2QTRA

Crystal structure of nicotinate mononucleotide adenylyltransferase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
publication title Kinetic and X-ray structural evidence for negative cooperativity in substrate binding to nicotinate mononucleotide adenylyltransferase (NMAT) from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 56
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qtrA00
3IDFA 1TQ8A 1ZUNA 3GLVA 2BYTA 1WOYA 1XNHA 2Z09A 3GMIA 1V8FA 2WB2A 3CLTD 1ZH6A 1N1DA 3IOCA 5BNZA 3AG6A 2YWCA 1TEZA 3K9WA 3ZJUA 1R6TA 1F4LA 1MB9A 3ILVA 1O95D 4NATA 2CSXA 4MULA 4MUKA 1O0CA 3NBAA 1N2IA 1U3CA 2A1UB 1N2JA 5TEVA 2G36A 1EUYA 1GZUA 2QTNA 4OJMX 1O94C 1BS2A 2CV0A 2ZUFA 3AIIA 1JEEA 2DR2A 4HK4A 3IUBA 3INNA 4MW7A 5AHWA 1GTSA 2HGZA 1PG2A 1O5TA 1N2OA 4S1OA 1QRUA 4CQNA 1N2HA 3VU8A 3G5AA 2GKSA 2A1TR 3SZGA 4KR6A 1JILA 4I6JA 1O96A 3NV7A 2A88A 1ILEA 3UOWA 3OP1A 4MW9A 1MAUA 4JZYA 2BTEA 2TS1A 4MW4A 4NX2A 1G8HA 4NAUA 4R2LA 3JXEA 4G5YA 1O6BA 1EFVA 5F23A 4EF6A 1EFPA 3M5WA 3PRHA 2AG6A 4QREA 5H7XA 3DO8A 3ISJA 4EG5A 4A91A 1H3NA 1M8PA 1IQRA 3X1MA 3CLSC 1NZJA 3H99A 1Q19A 2QUIA 1J21A 1JIKA 4DLPA 3KT8A 1O97D 3HV0A 3BL5A 3SYTA 1VBNA 2O5RA 4JFAA 3SZ3A 4MW6A 2PZAA 1YUNA 4NAHA 1YIAA 1V47A 1RQGA 2IJGX 1N2BA 1PFUA 4X0EA 3CVXA 2A84A 3ELBA 4EG4A 3COVA 1JECA 3CLUC 1TFUA 1YUMA 1KP3A 5LLTA 5K0TA 1H1TA 1MAWA 2CT8A 1EFVB 3X1JA 3ND5A 4MUGA 1MRZA 4NZPA 1JIIA 1Q77A 3N05A 1NUUA 2C5SA 3IMCA 1IVSA 3H9CA 2H29A 2X3FA 4RPIA 1FYDA 4MWBA 1Y42X 3MLBA 2WQ6A 2PG3A 3AFHA 1J70A 3COWA 1GAXA 1T9GS 1KORA 4EG6A 1WXGA 4MWCA 2D54A 1Q15A 1M83A 3IOBA 1T6ZA 4Q93A 4ZT6A 4DE5A 1J1ZA 3A4IA 1IFXA 5HUJA 3RBAA 4QBTA 1OWOA 3AG5A 1I6LA 1NUTA 4JYZA 1NUSA 3FOCA 1K4MA 1EJ2A 1I6MA 4ARCA 4U8HA 1WKBA 5J5AA 3KFLA 4J75A 2E21A 2CV2A 4DDHA 1J09A 4MWDA 3ZGZA 1M8GA 1IQUA 2XRZA 4EGAA 4ND6A 3CA8A 2CFOA 1M8FA 3IODA 1U3DA 4CDMA 2EL7A 1YI8A 3PNYA 5J58A 1EUQA 4ZT2A 3KT3A 3F3MA 2ZUEA 1K92A 2QJOA 1O94D 5LFAA 4ZCPA 3UMVA 2VTBA 1U7XA 1U7DA 3FETA 3PNVA 4CT0A 4PBRA 2J09A 4ZT7A 2H2AA 4WSOA 1XJQA 2E89A 1NP7A 1TYCA 1A8HA 1TYDE 3ZXSA 1WXIA 2Z3VA 1JEDA 4MW2A 3LE8A 1DNPA 1WXFA 3VRHA 1G8GA 3Q10A 3ZXIA 3VGJA 4ZCTA 1OBHA 3RK0A 2J07A 2PZBA 1OWLA 3TZLA 2CYCA 3D6VA 4MWEA 4MUNA 3TNJA 2A4MA 1I2DA 4AS1A 4PBTA 1WY5A 4DJAA 3MXTA 3KT6A 1VBMA 1QRSA 1F7VA 4UZEA 2HZ7A 1XNJA 1KAMA 1GPMA 5IJXA 5TEWA 1JMVA 2R5WA 3P0JA 1N75A 3A05A 2QJTA 3CLSD 1R6UA 4MW5A 3L92A 2PFSA 3IVXA 1M1ZA 3NBKA 3CVVA 1KH1A 2DPLA 1OBCA 3CLRC 4F4HA 3CVYA 2CV1A 3SEZA 3FH0A 1NYLA 1NSYA 4MQ6A 5KCMA 3TQOA 1COZA 4AQ7A 2AKEA 5EKDA 1NURA 3FDXA 1I6KA 1IHOA 3PXUA 4MLPA 1X8XA 3H9BA 4H3SA 5TS2A 4ZCRA 1QTQA 2DEUA 4F3RA 3DPIA 2O8VA 1LW7A 5FNZA 1B6TA 3UK2A 5TGTA 5IHXA 5LM3A 4ZT4A 2V0CA 2A1TS 1QU3A 3CLUD 1O96B 1MJHA 2JAXA 3PNBA 3KT0A 4MUHA 3IH5A 1WXEA 4NDAA 1JZSA 3HL4A 3RFFA 2NSYA 2X0KA 3OTWA 3D6UA 4YBRA 4U7JA 2J4DA 4I6EA 1VBKA 2QTRA 5DB4A 4EFKA 3DV2A 4MVYA 4HJXA 2CYBA 2IP1A 3L93A 1EFPB 3COZA 3FWKA 1N2GA 2YXNA 3FNRA 3A04A 3LOQA 1H3EA 2QUHA 2JA2A 4L2IA 2AZXA 2QUKA 1EXDA 1H3FA 2CYAA 3P52A 4MVWA 1K97A 5DEOA 1MC1A 2X1MA 1N78A 1CT9A 1D2RA 3HMQA 1PG0A 3MUEA 4FZJA 1F7UA 3A2KA 3MMXA 3DLAA 2EJCA 1YIDA 1G8FA 4ZT5A 3N8HA 1PFWA 2NZ2A 3H05A 4MAFA 4ND7A 5K0SA 3FY4A 4G6ZA 1IRXA 1O0BA 2DUMA 1KH3A 4KR7A 4MUJA 3RK1A 3COYA 1N2EA 1KAQA 1K4KA 1Q11A 1WQ4A 4KPUA 3QTTA 3ZUGA 1ZH0A 4EG1A 4K03A 4MVXA 2OV4A 2CUZA 2JANA 3ND6A 1KQOA 4K0RA 5HUHA 1WZ2A 4E1AA 2V0GA 2WSIA 4WNYA 1PFVA 1MB2A 2PZ8A 2A7XA 1UFVA 4UZFA 3FHJA 3UY4A 5DK4A 2QUJA 3CVUA 2D5BA 3AL0C 2I1LA 4XFDA 1VLHA 4ZT3A 1T6XA 3IVCA 1OWPA 4RUKA 1OWNA 3AKZA 1KKUA 1T6YA 3CLTC 3C8ZA 4YP7A 4OUDA 3K32A 1KQNA 2DETA 2X1LA 1N3LA 3HGMA 1VL2A 2YY5A 1G59A 2A86A 1F9AA 2QJFA 4MW0A 2HMAA 4EG8A 3CVWA 1GLNA 1NUQA 4TS1A 4DNXA 2DLCX 1KR2A 1O95C 4KPUB 1U0BB 3E27A 5J59A 3Q12A 1GTRA 1JGTA 3IVGA 4PBSA 2RE8A 5FO0A 1GN8A 4EG7A 2D13A 3G59A 4R2MA 4DDMA 3LCJA 1IH8A 3N9IA 4YP6A 1NUPA 1WQ3A 3CLRD 2Z08A 4KKVA 5FO1A 2YWBA 2VTBB 3IMEA 2GOYA 2ZP1A 1ZJWA 4MUIA 1YULA 3ZIUA 2J08A 4EG3A 4GRIA 4YMIA 1QU2A 3X1KA 2E0IA 1NI5A 2PXHA 1MBZA 1WJGA 4ZCQA 3P0HA 4OUDB 4DDKA 2WQ7A 4QRDA 1XNGA 2GM3A 3TS1A 2XRYA 3G6KA 3U1VA 1M8JA 4I6GA 5DASA 3IUEA 3H97A 4ARIA 3SDBA 2J5BA 1JZQA 5HG0A 4G5FA 2B7LA 1N77A 1MOPA 4KR9A 4GU5A 1WXHA 1T9GR 3SP1A 2OQ2A 4J76A 1QNFA 4P2BA 4R0NA 1TYAE 3FIUA 4CDNA 3RJZA 3TZEA 1QJCA 3HFJA 1OD6A 3ND7A 3RHSA 2QTMA 4BWVA 4JXXA 1HYBA 1O97C 1OWMA 4JXZA 1EE1A 3I05A 4MUFA 4XFJA 2IELA 3SEQA 1X6VA 1JIJA 1LI5A 1KH2A 4HJRA 3FG9A 3S3TA 3P0IA 4Q16A 4U63A 1J20A 1QQTA 1TYBE 1JHDA 3FI0A 1M8KA 1KQPA 1LI7A 2RD2A 1QRTA 1KP2A 3IOEA 1PFYA 3HZRA 3QTBA 1SURA 2VXOA 2E18A 4MUEA 4ZCSA 3MLAA 4XSVA 3ZJTA 3GUZA 2PIDA 4HPWA 1IQ0A 2A1UA 1ULHA 3UC5A 3CR8A 4YP5A 4PY2A 1S4MA 3TQIA 3ZJVA 3IMGA 2DXIA 5JBNA 1R6XA 3N2YA 4MVCA 1FFYA 3Q4GA 5H16A 1J1UA 3QE4A 2DERA 4L2IB 4MW1A 5KHAA 5KWVA 1P7PA
chains in the Genus database with same CATH superfamily
1XZGA 3I0MA 1OXKB 1YC2A 4R3NA 2I6UA 4BVAA 4BZWA 1TQ6A 2GBLC 3JQ8B 5C5DA 1NBOA 3HJBA 4P4LA 1CS0A 2JJQA 1HNXB 4PPQA 4D5EA 3WKBA 1OTHA 2RHTA 3BZWA 5CM8B 4UMEA 1GU7A 3RTEA 4QXMA 3ZZ1A 1Y1TA 3IE0A 5K8UA 2G80A 3ZJUA 1NVAA 2IIPA 2VBGA 4HLUA 1ZINA 3GG9A 5DN6D 1RVV1 1CQXA 5E6RA 5KAPA 3TPFA 1ZISA 2XVZA 2I91A 4MK4A 1Y5IA 1G8YA 2Z4TA 1PHRA 3G02A 3KFVA 4ZOLF 1N25A 1H2ZA 3Q6IA 4LV5B 1TJPB 4FHDA 4NEHB 3E18A 1GRCA 2C88A 3A26A 3O2QB 4QKQA 2FSPA 3KQYA 4MV4A 1QX3A 3HDTA 4LCJA 2HEGA 3ZHBA 3D6MA 5GZ1A 5IANA 1M1UA 5KQGA 2EIHA 5BQ3A 1DIOB 1N3BA 1T0JB 5GMOA 4KHZA 5F73A 3F46A 4QTYA 3UICA 2GZRA 1DJLA 2RGDA 1BZYA 1JEEA 2JBAB 2BJHA 5BN1A 1AN0A 1FUEA 1ELOA 1WDLA 1XFDA 2I2AA 4OB7A 2VUTA 3HU3A 4PPYA 4TXHA 4DWWA 2OLJA 2WWYA 2H1OA 3W05A 2JHCA 2Q1WA 3HJCA 3L0SA 3TAXA 3ICQB 4K3UA 2XBUA 5HCNA 4S12A 3WHPA 1QK4A 4Q4AB 1AQLA 2R48A 4MRNA 2P0EA 2PR7A 1V7ZA 3ELWA 3KVVA 5AVYA 2PUGA 3OPQA 3ORFA 1I4EB 4W1PA 3UOWA 4XDZA 4LJKA 4X6LA 1FNMA 4XIGS 1Z13A 4W9NA 4TTSA 3QVKA 3I01M 5F64A 2WKRA 4JZYA 4R1TA 4GR5A 4M2LA 1Q92A 3RUIA 3WGQA 5DM70 4CEHA 2EYUA 4IWNA 3MS7A 4IDOA 4CG1A 1JPUA 1YL7A 3DOHA 4JLAA 4G5YA 3QFTA 5AUPB 1O6BA 2NVUB 3K71B 1PEYA 1JFLA 2XUGA 1E63A 1KU0A 3L5KA 4DR6B 3GW8A 2G76A 2IZ1A 1YBMA 1SQ0A 1TM3E 4NMMA 4C21A 3DO8A 1VPDA 4MARA 2JGJA 3LCCA 4QHYA 4TLEA 5COQA 2XA9A 3RVQA 5LYJF 4C1NA 2ZCJA 4CIYA 5HW0A 3T1OA 3ZUPA 3JQFA 4M1MA 1RJWA 1RCFA 1C29B 1I7LA 1XT6A 2QUIA 3KKLA 4PSAA 2J6BA 2ZBPA 5H82A 3WIUA 3QSYA 5K05A 5KYXB 1FX0B 2H7YA 5K8VA 1JEQA 1AUPA 2XE7A 2HMVA 1FZQA 4F86A 5TMPA 1AG9A 1YZHA 1TKRA 1ZRSA 4FGZA 1LUAA 4R05A 5KOIA 5JU6A 1E3LA 1SNYA 2PZAA 3NH6A 2QK4A 2DJ5A 4KL8S 4AJPA 2M2IA 3JD2A 1XA4A 2PFGA 1F5NA 2Q1YA 4DA7A 1B15A 2REBA 3KJZA 4FXOA 4X0EA 3KJHA 5LA6A 2EEZA 5KQPA 3OEWA 3JSXA 3ORSA 3E1KA 1I4DD 3E3NA 4JY7A 4KQCA 4GL2A 4IVPA 1GFZA 2VATA 4WCFC 4XFKA 3TLXA 4EJSB 4P0QB 3R77A 4NENA 5TC4A 3WV5A 2CLFB 1WULS 3HDVA 4QBGB 4OLAA 2YHBA 3RUCA 5EJ5A 2K2WA 2ZQYA 3HG7A 2MSDB 4RV4A 1H0SA 5LP6F 3QA9A 2ZYDA 3CGGA 5HS6A 1JPNA 3GLIE 3D3QA 3LS2A 1FJ2A 2C92A 1G2IA 1UR5A 3DUWA 4WK0B 3DS8A 4N6NA 4XH9B 1J70A 5CX4A 4L0DA 3NS7A 2RK3A 2YV4A 3KEGA 1FRVA 3AUTA 3GJ5A 3O3OB 3OMXA 4INJA 4ISBA 4P80A 4PNZA 3D2BA 2AOUB 3IX7A 5EEGA 4K5QA 1YZQA 2WM9B 3VHRA 1U94A 1PR0A 2CLIB 3BIXA 1OXUA 4C4TA 8ABPA 1J22A 3I6IA 2VJLA 4JB2A 5YASA 3A4IA 4RH1A 2GZSA 4BX3A 1ZGBA 1UP6A 4EKEA 4ZALA 4AYXA 5I7AA 3AG5A 4NNPA 4H7PA 2EZTA 1YRHA 1FX1A 3QH4A 1R8SA 3ZOKA 5ITSA 2C58A 4MTLA 3QU2A 3MJVA 4L4UA 2MYTA 2NVOA 3O74A 2FZLA 4LV8B 3HYSA 3ZS8A 4N8DA 1JBKA 1GPAA 2F3RA 2R4UA 4HFRA 3FFBA 1QYDA 4HFJA 4URZR 4F11A 2BISA 3RNOA 2J0UA 3TR6A 3M5DA 3U2QA 2RGWA 1KR5A 1ZKDA 1FP4B 1GAEO 2XQVA 4ZEMA 3AV3A 1L7AA 1MT0A 5I48A 4M9RA 2VJMB 5K2OA 4AXBA 2RAUA 1Q1ZA 3JTMA 1I2ZA 3PRYA 3BE8A 3TUZC 2O8DB 3EXHC 3Q3IA 2EKPA 3N53A 4C07A 5FR1A 1WP4A 4FNMA 4M7PA 3GN1A 4IDDA 4C88A 5IAKA 1USKA 3NWEA 4GDMA 4IY1A 1U7XA 2PANA 5C7IO 1V4BA 4OQ4A 4W5RA 4PQYA 4YK7A 1CUWA 2YASA 1FTWA 1RWKA 1E9DA 2JHPA 1OB5A 1E8NA 1LBSA 1FBTA 4URYR 5A3JA 3V8MA 1GRQA 4WRRA 2X14A 1ADJA 3OPYB 5IN5A 1T2NA 1QOQB 4FW9A 4S1TA 5LOVA 4OHYA 1II8B 1ITZA 3BQMB 2TMYA 5B2FA 3EJWA 3MHTA 1I10A 2ODNA 4DMRA 4EKIA 3VRHA 4F4UA 1OYOA 3JAWB 3ROGA 2Q3BA 3W6ZA 3U26A 1Y89A 4UVHA 1YAHA 3TQSA 3X2FA 3DNPA 2QTGA 1IHXA 5B6JA 5DNVA 2NMVA 4OJTA 3CZ9A 1DCFA 1Z08A 4OHBA 2FSFA 3T3GA 1GRNA 4L8VA 3ZCQA 4G07A 3IT0A 4UHHA 3JQCA 3V4SA 4EHBA 1BXRB 4OJNA 1WY5A 4AS1A 1X9HA 1V3QE 3ZJ4A 2L18A 1Q14A 3DCJA 2JDIA 3DLCA 2WNIA 1F7VA 3OPVA 3PKIA 3IR7A 5EL0A 4AF8A 3H8VA 4GI7A 2C2BA 4QLOA 4DEVA 2CKDA 4CPDA 4S2UA 5ARBA 4G0WA 3MYRA 2YV2A 3DDNA 1G6OA 1TJ4A 4TSRA 4MW5A 1HH4A 3IVXA 3MD0A 2H52A 2Q4EA 5CA0A 4FGLA 4FILA 5LL6P 2XUPA 2XTAA 5LZ8A 4MDEA 1WMAA 2JFWA 5KOHB 4M0FA 4EECA 4FSDA 3VYSB 1S8AA 3BXGA 1E0AA 4O4IA 3N2LA 1DI0A 3PHGA 3RTBA 1VG0B 4B3GA 5F9HA 5EE3A 5EQFA 2QXTA 5KCMA 3RS2A 4BL5A 5FV7A 3L1VA 5ICSA 4W8HA 2ODTX 3U37A 3EXG1 1YZGA 4NJOA 2NZJA 1C7EA 1DRKA 4YXWA 4ZVRA 1NPTO 3DBOB 5BSEA 4PPGA 1MVOA 4TRNA 4ZT4A 1I5EA 5EUQB 2IQ5A 4XYMA 4Y67A 5TDHA 1FMLA 2BFPA 4ZMRA 4LTDA 3NJ4A 1ENOA 1W75A 4Q3BA 3HBNA 4E08A 2JCYA 2X8AA 3M1YA 4K6GA 1LV8A 1FXWF 4IFEA 3RVSA 1Q22A 2D1RA 3NHJA 4P4SA 3STWA 5DT9A 3LTEA 1V8BA 3RVMA 1N6RA 1IJKA 1X38A 2YHAA 2VH5R 3BGVA 4YBRA 4NYMQ 2W5UA 3UXEA 1H2XA 5LXTA 1P6QA 1USWA 4MEAA 4YUVA 2ZOSA 4BN5A 5KSWB 4QDTA 4OQQA 4KR3A 2O14A 2Z3ZA 4PQRA 3P2MA 4U7FA 2VPZA 4V0KA 3SQNA 2WVGA 2JL1A 5AOCA 4MA4A 1E3IA 4LWQA 5DISB 3WBBA 4I1VA 4L2IA 4YRPA 2DTXA 2CYAA 2DH6A 1HRDA 5EJMA 4RTOA 3P52A 1GNVA 1JKXA 2C29D 5E3IA 1U7UA 4JBHA 3STYA 3T95A 1QFYA 4MVWA 2AN3A 1OLUA 1SOAA 4IFIA 1TGVA 2GWRA 5DEOA 1P74A 1O6GA 5NULA 4C6RA 5DVZA 5K4HA 2EHDA 3HV2A 2F3QA 1OH5A 1VHWA 3MJEA 4MS4B 3SY8A 3VAYA 2GEBA 4BNLA 2GRAA 1JA0A 4O4JA 3N0VA 4EPTA 4W5WA 4ER0A 3DO5A 1CFZA 1S2NA 4L9AA 1K8YB 1RTKA 3LRTA 3DC7A 5F4BA 2A14A 2JFNA 1OFUA 1U6KA 2R44A 3HRHA 3KUKA 4H15A 4L7VA 5EZYB 4BVJA 1GUAA 4JWTA 4NHOA 2PUTA 1Z7GA 1F0KA 2XDYA 2XGMA 4EIWA 4O33A 4MV0A 3DBHA 4TS9A 2X8LA 3QV2A 3JZIA 4WPGA 5BSTA 4L7QA 3I64A 4DV1B 3FWNA 4ZQFA 1AX9A 4KTTE 3H9GA 2C1XA 3RUDA 5KVVA 3PIRA 5CLHA 4LY9A 1X7YA 1VYUA 1J06A 1ODSA 3EGOA 4PEVA 4PV7A 3BCSA 3Q15C 1SCUB 4DIFA 4B9EA 4GP9A 2P62A 4Y18A 5JNRA 2AFIE 3RM3A 2NZUG 3H11B 5KNDD 4GBED 2EC5A 3HU1A 1BU5A 2HQRA 1Y98A 1E1NA 3T3PB 1UBOS 2VLBA 2W6QA 4E22A 3BT7A 3LUGA 5TQ2B 4J2TA 4K46A 1QFJA 2XGOA 3OEEA 1DKRA 2WYWA 2BTQA 3PJFA 5IHPA 5CR9A 5EERA 4K8RB 4ZDIA 3ERCA 2C5HA 4IHJF 1H5UA 3RNLA 3SXJA 1FBNA 4ZO7A 2X9VA 3AR9A 3O95A 1JU9A 1DAGA 3HGMA 3F6CA 4JSTA 2AT1A 3OZAA 2WJZB 4MW0A 3RAFC 5AJUA 4L50A 4MGHA 4Q7QA 1LB1B 1CNMA 2G07A 4WY8A 1VGVA 5K3FA 1AGXA 3OQMA 2W6ZA 1G9SA 3GNLA 3LCUA 4XQEA 1KR2A 3DMPA 3U3MA 4DV6B 2AMVA 3EW7A 1HDYA 4CLRB 4LRUA 2QD2A 2PO5A 3WWEA 2FG6C 1P1FA 1Z7EA 2A5GA 4J4TA 5LNK6 2QRJA 3IXQA 1MZPA 1CYDA 1M72A 3IB6A 3UG6A 4DRYA 3UMMA 1A77A 4LX0A 2C5EA 4QUBA 1G8AA 2ANCA 3K0EA 2W2KB 5HKLA 3BD8A 3O8OA 1IHYA 4HTFB 3QVSA 3CLKA 3WGKA 1W2HA 4PHTA 2GN2A 1YR7A 2E9SA 3MTJA 3ZU2A 1PNVA 2GEKA 2OZLA 2V7VA 4X5OA 3ABIA 2H63A 3Q3VA 5H02A 5FL7A 5DM1A 3EUFA 2OFPA 4OFZA 1GPYA 1G20E 4XLTA 3RVNA 1XWIA 4ICIA 1BX0A 4FTWA 4GOND 4YREA 2HM7A 4RGVA 4ZZIA 4JLWA 2VSQA 1TKBA 2IS2A 2CFIA 2PX4A 2XY4A 3DZDA 3AIKA 1QBKC 1ND5A 2GSDA 5DTJA 3WO0A 5J1TB 1FS5A 4A0HA 4MVJE 5C8VA 5TARA 5KNCA 5T6MA 1KK3A 1WP9A 2C4HA 3R41A 2MMCA 3UC9A 2RK4A 3SDBA 3MTGA 2B2XA 1MO3A 1YZNA 4ZTBA 3D8NA 2OR3A 4NVRA 4ROSA 4UM9D 3EIXA 2D2XA 5KJ6A 4C0JA 4PZLA 3LT5A 2ZTHA 2UYGA 5EWJA 2P9YA 1Q0UA 1Y6ZA 1J0CA 2RH9B 4HDMB 4F8EA 3IKTA 5D3ZA 2BKUA 3AO0B 3BKXA 2JCVA 1S2LA 3WHLA 4G89A 1NVKA 1P81A 2G1JA 2ZAYA 3H0KA 1E2EA 3ID6C 3O7WA 2QLJA 4HAUA 3BMQB 1Q0QA 3NFYA 1QG0A 4NULA 4C30A 1ESDA 1JB1A 1XXHB 4MDYA 1U3FA 4LXQA 4XDHA 2V9ZA 1KF0A 3MIZA 3UT5A 3V4ZA 5HNKA 1CE8A 1P39A 1SHKA 3F4LA 4XPZA 4AMBA 3KQTA 3VGPA 1KYWA 2HHJA 4MQFB 2VJAA 4KGVA 4NZNA 3ZCPA 2X2OA 13PKA 4WOBA 1GEGA 2XQGA 5CFRA 1PNQA 7REQB 4M6WA 1GT6A 1FYFA 1O0SA 2XMGA 4GAEA 1SHLA 4R0VA 3ROTA 3PIIA 1H05A 2WTAA 5IYZA 1L4UA 1LVGA 2ZBVA 2ATCA 2IF2A 2IW1A 1XTBA 3G82C 1QHEA 1T26A 3ZX5A 2R1UA 5JFOA 4PLYA 4J9VA 3FKQA 4ZOEA 2UXCB 2AI3A 2B9EA 5GOTA 1R5JA 4HNRA 3CZPA 4H7JA 4WJLA 5LC1A 4LJRA 2YZGA 4G2TA 2JGIA 4KE7A 3WL3A 1XTSA 3BCHA 3EZXA 3G49A 3QTBA 4KXUA 3FPCA 3C3PA 4L07A 5I7VA 2BFDB 1ECFA 4IO1A 3HDYA 2V03A 3CVXA 3LHIA 2Z43A 1X80A 3LUDA 1V8ZA 3QY9A 4M9SA 3UC5A 3C39A 2PL3A 1FDRA 4MS1B 3ZXXA 3E4CA 3AFNA 3PDHA 4MKXA 3X1XA 2Z83A 2R6AA 5T57A 1VJTA 3B1JA 1U3TA 4FYMA 1IU9A 3S2GA 4D4HA 2N75A 3URMA 3WK9A 4DG9A 4TZ0A 5JBNA 3FWHA 1PJQA 2JAOA 2ZB7A 1Z22A 2HK7A 3KJQA 1T43A 4K1LA 2WWWA 1FFYA 1BWRA 3K9GA 1CC1S 4RGQA 2ROQA 1NMZA 1SGWA 5E7IA 5CFQA 3KR9A 4WIAA 1I6WA 3K0HA 2LKDA 3U7JA 4YYEA 2RIRA 3R0QA 2OCIA 4H6WA 2WOJA 4KYUA 4NPCA 2BRUA 4AP6A 2FP4A 3C2QA 4RPJA 3GLVA 3H2YA 4V0RA 5JADA 2GCOB 1W2GA 4JC4A 2QD1A 4CL0A 4X1KA 4H77A 1RQ7A 2IP4A 1E94E 1FDIA 2AGVA 2Y2VA 3B2QA 3IOCA 4RM2A 4DRZA 3FPAA 3SHQA 3LX5A 4UEKA 3BIJA 2AG0A 3HYTA 5G0UA 3PQ7A 2XE6A 3ASVA 2QXYA 1L7NA 3K9WA 3MWGA 4WLNA 4HBGA 1HT3A 5GJVC 5KKAA 4ENRA 2YJNA 5CDUA 3SM9A 5HP4A 1TT5B 3U5ZB 1LDMA 3MTQA 3SCZA 3GJ7A 4TMZA 3GJ0A 4R2XA 1B8OA 3OA2A 3O5AA 1YR1A 1THTA 4P5DA 2QP4A 5E9JA 4C20A 4DYDA 4P3OA 3UANA 3ZV7A 1GYQA 5CW2A 1PGQA 4RJJA 5C4IA 5DHAA 5CA1A 3RVOA 3EG5A 3O0DA 1EUYA 1UJ6A 3PA6A 3SMQA 3UJ8A 3L18A 4QEDA 2A6PA 2VNIA 2CV0A 2F17A 3GIWA 2O48X 3MNFA 4I1PA 2DBQA 1DDIA 2OBFA 1MPTA 2PH7A 3FMOB 5FF9A 4HK4A 1E1RA 1UDWA 1KVRA 2MMGA 2VF5X 3B13B 3NRCA 4CV0A 1VA5A 1E5TA 2ZR7A 1J8DA 2AFIA 2IUUA 1KNQA 4PX2A 1H0RA 1FFWA 3NJRA 4K1XA 4TWRA 3GBVA 1FMTA 4IMRA 2VT2A 4HATA 4YRFA 3H13A 1YQTA 5JD4A 2GEUA 1KJYA 4ARSA 2ZU0C 1RLUA 1EVEA 1Z17A 3N2GB 2A9JA 5T41A 2OECA 3BTOA 4UE6A 1JFFA 1P2UA 2REQA 3I34X 3SKVA 3T35A 1L7BA 3NIBA 1W5AA 3LYHA 4JSRA 5JFGA 4CCAA 3DCYA 4CFSA 1LLCA 1WY7A 3CRZA 5CCDA 1PK8A 4RLHA 1BGVA 1SU7A 4ZIRB 3OKCA 1PL6A 4HWTA 4LFAB 4CQMB 3W06A 2WZDA 3K6KA 4OGWA 4D42A 2ZYTX 3KTDA 3KQPA 3H2GA 3OHSX 1U80A 3GNQA 1OI2A 4F84A 3A37A 4CTOA 4PRKA 1TIKA 4QGBA 3PDWA 4NF2A 3LXMA 1SKAA 4ZCLA 5AJVB 2X7XA 4WEOA 1M54A 5HQJA 4YS6A 1NE2A 4FSHA 4D9HA 1S2MA 1T4DA 1V1RB 2CF6A 3CLSC 2BHLA 4QDXA 5HQ3B 3BMNA 5K8CA 2EV9A 1M2VA 1COWD 4D7AA 2OAEA 3UPUA 2Y4NA 4Q9AA 5JNSA 1ZHOA 4ZOLA 1ZCFA 3C3CA 5DEIA 4F12A 5AW3A 1GGEA 5CB4B 4PZAA 4UTZA 1EG2A 1JG4A 3LU1A 5KC8A 4HADA 2CSUA 1PNOA 2VZ9A 3A3PA 3B89A 1ZMOA 3BGSA 1VCMA 1IATA 3H0EA 2H0QA 2XHZA 4NZYA 1EFRA 3BFVA 3ZHQA 5A2GA 3O90A 5KYNA 4ER5A 1P1IA 1I7SB 3THWA 4DLWA 4CL8A 2ZSEA 1G20A 2FLKA 2CWDA 3GJZA 5LWQA 1A1VA 1OPXA 1BX1A 1IVNA 3WLKX 4B84A 2B92A 5DV9A 3E7FA 4JLPA 1H4TA 3VVMA 3KR2A 2WFLA 4MVJA 4TV9F 1D2MA 2YJ5A 5B4VA 1DGQA 1Y1PA 4BFSA 1GL3A 4RANA 4P4UA 5D3MB 3WL8A 1OIXA 5CVJA 1P7YA 5CG2A 4A16A 1CDOA 4R2IA 2AG8A 5BSUA 4C14A 4KEAA 4MP6A 4C5CA 1X2BA 2WK1A 2Y6UA 3FDZA 1T8TA 2EU8A 3HCFA 1FZTA 1NTOA 5B1HA 2V5UA 4L15A 4KKXB 5AM1A 4BX9A 3KB8A 1O03A 3LWNA 4EG6A 3K9LA 4K26A 4NYJR 5IAAA 1U3WA 1NU6A 1FVHA 2EQ5A 2RONA 3BA6A 1YRAA 1U1CA 1WPGA 2D1FA 2Q5FA 2XDQB 4MWTA 4PLTA 4UUNA 4Z8YA 4D9BA 1ES9A 2FE1A 2YH2A 2WV9A 3Q5GA 5KJ1A 5LYJA 1QMGA 4KC0A 1ML4A 5TMEA 3WJ1A 1DB3A 1TU4A 3WNDA 4CIDA 3CB4A 3HR7A 4IG4A 4YCCA 2IY9A 5LBTA 4NE2A 5A4AA 5GINE 1JTEA 1ZRHA 4TTJA 5FLEX 4BUCA 1D0IA 2N0SA 1U8ZA 5DFAA 5U9CA 4UQPA 1PD1A 3VJMA 3TZ6A 3QXGA 4IP0A 4IGIA 2CNWD 1HDRA 1Z06A 2JLQA 1GA4A 2A78A 2K6GA 2HO4A 4XEHA 2C7QA 2W6MA 1NE7A 3GRUA 4D8WA 2ESRA 3CEPB 4X3OA 1RM5A 3DBVO 3DW3X 2AOTA 5LSAA 3DMHA 3VZDA 4K28A 1SJ9A 1MQAA 3F47A 1UAAA 1LXCA 3RG8A 3DLHA 1UK8A 1ZHHA 4PO1A 1PE0A 1EFHA 1V71A 4BV8A 1KY2A 4YAEA 1YS6A 4BFUA 4EI2A 3CZMA 4UFPA 1ZUD1 2BFCA 3FMVA 4MP8A 4YJ3F 2X0DA 4UMVA 5B53A 3C3DA 4ZQIA 5LFAA 5CCBA 1RBZA 2WF8A 4IVRA 1US8A 2J5RA 4M7RA 1XEWX 5FPYA 1DEHA 2OYSA 1MDBA 3G6WA 1HT2E 1F3OA 4ITUA 3QI2A 5LP6A 2NUPA 4X85A 4AROA 1U2EA 2OHGA 2I67A 3DGEC 3TO5A 3RVBA 4G0PA 1LNZA 3B38A 3N70A 4RDIA 5FWXA 4X64B 4OAQA 3ILHA 3UV3A 3VAAA 1XI2A 2D4AA 4DMGA 4QFDA 1I4TD 1R12A 4CR8A 2I3DA 3OM8A 3VH2A 3RW9A 1B8UA 1PCXA 1ZM2A 3DKRA 3K94A 3PU6A 4ZP1A 1TQ2A 3ES9A 2QLTA 3NMUF 3AKCA 2EJWA 3GRZA 3VGJA 4B4UA 4LXYA 2XCIA 1W1WA 3T1YB 2CHGA 3DL2A 4B80A 1PL0A 2HTEA 1PYDA 3TZLA 1KKLA 2WIKA 3ROXA 1C4WA 1PL7A 2XDAA 5AHXA 1M1YB 2EW1A 1YBHA 1AQYA 3TRDA 3RLFA 4Z4HA 1U0RA 2GUWA 1MD9A 1U8XX 4ZI7F 2V6IA 2VQ3A 4Q4LA 1XAIA 4KIJA 2FPSA 4Q1EA 1OXSC 2GN0A 2IIBA 4E4TA 1F2VA 2JIBA 3GDHA 1JT9A 3MT7A 1JAZA 5AKXA 3RVPA 1UM8A 5IZCA 3U3KA 1XNJA 4WFIA 3UAOA 1NVMB 4ZZ0A 1WDWB 2G0TA 2ZT8A 4CLDA 1GVNB 3G89A 2VPWA 4YLEA 3CMMA 5BV1A 1CUHA 3O84A 5CVDA 3TG2A 1JALA 4NXNB 2F1HA 2PKQO 1L1EA 2QL5A 1KU6A 5KAMA 3RSLA 4PC3A 3MUOA 2Q3EA 1YU6A 3GEGA 3NHFA 4WZAE 4OGGA 2HI0A 5L4NA 1COZA 1GJRA 2OUIA 1TJ5A 1L1RA 2BFOA 3KXPA 1E32A 4F45A 4A9AA 2C4MA 2DMRA 3PYMA 2MHCA 1VQ1A 1DAEA 1OTXA 5BR1A 2GK3A 2FA9A 5EJ4A 1BHO1 2RI6A 3HWWA 1DBVO 4JQSA 4X24A 3G88A 3HJFA 3FGZA 2A1TS 2RJOA 2A5JA 3FUCA 5F5NA 2OMEA 4EYQA 3AOEC 3N8IA 3ABZA 3D1JA 3AONB 4LJLA 1NNEA 2XXJA 1XCMA 4MDFA 2XMBA 3T4EA 4R1SA 4J7AA 4P4TA 3SZLA 3NXSA 3OZTA 1HQYE 3GLFA 4CEHB 5DRYA 2LGJA 2OHXA 4P9NA 3VM6A 4GX5A 2AG5A 2ON6A 2A5FA 3OJOA 4ZZ2A 4D9CA 1ZITA 3D59A 5CEEA 2R62A 3BJMA 4LYGA 5JAMA 1QP4A 5MGBA 5IP5A 3R9XA 2HU8A 4FEGA 4XOUA 1IE3A 1U99A 1B14A 5B1SA 2Q5HA 2PNJA 2P1RA 3RYFA 2BGJA 2P67A 3GYGA 4MXDA 1V5FA 5F5XA 4A92A 1GUFA 3LDGA 5ICGA 3JQRA 1I5RA 1WNFA 4UTXA 1Z3IX 2O8FB 1T8PA 4EA8A 4M21A 3WL5A 1BC5A 4ZTUB 3GU3A 1JQJC 4D0SA 2DFPA 4BXOB 5DK6A 1Q7EA 2HCTA 1DBIA 2C82A 2QAGB 4BRSA 4ZAWA 1JEQB 3BH7A 1JFVA 5LQAA 4BJ3A 4BRWA 1NW7A 4IX9A 4EGCB 4N5LA 3Q2KA 3LX6A 1T9KA 4E21A 2H92A 4X62B 2VCEA 1DC3A 1O94A 3QBJA 2VSFA 1S96A 1W4LA 2ZJ1A 5LA6B 3UF0A 4LE2A 2QN8A 4F2PA 3RK1A 4IGKA 3DEKA 5CVUA 5LZ2A 4KPUA 4OHRA 5DX0A 3W9YA 4J90A 1OPRA 3OX3A 5CT5A 3W3AA 3NWBA 4PFKA 4YJHB 3ZXUB 4FHCA 1OB2A 1TAGA 4G8CA 2QTAA 1ZI8A 1JRLA 4LDZA 1Z7BA 2Z6VA 5E1BA 3ZWOA 1NW3A 2WSIA 1V95A 3GEPA 4L3VA 4V3BA 4M1SA 2FKNA 3D6JA 3F3KA 3LY9A 4C3UA 4D26A 4TTQA 1XZMA 4Q12A 3UW1A 1B4DA 1NHWA 1OXXK 5JJ5A 1WZUA 3AFGA 1RS0A 3TBHA 1U6JA 3IDSA 1X1TA 3VUEA 4QXRA 4A27A 5CDGA 2UUCB 1V11A 6ABPA 1E4EA 4YP0A 1QKKA 1POXA 4EH1A 4ZT3A 1NUHA 3FTPA 5L4LA 4O2AB 4X20A 2NWQA 2QWXA 2H6EA 3DQZA 4M3NA 3VBEA 1FFGA 1QP0A 1QGED 1K7YA 2ZBQA 3SF0A 3AM1A 4RYLA 4ZD6A 1YK0A 4NCHA 4DY6A 2AMJA 1A5BB 2PMDA 4TL9A 4BZXA 3UMCA 1GAXA 2GAIA 2C2XA 2HMAA 4DA9A 1G8PA 2PSHA 3JD3A 1KPGA 5KOYA 2VP5A 5K6TA 4I3HA 3V8PA 5E38A 3DOOA 3BFKA 1SPBS 3C5HA 4R4JA 1V7PC 1NKVA 1U2TA 3FKSA 1X1SA 2H2FA 3KYDA 3P9YA 3ESXA 4QM6A 4EQ6A 2SKCA 3FCUB 1FTYA 1A8QA 1TEHA 3B12A 5FWAA 3ZNNA 5JZSA 3UT0A 4GPBA 1SCJA 1P0MA 3JYNA 1U98A 4LJ4A 5A5GA 3WLLA 5JZ9A 2ZGVA 3FNEA 1KSGA 3DAPA 4C0XA 1EUDA 4BY9E 1XD8A 1R5OA 5J4HA 1JQAA 3GJ8A 5KQSA 2I6XA 5AHKA 1ZJWA 3U4GA 2WYIA 4F3KA 4DLNA 2O07A 4IVQA 3Q2OA 4A23A 4AF6A 1SUAA 1APBA 2HK6A 3OU2A 2QRUA 1J8YF 2XQIA 4KXVA 3PDCA 3VDXA 1T9CA 2XCRB 4GGPA 3C24A 4DYVA 3MA0A 4ML3A 2E0IA 2B2CA 3HXMA 2BZGA 2JLSA 4IZHA 4PG5A 2AUNA 3T9AA 4YACA 1Z2PX 4QRDA 3F67A 2HSEA 5F76A 1DTSA 5BNFA 3AL2A 1TUBA 1CEXA 4YWJA 1NJ8A 2QROA 1ZD2P 4ZYYA 1W8IA 3JZFA 3KLOA 4CLOA 3WRXA 3KZMA 3TRIA 2BPOA 1XMSA 4GPIB 2G9QA 4H4CA 2W2VA 1A69A 3A4YA 1JZQA 4IHJA 5FBRB 3WNZA 3MM4A 5LJLA 2PD6A 4W5JA 1N77A 1ZICA 1J25A 1C9NA 2GPWA 3OSZA 4ZAZA 4ENUA 3OZDA 4HGZA 1VJRA 4X63A 5KSPA 4F9GA 2P2YA 2OBNA 3LGSA 2A9VA 5HBRA 3HJHA 1QHFA 1PP4A 1D6SA 3AQ4A 3ER8A 4LXHA 3GZNA 5ULLA 5TIIA 5PNTA 4WD3A 4NEQA 5EJ6A 5JZOA 1Z5OA 4BB5A 3H1EA 1QJCA 1WS6A 1Y3AA 4MV7A 4Z7NB 2BMEA 1RLIA 1XZLA 4JP8A 1FSGA 3ZE7A 4MEJA 3WSWA 1TCVA 4PO3X 2NU8A 5CA0B 5JTUA 4EFNA 2OORC 2GVNA 4BNVA 4WZAA 2YL2A 3H1BA 2DUJA 5BPFA 1SN7A 1DJQA 3QFSA 4XPIA 4BN4A 3ANNA 3QVLA 4LZAA 3WHIA 4IIHA 1OKKA 4H0FA 4Y2SA 4YGXB 3CKYA 3VZPA 3FOFC 5C4MA 4FE3A 3G7SA 1EX6A 3O9MA 4MLCA 3HDQA 3ZDXB 4C4PA 5JCOA 4R8SA 1NA5A 2XVXA 1AGYA 1L7RA 1N6IA 3I1YA 2QN9A 5THXA 1RMTA 3K16A 2D1QA 3QFHA 5DWQA 4ZC8A 2DVMA 3D02A 4F4IA 3ICCA 5LIRA 5JMTA 3D4NA 3ZS9A 1KTVA 3PC8A 3PTAA 1XA3A 1EA5A 3NRBA 3BH0A 5ESXA 5HIMA 2NYUA 1B6RA 3M89A 4YDRA 3JALA 3OY2A 2R97A 4MGEA 1Q21A 3DTVA 3UPDA 4CGYA 1NVVR 1GFIA 1SD5A 1JLHA 1U28C 2YFQA 4U6SA 2Z04A 1Y6GA 4FYVA 2XB9A 1IUOA 3FAZA 1QCYA 3UJDA 4YP5A 3LQRA 5LXTB 4PVDA 3IMGA 1XRQA 2J3DA 3JWHA 4RKYA 3S2YA 7ABPA 1KPIA 3VA7A 3PLNA 2H57A 4B6EA 4DJTA 2RGNA 3QTLA 4Z9BA 4TGLA 2KPOA 1I3MA 3U40A 2BN4A 4BJ5A 2IZZA 4J16C 3G2OA 4L2IB 4F9FA 4UASA 4MCJA 2CL7X 4BGVA 4RDHA 3NHKA 4ZU6X 4G0ZA 2FNAA 1HSZA 2Q1TA 5D84A 5DX8A 1EFAA 1SCIA 1AUOA 1NVGA 1Z34A 2WNSA 2Z09A 3C6BA 2X5KO 3BHNA 1CDDA 5F1YA 5H1YA 4EI9A 3VR6D 1FLDA 2X86A 4AMUA 2GVZC 3HEMA 3B7PA 3HUFA 4Z4GA 2XWSA 1Z45A 3CCFA 4GYKA 1NNUA 1XBTA 4PSUA 4WJZA 3H3FA 2B6NA 2P4HX 3MINB 1T8WA 3DWGA 3SLGA 4QAQA 2P78A 4MKFA 1UXJA 1MB9A 1SKBA 1T2FA 4D0NA 1GNSA 2AR7A 1B1AA 1E96A 1O95D 1T5BA 1XZQA 4G5XA 1C0KA 2IYQA 4KXFB 1A04A 5GGYA 4DNFA 2IOHA 3DBHB 4JEIA 1WMDA 2Z5FA 1STOA 3OE7D 4MSUA 3IAM1 1CJSA 5EHIA 1WSAA 1CJMA 2F4NA 1KI8A 2V8OA 3DAGA 4N7RA 4ODIA 4B2IA 4Z53A 5HKBA 2O5EA 3QP9A 1WQ1R 1LBTA 4WL0A 1H9CA 5CAEB 4BX0A 1R50A 3DT9A 4BZQA 4J03A 5H83A 1EZ1A 4UCXA 1E7RA 4W4TA 1K2VN 4RTMA 4U2KA 2E6UX 3E8XA 3EPKA 1RQPA 3N75A 5ICCA 2H8GA 1H6CA 3GLIB 2DR2A 2IPLA 3VXKA 4IKPA 4D8VA 3DHVA 2HA7A 3E22A 5CMLA 4MQUA 3OJEA 1HO3A 2XT9A 5DHQA 2WA2A 3AB7A 3RYHA 4CBVA 4Q9NA 2REXB 2IBTA 3RUAA 3TB6A 4BWGA 4MKGA 4YCMA 4IIXA 5A0TA 2Q0QA 5TSDA 2ZANA 4EY3A 2Q5LA 4LY3A 1SIBE 2ZRBA 3EZ6A 3LBFA 2SKEA 3AW9A 3LT2A 1C0LA 4MPPA 3TKLA 3VPHA 4AG5A 4KSCA 1ILEA 3O9VA 1RKUA 3DKIA 2ECPA 3DLBA 2R7NA 3IAXA 1ZAYA 4J0DA 3AF4A 1J2RA 1N6KA 4KCGA 1G8HA 4NBVA 1MJGM 3FNQA 3RWOA 4UBKA 3T5PA 4B82A 3ULKA 4HEJA 2ZYVX 1V6AA 1BQ4A 1SC4A 2DHDA 3KDPA 4KXLA 4XSHA 1QYRA 3R8XA 3WO1A 3EQ9A 4KLCA 2PLWA 3VU9A 3KSAC 4DCTA 3AM4A 3E2IA 1H5QA 1IONA 1IZ7A 4XWYA 5K3DA 3A6GA 2SHKA 3Q6NA 3QI7A 4BZZA 3WJ2A 5KNLA 1B8NA 1U7PA 2HIHA 2R60A 3LC2O 2XD4A 4IOJA 3QEOA 5CP8A 2QTZA 2P6MA 3WFZA 1HDEA 1M6NA 4LF8B 3OFNA 4RXMA 2YINC 2C96A 3N8KA 1QO0D 1XQ6A 2PWZA 4BVBA 4DUPA 3KT8A 4RY9A 1O97D 3HV0A 3FNHA 4GR4A 5I7EA 5KX5B 4IG9A 2QVCA 2PZFA 1J2YA 1RADA 1WW8A 1Y8AA 4GLBA 4M1QA 4RELA 4XAQA 4AZ3A 4BMXA 5A9SB 1XCJA 4NU8X 4Z0HO 4ETIA 2ZRJA 3EDQA 3M6MD 5IMSA 2OZLB 3EGXB 4FYYA 3U3DA 2OD2A 5SY6A 3QFCA 4YUXA 2IJGX 1E2GA 1E79A 1R5NA 1ZUHA 3UYLA 2YVQA 2DBVO 1LBQA 3JYOA 1TFUA 4C0LA 4Y6SA 5ANRB 2X9QA 5BSHA 4M22A 2VYNA 5DTMA 4R8VA 3QIAA 2OGSA 4MUGA 3DZFA 4AO7A 5E9QA 3VO8A 1F2TB 1G0NA 5HYVA 3HSYA 3V97A 2QBYB 3LBIA 1NXTA 1P2FA 2A0XA 1DG3A 2VPXA 3A1TA 2JZOA 3JPYA 3I76A 3KWFA 2OCDA 3LHDA 2Q5EA 4KDEA 4AQDA 3AVTA 4BNIA 5FPKA 2GFQA 2P0YA 3WGLA 4EGSA 2YY6A 1PWZA 4KXNA 1I1NA 1H22A 1QORA 3VZRA 2CXPA 4YRAA 1NNI1 2GZ2A 1EMDA 1TTPB 3IOBA 3L5OA 5K51A 4L08A 1T6ZA 2IU6A 1LZLA 3PGXA 4Q93A 5A7FA 3B36A 1GL9B 2A3RA 2QX6A 3HO8A 5F52A 2ZQZA 1W5BA 4F3NA 3CT4A 1EK2A 4IOLA 5KINB 1E2BA 2O8BA 4Q15A 4ZANA 1IZ9A 2CL0X 4QOSA 2NPFA 1K98A 1ORHA 1TQDA 3F8TA 1GTG1 1N57A 1FRNA 3CINA 3NWOA 2OQVA 2CE2X 3AGPA 4DWOA 1PJ3A 4M6WB 1E2HA 2Q45A 2W2PA 4S1PA 2G1AA 5F51A 1J09A 1E2DA 3OZWA 3W2GA 1X7DA 1W5SA 1LVHA 2QY6A 4JJAA 2AI2A 1RP7A 1S7GA 2QX8A 3NGMA 5A7HA 2VYVD 5GJCA 2B98A 1ADYA 3QBVA 5FNVB 2B1RA 2FN8A 3GD5A 2G25A 3TL3A 1Y5RA 3QYFA 4LWPA 5A5EA 1MABB 4N6OA 4ZHQF 1RFLA 3WLTA 2JIRA 1A7UA 4YTEA 4E2WA 4HSEA 6CHYA 3L8HA 5K03A 3H87A 3ICWA 1ISSA 1DFHA 4IUBS 2JH3A 3GA0A 3WA7A 2PUEA 4XASA 2I2FA 2BEVA 1JQ5A 2ZIFA 4KQEA 5GOZA 1XC7A 3OC6A 3UHPA 1PTJC 1SY7A 4BOYA 3DOUA 3TSWA 2C61A 1NP7A 3MPOA 4CUJA 3AUAA 1LK0A 4DLTA 1B16A 3RYIA 3MMZA 1F9EA 3QELB 4EB6B 3DONA 5AXAA 3N76A 5A71A 2FW8A 3EEIA 4ZC1A 2DKFA 2H1SA 3X1ZA 2FP4B 3C8MA 2IF0A 2K2QB 4BE9A 1G60A 1SQ5A 1GZSA 3AHDA 4N9QA 2KX7A 5GM2A 1PR9A 2OCGA 1KDRA 5BURA 3TLBA 4OKNA 2ACWA 2ISSD 2XADA 4MPRA 4EELA 4JJGA 4C4YA 1JA9A 3HKCA 4TMXA 3TD9A 3K1ZA 1RYEA 4W7HA 5CVTA 3HN2A 1W85A 3MGBA 1X8LA 2WF7A 4PLZA 1HEUA 2J9GA 1F14A 3RYCB 4MJLA 4G37A 1CRLA 5TEWA 4K9SA 2XB2A 3HCCA 5D8DA 5FBWB 3WIEA 1Y34E 2H4HA 2PZEA 2QJTA 1X9GA 4POOA 1Z8NA 1LY1A 3P94A 2O5CA 3LZDA 1NG1A 1M1ZA 2Y0BA 4EHDA 3NBKA 3TQRA 5C0OE 3RS7A 2YN4A 3IPYA 2QQFA 3IMKA 1GL7A 5IU6A 3CVYA 1FE8A 1L2TA 3W5UA 3MT8A 5LPNA 4I2VA 3FH0A 2HRCA 1THMA 3P9QA 2O6LA 4MQ6A 4YAJA 4U3JA 3ZV5A 2JLUA 3O3NB 2NUBA 1AS3A 1BVYF 1KO1A 2AFIB 3QKTA 3M82A 2KB0A 2WVAA 3D8TA 3DC2A 4KMMA 4MB6A 3ESZA 1HYHA 1FNDA 4LXXA 5TY0A 3WWPA 4YCSA 5HHTA 2OENG 2IY7A 1QIKA 1ST3A 5CBPB 2DEUA 4B6JA 2Q2NA 2G9UA 2OSVA 2FQXA 2XAAA 5TGTA 4CYMA 1OVMA 2IKSA 3RANA 1KYTA 5TV2A 3GJ6A 3FYTA 3HRKA 4X6UA 4BLWA 4CXMA 1XMJA 5DBIA 3TAHA 3KQKA 2A9RA 3L06A 1JFFB 2RH8A 2REQB 3GX1A 3MAGA 2VHUA 4ISCA 4PC2A 4QO7A 1KDVA 3ZLBA 4K9RA 1GZHB 2I65A 3L8ZA 3PX3A 3R3HA 4XWOA 2IH4A 4TMWA 1N1EA 2QMZA 1EQ2A 4HVCA 2V97A 1RACA 3V7FA 3V9PA 2MJLA 1KZHA 5TF4A 1L5GB 5JVDF 4HJXA 4E7OA 3M6VA 1OX6A 1P9OA 3A11A 2W6ID 2YXNA 5AI4A 2IHYA 4E5MA 1LPSA 3RRZA 4ZI7A 1H3FA 1OIVA 4E4YA 1ZG3A 3W04A 2XCLA 2BEKA 4BMCA 3M9LA 4W9RA 2VRBA 4DT1A 3BMNB 5BOSA 2CUNA 3AEQA 2O1XA 3I83A 2JEYA 1CT9A 2D74A 3OWXA 2HC9A 2HCFA 2JASA 3JVEA 4I4TB 1N5KA 3HZOA 4FZJA 2A2ZA 4JVMA 2JEOA 2NO0A 3WLRA 1VE7A 3MMXA 5C1BA 3QU9A 3ZDQA 1SXIA 1UM9A 4MOWA 4XOIA 1M5RA 3RTCA 4MAFA 3SHVA 4OSOA 1H8HA 3PC3A 2NZYA 4CLXA 2H1IA 4LYDA 1G20B 2VRNA 3LW7A 2C00A 2OBYA 3PHHA 2JZCA 4BN0A 5JARA 5A4MS 1SBHA 2J5QA 2AJTA 3GPCA 4TXJA 4XR9A 5DM4A 4MUJA 1CB7A 2V4MA 3UV6A 4RK4A 4IIEA 3KJFA 3C7KA 1HSOA 2XKAA 1PJRA 4DL9A 5JNTA 1R0SA 2O0LA 5FHQA 3BWVA 1PUJA 2WP0A 3DNFA 2YIVX 1B6SA 3CCCA 2P1DA 3JQ9C 5U1PA 3A06A 4WNYA 2XZPA 3FDZB 5BWMA 3WFIA 1U5CA 2PQ6A 3DULA 4FOTA 3U4DA 2RGGA 2DWUA 2VP3A 1K8XB 3BGWA 4IQGA 4PGGA 3IT3A 3QGMA 1U7TA 4BBJA 1B23P 1QTNA 1P0PA 3F97A 4YIHA 1MVNA 3GDFA 2IZ6A 3PKJA 4FNGA 2VO1A 3RFCA 1O6CA 2YXPX 4DAOA 3GQVA 2VT6A 1YMQA 3TEJA 3CVUA 1FDOA 4C0SA 4FMCF 2Y1LA 3D6TB 2JFPA 3I0ZA 3LG2A 2QD3A 3RUFA 4PZ9A 4KQJA 3EH2A 4QULA 3KHUA 4JS0A 1EFUA 1JF8A 3QMMA 4EWLA 4FJ0A 2I2BA 1ATZA 3R7WB 1G42A 2QGFA 4QXAA 5KYUA 4OUDA 1KQNA 2D06A 1PZGA 3QOFA 4U4AA 4C9BA 1CF2O 1VL2A 4NEGA 1ZCAA 4ZXFA 2P3LA 4B40A 2ONYA 3GPDG 4ABYA 1HI9A 4I9NA 4RD1A 4BMPB 4BEJA 5K3CA 2OPBA 1M0SA 4M1ZA 1LNQA 3OWOA 1JH9A 3EQ8A 3EA4A 4QT4A 5J3JA 1KO5A 3FVWA 3PC7A 4UQLA 2ECFA 1IK4A 1SCAA 2LPMA 3Q12A 1GTRA 4DM4A 4F4FA 1VKZA 4Q3KA 5GM1A 3SBOA 1L5HA 3RASA 3TLMA 2E5FA 5F21A 1KJJA 2IYAA 4L9WA 4YAKA 3HCBA 3HQ4O 4OG2A 3OOYA 3L79A 2Z08A 3HCEA 4E15A 1DARA 1U1EA 1YJBA 4ESEA 2GOYA 4G4SP 4IIGA 5D1NA 1RXYA 2IKQA 3FZNA 3T12A 4BKUA 5BXYA 1NLUA 2UUAB 3R6TA 5BYBA 2G83A 5F2NA 1N8NA 3WIDA 2WUEA 3M81A 5JATA 1JEOA 2W2QA 3KYCB 3PFCA 2ATEA 3NT4A 3PNSA 4N12A 3UAXA 5F12A 3ZWMA 4D9FA 3E9YA 3T5TA 2WYUA 4CF5A 2PJRA 2J3KA 3L4KA 5F1KA 1ZN9A 3A28A 5IKMA 1THGA 4IYJA 3IELA 4ROTA 3OOWA 1A9SA 2WICA 1S3FA 2PLFA 1KEWA 3JQAD 4LWZA 3M3DA 3KZKA 4YCNA 1GV0A 3KHKA 2ZS9A 2VJPA 1PGJA 3KM0A 2CK3A 4QFCA 1KC3A 3IUEA 1PYOA 2O1SA 1H8EA 1S1CA 2GDZA 3P2OA 4NWIA 4Y0VA 5HS4A 3MJFA 9GPBA 2W2LD 2E4XA 1KYXA 5DKFA 3N8GA 1C3OA 1TFRA 4X7MA 3OH8A 2QS9A 4OA5A 2G5GX 1ZOIA 1M2JA 1IN1A 4PGHA 3RJ9A 4K86A 1T9GR 4HUTA 3M6AA 5JANA 2NP7A 621PA 1JSCA 1SXJD 1PZEA 3K1AB 1QNFA 2Y76A 2FW1A 1Y1QA 4J4HA 2J3EA 4RZSA 2CCGA 1ZN2A 3BZUA 3WSTA 3ER9A 5F7XA 1XMIA 5JPCA 1RLJA 3U39A 2NLOA 4PSVA 1NMSA 4YV7A 2FSVA 3ND7A 2RB5A 3X44A 2PX8A 4QGAA 2V9PA 3LH5A 4B0PA 2WIAA 2Q2QA 3HB5X 1Z0KA 5ALEA 5ILGA 3D8RA 2UV8A 5IFKA 1C8KA 3IJRA 4OHPA 5J23A 2C2YA 2F1JA 1QV7A 3O8QA 2ORYA 4DIOA 4OAPA 4CM5A 3GPLA 4M7OA 1RLMA 4MHSA 3V4OA 1M34E 3EDRA 4YC7A 5L95A 3EXEA 4HN9A 2P75A 4QXQA 3WRYA 3KETA 2OQRA 3FTQA 1SOWA 2PFKA 3WG9A 2HF8A 2H07A 2X0FA 3FAKA 5F5LA 5IM5A 1LLQA 2VG8A 4DTCA 3P2JA 3D5EA 4PIPA 4KMOA 4N3CA 2PQ2A 2W83A 5IAOA 5KYWB 2PLAA 1CD5A 1MNQA 1AZLA 1T3LA 4TLMB 4BNFA 6REQA 1KK1A 2HJHA 2IEGA 2FY8A 4CR6A 1BXGB 5FOUA 3O8LA 3FJ1A 5JCJD 2EZUA 2EX1A 3IAAA 4OVKA 5FH9A 4EKNB 1IUNA 1CP2A 1JAHA 4KLRA 3AY7A 2VKTA 1XQ1A 3OECA 3JD4A 2CL6X 2YNMC 2J7PA 3EEYA 3OMWA 2VLIA 4NBSA 1RJ9A 2XEDA 2AHOA 1M6WA 5D6NA 4CIAA 5JAIA 3CNLA 4KYVA 3H2HA 5GJWC 1M7BA 1ESZA 3R9XB 4OMUA 4JK3A 3E35A 4Q4JB 2BFBA 2VKQA 1FFEA 3I28A 3CLHA 1K08A 2XLBA 4MW1A 4KWEA 1WHTB 1CF9A 1SXQA 2VDUE 3PPIA 4WK2B 1JIQA 4UDYX 4J94A 4YAWA 3QK7A 4L95C 3KJEA 4LRSB 1N33B 3RREA 5AHRA 3RI3A 4B8WA 1HYQA 1YRBA 1GSAA 5CT9A 1V8FA 2V3CC 1NYRA 2UYCA 1T36A 4WXRA 3TLJA 2P5YA 1YACA 2OWEA 3C43A 4UE3S 1WBBA 5FBKA 5EE1A 3ADBA 1PLJA 1QDUA 4XUCA 2JLRA 1YOVB 3HVJA 4XJTA 2DC1A 1IZZA 4CCYA 3W6PA 3CPSA 1Z36A 1U3GA 1ZVQA 2H0AA 3BTUA 1P2VA 4TLLB 3SYNA 1IMOA 1IBCA 3DTYA 1EESA 3JZMA 4EPRA 2W0MA 1B7GO 2MSEB 1CRPA 3JQBA 5BWNA 1E6LA 1TF2A 2NU9A 3DPUA 3JWPA 4MINA 4R3WA 2I4OA 3FF1A 1D8AA 3L0BA 1V5GA 4OJMX 4X1IA 3ZNQA 4A0RA 1BS2A 1DL5A 1SZJG 3HXKA 4W6ZA 1CUAA 4C3OB 3J81A 2HCJB 2WIFA 2ZUFA 1GUYA 1PX2A 2HFJA 1XZDA 1WV1A 1LA2A 3H3XA 2WU4A 2Y6VA 5H9VA 1CPYA 2A35A 2GA8A 2B21A 2PPVA 2Z2XA 1QR2A 2ZBFA 3OE1A 3QPWA 3LUAA 1UQUA 2PGJA 3SOPA 3P9KA 1VJCA 3FUXA 1N2OA 1R88A 2D3TA 3C5EA 2PX5A 5REQB 5GADl 2W6JA 3I5XA 1UAYA 2QN2A 1A0OA 3ETCA 2GKSA 2DKNA 3AF0A 3G0IA 3R3XA 2GPAA 2J9YB 3WV4A 4BV2A 1LQ2A 1YI1A 1XEAA 1BU8A 3PE3A 4ZI3A 3IDZA 3PWSA 4G85A 2ERCA 5CNKA 3UGTA 4X65B 4IF4A 5JSYA 1P2GA 2H2HA 4J0EA 3F8WA 4OI1A 4C3VA 3NT5A 2DGDA 1YHNA 2QLLA 4RS4A 4MW4A 2FPIA 2DY1A 1PEAA 3N5CA 4IJUA 4BLTA 1P72A 4WKPA 2W58A 3O3CA 4PAMA 4B6PA 1IY0A 4ZVUA 2O4UX 3LCRA 4R51A 3F2IA 2AG6A 4KVZA 1I3NA 2RFLA 2WG1A 4GVPA 1I80A 4BQIA 1Q1GA 2BTEA 3VYVA 1MGOA 1SUSA 3VR4D 2F3PA 2CHVA 1E3MA 1NI4A 1SC9A 1L4EA 1Z2CA 2J33A 1Z4KA 1R5BA 3KYDB 3OJCA 3FLMA 5TPZA 3P1JA 3V8BA 4JC0A 1GQQA 3HVKA 3SSNA 4RTNA 3KRTA 3RAEC 4N1AA 3T3MB 3T9EA 1H2RS 2R8EA 1RBYA 4GRAA 3Q3CA 1C7FA 3EULA 1HX7A 1EUDB 1J9ZA 1W0KA 4H6PA 5DCYA 5IKPA 3IKJA 4M98A 4DSZA 5ER6A 1XZEA 1ZK3A 5CEFA 3NVDA 5EMLA 3AZPA 1CEQA 1KI4A 3NEAA 3PCXA 1VHLA 4G0OA 2B0CA 1RU3A 2XMRA 4AJ1A 2ZRKA 2V7XA 5ALRA 2XNSA 1U1GA 1C50A 3GLHA 3ELBA 3AM5A 1UPTA 2WJHA 5LZ7A 5J2TB 5EVCA 2OLKA 5CH8A 3A3YA 2ODAA 3E70C 2C9YA 3AHJA 3KR0A 2XMQA 4MB2A 4R9VA 1FJGB 4AJHA 2D2EA 1WMSA 2UAGA 1MC5A 4R01A 4CLOB 5LQDA 3G13A 4BFCA 1AJEA 4O4LF 4W9NC 4E2FA 5BPHA 3KOOA 3REFA 3IMCA 5EMNA 4C2BA 2WT4A 1D6MA 1NLFA 5HTOA 2EBFX 3H5TA 2W48A 4JOCA 2OXCA 4JIGA 4U6QA 1GDTA 1L8XA 1EGVB 3P45A 2OHJA 3UJCA 5J1SB 1BHSA 1Q15A 4RIFA 1M83A 1U4NA 1X39A 2HDHA 3B53X 1UXIA 1KEPA 3JR7A 1N5IA 2OQIA 5FULA 4E09A 4EHKA 5AUNB 4DC9A 3ZC3A 2XTNA 4PLVA 4RIIA 4F92B 5BN5A 3X2SA 4DV3B 4KHPB 1OX4B 3GDGA 3A1VA 3JQFC 4IQFA 2E87A 1GKIA 3P71T 3FWPA 3ROFA 3W2EA 5IJAA 1HZJA 1NUTA 3PXDA 3DDSA 1JQKA 4WZAB 1OGIA 3OMLA 4ARCA 1GG5A 4MYSA 1YSCA 4XPIB 3ZU5A 4CEIA 3QLVA 1M34A 3AEUB 2E21A 4J75A 2WG0A 5SICE 2CV2A 1FIUA 1C1YA 3ESDA 4C7KA 5K3EA 4H17A 3WGIA 3TJMA 5JJKA 1PR6A 2ONKA 4D8TA 4PYNA 4JUIA 3C85A 2YQ4A 1E5LA 4P98A 1ANKA 2BKAA 1NBMA 4RIGA 3IIKA 3FYUC 3OVMA 1E2QA 3TZHA 5JI3E 2JKZA 2II6A 3F3SA 3A2NA 3DMDA 2O2CA 3DZKA 4HRVA 2BONA 2BUCA 4ILKA 1KFJB 1YI8A 2OXIA 1Y37A 1SOUA 3HY3A 5EG5A 3SDSA 2IYTA 2C3MA 1K92A 1EWTA 2ZYSA 4QPPA 4FCCA 4RA6B 5C37A 1YQEA 5HPYB 1MQSA 1U7DA 3V4FA 5CEJA 6NULA 1GCOA 2WYVA 4XRRA 5JISA 3A4LA 4LHSA 4CEJA 1F6DA 1TIPA 2J67A 5BW6B 2IX9A 3SR3A 4ARAA 5FOVA 2WE8A 2BR5A 1Z5WA 3T34A 5IXYA 2ACKA 3FD8A 4EI8A 2DBZA 1GFWA 2FXVA 1JHOA 3VVCA 1UDBA 1E1LA 2DWPA 3OM0A 3PXAA 2PUFA 4DG5A 4Q37A 5IWCA 1AF7A 3OTQA 1R0CA 2OZEA 3TGWA 2FQWA 4WXYB 3B6ZA 5DLYA 1GSOA 3RSSA 1MDFA 1GGKA 1ZWLA 5CIYA 2ID8A 3R7NA 1YBVA 1YUBA 3OT5A 5BWLA 1ZH8A 1GFSA 1K4YA 2CYCA 4MWEA 2F67A 2I7XA 2JH8A 3K2QA 5I9SA 1QB8A 1YJ5A 3BBPA 4E0BA 3EDOA 2OXRA 3N6RA 3VTZA 5DGXA 1X7ZA 1FSFA 5EINA 1DADA 3GO4A 1SVOA 2P9ZA 1ZJ5A 4NJEA 1RXUA 3CUUA 1QUFA 3GPBA 4N0DA 3LOPA 3SLKA 2JGRA 3AHEA 5CFNA 4CMHA 3IP5A 2B4KA 2DG2A 3A05A 4U9UA 2JC3A 5L40A 2HW8A 4JJ6A 1PJCA 2NV2B 3AGQA 2PBZA 1YONA 1KEKA 1IOWA 2XW6A 1RKXA 2HQBA 3F6RA 3G2MA 5LJIA 3RFVA 1SKMA 4EVQA 4ZU1X 2HU5A 4L28A 1UBMS 2B4QA 3PWKA 4RTJA 3NDJA 5CVVA 2LNDA 4BO5A 3IO3A 1AGPA 1BCSB 1KS9A 4AECA 1MVLA 3INGA 1CETA 4KIFA 1OBFO 3I8SA 2OYRA 3MHPA 4EL0A 4HFMA 3K9NA 4OI4A 1XN1A 1X8XA 2P9EA 4RFSB 3RYHB 4UTNA 4Z7OB 4RQUA 4DY4A 1O58A 4WQMA 2VQDA 2R8BA 1V45E 1UAGA 4AMZA 1QQ7A 2JAXA 3CUSA 2GZ1A 5I8ZA 3UFXA 1QH8A 3I62A 1J49A 5I7WA 3PC4A 1NFQA 4L3OA 4PN3A 3KTAB 3WRVA 4FQ8A 1WBDA 3OF2A 3TXAA 3PBKA 3B5JA 1IJEA 1W4CA 1HEYA 3B48A 2KHZA 4OGFA 2I03A 4M9CA 3K05A 1WV0A 2PU7A 5DB4A 3JVVA 3R3WA 2GBLA 3Q9UA 3GA7A 3N7AA 4MMZB 3ZR4B 3ZY5A 2QM8A 1RM0A 3FWKA 5K0FA 4B7UA 3WMEA 4CMIA 4RVDA 3BWCA 4MR9A 1XEXB 3IUMA 2JFGA 3OQ1A 1SUFA 2I0FA 4YRQA 2IEBA 4GP6A 4NQZA 2JLBA 5ALTA 3L84A 1MZVA 2C3YA 2W43A 1PJLA 1VCNA 3M83A 2P4QA 1K6MA 3FWZA 3GFOA 1PG0A 2Y1FA 1I1OA 1QGYA 1KDOA 4V03A 2RDMA 3JQ7B 3C16C 1R3DA 5A9RA 2GCNA 1YR2A 2O0KA 4IH4A 4Q7EA 4ZOCA 1G8FA 4P36A 4DPLA 5HFAA 1Z0JA 4L57A 3ADKA 1CRQA 4HO1X 1ZCBA 1CY7A 4P0PB 3KE8A 4TMKA 4Z6KA 4DKXA 4G6ZA 1R15A 3VDRA 3OC0A 4P5EA 4Y1GA 4NBUA 2Y1EA 4KR7A 3ZWDA 3LCMA 3JQDA 3D0OA 4RVGA 1KAQA 2Q3MA 1E2MA 1GZ4A 3FIJA 2ISQA 5FOQA 2R85A 2JD0A 2PSDA 2H2IA 2WSLA 2VNSA 1DUSA 1PHPA 1XYGA 1EK5A 3ND6A 4JDUA 2O7RA 3RC1A 4PCLA 3TW6A 5IASA 3A6JA 1JHQA 4AJ2A 1RZ3A 1PTKA 2ZREA 4EW3A 2AR9A 4IIVA 2VTKA 1IN8A 4PC7A 3RK4A 6AT1A 3D64A 2GERA 4AKHA 1YB5A 3GQBB 3OAAA 3NP7A 3CPHA 3EN0A 2VH2A 1Z88A 4AS3A 3PUWA 5KHOC 5JVDA 1UDAA 4P4GA 1QHXA 1NOKA 3LZ6A 2QUJA 4QWMA 1NWHA 3DMYA 1ZOSA 3LUKA 3O21A 1E20A 1SG6A 2FWBA 1QSGA 2QIOA 2VYFA 3B9QA 3PVZA 4YHBA 3TMAA 2RAPA 2H08A 5EIBC 5IJ9A 1ACMA 3HYRA 2O8BB 1Q3KA 1WSBA 2SNIE 2X8JA 2JGAA 3QUAA 2O3RA 3DMNA 8GPBA 3N07A 1BKYA 1BMFA 1QNLA 4CETA 1UXGA 4BNMA 2RMKA 2WTEA 1MW9X 1VMIA 4KUEA 5AK4A 4C4ZA 3GCZA 4D0LB 1ZDMA 4IH9A 2JIOA 1K6JA 3ZD6A 4JROA 3PHBE 2AN4A 3GZ4A 3MW8A 4R2JA 3ORHA 2JK0A 4MR7B 3HM9A 3K0KA 1LJLA 4JJIA 1GAQA 2OP0A 1AIPA 2ZRHA 3ECCA 3EGWA 3TCNA 3K0FB 4EO4A 1NQAO 5JNUA 2IYEA 2JGMA 5CJ2A 3J81k 1HNWB 4FFNA 3GI1A 2ZRFA 1G3RA 1GZ6A 1S2IA 3OD1A 1H6BA 1YASA 2NSJA 3DE2X 3HB1A 4O0LA 3A4MA 3VR2A 1Z83A 1WQ3A 4G67A 3CZCA 1MC8A 3UEOA 2ZP1A 2IDJA 1UKEA 1VRWA 1KDZA 5C7OO 3LNCA 4AG3A 2O5VA 3WWCA 4QUKA 1YZTA 3FMPB 3ITEA 4RY2A 1HOTA 4R1QA 3DEIA 5JJLA 2JFXA 1KSJA 1QO9A 4L27A 3R7SA 1DEOA 1L5OA 3R8CA 1MEEA 4ASUD 3UPTA 4X61A 3RYIB 4RJLA 1MQ9A 1RKQA 1MBZA 1Z2OX 2SECE 3HNOA 1IB0A 1BH2A 2WI8A 3CCBA 4UKDA 3L1JA 5FUXA 3ZG6A 2JVJA 3E3MA 3MAJA 1K5HA 3S44A 3MSCA 3A6PC 2B1QA 4Y98A 5DHUA 2CNKA 2BM1A 3KZOA 4RZUA 4G9EA 3JASB 1J0DA 3QXSA 1EIWA 3R3YA 2FOXA 2LP4Y 2IH2A 2GCGA 2RJ3A 1JSRA 1I33A 1QV6A 1ZL2A 2BEUA 2Y9PB 3NGXA 4QHTA 4UVDA 4ZVMA 3UHFA 2B7LA 3GAZA 3FPLA 4QEZA 3SWWA 2HRZA 5DMHA 4L0QA 3HKCB 1DXHA 1A5AB 1R37A 4U00A 1BEZA 1DKOA 3IE2A 3WLPA 3OETA 3KXKA 5BUQA 3WGYA 2IK8A 1R9NA 4ZV7A 2V5AA 3ZH9B 3I61A 5KPJA 1DAFA 3PJRA 4WLVA 2R96A 2ZLBA 4PYRA 5AUQA 4DXDA 4TWIA 1EQAA 4EHJA 3AYZB 4PTZA 3O82A 1FUIA 3OY7A 1N5MA 4QQNA 2ZITA 3C8HA 4R9UC 5HILA 4ACBA 4CM9A 4JXZA 5G4KB 2JFBA 3C7AA 4R1LA 4ZAVA 4CRWB 2O8NA 4DLZA 2BI8A 3AUSA 4YVFA 3BRQA 3SJ7A 2VPYA 2QN3A 3JQEA 3EZGA 2BBTA 2CMHA 3AUFA 3EXHA 1F51E 2FMFA 3Q7EA 2WD8A 1T8UA 4PICA 2YRFA 2EX0A 3BRWD 4EFKA 3TM5A 2ZUWA 3K35A 3BE4A 1M73E 2XWJI 2XYQA 4IRMA 1RJFA 1K0FA 4L8FA 1TQ4A 4GOXA 5FIUA 3UAWA 3IOEA 1ZXBA 3PQ5A 1G291 4REQB 2ZT7A 5L7YA 3PFBA 5BSVA 4JB0A 5FPHA 4X9XA 2EXXA 1XAHA 1ZS9A 3NI2A 4LDNA 2QZZA 5DLEA 4KQ6A 2HU2A 2Q4BA 5IT4A 2PJDA 2H16A 4XSVA 1QH1A 2I66A 3AR5A 1EWQA 2NSLA 4X8HA 4AF7A 5ITWA 3CR8A 5BWBA 3HO1A 4EYOA 2RAFA 3CEHA 1V4VA 3NYIA 3I32A 3R5XA 2HMTA 1Z5ZA 2YMQA 1H2BA 3GVPA 2BZ0A 3GLKA 4GI2A 4Q21A 1KMHA 1T9ZA 1XUOA 4ZDWA 2Q29A 3WYFA 4DV5B 3GELA 1XVLA 4M87A 3OI7A 1SU8A 2VUUA 2DUUA 2ID9A 3SHOA 5DULA 1G8MA 1J6UA 4K9QA 4DT1B 1SUEA 5JQGB 5KEIA 2R7MA 1NX9A 3AEQB 1P2TA 3DHYA 4M1KA 1WSWA 3O3MB 2A3NA 1IZ8A 1LWNA 3NONA 1DU4A 3HEAA 4Q7KA 4UVIA 1EX1A 2ZCUA 4FDAA 2QTBA 4QOEA 3ZHVA 1IBKB 3L7MA 2FSUA 3V6MA 2V5VA 1TEZA 1UM9B 2HD4A 2ATVA 3LHFA 2MYPA 2GJKA 3OIGA 2D5LA 1DTWB 1VL8A 2LV8A 3HY6A 1N0HA 1YB6A 4H2DA 3TDNA 2IQIA 3EQZA 2YN0A 4EBBA 3AVYA 5K0EA 3SVLA 2Q9CA 1JDSA 1N2IA 3H19A 1E62A 2R84A 5HRAA 2A1UB 3B9RA 2IL1A 2VXBA 4X8LA 2DUWA 3I58A 4M1YA 4AN1A 2ZT6A 3WTCA 1K1EA 3E9MA 4LZJA 4P35A 4G5QA 4NC9A 5B6PA 3ZDCA 1GZUA 3I01A 5CDTA 4CMEA 1JDZA 1O7JA 4DUGD 3HZHA 1GNRA 1IQPA 1FPMA 2IODA 3G2KA 4F8YA 2XR1A 3QG5A 5IDXA 1WXQA 3HU2A 4MW7A 5B36A 5AUOB 3UWOA 2GO1A 3F5FA 1D5CA 1GP2A 2FMTA 1RRFA 2BGNA 3A1FA 4TTVA 1VFPA 5FCDA 5H81A 4AMGA 8ATCA 3IURA 1QRUA 1DJPA 4HOYA 4LOJA 5K1ZA 4D97A 1XDDA 2UU9B 2Z2KA 4I6JA 2PMFA 1CDEA 1LNSA 1U1IA 3ICVA 3ZJYA 3NR2A 4JASB 1T4CB 1U0HC 5AYVA 2ACVA 5K20A 1IY8A 1UKYA 1M2NA 3U13A 3AUKA 3VHQA 3QWBA 1KJZA 5K4AA 4D0GA 4YUWA 7GPBA 5KYUB 5K0BA 2IHUA 1LGYA 2O9JA 5CLGA 1DXYA 1ECBA 4URWR 3VPCA 3HBAA 1EJ0A 1V2GA 5E7MA 4LBWA 1A5SB 1XVAA 5FORA 3U3RA 4DCNA 8AT1A 2FZCA 3EIEA 5BYJA 3M5WA 1MO6A 4HH1A 4LSWA 5FL3A 1JR6A 2X4IA 3FCAA 2EF0A 16PKA 1PLLA 1UOPA 2NTYC 3DG9A 4XXHA 3U3OA 4BFWA 4CHGA 1WKCA 4DC0A 4BAUA 5A6SA 2Q8QA 4XD2A 3VBCA 1K27A 1L5SA 1II9A 4J0CA 1Z16A 1XD2A 3URKA 4AZVA 1MX3A 1OFIA 2RCNA 2J6IA 1E8MA 2GD2A 2MSCB 1SHZA 1YQXA 3H99A 2GPYA 4DC1A 1K7XB 2I8CA 1L5HB 4JUDX 4RBNA 3ZCXA 3KO8A 4DLPA 1WTAA 2DCUA 5ENZA 3T0GA 1XCOA 1EP9A 3BL5A 4LHXA 3D5TA 2OXTA 1EK0A 3UT6A 1IIRA 1XSEA 3KQWA 1M2FA 3LVQE 4MV8A 4B79A 4BJ1A 1JJVA 5T67A 4KJZA 4XUGB 5KTKA 3GFBA 4MW6A 4RTLA 4YUYA 4B85A 2JI6A 2Z6AA 2CLEB 1QE0A 3VV2A 1NDQA 4RKRA 4EUKA 3LLMA 1N2BA 4DDUA 4QDOA 2XSZA 3SC6A 1YV9A 3H6KA 3UUEA 4I4IA 3KOYA 2I33A 3ENKA 5DHRA 2NTVA 3G1WA 1AHPA 1ZD8A 4L4YA 1PFQA 1Y5MA 2H4ZA 5K0TA 1C9DB 2LE0A 3ET4A 4MV6A 1IEWA 1XU7A 2GNPA 3KYJB 3ND5A 1Q95A 1YVRA 1Q84A 4OHKA 2VZ8A 1BTOA 3HDJA 3N05A 4IVNA 2G9VA 3AHIA 2P9QA 1C3OB 2ZIWB 3WE7A 4UZSA 1MW8X 4WK4B 4OHMA 3KV3O 3A9TA 2WQ6A 2GCIA 4IUCS 1OGYA 1H6AA 1K3TA 3AFHA 3COWA 3DV9A 3OHPA 1NTRA 1C7ZA 1SKYE 2Q5OA 2R00C 3EAQA 3EXFB 3OOSA 4KQ1A 4GLFA 1P5RA 2HUNA 1B73A 2XCQA 2D54A 3LQKA 5FBQB 2G72A 3EDCA 3BULA 1QONA 1MCZA 2PKCA 1TLTA 5EWLA 1KYYA 4M89A 1DQSA 5AW8A 1XHLA 4KWHA 1DO2A 1IFXA 2H8KA 1P4HA 3HNRA 4FU0A 2YC4C 3CJQA 5ESRA 4MKIA 4B34A 2G9ZA 5EJ2A 3WNQA 3TZQA 2V7WA 3BEOA 4FYXA 4X45A 3IT2A 1P9LA 1ZNXA 2QJRA 3V2GA 4JYZA 4UTVA 2QT1A 4L4SA 4FM9A 4IV5A 2PVCA 4Z54A 5K8LA 4DEYA 1SZCA 2V1UA 2FEMA 3O8QB 3IA7A 4G1EB 4IEFB 2GFIA 3G0OA 2MR5A 3FKJA 1KMQA 1TC1A 3E15A 5CT4A 4HGNA 5B4UA 4AY2A 2WB4A 2VTEA 1A96A 3L7AA 3IQGX 1QYVA 4L6CA 1PW5A 1C0IA 2DHCA 3VR3A 1XPRA 4ZI5A 3K8ZA 2GBPA 4I1UA 1GUBA 2YJ6A 3MN1A 6REQB 1M8FA 5DI3A 5JWRA 2BLNA 2ZRCA 4RJ2A 2EL7A 3O4VA 4FYKA 1AA6A 3WLMA 4ZT2A 3TEMA 1WTCA 4MI6A 1FU4A 3OTHA 3UMVA 4HZIA 1IHDA 2Q7XA 5IM4F 2H31A 3TRHA 5E1MA 4IDEA 3VH1A 1RJ9B 4O4LA 4D9JA 1JQDA 1BNCA 3DO6A 2C8KA 1NF8A 1TYCA 4B17A 2AQ8A 3AP3A 2HTFA 1GT91 3T1NA 1QE5A 2F6RA 3C1OA 4KN5A 2XGSA 3ZHOA 2LZ0A 4FONA 2BFFA 1V43A 4BGEA 4UEJA 3FLAA 2GD1O 1CVLA 1RP1A 2WZCA 3H3JA 4JLKA 4NE9A 3VPAA 3PX7A 5FTKA 3FZYA 4BO1A 4MJXA 4HZGA 2WWIA 5JEDA 1C3LA 1YGPA 5SZKB 1J8MF 2CFSA 4BQRA 1G64A 3QF4A 5F33A 3LY7A 4K2HA 1EA7A 3RK0A 2J07A 4TUYA 1D2EA 2YWDA 4QNMA 2PLRA 3MJHA 3U1TA 3SI7A 1EB8A 4LW8A 3PGJA 3U48A 4MHTA 1N4AA 5IC4A 2KBFA 3LF2A 1I0IA 1X92A 3H83A 4NAVA 4QYIB 2WIBA 1O87A 2LIPA 2XMSA 2KLBA 4LF7B 4OU4A 3W4JA 3L41A 3WB1A 2RKWA 1PDOA 1NRJB 5CPFA 4K9PA 4B6RA 4DPKA 1P29A 2OGWA 2Q6OA 3DDCA 1EBFA 3LYUA 3VISA 5ISMA 3P0JA 4EYGA 4HKTA 1ZA2A 1IBLB 3ZBPA 3STVA 1R6UA 3FSEA 3EA5A 3PSAA 1UBFA 4RPLA 3ZWCA 5A2QA 1A9TA 2NU9B 5JEEA 1CHDA 1R4ZA 1GNLA 4U39A 2GNAA 4C22A 4GECA 1GDHA 2GRUA 2BGRA 2JHFA 3QE0A 1W5FA 4X1IB 3FNGA 4TQUS 4Y9RA 4YT5A 5BN4B 3T9BA 1JU3A 1LK5A 2RBKA 4X8OA 4XB6B 1SHJA 4PGAA 5EJFA 5AK5A 3OQOA 2XEXA 3O75A 4DIKA 2DHQA 2L82A 2O7VA 5C8YF 1LDEA 2JD2A 4ESOA 1Q0ZA 5LP6C 5A3VA 1HK7A 2QL7A 1E9BA 5I4CA 2O8VA 1A27A 4DLSA 3RVLA 3SQXA 3D8HA 4G41A 1Z56C 3P9SA 4HNGA 4MUHA 5AM4A 1MGPA 3VDQA 1G1MA 1GPKA 2FEXA 5DGHA 2C94A 1F0YA 2WHXA 2B7BA 3HVIA 3II6X 2PUCA 1AZSC 2CXHA 3LIPA 3C5WP 1W34A 4WLOA 5ERYA 4Y2GA 1QR6A 3JU3A 1KDYA 5CLFA 1ZVMA 2HADA 3B1XA 1P4RA 4DDWA 5KOJA 4JMLA 3COZA 1UUFA 2O2GA 4JGGA 1F6BA 5F1PA 4DSNA 3SYLA 1F6WA 2QUHA 4BV3A 4EY8A 1OOEA 5K5EA 3A9UA 4EJSC 2I76A 1G3QA 5EKSA 4B6GA 1QS0B 1PDVA 1P0IA 1NI4B 2QPOA 3ZVRA 2O59A 1ZA1A 4KPFC 2ZSKA 4XKJA 2QX4A 5DIZA 4UHBA 2C54A 5G0TA 3QBEA 2F48A 2FWJA 4HUQA 1RC0A 4OTZA 1YRLA 3NNNA 5DWDA 4RO0A 5KYKA 4UTPA 4ESVA 4E5VA 1D0VA 4BBPA 1J5PA 3A2KA 2YYYA 3OLCX 4LZOA 1Z8HA 3KOXA 1IK6A 5EPEA 2QYSA 2ASEA 3QXCA 4PNHA 1E1CA 3FY4A 4H7EA 4LGCA 3ZIAD 3PPXA 5CB6A 1C5KA 2NXEA 1X1QA 2GESA 3HKBB 3RT9A 1OAOC 3FPJA 3OPYI 4NI5A 2IVZA 5ENDA 4JX9A 4KO3S 4EUHA 3SVTA 2O0HA 1HQCA 1CR4A 4IRXA 4IWYA 4E4RA 2HHAA 3HFSA 3NTXA 1WQ4A 2J85A 4P81A 4FBGA 4EGFA 3KLPX 3F6EX 3FTFA 4QU8A 2VDWB 2X2FA 2BJVA 3AERA 3ZI7A 2Y27A 4FFBB 3TSOA 2HWXA 1A9XB 4A1OA 2UZIR 5BR4A 3NHPA 4A2WA 4HT3B 2Z6QA 5B4TA 4CHTA 2GVDC 2JF0A 1UADA 3N2ZB 3EY9A 2W0SA 4QQRA 5TE9A 3TTUA 1V35A 3AEYA 4IW3B 3LK6A 5LD2C 4BO7A 5E6SA 3HA3A 1DRUA 4A2PA 3MTEA 4O2BB 2C97A 1AV6A 2WIJA 1R6BX 2IYSA 1I01A 1YAJA 2AVDA 5HMLA 1S7CA 5K09A 4ARZA 2D5BA 1WVIA 3GAAA 3WWZA 4Q3CA 3BFJA 1HWYA 4Q7JB 5AESA 4WNAA 3OZEA 4Y6OA 4J1TA 3ICPA 2YZNA 1F06A 3DZBA 2N47A 2F1KA 1QM5A 2HA0A 5DX1A 5IXJA 2C8VA 4KQ9A 4CQJA 3ZV6A 3S70A 1B0UA 4BP1A 1VKRA 1XP5A 2VJCA 4MIOA