI7A 1YFLA 1OC4A 1SOUA 1ND6A 4HPWA 3N6VA 4MVJI 1DGQA 1UKYA 2D1TA 2QUIA 1QWSA 4OQMA 2SICE 4UJ3A 1RADA 3BXHA 1K4YA 1F0YA 1RPAA 3NW9A 3PT5A 4D8XA 1SUFA 4ZGGA 4N40A 1G59A 1WHTA 4DDMA 1Z0KA 3TQOA 1ZCJA 4QJBA 3ZV5A 3K6SB 2C7OA 2BSAA 4QX6A 1EGVB 2ZPTX 1X13A 2ATCA 4CIXA 3THWB 2CSUA 4CR7A 1BW9A 1QZXA 3CRVA 3IUNA 1BCRB 2Q99A 4KLCA 4KV9A 3I2GA 4CNBA 1C9MA 2IY9A 3I53A 1QHNA 1SVIA 221PA 3IEIA 2WKRA 3REQB 3AJEA 3ZJUA 2OXEA 1KS2A 4IQ8A 3L7OA 1G8PA 4XX0B 3M6LA 4ME6A 3WZMA 2P9GA 4HAUA 1U04A 2BKEA 2GEBA 1PNVA 2XAUA 4AZTA 1QHHB 1VHQA 3FKJA 3N1UA 4XZ3A 1KYVA 1NVGA 1R0KA 2PZKA 3PLAE 3F8WA 1PYOA 4WLVA 1G4AE 5LMZA 4JBYA 3C5VA 3PWSA 4EFKA 3FJ1A 1T2CA 2ZXFA 1H6BA 3VKHA 3T3HA 3KR9A 1XVTA 1VPDA 3A04A 4MKRA 2Q8NA 3H3FA 4A4DA 3TS1A 3PDIB 4RFLA 1T9DA 1AUXA 1DSSG 1XZGA 2B83A 2NAPA 3ZHZA 3R1IA 3VSEA 2YV2A 2PVCA 4D4IA 1IRIA 2RKWA 3B6ZA 4WVFA 4HUTA 5JDCA 4KSCA 3DLIA 4WOJA 1D4OA 1C3XA 2FHPA 4EY6A 5CVTA 2OAP1 3EOZA 3FLAA 3I0NA 1Y63A 4CFYA 3LMKA 4LHWA 3CZMA 1O9HA 3T7SA 5JFOA