3JSXA

X-ray crystal structure of nad(p)h: quinone oxidoreductase-1 (nqo1) bound to the coumarin-based inhibitor as1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
270
structure length
270
Chain Sequence
b'GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H dehydrogenase [quinone] 1
publication title Synthesis and biological evaluation of coumarin-based inhibitors of NAD(P)H: quinone oxidoreductase-1 (NQO1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 80
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3jsxA00
3B6IA 3TE7A 3OVMA 3NLLA 2QX4A 1CZLA 4ZVKA 3GAMA 3F6RA 1QHEA 2FCRA 2WC1A 1AKQA 1OFVA 1DXOA 1FLNA 2FLVA 2QX8A 3NHWA 2Z9DA 1AKUA 1RLIA 1V4BA 3OJWA 1J9ZA 3SVLA 2FAXA 3L9XA 3O2NA 2Z98A 3NHJA 4YALA 5JROA 4DILA 1KBOA 5LJLA 1OBVA 3N3BC 2FVXA 2BN4A 4ICIA 5NULA 3QFRA 3NHSA 4ESEA 3OJXA 3B6KA 4YQEA 1VMEA 2R97A 2QX6A 4YAFA 2MOKA 2D5IA 2MTBA 2RG1A 1H66A 4NLLA 1QRDA 1FVXA 1T0IA 4BMPB 5ULLA 2KQUA 1NNI1 1YCGA 3B6JA 5NLLA 2ARKA 3OX2A 5F51A 1D03A 4J8PA 4M0CA 2QMYA 1YDGA 4GQIA 4QOIA 4C0WA 4FX2A 3F2VA 3FVWA 3EYWA 3S2YA 4PU0A 3NHRA 2XOEA 3UXHA 3N3AC 4C76A 5FX2A 4QOFA 3NHPA 3R6WA 4YAWA 3NHFA 2MWMA 2GSWA 3JSXA 3RPEA 5EAIA 2FDXA 1YCFA 4DY4A 1ZWKA 4Y7CA 1YRHA 1J9GA 4LAFA 2M6RA 4QOGA 2FOXA 5LBTA 1JA1A 2Q62A 1E5DA 5LJIA 3HR4A 3F90A 1C7EA 1YKGA 3KLBA 1SG0A 4OXXA 4N82A 3KAQA 1QR2A 3K20A 1ZWLA 3OWXA 2OHHA 5TGZA 5LBUA 1T5BA 4YAUA 5LVAA 4H2DA 4U7HA 4R81A 1RTTA 3ESXA 1FTGA 2Z9CA 1OBOA 1XYVA 5FA6A 2R96A 2BZSA 4S24A 1AKRA 1CZUA 1BVYF 5F4BA 1AKTA 1CZKA 3B6MA 4DIKA 6NULA 1CZRA 2M6SA 4XDGA 3FW1A 4LTMA 2N1MA 3LCMA 3GFQA 1JA0A 1CZNA 4PTYA 1XYYA 4U7GA 4C14A 3G5MA 1J8QA 4F8YA 2XODA 2HNBA 1KBQA 1QBGA 5A4KA 5FUQA 2X2PA 2V5UA 4GI5A 3P0RA 4ZVLA 1AG9A 2Q9UA 1FUEA 1AKVA 2HNAA 1FLVA 5EMNA 2AMJA 1DX9A 4ZVMA 3EDOA 4FGJA 1SQSA 1CZHA 2V9CA 3NHYA 4NULA 4GR9A 3NHLA 3GFSA 5EA2A 3W7AA 3D7NA 3OX3A 3N39C 1BU5A 1CZOA 2BMVA 4Y9RA 1B1CA 3NFRA 5LLDA 1C7FA 1FX1A 2FZ5A 1D04A 3QFCA 1F4PA 5LMCA 5B3KA 4N65A 3U7RA 2OYSA 2QR2A 3KAPA 1TLLA 4FGKA 1TIKA 2MT9A 2QWXA 1J9EA 2A5LA 4CETA 3ESZA 3W78A 3W79A 3F6SA 4LTDA 1AMOA 1FLAA 5BUCA 2OHJA 1I1OA 4U7FA 3GFRA 3O73A 1FLDA 3W77A 2QMZA 3ES9A 4XDHA 1GG5A 3FJOA 4FGLA 1H69A 2HPVA 2BF4A 2QX9A 1RCFA 3TEMA 3QE2A 2W5UA 1YCHA 1XI2A 4N9QA 2V5VA 4D02A 1X77A 4PTZA 3ESYA 4YAOA 4CF6A 1DXQA 3FNIA 2X2OA 3HLYA 4BMOB 1RLJA 1AHNA 1XT6A 1AKWA 2FX2A 4QOJA 3ZHOA 4Y9UA 1ZX1A 4HS4A 4C0XA 5B3LA 2F1OA 3TZBA 4QOHA 3NHUA 2FZVA 3K1YA 2BPOA 3NHKA 2OHIA 4LA4A 2Z9BA 1AZLA 1D4AA 1WSBA 4ZVNA 2KLBA 3LT5A 4QOEA 4H6PA 3U7IA 4QODA 3UXEA 5F12A 2ZKIA 3KEGA 1YOBA 3L9WA 1WSWA 4LTNA 3OX1A 3FX2A 3HA2A 3OWHA 4HEQA 2B3DA
chains in the Genus database with same CATH superfamily
2CF6A 2ZATA 1XV5A 4MWCA 3SX0A 3OPVA 2YMLA 1QE0A 1T4CA 4JVNA 2P4UA 1VGRA 3NXSA 5FF9A 3BGVA 2OWDA 3FZNA 4JL6A 2R44A 2WAAA 4E07A 1J23A 1KO7A 3LLVA 4OFZA 3MMSA 1XMSA 3GJ0A 2QT0A 1PD0A 5H7XA 4MULA 4BNHA 1Z83A 2VHWA 4W9NA 2NU9A 1CP3A 1E7RA 1YIAA 3P71T 5AW5A 4EY4A 1BXGB 4FCVA 1E9DA 5JNTA 1BWSA 3DULA 4Y0NA 4BLOA 4U7TB 3O8OA 2WF6A 5ESDA 2WM9B 2M98A 4DZZA 4NDAA 5A7HA 1RWBA 1VE1A 1N6NA 1ZOLA 1U2DA 2FLWA 4HRAA 1ORRA 3PLNA 4MK4A 4XIYA 3WHLA 5HXAA 3TRKA 4BYGA 3T3OA 2BI4A 3V42A 3VBEA 4HDSA 4G63A 4FJ2A 5E1OA 4OAOA 4Q37A 3S1AA 1QV9A 4Q19A 1NW4A 3JWPA 4PFQA 4WSOA 2C3YA 3TK1A 3UYLA 3H19A 1Y80A 2FP4B 1GLNA 1T0PA 3QU7A 3DOIA 1YA6A 1DWOA 1KBOA 4MX8A 5LMZA 4W5HA 1RE0A 3EN0A 1K89A 3QWHA 1EFKA 5KYYA 4DV6B 5BWCA 3V8QA 4I5GA 5EYPB 2RAPA 1RXSA 2WU1A 2PMWB 2TMGA 4LY9A 3CZAA 3SU8A 2ZUEA 2QUZA 3E3LA 4R9SA 2Q5FA 3D0QA 1Y63A 5NULA 4EUHA 2WINI 3G0IA 3NH6A 2QRGA 1NOJA 1RVDA 2Q3BA 1JAZA 2WJGA 2B8EA 4J0CA 1TA4A 4PS0A 2QU7A 1LX7A 1YWGO 2DBYA 2LKCA 4RD1A 3FOCA 5JG7A 4MWSA 4ZQIA 4MQEB 2HX1A 1ZGGA 4YQEA 4BQFA 4PN3A 2F90A 4LRSB 4ARZB 4U5XA 3GZ4A 4PG6A 3DJYA 2JFYA 1Z62A 4REQB 4E70A 4DC1A 5KNDA 4Y2RA 2MOKA 4GE3A 2W6ZA 1OFUA 1OIWA 3C6XA 5JDCC 1M54A 4ZJUA 2X19A 1ZJ6A 3G9UA 1PTKA 3EYAA 4M9ZA 4RIEA 3M9LA 2AIRA 1NDHA 5ALJA 4YFYA 1T9HA 1KZ6A 3MFQA 1WBJB 2PWAA 3DUWA 2NZ8A 1OKKD 4HHEA 1XLTA 1KAOA 5IZ4A 4DV2B 3O1JC 3T4EA 3WGQA 2P68A 1MDFA 2JFFA 1M1XB 4IXMA 2I7DA 1DAGA 4OM7A 5AM2A 5GINE 3H13A 1DMSA 3L7IA 1TKCA 1H94A 3E0QA 3G79A 3P32A 3ZCSA 5K6AA 4I1YA 2VBCA 2OXFA 2IPNA 3PB3A 1OLXB 1W6UA 1JHVA 2HWXA 2BKEA 3HP1A 3JYLA 1KPIA 1ENPA 3ANXA 3LUCA 3Q1LA 2OD7A 4D42A 2R8XA 1QGED 3WLPA 2P2CA 3EOBI 3RC9A 3G5TA 4LRTB 3UH1A 5I8WA 1ZRNA 2R6GA 3AK4A 1TM7E 1Y6GA 2V7QA 5KJFA 3DO5A 3BDIA 4OLHA 1E1MA 2MSLA 3F7NA 2JH3A 3AERB 3VISA 2D8MA 1DO8A 2EATA 4AKGA 4HQFA 5CX4A 4NFYA 3BC1A 4KE9A 1HRKA 1B73A 2VKTA 4R4JA 2I4LA 2GUWA 3F4LA 3IRVA 2DWCA 2WICA 3I8OA 5E2BA 1QIMA 1QF6A 3KK0A 1ZUWA 2CFRA 3PUVA 1S3FA 1J1ZA 4L8VA 1YZKA 2IT1A 4WA7A 1H9CA 4HMPA 5KYUB 4BECA 4DSTA 4KVAA 1DWUA 2KE5A 1QPBA 3CF4G 1YJ5A 3GT4A 2PZGA 1QOZA 1XUOA 4YJ2F 1L8XA 1E1NA 1JEQA 1T6NA 2WKSA 5FJIA 5GZ6A 3T7SA 3QJ5A 3Q41A 2D0OB 5JS6A 4C4SA 2FI1A 1U1IA 2Z3WA 1USIA 3QFSA 5AW9A 4OLFA 1KVTA 1FNMA 3SXUA 1G7SA 2VSYA 3HDQA 1DKNA 2G83A 4HVTA 5E2IA 4CM1A 4EG3A 5AKXA 6LDHA 3L7CA 3GLIA 4G0OA 1P61B 3JVDA 1NKTA 1IE3A 1FXSA 3REQA 4OQ4A 3V1YA 4AG3A 2AFIA 4BXOB 1WDMA 3A1VA 2BMAA 1FYEA 1RXUA 2H1CA 3SJCA 3TTUA 3JSXA 2I78A 4JDPA 3U4QB 1B2RA 5EWJB 5CYFA 4GPAA 2GRAA 4Z9BA 4JP3A 5JMTA 1WXWA 1EUQA 2VP4A 4Q21A 5FKJA 3U62A 2WWWA 3LD9A 2RB5A 4P3OA 2Y1EA 4K05A 5C7IO 2OEPA 5HUQA 4BV3A 1WETA 4BO6A 2N47A 1ZXBA 4COOA 5D2CA 2IXBA 2AG0A 3AR6A 1ONBA 1F5NA 2MSCB 3EVEA 1MPTA 3L1KA 5K0LA 3TWOA 1UBMS 3JD2A 4LDZA 4A82A 3G9QA 3NJ8A 4WAUA 2P4SA 5FNVA 4WFJA 3PC7A 1HG0A 4N0MA 1I7QB 3FOZA 1U11A 1Z4MA 3ICEA 1QAQA 1QKIA 4HN4B 2RBEA 4O4JB 1SXQA 4V39A 2RDMA 3KLBA 2HKIA 5IMBA 3FWNA 4J9UE 3NO4A 4CM3A 1M0EA 4BLPA 4XJTA 2FK7A 1NQWA 2ZJZA 3F78A 3PSHA 2C00A 5LU9A 1CJVC 2C1ZA 2EV9A 4X6LA 3WJ7A 4C07A 1PNTA 2JD0A 1FQOA 1IDN1 1GN9A 3WL3A 5LBUA 2XA9A 1DG1G 3C74A 3G9TA 3O4IA 4X90A 4TZ0A 1SPXA 3VPGA 4EPRA 2PWYA 3DYBA 1YH3A 1UZMA 1R0WA 3CZ4A 1QHXA 3FGOA 4PNZA 4Q34A 4PNHA 4RPLA 4LVNA 2FMHA 4YX9A 4IIFA 3A31A 5L3RA 2EGUA 5DXAA 1FU7A 1HYQA 4OAQA 3WQSB 3G1UA 4OHMA 4OQZA 4C0HA 3HEMA 4QO8A 1KARA 4KAJA 2HV8A 4S05A 4JIGA 3I5AA 4GGOA 4DYDA 5E6UB 2TMYA 1BE1A 2HF8A 3GIWA 3CF0A 4MUIA 3IP6A 4HTAA 4XVQA 1UZAA 3LFTA 1YONA 1DIRA 2P75A 1L8AA 3AUAA 1V95A 3HDHA 4YUVA 4HGQA 3RT9A 3ZDZB 3O83A 4F91B 1OWMA 1R6BX 5TEVA 1I2BA 2ZDGA 4OUKX 3IXQA 3P9CA 4H08A 3OTWA 2BD0A 5B4VA 1I3LA 4QPNA 2GXSA 3TLXA 1ICEA 3FNGA 4QELA 2P6PA 4Q3KA 4CM6A 4S0XA 4PM4A 1FP6A 3WMEA 1NFRA 2JLWA 1W44A 9LDTA 4QNRA 1TLTA 2IUTA 2Q46A 1N0IA 1O03A 3OMWA 4GOOD 1B6RA 4KXLA 4F5YA 2V98A 4KZKA 4Q3AA 1WEHA 1AA9A 1EKXA 1YVRA 3PHGA 3A3KA 4UMVA 4DV3B 4QUHA 1SB8A 3UYKA 2ZVJA 1AUVA 4POAA 4KXMA 2GN2A 3JRXA 2DRIA 5D86A 4PBTA 3BIOA 4HGZA 4BLSA 1EFDN 2Y77A 3F5MA 4JSRA 1YXMA 4CHTA 5KTRA 4WADA 2WD9A 2XKAA 5IKXA 2MSEB 2JLXA 1W75A 3ZZTA 4BB6A 4HFRA 3K92A 5DGIA 4HB0A 1K8RA 3G2MA 1JIXA 3KE9A 4HDKB 4PC1A 1TVKA 2VXBA 3EEYA 3MUFA 3IVCA 2BTQB 3H86A 1J8VA 4Q00A 2XTJA 4MCJA 4RFVA 1A9XA 1SR8A 2NZXA 4RAQA 1GP2A 4OJNA 1XTRA 2OGTA 1RAGA 2GCOB 3CA8A 3IQDB 3JQFC 2XADA 4PRLA 3UGKA 2K2WA 3FOWA 5AESA 5AK5A 4ZZ3A 4MUHA 3WRYA 1FJ2A 1I2CA 4OGKA 1QU3A 2UDPA 4PLPA 1U0FA 4XD2A 1LDMA 1W25A 4PWZA 4RA9A 2QM0A 1DJQA 1YQGA 3NUGA 4FGZA 4J75A 3C1TA 3O2QB 1ISJA 2O7NA 4KDRA 4XSHA 2PGOA 3E7DA 1T4MA 3L7AA 1OFTA 3FMOB 2G9UA 2QRVB 4I6EA 1BEZA 4RULA 1EDBA 2YCLA 3UWDA 4BGDA 4E4TA 2Y1XA 3L7OA 4LRWA 5CIQA 4C08A 3ZWPA 1QIGA 4UNPA 5CLFA 4B80A 4M36A 1KE1A 3HCRA 4EEXA 5FOXA 1JQLB 1JHOA 3ETJA 3V48A 4Q4JB 3LQ2A 3E1GA 4Q12A 2WKQA 5G3ZA 2JLZA 4RY0A 1W0JA 5EA2A 4R1PA 4KTVE 4YCMA 1TGYA 2XY4A 1CR4A 3M6FA 1X7HA 1T9ZA 1DC7A 2A1TS 1CZOA 3K8ZA 5M5BA 2K5UA 4RMHA 2A30A 3A28A 2HJSA 2ZUBA 1FX1A 5A3QA 1UFKA 4F2PA 4K0KB 1IC6A 2ECOA 4EH1A 4O6VA 4DYVA 2AXPA 2LUOA 4NWIA 2OR3A 3C70A 3NGLA 1U4NA 4TMXA 2RAVA 1RC0A 2GAOA 3KTAB 5CTAA 4DLNA 2DAPA 2R8OA 4HL6A 3T7TA 3TW8B 2VDLB 3BFVA 4OQXA 3L6OO 3UB2A 1FNSA 1FFHA 1G291 1Z6TA 3C24A 3H2BA 3LQFA 3NM5A 2AEMA 5CM2Z 2PK3A 5EHXA 3EZXA 4RETA 3P9YA 5DWDA 4DT1A 1RM4A 3CFYA 4C87A 1NT4A 4ZI7F 4NNPA 2YHSA 4EAQA 3LVRE 1VE3A 1L4YA 1NASA 5HCIA 4KQXA 4KHPB 5LDDC 5HJEA 4Y2HA 4CM9D 1D1TA 3P9NA 1DADA 3LUAA 4WOJA 3DMTA 1EX6A 3VYSB 1E5QA 2IC5A 3K0FB 2BFNA 2C4HA 4X71A 1XZNA 1QIKA 4MGEA 5KCMA 3B9RA 1NATA 1VL2A 2A9FA 2C95A 1AKEA 3GLHE 2AOUB 1Z88A 2VNSA 4HAYA 4LTDA 4UBJA 4YEDA 1KWKA 3D8BA 2IBTA 1TU3A 4R84A 4FZ3A 3CZ5A 3GH1A 2HJ9A 2GK4A 2D3WA 1LA2A 5LP6F 1VMIA 2CUTA 2X14A 5CHYA 4F85A 3WO1A 1BDJA 1GNPA 4KQ2A 4NK5A 1R6AA 2VPWA 3GCWA 4G5XA 4ZU3A 3OPYA 3RO7A 4R8SA 4ZVSA 3K9BA 2ZE6A 2I7VA 1EK0A 2PIAA 1XZLA 2XDQB 2I4OA 1X8KA 3AY6A 5HNKA 1CR6A 4XVHA 3KALA 3LKVA 1ZSYA 4EHKA 4Z5XA 4YCCA 1LNZA 1PW7A 4EB6B 3ZHZA 5AVSA 5L6MB 3Q1KA 4E5YA 1VL8A 2INGX 3OE7A 2ILVA 4XOIA 3C1UA 1V16A 4HB2A 5FR1A 3V1MA 1KRWA 1DC8A 2AC2A 5DBOA 4LC9A 2QD4A 1LQTA 3KB2A 3PLAE 2H7YA 1F7UA 4KPGA 3ESYA 4Y2JA 3FUUA 3W5BA 5I9MA 4D8UA 3HXOA 3A6FA 5JD6A 5ADWA 3R7SA 4M1OA 5JAHA 2ZIXB 4B5LA 3TOXA 4BLVA 1W36B 4IPTA 1BO6A 1I13A 1XMJA 4ZAZA 1UQTA 3PNQA 2QQ0A 4KRXA 5FPKA 5K99A 3RF7A 2QRNA 5AUQA 4B40A 3M9XA 2PRZA 1YB2A 2WBLC 5GP1A 5H3CA 3WWEA 1MG5A 2QJWA 2PD6A 2VDWA 2XT6A 3QOWA 2JFUA 1AQIA 3D2CA 3T5CA 3E03A 4AX4A 4C21A 4AICA 1QG4A 4ALIA 5ELMA 1U3FA 2PQ0A 1IRIA 1RBMA 3A4LA 1I94B 2O52A 1BH2A 4LQDA 4C29A 5IJWA 3EGCA 1QP0A 2NTNA 4LHZA 3M6MD 4CL8A 1D2AA 4MZDA 1E3LA 2WU4A 2W2OA 4HN9A 2C3OA 4GXQA 1AHPA 3NHUA 3G88A 3EEOA 2RI6A 4BJ1A 2GLTA 1ZNWA 4F5ZA 5IDWA 3WWOA 4C0JA 3PNVA 3K70D 2Q3EA 4LA4A 2QY6A 3EGVA 4Z3DA 3VKFA 4CNQA 4OBEA 3HU5A 3NDBB 1SVIA 1WCIA 2R1UA 2PMKA 3M4XA 4OHPA 2H63A 3DNFA 4UBIA 4X1YB 1OH8A 3PDHA 3QPAA 4DXHA 2B61A 4RA6A 3MRTA 3QF4B 4TMZA 1T5DX 3IJ5A 3M1AA 1SMKA 5HK8A 1MAWA 1TRHA 3I6QA 3R3XA 4IUYA 1IH8A 1A7AA 4NF2A 2BFAA 1T3SA 4RFSB 4NG4A 5TMBA 1XF1A 1IY0A 1T10A 2IKSA 2Q6OA 1RWKA 1N0UA 1V8DA 3IRUA 4PYMA 1UUFA 3DC2A 3ZWYA 2BY4A 2VYND 1RRFA 3K0BA 1T4GA 3R0ZA 1JA9A 3ZZMA 1MJNA 1SKYE 3WDLA 4LFAB 2JI6A 1U0OC 3T52A 4AURA 1NIPA 2Q3HA 1O89A 1X7YB 1QZUA 6REQB 2XEDA 5L40A 3TNJA 2Y3IA 3N5KA 3SBXA 2CHVA 1CB7A 4G1CA 4L4YA 5CVJA 4F7WA 1Y1LA 3NTVA 4PF1A 4PZDA 1DO2A 2FJUA 5ALEA 5I4BA 5JD4A 2QSZA 4QXMA 3F6EX 1QCCA 2VIIA 3EUWA 4GZMA 1A2KC 1F9AA 1CJBA 2BRUA 3TO5A 2FUEA 2ISCA 2MMCA 3KWLA 1JIJA 4I46A 2NTYC 2GF0A 1UM9A 2NSJA 1AK2A 1S3IA 3EZLA 3MWDB 4YRNA 3KHTA 2FP3A 2VK1A 3WWCA 4IDEA 3WO0A 1YA4A 2JGEA 5F2KA 4ZCLA 5G1PA 4ZI2A 3IBSA 4LYJA 3RU9A 1A5TA 4OXRA 1JHAA 1T1JA 1DCKA 4I5EA 5J2UA 1QHEA 2HXSA 2IIBA 3LL4A 3DHNA 4RK7A 3VVBA 4EJSC 1QRSA 4EQ6A 2CMHA 1OFVA 1CP2A 2NXCA 1MZVA 2O2SA 3HNRA 3NCHA 1EIWA 3HUEA 1WDLA 3NHWA 4L5AA 3CH7A 2HTFA 4ZO6A 5G4KB 3TBHA 5H02A 1VSQA 3AQIA 1P0CA 1MJGA 1PYGA 2VRCD 3QY9A 1UDAA 4TM8A 3T0FA 2C9DA 3JQ8A 2HPHA 1KETA 2QYHA 1JEYA 5DHFA 2JW5A 2IFTA 3JYQA 4OSPA 4RIFA 2UZ4A 2F8TA 3M9WA 3L6EA 3L9XA 4DLYA 2XNHA 3H75A 5CVVA 5FJJA 3UPUA 3BQ9A 4L73A 2OGSA 1EX7A 1C1XA 2J41A 5LB2A 4DILA 2WFLA 4X6XA 3T38A 1Y89A 4MW4A 2QTTA 2PLAA 4UAUA 2A7QA 3TZCA 1UPBA 4N5DA 1P0IA 4WN9A 3VR2D 1FRNA 5FLXA 10MHA 3RT7A 1O3YA 2ZR0A 3CUVA 4GYJA 4AY2A 4TKVB 1SWVA 1OFGA 1SIWA 2BBTA 2FEOA 2JFQA 3WXMA 1JKJB 5LQJA 3EIOA 2VPIA 2MSWA 4OEHA 1GNLA 3I32A 4EDFA 3TPZA 4EHAA 4QLBA 3ISJA 4PPQA 5FWXA 3BQNB 2V65A 1MH1A 1VB5A 2P2SA 1VHJA 3OFND 3Q7RA 5FQNA 2FW0A 3L8EA 1T26A 2I87A 3BHJA 3B6KA 3OBIA 1ORTA 3TTWA 3WLFA 4YH1A 1XDSA 3BAZA 5DEOA 2JF0A 5L95A 1PO7A 3G1TA 4LPKA 5ALRA 4JNCA 4KO2S 4NFSA 4O4IA 4XIJA 1W76A 3R3UA 3H65A 4NYMQ 5JSKA 3TCKA 1S2NA 3DKVA 3F73A 1I3MA 2DFDA 1IHXA 1DNPA 2RIRA 5AKLA 3MWGA 1EUCB 3GLTA 2ZS8A 2ZJFA 4F96A 3QNMA 4YS6A 4BBZA 4CF4A 1RYBA 4V1CA 2JLRA 4A26A 2X13A 4UVIA 2VYVA 2V4MA 4JP1A 3VOSA 1GR1A 2BLNA 5EPEA 4M9UA 4C2BA 4CTNA 4U6SA 3AJ9A 3VR5H 4PLWA 2HA5A 1YS2X 4QU9A 3QXJA 2XVZA 3T3DA 2R7KA 1NXPA 2A0UA 1VE9A 2VR1A 3AETA 3RS7A 1UPXA 2VF5X 4A0RA 4ER0A 3ND5A 1SN7A 2O20A 4CUKA 5JS1A 2QF7A 4B9AA 1JVNA 4BU0A 4II7A 4AJHA 2A9OA 1RXCA 2B0CA 4J6EA 1MIHA 1KAEA 1CK4A 4IS2A 3GLFA 5FWYA 2IS6A 1QU2A 1NVWQ 3RIYA 1BZYA 5DZSA 2QHXA 4E31A 3CBQA 1L4MA 2CHFA 3MOSA 1XVTA 5DGDA 2XF2A 2XB8A 5TPZA 2ORWA 4R7ZA 2HLDA 2OBXA 3KDPA 4KWTA 2YS6A 2QZPA 3MCVA 4P3NA 4QTUB 2QNRA 4QYMA 1AS3A 821PA 1JIKA 1K5PA 2C5GA 4KYUA 3JTMA 5AHXA 4L4XA 4EL5A 4Q05A 4D41A 2DOKA 4JJFA 4QBKA 5ALDA 1JJ7A 1U31A 2IYQA 3TD9A 3UXHA 3PQDA 3NIWA 2ERXA 3GGJA 4B74A 4YI5A 1Y8CA 3H6KA 3PR1A 4DLZA 1NUTA 3JALB 2NVUB 3JATA 3TTYA 5E95A 6YASA 2NYUA 1YS1X 2HHLA 4ZEXA 1AU9A 4FOSA 1HYHA 1JFRA 4KVGA 2L69A 4RELA 4D45A 3ELDA 3PEVA 4UNSA 4F12A 1P31A 3ZZ1A 1N5OX 3AL3A 4JBLA 4PV7A 5IK2A 3Q8MA 3QLVC 3VKWA 4OB6A 1N77A 4EY5A 2QL5A 1Z75A 4IDQA 1R9GA 3HHEA 1XRNA 4ZAWA 4B3HA 1SXIA 2J3KA 3I6BA 2QW8A 4TWBA 4WVFA 1NKSA 5K6RA 4FDTA 1K5HA 3LNCA 4TVKA 4Y7CA 4EI8A 1V8OA 3O9VA 2RONA 1I2DA 4NEGA 2XB2A 1PJCA 4CEIB 5BV0A 2VP3A 4QGFA 2PT6A 3EVDA 2AFHA 3L02A 4K40A 4Z0TA 4F8JA 2AG5A 3W90A 3PX7A 2PL9A 4DIMA 3LT4A 1IWOA 3NASA 3CNLA 1P2GA 4HXGA 3THSA 1PJQA 1XAJA 1XJ5A 2OFXA 4JLVA 2F3TA 4ND6A 4MVJI 3R40A 4Z0HO 1DQYA 2J48A 5CURA 1L8QA 3L49A 4LXUA 2C57A 1N5DA 3U0VA 1VHWA 3A3NA 2RHRA 2AN3A 1F48A 4G0MA 2A67A 1OLSB 1C7EA 2YXDA 3JR7A 3H5TA 1UBNA 2Y27A 2L18A 4U7DA 1RYFA 1XDZA 4YRCA 3HI6A 1QR2A 3MQ4A 2XNSA 3KUUA 3MVEA 5LQUA 1JFFA 3ZHXA 4GZLA 4JJ4A 1ODFA 2VOJA 1JR3E 3UAVA 3V34A 4UW9A 4D9EA 1XD8A 5KNCH 3BWCA 2Q1XA 2WMOB 4DV7B 3ENKA 4ID9A 4RZXA 5I7OA 3OU2A 5D5HA 4YAUA 4PY2A 4EG8A 3ROMA 2D4AA 2GPAA 4Q4AB 2XE7A 3AUXA 3OZEA 2D62A 4TQUS 4MRMB 4YRTA 3VR4D 4C3VA 4TRMA 3ZWWA 2X6TA 4MQ4A 2GETA 4P4TA 1S8FA 1ZNXA 4EGQA 1XJQA 2WPDA 3QTLA 4Y1RA 4YPFA 1SKBA 2REQA 2YWGA 2O0HA 5YASA 1T25A 5G41A 2Z2XA 1QFJA 5IKPA 1THMA 1W4AA 4IBOA 1GTL1 3AC0A 3DNMA 2H2WA 3A6JA 1KQOA 4NEHB 1SURA 4G9BA 2CJWB 4YONB 3WK5A 3L6BA 3WKAA 3HCFA 4EDHA 4ZKDA 1BXGA 1RHUA 5E1MA 3ZUPA 5BOSB 4P7KA 3SJ7A 1PWZA 1MAVA 5D7NA 4A03A 1SVLA 2VTVA 3OKCA 4MIKA 3UMSA 4FOPA 4Q7EA 2HRCA 2DTEA 1RC1A 3OOJA 4X44A 1VPDA 1UKAA 3E2PA 4D0LB 4Q4CA 5BMVF 4CW7A 3FPGA 1TQHA 4GAEA 4G4SP 4XQ9A 3G13A 521PA 4I9GA 1PIWA 2JJMA 3DVSX 2GUGA 1IZZA 1CQJB 4NV0A 4LYEA 1TZ2A 4MKGA 4KQCA 4MUXA 4J0KA 4WNAA 5ABPA 1OHHD 2FSVC 1RYYA 3FIUA 2R5NA 3RVLA 3RE1A 4CVNA 5KYXA 1D9ZA 3EXFB 2X8AA 5LPNA 1HLGA 5HCNA 4XWAA 4IIYA 3C8DA 4KXXA 3ZVKA 2VDNB 1NYQA 1CS4C 3ZQ4A 3ABIA 3MCZA 3GFBA 4AKSA 3DCNA 3IPRA 4AN4A 4ZJZA 1H2FA 1EAYA 2HO5A 2JCGA 3HBLA 4LX8A 5MGBA 5FV7A 4C4YA 3BD7A 5FUQA 1E3SA 5GJBA 4HEJA 2QZJA 5BSFA 4G2TA 1G55A 4UKDA 4MQEA 2PX0A 2QM3A 2W6JD 4NU8X 1N78A 1E5VA 1W46A 1HXHA 1NX6A 2UV8A 3HM9A 4TPKA 4M60A 2J0EA 3GLVA 3KQHA 3PIRA 5E6SA 3NBAA 5DI3B 2YWRA 3W5JA 4K86A 2FMFA 4A6XA 1SM4A 4JEIA 2QQFA 1RAFA 3RAJA 3VR6D 3VUFA 3DE2X 1T2AA 4CQMD 3QKSA 2LD4A 4J0HA 5LNK1 3V6LA 2ZUFA 1E77A 2CD9A 3GRUA 4F84A 5BSEA 2GNAA 2PSHA 2YH2A 1C2TA 2HRDA 2YKGA 2I55A 2EARA 1F8YA 2NT3A 4YV2A 1Q0UA 2X9QA 1VBFA 3SF8B 13PKA 1NXTA 2IPAB 3L06A 1SHUX 2PKRA 4JP2A 3DXZA 3NHLA 4DANA 1TM3E 5F9HA 3RTDA 4WCFB 1KAGA 5JDCA 1A9OA 5DBEX 4IRXA 3DL2A 1U98A 4ND1A 3WGHA 4B6GA 1V45E 4US0R 1A4RA 3LYUA 4LZJA 5EJFA 4HUQB 5KX5F 1M2OB 1OLXA 3L0ZA 2YCBA 1U2ZA 3DAYA 1NZFA 3B1XA 3PXCX 4RTMA 1Q14A 2F4NA 3CX6A 4UPEA 2XZOA 2OV3A 3M3DA 4PLFA 1FDRA 1SC6A 1U28C 4P5DA 4RF4A 4K6MA 1T6BY 4R9NA 5F23A 2FPXA 2UVPB 4E5DA 4B47A 3ZIUA 1GPYA 2MIIA 4ERXA 4TZ6A 2R7NA 2IJGX 5TQVA 1XJ0A 4WDRA 4Z49A 3QX3A 3HZHA 4Z7QB 1JG6A 5C8XA 3JQPA 1KPGA 4IUDS 1ITZA 1XDWA 2ZQ5A 2VSOA 1E6CA 1OT5A 3PUYA 4H59A 1M8JA 3GPIA 2AN9A 4N7JA 4EW1A 3HB4X 3ROZA 1AM4D 1EJ6A 3LCRA 4G5GA 3W2FA 2LV8A 2QTVA 4UZSA 1N32B 3ELUA 4R1TA 2QR2A 1F2UB 4UUAA 5IKOA 4EF6A 1AV6A 3ND7A 5LYJA 1JI3A 2XV1A 3GRKA 1U8CB 2QMUA 1KY3A 1X6VA 1E96A 2X5NA 1TF2A 4G1EB 4NMHA 5FUVA 2OPHA 1GG9A 3TW6A 3C45A 4BVBA 3VU9B 3ZXUB 2WD7A 4W7IA 2B8JA 4KK3A 2WAMA 4LRQA 3LRXA 2CJXA 3A2LA 4QECA 3F6SA 4YT8A 1U0GA 3MGBA 4E5PA 5AVYA 4Q4HB 2GA9A 3WQHA 2O8DB 5AK3A 1L1QA 4ZO9A 2R8BA 4K28A 5I47A 3OY2A 4NYIQ 1L8OA 2PUCA 2W37A 1V25A 2B1QA 3E48A 1CY6A 2ZYUX 1F8GA 3L6UA 2OP0A 3W3AA 4L6CA 3I72A 4EG1A 2WR8A 3EZYA 4UOQA 5FBWB 3V6MA 3CRNA 3AIMA 3GFRA 3M1LA 3O73A 4R69A 4E13A 1MW8X 1G5IA 1V47A 2BFDA 3KAJA 4IGFA 3ZE6A 2R8RA 2GEUA 3AWDA 2EG9A 5JXJA 2AWNA 2PUGA 4ZZ1A 2W22A 2V6MA 4M38A 1UXGA 4ALLA 2ID7A 4JAVC 3ZNPA 5DNDA 3DPIA 1I5RA 5FOWA 4JXZA 1RYZA 4XH9B 3EVAA 4OXKA 2Z1NA 1A7UA 4R16A 1E99A 3QVOA 1VLHA 2GXAA 4YRLA 3EGXB 2C8KA 2DQKA 1KL7A 2WIKA 1GWNA 4N9QA 2GK6A 5CB6A 2V5VA 4IDDA 4IYRA 2YJGA 2EG5A 2J5BA 1QYXA 2GN1A 2OV8A 2QV7A 2XUFA 3DD1A 3QEMA 5ESRA 3BE4A 2B0JA 2ZSUA 4B1FA 1DO0A 4JT4A 4AMUA 2VJYA 3AF6A 3OUTA 3MT9A 3EGIA 1N7HA 3SR4A 5BNWA 5CFPA 2TECE 4YACA 2BFFA 5BNZA 2PLRA 2PUEA 1B74A 1TIBA 4PAOA 4U8GA 4XSGA 4G65A 4PHGA 1ATZA 5F7OA 4EJ2A 1PX2A 2RG7A 2HM7A 5KPJA 3DLTA 3RYCA 2LCQA 3E4CA 2HGSA 5GIOE 2BR3A 2IQIA 3O4RA 3ID6C 4K0RA 2ECFA 2RHCA 2E1RA 2R6R1 4UXHA 4WINA 3EDRA 1PK8A 3BAFA 1LBSA 5AD1A 2IUUA 1I2AA 3V8EA 2AZXA 1T29A 1G3RA 1PAUA 1UH5A 1UIRA 3GWZA 4UE2A 5CT6A 3TM4A 4AZ0B 3ZHOA 3AR5A 3CCCA 3VAZA 4CKYA 4CV1A 3A6PC 1DKPA 3GPDG 2QZ4A 4MS4B 3MLEA 1BRMA 1CJSA 2ID4A 5DE3A 5I4KA 5F3WB 2PL5A 3B51X 1UBJS 2DLDA 1DSSG 4R1UA 3OX4A 5L9AA 2WIBA 2B2CA 1I5EA 2WNHA 3NHKA 5GONA 4DB4A 3Q2KA 4Y1GA 3TQQA 4RV5A 1GCUA 5BQOA 3VHXA 1IVNA 1I32A 4TS3A 3U31A 5EGSA 1T9KA 4M22A 3ZHUA 1AZLA 1G8AA 3CF6R 2GKOA 1WUYA 4LNUA 4UUQA 2R65A 4ENVA 3I5YA 1WW3A 5BSGA 3BFJA 2WTBA 3FLEA 4LVCA 5EESA 3SJAA 3ZWXA 1GCOA 4X1IA 4FFBB 3VO8A 4BFUA 4BNZA 3STWA 1WXFA 3BMXA 1RPZA 3VDXA 2V6IA 5K8JB 1A2QA 1P4AA 1QZXA 4HF7A 4B6EA 1LSSA 5BRJA 1UXOA 2PGXA 1WVIA 4GDMA 4KNYA 3FSEA 1ULBA 3HYTA 3RGWS 4P3PA 1XXHB 1EUDB 2SKDA 2Y1GA 4ZO8A 1DHRA 3BGWA 4Z0NA 3SZOA 1NMSA 4LXGA 2HXYA 1WULS 1U90A 2ZTMA 4R7TA 5AOCA 4BO8A 4NC9A 1ECCA 4GFDA 1I9CA 2OORA 1WSWA 2WVHA 3L5KA 5F76A 5T4EA 3IKTA 4KSYA 4QFBA 1BWRA 1H2AS 4FNGA 1MT0A 3E1KA 4FDLA 4L50A 3RT1A 1ODTC 4O2AB 3HA2A 2VYCA 3QX8A 1LNSA 4GU5A 3MJCA 4ARSA 4XQCA 1O9HA 4BO7A 3FMPB 5COAA 3SHVA 4N3BA 3LBAA 4CG1A 4LZAA 3A1UA 1V4NA 1XPUA 4MUMA 1E9VA 2DWPA 4G09A 2JGRA 1NMEA 6ABPA 3ADBA 4AAYA 3O74A 3AFHA 4HFJA 2CXNA 2QUAA 3ZW8A 1C29B 2C94A 3DAHA 3A58B 3WZ2A 2J9ZB 3H7IA 1OB2A 3UJHA 1WLSA 2JJYA 3U19A 1VG8A 3PFBA 4O4JF 4ZTUB 4AUEA 1NGSA 5DMHA 4MW0A 2K7FA 3G59A 2FLVA 1P6UA 1WF6A 3JTEA 5IHXA 5ADHA 4YUXA 3VNAA 4I1IA 2G04A 1X2EA 1MA3A 2OCKA 3G3EA 4KQJA 5K3DA 2GCGA 2WJJA 1SXJA 1EFRA 1BOFA 1VYHA 2JLSA 1UC4B 4JIMA 1DEXA 2OYCA 4COKA 3GLQA 3SX2A 5J4VA 3IDFA 4XUDA 4BN4A 1DAHA 1V3QE 2QPOA 2X40A 4Y7DA 1W34A 3A27A 2OFFA 2WABA 4LI0A 3UVEA 4D26A 3H2JA 1TM1E 2F67A 2G9RA 2I6FA 5B1SA 4ZDIA 2GXUA 1VXOA 1HGXA 1XK7A 4O59O 4LGYA 4XIFA 3UEOA 1HX7A 5AW4A 1E2QA 4K9DA 4LCJA 1V96A 4EKNB 1RPJA 2CMGA 2FVXA 3RROA 4EENA 1EVLA 1NVKA 3RABA 3LE8A 4LDNA 5D85A 5AK4A 1YI8A 4QJIA 3BH0A 3GRVA 2RHDA 4R2KA 2XIQA 4ZV7A 3HKBA 2VO1A 3ZIAD 1P5ZB 1Q1QA 4INZA 3SKYA 2YUTA 1O57A 1OXSC 2AN5A 4KQ6A 4UREA 4DYHA 2AEJA 4MUYA 4E0BA 3RVRA 3ZQ6A 1XCJA 2YDYA 3HCDA 3I01M 3HJBA 2JGFA 4OOEA 3O6VA 1RYDA 2MTBA 4ZGBA 1H2BA 3U9LA 3EXG1 2GEFA 3ZLUA 1CUEA 2HPZA 4BNLA 2CUKA 4WZZA 2UUOA 1L5RA 3QMPA 3KJQA 1T2UA 1MOZA 3LUDA 3DBRB 2P3OA 4F72A 1Z7BA 1Q77A 2HC9A 1KZ4A 5I7WA 3PD7A 1HT0A 4B3IA 4BMPB 1NBWB 3WQQA 1GNTA 5DTIA 3ZBTA 3FKQA 4F4FA 1JLRA 1O7JA 1S9HA 4JHLA 3DEKA 3PL1A 4L74A 4LX0A 1I7LA 2Y92A 4X95A 1B0ZA 2GF2A 2OA0A 3ZGVA 4PQYA 4ZCSA 1P3JA 3HGMA 4JXJA 1W5BA 3PPYA 4F4CA 4B45A 3FYHA 5L3SA 1LD3A 4YPVA 4DQLA 5KTPA 1COWD 1X8JA 1HDCA 2SKCA 3AI1A 4A1FA 1F2TB 4A2WA 4MKRA 3ER6A 4XSVA 1U0BB 4JI3B 1GA6A 3KB6A 2AFRA 4DW8A 3IPYA 2H2IA 3UATA 4A0QA 4D9JA 1NT2A 1VYTA 1YOVB 2WWTA 4S04A 5EFOA 4LSMA 4B9EA 2WB4A 1GAEO 3E1SA 2WJAA 1Q12A 4CCYB 3S28A 4GOND 1FJXA 8GPBA 3QSGA 4IIGA 1ND6A 1QH9A 4QAJA 3LWBA 4A2QA 1AQLA 4YDSA 4FUTA 1DP4A 1JALA 1XPOA 1HK7A 1ZH8A 2FXIA 3AHFA 4QDUA 5E6RB 3WGNA 3BIFA 3BWBA 4MW9A 4CR8A 3HB5X 2ZRPA 1JHPA 1ZM7A 3D3NA 4FX2A 3CZMA 4WK6A 1NUPA 2CLDX 4X60A 1ZITA 3BREA 4HQLA 4YV0A 1LK7A 4IHAA 5G3YA 5B7NA 4EG4A 2C8VA 2E4YA 2JRLA 2FSSA 5KTMA 1KJNA 4BE9A 1IOVA 3SE0A 4M6WA 1ODCA 4KXQA 4QUJA 4RPKA 2TMDA 2VZLA 5LWQA 5J2TA 2I9PA 1W73A 1HF3A 1G1AA 1IATA 5CAEB 1O6GA 2XSZA 4RJIA 1KDYA 4B6FA 2Q6LA 1ZAKA 3AUSA 3N0VA 5A2GA 3B20A 2GYVA 3LYLA 5REQB 2ZBDA 1SBZA 1V1RA 4B3FX 3HXKA 4I99A 1SVUA 4D57A 4XD7A 4N40A 4LXIA 2B7CA 3ICPA 2W2NA 2AOVA 4NARA 1YCFA 1B4DA 3PDWA 1L5YA 4BP8A 4HJXA 1HURA 3AUTA 4EY3A 3EXHC 1XAHA 3OLZA 3G0CA 4TLLB 5DIZA 2ZE7A 1J9GA 3CLVA 1EZ4A 3MWJA 1V9SA 3NGXA 3TNLA 4CIXA 1MX5A 4HB3A 3X1MA 1MNQA 3KIPA 2JFZA 2NUAA 1HR0B 3CH4B 3JQGB 3JVIA 1G6OA 3R3SA 2P9FA 3HGTA 1R12A 1VKJA 4IWNA 1RU3A 4FWIB 2DBRA 2OXTA 4GYYA 4HDQB 4PAMA 4OGWA 1JXAA 2DMRA 1A69A 1ZD9A 4TMWA 4RGVA 1WOMA 5B37A 1B26A 1NV9A 2LIPA 4CR7A 5CB0A 3R0XA 1JQEA 1TUIA 3HR4A 2ZTUA 2HK6A 3IUJA 4XVUA 4D25A 1CU1A 1MQSA 1P7YA 3I58A 1HORA 5JSZB 1KH1A 3KT0A 1SG0A 4HC4A 2FR8A 1Z0DA 1KMCA 1W4CA 2RKWA 1P3DA 4QQFA 5EUCA 2CN1A 1ND5A 5KEIA 3ISVA 1KSGA 2DTXA 1DX6A 1OAOC 5BSMA 4HCJA 4K9LA 4EFKA 1NJ6A 1IVYA 1ZWLA 2I2FA 4DCMA 4RDCA 3PQ3A 2PEZA 4W9RA 3RM3A 1LS6A 3EWSA 3UUFA 3VYVA 4CEJA 2CMFA 2I76A 2WKWA 2ZJYA 2ZDQA 1ZVQA 2C1XA 2IKQA 3FTQA 5EMMA 4B4KA 1JKIA 2EW2A 3WVNA 1OU0A 5HE9A 2PGAA 4JI8B 3IHWA 4F1JA 5L3QA 2VRWA 3ET5A 1OPRA 4AJ2A 5JSHA 4R81A 4XOUA 3SIXA 1OWNA 1DGQA 3B9BA 3LP6A 3K5IA 3I42A 4N6OA 4Z9XA 1QOQB 1E4OA 1T43A 3UHOA 2FPPA 1IBLB 2FGKA 1YJBA 4RVDA 1PR3A 2B7BA 4LJKA 3WGLA 2BGGA 3AB3A 3BGIA 5AVOA 3PNOA 1ZXXA 2P5UA 4EMBA 1R5JA 3O1HB 5K05A 3M81A 3EA5A 4OFXA 2M1XA 4B17A 4UCFA 5HKBA 4KYIB 5DB4A 1Y1RA 4L9SA 5AJTA 1GTG1 1W1UA 2FPLA 3DOEA 3EFHA 3HWWA 4GE0A 4Y6SA 3S99A 4AP6A 3CSSA 4HYTA 1R0SA 1SBNE 5B36A 5F9FA 3N7UA 1ZH0A 2XA1A 4OK3A 4U8HA 3ONFA 3AM4A 4BPRA 2EC5A 3D1LA 4GIBA 4UEJA 3WK9A 4DBZA 5ECYA 4IICA 4NV1A 4YGXB 4EJSA 1WVGA 3AI2A 1XG5A 2FPIB 3AKEA 4PLGA 5FT9A 5JFOA 3KSAC 2BGWA 5TSDA 3RVSA 3L8GA 4LEIA 4M55A 3CX3A 3GFQA 4J0IA 5AKKA 2JD1A 4DSZA 1GTMA 3M6XA 3G2QA 2EKQA 1BCRB 3NEAA 3SIWA 2IF2A 2G08A 4PCAA 1M6YA 1RZVA 2ZEJA 5CJPA 3NBZC 4TKVA 4OFBA 3A6HA 4Q4DA 3QOXA 1SUDA 1Z4IA 2II6A 3MD9A 3R6GA 1DAKA 3MWEB 2VXCA 3LA6A 4DIOA 1PUJA 4IDCA 3TRIA 1VL1A 1GZHB 3LCVB 4MVJD 4O8CA 5AJWA 2G6BA 1E1LA 3KZMA 4N5LA 3OTGA 4M7RA 2GO1A 2A1IA 2EQBA 4DIFA 3T9EA 2E85A 1OJLA 2X5JO 2PXAA 2JZNA 4NDNE 4BVAA 5B55A 4YO8A 1HDOA 2JLAA 4LGVA 4IIDA 2O14A 4ZALA 1DOZA 3MIIA 1MABB 5IAGA 1L4EA 1NW7A 5FBKA 2GPWA 4ETWA 1OW3B 1W1WA 1WO8A 4AF6A 2TSYB 1R4MB 1TEZA 2X4GA 3PL5A 1GQRA 1C7RA 4HPJB 1BS9A 3WXBA 4P3KA 4S0ZA 2V9CA 3TSZA 3QQPA 1O5OA 1TYCA 4B82A 4JJIA 1UMBB 5EE5B 2D1QA 4GR9A 5ITZA 1RLUA 3A6DA 4D9HA 5ITVA 3JSAA 1RPTA 5AFSA 1UWLA 1B8PA 1X7DA 3OPYI 4Z4FA 1X42A 1CQWA 4YJHB 1OPXA 4MAMA 1NRIA 3HKEA 5DLEA 5BY2A 2W2KA 4CU2A 2W8ZA 2UYGA 1XEFA 3NTLA 3JARA 5CVUA 1Y7HA 1IEVA 1V5IA 3V46A 4BHTA 1JUDA 3GFTA 4JC4A 1GRVA 1V39A 4TWRA 3X1WA 3PUIA 4WN3A 1JU3A 4J4HA 1X38A 4JLDA 2EEPA 4J0JA 1J25A 2RHLA 2IYAA 1QDLB 3D3WB 2IS2A 3RR2A 3GMSA 2ECQA 1Y8RA 3TM5A 3O2JA 2HL6A 3LSTA 3ADDA 1D1SA 1Y6ZA 4QOSA 3V1LA 3W06A 5IEBA 3ZV7A 3F67A 4YV7A 5M3BA 4HAZA 1DKUA 2OKGA 2PTGA 5ALUA 1AMNA 2PRYA 3C1OA 3DMYA 3KLPX 2Q2OA 3HCWA 4Y2VA 4EI7A 3QHQA 5C8YA 2P3QA 4PFSA 1UFVA 5BSVA 4C2AA 3IQWA 5CX1A 1A5ZA 2QAGC 4GI3A 3RRFA 4C04A 2CNWD 4CI9A 1KC1A 5IXJA 3ZXSA 2VK4A 1FU4A 1M73E 2AGVA 3MTGA 4XR4A 1HQCA 2A9PA 3E9EA 3NIFB 1E1QD 2ZT7A 2LDBA 2VCEA 4WE3A 3HYLA 2YUIA 2IGBA 3P27A 1R9NA 4V0NA 2N1BA 4W99A 5F1OA 1R0XA 3P2MA 1V2HE 1GAXA 3JALA 3CLKA 2XT9A 3GVPA 4BS9A 1IZ8A 1YAHA 3IDSA 1XZFA 4IR7A 4QSMA 1N6RA 3V7NA 4EGFA 1XL1A 2LGJA 3IEKA 4UCQA 4KXVA 3QENA 2I5PO 5BW4A 3E0XA 2BUAA 2FW8A 3L43A 1O8BA 1PN3A 4PSVA 5E3JA 1J70A 2CXTA 2AYYA 3Q8LA 3H6HA 3EWAA 4DNQA 2YDXA 3IS3A 4IJUA 4RY9A 4Y9TA 3CJRA 1U2RA 4YQZA 2EFJA 5AW6A 3DPSA 3ULKA 3EQ6A 3O26A 1X1CA 1YUNA 5A71A 3S2IA 3FFTA 2YIJA 1XZQA 5TJHA 2BAGA 4X6YA 5KNBH 4PGMA 3QLVA 4KPYA 4BEWA 1Z2PX 2DUUA 3UJ7A 5DHQA 5LA6B 2Y6UA 4DL9A 1R1DA 2C4MA 3BFPA 1FQKA 1LC3A 2Y1WA 3OZSA 3C7TA 1FMJA 1LPOA 1GG8A 1AQYA 4LZOA 4LJ8A 4OMDA 5DSTA 1QFXA 4B43A 2FWMX 3CKKA 4QDOA 3KPYA 4B8YA 2QX9A 1PU2A 4K9NA 4YUZA 3PSAA 5JZBA 2W5UA 1KAMA 1NOKA 2OCXA 4DXAA 5E7MA 1BKYA 1D2NA 1YVPA 1EGQA 3CURA 4U7PB 3IOYA 2G09A 1T13A 3LVFO 3R6LA 3V4FA 4NCBA 3ZPXA 1KOLA 1A88A 3FZYA 1KO1A 2ZJ5A 3CUTA 4P7FA 3FGZA 3V8NA 1NJFA 3NEPX 5E0OA 2F9LA 5E4FA 3WFIA 1PNRA 4HSGA 1TD1A 2PX2A 3TR0A 2L0XA 1G3UA 1Y6JA 3JQRA 4G0ZA 3FNIA 3VPXA 3U16A 5K8VA 4G5FA 1NU6A 4AULA 5AI0A 4DA9A 2JEOA 1GCGA 3Q88A 1T8PA 5CD9A 3KCNA 1UF9A 2DF8A 2XWPA 1IFXA 3KLMX 3O21A 4X54A 1TLFA 5L7TA 1TECE 3FLMA 4ZIRB 2IW3A 1JLLA 4Z99A 2C77A 2YMQA 1N0HA 2D2VA 1VPEA 5B2ZA 3JD4A 3OEHD 2OC9A 4YCNA 3HJTA 3GCDA 4RSMA 1X80B 4Q5IA 1C0IA 3KXPA 3L8ZA 3X1XA 4BMVA 3CRRA 1CB0A 1K86A 1F8XA 1QOPB 3K8YA 4LJRA 4UVHA 4ZYXA 3TZBA 5LZ4A 4QPZA 5LZ5A 5BOSA 2FZVA 4Z4IA 1NJ8A 5HR5A 3KOMA 2QL9A 2QT9A 4I2VA 3ZHSA 1YR1A 3TZHA 1RQ2A 1MVLA 4G5HA 2VRNA 1JT9A 3T8YA 3DDZX 4BFZA 5JJCA 3IV6A 3LO5A 2XUQA 3HCEA 1NP6A 3MHPA 2WAXA 4QJ4A 1DBIA 2LR0A 3K0CC 4RZ3A 4HAWA 3R9XA 1JEJA 3OTHA 4M0DA 3RVMA 3I04M 4A23A 1Z0JA 3IC5A 1W88B 3G2IA 1YR6A 3U1VA 1Z15A 2G6TA 2NSLA 3UG7A 4NZMA 4RXTA 3IP3A 4RKFA 5K3EA 1N6KA 3GG9A 4Y3UA 1IMOA 1G9XA 1DS6A 2V7WA 1F6DA 2A84A 2REOA 5C80A 1WOYA 4K9RA 2R1VB 3LWNA 2ZZMA 3NEYA 3AJAA 3GQBB 1AURA 121PA 1IAQA 1Y1QA 4A0HA 3ONEA 5F12A 4RE5A 2O7QA 4KO8A 3SYTA 4XX1A 4DMFA 1N8SA 2ZBGA 2FSVA 1FDOA 3W7BA 5EP2A 3DOHA 1PGJA 3NT4A 1VJ5A 3AEUB 4QDJA 3RU7A 1KI9A 1R0LA 3FHJA 5EE1A 3DM9B 3UMMA 2SICE 1T1EA 2BGTA 2HHCA 2YMPA 3K4PA 5DXJA 2G9NA 3H2KA 3OX1A 2FG7C 1ZD5A 4BQIA 2Y6VA 1ELOA 1VKHA 4QYSA 3U3JA 4HWRA 2Z6QA 1S7CA 3U37A 4RCZA 3LDFA 3WS7A 1LDNA 2CVFA 3G5AA 1DBRA 3M1IA 5FEUA 1RWXA 2XB4A 5HILA 2VHUA 4G26A 4EA7A 3NLLA 1U0TA 4MGIR 5K3FA 2ZJ2A 3LQRA 3PA8A 1KTIA 4V1CI 1IQ0A 1FPMA 3M4NA 1FOEB 1K6MA 1SKYB 2AOWA 3LO8A 5FOTA 4DPMA 4WBNB 4ZVKA 2FMUA 3FGNA 1NQXA 3QIVA 4N1AA 1PR0A 5HBRA 3SF8A 2PV0A 1ID8A 3SVTA 3RS8A 2BMJA 1TXGA 1XDBA 2VT7A 1VSVA 1NU8A 1GILA 3JQAD 1XB2A 3FY4A 2ET6A 3BK2A 3GEPA 5DNYB 1TQ8A 1M2KA 1YUBA 4I9HA 2CVPA 2Z9DA 4MUBA 4R6XA 5HPYB 3C6ZA 3I76A 2J9FA 4KE6A 4WGGA 4FVTA 4B85A 4PR3A 2GZ1A 1RLIA 1GAQA 1GGJA 1KIMA 2A5FA 2KPOA 4M8LA 5F1YA 1CFJA 4BBPA 3D4LA 1UK8A 1BE8A 1M0SA 3NBXX 1JE0A 5SY4A 3ORYA 4WLUA 5BR7A 1FX0A 1I33A 4EPTA 4UTVA 1IZ7A 3K70C 4CCWA 4X7RA 2WWRA 4KGXA 2J09A 1L4BA 2IZ7A 5JXHA 3ZNQA 3E7WA 1QP7A 2ODWA 1KI6B 3IPAA 1OZ0A 4BMSA 3NM4A 2WT4A 4E46A 1FDSA 1E0SA 3ZWDA 1U28A 5K8IA 5LWHA 3AB8A 3T6KA 2CLEB 4KW7A 1ZBDA 1HNNA 2QB5A 2YVAA 3MWLA 3QA3E 4RM3A 4P1ZA 4AYTA 3D7MA 4TVOA 5T6BA 4KACA 2QKYA 1P2TA 3ND8A 4HGOA 3K53A 1H8EA 1X70A 2G1KA 3D0RA 4GM4A 1R8XA 2X9LA 1UMCA 2YQ4A 5COQA 3BD9A 5GJVC 4DA8A 3LLUA 4JROA 4M37A 2QX6A 3MTQA 2JLVA 2CL5A 1TDJA 1JR4A 2IZ1A 1JAIA 3ZDXB 3DBHA 3LQYA 1Y8QB 4KKVA 1H66A 1MCZA 3EJWA 4CNBA 4LMRA 2XQVA 1T2DA 3NOOA 3RGGA 4MGZR 3BSFA 1U9CA 3D4BA 3IO5A 3A6GA 3CKLA 4D6YA 2WDZA 3LK7A 3MC1A 5DX0A 4ESHA 1ISGA 2Q4RA 5DLDA 3WNZA 4D80A 3QLTA 1LH0A 2W2MA 1NNI1 2CL7X 4HEHA 4FWBA 4I8IA 3TS1A 1UXJA 1Z9BA 1N5LA 2TMKA 3FTFA 3IAFA 5HMMA 2WUDA 3BPSA 3FE2A 5KNDD 3VX4A 2EIHA 1L6IA 2FPUA 2H5LA 4TV8B 4CLOB 4F9FA 5I7SA 1E2FA 5EHGA 3TQCA 4HWOA 1PZHA 1UCFA 4YMWA 2P2LA 3TR5A 4FW8A 1HDXA 3RRZA 5IEJA 4U9HS 3ROKA 2VUUA 3OT1A 4Q48A 3TXYA 4M8IA 1DIOB 4EUNA 1FTWA 1A8SA 1A2BA 3QKWA 2ZW9A 1P4HA 4HTFA 2XZLA 3WNDA 1G60A 3OG9A 2N3ZA 4NKRA 2P30A 3CONA 3BMNB 4MVWA 3EGXA 2CC2A 3KXKA 5KMGA 3C6QA 4X45A 4RTQA 1JQ3A 3IT0A 2EJCA 3DBIA 2HHJA 4MIOA 4I5FA 1UQRA 4MKIA 3ZQUA 5KTTA 4UFNA 5T5QA 2ZM6B 1OVGA 1O6BA 5KVCA 1R2QA 2IYOA 4Z7OB 2V7QD 1RP1A 1QQ7A 1SIUA 3AR4A 3DDHA 4FLFA 2FKNA 4XGKA 1WD5A 2H1RA 4JEUA 3WZMA 3NHRA 2UXCB 1OB5A 2P3SA 4EJFA 1H5UA 4Y0VA 5ICGA 2XVYA 2GAAA 2OGUA 3IE1A 2G8NA 2ZSDA 3GYBA 2X9GA 4NZ9A 3KXLA 4QBGB 4G0QA 3FPSA 3DBLA 2O4UX 5FL3A 1LU9A 3AESA 4RQBA 2Q5OA 2QW0X 1WJGA 1JJFA 1GXSA 1KFCB 4JUIA 1XVVA 4WKBA 3IB6A 4CR6A 3DMDA 1CY2A 2C96A 4DARA 5AW3A 1IMJA 1O94D 4LRUA 3T7RA 3UENA 2XGSA 3F9RA 3BK7A 1V3UA 3KZNA 3SBDA 3SKXA 4A8PA 3T3IA 4YJGA 5EEHA 3FHCB 3KKZA 2ZITA 1Q0LA 2JIBA 1N6HA 4H4EA 4UM9B 4I6GA 1UT8A 2JGDA 3TBKA 2BSAA 1P1FA 3H9UA 1FDUA 1YBVA 4PNPA 2IF0A 3FDJA 4KZPA 3UMVA 4J3FA 4JLAA 5BUSA 4FZ5A 4CDGA 4LJAA 1ZLXA 3PFIA 1N2CE 5CVCA 2ZSJA 2GTHA 3PXDA 2HMTA 3TIVA 2Q62A 4TN1A 4J0DA 4EGJA 1G4AE 1G3IA 3R7NA 5HTOA 3F1LA 3LLCA 5CFNA 3IHKA 1JYFA 2C4WA 4P22A 1Z13A 5EE9A 3UMFA 3FWPA 3ZDBA 5IBRA 3AVVA 2L19A 4GWGA 2X3YA 4LJ5A 2ORIA 4R1SA 4F4HA 5KDOA 5SYNA 1L4LA 2Y2VA 2IYYA 4KK4A 4CMIA 3N70A 1B6TA 2BFWA 2KM1A 3WI7A 1K7SN 4ZRMA 1GKIA 2R6ZA 1BDHA 2GCNA 2QRHA 3HFJA 1XCOA 1D0VA 2WU3A 4IDOA 1NY5A 4PWYA 4BYMA 3FN4A 4UXIA 3QVTA 4AYXA 1T5BA 3LUFA 2PO7A 3CX4A 4WESA 4I6JA 5FP0A 3RAFC 1A1VA 4DCNA 1QG0A 4DJ5X 3KKPA 3FI0A 3LP5A 5T3YA 4LDPA 4EO4A 2W6ID 2BE9A 4FEGA 2BM8A 4FBMA 4GXTA 2YV4A 4G4GA 4BGIA 3OZXA 2EHDA 5TR9A 2IRWA 1EUZA 1FFBA 2YW2A 3O2SB 4U7HA 2JFBA 3ZE9A 5CBPA 1DX4A 1EP9A 3U4CA 1CBUA 5HS4A 1P0PA 4M0FA 1IYZA 4MIEA 2Z9CA 3CNHA 3OT5A 2PH1A 4PCVA 4Q7KA 4QUGA 3V7UA 2J31A 4JB0A 1RM5A 2BZSA 2Y68A 3A1NA 1SQ0A 3WGOA 1HDIA 1T5LA 2VJLA 4KR0A 2DQSA 1PR4A 3GX1A 2R4UA 2VDUE 3P4UA 4G2NA 5FUBA 2OK8A 2BP7B 1ZZEA 4PFJA 5JBNA 4W9MC 1GKYA 3HDTA 4EJ6A 2QRUA 5HHTA 1WBBA 2RAUA 2R6HA 1AQ6A 3MGAA 4KN6A 4CKWB 4FOLA 2P9QA 3A11A 2AZTA 1USGA 1T9BA 2RC6A 4BJ6A 4CJXA 1EFCA 2IXFA 2P2NA 4RTLA 2V1UA 2X41A 3IB3A 2WOOA 3UG6A 3FVRA 3ICVA 3FW1A 1PJ8A 5FHQA 4Q9KA 4OUDB 4DA6A 1W30A 4P5EA 4YDQA 3DHVA 4DIEA 3KPJA 4HX5A 4AFNA 3RRMA 2C20A 3GLKA 1Y81A 1IIRA 1KVRA 3PEFA 4PSDA 4EPXA 1NW9B 3HNPA 5FH9A 2CV2A 3OQ1A 3HK2A 1WMAA 5GOZA 1URPA 4R01A 1GY8A 1Q91A 5K0FA 3RYHA 1WEKA 1RR6A 3EE6A 1G9SA 2PVSA 2VUTA 4X8MA 4Q9JA 1Q3HA 3AHEA 3FGPA 4CT5A 2Z2JA 3OUUA 1DG3A 3TZQA 1Z38A 3RREA 4LZNA 4Q1BA 1QBGA 4ZA2A 2MDTA 3MJDA 4R98A 3CRMA 4NK4A 3GMDA 3SK0A 5U9CA 1LY1A 1DWPA 3A14A 3VR4H 1U6KA 4DN6A 3ZY2A 1XZCA 2C31A 2Z8XA 4QQNA 2ZYWX 5C37A 1UJ6A 2UZ3A 3E9CA 3PWTA 1QSGA 1EESA 3TYXA 2Q3DA 1QE5A 9GPBA 1GKKA 1MGPA 1YJQA 2DKOA 3EDOA 5CXSA 3K0AA 2HF9A 2GVZC 2YWHA 3OD1A 3ZKWB 1QQBA 1XZEA 1X8LA 2G0AA 2M32A 3VPDA 3DBRA 3BBLA 1E2HA 1VFPA 2JVJA 4RJLA 1QYDA 3A04A 1RRPA 1VMKA 4PXSA 3ITEA 3FTNA 3VSEA 4JLKA 4U7WA 4NTZA 1Z7EA 1QO0D 2BZGA 4UNIA 4TS9A 1QP4A 3I2KA 1GU0A 3C8MA 4MR9B 4MHTA 2V74B 4PZAA 3SC2B 1MXFA 2I34A 5FULA 2JD2A 3ROXA 4WKCA 4LY6A 4ACAA 4FC6A 1U8UA 3UMRA 3PEYA 2NU8B 1TEVA 2ALJA 2PU7A 3VOTA 4ZICA 2NO0A 4L78A 1CF9A 1DQRA 3I34X 4HLQB 1BA2A 1H9BA 1YS7A 3JASA 3W8NA 3N39C 1K3FA 1S0UA 3L41A 4OD0A 2BL4A 4WFIA 3ZBPA 1N1GA 3RNOA 4RO0A 3ZDFA 3UOGA 4PX5A 4Y9RA 2YVKA 3DW3X 1USWA 3TQIA 2GF9A 4O5OA 3IUEA 1F2TA 1RI4A 2JH9A 3ZW9A 1OBHA 1ULUA 2PY6A 2YOFA 3H5WA 4M0UA 4ZZIA 1HOTA 4OA8A 1P62B 1UOEA 3LDUA 3LQ4A 4O2AF 1G8KA 2GQ0A 4TOIA 4F2WA 5J47A 4C88A 1W0JD 3Q0IA 4DLUA 4MQUA 5I5GA 4Q0MA 2ZB3A 3DHYA 4LV5B 4XCQA 1UP4A 5CNJA 4JVOA 5A2QA 1EWKA 1W5FA 3KTDA 4B2LA 3AIKA 3BS4A 3DEZA 4II2A 4N65A 1WQ4A 3FFBA 3S6JA 1RJDA 5E6RA 5AM1A 3GUZA 4EPVA 5CFZA 1AS0A 1WE2A 3NWBA 3QRWA 4L9RA 2C0QA 1M3SA 3EPJA 4GMXA 3ZK7A 4BNTA 2BMFA 3PHJA 3U3DA 1WVMA 1JHDA 4WY5A 3ZDYB 4C9BA 4CMEC 3T7CA 1Q17A 4UTPA 2I3GA 5SZJA 2CHUA 3PUHA 1YDWA 4YT4A 4JI7B 4JASB 4KH1A 1IJBA 2MT9A 4IV5A 4JA2A 4EI2A 1FPQA 3VR6H 4BFXA 4FFWA 2X8LA 1BWQA 2GAIA 2GZSA 3B3FA 1IUNA 4M54A 5EZSA 5K3BA 3VH4A 4WRRA 1W7AA 1SU8A 4FFRA 1QV7A 1I5OA 2OO5C 4RWZA 1TK3A 2WNSA 3K9FC 1I4OA 1VRWA 3Q7EA 3W79A 1RJ9B 3JQDA 3WYGA 4P80A 3QFFA 4MR8A 5BR1A 3HS3A 5T7BA 3FHTA 2A2ZA 3WIUA 1NVUQ 1G4UR 3U7EB 3DTVA 2IDJA 1VBMA 1MRNA 1ZK2A 1ZL2A 1FUYB 1E9EA 4MW5A 4XGNA 3DQQA 1JJBA 3LH5A 3W6NA 1FJGB 2ZZNA 2XE8A 1J49A 3AZOA 3MMPA 4G85A 3TL2A 4HD8A 4DA4A 2ZI9A 3W05A 5DK4A 1CEEA 4YQYA 4C4TA 1DAIA 3ZNOA 2IXTA 2ZRQA 1JWAB 1X9HA 1YB5A 1B15A 1GG5A 1EVZA 3FDZB 3FJOA 1KH2A 4FGLA 1ZC4A 2I2BA 1CG6A 1F38A 2XMDA 3EXHA 2C5EA 3PIDA 5FOSA 3GBVA 1YMQA 1HTTA 2CBZA 3IMFA 1E6WA 4K9PA 1C30B 3TNYA 4QGSA 1YCHA 3DAPA 2DQYA 1OTHA 2YV3A 1DEKA 2XDAA 4OM8A 4KSCA 1E3MA 4I3HA 2FJ0A 3DE1X 1KPHA 1ZESA 3UMJA 2J0UB 2VJNA 3DWEX 1LTHR 4GICA 4L27A 2F59A 3T41A 2W2TA 2CXUA 3ZGXA 2V3VA 1FXWA 4BO1A 1N2ZA 5CM9C 3CKYA 3KYDB 3MAAC 4LY0A 5IJ9B 2FDCA 1R4NB 1SBIA 2QVGA 2XRFA 2YNMA 1K8QA 2CLHB 3ENNA 4KDEA 5G0WA 1DAPA 4UQLA 1XQ1A 4BVKA 5CK5A 2JAQA 1E1DA 5FADA 2XNKA 5D6OA 4BQNA 4EHNA 1AVTA 1HE2A 3KYCB 3P0EA 1N8NA 2C5BA 1CS0B 2VRBA 5LXTB 1O8CA 2NPOA 2WZQA 3E9YA 5BUQA 1AE1A 1CUZA 3BRCA 3Q5EA 4MV7A 2NAPA 2WF5A 4MUNA 1BXRB 1N3LA 1DBVO 3VPCA 4QHYA 1GITA 2O1EA 3CJTA 3O7MA 4BVFA 4CKXA 1Q0TA 1JSRA 1SU7A 1THTA 1HC7A 1NVBA 3IP8A 2NSDA 3RU3A 3WMWA 4W4TA 1ZINA 3OEEA 1ISIA 4L7VA 3CLSD 4V3CA 4H0CA 2OXRA 1H8HA 2YRFA 3CUKA 4OVKA 3ACDA 2WG1A 4RVSA 5EFZA 4MUFA 3E15A 4L1KA 1FSFA 1XTBA 4ZGGA 1D4AA 2QLNA 1MO2A 4OY3A 3LT5A 4XUGB 3CN9A 4DNPA 1H93A 2J6BA 1GJRA 5T6MA 1PJBA 4LOKA 3V4VB 4RNDB 3R7WA 3NBUA 4ALJA 3GIDA 1N2IA 3PT9A 4ZRNA 3GVXA 1N6IA 3GT0A 3LAWA 2F6RA 3FTDA 4GI7A 4V0SA 1YDEA 3BN3A 4II3A 4YFVA 1Z4OA 3ZQJA 5ALIA 4Q03A 4P3XA 4JJ7A 2YZNA 1ILWA 4FT2A 3KEGA 2AJBA 1ZISA 4DJTA 1JQKA 3PPVA 5C18A 3NYQA 1DDGA 3PV0A 2ZB2A 3AJRA 1NXOA 1VB3A 3CEMA 3DMGA 2WG0A 1YQUA 4YRKA 1ULHA 1O4VA 3PRJA 4Q9DA 3UK7A 5C1OA 1L7NA 1E6MA 3H9EO 3F49S 4NONA 4GUAA 4X92A 3LOQA 2IE0A 5HMLA 3ZHVA 4OHCA 5H81A 4ZDKA 1Y42X 1B0PA 1OYVA 4WEQA 2F3SA 1VXRA 4ZRDA 2XVXA 4ZMSA 1CERA 5A5FA 1ECJA 1SHTX 1T4DA 3B6IA 3VKGA 4H7PA 3IDAA 5K3AA 2WLTA 3BHIA 3UMBA 5DKFA 2WJZB 1DLIA 3A36A 4JLMA 1T15A 4U2GA 1C3LA 4KKXB 3GAMA 5BWMA 5ICCA 1Z4JA 3P2EA 3NRCA 1UMBA 4YRPA 1KK1A 4XQGA 2JGLA 3BJZA 2XX3A 1ESEA 5D3MB 4DRYA 3WWYA 5FXMA 2IBSA 3SQWA 2XMCA 4N54A 5E38A 1G2QA 4JY7A 2FW9A 1DI0A 1FFXB 1MEEA 1DARA 3R76A 1USUA 3L1IA 3O82A 2PZLA 5FWAA 3BH7A 4TMTA 2PHZA 5H70A 1OXMA 3OA2A 1JDVA 4U5QA 2W71A 3H1BA 3MJEA 4Q66C 3VTKA 4O2BB 2NP6A 2O23A 4RORA 3YASA 1K7XB 1U8TA 3IEPA 2QJOA 5IJ9A 3LSYA 5LUAA 3PUJA 2WQ7A 2A3NA 3WLLA 4H1UA 1I4TD 4GPD1 4KQFA 1WV0A 4XM2A 2J4FA 3OURA 3E7XA 3Q12A 1CY0A 3PNMA 4F3RA 1QHGA 1XMOB 3ETHA 1IEQA 1TA0A 3Q3CA 1EJBA 2ZB7A 4KNVA 4P7JA 1RLMA 1C9EA 1PZEA 2FWAA 2WWIA 3NONA 3CE6A 4BJ3A 2LWIA 3PYMA 1QIEA 1TX4B 2G88A 1SCNE 1QUEA 2GA8A 1JMKC 3JYNA 4FHGA 3V4OA 4YWHA 1FY2A 2WV7A 5ERYA 3VZQA 3ZKAA 4AL4A 1OY1A 3UF0A 3VPBA 3I5XA 5JSUA 4MS3B 4PBRA 1RM3A 1QFMA 2Z04A 1OREA 4UUPA 5ALOA 3KM0A 3OICA 2HA3A 1ZGCA 4QUIA 5K3CA 2OGZA 4DS3A 3S8MA 3VV3A 3WIDA 1W4BA 2QAGA 1SZPA 1RI1A 2AOXA 3WGVA 4YRAA 1TUGA 3QA9A 1W85B 3BWDD 4GMHA 4ECAA 2AF4C 2G0NA 2IK8A 3BRWA 3EXEB 4ND7A 1NA5A 1T8SA 3PE3A 5BMOA 3D0KA 2H11A 4F86A 3HCNA 1V8BA 4FIDA 5KWIA 2FE1A 2H5JA 3E8XA 5FWNA 1NQAO 2O2HA 5E8JA 2ZE5A 1Z0KA 4ZMRA 3KQWA 2OMEA 2YHAA 1X7ZB 2QDXA 3KQVA 2J3DA 2OSVA 2GJSA 4XGIA 2JFHA 4YVFA 2YY6A 4KFTA 5LA6A 4B09A 1VMAA 2WJPA 1EHIA 2AKEA 2O8EA 1DXYA 3NNNA 3EMVA 2BGNA 1G66A 4NJMB 1MO5A 3PE6A 2Z58A 3WV4A 3WJAA 1LBEA 2G63A 3AP2A 3QFHA 3N07A 1BC5A 4OXYA 2VYVD 2H1IA 1QDUA 2COEA 5IUKC 3NC0C 3NV7A 1M5TA 1RAHA 4CQLA 1D1PA 4M98A 2YXBA 4Q82A 3M4JA 3GT3A 4CLRA 5DYTA 1HUQA 5JJLA 5JALA 2LP4Y 3COZA 4BAZA 2CXSA 3G2HA 5A4MS 3O3MB 1SOUA 1E9AA 3H05A 5CDFE 3PXBA 3R44A 3ER8A 3F3KA 2R25B 4IUCS 1DOHA 3PZRA 2EVWX 4D3FA 3Q10A 3OIVA 1CQIA 3TCNA 1H2ZA 3F2VA 4D9IA 3IH5A 4LXHA 4O4HA 1EXMA 1CJCA 4KUEA 4DNFA 4L3VA 4BNMA 3S2YA 2P9BA 4PU0A 4XUCA 3NM6B 1S4QA 4GM1A 3N3AC 1IZ9A 3FCOA 1GPH1 4LCEA 4ERNA 1QB8A 3ZCQA 4RAOA 3A9TA 3RU2A 1BJRE 5TPZD 3BXPA 5IKMA 1PK9A 1TC1A 2FEXA 2GPTA 2HLDD 2CF5A 2V3CC 2CLLB 1YJ8A 1JYEA 5IC4A 3Q3IA 1TD9A 1ZUD1 1WCXA 2FEMA 4KN9S 5FLKA 1QH1B 3QYPA 4JQOA 1RQLA 4L8LA 3AVXA 1RLTA 3VR1A 4WWHA 5EHZA 3WX0A 4X3PA 1X13A 3W8RA 1T6XA 4DR2B 1GZUA 3O4GA 2DLCX 3S2FA 2DPLA 3K1JA 3C16C 5HIIA 1J0EA 1PEDA 2W4QA 4O1HA 2BEWB 3EHEA 4PYNA 5A4AA 4DDTA 4IEEA 5BRNA 4GEKA 3TLGA 3WJ2A 3LOPA 3A05A 3QJYA 1HDYA 1R0BA 2B1JA 3DLCA 1PEYA 4KX5A 2BDTA 2V5AA 2YVUA 5F78A 4HNQA 4F3CA 4QNNA 5CT4A 3ZIDA 1NX9A 3Q6IA 4J7XA 5IK2D 1NV8A 5ALLA 1KXJA 4RY8A 2RIPA 3W2EA 3L79A 1KR5A 4EELA 5BSWA 3PX2A 1G7TA 3BQMB 4C6TA 4L5BA 4JQSA 3V4ZA 3SEFA 2QVXX 5DNVA 1IN7A 1X1BA 5SZIA 2R1VA 3KHUA 4PGAA 3LHKA 5CDYA 3SYLA 2X0DA 1YKGA 3OQVA 2B1RA 4DAEA 1JWLA 1BU8A 3G2PA 3LVBA 3B85A 3W5VA 2N75A 1D2GA 5JI2E 1EWTA 3LK6A 4QRIA 3VDMA 4ATNA 4BO0A 1NVEA 1O58A 2X7JA 5GV8A 3E8SA 1QZTA 4O0MA 4ESVA 4UFOA 5EKSA 2HCBA 3H5RA 2E0IA 4CG2A 4BKUA 3WK7A 4EB0A 3M83A 3MINA 5E4TA 5EUBA 3SCZA 4F6CA 3OPXA 2OCAA 5JC8A 1EUYA 1KEVA 1NXVA 2JIDA 5B3JC 1ZKDA 3VUEA 1IG0A 3EOAI 1CUCA 3GCZA 3VR5A 4DDKA 4QIHA 5DT9A 1NZDA 1QGYA 3JW8A 1O96A 1VGVA 4MLDA 3CW9A 4CWAA 5LA6F 1R37A 1XO1A 4FR2A 4JB3A 4EPWA 3V8MA 2IDZA 1TW2A 2AK3A 3DVQX 2JFGA 2OM6A 4IO0A 1PHRA 5EERA 3T3EA 1Y5MA 3KC2A 1X1EA 1OBOA 2HIAA 2ZJ8A 3FKJA 4TVSA 3WIEA 3KL4A 1SUWA 1E63A 1Q15A 2ILTA 2CZCA 4QASA 4RHYA 4DHEA 4WXPA 4DLKA 4UNQA 5JWHA 1OV6A 4HQ0A 2FQWA 2VFAA 3A9UA 1NN3A 2JEZA 1NMZA 2WPDD 3D4OA 1UBHS 3PNSA 4BNIA 1RI3A 4PO3X 1I2MA 2PUVA 3BD8A 3WNVA 3AVPA 4LJ6A 2R00C 1CNFA 3O03A 1KQPA 2BT4A 3DE7X 3NANA 2ZUVA 4KI7A 4XDGA 4ZPXA 1EFVB 3P19A 1A0OA 1AUQA 4PPFA 2AEEA 4WW0A 1DQPA 3KWFA 1QGAA 2VNJA 3C3PA 4XRRA 1HZZA 2NWQA 3WRWA 1E98A 2PWZA 4I4LA 4U7GA 5HIJA 3N53A 3ENZA 4MI6A 2DUJA 2SCUA 1GKLA 1ZAYA 1D8TA 3GO4A 5PNTA 4D0GA 3Q85A 2AR7A 1LPBB 2CXHA 2XD9A 1TO6A 4JSYA 4Q3NA 1R0CA 2BUBA 4WACA 3R5JA 3X2FA 1KQGA 4PHCA 1RQPA 1D0IA 4UVGA 1UWCA 1U6IA 3VYTB 1A77A 4E4YA 3N8IA 5A4KA 2IE8A 1N36B 1C8VB 3E9DA 2A4KA 5H68A 2IHUA 4YV1A 3U1BA 1ZL0A 5LU8A 4IFIA 4A3SA 4J7UA 2XUGA 5JU6A 4H1TA 3OA0A 2RAFA 1VRCA 1S8NA 2CE2X 1XWWA 3LCJA 1QORA 5D6NA 1NVDA 4A0GA 4J2HA 4EB3A 1THZA 2ID8A 5AO9A 5CDTA 4OQFA 3A4YA 1Y8QA 5CVDA 1BTOA 3HYSA 4FILA 3U09A 3GROA 4JYZA 4RHCA 1G20A 2PKXA 2PDAA 1K5DA 3MUOA 3B13B 1NF8A 3N8HA 1SY7A 2H2AA 4XASA 3HY4A 3WB0A 1JFTA 2AJTA 2JCYA 2VDVE 4RGYA 4QGHA 2FEAA 4GQBA 4Q4LA 3CQ9A 4NULA 5CCDA 3SDZA 3W8EA 1LEHA 5KU7A 3U44B 4QGBA 2WT9A 4RVNA 1RBYA 3GFSA 5BYJA 4BOYA 3G8AA 1N7IA 4O1MA 4IY1A 3D4PA 3FBGA 4DCSA 1GPDG 2I8CA 4QC2A 2ZIEA 2P7HA 1LZKA 4IHQA 1OWOA 4KC0A 4UPVA 4IFEA 2XB6A 3T1OA 4DIUA 4IKPA 2PRJA 1RXIA 2CHQA 5IM4A 3R5TA 4I08A 1FS5A 3UKJA 1GNRA 2C2WA 2H4WA 3NFRA 1ZQ9A 2FF5A 2H31A 2PT7A 5AKYA 1J8FA 2ZUDA 4Q1EA 4AP9A 2F8SA 2QZZA 4Y2TA 4XXHA 2GEVA 4WJKB 4PLVA 5JNUA 3O4FA 3ZJVA 4L6IA 3BMNA 5I9TA 3QFCA 5AI5A 4DIDA 4F2GA 1OIVA 4MWGA 2ZR7A 1E2PA 5BSHA 2DG2A 3RV4A 2WYHA 5AWFC 4HEA6 1WSAA 4L0CA 4GBMA 1B41A 1TKAA 3L0SA 3USZA 3GYGA 3DBOB 4MMXB 4WBNF 3A4NA 5DBIA 3PYXA 4D99A 3CVXA 3P9IA 4D8TA 3VKHA 4MSUA 3T1HB 1ZKMA 4CBVA 2GDZA 2I7XA 1L7EA 4J1TC 1XYGA 4RVHA 5CJ2A 3PDIB 1E2IA 1VKOA 3PICA 4KOAA 1RZUA 1H05A 1IY8A 1E2KA 1U7ZA 2ZCVA 3GC6A 4P7BA 4LDAA 2GZRA 3K9HA 2WM3A 3BEOA 1J42A 3KP1A 2A5LA 3R2JA 5DI9A 4AZTA 1UWVA 2IXGA 1DFIA 2H1LA 4RLFA 3EG9B 3LG2A 4MKZA 1T8UA 4GLLA 1A97A 3PENA 4N0QA 3GXOA 4RPGA 1ZIOA 5DH9A 4BIMA 4DIBA 4DZTA 1U63A 2BJWA 5C31A 5BN3A 4MWOA 4RLSA 4KRGA 2QK4A 1V6AA 3BK1A 3BWVA 1ADGA 3DV0B 3RJ9A 1X7XB 2ONYA 3ORQA 3VR2A 1P7VA 1CNEA 2GCEA 2HSJA 1A04A 5F33A 5AXCA 4A16A 2J3QA 3CIOA 4MROA 4F3YA 1C9NA 3D8HA 1KJWA 4R0NA 1HT1E 2YV2A 3INTA 1N0VC 3FUVA 3LP8A 4ZOLA 3HUDA 3LUKA 4S12A 5GM1A 3SZUA 3BT7A 1GZ5A 1WY7A 3RJTA 1EMDA 1TKRA 1Y3CE 4PIVA 2XVMA 3T5PA 2A0YA 3ZV6A 4RACA 3SDSA 3R8CA 1UBEA 4WJLA 3LC0A 3QBTA 3D2BA 2X0FA 4H7KA 3NYWA 2XDWA 5DYWA 4TVBA 1E3QA 1Y3BE 3BCUA 3GHHA 3ZH9B 1C4XA 2VQ3A 3ZDAA 1T9GR 2GNOA 2IP1A 3LHIA 1GGFA 4QAQA 2ANBA 3TEMA 2W7TA 5BN5B 3W3AD 1JDBC 3CPSA 3RTBA 3AW8A 3EQ9A 4AJ1A 4O25A 1EP2B 5JCOC 3GOHA 4W1RA 5AM5A 1MOPA 4FJ1A 5KTYA 2QMHA 1PVDA 1LBHA 2R84A 4TKUA 5C34B 3AVTA 1L3IA 1ZUNB 2GTIA 4TRNA 4OHYA 3A9VA 4OHFA 2BCEA 4C7VA 1SCKA 2AC7A 2EJWA 4BWYA 3LLSA 4TYPA 4X66B 1QB7A 1PHPA 2C78A 3HLYA 2B2NA 5D3QA 1TTPB 4UHHA 1L1FA 2I4TA 3AOGA 4AT1A 2I7CA 4TV8F 2B6NA 1E2JA 1IOWA 5HZHA 1NUQA 5AJZA 5IYZA 1M6NA 4JUDX 1ECGA 4IOMA 2K7ZA 4GL4A 3SHWA 1Z2OX 2MYNA 5ETJA 4JYCA 4HLDA 4AXBA 3VC3A 1B16A 1Z6AA 1RP7A 2B78A 2ZYRA 1B93A 2VJKA 3WNBA 2F00A 4QEKA 3G9ZA 2BE7A 2YTZA 3O7WA 4G23A 1IVSA 1JZQA 2XHZA 4NI5A 4RV9A 4CN8A 1FA9A 1K06A 3ZJ5A 4EYKA 4YJ3A 4HVCA 2XJ9A 2X8WA 2EZ4A 3VZSA 1BA3A 2O5VA 1VPTA 3K1YA 1R9MA 1JKXA 2BHSA 2QP9X 4HO1X 3A4IA 3I12A 1AN0A 1K2WA 2QPAA 1JB1A 2D7JA 2CB0A 4BNVA 4N5MA 1ZH6A 3OQOA 4YMTA 5AMXA 1RJGA 1UKCA 3JS5A 1EFLA 1N6OA 4Z8XA 5EKTA 5IW8A 4H6PA 3WBKA 3L0BA 5KQSA 4IZHA 4YCDA 1Z7WA 1G5TA 2HH9A 5A9SB 5KWEA 3DPUA 3IEMA 3UV3A 1ZNQO 2X8JB 5IU6A 1VBNA 1M34E 3DHWC 2DQ4A 1LSUA 3VKUA 3PS9A 3HDGA 4KVZA 4QPDA 3ZI7A 1N9GB 5DX1A 3I05A 3HNOA 4KIFA 3SQLA 4M4SA 5HQ3A 1XRLA 4EHDA 1QF9A 1G21E 1ZN9A 3LS2A 4AO6A 3S3TA 3EY9A 1GPWB 4QG3A 1C4KA 1HH4A 1QLJA 4DUZB 1J20A 2NU7B 1QKKA 2QY9A 3DFUA 3PFFA 1TJYA 4MW6A 1P5FA 1RXYA 4UUOA 4L22A 3HY3A 1IN5A 2O3TA 1RCUA 2VBIA 1XXLA 2XBUA 3E22B 3IBFA 4YYEA 4C20A 5IZCC 7GPBA 1AJEA 3QVMA 2QRPA 1LWNA 1PGOA 1ZVMA 2DJIA 4RK5A 4BQSA 4FKZA 1XTPA 2XWJI 5FLYA 3CG0A 3HSSA 1EFUA 1NLUA 2AA3A 4W1QA 1QVWA 3G6WA 3O47A 3T4XA 1SC3A 3TRFA 4D6XA 4DG8A 4HNAA 2DPXA 4LG1A 5F7XA 1RHRA 1L1EA 2AXNA 2QLLA 2X0KA 1TPYA 1Z0ZA 2YICA 3PA6A 4I1SA 3ZKWA 4ZYWA 4XDYA 3BE5A 5KOJA 4Z53A 1G2IA 2I4IA 3DFFA 3K09C 2XT0A 4G89A 1XRJA 5K3SA 1E20A 1JG2A 3RTGA 4FNOA 3SC2A 3EZ7A 4B71A 2B5OA 4WOBA 4BGUA 3B2NA 2G5CA 3GLUA 4S2EA 4YCJA 1YASA 2WJVA 3COYA 2KHZA 3U6KA 1ORDA 1GQFA 4EKYA 2EF1A 2F17A 1TUBA 2FPGA 3O8RA 4TKMA 3TOCA 2V6FA 5JUWA 1LDBA 1V1MB 2QJTA 3A1CA 1ACLA 1TZKA 2CUZA