2AK3A

The three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
GASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETSVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE ISOENZYME-3
publication title The refined structure of the complex between adenylate kinase from beef heart mitochondrial matrix and its substrate AMP at 1.85 A resolution.
pubmed doi rcsb
source organism Bos taurus
total genus 70
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 1995-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak3A00
4TSFA 5CM8B 4LK2A 1Z07A 2AKYA 4JT4A 1JALA 3BC1A 3AVOA 4DKXA 4M0LA 2QAGB 1EFCA 3QF7A 1U90A 1QHXA 2FPLA 1VHLA 3K53A 2GF9A 1RRGA 2DY1A 2FF7A 5GVSA 1GZSA 1R5NA 1B0UA 4QJ3A 2QROA 5IF9A 1N0VC 1QHYA 1R10A 2B8WA 3OEED 3PEUA 4DDTA 1XTSA 3DM5A 3FFBA 1XU4A 4LDJA 2IEYA 3P32A 4ZDKA 1ZCBA 1AA9A 4ZCIA 3W34A 1A2KC 1LVGA 2BM1A 5B57C 5JWOA 3T1TA 2VEDA 5ANRB 5BYKA 3HYTA 4ZI3A 2HJGA 3QKRA 1GNQA 2O0HA 4D4LA 1Q12A 4GPTA 3ASZA 4G5RA 4R7ZA 2DBYA 1HT1E 1GIAA 2DCUA 4OHWA 3IQWA 2D2EA 4EAQA 3FWYA 1NBME 1PUJA 3M0EA 4L15A 1RPZA 4GZLA 4S35A 4JVNA 5F3WB 1R0WA 2O8CA 1E9RA 1PLJA 3AVTA 4JLBA 4XD7D 4Q9IA 4HAYA 5H68A 3CPHA 3K70D 4RJLA 1COWD 2FZLA 2ZRAA 4IOJA 621PA 1P2UA 1UFQA 3PUZA 5IHPA 1OW3B 1DG1G 1LTQA 2B8TA 1G7TA 1IQPA 1XEWY 1QG2A 4Q4HA 1TTTA 4MUAA 1G19A 4Z51A 3GFTA 3QXHA 1MABA 2EFEB 2F1IA 2H8KA 3ZIAD 4DB4A 2O8EA 3W5JA 4WXPA 1RJ9B 4MKGA 4OK6A 4EPVA 4DB2A 2NO6A 4NCHA 2IS1A 4JLVA 1EX6A 3KFXA 1W48A 4NH0A 4URZR 2VP0A 4R9UC 2OG2A 2PH1A 5EE0A 4JLNA 1PUIA 1HEIA 3U3JA 5AUQA 2VHQA 2IHBA 1ZAKA 2XB2A 3A36A 2ZSBA 4LHZA 1E2GA 1SXJC 1T91A 4D2IA 5FH9A 3MCAA 4RD2A 3R7WB 3PXGA 1QDEA 2OE2A 4EJSA 3THXB 1HV8A 2ASEA 4AG6A 2L0XA 5DE3A 2WMOB 1JJ7A 1SHZA 3GJXC 1VHTA 3K09A 1S2MA 4OK3A 2AK3A 2EYQA 5FOWA 4YDSA 1NF3A 2ZI9A 3C4JA 1JPJA 4WZ6A 3ZZTA 4KYIB 3R9IA 4MYUA 4YLGA 5JZVA 2RHMA 2CLCX 1QHHB 2Q3HA 2ERXA 2OUKA 4OKSA 1FOEB 1WMSA 3UANA 2YOHA 5AJXA 4R71A 3KJIA 4OQMA 2IHYA 4P4UA 2VP2A 3IILA 4OHXA 2VHCA 1CR0A 3SJZA 4B76A 1OLOA 2ZTSA 1G64A 4TYQA 1JECA 2XNSA 1XPUA 1GILA 1GTVA 3AP1A 1IJFA 2FZ4A 2ZRMA 1T3LA 1IXSB 2RGAA 4GP7A 4LJ6A 2C03A 1F48A 3SC3A 1NLZA 2A5YB 2NTYC 3NBXX 2QUZA 4FMBB 4YMTA 4Q7MB 5JS7A 3ADCA 4A82A 1PV4A 4MUBA 3CX6A 4XTRA 2ZUDA 4UNNA 2XJ4A 5EXSA 3PCRB 2P0EA 1SXJB 3U3MA 2GCPA 2QRNA 1KAGA 5E95A 4OI0A 3K70C 3KB2A 3GLHB 4AY2A 2OXCA 1KO4A 4CEHA 1DAGA 1WCV1 2IYRA 4DBLC 5BXQC 2FEOA 3F3YA 2NGRA 2F7SA 1OXUA 2GEDA 3TR0A 2FNAA 4XJXA 1KSJA 1YHNA 4V0LA 3O47A 2OT3B 1TX4B 3M1IA 4W5WA 2IS6A 2W6JA 2OFXA 2KBEA 5DSZA 4G5QA 2MSEB 4X8MA 5IT5A 3N2IA 1XTIA 2KJQA 1RRPA 1VPLA 3L2OB 3KKNA 4Y0VA 4NL4H 3AM1A 4C0BA 2IW3A 1E99A 2A78A 1E2DA 1N5KA 4M1SA 3SJAA 4LGMA 3SBDA 3I62A 1O87A 1CF4A 2OCBA 1U8AA 3K0FB 3B9PA 1FX0B 4ZO4A 4O2LA 3GLIE 3ZLJA 4TMVA 2ERYA 4IFBA 3X2SA 1VCOA 2WOJA 3FPAA 3THYB 3WRXC 3SQWA 4FMDF 3TLXA 2J9RA 5DIFA 3K70B 3ZVMA 4CEIB 1E1QD 1WQ1R 3TVTA 1F2UA 2C8VA 3AH8A 4HDQB 4U00A 3AF1A 4LJ5A 4PO9A 3VU9B 3AV0B 3P20A 4LYAA 3W3ZB 4MQBA 1P6XA 5KSPA 2GKSA 5L3QB 1KI8A 1SKQA 3AP3A 3D3QA 5L3SA 1MV5A 2HT6A 4PFSA 2QQ0A 3GD7A 3VMFA 2V1UA 3TUJC 5JI3E 4BFYA 3LX5A 5C4GB 3AVXA 2P2LA 1DPFA 2OFOA 1NVWQ 2I3BA 2BDTA 4JYBA 1G4UR 4B35A 4Z1MD 1KI4A 5FUVA 3QKSB 4LJ7A 2YWEA 2ZSEA 3QXJA 1E2JA 1CJTC 5DI9A 1OB2A 3SQXA 5D3MB 2IYZA 3T1VA 2WAYA 2MSDB 1HH4A 1OSNA 1X1RA 3GJ5A 2XTZA 2AK2A 4UNPA 2F1HA 5TARA 4C4PA 4NDZA 2QTVB 4V02A 1IHUA 1KSFX 3HU3A 1OE0A 2VLIA 2ZJ5A 4RZ3A 1NIJA 4UXHA 1EGAA 4BLOA 5CB8A 1YZUA 5FR2A 4HZUB 5G3YA 2ZS8A 1TMKA 2ZYVX 1T8UA 3A1UA 2R65A 1E69A 5LPNA 3MJRA 2VP6A 1N5JA 2JLXA 3CUEF 4JBWA 2AR7A 2QENA 3KL4A 2RGNA 1CR2A 2VHJA 2HUPA 3KB1A 4R2HA 2OV2A 1Z29A 2YC4C 5UKDA 4NYIR 2X77A 5C2JB 3SYKA 3AQ4A 3NIBA 3H84A 2HF8A 1SHKA 4HZIA 1YZQA 3KJGA 4URWR 5EP2A 1VECA 3VR2A 2OCYC 4WOPA 1RFLA 4QM6A 3B7GA 4Q4JA 1GKUB 2OHFA 5HCIA 3WHLA 4A0GA 1SVLA 4PQFA 1UDXA 1E96A 1F3OA 1KK3A 1RIFA 1JBKA 2CXXA 1FTSA 1AZSC 1ZM9A 3LQQA 3QKRB 4LJ4A 2RGCA 1Z0JA 2ZJZA 4Q21A 3SFZA 2C9CA 2OESA 2OAQ1 3IPXA 4CEJB 4UNQA 4PSKA 3WRYC 1XMSA 2C9YA 1LS6A 1CIPA 3SR0A 2G6BA 1OXXK 2ZE5A 4C0AC 3BERA 3QY0A 1QHGA 1Z63A 1VMAA 3W90A 2WJYA 5EXTA 3B9QA 1S9HA 3MLEA 4KCGA 3QF4A 4WW0A 3CKLA 4RD6A 4YMSA 5FPHA 4BFSA 4PANA 2WWFA 1E2FA 2WWHA 3KXKA 2OLJA 1MKYA 1GRNA 4JYCA 2R6DA 5LDDC 4YXWD 2NPIA 4OI1A 4NYIQ 1US8B 4XWOA 4Y0AA 2CHVA 1NVVR 3GJ3A 4PZZA 5EUQB 5AJVB 3ZGXA 4OHYA 1NLYA 1P4SA 1P9RA 1U8ZA 2A5JA 1VIYA 3AKDA 3B5JA 4BLQA 5FBVB 1CRPA 3QBTA 1HQCA 1WP9A 3VR5A 2ZI6A 2J0SA 2CL6X 2EFHB 2BBOA 1ZD1A 3TH5A 2FEMA 2Q9CA 4O25A 2ZVQX 2IT1A 1OIWA 2JIZD 2HCBA 2YWGA 4LUCA 4RY2A 3RS0A 5H1YA 5EJEA 1JQJC 5FI1B 2NQ2C 2NO0A 2RGEA 2A5DA 3DOEA 3QPUA 4HI0E 3L8ZA 4Q48A 2GAAA 4PPQA 1GSIA 3V00A 1DAHA 2VO1A 4XVQA 3AKEA 1U99A 2JLQA 5FUYA 5SZKB 2JLZA 1Z6AA 2F9MA 2JATA 4B3GA 2R6GA 1FFHA 1D2NA 3ASYA 4QBHA 5C46F 1Q1QA 1VYVA 3FDIA 2P6RA 2PX0A 2ZVPX 1DAKA 1I4LD 1XEXB 1XD2A 2D2FA 1UKYA 2XTMA 3ADBA 1CJVC 4IOKA 2QT1A 4BFWA 1E79A 1GNPA 3CNOA 1E0JA 3EPLA 1S0UA 2B7CA 1NVVQ 2ZANA 5KPJA 3FMPB 3T34A 4F93B 4HSEA 4XVRA 4QOSA 5A4JA 3AUYA 2ZRIA 3I8SA 3HU1A 4M9QA 4B48A 5BW8A 2PLRA 1U2RA 2DFNA 3LLUA 3OZXA 3TNFA 3TQCA 4QXAA 2QAGA 3OIYA 4TLDA 3VHXA 4G5OA 2H92A 4LV8B 1G7SA 2CDNA 2EFGA 2QM7A 3B6EA 4KJZA 4NE2A 4TTQA 1EK0A 3A8TA 2O8FB 1KJZA 2EVWX 3EZ2A 3B1VA 4TT3A 1N0UA 2OCAA 3EAQA 4E07A 4B43A 3D7MA 4TTPA 4M8NE 3K9NA 2VF8A 2WJGA 5ELXA 4AYTA 5CYOA 3O8CA 2CVHA 2E1RA 2IWRA 4B2IA 2FFAA 2RGGA 2IEZA 2QPOA 3HP1A 4QRHA 3HR8A 4TZ0A 3EASA 2YOFA 2XEXA 1V43A 4DIDA 1YVDA 1A82A 2IYXA 1LY1A 3T5GA 2P5TB 4LYHA 4DSNA 1RRFA 1Z6GA 2IXGA 2CL7X 5HZKA 1EFRD 2DWOA 1OYYA 4KFUA 5DH9A 2WKQA 4BLTA 1KJWA 2IYYA 4DLVA 4ZIRB 4QG7A 4U5XA 1KZGB 3KQLA 5M04A 3SS8A 1ZM7A 3L82B 1J90A 3O8BA 4J0QA 4TLAA 4D82A 4JLPA 4EQ6B 1OXTA 1Z2CA 3A4NA 4Q1BA 3RANA 2PZFA 4IDOA 1T3SA 1ZC3A 1RW4A 1XRJA 3FKSA 4MRSA 4IJMA 2FPMA 3DM9B 2ZI5A 4LJAA 1E94E 1JR6A 5HKKD 4F92B 1XD9A 2IUTA 3GEHA 2JJ1D 3WMGA 4US1R 4P4SB 4Q4LA 4AYWA 1RC8A 3AF2A 3TK1A 3REGA 3KJEA 5BYJA 4DUGA 2FOLA 4Q1FA 2ZS9A 3A1SA 2VF7A 3C15C 4G0NA 3BAFA 4P0TA 2XSZA 3EW9A 1JR3D 1RJ9A 3CO5A 3AP2A 1ZM2A 2B21A 4B73A 2HDNB 5A5GA 4F38A 1WB9A 1XFAA 2ZETA 3TAHA 5CDFE 1IY2A 1E9CA 1XZQA 2C96A 4PHFA 2VH5R 3R8FA 2J3EA 4FW9A 3H2YA 4I1UA 2WZQA 1M6NA 2IYVA 1OXVA 2QN6A 3TVDA 1ZNXA 4KAXA 3QKTA 2GF0A 4PX9A 1VKJA 2V1XA 3CR8A 1BMFD 1KK1A 1NMZA 1Y3AA 2GJ9A 4RZXA 5JFGA 4L4UA 3R7WA 3CRW1 1IBRA 5EQTA 1H65A 4BZXA 3NH6A 4OI4A 3THXA 1Q3HA 1XXHA 3EIEA 1E2PA 4KITB 1BYUA 4QKQA 2GZAA 1GL6A 4GP6A 2AWOA 2XOKD 4B3FX 4US2R 4Z8YA 3QG1A 5IRCD 4JVSB 4D0LB 1NG1A 5LB2A 4I1OA 4B3BA 4BFVA 2QNRA 2V7QD 4IXNA 3PIRA 4B71A 2A5GA 4GRAA 4TYWA 1U0LA 3RYTC 4A15A 1I4DD 3EA0A 2V8OA 3PQCA 4DCNA 3I8XA 4I4LA 5EE9A 4A2PA 1S9DA 2J87A 2XGJA 1AKYA 5KSOA 4D4KA 5KYKA 1W1WA 5K8IA 3FOZA 3FB4A 4QFMA 1KSGA 3NTUA 1T3HA 1H8ED 3KUCA 1DOAA 1KI3A 4R98A 1II9A 4LCBA 4UNSA 2QMHA 1OH7A 5FUWA 4QHSA 2GESA 3RS3A 4M4SA 3QVVA 4Q03A 2DB3A 1ZM4A 3S1AB 3W3AA 4L16A 1RYHA 3FMOB 1TL7C 2Z43A 1ESMA 4IDQA 1E2KA 1SXJA 2BWJA 3U5ZB 1YR6A 3IIKA 3LQRA 5JS8A 1B23P 4XIGS 3HR7A 2ODNA 4OJQA 4LBYA 3GLHA 2WTUA 2V3CC 4PTLA 4BLSA 1E3MA 3FKQA 3ZJYA 3K9GA 2NIPA 1EG7A 2N46A 1IN4A 4UKDA 1N3BA 3SZRA 1M2OB 1KNQA 2ZE8A 3B1YA 3UWKA 1TF7A 4AIIA 1OXSC 4IDHA 3OEEA 3PUYA 5AJYA 1CR1A 3WHKA 2BM0A 4Q02A 3THWB 2PT7A 4HB0A 2BV3A 4Q66C 4QC2A 2J5XA 4PHTA 3X1XA 5G53C 4A1FA 3ZQJA 4AI6A 3GJ4A 4FWIB 4QJ4A 521PA 1X6VA 3CB4A 3R8CA 3QF4B 2C5LA 5CYPA 3N5CA 2AX4A 3CX7A 4TLBA 1RZ3A 4N0EA 4D4JA 1WDTA 1ZVQA 3QXCA 2FE4A 3ECCA 2YWHA 3K0FA 2OZEA 3IO5A 1FX0A 1Q3TA 2E9SA 2WWIA 1OFIA 2R2AA 3RWOA 3THYA 2V6JA 2Z5FA 4MH0R 4XD7A 2NO9A 1RRCA 4LJ8A 2JDID 2ZE6A 3DKVA 3QEJA 4LV6A 4M2LA 3CH4B 3WP0A 1E0SA 1E2LA 2GA8A 221PA 3RC3A 4DT1A 2LKDA 1D2MA 2W58A 1CEEA 1NIPA 3VU9A 3CRRA 2QAGC 3T5DA 2UKDA 1XMIA 5HPYB 2A30A 2XNDD 1NL3A 5L3QA 4GOXA 3ZIAA 1K5GA 4JJKA 3BFVA 3OE7D 4M1OA 3ZZ0A 3CWQA 1TUIA 1E9FA 3NC0C 4IHQA 3BFKA 1SKYB 4UXIA 4LI0A 3R20A 3RS5A 3W9YA 3GLFA 3IEVA 4N0DA 3QKSA 3N70A 3PFIA 1LS1A 1R0XA 3P4YA 1OH5A 1YZGA 4EPWA 2G1KA 1DARA 3QXXA 1LV7A 1JPNA 2WHXA 3CZPA 3A1TA 1ZYUA 1KI6B 3DZ8A 4JLJA 3FTQA 2OLKA 4UQOA 4C7OB 2C9OA 4B74A 4HZUA 4FI3C 4Q01A 4N3NA 4O3MA 2JJ2D 2WWYA 1KOFA 2AN9A 2Y8EA 3HYRA 1N6HA 5CM9C 4TZ6A 4LJ9A 3QVUA 4M1TA 2RH5A 1F2TB 3TGPA 1VCNA 1DAFA 2RKOA 3RS2A 2C2HA 2ZJOA 1U0HC 1G5TA 3TRFA 1BKDR 1Q20A 4XOIA 3SN6A 3SNHA 3PR1A 4M1YA 3X1ZA 2IL1A 2G9NA 4L9WA 2KSQA 5FL7D 3Q7PA 3EWAA 2RCNA 1BIFA 2GCNA 3RS7A 1UJ2A 5B58C 2V55B 4MGIR 4I1VA 1M7GA 1P73A 3KTAA 4DLTA 5J4KA 3MRSA 2G0NA 2VYFA 4II7A 3UKDA 5F9HA 4FN5A 5C1BA 1G291 1UF9A 1TEVA 4QNRA 4CEJA 2SHKA 3E70C 1M7BA 4JZKA 1Z8FA 1S8FA 3ND9A 3EX7C 1HTWA 1Q1EA 2GJKA 3F0TA 2YHSA 1XTKA 1HY3A 4TMTA 4P33A 3KUDA 3THOA 4LX0A 1KAOA 1Z5ZA 1X86B 4B2PA 1DE0A 1MOZA 1TPZA 1ZINA 4RVCA 1E9AA 1QF9A 1R6BX 3CF2A 3IIJA 3V9PA 3OHMA 2QP3A 1KYIA 1H8HD 1Z0DA 2OILA 1E4YA 2IYWA 4BRWA 1YZKA 1SVKA 4C2UA 4H1UA 5FPKA 2IBMA 4LPKA 4Q7LA 1US8A 3T15A 1W4CA 2WV9A 3VTKA 1FNMA 4ASUD 4XVUA 4MGZR 1EESA 3QXSA 1QBKC 3WYAA 1ZBDA 1RKBA 1JAIA 1UADA 2RGBA 3LXRA 4OHVA 2PCLA 4S2EA 5FTJA 1Z0FA 2D62A 1GAJA 3AVQA 3HDTA 3QENA 1Y63A 4Q7KA 1S96A 3RSOA 2IA5A 1M1YE 4KFTA 5DI3B 2HLDD 2CK3D 3AGQA 1L4YA 1UEJA 4JLDA 5H70A 2LCFA 3OAAD 4KSBA 1KGDA 2GCOB 1E1QA 5CIWA 3MJHA 3NHAA 2GXQA 3U3RA 3IDQA 1G4AE 3K0AB 1XXHB 2ZJAA 4LHXA 2CHGA 5KPDA 2VSOA 4TLEA 1ZC4A 4L8GA 1NNEA 1GL9B 5SZIA 4RFSB 5DGXA 2ZAMA 1L7VC 2VRWA 3ICQB 2R8RA 4MYCA 2FN4A 3AF3A 4QBIA 5FPTA 1NRJB 2W2XA 3PITA 4P3YA 1ODFA 4TWZA 1XEXA 4NYMR 3RHFA 3CRMA 4IVPA 4Z1MA 1JNYA 4DEYA 5EP3A 2CLSA 5CB6A 5KO2A 1M7HA 1TU4A 2KI5A 3H1TA 4HLDA 4ZV4A 1DVRA 3KZ1E 1CBUA 2N42A 5FTLA 5E7JA 4LRWA 3LV8A 4BGDA 1UKZA 2ONKA 4FMCB 2ZM5A 2Z83A 2NOAA 4CF7A 1XPRA 4NU0A 3K0SA 1A1VA 1ZJ6A 2IYTA 1W44A 4UNRA 4MRPA 2QPAA 2EWWA 4KFSA 1E0KA 4D25A 4GI7A 3BB4A 1OPXA 1T9HA 3SHFA 1W5SA 3U44B 2VSFA 2O8FA 1O3YA 2GK6A 2P3SA 4DXAA 1G21E 1II8B 1IN5A 2CL0X 3CPJB 1R0ZA 3EA5A 3ZZUA 1A7JA 1U9IA 4C3ZA 4Q4AA 3LBNA 1XTJA 4CYMA 3WMEA 5KDDA 2ATXA 1T8TA 1IN7A 5H8WA 5HR5A 4ESVA 1KMQA 1UPTA 2CNWD 3PV0A 3OFND 1HYQA 3CNLA 2XZOA 2WOOA 3EXAA 2WJHA 3QPWA 1OFTA 2ONJA 4NYMQ 5JCZA 3A4LA 2PJZA 3W8RA 1OFUX 2OBLA 4G3XA 4ZIRA 1ZCAA 2HYIC 4PHHA 2GK7A 4P4TA 1KDOA 3LX8A 2CCGA 4GOKA 2R62A 2ZJYA 4EQ6A 1XD8A 4OQNA 421PA 5IK2D 2BHRA 1MO6A 3I73A 2KE5A 3EIHA 4LYJA 1CP2A 4PZYA 2QZ4A 2QGZA 1CTQA 2ZRNA 1PZNA 2WAXA 3AF0A 3P26A 1FTNA 3TE6A 4P4SA 2X2EA 2W00A 2ZRHA 4WXRA 3GLGB 2NMVA 1KKLA 4YDHB 4C0KA 4W9MC 1Z22A 3KQHA 2IC5A 4DT1B 1YJ5A 4LYFA 1VYTA 4ITRC 2BMEA 4PAQA 4QHYA 2PMDA 5FL3A 2QSYA 2MMCA 2O5VA 2QA5A 3WYGA 2BEJA 3BB3A 3LBIA 4YXWA 3G82C 3WNDA 5KSYA 2VIIA 1N6IA 1KO1A 5HE8A 4NCNA 5CJ2A 2NO1A 4JLMA 1KY3A 3IKJA 2F6RA 3VR3A 2V6IA 2B92A 4MRVA 1VG1A 2WMNB 5L3VA 3CRVA 3GLFB 3U7EB 3H86A 3X1YA 3NKVA 1U81A 4DLZA 4IFEA 1MR3F 1E9EA 2JIZA 4M22A 5JI2E 2QMOA 4B3CA 3PEYA 1PVOA 1Q1BA 4TYNA 4MYTA 3EC1A 3W5IA 1IXRC 2BMJA 4LY6A 4YMWA 2AWNA 4GNKA 4ZKEA 4BEBA 5LD2B 1GP2A 1XBTA 2J0VA 4C0QC 3FFAA 3LBHA 2J45A 5L3RA 2ZJBA 4TQUS 2DFKB 2VQSA 1SKYE 5E7IA 3VNVA 3JVUA 1QVAA 3VX3A 3I4LA 4B32A 3TR5A 4EPYA 5CITA 2CCKA 4WA7A 1KK2A 4Q9HA 4NYJQ 2FSIA 4K81B 2REOA 2E87A 4BECA 2D4HA 2ZROA 5C4MA 3MWLA 1G17A 2QAJA 1XZPA 4ARZB 2ZITA 4G01B 5B64A 2JLYA 4BFZA 1TQDA 4OJKA 4DWJA 1N5IA 1ZNWA 4BE7B 3S1AA 1AQUA 5G40A 5E4FA 1Z47A 2J7PD 2QP9X 1VTKA 3FYHA 3NWJA 5FTNA 5EP4A 3BFXA 1F6BA 2FPKA 3EWSA 4HDCA 4BZPA 5GADl 2ZREA 2F1RA 4A9AA 3FHTA 1G1MA 2QE7D 3W6PA 3B1XA 1PLLA 3O8RA 3GJ7A 1NBMD 2WBLC 3L0PA 5E7MA 1J2JA 4FD2A 4B3XA 3KTAB 3Q9LA 4A2WA 2QRZA 3IHLA 4KXFB 4NMMA 1KKMA 2Q3FA 3I1FA 2IS2A 1W0KD 1SVIA 2Z0MA 4EFMA 1E2EA 4F7WA 3W6NA 2TMKA 5FTKA 3D8BA 4OYHA 2FH5B 5SZJA 4UJ3A 1D2EA 1JXOA 2CLDX 1QHIA 3THWA 1OFHA 1KK0A 2VBCA 5TY0A 3T1OA 4TLCA 3FE2A 3REFA 1KDTA 1Q0UA 3UMSA 3EIQA 5KNDA 3KKPA 1EFRA 1NG9A 4LOAA 2GETA 3RRMA 1E32A 1L2TA 2Q3MA 4WZAE 3A4MA 4IEEA 3EPJA 1D8TA 2W6ID 4HLUC 5CJPA 1L4UA 1OJLA 4IRUB 4M9ZA 4CGZA 1FNNA 1YR7A 5JRJA 4URUR 4W5JA 3L0OA 2RGXA 4A2QA 4O2RA 4TL7A 2KWIA 4V0KA 3JZMA 2G88A 2CHQA 3PG5A 1AN0A 3MGCA 5HKKA 3R9XA 2JJ1A 2N1BA 3DPUA 1E2QA 3VR6A 4CZ2A 4E22A 3MWYW 1Z6XA 1MO5A 4E09A 4A8JC 3QUSA 2QL6A 2VP9A 2P67A 3B85A 1BYIA 3P27A 4EIWA 4AURA 4JL8A 1JR3A 2VP4A 3UIEA 3BJIC 5FBRB 5EZ5A 3ADDA 1Q57A 1DS6A 1J99A 2IYSA 4E5UA 3GQBA 1U9IC 1W7AA 3ICEA 2JEOA 4TMZA 2NZ8A 3RNLA 1G3MA 1ZM3A 1Q44A 2ZRCA 4BEJA 5JBQA 1JAHA 1ZD8A 4Z54A 1BMFA 4TYYA 4F4JA 1C4OA 2PEZA 2F9LA 1W2HA 2F43B 4V03A 4K8OA 1DAEA 1KI6A 4JMPA 1EWRA 2X8AA 4C7OA 1XXHE 4FCVA 3WXMA 2XOKA 2R6AA 3AUXA 3FVQA 1IOZA 4NKRA 2CE7A 1EWQA 3IBGA 2ZSFA 2WPDD 2PX3A 5CLQA 1FUKA 2V7QA 2RB4A 1F2TA 2LKCA 3CPEA 4RZUA 1Z0IA 1HT2E 1U8YA 1KMHB 5BQ5A 3OEHD 1N25A 4LHVA 4KFRA 4A8JB 4A92A 4GBMA 3NBZC 4LHYA 1G7RA 1LNZA 4EKDA 1X1SA 2WJJA 3C16C 2BJVA 1MT0A 2ZYUX 3V4RA 3BWDD 2W0MA 2UZIR 4JIMA 4YC7A 4RCZA 1H8EA 4DVGA 3KKQA 4RSGA 4HAXA 4OQLA 1Z0AA 1AQYA 4Q4AB 1DADA 2O8DA 2RMKA 2FDCA 2B6HA 3LO5A 5CLLA 3VR1A 2GVZC 3IUYA 2O52A 1ZIPA 4LZZA 4TMXA 4B47A 1IN6A 1OKKD 2ZR0A 3WNCA 3CM0A 4G5SA 4DCUA 1W46A 5JJKA 1HQYE 4C2TA 1SXJE 5EXXA 3DZDA 4FMCF 4K46A 2GBLA 1AK2A 1JQLB 3KKOA 2ZR7A 1XCGB 1I4TD 2GVDC 3GLHE 4IEIA 2BC9A 3LLMA 2ZSAA 4HAWA 2VA8A 1YKSA 2PL3A 1W2GA 4QNMA 5DHAA 3D31A 4QHTA 3O8DA 5DHFA 4B75A 2XZLA 1TADA 3B60A 2W2TA 1FMJA 3CRQA 3LDAA 1NN5A 3ZVLA 3VNUA 2FGJA 5G41A 2ECKA 1G6HA 3L0SA 4M53A 4PPNA 3RVBA 2FSFA 3NH9A 2ZQ5A 3FHCB 4RZ2A 4XTCS 2K5UA 5BN5A 3A1VA 3TAUA 1UDWA 4HB3A 4V0MA 1QZXA 2FMXA 3SU8A 2D7CA 4DSUA 3H0KA 1WBDA 1YR9A 4KLZA 1XX6A 1KNXA 2B7BA 1KTVA 2P5SA 5J4VA 1E1RD 1SQ5A 4GMDA 1E9BA 3MAAC 3T1QA 2GXUA 5DI3A 2H5EA 1AS2A 2XX3A 4LJYA 3BH0A 1AM4D 1R5OA 2CEAA 2BCJQ 3E1SA 1A4RA 2JDIA 2O0JA 3OIUA 2XXAB 1E9SA 3SE0A 3SFVA 2OCPA 2H16A 2GCOA 1HURA 5AR1A 1S1MA 3VR4A 2WIBA 2OM2A 1NSFA 2D06A 3K0AA 1OH6A 2G83A 1J8MF 2PZGA 5BN4A 4AKIA 2XNDA 3T35A 3LVQE 2ZI7A 3VX4A 4MDFA 4JJZA 4RFSA 1FUUA 3OE7A 1KI7A 4RD3A 3X1WA 2OFWA 3K9LA 4MGYR 3QPVA 3CF0A 2DR3A 5JWRA 4DCSA 3VKWA 1W4BA 1S3GA 4C0HA 3FGNA 1N6OA 2W83A 2EFCB 2V54A 3GLFE 1G18A 3N2EA 4LHWA 4AYXA 4JKYA 2ORIA 2QTFA 3ONWA 1X8LA 2GJSA 2CJWB 4DLRA 821PA 3KDSE 3QSYA 5IDVA 3I5XA 4B44A 2EQBA 2P6UA 3BB1A 2JGNA 1GL7A 4XSGA 4DCVA 1K8RA 2CCJA 1NY6A 2OXRA 2ZRPA 3KXLA 3AKYA 2IK8A 1W5TA 2WICA 5KNBA 1XTQA 3RABA 2BKEA 3W8NA 5AUOB 2JJ2A 2Q9BA 4HAVA 3CF6R 2IF2A 1SVMA 2JLSA 2WVJA 2YJTD 4OK5A 2ZRJA 1N6NA 5AJWA 4AG5A 3U44A 3GEIA 3PEVA 4GOJA 2W2VA 1II8A 2NPFA 1TQ4A 2QI9C 3AKCA 3CR7A 1N6KA 2ZI4A 3KKMA 3M4YA 8OHMA 2YKGA 1Z0KA 1KO8A 4TL8A 4JLAA 2HT1A 3CBQA 4D6PA 5TVKA 1G20E 1VIAA 1NY5A 1UBCA 4ESHA 5J4LA 2GDJA 3SEAA 1E98A 1WE2A 1EFTA 5TXGA 4FCWA 4N1AA 1OHHD 4Q1EA 4D4MA 1PJRA 2VP5A 4IDNA 5LB4A 5J4YA 4U7DA 1YZTA 2A5FA 4R2IA 4TL9A 2PT5A 5FL7A 4HYYA 3IQXA 3PENA 1I2DA 1IM2A 2A3RA 1LB1B 3LW7A 4NCIA 4HB4A 5TV2A 1VCIA 2ZAOA 3A37A 4L5BA 4URXR 5KTYA 1KZ7B 3UATA 5JEEA 3BORA 2QORA 3DL0A 5GJWC 3SJBA 3VKGA 2XAUA 4FMDB 4E03A 2NG1A 5C18A 1ZU5A 3NBFA 3ZS8A 3H4MA 2ZRGA 3DO6A 4FCTA 3BH6A 4O0MA 4OL0A 2FV8A 4DIEA 4DLYA 1CULC 3GLIB 2H1LA 1RVDA 4A0HA 4D26A 2ODBA 2RGDA 3U3KA 4Q9KA 3C5CA 4NCJA 3JVVA 4C0SA 3GLGA 3I3SR 4AWXA 2FSGA 1MO3A 3LRPA 1H8HA 2QM8A 3NDBB 4KYUA 1M74A 4AD8A 1FP7A 4I99A 4Q7JB 1GWNA 2OO7A 4B34A 1UBGA 2O8BA 1LFDB 1XWIA 2JLRA 4ASUA 5TB5A 1Z3IX 1RYFA 1V5WA 1R5BA 5JWHA 3KFVA 2RHDA 1FL9A 2REXB 5EXPA 4NCKA 3U4QA 1OH8A 1W0JD 4UXJA 5J4HA 1P3JA 3LVRE 5F98A 3MD0A 5CK4A 3DMDA 1LF0A 3B1WA 1CR4A 3HJNA 3RLFA 1DTSA 1Q22A 3RC8A 1E2IA 2HLDA 2CK3A 4WVFA 4KLNA 4NTZA 3PUVA 4HEJA 3WBKA 3Q3JB 4DC9A 5JEDA 3OAAA 3D6TB 1J7KA 2XJ9A 1XJQA 2BBSA 3ZYCA 4ZKDA 5DISB 2GBLC 2ZRKA 4PC3A 4PO8A 4TYPA 4CVNA 3BE4A 3IBYA 4HAUA 5FOXA 4MYHA 2VL7A 1FPMA 4JVLA 2VHUA 5KOYA 3OESA 1T0HB 1TU3A 1P62B 5JECA 1KI2A 3AF4A 3SYNA 2DPXA 1G41A 1XCMA 4DLXA 3Q85A 2AD5A 3CZQA 1ZRHA 4CRWB 4ARZA 1OV4A 2FA9A 4IVQA 2WM9B 1G8YA 1L8QA 1S1CA 2ZIAA 3LD9A 4V0NA 3L0IB 4IVRA 1CKEA 5B2ZA 1EXMA 1ZNZA 3I72A 3UG6A 4MA4A 4CIDA 3DVLA 3LH5A 1P9WA 3TUIC 1SZPA 3FHOA 1AS0A 2G0TA 3GMTA 4FWTA 4AKGA 4LSGA 3M6AA 1JI0A 3CH5A 1G3IA 2OAP1 2O8DB 1CU1A 1JJVA 4C0LA 1GFIA 3QKUA 1TUEA 4DLSA 3TJZA 1F60A 4MKHA 4LC0A 1ZP6A 1NMXA 2QGNA 4KV9A 3SDZA 1NMYA 2WWGA 3QI2A 3K0EA 4BASA 2WJVA 4A36A 4RKFA 4DZZA 5K8UA 2QY9A 2FFHA 1X3SA 3BGWA 3C8UA 3K0CA 1P9NA 5FBQB 4ZCLA 5AUNB 3NEJA 3U60B 3EG5A 4OI2A 2CNWA 3VQTA 1P7CA 3OFNA 3KQUA 1G3UA 4LWZA 2EYUA 4HDOB 1Z06A 3QE0A 3RWMB 1GKYA 1WA5A 3NVAA 4TQAA 1XB2A 3A1WA 5EE3A 3VAAA 4FINA 4GFDA 1HUQA 1XJCA 3CX8A 5D3QA 2DHRA 4BWYA 3AVVA 4BQSA 4QBFA 4L9SA 1XF9A 5IK2A 4AK9A 5HTKA 2H18A 2FX3A 4D80A 5DLQC 1YQTA 2QU8A 3C7KA 5JCPA 5KU1A 4IOLA 3UMRA 2JJ8A 2Q6TA 1FQJA 2VPPA 4LBZA 2UVQA 3OF5A 5AK0A 4KI0A 3I92A 4GSYA 4ACAA 3PUWA 2Z4RA 4BUJA 4IW3B 4ON9A 2J0UB 1R8QA 3TW8B 4PC1A 3A6PC 3B82A 4CDGA 1P72A 3MMPA 3QNUA 4Q19A 1ZMXA 1SVSA 3I61A 3GFOA 2PEYA 2XITA 1MO4A 3DKPA 1WXQA 4M9SA 4KBGA 4PPGA 2I4IA 4JSYA 4DLWA 4M1MA 2IF0A 3DHWC 1A2BA 4XWAA 4F4IA 2GZHA 2UZ3A 3ZVRA 4F4CA 4DDUA 2X2FA 1TQ6A 3Q5DA 4FXPA 2F43A 3EZ6A 2G1JA 4I1SA 3U7HB 4HLUA 4PAOA 1QHNA 2ANCA 4URVR 1N6PA 4GMXA 3L43A 2C98A 2FU5C 3K8YA 2BOVA 1F5NA 2H57A 1XJ0A 1IN8A 2RAPA 2BCGY 3DOFA 2GILA 4A0FA 3BK7A 4JS0A 3I32A 1G8PA 4TSFD 2GJ8A 3KXIA 1KMHA 4PPFA 3VHLB 1IJEA 2H17A 4A8JA 1JXMA 4Q9LA 3CWZA 1MH1A 1XNJA 3NEYA 1YE8A 2I1VB 1MRSA 5FOVA 3IGFA 2ORVA 3FMIA 3IHWA 4H9GA 4PC2A 4PQRA 4F91B 5JLJA 1OB5A 1TF5A 3KQKA 121PA 1UAAA 1IXZA 4LPSA 1IAQA 5KUTA 1P60A 2HF9A 4DDWA 1P2VA 2C04A 3RRYA 5J5CA 2AXPA 3Q8XB 1NSTA 1D6JA 2F3TA 1DBSA 2OBMA 2J7PA 3QJYA 2J59A 5FUXA 1GITA 1VG9B 1P2TA 3HU2A 5KNCA 1U94A 3ZS9A 3QBVA 4YMUA 1AKEA 5FTMA 3AVPA 4NZYA 3PJRA 2AHOA 2QE7A 1GVNB 3ADKA 1UM8A 4PAMA 5DYIA 1NBMA 2ANBA 3BOSA 2F55A 1JEDA 4X8OA 5P21A 4PSAA 1GKIA 2IYLD 5JSZB 1W0KA 3VFDA 2ODEA 4OHZA 2PZEA 5FOUA 4BFXA 1TNDA 2ZI3A 1ESNA 2IYQA 4D81A 3RS4A 5LD2C 5FI0B 1ANKA 3UG7A 4IKEA 3GJ8A 3RRNA 3U61B 1XMJA 2XB4A 4TMWA 1AZTA 4DSTA 2YZ2A 2ZPTX 4PQYA 3CNNA 4EPRA 4YONB 4NYJR 2YOGA 2PCJA 3TUZC 4QL3A 4OBEA 4HLCA 4Q1AA 1OIVA 2GTPA 1R0YA 2HCJB 4MGKR 2AL7A 5FPSA 1BS1A 4US0R 2O8BB 2ZRDA 2ORWA 3CLVA 4X8HA 1T5LA 1TQ2A 4GL2A 5FR1A 3EZ9A 2J46A 2W6IA 4HLQB 4PHGA 5TMPA 1Z28A 2GEUA 1FQKA 3Q72A 3U4QB 4QGGA 2ZYWX 3ZDQA 3P1JA 3ZD6A 2NO7A 1W4RA 2QMEA 2GJAA 3PUXA 2XXAA 1XTRA 1CJMA 1J70A 2XTNA 1WRBA 4OQXA 3UXMA 721PA 3EPHA 3QIAA 2H7VA 3TIFA 2QPTA 2ZSDA 1GUAA 4KODA 2ZRLA 2R44A 1CLUA 4Q00A 5FPYA 1RE0A 3B8HA 4GDFA 5J40A 4LBWA 1KSHA 4HUTA 1R4AA 3EZFA 1QVRA 2PJRA 2PLFA 1DAMA 2WWWA 2C77A 3IIMA 1JR3E 3IPYA 5AUPB 1DO0A 2WIAA 2Q9AA 2AKAB 1E2HA 4WBSA 3RAPR 5FBLB 2JLUA 1T6NA 4RD1A 3K0CC 1Z2AA 3CONA 2J0QA 1QHSA 1E0AA 3AGPA 2CJWA 1E6CA 4NONA 3LFUA 4ZDIA 2QBYB 4IXMA 2WKRA 2WSMA 3KX2A 4DHEA 5F9FA 3TW4A 4BFTA 1G3QA 2FSHA 2YINC 4HUQB 1W4AA 1BO6A 2C95A 2HYDA 2WKPA 5EP1A 3LXXA 1KDPA 5EZ6B 2GNOA 2PBRA 1OYWA 3MWJA 1GG2A 2VTKA 4X8LA 4QM7A 3E2IA 5KDOA 3PVSA 1YU9A 2WPDA 2GXSA 3CIOA 1DELA 1XEFA 2IUUA 2VSXA 1G3RA 3OEHA 2P6NA 3IO3A 4MKIA 3F8TA 1NN0A 1T0JB 4AKEA 2IYUA 1BOFA 2R6FA 2FFBA 4G1UC 3LW8A 5EE5B 5E3HA 2ZUCA 3JZAA 5DNYB 2EW1A 5DYGA 1R2QA 2W6JD 2QG6A 2MSCB 3K1JA 3K9HA 3NG1A 5FOTA 2EFDB 3UWOA 4BZQA 4EDHA 1Z6YA 3EC2A 1OKKA 2OEPA 1M34E 2XZPA 2X1VA 1T4GA 3MUFA 2Q0HA 4MRRA 1K6MA 1W47A 1DG3A 1GNRA 3B13B 1A5TA 3GLIA 1IONA 2ZU0C 4EJSC 3SJCA 1OF1A 3BXZA 5FFMA 4JL5A 2O8CB 3K09C 3ETLA 3WY9A 1VCMA 3U7FB 2JASA 2IWHA 4ZCMA 1XPOA 3BH7A 1NJFA 2JCSA 1ZUHA 1KI1A 5GVRA 4PC7A 1NKTA 4EFLA 2BJWA 4EUNA 3U6BA 3WYFA 2F1JA 4B2LA 4TQ9A 4Q4HB 1D5CA 2ZJ8A 4CT5A 3WP1B 3Q7QA 5J47A 4MITA 2CVFA 1MABB 2O8EB 2EWVA 3ND8A 4A6PA 1CXZA 1WF3A 3AEZA 3TSZA 3NBYC 1GM5A 2OSBA 4V0ME 5CIQA 3I5YA 3A58B 3AVUA 1E1RA 2O0KA 4AKHA 2GZDA 2HXSA 1JEEA 3RRZA 4QJ5A 3TSWA 2BBWA 5EE1A 2DWQA 2ZXUA 4ILEA 2F3RA 4M1WA 1IY1A 2OBNA 1N6RA 3B2EA 4B6FA 1ETUA 4WZBE 4BRUA 3GJ6A 5HE9A 5KDLA 2G77B 4PR0A 4CW7A 3U3OA 4ERNA 2JLVA 2VHTA 4YMVA 1QRAA 4DDVA 4XSHA 2QT0A 4IDPA 1OIXA 4H1VA 4PXAA 4AC9A 5LBIA 4EJSB 4MDEA 1NVXQ 1N6LA 1T5IA 2Z6VA 1YRBA 4UJ5A 4I81A 2AXNA 2DFLA 1U98A 2BVNA 4ZI2A 1X8JA 1NN3A 1XEWX 1ZIOA 1AGPA 4G5GA 3L8YA 4QGHA 5HZHA 1D9XA 1R7RA 2MMGA 3UK6A 2WWXA 3BIFA 4RCYA 1DEKA 1FMLA 2BIFA 2A9KA 1Z6TA 4POAA 3W6OA 5JMTA 1R8SA 3EPKA 1N2CE 1CRQA 2ZRFA 2ZUBA 4PZLA 4DCTA 2D7DA 1NP6A 2ZJ2A 1X8KA 3VKHA 4KO8A 2DFTA 4JVMA 1DO2A 3E5HA 3MSXA 1N5LA 3EARA 2WJIA 4GZMA 4W5HA 1SULA 1G5RA 3HPQA 4KU4A 1W36D 2LWIA 2AFIE 2J41A 2P65A 3NC1C 3X1DA 1UKEA 1AJEA 3QEOA 4BFUA 2J1LA 1G8GA 3DMNA 4ABYA 1S4QA 2IUSA 4A6XA 1P61B 2ZS7A 2BBTA 3KQNA 2HV8A 1ZW6A 3LA6A 2HJVA 2FWRA 1UBEA 1CJUC 3SHWA 1EFHA 1G16A 1SVWA 3LWNA 4BLRA 4CEHB 1HA3A 3G5UA 2D74A 3DDCA 1OHHA 2YYZA 5JJLA 3EZ7A 2NZJA 1TAGA 2DWPA 4Q18A 1LF5A 1NJGA 5HCNA 3BS4A 5K8TA 3F5FA 1N0WA 2GXAA 2QP4A 4LBVA 1YZNA 2R6CA 2FG5A 4EPXA 3HWSA 1GOTA 1SVOA 1BH2A 2Z4SA 3AVYA 3ZD7A 2X19A 3QG5A 1EFUA 4TL6A 5JHHB 3ZH9B 1VDZA 2D3WA 3T61A 1YR8A 4M21A 1HE8B 5F2EA 3U7GA 2V9PA 2ZU6A 1GRQA 1UBFA 1ZD9A 1P5ZB 4DRZA 2YC2C 5DN6D 2C99A 1E2NA 4Q1DA 2IXFA 2W0SA 1KHTA 4D0NA 4Q1CA 1U0JA 5A0FA 3P4XA 3UMFA 4QGFA 4Z8XA 4HB2A 3GLGE 2J0UA 4M1KA 1KI9A 2R9VA 1K5DA 3OIWA 4NHOA 1F2UB 3TSOA 2RGNC 3TKLA 1DAIA 1NLFA 2ATVA 1UEIA 2ZE7A 2ZEJA 4LC1A 4U02A 1TF2A 5L3SB 1FP6A 2CBZA 1CJKC 1Z08A 2YV5A 3C41J 4URYR 2A2ZA 1W0JA 4JBYA 1P75A 3GEEA 1II0A 1YRAA 4W7SA 1EX7A 1KJYA 4C30A 4A0RA 2GWHA 1NN1A 2Q21A 2QMUA 2WSSA 3HPRA 5FOSA 5TDHA 2GAOA 1W36C 3WMFA 1G8HA 1VG8A 3GPLA 1ELOA 2FJUA 4TMKA 4QBGB 1E79D 3RSLA 2ODWA 4RKEA 5G3ZA 1HE1C 1Z83A 5SZHB 1P2SA 4DSOA 4D0GA 3LNCA 2BKUA 1WBBA 2QSZA 1G9XA 2HXYA 4EPTA 1QHHA 1S3SA 2KB0A 4KBFA 1J8YF 1ZUIA 4C9BA 5GJCA 6Q21A 2J7KA 1XCPA 3G0HA 4PSVA 4P31A 3SBEA 4CT4B 1ONBA 3BRWD 4JL6A 2AFHE 1CS4C 3SYLA 2GHIA 4TT3D 2BMDA 5L8VA 2GEVA 3MG9A 3Q5EA 4OQFA 5BN3A 5DN6A 1OT3A 4RFVA 1E4VA 5KHOC 1FW6A 4DLUA 3NXSA 4NP6A 4PO1A 3T12A 5B30A 1FZQA 4NBSA 1Q21A 2DYKA 2QQEA 3FMFA 3T06B 4WAUA 3WBJA 4QGAA 4JLKA 4BPBA 1UKVY 5FBWB 3PEWA 3GJ0A 2QEQA 1W36B 1KO5A 1XMVA 4Q4JB 5JRZA 1TEXA 2CE2X 1ZNYA 5BWMA 3V4FA 2HEIA 3CW2A 1E9DA 5JSZA 4M9XA 1G7CA 4DEXA 2AD1A 4DJTA 4Q9JA 4FIDA 4B33A 3FKSD 4V0OA 3C5HA 3LY5A 1E2MA 2JLWA 4Q47A 3ZVNA 3RDPA 1AS3A 5AWFC 4TTRA 1ZUNB 2JA1A 4LV5B 3IEUA 1C9KA 1G5PA 4ACBA 4DUGD 4MKFA 3B78A 2IS4A 2GRJA 2QTHA 3NDPA 2KBFA 3QQ5A 3SOPA 2JAQA 2XSZD 2BEKA 5CDFA 5JJIA 4MRNA 2I1QA 3BBPA 3GFPA 2YNMA 2ZYTX 1D9ZA 4JLOA 3SI7A 4PC6A 3TBKA 5DO9A 4JBXA 1M8PA 3KJHA 3B1ZA 1SGWA 5EUMA 4WIAA 1GDDA 3UPUA 2IXEA 4HATA 4KVAA 4IOMA 5K8LA 4JSTA 1XP8A 1COWA 1KO7A 2WSSD 1KY2A 4EFNA 4NPHA 4ZDWA 4CEIA 1YZLA 1XDBA 4KHZA 3WNBA 1NVUQ 2ZRBA 3OIVA 1KIMA 2C78A 5CK5A 1C1YA 3QOFA 3TQFA 1AGRA 1JB1A 1W49A 2EU8A 4KVGA 4BLPA 5JHGB 1I2MA 3U6KA 4RD0A 4B3DA 1KDRA 4Q5IA 1MRNA 5GJVC 2PMKA 3R9WA 3AB3A 3C14C 1G8FA 1VYUA 4YQFA 2IX3A 2G3YA 1GRRA 1VG0B 3DEFA 1NI3A 1Q1ZA 2REBA 3J81k 1PLKA 2V4ZA 3GP8A 4GT1A 4HAZA 4C0JA 3LAWA 2CMKA 2YVUA 2FFQA 1NKSA 3MWKA 5AJZA 2QBYA 4P32A 2BMFA 5D3MA 3MFYA 2FGKA 4TN1A 1LW7A 1G6OA 1XD2B 5KSZA 1ZU4A 3BD9A 2A7QA 4JKIA 3NHBA 4HUQA 3TMKA 2ZR9A 4KSCA 4XWKA 1AIPA 3U2QA 2YWFA 3GCGA 5GJBA 4B6EA 1QG4A 4XH9B 4JT2A 4ZDJA 3ZQ6A 4ZPXA 1IY0A 3AVWA 4RD4A 4A4DA 1SXJD
chains in the Genus database with same CATH superfamily
2V5VA 3K8OE 5CM8B 4ZQCB 2VHXA 4CQNA 3FCEA 4YMIA 2GCIA 3BC1A 3DR5A 4ZJZA 3ZU3A 1QHEA 1ZRMA 3QF7A 1QHXA 2FPLA 2W4QA 1V7PC 1Y6QA 1F0PA 1LVUA 1VHLA 3IEXA 4B6RA 3BDIA 4EMSA 2XCTB 2GOYA 2QX8A 4OSPA 3KOWA 3QU7A 1ODJA 1H0SA 3U1BA 5H9VA 2AHRA 3T7IA 1MB4A 2P9EA 4BNJA 1NUTA 5EJ2A 3RO7A 2B8WA 1R10A 2RH9B 3OEED 5H16A 5BW6B 5LXTA 1XTSA 3DM5A 4IX9A 5EPOA 1AA9A 1LVGA 2GWRA 2BM1A 2FSSA 2ZG6A 4J03A 5ALUA 3NOOA 4DV7B 4AWBA 2HJGA 2FPOA 4UEOA 3T4UA 3ERCA 4KQMA 1K3FA 2FN3A 3NAQA 3AUKA 4QVKA 1K7XB 4G5RA 1WTAA 3NWBA 2DBYA 1SBNE 1WDMA 3KPYA 3NM5A 4QA9A 4R7ZA 4BRZA 2DCUA 4RENA 4OREX 4EA8A 4GOLD 1ORRA 4YROA 3WKEA 3O0TA 4LOIA 3TD9A 1E1LA 5ALMA 4Z7NB 2AMJA 4W6ZA 3RTEA 5EJ6A 4JVNA 5F3WB 1R0WA 4FZVA 5KVAA 1OTXA 5KWJA 4U7TB 4LMBA 2GNPA 4GBGA 1QANA 5AOVA 2SKDA 1EE9A 3CPHA 4RJLA 3GO4A 5DWVA 3UA3A 3PUKA 4PHCA 5JNLA 4ZVPA 3JD0A 3MOSA 1EA5A 3O91A 2Z2IA 1UFQA 1Q16A 3IAFA 3EN0A 4FYPA 5L53A 4XXHA 5TR9A 3AU9A 1IQPA 1Z7EA 5J5AA 1G5IA 1XEWY 2C3PA 1TTTA 4TX1A 4F7DA 1CY0A 3PEEA 4R1UA 1KEKA 1NVKA 5CIYA 2XRFA 1MABA 1VC2A 2H8KA 1XQWA 4WBNF 3COZA 3N2GA 4DUYB 4WXPA 1RJ9B 4EPVA 1IDN1 1UBOS 4JBNA 4Z7OB 2NO6A 3MOIA 3OEWA 4DB2A 3G9UA 2W6ZA 5E2IA 4Q3OA 4BFCA 5IJWA 3E9NA 2YXNA 4NNJA 2IS1A 1DIOB 2C7OA 3BWMA 3WJAA 3MINA 3U81A 1W48A 3JD3A 4BB5A 4NH0A 4GW3A 1DLIA 4LWPA 2OG2A 1ML4A 1U7DA 3NDIA 3DGEC 3AILA 5LLDA 1D2RA 1EEHA 2IZOA 4U2KA 1BQEA 2VHQA 3PK0A 4DM3A 2BTQB 4IYJA 1V0JA 1XOIA 4IJWA 4LHZA 3NBQA 3AB7A 1T91A 3L3BA 3Q6MA 5SYAA 2G08A 4BN5A 3C4QA 3SQDA 5BMVA 3PXGA 3N2KB 2OE2A 4UASA 1UIMA 2WMOB 4HEHA 1M0EA 1P1KA 1VHTA 3K09A 4MDHA 3R5JA 1ONOA 2AK3A 2NV6A 4G0XA 4JFRA 4YDSA 4G4JA 1NF3A 2ZI9A 4WZ6A 2D5BA 4OBBA 3ZZTA 5KNLA 4MYUA 1FTQA 5ESXA 1KFJB 4N18A 5EZYF 2WJ6A 2EKBA 3NUGA 3HU5A 3P0IA 3ROZA 2BI7A 3MZ0A 1QHHB 2GM5A 3FNEA 3O2SB 1H1TA 4PGGA 5E6RA 3RUFA 1GUZA 1JHOA 1FOEB 1WMSA 1K0FA 2HIAA 5HMLA 1V11A 3WA6A 1R6VA 3BD6A 1BX3A 2E4WA 4P4UA 3IILA 1I2ZA 4YI5A 2PZMA 2XVZA 5CR9A 1D0IA 3A1DA 1PTJA 4MOWA 2Y0DA 4W1SA 1FLAA 3QE3A 4FJ2A 4WLUA 4X45A 1JECA 4EVRA 1XPUA 3OWOA 2ZRMA 5EWJA 5ALGA 2RGAA 4GP7A 4UVHA 1BW9A 2JK0A 3ILHA 1ZFNA 3BWBA 2A5YB 3EIXA 4N49A 3NT5A 3NBXX 4MJLA 1B00A 3DBHB 1VLHA 2H7YA 2QN7A 3C0KA 1R0RE 4Q7MB 2NSHA 4I4TF 2KX7A 4X60A 3MB5A 3ADCA 4M89A 4B8YA 1H2FA 4CHGA 3GHYA 5CNJA 3LUGA 1PSZA 3CUTA 4IDGA 5IC6A 3AUTA 2XJ4A 4KNWA 4BMSA 3E27A 4HDKA 2P0EA 1SXJB 3L7MA 5IULC 1XELA 2PBLA 5I7AA 1VBKA 3CEPB 4JJ4A 1ADCA 1WMDA 3D6AA 4K6GA 3KB2A 3GLHB 3WV5A 2PS1A 3K70C 2PZAA 3KTFA 2IEIA 5B12A 3FX2A 1FDTA 3X1KA 4QICA 2ILVA 2XA2A 5BXQC 4JC8A 1OXUA 2GEDA 5C5CA 1ZICA 1JP7A 1W94A 5IUNC 4EKYA 1TX4B 4KQIA 2KBEA 3K1ZA 5DSZA 5AFSA 4TS9A 3SZUA 1I7PA 2YZNA 4X8MA 2IDJA 5FEMA 4DPMA 1XTIA 2KJQA 3K20A 4MS4A 2PMFA 3N2NA 3HUTA 2J9FA 5G0UA 3JD1A 3ONNA 4H2DA 1ZMRA 5CX1B 5JS1A 5A4IS 3UCEA 3AM1A 1DIRA 4O33A 5IYZA 2DXIA 2ZTUA 1H66A 2E49A 1E99A 2QTWB 2A78A 4I46A 1XZBA 3WYEA 1Z2PX 4HP8A 1WBJB 3O5AA 2OCBA 1U8AA 3K0FB 1XQXA 2WF9A 1V1JA 4TRJA 3B9PA 5HQTA 1DC4A 3EEBA 2P5YA 3I9KA 4O2LA 1EFVB 1OD6A 4MVJG 4UAVA 5KYYB 3GLIE 3FPAA 1RXVA 4L8LA 3EGVA 3WRXC 1GPKA 2BLLA 3FYUB 4FMDF 3AR2A 2VJBA 1IEVA 3MS7A 1NF8A 5AK5A 4TRRA 2F3SA 4JYAB 5F64A 1RHMA 2WI8A 1RI3A 1AT1A 1FNBA 1F2UA 3AH8A 3EGXB 5LNK1 1FFSA 4IIEA 4UU8A 2HMUA 3OZCA 3FDXA 2P9ZA 5ALIA 3FVRA 1E8MA 3SSOA 3W3ZB 1UK9A 1OPRA 1SIBE 1ZUWA 3Q10A 2UYGA 4OPMA 3ROFA 1BGWA 1Z5PA 2JH8A 3WMXA 3HXOA 2HT6A 3ZHQA 1KQFA 1KY5A 2I87A 3NATA 3TLEA 4EHNA 2V5AA 3GD7A 4EJ0A 2G80A 2NADA 5IVHA 2V1UA 3EXG2 2PM8A 2PA3A 4CM5A 3IUEA 3B38A 4PPYA 5IH7A 1RKXA 2YVLA 1N33B 2OD7A 2JFUA 1NVWQ 3CV3A 5AVKA 1UP7A 1VMIA 4OAQA 1CT9A 5FUVA 3QKSB 5FFNA 2CGEA 3WLPA 1WNTA 1UOOA 1X1AA 3GVHA 4JP8A 4XYEA 3TSAA 1AA6A 1EVEA 1AHIA 1U2EA 1C0LA 3QXJA 4HNQA 5FBKA 1TCAA 2GTIA 3RIXA 1OB2A 2IYZA 2QL7A 4JBLA 4OQQA 5JIBA 4M7WA 3MPOA 3H9EO 1OSNA 2XTZA 1E1CB 4C4PA 2QTVB 3EZNA 4R2WA 4RZ3A 2J08A 4UXHA 4BGVA 4BLOA 4Z9AA 5CB8A 5FR2A 2ZS8A 2ZYVX 3AM3A 3L6BA 1IU9A 1VDMA 3FCOA 4RNDB 4WFIA 5LPNA 2NXJA 3MJRA 3TD6A 2JLXA 1BN6A 4AMUA 1LLUA 3CEMA 1G21A 1N9ZA 4JBWA 5EKDA 1GV0A 3IFSA 4KDRA 2VHJA 4KAFA 4E46A 4ZZ3A 2VSYA 4ZEXA 4R2HA 4GXNA 3OBBA 3PDIB 4FHEA 2YC4C 1Y48E 2VUSA 3OCXA 2BZGA 4NYIR 2X77A 5UKDA 5C2JB 3K8ZA 1KYVA 5KQRA 3AQ4A 3NIBA 2M1ZA 2VDRB 3H84A 3UGKA 4URWR 5EP2A 4UM5A 3FBGA 3WNZA 1NWCA 3VNBA 1VE3A 3KU4A 1E6UA 2OA0A 2ST1A 1YA6A 1I1OA 2F3QA 3Q2OA 1CB0A 2O6LA 2QZZA 2VCHA 2WIGA 1LQUA 3B7GA 4YFVA 1U0GA 5HCIA 1SVLA 4PQFA 4K9SA 1UDXA 1RYNA 1E96A 1Y6RA 1KK3A 3OD1A 3HHEA 1FTSA 3L7OA 4PG6A 3OMLA 2XCRB 5EJ8A 1XHEA 5JYEA 4EYEA 3KEMA 1VIDA 1PT6A 1Z0JA 1H9BA 3SFZA 2CNKA 3COWA 3RVNA 5HILA 3LOQA 4IWYA 1QR6A 2OAQ1 4RM2A 4G6ZA 4PXSA 4UE2A 3V3TA 4AJHA 1BAPA 3TW0A 4BX8A 1KRXA 4NU8X 2FOIA 1Y34E 5D8DA 2B99A 4FS8A 4G65A 1CIPA 1LVHA 1QGED 2JFNA 2ZE5A 1Z56C 4UDXX 4G0MA 3U80A 2RJ3A 3DC7A 3QY0A 1QHGA 1NRXA 3HA2A 4I3FA 5ALEA 4DVJA 2CDBA 1SD2A 2LVBA 3W90A 1DFIA 2ZBVA 3HFRA 3MLEA 3QF4A 4KCGA 3CKLA 4N0MA 4YMSA 2QR3A 2EBFX 3QVWA 4PANA 1PW5A 4MS1A 3GF4A 1SU7A 1MKYA 4X7RA 1EZ1A 3A31A 2B78A 1TPYA 1UMCA 2NPIA 5LDDC 2R6R1 4MWOA 3IAXA 3AEUA 2XY4A 2GD0A 4A8HA 5EUQB 5E1OA 4OHYA 1C9EA 2L42A 1L5YA 1D6MA 3JWGA 3S2GA 4CR6A 4Q34A 1VIYA 5BR8B 3O73A 5CFMA 2QV0A 3K6SA 2AR9A 3WI7A 1QE3A 1V5EA 3UOAB 3VR5A 2IZ5A 1P1BA 2CL6X 2CVOA 3H11B 2BBOA 3PWZA 4O2BF 4KOEC 1ZD1A 3FOCA 4BU0A 1IL0A 2INGX 1ONSA 1CNEA 2IT1A 2PXAA 2Y68A 4KQCA 4X44A 5L7YA 5LA6A 4PZEA 3VPFA 5THXA 2YWGA 3MT0A 3TTXA 5H1YA 3RQSA 3HFSA 5FI1B 4RULA 2NO0A 2RGEA 2A5DA 2DHCA 3QPUA 3IOYA 4HI0E 5EIHA 4BVJA 2X42A 3LBFA 1TI7A 2OGSA 1BMQA 4NZNA 4D56A 4EB3A 2W71A 3ANXA 1TCCA 4PPQA 4PZ0A 1DC5A 5HFNA 4OMDA 2HWXA 1XZKA 4Q3KA 1WMFA 3AJRA 2VO1A 2EJTA 5C51B 4RFLA 4P7FA 2A5LA 1U99A 5FUYA 3Q8MA 4IIHA 1I3MA 2BGRA 2JLZA 4N01A 3FNFA 4Z3DA 1Q1GA 3SC6A 3CZ9A 2R6GA 3U09A 2V8BA 4QEZA 1U0FA 5JATA 1Q1QA 1VYVA 1MG5A 5IEJA 4LHSA 3V97A 1HF3A 3SC2A 2XWJI 2DM6A 2LXNA 2XTMA 3IERA 2G82A 4KDCA 1PWEA 1T9GS 3CLKA 3SQOA 4LXGA 1O6BA 5KWEA 1S0UA 2IP4A 5KPJA 1VPVA 2HPVA 3T7RA 3SXJA 3ZW7A 5CDFE 1PIWA 2ZYHA 4QARA 1E6WA 2DAPA 2M98A 4MVCA 1WEKA 2NSLA 5AHWA 4TQGA 1ZN7A 4B48A 1OWOA 4B0PA 1KQGA 2Q2QA 4OGFA 3UJHA 2DFNA 3OZXA 3BVPA 2OTCA 2QAGA 3OIYA 1H0HA 4Q3CA 2GMWA 2H92A 4LV8B 2CDNA 1PSDA 4TLDA 3UY4A 3V1NA 1XDGA 3ORRA 4KJZA 4WKBA 4AZ3A 2O8FB 2E4AA 1KJZA 2EVWX 3EZ2A 3B1VA 3B52X 2OCAA 3B48A 4O2AB 3B6MA 1TC1A 1HL3A 1I3KA 2V3VA 2WU3A 3D7MA 3N8KA 3PNLA 4NPAA 4X61A 1BNCA 1SHUX 4W7IA 4F3RA 1T0IA 2CVHA 2E1RA 2BELA 2IWRA 3TTUA 4JHLA 1WSAA 2FFAA 1M5RA 3IURA 4XJTA 3HP1A 5JSKA 5F51A 1M2GA 4RX1A 2YOFA 4ND5A 1S2LA 2BF4A 3U7IA 3TOVA 1A82A 4WGGA 3WLHA 2AC4A 5AW2A 4LYHA 1WUYA 5KTTA 2EKLA 4K87A 3VMMA 1Z18A 4MAAA 1WNFA 1RRFA 1V8FA 4L4SA 3HKEB 1ZMTA 2CL7X 2Q27A 3DWEX 3QFFA 2JVKA 5B1HA 4BMXA 2WKQA 1R74A 3CGWA 2DPMA 3RR2A 4ZIRB 4P0QB 1UFOA 2O8VA 4QG7A 3MT8A 4U5XA 4DDMA 5M04A 1JHMA 1RWQA 2XOXA 3R3VA 1ZM7A 5JDCC 3O8BA 5ULLA 2JIBA 1PL8A 4J0QA 4HUJA 1DB3A 4IDCA 1OXTA 4HFJA 3A4NA 3HO1A 2XNHA 2PZFA 1UINA 1RW4A 4H7EA 1KF0A 2AG0A 4P35A 4TN5A 1A9XA 3GL9A 3WYBA 4LRSB 1QJ4A 1C7QA 3EW7A 4OATA 4LJAA 5LBTA 1SXPA 1E94E 3PRYA 3R7NA 2IGBA 3DMTC 2SICE 3R75A 2IUTA 3JXEA 3TFQA 2JJ1D 2Q7XA 1KH3A 3ENQA 4YAUA 3D0RA 3JQ6A 4Q4LA 2JEZA 2OGZA 1C30A 3KJEA 4DUGA 3IIEA 2JCXA 2RK6A 4NBWA 1N7IA 2ZS9A 2VF7A 4Q1FA 5CFLA 3BBLA 1SZJG 2ZCUA 1M3SA 2WTBA 4RVGA 3EW9A 4CLOA 1JR3D 4DV2B 2B21A 2BZSA 4RXUA 4B73A 2NU7B 4JUCA 4F38A 1VL0A 4OUDB 4NFHA 5AT1A 4PHFA 1E9CA 1FNSA 1GXSB 1FVXA 1XZQA 2VH5R 3DHVA 1FDOA 1WVIA 3DO5A 4LYEA 1BD4A 3OTGA 5JTTA 4S04A 2W22A 4HXFB 4LZNA 3WRWA 4Y6SA 4CQMB 3HVRA 2XQFA 2GH1A 3N1UA 3Q8WA 1D0SA 1H4SA 3CX3A 4PX9A 2V1XA 3CR8A 4YCMA 1Y3AA 1KK1A 1ZLXA 4N48A 4RW0A 2C4HA 4FS3A 1E3TA 3R7WA 2HPHA 4PCLA 1TTHA 5EIBD 3THXA 3KUUA 2J48A 3A04A 2D5IA 1F7UA 4WKOA 2FETA 3JQGB 1E2PA 2Z1MA 1BYUA 2JFHA 3O83A 4QFCA 2FWAA 2WYIA 2XOKD 2GN4A 5B2FA 3D1LA 3EUFA 1JLLA 3QG1A 1X8XA 3L18A 3G85A 4I1OA 3T9AA 2QNRA 2V7QD 3CUVA 5REQB 2Q3LA 4KQ2A 1VI5A 2A5GA 4GRAA 4D3ZA 3V32A 1X92A 1RI5A 3K16A 3RYTC 3ANLA 3QTBA 4CIVA 1DTEA 3DEKA 3OF3A 2FMUA 3PQCA 5AVZA 4YAOA 2C00A 4LF4B 3INRA 4I4LA 3VH3A 1OGJA 2H1FA 2I34A 3DDWA 1GKKA 4D4KA 5KYKA 2EJBA 4PFKA 4HDNA 1FFCA 5K8IA 3ESZA 2VUUA 1KSGA 2XDQA 4JI5B 1IBKB 3T95A 2PUTA 1DOAA 1KI3A 3K2QA 1EZZA 2QN2A 4UNSA 5DYYA 4DLNA 4L6IA 3TLCA 4FDMA 4QHSA 2GESA 3RS3A 4DR6B 1Z12A 5FLKA 1A9RA 3W3AA 3E1GA 2JGFA 3PJEA 3R0QA 2OK8A 2W2NA 4HQKA 1RJFA 4K9RA 5EWMA 2JRLA 5K3DA 3WG9A 3HSKA 3WO1A 5E6SA 3U5ZB 3M1AA 4E31A 1MRZA 1B23P 2Y93A 1TW3A 1YR2A 1X7WA 3HR7A 1R64A 4DZTA 2JPDA 1NQXA 3TNYA 3FKQA 3RJTA 4DIOA 4OGLA 3M81A 4IZOA 2OYRA 1EG7A 1GGEA 4KWHA 4UKDA 4C22A 1N3BA 3CWCA 3CKMA 4YUVA 3UWKA 4B09A 5KQGA 2PWYA 5CDSA 3PSHA 3OEEA 2QX6A 3I2HA 4U6QA 1YUNA 1I0ZA 2PZJA 2EQAA 2XUOA 4FW8A 5AM0A 1ILEA 1T4BA 3E2PA 3VDMA 1T9ZA 1R6UA 4FYYA 4NZZA 3V7WA 2ZBEA 3THWB 3EOBI 4Q66C 3ZQJA 1ZVMA 2J5XA 3WLMA 5I5EA 4AI6A 3RSQA 3OT1A 1QH8B 1F51E 1XZDA 2OC4A 4YJ2F 1V8BA 1LU9A 1WTCA 1WXHA 2Z9CA 3H4VA 4L3WA 5CYPA 1DZIA 2DCMA 3L1KA 1SA0A 1Z8HA 3CX7A 5LXTF 4BMYA 4UFPA 1X42A 1DCFA 3QA9A 4GL4A 2J9GA 5EINA 4D4JA 1WDTA 4TKLA 1U9ZA 1Y8ZA 4DY6A 5FUMA 3IO5A 2E9SA 1UBSB 4X1IB 2WK1A 1PV2A 4N8EA 3Q9NA 1BVRA 2BZ1A 2IJGX 2QRUA 3RAJA 1F5SA 2G25A 3OOYA 1Z6QA 2JDID 4LV6A 1J5EB 3QEJA 4ZANA 3M3PA 3RADC 5GOTA 1RQGA 221PA 2X4DA 3RC3A 4DT1A 1ZMBA 2LKDA 2UAGA 1RPJA 3CRRA 3O4JA 3FZQA 3T5DA 1ZDMA 5DF1A 3C3PA 2OXTA 3ZW8A 5ABPA 4QDOA 4DV5B 5H7XA 1K7SN 1P29A 3KZMA 3DJYA 1TM5E 3OE7D 4OHOA 2ZPUA 1A7UA 2C5GA 2RAVA 1E9FA 3GMSA 2AYZA 4IP0A 3WWZA 1C7FA 1BX0A 1EK1A 4UXIA 5K0BA 3QBJA 3U1VA 4RQUA 3G2OA 2IELA 5CGQB 1MC8A 4GLFA 1PWXA 1CUAA 5L4SA 1QRUA 3UJBA 4X64B 1SN7A 3H65A 4Z0TA 4QVGA 1DEXA 1SC9A 3DYBA 3LPAA 3GDFA 1JWBB 2WYVA 2X86A 2UYOA 1MA3A 1ZI9A 4ITUA 2E82A 3W2EA 3QE9Y 3C70A 3L4BA 4FGUA 1DARA 3JYOA 3M83A 3BDVA 4BUCA 3GA0A 3GJSA 2YIVX 4QTUB 3WISA 4F1KA 1LV7A 1JPNA 3ED5A 4N4AA 1DRWA 1H6BA 2TMYA 4REQA 2B3DA 1YR1A 3RFXA 1KI6B 3CW9A 3DZ8A 5A3QA 4FZ5A 5KKNB 3A2MA 4B74A 4XWWA 3I6BA 5HF6A 3PGMA 4Q01A 5K2MA 2WT4A 3NV9A 4NBUA 2X6TA 4EABA 2BFCA 1Z4IA 2RH5A 1F2TB 3CR3C 2DOKA 5T8KA 2DLNA 1KA9H 1V2HE 2IXTA 4ZMRA 5C53B 1N9GB 3VHXB 2FN8A 2I6TA 1G20A 1H4VB 1YUMA 2C2HA 2HSWA 1M9NA 3P0HA 1EXVA 3R6WA 1U0HC 4W82A 1U80A 3MGGA 1SC4A 1FX1A 1R16A 3QA3E 3SNHA 4OHPA 1TUBA 2O0LA 1LFAA 1XQ1A 5ECYA 1TKCA 4IF4A 2QVBA 1K6IA 1FLDA 2Y1KA 5EMLA 5IBRA 2G9NA 3TLBA 4JI2B 2H7CA 1B0ZA 3L8CA 4IMIB 4NH4A 5AW4A 2F3UA 3Q7PA 3AZPA 4YV7A 1CEXA 3FCAA 4K26A 4MKZA 3RS7A 5KKCA 1UJ2A 1IMJA 5B58C 2V55B 1B3RA 3OQIB 1NQUA 4I1VA 3DYVA 1DG9A 2ALJA 4RZIA 3EYAA 3MRSA 2VYFA 4II7A 3UKDA 2EZTA 4EVIA 4IGKA 4YR9A 5F9HA 4E08A 4FN5A 1H3EA 4H18A 1UF9A 1YFKA 1MQ9A 4C3UA 5C1BA 4WZAB 3H5WA 4P2BA 2H65A 1MF7A 3HNPA 3A2NA 2B34A 4JYMA 1PD1A 1OLXB 2GJKA 1Y6FA 4PYOA 4WLFA 4P33A 4IS3A 1WZ2A 1JF8A 3EQ2A 1ACLA 4NENB 3THOA 3R3XA 1TPZA 4CNBA 1ECCA 4WNCA 4BECA 2C4VA 2LE0A 2NPOA 1Z4LA 1DKMA 2C7RA 3OHMA 3EVFA 2R25B 4PX3A 1E4YA 3FFWA 2P0YA 2BKAA 2VNHA 1BRMA 1YZKA 4L50A 2O1EA 1JUDA 4MA0A 3H16A 2VF2A 3JARA 4P2GA 3VTKA 1SQGA 4LNHA 3WIVA 4XVUA 3QXSA 4K03A 1QBKC 2DH6A 6NULA 3WYAA 1EVQA 5JUWA 3M82A 5KYXB 2XVAA 1UADA 1K8ZB 3A9VA 4OHVA 1T3ZA 4HSGA 1Z0FA 4RHTA 3AVQA 4ND8B 4ZI5A 2B9VA 4UVDA 1S96A 1ML3A 2IA5A 2LDXA 2XRMA 2DMRA 3RSOA 5JSUA 4M36A 1R4MA 3E23A 2HLDD 4MIOA 5DI3B 3ZKWB 4XVCA 1PL7A 1GL3A 1FF9A 2B4RO 1U8EA 2QJRA 3DVQX 3PHJA 4LXHA 1DWQA 1JLHA 1L3IA 5IYZF 5BUCA 1U63A 1NE7A 1MJGA 5BMVB 3GRFA 5CIWA 5A9TA 3WFZA 5CCDA 1IJKA 2NU6B 3TXYA 3M6LA 1UPAA 1G4AE 3KNZA 2CB0A 3K0AB 3FETA 2ZJAA 5KPDA 5K0JA 1O94C 3JYQA 4QPDA 5DM70 3DMGA 4DANA 1OFGA 3X1JA 2R1ZA 3QYJA 3ZH2A 1NSYA 4LDZA 5DGXA 4YRKA 2HU7A 1JA0A 3E05A 3LIIA 1E5TA 5GM2A 5LBUA 4ZRMA 1OU0A 1SJ9A 3O3CA 3TEMA 1GFSA 5ALHA 3ADPA 5DTJA 4EVSA 1XEXA 3DE3X 4FJ0A 5A06A 3HH8A 1DIBA 3DZKA 3GA5A 3N7UA 5LCXA 4NIMA 3HO6A 2FWMX 4MV6A 5E38A 1TU4A 4JMLA 3W2IA 5B1DA 5KO2A 3ZV4A 1PJQA 4RMGA 3IEKA 1MAAA 3KZ1E 4X66B 5FTLA 3WLNA 1PBTA 1L7PA 3BZBA 3LV8A 4HJXA 3THSA 1UKZA 3AYXB 4BGDA 4D9IA 1YA8A 4CF7A 2YJ6A 3KJZA 5DEOA 1U7OA 2XHZA 2IYTA 1HT3A 1W44A 3M6XA 3QYAA 4QU5A 4MRPA 5FI5A 2W70A 3WGYA 3VAYA 1Z0SA 1E5DA 3ZNNA 4HVLA 1G63A 2EBUA 4AB1A 3M6FA 3BB4A 1OPXA 5K05A 2VPYA 5U1PA 3U44B 1UOQA 1QYVA 2GK6A 4ZYUA 1VJCA 2HK6A 4FQ8A 4Q3DA 1IN5A 3ZK9A 2Q3DA 4WVLA 4WLVA 1HE5A 5CM2Z 3L8GA 1RWOA 3BGSA 3OM8A 2BFFB 1U9IA 5JD3A 3UUFA 2W8BB 2Z58A 3DXYA 4F2GA 5KS2A 2WVGA 4CYMA 1XCJA 4Y6LA 4HWPA 3VZSA 3HYNA 3MWEA 4DXHA 4ZODA 1QCYA 4M6WA 3QPBA 1JTVA 1C9JA 2ZFUA 3I9NA 4JC4A 4OYRA 4RPKA 1JIQA 2YW9A 4CMJA 4FP9A 2XZOA 1YFZA 3VOSA 2NU9B 4TWRA 2WJHA 4B7ZA 1GR0A 2R47A 4EY3A 4YV1A 3H9BA 2V6GA 1RM3A 3GDGA 1W9MA 5EIXA 2HF7A 2QLJA 1EHIA 2B82A 2CCGA 3QY9A 5JXHA 2WINI 1MO6A 2QKYA 3KR2A 5EKTA 3HFGA 2KE5A 4ZYXA 1CP2A 3JD4A 5IWCA 5A9SA 3PCTA 4U8GA 1V16A 4MWCA 1AN9A 4RPIA 2WAXA 3N75A 3ND7A 2A9FA 2AOTA 3QVJA 1Z0ZA 2X2EA 4P4SA 1T6YA 3JQQA 4WXRA 3WBBA 4AF7A 1WHSB 3L93A 4DYDA 5L3ZA 1HLPA 1KKLA 2NMVA 3AM5A 1GUYA 1Z22A 2VAPA 4UEJA 4ITRC 1U0RA 4K2HA 1U9CA 2PMDA 3GRUA 5CRIA 1MB2A 1OBFO 3B6ZA 2PXXA 2ES4A 3PPVA 3LBIA 2J8ZA 3UCXA 3NP9A 5FA6A 4E70A 3H2HA 3GFSA 4MW7A 3ETHA 1N6IA 1ULAA 1KO1A 2NO1A 1KJQA 1ZQ1A 3IQFA 4CM1A 4DLKA 2F6RA 3HV2A 3UWPA 2C1XA 2UYHA 2ZT5A 3CBGA 3C3WA 3PJFA 3OOHA 1Y7PA 4K6HA 4IHAA 1G8MA 1BDMA 2P3QA 2JFQA 2TYSB 2UVPA 3E15A 4RABA 3X1YA 3IKTA 1FUEA 3DVSX 4IQGA 4ZQEA 4DLZA 1BVYF 1KR5A 4OX9B 4ZCRA 3T1HB 1NQVA 3HUUA 3ICPA 3KFLA 5K0NA 4EB0A 4EKNB 2QMOA 3B6IA 1TA9A 4LDNA 1U7PA 4HPWA 5B1YA 1Q1BA 4A2CA 1K1EA 2ISQA 2V7UA 2W6QA 4RVNA 5J9FA 5BUQA 4EKIA 4E88A 4LY6A 2AWNA 3KZVA 2VCEA 1NMEA 1PJAA 5JVDB 4ZKEA 5IFKA 2YICA 5LIPA 4ZXPA 3GC6A 2J45A 3DCJA 3LECA 2ZJBA 2QZ9A 1L7QA 1A69A 2P2GA 5LA6F 3V4VB 2YQZA 2XECA 4DV1B 3IR7A 1P4AA 3O92A 2PKYX 1TD9A 3TR5A 5I9NA 3SHTA 4BXOA 2CCKA 4NCXA 1BE0A 3DE7X 4MUHA 4R8MA 3RUCA 4O3FA 4ZOCA 4REMA 3LO8A 3RW9A 4LRYA 3HVJA 2BE9A 2JLYA 3AERB 1HPLA 1YACA 1ID8A 3UENA 2EHDA 3OKCA 1TQDA 3LVBA 1JT2A 2XUFA 4GD3Q 3VR6H 4DWJA 1U2ZA 3AESA 4RANA 1SG6A 2WM2A 5J1TB 1FIUA 4BO9A 1AQUA 1JQ5A 3EPPA 3HRKA 2OG1A 1I4EB 1KZYC 5FTNA 4EK9A 1WABA 4DEVA 4EX6A 3PDCA 1NBWB 1X9HA 2FCAA 2QD1A 4KO3S 4O8ZA 4ETWA 3O8RA 1ODKA 3ZHUA 3GJ7A 1NBMD 5DYTA 5E7MA 4EW3A 1J2JA 1KC3A 1KPHA 1B2RA 2PX8A 2BFOA 3HYCA 4ND6A 1DEAA 3AEQB 4AKTA 2CSXA 2W9XA 4GI1A 5C7LO 3NEAA 4AFNA 2IS2A 1W0KD 3JQ8A 3ABSB 1WPRA 1P1FA 2L2QA 1PFWA 5CHEA 1QWOA 4EFMA 4AO6A 3F8WA 1EQ2A 2YHAA 4F7WA 2F59A 1JEYA 1WU8A 4DR5B 3QUCA 2PFGA 3BFPA 2FH5B 2DFPA 1W8IA 4ZREA 4UJ3A 3Q3IA 2OP1A 1JXOA 2CLDX 3LY7A 4OXRA 4B9AA 3V1TC 2I2DA 1VHDA 4LJLA 1QU2A 1ST2A 2EKZA 3O8OB 3REFA 4F12A 2G0AA 3NWPA 1L5QA 4RHUA 5A0TA 4D99A 3KKPA 1Z5VA 5F1PA 1MC4A 4KK3A 1VHJA 3TDMA 2K2WA 4LOAA 1YCHA 2GETA 3GPDG 4YRPA 3RRMA 1U3FA 4HJRA 2Q3MA 4WZAE 3GR6A 5K4HA 1U5AA 1BU8A 2W6ID 4KNVA 1L4UA 1OJLA 2EW8A 2DUWA 2N9UA 1FNNA 4IRUB 4CGZA 1V1RB 3QWIA 3GRKA 1NASA 3PGVA 4OIMA 3KJQA 4GZ6A 1TYZA 4ENUA 2O19A 4V0KA 3GMIA 2OCKA 3DNPA 3R9XA 1L4EA 1I1HA 2JJ1A 3DPUA 2PAAA 1E2QA 2WUFA 5I7EA 4RELA 2A9RA 3MWYW 4BIMA 4D4GA 4E0BA 1Z6XA 4UBLA 5EGSA 5LP6A 1MO5A 2I3DA 4X1YA 3QUSA 1ZG3A 3QVSA 5AHKA 2QL6A 1YNSA 2P67A 4TM7A 4HNSA 1HKHA 4EY8A 4XX0B 4I0WB 1JR3A 2VP4A 5CG1A 5L95A 4D5GA 3FPGA 1UDRA 2VRBA 2ZAYA 2Z1NA 5EYPA 2WEKA 1AXRA 1MVNA 2X0KA 3AOGA 4U5QA 2ZSJA 4HO1X 2NZ8A 1EUDA 3Q88A 3B1JA 1AQIA 1FP4A 1G3MA 5G0VA 3ENNA 3RNLA 1NWHA 1SKBA 3U1TA 3UAXA 1Q44A 4OIFA 1G8KA 4AKSA 4KMMA 2DUJA 2CXPA 5C8YB 5HIIA 4UTOA 1C4OA 1F14A 2F9LA 2VHEA 1OC2A 2HB6A 1X2EA 4F4JA 1L5WA 3IJRA 1QQAA 2F43B 1SOWA 2LR0A 2OV8A 3ELDA 3JALA 3L7JA 3NIDB 1DAEA 2JGDA 2PD6A 2CDAA 4R2JA 1XVAA 2J9ZB 4ZHQB 1UDBA 1EWRA 2X8AA 5TQ2B 4YRLA 5LQUA 2XOKA 2H31A 1YDGA 2XGOA 4Q15A 3OQ1A 1V5IA 2MSWA 2XCQA 1IOZA 4NKRA 3AFMA 3CLTD 4C6TB 4DA4A 5IDYA 3BE5A 1NUAA 4KZPA 2V7QA 3CPEA 5IKMA 1F6DA 2WC1A 3BGOS 1POWA 2EC5A 2WQ6A 3G9TA 1HT2E 1THGA 1ZIDA 4JSRA 3OFKA 1UQUA 4A8JB 2WG1A 3GJTA 4M76B 4ZEWA 4A92A 1F4LA 3P45A 5D5HA 1G7RA 1H2XA 2WJJA 4EKDA 2W2KB 2BJVA 2FR1A 1MT0A 1CS0B 2ZYUX 4Q93A 1GPH1 4UFOA 3V4RA 2UZIR 4BEVA 3MELA 4F84A 2QRVB 4JIMA 4RCZA 2RHBA 4MW6A 2OSVA 2UYYA 1FYEA 1QU3A 4N3GA 3HBNA 2O3UA 1K4MA 3HEMA 4OQLA 3VR4H 5AW0A 2EGHA 3QVOA 2F4VB 4JGBA 2B6HA 1LSSA 5CLLA 2ZM6B 4YV0A 2PD3A 5KYWB 1NVEA 1PFYA 1ZJ4A 2O52A 1XAJA 4L02A 3ZXXA 2Z6QA 4Z3OA 2AEJA 2FZVA 2AI2A 5KVSA 4G5SA 3UO8B 5FQNA 5JYDA 1HQYE 5EXXA 3DZDA 5F4ZA 4K46A 3HCAA 3EAGA 1QO0D 4JBIA 3ONEA 1LPSA 1XCGB 4J2OA 1XRMA 4IEIA 4IH4A 3I37X 4ALMA 1KOJA 1PUXA 1PKXA 4UPDA 1IUNA 5F7XA 1YKSA 1EP3B 1U8TA 1E77A 3G8YA 4CF6A 3B60A 1BU5A 1ZNQO 2EKQA 4ZAVA 4A1OA 4X94A 3OHPA 1CWUA 4CM9D 3CRQA 3NNSA 3RF7A 4F6LA 4KO1S 5FFFA 4P3NA 1RQRA 3WIDA 3LL4A 2CC2A 1DQSA 1CUYA 2JJQA 1JVBA 2ECKA 2FDXA 5K4GA 3JY6A 4WI1A 3NH9A 5KNBH 1B6RA 4RZ2A 3GLVA 3O8QA 4H60A 5BN5A 3U9TA 1UDWA 4GOND 1YJBA 1QYDA 2IV7A 3SU8A 4WXYB 4CF4A 1NAIA 4LHEA 4CCYA 4EBBA 1YR9A 4K3UA 4YHHB 3O26A 1GD1O 5AVSA 1UJBA 1WU7A 3WS7A 4ETMA 2QTCA 3IRVA 2Q0QA 1E1RD 1SQ5A 4GMDA 3PDJA 3V2UA 1E9BA 3MAAC 4QTXA 3T1QA 4WZBA 3IC5A 3ZHTA 2H5EA 1AS2A 4ARCA 5J2TA 2XXBA 4F5YA 2JD0A 4QEDA 1YQEA 5CNMA 3VC1A 7REQA 2JDIA 2M6RA 2O0JA 1X70A 3O2NA 5L7WA 4PRZA 1C5KA 1E9SA 4J1SA 3SFVA 2H2HA 4MWTA 1HURA 3VYVA 1RQXA 5C1PA 3JAMA 2ISSD 3HUEA 2O1SA 2PNJA 3FYCA 5K0CA 1UUFA 2OB1A 3UOGA 3FR8A 2G83A 3DBRA 2PZGA 3NTVA 5KWIA 3T7SA 5BN4A 1P0IA 3WK9A 3PL5A 3FCSB 1TZCA 5A5FA 3VPGA 2PGIA 3WYNA 3OE7A 4O4IA 4Y1RA 5BRNA 2O2EA 3WL5A 1FU4A 3X1WA 4LIPD 1DO8A 4LXXA 1J9GA 3JR7A 4J49A 1GU7A 2DR3A 3FPCA 1LSJA 3HRHA 1DBVO 1GGMA 2V54A 5AXAA 1G18A 1CUSA 2P1DA 3TSYA 4C5CA 3VSAA 3BCRA 4GLBA 2H1OA 2N1MA 3ONWA 3VPCA 2GJ4A 2KLBA 5C37A 4OB7A 2HRCA 1PD0A 2QXYA 5P8WA 1O5OA 2B98A 2ILTA 2RHRA 3OSUA 1XLTA 3GH3A 4NR0A 1GZ3A 3QSYA 1XTVA 1ZWLA 1YOVA 3MMXA 5IABA 2FPGB 2P9TA 4BGIA 4CU5A 5IXSA 3BB1A 2JGNA 1GL7A 4XSGA 1Q3KA 1K8RA 2ZUWA 3WJ7A 4YGXB 4JGIA 5EXDA 1W5TA 5GONB 5ADUS 3ZR4B 2YY6A 1UM9B 2VVTA 2I54A 3O8NA 2I6XA 5AUOB 5CH3A 1C50A 1Z34A 1CQPA 2AIR