3JSXA

X-ray crystal structure of nad(p)h: quinone oxidoreductase-1 (nqo1) bound to the coumarin-based inhibitor as1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
270
structure length
270
Chain Sequence
GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and biological evaluation of coumarin-based inhibitors of NAD(P)H: quinone oxidoreductase-1 (NQO1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords NAD(P)H dehydrogenase [quinone] 1
total genus 80
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3jsxA00
3K20A 2M6RA 4C76A 5LVAA 2QX9A 5EMNA 2Z9DA 1KBOA 2FX2A 1ZWLA 2X2OA 3W78A 5B3LA 4BMPB 1YCFA 3HA2A 1XT6A 3NHYA 5ULLA 3KLBA 5LJIA 5LLDA 2QMZA 2X2PA 4F8YA 4FX2A 1YRHA 4Y9RA 2V9CA 3OX2A 4YAWA 5NULA 3W7AA 4YALA 3OX3A 3KEGA 2OHIA 1D04A 2Q9UA 3P0RA 5F51A 2A5LA 3ESYA 2MT9A 2M6SA 3OJWA 4FGKA 4DIKA 5LBUA 1XYVA 3B6IA 2FZ5A 4FGJA 2QX4A 5BUCA 5FUQA 2FOXA 4BMOB 1YOBA 1YKGA 4ICIA 1J9ZA 2FZVA 1AMOA 4N82A 1CZNA 4QOIA 5LBTA 1JA0A 4J8PA 5F4BA 4CF6A 1AKWA 1GG5A 1CZKA 1V4BA 2Z9CA 5LJLA 5B3KA 1SQSA 2Z98A 5EAIA 3GAMA 3N3BC 1FLDA 1RLIA 2OYSA 4YQEA 4LAFA 3EDOA 2V5VA 4H6PA 4C0XA 1FLAA 2QX6A 1AKQA 1CZLA 1RTTA 1T0IA 3B6MA 1AKVA 5EA2A 2FAXA 3FX2A 3GFSA 4CETA 2KQUA 4YAOA 4QOHA 3ZHOA 4DY4A 1NNI1 3B6KA 2MOKA 3NLLA 4LTMA 3LT5A 4PTZA 3NHRA 1CZOA 3F90A 3QFCA 4ESEA 6NULA 4LTDA 1CZHA 2FVXA 1DXOA 2D5IA 4NLLA 5LMCA 1OFVA 1CZRA 1QBGA 4LTNA 4ZVKA 1BU5A 5NLLA 4GQIA 3JSXA 2KLBA 2QMYA 2MWMA 2HNBA 3B6JA 2OHHA 4H2DA 1YDGA 4S24A 1YCHA 2R97A 3QE2A 4R81A 2QWXA 4ZVMA 2R96A 2OHJA 1DX9A 3FJOA 1FLNA 3NHLA 2AMJA 1VMEA 3F6RA 4Y9UA 3TE7A 1JA1A 4PU0A 1C7EA 2HPVA 1B1CA 1AZLA 2Z9BA 2ZKIA 3FW1A 3KAPA 4PTYA 1OBOA 4YAFA 5F12A 3W79A 1D03A 3RPEA 3UXEA 1RLJA 4C14A 3N39C 3F6SA 3K1YA 3OJXA 3UXHA 2WC1A 3LCMA 1AKUA 1TIKA 3OVMA 2B3DA 3R6WA 1SG0A 5FX2A 5TGZA 3G5MA 4N65A 4Y7CA 1YCGA 4NULA 4GR9A 3ES9A 3ESXA 3W77A 4ZVNA 1H66A 2F1OA 1FX1A 1CZUA 2BPOA 4QOFA 2XOEA 4QOGA 3U7IA 1AHNA 3N3AC 4U7GA 3TZBA 5FA6A 3FNIA 3O2NA 1XYYA 3QFRA 4C0WA 1BVYF 1FTGA 2FCRA 2Q62A 3ESZA 3GFRA 3GFQA 2XODA 5JROA 1J9GA 3NHUA 2W5UA 4QOJA 2QR2A 1QHEA 2HNAA 3NHPA 1FUEA 1KBQA 3NHFA 4FGLA 3NHJA 4OXXA 1TLLA 2ARKA 1D4AA 3U7RA 4ZVLA 1OBVA 1AG9A 1J9EA 3OWXA 4HS4A 1FLVA 1ZX1A 2GSWA 3FVWA 3NHSA 1AKTA 1X77A 3KAQA 4GI5A 5A4KA 4D02A 3SVLA 1FVXA 2BZSA 1I1OA 2BMVA 2FLVA 3D7NA 3S2YA 1E5DA 1H69A 2V5UA 3HLYA 3NFRA 4N9QA 4U7HA 3HR4A 2FDXA 4YAUA 1AKRA 2BF4A 4QOEA 1J8QA 4XDGA 2MTBA 3EYWA 3L9WA 1DXQA 3NHWA 4DILA 1RCFA 3L9XA 1T5BA 3F2VA 4LA4A 1QRDA 3OX1A 1F4PA 2BN4A 4M0CA 3TEMA 3OWHA 2RG1A 2QX8A 4U7FA 1WSBA 1ZWKA 1WSWA 1QR2A 4HEQA 4QODA 3NHKA 3O73A 4XDHA 1C7FA 2N1MA 1XI2A
chains in the Genus database with same CATH superfamily
4J0EA 4WOCA 1T0BA 3S2SA 3RUAA 3MPOA 3IAFA 2YTZA 3M4XA 1OXUA 1YDWA 2A88A 2QQFA 1PT8A 1SQGA 1U1CA 2QV7A 1A72A 1NVWQ 2VAPA 2RAPA 3A06A 3ECAA 3MJSA 1Z17A 1DADA 1L5HB 4KWIA 2FSVC 3TKLA 3G17A 4BU1A 3VHXA 4LYGA 1EK1A 4B48A 1EA7A 1NW5A 2N42A 1A4UA 1R9NA 1U7DA 2VSQA 5JY1A 2ET6A 2PKYX 3UUEA 3IAUA 2XHEA 2HK6A 4YCBA 2YOHA 3GRKA 2VQFB 3RV3A 4YAIA 2I2BA 4OM7A 2H8KA 5EOVA 4XEUA 4B73A 2D6FA 2AOTB 4UAJA 4KXQA 4NFHA 4M36A 3O9MA 3BM5A 1W88B 1K08A 1OYOA 3ZNQA 2VVTA 3FPBA 1DBRA 1KERA 3G2MA 4B3SB 3VVMA 3WGOA 1PUIA 5H68A 4DC1A 2Q3DA 4I1IA 3GAMA 4WGGA 4CIXA 4GP9A 3JYHA 4J75A 4I36A 4D45A 4C0XA 2OZLB 1DDGA 4GM1A 2NO0A 4TXLA 1F14A 2CLMB 2ZTMA 3ASYA 4MQ6A 4EHIA 4XVHA 3TBHA 5DLEA 5KNBD 1GQOA 2D74A 4IF6A 2VR1A 4OGKA 4PRYA 3WKAA 1THGA 1ARZA 1CS0B 1P2TA 2BM1A 5AJWA 3O4RA 1EGAA 1CRPA 2HEGA 3GA5A 4JLUA 3TJMA 4OXIA 1QO0A 3EPHA 1WU7A 2RK6A 1CR6A 2ZROA 2BBTA 2I7VA 2J4CA 3IBYA 4S24A 4BMZA 4UQLA 4CM8A 1ODSA 5TQ2B 1A98A 3DS8A 5C7LO 3PUXA 3QPCA 1YKSA 2PFSA 4BVKA 5C8ZA 2J3JA 5CMLA 4ZI7A 4CF4A 4QEDA 5ADWA 2FLWA 4D3YA 4X8MA 4E08A 1Q0SA 2UZ4A 3IOCA 3FTQA 3UXEA 3NTXA 3SF8A 1OHHA 3OEED 3B78A 2VP4A 4IV5A 3RIXA 3MG9A 4D97A 1GV0A 4ZDWA 3IKVA 4NDZA 5K6TA 4PX2A 3SIPA 3O5AA 1WUTA 3PNMA 3WLJA 4BVAA 4D0GA 3Q8MA 1AXGA 1FRQA 1HEUA 1Q15A 3SFVA 1XA4A 2ZXEA 1MIOA 3W04A 4EGCB 1EGHA 1EHCA 1P0IA 1PL8A 2WJWA 3OLVA 4RXUA 4WRRA 2OSBA 3TZBA 5JADA 3DXYA 3IAS1 2G9ZA 4NU6A 3EQ9A 3GD7A 3KEOA 4NMWA 4PHHA 4X5OA 4A8HA 5HZHA 4DA0A 5JEEA 1XZQA 4JBLA 5KYUB 4CIAA 4X6YA 3GLGB 4TL8A 1U6KA 5PGMA 3UHPA 3H9QA 1RC0A 3EFBA 4BFWA 1ZD1A 4GR4A 4P36A 3R4VA 4EW3A 4C0AC 3F6PA 4N8SA 1ZR4A 1ZI8A 3HBAA 2AFIE 2F43A 1AS0A 2DMRA 3DM5A 4MRPA 4QXAA 3RASA 4YJHB 5JYEA 3EISA 2W0MA 3C6ZA 3AVXA 3L8MA 4ZO6A 1ETHA 3DHNA 3NT5A 2E5LB 3C4QA 3KQLA 4P83A 4IDDA 1XRPA 1IRIA 5KQMA 4A27A 3K71B 4HWKA 5KDDA 2C3UA 2P2SA 3PRKE 1P5JA 1VJTA 4HPXB 4KLZA 1JEAA 1JPJA 3O4HA 3VR3D 3E8XA 3FWKA 4CMAA 5E4YA 2OK7A 3V7NA 2J4DA 3IA7A 4LDJA 1Q6YA 3H2YA 3HY3A 3CLRC 1S1CA 2D7CA 4MROA 4G0WA 2FX2A 3NKVA 3D8UA 3REQB 4MARA 1IRXA 2B34A 4M7PA 1KE1A 3T5CA 1DJMA 4WCFC 1ZL0A 3QHQA 2XADA 1NNLA 3NH9A 3ZY6A 3WYGA 1SEPA 4ENTA 2BTEA 3ILVA 3R3SA 2M1XA 1Y1LA 3SR4A 4E5KA 3R77A 3VNVA 1VLMA 1HDCA 3SEQA 1G3MA 3CINA 1GNVA 5A3JA 1T5LA 1VIAA 3WP1B 1N3BA 2FW1A 2IKSA 2W00A 1BFKA 3WL7A 5GTDA 1UKEA 1T3SA 3ADPA 2C8KA 3OQBA 3P19A 1GV1A 4DKJA 1X1TA 2P75A 2QVLA 4AJ4A 5KCMA 5IZCC 5LN1A 5TQ2A 1LW6E 3DEHA 1ODKA 3KJNA 3GDOA 1CJSA 3HQ4O 4ZZ3A 1RLIA 5BN5B 4TYWA 4B3RB 1G3QA 1RS0A 4IUCS 4KODA 2WV7A 4OHFA 1W1WA 1B41A 4RACA 4YS6A 4E5PA 1SD5A 3U7QA 1LKZA 2PPLA 4QRHA 1Z5ZA 3ABOB 1IOLA 4MUKA 2AFHB 2FMTA 2PGOA 2WF6A 3H13A 2UAGA 3WQSB 4DQDA 4N41A 3L5OA 1XV5A 5DNVA 1XVUA 4AICA 4GWGA 2QNRA 1YJQA 3UB3A 3ZE9A 5CBPB 3D2AA 1CDDA 3FI0A 3ZDQA 1ORDA 3UJBA 2CUKA 3F6RA 4EHDA 1JA1A 1C7EA 1T6YA 1NVMB 2W2KB 3F5QA 2V65A 4MW7A 1PZHA 2HA3A 4J0KA 4AZSA 2QZJA 1T1JA 1Z8FA 2CZQA 2QAGB 4AJNA 4HFJA 1TIKA 2RH9B 1W47A 2B3DA 2OO7A 2WF8A 5HP4A 4LJ6A 2AG8A 2ZTLA 3LQQA 3PD0A 1GPMA 1HURA 5JUWA 1U0BB 4ITRC 2FN8A 4L9AA 2DZDA 3DBOB 4K46A 5I4CA 3EVEA 1H2EA 4QSMA 4RJLA 3PVZA 1XRLA 2IXGA 3L8EA 1TMGE 1N6LA 1GDDA 2AHRA 2AR7A 3KT3A 1VB3A 4R69A 4RWZA 5DGHA 1TYDE 3WLTA 5FWDA 4AZ0B 5KREA 5EINA 3TXYA 3QJGA 3W8DA 1AJEA 1GSOA 1X80A 1C0EA 2DBZA 2BZ0A 1QH1B 2X9QA 2J7KA 1ZGZA 4REOA 4B3DA 4KQFA 4FMCF 2ZDHA 3NHJA 5EJGA 4EI7A 5JXWA 2UXCB 2BDUA 2ORVA 3MEQA 5C1BA 3DOHA 3HEAA 4HTAA 4CLEA 2JRLA 3CCCA 4D42A 2UVPB 3N0XA 1GRVA 3S2ZA 3QEMA 2ZI5A 2DT8A 2FWAA 4I19A 4ZPJA 1KOFA 1PJBA 2W22A 4BP8A 4ZHQA 1JYSA 4M9SA 4KWEA 1RJ9A 1FP1D 2R47A 3QOWA 2H85A 2WMNB 4HAXA 1ZA2A 4JN6B 4NICA 2WHXA 3QVUA 4WNIA 1K8XB 2WFAA 1UKVY 5IDYA 4B6JA 3LRPA 4PSAA 3TNFA 5TQ0A 5C4MA 1CP2A 3JPYA 3ZQKA 1JNXX 4MS3A 4MW4A 5JSQA 2QJRA 3BZUA 2FDRA 3GC6A 1FSFA 1VHJA 3UJ9A 4N5IX 5H3HA 2CNKA 4RTKA 3SHVA 4DPLA 1BCSB 1EVIA 1KQ3A 1EX1A 2V3VA 3ER9A 2IHKA 2WT8A 1AGNA 3DMDA 1JXMA 1QANA 4S1PA 2NU7A 2MR6A 1ZCAA 2HMAA 4JDUA 3RBVA 5KKCA 4YACA 3WGYA 1C0IA 4RTRA 4Z3DA 4YV1A 3K5PA 1IJFA 4L51A 1GPLA 3ZC3A 2RJOA 3FYCA 1POXA 3VTAA 5JCJD 3QKSB 2XIJA 5F76A 3EVBA 4ZCTA 5JISA 4OHRA 2Q6TA 2GAAA 4G1BA 3FWHA 1E7YA 4MQFA 1NQUA 4BNDB 2UYQA 2NG1A 1P31A 4DIKA 2CDCA 3IKLA 4HYEA 3VU9A 1XEWY 2NXEA 2B78A 1QONA 2VRBA 5DU2A 1QVZA 2PTHA 2RKOA 2RHRA 1PR2A 2ZBVA 3JVIA 4V2UA 3I04A 2BKLA 4INOA 1KYTA 4C5CA 1DAIA 4KTVE 1JJAA 2A8YA 4OP3A 2QPOA 5DZSA 4LOKA 1T4GA 1QIKA 2GK4A 2X5XA 2DY1A 2J0UB 5ALUA 5ALYA 4DJ5X 1AKQA 3C6XA 1UPBA 4W5NA 3EAGA 4KXWA 3EZNA 4UTOA 4EX6A 1E5VA 1CS0A 1UC4B 2O1XA 4I81A 5F5NA 2VAVA 3W2HA 2ZRLA 2RGAA 1T6XA 1OIWA 1E6WA 3F90A 1O0BA 4RFSB 1NYRA 5T8KA 1G8HA 2WUWE 2X9LA 4RFLA 5F77A 4D3ZA 5DNCA 1FTNA 5EJAA 4DCTA 1I3LA 3HNPA 2IZ0A 4LYHA 4N5DA 2XCIA 3E58A 4R9SA 3DMGA 2D2VA 4L4XA 2QUBA 5KX5A 3SQWA 3TSOA 2QIPA 3MCAA 1J70A 1KMQA 1NM5C 1BAPA 1AKNA 1FDUA 4C14A 4C29A 4JB0A 3WJAA 1XCMA 2J6CA 1RBMA 2H9AA 2VYQA 3KD2A 4ME6A 5H82A 1XRRA 2ZWIA 3RPEA 1EUYA 2CLOB 2A58A 3AP3A 3K09C 3PNKA 1M6YA 2L17A 4FT2A 2NACA 4FB5A 3CLHA 1WPRA 2QSZA 4Q7JB 5EWMA 4DV3B 4XSVA 2LPMA 2A0WA 1UMCB 1NOIA 1UDBA 4O6VA 4GPAA 2A0FA 4TRJA 1GQ2A 1UZAA 3PQCA 2FPWA 1UM9B 1XX6A 1ZMRA 3PC2A 1VMIA 3AL3A 4I4TB 3AHJA 1VTKA 2Z8YA 1UXKA 3ZJTA 2FN3A 3EVTA 5HTOA 5DSXA 3ORFA 3AW9A 5DB4A 4EF4A 4PHFA 1OZGA 4IO1A 1TW3A 1ODIA 3CH6A 5JD4A 3ZY5A 1C2TA 1RJFA 4X6LA 5CVDA 3L6RA 5G40A 4U7DA 2WWHA 4RHCA 3NC0C 2ZS8A 2QW8A 4JCCA 1C9KA 3V4OA 2XLBA 3KAQA 3LXRA 4OA8A 4XM1A 5CHEA 4F4UA 1NLUA 4TKVB 1KVSA 3TLJA 4GXQA 2P9ZA 1IUNA 3ROTA 5HVNA 5EIHA 3T5AA 3A6HA 2OLJA 4IQGA 5AHKA 1WWKA 2MYNA 2I3AA 3VAYA 4HAIA 1RAFA 1W8DA 3D3QA 4MW2A 3ROKA 2ZPUA 3AONB 2WJGA 4FHCA 5DYYA 4GO1A 1VIVA 3SYRA 1EP1B 4DEXA 3KQUA 4BLVA 5LMNB 2X58A 1SB9A 3F6YA 3KYDB 3R09A 3JAKB 5JSZB 2MIIA 1WB4A 1S2IA 2XCLA 4KR7A 3FMPB 4AKGA 3HR7A 1PJ4A 2PS9A 4CW7A 2YW2A 2PVPA 3DJYA 3LC1O 3REQA 4PNHA 2WSSD 9LDTA 3WLFA 1G4HA 2ZRDA 4EUSA 1XQ9A 5MN6A 4OJYA 4OQFA 3O2SB 4QSHA 2OOKA 3VPGA 3M9XA 5K0ZA 2DBQA 5AP9A 4NQRA 5IC6A 1VJ1A 2VZLA 1T2NA 4M86A 1KGDA 3W34A 5ECYA 2ZRPA 2YWHA 3ZLBA 1CJUC 1P62B 1BXGA 1NATA 1OTYA 1V4NA 2X7XA 3MAGA 4CUZA 1Q3KA 1TJ3A 2COEA 5ALSA 1XWFA 1MQSA 5IXSA 4KLNA 1ESCA 3IRUA 3UOGA 2GEJA 1HPLA 4MWEA 5CW1A 1J23A 3C41J 2H7VA 3EUWA 1KO7A 2IS2A 1I3CA 4TYQA 1V3QE 4OHXA 3QEMB 1CZKA 4KDEA 3U26A 2MSLA 1M0WA 4HGZA 1QVRA 1HMPA 2H1SA 3AU8A 3G5TA 4HDNB 2G17A 3QLUC 2X2EA 3GPCA 2V5VA 3NVMB 4EHBA 3UKJA 4G5YA 4CR6A 1N32B 1WABA 1R9MA 4YI5A 4D5EA 4EKGA 1JBKA 1Z8HA 4R6XA 2QMQA 2YIJA 3PUKA 3VX3A 4K3UA 2QRPA 2UUAB 3TOVA 1MUUA 4BMSA 1IDOA 4ZCSA 1BFDA 1NXVA 3KUXA 4KN8A 3H2BA 4NMXB 3W5VA 4BV8A 2KLBA 3ND8A 4X85A 4YRPA 3R7WA 1Z7WA 1YIAA 3C7AA 5ALWA 3ZI7A 1IVNA 1VRVA 1NUUA 1ESMA 3PWZA 4M1YA 2VK4A 2Q1XA 4MUNA 3TTTA 4BQSA 1FLNA 3IIMA 4HEJA 5ESXA 1E2LA 1NVKA 2ZATA 4KFRA 1KZ7B 3W5UA 5B12A 1ES9A 2CJWA 4IHJB 2EZ4A 2KLHA 2MU1A 2WZCA 3O4FA 1XZCA 4HKTA 4P08A 2QZ9A 2P41A 3KQTA 3N86A 4F86A 1LPNA 5L45A 3TF5A 2ZJ6A 2IDZA 1EK5A 3AJ8A 3QEAZ 4CEHA 3R6WA 1ZINA 2J67A 4L2IA 4TTSA 1DIRA 2YFQA 3CU5A 4LZWA 4TQUS 3RSSA 1NTOA 2A9PA 4RVFA 2QR5A 2HF9A 2OV6A 4GI7A 4KWHA 1I2DA 3RVJA 1A1VA 3RAEC 4G4SO 3OAAD 1T6NA 3PHGA 2EFYA 3QE3A 4AN1A 2BUAA 2WD7A 4AJEA 5J2UA 4M0FA 3HKBB 3G2KA 4QAQA 3SX4A 1FFYA 5JSFA 3CNEA 3VR4A 4P53A 1JHPA 1QE3A 1RKQA 2J6BA 3FPJA 5E9AA 5AD1A 4QQRA 1BJKA 1KEPA 4B3TB 4QT4A 1AUOA 4A91A 4QWMA 2ZIVB 3STYA 4ESOA 5B55A 3MTIA 2O2YA 2EKBA 3EBPA 4PEVA 2AOXA 2QG6A 3ZS9A 2HRRA 3P32A 4NYIQ 4YCAA 3TKAA 3QW2A 3LLMA 4A0QA 2Q1YA 5GWXA 4LVNA 4DR3B 3RT9A 3D0RA 3PBKA 4YY3B 3OHMA 2P2ZA 4MWBA 1LNSA 1WSAA 1AHIA 2B1JA 3H3JA 2NZ2A 3TNYA 4F06A 5ED4A 3IEMA 1ZVVA 3G0OA 5DHQA 1Q1QA 4RV5A 4B6PA 5MGBA 4NS4A 3W5IA 3L9WA 3ZW8A 3R3JA 4BNKA 1M73E 4ZEXA 2G5GX 2H11A 3EGWA 3B89A 4OXKA 2ODNA 4RD4A 1KYWA 3EXIA 3RHTA 2GCIA 1P4GA 1T8SA 1U02A 2B5VA 1T6ZA 1SIBE 2BTQA 3CLUD 5C34B 5JC8A 4C76A 1NG9A 1HNWB 4M55A 3VHQA 2GGSA 4BEVA 1M8GA 5KOHA 4KXXA 4XRGA 1QGUB 1Z13A 1PLJA 2VA9A 1G21E 2WTEA 4E88A 3CUEF 4QRDA 3ZHYA 3V33A 5JZSA 1W36C 3LOQA 3SJAA 1ZAYA 1NUPA 1Z6PA 3QU7A 3SDBA 3V1KA 5IKOA 5LKRA 1ESZA 3PI6A 2BMWA 1UCFA 1F6WA 1BZYA 2X76A 3EOZA 3PLRA 1DKPA 5HKKA 2QPAA 5IN4A 3HCWA 4XLLA 3ZOZA 3ABRB 3C24A 3RI3A 4EVRA 3DEJA 3FHOA 3U6BA 3L93A 1CUXA 1SBHA 2ZS9A 4W1RA 2GPNA 4MP8A 1GDHA 4ZIRB 1CF2O 4RD3A 2CZGA 4UEJA 6ABPA 1EHIA 3E5NA 5DM0A 4E33A 3LBYA 1SXJC 5EAIA 1TGYA 1KZHA 4YRZA 4LFBB 3EIUA 1EFRD 1PV1A 4F5EA 2QBYB 1CK4A 1ZGJA 3SBXA 3TAUA 3VMFA 4B45A 3QTBA 4AUMA 1U8TA 1YRWA 3I30X 1O94C 4GS5A 4UE3S 1JIQA 1Q0ZA 2F1RA 4ZPXA 5SICE 3SDSA 5CXXA 4DY4A 2A33A 2PRSA 2YBEA 4II2A 3EY4A 4Z3OA 3FDJA 3OLZA 3KXLA 3EQ8A 2PLWA 4ZO4A 5D5PA 4FM9A 1JFRA 3TAXA 5I7FA 2YHSA 4AYWA 2IGBA 2V7VA 3L01A 4HLCA 5M7EA 1EUQA 2H1OA 1YV9A 3C4JA 2H0QA 1USKA 4BNJA 4RZHA 1QHFA 5EHQA 3GUHA 1Z34A 4NZNA 5DTEA 1T2DA 1JBQA 4H31A 2F8LA 4JOCA 4B87A 1R10A 3QWBA 4QBKA 2MHCA 4NAVA 3BFKA 4G8DA 3LQKA 4KE9A 2PNFA 4QASA 3CSUA 4MQLA 3ZVLA 3ZWXA 4D57A 2HK7A 3UAOA 4BY9E 1OSNA 1XLTC 3M6UA 3UMVA 5TS2A 2QTZA 5TPZD 5ER6A 4E6PA 4XSHA 4F97A 5J2TB 1X8LA 1N5LA 2E6UX 4JJ4A 4OHVA 3B12A 4DF3A 1TQ4A 3OMWA 4I99A 2XA9A 4C4YA 4R2MA 1SBCA 3BCUA 2GTIA 4QPDA 4WIAA 1RQNA 2C8VA 2J3IA 3MGBA 1VGVA 5E9JA 4ZMRA 1H2WA 4IDGA 3RYHB 1IY8A 3H1TA 5IAOA 2XYGA 1XN4A 3EQ7A 3K8QA 4MVJG 3JZFA 3ML1A 4RPKA 4QQKA 4F21A 2HJ9A 4RF3A 3PZRA 3C8ZA 4DZRA 1CR4A 4ZOLF 2WAMA 4GAEA 4JDPA 4R2JA 4UFNA 1M76A 1TMOA 3LT1A 4WX2B 1HE3A 4W7HA 4CM1A 4KI0A 1W29A 2ZW9A 3FH0A 3ZYZA 2JGFA 1GUFA 2NO4A 2WMDA 1T9DA 1KPHA 1Z5GA 1JJVA 3H5AA 3PENA 2V98A 2HPAA 3WLQA 3CNLA 4CL2A 1M8KA 4CL8A 1U11A 2MINA 2GXUA 1H5NA 3A1EA 1GXSB 2VWGA 1EFPA 1Y89A 4WKOA 4YV0A 3AF0A 1JPNA 1SOUA 5FEMA 3RVSA 2IOHA 1KMNA 5TF4A 2R0QC 4BLUA 5BYKA 4A8JA 1NBMD 3P4XA 3EC2A 2EEZA 2HJVA 3GFTA 5CYFA 3LHFA 1IZ8A 4HQLA 4ZU1X 3ZE1B 1E3WA 4BFYA 2WKQA 4ND7A 1W5SA 2EKPA 4MQ4A 5ALOA 5DO9A 4C3OB 2O8CB 1XCJA 2O4UX 3A0RB 3JPWA 2OGWA 4NENA 5HPYB 4NE2A 4X93A 4EELA 2JAQA 2H2IA 3HA2A 3B6ZA 1VSBA 3OF2A 4HWPA 1M33A 1Y7PA 3B82A 3UVEA 3W7BA 5JPDA 4Q16A 1E2MA 2NAPA 1T24A 2QXTA 2ZRKA 3T0FA 3ZKWA 3D6JA 2NSJA 3AR7A 4IX1A 4OU4A 1L7DA 4L5JA 4L57A 5F3RA 2HIGA 1U0HC 4DAOA 4RJTA 1YAJA 2EBWA 5JHHB 1L5MA 1RYMA 4BUCA 3OJWA 1F2UA 5EQDA 5J1TB 4R2LA 3VU0A 4DPMA 2G7MC 4YWHA 5HOEA 4EB6A 1M2JA 1UUFA 5LXTA 3DMHA 4ICIA 1OPRA 4XFJA 5H70A 1JR3A 2Y0EA 2ZYUX 2OCGA 3AETB 4RD1A 4ZHSA 3R40A 3WVNA 2ZE5A 4B4KA 3TUZC 3Q9UA 1UBEA 3HB1A 4I5DA 4BUZA 1G7CA 4I5FA 1G98A 4R9RA 4XTCS 1FSSA 2D7JA 4QNRA 3TTYA 1TAGA 4D8WA 4M0EA 2ZGVA 3TNLA 2V03A 3IT3A 1OBFO 3VNQA 1UOOA 4O2AF 1FXWA 4CM7A 2OP1A 3GRPA 3ZE8A 4I9NA 5BSVA 4J6FA 1OU4A 3C1UA 1QFJA 4H7IA 1WXDA 1CZRA 4G4IA 3F4LA 1NR1A 2CNLA 1Q14A 4R1TA 1GTG1 5KNCD 1P0FA 1VP9A 2R7AA 5E7MA 2V59A 5JPCA 1I7LA 2VYND 4FWBA 1Q1GA 3RCBA 2ZR7A 2FMIA 3SJCA 3D43A 2PDAA 2ZKIA 1NBWB 5ERGB 4NBLA 4UNSA 5D85A 2J0SA 1K0FA 1L5SA 2O2HA 1MC4A 4PLHA 2WAOA 5HUHA 3GCXA 4ZOEA 1O95A 2BONA 5CA1F 3KDPA 5ADHA 2IH4A 2XUQA 4G0VA 1KO1A 4BNHA 3DO6A 4IXNA 1U2QA 1GRRA 3HU2A 3BULA 2IT1A 3OZTA 1Z7GA 1D2RA 4H7JA 5T4FA 1TO2E 3HKBA 3VO9A 2PWBA 1I6KA 4MQEB 3INTA 3BMQA 5JAOA 4I66A 3TRDA 2DPHA 2MINB 4JP2A 1JJ7A 3HS3A 3HSYA 4AP5A 3GRYA 3EZGA 1DQYA 4QTXA 3U4MA 5A06A 3KIPA 1PT6A 4HAZA 4I8IA 3NDPA 4OMCA 2ZJFA 1XEWX 2OBXA 3AIOA 3STHA 2H0RA 2HHLA 4U3JA 3PVCA 4DJEC 2XVYA 2FSGA 3U4QA 3CO5A 3UWSA 1ZQ1A 2WJHA 5A4KA 4KIFA 3HVRA 3AVUA 4AAYA 7MDHA 2NO9A 4MTLA 2YNMC 4IGAA 2E4AA 1GAEO 3LAWA 1ZH2A 4Q9NA 5TPZA 1Q7EA 3EA4A 4QDOA 2H54A 1QYXA 5AMXA 2GCPA 2IEGA 5KOIA 2NVWA 1D5CA 3AEKA 3PDIB 2MSKA 4XUCA 5EPUA 3P0IA 4PIPA 5IUJC 5CFZA 1P8AA 1NVTA 1XDGA 2YQZA 3WYCA 1FQOA 1IG0A 1W4CA 2X41A 1E99A 1T9AA 3LCJA 4G0MA 4BGVA 5KOHB 4NY1A 3CEMA 4OI0A 1Z6XA 3DTTA 3LZ6A 2XXAB 2VJPA 3R7BA 3NVAA 1Q0UA 1U7PA 3OFND 1G66A 2A9QA 5C0OE 2IBSA 1BE0A 1KS2A 4RELA 3W7AA 5LP6B 3RS2A 1KY4A 2HF7A 3KEGA 4M1EA 3AY3A 2QE7D 3KB2A 4KMMA 4UTZA 5DK6A 4UHJA 1LBSA 1ACJA 3AJDA 3OFNA 3GQBA 1RWMA 3OZDA 2IOQA 4LJ4A 1NW8A 4CBVA 1PQUA 3LLVA 1S3FA 4HLUC 4XTRA 3RSGA 2C4NA 3KSRA 3L49A 3WLKX 1DQNA 2P5YA 1SVMA 2ZFUA 3SYKA 3WGZA 5F9FA 2NU9A 2C29D 3G88A 4GRDA 5BVGB 4LMAA 1POWA 1AKYA 4BCBA 1BS1A 2AEJA 2QTRA 3MPUA 3O92A 1TU0A 2WUDA 4NDNE 4ZK6A 1Q1EA 2I29A 4GGOA 1U8XX 2FPGB 3COSA 5C2JB 3AM5A 1F2VA 3O4GA 5CJJA 3CE9A 5HK9A 1C4KA 1PF7E 3MQ4A 4X91A 4QBGB 2X8JA 1AGYA 1D0SA 3CA8A 3HZOA 4MGEA 1K3UB 3FFXA 1XJWA 3N2GB 1C41A 2I7XA 3TB4A 4GG1A 1E77A 2LCQA 3EGDB 1NY5A 2R00A 1NMQA 1QMPA 4Q02A 1IZZA 2UZIR 3NGXA 4R1SA 4XOIA 3U3RA 4ALKA 1XEXB 4CQLA 5EJ5A 4TVKA 4DYVA 2FW8A 1R4MA 1WD7A 1YSCA 1ZAKA 1SHUX 2FR0A 5KMGA 4XARA 3PFGA 2KWIA 4KQ2A 2O8EB 3Q0EA 5K01A 3Q7SA 2Z4SA 4ARZB 4F71A 1MW9X 3P0FA 3BJMA 2I22A 1KOGA 4FHEA 2PH3A 1EBFA 1LSJA 2BFNA 3A0UA 2QGZA 1RAEA 3LOUA 2J32A 3JD4A 4QGGA 5KWJA 3IHLA 3P9QA 1EH5A 5GONB 3BFXA 3EH2A 4R16A 3TD6A 3FNIA 1XTIA 2L2QA 4P3NA 4RDIA 2CMGA 2NQ2C 2AI2A 1Y42X 4LJYA 1W52X 3NJ8A 3SZOA 3IMCA 1BN6A 4LJAA 3U16A 4F6LA 3BAFA 2C2WA 5CURA 5F4ZA 1PR4A 1U6JA 1XJ5A 4P0QB 3GP5A 1HRDA 1KJYA 3T3HA 4ARSA 4Z7QB 1U28A 3E1KA 4HH0A 2QTTA 1TMYA 3E5HA 1DV1A 3EIWA 2G76A 3D4PA 1NXTA 1CQJB 1DC8A 2R1ZA 3DUFB 3OHSX 4L0MA 3VRHA 3JAMA 2F00A 3F8SA 5H5JA 3D9QX 2IP4A 2FOIA 3KQMA 1N7GA 3MAJA 3NDIA 4Q3LA 3T15A 4DSOA 4UCXA 2I99A 2D2IA 2EV9A 1OHHD 2GRUA 2OENG 2O0JA 2QE6A 2XUGA 3A4IA 3ITNA 4O4JA 3LECA 5CLHA 5KOYA 2IU3A 5FLYA 4JI3B 3GLUA 3PTZA 1XN1A 2G8LA 2HSZA 2XY4A 1KFBB 1OFHA 2QX8A 1J8FA 4F56A 1N2CB 3E2PA 1EEHA 4PBSA 3NHKA 3M6IA 2C4UA 4LWPA 4CG3A 2GKGA 3U39A 1VYUA 1DKOA 1TKAA 2B83A 4JHXA 5CCEA 4AF7A 5BMVA 1B2LA 4XPIB 5F1KA 2OWEA 1SC4A 3Q72A 4BMPB 4RLSA 2E49A 5GINE 1NULA 4L0CA 3V3TA 1X8KA 4GXRA 1U2SA 3GP8A 3IKMB 3FOBA 5J2UF 1EZ4A 4ZYZA 2J5XA 1TM5E 4RF2A 4TV9F 3IKTA 5HFAA 4J49A 2YWBA 1KWKA 1PNOA 3QKWA 6LDHA 1DXHA 2AQ8A 2C57A 5DBGA 3H4VA 3U4QB 4N6NA 3FBGA 3I5YA 1WLSA 3H1AA 1PG0A 2PX3A 4DIFA 1R6UA 2A5FA 3W6NA 2NUPB 3PGMA 4RHTA 1R74A 4E15A 2JK0A 4FILA 4O0MA 3ZHQA 3W6PA 3JQGB 1WXFA 3H8SA 4H6WA 1OREA 5FL7D 3S2GA 1JP7A 2YASA 1X7XA 4WH0A 5CYGA 2XQIA 3U4HA 4E03A 1P6XA 1FW8A 1U3CA 2ZJOA 3HZZA 1EX7A 2PRZA 2DHCA 3VOBA 3CUTA 1R4MB 3IKJA 4Z6KA 5IKPA 2WNIA 3PUWA 1GJRA 2QE7A 3VOTA 5AM0A 5EY5B 3TPCA 4QWWA 2DUNA 2C2HA 4KDCA 2R1TB 3QBEA 3DG9A 4UMVA 4AJJA 1I9GA 2HU7A 2ZAIA 4HXEB 1ML4A 2AH5A 1Z0JA 3I2GA 4KEAA 1AGPA 3H2JA 4KR9A 5IF3A 1Y8AA 4TTVA 1M2VB 1GG9A 1TDJA 4D43A 5LUAA 1Y4SA 1GQFA 1PFGA 2QLFA 3GMIA 4MZXA 1P18A 3NM4A 1WPQA 3OU2A 3IO3A 2R6CA 2Y1WA 3QA9A 4Z9BA 4ZVMA 3C8HA 4JC8A 1E32A 1OX6A 2Q5CA 4X0EA 1E7RA 1ONSA 1K7EB 1VMEA 1E18A 3W2FA 5I7OA 2P2YA 1H0HA 4JUBA 4DNQA 1MA0A 4DRZA 5EESA 4M88A 3EGXB 4HQFA 2HCFA 1OXSC 3GLSA 2WEKA 2WHQA 3H7AA 5A9TA 4HT3B 1OIXA 3GK3A 3S1AA 3T95A 2ZVJA 3JWIA 2GDJA 4TSKA 3FAKA 3U1VA 1NVEA 3I4FA 3CZPA 4Y7CA 2CJXA 3ROMA 3ZJ4A 1DRJA 2I2CA 2ZSEA 1XQVA 1GAQA 3F74A 4WXMA 4CGYA 2XDQB 4YRDA 4BLTA 1AMNA 4BXOA 1PUXA 4RQTA 3BMQB 5HWSA 2W2NA 1Y8CA 3OE7D 1P75A 4MWGA 4DSZA 2C2GA 3BGWA 2IELA 2O6LA 3DOJA 4NPAA 4X41A 4C2BA 4YXFA 2JGEA 1AZWA 1GA4A 2VJKA 3O8OA 3TVYA 3GROA 1VFNA 4B2IA 2C96A 2FFJA 3H0EA 4IJVA 2QM3A 1FUIA 1CULC 2ACVA 2J41A 3M1YA 1Y7IA 1OBVA 3OT1A 2WPDD 5TR9A 3G3EA 3IB3A 3F67A 2ISCA 4RPIA 3VTZA 3LLUA 5DCUA 4DWOA 1KZ1A 2J33A 3S2YA 2BMVA 2YWFA 3D7NA 4QUBA 4F3KA 2O8FB 3VGJA 4CQLB 1SQ6A 1KOJA 4Q6BA 3SAJA 5B58T 4JXXA 1ZEJA 2RG7A 4PQYA 1JMVA 1GZDA 2BMAA 2CMKA 5CT4A 4C7KA 5K0FA 2WQ7A 4RA6A 1O95D 2XZOA 1T5BA 1ZOOA 5C8DA 4RV4A 1E6UA 4LF7B 3U3MA 2Q6OA 2YFHA 5BO5A 1WSBA 3WAGA 4PZZA 3CWCA 3O73A 1JXQA 3J81k 5I4IA 1QG4A 1G7SA 1A4XA 3IPXA 3GRUA 5H9VA 3T06B 3R7FA 3UT0A 1ZOLA 2P7HA 4B6EA 3G0CA 4US0R 4D4MA 2R4TA 3PHCA 4AJPA 5JH7F 3K0FB 3KOOA 3UFBA 1GARA 1QKIA 2WIFA 3HYCA 1SZDA 2AJTA 4LNAA 2DAPA 2D0PB 2IUYA 2JCYA 2QVZX 5HQJA 2E0IA 3R6GA 3HXQA 2IWHA 3RVDA 1M2VA 1YOBA 1ZKDA 4I7EA 1MB0A 5H16A 4QICA 1K97A 2XB8A 3GT7A 3A4YA 1JSCA 4CHTA 1ZNQO 3BL8A 1BHQ1 4NU5A 3PQ6A 2EHJA 2CW5A 4NC9A 4U63A 2ZSIA 3VR5H 1LPOA 4PPGA 3RS5A 3QFFA 2DF8A 3D7MA 4JB8A 2B4KA 5LCXA 4JI0B 3H9UA 1KAQA 4WD3A 2FETA 1NVBA 4ZAYA 4DLLA 1SKMA 2A1IA 4MA4A 4CTJA 2HV9A 3JWEA 3JR3A 4ZI7B 2KQUA 1Q0QA 2H5JA 4EFNA 5IJ0B 5J4HA 3CM0A 3U09A 3H05A 2C7RA 4JT9A 1L5WA 1QZXA 2QDXA 3WBKA 4MEJA 3O7WA 1Q5PA 4ER0A 4Y2TA 2ZM5A 2YICA 2BEUA 2YUIA 3OMXA 2YWEA 4L0DA 3ITDA 3TO5A 4LMBA 3HVJA 4AW9A 4IDNA 1ZNWA 5EKUA 4QDZA 2AB0A 1AUQA 1RYNA 1SZPA 4XZ3A 3W8RA 4PC7A 3A2KA 3AINA 5LZ9A 1L5FA 1OAKA 2E55A 1SA0A 2FSPA 2ZIXB 3KHUA 3LT4A 3QENA 3NAQA 4WESA 4FWIB 5J5VA 2GO1A 1RWXA 3RODA 3MT7A 3DPUA 1UC5B 4KVAA 4QUDA 2ZYWX 3FFAA 3OTOB 1U2TA 3BORA 1T9ZA 1RQLA 1QQ5A 4TV8F 3COJA 3KJGA 3WNCA 1AN0A 2I6UA 2J7PD 2VT7A 3EZFA 2HN9A 1IQUA 3IXMA 3P9CA 4Q24A 4DW8A 5IDWA 1Q77A 3A27A 3AGQA 4KXLA 1T0HB 3KKNA 1TD9A 4MOWA 4NFSA 1KKUA 1XU4A 3AZPA 4HVAA 2YFYA 4H1WA 1STOA 1T1EA 1K8YB 5FPHA 1RPNA 3X1YA 4UQPA 4B09A 5C1OA 1XYGA 3AR9A 3K9QO 1LJ8A 1X39A 3GFFA 4WLVA 4MIKA 1DFIA 4QUGA 4RE6A 3TH5A 1U1DA 1VDMA 3C87A 4KQWA 4HDOB 2P6NA 2QVBA 4OLAA 2GKSA 2NIPA 1Y4ZA 1Q0TA 1C0PA 4H3HB 3SF0A 4I50F 3SVLA 1KGSA 1K86A 2HIMA 4IV8A 5AUQA 5K3OA 1YRAA 2FLVA 3AT1A 3FFTA 3CH7A 2ZUDA 3KXPA 4JX9A 2Q1SA 3HLYA 3JALA 1NU6A 4C6HA 5AVUA 1ZVQA 1XO1A 3Q2IA 3LDFA 4K9PA 1V35A 1XHFA 5DTJA 3COVA 1N6HA 1EFUA 4FUTA 2YMQA 3GOQA 4LOAA 3WBFA 4AZ0A 3PE6A 3CVJA 2DVMA 1II9A 1QK3A 4JQOA 4DCOA 4JI4B 5LKAA 4KMSA 6PFKA 3I72A 5ALRA 3VNRA 3B2NA 2ZANA 2W0SA 3NCHA 3R3XA 3TW8A 4IIBA 2FPMA 2WWTA 4D9NA 1CUCA 4GOMD 1P45A 4D74A 4JXJA 3HBNA 1OFTA 4X1YA 3R44A 3CR7A 721PA 3ZZTA 1E63A 2WHPB 2LWIA 4KLAA 1LU9A 5LC1A 1J0XO 3GJ6A 4K87A 5LZ5A 1E69A 3ESRA 1UK8A 1DXYA 2GD6A 1YJ8A 4E2XA 1O54A 2RAFA 1VA4A 3VDMA 3GJ5A 3KKOA 3TLGB 2ZSDA 1NP3A 4N40A 1Z6TA 2HO4A 3QU5A 2Z1MA 2H1CA 3HUUA 4D4IA 2PRKA 1W87A 1Y1KE 1PJSA 3G2NA 4LXTA 1XNGA 4N47A 3ZDAA 3C3WA 3MJEA 3KWLA 3U19A 1TJPB 1QTQA 4BNUA 1ZBDA 4CRWB 4Y6QA 4I1RA 5A2QA 1PJRA 5F2KA 5BV0A 2JCGA 3KALA 4JJZA 1HE1C 3GRVA 4S1TA 2HWXA 4D8XA 1VBKA 3NIBA 1DTEA 2YJZA 4R54A 1LH0A 4XJTA 3UJNA 1S96A 5GPBA 3SC6A 2A5GA 1SKUA 1OU0A 3EXAA 4JYCA 4RA6B 5FR1A 2RD2A 1L7RA 1T3LA 1EDZA 2ZAGA 3LA6A 4LE2A 4BNWA 4CM6A 1T35A 3DVQX 4JUCA 4QDXA 1WTCA 4EQ6A 1KHTA 3B3JA 4I1VA 4NHEA 4QYXA 5BR8B 2HU5A 3E61A 3NBFA 1W76A 2IY8A 4JBHA 4JJKA 1RNLA 2OQVA 1W8IA 3I8XA 4ZT4A 3HBLA 2AQHA 2P9BA 1NC3A 4GOOD 4JS0A 3HGTA 1WXXA 4D9MA 4CV0A 1K4KA 1AKMA 1PYGA 2W2XA 3AKDA 2RGYA 4GLFA 4V3CA 5DSTA 2PIAA 1ZUNB 3NM5A 4M6WA 1KZ4A 2AMJA 3M3PA 4NATA 3NNSA 1QHXA 1X7HA 4M1KA 4I1OA 4NECA 3ZJUA 2H1RA 4RA9A 3VO2A 2VZ9A 5D7NA 5LOVF 1I24A 4WK0B 3FRJA 3O1IC 2HK9A 3L40A 3IALA 5D84A 2EARA 5EZ6B 3V42A 2HLDD 5BN4A 2IP2A 2R8XA 4IDAA 4IFTA 2II6A 4HSGA 4V39A 1X42A 2B25A 2B5OA 4ZCPA 4P93A 5JDIC 4YCSA 3FNFA 1LUAA 3UMCA 2VHWA 3PFNA 2OD9A 4JJ7A 2AKEA 1KAGA 1RKVA 1BRMA 2SKEA 2CV2A 2HSWA 1G0NA 1DQZA 2G9UA 4E3ZA 2Y9MB 3AWIA 2ERXA 2WUGA 4KL8S 5JFTA 1ECFA 5HJ5A 3DHEA 3N6XA 1UKAA 4WFJA 4O1MA 4WZAA 3VXKA 4EY6A 1NJ2A 3E3LA 3UYLA 3WYFA 3U7RA 1QPZA 5T4BA 1QLHA 1J2JA 1SHTX 1QUFA 2Q49A 1XZJA 2H7CA 3LVQE 1YA4A 1TO6A 1FVXA 4LHYA 2AQKA 2C9ZA 4WZZA 2FPPB 4J7AA 1OT5A 3KJIA 4I6GA 2IF0A 4MVXA 2AFIB 2LKCA 3N9IA 4K8RB 3OESA 1IONA 1S89A 1DWQA 2H1VA 3CONA 3ONNA 4ZVQA 1MJGM 2JPDA 3K53A 3VTFA 1M6VA 4CVNA 1GP2A 3NB0A 2OORC 3KBBA 1RYFA 2P3OA 3ELWA 4FN5A 5AVSA 5FL3A 4NKRA 3MTGA 2VJAA 3GCWA 3GIWA 1UOEA 3RTEA 3WKCA 4DLVA 2I6QA 4LJ8A 1UBJS 3ED1A 3QEOA 4IIEA 4EUKA 2ZSFA 3BMNA 1CRLA 2VDLB 2UYOA 3ZV7A 2WZBA 3PXEA 3PNSA 4CQJA 3GLIE 4KPYA 2YXLA 1UXOA 3KZCA 3HSKA 1DKQA 1HG1A 1W49A 2LDXA 3RJTA 4UBKA 3KLBA 2ZU0C 3C3KA 4X63A 3ENVA 1V5WA 3WLSA 1ZIPA 3W1EA 4FVTA 4A2PA 1C50A 5JALA 5BOSB 1H2XA 3IHKA 4O0LA 4WW0A 5CB8A 3UMFA 4GPZA 4JWTA 4LNHA 3PHHA 2WM3A 4FYHA 1OF1A 1WEKA 3GPBA 5HCNA 3LWZA 1K6MA 2CDAA 2JIPA 3GLKA 3TB6A 2DRIA 1FW6A 1MDBA 1EKXA 3QBJA 4M22A 4MLPA 1ICEA 4QDTA 2AUNA 1YO6A 3UAXA 3AILA 3UMGA 4WBNB 4PQGA 1O5OA 3UH0A 2YJ6A 2BVNA 3GZJA 1IUPA 2EKQA 3JASB 5EP4A 3UV3A 4B80A 1FLDA 3U17A 1TUEA 1A04A 1IM5A 1PG5A 1GQQA 1FFEA 2QL6A 5EA2A 5KB3A 4PSVA 3QTLA 1XL1A 4KQIA 2PX2A 1H5UA 5TNXA 4C7MA 2RGGA 4HF7A 1N6NA 3NX4A 4RDCA 1MMFB 3DV0B 3QNWA 3ROQA 2VNIA 2XWSA 1RWWA 4LPKA 4JJ8A 5AOAA 4K86A 1O8CA 3HDVA 4MGZR 4I8DA 3WRYA 4EG4A 1AIPA 4F46A 3NYRA 4YRNA 1LDNA 2PO7A 3I32A 4TKZA 4D46A 4DLBA 3VNUA 1YDGA 3GEIA 3C3AA 4IMRA 4D0LB 1A5BB 2PSJA 5FWNA 4WESB 2RH4A 1EVJA 4O5OA 3ILSA 2KW5A 5AVKA 3DBLA 4Y6OA 4M0PA 4CTKA 4RKRA 5BQXA 1MJGA 1HTTA 4LZJA 4UUPA 4NG5A 3V9PA 2BZGA 2CHEA 2X1VA 2VO1A 5DRTA 4CN9A 5C51B 4LBVA 3H65A 4NTZA 2DJIA 3HKDB 1JS1X 4TMKA 3QPAA 1QQAA 3MD0A 3VPHA 3VZPA 3WGJA 5ICMA 2YV4A 2PT6A 3B2EA 3N6RA 1DO2A 4RGBA 5TE9A 1PFQA 3G2PA 2IHZA 1Y6GA 3FYUC 2BFMA 3F6EX 1CZUA 3RLIA 4MYTA 2Q2WA 2PUTA 4LQDA 2WFZA 1YUNA 3HJNA 3G7NA 5DHUA 3SYLA 3GJXC 2IYEA 1NMXA 1ZK0A 1L5HA 5COQA 3HA7A 1GZ5A 2Q3HA 2W5UA 3B36A 3N7UA 3VZRA 4EQ6B 2PG3A 3D8HA 4HTFA 1N1DA 1S5PA 1LI7A 3GH3A 1DC4A 2VUSA 3KTDA 2Q7DA 3IVXA 4LF8B 3NWPA 3U5TA 2AFHE 3DB2A 5LU8A 4HYYA 1E92A 3GFOA 3GLHE 3R3ZA 2OQRA 1G2QA 4O2BA 2QNIA 4MO9A 2FQXA 1PZXA 1LF0A 5CPBA 5J5AA 3RVOA 1V39A 3KYCB 3W6ZA 1X7YB 1ZOPA 1OTXA 3T38A 1IUKA 4AP6A 4OB7A 3MB5A 3WE7A 3HJHA 2RJNA 3H5TA 1RWVA 2IK8A 4RK4A 1Y5IA 4M8IA 2IZ7A 1GUYA 2I0FA 2UKDA 1HFJA 1N3IA 3HWRA 5DISB 3UCFA 1HMYA 1ZH8A 4FZ5A 4LDPA 2PLFA 1PK9A 2E4VA 2P65A 3GJTA 3I73A 4ZZ1A 1E2JA 4WA8A 3RRFA 4PAOA 1VB5A 3EMVA 2EIHA 3ZZNA 1Y7HA 2DKOA 1UL1X 4OHBA 1XF9A 5CIWA 4DWVA 1SQ5A 3OLYA 4QVIA 4LSGA 3G8DA 3JASA 3EPJA 3UJ8A 4PRLA 4E3WA 2R11A 4KPUB 1U7TA 1JR3E 2CVHA 1UBSB 1UZMA 3FR7A 4WCVA 4EO9A 2R62A 1XRQA 2R3SA 5D3MA 2FZLA 1BEEA 3AL2A 3L8YA 1A5AB 1S2GA 2XCUA 4FGKA 3W3AA 5DIFA 4EDHA 3NWBA 4B3JA 5JZMA 2PZGA 1ZG3A 1Z18A 4BMOB 5SZJA 4MVJH 1S8OA 3COPA 2FZVA 2L82A 3P9IA 1WZIA 4PHGA 1NL3A 1RYDA 3GNSA 4WHMA 1CY1A 3AUKA 1QHIA 5AK4A 1R6AA 2VYVA 5KAPA 5IBRA 4EIWA 1SHZA 2GZSA 2WFLA 3FYUA 2BIFA 1HL7A 4M46A 4URYR 1RTTA 2B2NA 2AEFA 1BVRA 5T6BA 3GLGE 3JXEA 1HDXA 3PL5A 4FXOA 3KQOA 3GAZA 1W6UA 3K9GA 1L7NA 5KYUA 3ZHOA 1F4VA 2PSHA 3S6JA 4TLMB 2CHVA 3NIDB 1OXKB 1NR5A 3CNHA 2D5IA 3ZGYA 4IHKA 4A4DA 5LB2A 2WYWA 3BCHA 4QPPA 3FVQA 4W5JA 4U4AA 2O57A 1R88A 2HNBA 1R4NA 3T7CA 3VR5A 2R97A 4LV6A 4V0QA 4RO0A 3E6AA 2AVDA 3I1YA 3L82B 2B6HA 2IE8A 3DT8A 1M8FA 2I4TA 1M67A 1NZDA 1SU6A 2E85A 3U4AA 1I94B 6CHYA 4AWBA 2WABA 4KYIB 3GEPA 1RAGA 4I3FA 2EX1A 3GEGA 1O8BA 4JT2A 3IURA 4RFVA 2IYYA 1XK6A 1NONA 1VP3A 4IZIA 4PG5A 5K4AA 3AUYA 4LWOA 3ACCA 4C7XA 3TTVA 1BHO1 3WLOA 1G64A 1FNBA 3IV7A 1J20A 4DC0A 1Y8ZA 3EQ2A 3ESXA 3JVDA 4L4ZA 4XQGA 2JAPA 3DGFC 3I9NA 3N5CA 3HTXA 5IBQA 4H3SA 1P80A 2Q50A 3GW8A 1TFRA 4FDLA 2GWHA 1QKJA 4NJMA 3IUSA 3RM3A 1RHJA 4HNVA 2AJCA 1F38A 5K0JA 4ND4A 4CEJB 5J9FA 1QHEA 4HFMA 5A04A 2CBGA 4DV6B 2H59A 3QITA 4MITA 1GGFA 1RPTA 5AK5A 4TLLB 3IR6A 1SU7A 3MJCA 4GVPA 5K0LA 3WA7A 1R6DA 2V45A 4XYEA 3FRHA 2J07A 4G6ZA 4LI0A 5G0WA 4I2NA 5T5QA 4L7QA 5JFOA 2EERA 4QXMA 3R5TA 2CCJA 3W9YA 3GXBA 5BSEA 2CFRA 3V7WA 3QK7A 2PBLA 1W0JD 4TSFD 1RHRA 2Y76A 4HGQA 1FSGA 4Y2HA 2OR3A 2CVPA 4NZZA 2D13A 3MLEA 3T4PA 3Q9NA 3IIJA 1HG0A 1B74A 3Q7RA 3TSWA 3GPLA 4PLZA 3VA7A 2UV8A 1YRYE 4RNDB 3PUVA 3RK4A 1KI6B 4Q6WA 2NLOA 5MFZA 1MC8A 2B0JA 3JQAA 2Q28A 5H0IA 2PSEA 1O58A 2ADOA 2GZ2A 1HE5A 3MLAA 4XVCA 2FF7A 1EJBA 3WDLA 3CC8A 3DTNA 4ZO7A 1A8SA 4GH5A 1JIVA 1EWQA 3V8VA 4K88A 3O74A 1A8IA 1J22A 3JS5A 2WKSA 1DARA 2JD0A 1PJQA 1ZR2A 3DMNA 1JXOA 4RK5A 1N25A 4TZ6A 1N7IA 2D4AA 2XNKA 4JL8A 4LJLA 5LBUA 2B20A 3K0SA 2D1QA 2H4HA 2OUKA 2QX4A 3HZHA 3S0JA 1Q7GA 1WXQA 1ZXXA 2F48A 2GK7A 3HYRA 3L0YA 3CPEA 3K8ZA 4G3XA 4LYAA 4RQBA 3QG1A 3STWA 3WOHA 1UJ5A 2QY6A 2Y1XA 4P4LA 4QQFA 3TLMA 4RIHA 3ISTA 4RSRA 1SCQA 3CRVA 3S40A 5FTLA 4BNLA 1TCVA 5IJZA 1Z2OX 2EBUA 2RARA 2WG1A 3L05A 4LYJA 3ZU3A 5CNMA 1I0LA 3GDWA 1NVUQ 2O8CA 3I34X 1Y3DE 2X0JA 1EAMA 1PTJA 4FP9A 1M5UA 3AJ9A 1N33B 1KTVA 2P9HA 2WINI 4S1WA 1Y98A 4MVJF 3PGKA 2WU4A 1DJPA 3WP0A 2VOJA 3AC0A 3K3PA 1E2KA 2WK1A 3BB1A 2PZKA 3F3SA 3Q88A 1NVDA 3IESA 5CDFE 5BORA 5FAXA 3T9DA 4IDEA 1IZ7A 4RZSA 4EF6A 3T4XA 4OMUA 3VJRA 3FPFA 2DPLA 2NU8A 3V2UA 3L8ZA 1DI0A 5L6MB 1JTEA 5DGTA 2X1MA 1YDMA 3DWIA 1PX0A 1JIXA 3FJOA 3ZEIA 4PZAA 5KIAA 5MFPA 5DM70 4JI2B 1H6AA 2O8BB 1T2UA 2OBFA 4DDKA 1IAVA 3KAPA 3E82A 3I62A 3OEYA 3HKDA 1X74A 4D3FA 4I9UA 1NQOA 3E9MA 4HBZA 1W30A 4ZT5A 4MMZB 3O7MA 4UXIA 3ZGOA 4BO4A 1CDEA 4ZA2A 2WUEA 4PXSA 4J91A 1XVLA 3WB9A 1N57A 3BWDD 3GT0A 4UZSA 2XMPA 3K2BA 1JU9A 3RKUA 4XYLA 2A9OA 2G28A 1G2PA 3LC0A 4XM0A 4IVRA 1XB2A 3DW1X 3UENA 2WFLB 1Y63A 5TJ9A 2GZHA 1MAHA 2O0KA 2YC2C 1XEFA 1G6KA 1CUGA 4PCUA 3WL8A 4IL5A 4EX7A 4F5YA 1P9WA 2ATVA 2VZEA 4CNQA 4CV1A 3QKSA 4ER3A 1QMGA 1QAQA 2XJ4A 3KLPX 3HCCA 2J9ZB 1F8YA 4Y1FA 3KEFA 2R1VB 4FFBB 5WRFA 3TRJA 3UK6A 1CJTC 3H84A 1QQTA 4JBNA 1IMOA 2IEDA 4P4GA 3H9CA 5JNUA 2OZKA 2LE0A 3CE6A 3TTXA 2YBDA 4TWZA 4YP1A 5AKYA 1SC9A 4FE4A 1IYZA 2A86A 2RKBA 5LP6C 2Z43A 2JNWA 4G5FA 4NYMR 4EL0A 3K0CA 2BEJA 1DXQA 4MQEA 4CLRB 4DB4A 1L2TA 1DQSA 2GNOA 3N2YA 4LA4A 4UU8A 5TEWA 3OX1A 4PN7A 4ZOAA 3L1HA 2ZJ4A 2BEVB 3JYQA 1XXHA 2B1QA 3K1TA 2X6RA 2WIKA 3HVUA 5ARCA 3I6QA 4ENSA 1T9GS 1ENPA 2H3HA 4CMHA 1U8CB 3UZUA 3WAKA 2ENUA 1TZ2A 2ESRA 1KH1A 4IJ5A 1CRZA 2WSYB 3HE3A 1EM6A 4WZAE 3GFVA 5DM2A 2HBYA 4RXMA 2HSJA 4O4LF 1JDUA 2JATA 1RRKA 1NRXA 3PPIA 5JJCA 3RH0A 4AUNA 3NALA 3W1VA 2GS9A 3ZWVA 1HSZA 4JMLA 4LC9A 5D7BA 4CFYA 5AM2A 2NAFA 2Q5OA 3NT4A 4G5GA 4Z0HO 3ZI0A 1XYVA 5JS1A 5EC8A 1UK9A 4ZQFA 4KKXB 5JR3A 4HH4A 2B4TO 2UYCA 2D8AA 4P5PA 3EOBI 1PWEA 2QPTA 2ZRCA 1S4MA 4TS1A 1XTRA 1KK3A 4UREA 1RRGA 2F2TA 3Q3CA 4LYEA 2GZ1A 3KUDA 1E1YA 1JQEA 4A0RA 1O6CA 1QG6A 2Z98A 3DFKA 3N3BC 2OL4A 2O2XA 3A1NA 1ZY2A 4H7EA 4CM9A 8ATCA 3D1LA 2ZJ5A 5EN4A 1TOAA 2WTUA 3KR9A 2NVOA 4ONEA 3W05A 3N87A 2D00A 5HYVA 3KXIA 1QHHB 3RSOA 2F3UA 5DTQA 5IMSA 4KQMA 4RS3A 1QNFA 3HU3A 4EYKA 1K8ZB 3DNFA 5NLLA 1ELOA 5C3UA 1Q95A 1D6SA 2AEEA 2QV0A 3C3BA 3R0ZA 1VFPA 5JATA 3LGAA 1JMKC 1VG8A 2YIMA 4EKYA 5E7QA 2IOYA 1XTJA 3OCYA 5B6JA 2VQDA 4NHOA 5A5DA 1J21A 1ZZEA 1YCDA 3V8PA 3K6SB 2G5CA 1E3TA 2V7BA 5IASA 1I30A 1QPBA 2X0IA 3AQ4A 4DJFC 4M0UA 4ZT6A 1N5OX 4DDTA 3O4VA 4GWKA 1QSGA 2PO5A 4M2LA 3B9BA 1AKUA 4QJ4A 4S12A 4WFQA 5DH9A 4B71A 3AKCA 4DC9A 3LGXA 4YUZA 2ZEJA 5ALPA 4ZI5A 2JKZA 1B8VA 4L2IB 2G08A 5H7XA 4ETMA 3DWEX 1HLPA 3OTIA 1N2JA 5IXJA 4HC4A 3MUOA 2J85A 1TC2A 3AK4A 4FR5A 1CUFA 4MR9A 4XCVA 3D6FA 1BHJA 5FA6A 1DPFA 3B48A 4EY3A 1YI0A 1WMAA 4XH9B 2GAIA 1FBNA 2PS3A 5BSKA 3ROGA 2HNAA 5I5EA 5D1HA 1H0RA 1UPFA 1YL7A 2EP5A 4LPSA 3OQIA 4M53A 2FB9A 1ILWA 2QTAA 3I0ZA 3PYLA 4H15A 4R0NA 1NBMA 5K45A 3CLRD 2D3TA 2Y1DA 4ENQA 1RHMA 5EHZA 1NFFA 2GYYA 4NV0A 3BGIA 1BDJA 2AXPA 4D81A 5T64A 1QFXA 3ZNPA 1XZLA 2Q8QA 4IIFA 4F12A 4WZBA 3HJBA 2RGEA 1ESEA 3ZBQA 4JBGA 4RWEA 3WNVA 1PS0A 2V3WA 3ZWOA 1D4OA 3E22B 3HRHA 1XZ8A 3LPDA 4R1PA 5AKGA 3R5XA 1YJXA 1WW3A 3IIKA 1W1UA 1ZSYA 3LG2A 1UKZA 1NLZA 1UP4A 3EHDA 1PK8A 2H7YA 4J0QA 4KVZA 3WXMA 2HX1A 2POQX 4QJ3A 3NDJA 4EITA 2AI1A 5B1HA 4YXWD 4XWOA 4K9SA 2QJWA 1EP3B 4XDHA 1GPH1 1J7JA 2AK2A 4NDAA 2VS1A 3LVBA 2NZUG 4Y6LA 4E5DA 1I3OA 3OFVA 3MJ4A 4OD0A 1XMOB 2YVLA 1PGNA 2C92A 1F17A 1Q17A 1MX3A 1R16A 4ZALA 5ENVA 1JTVA 5LQCA 2HAEA 4IAOA 3ZUGA 3I2HA 1U0RA 3QY0A 4M37A 5DGDA 1RI3A 4ZQBA 4MCJA 1ONBA 1S2OA 1IBSA 2DC1A 3O3NB 5DI3B 1W93A 5IJ9B 2HH9A 2VA8A 3BIOA 5IJAA 5JEDA 3DDNA 3GZNA 5JDCC 4BEJA 1SRRA 1NZJA 4QIHA 3S99A 1G0OA 4BTLA 5BV2P 4LJ9A 4G0OA 4PCVA 5FL7A 1SCNE 2CMDA 1Y4UA 2I7TA 1V3VA 5HF6A 3VKUA 1KC1A 2BP7B 4P34A 4QYWA 3RUFA 1T0UA 2GFIA 2JAWA 2RH5A 3OO0A 5A02A 4WBNF 1F8XA 4EGAA 3UK0A 4YQEA 1P74A 3AVYA 4CI9A 3EDOA 4OAOA 5BMVB 5EIBC 2DH6A 3CJQA 5EYPA 1WZUA 3LY8A 3QVOA 4GX2A 5J2UB 1N0HA 2JA1A 4XRRA 2YRFA 2WE7A 4JODA 1W4BA 1X9GA 4PCAA 1E2QA 3HFJA 3DL2A 4L75A 2WSMA 1L7EA 1PFKA 1K6IA 5LQAA 2JJ1D 2PD6A 1ZNXA 2XQKA 3KZKA 1V5IA 3L0IB 1PGOA 1JZQA 4R7TA 2QAGC 1F9EA 1QO9A 3T3EA 3VC7A 1LLDA 4YMGA 1SB8A 5KOJB 2AJLI 2WYUA 2V4ZA 5I4KA 1KJNA 2OMKA 3R6DA 4ND8B 1LTHR 2Q4OA 3VHRA 2FWPA 4BBZA 1UPUA 2B37A 2OCLA 2ATCA 3DEAA 2AX3A 4H1HA 3U3KA 2XNDD 4RTLA 4DR2B 3AFGA 3OQOA 2O19A 2B7LA 3N39C 2VWPA 3R3YA 4EATA 3EZ2A 2FE4A 4YLYA 2DKNA 3B5IA 3DE7X 1YB7A 3OQIB 5EI5A 3T9CA 4I55A 4TV8A 1N7JA 2G67A 3KBOA 4FGSA 4FW9A 2B8JA 4NPHA 5CRIA 1NF8A 5EP1A 5AJVB 4TM7A 4UAGA 4B3IA 4TKUA 4NYIR 4JR2A 1NPDA 2H5EA 2PKCA 4NBVA 4WACA 1RMYA 2ORIA 1XAJA 5DV9A 1EVEA 3L0BA 4F93B 5J47A 3ED5A 4R01A 1WXGA 2XYRA 3ZU5A 1BVYF 2Q1UA 4C87A 2J3QA 4N49A 4JI5B 2VPZA 3SG0A 1IOZA 4M87A 3VO1A 2IDMA 1BWSA 3WK9A 3K7EA 3PC7A 4OQMA 1Y0BA 3P9SA 4LW8A 5B3JA 1RM4A 3VU1A 4EPWA 2BISA 4P3OA 3PHIA 2R1VA 3DM9B 3HHEA 5FWXA 2O50A 1DFGA 5CITA 1HQYE 2FNAA 4HAUA 4O2BF 5I7WA 3CKLA 5HQTA 2GSWA 1V41E 3GV0A 4BAUA 2Z2XA 2QA5A 3UANA 4YMUA 1E2EA 2BZSA 5AO9A 3GEHA 4GL2A 1JR4A 2RSLA 4KO4S 4Q19A 4ARIA 1T5TA 2W6MA 5BXYA 5DP2A 4MB2A 3LWBA 1JB1A 1F06A 2DP4E 2GEBA 1Z25A 3EMBA 5KYWA 3O3CA 2QZPA 2OM2A 2VZ0A 3NHWA 4ESVA 5AHXA 1CY6A 1GIAA 2IIVA 4OBEA 4R8RA 4DV4B 3Q2OA 5M04A 3EPLA 1HDIA 2CMFA 5GM1A 2EJUA 5TMEA 3UAYA 5JI3E 3FSRA 4BLPA 2FW7A 2XVZA 4A8JB 5BW5A 2BGTA 4RYLA 5DX1A 4OK5A 3B3FA 4X3PA 1IB0A 5CA0F 3I5UA 5E6SB 1OFIA 1KK0A 2B92A 2PJZA 4UXJA 1T4MA 4C0HA 2QX7A 5AW4A 3KSDO 2BGGA 5GV8A 5D2CA 5ULLA 3IVGA 1GPUA 4RPJA 4MEBA 3WNBA 3ZQ6A 4RL4A 3VVBA 2ZXUA 3CUSA 1L5KA 3C74A 4MW1A 4FR0A 4TVSA 1ORTA 4WWHA 4DMCA 1UBLS 4YCLA 2VC2B 1AZTA 4ZDKA 2BLLA 4MVJD 1ZD2P 3ND7A 1QX3A 1XZFA 2FZ5A 1A9ZA 3OZUA 2ZG6A 1V1MA 1KYVA 1YS6A 2FOXA 2WD8A 3BH0A 4PC2A 1M74A 4HNAB 2VFAA 4AJOA 4LF5B 5KYVA 4ZARA 1GDTA 1OPXA 3N0TA 1FCJA 4PZYA 1DEOA 4MNTA 4NX2A 1KI2A 1VLLA 1U94A 4MA5A 5A4FS 2IU0A 2VYNA 1SKQA 1U3FA 3DO5A 4C08A 1CUEA 3DHWC 4FS8A 3UY4A 3T5TA 1XCBA 3O21A 4NZPA 1RVV1 3Q40A 5CDGA 2V0GA 2HTEA 1YHYA 4LTMA 1LZKA 4FHDA 4HVLA 1DXOA 4C89A 2YV1A 5DWQA 4A36A 5JXGA 1XMPA 4QATA 2HXYA 1TK9A 3DW3X 1MQAA 4JP1A 4TKUB 4ARCA 4XJVA 3EXG2 3AB3A 5BNIA 2XDQA 3OO1A 3HP7A 2VTBA 3KKLA 2JFWA 3LFHA 3BB4A 4M9UA 4HWOA 2W2TA 4IGKA 4W6ZA 2CF6A 4B5KA 2AXEA 1GCUA 2YV3A 2JEOA 3T3MB 2PR2A 5JAHA 3U40A 4INJA 4LZZA 3C43A 2HUNA 1X3SA 1O4VA 5AW5A 5JS8A 3SZLA 2WC1A 2B0CA 3HCPA 1E0DA 3BE8A 3JAWA 2JJ1A 2LW7A 3A04A 3LFTA 1FFWA 4O1IA 9MHTA 3E5RA 2LVBA 1HT3A 2XF2A 2XE7A 3QHAA 4KFSA 2JIBA 1Z4JA 2EW8A 2IYTA 2YV2A 3EUEA 4FOPA 1K66A 4LWQA 4QGFA 5KSYA 4NV1A 3U3JA 1ECBA 4KXFB 1AV7A 1NE7A 2OAP1 4EJSA 3V1YA 4R2KA 4D9FA 1WUKS 4RVOA 4QFDA 1I5RA 1CEXA 1CVIA 2QQGA 3NRCA 3QXGA 1NQAO 1K7FB 5L3SA 4C05A 5KNDA 3ZD6A 4CEIB 5IK2A 1J6UA 4LF4B 2FRXA 4AJ2A 3PIIA 1H8EA 4LFCB 4C2UA 2PA0A 5K8IA 1X7ZB 4D6PA 2O48X 1Z07A 3ETCA 5A5FA 5ECWA 4EJSC 2J5BA 3ZH9B 3OJEA 1BD4A 4IFBA 3SCZA 2VNSA 5IYZF 5EXTA 3LCUA 1AKEA 2Z09A 3K2IA 4UC0A 4XR9A 2N47A 3I4CA 3RYHA 3I9KA 1B8PA 4X94A 3OZCA 1D6JA 1SGWA 3C6MA 5EFOA 2EBFX 1PRYA 2HFJA 2XMDA 2G4CA 4C4RA 3TAHA 5K05A 1B26A 2AOWA 2WUVA 3OFSA 5ALFA 2XKAA 1CY2A 1EJ6A 3LD9A 3CHYA 2QW1A 1NT2A 2G6BA 3HU1A 1ZWKA 1JJFA 2AMVA 4CT4B 5JD5A 1HETA 1V8PA 2IITA 3K20A 3TBKA 3DOCA 1NJ6A 3P9KA 7ADHA 1NDQA 1G55A 1IBMB 1ZK2A 1V2GA 4Q3EA 1KYZA 2WT9A 2Z9DA 3CRNA 3LRTA 9ATCA 1EK6A 1VIYA 1W46A 2D1TA 1YONA 1E2BA 3H11A 2W71A 3LVRE 1ZN9A 4H18A 3W8NA 3NEYA 3L02A 3KAJA 2NPFA 4BX8A 3BMCB 3ROPA 3FSJX 1G8GA 3DFUA 3A6PC 2Q9UA 3I6MA 1JHDA 2ZBGA 1M2EA 4ARAA 3OLCX 1WOMA 3J80A 4FR2A 5B3JC 4MHSA 5KQSA 2Z08A 4B3XA 4DA4A 1H2RS 1T9BA 1E7QA 2BUBA 2AV6A 3MGGA 2VDOB 3NBKA 3SX0A 2SECE 2AR0A 4UULA 2P30A 2GNAA 4FW8A 1DVRA 3WHIA 1ORWA 3AKEA 4TLEA 3UMRA 4BGIA 1IN1A 3C8UA 1QGED 3JYLA 1Z75A 4Q3DA 4HUQB 1WMDA 2JFBA 3TOZA 2WWIA 3HPRA 4J07A 1J1ZA 4C7BA 1CIPA 1K75A 1QVAA 2G82A 1WTAA 3IUYA 3NTQA 2XB2A 1SBNE 1ZO8A 3NHRA 4A2QA 2JL1A 3CX3A 2Q45A 1T4CB 2R84A 3A3KA 2ZUVA 4MPJA 2WF9A 4RABA 4EB6B 2QUHA 4JEMA 4MSUA 4WJZA 3SICE 4Q7MB 4YEDA 2NO6A 3PJEA 3JSXA 3T7AA 2X8JB 4OFZA 3ZGZA 1F48A 1XF1A 3OG9A 2QRZA 3OICA 5EP2A 3SLRA 3TIVA 3VC1A 4D2IA 3PFCA 2I66A 5IAEA 1R0BA 5HF8A 2DOKA 2Z3WA 2YJ3A 2CNNA 2GHQA 3MMZA 4G4JA 5DE3A 4CKCA 1OBOA 3TCKA 3N8DA 4JNKA 4F4JA 1NT4A 1RIIA 2VXOA 3H4TA 2D1SA 3PKJA 1GTMA 4UHCA 3L1IA 2M6LA 3OKCA 4CEIA 3C3XA 1ENYA 1RZUA 2ECPA 3CVVA 2C9BA 5TGZA 1PGQA 3Q7QA 3ZVKA 4MVJE 4O4HA 3GLFE 4O59O 4DUGA 3TOSA 2BFCB 1XKXA 4PF1A 4QYIA 4BJ6A 3G5LA 5IKEA 1YQUA 1NUTA 4N7JA 1HTBA 3OCJA 1PDVA 5AXBA 2W4MA 5FRDA 3AZOA 3IODA 2EFJA 1I4OA 1LB1B 3A6DA 4YRRA 5AKJA 1ZUNA 3HABA 4M6WB 1Y81A 3A37A 5IANA 1KEKA 3OFJA 4XE5A 1V8OA 1RM0A 2GJ9A 3A3OA 2FFBA 3X1XA 4PHTA 4TXMA 4J0HA 4ML3A 5I4BA 2R7KA 3TDMA 3ZV3A 2QN2A 4HDKB 5ECDA 4KN6A 3TUIC 2BDEA 1VJGA 5JXHA 3OLXA 5AR1A 4BV2A 3LLCA 4NIMA 1W36D 3ETGA 3OIGA 3ZVMA 3PYMA 2C9MA 1GKKA 4U7HA 2AUMA 1JEQB 5EXXA 4EHAA 2HK8A 4ZKDA 3K16A 3QBTA 3RUCA 1E5QA 3KKKA 1XMSA 3STTA 4KBYA 3FRIA 5BUQA 1GT91 3ZV4A 2E3JA 2Z3VA 3DR5A 4KQJA 5KU7A 3O47A 1BMFA 3IAAA 2GJAA 2ZJYA 2YJ4A 3TLGA 5AFSA 5BT8A 3FOCA 2P6RA 1MO5A 4U7FA 5FKJA 4A5SA 4NNOA 4GVXA 5IVHA 2BFFA 4L73A 1GEEA 2RHTA 3RS9A 4V0LA 2IS1A 4JU9A 5ERXA 3SDZA 3VZCA 1GAWA 5FUXA 4PY2A 5F2NA 5GM2A 1C9YA 5EE1A 5DVZA 1L4MA 2C3PA 2ZR9A 3HYSA 5HUJA 1ORIA 4DCCA 2C9DA 1H85A 4JLVA 5IHPA 2C2YA 4DBLE 1Z37A 4LMRA 1AK9A 2B35A 4LE0A 4DSTA 4JSTA 3SM3A 4L8GA 1PU2A 2A7XA 3B9QA 1DG9A 1DC5A 3MBIA 4XX0B 5ISMA 4JP5A 4YCJA 1DCFA 2VEOA 1SXGA 1QYWA 3KT8A 2WDZA 3M82A 1V3TA 2X9VA 2I6XA 1U1EA 1QGAA 3DO8A 3OD1A 3QKRB 4B8WA 3GLGA 3V00A 3QBVA 3KKPA 5IARA 4EVSA 3BGDA 1OWMA 4ALNA 1UJCA 2HFKA 3LDGA 2P5UA 1J1UA 5B1EA 1JH9A 2XXAA 3MBKA 3TTWA 1IVYA 4YRBA 1Y9JA 4DBLC 2C5GA 1L6RA 3PDUA 4XPZA 5THKA 4V0OA 4ZU6X 5JDCA 3SEFA 4G1VA 3M1AA 1YI1A 3DZCA 3UW3A 3V1MA 2AG0A 4AIIA 4HI0E 5FOXA 1EI9A 2GAJA 1UJBA 2P27A 5FWAA 3EF1A 2BGUA 3U9LA 2IIBA 5EIXA 2Z6QA 4H16A 1YR1A 3PX7A 4DMMA 2Y1CA 4B3FX 2VYCA 4CMEC 4D44A 5LDHA 1NUHA 3NUQA 3B1XA 1XVAA 3Q5EA 4J2OA 5F7ZA 1U3UA 2EXXA 2XUAA 3KPYA 3R0IA 2FWRA 4YMVA 3FMIA 2AK3A 1KRHA 3G59A 1SVKA 1EG2A 5JV5A 4NCIA 1LVUA 3ZZ0A 5A5GA 5ALXA 3R0JA 1Y8RB 2ZQZA 1ZN2A 4YAUA 2Y99A 1FSPA 1U5BA 4IDBA 1KXZA 4YWJA 5K3DA 3UATA 2W93A 1C7JA 3EOAI 1CF4A 1D03A 4MI6A 4E32A 3NYWA 4HUJA 1YS7A 5GZ6A 3FMOB 1L9XA 4GI2A 4J2HA 3ZJVA 3Q1LA 2EG9A 1UPCA 2F3QA 2XYQA 1DB3A 1WAMA 3RYIB 4COOA 3HJRA 2ZK7A 4EZIA 4OM8A 3WMRA 1DAGA 1IAQA 1WUHS 4II7A 5HW0A 3ESAA 2GYVA 4UVDA 3LIIA 4AJHA 2JB9A 5HQ3B 1E7SA 5DLYA 1FQJA 2QUJA 3RROA 1L7XA 3AGPA 3DLIA 1DPGA 4HUQA 2OD7A 3AWDA 3L7NA 3M4YA 3PNBA 1L1FA 2F1KA 1C14A 2EZUA 3KC2A 2FWJA 3F7TA 3DBLB 1UBRS 2X42A 3LNCA 1AT1A 1D4AA 4JJAA 2VUTA 1YQXA 4P92A 5DHPA 3WQBA 4ZV4A 2XZDA 1BMQA 3RYTC 2YZGA 2P4SA 4KMRA 4LRWA 5AKXA 2O2CA 2PLRA 5EQFA 4HN4B 4RK1A 1GZ4A 1SY7A 1RABA 3OEHD 2I3GA 2VOEA 3L8HA 5K0BA 2PLNA 1JECA 2I1WA 2CLHB 5JS7A 3BEOA 1L8AA 2PQMA 4KC0A 2O8FA 3VV3A 2J5QA 2C2MA 2F43B 2JFYA 3A6ZA 3GLTA 4UUBA 4I6JA 3WV4A 2WF7A 4AN4A 3WJ2A 1QPGA 3Q85A 5TQVA 5JQGB 3QPWA 3RU2A 1TNDA 4MKFA 4R8KA 1LRKA 5BOSA 4X9XA 3P5SA 1EX9A 2IYWA 2OHFA 5EKXA 2GN0A 3IOMA 5DN6D 2F8SA 1NAIA 4JQYA 1IATA 3AR2A 4O08A 1JHYA 2QGFA 2JIMA 3KYBA 5DYGA 1GCIA 2Q5IA 3NATA 3JATB 5SZKB 2V7UA 4R2HA 2O3JA 4C6SA 3BZBA 4ZJUA 2A9FA 1HLFA 3BMCA 1W0JA 4TSFA 4E5VA 4PVDA 4HVCA 1A96A 4R3UC 1X7YA 3ILXA 3JQ7B 1QIFA 1EGQA 4X1KA 5E0OA 1Q83A 1Y6QA 2OGZA 2W6NA 3OOEA 2VDWA 2ZAYA 4CYMA 1RKBA 2OTCA 3FCEA 4HCJA 3B5JA 5F7JA 2W2QA 4FB4A 2B7CA 1C7RA 5FORA 2F9MA 4MB0A 4K05A 4MVCA 1ZJWA 4DJDC 4IDFA 1R50A 1CEYA 3FWYA 1XSEA 3CNBA 1JSLA 3AJEA 5ALMA 1Z8NA 1V4BA 4JV5B 1HKUA 2JJ8A 1ADGA 4EWLA 4HPJB 2DX7A 1GY8A 1YFZA 2Q7XA 3JARA 3U4GA 3W2EA 4AKIA 4H0NA 3GRCA 4HZUA 3WMGA 3B6MA 4R8MA 1UC8A 1KIAA 4FLMA 3HXOA 4ZHQB 4YAOA 2REQB 3M34A 4P4SB 2P4EA 1ZJJA 1JJBA 4X7MA 5FOVA 1M83A 3ON5A 5IJ0A 1I2BA 4K5QA 4LRUA 4OHOA 2EJCA 1PWHA 3DCYA 3EQZA 1JWLA 1CUVA 3L6EA 4DLTA 1RQXA 2FKNA 3FF4A 2GPTA 5C35A 2ZRJA 1KDVA 2G36A 4RVHA 1EM8A 4M9RA 4YRFA 5BW8A 2JFVA 2UUBB 1NW6A 1B14A 1Q22A 3D4NA 3K6JA 2A4KA 3S2FA 1U2PA 1C1HA 2OHJA 1E9BA 3QEJA 5I3CA 4IICA 4BYMA 3PDCA 1CD5A 4C22A 3KSZO 1UWLA 1L7BA 3EBLA 4FYVA 1GPDG 1R6VA 1EGMB 1YMUA 4PTYA 4YP7A 5HK8A 3ZY4A 4YUWA 1BE1A 1RLJA 2X7JA 3G8CA 1D6MA 1N5RA 4LNUA 4YQZA 3OJXA 4EMSA 2ZM6B 1NURA 2HQOA 5BW6B 2V7GA 5EUBA 2VPXA 3DH0A 4IGFA 1OAOC 3G5MA 3K0CC 2OP0A 1TLFA 2WW8A 4MS1B 5AKLA 2R8RA 1W2HA 4FSDA 1R9GA 1N2IA 3AUXA 4HP8A 1EESA 2DTEA 1PO7A 1T8TA 1RCUA 3VO8A 2XIQA 1Q1BA 2KJQA 1AK2A 3E7WA 2IP1A 1U7ZA 4L3OA 1P3DA 3JR7A 2XODA 3BC1A 4PLCA 2BFAA 4QOJA 1GSAA 4QVKA 4Y18A 1BDIA 2FDCA 3ER8A 1KBQA 2DBVO 1G5IA 3LO5A 3L4BC 3D7LA 3O9ZA 4URFA 2BGWA 1G41A 3G6KA 4FDAA 1WVIA 2FQ1A 1KVTA 1ZJ4A 2RHCA 4K0RA 2RGBA 2VHUA 3GMSA 4GDMA 4IXTA 2GLXA 2OCIA 1YDHA 2X1LA 3R3HA 4C4TA 4QM7A 2EU8A 2G9QA 3RREA 5C8VA 1JF8A 3SSAA 5F23A 5TVKA 1FYDA 1X86B 1VPWA 4HGRA 2O5VA 5G1NA 4EI8A 5JC1A 1CDOA 1DX6A 4QUAA 1BNCA 3UJCA 3WSVA 4HLNA 1G5HA 3JV7A 1FEZA 1V5GA 1IWOA 1RCTE 5FF9A 1GFZA 3F2VA 1QRDA 1YACA 1YZ3A 2G40A 4GYWA 4OXQA 1NF2A 3M6WA 1SQ0A 2FUG1 1TKCA 4FHGA 3SWWA 1Y82A 3QLJA 4QGAA 3SZUA 1KA9H 1PDWA 2M6RA 3RHFA 1EJ0A 3GP3A 3LRXA 1KQFA 3OF5A 3N2NA 4J0DA 4JL6A 4AJKA 1YOVB 1Z7EA 3T9FA 1QQBA 4L76A 2JFZA 1B76A 1RFGE 1E1LA 3CH5A 3LP8A 3N2IA 3O94A 4UTXA 3T41A 3USCS 3NKLA 1LJUA 2QD1A 4G23A 5ALTA 1GZ7A 3D6HA 5CDSA 1FE8A 2CGEA 1TW2A 1NQXA 4DADA 3SGLA 1IQRA 4G5SA 5JHGB 1FX0B 3NUGA 2VCHA 4X61A 2WAXA 2E6KA 1G9SA 1SCUA 3Q3GE 1Z7BA 3CGGA 1CKEA 1AQUA 1JDNA 3IPLA 4KFTA 2J3MA 3TIGA 2UUOA 1RXYA 2JGDA 2FR8A 4C04A 1YE8A 5TMDA 2IYAA 3CEPB 3CVOA 5B3KA 4II3A 1IHOA 1MAWA 3M6XA 4FFDA 5EJ4A 3F71A 3GT4A 1SUDA 2VF4X 4QHYA 5BWMA 3NYQA 2R8PA 2YMLA 2N9UA 4F3RA 2ETXA 2J5KA 3T1YB 1LW7A 3MCVA 3PR1A 5DM4A 5FI1B 5IU6A 3VZSA 1LXCA 1E9SA 3VU3A 3WGGA 4LZPA 1X2EA 1VMDA 1GN9A 1MENA 4PLYA 1ACMA 1S8NA 3TFOA 3HB7A 3I9MA 1Z4OA 2GHRA 2MMCA 2XNSA 4KKVA 2NTEA 3KT6A 1E3IA 3WLAA 5C1PA 5J4VA 1ST3A 2I6FA 3C3YA 3CB2A 3KPUA 1ZGGA 2PMKA 2QQEA 4P7FA 4RETA 3V8MA 1DEHA 2R7NA 5FUMA 5JSZA 4P7KA 3QVVA 1XKLA 3H5IA 4YFVA 3VVCA 2YFKA 3HVKA 1ENOA 1Q11A 2XLCA 3FB1A 3ECSA 3RS4A 4EPYA 1MGOA 2C07A 5F12A 3ZK8A 3TIXB 3H5RA 4B6OA 1H8HD 2V7QA 4DNOA 3O1JC 1J90A 3EGOA 5KQLA 1U8FO 1U9ZA 1E0KA 1P3Y1 1PE0A 3DDSA 2CZCA 5FBWB 3TW8B 1CQIA 2AWNA 4M7OA 2P9YA 3PDJA 1L4EA 1PAUA 1OQAA 3QKUA 4QOFA 4URVR 3GVPA 4AYTA 1VSUA 1CUJA 1J0BA 3OM0A 2VF2A 3RG2A 1VJ0A 3WG9A 1QJ4A 3GFRA 1HEYA 3FIJA 4RGYA 2QMUA 4OU5A 2V3CC 2I1LA 1G9XA 1EFCA 4K9MA 5DT9A 3V46A 3IEPA 2YZ7A 1GPYA 5H83A 2ARKA 4FJ2A 4L27A 4O8CA 4N8EA 3DQPA 4JJEA 3V7YA 1QFYA 1QGDA 5AYVA 3H83A 1KMHA 2C2OA 3ASUA 4IDCA 2C04A 1TYZA 5BWBA 4D02A 4BGDA 5LWQA 1UEXC 2VHEA 2SKDA 3P9RA 4HATA 4HLQB 2BJWA 1R12A 4X84A 5LM3A 2GDZA 1BS9A 1DKMA 3IBFA 3RVNA 3OTWA 2DLDA 4TTAA 4DG8A 1LDGA 1DUIA 1Y9EA 3QI7A 1WXWA 1DAKA 4KZKA 2GBCA 2WJAA 4MV3A 4UVHA 4OUDB 1JN0A 4ZN6A 1W0CA 3WFIA 4L5BA 1ICIA 4