2QTRA

Crystal structure of nicotinate mononucleotide adenylyltransferase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
b'MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
publication title Kinetic and X-ray structural evidence for negative cooperativity in substrate binding to nicotinate mononucleotide adenylyltransferase (NMAT) from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 56
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qtrA00
2HGZA 4KR9A 1JEEA 1EE1A 3RFFA 4DJAA 2GOYA 5H7XA 1K97A 2YXNA 4EG1A 3SZGA 1TYAE 1SURA 3VRHA 2Z08A 5TGTA 4MUEA 1Q19A 4QREA 4CQNA 2DERA 1J20A 2AG6A 1ZH6A 3CLSD 4ARCA 1F9AA 1KP3A 3OP1A 3ZUGA 4KPUA 4DDMA 1JMVA 1OWNA 3ND6A 4PY2A 4NX2A 3CA8A 1IHOA 2O8VA 3PNBA 3ZGZA 1UFVA 3DLAA 4EG8A 4F3RA 1U7DA 2CYAA 3H05A 4MLPA 3IOEA 2QJFA 3MLAA 4ZT2A 2CV2A 1JZSA 2IJGX 4XFJA 3IVCA 1F4LA 4ND7A 1U0BB 5HUJA 3ZJTA 2A1TS 2DUMA 3KT0A 1O96B 3UOWA 2ZUEA 3IH5A 1EFPA 4NAUA 4WNYA 2GM3A 1VBMA 1H3NA 1N2BA 5J5AA 1QRSA 4YBRA 2CV1A 1G8HA 2QTNA 1F7VA 2E18A 5BNZA 2I1LA 2QTRA 4PBSA 1XNJA 1G8FA 2X1LA 1LW7A 1DNPA 3FIUA 3RHSA 4R0NA 5KCMA 2VTBB 3FOCA 2CYBA 3DV2A 1VL2A 1O5TA 4G6ZA 3HV0A 3U1VA 4EG6A 3H97A 5FO0A 1O97C 3QTTA 3IMCA 2BTEA 3CLSC 1G8GA 1TQ8A 1PFWA 1R6UA 3H9BA 1IQ0A 3CLRC 1WZ2A 1XNHA 1M83A 4KPUB 3L93A 1KH1A 1VLHA 3IDFA 1N2EA 3IOBA 1PFYA 1I2DA 1D2RA 1OD6A 3ELBA 2DR2A 3L92A 4J75A 4KKVA 1H3FA 3MLBA 3QTBA 4JZYA 3FH0A 2C5SA 4MQ6A 4ZT4A 2CT8A 3S3TA 1IQUA 1KP2A 4YP5A 2A4MA 4GU5A 2IP1A 1XJQA 3AFHA 4DNXA 4ZCRA 2XRYA 1B6TA 2AZXA 4KR7A 2AKEA 3AL0C 1EJ2A 2E89A 2ZP1A 3DO8A 3FY4A 2YWCA 1MBZA 1KQOA 1QNFA 2O5RA 3KT6A 1S4MA 1NUUA 4NZPA 2Z3VA 4MVXA 2DEUA 1GAXA 1JECA 3IMEA 3FI0A 3PNYA 4YP6A 4QBTA 1QTQA 2A1TR 1MB2A 1J21A 3SEQA 2QUHA 2DXIA 4ARIA 1N2GA 1ZUNA 1M8PA 3CLTC 1WXHA 1N2HA 4ZCTA 1I6KA 3IUBA 2A88A 3CLUD 4R2MA 4R2LA 2ZUFA 1QQTA 1CT9A 1N78A 2TS1A 4XFDA 1ZH0A 2V0GA 2J09A 3FNRA 4GRIA 1WXEA 4EG7A 4MWEA 4MW9A 1O0CA 2RD2A 1O6BA 3P0JA 2J5BA 4MVYA 3RBAA 4BWVA 3NBAA 3TNJA 3GUZA 5FO1A 1V47A 4KR6A 4HPWA 4MUHA 2A1UA 2E0IA 1WJGA 4MW1A 3LCJA 4MUGA 1NUPA 1YIAA 3D6UA 1N1DA 2OQ2A 2QUJA 1EFVB 4MWBA 3N2YA 1LI5A 2EL7A 2PG3A 4L2IB 3KFLA 4E1AA 5HUHA 1TFUA 1H1TA 1MOPA 1TYDE 1Y42X 4U7JA 4X0EA 5K0SA 2RE8A 1NI5A 3N9IA 3P0HA 2EJCA 2JA2A 3HMQA 1I6MA 3M5WA 3CVWA 3LOQA 1PFVA 4DDHA 1QU2A 4OUDA 2VXOA 1RQGA 3IODA 1YI8A 3JXEA 3FWKA 2A84A 1WY5A 3INNA 3UC5A 1H3EA 1V8FA 2WQ6A 2PZAA 1M8KA 3LE8A 4MW4A 4EG4A 1U3CA 4FZJA 3K9WA 2DLCX 1COZA 2NSYA 5JBNA 1Q15A 3MXTA 1GTRA 3CLUC 4HK4A 4MUJA 2PFSA 4EG3A 4RPIA 1TYBE 3OTWA 4JFAA 4QRDA 3CVVA 5DK4A 1KH2A 1GN8A 1MAWA 1QRTA 1J09A 4Q16A 4A91A 1T9GS 1FYDA 1VBKA 3G5AA 1Q77A 2YY5A 2H2AA 2JAXA 3X1KA 4H3SA 4CT0A 3Q4GA 1PG0A 1FFYA 3CVUA 1O95D 4I6EA 2D54A 1EUQA 1KH3A 2WQ7A 1A8HA 1Q11A 1EUYA 2OV4A 1YUMA 4DLPA 1JZQA 1ILEA 4K03A 1T6ZA 3COVA 3H99A 5F23A 4JXZA 1NZJA 1N2IA 1X8XA 4HJRA 4MW2A 3HFJA 3COZA 1KAQA 4MUFA 1O94D 5K0TA 1PG2A 2J07A 3K32A 4G5YA 3SP1A 1MC1A 2PZBA 1KKUA 4XSVA 4NATA 3IUEA 1BS2A 1GPMA 1QJCA 4U8HA 1ULHA 1T6YA 1WXGA 1M8GA 1MB9A 3TQOA 3IVGA 3IVXA 3DPIA 3PNVA 1VBNA 3UY4A 3CVYA 1EFPB 2PXHA 1OWMA 4TS1A 2HMAA 4ZT5A 4MUKA 3A2KA 5EKDA 2A86A 2IELA 3RJZA 3PXUA 1R6XA 3PRHA 1IFXA 2E21A 5KHAA 1NUSA 3ZJVA 5DEOA 1M8JA 3I05A 5HG0A 1K92A 1KQPA 1YULA 1U7XA 3ND5A 1O95C 1KR2A 3HL4A 3ZIUA 1YIDA 2J4DA 3G59A 3BL5A 2CV0A 3P52A 3H9CA 5TEVA 3RK0A 1O0BA 3AG6A 3MMXA 2H29A 1N3LA 3A04A 2DPLA 2D13A 3SDBA 1IQRA 1O96A 3A05A 3GLVA 3IMGA 1ZJWA 1N75A 1NUQA 3TZLA 1P7PA 1O94C 4MVCA 4MUIA 4JXXA 1MAUA 1TYCA 2XRZA 2CUZA 4G5FA 2PIDA 4NDAA 1JILA 1PFUA 3IOCA 3P0IA 2VTBA 4YP7A 5J59A 1OBCA 3HZRA 3ND7A 4EGAA 1WXIA 2PZ8A 4ZCSA 3CVXA 3SYTA 4AQ7A 3N05A 4MW6A 2NZ2A 4I6GA 2X3FA 1O97D 3KT3A 4ZT6A 1NURA 3ZXSA 3ZXIA 3COYA 4MULA 2CSXA 3CLRD 1OBHA 5TS2A 1T6XA 2R5WA 3FETA 2Z09A 3TS1A 1KAMA 1JEDA 4MAFA 1J70A 3COWA 1JGTA 2YWBA 2QUIA 4EFKA 3ISJA 4F4HA 1M8FA 2JANA 1OWLA 3FG9A 4Q93A 3UK2A 1OWPA 3FDXA 2X1MA 1F7UA 3N8HA 3AG5A 1NP7A 3NBKA 5FNZA 1R6TA 5IJXA 1EXDA 1MRZA 4RUKA 4ZT7A 5DASA 1N2OA 4MUNA 4I6JA 2WB2A 3NV7A 4JYZA 1M1ZA 4MWDA 4UZFA 2QJOA 3Q10A 1TEZA 2QTMA 1JIIA 1U3DA 2CFOA 5KWVA 1JHDA 1K4MA 2DETA 3G6KA 2HZ7A 4MVWA 4MW7A 4AS1A 1IH8A 3C8ZA 3SZ3A 2WSIA 3F3MA 2A1UB 4S1OA 3MUEA 1WKBA 2J08A 1WOYA 4ND6A 1JIJA 2V0CA 3ILVA 4J76A 4ZCQA 4DE5A 1GLNA 2X0KA 3AKZA 1HYBA 1WXFA 1KORA 4YMIA 1KQNA 3AIIA 4ZT3A 1MJHA 4MW5A 4PBRA 3CLTD 5J58A 5DB4A 4PBTA 2D5BA 1LI7A 4MW0A 3QE4A 5LM3A 5LLTA 4DDKA 1GZUA 4OUDB 3KT8A 1J1ZA 4NAHA 3X1JA 4CDMA 1WQ4A 4U63A 1J1UA 3A4IA 3X1MA 1GTSA 1NUTA 3TZEA 1NSYA 3SEZA 4CDNA 1N2JA 1N77A 2QJTA 3UMVA 2CYCA 1IRXA 1OWOA 3CR8A 3HGMA 4UZEA 3VGJA 2GKSA 1EFVA 4OJMX 1WQ3A 3ZJUA 4L2IA 1IVSA 2QUKA 1G59A 1QRUA 1QU3A 4P2BA 3D6VA 5TEWA 5AHWA 3E27A 1XNGA 1YUNA 3FHJA 5H16A 3TQIA 3VU8A 4EF6A 3GMIA 1NYLA 4HJXA 4K0RA 2A7XA 5IHXA 5LFAA 4MWCA 2G36A 4WSOA 1X6VA 3RK1A 1K4KA 1T9GR 2B7LA 1I6LA 4ZCPA 2BYTA 1JIKA 4EG5A 3Q12A
chains in the Genus database with same CATH superfamily
4XFKA 1X3LA 4DV6B 1LCIA 3UB4A 2AG5A 4Q4AA 1GNQA 5K8TA 4OY3A 5G41A 3GCWA 1B00A 1UBEA 4B3RB 1QZXA 3D7SA 5DHAA 5FOQA 1XEXB 1HM5A 4OHBA 3D64A 3T7JA 2Z08A 1EESA 3SDZA 5COAA 3NBZC 4IGKA 3VH4A 5LQNA 3NRBA 3ELDA 4GG1A 4FW8A 1BCRB 1I1NA 5HF6A 3RRMA 4ZOEA 5DM0A 2MMCA 1WB5A 1ZH6A 1UK7A 5K0JA 1IXSB 3OP4A 5JWOA 3IQHX 2Z6QA 2ODPA 1UKEA 2RI1A 3T5GA 1VA5A 3PD1A 4NFHA 1VRVA 4QELA 4EVQA 4ENVA 1BAPA 4MQLA 2VO1A 1V48A 3W1VA 2VJQA 4XWKA 5KYKA 1FNBA 3MHTA 4WOPA 3CEPB 1JHQA 2Z2IA 3MRXA 4GQAA 1VSUA 1LD3A 2HV9A 4P3KA 3HM9A 5KYNA 1GNVA 1T34A 4HNSA 4FXOA 4LRYA 2H5LA 4P4TA 1NAHA 3W2EA 4CCYB 2AFIA 3GMTA 2WG2A 4KAJA 3UT5B 1Z47A 2AC7A 2OK8A 3JQ9A 1AZLA 4FFBB 3R9IA 3HS3A 1RYMA 3IQIX 5HFNA 3NP9A 2H2IA 4YX9A 3IVCA 2XCSB 4XJTA 4YCSA 3FDIA 4X45A 4QO7A 3LUBA 2JK1A 4YRAA 2DPYA 1S01A 5CCXA 2Z3WA 5YASA 4GKJB 5EXEA 1FDWA 2ZIEA 4GOND 4HDMA 4KXQA 2JFGA 5E7MA 3TAXA 3PKIA 5A4DA 4QYTA 1CF2O 5DN6A 2FW6A 4MNTA 2CNOA 1ZK3A 3V42A 6Q21A 3FDFA 5HKKD 3HCWA 1AKEA 1CY4A 1MR3F 3UJHA 5BOVA 2YJ6A 3NEAA 5GTDA 1T9HA 1TC2A 1UZMA 2B1JA 4YQYA 2ZWVA 1B41A 4PLZA 1R8SA 5JXGA 3Q8LA 2HHCA 4HOYA 1VL2A 3MJVA 3NYIA 5CVEA 5LWHA 3E4CA 3PE3A 4COOA 1N34B 4NXMB 1Q7TA 1OLSA 3CRVA 2JK0A 2QENA 2RC5A 3H4TA 5IWCA 3CLSC 2OV2A 1R4MA 1L4LA 4ETNA 2CBXA 4E11A 5BN5A 2ATVA 2SNIE 4MMZB 4QEZA 4W4TA 1KMIY 1W0JA 1LV8A 4XWOA 2HK6A 1FJXA 4DTCA 1Q1NA 4ZU1X 1YHYA 3IDFA 4HWGA 2W6PA 1C41A 3L06A 5ETJA 5A0FA 3ZGXA 4YPOA 2QRZA 3VNUA 1RYZA 1OD6A 1YQDA 5BQ5A 3MJRA 1Z33A 4XCXA 3INTA 3S2IA 3OZEA 4BJ5A 4PHGA 5C8YB 4MLDA 2XUQA 4KV7A 1AT1A 4L8FA 4LFAB 5B6JA 3G7SA 4DC0A 3TLAA 3MGGA 3TSAA 4W5WA 3V8VA 2X8JA 1IZZA 2VSFA 2PXCA 5D87A 1BDBA 1RXYA 2R66A 3M1IA 4ZCRA 5SICE 4D9GA 5GP1A 1XWFA 2AKEA 5JYBA 3UWKA 1F06A 3EPRA 4EI9A 1N5DA 1SVOA 3HPRA 4O8CA 2V7BA 4DV3B 1KQOA 3T99A 3RU9A 3DEYX 2ZXUA 3MTGA 1OKKA 2A5LA 1QX3A 5CAEA 1Z2DA 2EWMA 3KC2A 4Z3DA 1SHKA 3DFUA 3ITKA 4FM9A 3EG5A 1H42A 4RM3A 3BD9A 1E3TA 2R5FA 3BMQA 4GC9A 2LKDA 3GEBA 3R5HA 2E4VA 5H81A 3W78A 1AG9A 2BGRA 5IJ9B 2X40A 1HNNA 2PR2A 1MPXA 2NT3A 2IS6A 4GM4A 2A9FA 2A14A 4V0NA 3I64A 1HFJA 1ZUNA 5DFAA 4L51A 1LLDA 4N8EA 3QVUA 1Z0DA 4E2XA 3M5PA 3JYOA 2EBFX 4B9EA 3IUBA 4B6EA 1EWKA 2A88A 4PN7A 1PCXA 1W52X 5AVRA 5KNCA 1RQNA 1Y6RA 4GO1A 4KQMA 4YJ3F 3FJYA 4I08A 2R1UA 4ARVA 2IYYA 1YQTA 2IYQA 4DT1B 1GCOA 2CB9A 2ZTVA 4D4KA 2J7PD 2VRCD 2IEBA 3HDHA 4AN1A 3H4VA 3D6AA 3CNNA 4LXHA 3GEIA 5JW6A 1XVLA 2JLYA 3JVEA 1N1GA 4FGLA 2UUOA 2V7UA 4BQOA 4LKOA 4GBMA 4RBNA 4B74A 5EKXA 13PKA 3QU7A 4Y2XA 4EMSA 2OSBA 5I7AA 4YYEA 1DBRA 3H11B 2I7VA 3C3MA 3HI4A 1I5OA 3WRXA 4XARA 5F1YA 1PHPA 1FFXB 1XN4A 2Q0QA 2AXEA 5P8WA 1A1SA 3F5MA 3HDGA 2SBTA 3SR4A 3NDPA 5IHPA 2W48A 4WN3A 5BSMA 4CIVA 2DYKA 4JP2A 1VLZA 1FTQA 3FPFA 3AKEA 1UWVA 1Q95A 3C0KA 5IK2D 4R8KA 4CEIB 2C2BA 4TTTS 1ZIDA 3ONDA 2ID4A 3ESRA 3I53A 4M0LA 1Z5ZA 5EMNA 3MAJA 1ZJJA 2CVZA 4B46A 4BCDA 4ZIRA 2Z6AA 2W6QA 1A5TA 1Z75A 4LPSA 4PHTA 4D43A 4HZUB 4BJHB 4YP9A 4QYIA 3WE7A 1Y9DA 4J90A 4UULA 3B1JA 3NHKA 4M99A 3AI3A 3JQPA 4ICIA 4JI1B 5FLEX 2G0AA 4LV8B 1LV7A 4JJ6A 4L28A 4W5OA 5DMXA 4BU0A 4YRJA 4DXHA 5ISMA 3NUGA 3BILA 3EISA 1P2BA 2Z56A 3DPUA 3E1SA 4XAQA 2JLZA 1AVTA 4D3ZA 1NHWA 3ZWMA 2VCEA 4I9FA 5BORA 2XTAA 3FGZA 3NXKA 4MI6A 3ZWCA 1QVRA 5FF9A 5A4IS 5LR6A 4TKUA 3VU1A 3RYCA 3HYNA 1ZD3A 2R2AA 3ZCVA 1Z5UA 3CX8A 5CDFE 3RSZA 1UBTS 4LTDA 4S1PA 4FMBB 4F3KA 8AT1A 5DXAA 1G21E 4GEGA 3ROMA 3AO0B 5LP1A 2QD1A 3DAYA 1GQRA 2ZYUX 3FPGA 5IJZA 4JQYA 3CUKA 2Q7XA 4IXMA 1N2CB 4G0QA 4ZOAA 1BDMA 1ZFNA 3VOAA 4EKNB 1STOA 1G42A 4I8IA 4Q24A 5M04A 1TIKA 1W4ZA 3DE2X 2FVXA 2R8XA 3DWEX 1KH3A 4POAA 1XZIA 3BWBA 3PDUA 3CKLA 1PRYA 1JVBA 4IJ5A 3PHCA 4KAXA 4E88A 3I1IA 2NG1A 2ZOSA 4NZZA 5DN9A 1M76A 4FE4A 2QTZA 1QS0A 3DWGA 5IUKC 4LN1A 1NJ8A 4BC1A 1C4XA 2XMGA 2BFFA 3FBTA 4ODIA 2GK3A 2PMEA 2O8CB 2DY1A 3TLZA 1ZH4A 1G60A 3HH8A 4I50B 1WCXA 2A92A 3HXKA 1NZJA 1J99A 1P75A 3HFJA 1ZYUA 1D1SA 3SX2A 2O1WA 4PWYA 4HV4A 1CJCA 4O4JB 5A6VA 4LMAA 3HO8A 4JYMA 3ZY6A 2OGSA 3P7MA 4OYLA 4G5YA 3MM4A 1U1DA 3F2VA 4P0TA 5JFTA 5L3VA 3RIGA 3RC1A 1W47A 3MGAA 5CDUA 5JAZA 3QXCA 1JS1X 2F43A 3VI3B 3R74A 3SFVA 1DAFA 2P1ZA 4G0PA 4C3ZA 3RYHB 3WL4A 4DCCA 1E8MA 1IM5A 2EKPA 3WSTA 3HO1A 3PPVA 2VQSA 1K6MA 4H6VA 2F00A 2AV6A 1SG0A 2VDMB 1OZFA 4EJFA 1EFPB 4LDRA 2J3IA 3AVTA 1EBUA 5JCPA 1IBSA 4CGZA 1YS6A 1Y5MA 2VF5X 2JHPA 4XR4A 2ISSD 3O8QB 5FFNA 2WHXA 3L5OA 2Z4RA 3ESYA 3K73O 4URVR 2CSUA 2X4LA 5AVTA 1F0NA 4OAPA 3QOFA 4LDZA 1L7XA 1O6CA 5FT9A 2BDTA 3SS7X 1U8AA 1Y5LA 2G9VA 4CEHB 4OYRA 2JLSA 3IR6A 2V8BA 3KKLA 3Q87B 1V4BA 3UYKA 3DD1A 3RADC 3FFAA 4JOQA 3I2JA 4QBKA 1U7XA 3ND5A 3KB2A 4R9SA 1WQ1R 2X5XA 4Q4LA 5D3MB 1O95C 3WBBA 3HGTA 3G59A 3V1TC 3Q85A 5DLEA 3W8DA 3K53A 5BRNA 3HBFA 3TM4A 1VKJA 2I3DA 2GTPA 3NHPA 1O0BA 5EL0A 3THWB 3KQQA 2ATEA 1JSLA 2VT2A 1CSEE 4JBYA 5FTJA 4E08A 3ADDA 3NAGA 2EBUA 5GZ6A 4UQLA 2BJHA 4Y6QA 5GOZA 1PJTA 1D09A 4KXXA 3RSCA 1QHGA 1NUQA 2ZQZA 4PYKA 4GPZA 1P7PA 1YC5A 1XLTC 5EVJA 5IASA 4FHZA 2QX8A 2G80A 3M7IA 3V5NA 2JGAA 5THXA 1IHYA 4DEYA 1MEEA 1ECFA 2R8BA 1QANA 2FU5C 1HETA 1ZRNA 5HWSA 4A36A 4FHDA 2WDPA 4MDHA 2V54A 2WINI 2OQIA 1YR1A 4PQRA 3O1LA 1MVLA 3TVYA 4AN0A 1RDFA 4QT0A 3KTOA 4D81A 1G5FA 4RETA 2OBBA 4BEBA 4AZSA 4HQNA 5J5VA 2DKFA 1WPGA 4LXTA 3U19A 3KLNA 1PW7A 2R3SA 3TB6A 2NLOA 4I6GA 3KQLA 2NGRA 3T8YA 1RIIA 2VQEB 1YL5A 3T3MB 1VIDA 1T2EA 5K3FA 1OH5A 4TQGA 4BNTA 1EMDA 1HEIA 2BGMA 3N0TA 4KFTA 1J0DA 2UZ1B 4Q34A 2I3GA 3QXJA 4TQUS 3K0CA 2FPKA 1KU0A 1M67A 1A4RA 3TQTA 4E51A 1VGVA 5KTMA 2P62A 1T29A 1UOQA 2YWBA 4Y1GA 1HDCA 4FFDA 3ISJA 4JHXA 1O08A 2FP4B 1M6EX 2FEMA 4INAA 1SELA 3HL0A 2W2MA 5AVWA 2PWYA 3ZD9A 4CV1A 1XCLA 1XTPA 5FJIA 5K4HA 3QU9A 3QLEA 1TPZA 1T5OA 1Q1EA 3EMBA 5AHRA 2VUIB 1R6TA 1MQSA 1GGHA 3BA1A 2O14A 2BR4A 4U02A 4YGYA 2X19A 1ZWKA 2QVCA 4LZWA 4X8LA 1K63A 2J0QA 1G7RA 1L1RA 2G7ZA 4OBXA 2Z8YA 3MWFA 1FEZA 2PS3A 2QJOA 4IIUA 2WAMA 4HH0A 4MPJA 1DBSA 2PS9A 5EZYF 1L5LA 4X3OA 2HDNB 3PEYA 3INRA 1DRWA 1N4DA 2Q9BA 4NZYA 1NX6A 2AFRA 2FR8A 1V45E 4XB2A 1G3MA 3G6KA 3JQAA 3R5TA 2P9TA 4UC0A 2AX4A 4P1ZA 5DF1A 5ALZA 1JBKA 1WSBA 2B37A 2JHAA 3G0CA 4FOTA 4KN8A 5BY2A 1DBPA 3IA7A 4N82A 3I5MA 3WGIA 4JBIA 5LZ5A 4TWJA 3ZY5A 4AQDA 2IYPA 3DDSA 1YE3A 3CXUA 2F64A 1UBHS 1T2DA 4M76B 3VSCA 4Z9FA 2TMYA 3GPBA 5IN5A 1NAIA 4P58A 2PZGA 3AU9A 3OCUA 5AIBA 1L8LA 1EBBA 2UYCA 2AJCA 2RGDA 3NXSA 1OZAA 2VJBA 4GYJA 3HSKA 3KTDA 2DUWA 4RHYA 1EFCA 2QDXA 1KQNA 2VN8A 3AIIA 5T41A 4CKXA 1PZHA 1RT9A 3NOVA 1H8HA 3D7MA 2MINB 4NCXA 5LU8A 4B0OA 5LM3A 3MTEA 2RGRA 5SYAA 1G4HA 4PAMA 2HOQA 3UB3A 4CLXA 2P8JA 4RD3A 3ADOA 2IGBA 3DCYA 3KEGA 4M9XA 2KPOA 5DOVA 3WMXA 1V35A 4A73A 3FHOA 5K6RA 1CRPA 2C57A 3LUCA 1SIWA 1WQ4A 3ZK9A 3OHSX 6ABPA 3ZQJA 3GRVA 4R2JA 5ALOA 2CXNA 4MGYR 1IN4A 3UMVA 4U9UA 3EUEA 3VVMA 2CYCA 2DT5A 5T4BA 3UJ6A 1XPRA 5CEFA 5TVKA 2B35A 3DV9A 4HGPA 1DWPA 1E6CA 4LHZA 3UAVA 4PX2A 2GT1A 3NOQA 2BF4A 3KB1A 3Q2IA 1NT2A 4CKEA 3DMPA 1GYQA 5KNCH 1B0ZA 1C8VB 4H1UA 4F06A 1XHEA 4MB2A 4UHEA 5TEWA 1EXMA 1OU0A 1SIBE 1Y8CA 3UF0A 3R09A 5CB8A 4KGXA 2XZLA 3FHJA 4PNPA 3STUA 3W2GA 5KDOA 1E2JA 2I4NA 3W4KA 5B6PA 4MV6A 1PTJC 4OFWA 5JS2A 4BRUA 1GZ5A 2NYUA 2EJWA 2JW5A 5ALDA 4D1YA 3OLWA 3GVCA 4Q1VA 1X6VA 3DM9B 5CPFA 5ALYA 3WTCA 3HB4X 2Y1FA 1P4AA 1W88A 4N4AA 4HGQA 5EQDA 5EJ7A 1C7RA 1T8YA 1TJ5A 3ZVNA 1PP4A 2WJZB 2XWQA 2YL2A 4IIXA 3F4BA 1QAQA 2Y93A 4YJ2A 3SXUA 4G5RA 4QARA 5H9VA 3K2BA 3ZY3A 2D5LA 3WGTA 4BNNA 4EFDA 1U81A 2LIPA 1IK4A 3R8CA 1FYWA 1IPEA 1OXSC 2ZYSA 5ALIA 5B57C 5DTRA 2CXTA 3MRTA 3GLIB 3IP9A 3V2HA 2VK2A 1YZLA 3VC1A 1KJ9A 1ZESA 3GQBA 3K2IA 1G18A 1P81A 2FETA 2BGUA 3QLUA 3QQPA 1HEYA 1BX0A 2HSJA 5H7XA 3AP3A 2WYWA 4U5QA 1LW6E 3C16C 2Q1SA 3CRNA 2B8NA 5FOTA 3TDNA 3VRHA 2ILTA 5CMLA 4XX0B 1GNSA 3ABZA 1X87A 4WDQA 5AVYA 5KTPA 3CH4B 2OPHA 1YA8A 4C0WA 2AG6A 4B3HA 2CHGA 3JARB 1XA4A 2RH5A 5AW3A 1P2FA 2R8EA 5BSRA 4DDMA 3Q9LA 3UGQA 4F5DA 1QLJA 3AVUA 2ZR8A 2O2GA 3BFVA 1SR8A 1OYOA 4EKGA 1PR3A 4IF4A 5IG2A 2HA5A 3CA8A 4H0NA 4C7KA 1Q84A 3P9PA 1DBQA 3UZUA 2N9UA 4LX0A 1YQWA 5L3SA 1USWA 1X1SA 1ZMBA 3D7NA 5BUCA 1UOOA 3NNDA 1G2QA 1N2CE 5F35A 2F8MA 3RIHA 1ECCA 2JJMA 2OK7A 2CK3A 3C39A 4LHVA 4XB6B 4F85A 2QUBA 3VH1A 2GCOA 3EULA 3RYTC 5FPSA 2PGJA 3WMWA 3TG8A 2F3SA 1ZK2A 1HV8A 4K9MA 5GMOA 4XFJA 3G68A 1TIBA 5JRZA 2I3AA 2EGHA 3OECA 1J2EA 5FCDA 3P26A 1C0KA 2ZS7A 4C3UA 2VT7A 5AXAA 2RHMA 2MCFA 3S55A 3WB0A 2GKOA 5ENVA 3PGKA 4IIJF 1WCV1 2WMYA 3KT0A 2ES4A 1EU1A 3DEIA 3CS3A 4RA6A 4UMEA 3VVLA 4KI0A 3FNFA 4ND2A 2HBYA 1TYZA 4BEVA 4QDJA 5KDDA 2AI1A 3TE6A 1WB4A 2B4AA 2YS6A 1O5IA 3IVAA 4B87A 2A0FA 4NDNE 2JI4A 1AV6A 3JSXA 2GHRA 2QTRA 2ZB7A 3I4FA 4P32A 3L0SA 3CN7A 4DQLA 1KC1A 2XTZA 1Y4AE 4A2CA 5IBPA 4D44A 5MGNA 1O5TA 3DNFA 4KDEA 2BGWA 1E2KA 3HV0A 3VU9B 5AESA 2WJ3A 2PWBA 2AD1A 1IBRA 1QRAA 1G8GA 1N0IA 2YH2A 5I9BA 2QTGA 5EHZA 2HY7A 3FD8A 4I1SA 4OH7A 3ETHA 4RC9A 4XD7D 5MN6A 3I5YA 2HT1A 3DULA 5HX7A 1E5QA 1L4BA 1I8TA 1IBCA 2FHSA 2GYVA 2I6QA 2VPTA 4MSUA 4PM4A 4WA7A 4F9TA 1LDMA 3MT7A 1JFTA 3W5SA 3ECCA 3WLHA 5FOSA 2ICAA 3MNFA 1ZMOA 4R2HA 5BYAA 5BUZA 1VBFA 1NMSA 2DR2A 3CEJA 1E0SA 1KZ7B 3ACDA 4RHFA 1G0OA 1XU9A 3UH1A 4YT5A 2IT1A 3K1AB 1W1UA 1BU8A 1H3FA 4J75A 3LL4A 3FH0A 1QHYA 3OF3A 4GL2A 1EQUA 3X44A 1TE2A 3BIOA 4HWSA 4YP5A 1O2DA 2A4MA 3QJGA 3ZJ4A 4NDZA 2NVUA 3VBCA 1NBIA 4A1FA 2GETA 1E2QA 1A2QA 3KZMA 3TF5A 1ZITA 2QYHA 1H2EA 3RUEA 1P7VA 1JG3A 2R00C 4NYMQ 2XUGA 3FTCA 4Z8YA 2AZXA 2Z57A 3ZCRA 4F8YA 5BWLA 2H1FA 3HWRA 2BMVA 1IAVA 4WKPA 2DWOA 2IK8A 4IIFA 5HCNA 5JCJD 4GFDA 1VHJA 3AR2A 3IPCA 4Q1FA 2O5EA 4EPTA 3T54A 4YXFA 1FK8A 1KSFX 3AOEA 4DYHA 4NZPA 4WJZA 4FYJA 1FNMA 5DRYA 1UK9A 3QHQA 3VVBA 1RKVA 1VG8A 1T3GA 2FMKA 4KG7A 4RK7A 3TW8A 4POOA 4DLXA 3PFWO 2J30A 1YV9A 1N8KA 2G5PA 2J9ZB 3WS7A 1TTHA 2RCNA 3AI1A 2HJHA 2I8AA 1DJQA 4WI1A 2KE5A 4KKXB 1UXKA 4LHSA 3QEMA 4H1TA 3LSYA 4Y2SA 3Q5GA 2WTUA 2V6JA 1SXQA 2JLBA 2BMEA 2DXIA 4HDSA 3RTCA 3HN2A 4RVGA 4KTTE 4G0ZA 1U11A 2AQ8A 2SKEA 3T9DA 4CM9A 1WXHA 3BHIA 1E94E 1ZUHA 1R2QA 3PTZA 1C9NA 3PFIA 3FTFA 4YDQA 5DX8A 1CP2A 1K8YB 4OMUA 1T35A 1QQTA 2Q2QA 3RS7A 1PEKE 1R27A 1N78A 1MO4A 3LAWA 4ZK2A 3PVSA 5CX4A 3BS4A 2GBFA 2ZUCA 3IAAA 2FFAA 1RBMA 3OAAA 3FNRA 3P9CA 4YI3A 2QT0A 1JFLA 1WXEA 4DRYA 3U6KA 4CL2A 5FD8A 5M5BA 1UDBA 1QHSA 1O6BA 5LB4A 3G85A 5GJVC 1JTVA 1GKIA 1NMEA 2Y76A 1GPNA 2I7DA 2P3LA 1L5YA 4IH9A 5CXSA 3ER8A 4LGYA 3MINA 4EKEA 4LV5B 3BZWA 4EELA 4XDYA 2XB9A 1ZM2A 1JJFA 1R5JA 2JVJA 2OLEA 3FOAA 4JI6B 5J4KA 4A03A 1JEYB 4X20B 3JVVA 1E79A 4ZALA 4A8JC 3ZI7A 3GLIE 3GG2A 1RMQA 1UBFA 5BV7A 2QD2A 2IPLA 2IIVA 5EUQB 4EYSA 4RDHA 1X7ZB 4CVNA 3BSSA 1ESZA 1M73E 2FZGA 4OQLA 3UT0A 3WRVA 5LQDA 1T2CA 3V2IA 1OLOA 2YR0A 4NHEA 5DM2A 4Z4GA 4ZEWA 1VPWA 2I33A 1ORHA 3MPUA 3OQPA 4M55A 3WC4A 1ZC4A 1ZVMA 1ND6A 5DBFA 2PLAA 3MK31 1CZRA 4NBNA 1SCDA 2FUEA 3ICPA 4D8VA 2I03A 4G0YA 5IJWA 3LK7A 4ZDJA 3E03A 5G0UA 1OUMA 1RLTA 2EBHX 1CR6A 1HT1E 3CNLA 3WK6A 1Z2EA 2D4AA 3PUJA 1RQGA 2A5GA 4HNHA 3UJ8A 4AJIA 5C7YA 1H3EA 1L4YA 4KIFA 3H9JA 2RI6A 1FPMA 4CMEC 1SUWA 1YKSA 3QSGA 2WJYA 3IERA 1I2BA 3JD4A 3LOPA 4Q3NA 5D5QA 5IDVA 2CXRA 3TUIC 3F8SA 4JP1A 2EJUA 3MRSA 3EW9A 2O8FB 3L8FA 3ICWA 4JV5B 3HYRA 3V7UA 4CNBA 2R60A 2ZVPX 3CLUC 3M9LA 1G3IA 1FS4A 1XYGA 2XF8A 3BGIA 5L45A 1MN6A 4QRDA 1AGRA 2B2NA 5EA2A 4E5UA 1REQA 3G2MA 2A9JA 3AVXA 1SCNE 2Y1CA 1J09A 4URUR 1Q50A 4DCPA 4CEHA 1P74A 4O4LF 1P60A 2B98A 5H9WA 2JIZD 3PJEA 1BX3A 3EUFA 4IINA 4WCVA 2NU8B 2OG2A 5J1TB 4JK3A 2W7TA 3P9IA 1EVYA 3AU8A 3PNLA 4H3SA 4QA9A 4UQPA 3BD7A 1Y1PA 2DB3A 3TNYA 2HF7A 2KYRA 1JLSA 3C97A 2WSSD 1J0AA 5JPCA 2C5LA 4EHLA 1F8GA 2H63A 4MP6A 1AK2A 5A71A 5LXTF 3B12A 3BSFA 3GJ8A 3IDZA 1LH0A 2GD6A 1C50A 2LTAA 3LLCA 2Q28A 1HNWB 3F67A 1ADYA 1Z5VA 3C6BA 2IUYA 3ELYA 1JLLA 3OO0A 3ANSA 2I2AA 4K26A 1GOTA 3WIOA 4YVFA 4CDGA 1QQBA 1IVYA 4ND4A 4BNLA 4DY4A 1KAQA 5AKKA 1JDZA 2IHUA 3OY2A 2JVIA 2OAQ1 4HB3A 4KXUA 4X8MA 3JYLA 5K0TA 2PL1A 1L5KA 3R9XB 3ZVLA 1PG2A 3SP1A 2B1QA 3U1TA 3ONEA 1W59A 1J39A 3I6QA 4C89A 1QKJA 3AR8A 3U81A 2X8WA 5J2TA 4B82A 5JECA 1TA0A 1Y1RA 4GWKA 4I9GA 1JR2A 4N9QA 3ZS9A 1E2BA 1P4JA 4ON9A 4WNIA 5EJEA 4XH9B 4J43A 2WMDA 2W8BB 3IVGA 4O4IA 1T6NA 1R3UA 2AD5A 4AMGA 3KQOA 1Z4QA 1U04A 1OWMA 1OASA 4LBVA 3R7SA 3S40A 2YWGA 4I4LA 3SICE 1NUHA 3D54D 4UAUA 5EIBD 2ECPA 1DX6A 3IS3A 4V0QA 1M5UA 1R6AA 2Q2VA 4MV7A 3CF4G 3KQTA 3VOBA 2BH2A 4DDTA 1U5CA 4BVGA 1R5BA 2JEOA 2BMFA 2HWWA 2XADA 1BWQA 2CMKA 3E9NA 3L0DA 1J2JA 3LHSA 4IY1A 2BEUA 4JQCA 4Q21A 4AXXA 3ZJVA 5L3QB 4CM4A 3DW1X 1EX6A 1T8SA 3RNLA 2ROQA 5E3JA 4AO7A 5C4GB 2OFOA 4DIDA 4GEKA 1XDWA 3VR5A 4LSWA 3HL4A 1BEUB 4QUAA 2J4DA 5TGZA 1S0UA 1C5KA 1DAGA 1DC3A 1HWYA 1XELA 3QVGB 4D0NA 4WXEA 4F4IA 1M75A 3SDSA 1RXWA 1KY2A 2VHVA 4QOIA 2P2CA 4BE4A 4DQVA 4OU4A 2BFOA 2WU8A 1FRNA 2HO5A 3LC7O 4FR0A 4M37A 5FB3A 1M2JA 3PDCA 5FWDA 4JXJA 4EUSA 3DD5A 2XOKD 1GPAA 3G7UA 3FNBA 1NQXA 2QT9A 1D1TA 3H5RA 2PWPA 1EIWA 1CW2B 2R6CA 2V7VA 3KFVA 1DARA 3GLSA 3R0ZA 4TLLB 3KYCA 1RAEA 1GPDG 1RLIA 2P2GA 4IS3A 4MUIA 4US2R 4JXXA 1KXJA 1TYCA 3P19A 3AIOA 4UREA 4AWBA 1WHSB 3RV4A 4G5FA 1TLFA 4MA0A 5JZMA 5LMNB 4QRHA 5G4KB 1ZQ1A 4C08A 4S0XA 5IS2A 3BB3A 4JLDA 1N0UA 4K9PA 4JJ4A 2JAUA 2QN9A 3OIDA 1B43A 3HZRA 1K4YA 5BN3B 3K71B 2CVFA 2QTWB 5ALWA 4FKZA 3CVXA 1Q12A 3ORFA 1U9IA 1ULAA 1ADBA 1Z4LA 4EYKA 1UPTA 3R3UA 1E92A 4AZVA 4P22A 1UDAA 1XTZA 3OQ6A 4Y9TA 5HRUA 3HG7A 3A6JA 1TCCA 3EZGA 3WO1A 3KOWA 2ZYDA 2W2PA 4FEEA 2HC9A 3U3DA 4EP1A 1GLVA 1AF7A 3QVXA 5A03A 3WLIA 1MAAA 1ORRA 5K8UA 1M8FA 1JDVA 2L42A 3K09C 5KOHA 1D4AA 1R74A 1TQHA 1Z0SA 2J32A 3I8SA 4QLOA 3ND9A 4RSHA 5D01A 5HQJA 3LQQA 3S68A 5K03A 3K9BA 5G1OA 4NCBA 5KWJA 4M8SA 2DTXA 2XSZD 5TC4A 3C98A 1KY5A 4RUKA 3RW9A 2XTNA 1EQAA 2HK7A 5I8ZA 4BVBA 2RHBA 4JUBA 2P9HA 2ZRDA 5SV2A 3EXIA 3A1NA 1PK9A 4YCJA 3PEFA 2IDZA 2QTMA 1UIMA 1UXIA 2YUIA 2O7QA 1CEQA 1PZFA 3L9XA 2W6IA 3NBYC 7ADHA 4IJVA 2WG1A 1VCOA 2WHQA 4I3HA 2MTBA 1GPKA 3LUPA 1FTNA 5HE9A 3VR3D 1M6VB 2EKLA 4JLPA 3H0CA 2NYVA 1U9ZA 2Z1DA 2QSUA 4XEUA 4A0HA 3BMCB 1M0SA 1Z9BA 4MW7A 2PUJA 4YC7A 1KPGA 4K7JA 4DJ5X 1TEVA 4X64B 4EDFA 1X1RA 3R7BA 4RDCA 3MUEA 4ZHSA 4KEAA 1FQKA 1DOZA 3NRJA 2J08A 4HX2A 1M1YA 2O2EA 1XEWY 4E33A 2Q3CA 4B83A 2Y9MB 1VPTA 2V0CA 3LI2A 4MH0R 5IKXA 1SB8A 5ED4A 2OBXA 2P27A 2X2FA 1WSWA 3HKEA 2FCRA 2ZSIA 2RGNC 3GBPA 3AFMA 2ZGVA 3MMSA 4OM8A 1ENPA 2BRUC 3TMYA 4I2VA 5JSQA 3AKZA 2X8BA 1KA9H 3L8HA 3I62A 4C03A 3EB9A 2HSGA 2UKDA 3AEQB 3IEXA 1PJ8A 3QRWA 4DEVA 4LZNA 3W77A 3KTFA 1RPTA 3BH7A 1TMOA 1IEWA 2GN8A 3DM5A 3L0YA 4FNOA 4EKDA 3MCTA 5ESXA 1EP2B 1G2OA 1UAYA 1XCJA 3E9ZA 3BBLA 4JI5B 2O2JA 4CIYA 1BIFA 5ALTA 4R1NA 4QOFA 4BMYA 1TTTA 2HLDD 2O0JA 3X1MA 4G56A 4JYBA 3BFXA 3AVYA 4A0SA 3SEZA 5JCOA 4P4SB 1XP8A 4P08A 2JFUA 2ZIWB 1U94A 3L4KA 3DFKA 2CBZA 2ZJ5A 2O8EA 1T2AA 1KOGA 4JITA 1KBQA 3N8DA 5HJ5A 1IRXA 4UAVA 1OWOA 1S3SA 2NUPA 1TZJA 3IQEA 4JLKA 3IQZA 4CTOA 2ZJ2A 5J2UA 3UOGA 2R6FA 3GLUA 1TYEB 2EFEB 2KX7A 1QRUA 1XKQA 3EA0A 4W6QA 4KACA 2G1KA 1YR6A 1JEQB 2XQFA 4HH3C 2CD7A 4Q3KA 5ALRA 3KHUA 3W5HA 1W9HA 2X7HA 3KLPX 4DF3A 5JNVA 1WR8A 2C4WA 1FNDA 3FX2A 2A7XA 4NBTA 2JRCA 1OX4B 3GD5A 3F6PA 1KO5A 5C8DA 1D0IA 4U9HS 2O7VA 5FJJA 3WNVA 3HFGA 4A3SA 1IN6A 3B1KA 3MTDA 2ZJBA 4PZ0A 3OEYA 1T9GR 1MENA 3A2MA 5EWJB 2NU9B 4BS9A 1I6LA 5B2FA 2ZDGA 1AO0A 1L7VC 4Q48A 4QPDA 3V7NA 2O8DB 3K9QO 3L0OA 2YFKA 4ZYZA 3IB3A 3B5IA 1T15A 3EYAA 5A4AA 5I51A 3N0WA 1NLFA 4RVCA 4W1QA 1POXA 2VZ8A 3PNPA 2WHRA 2XNHA 2ZTHA 3F71A 4UATA 4DLKA 3B1XA 3ER6A 2Z8YM 3V4PB 5CLHA 5KTNA 3U3XA 3H86A 2BSAA 5KVVA 3HP4A 3KJNA 2GFQA 4IOKA 4UVDA 5AJWA 3D4PA 4EG1A 3HB7A 2R47A 4CUZA 4DWVA 4YDSA 1Y33E 2NXWA 2C9OA 3N2NA 1HMYA 3VU9A 2IA5A 4HHEA 4RADA 2XQVA 3SOZA 4WOCA 4Z54A 4JVNA 5DN6D 4Z0NA 1J20A 5GY7A 3KWMA 3MGKA 2HK9A 5DGTA 3ZUGA 4D8WA 4FFRA 1G9SA 4OK3A 4BNKA 2XKKA 5IBCA 3PGVA 1TF2A 4PY2A 3RF6A 1VHWA 2H4HA 2WYOA 2BBWA 5KTRA 3F6RA 1THZA 2X2EA 2IYTA 3AXTA 5LYJA 4G0WA 4K2AA 3W7AA 2C0CA 5KTYA 4MB6A 1LLUA 2ORED 1GSHA 3CPEA 3A3OA 1G8KA 3V6LA 4GOJA 5KINB 4HVLA 3Q8XB 3KPVA 4B2YA 3FFWA 2BGLA 4GIBA 5EKTA 4TYPA 5SY9A 8ADHA 5E7JA 4B17A 4RL4A 1H05A 1J0CA 3TINA 3SQDA 5TMPA 2YOHA 2HA2A 5H02A 3VA7A 1FDIA 4B4UA 1W0JD 1RC8A 4ERNA 3FSEA 4B4OA 2YV2A 2BJVA 2ZSKA 1BCSB 4DWOA 1TM2A 2HNKA 4JBLA 4ZVUA 2Y8EA 4CMCA 1IN7A 2OFPA 4BV9A 2BONA 2QD3A 3DE1X 2NVWA 1WDTA 4PRZA 1RYHA 1VQ1A 2WSMA 5I7HA 4FFSA 2FB9A 3IH5A 1K08A 3L5KA 4WNYA 1U0RA 1H3NA 3R0XA 3K70C 4O3MA 1T6BY 3GEHA 4F6RA 2NZUG 1B7GO 2VJMA 3Q3VA 3TOXA 4XPIA 3FUXA 3ZNQA 2GJKA 3CB4A 4EVRA 2RDMA 4GZ3A 1EXVA 2HEGA 2OZPA 5ULLA 1GR1A 5I3ZA 2WC1A 4RTMA 4DR2B 2VHXA 1BWSA 1HLDA 3AR6A 4FKBA 1PR0A 5K0EA 5CLIA 3TZ6A 1I33A 1EGQA 1UFKA 2R4UA 2XDWA 1U4SA 2R9VA 3R0QA 3WHLA 1PS8A 3QBEA 3SEFA 3Q3IA 1W75A 4M0CA 2PZFA 1JF8A 1A8QA 2QORA 5IKPA 1ORIA 2EFJA 1V7ZA 2EKQA 3PNMA 4B40A 1GUZA 4REMA 1BMQA 3L4BC 5IDXA 3C7DB 3JALB 4Q7MB 2H7VA 4C7OA 3QFTA 4LOLA 4RLSA 4DM7A 1NT4A 3USES 1BTOA 1CUFA 1I0LA 4MUMA 5K8LA 3EF3A 1N2EA 1ZNQO 4OB6A 1KSGA 3H18A 3D1JA 5FH9A 3RSFA 2ZETA 2XB8A 2QBYA 2P1RA 1RQ7A 2H1LA 3D2CA 4QG7A 5AUOB 3EC2A 4RGYA 5CFQA 1SQ6A 1S1MA 1G0NA 2DQ4A 5ANRB 2GPYA 1H1LB 1HTBA 2OO5C 3PEVA 4LI0A 3OF2A 1P9OA 3A1CA 4NKRA 3HRIA 4ZU3A 5CDSA 1FMFA 2WVGA 3QE0A 2IEYA 3DH0A 4YCDA 3DQZA 1LQUA 5KNCD 2R1TB 4X20A 3CIOA 3SSNA 1N36B 1QG4A 1BQ3A 5F7JA 2I80A 3STXA 3VR5H 3SYNA 3CWCA 5JYEA 3PD0A 5LJIA 1WB6A 4M9ZA 1PJ4A 1E9FA 1IG3A 1PQWA 4OIFA 3WGJA 4Q1AA 2AYYA 4A10A 4Y6LA 4BOYA 1JSZA 2CNKA 4FGJA 3ZBPA 5JJBA 1S6YA 4MVJA 4KREA 2IEAA 1LRKA 3QWAA 5GWXA 3LDAA 5LCXA 3KT6A 4E5DA 4EB3A 3OPYB 5BV2P 3DUFB 3GZ4A 3ROZA 5JIBA 2NSLA 1TI7A 1ZNXA 1CS0B 4K6CA 3GJ7A 3PRYA 3QM1A 4MVXA 3L84A 2UUCB 3W6ZA 1MGOA 2CZQA 4QVGA 3RASA 3E9EA 4RS3A 4JEMA 3FYUB 3AY7A 1QO9A 3HJTA 4AURA 5L4SA 2PANA 1YONA 2P65A 4RTOA 4IZ6A 3PPWA 4KXFB 4KNWA 5ECDA 2WF9A 5LLSA 4KR2A 2WMOB 1SUBA 4WIAA 4ZQBA 2C7BA 4JFRA 1IXKA 4O33A 4M3NA 5BSUA 4ZZ1A 1NJ1A 4MROA 4DKJA 3T3NA 2J41A 5H83A 2C2OA 2D0OB 4IJKA 1MPTA 2O8FA 2AR0A 5A02A 2EP7A 1YQGA 1OROA 2DCMA 2Z58A 4EJ2A 3HKBA 3HJFA 4N7RA 5CU7A 2BBTA 3N2KA 4JJ8A 2F59A 2AA3A 1LEHA 1XD8A 2GK7A 2R4QA 3ET4A 3IJ5A 4FJ1A 4MKGA 3U7RA 4ASUA 1E2FA 1Z88A 3QXXA 5C8XA 2Q0HA 2IE8A 4GRIA 4CMIB 4RA9B 3UJNA 1VFPA 3UAYA 5AICA 2OGWA 4K9LA 1QZZA 3FF4A 2BP7B 3GA0A 2BI4A 3STYA 4L9AA 2NV0A 1GKKA 2GXAA 3KL2A 1G3QA 3MJEA 4Y6GB 3QQ5A 4DIOA 1OI4A 4BAUA 1JWBB 3ESAA 2R7MA 1W5SA 5I4BA 1R8XA 1WJGA 2HFJA 1NUPA 3VPDA 3PYLA 1T0JB 1CQWA 3RTDA 5JH7A 1EFVB 1F8YA 1TOAA 1XX6A 1LPNA 4R3NA 4RD2A 4TS3A 5AOAA 5EINA 3S4YA 1PFGA 3JD0A 3Q6NA 1PGOA 2IU6A 1UXGA 1OZGA 2JKYA 2UYQA 2VLIA 1YR7A 1A9QA 4Q9NA 3FVRA 4F9GA 1HYEA 2NZYA 4F86A 2IYUA 4PZAA 4GPIB 4R8SA 2ZWOA 4Y98A 4QNNA 3CZPA 2V45A 3JQ8A 3QHPA 4OUDA 3DOIA 4MA5A 4XCQA 3SF0A 4B31A 2BGKA 2YV4A 4D0RA 5DTQA 2UXCB 1LF0A 2IQ5A 3CVOA 3LKZA 1GKYA 2ISCA 2WABA 2RK4A 2WMNB 4BNDA 2FWJA 3BICA 1QDLB 2IE0A 4EG4A 5KSWB 2ZSDA 1XZCA 1O54A 3D0QA 3MWEB 1YB7A 2B1RA 3ND8A 3PNSA 4IDEA 4J4TA 1UWLA 5HEKA 5F64A 1ODTC 1UFRA 4IDDA 2DFPA 2P2LA 3HUDA 4HK4A 4Y67A 4HSGA 2W6MA 2J0SA 1MB3A 1FCJA 4KYVA 1G17A 2PSSA 4MCIA 1KH2A 1K5PA 3EAFA 4Q6WA 4AG5A 5MGBA 3IV7A 2UV8A 1U28A 1ACJA 4QPCA 1DXOA 2Q62A 4O1MA 4IO0A 3UXHA 4O6VA 3FIJA 2JFQA 2XGGA 1ID1A 5EHQA 4N48A 4O29A 1SKQA 5CT6A 5EKSA 4FU0A 3Q4GA 1UPCA 1Q0HA 3QVGA 4W5JA 3HN6A 1NM5A 3JYNA 4U39A 4EO4A 4PLCA 4EW2A 2FZVA 2GVNA 4XIIA 4IDNA 1Z83A 2XB2A 2NO6A 3RI3A 2C5AA 4U2KA 1R0RE 2Q3JA 4RPCA 4DQUA 1MIOB 1NF9A 1P1KA 2C8VA 2NSDA 4R3WA 4NCIA 5DCLA 4BUZA 1WBBA 2VAMA 1NVVR 2C2GA 4UM9D 1PJAA 5U4QA 1KMQA 4A27A 3HPQA 3ESZA 2XYQA 2YZ2A 5K3OA 1GPUA 3OCVA 5AW9A 1V8ZA 1U3VA 5GAJA 1FMLA 1PSDA 3RVPA 2JLXA 4J7XA 3RR2A 4ENWA 1QZTA 1JXMA 3KKMA 3HLKA 2OYCA 5BSEA 1ENOA 2HRZA 4HB0A 4YDHB 1AS2A 2A5FA 1B0PA 1GTVA 1K27A 1MX3A 4QXPA 4DIUA 2JGDB 2DMRA 2OILA 1KKUA 2PZBA 4C04A 1PUXA 5G1NA 5HRCA 2Z0MA 5IT0A 2VTEA 1P2TA 3N1UA 1CUDA 1DEXA 4ZU6X 1YZTA 2ZIUB 1UP7A 1QX4A 1WTAA 3FCOA 1GL6A 2CHFA 1MCZA 1M8GA 3IQFA 4LGMA 3W6OA 3ZLBA 4G5HA 2QL5A 1E1QA 3PS9A 4YJGB 3KVYA 4GR9A 4DZTA 2QPLA 4O2BA 2FOXA 3UH0A 5AI4A 1U8UA 1TC1A 1XTJA 5JHGB 3BM5A 3L4JA 3LTEA 5JZOA 1Q7EA 1SXPA 1D6JA 2DHCA 1RQXA 2LDXA 3OPXA 2WJIA 3GRCA 3UK1A 3UGJA 4WBSA 1KFEB 3P9YA 2GO7A 2OCAA 1I10A 4ZQIA 4PEVA 1N2SA 2Q5EA 5JBIA 3BK7A 1M8JA 1N3YA 5JNTA 1ESNA 1VRCA 1KQPA 1LC0A 3P9ZA 4G01B 1SO8A 4II2A 4FFVA 5CM9C 2I6TA 4EEKA 1HXHA 1T2UA 2QMYA 2X1VA 1RM5A 3E7XA 2ZUWA 2Z2YA 3G0GA 3N6VA 3V33A 3AJEA 3R6DA 2VK4A 4RK5A 3L1VA 1CP3A 4FMDB 3RU3A 1KYYA 3CWQA 4AG3A 4AJ2A 3M1AA 5LWQA 3EDQA 4P6VF 4QATA 1XQWA 4S24A 1XMOB 1KIAA 1V8DA 2HZBA 2XOXA 1RJWA 2D13A 3LMKA 1ZUWA 4MR9B 2ZUTA 4UTZA 3VPAA 3A6GA 1MJFA 2B82A 5EIWA 5IFLA 1E7RA 1GM5A 3DEAA 3VTAA 4RTJA 2C84A 1CXZA 2LPMA 4LOAA 3AKCA 1Z5OA 4GUDA 4MKXA 1SBTA 2IVFA 5BMVB 2XCQA 4MZXA 3L04A 5BXQC 3TBFA 2OOSA 2IUEA 4KZKA 2ZR7A 2IXDA 3K9CA 3DAPA 1L0BA 2NU7A 4ZHQA 1LK7A 1FFWA 1KQ3A 3FKJA 2JFYA 3DTNA 4HAUA 4X1IA 5E1MA 3FWPA 4D41A 4KQCA 3UK7A 5JAMA 2PBZA 4X92A 3W7BA 4JUCA 5DHPA 1KHHA 1ZIPA 4YP7A 5J59A 4HAVA 1XTRA 1CHDA 3WLSA 3CBGA 3JQAD 3D3EA 1F14A 2OP0A 4KQWA 4HQ6A 5BR8B 3ZNPA 5MDHA 2W90A 2W6ZA 3COYA 1WD7A 1YJ8A 3H6GA 4RKQA 2GF0A 2Q41A 2YJ5A 3D5EA 1WU7A 4UCFA 3RE1A 3SYMA 3TTYA 2GQ0A 2PV7A 1UBNA 2R5WA 2J5QA 2Z09A 1B6GA 3B5EA 3I28A 1AK1A 5JWHA 4BB0A 1NU6A 3UBTA 4BWGA 4FFOA 4NCNA 3T4XA 1A9YA 1CS4C 1U7TA 2H5EA 5HQ3B 3D2LA 1IB6A 3PC3A 2VHQA 3GVPA 5UKDA 1DAOA 1DEAA 2OFXA 4V24A 1RHRA 4N5NA 1UJ5A 4REOA 3V55A 1G6Q1 2IHBA 3GFVA 4P4SA 3MCAA 3SK0A 3S8YA 1P44A 3GZNA 2ISQA 3MSCA 4NBVA 2HV8A 3B3AA 1O4WA 4FNMA 3SJ7A 2WUFA 1IUKA 1PWYE 1H8HD 3NO4A 1MD9A 4J1NA 4AX4A 3GGCA 3QLVA 1J7KA 3HVIA 4FT2A 5CXUA 3HJAA 2PH1A 2WTNA 2ZT5A 3UANA 1EZ4A 1W94A 3AW8A 2IPNA 3E9RA 1B8NA 1WTCA 2ENUA 2OA0A 4JYZA 1M1ZA 3FE2A 4MHSA 2EATA 4FGZA 1JEQA 2CHUA 1A72A 1UMDB 2WAYA 5AP9A 2E4AA 4V0MA 4YRMA 2AXQA 2ZJ0A 5KSOA 3QKTA 2DY0A 1KNQA 1RQRA 3OEHA 4HRXA 3I0NA 3VR4A 1OX4A 1PL7A 3L8MA 4PZPA 3PDJA 4WNAB 1NQOA 4ZWNA 4C3OB 1WOYA 1JHZA 1GA6A 3OQNA 1B2LA 1G66A 5IC4A 1UDXA 3UFXA 4FIZA 2NU9A 4CLRB 4RHUA 4ZCQA 3N2LA 4IHJA 3WVNA 3HJCA 4RJJA 1HYBA 1QGUB 3KV1A 3AONB 4KHZA 1L5NA 5KSYA 4R2WA 4JI0B 3UGKA 4MRMB 1E1LA 1KDTA 3FLMA 3IEUA 5I4IA 2GN2A 4MVJH 4AO8A 3H75A 1V5WA 2QQEA 1PV2A 5LP6B 1I32A 3AILA 4K46A 3E3AA 4TSKA 5BUSA 1FP6A 2H06A 2BCJQ 3GP8A 2J87A 5B64A 2PRKA 3M4NA 5AK3A 5IMSA 1MTZA 3JVIA 3SJZA 3R3HA 2GBLC 2RGBA 2O50A 5BVGB 3OQJA 4HDNB 2PX3A 9ABPA 3EEBA 4A92A 1RYYA 8GPBA 4E21A 3UM9A 1ZICA 2C9BA 1Q5PA 1O89A 2ZQ5A 1H0RA 3DMTC 3LZDA 4HFNA 4QOJA 3AF0A 4Y6PA 2ZJAA 1LLFA 5E8RA 4DMMA 2B34A 2HHHB 1ODKA 4XD2A 2YZGA 5D1HA 3A9WA 2NSHA 3PFHA 3PLNA 4GM1A 2VOJA 2D00A 1VHTA 3CRQA 4ZI5A 3ORYA 3KUCA 3LFUA 3CH6A 1ZZGA 4ADSG 1N57A 3CF0A 3A4VA 1T36B 2W00A 1YZFA 3OJXA 1YFZA 1LNQA 2Z5FA 4RY0A 2GLXA 1Z73A 4K5QA 2G1PA 1YUNA 3BD6A 4WRRA 3KBOA 3TQIA 1MDBA 2B21A 1Y3FE 1LB1B 2VYVA 3C7CB 1ZEJA 2NXCA 4JC8A 4KMOA 2I2XB 2G1AA 1DC4A 3O91A 4YASA 3O8RA 3L6EA 4OXRA 2ZR0A 1TAUA 4MJ3A 3HCRA 4MYTA 1MB0A 3AJRA 4I4TB 1K4KA 4ZYUA 1KVUA 1DMSA 4YCBA 1BXRA 2FFJA 4J1TA 4EG5A 4DV0B 3JATA 3AH8A 4HDRA 3TNFA 4YJ2F 2FQWA 3Q0EA 3FTQA 4X85A 3UIEA 1ZGJA 2D0DA 2UVDA 3EVDA 1P19A 3V8NA 1Y8AA 4DPLA 5JMOA 3JAMA 3JWJA 1SXJA 3EEYA 1JEEA 1LRLA 2XDAA 1ZM7A 1JEOA 1XV5A 1O5OA 2XWSA 1BW9B 3IUMA 4I2NA 4PSDA 3JR7A 2F9MA 1P2VA 2YTZA 3BGVA 1T1SA 3THSA 4HWTA 2XUFA 2JGLA 4AJ4A 4AJ9A 4UXHA 1B3RA 1T8UA 3BRCA 1MO2A 1H22A 3HCPA 2ZBPA 3ON5A 4RPHA 3LYUA 3SQLA 5ITSA 4GKKB 4TTRA 1W1WA 3ETJA 2ECKA 2HCJB 1WEKA 1P9LA 1SURA 2Y67A 3IIEA 3T12A 5I9LA 5TGTA 2P69A 4D9EA 4D5EA 2EIHA 5JMWA 1I30A 5EXTA 3UMBA 1MX9A 3QW2A 1D6SA 4QREA 4AICA 4DNFA 5J47A 2BE7A 3K9LA 1RYFA 5EIBC 3U0VA 4OJKA 3FCUB 1G8SA 2C2KA 1A9ZA 3C24A 1XZMA 1KP3A 3INYA 2GZ2A 3M6VA 3N3AC 3IAXA 3OP1A 1FB5A 1JMVA 5EHXA 5BWMA 3PQ3A 4UOQA 2PBFA 4JC5A 4K2HA 4HLUC 4X6LA 1A71A 1OC4A 1XG5A 4I8XA 1XVVA 4IWXA 2D7CA 4NFSA 2Q49A 3AI7A 4MGEA 4XGQA 2X14A 4ZYYA 5ABPA 4BLTA 4D9CA 4YCMA 4F9FA 1NU8A 4QTUB 4UEQA 4R51A 4DTIA 4NECA 5BRJA 3KXIA 3HM2A 4YFVA 2GZ1A 3LWZA 2D5IA 4NLLA 1QG2A 4X1KB 4UQOA 3LHKA 4LECA 4AVYA 2CHEA 4NG4A 3V9PA 1A5SB 3Q7IA 5FTMA 1A9XA 3U3OA 2IYXA 3Q0TA 2CLLB 1C3XA 1JKMA 2OBNA 1P1JA 3QPCA 4B3JA 5BQXA 4LJ7A 1H6CA 4B9AA 1XI2A 1WE2A 2Z04A 1TMGE 1Y6QA 2BF7A 2X42A 2XMDA 3O0TA 1KEEA 1VHQA 1K86A 1RMTA 3F4KA 4RK6A 3FPBA 5CURA 2CE7A 1JQLB 1WAMA 3N7AA 1IEQA 3U17A 3LWBA 2GBIA 4YBRA 1IY0A 2AOWA 2PVCA 5GIOE 3U61B 4R9VA 2ZRBA 3IBFA 3GEDA 1YNOA 4I55B 4WL0A 4YUVA 1EK2A 1XDBA 3NHFA 2I1LA 3A06A 4N40A 2FP3A 4WPGA 4CIWA 4LDQA 2EP8A 2OOKA 4HADA 1IL0A 5KYYA 3MILA 3CPSA 4L7QA 2YHSA 3ESQA 3GLGA 1I3OA 3FRIA 1U2GC 1YL6A 1GY8A 1UKZA 2BSXA 4HATA 4Q1EA 1JTFA 1ODJA 4EG6A 3IMCA 1SZCA 1CUEA 2GWHA 4QLAA 4P83A 1U8FO 1UDCA 1TQ8A 4LZJA 3NDRA 2FZWA 4QGHA 5GONA 3RS4A 4AWXA 4YIHA 5FBWB 4NRDA 4E2WA 4R41A 1DPGA 2EC5A 2IF0A 4RZIA 3TNDA 1ADFA 1CYDA 1JE1A 2VKQA 4M4SA 4CMIA 4DCJA 1N1EA 1EJ6A 4B3FX 1GA4A 2AC4A 2WIFA 1TQ2A 4UAJA 3SXPA 5C1IA 1Z0IA 2R1ZA 4YWHA 1I9GA 1OH6A 3K1YA 1PQPA 4O0MA 3DKRA 3BKXA 1TFRA 3OIGA 1QYVA 2ZU6A 2W2VA 3GUUA 3OFNA 1MDFA 5C3MA 2XQKA 4B7CA 3VDXA 2HDHA 3OICA 3KYBA 2ZBFA 5ALQA 3WYCA 1HZZC 2VK8A 3IJEB 3OAAD 3K70D 2JD2A 4Q00A 1DIGA 1KI1A 4CF6A 3FCXA 4HRAA 1EJ2A 1OJ7A 4LS3A 4PGMA 3TD6A 3RAEC 3R24A 3O4RA 3LLVA 1XZBA 3FY4A 3BIJA 4FEAA 3OOHA 2OXCA 4LZLA 5TIIA 1C1DB 3ETNA 1Y5IA 1BMTA 1MABA 2WJHA 4XOIA 1N9KA 4LDJA 4MGZR 1YRHA 4LCJA 4BN0A 1EVLA 2GAOA 3OKCA 3EDMA 5F5NA 2ZBDA 1EUDA 1RWBA 5BW8A 5GQSA 4G0UA 2FOIA 1ZRHA 3OPYI 4IV0A 3NT5A 1PO7A 3CUYA 4RS4A 4BKMA 6YASA 1HLGA 1ZCBA 5IULC 1HDXA 1XMVA 4IDPA 3KOXA 3HI6A 4UTPA 3TLGB 1QRDA 3D59A 1GXSB 1LNSA 2OLKA 2XNKA 2WKPA 3DZHA 2IYFA 1V4VA 3KBBA 4UUBA 5B1IA 4F84A 2PKRA 3DSRA 2FSGA 2W0SA 3DBRB 3VPGA 4Q18A 4DXAA 3NC4A 3A37A 1N2HA 2AG1A 2FMFA 4CM3A 3N7TA 1ZNZA 2WYHA 4JCOA 1GRRA 3IV6A 3B3JA 4N5MA 3AY0A 3TRDA 2VT6A 1J8DA 1NGSA 1YS1X 1QIGA 2K4MA 4J3JA 1DJLA 5J5CA 4JB8A 2V0GA 3IMKA 1Q22A 3R8XA 1O77A 1V8BA 3PGMA 4ZGBA 1C3OB 1SUIA 1ULSA 4DJFC 3RSOA 2E37A 3DZCA 3DZDA 1N9ZA 1NW7A 3NBAA 2FSSA 4NICA 3G82C 2A59A 2WT4A 1L4KA 3KLOA 5IXYA 3T7EA 1TMKA 3G8DA 2QAGA 1AOXA 2JI9A 3K8OE 1JSRA 2H9YA 2HH9A 4L50A 4QODA 5TQ2A 1ZXXA 3FNQA 4IYRA 1JJ7A 4UE6A 3SC2A 4CKWB 2TMGA 4EB6A 1U4OA 4IZHA 1BS1A 4XUDA 1MQAA 2HNBA 4MP8A 5IU6A 3AR9A 5ALHA 3LW8A 2JCSA 3N2IA 3ZKWA 3S44A 2E4ZA 1ZZEA 2O0HA 2W43A 1UQRA 2WPNA 3P2YA 1QVVA 3UATA 4C76A 2CY0A 1UKAA 3L46A 3AF6A 1Z2CA 2IU4A 3M5CA 5DGHA 4OHCA 3HEBA 4FMCB 4RCVA 5TDHA 2OEPA 3UV6A 2V7WA 1NJ2A 1JLKA 3PK0A 2BN4A 2CCGA 4Z0PA 1YI8A 3CIFA 4R5MA 3VR4H 3S2GA 1CPYA 2O3TA 3U7IA 3INNA 2ZU0C 3QKSA 5JYCA 1AUPA 1GNRA 1KYQA 2XBUA 5DCUA 2ACKA 3T0FA 1VB5A 3VQTA 3OLXA 4JAVC 3JQ9C 4RANA 4RK1A 5DU2A 1YNSA 2AOTA 4JJIA 1G4UR 3GLFA 2JFFA 4ZMBA 1G55A 4IDCA 4OPMA 4WY2A 1NQAO 4BQPA 4B81A 1H6DA 2CF6A 2VJKA 4OFZA 2VC2B 4QFMA 5FNVB 5KB3A 2R8ZA 3V46A 5PGMA 3HXOA 4WLNA 3QGMA 2X9GA 5H4GA 1JR6A 3L1KA 2M9MA 3EJWA 2WE7A 4B48A 4NS4A 4MS1A 5IW8A 2R86A 1WMEA 4GP6A 2D5AA 3HWX1 3M33A 4NY1A 5H1YA 3TFOA 3V1NA 1HDIA 4EJSB 4YT8A 1LXCA 4QNMA 2G5GX 3K9GA 2G0NA 1XJ5A 5LVAA 3U62A 3UUFA 1D4OA 1YS4A 1W36D 2DWUA 3GJTA 3ZN2A 1XAHA 1VE1A 4V0OA 5EJGA 1BXGA 4YR7A 1P8JA 1YMQA 5FR2A 3RHFA 721PA 3BFJA 4C4RA 3M8KA 1O4VA 4R8RA 4MW2A 3VR5D 4AJJA 2FN4A 2B7CA 4HVTA 5K8CA 4MQEB 1EVEA 2OCDA 1Z4IA 3Q3GE 1WZCA 2H3HA 4O63O 4YA6A 3O9ZA 3FJ1A 3R7AA 3K4QA 1ZM4A 1IWBB 2QRMA 2O57A 1K7SN 2F3TA 5DM70 4NYMR 1TVMA 3R5SA 1ZS9A 4OIMA 3A6FA 4WXMA 4HXGA 4G1MB 1I5RA 1EG7A 1BVHA 2OGTA 5ELXA 5CDTA 5CX1B 2RGCA 4R8MA 2ZAMA 4OM7A 1GPMA 4ZOLA 2R6ZA 4FDTA 5DI3B 5J2TF 5JAPA 1FIUA 1E2EA 3UV7A 1MB9A 1DXYA 1AKWA 3N2GA 4YALA 5FDFA 3IVXA 5LOVB 4LZAA 2FWNA 3O4JA 4QM6A 1VBNA 4X93A 4O4IF 1Z2PX 4E2FA 1BE1A 1T13A 3B9RA 1Z0FA 5JQWA 1JA9A 3K2QA 1ZGGA 2R48A 1BJKA 3ROPA 1F3LA 1CY7A 5KHLB 1B0UA 1NVDA 1UMKA 4WINA 5FOXA 1E9CA 4EHIA 3RJZA 2FSVA 2YYZA 3REQA 1CJKC 4IHQA 2FPGB 1VPLA 2RC6A 1O8BA 1U0EA 3FPEA 4AO6A 4LY0A 3VYTB 4B6GA 2GYWA 4IFIA 2FZKA 5H3CA 2J3MA 4K87A 5FRDA 1BA3A 1CZOA 3KAKA 3B53X 4YQEA 5C4MA 1G6KA 2QD5A 3KHTA 1H2ZA 1EAYA 1SCUB 4L4XA 4WBNA 3FYCA 4YRZA 2ZE8A 3WOVA 3IESA 1DTEA 1T26A 2RHGB 3BGDA 4Q9LA 1W85A 1CEXA 3H9CA 3ZV4A 3IPAA 1KZ6A 2FFQA 2A9VA 2W8ZA 1QYRA 3AL3A 3KXLA 3AG6A 4IIEA 4XZ3A 3IXMA 5IC6A 1T25A 3SQOA 4DVJA 4IO1A 4LDPA 3LPAA 1B26A 3OJOA 3OM9A 3TWOA 3X1ZA 3IOMA 5B30A 1QGDA 4RZSA 4ZI7A 3EPLA 4DR3B 1Z7WA 2OHHA 2VZ0A 1QAMA 1ISJA 3K6KA 4KQ1A 2WWVD 3UHAA 1A9SA 4LHEA 5TF0A 3EAGA 3RSSA 3DFIA 3DZFA 3JU3A 4LWQA 4PPNA 1MORA 1AH2A 5FUXA 2R97A 1W5AA 2QZ4A 1DO0A 1TZBA 3I73A 4FLMA 3T6KA 2FW8A 3BA6A 5DNWA 3VAZA 5EZSA 2JVKA 1M5TA 3U48A 2RJNA 1Z29A 4I81A 2JIPA 3PHJA 3C3KA 3OM8A 2W42A 4FFPA 1J2YA 1YU6A 4I5GA 2W6ID 4M86A 1FSSA 2NZJA 3DAGA 2ZTSA 3GT4A 1E0JA 4IEEA 3TJZA 2NUAA 3QENA 5CM8B 3GPIA 4Q4JB 3SHOA 2NZ2A 3LZ6A 3DOJA 3ZXIA 2WJAA 4Y2YA 3ORSA 2D1TA 1HGXA 3WRXC 2QZ9A 4QGSA 5LP6A 1U0JA 2ZCVA 3QVOA 4LC1A 2IPXA 3QLTA 2HFKA 3DTTA 1JG7A 5K01A 5T8KC 4S12A 2IEDA 5AJUA 2JJQA 1FDSA 5CXQA 5BOSA 5A0VA 2DFKB 4LW8A 2JBAA 1JNYA 3U13A 3V8RA 5KKCA 2FUKA 1QZUA 1YBFA 1Z56C 2EGGA 1P3JA 4R1LA 1DIAA 5G4LA 4UTXA 2VHZA 3SZUA 1R0WA 3D8SA 1JKIA 3NBKA 3L7OA 3KSAC 5I9NA 4ZT7A 1U6IA 3WIEA 3AEXA 1HQDA 3CPJB 4ZJYA 3PQDA 3SHFA 3PL5A 1X7XA 3KJIA 3DWFA 2EF1A 4M2LA 3Q10A 1I0ZA 2VPWA 4UTNA 3CQ9A 4ZVQA 4GI1A 1P9NA 4WXRA 1E60A 1RLOA 1VL8A 3PA8A 1EM8A 5CIQA 4HI0E 4WZBB 5A9TA 4D4HA 4D8YA 1JAZA 3VFDA 3VKVA 1K4MA 2ONZA 4E07A 1PEAA 5IXJA 1JT2A 5JUWA 4KO2S 2I7CA 2PMFA 3HVJA 4KMMA 4H60A 5L7WA 2P7HA 1G98A 4HQOA 1E7YA 1W19A 2WSIA 3GBSA 3NVAA 2QAIA 1I1QB 4WKBA 3S5UA 2F3RA 2CW5A 1GSIA 2G82A 3KOMA 4S1TA 2ZBEA 4UVGA 4DJEC 1XRSB 2PUAA 3I9MA 3E9YA 2Z6VA 4M49A 4QQ8A 2E6KA 2REOA 4L85A 2WV9A 4MIEA 3SIRA 1V1RB 3B38A 1UWKA 3H9UA 4J2HA 4JH0A 4YMIA 5L8VA 2IH2A 2XGJA 4ZT3A 2JG3A 4B7XA 1VIAA 5JXWA 5ICSA 3LRXA 4YAGA 1HF3A 1Q74A 1Y3HA 2W6OA 1RKXA 3ESCA 1NW5A 4OQQA 5IM5A 5TT1A 2Z6UA 2ACVA 4WASA 3GXOA 2JLUA 3QMVA 3B2QA 2HPZA 2FJPA 3G5TA 3TJRA 1GTSA 2C2XA 4RSMA 1J7JA 1P5JA 4RGQA 5KYGA 5KX5A 1PWHA 3UPUA 2FN3A 4NONA 3D7KA 1GKLA 2HX1A 4RESA 2G1UA 5JASA 5HCUA 5HZHA 2X3YA 1USVA 3T7IA 3U80A 2GKSA 4TXNA 1SH7A 3L7NA 2LKCA 4YAFA 4YRIA 3A2NA 4J3NA 3GQVA 5J2UF 3ZJUA 2QRQA 1AHHA 1M6WA 1RFLA 3A4LA 3GJZA 4RIIA 3COJA 1C1YA 1OGIA 3RRYA 2P9ZA 3VI4B 2VDOB 2QI9F 3ENQA 1NXSA 5H16A 2Q29A 3EAQA 2G9NA 3O1IC 4LOIA 5IAKA 5AJZA 2JBHA 2GAJA 4OXXA 2GFIA 2XGSA 3SY8A 2IITA 1IULA 2ZSFA 4UNQA 5A6SA 2D6FA 4K0RA 4X1KA 2PGNA 3R7WB 1A1VA 2AHOA 1QQAA 3ODGA 2QLTA 3EARA 3QPDA 1T4CB 2X15A 2BIFA 4NJMA 3L40A 4PS0A 1EE2A 2R25B 3MAGA 4MRPA 5TPWA 4RK0A 3WLPA 4TS4A 1FQOA 5JWRA 4E5YA 1TCUA 2V03A 5KYXA 2CL7X 1T8PA 4QXOA 3W4IA 4JOSA 1EZZA 1TT5B 4CCAA 5K3BA 1JFFA 3F7MA 3CZMA 3CT6A 3ILXA 1L7OA 1FXSA 3TSZA 2EL9A 2PEZA 1XLUA 2I54A 1CUJA 1WULS 1V3UA 2RKWA 4I55A 4IV8A 4D9IA 1Y5NA 4YUZA 1PT8A 2H1SA 2QMHA 5FPPA 4QG3A 3PUIA 3OFJA 4QAQA 2B92A 3I12A 1V7QA 3PDWA 4MS4B 4TLBA 3EMKA 3QKUA 5EESA 4HN2A 1XEWX 3KQSA 1OAOA 4QDTA 1NF2A 1CR2A 1NTOA 3JQRA 4KCGA 4BUCA 2W4IA 3FYDA 4EECA 5KKNB 4WESA 1D9ZA 1IOZA 4B6PA 1YGYA 3U56A 3IMFA 3G8CA 4G1VA 3EXAA 3IILA 1CUUA 4E30A 1A7KA 1WY7A 2WSLA 3ROKA 2P91A 1QSGA 2PJUA 1UWCA 2P4UA 3ELUA 3LCCA 3M4XA 3BH0A 2GRJA 3FUWA 1V5GA 2O8VA 3ROQA 3ZGYA 1U2TA 1SOUA 3K35A 1NR1A 4B1FA 1LTKA 5LYJF 4QOHA 2HTFA 2FFHA 3A3KA 4A82A 5JTUA 4MEJA 3EASA 4B2IA 1CZUA 1V25A 4DLUA 5CW2A 1XXLA 2W2LA 1JFSA 4P8RA 5B1SA 2L0XA 4R1UA 4QU5A 2WJWA 4TKZA 3OLCX 2AJ8A 3TUJC 1AUQA 1PJBA 2XIJA 3HB0A 4OK5A 5EJ2A 4QWMA 3V1KA 4GBGA 1PJCA 1Y9ZA 4EFMA 2PKYX 2XB4A 1O57A 3N59A 3W8FA 5EJ8A 5BXYA 3KB8A 3MJHA 4PFKA 5DISB 3SQMA 2AKYA 4JLVA 5K0NA 3UAZA 2O0MA 4IG4A 2P90A 1C1DA 2C4MA 3DBOB 1SPXA 1NJFA 2FPIB 4RMIA 1EDBA 2PYZA 1F5NA 3EZ9A 2BGIA 4FLEA 3SIPA 1USGA 3W1EA 1KEVA 5AXCA 3PA6A 4B45A 5DYGA 1YZNA 3QBDA 2IPMA 4R2KA 3O26A 5FADA 2QTNA 5A2GA 2QSZA 2WU4A 3BULA 2BL4A 2QYSA 2YY7A 1IB0A 4IMJB 4EG0A 1ZR4A 4FWTA 4MQBA 1DNPA 2NU6B 1P9WA 4X54A 3QE3A 3WLEA 3S81A 3ZI0A 2VJDA 4MVJD 2FR8C 2BLNA 1UINA 3PHGA 3ESDA 4P4GA 3OLVA 5KVCA 1GAEO 1EWTA 1NN3A 2FPSA 2H54A 3PE6A 5DSZA 3OM0A 3U26A 5BSVA 4L9SA 1UMBB 3Q5DA 4ZAVA 1GT6A 2XITA 2WI8A 3O8OB 3PR1A 2BEWB 1DDOA 1UKVY 2OCIA 2ZITA 3G7NA 3IBCA 4A9AA 4LIPD 5JLJA 1R3DA 1XGKA 4OP3A 3OCZA 1RI2A 5ILOA 2W58A 1MP0A 5LZ4A 2BKEA 4MS3A 2WYVA 1V16A 3ZH9B 4X5OA 4F97A 1NSFA 1UDRA 2ID7A 2PEYA 4QEDA 1PFYA 1SVIA 3QEAZ 3CZAA 1BKSB 1OQAA 3AP2A 2NV6A 1G5TA 3GELA 4KH1A 3MLBA 4QYXA 1QF6A 4OGFA 1A9RA 1NFRA 1KP2A 1H2AS 2D0PB 3ESBA 3LBFA 4GE3A 5ER9A 3ROEA 3RRBA 4C88A 3VMMA 4H7PA 3MS7A 3VSBA 5LZ2A 2IP1A 1KK0A 3O47A 1Q83A 3HUUA 1L1EA 1I3KA 3G49A 1I5EA 4LFCB 4ASUD 3IUSA 4JLJA 3I83A 4MQUA 1AUOA 3PE4A 4BLSA 4CT5A 4OB8A 3EJ6A 3DO5A 2QNRA 2C5EA 3A8TA 3EZYA 3X3HA 2JD1A 3CNEA 2CJWB 3VU0A 4V0LA 2HCTA 3ENZA 1AIPA 1U0NA 2DC1A 4MVJF 3DL4A 3EOAI 1FU8A 1SWWA 2JGKA 2CMDA 5LZ9A 3IUQA 3RYIB 1L5HB 4IEIA 3WLRA 3VISA 2COKA 1YACA 4Z7NB 1CD5A 4YJFB 3NG1A 3EUWA 1DJOA 2C00A 4LF4B 2OGUA 1A8PA 3LXXA 2PBLA 4RMNA 2TRSB 3PNYA 2KBEA 3CZ4A 4YV1A 2YVQA 5ITWA 2JZCA 4KYUA 1AB6A 5E8JA 3FW1A 1V6AA 2OCKA 3AYXB 3GNSA 4Y2JA 3RVSA 3UMFA 1CTQA 2IUSA 2N1MA 4MEAA 3OQOA 3A7DA 1AA6A 3U3RA 2YZNA 5CFRA 4LF6B 4AECA 5TT0A 1R5OA 1CEYA 2C94A 1RVV1 3I09A 3FYSA 1PW5A 2QR2A 1J22A 3I6IA 1CUCA 1RW4A 1N7IA 3OIFA 3OZ7A 5HFAA 4RTPA 2Q6KA 2P5SA 4G4SO 4XIYA 5ED0A 3G6WA 1LX6A 1XA0A 2NQ8A 4DLNA 5EJ5A 4IQ4A 4EX7A 7GPBA 1CQIB 1M6NA 1CF4A 2VNJA 4L3VA 1O7JA 1QGZA 3DVLA 1MEOA 2Z5VA 5HYVA 5CA0B 3EQZA 3FZGA 4CF3A 3OZXA 3K0AB 4K86A 3LHFA 3O94A 4KFRA 3H0KA 5JS8A 2YNMA 5EC8A 2BI8A 2QRKA 4DCGA 1T8TA 1Z6AA 3AB7A 4X94A 3QG1A 1SOWA 2QM8A 3RS2A 3TNJA 4ZREA 5EPEA 3V4OA 4D26A 3H3XA 4CU5A 1GGMA 2HJRA 1TK3A 2QPAA 1YASA 3AZPA 3LNTA 3QLUC 3K3PA 3LCJA 4TYNA 3EDOA 5BQ3A 1WM1A 4IXTA 2OYRA 5U4XA 2CEAA 2QN1A 3TSCA 4GLJA 4EZIA 3BHMA 4JUDX 1AKVA 5JH7F 4GLBA 2A3RA 5EQJB 1R0BA 2YCLA 4RV5A 3TGWA 4DA8A 3PICA 4D92A 1OREA 1BH6A 2GTHA 5AJYA 1BVYF 1JT9A 1N6HA 1GPYA 2PY6A 2JFHA 4ITRC 3WOHA 2W98A 1N5JA 4JELA 3WJAA 3T06B 2ZXFA 1E6LA 2C5FA 2P67A 4HG2A 3CVWA 5D6NA 3QEOA 3ZHCA 3O21A 3PLAE 1SUSA 3C7AA 1JYSA 1NXWA 3H42B 1OFHA 2QMZA 4Q82A 4AYTA 5ALVA 1X9IA 1CLUA 3N2ZB 2GNAA 2I6UA 3TPZA 4V0RA 1YBHA 2Q0XA 2QMUA 1FP2A 5DI3A 3FFBA 1NNEA 2H1RA 2XEXA 3LBHA 3SS8A 4ER3A 2HDOA 1DO2A 3G0BA 3K5IA 2YXEA 4BVKA 4F5WA 2ZAYA 3O74A 2QLNA 5LOVA 5FI3A 1EX9A 2HWYA 3JR3A 1R6DA 3NKVA 4MW4A 5CVDA 3ETEA 2AUTA 4ED9A 1COZA 1QH0A 4XWWA 3OMWA 2V7PA 4RTRA 2Q6TA 1BH2A 3IPYA 3MTQA 3MXTA 1H5UA 4B84A 1E0AA 3K1TA 4RCYA 4BEWA 4EG3A 4FDAA 5LMZA 2J9FB 4AJEA 2GCIA 2SKCA 4DQXA 5K6TA 1A4IA 1HBJA 4BVLA 3HKCA 1OMOA 1FFCA 1MC5A 2OHXA 4KN6A 2YVAA 5JXIA 2G6TA 2E6UX 2VAWA 3FSRA 4W8HA 2V5VA 1NWCA 3KSBC 4JX9A 2A0WA 1X1EA 3P2JA 3GV0A 3T3EA 1Q77A 4EMTA 1E1QD 1Y3AA 2R1VA 2ZYWX 2XZPA 3BXXA 1GAWA 4GVXA 3OFKA 4K81B 2QTHA 4EFLA 5EKUA 2HIHA 5LQSA 3GA7A 5KO2A 1EUQA 1R0SA 3C1UA 3V00A 4UHBA 5JI2E 3RGWS 2E4YA 3AY3A 2VAXA 4DBLE 1QH1B 4EQZA 5E9JA 3QNMA 4WN9B 3ZEIA 4K03A 4PQGA 1T6ZA 3RIYA 4Q4CA 1SU7A 3KTAA 1E69A 3F3YA 3GY0A 1W2HA 4IXWA 4NEGA 1X8XA 4QNRA 4YRBA 1RWPA 3GP3A 3RAFC 2X41A 2QIPA 3PIRA 2I6GA 4KIWA 4N3BA 5ALLA 2XGMA 3E84A 5DEIA 1S3IA 2QROA 2FQXA 5FI1B 1G5RA 3WWCA 1LC3A 2OR3A 3EIXA 3OIWA 4UCWA 5AUQA 1MAVA 2ZKLA 3TQHA 1H23A 4F2PA 3KALA 2XXAB 1EP3B 1P91A 4P82A 1PT7A 4HB2A 1W0CA 1BZYA 2HRCA 5DIFA 1WPRA 1I7DA 2A1IA 4W1RA 2JH9A 2VF4X 1QYXA 2V59A 2W2XA 3DPIA 4BFWA 3UY4A 5EJAA 2FQYA 1B15A 1LUAA 1H5NA 1L1QA 1T5TA 4LSGA 4URFA 4V03A 1F8XA 5HBRA 5CLJA 4BNFA 5H82A 1JHVA 4MUKA 2Q8QA 3A2KA 3B82A 1TRHA 4X63A 2BE9A 3QFSA 4O2BF 4UBIA 4ECEA 1VLVA 4ARAA 1XU7A 4CF4A 3R7LA 1W5BA 1QHXA 1Z7BA 4M7OA 1QF7A 3NTVA 3HYCA 1KPIA 4H4EA 1O03A 3GL9A 4NZOA 3NTOA 3UWMA 3W6PA 3QU2A 5IVKA 1Q0LA 3HZZA 3K20A 3QP9A 3RKUA 1J8YF 3QXSA 1M2OA 1YDGA 1NY5A 1A5BB 4OMDA 1C7FA 1CYEA 3H5OA 1KOLA 5CHEA 4EO9A 3RJTA 4G4IA 2JGMA 3OT1B 2HWUA 5I8WA 1JDUA 1QRRA 1C2TA 5E6UB 2PBRA 2Y68A 4Q3CA 5K05A 1SZPA 1TA4A 2VA9A 3DV0A 3RIMA 2RGWA 2JI8A 3VYVA 3SM9A 2I7XA 1NV9A 2WZQA 3AGQA 3QX9A 4OFBA 4WJKB 4WZBA 1CQJA 2NO4A 4M46A 3DMNA 4PO1A 1J6UA 2GB4A 1J25A 5A5GA 3GBVA 4MVCA 5EOVA 2CLEB 4KAAA 3TM5A 3FDZA 1SCKA 3G2KA 2X23A 5AI6A 4TOIA 4DC1A 2H5IA 5BQPA 4JIMA 3RHTA 4A8HA 4V1CA 1JKJA 1OLXB 2PFKA 4ZHQF