2QTRA

Crystal structure of nicotinate mononucleotide adenylyltransferase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and X-ray structural evidence for negative cooperativity in substrate binding to nicotinate mononucleotide adenylyltransferase (NMAT) from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
total genus 56
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qtrA00
4UZFA 1MB2A 5DASA 2CYBA 1T6XA 4QBTA 3COZA 1VL2A 1KP2A 4MWDA 1OBCA 1WZ2A 1M8GA 3ELBA 3X1JA 1H3EA 1YI8A 2Z08A 3CVVA 4EG7A 1U7XA 3FNRA 1KH1A 1U7DA 1Y42X 4MW7A 1EUQA 1KORA 4NX2A 1NURA 1NUTA 2DLCX 5TS2A 4YMIA 1LI7A 3SZ3A 1FFYA 1OWNA 4MUEA 1NUUA 2DR2A 3KT8A 3AL0C 1MAUA 2J4DA 3AG5A 3UOWA 2DEUA 3DO8A 3U1VA 4DDMA 1TYAE 2H2AA 3MLAA 1WXIA 2CYCA 3FWKA 4MUKA 1G59A 2WSIA 2PFSA 1U3DA 1WXEA 1T9GS 4P2BA 1N2BA 2R5WA 4I6JA 3RK0A 1QU3A 1WQ3A 2EL7A 2GKSA 2IELA 2DETA 1OBHA 4DJAA 2X1MA 1K4KA 2PIDA 4R2MA 4I6EA 1Q19A 1F7VA 4EFKA 3DPIA 2PZAA 2RD2A 1JECA 1I6LA 4JYZA 1BS2A 3IVCA 1M83A 4OUDB 1KQPA 2X0KA 1PFVA 1WY5A 3L93A 1IVSA 4YBRA 1QRSA 4R0NA 1ZH6A 3KFLA 1QTQA 4CDMA 4KR7A 1R6UA 3IH5A 2E21A 3FG9A 5FO1A 3E27A 1K97A 1JZSA 2A7XA 1J20A 3INNA 1XNGA 3K9WA 4PY2A 4MUNA 1EFVA 1J1UA 4MW2A 5BNZA 4KPUB 1NZJA 4GU5A 3S3TA 3A4IA 3OP1A 1O95C 2GOYA 2WQ7A 5HUJA 3H9BA 3IVXA 1I6MA 1D2RA 2QUKA 2JANA 4CT0A 3HV0A 4MW0A 1H3NA 3NV7A 4JFAA 1OWLA 1ZUNA 4UZEA 1N2OA 2QUJA 4BWVA 1B6TA 3PNVA 4DE5A 2IP1A 2CV2A 4KR9A 1O97C 5F23A 1TYBE 5FNZA 3ZJTA 1KH2A 3TQIA 3IOBA 1EUYA 4G5YA 2CT8A 1MAWA 3FH0A 1QU2A 4HPWA 4KR6A 4DNXA 1WQ4A 1KAQA 5DB4A 4MW6A 5JBNA 1NUPA 2ZP1A 1IQUA 3A04A 4E1AA 1LI5A 3CLRC 1F7UA 1XNHA 4L2IB 1N78A 1O0BA 3A2KA 3P0IA 3CLSC 1WOYA 3ZXSA 3NBAA 1IQ0A 1S4MA 4EGAA 2A88A 1GN8A 1SURA 4EF6A 1Q15A 4ZT6A 3CVUA 2CFOA 2A86A 3QE4A 5J58A 4AS1A 1O97D 4MLPA 4NAHA 3TQOA 3UC5A 3MMXA 2H29A 1KKUA 3CR8A 4PBTA 1VBMA 3P0HA 3TNJA 3CLRD 4JZYA 2QJTA 3Q12A 1T6ZA 5DK4A 1VBKA 2X3FA 1GTRA 2A1UA 3HFJA 1YUMA 3P52A 4K0RA 1N3LA 3FOCA 3ZJVA 3BL5A 1T6YA 4OUDA 1O0CA 2DPLA 3LOQA 1XNJA 3FIUA 2VTBA 1N75A 3FY4A 1M8JA 5H7XA 3IDFA 2J08A 1XJQA 5EKDA 4MW4A 4JXZA 3CVWA 2XRYA 2E18A 1O5TA 2E89A 3IUEA 1GAXA 4EG6A 4J76A 3COWA 4MQ6A 4ZT3A 3QTBA 2GM3A 3IOCA 3AG6A 2JA2A 3GLVA 4I6GA 2DERA 3D6VA 1JMVA 2YY5A 3C8ZA 1TYDE 3OTWA 1O95D 2A1TS 1YIAA 1I2DA 4G6ZA 2IJGX 1PFUA 4U63A 1ZH0A 5KWVA 4MW9A 3N8HA 2HMAA 3TS1A 4ARCA 3FI0A 4TS1A 1HYBA 2YXNA 4QRDA 4MVCA 2YWCA 3G59A 4U8HA 1WXGA 3DV2A 3LE8A 3RJZA 1NUSA 3CVYA 1PFWA 2CV1A 4ND6A 3PRHA 1FYDA 4G5FA 1YIDA 3LCJA 2J5BA 1JILA 3N05A 2B7LA 3KT0A 5DEOA 3MLBA 1J70A 5LM3A 2J07A 3H05A 3CVXA 2I1LA 1KQOA 3DLAA 3X1MA 2BTEA 2EJCA 3VRHA 1TQ8A 4WSOA 1OWMA 1PG0A 1OWOA 4YP7A 4U7JA 1EXDA 2O8VA 1A8HA 3COYA 1JEEA 2NSYA 3KT3A 1JEDA 1QQTA 1NUQA 2AKEA 5KHAA 2O5RA 1O96B 3IVGA 4RUKA 1R6XA 1TFUA 1EFPB 1UFVA 1IQRA 1TEZA 4ZCQA 1MRZA 1T9GR 4ZCTA 3RBAA 1NSYA 4EG5A 1VBNA 4MUIA 3MUEA 3FETA 1TYCA 1JZQA 3AFHA 4FZJA 1QJCA 1ILEA 2D5BA 4EG1A 2D13A 3CLTD 2BYTA 1MB9A 1IFXA 4KPUA 3PNBA 1EJ2A 1PFYA 1MBZA 1RQGA 1NI5A 2A84A 1YULA 4PBSA 4OJMX 2AG6A 3GUZA 2PZ8A 1ULHA 1G8GA 1COZA 3VU8A 3UY4A 4DDHA 4MUFA 4DDKA 3I05A 1NP7A 4HJXA 5J5AA 1EFVB 1IHOA 4CDNA 3ZGZA 1J1ZA 3PNYA 4ARIA 2ZUEA 4XFDA 1O94C 3VGJA 5K0TA 1NYLA 2PZBA 3SZGA 3G5AA 2QUIA 4MAFA 2QJOA 1H3FA 3SEQA 2Z3VA 3RFFA 1N2HA 1ZJWA 4MVYA 5TGTA 4J75A 2V0CA 3L92A 4CQNA 4MUJA 3CLUD 1JIKA 3G6KA 3RHSA 4XFJA 3ISJA 1QRUA 4L2IA 5H16A 3ND6A 1V8FA 5KCMA 1N2IA 3GMIA 4EG8A 4NATA 3IODA 3ZJUA 2CYAA 1H1TA 4PBRA 5AHWA 3ILVA 3AIIA 4WNYA 5HG0A 2NZ2A 1K4MA 1KAMA 3RK1A 4NDAA 2XRZA 4ND7A 1MOPA 3H97A 4HK4A 4F4HA 4ZCPA 3MXTA 3UK2A 1I6KA 3F3MA 1WXHA 3N2YA 2CUZA 1K92A 1PG2A 4HJRA 4JXXA 3IMEA 1GZUA 1Q11A 1X6VA 2A1UB 4ZCRA 1JIJA 2QJFA 3H9CA 4EG4A 1LW7A 3IUBA 3M5WA 1P7PA 3UMVA 3D6UA 3AKZA 3NBKA 2E0IA 4RPIA 4NZPA 2WB2A 1MJHA 3HGMA 2A4MA 1N2JA 2D54A 3IMCA 5TEVA 3Q4GA 1KP3A 2QTNA 1J09A 3PXUA 2J09A 3SYTA 5LLTA 1F4LA 4MVXA 5TEWA 3TZLA 4MWBA 3SDBA 3ZUGA 4K03A 4MULA 2QTRA 2Z09A 1O96A 1M8PA 2CV0A 3CLTC 3SEZA 2OQ2A 3FDXA 3HL4A 3ZIUA 1GLNA 2HGZA 4MUHA 1R6TA 1F9AA 2A1TR 1QRTA 1KH3A 2CSXA 3ZXIA 5IJXA 1VLHA 1V47A 2WQ6A 3TZEA 4KKVA 1DNPA 1OWPA 4MVWA 2QTMA 1EE1A 1O6BA 3SP1A 4DLPA 3ND7A 4R2LA 2PXHA 3HZRA 1JIIA 1EFPA 4ZT5A 3QTTA 1IRXA 2YWBA 3IOEA 3JXEA 4MUGA 5J59A 4MW1A 2QUHA 1M8KA 4MW5A 5IHXA 3A05A 5FO0A 1N2EA 4ZT7A 1WKBA 1N77A 1Q77A 1KQNA 3Q10A 2V0GA 4Q93A 1JGTA 1X8XA 2VXOA 3X1KA 4EG3A 4S1OA 1KR2A 4Q16A 2ZUFA 3CLSD 4MWEA 5HUHA 2AZXA 2DXIA 1QNFA 1IH8A 2TS1A 2G36A 1WJGA 4X0EA 3CA8A 5LFAA 3P0JA 3IMGA 1U3CA 4MWCA 3COVA 1CT9A 1JHDA 2PG3A 2HZ7A 3KT6A 3H99A 1M8FA 1N1DA 2C5SA 4A91A 3K32A 4GRIA 4ZT4A 1WXFA 1J21A 1YUNA 1N2GA 3N9IA 1MC1A 2DUMA 4H3SA 4F3RA 1U0BB 4XSVA 1G8HA 2JAXA 2RE8A 1O94D 1M1ZA 1OD6A 3CLUC 3ND5A 4YP6A 2VTBB 2OV4A 3HMQA 4ZCSA 4ZT2A 1GPMA 4NAUA 4AQ7A 1G8FA 2X1LA 4YP5A 4QREA 3FHJA 5K0SA 1GTSA
chains in the Genus database with same CATH superfamily
3T52A 2V1UA 1OTXA 221PA 4YEDA 1BEEA 3UWSA 1PUXA 1T6XA 3R4VA 4KRYA 1JB1A 2YXLA 4TUYA 1VE9A 5AICA 1I3MA 3UUFA 4BXOB 4I8DA 4J8PA 1P1IA 1VJTA 4PCUA 4LOJA 4YI5A 1KJZA 2XW6A 1WL8A 5IAOA 3P27A 3SBDA 1RWWA 2XMRA 3TIVA 3LL4A 2BE7A 2Q4EA 2Z08A 2ZSUA 3B1KA 1M6VA 4N8EA 4RWEA 4W9RA 5HOQA 3MMNA 4ZTZB 2HSJA 4BFVA 4QVGA 2X22A 1EHCA 4BE4A 2QU7A 2PEZA 4U6NA 1R8JA 4GOND 4S2UA 4JL8A 3AHGA 2HK6A 3EOZA 4BFUA 1E9EA 3SZUA 4BX3A 3FAKA 5A3QA 3HVRA 2YZ2A 1UFKA 3GK3A 2ARKA 2G09A 4IEEA 1N6KA 2WWYA 2EJUA 1BG6A 1G8KA 1UBKS 4ITRC 3FXAA 4ENUA 4WGGA 4J29A 1PS9A 1RI1A 2DEUA 5DCYA 4CNQA 3PDIB 1R0KA 2NUAA 4Y2YA 1I7DA 3BRSA 4NHEA 3UJ3X 1QGYA 4KH1A 3OX3A 2QRZA 3A1FA 2UXBB 1Z18A 3WXBA 2FFBA 1VG0B 4JODA 1JIVA 2FMUA 4JBNA 2NOAA 2PRSA 4NJOA 3VPXA 1GUZA 3R41A 4B6FA 5B1EA 2WHRA 3K7EA 4LRXA 1T9GS 4I1RA 3IPYA 5CJJA 2HYIC 5JROA 1GUFA 1OJ7A 4WEOA 4DCJA 1KJQA 3IAM1 4MEBA 2W11A 1CE8B 2XDWA 4CYMA 2X1MA 1ZR4A 2CKMA 1T29A 3PSHA 5ALEA 1MVOA 2LE0A 5LJLA 3PGMA 3HSSA 1T3HA 4MR8A 1KQGA 1AZLA 1XTUA 4X6LA 4C4SA 3QKSB 2QMZA 4JKIA 5BYBA 5DX8A 1XPUA 3EXHB 2A3RA 3PXAA 3F7NA 2VSYA 4KX5A 3G17A 2H92A 4ZV4A 3DHYA 4UM5A 1ZXLA 5JPIA 4YAGA 4JLVA 4RM3A 4BNKA 4G0QA 2A7QA 2AN4A 4DJDC 6NULA 4UMVA 4XWWA 2ESRA 4S1NA 3O2SB 4UVDA 1QTQA 5TPWA 5JAUA 5DNCA 2YYAA 3DBRA 3LZCA 5G1OA 2N42A 3HFRA 1KMIY 2E21A 1SG9A 4QPZA 5BUZA 3TTSA 1K97A 4EQZA 1DJLA 2WJ3A 3EDMA 3VJMA 3BXZA 5ELLA 3HXOA 1E0DA 2ZRPA 4F60A 3TW8B 3VSBA 1PR1A 5LBTA 2YXEA 1ISJA 3WYDA 5FDFA 3R5HA 4F21A 1K8ZB 3GWZA 2ZJ6A 5L4NA 1HT0A 4EELA 1QQBA 2JI9A 1BZYA 3M4NA 5BQPA 4QEDA 3ZV4A 4DNPA 5ALXA 5CVUA 2NTYC 4WN3A 1E9FA 5CRIA 1SU8A 3ZZMA 2H7CA 1P7ZA 4CT4B 3F7TA 5FFNA 4QDKA 1AU9A 2QVXX 2R79A 4C03A 1BHO1 4E1VA 3W5SA 1KFEB 2V6IA 1OQAA 1V39A 3NYRA 4PG4A 4BVEA 5IUKC 2YCLA 1CRLA 1PJ4A 2IUEA 1NI4B 2IP1A 2YOGA 2ZIUB 3K5IA 4GX2A 2W7TA 3AEQB 1W47A 2OYRA 5ABPA 3TSCA 1A72A 3UTCA 2I78A 5KDOA 3ZV7A 1G7RA 2J9XB 5DM60 3ZWDA 5ICMA 4I55A 1DQNA 2ZE5A 5CFPA 2YN0A 2AW5A 4ZPXA 1UQUA 4DGQA 4AKHA 3CBGA 1EX6A 1PFGA 4MS3B 4CW7A 3VBCA 1ESCA 1Z7BA 1JU3A 1A9XA 2XGGA 3L8GA 3QBDA 4DRZA 1IZ9A 1V6SA 2JA1A 4Z1OA 4HTFB 1TW3A 2DWUA 3DHVA 2MINB 3CLRC 1NXPA 2QP3A 1QO0D 1Y8RA 1HE2A 3V6MA 2XDQA 3AJAA 2V0NA 2BFAA 5EUCA 4B3CA 3VNVA 4JT8A 5DI9A 1R0YA 4GSKA 3ENQA 1I1HA 4TSRA 2QRLA 3TB4A 4BBPA 1LQUA 1NLZA 1B0PA 2DLDA 4G5HA 1H4SA 4J0DA 4MICA 3ZWNA 1JLSA 2K2QB 3B5EA 4HZIA 1DQZA 4M9UA 4BKMA 3FGPA 3O47A 3WNCA 4YDQA 2HQBA 4RAOA 1HSOA 4ZT6A 5A9SA 2CFOA 1NMSA 1KJYA 2GCOA 2I4OA 3QE4A 1FJXA 2E85A 3T7IA 3SBOA 4QUAA 1MNAA 3IEMA 3SQLA 4BY9E 3UC5A 3AEXA 4HEJA 2EV9A 3FZYA 3EIUA 4MDFA 2BELA 2QV0A 3CSDA 3O94A 1XF1A 3F5QA 2IXEA 3OVMA 4LISA 1K7XB 5A6SB 1PG5A 3DF9A 1YA4A 2JIRA 2R87A 2W6CX 1G41A 2WHQA 4BKQA 4JJKA 3AESA 5KYUA 1WMBA 3VTAA 2FCAA 3G9QA 2VG8A 5L3RA 4PO9A 4TKUB 2BSXA 3OWXA 1KBOA 4HAXA 1I7NA 2YIJA 3LUPA 3LUBA 2SCUB 4W8OA 5KYXB 1WB9A 3GGDA 2OO5C 3QE2A 3I2GA 4FS8A 1IUNA 4U3JA 9ATCA 4P22A 1AGXA 2OGTA 3CB4A 1KNXA 1RI2A 3KBBA 2I2AA 4YC7A 1K6XA 4URWR 1JWLA 3FY4A 5H7XA 2ADMA 1XCGB 2FW6A 1B00A 4IVNA 4LKRA 2R84A 5HGJA 2FMIA 2V3VA 1EWQA 2E89A 1B73A 4XWAA 4EITA 3VI3B 4PPNA 2PUBA 2DTDA 4JI4B 1N4AA 1H65A 5CLQA 5BV2P 2FK8A 3GLVA 1N9KA 2EP7A 4D9HA 2QW1A 1ZD5A 1QHHB 1YJAA 2X77A 4PRKA 3T9DA 3V3KA 3ZCPA 2EG5A 3OTWA 4RULA 1M33A 5LD2B 5JS1A 3SF8A 5TX7A 3LI2A 3V7YA 3QWBA 3MUNA 5JW6A 1PFQA 2NUBA 3PL1A 3UICA 1F17A 1EFDN 1HYBA 3NIWA 1ZN8A 3OQPA 4O4IB 4QBFA 1WZNA 4RK1A 4EKIA 3QOYA 4YAEA 3D7SA 2AN5A 4Q4DA 2Z8YM 1IXRC 2Q4RA 2YMQA 3EJ6A 1TKCA 1GKKA 1FE8A 1ZVJA 4EB6B 5IZCA 4H4CA 4CIYA 3WL6A 2XMGA 4EJFA 2PSEA 3EDCA 1FZQA 1X7ZA 2R1UA 4P7JA 13PKA 3MCZA 1JILA 5A3RA 3C3AA 1RXSA 4M36A 4M7OA 2Z9BA 4BFCA 2H2GA 1TZJA 3BFVA 5M3BA 1QLWA 5I48A 4B47A 2RONA 2Q5EA 1X74A 4W82A 1J0AA 5BYAA 4B3XA 5JWRA 3WFJA 4YV7A 5LJIA 4ESEA 3K73O 2J6IA 1N0UA 2D5CA 2GCOB 1XL0A 3GMSA 2XCQA 2JI6A 3HRHA 2XCUA 3PJFA 1R9JA 2GK4A 1UJCA 1WETA 3QKRA 3NBZC 4O25A 2CXNA 2O4CA 3FSGA 4I81A 4BO3A 5FBVB 4QGBA 1ULAA 2R9VA 3F6CA 3M6VA 5EA2A 4ETNA 1DEXA 1PWHA 4BVFA 2G63A 3UK0A 1WMEA 2HL6A 2VPYA 1U99A 3LHDA 4QNRA 1PGJA 3LYUA 3EVGA 4HQNA 4R1NA 4U7JA 1DCKA 4V0KA 3SXPA 3UW3A 1I3OA 1UT5A 5H68A 5J4KA 5LC1A 3ZKAA 1JEEA 4RA9B 2VT6A 3HU5A 3QKTA 3U4MA 1AHNA 1ZNWA 3HCRA 2DX7A 5LQCA 1Z3IX 2DOKA 1FS6A 2VDJA 3JWPA 3E9CA 1I32A 1I0ZA 2R2GA 4JU9A 4U3JB 3O2NA 1YIOA 5B1SA 1FTYA 4HC4A 1YOVA 4AF7A 1SQSA 4WLVA 2H2DA 2GPBA 2VATA 1BJTA 3KUKA 5GONA 1GFIA 3DAOA 1Z08A 2G8LA 5AOAA 3USZA 3WDMA 1W88A 3JZMA 4IIJF 4RESA 4RJKA 4E13A 4TKVA 9LDTA 2JHAA 3AFHA 5I51A 1G2PA 1RZ3A 2CCJA 1F60A 3FMVA 3AF3A 4TTRA 3OQIA 3T7JA 3FX2A 4R40A 3UHJA 2OHFA 2XH8A 3KLPX 3ACBA 4RS4A 4TXNA 5KS2A 1EUDA 2UXDB 4ESVA 5I4BA 3G0DA 3LT4A 5T6BA 1D2HA 2V7TA 4RCVA 4DRYA 8AT1A 4CV3A 3WNDA 1Z8NA 1I3CA 1ZGCA 4LJ7A 4BU1A 4AN4A 2IXDA 2H1HA 3CFYA 3FJOA 1AMOA 2I33A 1BXGA 4X1OA 2ZM5A 2I34A 3OT1A 4ML3A 3WYNA 3VYWA 3KJIA 3KLOA 1A8UA 3REQA 1MO5A 1VB5A 4YUXA 1F6BA 1W87A 5IAJA 5HRCA 3GJ3A 3DFZA 2FQQA 5KBYA 4ZJUA 5HWSA 4FYIA 1IHOA 4CDNA 1R5OA 1TUBA 2H0AA 3LSYA 1J1ZA 1BFKA 4D9NA 1WUTA 2XE8A 3OOWA 4RA6A 1VE6A 1RRCA 2ZRGA 2D59A 3VNUA 2QT1A 5E2AA 1T43A 3EHEA 1A8QA 4TUYF 1UXKA 1TK9A 4MWZA 3WQRA 3HDJA 3WQHA 3ZV6A 4C4OA 4CKEA 3I9V6 1Z6PA 2VDMB 4WFIA 4MAFA 2O59A 4G65A 5KTMA 4N7MA 2O8EA 4FN4A 4Q3AA 3V4RA 1QAQA 3EMVA 5ITZB 4MVYA 3FNBA 3TL6A 1CR4A 1WHTB 1EQUA 3E53A 2MMCA 3BK1A 3GPBA 3LVQE 3Q3VA 3P9QA 4HWGA 3NNDA 1A27A 4Q1BA 3Q88A 5HFJA 3TIXB 3ZS8A 4BX2A 4CJXA 4ZAFA 1DZ3A 4I9HA 4F8YA 3U3DA 4CEHB 2MDTA 4FVTA 4OOEA 3VNRA 3ZBQA 1HO3A 1OFUA 5K01A 2RCYA 4TL9A 2B1IA 3UT0A 4JVNA 1XVLA 3NBXX 1JDVA 1A82A 2XGMA 3ND6A 2B0CA 1KJNA 3O8OB 3EEIA 4HVTA 4M49A 5GM2A 2R66A 4CLDA 1I1OA 3WWZA 3K70D 3LCUA 1TOAA 4H35A 3QPAA 5F7JA 4RE5A 1O5OA 4IIVA 1RFGE 1ZBDA 2XQGA 4MMZB 4RVCA 5DT2A 5HG0A 3BXFA 4GSLA 3RBXA 4GC5A 2XWSA 3RK1A 4JUIA 3H6KA 3G2KA 2UZAA 2ZM6B 2PLFA 4BLPA 4M22A 2WIKA 1CNFA 1JS1X 5CFNA 1Z45A 3W1EA 3WB1A 4A5OA 4HQKA 2NT4A 1JVNA 3GRYA 1E2GA 4RDHA 3CM0A 4ZCIA 3FBGA 3ZH9B 1M5TA 4RNDB 4Y0NA 3WHPA 1TL7C 1X2EA 4IGKA 4XWGA 1PR3A 3S2GA 2I7XA 2WIGA 3INYA 1FSFA 1I01A 1XTPA 1DKUA 2I2XB 3NX4A 1PZXA 4OMFG 5AJUA 3TX6A 4PC2A 4YJDA 4EUSA 3LD9A 1SVMA 1FUKA 1XCOA 2NVOA 4JUDX 3T9BA 4ANFA 1E5LA 4GPZA 3QITA 1L5SA 5L3SA 2QENA 2QWXA 2O3SA 1RIFA 3PTZA 1RHJA 1BKDR 2GAJA 5LZ2A 3GHHA 4PR3A 2MCFA 3R7WA 2CZQA 3PEFA 5BMVB 3CJRA 3HGMA 4CHTA 4TWAA 4ZGGA 2TMYA 3P4XA 4FHEA 1RM0A 3GD5A 4MCJA 2HA0A 1Z7YA 4MSUA 3R8XA 4ZDJA 2VTVA 1IZ7A 2ZI6A 4B34A 3LKVA 2YJGA 2WU8A 4F5WA 5JNVA 4IQFA 4BJHB 1QYVA 1SZCA 3DKIA 4MV6A 4TKUA 4U2EA 4U1RA 1P5RA 3SAJA 4BE9A 4MULA 2XJ4A 3GEPA 1XKQA 2ZRFA 1PO7A 4R4JA 4LTDA 1NX9A 5F76A 1E2EA 1JKIA 1ONNA 3ELWA 2OQ2A 4NK5A 5AJTA 5IT9A 4EJSB 2G3YA 3OZUA 2R5FA 1SG0A 5JIBA 2I9PA 1F9AA 2CSXA 1KKLA 2XUZA 3HDQA 4MUXA 4DCGA 1XDWA 2NG1A 3WJ2A 4QWMA 4AJ4A 1GQOA 1VZ2A 4YRSA 5DT9A 4B4KA 1MN6A 1FJHA 1GDDA 1VRWA 2QX6A 2NVUB 3UCFA 1MW8X 2FSSA 2JFQA 4EA7A 5HS4A 5J3JA 2AZDA 5F5NA 1PK7A 3PC8A 4OI4A 4N6OA 4DLPA 5DGCA 2Q45A 2AR0A 3ND7A 3A4YA 4PZ9A 1XEFA 1FDSA 1E6LA 3ODPA 2HRDA 1NJ5A 2ATXA 4NENA 5HK8A 4OA5A 2GXUA 5HKKD 2BP7B 2EFDB 4W99A 2OCIA 2FUNB 1WTAA 1BGWA 1HBJA 1UQTA 1VMAA 4FT4A 3WZLA 2SKEA 3A05A 4HB0A 4K9NA 1XZKA 2R7NA 4YDSA 2EVWX 3EWAA 1QH1B 2CNNA 2EQBA 2QRJA 3ETJA 1GSIA 1KDTA 1WKBA 3PDWA 4ME6A 1XAIA 2BGMA 3KS9A 1CE8A 2EZUA 3OZXA 4NNOA 3ZDZB 4BC1A 4BLVA 2UYHA 3ZLJA 3ZXUB 1R8XA 1J1IA 1JAHA 1NYRA 1PX0A 2BFWA 3FM9A 2C83A 4JLKA 4OSEA 1CUZA 4WBXC 2Y1WA 5KJ6A 1Z4JA 5IC5A 4I9GA 4F1KA 1ZIOA 1XT6A 1T5IA 4LZNA 1GL7A 3FJ1A 4UTVA 2DUWA 1IH8A 1WUIS 1F3OA 2F1RA 1R5NA 2RHRA 3W4IA 3ULKA 5CB6A 3I72A 3CWCA 3S44A 3QEOA 1JLKA 4H6PA 3JU3A 2ST1A 3JWGA 2Z1MA 3ZHCA 4Q4CA 4RZHA 5CA0A 5E1OA 5TPWB 3L05A 3TGPA 3ZX5A 2PG3A 4B83A 3RGGA 3T35A 3JYPA 2IYSA 5F3RA 3AXSA 1ISRA 1KDVA 5EVJA 1VPVA 4D0GA 3B2NA 3WQSB 4J0KA 4PGAA 3WLNA 4KACA 4Z4QA 2OHXA 4BJ3A 3N0RA 3GNQA 3BWEA 4OYLA 3FTEA 4GWKA 1POXA 1CFZA 4HT3B 3ICVA 3ZHBA 2QIPA 3P9KA 1REQA 4IDOA 3HLKA 4CR8A 4XR4A 1MKYA 2JAOA 2IRWA 5JH7A 3M3DA 3EVNA 5EOVA 5GIOE 1NQVA 1RLJA 1RKXA 4LF4B 3KQHA 4LPKA 3G9TA 5EHQA 5FBLB 1IUKA 4RF3A 3RWBA 5ALWA 1YS2X 4KOAA 1FYFA 3GC6A 1JB9A 1SBCA 4UUOA 2GI4A 2ODQA 3HXPA 1P19A 2C7RA 1NZDA 3PDCA 2W37A 4TWRA 1UBNA 2IVZA 1EVKA 4LDRA 5BR7A 1N92A 2QTVA 3CX8A 5LUBA 3WOVA 1II9A 1E3WB 1SXIA 1OUMA 4PSUA 2PO7A 1KTIA 3CVVA 3UZUA 1NU8A 3QVMA 1BMQA 2ZI4A 3F5FA 5ALVA 4M1WA 3TFWA 3N5KA 1A9OA 2H9AA 2HMWA 4KLAA 2NUTA 1SU7A 3IP5A 3Q0EA 1P1HA 1KRHA 2DCUA 5CFOA 1Y5MA 2QTLA 4EQ6A 4EMBA 3H4TA 3JPWA 4JUFA 2EL9A 1IG0A 2VPQA 3LW7A 2YC4C 2J3JA 4QGGA 4CKWB 1L6RA 4TYMA 2C2XA 2WU4A 1PV1A 5DU2A 3WADA 2PBFA 2YFHA 3R5JA 1NUHA 2XE6A 4W5QA 4EB0A 1U7UA 3P2OA 5E4JA 1TYAE 4ISBA 1UXIA 3HKCB 1WXIA 1QP7A 3IKLA 1JL3A 3W1VA 1G59A 1SUDA 4KE6A 3VTFA 5ISMA 2C96A 2BKUA 3RRMA 1IXYA 2A5DA 1GGJA 2BN4A 2WJIA 4QIHA 3O8QB 2RIRA 2R5WA 4I6JA 5HRUA 2QNIA 1Z4QA 2Q1UA 5KKAA 1XXHE 2H0RA 1DRUA 1P0PA 1FVOA 3EK2A 4HGRA 4HNUA 1RAFA 1W85A 4DARA 1LTHR 2Z5FA 3PHLA 4WASA 4B3HA 4BNGA 4MHSA 5K0FA 5KHOC 1PHRA 2JD1A 4FYXA 3M1AA 4CM4B 3SD7A 4D79A 1Y48E 1AXGA 3EZ7A 3UYKA 3IAS1 3HB0A 4YRQA 4QOJA 4FILA 1YI1A 3WKDA 1P0MA 4M0PA 4AI6A 4OHVA 4E1BA 1WEKA 1EK1A 2JGKA 2VH5R 4HGQA 4PPYA 3GGCA 1VDZA 2EC5A 5E2IA 3DE7X 1U0OC 3B8EA 2W22A 2VL7A 3E3OA 3HDHA 4Q9NA 3S40A 8ADHA 4LF8B 5JVDF 4KV9A 4PC7A 4L6AA 1I13A 2V7EA 2MSDB 4UCFA 3UPTA 4IVRA 4FE7A 1EEXB 4BQFA 3H19A 1WUKS 2O2EA 4FYMA 3IKVA 4I14A 4A73A 1FDOA 2IA5A 1V11A 1PJ3A 2WQZA 4WGFA 4Y67A 5E6SA 4X41A 3AEUB 2EKDA 4MP3A 3RRBA 3DMRA 3A4IA 4IIYA 3OP1A 2Q9UA 1YR3A 4FFDA 4OI1A 2Q0HA 3L1VA 4J0IA 4RK5A 4BO5A 2WY2D 3DKKA 4C7VA 3LX5A 2PCJA 1MJ5A 5IJWA 3TNFA 3TQFA 3HUTA 3I04A 3ZU6A 5JNLA 5LMZA 1NZFA 4X3PA 2P2LA 2X3YA 3LLUA 5DIFA 1RQRA 4GPIB 4NULA 1Q3KA 5C1DA 5KAMA 2YZGA 5K0GA 2IUYA 1W2WB 1IZYA 1XLVA 3JASA 5HQ3B 3ESBA 2XXBA 4BKRA 4UU1A 4ARAA 4EQ6B 3JQ9C 4KTTE 4GFDA 4RV5A 3DOIA 2AN9A 5HBGA 3E05A 1F9EA 1Z62A 2VF7A 1AF4A 5B3JC 1GADO 5M04A 2IH2A 2OLEA 2Q5IA 1EFTA 4HN9A 3O1LA 4FMBB 1ZOLA 3FGOA 4MVJP 4Y6LA 4KPFC 1MNQA 5BT8A 4K26A 4HEA1 2RGEA 1TKBA 1XTVA 1IOWA 1L4KA 2JCVA 4JVMA 5JFGA 2RHDA 3AUUA 5CVVA 1GILA 2REOA 1QONA 4Q7JB 4FC7A 4R51A 1CZKA 4WTOA 4B75A 4CUKA 4C3VA 2R8ZA 1J7JA 3QEMB 4X84A 1OCEA 1P7CA 1T4GA 5D7BA 1EIWA 3IOMA 3ESQA 1GZ5A 2H06A 4BYMA 4DJTA 3L7KA 4FOOA 3A9CA 1ZD3A 4REMA 5DGTA 3ANXA 1TJ3A 1K8QA 2ZU6A 5HBRA 4OD0A 3QRWA 4Q37A 2GNAA 3ETLA 5C8YA 1KDZA 2YW9A 3LYHA 3D4NA 5IFLA 3IT2A 4DMGA 2Z9CA 5HKOA 3WRWA 2XX3A 4DGSA 1QP8A 3MJ4A 4TT3A 3DE0X 1U8AA 2MINA 4C14A 5TT1A 3N2KA 2PD6A 4UTOA 3JWEA 3QVXA 4JZYA 1B6RA 5DDIP 1ZMRA 4G8JA 1ZCBA 3AB7A 4X1KB 2WU3A 4X7BA 3TE7A 5BUCA 2AFRA 2A1UA 3WAKA 2JJ2D 3FUWA 1N3LA 5GINE 1KVUA 1J0XO 3L4SO 2BDTA 2FMKA 5CYFA 3ZQJA 1Y33E 2QVBA 2H5EA 5JBIA 2VUUA 5HA5A 2P67A 4YMUA 4DM3A 3Q1LA 5BMVF 2TMKA 3O31A 1EUDB 1Y63A 3A6LA 3LO8A 1O0CA 2DPLA 3NJ8A 1XNJA 3STWA 4CWAA 5EHGA 1DIBA 3NEJA 3WMEA 3QI7A 3P9RA 4MVJM 4TXLA 4WXHA 2DBQA 4YALA 4PYQA 4QA9A 3O1IC 2QMHA 4QQNA 3H6GA 2XRYA 4C3OB 4LDPA 4RAQA 1ORRA 3JQDA 3P94A 2E1PA 1WW2A 2X9LA 5BWCA 4UM7A 5I7OA 5GZ6A 4DM4A 1I3LA 2ZI5A 5FUBA 1BRMA 1ZN9A 4FX5A 3FDZB 4HWKA 5ESDA 3NHFA 5BWMA 3E22A 2JH9A 3DLHA 3RASA 5THQA 2VZ0A 1O95D 2NXEA 2QQ5A 1RPAA 4RY9A 4BOYA 4UPEA 5AHOA 4RHYA 1V3QE 1I2DA 4M55A 4XYEA 5AKEA 3RC3A 3FLMA 3VPSA 2KI5A 3MFYA 4QQRA 2FSFA 3F1LA 4LSZA 1UM9A 4K1LA 4C4TA 3G0HA 2W90A 5B6IA 1XPRA 2R4TA 3OM8A 4U0KA 4LMPA 4BMZA 3WGYA 2YWCA 1TM2A 3ABOB 4C05A 2C92A 3IC5A 1A8PA 4KXLA 4Q7EA 4KKXB 3DAHA 3IEUA 4OQQA 1XA4A 3NJ4A 1T2DA 3T1YB 1OYYA 2ZCUA 2C82A 2AN1A 3HKDA 3WRXC 4NYMQ 5AKZA 4DLRA 2QL6A 3G88A 1GT6A 1RAEA 3N2LA 3MINA 1RC0A 2WIDA 4KVZA 3SJAA 3FDFA 3VOAA 3I0NA 1MZVA 1VJ5A 1KS2A 3K30A 4OJKA 4P80A 1QMGA 3KU1A 4A1OA 2P6OA 2Y9MB 2WUEA 2UUAB 2FSVA 5ER6A 3GJSA 5KYYB 2F4VB 5ILGA 2ZTHA 2X41A 2X7XA 4YRDA 1FCJA 2FPGA 3SR4A 1FP7A 1YVUA 1KK0A 3E82A 3WHLA 4XLTA 3SC3A 2WIFA 3HZOA 3IE2A 1XD2B 1ZGZA 3I52A 4DCUA 2GWRA 5I9NA 2WHXA 5LQAA 3WYBA 3MWDB 1UPAA 4ZYXA 1Z39A 5DHQA 3FPHA 3P32A 4N5NA 3UAOA 4D3FA 3SQWA 2ADOA 1QB7A 1M76A 2PFKA 3GRZA 2HXGA 2YCBA 3COYA 4OB7A 4OHFA 3FF4A 3FCYA 1R00A 2IP4A 3TYXA 3HLTA 3PQ7A 1TB4A 2XRFA 1O96B 4IUBS 4KPGA 3RS0A 1G3QA 1PQPA 2C07A 1ZUWA 4EFMA 4N3GA 5GIPE 2QKYA 1UH5A 1UPBA 3G7UA 3MCWA 1G6Q1 1U3UA 3GPIA 3UWPA 1Y9AA 4AXXA 3I1FA 2WPDD 2JDIA 1NSYA 4M1ZA 2JLRA 4HL6A 1UPFA 1ONOA 2NADA 7MHTA 1P39A 3BJMA 1CUAA 2NVUA 3RVBA 1JEAA 1I10A 1I4LD 1FDWA 4XDHA 3DXFA 3X2EA 4EPWA 4ZOLF 3THYB 3DZJA 4DA7A 1NF9A 1NT2A 2ZJ2A 2PX6A 3T7EA 4JLDA 5GTDA 1Z5OA 5FORA 3N8KA 1OI4A 4EYQA 1NVAA 2Q2VA 1UBFA 1YR8A 4NENB 2QAJA 4RETA 5JSYA 2E2WA 4IRMA 4Q7QA 4Y9SA 4G07A 5L3ZA 3K1AB 1T8RA 1P9LA 3ETDA 1JHOA 1QJ4A 1HDOA 1PK8A 1LPMA 2CLDX 5FKJA 3TLEA 2GFIA 3D2BA 4X6YA 1RLIA 3HR4A 4BWYA 5G02A 5KIAA 5F9FA 4TMKA 4WDRA 3X1DA 5EFOA 1OGYA 3NORA 5THXA 1M2VB 1O3YA 4AZ3A 2WSSA 1RM3A 1GGVA 1SOMA 3KOYA 4P84A 2ZYHA 1J8FA 5MGNA 1UT6A 3I9LA 1V5WA 1UK6A 1GCIA 2QUZA 1B1AA 4GZ5A 4HJXA 4NBUA 4I8XA 2RK3A 4JEUA 3MJTA 1U7WA 3PNYA 3RFUA 1QZ3A 1UWVA 4C4XA 3PA8A 3X43A 4D8YA 5LXTB 2DBVO 1W0KA 5JNUA 4FD2A 3WGVA 4Q12A 3H42B 4CL0A 1EINA 1CDDA 2HDWA 1S96A 5AI0A 1M1YE 1XNQB 4G24A 2IH5A 2N1BA 4YJHB 4CMBA 1N2HA 1PEAA 5DW0A 1ZUNB 4Q3OA 2Y93A 2VDKB 3QNUA 4F38A 1CJUC 4PVDA 3BORA 1ZJZA 1VKHA 1PEYA 3D6JA 4EYGA 5DULA 2QVGA 2WK1A 3BXGA 2ZIXA 3IERA 4M98A 3TK1A 1M6YA 2X15A 3SOZA 4EAQA 1YBFA 1HL7A 2QPTA 2X19A 4OCZA 3U0VA 3KD3A 4MVJE 2WKRA 2YN2A 1ISMA 1FTSA 2CB9A 2XRZA 3NDRA 1MOPA 2NXJA 4EA8A 2CXSA 3U39A 1JEYA 2WYVA 2JCGA 4L9AA 1EWVA 4BVBA 3AW8A 1JXOA 4I1YA 1TO1E 4CEHA 5I7EA 2PSDA 3BTUA 1JTFA 3C6BA 1KARA 1FA9A 1YRAA 4L7VA 4PYMA 3AB3A 4A8HA 3QXSA 4FGSA 4D1YA 4DJJA 3D6HA 3VJRA 1SVUA 2Y1XA 3TBHA 1RYBA 2AQKA 3KEOA 1ISPA 3AF2A 3IMEA 1Q11A 1X6VA 3E3LA 3WNQA 4LJ5A 5B4TA 4LOLA 4DADA 3TD6A 3G2OA 4QFDA 4EG4A 5ETJA 3JVEA 1SIOA 2AMVA 2YHUA 2GBFA 3D6UA 2QMEA 3WDSA 1K7CA 4RXUA 3ZDXB 3RAJA 2F17A 3KQVA 1EH5A 1IM8A 4I5FA 3ZNOA 2FFAA 5EQTA 4HRXA 3TZCA 3NR2A 2QTGA 2VBGA 3GMTA 4XEHA 3OJLA 1IEQA 2Q4OA 1N2JA 5A7GA 1DC8A 3HQ4O 3NYWA 1TNDA 3U26A 3P5SA 2BUBA 1KVTA 2N3ZA 4WQMA 1Q5PA 2BM9A 2G17A 3ZHYA 4ARBA 3B1VA 1FYEA 1MJGM 5FX2A 5C1IA 1QYRA 5TEWA 5JLJA 2Z5LA 1WZUA 1ZRSA 2Z09A 1K1EA 3SJCA 1NE7A 2OB1A 5BQ5A 4WBNB 5J4LA 3GA5A 4JR1A 4AF6A 3ZCQA 5KB3A 1T6NA 5JMOA 2A1TR 3KV1A 5DBHX 5LZ7A 3I9FA 5CG1A 1BO6A 2C5AA 3GRFA 2XA1A 3OQNA 3HDGA 4PWYA 2WQ6A 2WF9A 1KF0A 2K87A 1VI6A 2DY0A 3G0IA 5ALRA 4KKVA 3RVRA 2P9JA 1NP6A 3BD8A 3TQTA 1PYGA 2C7GA 1SVKA 4XB1A 2G80A 2FY8A 3PC4A 3MUOA 1IUPA 4RVSA 4CTNA 1M6WA 4US2R 3QVJA 2OFXA 3HBLA 4WZBB 2HK9A 4S1PA 1L5KA 2O0MA 5HF9A 4NBRA 1RZUA 4R05A 1XZIA 5E7MA 2GD1O 4KH0A 4NNPA 2PQ6A 1UK8A 2CF5A 1T5OA 4J6EA 1L2TA 1UXOA 3IOEA 2FEOA 3JXEA 4MUGA 1F0YA 1RHMA 2YXDA 4MGZR 5CJPA 2PDAA 1VPLA 4S12A 5KYNA 4YHHB 4AKGA 1U4NA 4E31A 3SEAA 4XYBA 5GZ1A 1YB4A 1WQ1R 5AVRA 1U1EA 3CBQA 3N0VA 3N74A 4JC4A 3Q10A 4ZAWA 5JO0A 2P6PA 5G0VA 2B6HA 3W5HA 1V45E 1FP2A 2GEFA 2ID7A 1UBTS 5U4QA 3OU2A 5HKLA 5CFRA 1AUXA 3HP4A 4E14A 5CIWA 1ECLA 4FGUA 1U0GA 2PKEA 4EG3A 1KR2A 5D5PA 4C7OA 1Z37A 3OAAA 3W77A 3Q8XB 2RBGA 1FDTA 1XEXB 3MRTA 3K9BA 2UV8A 5C7IO 2DXIA 4N5DA 2ATEA 2REQA 3F49S 1A5TA 2PKRA 3LHFA 2M2IA 4JC0A 1NC3A 4KLRA 3NHSA 5EIHA 3WGMA 4C6SA 1DC4A 2WFLB 5BN1A 3GJ0A 2PH3A 2ZBUA 3N2IA 1CY4A 4JL6A 4RENA 2UYGA 3AVXA 2FFHA 1JHDA 4H17A 1JHAA 3PGKA 2HZ7A 2GEDA 4WDQA 1CEQA 2IXGA 4DPKA 2P40A 2YH2A 5A5VA 1U8ZA 1JH9A 2IS6A 1N6PA 5JS6A 4N3BA 3CH7A 3WYAA 3N2GB 3FIJA 3FCEA 1C4WA 3FPAA 5AW0A 2NVWA 5J4VA 2NP7A 5KPDA 1A2KC 1J21A 3EMDA 2A67A 4P3PA 2H1VA 1PRYA 2A33A 2I7VA 1MAAA 5I4KA 3KQLA 4Q05A 3B1ZA 1NDUA 3L8YA 3V4VB 3EGDB 3ZU3A 1BNCA 3ZZTA 1MB0A 1HRKA 3KQOA 1OD6A 3CLUC 3DP7A 2X0FA 4BFSA 3FCAA 1OU0A 1V1MA 2C4UA 3CRMA 3PQ6A 5D3MB 3CUEF 1PE0A 2IEIA 2RBEA 4NAUA 4BQQA 4ESOA 1JSXA 2O2GA 1AY0A 3HP7A 3T8YA 3W5JA 1LK5A 4BQRA 5H4GA 2G9QA 5D2CA 2YY6A 1WSAA 3OTHA 4KP7A 4FZ3A 6AT1A 3NOVA 1JWAB 4AN1A 1QO7A 1BN7A 2V7VA 3LUJA 1P33A 5C34B 3KQWA 1XWIA 1GHTA 4P4TA 1BD4A 4H7HA 5A4KA 1H3EA 5EMNA 5FLEX 1PWEA 3PEUA 4HYTA 3RD5A 3TBKA 1KAEA 2I2BA 4INOA 4LYYA 3GOQA 3TGLA 2V7XA 3I6ZA 3WGTA 1U98A 2WM9B 2R97A 3HH8A 3GDGA 1ZISA 1H2EA 1QH8B 2GNPA 1KORA 2JIBA 4S04A 4FDAA 2NIPA 4MPRA 1TM5E 1NJGA 1A9ZA 5IBQA 3WTCA 1RVV1 1SQ5A 1TO2E 2I1QA 3FROA 2CUNA 3H13A 4QXQA 3F2IA 5JJIA 5AVXA 2JGIA 1QIIA 4HNHA 5JARA 2WG0A 2FQYA 5KSZA 3GP5A 3UJAA 2DPXA 4L07A 5BWOA 3RB8A 3F5MA 3MW8A 3TB6A 3PJEA 1F8YA 1G1MA 1R4AA 3E9RA 4MIOA 1R0LA 2Z2KA 3U1VA 2I65A 2PTHA 2WDPA 4DDMA 3EIHA 5GQSA 3IOYA 2CYCA 4UHCA 5JG7A 4CKCB 3H2YA 2YBEA 2XXJA 2DR0A 5E4YA 1RYYA 4ZRNA 4LJ6A 4NICA 1X9GA 2WC1A 1UIMA 4D6PA 3IV7A 3RUDA 4L6IA 2I7DA 3H11B 3AR9A 1XXLA 2RGAA 4HX5A 3EAQA 4RGVA 4B6EA 3AUKA 2GAIA 5TIIA 1ZBQA 2I4MA 4B6SA 2EATA 2R6FA 2WWHA 4RPKA 2JC3A 1GU0A 2B2CA 2OENG 3ACDA 3C3MA 1H22A 3CLKA 4FNGA 4JB3A 4ZXPA 4D3XA 2JAQA 1TRKA 1BHQ1 1VJGA 1RNLA 4RCYA 3DVAA 1O95A 4P32A 3TNLA 4LZZA 1BE1A 4FD3A 1SKYB 1PSDA 2ZYGA 3MJDA 2BKLA 4OUDB 1IN7A 2BEUB 4U2FA 3OHPA 2WDZA 5B1IA 4PFKA 1CRWG 2PK3A 4NSNA 3WSTA 1UZUA 1Y9ZA 1ZH6A 2AV6A 2C4KA 4HMOA 4J7CA 4JYPA 2IYTA 1GV1A 4MDEA 1CNEA 1L5GB 5ICEA 4CDMA 2HIHA 3IH5A 3DZBA 2PUEA 1B2LA 1F8FA 1QIKA 2OL4A 2P78A 3PKZA 1UC9A 3R6WA 3GG9A 4LHSA 5F1OA 4ZAZA 4DHWA 7YASA 5K0NA 2WD9A 2V9CA 1QCYA 5BRNA 4EKNB 1PTJA 3JW8A 1RCFA 2BAGA 4O4LA 3ZZUA 1UKYA 5HTOA 2VEDA 2IYQA 4FDLA 4O1HA 3T7TA 2WQ7A 4DPLA 3V55A 5SZHB 1I6MA 4CL2A 3ZE9A 5LSAA 2YKGA 2BE9A 3PPYA 4TZTA 3TEMA 1PNVA 2X1VA 4V1CI 5F77A 4ENSA 1V7ZA 5KYYA 5HIMA 3WKEA 1C1DA 2O2XA 4ZOLA 4PQFA 3FCXA 3DNPA 2ZUWA 1DJPA 1V4VA 1GNVA 1M0SA 3L4BA 4DC1A 1MP0A 3JQBA 3L7MA 3ZJTA 1K06A 4RJLA 2HWUA 1L4EA 1VECA 2PZGA 3M1YA 5BR4A 4IV8A 2DP4E 1F2DA 1I2CA 2WNIA 3R7NA 3K6SB 3P4UA 3TSYA 4GW3A 2CT8A 1DX9A 1NXWA 4NE2A 3FYSA 2A5GA 3DC7A 1TAHA 3LQFA 2ODAA 1RRMA 2AOUA 3EB9A 2ZSEA 4B4UA 3QU4A 3B12A 2ABWA 4RTNA 4OH1A 2PH7A 2AR7A 2IZ5A 4PX3A 5CDSA 3IBCA 2FA9A 2PZFA 1DT3A 1ZOIA 1QFXA 2P2DA 4NMMA 3WGGA 1NUPA 2WINI 1L0BA 3JATA 2HLNA 4ZEMA 1USUA 2VXBA 3TVDA 1EFKA 2IHZA 3O4IA 4JNCA 3G2QA 1TA9A 2OOKA 2Q0SA 1U2ZA 2RSLA 3JARA 2GTPA 2VH1A 2GZDA 3GA7A 3CLSC 3GY0A 3MG9A 2VDUE 3QBTA 1C8BA 4TWJA 1UINA 1WOYA 3A6FA 2LV8A 1HYGA 4YYEA 4QC2A 4EI2A 3BZBA 3NBAA 4B3RB 4M83A 1M2JA 4BNZA 4WADA 2JHGA 3NGXA 4F2HA 5LDGA 4URYR 2WJ4A 1U9YA 2CXQA 4NWIA 1DC5A 3A6EA 2A1IA 4LC9A 4KWTA 1SC4A 4YP9A 1VKRA 2JJ2A 4FEEA 4X9XA 1N36B 2WMNB 1MJGA 4WLOA 3B1WA 4B3SB 1KY2A 1JPNA 2XV1A 1XMOB 3NQ41 2ZWPA 5ILQA 3EQZA 2JPDA 3GQBA 2VJOA 2ORYA 4F56A 1HK7A 2FDXA 3F9IA 4Z8XA 3JVVA 1ADBA 1LPSA 5IBRA 2JFHA 2OXRA 1HDXA 4IZ6A 1H2FA 1P1RA 3BMNA 2CHVA 2Q0XA 3MPOA 5EZ6B 4AJLA 4HWSA 1OFGA 3VOSA 4BZZA 1GA1A 1RRVA 3DEJA 4AC9A 2I7CA 2PV7A 3BG5A 1NV8A 3O3CA 1Z6XA 4G25A 4HTFA 4YAWA 2O07A 3EY9A 4PGHA 4BVJA 4TPKA 3LPCA 3NT4A 1Z83A 2HFJA 5JNTA 2BFFB 3EMKA 3FWYA 2R1ZA 3EOBI 4JX8A 3EPPA 5EKDA 4BMPB 4JXZA 1KI4A 3K0FB 1QPBA 4L02A 3WFIA 3TMKA 4UC0A 3TCXB 1M73E 5DOVA 2Q50A 3TRKA 1UM8A 4IF6A 1U9IA 1KYTA 1IULA 4FSHA 2GM3A 4GZMA 5AWFC 3PPWA 3H2GA 3LZ6A 2YQZA 1TYDE 2HDOA 2Y1KA 1Q7CA 1L7QA 5CNKA 4B46A 1AHHA 2FR0A 2B5WA 4JI7B 3KOXA 1XMVA 3N8GA 1HPLA 2M9MA 1NVUQ 2HLDD 3QQ5A 4H7DA 5IDQA 3UF0A 1GNSA 2CXHA 3D8RA 4EO4A 2PMDA 1K2WA 5CAEA 3F8WA 4P9NA 1HDGO 2FW0A 4KIUA 4YY3B 5KQPA 3T7SA 1D0SA 3L40A 2FPPA 1Z06A 5CITA 4EKEA 1H05A 1KHTA 5LCXA 5C31A 4RNCA 1V3UA 1LB1B 3LGSA 3V9PA 5IANA 2CV1A 1FYDA 4MP6A 5EXDA 2JAHA 1T15A 4IDPA 1NBME 4HAVA 3GDFA 2UVPA 5BSWA 1KR5A 2R6AA 3H9GA 4D02A 5LM3A 2AUNA 1OV4A 1OPXA 1UADA 1UJ6A 2AI3A 2NO9A 3GU3A 4KX3A 5H81A 2WSLA 3LM8A 4Q9HA 5IJ9B 4X54A 5AI9A 5IRCD 5ECGC 5D85A 4YECA 2EFCB 2VZ9A 1IN8A 3DLAA 4GI7A 3ZDCA 1XX6A 2VJAA 3K4HA 4EI7A 4FFVA 1ZIYA 2XE7A 1CULC 3A2NA 3LFTA 5B1HA 1NJ6A 1FX0B 1T25A 4WMLA 1NVWQ 1G291 4NDNE 2PO5A 2H48A 2IPXA 1CUVA 1AV6A 3TDNA 1Y7TA 4HD8A 3DB2A 1H2YA 1E79A 1UJ5A 3IX7A 5I7WA 2F64A 3ZBTA 1OH8A 2BEWB 2I8LA 3H9QA 1D04A 1D3AA 2CVHA 2HDNB 3FUCA 2DY1A 2PN1A 3AKEA 3LCCA 3GRRA 4KYTA 4P08A 4TM7A 1MB3A 3PI7A 4YN3A 2AS0A 2GEKA 3E7DA 1KGSA 1SQFA 3SX0A 4XWKA 4PX5A 4LHXA 3RROA 4ASUA 2AC7A 1VCNA 3VHLB 2QAGB 4BECA 2OO7A 2IPNA 1M66A 2AJCA 3GLRA 5B5SA 1X1EA 3DQQA 1JI3A 3D7RA 3ROMA 2D1FA 3FTQA 4FHFA 3ST7A 4CODB 4E2ZA 3EVTA 3EZXA 3PQ8A 2C3UA 1NVMB 2NP6A 2C3YA 2HZBA 1QB8A 4B3TB 1JX6A 3AIKA 3T99A 3V5NA 2O48X 1KFKB 2O7QA 3BREA 4EF5A 4FOPA 1GDHA 1W6UA 4FM9A 4IY1A 2GSDA 4MKFA 4I3HA 5KWVA 4NTZA 1KK1A 3SIXA 3RTBA 3T3IA 1CUSA 1EP1B 1QCZA 2ZYDA 3AL2A 4F6CA 4F97A 3U7FB 1PWYE 1ZU5A 3QP9A 2DMRA 2ETVA 3OT5A 1G8GA 3VU8A 1S0UA 1ZY2A 3FBWA 5I7RA 1FX1A 2C7BA 4PSKA 2ZRHA 3DOUA 3H2IA 4NG5A 4A2PA 1NAIA 1PF7E 4E3WA 1VYTA 2RHMA 5L6MB 2Q6TA 2O50A 1SHJA 3TMYA 3GXBA 2YHAA 4YPOA 3ASYA 3MWEA 2JVIA 1KOJA 3G5AA 1VHLA 1JXAA 1K6MA 2WKPA 4UEOA 4XAQA 4JI3B 3R9XA 1LC0A 2Z3VA 3VJLA 2ZI9A 4FDVA 3HY3A 3SN6A 1Z07A 3G1UA 3O8NA 4BMXA 2BGWA 4V0OA 4YT8A 1IM5A 4PIPA 4MINA 5BWBA 5JYEA 2DWPA 4OYRA 3UFXB 1TAUA 1L8XA 4D97A 1QR6A 3NFRA 1SEPA 3EEFA 5H8WA 2VHJA 3A8TA 3TO5A 1E1CB 3UHPA 4R8MA 2V59A 3DYBA 3NXKA 4KQ1A 5I9MA 4BUZA 3UK1A 4FOTA 4DSAA 4C7JA 5A0TA 5FI0B 4B35A 2W6ID 2IX9A 3IODA 1PK9A 4O2AA 1SPBS 3BC1A 4OG2A 2D7DA 4H6WA 4FFMA 5K3SA 3M5CA 3NATA 4QL3A 1DOZA 3GRCA 3TZBA 2NZ2A 5H80A 4YUZA 4LNHA 1NQAO 1P0IA 1SK9A 3Q0TA 4HKTA 4QXMA 4BO7A 1X1TA 2JGNA 5ITWA 4HK4A 3ZD9A 1ZWKA 2NUTB 4U4AA 2GUGA 3FE2A 4D9JA 5DNAA 1ZRNA 2HAEA 3V1LA 5A4DA 3C14C 1BMFD 1T3GA 3N2GA 5IP5A 2VPPA 1HNWB 4IIJB 4NU6A 5FTNA 2ISQA 1TC2A 4G09A 4KDEA 4UATA 5FTJA 2ETXA 3ICWA 1MF7A 3IEXA 1NN5A 3RI3A 1D2EA 2ONZA 4KN6A 3TUIC 3QHQA 4C0KA 1U5CA 2E4ZA 3KOOA 1HEYA 1TF2A 2G1JA 1EXWA 2RH4A 2Q6VA 2FN8A 2Y71A 3N7AA 1SY7A 4L6CA 1GEGA 1L5QA 4PAQA 4TL7A 4NE9A 1P2TA 1P91A 2JGAA 3ZK8A 1W8DA 3LKDA 4Q4AB 1OT3A 1E1RD 3MNFA 2VIIA 3SMVA 1NQTA 4DLYA 1BYIA 2VVTA 3R3VA 1HYHA 1P5FA 4FGZA 2ZXUA 2Y92A 2B69A 2OP1A 3MGKA 2ZG6A 3N1UA 5DGIA 4WLFA 1GSAA 2AH5A 3IMCA 4HUJA 2GMWA 3ZGXA 2JLUA 4LQDA 3Q4GA 2QTNA 1JA9A 1TGVA 1VJDA 3D6TB 3GROA 2BONA 4EPVA 4C01A 4RIHA 4DKXA 4E51A 5KEIA 4MVXA 3ZU5A 2HA3A 1LH0A 2I6QA 4D98A 3VKGA 3EUFA 4Z3DA 4YUYA 2XNDA 5JDIC 2VP9A 3OJXA 4D9FA 1GZDA 1BWSA 4LXQA 5EKTA 4A6DA 4YLGA 3KVOA 3NHUA 4FXOA 4DSZA 3T3OA 5F3DA 2W58A 2DPHA 1H4VB 1TEVA 4FFRA 3BHIA 2GPTA 4X63A 4I1SA 4WV3A 3TIFA 2ZZMA 1FDIA 4O4LF 3ZIAA 4HDKB 1CQJA 1XAJA 4D92A 2J1LA 1LVGA 2XMCA 5AOCA 2XVYA 4KO8A 1T24A 1G5QA 2K5UA 4YAFA 4MKGA 1M2FA 1U8XX 2IOHA 2VZEA 4OK3A 4R2LA 3I76A 1WS6A 1Q92A 2EF0A 2M98A 3Q7IA 3NRCA 1XELA 1ZGBA 4ZT5A 1FNMA 4OH7A 1BQ4A 5E4FA 5EEGA 5J59A 1Z4KA 5CLGA 4DCPA 5IH3A 4NJEA 4FE4A 3VZQA 4L3WA 5KNBH 5SY6A 3FMFA 3E35A 3HKEA 1QV9A 1WHTA 1TIKA 5HDBB 5HR5A 3A28A 5JEDA 1WCYA 2V0GA 1CQZA 5C1PA 3PVCA 4R81A 3CMMA 3FBTA 3EG9B 4TLDA 5TGZA 2NO1A 4Q6BA 3THOA 2A58A 4GLLA 1U2TA 5EPEA 2OT3B 3R7SA 1NLUA 3USES 5B3KA 3O8OA 4TMZA 3O38A 1E2LA 1Y8ZA 1U8EA 3N8DA 3UT5A 1S2MA 4WFQA 1L5NA 4B6OA 5COQA 5G2OA 5IU6A 4QRIA 3KSAC 1V5IA 3HUUA 3ELDA 3PU6A 1ZJWA 3TSAA 2HWYA 4JLAA 4PCVA 3P0JA 1B41A 1SUPA 1FPQA 2C8VA 3RIEA 4YRZA 2FZKA 1PTJC 1R9GA 3BGVA 3DEHA 1AK2A 3IE0A 3KZCA 5DTEA 1Z7EA 3L0ZA 2PL5A 2VRCA 5SYAA 3WB9A 1SCBA 2WR8A 3BK2A 4I50B 5FV7A 1N2CB 4YRIA 2WT4A 4H59A 1MO3A 3TWOA 4L75A 4UM8B 3AYXB 3IPLA 1ZOOA 3L6EA 4DSUA 4A8PA 4E7OA 5GM1A 1G8HA 1MFPA 2C9OA 3LUDA 1Y9JA 2BWJA 1RPTA 2P9TA 4LE0A 4O0LA 3OQHA 4X71A 5CM2Z 5EUBA 1TMGE 5GP1A 5C8DA 2QM3A 1FRQA 3CEHA 4UCXA 4L76A 3KQTA 1GPMA 2HRBA 1GKUB 3DDUA 1P2GA 3KC2A 5JDCA 2G9ZA 3G02A 1NSTA 4H16A 3OEHA 3TINA 1Z47A 1GDTA 1U6IA 4OHKA 1UQRA 1RWPA 4C7MA 3QMWA 2W2MA 3S70A 4H60A 1ZFNA 1NKTA 2YFQA 3B1JA 1BMTA 2ECKA 2VCYA 4URUR 3I4FA 2UU9B 1C0IA 4Q4LA 3ZQ4A 5FPQA 1QYWA 5FWXA 2C31A 2HJRA 1TKRA 3CF2A 4UU0A 5FPYA 3CZMA 3DKPA 4X20A 4AJHA 4BZPA 1AJEA 1CKEA 2H7VA 1V1MB 3G89A 5ECDA 5GV8A 3N0WA 3CRVA 3FNRA 1XL1A 5CLHA 1Y42X 1Z33A 4JSYA 3DAGA 4WLEA 1DJQA 2WVHA 1Z4MA 3AHJA 1V8DA 5EJ8A 1JR6A 1M72A 3A25A 4R54A 4L4XA 3KUUA 2KMLA 2YYSA 3KXDA 5I3ZA 5A4MS 1WEHA 3QPBA 2B0JA 1I9GA 2I03A 4DL9A 1S3FA 2HIAA 1D1PA 2LWIA 3T0IA 4BRZA 4XWOA 3CKMA 5DM1A 2P65A 1EAMA 3GJYA 3ZHZA 5IJAA 1BU8A 3JYOA 3ZLUA 1QWSA 4NKRA 3OJOA 5BUQA 3H9EO 1QHSA 5JC1A 3K5PA 4AO8A 4MB6A 5EJ2A 3EF1A 3U16A 1IRIA 3EGCA 5GJWC 1JPUA 2H2AA 2SICE 4ALJA 4WKPA 3FWKA 4MIYA 5CCXA 3QVUA 5JAQA 1Z2NX 2WTMA 1A1VA 2V4MA 1YTLA 3AM3A 2R8OA 4XJVA 4ALLA 3BRWA 1B3RA 1OE0A 1JYFA 2B8WA 1NRIA 1YE3A 3IQDB 2EL7A 3A7EA 4DXAA 2PKYX 2AUTA 2QXTA 4V24A 3UXYA 2BGJA 2FWRA 5F9MA 4F3YA 4Z7JA 3OF5A 3THWA 2E49A 4K87A 5IXSA 3N7TA 2QM8A 1Y8AA 4ZYYA 3D7MA 3E3MA 1CEEA 1CY0A 5K05A 4C9BA 4WL0A 3GDOA 2IF0A 1LS1A 3VR5A 5E1DA 4OU5A 3AM1A 4Q9JA 1KQPA 2YQ4A 3NUGA 4BAUA 2W0SA 5EERA 4A2CA 3ZCVA 1Z6AA 5TDHA 3CZAA 1A50B 3WGOA 3R3JA 1RJ9B 5FIUA 1OLOA 3IILA 1U9ZA 1WD7A 3IP8A 3LHIA 3SVTA 2YHSA 4WLNA 1NW9B 4UUPA 3BA1A 5FWDA 3CZ4A 4ZQGA 4BLUA 1XNGA 2CY0A 3FR8A 3ISVA 3RDPA 3NLLA 4M53A 4P8RA 5BNZA 1NZJA 2AYXA 1E63A 1U8FO 3B1FA 4JK3A 4RK4A 4RVGA 3S3TA 2Z4SA 3AUAA 3EZLA 2N9UA 3LC0A 4GKBA 4FKZA 3D3WA 3O0DA 1A4RA 1H4TA 3UGTA 4K8RB 4D0RA 1THZA 2E3JA 2J4CA 2JANA 2VRNA 5GONF 2YXPX 1Q84A 1H3NA 4UBOA 1WW3A 3PNQA 4NPCA 1P9NA 2HWKA 4RU1A 1YBHA 2P3SA 1NULA 2EBHX 4B40A 3AOEC 4WBNA 4FMDF 2BJWA 1T2AA 5LZ9A 1KTVA 5F33A 2AMJA 2A5LA 4BKUA 4KR9A 3EXFA 3UA4A 3CIFA 5JQGF 1ZLYA 1W5TA 3S7ZA 4KNVA 2JFBA 1NJ8A 1TK2A 4JMLA 2ILTA 3GA0A 2XMQA 4G5YA 1T0BA 1A98A 2VDLB 3AILA 3NVKI 4HZUA 3UMMA 4JMPA 4NY1A 2YDXA 5K8VA 1AQIA 2Q28A 4UCQA 3OPMA 2Q5CA 3WA6A 4D9KA 4Q03A 3VOTA 3MOIA 2LDXA 4X7PA 5AVQA 4IDAA 1C0EA 1RE1A 2ZP1A 2H4YA 1LI5A 3PEEA 4Q4HB 4W6ZA 3FFWA 3JVUA 2G1AA 2R11A 1JVSA 1FNBA 3AEUA 1S3IA 1NKSA 3CEAA 3N8NA 4L2IB 3M2PA 3OOYA 4YJGB 4UAJA 2FNAA 3ZNNA 4M54A 2GM4A 5BT9A 3C6KA 4NBLA 1D5WA 3E1GA 4G5GA 4E2WA 3EH1A 3V4ZA 4JS0A 4GWLA 1S8FA 4MUMA 4MYRA 2FW9A 3PSAA 3R3ZA 1LFDB 2J7PD 3A0RB 4MDYA 1KZHA 3ZXSA 5H83A 3RYCA 1W6RA 2RKOA 1KI8A 1Q15A 3JWJA 4IILA 4KTVE 4QULA 1GM5A 2ZCJA 2FPSA 3KLBA 3GT0A 3IBSA 4MVJD 2QXYA 6ADHA 2QX9A 1Q83A 2Y68A 3AI7A 3C6MA 1RFLA 1PJ8A 1YR6A 3DZFA 4LXGA 5C4GB 3VKWA 3P1JA 4CI0B 4CKYA 1RMQA 4LJLA 2CVPA 2RI6A 5CX1B 1LCIA 3BQNB 4IXMA 1V8BA 1S2NA 2OILA 2Q5OA 1W5BA 3P0FA 4PYIA 2IUUA 4AXBA 4QT0A 1X80B 1KRXA 4DW8A 1LBTA 1KK2A 3CW8X 2C58A 3F7MA 2FVYA 2AMLA 1VIDA 2L2QA 3HDYA 3VR3A 4FDMA 1LW6E 2I3DA 2VR1A 4KXXA 3AINA 1HEIA 2QSYA 4EX7A 1MXHA 3PUKA 5EAIA 4U02A 3GLGB 1RXVA 2X5OA 3H65A 2OCBA 3EW9A 3LOQA 1NLFA 4P38A 5KSPA 1W2GA 4COOA 4EARA 1UM9B 2PKXA 5AUQA 2EF1A 2OQVA 4PC1A 5CFMA 1U1GA 5EZQA 5K99A 4ALMA 3W6OA 4FCVA 3U7EB 2HC9A 1NVFA 3COWA 2Y0DA 1FNCA 1RI4A 3OG9A 3O75A 3S2IA 4JJZA 5IJZA 4PHCA 1GU1A 1G8AA 3EXFB 2O14A 3O83A 4BX8A 2YY5A 3C8ZA 3W9SA 2AFIE 4G1UC 5FEUA 4A1FA 4N0EA 3MGGA 3UQZA 3O7MA 4E07A 1VA4A 2DU8A 1RADA 3S6JA 3I5AA 5CLLA 3R20A 5ALKA 2C84A 3EC1A 4N65A 4PICA 1GNQA 4UAVA 4CLXA 1DLJA 1Q21A 3AO0B 2YXNA 3PVZA 3IKTA 3AUJB 3R9XB 3L2OB 5FFFA 1UP6A 3ZWMA 3G59A 1X7WA 4IMIB 5EWJA 1E1KA 1HXHA 4WVLA 2VNJA 1U2GC 4IO0A 4AN0A 4RMGA 2DAPA 2H85A 3SYLA 3ROPA 2CL0X 1DRWA 2VQDA 4LJKA 3GWGA 4RGYA 5A2GA 4O3MA 3ZW9A 2X0RA 3EXIA 3NBMA 4LX8A 2AK2A 1JHRA 1N8NA 3AKDA 3CYFA 3DLTA 3O73A 4MRSA 4ZALA 4QTYA 2BBOA 5K45A 1OXVA 4MLCA 5IWCA 2GH1A 1RWXA 10MHA 2X86A 1ULBA 2ZAYA 3ESAA 4U7FA 1R37A 1PG0A 4MI3A 4FSXA 5ESRA 4XVHA 2BZ0A 2J6BA 3DEZA 3O6VA 3R3WA 1R8QA 2O0HA 1KBZA 4NZOA 1BX3A 2OC9A 1YDWA 1TCUA 1U0TA 5EJFA 1AKMA 1W0KD 2NSYA 1YJXA 1U9JA 3NUZA 1XCMA 3VC2A 3D8BA 2GJ8A 1E69A 4UMDA 3WWOA 4BDTA 4IM7A 3ZNQA 1QZTA 2AEJA 3M7IA 4FCTA 2PU5A 1I33A 1FUUA 4R9NA 2ZJ5A 2D4AA 1FX0A 3Q2KA 1XMPA 3JYHA 3TH5A 2HJGA 1JDPA 2VHUA 1NR7A 2Q2QA 3GLUA 1XRNA 1MAVA 5AW1A 2OV1A 4G1BA 2AOTB 4PHGA 1QFZA 1ND5A 4EL5A 2IIQA 3RSOA 3K9LA 4DG8A 5CBPB 1WRBA 3AV0B 1YZTA 1IZ0A 2BMVA 1SCKA 2ZIFA 4JKOA 1YB2A 1U2EA 2B34A 1EJ2A 2WAAA 2X2FA 3TSOA 3PGJA 1BWRA 4YPVA 1PV2A 2YZKA 2XWJI 5E7JA 4FW9A 4ZI7F 1ZLXA 4JJ8A 3I9JA 3OE5A 1Y8RB 4OJMX 1C3OA 1IHDA 4C6RA 2NV2B 3QY0A 2OAQ1 5T4FA 2AF3C 1IM2A 1GZVA 1Y6ZA 3ZXYA 4JA2A 4LY3A 5D5QA 3TD9A 3SQNA 3WV4A 2FN7A 5TMDA 1JLHA 2ZRMA 2P9FA 1RBQA 4K3VA 1QBKC 4Y2VA 5DOZA 5GZ3A 1Y1SA 4ECEA 5AOBA 2X42A 1U3FA 5K0JA 2QQGA 2VUTA 4QTUB 4UTZA 3FRJA 2JRCA 1TMYA 3PVSA 3W5VA 4HUTA 2IX3A 5IKEA 4E4RA 4F4CA 3GBVA 4CMEC 2J85A 4UPVA 3U7HB 1GPNA 1H3FA 2BR5A 4C0WA 4REQA 1ZW6A 5KJFA 3JRNA 4UHBA 1THGA 3Q3HA 2O2ZA 1AKUA 2C2BA 4MUJA 3KTFA 4Q9AA 2PFGA 1UJBA 1Q1AA 1JEJA 4INZA 2AQHA 3OQVA 2D1SA 3BB1A 2JIDA 3L9XA 3OZDA 4W1SA 5E7QA 3AJDA 1HLDA 5K3CA 3RKRA 4DQKA 3DE3X 1DSSG 1OB5A 3E5MA 3U80A 5KOJB 3FLEA 3NV9A 1Q0UA 2PGLA 5I4CA 2FDCA 5T3YA 3RKSA 3RSZA 3NIBA 5F5XA 1KAMA 1K3UB 3G13A 1XMIA 4UNQA 3W2TA 3M81A 3H97A 4LSGA 4IXDA 1QANA 3OKFA 3HB9A 1CV2A 2LCIA 3UK2A 2H1SA 1AKVA 1H8ED 1Z7GA 1N2CA 2EERA 2JGMA 3DEIA 3GZNA 5FQNA 5CURA 4G5QA 1B1CA 3TPFA 3ZY2A 5JCPA 2EIHA 1E59A 5G4KA 3FW1A 4YTEA 3AJ9A 4DRXA 2NNLD 1M6EX 1JBKA 1K86A 4RMIA 1DKOA 1P7WA 2QN3A 4W5HA 2A0KA 5ALHA 4ZYWA 2XTMA 4ND3A 5TQ0B 3IQWA 5A4FS 3SHWA 3H9CA 3N3BC 1BKYA 1W46A 2JFYA 2YXBA 3TLXA 2YN4A 2GHRA 1N25A 3DOFA 4L28A 5IC4A 2W42A 2OCDA 4QGFA 4DLNA 3KV3O 3SF0A 2YIMA 1ESMA 2FFQA 1DLIA 3FPSA 1Z5VA 3JD1A 3PNPA 4KMRA 5CPBA 1DEOA 3ZY6A 3C5HA 3VR6A 3MWJA 3L3BA 5G0TA 4X45A 3IAXA 3U19A 3RC2A 3DUFB 2G06A 2GM5A 3AF0A 1J8YF 4JBYA 3RVKA 4ARZA 5JXWA 1OAOC 4ZYLA 3DBLB 1ZVQA 3V46A 1A8IA 2VA8A 3BXXA 4G01B 3C85A 2RGDA 4LDQA 3L1KA 4XDYA 4F84A 3SDBA 3AZPA 3RQIA 5EIXA 1Q7EA 1CBUA 2ORVA 3R7FA 5DHAA 4CM9D 4PX9A 4CR7A 4FMCF 1CR6A 1RR6A 2VSNA 1HMPA 2YW2A 2FX5A 4EKGA 2A6PA 1TJ4A 4IOMA 3QELA 3FAZA 1C9KA 1CQIA 2G1UA 1QIDA 2QTMA 3MTEA 4JQZA 4WHMA 3TE6A 4JD5A 4D8VA 2IS2A 4IUDS 1USIA 1V8ZA 1P4SA 1UZLA 2I0FA 1L7BA 1BA2A 1GNRA 1OXKB 2C3MA 3ZQKA 2JIZA 3JQGB 2GJSA 4P36A 1IOLA 3A32A 4F4IA 3NXSA 3KUCA 4AZSA 1ZNXA 3ED5A 4G9GA 4M1EA 4MW5A 4YASA 5EJIA 3RVQA 3OPQA 3ET5A 2KWIA 1S89A 1XVAA 4H27A 4MRVA 5FCDA 4JOCA 3LXUX 5IABA 5AW8A 2RHJA 5DM70 5G3YA 4G41A 3LPDA 2GA8A 1FS5A 2HNBA 2XWBF 1MIOB 1G17A 4Q93A 4W5JA 4DB4A 4Y6OA 3NEAA 1EDDA 4Q7KA 1PI3A 2CNBA 3HJHA 3UJPA 1X7ZB 2GJKA 4FONA 2N75A 1ZL2A 3UB4A 3ESRA 5K8IA 4E32A 4I5GA 3HBNA 3AQ4A 4ZREA 3WB2A 2R00C 4CLHA 2ZSAA 1L7NA 3BDVA 4FJ1A 1ODSA 3PUJA 3AF1A 4X0EA 2WLSA 3BBPA 3AUYA 4OMUA 2HRQA 3L4KA 3OIYA 2XSZD 3K6KA 3W2FA 4ZJYA 1VL5A 2R6ZA 2VTEA 2WAOA 2OCXA 2I91A 3OT1B 3PJDA 5L3SB 3OZWA 5IEJA 2PUDA 2GN4A 3A1EA 2QJRA 2ZSJA 3C6XA 3NDJA 1TQ6A 2GDJA 1WXQA 1K7EB 1IL0A 4IS2A 1MC1A 2X0JA 3GBPA 5DHPA 3E81A 2XYRA 5IASA 4ESHA 1VHDA 2I66A 2JAXA 3LUGA 4BWGA 4QKQA 4D0SA 1YK0A 4FYWA 1YBMA 4A8JA 4E5VA 1V0JA 4PYJA 1XP8A 1FMFA 2DPGA 2H1IA 3OA2A 4M1MA 5JZBA 4LI0A 1SZJG 3NHYA 2GS9A 3RYHA 3EDQA 2B7BA 4L4ZA 1X0VA 3DMYA 3UCXA 4DJEC 2C4WA 2ORWA 3SDZA 2F9LA 5HIAA 1VKZA 3K9NA 3VPHA 1GU7A 4PYOA 3BYZA 5T4EA 1KMMA 3FNFA 2FPOA 3RODA 4XSGA 4UOEA 4WESA 3TTXA 4JYBA 1IPFA 2JLWA 2QD2A 5DYTA 5CEEA 2J32A 5AXDA 2IOYA 4QJ3A 2WD7B 1VG9B 1RYFA 5DGXA 4R98A 5KVQA 2VNKA 3LBFA 1U0EA 1P9RA 2XITA 2ZJZA 4P4LA 2Z43A 1E3EA 2XGOA 4PSVA 1KK3A 4XJTA 5FWYB 2QTHA 2ZAOA 4INPA 4EG7A 1MUUA 3RWMB 3CNQS 5IF3A 3RUIA 3ER8A 3EODA 4GQIA 4NZYA 3WSVA 3N28A 1CW2B 1K6EA 2CLOB 4PZ0A 3U61B 5TC4A 1EUQA 4GPEA 5DW3A 5H0IA 2F1HA 1IB6A 4ZKDA 2CNWA 4CGZA 4XVUA 4LDJA 1ODIA 3H11A 1JIQA 4LZJA 5GGXA 4UE3S 5B30A 1C3OB 3D9QX 1QBGA 4QELA 1QH1A 5JAHA 1J0BA 1JF8A 5CX4A 1E96A 3ZHRA 1KMHA 3HXTA 4F12A 5ELMA 1CUJA 1W30A 2H6EA 4JP2A 5JCOA 2PS3A 2VJMB 3BRWD 3OCXA 4LJ9A 5EQJB 3WR5A 4ZMRA 5ICCA 5K2OA 4CL3A 2Q2OA 1E5TA 2V5AA 3EXEA 3K20A 1G20A 2ZRNA 3U1BA 1IWBB 3NB0A 5JCJA 5HQTA 1IBLB 3Q0IA 4PLCA 3EOAI 1YTUA 4ARSA 5JXGA 2OFFA 1J0EA 3E7WA 3CT4A 4Q3NA 1HYEA 3GAMA 2CKDA 3A6HA 2XI4A 3AVOA 3GZ4A 4G4SP 3SS8A 5E6RB 1WQ3A 2FJUA 4MPTA 4OHUA 1XG5A 3SHTA 5M7EA 3TUJC 3DAFA 1L8LA 3M5PA 1IZ8A 4UREA 3U48A 4O6VA 2HRCA 4JVSB 4WACA 5JWHA 1W4CA 3HEMA 5EYPA 3A1CA 1YHZA 4DQDA 1WNTA 3VYUB 1FEZA 1L7AA 4KXUA 1I6LA 2AD5A 5BSKA 1K08A 3WIDA 1LF0A 4LGYA 1GPBA 2WOJA 5BVHB 4DR5B 1EZ1A 3D0OA 2Q8QA 2X0KA 3V9AA 4ZYUA 5SY9A 3F2VA 4HWRA 4P1ZA 2NO0A 4PO1A 4KO2S 2QYOA 4IICA 4E5MA 1TTQB 2XNSA 3GDWA 4LXHA 4BLOA 5AYVA 1WUHS 3DOEA 5FO1A 2WJYA 3T3EA 3E27A 1CFJA 4AICA 2WA2A 3HSKA 3I01A 1WXWA 1IMOA 3KJQA 2F67A 1L5WA 3BMOB 4MW2A 2OKCA 4DILA 3S81A 3BICA 3UH0A 4CLOA 4J0FA 3BSWA 1IY9A 2YS6A 3TW0A 3HWWA 4EUFA 5KTTA 3ZDAA 4KK4A 4X8LA 16PKA 3A26A 4P31A 1NVVQ 2PIAA 3ENWA 4WY8A 1DTSA 5I7HA 1SG6A 1WO8A 2LKDA 3LT1A 3WLQA 3UJDA 5ICGA 1AA9A 2PA3A 3OCZA 4YXWA 3CG0A 4CMEA 3PQ3A 2XYGA 2R96A 5DWVA 4WD3A 3QE9Y 5IBCA 1UBRS 2C2YA 2VAXA 4OGWA 4BMYA 4B9AA 2IHVA 1JE0A 1Z2EA 4JZKA 3KVYA 4Q9IA 1SCUB 2HF7A 2C5HA 4DIOA 1NW4A 5BOVA 3IDOA 1RYEA 4M0UA 4TKLA 2NT3A 2VHWA 5I45A 4RKFA 3G0GA 2IOQA 4FLFA 5TXGA 2BCEA 2IFTA 4BNFA 4Q19A 1N0HA 1TZCA 3HBFA 4V0LA 2H5LA 5LQJA 4GL4A 4DV1B 3AKCA 1EVJA 3C8HA 4GVXA 1XI2A 5BPHA 3PNKA 4MR7B 1RC8A 5KNBA 1KY5A 2AWNA 3BL6A 2IUTA 2XTZA 1XO1A 3D6FA 4J4HA 1EWRA 2A9OA 2V6GA 3A14A 3GP3A 1E0AA 2C3OA 1QOPB 3CHYA 4Z3OA 2AF4C 1X7XB 3DE5X 3AMVA 2PV0A 1AZWA 5T41A 5CBKA 1HDZA 3OTGA 3S1LA 2MMGA 4RJTA 1HV8A 4BLWA 3QXCA 2IEZA 3A2KA 3TTYA 3Q9NA 4YJ3F 4MKIA 1P0CA 1CUBA 3VX4A 1M1YB 3U7RA 5L4SA 4I4TA 3ZDYB 1BQ3A 1EJ0A 4A0HA 1OFHA 3LVRE 1IQ0A 4E15A 1ZNQO 5ALPA 2A92A 5I5EA 1VXRA 1Z3CA 3R1IA 4QHSA 2XUIA 3WL8A 4CG0A 1GLVA 2JZCA 3F74A 1TCCA 3D8UA 1Z8FA 1SWVA 2GVNA 2IUFA 1Z2CA 4WKCA 5ES3A 2RI1A 2BKXA 1XKLA 4W1PA 3UOAB 1YZVA 3WKCA 4ERXA 4YT2A 1IB0A 3K0HA 2E1RA 1T1GA 4IP0A 3HN7A 1JPJA 2DKNA 1Y4SA 4RV9A 3HFJA 4O29A 3IIJA 9ABPA 4D6XA 3FPGA 1IN1A 1N6NA 1BS1A 3I9KA 2QJWA 1QVZA 3HZZA 2WBLC 1YBAA 4M89A 4D74A 2I3BA 2C95A 5JPCA 2WZCA 3DDNA 4O0MA 3GMDA 3QV1A 4OUDA 1XMJA 1I30A 1JR4A 3GLFB 5EE1A 5TMEA 3U4DA 1LNZA 3BHNA 3BFPA 3E9MA 3A1DA 1PT5A 4AY5A 3CUYA 1MV5A 1NMEA 3C41J 3D0QA 1MRNA 5FBZA 7REQB 2P2GA 1CRZA 2H2WA 1Z8HA 1AVTA 2B20A 2GXQA 3LDUA 1GZSA 4HQ6A 1PJLA 1LF5A 2GXSA 2J3MA 2QGZA 4E11A 4V38A 3PC6A 4NECA 5AJWA 3FYCA 4B9EA 2EKBA 2V5UA 4LK3A 4W9NC 8LDHA 1Q7GA 2OZEA 3ND9A 4LRTB 5I7AA 3B6MA 4OL0A 1PFUA 2MYPA 2QT9A 3N7UA 4J16C 4IIDA 4NLLA 4XWYA 5T4HA 3O8QA 1HE4A 2VPZA 3ZW8A 4JDUA 3N8HA 3PB3A 2HADA 3GFRA 1TYEB 1N5JA 2XOEA 1F06A 3L9WA 3CINA 3HHPA 4JBXA 1JHPA 2WIJA 5JAZA 3ENNA 2AEFA 4AS3A 4IHJA 4UKDA 3WHKA 3DMFA 5CYOA 1RWNA 1RQ2A 3CF4A 3E9ZA 2D0PB 4H1UA 4PCAA 1G8YA 3SU8A 3S5JA 2B8EA 1GVHA 4V0QA 4UULA 3N87A 1JMYA 5BW4A 1HI9A 1LPOA 4DWVA 3L01A 3H87A 4XE5A 2JVKA 1JLRA 3K09C 4ACAA 1W2HA 2HV9A 2JDID 4YO7A 3RADC 2I9KA 2RDMA 4KJXA 4BGEA 3IXMA 5TPZA 3MLBA 3M9LA 1L7PA 1XLWA 3GFFA 1JQ5A 2GD2A 3LTEA 4PZYA 4E4YA 3ONWA 3PEYA 3FPLA 4WBNF 2I29A 5CG2A 4GMFA 3BSYA 1V7PC 2I1LA 2RH9B 3OECA 1J42A 1R88A 4L5JA 5EJ4A 3PHJA 5BSTA 4MS4A 1H0KA 4XD7D 4BN4A 4Y2RA 1QGUA 4DANA 3NO4A 4ZQIA 4MEJA 4TYWA 1U5BA 1V71A 2CHUA 1U6JA 2R6DA 2IZ6A 1S5PA 4JFRA 3KQNA 1GT91 4DJ5X 1AS2A 5JMTA 1NXQA 3KP1A 1CQJB 4PFQA 5G0UA 1ZD9A 4C7BA 2C7PA 2P2CA 4IDQA 4A03A 2WSSD 4AUNA 1G3RA 4QU5A 1MOZA 5AM0A 1I7QB 3BT7A 1TPYA 2O1SA 3HKCA 3V32A 4YLYA 2FCRA 4WWHA 5K8CA 4DV2B 3ZW7A 2WMYA 4A8JC 4CVNA 4HOYA 1Y6FA 1MC8A 1XAGA 1CZHA 2DJIA 2PLAA 4ZCQA 5TF0A 1MRZA 5HQ3A 3OZSA 3EFBA 4GECA 2PLRA 4QEKA 4Y2PA 2FN9A 4IFBA 4KG7A 4BXOA 1LBEA 3LF2A 8OHMA 2HX1A 3T5GA 2EHDA 3M6UA 1D7AA 7REQA 2HF2A 3SPXA 3D3QA 1DBSA 1LS6A 3DBIA 3HJCA 2ECOA 5CFLA 1JMKC 2AZMA 1N7JA 2DPYA 3B3JA 1Z29A 3N0XA 2QS9A 3CF6R 4OFWA 4G0VA 1APBA 4B2LA 4WIAA 3ZWPA 1ZNZA 2D13A 1DBWA 1Z56C 2J5KA 1H2BA 2JK1A 3DR5A 3VU3A 3DMTA 4NV3A 3QSGA 2OLJA 4BUJA 2WZQA 4HDRB 3NASA 3NBFA 3U4IA 4FNMA 3MLEA 2FPMA 4RVNA 3I1JA 4LVOA 4P34A 4AD8A 1I5RA 1Y5IA 1AQJA 2IV7A 5EMHA 2FH5B 3GV0A 1BCSB 2AG6A 1JEQB 3GUZA 5AESA 3OLZA 1NM5A 1OTYA 1T9KA 4AM8A 5A7HA 3DF7A 4BN5A 3QPVA 5JTUA 2IU3A 2X4LA 4OF4A 1A9TA 5AUNB 2R8PA 4K46A 1KOLA 1SVNA 5JZVA 4YRCA 3KPYA 4Y9DA 5HEKA 4A36A 4AJJA 2GZ3A 2UUCB 1TT5B 4NZMA 3FF1A 4HY3A 1KL7A 3C5EA 3V4PB 3VGJA 4B5KA 3EGOA 5EXSA 4ZAGA 3VH3A 2O7NA 2QUIA 1GRQA 1Z6ZA 1WDTA 2AC2A 3LECA 5LXTF 2BH9A 3AF5A 3BBLA 2HHAA 1MO6A 2V0CA 3CTPA 2P7HA 3QX9A 4DIMA 1X77A 1H9BA 2F62A 3IAHA 5HF8A 2R00A 3TLGA 1CC1S 2PL1A 2ONYA 3JS5A 3L4EA 3KOUA 4LSMA 1QRUA 4A2WA 1IHYA 2PD3A 3MWYW 2O8DB 4QAJA 2J0QA 2X0IA 1V8FA 3DKVA 3QUQA 4CG2A 1GL6A 5H3CA 4QG3A 3NAMA 3JD3A 1NLMA 5EZYB 4D96A 2DFTA 3HWX1 4MGIR 3D8HA 1C7RA