2AK3A

The three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
GASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETSVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined structure of the complex between adenylate kinase from beef heart mitochondrial matrix and its substrate AMP at 1.85 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE ISOENZYME-3
total genus 70
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 1995-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak3A00
2NGRA 1Z63A 2F3TA 4B73A 1KHTA 3P4XA 2YWFA 2OCAA 4BFVA 1J90A 2FGJA 3U7HB 4YMWA 1G8YA 1XXHB 2XXAB 5DI3B 1CR2A 2WIBA 4O0MA 4XWAA 3VFDA 3U5ZB 1W44A 2Z5FA 2VHTA 1OXUA 5BN3A 2ZIAA 3ICEA 2WJHA 521PA 5JI3E 1KI3A 5KDLA 1Z0JA 3SU8A 5KPDA 1Z0DA 2LKDA 3AGPA 2Q3HA 1ESMA 4V0KA 1UBGA 3JVUA 4C9BA 4LBYA 4GRAA 3EPKA 1KIMA 3Q8XB 5J4HA 1CS4C 4LJ9A 4LHZA 1KMHA 3KQNA 3A4MA 2GETA 2CLSA 2VHJA 3AF3A 1EFHA 4PHTA 4JZKA 4MGYR 4LSGA 3QBTA 4G5SA 1NKSA 2FFHA 2WBLC 4OL0A 3IIKA 4LGMA 4UXHA 5DLQC 3FVQA 5H70A 2F1RA 3KJEA 3T5DA 4KFRA 4B6FA 1II8B 1QHIA 3VR3A 2ZVPX 1SXJB 1P7CA 1U0HC 1M1YE 4MRRA 4YDHB 2JJ1D 3QVUA 4RD0A 3L0IB 4TLDA 2GVDC 3K1JA 2FOLA 3RS4A 1F48A 5JWOA 3K70C 4AKIA 4MA4A 2GJAA 3T15A 4BUJA 1Q57A 1SVOA 4RVCA 5EXSA 2DFLA 4CZ2A 4DIDA 3I8XA 1JNYA 4ZCIA 4OJQA 1MV5A 4PX9A 3KKPA 5JFGA 4KU4A 4F7WA 2J7KA 4TSFA 1N6RA 1Z29A 4CGZA 4FMDB 1R6BX 3R7WA 2RB4A 1XJCA 4AG5A 4AK9A 4AKEA 5EJEA 4C7OB 1NJGA 2H18A 1E2DA 4IVPA 1GKIA 3RNLA 4D0LB 2FDCA 2X2EA 3JZAA 3VR4A 1DS6A 1KDPA 1YZGA 1U0JA 2VSFA 4U00A 4EPYA 5GVSA 1IN6A 1CJKC 1GSIA 1MO5A 2GKSA 4UQOA 3AVOA 4PFSA 4BZPA 2QZ4A 3L2OB 1XCPA 2NQ2C 2OHFA 2ZRPA 3ASZA 5HR5A 1F60A 1KO1A 3CNNA 4OK6A 3AVTA 1G20E 4LC0A 1VG0B 4V0MA 2ZJ2A 3FB4A 2QRNA 2AKAB 5IDVA 4LJ4A 1E9DA 2GCOB 4OHXA 4Q7MB 1J70A 4FCTA 1SVIA 5FI0B 3U7EB 2O8EB 1UKZA 4QGGA 1AJEA 2I3BA 4B3FX 2GJ8A 4PSVA 5TVKA 4Z51A 1OB2A 1BMFA 1XDBA 2ZE5A 4V0ME 3QKTA 1KK2A 3TVTA 4Z8XA 5IF9A 3RC8A 3ZGXA 4OHVA 1ZM7A 2AKYA 2WMOB 3C5HA 4BZQA 3C7KA 1RRFA 1IN4A 2O0KA 5L3SB 4RSGA 3SI7A 2XTNA 1P75A 3PQCA 5EXPA 2V6JA 5H1YA 3K0FA 3NEYA 3VR6A 2JJ1A 3SQXA 3EX7C 4WAUA 2GCPA 3P26A 2ZSEA 5AJZA 2G1KA 2OFXA 1T3HA 3H86A 2J1LA 1YZQA 2IXEA 4W5WA 4AY2A 1E1QD 2IYTA 4KYIB 3RVBA 3FKQA 2ZPTX 3CM0A 1CULC 4BWYA 2OO7A 1XEXB 2A2ZA 4LJAA 1E2HA 1OIVA 5L3QA 3ZQJA 3V9PA 3NH9A 2IHYA 1GNRA 5EUMA 2XNDA 4Q4JB 4C3ZA 2PL3A 3O8DA 1IAQA 4D4LA 2O8FB 2QE7A 3ADKA 3V4FA 1SVSA 2AX4A 4P4SA 4D0GA 2GESA 4LJ7A 5HKKA 2VA8A 5KSZA 2G77B 5JWRA 5F3WB 2OEPA 3QEJA 3EZ2A 4OHZA 1E2JA 1R0ZA 5EZ5A 4A0FA 2A5FA 3NXSA 4JT4A 4ACBA 3BBPA 1X8KA 4OK5A 2NO1A 5DIFA 4AKHA 3T1TA 2O8FA 8OHMA 2NO6A 4HZUA 3C4JA 1YKSA 2NMVA 1Q22A 4A9AA 2Q6TA 4RKFA 3CLVA 1E9SA 3FKSA 4FMDF 4MGKR 3QPUA 1Y3AA 3GLHB 4HLUC 3KTAB 1RE0A 2PCLA 3LY5A 3NC1C 3KUDA 1UM8A 3OAAD 1XMJA 3Q7PA 4KFTA 4QM7A 4HEJA 2ZAOA 3GCGA 1ZW6A 2HT1A 5L3VA 1Q1EA 3T61A 4GP7A 1GUAA 4J0QA 1T5IA 2ZETA 4HAXA 2F55A 3LBIA 2IEYA 1MABA 4NONA 2HXSA 4US0R 4ERNA 4TYYA 2Q9AA 2BIFA 1DVRA 3MUFA 3GLGE 2ZRMA 1BMFD 2RHDA 3AUXA 3REFA 1ZUIA 3SC3A 1KO5A 2JLQA 1KI2A 2VP4A 4JL5A 4PQFA 3UG7A 1UDWA 4ZKDA 2P6RA 3K9LA 2JLYA 2L0XA 3QKRA 1CF4A 4LCBA 4TMKA 4V02A 4C30A 4OQNA 3ZS8A 3B1WA 1OH7A 4B3GA 1P9NA 3MMPA 3EW9A 4LJ6A 3IUYA 4OI0A 1E96A 1T0JB 3Q85A 1W36B 3V4RA 2W00A 4TT3A 1JEDA 1G4AE 4M9XA 3LWNA 3N5CA 1QG2A 1XX6A 2O8BA 1XPUA 2H1LA 2ZJYA 3E1SA 3S1AB 2DB3A 2EFDB 4CEIB 4BFZA 3I62A 4FMBB 2CE7A 4OKSA 2BCGY 2JASA 1MO6A 3THOA 1S1CA 4JLMA 5FOVA 2C77A 3W8RA 5BW8A 1XWIA 1ODFA 2J41A 1E9CA 1XB2A 4PSKA 4XD7D 4IDQA 2IL1A 1DAFA 4H1VA 2FEOA 1HH4A 4QBIA 1VCIA 1SVMA 4JLVA 3DMNA 4F4CA 3M6AA 2BJVA 3CIOA 3RANA 2J0UA 4TLCA 1XXHA 4RZUA 2QTFA 3BXZA 3BOSA 5AWFC 1ZU5A 2VF8A 1EFRD 1EWRA 1NMYA 3ZIAA 2ODEA 2R6FA 4JLBA 4TTQA 1ZYUA 3NKVA 4UNPA 4WXRA 5FTKA 2QG6A 3EZ7A 2CJWA 5DI9A 4A6XA 1E1QA 1QHHB 3NIBA 3AP2A 1NNEA 4QKQA 1HT1E 5AJVB 3CPJB 2RGNC 4IRUB 2YOGA 3IQWA 2HV8A 121PA 1NMZA 3THWA 4Q7LA 3CNOA 1XD2A 1AQUA 4Q9JA 421PA 2I1VB 3TKLA 1RVDA 2G9NA 4I1OA 3NBXX 1X8JA 2GJ9A 3FHCB 2ZRBA 4JKYA 2H8KA 2D7DA 4GL2A 4TLAA 3MD0A 2FSGA 5EP2A 1W2GA 5IK2A 2IS6A 1IXZA 3GEEA 4Q9IA 1HURA 3IQXA 3HYRA 3JZMA 2W0SA 3OEED 1P60A 2OILA 4KYUA 4DBLC 2YOFA 4DSNA 2BKUA 3EZ9A 1WP9A 2WTUA 5GJBA 2RGEA 1IONA 4URUR 3QXXA 1P62B 4HUTA 2VO1A 4OI4A 1OPXA 1DARA 1GL9B 1OT3A 1ZM9A 3L43A 3UMRA 3FHTA 4CEJA 3QI2A 4AWXA 3FHOA 3B2EA 1W46A 3RDPA 5HE8A 3BFKA 2AL7A 2X19A 5C1BA 4JVNA 4QBHA 5EE3A 2JJ8A 3C15C 3PEUA 5G41A 2FFQA 3ADDA 1DELA 2DWQA 1OKKA 3K0CC 4Q1DA 1JAHA 2IA5A 3GD7A 2IC5A 5DGXA 2X8AA 1TMKA 4Z54A 4MUAA 4ZI3A 1F3OA 1KDOA 1TF7A 2IWRA 4IHQA 1U8AA 3CH5A 4Q21A 2FV8A 1UKYA 4HYYA 5F9FA 3DOEA 2CNWD 2HF8A 1QHNA 1KSHA 2I1QA 4KHZA 2EU8A 2QUZA 2V1UA 5KYKA 2NPIA 4M2LA 1KO8A 1IN7A 3H1TA 1EESA 1J8YF 3OEEA 4C0QC 4TWZA 2O8CA 5CDFA 2ORIA 3GJ5A 3I1FA 3PUYA 4ESHA 4P4UA 3EPLA 1JR3A 1HA3A 1DO0A 5JJIA 1N6HA 1Z0AA 5LDDC 1WA5A 1TQDA 1M7HA 1E2MA 2UZIR 3PUXA 4Q9KA 1W0KA 1MH1A 2FPLA 2B6HA 1S1MA 3LQQA 3EZFA 4QHSA 4DLXA 1YR7A 3CWZA 2REBA 1KI4A 4B43A 4EFMA 2FGKA 2HDNB 1WBBA 1PVOA 3CRW1 1KGDA 4GBMA 1N3BA 1YE8A 2GCOA 4BEBA 4LPKA 1TAGA 2KSQA 4O3MA 3L8YA 1F2UA 2QQEA 1KY3A 4AI6A 2BBWA 1PV4A 4NMMA 1E98A 1D8TA 3CBQA 3PFIA 3W90A 1YHNA 1OIWA 2JJ2A 4RZ2A 3SJCA 4D82A 4DB4A 1S3GA 1E9EA 2YKGA 3GLFE 2WWXA 2Z4RA 4GZLA 4GZMA 1VHLA 1E4YA 1XMSA 4BFSA 1XTSA 3SR0A 1BOFA 1JEEA 4Z1MD 3VKGA 5ELXA 3UIEA 4WOPA 1NY6A 2ZYTX 4JS0A 3AVYA 1JJ7A 2FU5C 4NKRA 3EPJA 4ABYA 1M74A 2H17A 1P6XA 3LD9A 2VBCA 1G7CA 1KJWA 2ZE6A 5LD2C 3IPYA 4LBVA 1TPZA 1K5DA 5FL7D 4BLSA 4AKGA 2J87A 1N0VC 2DWOA 2RGCA 4LC1A 3UWOA 4JLKA 1LS1A 5EP1A 2B21A 2ONKA 4LV6A 2OM2A 4NCHA 4TL6A 3A1WA 2QORA 3K53A 3W5JA 2XEXA 1ZNWA 4PZLA 2Q0HA 1RYHA 4DCNA 1P9WA 2BKEA 2WIAA 3TAHA 4MRSA 4L8GA 4BLOA 2ZM5A 4XSHA 2GDJA 4P4SB 3IILA 1OFTA 3DMDA 1JR3D 2JCSA 1II9A 1KZ7B 2J5XA 2XOKA 4Q4AB 4EPVA 4OHYA 4UNRA 3IO3A 1JQLB 4IKEA 3SN6A 3OIVA 5SZKB 5KHOC 1OH6A 2RGGA 4TMZA 1UKVY 4HB0A 4PHHA 1GWNA 3HR7A 3GFOA 2PJRA 5HTKA 2CLCX 2CVHA 2V1XA 5K8TA 2VP0A 4PAOA 5EQTA 1C4OA 3TMKA 2VH5R 3ZDQA 1TUIA 5FPYA 3U44A 2OBMA 1ZIOA 2RGXA 3OIUA 2G6BA 2OCYC 5FOUA 4AYXA 1SHKA 5KO2A 2WJYA 4FCVA 1KSFX 5K8LA 2WOOA 1ZM3A 5F2EA 1TL7C 1Z6AA 2P0EA 4BZXA 3TQFA 621PA 3WYFA 1F6BA 4WA7A 2VHQA 3BS4A 1GL6A 3TBKA 2MMGA 1AK2A 4A2WA 1Q1ZA 3AV0B 3TRFA 4NCNA 2MMCA 1YR9A 4LV8B 2AFHE 2HCBA 1H8HD 1Z22A 2Q3FA 2QP4A 2ODWA 4DSTA 3HYTA 2ZITA 2ASEA 1D2EA 3WNBA 3R8FA 1U99A 1E2FA 2QGNA 4R9UC 4YXWA 4B2IA 3ZVMA 4FCWA 2B8WA 1FUKA 1SVLA 4HUQA 2WVJA 2QSYA 5SZHB 4N1AA 1II8A 1F2TB 1Z0IA 1OIXA 3Q72A 1Q20A 3A8TA 1AZSC 4UJ5A 4ON9A 5HZKA 2EYUA 3BB4A 4F38A 1XNJA 2GXSA 1N0UA 4PC1A 1D5CA 2W6JD 4M8NE 3QG5A 1JR6A 2GILA 3B78A 2EFHB 4CT4B 1I2MA 1NP6A 1XZPA 2F3RA 3FFAA 2JIZD 4IXMA 2HJVA 3VR5A 2FN4A 4HLUA 5K8UA 1LB1B 1N2CE 4ITRC 1DBSA 1R7RA 1G291 2JJ2D 2J7PD 5J5CA 1CJVC 3WP0A 1F5NA 4KAXA 3NTUA 5TARA 3NDPA 4LYAA 2A5YB 4ASUD 4DVGA 2OG2A 4EIWA 1N5KA 1T3SA 3SFZA 2CCKA 1QHHA 5H8WA 1GP2A 1RRPA 2QPAA 1XXHE 2ZROA 2PT5A 5A4JA 2DHRA 3KDSE 5C4MA 1QG4A 2C9OA 4P31A 5DHFA 4B3BA 2D7CA 3PIRA 4PANA 1XD2B 4B3XA 5CYPA 5CB8A 3THYA 3N2IA 4B44A 1VG9B 4LI0A 1IJEA 5DSZA 5M04A 4ZIRA 4Q1BA 3KKQA 2A5DA 4CDGA 1SKYE 5CLLA 2QL6A 1PJRA 3BE4A 2YZ2A 2O5VA 2ZS8A 2ZUDA 4Q5IA 1UBEA 4RD3A 3VNUA 4XVUA 4PO1A 2WWIA 3FMPB 4LBWA 1OXVA 2XNDD 1KI9A 4HAZA 3REGA 1H8EA 3AP1A 3WHLA 1W36D 5AUNB 3ZJYA 2A9KA 3RC3A 4JYBA 5KOYA 4IDHA 3KKNA 1VYUA 4BRUA 1A5TA 2F43B 4Q03A 1N6IA 3UXMA 1ZD9A 3ZH9B 2C99A 2XNSA 5KTYA 1NVWQ 1C1YA 4ARZB 2QBYB 1M7GA 2E9SA 2EQBA 1WXQA 1T91A 2C98A 1G7RA 2MSEB 3BD9A 1VG1A 1WBDA 5DI3A 2WJIA 1E69A 3KX2A 4CEJB 5AJYA 1GITA 4D81A 4TQUS 3THWB 1NVUQ 1QVRA 2HT6A 2JEOA 1W4BA 2ZR0A 3DZDA 4TL8A 3BERA 4RD2A 3U3JA 5J4YA 4BGDA 1E0JA 2BHRA 1UEJA 3E2IA 3T12A 4DSOA 4ARZA 4G5OA 1JPJA 4A15A 2Y8EA 4FINA 4GP6A 2O52A 3E70C 4PAMA 2O0HA 4PSAA 1ZBDA 4URXR 5JI2E 4DLSA 1D9ZA 4LY6A 2Z43A 3G82C 1ZM4A 4CF7A 2P5TB 5GJVC 5E95A 4ZI2A 5KPJA 2Q3MA 1BYIA 4TTRA 3I5YA 4Y0VA 5C4GB 1JXOA 1N0WA 1E32A 4NHOA 2R6AA 1IJFA 4WZBE 1YZTA 2GA8A 3RHFA 3WYGA 4D4MA 1NG9A 1SXJE 1JECA 1Z83A 3CPHA 3R9IA 1TQ6A 1COWA 1KK1A 1JR3E 2FZLA 4CIDA 2BVNA 3LVRE 1KNXA 1Z6XA 2WJJA 1HV8A 4M1TA 5JLJA 4HLDA 5E7JA 2XAUA 2GF0A 4G01B 2RGDA 5C2JB 2GCNA 2GBLC 2EFEB 3JVVA 3A37A 4QNRA 2JLWA 2F9MA 2QMEA 4S35A 2ZJBA 2EFCB 3L0SA 3I92A 1DPFA 2BWJA 5SZJA 1RJ9B 1NKTA 4B6EA 3CONA 4OYHA 1UDXA 1S0UA 2K5UA 1OW3B 1ZC4A 3A4NA 1HYQA 4MGIR 1FPMA 1C9KA 3B6EA 1NLFA 4HATA 4NPHA 3SJBA 2YOHA 2DFNA 3LLUA 2A3RA 5KSOA 2WHXA 2OESA 3TH5A 1T5LA 2GZHA 3D6TB 2HJGA 1DO2A 2VP9A 3RRNA 2DBYA 3WNCA 1YZLA 4LZZA 3K9GA 4G1UC 4EQ6A 1Z6TA 3M0EA 2BV3A 4Q19A 4Q48A 1Q1BA 3L82B 3RRZA 4A82A 3ZVLA 3EASA 2X77A 5UKDA 2JATA 1N5LA 1E2PA 3R8CA 4M1SA 4JT2A 1DG1G 3ZIAD 4PPQA 2F1JA 3K0FB 4IFEA 4RD1A 1JPNA 4N3NA 2ZJAA 1XPRA 1JQJC 2F1IA 3NG1A 4MKIA 4DUGA 3QXCA 4C0KA 1HUQA 4IVQA 5EP3A 5TY0A 3U4QA 2VEDA 4PQRA 1QRAA 4TN1A 5BN4A 3V00A 3FMFA 4A36A 2J7PA 1E2QA 1VPLA 2N42A 2JLXA 4UKDA 2R6CA 1NBMA 3EWAA 2BMJA 2VP2A 4WIAA 4EFNA 2VL7A 4OBEA 3MWLA 3NH6A 1ZM2A 1TADA 1GKUB 3A1TA 4JLDA 1COWD 4EDHA 2QPTA 4D80A 2BMDA 5AJWA 2QM8A 4KFSA 4RKEA 4MITA 1G8GA 4EJSA 2VIIA 3WMEA 4Q4HB 4PC2A 1RIFA 3NWJA 3PITA 2G0NA 5TDHA 1KKLA 3LFUA 4TLEA 4NTZA 4A1FA 1TUEA 3FTQA 4TLBA 3CX6A 2CDNA 2CMKA 2ZI5A 4DZZA 1WQ1R 4HB3A 5KNCA 1P2VA 1PLLA 2FWRA 4BLRA 4KVGA 5LB2A 2FFAA 5FR1A 2IUSA 2DYKA 2AWNA 1X86B 3KZ1E 1XJQA 3TW8B 3C16C 1DAKA 4I81A 4QGAA 2CK3A 2ORVA 2AXPA 5BQ5A 1R0WA 2ZTSA 1G3UA 3IHLA 1NL3A 3TQCA 4B75A 2A7QA 2GEDA 2UVQA 3OEHA 3SOPA 3WMGA 4Q4JA 5DNYB 2ZI7A 4HAYA 2IS1A 4I1UA 1GZSA 4XD7A 5FOTA 1E3MA 4OJKA 1VCNA 3MSXA 3TVDA 1US8A 2IYYA 4DDVA 3FYHA 1MKYA 4U5XA 2GAOA 1U2RA 4RFSB 4BASA 2UKDA 3RSOA 1R10A 1R5BA 1UF9A 2WKRA 3ETLA 4MQBA 2XITA 4GMDA 1CU1A 1KDRA 2ZEJA 2IHBA 2R9VA 3F0TA 3TSOA 4ILEA 4M21A 4PHFA 2RGBA 4M1YA 4LWZA 2VF7A 3UKDA 2H7VA 3H2YA 3R9XA 2IYQA 3UMSA 3AF0A 2ZYUX 2OXCA 3K0SA 1KMQA 2JLSA 3Q7QA 5GADl 4IOKA 3TW4A 5CYOA 1RRCA 1B23P 2ZRCA 3QY0A 3W6OA 4NL4H 2P6NA 4LHVA 5FBLB 3L8ZA 1W5TA 1XTRA 2NZ8A 2ZJZA 3C8UA 3BGWA 1FMJA 5G53C 5SZIA 1FUUA 3RS5A 3FOZA 3VX3A 2CHGA 3LO5A 5CIQA 3AF2A 4QC2A 1XBTA 4Q9LA 3ZD6A 4EKDA 4QM6A 4G5RA 3GLFB 3VKWA 5FTNA 1SHZA 5LBIA 2OUKA 1ZD8A 1SULA 2ZUBA 3MLEA 5CIWA 3WBKA 3K0CA 3LX5A 2V6IA 2FPMA 2G88A 4B34A 1DEKA 5FL3A 2LWIA 1Z3IX 3QNUA 1LTQA 2PBRA 1VG8A 3AKYA 3OAAA 2V4ZA 2ZSDA 1RPZA 3GP8A 1QHYA 2DCUA 1G5RA 3O47A 1NIPA 4OQXA 1YJ5A 3AKEA 3A1SA 1N5JA 2GEUA 3BB3A 1JB1A 1X1SA 3IDQA 5CITA 2GK7A 2IYXA 4E22A 2ZRDA 4G5QA 2VP6A 4EQ6B 3S1AA 1HTWA 3LXXA 3BIFA 4FIDA 2HLDA 3M4YA 3GLIA 1QZXA 1LY1A 1ONBA 1WMSA 1CR1A 2AHOA 1GRNA 1VKJA 4Z8YA 2ZYVX 5B57C 1E2IA 3LA6A 2WMNB 1Z6YA 2YNMA 1CXZA 1W4RA 3QF4A 2ODNA 4HLQB 3GLGB 1P2UA 5HKKD 4TTPA 1ZAKA 3BK7A 1UPTA 2GF9A 4FD2A 2PLFA 3FWYA 5FOWA 4W5HA 4HDQB 1WRBA 5JZVA 4ZDIA 2A30A 4C2TA 1BH2A 2JLRA 4PC7A 4PZYA 4DWJA 2W83A 4DDTA 4JLOA 1R0YA 3DM5A 3IPXA 1LNZA 2PH1A 2ZSBA 4Q01A 4DLWA 2OFWA 2QRZA 3A58B 5FBRB 1OH8A 1FL9A 5D3MA 1Z07A 3ZVNA 4WVFA 3SJAA 1W5SA 3K0AB 2ZE7A 1AQYA 2ZU0C 3LW7A 3PXGA 3WRYC 1VYVA 2HF9A 3FMIA 1NVVR 4R7ZA 4QG7A 3O8BA 1S8FA 3TK1A 4QJ4A 2XXAA 4CT5A 2QSZA 3DHWC 2IS4A 2QP3A 5FR2A 3W34A 5CDFE 1GM5A 1FFHA 2PZGA 3VR1A 2VRWA 4QJ3A 2BBOA 1ETUA 1YR8A 1Z8FA 3FGNA 1Z6GA 3QQ5A 1BO6A 5JS8A 2PT7A 4URZR 2FSHA 3SHFA 4BRWA 4KLZA 1D2NA 3GJ8A 2OCPA 1CBUA 3B9PA 2CE2X 2QMHA 3UG6A 3TR0A 2XSZD 5BXQC 3CRVA 2IWHA 2QEQA 2VLIA 5H68A 2ERXA 3WYAA 4P32A 1BKDR 2RAPA 4MDEA 2J9RA 3WY9A 5C46F 1ZINA 4JBWA 4H9GA 2IYUA 5JECA 2DWPA 4IEIA 1XTIA 1W49A 2OCBA 1N6PA 2J0SA 3GJ3A 1TQ4A 1VCOA 3KKOA 1NMXA 2ZS7A 4AYTA 1Q21A 4XWOA 4MRVA 5J4VA 5B2ZA 2WJGA 3R9WA 2BBSA 4QL3A 4R2HA 4ACAA 1GFIA 1KI1A 2G0TA 2IYVA 4JJKA 2WWYA 4HB2A 4L5BA 4C0SA 4IDNA 4M9SA 1I4DD 1KO7A 4D0NA 3WMFA 2GJKA 1ELOA 1CRQA 2PX3A 3NBYC 1LF0A 1HEIA 3RAPR 2ZRNA 3KXLA 1AZTA 1JAIA 1U98A 4CEHB 4IJMA 1ANKA 1DAHA 1MO3A 2IEZA 3VU9B 5JHHB 3U3OA 2GAAA 1G6OA 1E2EA 2QAGB 5J4KA 2E87A 1K8RA 3SYLA 2P3SA 1Q0UA 3LBHA 5TMPA 2ZRJA 4E07A 1Z5ZA 2RMKA 1I4LD 5KU1A 1ZC3A 3TE6A 1UJ2A 4CYMA 3AKDA 3ADCA 3B85A 1M8PA 2QA5A 4RD6A 2JIZA 5FOSA 5GVRA 4C0HA 3D3QA 4AG6A 2E1RA 3DM9B 3PENA 4LBZA 3U61B 1UEIA 3AVVA 4KV9A 3EPHA 2BC9A 4JBXA 3B8HA 2DR3A 3ZVRA 5IRCD 5DYIA 1UBCA 3X1WA 1Z28A 3LNCA 3K70D 2QI9C 2QAGC 4K46A 1SVKA 3TUZC 2P65A 4NCKA 1XEWY 1FNNA 1G5PA 3EG5A 1N5IA 3LH5A 5JCPA 1P2TA 4QFMA 4DDUA 3O8RA 2BDTA 1EG7A 4Q4HA 1E9AA 4YXWD 3OE7D 4US2R 1E4VA 3QXJA 1KJYA 4ZCLA 4E03A 4XWKA 3KQKA 1N6NA 2H92A 5LB4A 4NCIA 2JA1A 1GILA 2V55B 1J7KA 3MWJA 4ZDJA 4GOKA 3KQUA 2GJSA 3ZQ6A 3HJNA 4PPNA 2OBNA 2OAP1 3AUYA 5AUOB 5KNBA 3HR8A 1KNQA 1XJ0A 3B1YA 2C78A 4BEJA 1AN0A 2ZYWX 4LHWA 1N6KA 4JSYA 4QNMA 5FUVA 2AR7A 4XSGA 3HDTA 4OK3A 3QUSA 2R2AA 3R20A 2ZR9A 3KXKA 1VIYA 1NF3A 1ESNA 3CB4A 3GLHA 4RY2A 3KTAA 5JRZA 1FP6A 2QM7A 2FNAA 5CK5A 3I61A 1GTVA 4TZ6A 3K0EA 2HYIC 4OQLA 4UNSA 1H65A 3U7GA 4NCJA 1Z2AA 1TX4B 3MWYW 3T35A 3OE7A 1ZVQA 3C5CA 1A2BA 3WP1B 1HE1C 3DDCA 1GNPA 1SZPA 4NBSA 3LBNA 3OFND 1JJVA 3DEFA 3I4LA 2FF7A 3B1XA 3RWOA 1W7AA 3U60B 2W6ID 1E2KA 3QKSA 2CVFA 4M1MA 4PZZA 4O2RA 1DE0A 1HT2E 2BMFA 2R44A 1L4UA 3HU1A 4CRWB 1ZP6A 1D6JA 1CTQA 3U6BA 1P4SA 3Q5EA 2ZRLA 4MDFA 1NBMD 1X8LA 4TSFD 3BFXA 1OJLA 5AJXA 3QKRB 4LJ8A 4XVRA 3TGPA 5FPTA 3RSLA 3SBEA 4M9ZA 1US8B 3P27A 3W3AA 4Q1FA 4XVQA 3AM1A 4RFVA 4CEHA 2QMOA 3T5GA 2C03A 4Q02A 3QPWA 2GK6A 2AD5A 3TSWA 1LS6A 5J40A 3IKJA 4TMXA 4IDOA 2XB2A 3KUCA 5E7IA 5HCNA 3NHAA 2ZU6A 4DLTA 3FKSD 4GOJA 3IIMA 3T06B 5D3QA 4C0BA 2KB0A 3HP1A 1G21E 4HAUA 3AGQA 3QXSA 1II0A 5AUPB 4C7OA 4LRWA 4D25A 1VDZA 5ANRB 4JVMA 2G1JA 1NRJB 2ZJ5A 4PAQA 4HLCA 4MYTA 1FX0B 2VPPA 3UK6A 2XGJA 1PLKA 1OXSC 2FJUA 2WM9B 3ASYA 3VTKA 1ZD1A 2W2XA 4DXAA 3RS7A 4F4IA 3QIAA 5HPYB 2GHIA 2ZRAA 2ZS9A 3EIHA 1XEFA 3OEHD 3DKPA 1AM4D 3NBFA 2AXNA 2QAGA 3VMFA 3W5IA 4B2LA 3GJ0A 2XTZA 2NG1A 5BWMA 3TSZA 1TTTA 3VQTA 2VP5A 1G18A 5A0FA 2UZ3A 3RS0A 3U7FB 1GRRA 4F91B 3EWSA 2JLVA 2FPKA 5G40A 4LHYA 2C96A 4TL9A 3H84A 4NYJR 1S4QA 3OESA 3Q5DA 1KK3A 4IOMA 3N2EA 4YMUA 1TU4A 3LV8A 1X6VA 4TMTA 1E79D 5JBQA 4QXAA 3T34A 3GMTA 2FZ4A 1A2KC 2WWHA 2YVUA 4PR0A 1E94E 2EFGA 2R6DA 2V7QA 4EJSB 1M34E 5EXXA 4KI0A 3B9QA 1DOAA 2QROA 3CNLA 2ECKA 3MFYA 4U02A 1G3RA 3K0AA 3OIYA 1EFUA 2Z6VA 2W6IA 2ZUCA 2D06A 2FSFA 2R6GA 4IVRA 4V0NA 3K70B 3TAUA 2W2TA 4XH9B 4C0LA 2O8DB 5FTMA 1OYYA 4JSTA 1DADA 5BYKA 3SYNA 1VTKA 1L2TA 3UMFA 2XOKD 3WHKA 2QNRA 3IO5A 3L0PA 3CO5A 2B7BA 3NEJA 5JJKA 3SBDA 1K5GA 3T1VA 4YDSA 3BAFA 2SHKA 3CR7A 2EWVA 3HWSA 4Q1EA 3SZRA 4LJ5A 1NSFA 5BYJA 4BLQA 1DTSA 3DKVA 4K8OA 2F43A 1GG2A 1E1RA 1TF5A 2PLRA 3HU3A 4NYJQ 5P21A 2LKCA 3OHMA 4G0NA 1FMLA 4BFXA 3AP3A 3K9HA 4PQYA 4KSCA 4UXJA 3C14C 5L3RA 2QT0A 3FMOB 2V9PA 2RKOA 4B33A 1J2JA 3IHWA 3AVXA 3SDZA 1S96A 4PXAA 3WBJA 4B3DA 2D3WA 2ONJA 1AGRA 1NN0A 1RRGA 3LAWA 4LYJA 4KCGA 1ZNZA 2ZRGA 1JALA 1U0LA 4YQFA 5AR1A 1AKYA 1T4GA 1CR0A 5DYGA 1DAMA 1OYWA 3SJZA 2R62A 4D6PA 1W48A 2GVZC 3UATA 2BM1A 3WRXC 3PJRA 1UFQA 4N0DA 1KZGB 1TF2A 2AN9A 2Z83A 2W0MA 3IEVA 3AF1A 2ZREA 2D2EA 2FEMA 3KJIA 2QQ0A 5TXGA 4DLRA 2QY9A 1MRSA 1IN8A 1Y63A 2IBMA 4P33A 1Q12A 6Q21A 1VCMA 3SNHA 1D9XA 3K09A 2FA9A 2HCJB 3B7GA 1A1VA 1MABB 2ZE8A 4PC3A 1SXJD 4JLAA 2OXRA 1G17A 2CLDX 2WOJA 1GVNB 1QBKC 1U94A 2GBLA 1AGPA 4UXIA 4DJTA 4LK2A 1LVGA 3LX8A 1IY0A 3PVSA 4X8MA 2PEZA 4MGZR 2B7CA 4MRPA 5FBVB 4TYQA 4V0LA 4GT1A 4P0TA 3EXAA 4EFLA 2CXXA 5KDOA 1H8HA 1RFLA 5G3ZA 1QF9A 1TEVA 1WE2A 2HLDD 1G64A 4DEYA 4R71A 3EARA 3KQHA 4RCYA 3FFBA 1XEWX 3D31A 5FUXA 3QKUA 1ZUHA 3CF0A 4EPTA 1OFUX 1T9HA 3GLIB 4QBFA 2Q9CA 2R8RA 2ORWA 3W8NA 1F2UB 5IK2D 4I1VA 2GXQA 2PZFA 4FW9A 4HUQB 1EGAA 5C18A 1XCMA 4QHTA 1GNQA 3N70A 3BC1A 4ZV4A 3K9NA 4NZYA 3ZLJA 1Z47A 3CX8A 2CCGA 1V43A 4GPTA 4PO8A 1CIPA 2NIPA 5KSYA 2ZRHA 2BEJA 5B30A 1A7JA 2FMXA 3QG1A 5GJCA 2AWOA 1I2DA 2X1VA 1ZU4A 2IYSA 3GJ7A 3PG5A 1PZNA 2WAXA 2WSSD 2D74A 5KUTA 4BPBA 1XEXA 2J0UB 2EWWA 1LW7A 1M2OB 3W6NA 4AIIA 4DIEA 4YONB 1KAGA 4L16A 4MYCA 2WKQA 1NN1A 3TUIC 2QMUA 2YWEA 2J3EA 4OQFA 3CRRA 1XP8A 1XD9A 3DZ8A 4DHEA 2CJWB 4NYIR 3OIWA 1SGWA 3ZZ0A 4BLTA 5FFMA 3K09C 3BFVA 3U44B 1HQCA 3GLHE 5FUYA 1W0KD 1KKMA 1R5NA 4DKXA 2BJWA 4BFYA 3C41J 4B32A 1OHHA 3KQLA 4Q9HA 2PJZA 4JMPA 1CJMA 2AK2A 1BS1A 2XX3A 1G3IA 1FW6A 3AVPA 2QBYA 1V5WA 4GSYA 4Q00A 1U90A 2V7QD 4G3XA 2LCFA 2AK3A 2HXYA 4NU0A 1GKYA 3BB1A 4ZIRB 1Z06A 4JL6A 4OI1A 2HUPA 4F4JA 4TL7A 1VECA 3NC0C 3VNVA 4LDJA 1E2GA 3LRPA 1CLUA 1NI3A 1FTSA 2XZLA 2CNWA 4ZKEA 4CVNA 4KODA 3SEAA 3IIJA 3QPVA 3MJHA 3A1UA 1U81A 2H16A 1NVVQ 2KWIA 1NY5A 5F98A 4US1R 3ZS9A 3CX7A 1WF3A 3TR5A 3CW2A 3F8TA 1AIPA 5EE1A 4A8JB 2H57A 4HZIA 4W5JA 1OFHA 3H0KA 721PA 3BORA 1VIAA 3IBGA 2F7SA 4RFSA 1G19A 1HE8B 2OLJA 1KSGA 4C4PA 3LDAA 5TB5A 4BE7B 3G0HA 2DPXA 3G5UA 1KI8A 3A36A 2YC2C 1IY2A 2DFKB 4Q66C 4D2IA 3EA5A 4MH0R 1T3LA 2KE5A 3KB2A 3RRYA 3CZQA 4A8JA 4V03A 4NYMQ 1IOZA 3B1VA 1VHTA 4BFWA 2BEKA 3MAAC 2YWGA 2JAQA 2IS2A 3I72A 1JBKA 3W9YA 3FE2A 5IHPA 4PTLA 1L8QA 1G7TA 1U9IA 1FQKA 4Q1AA 5FL7A 2GXAA 1CR4A 2I4IA 1SVWA 4X8OA 5JHGB 5EE9A 3KJGA 4KBFA 3RS3A 5FOXA 4UJ3A 3AEZA 3PUWA 2QTVB 2RHMA 3CH4B 5FPHA 4TYNA 2PCJA 1QHGA 2VYFA 4FMCB 4FN5A 4I4LA 1VMAA 3LW8A 3VHLB 5DHAA 2ZJOA 5E4FA 1AKEA 4QOSA 4HDOB 1SXJC 2Q9BA 4HAWA 4R2IA 4DEXA 1W47A 3MJRA 1W0JA 3PUZA 2C04A 3J81k 3CUEF 3CPEA 3GLFA 1EFRA 1EX7A 4YC7A 2O8CB 1OHHD 2GXUA 1YZNA 2ZI3A 3EAQA 1Z0FA 4B2PA 1DAGA 3GFPA 4R98A 2RCNA 1RJ9A 1G4UR 4MYUA 4CW7A 3TUJC 3K8YA 4OQMA 2IX3A 2J59A 1IN5A 5IT5A 4TYWA 4DSUA 5L3SA 3X2SA 1SKQA 3U4QB 1Z08A 3UWKA 1CRPA 2GTPA 3THYB 2VSXA 4FI3C 1IM2A 1FQJA 4ZPXA 2O8DA 2FE4A 3NBZC 1OXXK 3MRSA 2GEVA 2N46A 2OT3B 2NTYC 4LYFA 4W9MC 1Q3TA 2HEIA 2ZI6A 2ZR7A 3LLMA 2AD1A 4GI7A 4URVR 4BLPA 1NVXQ 2PMDA 2MSCB 3I73A 2GZAA 3OF5A 3VAAA 1CEEA 4YLGA 2BM0A 5E3HA 2WZQA 2W6JA 3KFVA 2PX0A 3GJXC 4V0OA 4URWR 4G5GA 1D2MA 3Q3JB 1RKBA 4DDWA 1QHSA 4DCUA 3PUVA 4LPSA 3U3RA 4I99A 3VR2A 1GIAA 4Q4AA 4AURA 2G83A 1G7SA 2IT1A 4L4UA 4F93B 3GLIE 2QE7D 4EPRA 2P2LA 4TQAA 3CF6R 1E0SA 4C0AC 3X1ZA 4B3CA 4DCTA 1U8ZA 1BYUA 1Z0KA 2F6RA 1CJUC 2KBFA 1ZCBA 2GWHA 1NN5A 4IEEA 1Z2CA 4QBGB 4M53A 1WDTA 3GFTA 4A2QA 4DLYA 3MG9A 1WB9A 1ZRHA 2ZSAA 1YVDA 3QKSB 1OB5A 3B1ZA 1EFTA 2XSZA 2Z4SA 1G1MA 1T0HB 1XFAA 3I8SA 5KDDA 3RLFA 3T1QA 4DRZA 4XIGS 4P4TA 4KITB 3SFVA 1TEXA 5F9HA 4HB4A 2ZRFA 3BH0A 3PEYA 5B58C 4MKFA 2JGNA 2W2VA 1L4YA 1DAIA 3L0OA 3NHBA 2CHQA 4WZ6A 1G9XA 1PUIA 4RZXA 1OSNA 3HU2A 2C2HA 1IXSB 4Q7KA 3VHXA 4YMTA 2ANCA 2RGAA 5J47A 1B0UA 1KI6B 5LD2B 5DO9A 2YINC 2R65A 3HPQA 4M9QA 4A0HA 4ZDKA 1IY1A 2B92A 3R7WB 2Q21A 1XPOA 2HYDA 2ZXUA 1E9FA 5B64A 3EIEA 3THXB 2DY1A 4KJZA 1F2TA 2IYWA 1G16A 5A5GA 1R8SA 3RABA 4QRHA 5JRJA 4H1UA 2J46A 4MYHA 5J4LA 1IQPA 4FXPA 4ZO4A 1TQ2A 2OAQ1 3D7MA 5KNDA 3CRQA 3B5JA 1E1RD 3I32A 2V3CC 1E6CA 1KY2A 1FX0A 2IYZA 3UANA 1A4RA 4Q1CA 1NLZA 2ZRIA 5EXTA 3AKCA 1E79A 1SKYB 3DVLA 3F3YA 3H4MA 4LV5B 4A4DA 3CR8A 3SQWA 1M6NA 4JLNA 2WICA 4GOXA 3VU9A 1YZKA 4KLNA 4WZAE 2VTKA 2ODBA 1AS3A 4P3YA 1J8MF 1Q3HA 4PHGA 2IK8A 2XJ4A 2O8EA 2CCJA 2WKPA 3CF2A 2J45A 3KKMA 3GJ6A 2IUUA 4W7SA 4KBGA 2KBEA 5AUQA 1FTNA 5CM8B 4ZDWA 3DO6A 1OH5A 1G8HA 1S2MA 3KJHA 4QHYA 4NYIQ 2CL0X 2V54A 4AC9A 1GAJA 3MWKA 1XF9A 1OE0A 3ZD7A 4XOIA 3A6PC 1MO4A 3DL0A 4DLZA 4LYHA 1DG3A 1LFDB 3SE0A 3ICQB 3GLGA 1YRAA 2OSBA 3X1DA 3KXIA 3TNFA 4HSEA 5GJWC 2QN6A 1TNDA 2ZSFA 5JSZA 1P73A 4EJSC 1WCV1 1OF1A 2YYZA 1FZQA 1KOFA 1N6LA 2TMKA 1NJFA 1XTKA 4RZ3A 2O8BB 1P9RA 1ZNXA 2RGNA 4QJ5A 1G8PA 2O0JA 1CKEA 2QU8A 5CJPA 1N25A 4B71A 3PR1A 3VKHA 1KAOA 1KDTA 3ZZTA 3AH8A 1GDDA 2FSIA 5JMTA 1XD8A 2XB4A 3EA0A 4Y0AA 2ZRKA 4M0LA 1G41A 1J99A 4XTCS 4YMSA 2J0VA 4DT1A 1X3SA 4BFTA 3B13B 4A92A 2REXB 5JS7A 2FFBA 4IXNA 4F92B 5L3QB 1HY3A 1MRNA 2YV5A 3QE0A 1KJZA 4A2PA 4XJXA 2FX3A 2OV2A 1EFCA 1P2SA 1T8UA 4II7A 2BMEA 4MKHA 1OFIA 1S9DA 2VQSA 3PEWA 1ZCAA 2PZEA 4X8HA 3WXMA 4GDFA 2IXGA 2VHCA 4JYCA 3A4LA 4ZCMA 1L7VC 1P72A 3IEUA 4HZUB 4O25A 1EXMA 3LQRA 4HI0E 1W1WA 1KK0A 4KFUA 1UKEA 1W36C 4BFUA 4OHWA 4PPGA 4JJZA 2IXFA 3LVQE 2A5GA 2AFIE 4X8LA 1OXTA 2JLZA 3MGCA 1E9RA 1OKKD 2GZDA 4IOLA 1EK0A 1KI7A 5LPNA 3AVWA 4TZ0A 1T8TA 4NE2A 1SXJA 4M1KA 2MSDB 4D4JA 1XZQA 4QGFA 1ZMXA 5KSPA 1X1RA 2J0QA 3VX4A 2QP9X 3SHWA 4WXPA 1E2NA 2IYRA 3QJYA 2QAJA 1FOEB 4A0GA 2C9YA 2BBTA 1PLJA 5FBQB 1TU3A 3DPUA 1XCGB 4GNKA 5CM9C 2IF2A 4RCZA 1ZIPA 1Q44A 3TLXA 1NN3A 4A0RA 4B74A 1QVAA 1KMHB 4DC9A 2IF0A 4NP6A 5JJLA 2H5EA 3D8BA 1YQTA 1W4AA 4MUBA 2IUTA 2XZPA 3ND9A 1UAAA 5DE3A 4I1SA 4DCSA 3O8CA 3CWQA 3KB1A 4M1WA 2WWWA 3QSYA 1KI6A 2BOVA 4A8JC 1T6NA 1EX6A 2N1BA 3GPLA 1XMVA 2REOA 3AF4A 3P1JA 1S3SA 1LF5A 1VYTA 3GJ4A 4JKIA 4L15A 4ESVA 1KTVA 4E5UA 1M7BA 2QPOA 2EYQA 1CP2A 2WAYA 5JEEA 1ZNYA 3NVAA 4POAA 3BRWD 3U3KA 4HAVA 3B60A 4KXFB 5FUWA 1UADA 4JVLA 2NPFA 1JXMA 2IYLD 3BH7A 3QBVA 5DISB 5EP4A 1SQ5A 4TQ9A 2ATXA 4M1OA 2PEYA 3AQ4A 4GFDA 1ZUNB 4B47A 1R4AA 1RC8A 1G8FA 1QHXA 1R8QA 2C5LA 4B48A 2YC4C 1E2LA 3EC2A 2EW1A 1JI0A 2D4HA 3QENA 2ZANA 5CK4A 2GRJA 2Z0MA 3ECCA 5JCZA 2CHVA 5TV2A 2QGZA 4LX0A 4JBYA 5JWHA 4TYPA 2WPDA 5EE5B 2DFTA 4AD8A 4C0JA 1R2QA 2A5JA 1NBME 1OV4A 1RW4A 2GNOA 2NOAA 2B8TA 2WV9A 1KYIA 1GOTA 4XTRA 4BECA 1AA9A 1S9HA 3QF4B 2ZVQX 4JL8A 4TT3D 5FTJA 5CB6A 3RS2A 5JEDA 1NIJA 3AVUA 3OFNA 4KVAA 5E7MA 4EPWA 3I5XA 221PA 4IFBA 4O2LA 5BN5A 5HZHA 1R5OA 4JVSB 1MR3F 5FPSA 5L8VA 5HCIA 1YR6A 1P61B 4IDPA 1UBFA 2YWHA 2CK3D 2WWFA 3P4YA 2XZOA 821PA 2NO9A 3ZZUA 4D26A 2JLUA 5DN6D 3DOFA 4N0EA 2G3YA 5JSZB 1KSJA 4OI2A 3P32A 2ATVA 2YHSA 3PV0A 4LOAA 4LUCA 4Q47A 4FMCF 1E9BA 3WNDA 4M22A 2X2FA 3OZXA 4EUNA 5DH9A 5FTLA 2CEAA 4M4SA 3NDBB 4AYWA 1BIFA 4D4KA 4U7DA 1O87A 1NG1A 4L9SA 2FH5B 1G3QA 4URYR 2NO7A 2IW3A 4GMXA 2QENA 3GEIA 2ZJ8A 3AB3A 3EC1A 1G6HA 3W3ZB 4KSBA 4Q4LA 1LV7A 1NLYA 1YZUA 2ZI4A 1Q1QA 3E5HA 4DLUA 4MKGA 3T1OA 3BWDD 3A1VA 4Q7JB 1KO4A 4NH0A 4PPFA 5FI1B 1EWQA 4PO9A 4A6PA 3BH6A 2OLKA 2QT1A 3CKLA 3ND8A 3THXA 2OFOA 1O3YA 3Q9LA 2ZAMA 3ZYCA 3U2QA 1FNMA 2PMKA 2EVWX 1W4CA 1PUJA 3RYTC 2W58A 1IXRC 1P3JA 4LJYA 2WPDD 1HQYE 2P6UA 5HE9A 1E0KA 1XTQA 2JDIA 2P67A 4HDCA 3RRMA 3EZ6A 1MT0A 2A78A 2CL7X 4Z1MA 3QXHA 3U3MA 4E09A 3P20A 1P5ZB 4NYMR 4UNQA 3CZPA 4TMWA 4KO8A 1G5TA 5FPKA 1MOZA 2BCJQ 2FG5A 2ZQ5A 2C8VA 4ASUA 1A82A 3CRMA 4S2EA 4L9WA 4FWIB 2YJTD 2WWGA 3SS8A 4DB2A 3HPRA 3IGFA 4QGHA 1AS2A 2XJ9A 3AVQA 1W0JD 1YU9A 4JLPA 3ADBA 1YRBA 2VSOA 1GRQA 2C9CA 4WW0A 5CLQA 2NO0A 2P5SA 3LXRA 5FH9A 4B76A 1N6OA 1IHUA 1OLOA 1RYFA 2XTMA 3IBYA 4RJLA 5EZ6B 5EE0A 1XMIA 3QVVA 4UNNA 1AS0A 1ZJ6A 1XTJA 4NDZA 4YMVA 5K8IA 3MCAA 4DLVA 2CBZA 1IBRA 4DCVA 1U8YA 1E99A 4PC6A 3SYKA 2D62A 4B35A 4LHXA 3QEOA 4EAQA 3GEHA 5EUQB 4IOJA 1H8ED 1XU4A 1E0AA 3W6PA 5G3YA 3UPUA 3QOFA 1CJTC 2WJVA 1GL7A 3X1YA 2VHUA 3I3SR 5FBWB 2C95A 1I4TD 2ERYA 4MRNA 1W2HA 1R0XA 2KJQA 3KL4A 3GQBA 4TMVA 1DAEA 4JLJA 2D2FA 1RZ3A 2QTHA 4RD4A 3F5FA 3QF7A 4K81B 2OBLA 3EIQA 3FDIA 1QDEA 2CL6X 3B82A 4DUGD 3TJZA 3BJIC 2F1HA 2V8OA 2OE2A 4BQSA 2OZEA 2WSSA 3FPAA 4IW3B 4CEIA 1NSTA 3PCRB 4C2UA 2JDID 3RWMB 4FWTA 3U6KA 3TIFA 1FP7A 3X1XA 1K6MA 5DN6A 2ANBA 5CJ2A 1G3MA 1XRJA 2WSMA 5AK0A 2NZJA 4DT1B 3PEVA 4Q18A 4WBSA 2RH5A 3KFXA 2ZI9A 1U9IC 3ONWA 4EPXA 3M1IA 4JIMA 2KI5A 5D3MB 2F9LA
chains in the Genus database with same CATH superfamily
1CUBA 1Z63A 1MVLA 3R5FA 4EJ0A 3P4XA 1PK7A 2AEFA 4YAWA 5AD1A 5JAOA 1YS9A 1U7UA 4E5NA 4YCCA 2GZSA 3JQFA 4KMOA 2PBZA 3VDMA 2V7PA 4RETA 3A9TA 2HMYB 2OP1A 4IDBA 3HZHA 2UYHA 2AI2A 4IP0A 3SZGA 2PN1A 3VH3A 5SICE 1FP1D 2VCYA 3QSGA 4MQFB 3U5ZB 1FBTA 2ZIUB 2NXWA 2VHTA 5BN3A 1C1DA 521PA 2H9AA 3GA0A 1BMTA 1RZVA 3S2ZA 4MLCA 2BDEA 1VLLA 8ABPA 3RBZA 1E5LA 1KI3A 1X7YA 3FCOA 1SU8A 2NSDA 4F12A 1Z0JA 5JAPA 5KPDA 2IBSA 4XWWA 1PEYA 5IEJA 2LKDA 1GZ7A 3OX2A 4ID3A 4GZ3A 2VS1A 2Q3HA 4EO9A 1ESMA 5C51B 4V0KA 2NZXA 2XWQA 5JASA 3JVUA 3S68A 1YXMA 3D54D 4E1AA 4KQCA 4C9BA 4LBYA 3EPKA 1OA1A 5ICGA 1U7ZA 1XZIA 1A98A 3Q8XB 1QVVA 3T5MA 1CS4C 3GRRA 3OZCA 4LHZA 4LJ9A 2I62A 5J4HA 3B52X 4JQYA 3A4MA 3C6BA 5THKA 2W2KB 2X8JA 4YACA 5JYBA 1UODA 3AF3A 4MZXA 2Y05A 2B69A 4HGPA 4MGYR 4QFCA 2I99A 2VYND 4OL0A 5AW3A 4LGMA 5H70A 2ZT6A 4JASB 4YBZA 4EARA 5FWXB 1S2OA 3T5DA 2ZYSA 4MUMA 4DMGA 2ZYHA 3HDGA 1E1CA 3EGIA 4EJMA 2YW2A 1K3TA 1II8B 5AW8A 1U0HC 3ZE2B 4MRRA 2OZKA 1W8DA 3E3AA 3L0IB 2GVDC 2GLXA 1NXTA 4H7JA 4IINA 1UEXC 3EUAA 4J07A 2GYYA 1NQTA 2GJAA 4MA4A 3MPUA 4QQ8A 3LOPA 1YF3A 1SVOA 1ICEA 2YIMA 2DFLA 3GRYA 3ISTA 2MCFA 3SD7A 3I8XA 4AX8A 1XDZA 3V3KA 3KKPA 1YH3A 1WMFA 1IEWA 2J7KA 3EXEB 4F6LA 1N6RA 1WNTA 2W4QA 4DRXB 4EA6A 1R6BX 1Y4ZA 3N2ZB 3KVNA 4BMDA 4C7OB 1TCAA 2C2MA 1I51A 2AFIA 1E2DA 4PZEA 1GKIA 1K7FB 1R8XA 1YZVA 3KL2A 2A57A 1XSEA 4KLAA 2CV0A 4S2UA 2BGTA 2VAPA 3JZAA 3VR4A 1DS6A 3ICVA 2VT2A 2WTMA 5SY9A 5FADA 5GVSA 2PS9A 4PF1A 1BXGB 1M2VA 3RF7A 5F5XA 1CJKC 3W4KA 4YRPA 2GKSA 1R0CA 5ENZA 3QWFA 1SUEA 1EFDN 1NT2A 4PFSA 1NPYA 1RAIA 4WBXC 3KM0A 3L2OB 1XCPA 1QIJA 2OHFA 2W98A 3BL8A 3QA3E 4LY3A 2VJQA 4M9RA 3VTZA 1F60A 3O1JC 4OK6A 3AVTA 1LSJA 1IMOA 5K2MA 2VJMB 3WLIA 4C89A 4CU2A 5I4CA 3D7SA 3LQYA 4BWFB 3A4VA 3PLAE 4KH0A 1Z5WA 5BNIA 1JHMA 4JEUA 4G63A 1N92A 3KVVA 3NAMA 5H9VA 2O8EB 1SBIA 1U6KA 2I3BA 3ANLA 1D0SA 3HB4X 2ZSIA 4UFOA 5LUAA 3NETA 5LYYA 2XMGA 3S2FA 3WRYA 1XDBA 1BC5A 4K3UA 3FHJA 4QDKA 3TQIA 3AILA 4I7EA 5IF9A 4MQ5A 1A4IA 1GQFA 1UWLA 3UK7A 1A50B 1LXCA 2Z3ZA 3AZQA 3L4BC 2AKYA 1JP7A 2QX8A 2H07A 3MIIA 2C2KA 3GN1A 4OM8A 5DNWA 3DE1X 4JITA 4B7XA 1P75A 4Y2UA 2XXJA 3PQCA 3VJLA 3IA7A 5HKBA 1N7GA 3BVPA 3OCZA 3PICA 3W1WA 2JL1A 3K0FA 2FPRA 4F21A 3VR6A 2X3YA 1MB0A 4MR9B 5IAAA 1H4VB 5CT4A 2QM3A 3RJ5A 2WF5A 4PVDA 1JQ3A 5AJZA 1Y7HA 4N5HX 5BSEA 1BE8A 4F2HA 4UCXA 4W5WA 1GPNA 1M6VA 2L18A 3SC6A 2OOKA 1E1QD 1KMNA 2NSJA 2ZPTX 3CM0A 3FDZA 1CUJA 1CULC 4FDVA 1DRJA 4RSMA 3B53X 4LMBA 1L5WA 2G72A 4Q3DA 2ZCVA 2J3IA 4YCAA 3PE4A 1E2HA 5JYEA 2E5LB 3ZQJA 2IHYA 2X14A 1YIAA 2H7CA 5EUMA 1X7GA 4NFHA 3JARB 2PL3A 2HA7A 1DC6A 1IAQA 1NXSA 2I6QA 2LIPA 3EWIA 2PFGA 3V4FA 1QH1A 1IH8A 5KYGA 4DS3A 3M34A 4BQIA 4MUYA 4G8CA 3H5RA 3TZEA 3DUFB 2PSHA 4HEQA 4LJ7A 2HR1A 3X1JA 5KSZA 1E1KA 2W71A 5F3WB 4Q9DA 2ZBVA 3K2EA 1R0ZA 5CYFA 4HX9A 5IKOA 4EFKA 2HU5A 2R5NA 1AUQA 1CNEA 3I64A 4OK5A 2OHGA 3T1TA 4A1OA 5J1SB 3ZBUA 3EHDA 1R66A 3HCAA 3K6JA 4IUYA 4R9NA 1QH1B 2NO6A 3VNAA 1RWXA 4X3OA 4D79A 3EEFA 4A9AA 4Q0MA 2BELA 3FKSA 4MGKR 5AHXA 1XRMA 3H13A 3VU3A 2GEKA 3P9KA 3OO0A 1QB8A 2CMGA 2V7UA 1RE0A 1NE2A 2ZWOA 4K6KA 5IFLA 1KP9A 1RHMA 4C87A 4GECA 3GDGA 1C8LA 3RYCA 2HA6A 1UDRA 1VKNA 2ZYGA 3KOOA 4XVHA 2IEIA 2HF7A 4JOSA 3LP8A 4Y2XA 2IDKA 4QM7A 2ZAOA 3U7QB 1ZW6A 3WFJA 4BU0A 1X2EA 1Q1EA 4J49A 4KBYA 2HT1A 4GP7A 3FMGA 2GAIA 5DSXA 4J0QA 4ZWNA 1F4LA 1TECE 3QPCA 3LBIA 4TZKA 1Z0ZA 3UHJA 2HXSA 3FRIA 3H9GA 2XUPA 1D6NA 1GZVA 3I9V1 3SC2A 4BJ1A 3B6KA 3V4PB 4F45A 1DU4A 2ZRMA 4N82A 3FF4A 1GGMA 3NJ4A 1BMFD 2MIIA 1W35A 2IPXA 2ZWAA 5EKXA 4CL3A 2XKJE 3I2KA 1ZD2P 2JH3A 3DXYA 4PQFA 4RA9B 4WL0A 2Z6QA 4LF9B 4MWOA 1JA0A 2QYHA 2XT0A 4QT0A 1EBUA 3JYLA 3S1LA 3K9LA 3BAZA 4G8BA 3EOZA 2QRLA 5HRAA 2H8GA 1FTWA 3QKRA 4MI1A 1CF4A 4N3AA 4XA8A 3LF1A 2PMBA 2OWEA 1MFZA 1Q0ZA 3HFSA 1KYTA 4L22A 3WL6A 1SZCA 1SUSA 2OD2A 4ZO9A 4BQOA 5JZOA 2O05A 5ENDA 4TXJA 1KMIY 1WVGA 4R8VA 3LZ6A 4LYEA 1W36B 4DMCA 4TT3A 1PL7A 3BHIA 2CN1A 4RYDA 4PFQA 3LL4A 3LWNA 2I4MA 3EDMA 1XPUA 2AMVA 4HN4B 2BTQA 3CT4A 3HZRA 3QLUC 2Q6OA 5D86A 4BFZA 3U4MA 2H4WA 2CE7A 3O4GA 4OKSA 5GIPE 4LRXA 1DJOA 1S1CA 2P2NA 5ILGA 3M3DA 2VTVA 2WEKA 4DLNA 1E9CA 1TVEA 3ZJ4A 3WB9A 4XD7D 1PL0A 4ZRNA 5TSDA 1U1GA 1VCIA 3C3AA 3PDIA 4D0SA 4F4CA 5HOQA 3H3FA 3KNZA 4YAOA 5IM4F 5BSKA 5CW2A 1R0SA 3A31A 5LM3A 2X40A 1ECGA 2HRQA 1GU0A 4NF2A 5KJ6A 3MOIA 3LKDA 1I0ZA 2M6RA 5K0CA 5IYZB 1T1EA 1RCTE 4UAVA 2R6FA 1HI9A 1TM4E 2HRRA 3M89A 3PHCA 4Z4QA 1ZYUA 3PPXA 4JU8A 2NVBA 1NRWA 4WGGA 4DMMA 4ND8B 3BKXA 2CJWA 5DI9A 1BFKA 3ZQKA 3NIBA 4A6XA 5LU9A 3LY9A 1NNEA 2IZ1A 4QKQA 5BSWA 3CPJB 4ZODA 1JIQA 2IY7A 4AMZA 2YXNA 4L0DA 4MIOA 3IQWA 2XVZA 3REQB 3THWA 1XD2A 1QOZA 1FRFS 3R2JA 1QRSA 3VNSA 4HH0A 1P1JA 1L1FA 4MI6A 2G9NA 1YMQA 1JG6A 4C3OB 4XKJA 9ATCA 3TTXA 4QA9A 2GJ9A 2JANA 2D5AA 1EM8A 2H8KA 1UH5A 3K72B 3MD0A 4DUYB 1X74A 1P19A 1KJ8A 1W2GA 5IK2A 4F85A 2BI7A 3F74A 1T25A 5LLTA 2PZKA 3MBOA 3DBLA 1FS5A 1Z2PX 1SZDA 3OEED 1P60A 4KYUA 4OXYA 5TMEA 3B3AA 3MGGA 1TLFA 5E1BA 2Q3EA 4J75A 5DGIA 1WP9A 3GCXA 1P29A 2RGEA 4HXGA 5GJBA 3QXXA 1T9KA 1ZX1A 4WN9A 4C7KA 3IOBA 4HUTA 1OPXA 1RQ7A 1SCUB 3K71B 3C5VA 4MHSA 4E08A 3B2EA 4NS1A 2JHPA 2V0CA 4RM2A 4XUGB 1HTBA 2KPOA 2PH3A 4XXHA 3IV6A 2JJ8A 3QA9A 5ICSA 4XM0A 3QEMB 2FFQA 3E4DA 5BQFA 1AN9A 1IAVA 3ADDA 4Q1DA 4P38A 1JAHA 3GD7A 1LDGA 4EA9A 1LSSA 3W5HA 2VDWA 5AVVA 1TMKA 2GCEA 1JAXA 2MSLA 4EZBA 5BV2P 4IHQA 3ZG6A 2JB9A 4R1OA 2UXBB 2FV8A 2QG9A 4HYYA 3RVJA 1V8DA 3DOEA 3U0BA 2BMWA 5F9FA 3E3NA 1H2XA 1XVLA 2G5CA 3AEQA 1TAQA 8LDHA 5FB3A 3G5TA 5JZMA 1I7SB 1PHPA 2NPIA 4OHFA 5KYKA 3VGJA 1DLIA 1Y8CA 1T36A 1IN7A 5D2CA 1GEGA 5ADUS 3TKYA 4PS1A 3JX9A 1IL0A 1N2ZA 1XDWA 3H5WA 4TWZA 4RTRA 2O8CA 4OXRA 3RU7A 2NTEA 3FJOA 1G1AA 1G21B 3A25A 3GJ5A 4J0GA 2A67A 2C2WA 2ZAYA 1JR3A 1HA3A 1VZ3A 1YL7A 3TQOA 3PHGA 5C9ZA 2B1RA 1KOGA 1YNOA 4FNOA 1JVBA 2Z2KA 4P86A 4PCAA 2WINI 1OJ7A 1P0PA 1M7HA 4UARA 1XZHA 1EXNA 4X1IA 1MH1A 2X5XA 1U2PA 5HUHA 1VDMA 4L6CA 1S1MA 2YFHA 1NQXA 4O59O 3WFIA 2XCOA 1DRVA 2X3FA 3EZFA 3OQPA 3KQYA 4HEA1 1F6WA 5ALXA 2REBA 1PVOA 1E6WA 3E7DA 2WNHA 1N3BA 1O58A 1QGUB 2O7QA 1ZIDA 4CT0A 4OP1A 3PFNA 3TQSA 2QTZA 1NVKA 3CZAA 2KSQA 4JNKA 4RK7A 2IGTA 4TVKA 1XO1A 2BFEB 4QE3A 1PSWA 3T95A 3VU1A 1KY3A 3CN9A 4WPGA 1SQ6A 1N3IA 1EE1A 2Q0QA 3EAFA 3TMAA 1E98A 1NQOA 2C0QA 3PFIA 4YMGA 5EYPB 1P5HA 1YHNA 2JJ2A 2C5HA 3GDWA 3IVAA 4RZ2A 3TB4A 4DB4A 5ALLA 5I45A 1ZXBA 4ZJUA 4OU5A 4YI3A 4GZLA 4B45A 3CEJA 3AIMA 3E9NA 1J1UA 2FG6C 1XTSA 4DNOA 1MUUA 1KPIA 4YALA 3K4PA 1BOFA 4RMGA 5IJXA 4QU0A 4EMBA 5IDXA 3VKGA 2J4CA 1NY6A 1Q95A 3DHYA 2ZYTX 3PGXA 1X0XA 3BQMB 4NKRA 5CFQA 4B6SA 4E12A 4E51A 3LD9A 3PZRA 4KO2S 4M8LA 1LV8A 3FB1A 1DCFA 1M67A 2ZE6A 4LBVA 3AFNA 1UBNA 2V5UA 5FL7D 2V6BA 3LPAA 4DG5A 1NTOA 3AOEC 4BLSA 1N0VC 2DWOA 2RGCA 3JQ8A 3BREA 1DXOA 2ZKIA 3GEBA 4MKXA 4YJFA 2B21A 1FDRA 3DMFA 2VHXA 2EKBA 1IWPB 4TL6A 4TQGA 4ZT5A 4MWGA 5AW6A 2AFRA 2OP0A 3K53A 1MDBA 2XEXA 3GLQA 4FC7A 5EGSA 1E20A 1RYHA 3BJRA 5LIPA 3UW3A 3BXXA 3IPAA 2WIAA 2ZM5A 4DQLA 4ZYXA 4RKRA 4C08A 1LX7A 4JI2B 1SUDA 1YFZA 2SBTA 4Q4CA 4N01A 1II9A 4NJMB 2RKWA 3JAKA 4EPVA 1PW5A 2HZ7A 2W8BB 4UNRA 1N5MA 2DP4E 5KHOC 2C3YA 2O14A 1Q0PA 3TTUA 1UKVY 2IU6A 4HB0A 1GWNA 2RIPA 3HR7A 4MR7A 3ZNOA 2PJRA 5HTKA 4L74A 4JJ8A 3TD6A 3W2FA 5CIYA 2Q3LA 3FSGD 2ZLBA 4Q7EA 2IU0A 2Y2VA 2IQIA 3ZV5A 5A04A 2JH8A 1UIMA 4MUEA 1TUIA 1NMEA 3LUHA 4Y2VA 3OIUA 5FPYA 4FB5A 5K3FA 4BCCA 2OCYC 3NW9A 5FOUA 2A0KA 5KAPA 3HL4A 1T1RA 3QFRA 4IXWA 1KSFX 3T54A 5K8LA 3IEKA 1ZM3A 1UL1X 1ESDA 3AFMA 3M8KA 5F2EA 2NM0A 2P0EA 3ZDYB 1RZRD 1YRYE 1V16A 1VPEA 1KPGA 4WA7A 4YRFA 3BS4A 1GL6A 3WWPA 5F73A 3G9UA 4A2WA 3AV0B 1VZ2A 1KKUA 3T1NA 1QP8A 4X63A 1HDCA 2AFHE 4HXFB 2HWUA 3ELWA 3NHLA 1JIJA 1YJXA 3OM0A 1TXGA 4MJ7A 2OCIA 1F8XA 2VBGA 1V16B 3FBTA 2ASEA 3OPXA 3ZGOA 1V1RA 1CUVA 3B9BA 1RADA 3N39C 1E2FA 3C6XA 4IVNA 3D3KA 4YXWA 3D5QA 4O33A 4P08A 3T4PA 1PCXA 1TM2A 3N0TA 2YVKA 4DTCA 1JZSA 5SZHB 3DDZX 5CUQA 5CFLA 1II8A 2ORYA 4IIJB 4YUZA 2P7HA 2E6KA 2HA3A 2EYUA 2G67A 4TV9B 3SZMA 2WSYB 1J0CA 1XNJA 4N54A 4R1LA 3R77A 1L5OA 2G40A 1N0UA 1TLLA 4WCFB 1MEEA 2WU0A 1DUSA 2QD3A 1GA1A 3D3WB 3QG5A 3RV3A 5L45A 4LF4B 3TIIA 1JKJA 1CF9A 3O2JA 2EFHB 3R6LA 4BN5A 3UBTA 1H6DA 3SSAA 4KQKA 1RS0A 3SLGA 1AO0A 4AF8A 1I2MA 1XZPA 5TGDA 1NATA 1ZH0A 5DFAA 4IXMA 2QLFA 2I0FA 2YWBA 1JG2A 1LJUA 1MJGA 3C7CB 2CXRA 1CJBA 1C9DB 4UTZA 3V8EA 3QVGB 5K8UA 1G291 5KNBH 5J5CA 1CJVC 3NC4A 3O8OA 3WP0A 1GNSA 5A7GA 3HA2A 5AKHA 1NVEA 2DJ5A 1UPAA 2B0CA 4KGDA 2O2YA 4GGMX 4GU5A 1QU2A 1POWA 3VUEA 1EWKA 1A04A 2HMUA 2CCKA 1NQWA 3EUEA 5C1PA 1GP2A 1RRPA 2B25A 1YMVA 3A27A 3I5UA 5KJEA 1QZ3A 4BO9A 3IMEA 4KXMA 4ZCRA 4C4TA 5JNVA 2AQKA 1CUIA 3USZA 1QG4A 4IDFA 4FP9A 2CNNA 5G0WA 3KYCA 4B3BA 3BMOA 1O0SA 4CMBA 3WRVA 1C3EA 1XD2B 5CB8A 2CLMB 1SO8A 4J3JA 4TWIA 3BIJA 1VRCA 4L3OA 3V3TA 4O63O 2PHZA 1VG9B 5DSZA 3CLSC 3RHZA 1DWOA 3MELA 3KKQA 4LQLA 4NBRA 1PJRA 1WKBA 2WTAA 2YZ2A 4TKMA 3I04M 2HU7A 1UBEA 4RD3A 5CP8A 3AT1A 3WG9A 4LKOA 4XVUA 5B3KA 1Y3FE 4K6HA 4TKUB 5FA5A 3KQVA 3RSCA 1H8EA 3EBOA 4X84A 3KZCA 3F7OA 5AUNB 4PGFA 4Q15A 4O29A 3ZJYA 4JYBA 1S5PA 2CFSA 1NF8A 3KKNA 1HZZC 2K4MA 3EQ2A 3OJWA 1EUZA 1DFHA 4EZEA 4M83A 2GT1A 4Q03A 4ZQGA 5KTYA 2C99A 1Q6ZA 3FRHA 3QYJA 2N9UA 1C1YA 1RIIA 3FNGA 1XZLA 3LBAA 3WTBA 4ZO7A 4ARZB 1M7GA 3OZAA 2EQBA 2QBYB 1MW9X 3KR1A 2BFFB 2ZYRA 4NDNE 2C98A 1F7VA 1VG1A 2EW2A 1J22A 5DI3A 2WJIA 3I5MA 3FDXA 4DR5B 3H4IA 1XU9A 4UUBA 2W6NA 5AJYA 3R7NA 1GITA 3A05A 1PKXA 4DMUB 1XWFA 1NVUQ 5IH3A 3N76A 3OTQA 1W4BA 4P80A 1U31A 5LA6F 1RP7A 5IS2A 3BERA 3FUTA 4BGDA 1E0JA 1Q14A 3OM9A 3E2IA 1P74A 2AVDA 3T12A 3AY3A 1PJAA 4ARZA 3F3SA 4FINA 3FVTA 3EXIB 4GP6A 2O52A 4YMLA 1N5RA 1T36B 2XUQA 2G71A 5BR8B 1PV1A 4L9RA 1JDPA 3HKEA 2EEPA 4PSAA 1ZBDA 5CTJA 5BSRA 2O59A 1D9ZA 1PNVA 1ZM4A 2NWQA 3QX8A 1LI7A 4P7JA 3VO8A 4CF7A 2DQSA 2COKA 3PI6A 4KZPA 1SC6A 2JD2A 4D42A 4RH1A 3V6MA 2GN0A 2Q3MA 1E60A 2WF8A 1JAYA 5K9ZA 4UHDA 4Y0VA 8AT1A 1YS7A 3A6LA 1B6RA 4CBVA 1CQIB 1N0WA 2GK4A 2R8PA 1AG9A 1RI1A 3F90A 3HR4A 4NHOA 4RK1A 5CXXA 5DM0A 5I3CA 2C0PA 1NG9A 3FPCA 3H9EO 5KQRA 1K68A 1UT8A 4PIMA 3PVZA 4QEZA 4EB6A 3WICA 4TV8F 2O3TA 3CPHA 1COWA 1P3DA 1IEQA 1L4GA 4JOCA 1UJ5A 5DNVA 2Z56A 3LVRE 1JIKA 3FFWA 2WJJA 3G2PA 1QDLB 5THQA 5L6MB 1EJ0A 2CB9A 5H16A 4GX2A 3FNHA 3G2LA 3LA8A 4AU1A 1PHRA 3PD7A 4QNRA 3A37A 5C2JB 1X9HA 5EI5A 1DBIA 5LOVF 5A03A 2XHZA 5SZJA 1U28A 4OYHA 3RB8A 1XZKA 4ZCTA 1G55A 2EQ5A 2VAXA 4NEGA 5M3BA 3T4EA 2VNIA 3DWGA 3R40A 5I7EA 1Z7BA 2E4VA 4ZYTA 2F2TA 1H9CA 1Z13A 1K6XA 1NLFA 4NPHA 3RTGA 3SJBA 3OBIA 5EQDA 3IJPA 1WJGA 3JZIA 3LLUA 4FZJA 5T67A 3RQSA 4ZPJA 3GLTA 1ZI8A 3BF8A 2D1QA 1DO2A 1BDIA 3Q11A 3VSCA 1J7JA 2QOEA 4MWZA 2YFYA 3IH5A 1QTQA 4AJ9A 2H7XA 3CNEA 3LYAA 5ALFA 1FDIA 2JATA 2D4AA 1N5LA 1H05A 1ZUNA 2G8NA 2XIQA 4JOBA 4UUAA 3R8CA 3RD5A 3KE8A 2R60A 2D1TA 3E8XA 3BGSA 1TU0A 3VDXA 4CMJA 1JVSA 4N3NA 2BI8A 4K9PA 1N1EA 2F1IA 1JFRA 1GCIA 5DHUA 3RIEA 4H4DA 4CHTA 3RFXA 1Q7CA 3IAEA 5ALUA 3OQOA 4CCWA 1PNOA 1FMTA 4IQ0A 3OWHA 1HUQA 2PD4A 4TKZA 3UENA 4IVQA 3U4QA 4FFMA 2C9BA 3BRWA 5I48A 3G5LA 2VDUE 4C7VA 5T64A 2QMYA 4PWZA 5DXJA 1EVJA 1JHVA 1BJRE 1H2EA 3STTA 5BN4A 1YR1A 2NZWA 5JZSA 4BNZA 3P2EA 2DPYA 2J7PA 1E2QA 2N42A 5C8ZA 4ZAYA 1O6GA 1OCEA 1NJ2A 1S8AA 2X0KA 2VL7A 1PFGA 4CV1A 1TA4A 2XRMA 2JRCA 3RSSA 2DMRA 2APJA 1U0NA 3A1TA 2ZW9A 3UV3A 4D80A 4BNLA 4BX9A 2WJZB 2P0YA 4KFSA 2B8EA 5A5EA 5IPFA 2NTNA 3JQ6A 1QHEA 3NWEA 1G8GA 4C1NA 4DARA 1ZGHA 3WMEA 2EKZA 2DUWA 1V1JA 3NWJA 3PITA 4MR8B 3TRIA 1SXIA 3FLBA 4OA8A 1JG3A 1QZTA 2I7VA 1SELA 4A1FA 4HNHA 1K0FA 2B4YA 2P9CA 3PQFA 4GPZA 4HK4A 4WTOA 2CMKA 3G0CA 1TM3E 3I6BA 3STVA 2RAVA 1WQ1R 4K03A 2G4CA 1EFPA 4MW1A 3RTBA 5DZSA 3TQQA 4JFAA 1NLMA 4WLNA 1J0AA 1QTNA 4RGYA 3UAGA 3CTMA 5TLSA 2XLBA 4M8KA 1YQUA 3COZA 1ZJ4A 1TVKA 5CT6A 1MOPA 4OFWA 1XJQA 2C0CA 3C16C 5ERYA 2VZ9A 3OE1A 2L42A 4HG2A 5KYXB 1U3CA 3ZK9A 5JNWA 2AXPA 3FBGA 3E7PA 1R0WA 5JAMA 1EHCA 4N5NA 1U7OA 1X7YB 2XMDA 5A3VA 3BT7A 3TQCA 4GPEA 3FDFA 2HFKA 1C8BA 2GEDA 5FWYA 1BD4A 3SOPA 1AHIA 1Q2UA 2JFBA 3MOSA 2DULA 4Q4JA 5DB4A 5DNYB 3DEHA 2ZI7A 3W4IA 5KYXA 2J9YB 4XD7A 4MAAA 1TD9A 2HKIA 1P77A 3PIIA 4F4FA 4MV3A 1ZR2A 3BM5A 1US8A 3L8GA 2IYYA 5CA1A 4DDVA 3FYHA 4GEGA 4KO4S 1U2RA 2FWNA 1RRMA 5C7LO 3OTHA 1KC3A 3RSOA 1R5BA 2WKRA 3ETLA 3KZNA 1QMGA 4EGCB 2WLTA 2XDYA 1KDRA 2ZEJA 2IHBA 4R01A 1PR5A 2Y6VA 3H83A 3G8DA 3D3WA 1TIPA 1QGED 1YJBA 2EZ8A 2PUGA 4M21A 2RGBA 3TYXA 3ESXA 2PKYX 2VF7A 3LC2O 4LWZA 3UKDA 4WKPA 2H7VA 2OA0A 4YPOA 1QDUA 3H2YA 2FFRA 4P2GA 2YJ6A 4PCVA 3WLEA 3R9XA 3DLIA 5FI3A 2I7XA 3UMSA 5AQ1A 3NEPX 2HO4A 3QNWA 5LQCA 2NVOA 2JLSA 2XYQA 5GADl 2ISQA 4YRJA 3L7JA 2BH9A 4ZVSA 5IG2A 5KTRA 1G8KA 1V6CA 2ZRCA 1UANA 3OF2A 3VR0A 1PFVA 3WQRA 4FCCA 4X24A 1X14A 1N4AA 5CVVA 5AMXA 2P6NA 1AUOA 3WI7A 3RADC 1NUHA 3L8ZA 1OD6A 3QLVA 3E23A 2OVBA 4RIIA 1RXWA 3C8UA 4K6GA 4FE7A 2D8MA 3ENQA 3VX3A 5HGJA 5TT0A 4ALNA 4B2YA 4XEHA 2JCYA 1XWWA 4FDTA 2P68A 3ZHOA 1MA3A 4EY5A 4POOA 4U2KA 4GWGA 1IQUA 4ISCA 1C8VB 1MO2A 3PGKA 5FTNA 3U7GA 1YDHA 5LBIA 1VRWA 3CHYA 1ZD8A 4QREA 3U1TA 2R7NA 3E53A 3MLEA 3K0CA 3PNYA 3Q5GA 3VI3B 1D7AA 1RHKA 2G88A 4B34A 3QVXA 4L1KA 2LWIA 3H1GA 5B1DA 1ILWA 2LRHA 1OX4B 3T52A 2OO5A 1QCCA 1N5OX 1GYPA 1QH9A 1JU9A 2GAJA 3HJTA 4HQNA 2DCUA 1RQRA 2RB5A 3O47A 1K8XB 4JJFA 1NIPA 1NNLA 1Y3IA 2DSNA 3IRUA 1PAUA 2GEUA 1JZTA 1OI2A 3I2GA 4UUPA 3UHPA 5CITA 4L0CA 4ZYWA 2XLCA 2UVDA 2ZRDA 3SSMA 3VOTA 5JQWA 2VP6A 2JK1A 3S1AA 1J56A 4RU1A 3QE4A 1M2OA 2BFEA 3BIFA 3KSMA 2HLDA 3EGOA 3M4YA 3GLIA 2HMWA 3IKTA 3UB2A 1XL1A 1QLWA 3IMFA 4IS2A 2I54A 3ZE9A 5LXTA 1GRNA 1J00A 4HCJA 4OPMA 4CM5A 3KSBC 3HDVA 1W2WB 3CNHA 3FZQA 1PUXA 4N3CA 3U9SA 2PZBA 4C6TA 3OD5A 1TJPB 1W4RA 3QF4A 4HX5A 3GLGB 1WOYA 5AW5A 3W2HA 5HKKD 3CRNA 2H2FA 3BK7A 1NFQA 4WVLA 3TOCA 4AN0A 2GF9A 3H2JA 2PLFA 3FWYA 2POCA 1HMYA 2OZLB 4FD2A 3DBVO 5HIJA 3RF6A 3V8MA 5INTA 4FHFA 1K88A 1JLRA 4V39A 2ZT8A 5E8RA 2JLRA 3NBKA 5ADWA 2JGDB 5LQRA 2WAAA 3L49A 2VUIB 2XGGA 1KFKB 4I5EA 4R3WA 5TMDA 2DR2A 2C88A 3FKJA 3OCXA 3OOHA 1LNZA 2ZSBA 5BVGA 3TINA 2I8CA 4P3XA 4Q01A 4Y9TA 3S2SA 1WG8A 2OFWA 1OH8A 3UAZA 3H97A 5D3MA 4EMTA 5I9MA 3QWBA 4ZQIA 3SJAA 1PL8A 2H4HA 3A04A 4CM6A 1R9GA 3FI9A 2ZU0C 3JAWA 1YZHA 3LW7A 3PXGA 4OFZA 4QYIA 3RC1A 1J2YA 3TK1A 3H2HA 3AG5A 4OX9B 5J59A 4UHCA 4ERXA 2FWBA 3INNA 1U3TA 1I4OA 2LGJA 3RR2A 1U4SA 3QY9A 3T5BA 5A6SA 5CDFE 2PZGA 4MI9A 1MAVA 1GM5A 2IX9A 4MS3B 4PGGA 5ALSA 4EA7A 4QJ3A 4Y6OA 3DBRB 4DTIA 2Z6UA 3M3HA 4QYTA 5EERA 4KWTA 2PT7A 4JBGA 5CT5A 2VR1A 3GJ8A 2PFSA 3OVMA 3HBMA 4G81A 1FFAA 3RVQA 1IC6A 1PT9A 1WZIA 1YS2X 3R7LA 2JFZA 1GT91 4BBZA 4PQEA 4D4HA 4FDLA 3N05A 5YASA 3VVMA 3WYAA 1M6HA 2J9RA 2AE2A 1D4ZA 2A1TR 5DBOA 4H9GA 3PF9A 2ZTVA 5DT2A 5ETJA 3TSCA 1GLVA 4MV8A 1SIUA 4CDNA 5JPCA 4E5MA 4BZWA 4AXBA 4AYTA 2SKEA 4WOKA 2Q46A 1Z7EA 4MRVA 2Q41A 3K2QA 4FLMA 1KEEB 4ZU1X 1OFUA 3G2IA 5JCXA 3TLEA 4NOKA 1Q5PA 2GI4A 3UK2A 3WNZA 3R9WA 3VDRA 1G2OA 1KI1A 1Y1PA 1VYHA 1ND6A 2NXEA 2OMKA 3E9EA 4NOLA 3RSGA 4OIMA 2VK2A 4LF7B 1ZRSA 3Q3GE 3KOXA 4IJ6A 3FYUA 1I4DD 3TLGA 1Q7BA 4D0NA 1PYOA 4WADA 2GARA 1MJHA 1Z7GA 1MZPA 1E62A 3U3DA 3WMFA 4RDXA 4JI4B 3OTOB 3ZDAA 1ELOA 3JU3A 4LXQA 2I8LA 3D8SA 2HW8A 1V1RB 2GF2A 3L79A 2ACKA 1ZN2A 2AXEA 3IQHX 3O3NB 4YECA 5DTIA 3UMVA 1TKAA 4O4LA 5FQNA 5E6UB 4KQJA 5IVPA 1ANKA 3VU9B 2IEZA 3GX1A 3IAUA 3OMWA 1J2TA 3WB1A 4G4JA 3LPMA 1K08A 3PHLA 1DQZA 1E2EA 3CLTC 4FR2A 2E87A 3SYLA 2P77A 4HGRA 4DFDA 3MJTA 2GRUA 4ZEOA 1SQGA 2HQSA 2A14A 1WUJS 2JC3A 2VZ8A 1VPVA 1IRXA 4RQTA 5C5EA 1BVUA 1QR6A 5ALIA 4LSMA 3IULA 3ZKAA 1TRHA 1RYMA 5KU1A 1PYDA 2GFIA 1ZC3A 2YWXA 3M82A 1VE7A 5JNTA 1NONA 3V8RA 1M8PA 2QRVA 2QA5A 2D5CA 5K0ZA 1XCJA 3D3QA 4XPIA 3PPIA 3PENA 1ZXXA 1U0RA 3UFXB 2C29D 5HIIA 3U61B 1UEIA 3EFEA 3ZWAA 3AVVA 3OURA 1ZZEA 2B5WA 2DR3A 4L6IA 3X44A 4YAGA 2DHDA 1HE2A 3KV1A 5DYIA 1UBCA 2GO7A 4G0QA 5LKAA 4RZSA 1Y89A 1SD1A 2VOJA 4K46A 1TVCA 3PFCA 4QYMA 2VYVA 1M2JA 2BE7A 2AT1A 4B4WA 3ZDZB 4D41A 2PVSA 1FNNA 1C3LA 2F4VB 1ECLA 4HTFB 4RK5A 1U9ZA 3NHKA 4MWEA 3H87A 5C34B 1C80A 3R76A 3RG8A 1EWTA 2NU6A 3NUGA 4U6QA 2BDTA 1EG7A 3DWEX 4BEVA 4Q4HA 3VH4A 5B12A 2FXVA 1E9AA 3NM4A 5DBFA 3OQ1A 2VQ3A 3QLVC 4L08A 4JI7B 4KN5A 1U7XA 1TVKB 3BSYA 3KYCB 5LYJF 4YI5A 3KQKA 1N6NA 2H92A 2CNBA 2PJDA 4OP2A 4XDHA 3WL3A 3PEEA 2YZ7A 1V5EA 3BXEA 2JA1A 4R2KA 4RY8A 5AKJA 1J7KA 4IZOA 1GHTA 1RM5A 1X80A 1IVNA 2ZWPA 3TTWA 2MSKA 2GJSA 4GXQA 4PICA 4AZ3B 3FIJA 3F4BA 3HR8A 1JFFA 1KNQA 3G79A 5H3LA 3B1YA 1WABA 1E7RA 2H0AA 4ZAXA 2C78A 3NFRA 3MT9A 5HQJA 1LK0A 2O20A 2ZYWX 3PC8A 2AW5A 3LOQA 3Q41A 2M2IA 4A27A 3AB7A 3EVEA 5H81A 2MDTA 4GRDA 2I6UA 4DDHA 2IITA 4IY1A 1CZRA 4W99A 4WNCA 1KIFA 3HDTA 3MWDB 3IQIX 4HNQA 2BKVA 1M2WA 2JZOA 4KREA 4O4IA 3KWLA 1O94C 3DOIA 2ZB3A 3OJOA 4RY2A 3VR5H 5KJ1A 4GUAA 1FP6A 2QM7A 3G23A 3FTNA 4BO7A 1GTVA 4D02A 2Y99A 1N34B 4WMLA 1ES9A 4RPHA 3IE0A 2HPAA 2UU9B 1WHSB 2VDJA 3DULA 3R1IA 1DQYA 1Z2AA 3F6SA 2WUWE 1V3VA 1JLMA 1BDJA 3MWDA 4S0ZA 3F3MA 1A2BA 3OOYA 3WP1B 2R00A 3EVDA 2R1UA 3OFND 3LVBA 5DXAA 1NUUA 3WKDA 3S5JA 2I22A 4PXYA 4QXRA 4QX6A 1T2VA 2XUKA 3AR7A 3ORSA 5LL6P 3GV0A 2XH8A 4QATA 2W6ID 3SZLA 3WQBA 2CVFA 4K9OA 4B4KA 1GTSA 4LF5B 3OSUA 1JMVA 4CF6A 2BMFA 1ZGZA 4OMFG 1WHSA 3H75A 2R44A 4YJ2B 2JIOA 3HU1A 1ZDMA 3ENWA 1H2YA 1HLPA 2VTEA 3ZWKA 1Y6RA 4WKOA 2AVNA 4LFBB 1WMEA 1CUZA 2ZRLA 1C7EA 1NBMD 2ASVA 3DAYA 3ET5A 3JYOA 3OIFA 2R751 4UBNA 1Z33A 4IICA 4II2A 5AJXA 5KVQA 3SS7X 3WX0A 3QU4A 4WDRA 1RHQA 1U8TA 4G0PA 3U7JA 3CVXA 3IJRA 4P4GA 3RSLA 4DPKA 2D1FA 4G1EB 4A0SA 2EKLA 4AQ7A 3R5TA 3R7AA 1BVRA 5AM3A 3NDIA 5BRNA 2C03A 3KK0A 2GK6A 4P3KA 2AD5A 2FLVA 2W93A 3T5TA 3IKJA 3ZQUA 3C3MA 5DN9A 4FHGA 2O8VA 3KUCA 1O89A 3UCEA 1VFPA 2Z2ZA 4ZQHA 3U13A 1ZGBA 1XJWA 3H2ZA 4DY6A 3FKSD 2AN5A 2BRUC 4KR6A 5K0LA 2IEAA 3HP1A 4QQKA 4F3RA 4HAUA 4Y7DA 1EUQA 2YN0A 1AF7A 1YULA 4R8RA 3PSAA 4B46A 4D3XA 1FRVA 3OOWA 4QAQA 2R5WA 2G1JA 5ICMA 4HLCA 3ACBA 4MYTA 1CUAA 1SCQA 2OGZA 1JMKC 3HYNA 1PLKA 1OXSC 3NKLA 2FJUA 2WM9B 3G0GA 2P2DA 3A1CA 1UZNA 1NJSA 2BFAA