2QTRA

Crystal structure of nicotinate mononucleotide adenylyltransferase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
publication title Kinetic and X-ray structural evidence for negative cooperativity in substrate binding to nicotinate mononucleotide adenylyltransferase (NMAT) from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 56
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qtrA00
2E21A 1MJHA 2CV0A 1J20A 1T6ZA 3F3MA 3CR8A 3A2KA 1IQUA 2OQ2A 3C8ZA 4MUHA 1O0CA 3PXUA 2WQ6A 1OWNA 1PFWA 3E27A 2CSXA 1N2GA 2RE8A 3DV2A 1UFVA 4MW9A 1ZUNA 2IP1A 3HL4A 1TQ8A 2QJTA 3M5WA 5BNZA 1PFYA 5F23A 2YWCA 1JEEA 4U8HA 1KQPA 3FOCA 4MW6A 1NUTA 3DPIA 3K32A 2HZ7A 3VRHA 3ZIUA 1JEDA 2QUKA 4MW2A 2QTMA 1K97A 3SEZA 3AIIA 3X1JA 2X3FA 4KPUB 1WXIA 3H05A 5EKDA 1OD6A 2A86A 2J4DA 4YP6A 3H9CA 3IMEA 3P52A 1JIKA 3TZLA 2JANA 3SZGA 1G8FA 5KHAA 4WSOA 1KAQA 1F4LA 4AS1A 2VTBA 1T6XA 2X1LA 4J76A 4EFKA 1KQOA 3IMCA 1M8GA 2JAXA 4EG6A 1WQ4A 4MWEA 4NAHA 5DK4A 1V8FA 1Q77A 3RFFA 4AQ7A 3HZRA 4ND6A 2WB2A 1TYCA 1WOYA 1EE1A 5IJXA 3ZUGA 4ZT3A 2QJFA 4QREA 3CLSC 5DASA 2BYTA 2A1TR 3P0JA 2DUMA 5K0SA 2H29A 2ZP1A 2J08A 4E1AA 4MUJA 1JIJA 1EJ2A 3MUEA 2I1LA 5K0TA 1QRUA 2DPLA 4MAFA 2DERA 2EL7A 3NBAA 1KP3A 1KR2A 1O94D 1RQGA 2XRZA 2CYBA 1YUMA 3OTWA 1K4MA 1N2HA 3FNRA 2Z3VA 2X0KA 1JILA 2AG6A 2A88A 3IOCA 1T9GR 2JA2A 3HGMA 4EGAA 1NYLA 1MAUA 1VBMA 3JXEA 2HGZA 1IRXA 1XNGA 1N2BA 1I6LA 4PBSA 3FY4A 3P0HA 4WNYA 1H1TA 4MUNA 4YMIA 4HPWA 2G36A 1M83A 4MWCA 4GRIA 1ILEA 3N2YA 3VU8A 2D5BA 3Q12A 2CYCA 1PFUA 4MULA 1NP7A 4MUEA 3RBAA 4MVCA 1MB2A 1OBCA 3CVYA 3IVXA 2QUHA 1EFPA 4H3SA 5FO1A 3FDXA 1GZUA 3GUZA 1XJQA 2AKEA 1NUSA 5LFAA 2PXHA 3DO8A 1KP2A 3FWKA 3COYA 4L2IB 1EUQA 2PG3A 2CFOA 3CLTD 3P0IA 1M8PA 3LE8A 1LI7A 1YI8A 3CLRD 3ELBA 1FFYA 1F7VA 2QUIA 1KORA 1TEZA 1VBKA 4TS1A 2DETA 4G5YA 1P7PA 3N9IA 4XSVA 2A1UB 3GMIA 3G6KA 1U3DA 2QJOA 2YY5A 3HV0A 1O97D 4A91A 2CT8A 4ZCRA 4MUFA 2OV4A 2B7LA 1MOPA 1TYAE 2GM3A 3NV7A 4JXZA 1NUQA 1F9AA 1YIAA 1O96B 1JGTA 1KH1A 1EFVB 1Q19A 1I2DA 3ZJUA 1R6XA 1XNJA 1F7UA 1WY5A 4PBTA 3K9WA 1VL2A 4RUKA 1NZJA 3Q10A 1WXHA 1H3NA 4X0EA 3COWA 1JHDA 1JIIA 5DEOA 5LM3A 3VGJA 1N2IA 4MVXA 1H3FA 4U63A 4JFAA 3KT3A 1QRTA 3CLSD 1NI5A 2HMAA 1WJGA 4UZFA 1I6MA 1IQRA 4MQ6A 4EG5A 3ZJTA 1EUYA 1PFVA 4I6GA 3HMQA 2J07A 4UZEA 4MWDA 4G6ZA 3U1VA 4MWBA 3RJZA 5TS2A 4FZJA 4DDKA 5TGTA 4NATA 4OUDB 3SP1A 5FO0A 3MLBA 3MLAA 3RK0A 4KPUA 3UY4A 3CLUD 1QU2A 3QTBA 3CVWA 1A8HA 1NUUA 5HUHA 4EG8A 1WQ3A 4EG1A 4U7JA 1U3CA 3QTTA 3IMGA 3HFJA 1QNFA 3OP1A 4MW4A 4ZT4A 4MUKA 4MLPA 3COVA 1HYBA 3H99A 5IHXA 2DLCX 3KT8A 3IVCA 1KH3A 1JECA 1O95D 4ZCSA 3TS1A 1QU3A 4I6EA 4DJAA 3IUBA 2QTRA 3LOQA 3FG9A 5H16A 4JXXA 3KT0A 1YULA 3IVGA 1N77A 1J09A 1O5TA 1B6TA 3Q4GA 4MW5A 3IUEA 3IH5A 4JZYA 2XRYA 1KH2A 3PNVA 1O0BA 4NX2A 3SZ3A 1SURA 1XNHA 1ULHA 3SDBA 2E0IA 4KKVA 3RK1A 4ZCTA 3PRHA 1JZQA 4DLPA 2WQ7A 1EXDA 2C5SA 4EG3A 2Z09A 4YBRA 4ARCA 2VXOA 2V0GA 3QE4A 1X8XA 4MVWA 4DDMA 1J1ZA 4XFDA 4YP5A 3AFHA 1N78A 4QRDA 2Z08A 1N2OA 2CUZA 1J21A 1MAWA 3D6VA 4ZT6A 3ND7A 4XFJA 1TFUA 1GN8A 3X1MA 3AKZA 1GTSA 1Q11A 2GKSA 3N05A 4ZT2A 4JYZA 3AG6A 2ZUEA 3FHJA 4MW7A 3MXTA 1U0BB 2X1MA 2AZXA 4MUIA 3TQOA 1U7XA 1N3LA 3MMXA 2DEUA 1D2RA 1PG2A 1N2JA 3FIUA 1O94C 3IDFA 2J09A 1T6YA 3UK2A 4CDMA 1YIDA 4DNXA 2V0CA 4CDNA 3A04A 1J70A 4EF6A 1QJCA 2ZUFA 4EG7A 1QTQA 4S1OA 3TNJA 3AG5A 4L2IA 5JBNA 1QQTA 5KCMA 5HUJA 1BS2A 1MBZA 4CT0A 3L92A 1G59A 5J5AA 3S3TA 5TEVA 1LI5A 1OWOA 1OWLA 4K03A 5TEWA 1TYDE 2WSIA 4ZCQA 2GOYA 4ZT7A 2A1UA 4NZPA 4DDHA 2BTEA 5FNZA 4Q93A 2A4MA 3BL5A 1K92A 3COZA 5KWVA 4PBRA 4MUGA 2CV1A 1NUPA 3X1KA 1O96A 4MVYA 1M8KA 4KR7A 1EFVA 5J59A 1ZJWA 2DXIA 3CLTC 3H97A 3FI0A 4J75A 1N1DA 1GLNA 3KFLA 1IH8A 2EJCA 1M1ZA 1N2EA 3CLRC 4NAUA 3UOWA 3PNYA 3SYTA 1VLHA 4G5FA 3ND6A 1PG0A 4P2BA 1KQNA 2VTBB 3SEQA 3PNBA 1H3EA 4KR9A 3ZJVA 2IJGX 1G8HA 1O97C 3KT6A 4HK4A 2A1TS 4QBTA 1YUNA 1G8GA 1M8JA 1X6VA 5H7XA 1K4KA 1I6KA 1Q15A 1MB9A 1V47A 2O5RA 3INNA 3ZXIA 4OJMX 4ARIA 2NZ2A 3ND5A 3N8HA 3D6UA 2CYAA 2PIDA 4BWVA 3H9BA 3A05A 4OUDA 3TQIA 4YP7A 4GU5A 1WZ2A 1J1UA 1WXFA 3I05A 1T9GS 3GLVA 1NURA 2D13A 1Y42X 3NBKA 1CT9A 1KAMA 2A84A 3CVVA 2YWBA 1OWMA 2PZ8A 4MW0A 4Q16A 2H2AA 1LW7A 1IQ0A 1QRSA 4CQNA 1GAXA 4R2MA 2PZBA 2NSYA 3G5AA 1GTRA 1VBNA 3CA8A 3UC5A 3ZXSA 3ZGZA 3G59A 1GPMA 1WKBA 3TZEA 5LLTA 5J58A 2PFSA 1KKUA 1MRZA 3CLUC 1TYBE 1ZH0A 1S4MA 1U7DA 1MC1A 4ND7A 3ISJA 3ILVA 4DE5A 2CV2A 3AL0C 1IFXA 2R5WA 3A4IA 4NDAA 4F4HA 2DR2A 2YXNA 1R6TA 3LCJA 4F3RA 4MW1A 1OWPA 4HJRA 2TS1A 1EFPB 1O6BA 3FETA 4ZCPA 1M8FA 1OBHA 1O95C 2J5BA 4EG4A 4ZT5A 4R0NA 5AHWA 1ZH6A 2O8VA 3IOBA 3UMVA 3L93A 1JMVA 1DNPA 2QTNA 2PZAA 2E18A 2A7XA 3FH0A 3CVUA 4HJXA 5HG0A 2D54A 1WXEA 1R6UA 3CVXA 4PY2A 1WXGA 4I6JA 4R2LA 1COZA 1FYDA 2IELA 2RD2A 3RHSA 5DB4A 2E89A 2QUJA 4RPIA 1JZSA 4K0RA 3DLAA 4KR6A 3IODA 1IVSA 1IHOA 1N75A 1NSYA 3IOEA
chains in the Genus database with same CATH superfamily
2XH8A 1IN5A 4Q05A 2K2QB 4GYWA 1PCXA 1MJHA 2UZ1B 4D96A 5JH7B 5AOCA 5B7NA 1PNVA 1UOPA 1FZQA 3DDZX 2A3NA 2IU6A 4W7SA 3W1WA 1IJKA 4JLAA 2G8LA 2VF8A 2H4XA 3DMGA 3KP1A 4QUKA 1JKFA 1O0CA 3TNYA 1EGVB 4EWLA 4D0GA 4TTPA 1IATA 3OJWA 3KC2A 2O0KA 2YNMC 1PG5A 1GEGA 1V5WA 3IPRA 1KDVA 3REQA 3GWGA 3RYCA 1Y7LA 3UWPA 3WA7A 4AI6A 1LDYA 1OFVA 4LDPA 4Y0AA 3TSZA 4AJOA 4B81A 4G5RA 3QYJA 3AJ8A 4MW9A 4ZQFA 3VR5A 3ZDXB 3S1AA 3DMHA 2UAGA 1VKJA 2UYOA 4I4CA 2PKRA 3S7ZA 1U9JA 3WOVA 3ZGYA 1EWYA 3IVAA 1YFLA 2X4IA 1HYQA 1N32B 4YDRA 1WAMA 1SUDA 2NVOA 2OXIA 3ZHTA 2HZ7A 4IRMA 2EX4A 2QAGA 2VNJA 3OQHA 4OQ4A 4CR8A 2CL5A 4F5WA 3VVMA 4R3NA 2Q5EA 5BSUA 4DIKA 3EVTA 1JJAA 2X86A 5BR4A 1QFSA 5GONF 1SCQA 2OO7A 3DUFB 4KSYA 1XPOA 3T1TA 1X77A 2X3FA 3PHBE 2AIRA 3NJ4A 4K7JA 1P5JA 2Z4TA 2G6BA 4XOIA 4W99A 3S2YA 2IQIA 2YWJA 3RIYA 4L0CA 1O8CA 2J4DA 3ECAA 3LUFA 5UKDA 3SNHA 1TI7A 3DW3X 1YJQA 4HXYA 3CJRA 3ZE1B 2PGLA 3BERA 3K8OE 1A7KA 1H0HA 3A2MA 3ROZA 3SZGA 3EPHA 5KHAA 4K05A 4PV7A 4D8XA 1NJ1A 3CRNA 1GRQA 1J0EA 3IR7A 4Y2UA 1T4CA 5HYVA 1DRKA 3W7BA 2KHZA 3L41A 5LBUA 1N0VC 1RWOA 1U0TA 2OSVA 4ZAXA 1RI2A 5TS3A 4C4AA 5ES4B 1QOPB 4NHOA 3RU2A 1JMKC 1NXWA 1Q77A 4JVNA 4JY7A 4C0XA 9LDBA 1KRWA 4G0NA 3BORA 4F86A 1Z2EA 5U4XA 1M7BA 2BZ1A 1WSBA 2BSAA 2QM7A 4XX0B 4E1VA 1UBCA 2WHPB 4N8EA 5IBCA 3U1BA 1JB1A 1U2PA 3FCUB 4HEHA 4E2FA 3VYSB 4A5SA 1M0SA 2AOUB 2HO5A 4D0NA 2QTFA 4QYXA 4D8VA 1KAEA 2CZQA 3DVSX 1TYZA 4PPNA 4FQ8A 4DGSA 5K4GA 3QVGA 3RVBA 2RHLA 2DQSA 3OY7A 1VPTA 5KVVA 1TAUA 3ITNA 621PA 4IF4A 4XFKA 4ZU1X 2ODEA 4QUEA 2PQ6A 5HF5A 2QD5A 3QNMA 3QWBA 3BS4A 1QGUB 2DERA 3ACBA 2W2NA 1QB7A 3BDVA 1DZIA 2OTCA 3KR1A 3LFTA 2XDQB 4EBFA 4ZKEA 4U7PB 4XRRA 1P0PA 1Z7BA 4UD2A 4X66B 4AB1A 1YT5A 1NYLA 3MBOA 5KOJB 1NN3A 2G88A 1OMOA 4CMHA 4IMRA 3KLOA 2W2LD 1N9ZA 3MBIA 4KIJA 2ACKA 4JJIA 1SULA 1TZ2A 5EQJB 1E63A 1Y6RA 1W5FA 1SPXA 3RV3A 4C2AA 1NVXQ 2C3OA 3VHQA 3AETA 4MYHA 2A78A 3EFBA 4PLPA 3CT6A 2XVAA 2JGEA 2WTNA 5ALSA 2YW2A 1O87A 4UEOA 1M2VA 2HA2A 4OFWA 4YV0A 4H7FA 4EL0A 1F3LA 5HRCA 1T1EA 1PFUA 5CB6A 2OV2A 3FOAA 3BHNA 3HSKA 4JROA 3ZKWB 1E8MA 1LB1B 1UMKA 4J16A 4W8HA 4F2HA 3GRUA 4OHUA 2AOXA 2B0CA 2EBFX 2QDXA 2R8XA 2PDAA 1QDUA 1L7QA 1A5SB 1XQVA 2V7QD 4KMSA 3FOBA 4L9AA 4D0LB 5H0IA 4DQ0A 4F9FA 5BV1A 1XJQA 3NCHA 1Z5VA 4YQEA 1R27A 2V4MA 4QYTA 1Y6ZA 3CSDA 2QUZA 2NN3C 3VV3A 3BF8A 4Q7JB 1EUQA 2PG3A 3BFXA 3HUDA 4FFPA 1YVDA 1V35A 1A9SA 4CVNA 5ICMA 1X86B 2I80A 1RXUA 4JQOA 1A96A 1MZPA 1O6CA 3HZHA 1TC1A 1ZX1A 1VJ0A 1ZI6A 1M2EA 3UT5B 1DGQA 5AIAA 4PQGA 1TEZA 1JBKA 2WJGA 5CCEA 4EKNB 4FZVA 5C8XA 1R0KA 4BNTA 5DHFA 1ZVQA 3L8HA 3JQAD 4D9FA 2X7JA 4IOMA 1SUCA 2QJOA 3E6AA 2H7CA 5E2IA 3I9OA 2GM4A 3W3ZB 2XTJA 3QQPA 4JLNA 1NUQA 2R1TB 2V9CA 1PT7A 4UMVA 3ENNA 3RT9A 3T95A 1Q74A 3LQQA 3OZTA 1V4VA 1MO3A 3H4IA 4QNNA 4BASA 3LXRA 3Q9NA 3GQBB 4G97A 3ZJUA 1X0XA 4XR4A 1GQQA 3EXAA 2HQSA 2JKYA 1JT2A 4P4SA 1YFZA 2XZTA 2VJYA 4FW9A 2DF8A 1Y5LA 2IHTA 2XCUA 2P4UA 3PCXA 4NBSA 1IEVA 1WABA 3BMXA 2ZJZA 3Q10A 4FOLA 1G8PA 1TQDA 4FFVA 4LQDA 3UGQA 4B4OA 1FDTA 5BW4A 1WB9A 2GS9A 4QODA 4YMWA 2R7NA 2GJSA 5DSTA 4BKMA 2G72A 3HU2A 2JIRA 3D0KA 3MUNA 3D6FA 1FDVA 5CVCA 3RLIA 1NP3A 1WDKA 1TEVA 1YS7A 3SC2B 1EFKA 1GUDA 1UUFA 2CDRA 2IW3A 2XGMA 4HI0E 4LSWA 1U80A 4XDHA 5AW3A 5TVKA 1ZWKA 2AH5A 2WWWA 2AFRA 3A2LA 3VSAA 3ZC3A 4FMPA 4PQYA 1N6IA 4IJVA 3ZY4A 4REOA 2YBEA 1E1RA 2Z43A 5CM2Z 2AKYA 5A5DA 2GO1A 4G1CA 2XYQA 1AQYA 4UOQA 2BPOA 2XI4A 2FSHA 4BEJA 1KXJA 1N92A 2RGNA 1WM1A 3OH8A 3OWOA 4FS3A 2DBRA 4DMKA 5KNCA 4HDSA 4YB8A 4BXOB 4ZVMA 4MS1A 5C9ZA 4B34A 3IILA 2JI8A 2OBBA 2X15A 5CA0B 5I9NA 4UBMA 1JVNA 1QOZA 2A5DA 4PLVA 4KQGA 4B3TB 4EB0A 4U7JA 1IN4A 3MWGA 4U4AA 4R16A 4X8OA 2WJ3A 4DLXA 3LCVB 3I73A 3VZQA 2GZ3A 2FN9A 2GPNA 3DBOB 4L8WB 2EBHX 5SYMA 4XWWA 3QOFA 3ASYA 3H99A 3IVMA 4R9NA 3VDQA 3BD7A 4GHWA 5AW4A 2Y68A 3FZEA 5CFOA 3WK7A 1E98A 3ROXA 3GRZA 5CLGA 1F0KA 1A8QA 2YWXA 5FOTA 5K6AC 5B12A 5JAIA 4DJAA 2OFXA 3CO0S 1PLKA 2RAVA 2BMWA 2ZXEA 4ZI7B 4NEGA 1H1DA 2XOEA 3H2IA 5F35A 3TRJA 3BB4A 2K87A 2ZZNA 3L7AA 2QM8A 1NYTA 1VPLA 2V8OA 1N77A 2YIMA 3R5TA 1KYXA 2IUFA 2DFNA 1R0LA 3KAQA 3LU1A 4MQFB 5LWHA 3L7NA 3TAHA 5J4VA 5ILOA 1OLUA 5J2UF 5GTDA 3HTXA 2WVGA 3D3NA 1KJNA 2X7XA 2OO5C 1CQIB 1T3GA 4LJ4A 2ZUVA 1MG0A 2HU7A 4HMQA 3Q7SA 4A36A 3PRHA 1FW6A 1EXDA 1CF9A 3GRKA 1YR8A 1OXTA 4HPXB 3GBPA 1ZIOA 1GSAA 3PE6A 2ETXA 4RQAA 4IWNA 4ZO4A 4W5QA 3LJKA 2PK3A 4EAAA 3ZDAA 1HT0A 3W4IA 2HD4A 3EUFA 3VR1A 4P7BA 5C1IA 3WNBA 3STTA 5MN5A 2EF0A 2C58A 1XNQB 4LWPA 4KITB 2B37A 3T34A 3AF5A 4B31A 1XVIA 1DI0A 3D6VA 2FMFA 3H9UA 3Q3IA 1TFUA 1UH5A 3GZNA 3AY0A 4KDRA 4MO9A 1ECFA 1OAAA 1KI1A 1Q11A 2E6KA 3KQWA 1FX0B 4BX8A 1DDGA 2FKAA 3HABA 3Q87B 3FHJA 3AESA 1C0PA 2LXNA 3FTFA 4RZHA 5ETJA 4XCQA 3R20A 2ILTA 1J0XO 3UK7A 2AI1A 2VP9A 1CUWA 2FWPA 2PXCA 5LA6B 2DEUA 4Y1RA 2AEFA 4AMBA 1V9CA 1JQLB 3D0OA 1EINA 4CL3A 5YASA 5F3WB 2VHQA 2VHXA 1XAHA 2QU7A 4MB0A 1JUDA 1VOTA 4RA9A 1F1JA 4GXQA 5IVDA 4L8YA 2CXUA 2TECE 4D8WA 1MRSA 2Q8QA 4JXJA 5FKJA 4WVFA 5EJ2A 4HDRA 3FPLA 1CZRA 5E4JA 1U11A 1C9MA 1JR3D 4QU8A 3DFIA 4UHBA 1MB0A 3TGPA 2DWCA 4TV8B 1HH4A 2F00A 1E1DA 2XGGA 5SZHB 2JFPA 5KNDA 1ZMXA 4NRDA 2SECE 5HCUA 1EWKA 2N9UA 5HTKA 4EUEA 1KERA 5TEWA 5CYOA 2DCUA 4MPTA 2DKFA 4XWAA 3NVMB 2J9ZB 3OPYI 2GOYA 2FPLA 2ZYIA 4GX0A 4OLHA 4HTAA 2R8BA 4LC9A 2FW1A 3AILA 1V8ZA 4Z2AA 1PFQA 1MLDA 3MTDA 4EGCB 1JPUA 2IQ5A 5A9SB 1L5SA 3CZPA 4PU0A 2Z8ZA 4YJFA 2G70A 3HEMA 5TPWB 1XTPA 3E3NA 2P7HA 1VLZA 3AB8A 1AUPA 3I4CA 1LPNA 2PUWA 5ARCA 3W90A 1O96A 2FPUA 3NTLA 3O4IA 4RHXA 2E2WA 4G09A 4MLDA 2N46A 5HVNA 1YDEA 4BNGA 4N41A 4RZ3A 1T3ZA 1T8SA 4QYIB 1ZI8A 4FUTA 3I5XA 2PS1A 1VMAA 2DTEA 1KQ3A 1QX4A 4L7VA 1TEXA 2D3TA 3QKUA 3V33A 2IUYA 5LZ9A 5HBGA 3MZ0A 2CSUA 1P6UA 3EZGA 1J0AA 1RFGE 1VLHA 1NQOA 1SBIA 2H2HA 4KHZA 3U7EB 2C5EA 4BGVA 3L8FA 2C57A 3K05A 1U3WA 4GSLA 2FN8A 3UMJA 4IWXA 2Y1XA 3AHIA 3I45A 3TM4A 3WLMA 3UG7A 5ESDA 3P2IA 4ISCA 4MYCA 5G2OA 1U6IA 3CLVA 2HQ1A 3FWZA 3FOZA 1R0BA 1I33A 3LP8A 2H1WA 4RM2A 3T7IA 3ZHBA 4BFTA 1GTJ1 1EHIA 1MB9A 4O4LA 4WK4B 3UBTA 1PE0A 2OZEA 4WI1A 2XT9A 2JDIA 4DA0A 4EJ0A 1P17A 1BHO1 1ENZA 1W2WB 2C2MA 2ZROA 3FZGA 3GYBA 1XZBA 5HCIA 2IL1A 5FNVA 4D4KA 2R65A 2CYAA 2BP7B 2WWIA 4P32A 3TSYA 4KMOA 2NO1A 4BTVA 1IY0A 3V4OA 4P53A 3SJ7A 2IHKA 1R4MA 4F2PA 1W4LA 3MWLA 1XZNA 3TUZC 1D6MA 1T1RA 3AFGA 4ER7A 2FEWB 1WTCA 4NS4A 2JFWA 4UNPA 4OATA 5KJCA 2H8KA 1F2VA 3CVVA 5L9AA 2O6LA 3H5RA 3LWDA 3SMQA 4FSDA 5MHTA 4YYZA 2QN7A 1V5EA 2QPTA 4EQ6A 2NV6A 1KAOA 3FCAA 1Z45A 1V4NA 3U0VA 1ISMA 4NG4A 4B3CA 1YB5A 3AR2A 1GXSA 2KE5A 5IDWA 5AI4A 4GBJA 1DAOA 1S6YA 1R4ZA 1EDDA 3TE6A 1KBQA 2TMDA 2ZANA 4H7IA 1W6RA 4K88A 4BFYA 1KWKA 1LK7A 1XXHB 3GPIA 5DOZA 3WKCA 3H5OA 3LGXA 4TXMA 2VZ8A 2ZS9A 4QPZA 3SBOA 4B6FA 1YB6A 3L7DA 2F8LA 4QNRA 3CLUC 1N6PA 4UM8B 4DV2B 2FRXA 5G0SA 4NNOA 3P0RA 3UGJA 1RQRA 1FJHA 4DJJA 3W6PA 4MDFA 4WASA 2CV2A 4Z4CA 2VQ6A 2R5WA 3PL1A 3A4IA 2JEYA 3QIVA 5DHAA 2W22A 1A1VA 3GEPA 3FNQA 3SR3A 4HJRA 4DA6A 3FDZA 3BEOA 2BFEA 3H65A 1C0KA 1NWCA 5G3YA 1L1EA 5AYVA 3AR3A 1DHTA 3G0DA 5K0GA 3VVLA 2V3WA 2RAUA 2WT8A 1T8YA 3JQBA 1JHAA 3AT1A 1Q84A 1TK9A 2ICAA 4YALA 5FI3A 3SZLA 4N4AA 3WK6A 1YL6A 4XQ9A 3B1WA 5CLFA 3B5JA 1YKFA 2WM2A 4KC0A 1U31A 3E9QA 5B3JC 3DM5A 1U28C 1J42A 3H9EO 4KO4S 4REQA 1OBVA 1DV2A 3CWQA 2XGJA 4WTOA 1KEKA 3GLFE 1Z83A 2VJKA 1C30A 1M2OB 3NHFA 4OA8A 2I7VA 2VPTA 4NMHA 1VP9A 2W6MA 3CZ5A 3WNVA 3E8MA 3RIGA 4A0HA 3BULA 2OL4A 4I5FA 2Y6VA 1AKEA 2BH2A 1W85A 4B44A 1FYDA 2BF4A 3IBSA 1BU8A 4NTZA 2HKIA 2RMKA 4Q3CA 1USIA 1ND6A 3DD1A 3H5AA 4LI3X 4LTMA 1BJTA 5K8VA 1LSJA 1SXJA 1U9IC 2OGTA 4GC9A 4B5KA 4CUKA 1KARA 4CMGA 1LPOA 1MIOA 3TYXA 3DO5A 2C2OA 4XYGA 3RUPA 3NHPA 2K7FA 2JAWA 2Z56A 4R9VA 3TR5A 3R5KA 2JLVA 1FC0A 2WIDA 3GCXA 1JU9A 4ARZB 3GEBA 3IT0A 3L8YA 3MWKA 3R75A 3CPHA 4O2AA 4ER3A 4UM9B 1BVYF 1E1CB 3C3KA 2CJYA 3PKJA 2WQ6A 4RYDA 3HLYA 2CLFB 3E27A 5CU7A 5C5DA 1JP7A 3H13A 3EBPA 5K01A 3EIHA 1XXHE 3CW9A 1ZHHA 3BIWA 3QEJA 2HSJA 4FWIB 1V3TA 3G9ZA 3G9XA 1PJLA 4J0FA 5T4BA 1HKHA 4ZXPA 4LSMA 1H6AA 4ND5A 1EUCB 5BNZA 1NIPA 4TMZA 3GFBA 4YCCA 1OLSA 3AHGA 1KQPA 4TVBA 3LLUA 3KELA 3QELA 1NUTA 1U1FA 1VYUA 1G19A 3D0RA 2O48X 4IH4A 2Q4RA 4MIEA 2WWXA 5KYXB 1BQEA 3DMNA 3D3KA 4D26A 1GN9A 1T43A 2H17A 3G8BA 3IAAA 3OQ6A 3OF5A 3IDSA 1RADA 5H3LA 1H1LB 4Z4FA 1YRYE 2BV3A 4FE4A 2HL6A 2XF8A 3LW7A 3CH4B 3H5NA 3HWSA 2HK7A 2P65A 1L7RA 3N3BC 4MA5A 4QUJA 4TSKA 1I9GA 3HUUA 4YP6A 3SE0A 4CYMA 2V74B 3TIFA 4BMDA 2ET6A 2BI7A 4DY6A 4DUPA 3MTQA 4MRMA 5SY9A 4W5RA 4CCYB 3Q8LA 1SQ5A 3DDCA 4TWBA 1NVFA 1IN1A 4N18A 4YJ3A 5ALXA 1NAHA 1DU4A 1F3OA 2G76A 5KREA 2MYPA 3KE8A 2XCQA 1DEXA 4KRYA 4S04A 4JI0B 2H4FA 5CYFA 1MC4A 3H2KA 3UFXB 1WBDA 4XLLA 2I4MA 3PD1A 4L22A 3RARA 3K1JA 4ZV7A 1CUEA 1FTSA 1E4YA 3HBJA 4AL4A 3I42A 1I01A 1WOYA 1Z4PX 2VYVD 4ID3A 3UJCA 1UDAA 1ZD4A 1ZICA 2QJFA 3SLRA 5I9LA 4LZOA 3AQIA 3BIFA 4MV9A 1R10A 1RP7A 521PA 3TEMA 3EULA 4CI9A 4TZTA 3G2OA 1C3LA 4KX5A 5DASA 1E5QA 8ATCA 4MV4A 1I7NA 4ZOEA 2YOGA 4X7MA 3TDKA 5D3KA 1Z39A 3OQIB 1YJXA 4Q4JB 4WN3A 3OD1A 3EZ9A 3Q3CA 1NA5A 3OU7A 5GV7A 1FUIA 2ZIEA 1GQSA 2GARA 1E2JA 2OXEA 1A5BB 1H0KA 4ZAYA 1R0WA 3TVDA 1EJ2A 4DG8A 5HJEA 5JJKA 4EZEA 3MGKA 4RTMA 1WUJS 1DPFA 3WISA 1I10A 1DQNA 2ADFA 2LPMA 2Z95A 3FBTA 5BOSA 4EHAA 4P7FA 2CLEB 1V7PC 3KSAC 2Q6IA 4MJ3A 4MOWA 5FPYA 1U5BA 2C42A 3JVEA 4FLEA 3NC0C 4E5VA 2HHJA 1N6NA 1D2EA 1U2DA 3RTAA 1JSRA 4Y2GA 1KDOA 2HH9A 2PL3A 2JGLA 3B6ZA 3NH9A 1X7GA 1Y4UA 4D4LA 1V3VA 2V65A 3RAGA 4BO4A 5EP4A 1JHQA 1OC4A 3HCPA 2BELA 1RXSA 4UTXA 2IEGA 4U7WA 3UWSA 1ORRA 2CCGA 3WRYA 4IMIB 3FPJA 3E3MA 1XQWA 4LV5B 2VYFA 2ACWA 5BY2A 4DLSA 5KQPA 3BA1A 1L8OA 3Q12A 3HCFA 1E7QA 3N28A 4YQFA 3FYTA 3OUTA 3R4CA 4FMCF 1OGIA 4Y0NA 4DSAA 4GOJA 5LB2A 2HMUA 2KX7A 5CM9C 3EIWA 3N6RA 4IDFA 4RM3A 4C4OA 2L69A 1LFAA 1N7HA 3Q3EA 1BTOA 1VI2A 2D4AA 3EHDA 3NVAA 3FYUB 3OX1A 3PCTA 4G41A 2AR7A 2B94A 2J9RA 3MRSA 1QX3A 3STVA 2VPPA 1G21E 4B6JA 4D9NA 4ZZ1A 5H5JA 3KEQA 2XUKA 5LQNA 3FGNA 3D3WB 3M33A 1DXHA 4BV3A 3IIEA 1IE3A 3V48A 3OCWA 1QO9A 5G0VA 4ATNA 3VC2A 4CU5A 3CLRD 4BZPA 3FPAA 5DXFA 3UJ7A 3CH6A 5T8KC 2ZYSA 3S2FA 4P8RA 1NW7A 1VMEA 2QUIA 3VKHA 1P75A 1X74A 2JVKA 5LQKA 2EFYA 2PU5A 2BEUA 1P7PA 2JIZD 3DBIA 2WJIA 3IALA 2IKSA 2HWYA 3FMPB 3QE0A 4OOEA 1X1BA 2YY5A 5TC4A 4Q9LA 1AQ6A 3TLXA 4UQLA 1GYPA 1HSOA 4LDNA 1HRKA 4GNRA 4LMPA 2P9FA 4CQJA 4X9XA 3ZX5A 1OROA 3MTJA 5FNVF 3ZH9B 1VPEA 3Q0TA 1Y89A 5BWBA 5EP1A 5IUKC 3WQBA 4DZTA 1X7DA 5EMKA 1G5PA 1V7CA 2DJIA 1ZJJA 3AY3A 3OZXA 2ZDHA 4PG8A 5G4KA 3O91A 2A9FA 5E3IA 3ONDA 1XTUA 4F9GA 1D8TA 1KK0A 1XA0A 3U5ZB 1FLDA 1EBBA 1DBWA 1OYVA 1JKIA 2WOJA 3NKLA 3T1YB 3GN2A 3IE0A 8ABPA 3K9CA 3SXUB 3ZG6A 4QXMA 4E2WA 1JRLA 4YHHB 2HMVA 4TWRA 5AXBA 3RU7A 4Q4DA 4EPTA 1M10A 1NXSA 2I6TA 3E9DA 3EOAI 1E6UA 4RIIA 1NXVA 3USES 5BMOA 1QRTA 3DWFA 1XZFA 3VPAA 4AUKA 1IEXA 1PT8A 2O5EA 1RU3A 3KAPA 3ZHUA 2FNAA 5AVSA 1M1NA 2Z57A 4N5IX 3ID6C 4LECA 1PYDA 2F59A 1F0PA 4PEVA 3I8OA 4X6UA 2BVNA 4CM8B 4IF6A 4MWBA 4N7RA 1X7WB 1D0IA 5ADVA 2ZI5A 1SXPA 1K5GA 4I4IA 5BSFA 4QOEA 5REQB 5C4GB 3SE7A 1D4FA 4N03A 5AM3A 1EVKA 2ZTLA 1A8HA 1BGWA 2CLMB 3KBBA 3M6AA 3QENA 1WCIB 4Y2RA 3ZGVA 1S3IA 3CNQS 1RHQA 3AOGA 5BUCA 2QQ0A 4CKWA 1NVKA 2ZXUA 3X1DA 5M29A 1P81A 1H4TA 2RI6A 2YHSA 3JS5A 4D3YA 1VJTA 4FIDA 3GK3A 1TNDA 5AJHA 2DLCX 1R4AA 1T13A 1SBQA 1WMAA 3L9WA 4XWYA 1XRPA 1EB9A 4O0MA 3KZNA 4YUVA 5TDHA 3AUAA 3K09A 4YV2A 2QRQA 3ZDBA 3ITDA 3C7KA 3QVGB 1WVGA 4BNZA 1AGNA 4HVAA 1P2UA 1OF1A 4JU8A 4P7KA 5LP1A 1XEXA 1TD9A 3TX2A 4A23A 2PWPA 3WG9A 1XXLA 4K2AA 4HWRA 1YZTA 3PUVA 3UCXA 1H9AA 4C0BA 2BHLA 2D06A 4P81A 1E2MA 2I65A 2W6IA 2ERXA 1KFEB 5DTQA 3K16A 1WPRA 4YIHA 2JBAA 4BV8A 5J40A 4MW5A 1Z47A 2Y1DA 1VE5A 3CKYA 1NI4B 3QKRA 1TZJA 3RU3A 4NX2A 4MWZA 2B0JA 4JR2A 4Q03A 2IS2A 2AT1A 4G0ZA 4XGRA 4BLUA 3RIEA 1P7CA 2ZM6B 2QLTA 3Q85A 3ZGXA 3MIZA 4OYYA 3UJPA 2QSYA 3NLLA 4AMVA 2IHVA 2VHYA 3R0QA 2RCNA 1K7CA 2JKVA 2WA2A 3H5WA 1OXMA 2Q3DA 3FPBA 4G9GA 1IUNA 4S0ZA 4ZAVA 3AI7A 3GMTA 3D1JA 5T5QA 3KKZA 2F8SA 4O2AF 1JWBB 4X1KB 3TNFA 4RY2A 2HEIA 1DEAA 3SZUA 4QICA 4FP9A 4GQAA 4ND2A 4DG9A 2WJYA 5LNK6 4ERNA 3KOOA 1EFDN 1KIAA 3HG7A 5KTPA 3BWBA 2YJTD 1KKLA 3NASA 5LXTB 4JB2A 3C0KA 1YU9A 1T0JB 4BN4A 4ETIA 4JITA 1NY6A 1UEIA 4KGVA 2YFKA 3KLNA 3RO7A 5F78A 3H7AA 3MGBA 4FGUA 5EKSA 1NQTA 3OF2A 1XG5A 4TWZA 1CRLA 2VSYA 2ZBGA 2V9PA 3DEYX 3OVMA 5KTTA 3RI3A 4QGBA 2IYPA 4MI9A 1ZH4A 4JB3A 2V55B 4DLYA 1PG2A 3R3ZA 3CLKA 4D4JA 1HI9A 3F78A 1I1HA 2RG1A 1YBHA 2IXEA 2V6FA 3IDFA 3GXOA 2R6ZA 3ABOB 3STUA 3OCCA 1WQ1R 4GI3A 1YIDA 1XLUA 4G5HA 2JIDA 1DJLA 1VQ1A 2WI8A 4MAMA 4WKBA 2D2IA 3OQNA 1OKKD 4M0MA 4XWGA 4G8CA 4ZODA 4X94A 4EG7A 1OXSC 1ZUIA 5JAMA 2JJ1D 4HNAB 4XIFA 1V71A 4KI7A 5LQSA 4ZYUA 2GEDA 2QEQA 3I34X 1ZAYA 4D56A 4KPFC 3HI6A 2FFRA 3P5SA 4W9NC 2M6RA 4YJ3F 3ZI0A 5LQDA 3L92A 4HUTA 1UIRA 1YL5A 3EH1A 3LECA 4N0DA 4C89A 1JV2B 3L1VA 4ZU3A 4AF7A 1U9ZA 4X1YA 2ZW9A 3DOIA 3RM3A 3PXXA 4BQSA 3O93A 4MGIR 3S7TA 1RYYA 2O7SA 2XA9A 3EYWA 3MPOA 4K28A 1Z4LA 2RHOA 4MKZA 1J24A 3GWZA 1Z0JA 4AJ1A 4EW1A 4L5AA 2OKGA 1OT5A 4IAOA 1WXXA 3NIGB 3K9GA 1R6AA 3WHKA 1LBIA 3GUHA 1CQXA 3G02A 3ZWYA 4NJMA 5CEEA 3FI0A 4KLCA 2WJZB 1LRKA 3HKCA 3T99A 1IN7A 1UWLA 3GLSA 2EXXA 3WQHA 4CIDA 1ULSA 3A6LA 1T8PA 3D1LA 4G5OA 1N0HA 1VSBA 4P4LA 3RSOA 5C81A 4TLLB 4PG7A 5JADA 3FBGA 2UZ4A 1T6BY 3OOJA 4J4HA 3D8HA 1JSZA 3F6CA 1GPWB 3ND6A 5KYUA 1PTJA 1WL8A 5ICGA 4WT7A 3C3JA 4E5KA 2C3UA 3OM1A 4KVGA 2FMUA 1DINA 1TZMA 3QLUC 2NACA 3H8JA 2P0YA 1C29B 2CJXA 5FBKA 3SSAA 4IO1A 4FR0A 3E23A 1W0KD 3ETCA 2B36A 1FFCA 1V47A 2WNSA 4JDUA 2J5XA 3JD3A 1A2KC 4UHDA 3WXMA 1T2VA 3HZOA 5FR2A 4ZTBA 2HYIC 1RKUA 2P68A 5CW1A 3RSSA 4KIGA 4NENA 3QXCA 3M5PA 1PU2A 1NQWA 5K2OA 3PC8A 4LGMA 4BO6A 1B8OA 1GSHA 4YJKA 1P73A 3A36A 3ZPXA 3EW9A 3JYQA 3LO5A 3I05A 3PF8A 3IDQA 5KOYA 3CVYA 2Q27A 3QK7A 4IMPA 4RJTA 2J3HA 2YWFA 1V8OA 3I2FA 4EH1A 2OE2A 3IP8A 4QLBA 3ICQB 1GA1A 4HNRA 1LF5A 4X60A 4MP6A 4CUJA 3BHMA 4GMFA 1F8FA 1NJ6A 3HEBA 3MJRA 4UAJA 1OLUB 1EP1B 3KIPA 1LNQA 5SY6A 1Z9BA 4X90A 3W9UA 1A9ZA 5DN6A 4C0HA 2SHKA 1I1OA 2ZRBA 2PT9A 1GFSA 4L28A 5CW2A 3CVJA 1RI3A 4R81A 5BRAA 2ZWPA 3ENQA 4HV4A 4MEBA 3LUCA 1MCZA 1XB2A 4B7XA 2JLAA 4OI1A 5EUMA 4BCBA 3W4KA 3TZEA 2P9BA 4BJ6A 1JG7A 2UVPB 3RVRA 4Q3LA 2ZRMA 1TYBE 2V6JA 1X87A 4B6OA 1MC1A 1SZPA 3ILVA 1VE3A 2GHRA 3VQTA 1I5RA 2CVQA 1C3OA 2PGOA 2J32A 4H15A 1SC6A 5JD3A 4G0OA 4RKWA 4EG0A 1K0UA 1QCYA 2GN2A 4CEIB 4EY6A 5EN4A 1IZYA 2QWXA 3DJYA 5GQSA 2I1QA 1VHQA 5TQJA 2BR3A 4QPCA 1SQSA 1C1XB 2E85A 1A04A 5IYZB 2FRDA 1VMDA 4WNAB 3N76A 3E1GA 3TCNA 4G07A 4BJ3A 3FB1A 2GN1A 2H63A 1RYBA 2IZ7A 3DFMA 2A1IA 4PAQA 4JA2A 1V16A 3PGXA 3B3GA 3TH5A 1J8FA 1A4UA 3I2JA 5HK8A 3VNUA 1Z68A 3OT5A 5A7FA 1XPRA 4NJOA 1A4IA 2VCYA 3QPDA 4HDRB 1VE7A 3TI9A 4C22A 3DAFA 4M0LA 4B82A 1ZGGA 3R3HA 5JSZA 5L3RA 1B0AA 3F4KA 3GO4A 3T54A 2PIAA 5DK6A 3BTOA 5E0KB 3GDOA 1DIAA 4RD1A 4CFYA 5CJPA 1G7RA 3IUQA 4A8PA 5TXGA 2GEFA 2P1DA 3KSBC 4LZZA 4TMTA 3K72B 3W9BA 4FFBA 3QJGA 4IGKA 2J3IA 4P3NA 4XGKA 5LZ7A 1SZDA 2NV2B 3OE5A 2Q1SA 6REQB 1IQUA 3ELWA 1MHTA 5A0TA 1EVYA 4UULA 2QG4A 1P9WA 3FIJA 3HP7A 4WXMA 4PLZA 4QSHA 2ZBDA 5K0ZA 8MHTA 2EBUA 3KOMA 5K3FA 1X3SA 2IVFA 3WV5A 2D2VA 1DQRA 1UDBA 2YJ5A 3DV2A 3ZCSA 1F4VA 1Y3DE 4FLFA 3MEQA 1BN6A 2QT0A 3FUXA 3QV1A 3KHKA 4TKUB 4M37A 4NH4A 5ANRB 3RJTA 2HSWA 1PDOA 5KOHB 3O1JC 4IFEA 4P4UA 2C7BA 4MW6A 4QQRA 3ZVKA 1UP7A 4GVXA 4BGDA 2NXEA 3WYNA 4UNIA 3MWEA 2W48A 3BZWA 4MQ5A 3HY3A 4CM5A 4DDVA 2MMGA 2ZWMA 4ZO9A 5B2EA 3G82C 2YYAA 1I1QB 4MMZB 2RC5A 4R4JA 4HAIA 3S1LA 1GTG1 4DSNA 3T8YA 2ZAOA 3I9KA 3AIIA 2MYTA 4W5HA 4DLPA 2IEZA 2YZ2A 1J33A 4M0FA 4IZHA 3CNLA 4BDTA 1QIJA 2W90A 1U3UA 2UKDA 5A3QA 3SHVA 3FTEA 2YV1A 2EERA 1QS0A 4NXMB 2W6NA 1P8JA 3VJMA 4O4LB 2CN1A 3TNDA 3HSYA 3A0RB 4BUZA 1WF3A 3DT9A 3OM0A 4BVJA 2IX3A 4U6QA 4Q1EA 4L0DA 4GGPA 3ITKA 2Z9DA 4CRWB 1E18A 2OLEA 1GTZA 2AEJA 3SGLA 4H0CA 3ZCPA 3COJA 3H0EA 5IABA 2C4MA 2PFGA 3E5RA 3RK4A 3H8VA 3SHWA 1DRUA 1NR1A 1DVRA 3T5AA 1TVMA 1DBVO 1CR0A 1R4MB 1OFIA 2OB2A 3BB1A 3IP1A 4M1QA 4MSUA 1ZD9A 5DGIA 5DO9A 4JYCA 3V55A 3FB4A 3Q8MA 1L0BA 4ZJZA 3H9QA 5IJXA 4BNDB 3VH3A 3VDMA 1T8RA 4IHJB 2D2FA 2ILVA 5F9MA 1XWFA 2XUFA 3V1YA 1BS1A 3H83A 4GFDA 3WK8A 4A0FA 5L6MB 1G5FA 2Q6LA 4R1UA 1Z34A 2H4YA 4NY1A 4AYWA 1ACLA 3G8YA 3GNQA 3HHEA 3SM3A 1SKMA 4CM7A 4H77A 5F2NA 5B2ZA 1L5VA 3RIXA 1Z18A 2H52A 1FFGA 3W8EA 2YWRA 3KD2A 2QTTA 3OU6A 1USUA 3GL9A 2WKQA 4KG7A 4MEJA 2IBSA 4G85A 2YRXA 1JDPA 2PA3A 4BAZA 3DV0A 4CW7A 4YLYA 1EHYA 1W1IA 2CLSA 1XCJA 2WW8A 4W6ZA 1RQ7A 4DBZA 2JGIA 4FGSA 1ZOLA 1N2HA 3PNKA 4K6HA 5TE9A 2A88A 1U0EA 2BTOA 3DGFC 1I4TD 2FPPA 4HB0A 4H9GA 5DYNA 3W6ZA 5IVPA 3T1HB 1PL0A 1B73A 3DKIA 4HDKB 1BOOA 1QO7A 1BVUA 2PMWB 2UZIR 2VL7A 5SZJA 5J3JA 1H23A 1P1KA 4HTFA 4NFSA 4CIVA 2E4XA 3OKFA 1MO4A 3M9LA 4DCJA 1WB6A 5I8PA 5SV2A 3PYLA 4MYRA 3NO4A 2HK8A 3V8PA 4WNYA 3EWAA 1KYYA 2G1KA 1H1TA 1XZDA 1E3LA 3G88A 2WBLC 3RJ5A 4NAVA 3NGXA 4UHFA 3A9RA 3L82B 1JTFA 3VISA 4J91A 4DCNA 1UBRS 5KTMA 1ZS9A 5AJUA 3RVKA 1CS0A 2I7XA 3CURA 3LPCA 4RADA 3M9WA 5BYKA 4ZGBA 3ZQ4A 1Z3CA 2NYAA 2R00A 1YQEA 2HF7A 2XE8A 1PV2A 4R1MA 1XE3A 1IONA 4BN5A 5AVWA 2EL9A 2IZ5A 2NO9A 3NXSA 2PO7A 2LCQA 4LF6B 3NBYC 2Z2ZA 1NZDA 1NR7A 3CX6A 3VHXA 1V9SA 2VEOA 2OQIA 4RVDA 3UV6A 1EFPA 1QB8A 3DE0X 3H1AA 4BKPA 1QHGA 1NX6A 3AP2A 1G4HA 3IB3A 4PSDA 2EARA 4AY6A 1CJCA 3W4JA 1ELOA 3CEPB 3D6TB 4PIPA 4C3OB 3LC7O 4QBFA 4PWYA 2JASA 1NVMB 2W93A 5JT1A 3WDKA 4N3NA 3EFHA 5ALJA 4ZEOA 3TCKA 2HWWA 4P4GA 4EDFA 2X76A 5AWFC 2IYLD 4QRHA 4G1BA 3U2QA 2Z4SA 3UHOA 3DV9A 5ARBA 1NBEA 1PJ8A 2H7YA 3A6EA 3N5CA 1VBKA 4F7DA 1C3XA 3ABZA 3O31A 4U7DA 4DAOA 1FJ2A 2EJBA 4LX0A 3O4FA 2PUCA 4XIGS 1U3DA 3VNSA 4HVCA 3RJ9A 4CBVA 1WF6A 4HLDA 4CN9A 2QE6A 4JA0A 4R51A 4A2WA 4DRXB 3JW8A 3A8TA 3WWEA 4FOTA 1MV8A 3WC4A 3B3QA 3BBPA 1E1MA 1YQWA 1Z13A 4TLMB 4YFVA 4LYEA 3UJNA 3B38A 4OB8A 1KF0A 1Q19A 2LR0A 3NKVA 1JEYB 1NJFA 1PDVA 5CURA 1AZTA 1YRHA 1CRZA 2I55A 1TTHA 3T3MB 2F43B 2DHDA 2PTGA 2GZHA 2NPIA 3SN6A 1JIVA 1EU1A 3UB2A 1P4SA 1SKYB 4YRJA 5C5CA 5HS4A 4A9AA 4YXFA 1K9SA 2JFFA 4X0EA 1JAYA 1N0WA 2WWHA 3K0HA 3MJ4A 2P41A 5A4KA 1G63A 1Y1KE 2XZOA 3LY9A 1G3MA 3G7NA 3AKDA 1NFRA 3F5FA 4G9EA 1H3FA 1Y3CE 4C29A 1FVHA 4FT4A 4JFAA 4YMSA 5IT4A 4CODB 5JNLA 3KT3A 3CLSD 1AHNA 2A58A 3HADA 4ZHQA 3RKSA 3W5HA 1H22A 3HDVA 4QOSA 2XOKD 3AVUA 3EMKA 2I3BA 3K53A 3TOVA 4ZV4A 2VJAA 1XV5A 4UHJA 4RESA 3T38A 2C4UA 1YD7A 2PO5A 1VKOA 3HPQA 1DJNA 1IHYA 1GDHA 1CUXA 4NNPA 4XPIA 1CQJB 1GNQA 1XTZA 4ZVKA 5CCBA 4GS5A 4QUBA 1RWVA 3WRWA 1FTWA 4NATA 4CM4B 4EECA 1GG5A 2I3AA 2P6RA 1A82A 4FYKA 3AVVA 3ZE6A 1E9FA 3KEMA 4PNPA 3C6KA 1YS4A 5JDIA 1EFRD 4A2QA 2H0AA 3PEFA 3LFHA 3QTTA 1SXJE 1HL7A 2ZBPA 3A3KA 1QNFA 4KDEA 3KJQA 3LNCA 4F2WA 3N07A 4LXIA 4OHMA 2A57A 1FXSA 4IQFA 1HURA 2P6PA 4K9KA 4O4JA 3SKXA 1X7YB 2P27A 3IKTA 4TYQA 1X7HA 5FLEX 3WB9A 2ZG6A 1NR5A 2DUUA 3PUJA 1DTWA 3N0TA 3TS1A 3THXA 1OIWA 4Q4LA 3GJ4A 3ADDA 1U0LA 2P9YA 3IHLA 4PC1A 3LF2A 4WCFB 2P40A 1Y5IA 3K5HA 3P0FA 3QI7A 3A32A 3R6TA 4OVKA 5JPCA 1NONA 2WV7A 2VQFB 1GPNA 1PBNA 2V7TA 5FI0B 4J2OA 2O9JA 1YBFA 3QU2A 4MTLA 2GEKA 4FM9A 1R18A 3QRWA 1X1AA 4JZYA 1L5HA 1Y1PA 3MINA 3PRYA 5CNMA 5D3QA 1QYDA 2XITA 3DHVA 4RAQA 3RK1A 3SIWA 4DDMA 2BKUA 1RAHA 5FUMA 2IU3A 2OBYA 4ZZ3A 1Z33A 2Q9BA 1H2FA 3IAS1 2VHEA 1W88B 2BN4A 2OCLA 3ESYA 4HX9A 4RF5A 5AW9A 1BXGB 4WFKA 1BZYA 3I92A 4FHZA 2ID9A 4NMMA 5EWJA 3VU9A 3S2UA 4OYRA 4R9SA 3T7CA 5TT0A 1EVQA 3RS9A 3LIIA 4RV4A 2Q3EA 1VSUA 1DQSA 1OBOA 3SHOA 1LRJA 3MTGA 4YXWD 4DLRA 1ODIA 3OLVA 3U7QA 2Y2UA 1LS6A 3A1WA 4U5QA 4BZZA 1KQGA 1L4LA 4TT3D 3OLCX 3DFZA 2W8ZA 2DT8A 2ZE7A 3F47A 2AOTA 5G1OA 3A6GA 4Q9NA 5E6SA 3UGTA 5DI9A 4N47A 4BWYA 3D4NA 2MINB 4YMVA 2CXOA 1Z56C 2YMMA 2Q3LA 2AC2A 4IDAA 2DZDA 2OUKA 1RT9A 3MUOA 1BX0A 1Z4NA 3DR5A 3O03A 2D4HA 5EPOA 3ILXA 2FV8A 2SCUA 2YYSA 3U3MA 1U7XA 4BP1A 3SJCA 5M34A 3HLKA 4WFQA 5BYJA 1HZZC 4PX3A 2GD1O 3JYPA 4LDZA 4OQXA 5DHPA 3TL3A 4DDTA 3FIUA 3BMQB 3OIGA 3QEKA 3C7TA 4LDAA 5CFMA 4K9NA 3SLGA 1XJ0A 1R64A 1QMPA 2A0WA 1L9KA 4QU9A 4CDMA 2FZVA 3A6KA 4OQEA 4ESEA 3VUFA 1KGSA 1QP8A 3H1GA 3AJEA 2W6OA 1NF2A 3WLTA 3C7DB 4CDNA 4ECAA 3F6BX 7ABPA 1BDHA 2DP4E 1Q12A 1W44A 2QF7A 2Q62A 3K0CC 2A5GA 1LNZA 3OICA 1T2FA 2FVXA 4ZC8A 3USCS 4HNTA 1JQAA 2XTNA 1K1EA 1EG7A 5GZ1A 5KCMA 2H2IA 3V4PB 4UUMA 5FOXA 3EISA 3DMTC 5HMLA 4U7GA 3VR6A 3SYMA 1SU8A 2GTHA 3S3TA 2I6UA 4MR8A 1LI5A 3OE7D 1ZUWA 4W7HA 1GNLA 4NU6A 4LAFA 1GVHA 4MUAA 1ZESA 4BNJA 3VHLB 1RKQA 2AMLA 1TEHA 2C2WA 1ZNYA 4CQLB 1Q17A 4L9WA 2UYGA 3U4QA 4L07A 3X0DA 1U1DA 1DOAA 1STOA 3BL5A 5IT0A 2WSBA 3AEKB 3DTVD 3ER6A 3LBYA 1H2AS 1ZGZA 1ZP6A 2CJPA 3KJNA 2OYCA 2R66A 4KR7A 4URWR 4P35A 3FGZA 2R6DA 4QEZA 1ZJWA 1HDIA 1GLNA 1KR5A 3HJUA 4DLTA 1CUCA 1H5UA 3OO1A 4GC5A 2ZSBA 3GHYA 4YRFA 3H1FA 3TZBA 5CB0A 3F74A 4JU9A 4ALNA 1X19A 3U44B 4EY4A 4XD7A 1RJDA 2I99A 1OZAA 5JMTA 1YB7A 1MQSA 3H1TA 5FIUA 2VAVA 3BD8A 4HGQA 3P97A 3WSWA 4DA7A 3GDHA 4DKJA 2CLCX 1ILWA 2XV1A 3PJGA 1TW3A 1YDGA 1S2OA 1JEQB 3CJQA 4PYMA 2INGX 3HA5A 4A10A 4C76A 3GVHA 3IQZA 3KHUA 1SEVA 3P9PA 2E1RA 5AM0A 5JWHA 2FP4B 5DOVA 4D6YA 5I48A 3AV0B 5J2TA 2PYDA 4HMOA 4R9RA 1RPTA 3ZXIA 5BQ3A 4F21A 2HLPA 1C80A 4MPRA 4JEHA 5C46F 3N6XA 1I9CA 1G8SA 1EDZA 1QZXA 1EQAA 1LLDA 3HXTA 4HWKA 4A1FA 3SOPA 5A3VA 2XDAA 2QE7A 5DGXA 2Z9BA 2WUVA 1XTIA 4INAA 4J1TA 1SQGA 5BV8A 1LLUA 1EK0A 2ZI7A 3GD7A 1LUAA 2BHTA 1ZWLA 2G80A 3NBKA 1B0PA 3HACA 2QK4A 4CF4A 1XVLA 4EYKA 3ADPA 4WV3A 5EHXA 5JASA 1SG6A 5AI0A 3R44A 5B6PA 1UWCA 2YWBA 4AY4A 3ZU4A 4PS1A 2PZ8A 5JI2E 4MW0A 1FFWA 3FSGD 5EE3A 4AKEA 1AUXA 2AI2A 1R6BX 2O8FB 2IS6A 3RS4A 1GZDA 3K1ZA 4LY6A 3ZGOA 3OCJA 3MERA 3V34A 1CQPA 1WHTB 1ZH2A 5AKJA 5CD9A 4J7CA 1PL7A 4UHCA 1SBCA 4H7HA 1DAFA 1PRYA 3QVXA 4UVGA 3FYUC 4L5YA 3UC5A 4QQFA 4Q9JA 4Q15A 3IKVA 2G17A 3L84A 3PT5A 6GPBA 3TOSA 3ESXA 1PT5A 1KKUA 2GSWA 1IB0A 1DQYA 1L7BA 1WKVA 1K7XB 3L6EA 1P2DA 4Q9KA 1JW9B 1ZN9A 2L17A 2J3QA 2O2ZA 3NVDA 2H7XA 3C74A 3QG5A 4WXHA 5T4EA 4DYDA 4WY5A 1M7GA 2DR2A 1CY6A 4L3WA 1Z3IX 5I8ZA 3SF0A 4P3XA 3E5HA 4LXUA 3FETA 2GAOA 3HNRA 1B8VA 4CV3A 4Z51A 4E33A 4OX9Y 1BXZA 3C3MA 4JASB 3B85A 3C3PA 2P5SA 4KQXA 4QYWA 4OI4A 5JMOA 4DUZB 5COBA 4ND4A 1DFIA 3S2ZA 3NYWA 4IDGA 4KK4A 3QVLA 821PA 2NU7A 2VPXA 4UFPA 4BJ5A 1J9GA 3NTOA 2G8NA 3V8VA 2PMKA 2FSPA 4G0UA 2Q9AA 3NUGA 3UBMA 3IEVA 1PZNA 3AVOA 1UBMS 4K9PA 5TGDA 4E2ZA 2PLRA 2RAFA 3TR6A 3ZYCA 3ZVLA 3RS3A 2FMIA 4HJXA 1EWVA 1P2BA 2MYUA 3HO8A 5JD4A 4FX5A 5F2KA 2W42A 3PVSA 1T3LA 1I2BA 4ZHQF 1HEYA 2XWQA 2GCEA 3VZBA 4IRUB 1Q0TA 2RD2A 1U2ZA 1JXQA 3RHSA 2WD7A 2YDXA 2Z83A 4Z7QB 5JRZA 4NVRA 3F7MA 2DT5A 2OP0A 4YHBA 3R23A 3VNAA 5GV8A 4L51A 5HEKA 4KR6A 4O08A 4WOPA 2W2MA 5D5QA 1NTOA 2I0FA 4NCJA 5AM1A 2QTBA 3ROMA 1XTQA 1UKBA 3C3EA 4RD4A 3HKDA 5B1YA 3ZDDA 2EDCA 3OBBA 1I94B 5I01A 4L3OA 4EFMA 1IXSB 1ECGA 1TQ6A 3ORQA 2O54A 1FSSA 3IP6A 4DDWA 4R54A 3OOYA 4L76A 5C18A 4M1MA 2A9PA 3AM1A 3AZOA 5HIIA 3O4VA 4ZQHA 1DAGA 2L18A 3F2IA 3O2QB 2HU5A 3RB8A 2MIIA 2W6JD 5LUBA 2VNHA 3DYVA 1ZGAA 4F5ZA 5JALA 1DBRA 1ZR2A 4K40A 1Z2CA 4O4JF 1AM4D 5JOQA 1Z73A 4OYHA 2BHRA 4UCXA 3JAWA 2FHSA 3H5TA 1TUBB 3PFGA 4DLZA 2RI0A 3KUKA 4EYSA 2JLUA 2GQ0A 4D3XA 5FTNA 3NMUF 4LNUB 2BMJA 4S1WA 4X92A 4OAQA 4HWPA 4KMRA 2H1SA 4N6NA 4BE7B 1NLZA 5I7FA 5EE5B 4HH3C 4OJTA 1T2CA 3DP9A 3WTBA 2XODA 4DIMA 4CLRA 1NASA 2ZYUX 2WVJA 1Z17A 3LPDA 4RENA 1Q1EA 4MKXA 5CCXA 2Q3MA 5JR3A 1OYOA 2O1WA 2XE7A 3O84A 5AVJA 4C3UA 1Z36A 1EUZA 1E0KA 5GP1A 4B0OA 1WXIA 4CIXA 2O3JA 3PC6A 3KTOA 5EJIA 4EZIA 3V6MA 1TQ4A 1XR3A 1ZH8A 2FZWA 3OLXA 4CQMD 3B3FA 1R6VA 4MV7A 5JI3E 1YVRA 2Q07A 1ZCFA 1ZMOA 4Q3NA 4D42A 1V1RA 3IE2A 1AKWA 4MS3A 2JANA 2G06A 4KSBA 4YREA 4EM6A 1G6KA 5KEIA 5TSDA 4AS1A 3RAPR 4BLSA 3TLBA 3DEFA 4P3OA 3MS4A 1EP3B 1KSHA 4EFKA 1CYEA 3LT2A 5LYYA 5ICFA 4MWEA 4UBOA 4E4TA 1FTNA 2PZEA 3NAZA 1BFKA 3NAMA 4ZVLA 3ZWAA 1AQNA 2WB2A 1VJCA 3L0SA 2ODPA 2H4HA 4QOFA 4U0JA 3GPCA 2I4IA 3WADA 1S9DA 2W6ZA 4PSUA 3OIVA 4DAEA 1QTRA 2O8BA 4ERXA 3T06B 4CLDA 4J1QA 4YRTA 4YJGB 2IUTA 3K8ZA 5IM5A 4RK1A 2WM3A 3ABSB 3FWNA 2HTFA 2VDNB 1IB6A 2NUPB 4FJ2A 3TB4A 5FPQA 1EDEA 1Y3BE 3WWYA 5KYKA 3TGWA 2J08A 2O2HA 5FLKA 1CQZA 1BG6A 3R0VA 1DIGA 3B9RA 5BQOA 4ZALA 3ZJ5A 3E3AA 1RXIA 4K6MA 3FFAA 2TRSB 2JBWA 4FILA 4O6VA 1ZAKA 2ATXA 2WICA 4X1IB 1SIWA 5TQ0B 1KP3A 1LBQA 3NHJA 3E05A 1IXRC 1JA1A 1O94D 3P26A 3A1EA 3N2EA 1RQGA 4NC9A 5TGZA 2XRZA 4ZYVA 3SZRA 5HQ3A 2PMDA 2UZ3A 1GT91 2Z3VA 3LOUA 5A06A 1SC9A 4CTKA 5F98A 4G26A 3B2NA 3H2ZA 3GOHA 4C5AA 2F1RA 1FSFA 2R8RA 3BXZA 3UICA 2AMVA 2RHHA 3ZEAA 4B6QA 5T41A 1N2BA 1PHPA 4HRAA 1NBMD 3GCWA 4P0TA 1QZ3A 4FEEA 4WDQA 3UMMA 4KODA 1YQ9A 3JRXA 1XNRB 3G2QA 1Y8QB 4I1RA 3BMNB 2ZRGA 3RGGA 2VHTA 3E5MA 3NR2A 3A4NA 2ZOSA 3VPGA 4BFVA 4LE1A 3WK9A 10MHA 3ROEA 1OH5A 1MJFA 2HLHA 2BKXA 3LXMA 4JL6A 4DCOA 3HYCA 3WGYA 1QORA 5FADA 1YAHA 3UA3A 3OOEA 1VI6A 2DY0A 3O47A 4M55A 4J7XA 4C6TB 3H3FA 3PSAA 3DKKA 3Q6NA 1A9XA 1GZVA 1D2AA 2I76A 2B7BA 2P9EA 3NHWA 2OBXA 3NHKA 4IIXA 3LUHA 2OY0A 2J9YB 3K70D 1JDJA 1KRHA 2G5GX 1T25A 2VJQA 2XR1A 3I2GA 2GSDA 3B6MA 5EYPB 1F0YA 1ZW6A 3FNEA 4ISBA 5FBHA 4AUEA 4GH5A 4D6PA 2XCOA 4IEFB 5DTEA 5AI5A 3RUAA 3AF3A 3VOAA 1QBKC 3AVWA 1JXAA 3CSSA 3ESCA 5L6LB 1IZ7A 3NG1A 4WN9B 2QI9F 4HNUA 2DFLA 3BILA 1QE0A 3AEXA 1LI7A 1YI8A 2A30A 4UPDA 4BVKA 1T24A 3CG0A 3TOZA 1WCV1 3A2NA 3RFUA 5C35A 4URFA 1VA4A 2ZRNA 3BCRA 3OI7A 4R7TA 2A33A 3HVJA 2CFCA 5A4JA 4X65B 1B1AA 1RVV1 4KJXA 5EOVA 5TMDA 4JCCA 2IP4A 5J2TF 4BNIA 3U3RA 1CUFA 1GKIA 4RKYA 1LK0A 2JD0A 1A3CA 3D7RA 5K3FB 5KX5B 1SHUX 1E2BA 4G9BA 2QMHA 2PX8A 1RFLA 3SU8A 2C3PA 1OB2A 1KH1A 1WD5A 1LSSA 1R16A 2JGJA 1SG9A 2QMOA 3DFUA 3S2IA 1GNVA 4UM5A 4RFLA 1DDIA 3AUXA 4G86A 3WGTA 2B8NA 2CY0A 4YVFA 2P78A 5HF6A 3B52X 3K9WA 1TE2A 4KLNA 4UBJA 5EIAA 5DX1A 2WINI 1K5HA 1U0RA 4RC9A 4JI2B 1AF7A 4RMGA 3BJZA 1YJAA 2Q3FA 3OZRA 3C1TA 4BLRA 2I87A 5A6SA 4G1EB 1HYEA 2PQMA 2XYRA 1W76A 3EZLA 2KI5A 4LXYA 3AZQA 3DXFA 4QBIA 4H6VA 3T7AA 2JCSA 2FLKA 1C1DA 3LX6A 2YIVX 3MJVA 3F71A 3GIWA 2DR3A 3EG5A 1QLJA 2IOFK 3MAAC 4COOA 1YQDA 1ZGBA 3EZ6A 3SKYA 4DUYB 2WYHA 3WLEA 3HVRA 1PFVA 1U65A 4X8LA 4E4RA 4LDQA 2AL7A 1K27A 2JIPA 3VTZA 3HQ4O 1QFYA 3OFNA 1Y81A 1DRWA 1TTPB 3GT7A 1Y6GA 1UF9A 4ILEA 4G0WA 3K9LA 3KLMX 3PXEA 3SPXA 4DMCA 1M0EA 5CNKA 1JYEA 4X1OA 3A6JA 2J3DA 3DCYA 2A5LA 3H4TA 2I2XB 1O1YA 4RIGA 4YMLA 1ODCA 2VLBA 1MV5A 1O7JA 3NTVA 3VR3D 2C7OA 2AFHA 5JYDA 3WJ1A 1UZAA 2QN2A 2IZ1A 1HYBA 3W04A 2V96A 2OWDA 4Y6LA 4GX2A 3C5VA 1FSGA 5CH3A 1Y6FA 1O95D 3I9FA 3E8SA 4MLCA 5FP0A 5FA6A 3WIDA 3A9WA 1QAQA 1BDIA 5LZ5A 2AXNA 4DQKA 3CY6A 4WZAA 1RI4A 3GU3A 5H16A 4CZ2A 4EF5A 1P1IA 2EAUA 1UC9A 4KXFB 3V4VB 4R2HA 3ZXXA 2DBVO 4JENA 1UINA 3WNQA 1J7JA 2F48A 2HSEA 4GG1A 5DM70 5AW0A 3SQWA 2JFNA 1OFHA 4TYMA 3WSVA 4KLAA 5ESXA 1F5SA 4R8KA 4YBZA 3QE9Y 2ADOA 3QNUA 2H2GA 3IH5A 4M0KA 3DT8A 4Z8XA 3IJ5A 1ML4A 5IK2D 2V5AA 4ZCTA 2JLWA 1ZQ1A 5A62A 1A8UA 3ZDQA 4A73A 4C7XA 1JZQA 3NRBA 3RW9A 3MMPA 5KNCD 2OXTA 2D5CA 3ASZA 3N3AC 4N5HX 1X8XA 2Q21A 4ALKA 1L3CA 4NU8X 2IPXA 4Z7OB 3PR1A 2DPYA 4H0NA 1W5SA 4HDAA 4E5YA 1U0SY 3TZCA 3DZDA 5C8VA 2CFIA 3EVDA 1V2HE 3QIAA 4B3BA 2GMWA 1R7RA 4UDXX 4DNFA 2VCEA 4KQIA 4TUYB 2OYRA 3W0LB 1HE5A 2DC1A 3NXKA 4PW0A 3RWMB 4JLMA 2JHCA 2X5OA 5JBIA 4Q0MA 2ZT7A 3X44A 3VHXB 4BO1A 1E1QD 2R25B 4GX1A 2JLZA 3PLAE 2REBA 4OLJA 2JJYA 4D9BA 3GARA 5BQ5A 3OPXA 4DS3A 5I7UA 2VDVE 3TIGA 1I1NA 4XYMA 2M9MA 4YI3A 1TMOA 3TBKA 1NLFA 2HPVA 1HT1E 2JLSA 3FLAA 2Q5FA 1D2RA 2D7JA 2RAPA 3P5BA 4IXNA 4WLFA 5IJ0A 3PENA 2M6SA 2VQDA 4J0GA 4MLZA 5BSWA 1VM6A 1P3DA 2J09A 3RREA 4WDRA 3DCJA 5ENDA 2B3DA 2FX3A 4HVLA 4LXHA 5HM8A 1DCKA 1XGKA 4GXTA 1VE6A 3ZDFA 3FJ1A 4LFBB 3ABQB 4EYOA 2DM6A 1J99A 1XZIA 1OTXA 2BW0A 1QJCA 1QH1A 3AEUB 3ZW9A 5EJ5A 1UANA 2VNKA 4RQTA 3ODGA 1I7QB 2OORA 5KTKA 3HN2A 4L2IA 4QTTB 4M9QA 3OX2A 4H59A 5A0FA 2BEVB 3MJSA 3OHSX 4UMDA 1WRBA 1G0NA 2LP4Y 4JNCA 4JV5B 1HE8B 1DWOA 1UBLS 2PX4A 3AFOA 3HM9A 4YRZA 1OWOA 2ZULA 1NF9A 4EZBA 1OWLA 1B42A 4E15A 5ITSA 2YV4A 4JJ6A 2V1UA 3UK1A 1XQYA 1C7EA 3OZFA 1QFZA 1UPTA 5DI3B 2A1UA 1XFDA 1QH8B 1W9HA 3N2NA 3RPEA 4KO2S 1QG0A 2ZVDA 1QQ5A 1OLXA 4IGFA 5LSAA 3ZLJA 1PR6A 5FNZA 3JZIA 3T0FA 4N8DA 2I6FA 4I1SA 5ILQA 4EI9A 1DX4A 1H8EA 2PKEA 4EI8A 3M4NA 3K6SA 1T91A 2XTAA 3FFWA 4TKVA 2V54A 4QD3A 2OAEA 1Z16A 1JKJA 4PVCA 2AVNA 2X0DA 4EJSA 2B92A 3TTUA 5HFJA 4I4LA 4B45A 2DXIA 3OJEA 1GEEA 1H2HA 2Y9PB 4II3A 1IEQA 2XZLA 4P5PA 1Y3IA 3OC0A 4D8YA 1AUQA 2VF2A 1VI5A 3TPFA 4GPTA 2WF8A 2WWRA 3CLRC 1M5RA 4JP8A 4RY0A 4ICIA 2C99A 1S2GA 4KEAA 2AX3A 4PCAA 3KALA 4FKMA 4XPIB 2VTBB 2IPMA 3IUYA 1VIMA 3CQ9A 3LDUA 1H3EA 1Q1GA 3OECA 3DKPA 3TQHA 2GAJA 4FZ3A 2CK3D 2GEBA 3CUSA 1TO2E 2IYNA 2B1GA 3PKIA 4LJ9A 4GLFA 4CF6A 4ZDKA 4TXNA 5AIBA 1UR5A 1OY1A 1YVEI 3GCDA 3BMOA 1Q15A 1XZ8A 3F7NA 3KXDA 4GAEA 4BAGA 1IM8A 1YZQA 3H5VA 2PMEA 1DIOB 1JA9A 5GVRA 1T0BA 1N0UA 3B12A 4KFCA 3MA0A 5LMCA 4OJMX 1C5KA 2REQA 1RYEA 3AMVA 4TS3A 2IH2A 2V8BA 4C14A 2Q3HA 1GVNB 1AD2A 1RW4A 1SN7A 1VG0B 3O26A 3TQIA 2OLJA 1UM9B 2PRYA 4M7OA 2QOEA 2PXXA 4US1R 1J1UA 5C2JB 1DTWB 2XA2A 3NOVA 2FAXA 5H81A 4URVR 4HAOA 1N57A 4V1CA 2F55A 3N0VA 2HCJB 3NIFB 3PKZA 1SQ0A 2FXVA 3V2UA 2BUAA 2QBYB 3W7AA 4OHPA 5L3SB 1DTEA 3B9BA 4BX2A 4ZVSA 3S8YA 1RJFA 1FSPA 3FGPA 3NNNA 4FYWA 2EW8A 2NXCA 1G1AA 2FI1A 4PTYA 2FG6C 3JWIA 4Q16A 1L4YA 4N5NA 4BCDA 3PIIA 4DPKA 3O3NB 4FE7A 5K4AA 4KMMA 5EIOA 3R5SA 1KDRA 1JHOA 1KJYA 3JQ6A 4JSRA 2G5PA 5F3DA 1HNZB 1NVVQ 3HBFA 5JW6A 5CP8A 5TQVA 2J4CA 1XHEA 1B0UA 4UU8A 3VH2A 4UJ5A 3YASA 3GUCA 3SQXA 1KL7A 1M34B 4C0SA 4CMEC 2JARA 5LLTA 4O2BB 3UWKA 4B33A 4MGZR 3TRDA 2NZVG 3R3SA 3GFPA 3OQVA 5FOUA 3HHPA 3N2KA 3DZIA 3D9QX 1U7DA 1E92A 2CNLA 3A6FA 4HAXA 3D4OA 5F2EA 3IIKA 4E51A 3JQCA 1N2SA 5JS2A 1UKAA 1CXZA 2AW5A 2ID4A 3AL0C 2EFCB 3E9RA 4JLBA 5AOAA 1T1SA 1QG2A 1J06A 2VDJA 2VUHB 1GGHA 2C0QA 4WNCA 3M5CA 3ZHCA 4YAUA 5I3ZA 2EJVA 4Y8VA 5A4IS 3ZWQA 3MILA 5ER6A 3AM3A 2E5WA 4EI7A 2ZUTA 2AC4A 4BQQA 5J4LA 3SHQA 1PHRA 4RMIA 1Y8ZA 2FRVA 2HW8A 5EP3A 2BR5A 2SCUB 3WL5A 4W5JA 3M1LA 4XLZA 4MV3A 1DARA 1P2FA 2PZAA 4J9UE 1DJQA 1W0JA 2EP7A 3GXBA 4JHXA 5E4TA 4ZAZA 3U49A 4OHFA 5HM6A 1DSSG 2JATA 3OQMA 4PYJA 1JNXX 3CNNA 4FR2A 3FAZA 4UTVA 3KB1A 3W2IA 1R0CA 2XEXA 2WAOA 4QELA 4GQBA 1SU7A 3H6HA 5FULA 4JP1A 4B3IA 4O4IA 4R2LA 4F4IA 1YR7A 1AHPA 1RWWA 3BAZA 2F8MA 4MUBA 4EBBA 2CFRA 3K5WA 2MSKA 3G85A 3D8RA 3WJ7A 2XW6A 2PKXA 2X4GA 1G9XA 3AY7A 5E6UA 3IODA 2WR8A 3IRUA 5KSWB 2PMFA 3KOUA 5KTNA 2MMCA 4Y3UA 3CR7A 1YMUA 5FQOA 3TEJA 5I4CA 3QEAZ 2WKSA 4LBYA 3A2KA 1GOTA 1B00A 3PXAA 4X8HA 4P86A 1VB3A 4TVKA 2XA1A 1PFWA 3BTVA 5IXYA 4QVIA 3S55A 5I4KA 1F2UA 4FE3A 5JAUA 3DLPX 4J8PA 4B87A 2CDCA 2F1HA 4NL4H 3MJEA 4DLVA 3RIHA 3U3JA 1TQ8A 2FEMA 4GP7A 5DKFA 2WKPA 5AM4A 2JD2A 4RZUA 5KDOA 1TGVA 3RVMA 5CCDA 1GCGA 3NQ41 4U8HA 1U81A 4C2BA 4RFSA 2WTEA 1OILA 1W5BA 3B1FA 4Z1MA 3ZZNA 4YCMA 3JD4A 4PGAA 1TU4A 3KL4A 3TRHA 3E61A 2VP6A 2KBEA 2WWYA 1IYZA 2G3YA 1PUJA 2PBZA 5JNVA 2X14A 2QMZA 3JQEA 1FCJA 2FPKA 1KEZA 1W36B 4MAAA 4FK8A 1E64A 3KZVA 2PGAA 3H05A 4TL6A 2W8BB 4JWTA 2I4RA 1EA7A 1GGEA 1QKIA 1SXJD 1X94A 3K0KA 3LS2A 4JP2A 3IMEA 4WCFC 4ZEWA 1JJVA 5DSZA 3FMOB 4Z99A 3ZUPA 1QP0A 3K0AA 4FI3F 1YJ8A 4C04A 4X62B 3TSWA 1LTHR 4YJDA 4G5XA 2YHUA 4EATA 5IDQA 3D6JA 5K0JA 4GW3A 4YO8A 1NLMA 1GR1A 4ZMSA 2J7PA 3QBVA 1J8YF 3OEWA 1SCNE 3GH1A 2QTZA 1RE1A 1DJMA 5IS2A 4J4BA 5LCXA 3WWOA 3LBHA 1XU9A 4LOAA 1KI6A 4ND6A 4O1MA 4Z4IA 2WTMA 4LHWA 3VTFA 2RC6A 2JFOA 2ZI6A 2VC2B 4KXNA 4J7UA 4M0CA 2O0JA 5KNBA 2GEJA 1XVAA 3TTVA 2BYTA 2OP1A 3HCAA 1FU4A 5ALTA 5C0OE 2VCHA 2NO7A 2EIXA 4N3AA 3B48A 2H3HA 2R7AA 1F8GA 2XOXA 1QTIA 1UBOS 1WUHS 2YASA 3B1JA 2JAPA 1OXVA 3KKQA 4H6WA 2IP2A 4O3MA 1IVNA 5KSYA 1WHSA 2DMRA 3I09A 4CGZA 5L95A 1P4RA 2G82A 2GXUA 1GG9A 3PJFA 2WJHA 4EB8A 4Z6KA 4KUHA 2ZIUB 1TX4B 1HM5A 1ID1A 2YZNA 5SYAA 3IAS6 1J5EB 4A0SA 2OM2A 1A8SA 4R2JA 2BGIA 4UUBA 5CH8A 1JILA 1WP4A 2IDKA 4DBLC 5ICSA 4F56A 2JA2A 3IMKA 2EYUA 4UVHA 5CPBA 4BN0A 4EFNA 4EPXA 2C1XA 2WSMA 1PVDA 2B30A 1OZGA 2J45A 5JSHA 3GRYA 5DLEA 3QKSA 5ELLA 1KQFA 1XNGA 1YCHA 1GA6A 2OHOA 4DFDA 2POCA 3W05A 5KOIA 5M04A 1RC1A 2WJJA 3ODPA 1EWRA 3EG9A 3LAWA 4LV6A 1BJRE 2YL2A 2G9UA 1ZN2A 4B43A 2OSBA 1YQXA 3N7UA 4X6YA 3KZ1E 5EVCA 2I5PO 1RNLA 1BAPA 2BFFB 2ZTSA 2WJWA 3ZTTA 1ILEA 5IKXA 4LHEA 2QXUA 4JD5A 1GU7A 2RGAA 3ETEA 4X63A 3RYHB 5A4AA 1ZRHA 1SA0A 1YTLA 3GGOA 4O8CA 3EIUA 5COQA 3WL6A 4V3CA 2YHIB 4CLOA 2FMTA 1GO2A 2GCPA 2Q5IA 3QW4B 3LT4A 1SPBS 4JWKA 1HUQA 1FJXA 3PP8A 2P35A 3ZCRA 3RASA 3C4JA 1KS9A 2FPMA 4OI2A 5FO1A 1V7QA 3SZOA 1KEWA 1KMIY 2O14A 4EKEA 1O4VA 2YH2A 1QG6A 3LSTA 3E5NA 1UBUS 4OM7A 2HDHA 4GECA 3IT3A 2FN7A 1CFJA 4FQ7A 3TSOA 1OX4B 4HDCA 2C8KA 5LKRA 3KDAA 3HVHA 3SDSA 3HB4X 1DELA 2H00A 2QM0A 1XDGA 3BXGA 3NTRA 1M8PA 3QXSA 4D9MA 1U99A 3OZCA 4Z9FA 1DRVA 2R8EA 4P33A 4WKOA 4YT8A 2OO5A 3L0IB 1JU3A 4JJEA 4ZK2A 3KQPA 3HKDB 4GYKA 2O7QA 4KE9A 2FZ5A 2R4QA 4DCSA 1A5ZA 1NKVA 5IX8A 1IWPB 2C4NA 3NZEA 4GPAA 4C06A 2WF6A 5B7GA 1PEDA 4RORA 5JCOC 3G6KA 2G5CA 2OBFA 3BYZA 3QEBZ 1VYTA 4WXPA 1GARA 3RTCA 4MUFA 4F45A 3F4LA 4XTRA 1NI3A 1J7KA 3GBVA 1GFWA 1E9DA 3S0JA 3V32A 5K3OA 5LDGA 1Z5WA 4JELA 1YIAA 2J5RA 3PGMA 4MQLA 3NS7A 4HL6A 2FEKA 2GTIA 3A31A 5I9TA 4JJZA 5BMVA 1OI2A 1DWUA 4G0MA 3ANTA 4RXMA 1VLMA 4YRLA 3M1IA 2QZZA 3CXUA 4PBTA 5FL3A 4DJEC 3PICA 4RUKA 4IJ5A 2IOHA 1JLLB 3B78A 4H4EA 1GL3A 4WAUA 1D0VA 1TLTA 4XCVA 1PYGA 1C3VA 1RBQA 2H3EA 1QF9A 5AUQA 1YMVA 2VJNA 2GZ1A 1OHHD 1AE1A 2R1VB 3ICPA 3N2LA 4O4HA 4BO8A 5CDUA 2W2PA 1CR1A 3DBLA 2AW3A 4F96A 2C2GA 1HETA 1MB4A 1J6UA 1WJGA 1NF3A 3NYRA 2OUIA 4MVJG 1TM5E 5KI6A 1AGRA 1ZLYA 1OFTA 3BGSA 3DTTA 4JT9A 4MQ6A 3BG5A 5CXSA 3WKDA 3EDRA 3TX6A 4F2DA 2IEIA 5DPMA 4DLNA 4RHCA 2Y8EA 1V1MB 3P9RA 2DX7A 1OZ0A 3BWCA 3W2TA 4UUQA 1U6KA 1QVAA 3WYDA 1U2TA 3MC1A 1PQPA 1AA9A 5JYEA 2UUAB 3LPLA 5AKHA 2IZOA 2OILA 4V03A 1JYSA 2ZTHA 2E9SA 2H2DA 2B2CA 4QUAA 4FEYA 2XVYA 1E2KA 4PWZA 4RX1A 3ZOZA 2O3SA 3IIMA 3SBXA 5BSGA 1E3SA 1E3JA 1QU2A 3QTBA 3OX4A 5E1OA 2IITA 2IIVA 3V7WA 3W34A 1QV6A 2SNIE 2VG8A 3WL3A 4EG8A 5HUHA 5TV2A 1ZQ9A 3SSOA 4QT4A 5EZQA 5FA5A 3WSTA 1KMCA 2PT6A 3MTIA 5I45A 4FGWA 1XMOB 3E22A 3PQ8A 3PV0A 1VKNA 4B48A 1CE8A 4JBNA 3COVA 5IXSA 4PFJA 1HDXA 4FFWA 2ATEA 1JTEA 4DVJA 1AHIA 2HQOA 2WA1A 2ZIFA 3GP5A 2RHBA 3BJRA 5A4MS 3EXEB 1T2DA 4IM7A 5JAZA 1NXQA 3HXLA 2QMQA 3IBCA 4DKXA 3R0XA 1WW3A 3HCOA 3IO5A 4HGPA 4F6RA 1CG6A 5KC9A 4G5GA 3MT9A 1E3TA 3LL7A 2VRCA 5C3MA 3EDYA 3FKJA 1UKVY 3TXXA 3IVGA 4Q3BA 4UHHA 3GLRA 1J09A 1MABA 1R0SA 2A9QA 2Y4NA 4HQ0A 1WNFA 1FS6A 5D85A 1GCIA 3ESZA 3CT4A 2IPAB 2BHNA 4W5NA 3LLMA 3R3WA 1FJGB 4KQ1A 2BKLA 3KJHA 3SZ3A 2FYTA 1NKTA 1BGXT 2XT6A 2QX8A 3P2MA 3AR6A 4FHDA 2WQ7A 3SR4A 4QJ5A 5LBIA 4CWAA 1COWA 4DMRA 3EEQA 1CZNA 2VFAA 2V0GA 3UXYA 1HMYA 1NQAO 3AJAA 4PO8A 2DHEA 2IXBA 1P19A 1XQ1A 3OFKA 5K9ZA 1J0CA 1CDOA 1I3LA 4Z4GA 2NVUB 3HYNA 5JZ9A 2ZJ1A 4M9ZA 2CUZA 1L5YA 4FD2A 1KOGA 4JOQA 5IDVA 1K6IA 1ZK0A 4UTRA 4BHTA 5JRJA 1PLLA 1K6EA 5BR1A 1RKVA 2GUWA 2Q2WA 1Z25A 2W0SA 5IDYA 2GCIA 1EK5A 4RU1A 3D31A 3KOXA 4HN9A 4LYJA 5CFRA 4XEUA 4JYZA 4LTDA 3KR9A 2ZPUA 3FLMA 2R79A 1U0BB 2CLDX 1SUIA 1RKXA 5E7IA 1ZDMA 3H4MA 4C30A 1CRPA 1SU4A 4I50A 2RH5A 4PLYA 3RHFA 3TJMA 3TQTA 2FFJA 2HLDA 2YUTA 3B20A 3TQOA 4AY5A 1QRDA 2AV6A 4TMYA 2I7TA 2W6ID 1N2JA 4EUNA 3HKBA 2ZJ8A 2GBLC 4KPEC 1G7SA 3TG2A 4UUAA 4R1TA 3BH6A 2QV7A 4CM9A 4EF6A 1V11A 2HPAA 5AKKA 4CEJB 2OZVA 2PA0A 2QIOA 3IV9A 3ZDEA 2OV1A 4W7IA 4ALMA 1GQRA 3AG5A 4CG3A 1AK2A 4KXWA 2VP2A 4PTZA 1CRWG 3KJEA 5HQJA 1UBTS 2I4TA 1OXXK 3PNLA 4F93B 4W4TA 5EWLA 4AZ0B 3WS7A 2Z6UA 1DC3A 3T7RA 5LP6A 1AURA 3AINA 5C3UA 1NQ5A 2QL9A 5L3QB 2PPLA 2HJWA 4KQWA 4UEJA 2Z9CA 1DKUA 5FWYB 1KFBB 5CT5A 5H68A 3O1LA 3CCCA 4YO7A 3UATA 2A4MA 2AN1A 3ANMA 2FE4A 1K92A 1X1TA 3M7IA 1RWXA 3Q5DA 5DYWA 1FFBA 1JWLA 3F6RA 3IIIA 5B3JA 1R74A 3QBDA 4BOYA 4MVYA 3PVZA 5CFPA 4DM3A 2QSZA 3PTZA 2VKQA 2QJWA 2FXIA 4GI5A 4MZDA 3KV3O 4PRKA 4RPCA 4WPGA 1Z5UA 5J59A 1MFPA 5IW8A 3DXYA 2WUFA 3ESBA 3L6UA 3A9VA 3KFLA 3L9XA 3DS8A 1H2YA 1MXHA 4N7MA 4P98A 4DB4A 2N3ZA 1IY2A 1EQ2A 1YO6A 1CJSA 3JQ8A 4G24A 2NU8A 3W1EA 1M2FA 1JHVA 3B70A 3EGXA 4RNCA 2B99A 3JD1A 4OU5A 2EKQA 4HDNA 4X91A 3Q40A 2KMLA 3KJXA 1PJBA 3KQLA 4M86A 3WLJA 4UC0A 4MYUA 1V8BA 3N8DA 1KQNA 3PNB