2AK3A

The three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
GASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETSVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined structure of the complex between adenylate kinase from beef heart mitochondrial matrix and its substrate AMP at 1.85 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE ISOENZYME-3
total genus 70
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 1995-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak3A00
5EE5B 3BC1A 3FVQA 2ZRKA 2QL6A 1TUEA 1AIPA 2V1UA 2G9NA 4PAQA 1Q3HA 2C04A 4L4UA 2BBWA 2V1XA 1XTIA 2ZXUA 3MWKA 2IYYA 3KX2A 4HDQB 2QBYB 3U6BA 1YZUA 2OILA 3NC0C 4QGAA 1ESNA 2WWYA 3U61B 1L2TA 4B2PA 4A0RA 1KNQA 1EESA 1FTSA 3QKSB 1XTJA 621PA 4HB4A 4QKQA 4DHEA 1EXMA 1XPOA 4DLUA 1W4CA 1Z2AA 2OSBA 3EZFA 2QTHA 4I4LA 5DI3B 1P75A 4PC6A 2KBFA 1P7CA 3CLVA 1M34E 2QT0A 5AJYA 4Q1BA 5FR1A 4J0QA 5EP4A 5D3MA 1U81A 2IUTA 2ZSDA 4N0DA 5AUQA 3LVQE 3THXA 4DWJA 1HE1C 2C8VA 3CIOA 3FE2A 1XPUA 1N6HA 1W5SA 2FF7A 4HEJA 1KIMA 4NP6A 4HSEA 1T5LA 4W7SA 1V43A 1YR6A 3FKSD 2PL3A 2GJSA 1GNQA 1D2EA 2MMGA 2ORIA 1F2TB 2H1LA 4ITRC 5A4JA 1FNNA 1F5NA 5JI3E 3U3OA 1G3RA 3ZS8A 3SI7A 1FUUA 3TKLA 1N6IA 2Q0HA 1FMLA 2AK3A 4IDNA 1XU4A 1LS6A 5E95A 5AWFC 1Z06A 4ZDKA 3PEWA 2YVUA 4JVLA 4ZI3A 4FINA 1ANKA 4DSUA 1OT3A 1XZPA 5BWMA 1R8QA 1WBBA 2ONKA 5KSZA 4NCHA 4BUJA 1MO5A 2G3YA 1UKVY 4GOXA 1XEWY 2ECKA 2YKGA 3K70B 2QBYA 4BGDA 4OL0A 3FHCB 3LLMA 4BQSA 1D8TA 4QM6A 2WSSA 4HATA 1Z3IX 3QOFA 2EFDB 3WNDA 2ZROA 3AVTA 2O5VA 2FN4A 2MMCA 5CB8A 2G1JA 3D6TB 3T5DA 1FUKA 2W00A 1D2NA 5CDFA 1E2MA 1XD2A 2G88A 2OXCA 2A3RA 3TSOA 5K8UA 3TUZC 4KLNA 4RFSA 1HT1E 2Q6TA 2R8RA 4US0R 4EUNA 4PO8A 1X86B 4CEIA 1RJ9A 5E7JA 4DXAA 3CZPA 2ZI7A 1LFDB 4EPRA 3RRMA 2VRWA 4IDHA 3R20A 1ZIPA 2GCPA 2VHUA 2D62A 2ODWA 4PXAA 1XZQA 1CRQA 1E2JA 4Q9LA 4CEHA 1NVVR 2BEJA 3CF0A 1TQ4A 2ZI3A 3AVQA 3IEVA 3BB1A 4HLUA 1E2FA 2QENA 3ADDA 2YOGA 2CHGA 4NHOA 1HA3A 3GJ8A 3AVPA 3IDQA 5LB4A 4BFWA 1KI8A 4RD1A 1W4AA 5J5CA 1P2VA 4HAZA 4KFRA 4FIDA 5ELXA 3FMFA 4MDFA 4TLEA 3OZXA 4US2R 1IM2A 1GNPA 3KQUA 421PA 1NBME 3PJRA 2G1KA 3R8FA 1LV7A 1VPLA 3D7MA 3OESA 5FBQB 4B3GA 2VHQA 1G3MA 2HJVA 2NO9A 3NBYC 3B8HA 3SEAA 4M1MA 2GNOA 1G4AE 4HLUC 2RGDA 1HUQA 1WCV1 1G7TA 3BB4A 4LK2A 2VSOA 5DHAA 4EFNA 3U6KA 1HE8B 1KO4A 4NCIA 3JZMA 1VCMA 1ZM4A 1N6PA 2MSEB 2FEMA 4DCTA 2VO1A 2WKQA 4PO9A 3T15A 2O8DA 4Q01A 4C0BA 2WIBA 1J90A 4Q4LA 2AN9A 4F92B 5L3QA 3EX7C 4BPBA 4TTQA 4B35A 3LY5A 4ARZA 2KWIA 2UKDA 4Q1FA 2IYUA 2X2FA 4RZUA 1YHNA 3FGNA 5TVKA 2F9LA 4YXWD 1TTTA 2GZDA 1OIVA 1AS2A 1MKYA 3C5CA 3IO5A 4M4SA 1GDDA 5FPKA 4O3MA 4DDTA 3C14C 2YOHA 2OT3B 3H1TA 3KJGA 3CNOA 3BRWD 4I1OA 4TT3A 2J0UA 4C3ZA 1HURA 2J0UB 4LHVA 2F1RA 3AP1A 1E0SA 4V0MA 3DZ8A 1JPJA 5GADl 4QHSA 2QTVB 2CVFA 4DSTA 1WMSA 2XZPA 1Z6YA 4HUTA 2ZSEA 4GFDA 1DAGA 3TJZA 5FTJA 3IHWA 3F3YA 4LPKA 1OW3B 5SZKB 2LKCA 821PA 4UQOA 5IDVA 2EVWX 2B8TA 3O8DA 4KYUA 5JSZA 3IIKA 2YWEA 5AJXA 3K09C 2W0MA 1I2DA 3JZAA 3U44B 1YU9A 3ZVMA 2IYZA 1PLJA 5EUQB 4Q03A 2BEKA 1BS1A 1O3YA 3MWYW 3DVLA 2JCSA 1U9IA 4GL2A 1UM8A 2PCLA 4A1FA 4LV6A 3SJAA 3VX3A 1QG2A 1E0KA 2OCPA 5FBWB 4NYJR 4MITA 4HZUB 4LJ6A 1NIJA 4WVFA 5EE9A 3E2IA 3CRRA 3A1UA 1SVSA 4PO1A 2CDNA 3FWYA 4PFSA 3UATA 1HYQA 4HLCA 1AS3A 4IDOA 1GSIA 2H57A 2DWPA 4JYBA 1RYFA 3X1XA 2ZREA 2IS4A 2WMOB 4JLAA 2J46A 4D4LA 4AI6A 3RWMB 1X8KA 1JJ7A 3WHKA 2WJHA 4A9AA 3HDTA 4LC0A 4EDHA 1SVMA 4JL5A 3RRYA 5E3HA 1BMFD 2ZRIA 2IC5A 4DLXA 5JEDA 2CNWA 2CJWA 4Q21A 3H86A 1N0WA 5KPJA 1P2UA 3KFXA 3FTQA 1G291 2OE2A 4RKFA 4B47A 4BFVA 3PVSA 1DARA 1WXQA 3P1JA 1P9NA 4D6PA 3KQNA 4B71A 1Y3AA 2QI9C 1Z2CA 4YMSA 2OAP1 3U3MA 1AZTA 4PPQA 4XD7D 1X3SA 2GAOA 2RGGA 2C95A 1E2LA 2ZJ2A 5EZ5A 4DBLC 5JBQA 2IXEA 1UBGA 2BKEA 3RRNA 2JDIA 3ECCA 1QHHA 4JJKA 1JR3A 2JLXA 2HF9A 1G17A 4TQAA 1SKYE 1QHGA 1T9HA 1DG3A 2ZI9A 4F7WA 3I1FA 1Z22A 4KAXA 1EFRD 1G1MA 4RD0A 3O8RA 1II8A 2PJRA 3QF4A 2VBCA 4JZKA 2EFEB 4BFTA 1W36B 2HCBA 5D3QA 5J4YA 1G8FA 2A5JA 1G6HA 4OK6A 1NRJB 3LFUA 3QBVA 3NHAA 4AK9A 2WTUA 3LX5A 4EPVA 1E2PA 1XFAA 1R0YA 3A1SA 1D5CA 1KY3A 3G5UA 4IVRA 1F2UB 4QBHA 3IIJA 3FPAA 4Q02A 1G5RA 3P26A 2QU8A 3KZ1E 4XTRA 4Z1MD 3MRSA 4MRPA 1HQCA 3FDIA 4EFMA 5F3WB 2DPXA 2IUUA 3BBPA 5IT5A 1AK2A 2DFLA 5CM9C 3UKDA 2OO7A 5EXSA 4AYXA 1RJ9B 1VCIA 2A5FA 1HY3A 2IHYA 1IONA 1PLKA 1TEVA 4G3XA 4C4PA 1KOFA 4O2LA 2CCGA 2OFOA 3ZQJA 3DL0A 2R9VA 3QF4B 4MGZR 2GHIA 4ARZB 3HPRA 2O8BB 3EIEA 4GMXA 1NY5A 2OUKA 1NMYA 2CE2X 3BWDD 4IKEA 3W5IA 4ERNA 2QGNA 3EXAA 3LW7A 4OI2A 4MYTA 4GT1A 4II7A 2FPMA 1FOEB 3EZ7A 2H8KA 2J45A 1NBMA 2FZ4A 4MGKR 3T1VA 1DO0A 1W47A 1HH4A 2V55B 4NYMR 5FBRB 4QBGB 4LOAA 1F2TA 5KNBA 3EWSA 2IYXA 3REGA 1CR0A 1UAAA 4UXIA 2WOJA 1BIFA 2GF0A 1NVVQ 2HXYA 2VHTA 3BS4A 2WZQA 4R2IA 4EIWA 4KSBA 1QBKC 4TZ6A 1OKKA 4KBGA 1II9A 4TN1A 3RSLA 1VCOA 5FBVB 4WXRA 1ONBA 4OHWA 3CNNA 2ANBA 1DVRA 1WB9A 3TUJC 3O47A 3Q9LA 4K81B 1VTKA 1G16A 1TF2A 2ZJOA 4FD2A 4QBIA 3HU2A 2J7PA 3NBZC 1DG1G 2JLZA 1ZD9A 4MKIA 3X1ZA 1FMJA 2NQ2C 1G3IA 2X1VA 3TQCA 3AUYA 3NKVA 3T35A 3UMRA 3KUDA 4HAWA 4TL9A 4P4TA 3DMDA 4M1OA 3WMGA 1U0JA 4M1KA 3BIFA 1YVDA 4S35A 3KXLA 4CT4B 4GDFA 3SNHA 3B2EA 2NTYC 2QPAA 1YE8A 4BECA 3S1AB 2FFAA 1N6LA 1P72A 1XBTA 3GCGA 4Z8XA 2GK7A 3G82C 2V8OA 3QG5A 4GBMA 3SYKA 2GXAA 4AURA 3QE0A 4KHZA 4I81A 1QDEA 4JVNA 1PZNA 2WWIA 4Q4HA 5HE9A 4DUGA 4ZV4A 1YZTA 4MUBA 2XZOA 1IN5A 4F4JA 3EIQA 2B92A 3GJ6A 4OBEA 1X6VA 3OIYA 4LBZA 1Z0AA 3LDAA 3ZVNA 2W2XA 3QIAA 1GWNA 5KUTA 3CBQA 2PX3A 1VCNA 5FPTA 3K09A 4URUR 4XVUA 2QUZA 1YZQA 2FV8A 3KKOA 4Q4AA 3WYAA 1VG0B 2I3BA 2QRNA 3LQQA 4Q1DA 1D9ZA 1XXHA 1GIAA 3SN6A 3ASZA 3GFTA 1TX4B 3PUYA 3U4QB 3QUSA 4JT2A 3U4QA 4DJTA 1JQJC 2JLYA 1P2TA 5KDLA 4Q9HA 4OHXA 4RZ3A 2LKDA 2GF9A 2GEVA 4LWZA 3UIEA 1QHNA 2P67A 2PEZA 3DOFA 4LDJA 4TMKA 3ICQB 2IEYA 5J4KA 1W46A 1E79A 4Q7LA 1NJFA 5EXXA 4L16A 3ETLA 1SVIA 5CYPA 3FHTA 3OEHD 5G41A 3M4YA 3TW8B 2REBA 1ZUIA 2O8FB 1S1MA 5EE0A 1E69A 5F98A 2YNMA 2GEDA 1GKUB 4C0LA 1CR1A 3JVUA 2XTZA 3E5HA 3QVUA 1A2BA 1QG4A 3K9NA 1WE2A 4Q9KA 3C5HA 3K0CC 4URZR 3RHFA 1Z47A 3NEYA 2FPKA 2PZEA 3D8BA 1S3SA 1S96A 1II0A 2A5DA 2QTFA 4MQBA 4OQLA 2GA8A 1COWA 5H68A 1KDPA 1OFUX 3CX7A 4BLQA 3VU9A 1DAKA 1WP9A 8OHMA 4PC3A 2ZJ8A 4PSVA 3RS2A 1I4TD 1NY6A 5KYKA 5JCPA 4QFMA 2W6JA 3ICEA 2CL7X 3SJZA 4FMDB 4M9ZA 1ZAKA 4AY2A 1CEEA 2FWRA 3RVBA 3QXCA 1TU4A 2WIAA 1LF0A 3GLFB 1T3SA 2YJTD 2ZITA 3Q7PA 4OK3A 5FTMA 4TMXA 4A8JC 1TL7C 3U7HB 1N0UA 1U0HC 3W8RA 2VSXA 2DFTA 1RW4A 1G8HA 2OESA 1LW7A 2O52A 3C8UA 3L8YA 4TQUS 3K9HA 3VR2A 2F55A 1ZM7A 2JJ8A 2PEYA 3NWJA 5F2EA 2WPDD 1KKMA 4PC2A 3RS3A 2R62A 3QPWA 3GLHA 4D2IA 3V9PA 4KXFB 4TMTA 3NTUA 3CRVA 5HZHA 4OKSA 3NDPA 1U90A 1G6OA 2D74A 3PFIA 3IGFA 5DI3A 4LBYA 4B33A 3EZ6A 3GLHE 4C9BA 4I1SA 4B43A 1G8GA 4BZPA 1DO2A 4BEJA 5BN3A 1F6BA 5ANRB 1QHSA 1NG1A 1S9DA 1NNEA 4YLGA 5K8TA 3U7EB 2A7QA 2Z83A 4JLPA 2QQEA 4NU0A 3DKVA 5JWRA 2P6RA 1CRPA 4KBFA 2J87A 3CPEA 3PUZA 2BMJA 2DCUA 1AKEA 1NF3A 3OAAD 4DEXA 3Q72A 4LSGA 4PAMA 2OAQ1 1RFLA 4B48A 3BERA 4JLJA 2JAQA 1RRFA 1W2GA 1B0UA 1Q44A 1VHLA 1L7VC 1CXZA 3AVVA 1BOFA 3GEEA 1GAJA 5J4VA 3QPVA 3NHBA 2GJ8A 2RHDA 1C9KA 1FFHA 1NKTA 4O0MA 4KI0A 2J0SA 2QMUA 4NE2A 4HB2A 1UPTA 1VKJA 1G18A 2AD1A 1VG8A 4NCNA 4B3XA 3BFXA 4P3YA 4RCYA 4FW9A 1IY0A 1Q12A 3VR1A 4GPTA 2ODEA 1RVDA 5AJWA 2YC4C 3B9PA 2B7BA 1KI6B 3WP1B 3RRZA 4AC9A 1SVKA 3I8XA 4Q9IA 2ZUCA 2PMDA 1G5PA 1AQUA 1FNMA 1UJ2A 5FOVA 3A1TA 4XWAA 2EFGA 3T1OA 3MSXA 4POAA 5DN6A 2WJVA 4TT3D 1KK2A 2VIIA 2IYTA 2AR7A 4F93B 1P2SA 5LD2B 4EJSC 4URWR 3HU3A 3OHMA 1NMZA 2GXUA 2P6NA 4KO8A 1XEFA 4PR0A 3PR1A 5HR5A 3SYLA 1NLYA 5HTKA 2JLUA 1ZNWA 4O2RA 2VLIA 3SU8A 4TZ0A 4U7DA 4GI7A 1NMXA 4W5JA 4JMPA 5L3SB 3B1WA 1K8RA 1JBKA 3RS4A 1BO6A 3DZDA 1E2HA 2PT5A 1EFRA 4HLQB 2BHRA 4LYFA 3FKQA 2RHMA 3GJ5A 3B85A 2YOFA 5LBIA 1R6BX 3EARA 2QEQA 2ZIAA 1SZPA 1P9RA 4NKRA 3SQXA 3ADBA 1OH8A 2OV2A 3F8TA 1E4VA 4EFLA 1I2MA 1U99A 4BFUA 4D81A 3T12A 1Z6XA 1D6JA 1T8TA 2E9SA 1DEKA 2N42A 4U02A 1CJMA 1M6NA 1ZC4A 4WZ6A 2OFWA 1KO1A 4H1VA 3OAAA 4N1AA 3B1YA 1DTSA 4A4DA 4P4SA 3CH5A 2ORVA 3TVTA 2BM1A 3IPYA 2NG1A 1NLZA 4LZZA 3C15C 3KKMA 5G53C 3X1WA 1E3MA 5TXGA 1VIYA 4JS0A 4CEJB 4CGZA 1FP6A 3LH5A 3QSYA 1R5OA 3V4FA 4OHVA 1A1VA 3BJIC 2ZPTX 1P62B 3AB3A 4I1VA 1MV5A 1ELOA 2UZIR 4QGFA 5C18A 3FMOB 1XJCA 1TQ6A 1OH7A 1WQ1R 4LYJA 4HAYA 5KSYA 4JIMA 1LB1B 2K5UA 3B7GA 5CIWA 1NP6A 4MUAA 4XTCS 5JJIA 2GETA 2W6ID 1ZU4A 2Q9BA 2VHCA 3UPUA 5K8LA 4HB0A 2XOKA 5FUYA 5EP3A 4WOPA 4WW0A 2HEIA 2R44A 1Z0IA 3S1AA 2AKAB 4PPGA 4LJ4A 2AFHE 4OQNA 2P0EA 1SVLA 3A4LA 5JLJA 2CCJA 1AA9A 2GVZC 2F3TA 2D7CA 4QRHA 1LS1A 1VIAA 4HLDA 4NCJA 1DAHA 1E94E 2ZETA 2H18A 2QNRA 3KTAA 3MAAC 2WICA 1PJRA 2GAAA 5IF9A 2ANCA 4E22A 2QPOA 1E1RA 5CJPA 1EX6A 3SHFA 4B3BA 4MRNA 4L5BA 4TSFA 1W7AA 3T5GA 1M2OB 4Q00A 1NSFA 2W6JD 2NO1A 2PH1A 2OZEA 4FN5A 2QN6A 4JLKA 4XOIA 4CEJA 2ZVPX 2QAGC 4JLDA 1GG2A 3TR5A 3LAWA 1Z6GA 1UEIA 3M1IA 4RKEA 2B7CA 3RLFA 3ZD7A 4B74A 3VFDA 2ZRLA 3A1WA 4URYR 2F43A 3B1VA 4C0KA 3DEFA 3GJ7A 1SHKA 2BCJQ 2XTNA 3LV8A 3UG7A 3SC3A 2F3RA 2XSZD 5G3YA 2HXSA 2ZI4A 5LPNA 2WOOA 3ZGXA 3LRPA 1NN1A 1CP2A 2D2EA 4LI0A 1Q22A 1PUIA 2ZRPA 2IHBA 1LF5A 3TAUA 5JJKA 3W34A 2C03A 2EU8A 2FFQA 1FTNA 2J41A 2NOAA 2B8WA 3B60A 3VHLB 1ZC3A 2WHXA 2XGJA 1ZNXA 2WWXA 3LVRE 3EPLA 1L4UA 2CMKA 3CW2A 2V4ZA 3GD7A 4O25A 3K0CA 1KNXA 3AKDA 3UMFA 1GP2A 2BM0A 4LX0A 1KSHA 5HKKA 5FL7D 2KB0A 1MABA 3PEUA 5IK2D 1JXMA 2WJYA 4UKDA 4E5UA 5TMPA 4FCWA 4WZBE 3U5ZB 2CHVA 4MYHA 4PZLA 5CIQA 2NO6A 3WXMA 4TYNA 4KITB 1II8B 2IX3A 1R4AA 3A4NA 1GZSA 1BYUA 3WBJA 4AYWA 3VHXA 4Z8YA 5EZ6B 4EJSB 3E70C 2ZUBA 2JA1A 3LO5A 1XMJA 2LCFA 4QNMA 4IDQA 3GJ4A 4Q4JA 4NCKA 4B3CA 2CLDX 3O8CA 2QMEA 3T06B 1FZQA 4G5OA 2GBLA 4GZLA 2N46A 4MDEA 1G7CA 4WBSA 1GVNB 4LJAA 4ESHA 3THXB 3BGWA 2JASA 3AVOA 4M22A 5AR1A 2HJGA 1G8PA 1S3GA 4UXHA 3B1ZA 3HPQA 3UWOA 5B30A 3I62A 3CRQA 1Q57A 3X2SA 5JCZA 4EQ6B 1OXSC 1N6OA 3ZZUA 4Q66C 1T0HB 1UKYA 4XVRA 1A2KC 1OV4A 1M7BA 1NVUQ 1T91A 3I32A 4IVPA 4IOJA 1W0KA 4OQFA 5F9HA 2KE5A 2Q3FA 4C7OB 1IHUA 3B82A 2AXPA 3N5CA 2XNDD 1Z8FA 2KJQA 3B78A 3MJRA 2CXXA 4FCVA 2IYVA 1E9DA 1KI3A 3HWSA 5FTNA 3AF0A 4QHYA 3RNLA 1KYIA 2GILA 4OJQA 2ZSAA 2GXQA 2PZFA 3ZVLA 5KDDA 4AWXA 4KLZA 4MGYR 5DNYB 2DR3A 3CWQA 3I72A 2YV5A 5CDFE 5EQTA 1DS6A 1LNZA 3QBTA 3KFVA 4IFBA 1E2EA 4NMMA 3VKWA 4CYMA 2AFIE 2Q21A 1TQDA 3N70A 1XNJA 4H1UA 1R0XA 5BYJA 4YXWA 4ESVA 2ZJ5A 5BYKA 1PLLA 4TYQA 4AG5A 1SULA 2V6IA 3AKYA 1KAGA 5FFMA 5BN5A 3LBHA 1Z0KA 3DM9B 1U0LA 4X8HA 3G0HA 3VNVA 2WKRA 1OHHD 1TU3A 1NVWQ 2O0KA 1GOTA 3NEJA 1N2CE 5DO9A 1BH2A 2VA8A 4AKGA 3CO5A 2JJ2A 4PQRA 3UXMA 2A2ZA 5FTLA 4ZDIA 2IT1A 4L8GA 4A0HA 4D25A 1XXHE 4G5RA 5G40A 5AK0A 1XTKA 1KK3A 1VYVA 1XMSA 3PUXA 4JJZA 5C4GB 2KBEA 2IXGA 2EFCB 5C1BA 4V0ME 4DDWA 1K5DA 5JI2E 2A78A 3H0KA 2IEZA 5JWHA 4WA7A 4IRUB 3K0FB 4HAUA 3MJHA 4CVNA 1RE0A 1NLFA 3VAAA 4C7OA 3P20A 3KQKA 1UBEA 2F7SA 3O8BA 3U2QA 2ODBA 2QP4A 5FL3A 1NL3A 3CZQA 1E1QA 3AF3A 3BXZA 1G20E 4N3NA 1AGRA 3F0TA 1C1YA 1G7SA 2YYZA 1ZUNB 1FX0A 3LXRA 3EA5A 1CJUC 3QQ5A 3THOA 2ZVQX 3PEYA 2WAYA 3QNUA 3K1JA 2IYRA 1QHYA 2RMKA 4URVR 5KHOC 1OFTA 1XCGB 1CJKC 4FMDF 1OLOA 2OFXA 4Q1EA 3BK7A 1ZVQA 4Q7JB 5JS7A 4JKYA 3EC1A 3QI2A 1KJYA 3OEED 3U60B 5JRZA 5JS8A 1NG9A 1L4YA 2OLKA 2V7QA 1KO8A 5KNDA 2D4HA 4ZDJA 4ACBA 2XXAA 4A2QA 3QEOA 4KYIB 3CPHA 2R2AA 2EYQA 3FHOA 2XXAB 5E7MA 4UNQA 2ORWA 4JLVA 4R9UC 3K9GA 1VYUA 2KI5A 4D0LB 1R5NA 1JR3D 4PSAA 5JFGA 4FWTA 2NIPA 3TQFA 1DAMA 4DSNA 2XOKD 5KNCA 4LJ8A 4M1WA 4ASUD 2BMDA 2V6JA 3KKNA 2HDNB 5JSZB 4K8OA 2D3WA 3HR7A 1CR4A 5JEEA 4LUCA 4A2WA 4OJKA 3SDZA 1J99A 1QHIA 2JLVA 2PMKA 1TNDA 3P4YA 3GJ0A 1E9AA 1AM4D 2GVDC 4YMUA 2W2VA 1W4RA 4OQXA 1EK0A 3AF4A 3TBKA 4B2IA 4L9WA 4NYIR 5F9FA 1MO6A 2CL0X 5GJVC 1SXJE 1WF3A 3IO3A 3LXXA 4NYIQ 3GJ3A 1BKDR 3TNFA 4LJ9A 4LGMA 2R6DA 4JT4A 3M0EA 1XEXB 4TYPA 2BBOA 2G83A 4US1R 1UF9A 4QGHA 2CJWB 5LD2C 3GFOA 3QKSA 1Z63A 2O0HA 3Q7QA 1IN4A 2BKUA 2XNSA 3EWAA 3VKHA 1Q21A 5HCNA 2Z6VA 5C4MA 5CK4A 1KSGA 4GOKA 4F38A 3TE6A 2AD5A 1SKQA 2OBLA 2QM8A 3FOZA 4B34A 1BYIA 4V03A 3SOPA 5GVRA 5FI1B 2X8AA 4NTZA 4ZCMA 1OKKD 2ZANA 3LW8A 1IBRA 3OIWA 1VMAA 1YZGA 4AD8A 4A2PA 1XP8A 2IS6A 5CITA 3AVWA 3BH7A 2EWVA 5KTYA 2DHRA 3RSOA 3IILA 3QY0A 4UNSA 5EXPA 2WPDA 2IK8A 1F2UA 2OCYC 3U7GA 3THWB 2JATA 3GLFE 2R6GA 2ZRAA 5FUWA 1XEXA 5AUNB 1KDRA 4G1UC 2OCBA 4JBYA 4QOSA 5IK2A 1JEEA 4CDGA 2ZU0C 1JB1A 4JL6A 1RRPA 4Q7KA 4JSTA 4D82A 1AQYA 3WP0A 4HAXA 4BASA 2QY9A 2ASEA 4D0NA 3KKQA 4A0GA 1D2MA 3OE7D 1X1RA 3K70C 3CKLA 2ONJA 5AJVB 3OF5A 2JLQA 3OFNA 2GEUA 1R2QA 4GP7A 1A4RA 4JVMA 2GJKA 3B9QA 3SE0A 2ERXA 4JBXA 1ZUHA 1GL7A 1U9IC 3HYRA 5KSOA 3MFYA 4BFXA 4RD3A 1ESMA 2ZRNA 4RD2A 4TWZA 2EQBA 4GOJA 4L9SA 4FCTA 4NL4H 4IXMA 2BWJA 4DT1A 1O87A 2RH5A 2WWWA 1R0ZA 4DEYA 3EG5A 3QF7A 1N5LA 4QM7A 2ZE5A 1OHHA 1ZM9A 4C30A 1W36C 3AQ4A 4JBWA 4BRUA 2QQ0A 3OIVA 1KY2A 4C0JA 4PQYA 2QAJA 3CR7A 1ETUA 4GMDA 4Q4HB 2ZM5A 2WJIA 3CUEF 4IW3B 3EW9A 3W6NA 4C2TA 2ZS7A 5KDOA 2DB3A 1CJTC 3RANA 5JRJA 2WWGA 2G77B 2ZRFA 4DIEA 2PCJA 5CB6A 2ERYA 5TARA 3MMPA 1E0AA 1VG9B 3RC8A 1XTSA 1ZCAA 2ZU6A 1CTQA 5B58C 4JKIA 4UNRA 5AUOB 2QA5A 4JVSB 4DVGA 4JLNA 1ZIOA 2RCNA 4TTRA 5EP1A 1M1YE 4D4JA 2AX4A 1W0KD 4BZQA 4A36A 4EKDA 5CM8B 5EXTA 1E99A 4FWIB 2RGAA 2B6HA 5M04A 2GCOA 1H65A 4GSYA 1ZBDA 2IUSA 3DDCA 1COWD 2ZAOA 3U3RA 2Z0MA 4HUQB 4WIAA 1YR8A 4NPHA 1OB5A 1KDTA 3I3SR 3U3KA 3I4LA 4A8JA 3H84A 1DOAA 2QAGB 3W6OA 2FGJA 4YONB 1MABB 1ZINA 5JHHB 1CJVC 2IS2A 2IXFA 3DOEA 1A82A 4H9GA 1SXJB 1EX7A 5SZHB 2RB4A 3E1SA 3GJXC 1EFTA 2RKOA 4G0NA 3VKGA 3I5XA 2YHSA 1XD2B 4Q1CA 4LY6A 2WJGA 4D80A 2D7DA 2WWFA 3TLXA 3AVYA 1KI4A 3IBYA 1TUIA 3RC3A 3UK6A 4M53A 1ZP6A 1GKYA 1S1CA 2HCJB 1XDBA 5IHPA 1I4DD 1NKSA 1ZU5A 3LD9A 1Z6TA 1TMKA 4DZZA 4MYUA 3GLFA 1P73A 2FSGA 4RZXA 2ZR7A 2ZE7A 4YMWA 1PVOA 2P65A 4ZKDA 1MR3F 1NN0A 4R7ZA 4DDVA 2FU5C 1GTVA 5IRCD 1KO7A 2BBTA 3FKSA 4MKGA 4RD4A 4DLWA 2FH5B 4C0AC 2BC9A 1TF7A 3FFBA 3HYTA 3WMFA 1RYHA 1YZLA 2I4IA 3W90A 1G64A 2Z4RA 1GUAA 3GP8A 2R6CA 1PV4A 3Q5EA 1JJVA 1OIWA 2D06A 3IHLA 4LHYA 3W5JA 3K0SA 2J5XA 3AF2A 3V00A 1KJWA 3UMSA 5BW8A 2OCAA 3SYNA 1YR7A 1G8YA 3GPLA 2CLCX 1FQJA 3AF1A 3ONWA 1WRBA 2O0JA 3I92A 4QHTA 4QJ5A 3L0SA 1ZNZA 3KKPA 3ZS9A 3RS7A 2ZYUX 3Q5DA 2BJWA 2X19A 2IYSA 2WWHA 1KO5A 2RGNC 3NBXX 1CR2A 1GL9B 1SXJA 4G5SA 4DB2A 1E79D 1J2JA 4RZ2A 2CE7A 3LBIA 5DLQC 5A0FA 521PA 4D0GA 2QP9X 5EP2A 2VP2A 4TLAA 2FG5A 4FMCB 4DKXA 4OK5A 2XITA 1ZYUA 1NBMD 3QENA 2CL6X 2GJ9A 3MLEA 5BN4A 4MKFA 4ON9A 4TYYA 2F1IA 1GKIA 3MUFA 1W4BA 2ZRGA 3SR0A 1IN6A 4PC7A 2EWWA 2Q9CA 1OXVA 4X8LA 2DYKA 2F6RA 3BH6A 3EA0A 1XTQA 1KMHB 2VEDA 5EE3A 4UNPA 4B2LA 4BWYA 5C46F 2C9YA 2ATXA 4XWOA 4LHXA 3F5FA 3QG1A 4BFZA 1R0WA 5AUPB 1RC8A 1E9RA 3UANA 5EUMA 4S2EA 1P60A 3P4XA 4PHHA 2FX3A 5G3ZA 3UWKA 4GRAA 2FE4A 4P0TA 3TSWA 2PX0A 3AV0B 4R2HA 1U2RA 4W5HA 1NN3A 1KK0A 1UKEA 3BORA 1Z29A 3W3AA 2JLSA 2WMNB 1QRAA 2QMOA 2CK3A 4DSOA 3MGCA 4Q4JB 4BLTA 1N5KA 1R5BA 2DWOA 2FOLA 1DBSA 1EWQA 2HT6A 5H70A 5AJZA 4PZYA 2QAGA 3LA6A 1KI7A 2OXRA 2JLRA 2C96A 3REFA 2QSZA 4IXNA 4YQFA 3I61A 3FFAA 3R7WB 4XIGS 1GRNA 2BBSA 2E1RA 2A9KA 2J3EA 2J1LA 3AGPA 1KJZA 4KFSA 4R98A 2FSIA 4G5GA 2DY1A 1W36D 1S0UA 1GM5A 2EW1A 2BIFA 3AKEA 5KSPA 1S2MA 3GLHB 4IOLA 4M9SA 4P32A 3GFPA 3RYTC 3K0AB 1IY1A 2CHQA 4Q47A 3FYHA 2DWQA 4CF7A 3GEHA 1JNYA 1E0JA 2VH5R 5DHFA 2NMVA 2BMFA 1ZD8A 2B21A 3FMPB 1US8B 4FMBB 1IQPA 1UBFA 2FNAA 1J8YF 4ZIRB 2ZRMA 1H8EA 4HDCA 3LQRA 3EIHA 3L0IB 5FUXA 4PTLA 3VR4A 4CT5A 2OBMA 2MSDB 3B1XA 1XF9A 4Q7MB 3AM1A 3TRFA 4BFYA 4QXAA 1ODFA 2ZS8A 3RS0A 3K0FA 3K0EA 4P4SB 3ND8A 2IWHA 3TAHA 1W5TA 3TH5A 2P5TB 3ZYCA 3BFVA 2VF7A 1S9HA 5DSZA 3KXKA 5DYGA 2ZJZA 2XB4A 4EPYA 3CX8A 1AN0A 1ZW6A 2ZQ5A 4OI4A 3TGPA 2FMXA 1E4YA 1G5TA 5P21A 2WV9A 2Z4SA 3N2EA 4RVCA 3R8CA 1WA5A 4P31A 3W8NA 1XCMA 4ILEA 4ABYA 1NSTA 2IF2A 3CX6A 4HZIA 3TK1A 3QPUA 2J9RA 3JVVA 1E1QD 5HKKD 1MH1A 3PIRA 4BFSA 1T4GA 1EWRA 4ASUA 2C2HA 2V3CC 2HYIC 1IXSB 2C5LA 3BE4A 2UZ3A 1JAHA 3PCRB 4KSCA 2NO7A 4IVQA 4A8JB 2J7PD 5H8WA 1DAIA 5BXQC 1E32A 2QG6A 3CPJB 4XH9B 3DHWC 2XB2A 4DLZA 5DGXA 3IQXA 5E7IA 3CH4B 1RRCA 2TMKA 5L8VA 2N1BA 2PLRA 1G3QA 2QROA 2W0SA 4HYYA 4PANA 1JR6A 3ZIAD 1YR9A 2VP9A 3VR5A 2VTKA 1XEWX 3OIUA 4R71A 4XSGA 121PA 2AHOA 4JL8A 4EPWA 2OEPA 1GRRA 2DBYA 3KB1A 3GLIB 3IBGA 3AP2A 4ZI2A 1G41A 1OPXA 1VDZA 4QJ4A 3WRXC 2KSQA 1IAQA 1IJEA 3WMEA 3X1DA 3GLGB 2HV8A 5DH9A 4P33A 1GRQA 3B13B 4XJXA 1XRJA 4E07A 1CLUA 3UG6A 5GJBA 1NVXQ 2X2EA 1ZCBA 3QXSA 3QJYA 2VP4A 3SJCA 3ND9A 5FUVA 1XX6A 3W9YA 2V54A 1A7JA 5GJWC 1RZ3A 5DISB 4BLPA 4DC9A 3BFKA 3ZH9B 1OFHA 2VF8A 1E2NA 1ZNYA 1SGWA 3CR8A 1E98A 4LCBA 1CIPA 1HEIA 5L3SA 2ZRJA 3NG1A 3GLIE 1AGPA 1M7GA 4M9QA 2FGKA 2GCNA 2FDCA 1GILA 4PPNA 1UADA 4DLSA 3U7FB 3BB3A 1G4UR 2NO0A 3GQBA 3DM5A 2NPIA 3GLIA 4V0OA 3WNCA 1MRSA 2PZGA 1E2QA 1HV8A 1R8SA 1DELA 2VPPA 2ZRBA 2QT1A 3T1TA 4Q48A 5HCIA 1SXJC 1TPZA 3QXXA 4C0QC 2UVQA 2RGNA 2EYUA 2ZJYA 2ZJAA 1OYWA 4B73A 2W83A 2XZLA 4XVQA 1T0JB 1XCPA 3QKUA 2PJZA 4QBFA 2A5GA 1LTQA 3CWZA 1N3BA 2CLSA 2BCGY 4TMWA 1ZM3A 5FR2A 2J0QA 1X8JA 1T5IA 1JI0A 2HUPA 2PT7A 1YRBA 5DE3A 1OJLA 4ZO4A 1P9WA 1Z0DA 1KI2A 4DIDA 2V9PA 2ZI6A 4ZCIA 3TSZA 1QF9A 4D26A 4KV9A 5J40A 3K9LA 2P5SA 1P5ZB 3OE7A 3PENA 4LRWA 3VQTA 3AEZA 3LLUA 1DAFA 1UDXA 3MCAA 1QZXA 4MA4A 1XWIA 5J47A 2ZTSA 3L0PA 3GMTA 1KZ7B 3Q3JB 4Q4AB 5DI9A 4DUGD 5FI0B 3SBEA 1C4OA 4DLRA 2H5EA 2ODNA 3NBFA 2ZJBA 4F4CA 3AVUA 1OIXA 2EFHB 1UBCA 5CJ2A 3KB2A 3AKCA 1AKYA 4V02A 1T3LA 3RDPA 3D31A 2CK3D 1W2HA 4TMVA 2XEXA 4PPFA 5FPSA 4BZXA 4M1SA 3MWLA 3H4MA 2DFKB 1JAIA 3KJEA 1Z0FA 1ZJ6A 3WHLA 1J70A 3ADKA 4HI0E 3HJNA 4B44A 1W48A 1Q0UA 4M9XA 3VX4A 2JJ2D 4BRWA 5CLQA 3ZVRA 4HB3A 2JIZA 4KU4A 4RFVA 1YZNA 4OHZA 1Z28A 2OM2A 1DE0A 4MGIR 1E9CA 4LJYA 2PBRA 3CB4A 3MWJA 2BMEA 2D2FA 3CF2A 4TLBA 2C99A 3M6AA 4NH0A 4C0SA 4Q19A 4ZDWA 1KMHA 4JLOA 1LVGA 2H7VA 2XTMA 3L2OB 4RCZA 1P3JA 4HUQA 4JYCA 4Q1AA 5FL7A 3SFVA 2VQSA 1JR3E 3PEVA 2XNDA 1RKBA 4PX9A 5L3VA 2H92A 2GZAA 1NI3A 4LBWA 3K8YA 4MRVA 1Q1EA 1F60A 3KL4A 1E6CA 1CULC 1OE0A 1MOZA 1US8A 5J4LA 4D4KA 5EE1A 1QHHB 1KMQA 2ATVA 4D4MA 1Q1QA 4I1UA 4XWKA 2L0XA 1SVWA 4MYCA 3WYGA 4Z54A 3L43A 1TAGA 3QKRB 4EQ6A 3VR6A 4Z51A 2GCOB 4MKHA 1W0JD 3CONA 2QM7A 3DKPA 1M74A 3PUWA 4AG6A 1Q20A 1XD8A 4AKEA 1JEDA 2RAPA 2RGXA 4MH0R 4ZCLA 2FPLA 4PQFA 3WY9A 1DAEA 4HDOB 4I99A 4B3DA 1UEJA 2WAXA 2RGEA 1FL9A 1E96A 1T8UA 1S4QA 2GBLC 4QG7A 4LV5B 3ASYA 3T61A 4KODA 2YWGA 5DYIA 2F43B 4B76A 4YMVA 2GDJA 3OEEA 3PQCA 1J8MF 2ZR0A 2G0TA 1SHZA 4M8NE 4EAQA 1FPMA 3R9WA 1TQ2A 2GKSA 4PSKA 1RIFA 1X1SA 1EFCA 4FXPA 3SJBA 4YC7A 1YRAA 4LHZA 5CK5A 2JGNA 1Z08A 5L3RA 3ZD6A 1U98A 3B5JA 5J4HA 2ZI5A 1QHXA 4YDHB 1AS0A 3MD0A 5TV2A 3SFZA 3C41J 3TR0A 2F9MA 2GWHA 4BE7B 4HZUA 2OG2A 3NH9A 2MSCB 3QXHA 3U44A 4PHGA 5FOTA 1KK1A 1Z0JA 1KDOA 1OSNA 1EGAA 2AKYA 1U94A 4IEEA 5FBLB 3R7WA 1WDTA 3KQLA 2YINC 4TLDA 5SZIA 3R9IA 1Z07A 2OBNA 2XAUA 1DPFA 4Z1MA 2CNWD 2FEOA 4RY2A 3K70D 3MG9A 2HYDA 3WRYC 6Q21A 4LBVA 1XB2A 4IJMA 2H16A 1OXUA 2P6UA 1YQTA 2HT1A 4DCUA 2WSMA 5CLLA 3PUVA 5JECA 2GESA 2YC2C 4UNNA 2O8CA 4PHTA 3RABA 1U8YA 2O8EB 4DLVA 2BDTA 4CRWB 2LWIA 4RSGA 4A82A 1D9XA 2J0VA 2V7QD 4PZZA 3AVXA 4LYAA 5JMTA 2FZLA 2E87A 2AWNA 3A58B 4UXJA 1VHTA 1K5GA 2ZUDA 1V5WA 3TMKA 4NONA 3I8SA 2CEAA 4FI3C 4B75A 1RPZA 4Q18A 4OHYA 3LX8A 4JLBA 3A1VA 2JJ1D 1E2GA 1E2KA 5EJEA 4IHQA 4C2UA 4TL8A 1IXZA 5TY0A 3OFND 4HAVA 1A5TA 2ZSFA 1TADA 1VECA 2GK6A 1OB2A 5FOWA 1M7HA 4GP6A 4N0EA 3I5YA 3K53A 4A15A 1NIPA 1NN5A 2OLJA 3EPJA 3L0OA 4U5XA 1DADA 2WM9B 2ZEJA 1N6NA 4LPSA 4CIDA 2VP0A 2YWFA 2DFNA 4B3FX 3LNCA 3EPHA 2W6IA 2BV3A 1N5JA 2X77A 2CBZA 2ZR9A 4OI1A 2WKPA 5FPYA 721PA 3EZ2A 1KTVA 1SQ5A 2JIZD 2IA5A 3ADCA 1MO3A 4LJ7A 2J59A 4Y0AA 2ZE8A 4JLMA 1G21E 3C4JA 4GZMA 4PAOA 3C16C 5FH9A 1CF4A 4DB4A 3QEJA 4BLOA 2A30A 2W58A 4X8MA 3NH6A 5H1YA 3Q8XB 2G6BA 4PC1A 5SZJA 2BVNA 4URXR 3C7KA 2IW3A 1HQYE 4M21A 4V0LA 3GLGA 4Y0VA 5TB5A 1OYYA 1EFUA 4E09A 2BJVA 5HZKA 3A6PC 2FSFA 3VTKA 4IFEA 3ZDQA 2AWOA 5C2JB 3ZIAA 2FJUA 1VYTA 3IPXA 3NDBB 2AXNA 3WNBA 1YZKA 2GJAA 2P2LA 1ZRHA 3DO6A 3OEHA 5D3MB 4DCVA 2HF8A 4IOKA 2I1QA 1RRGA 1KI9A 1TF5A 4CEIB 1N6KA 5A5GA 2AK2A 4ZPXA 3KXIA 3VMFA 1KI6A 5B57C 2R6AA 1ZM2A 5FPHA 5FOUA 2IBMA 3PV0A 4OI0A 4L15A 5KOYA 1G7RA 3KUCA 4A92A 3ZZTA 4QJ3A 3IUYA 3WBKA 4AKIA 3HU1A 4KJZA 2RGCA 1W44A 2NZ8A 1Q1BA 1UFQA 2OHFA 3RS5A 1Z5ZA 4QL3A 4XD7A 4NDZA 1Q3TA 2F1HA 2R65A 2F1JA 4E03A 4KFUA 1NJGA 4TLCA 4NYJQ 4M1TA 2C78A 3HR8A 4QNRA 2FFBA 3I73A 4G5QA 1K6MA 3W6PA 2ZYWX 1E2DA 2XJ4A 2QMHA 1XMVA 2I1VB 3D3QA 1Z83A 1IOZA 3LBNA 4KFTA 4BLRA 2QGZA 4CZ2A 1JXOA 1CKEA 2XJ9A 4QGGA 2IF0A 4Q5IA 5K8IA 5JWOA 5KPDA 2C98A 1Z6AA 3CNLA 1MO4A 3TVDA 1E1RD 4EJSA 1XMIA 4TL7A 2J7KA 1CBUA 1G3UA 1Y63A 5HE8A 3AH8A 2C9CA 3NC1C 3RWOA 2JDID 3KDSE 1WBDA 2VP5A 4LV8B 2NPFA 3ZZ0A 3HP1A 1E9EA 1OFIA 2VP6A 4A0FA 5DN6D 1E9FA 2O8FA 1N0VC 3AGQA 3EASA 2R6FA 1FW6A 1XXHB 2GZHA 1GL6A 3IIMA 4IDPA 3CRW1 3QKRA 4M1YA 4K46A 1PUJA 3LWNA 4IOMA 1H8HD 3BAFA 1W1WA 4LC1A 1UKZA 1N6RA 4TSFD 4CEHB 2GRJA 4MRRA 5B64A 5E4FA 5FTKA 3NIBA 3BD9A 1OXTA 3THWA 3T34A 2QORA 1J7KA 1H8HA 1KAOA 4GNKA 1F48A 1AZSC 2FFHA 4F91B 4NYMQ 3ZLJA 3BOSA 3TIFA 2WSSD 4TMZA 3KTAB 221PA 4V0NA 1G9XA 3ZJYA 1OF1A 4U00A 5LDDC 1I4LD 3A37A 2YWHA 4M0LA 5KO2A 3B6EA 3VU9B 2Q9AA 2IYLD 2ZAMA 4KVGA 2RGBA 1M8PA 3L8ZA 1N25A 3CF6R 2HLDD 4UJ5A 1N5IA 5UKDA 3AP3A 1SVOA 2WJJA 4PHFA 1OXXK 1SKYB 4A6XA 3DMNA 2Z43A 1G19A 1TEXA 4EPTA 2IWRA 1R10A 3IQWA 5JHGB 2P3SA 4AYTA 3A8TA 4P4UA 1CU1A 1MT0A 2QZ4A 2C77A 1FQKA 1QVRA 1YKSA 2IL1A 1B23P 2CCKA 4A6PA 4FMCF 1HT2E 3W3ZB 3U3JA 3PG5A 2ZYTX 4LHWA 3L82B 3PITA 4KCGA 1ZMXA 3EC2A 1ZD1A 4OYHA 4ZKEA 2Q3MA 1U8ZA 4AKHA 3EZ9A 4B6FA 3Q85A 2ZSBA 2Q3HA 4RJLA 1P61B 1EG7A 2CVHA 1QVAA 1KSJA 3WYFA 4ACAA 5DIFA 2QE7D 1XJ0A 4EPXA 1JQLB 3SZRA 1S8FA 3THYA 4B6EA 2WVJA 3KQHA 2VSFA 1X8LA 4WZAE 1HTWA 5FOXA 5BQ5A 2XSZA 2NZJA 4RFSB 4DLYA 1XD9A 2H17A 1IXRC 3N2IA 1GFIA 1BMFA 1CS4C 1FP7A 2GXSA 2QSYA 4LYHA 5GVSA 1W49A 4YDSA 2JJ1A 3KJIA 5B2ZA 1IN7A 4OQMA 1FX0B 3IEUA 1EFHA 4X8OA 3SQWA 3CM0A 1P6XA 2QPTA 2ZE6A 3EPKA 1SXJD 1XTRA 3ZQ6A 1JECA 2HLDA 2C9OA 1IY2A 3QKTA 3J81k 2IS1A 4NZYA 4RD6A 2VHJA 5CYOA 2A5YB 3AUXA 2O8BA 3X1YA 2REXB 3TW4A 3EAQA 2XX3A 1H8ED 2FA9A 2GTPA 1OH5A 2O8DB 2NGRA 4DCNA 3H2YA 3V4RA 2REOA 4YMTA 2ZYVX 2ZS9A 5JZVA 2VL7A 1VG1A 4W5WA 2G0NA 2VYFA 3NXSA 4F4IA 4WAUA 3TUIC 4ZIRA 1OH6A 4DT1B 3A4MA 4DRZA 4M2LA 1F3OA 1L8QA 1JALA 2QP3A 2PLFA 1KSFX 3T1QA 4BEBA 1KGDA 5JJLA 3NVAA 2AL7A 4G01B 4WXPA 3R9XA 2JEOA 3VR3A 5TDHA 1KI1A 3K0AA 4DDUA 2WBLC 2FSHA 2W2TA 3FB4A 3RAPR 1E2IA 2YZ2A 3SHWA 3THYB 4B32A 1KHTA 1E9BA 1GNRA 2QE7A 2Y8EA 4Q9JA 5HPYB 5L3QB 4AIIA 2O8EA 1T6NA 3KJHA 4KVAA 3PXGA 3FMIA 1T3HA 4UJ3A 4CW7A 4V0KA 2IYQA 4TQ9A 1XPRA 2ZRCA 3IKJA 2ZRHA 1GITA 1YJ5A 1KKLA 2QRZA 5KU1A 4C0HA 4JSYA 1UDWA 3BH0A 5GJCA 3DPUA 3P27A 3QXJA 2SHKA 4XSHA 4DLTA 1JPNA 4TYWA 3SS8A 2Z5FA 2JLWA 5FOSA 2O8CB 4BLSA 3CRMA 4LJ5A 4W9MC 2IYWA 4IEIA 4QC2A 1IN8A 1E9SA 1IJFA 1P4SA 2BOVA 1U8AA 1AJEA 1R7RA 1KZGB 3QVVA 1MRNA 2ZRDA 1XJQA 1Q1ZA 3GEIA 3SBDA 4DCSA 3A36A 1LY1A 3GLGE 4TL6A 4TTPA 4MRSA 3P32A 1W0JA 3VNUA 5LB2A 4NBSA
chains in the Genus database with same CATH superfamily
1MTOA 4AQDA 2NTJA 4C05A 4WERA 2X0FA 1L7QA 1WG8A 2XYPA 3A2LA 1AIPA 4R2XA 2V1UA 1C14A 5CDUA 1ISHA 3RYCA 3FZGA 3WLFA 4R8SA 2QT9A 3DMFA 1EHYA 1ZIYA 1VLHA 2AT1A 2V1XA 3MWKA 3OU7A 4O4LA 3KX2A 4ER3A 5H0IA 1X0VA 3V2UA 4QGAA 3TZBA 5KWSA 1GGNA 2IV3A 4KAFA 5JT1A 3OTQA 1QQTA 5JNSA 2RAVA 3F71A 4YJDA 3WRYA 2HSJA 1C81A 1FTSA 4OM8A 3QKSB 2JL1A 4UHFA 2NO5A 5HG0A 4QKQA 2BEUA 4KX5A 5KEIA 2C00A 1E3TA 2WKSA 4QOIA 3JARA 1XPOA 3ZVKA 1W4CA 5U9CA 3SZUA 2DQSA 2VQFB 5DI3B 1P7WA 2PM8A 1UT6A 2IU4A 2KBFA 5JYCA 4P22A 3ZE8A 1M34E 4MQEA 4N82A 4YIHA 1TM2A 3EMKA 4Q1BA 4PAWA 1AN9A 4J0QA 3ZE9A 4D4GA 2ZWAA 4EH1A 3O6VA 2NSJA 4HNQA 2RK3A 2V0CA 4FLFA 5INTA 4IJ6A 3CIOA 3ZK8A 1JPVA 4B40A 3HZOA 3HUTA 2CKMA 1KIMA 4OXRA 2W70A 3B3FA 1XRPA 1T10A 4W7SA 3FKSD 2O8NA 2GJSA 2JIDA 3HBMA 2CB0A 4WCVA 2PKRA 2MMGA 1P77A 2VPQA 2BR4A 2IE8A 3K2IA 3VDMA 5IHXA 2HWKA 5C7LO 3RQIA 3C1AA 3EAGA 1FUUA 5F4BA 4ID3A 3SI7A 4E6PA 2BKAA 1N6IA 2Q0HA 1CWUA 4FHFA 5JTUA 1Y1SA 1MH9A 1FMLA 1JG2A 2AK3A 3IUEA 4IDNA 4G1CA 1XU4A 2Q2QA 1GPNA 4ODIA 1Z06A 5ALFA 5AWFC 3T7IA 2VDOB 4IDCA 4EVRA 2QG4A 3M1AA 4DSUA 2NP6A 1R8QA 4AKTA 4C78A 2DQYA 1VBNA 2G3YA 5GOZA 1UKVY 2SICE 3TLCA 2G5CA 2QMQA 5KREA 1PYGA 1XEWY 2ECKA 1X42A 1ZGZA 2O1XA 1OILA 2H1CA 3N0WA 3FHCB 1K3TA 3JALB 3UKJA 5EHXA 3EBPA 4PTZA 2I0FA 4INPA 4DLBA 3GT4A 4O5AA 5DHRA 4ZXPA 4D44A 3H0EA 2GARA 1YJBA 2VK1A 3NM4A 3CLSC 5LA6F 2PMEA 3U62A 3IELA 3PDIA 3DZBA 2WUVA 2ENWA 4OGLA 2QTGA 3T5DA 4WLNA 3WISA 5CDFA 1DFHA 4ZALA 1NUAA 1XTBA 4RM2A 1J1IA 1XL1A 3HU5A 3ZCQA 2FZKA 3TSOA 3WX0A 3HXMA 4RFSA 3U1BA 5IKXA 4CEIA 1FBTA 3ITEA 4MK4A 4WKPA 5E7JA 2PNJA 1IXYA 1LFDB 3TBFA 3QX3A 3NHUA 4EPRA 1V6AA 1ZG3A 3RRMA 3P96A 3R20A 3NVMB 4RF5A 4MHTA 1QF6A 1ZIPA 4TXLA 4EY7A 1JYEA 1CRQA 5DHSA 2NU7A 1JHZA 1CR6A 1H1LB 2Y1LA 2BEJA 3A3OA 1OCEA 4LTDA 4QAJA 4E5SA 5EJ5A 4CEHA 4EUKA 1TQ4A 2GKOA 1ML3A 3AVQA 1ZKDA 4YP9A 2BEWB 1BQ3A 3BB1A 5FYQA 1WABA 4BKMA 1OC4A 2WFZA 1M10A 1FFGA 1TYBE 1HA3A 2Z9CA 4FSDA 1ISFA 4ZEXA 2MYPA 3V7FA 2AX3A 9LDTA 1B1CA 3DYVA 1NTRA 1F2VA 1P2VA 3AM4A 3LHDA 2FP3A 2P6PA 2WJWA 4FIDA 4TLEA 3C6QA 1E1YA 3KEFA 5AVVA 3FZEA 4US2R 2ZTVA 3ES9A 3LK7A 4MLPA 1NBME 1IPFA 3RVQA 1N2OA 2IEBA 1UFRA 3E0QA 4B3GA 1S4MA 3LT5A 3LUFA 1LI5A 2WFMA 3B8HA 3GF4A 1G4AE 3TMYA 4A3SA 5KVVA 1NBAA 1Z26A 3OZAA 4GWKA 5K0LA 3PLNA 1WZUA 1C0EA 4DTCA 4LK2A 2O2IA 1PZEA 3H4VA 2R1TB 3VH1A 4A73A 3U6KA 2DHDA 1L5SA 2X0RA 3C6MA 3DGFC 2LP4Y 3DHNA 5GZ1A 1ZM4A 5JS6A 2Y1OA 5GZ3A 2VO1A 2WKQA 1F0KA 4Q01A 1N5RA 2V4MA 2AOVA 3FHJA 3NO4A 5A6SB 2P3LA 3QIVA 5AQ1A 1ZGGA 4TTQA 1C3LA 4B35A 3TMAA 4EG3A 5BSUA 3TR6A 4MUYA 2FP4A 3LVFO 2HAEA 3SEFA 4Q1FA 3E23A 2IYUA 2CDCA 4RZUA 1LBSA 2F9LA 5IUJC 3LPLA 4KQ2A 3ELWA 2GZDA 3NPMA 4AY3A 4M55A 1AS2A 1MKYA 5FPKA 3RAFC 1TTTA 1GDDA 4O3MA 4ME6A 4DV4B 1T5SA 3C14C 2YOHA 3H1TA 2ZQYA 1L7DA 1A96A 1T5TA 2NYAA 3GRVA 3KJGA 4ROTA 4ZOEA 1UXIA 2IU6A 4I1OA 4TT3A 1R9JA 3TW8A 3KETA 1NMQA 1HURA 3IVAA 3K3PA 4RHTA 4FOPA 1R9GA 2ZWMA 5BOVA 5E0OA 3AP1A 3DMGA 3QE3A 4GXQA 2I91A 5AKXA 1I5OA 1R6DA 4B81A 2OCKA 5H02A 5C51B 1NX6A 1XDGA 3QLVC 4FEAA 3T6KA 3R3SA 4YUWA 5LQJA 1SQ0A 3QZUA 2MHCA 2VJDA 2HGZA 4ICIA 2O4CA 2VK8A 3O75A 5KZMB 3GO4A 4YR9A 4F8JA 2OYSA 2YJ5A 3FI0A 4GFDA 1XV5A 3PZRA 1CF9A 2TRSB 1WD5A 4FFBB 4LPKA 4LXIA 4CL3A 1ZJYA 2BFPA 2ZAIA 3MPOA 1GUDA 4IGAA 1CY0A 1C3OB 2EVWX 4FFNA 2QTNA 2C42A 3C8ZA 4KE6A 4IICA 1O97C 3FLBA 3ZCSA 4DTIA 3OJEA 2W0MA 3UICA 3GMSA 4I9FA 1YU9A 2BP7A 3U44B 1PLJA 4QQ8A 4J0DA 4Q03A 5GOTA 2BEKA 1BS1A 2QN9A 1TAHA 3SJAA 2CLKB 4TWBA 1U1EA 1QG2A 4OOEA 1CC1S 1VQ1A 1AKTA 1L7EA 4MTCA 3F98A 4MITA 4LJ6A 3RG8A 4WVFA 5EE9A 2AFVA 3E2IA 1AQIA 2QRLA 2OVFA 4PO1A 1SVSA 2I7XA 3RIHA 4PFSA 3V4LA 2UYYA 2X41A 4WN3A 2H57A 1GQYA 2DWPA 2PJUA 1A0OA 2R5WA 2ZREA 3IVCA 4KQEA 2WMOB 4A8TA 3UCEA 2BTEA 4L02A 3SX0A 1Y1TA 4R2MA 4D4LA 3KU4A 3RWMB 1JJ7A 3WHKA 1HNZB 3Q7IA 3VM6A 3HWWA 3G1UA 4LC0A 4JL5A 5DYWA 4P1ZA 4PZ9A 1RPNA 3O93A 5CVEA 3EF1A 1ICIA 5JEDA 2CNWA 2CJWA 3L93A 4I3GA 3KFXA 3CR3C 4DEVA 1WHTB 3KT3A 3GA0A 4BO2A 4RMJA 2WHRA 4BTVA 3U80A 1P9NA 4A7PA 4KTVE 3E4DA 3K1AA 1XNQB 2NU6A 3BZWA 4LQ4A 1QIDA 2BKLA 2PO5A 4PPQA 1IB6A 1VKRA 4LDAA 3VYUB 5D87A 4YY3B 3VR6D 2DEUA 3IMCA 1RXYA 3VSBA 4G8CA 1E2LA 5HOEA 2E6UX 1Z5WA 2OGUA 1DG9A 4ZVNA 3OTIA 3R3ZA 4REQB 3P71T 3QKWA 2GO1A 3T1HB 1R1DA 1I13A 1QHHA 4OMFG 1U0RA 5LLSA 1G17A 1K6JA 3UQZA 4ALLA 3IVGA 1GPAA 3ZWPA 2VJNA 4N0MA 1T9HA 1DG3A 4JLWA 1Z4MA 2QRGA 4EI7A 4F7WA 4KAXA 1Z22A 4H1HA 3ZKWA 1CRWG 3UAXA 2PG3A 3LUJA 4ENVA 5IJWA 1K66A 4ZCTA 4YDRA 4I4NA 4FR0A 5K3DA 2VDPB 3B1JA 3O2SB 2HCBA 3GGCA 4P93A 2P11A 1C0PA 4CF6A 2PH5A 4WFIA 5AXAA 1QE5A 2IH4A 4AK9A 3NHAA 4DMFA 2WTUA 4OUKX 4KAAA 2ZJ4A 3QPBA 4KG7A 5B7GA 3NHYA 1FVXA 1QIMA 4B5KA 1DC7A 3W77A 3G49A 2CF6A 5CB4A 5JYBA 1LBEA 3UAVA 4QBHA 1UJNA 4FKMA 4FXOA 3VC3A 4EZBA 2WA2A 1ATZA 3FPAA 2XECA 4RYDA 3ESXA 3P26A 4TZKA 1G98A 1FP4A 4NOLA 3H2JA 4CWAA 1HZZC 4G2TA 5AXDA 3MT0A 5IT5A 1D04A 3M9LA 1AK2A 1SUEA 5CM9C 4UC0A 4YASA 4AYXA 3G0GA 4J7AA 1GGKA 4UAJA 1SU6A 3VVBA 2DKNA 3UGTA 2IXTA 1DUIA 2YJGA 1EDBA 3DL0A 1IB0A 3O8QB 4UVGA 4CLXA 1KFKB 4ARZB 3HPRA 2HBYA 1MOQA 1Q1NA 2G07A 3EIEA 5E2IA 4EYEA 1OX4B 1P0IA 2WILA 3ASVA 3P9NA 1T2EA 4X3OA 4KKVA 4FC6A 1D6SA 1NMYA 4IKEA 4XYLA 3W5IA 3MT7A 2QGNA 3HYNA 2XUHA 2GFQA 1YDMA 3LW7A 4I50B 4Z9BA 1VKHA 1U9YA 3QFHA 3ST7A 4X41A 3BMOA 3DQZA 4GT1A 4MB0A 1KAHA 3HKDB 1KVTA 1FOEB 1M72A 3A9SA 4WLOA 4DSZA 4R05A 5BWOA 1A27A 2CLFB 1FVHA 3KZKA 3TFQA 5I3CA 4BGUA 1W47A 4WACA 4FTWA 3V8QA 1HH4A 1T1IA 3QP9A 4XFJA 4CFZA 3P9QA 4NYMR 4M8SA 4P84A 3VSAA 5FBRB 4ID9A 4QBGB 5I7VA 4J1TA 1F2TA 4WSOA 4ZZ3A 2PGXA 4F2GA 2IYXA 2MR6A 3LSYA 1CR0A 1UAAA 2QTCA 3W4IA 1BIFA 1AGXA 5IKEA 1NVVQ 2VHTA 4R2IA 3PX7A 4ZTBA 4U63A 1QBKC 1OKKA 2Y0BA 1V2GA 4RLQA 3QJ5A 2MIIA 5D2CA 1WL8A 1VCOA 2WQ6A 4PGFA 5MHTA 1E6KA 4WXRA 4NCXA 4S1TA 3O4JA 2ANBA 4B3MB 1TQ8A 5ALSA 4I2VA 5JAUA 1WB9A 3OI7A 3R0JA 1PQ4A 2KLBA 1TZCA 3OLXA 4UTVA 4HLNA 1LK5A 3HBFA 3IAAA 2VJKA 4QDOA 1TF2A 3KSZO 1DKMA 3WLAA 3NBZC 5A4MS 1DBWA 1U3DA 1Q15A 1R00A 4IZ6A 2NQ2C 1LQTA 2ROQA 5K0ZA 2BUCA 1NW3A 3AUYA 3GFSA 4PFJA 5AI9A 4CXMA 3SAJA 4CLRA 4XUGB 4J4HA 3KUDA 4YV2A 5SY6A 4C06A 3SHQA 4P4TA 3FPGA 3HNRA 4I6JA 4QNNA 4ER6A 1NNSA 5LBUA 5BQXA 3I2GA 4GD3Q 2JKZA 5BV2P 1YA8A 2YJ6A 3K94A 1EFPA 2J3QA 2UUPA 3GK3A 1ZK1A 3S4YA 2NTYC 3O31A 3TLZA 1KAQA 3IV9A 5E0KB 1NVBA 4UTXA 3NUZA 4BECA 3DJYA 5LWQA 1N6LA 4Z8XA 3GCGA 4B8WA 2V7XA 4YRLA 1D7OA 4L72A 4KPEC 4LAFA 3AJ8A 1ZVVA 4DIOA 2RGYA 4H4DA 3UQYS 1GUBA 2WWIA 3M2PA 3Q98A 5HE9A 1VZ2A 4DUGA 5K99A 1A4IA 1YZTA 3X2FA 1IN5A 5I9NA 2F48A 5LCXA 2X8JA 3GJ6A 1GV1A 1W88A 4B6JA 4RA9A 5K3SA 3T3DA 2O2GA 4RQBA 5JCOA 4WMLA 1U3GA 3E3AA 2HY7A 3CBQA 4FDLA 5FEUA 1VCNA 3E7DA 4UEOA 1LNSA 3VJKA 3B48A 3K09A 4QFDA 5AVYA 1A5AB 2FV8A 1YZQA 1QV9A 3CHYA 3GZTB 1JDNA 1TECE 3KKOA 4Q4AA 2RONA 1VSBA 2I3BA 4PLFA 1WXWA 2W7TA 3G8YA 5IVDA 4K9KA 3RV3A 3V34A 3ZHQA 3B6JA 4Q1DA 4BNLA 1YVPA 1WX1A 1Y4DE 3DKIA 1QH0A 3ADOA 1KRHA 4Z0TA 1FJ2A 5GAJA 3UKOA 2Y0DA 1Z15A 3LWBA 2V03A 3ODPA 4L74A 4UDXX 1TX4B 4F5WA 5BXYA 4NG4A 2A35A 1HTBA 4PRKA 3PUYA 4TSRA 3V1KA 2FWBA 3QUSA 5LSAA 2P9GA 1PNQA 3U4QA 2AQIA 4K6FA 2BGIA 2JLYA 2AJBA 3SQDA 4WFKA 1PS9A 3ZXSA 4CCYA 3HXKA 1ZSNA 4FJ1A 5HF9A 5F3RA 4LDJA 4PBSA 2ZB2A 1IXKA 1RCFA 1SUIA 4XUDA 5J4KA 1W46A 2B7LA 1ZJ4A 1NJFA 2PTHA 4DV7B 1LK7A 1SVIA 2Q6IA 5GGXA 1NVKA 1QOPB 2M6RA 2AG6A 1IM5A 2JHPA 1M1YA 2VNSA 4KB5A 5EXEA 5I4KA 2O8FB 4HKTA 2RBKA 1PWYE 4FHZA 1OI3A 2YNMA 4BQPA 1GKUB 4C0LA 2VYVD 1CR1A 3EMVA 4LVNA 1NPYA 1X80B 3BIXA 1SEVA 3QVUA 4KQGA 4ZVKA 4XYGA 4EM6A 2FWMX 4Q9KA 1S02A 3K0CC 4URZR 1Z47A 3MTQA 1CY8A 4PS0A 5HZMA 3D8BA 1TZBA 1S3SA 1LLDA 3HV2A 4OAQA 2QTFA 4HDKA 2Q45A 1H3NA 2IELA 3P0FA 1COWA 2W8ZA 3RBVA 4MDFA 2WDZA 2FPOA 1KDPA 3WGZA 2XVYA 2HW8A 1V8BA 2H1HA 3KQPA 1LC0A 3VU9A 1CFZA 1SCBA 2R7KA 2ZTUA 3O4IA 1WP9A 2O4UX 2YWCA 4PC3A 1UBKS 3FH0A 3S5UA 3RS2A 1PK9A 1C1DA 4CU2A 3B6ZA 3R5HA 5KYKA 4QECA 1YAHA 1B14A 3FYCA 4PZUA 1AUXA 2GRUA 4U9UA 1ZAKA 4AY2A 1CEEA 2B3DA 3USES 4YT8A 1NR1A 3DBIA 2Y9PB 2A84A 3SZ3A 4KTTE 2IP4A 1GNTA 3DEKA 1LF0A 4YS6A 4JI4B 1T3SA 4HPJB 3RIYA 3TECE 4TMXA 4F5ZA 3U7HB 2ZYSA 1HSOA 1WW2A 3K0HA 5J5AA 4K26A 4XD2A 2GERA 1E7YA 1L7AA 2JFNA 3DB1A 4NXNB 2L18A 3GN2A 4UUPA 2O52A 2HA5A 3FIJA 4ZCPA 5ALUA 3K9HA 4LNUB 2OWEA 4IG9A 1SD1A 4LXXA 4R84A 4U5QA 3UM9A 4NV3A 2Q41A 1G9SA 3EJWA 5JAZA 4AO8A 1IQRA 1J25A 8MHTA 3NWJA 1XJ5A 1Y34E 5F2EA 4MUJA 2XPCA 1KKMA 1L5WA 3RAJA 4GQIA 1XTTA 4KH1A 3PGXA 3QVKA 2I3ZA 3GLHA 4FI3F 3V9PA 2VRCD 1HGXA 2ILTA 3KR9A 2C5BA 3OPYA 4OKSA 3S2ZA 4AMUA 4BX3A 1G6OA 1U2DA 4B6GA 2ZAGA 2G09A 3FAZA 4D99A 2R00A 3GLHE 1QWSA 1JG1A 1D5WA 1J2YA 1U2QA 2EHJA 4I1SA 2J31A 2XKBA 3G8CA 3LYAA 3MWEB 2RFLA 3NNDA 4YCDA 5TEVA 4BEJA 4C3VA 4UHKA 2RHBA 1U1DA 4ZAYA 1JV2B 4YLGA 2QUIA 3I9JA 2A7QA 3K72B 4DABA 1RXVA 3C3WA 4EELA 5JWRA 2NVWA 1CRPA 1VSTA 1IK4A 2BMJA 3OMXA 2A9QA 1ODKA 2KQUA 2PLAA 1Q0HA 2QD4A 2OAQ1 1RFLA 4O3FA 4QX6A 3IMEA 5B58T 3EVGA 1IOLA 2DUWA 2EJTA 2JAQA 1W2GA 5U4QA 4AZSA 2CVZA 1L7VC 1CXZA 3L5KA 1BOFA 4DSAA 3HZZA 3BYZA 4RESA 4V0QA 1ZGBA 3QPVA 3NHBA 2RHDA 1T1JA 1KC3A 1FFHA 1NKTA 4IR7A 4YH1A 4ALJA 4KI0A 2JFHA 3QOYA 4WY5A 2J0SA 2RARA 3LBAA 1VKJA 3HA2A 2L69A 3E2PA 3C1TA 3K35A 3RADC 1VG8A 4B3XA 4Y6LA 2VNKA 3K9BA 2R48A 2A86A 4N3GA 1W5AA 3VR1A 4F8YA 1HNXB 1W5EA 4LMPA 1RVV1 3W5UA 3LOQA 4YO8A 4O4IA 1RVDA 3BHMA 5AJWA 4G0UA 3IXLA 3NLLA 2CEKA 1P9OA 2VTEA 2DSNA 3RRZA 4I5GA 4AUNA 1MB0A 3DV0B 1IATA 2PRKA 1UJ2A 2V7TA 2EARA 1H4SA 1TM5E 2EFGA 4BO5A 5DWVA 3W5BA 2VWPA 4POAA 2O2DA 2WJVA 5LD2B 1ZN7A 2ZUUA 5JV5A 1QVVA 3HU3A 2P3OA 2GXUA 2C2GA 1G6KA 3EGIA 4KO8A 4PRYA 7YASA 4PWYA 3GR6A 3EEBA 2AXQA 3PR1A 4PR0A 1JI3A 2CMHA 4GICA 1DEHA 3GQVA 4Z99A 2QS9A 3RTBA 3W9UA 4Z53A 1FSSA 2DJ5A 3JQEA 2WR8A 4N40A 5HTKA 2VLIA 4N41A 2UV8A 3IRUA 3L6EA 4GNRA 1TYEB 4BKQA 5AW2A 1HK7A 4DV2B 1K8RA 2W2NA 1JBKA 3N6XA 3SDBA 4PYIA 4RPCA 3DZDA 3WKCA 1B6TA 1YKFA 4E11A 5L7TA 4MV7A 2IPXA 4NBRA 3URMA 3FKQA 4EARA 1BKSB 1TJ3A 2EERA 2RHMA 3GJ5A 3IR5A 2GNPA 5LXTF 2AOUA 4F45A 1JMVA 5LBIA 1R0BA 5F3DA 3L9WA 1C29B 1P7ZA 2OCLA 3OM8A 3R74A 1OH8A 2OHHA 3SQXA 1TB4A 3ORRA 4QYSA 1KEKA 2J6HA 4IY1A 1ZJ5A 5L45A 4BFUA 4AF8A 1HDIA 2JCXA 4L8WB 1Z6XA 4AS1A 4DM3A 4ENWA 4AU1A 1GCGA 1ISMA 2WC1A 4O08A 2D5IA 4P8RA 4Y67A 1KO1A 3VDXA 3WVNA 4BO7A 4D1YA 3B20A 5GQSA 3CH5A 1OZGA 1FXUA 1RKXA 4A4DA 5LXTB 1A4UA 5DSTA 4C29A 1XYYA 2B1GA 3IMKA 3IPYA 4G8DA 1B43A 5MF6A 3KKMA 4N3BA 1AK9A 1Q14A 5G53C 1IBKB 4BBPA 4YP5A 5IM4F 4G1VA 1A9RA 5HJEA 4EDFA 1O4WA 1NUUA 2FEWB 3AW8A 4CEJB 2AJLI 3MJVA 2BDUA 1R5OA 2B1IA 5M2QA 4K0RA 4NX2A 4M7WA 1D09A 4ZRNA 3SKVA 2BFNA 2XNHA 4N54A 1YQWA 1ELOA 1TYZA 1WD7A 3CEMA 3GJZA 1PFKA 4XKJA 4BU1A 5C18A 5J2TF 4D43A 3R77A 2QN7A 4JMLA 4HAYA 4BGEA 4BGVA 5KSYA 4M83A 2P4QA 2BUAA 4L07A 5CEEA 3OZRA 4MUAA 4LE2A 3NKFA 5JJIA 1YQEA 2W6ID 4UM9D 2Q9BA 1MV8A 3QY9A 4PBRA 3IFSA 1W2WB 4HDNA 1FJGB 2VJOA 4FBGA 5HSGA 2WKWA 4HB0A 2XOKA 2JW5A 5FUYA 5EP3A 3EG9B 2OGZA 2VHZA 4DDHA 3VDNB 1YL6A 3VA7A 2CXNA 5DXAA 3U4GA 1P0QA 1TCBA 1UM9B 1Z0IA 2AKAB 2C59A 5D7NA 4PG6A 3W4JA 1V4VA 4XYEA 2I6UA 1JA0A 3JD0A 1HFWA 3EMDA 3MBOA 1ILEA 2HQBA 3NOXA 3A4LA 4YK7A 2GVZC 5JISA 1RYDA 3TZQA 4J1QA 3TSAA 2QN3A 3WADA 4QRHA 2YHIB 3GDFA 4N6OA 1U63A 3AU9A 2IYPA 2JZCA 4G0XA 4HLDA 4OEHA 4PCAA 5LR6A 4BO1A 1RAGA 3TW0A 1JFFB 2ALJA 2J67A 2JFUA 3AR2A 3ILXA 4MHSA 2A0KA 4E22A 5JFOA 5JAHA 3T3IA 1E1RA 1NFQA 1UIMA 3KZCA 4ZRDA 3SHFA 2VNIA 4NDAA 4XGRA 1OFUA 5LQUA 4CKBB 1W7AA 3QW2A 1QV7A 1M2OB 4Q00A 3HC7A 1NSFA 3R1IA 6ADHA 3JYPA 3M1LA 2NO1A 4NY1A 4R1LA 1XYVA 2PH1A 3K71B 4FN5A 1EI9A 1MEJA 4JLKA 4AMBA 3DV9A 3LE8A 1UAYA 3N39C 2R0QC 1GG2A 3TR5A 1UEIA 4F6CA 1GR1A 3RLFA 2HD4A 4E1BA 2X5KO 4LZWA 3R0QA 1YK1A 3OT5A 3A1WA 4C3UA 3K73O 3ROQA 1Z5PA 3B1VA 4L3VA 5CFPA 5BR4A 3A9UA 1SHKA 2BCJQ 3PHIA 1O6CA 1P4GA 3D7LA 3SC3A 2RKWA 5G3YA 1XLWA 2WOOA 2Q7DA 3ZGXA 4KZPA 3O4FA 1NN1A 3L77A 3WLOA 2DZDA 2I8AA 2WF6A 1SK9A 3H5VA 4X5OA 3WK7A 4AQ7A 4B3SB 2ZRPA 1Z73A 1M6WA 1ZEJA 1LZLA 1LSOA 2X40A 3JQRA 3LXMA 4BVGA 5FLEX 3TAUA 4HEA1 5HWSA 3DBOB 2UYOA 4D56A 5C8VA 1P8JA 2PVPA 1J22A 1NPTO 4L0QA 3T9EA 4D3YA 1WB5A 2OORC 5LOVA 3OFVA 1YCFA 2B8WA 1N2SA 4MQ6A 5CCBA 1JDPA 2NT3A 3Q7EA 1ZNXA 2WWXA 3EPLA 2CHFA 1BMQA 1L4UA 3CW2A 4O25A 2C4MA 2FX2A 3EVEA 3CG4A 3UMFA 2BM0A 1GP2A 3MRXA 1E1LA 2PXXA 2UUCB 1KSHA 1EBUA 4I9HA 3IOEA 5IK2D 2WJYA 2H4FA 2GI4A 3L84A 2PPLA 1ZW1A 1H4QA 4FDVA 1YIDA 4WN9B 4PZLA 3ZE7A 4P81A 4TXJA 4F06A 2D2XA 4KITB 2VWHA 1GZSA 3WBJA 5ADWA 3ECAA 4MQUA 4F5EA 4TX1A 5EZ6B 1JR2A 4PO3X 2JA1A 3OTGA 4JP5A 3OHPA 3LO5A 1XMJA 2NUPA 3Q8KA 3GJ4A 3QHPA 1ID1A 3CNEA 4NCKA 4EOGA 5CW1A 1JIJA 3REQA 3WL8A 1BE0A 3JRNA 1G8JA 5DX8A 5KOHA 4D02A 2GWRA 4GPEA 4JC0A 2ZUFA 3Q3HA 2W37A 3ZWKA 2YJZA 4CM3A 2QE6A 3HVIA 4WBSA 3E8MA 4ROSA 3OH8A 4GYYA 3EOZA 3BGWA 4X20A 1QYVA 4WCFA 2XODA 3B9BA 3DT6A 4JFAA 4L2IB 1G8PA 5CA1F 1S3GA 4UXHA 4ARAA 2P9JA 4GYKA 3I62A 4BB9A 1Y98A 3IH5A 3JRXA 3AK4A 5BQPA 1ESCA 3X2SA 4HX9A 3ZZUA 4Z4GA 1BROA 3RNOA 4JUFA 2FJ0A 1EGMB 3E1GA 1N1GA 3I32A 4IVPA 4QUBA 2HDWA 2KE5A 3CTMA 2O3SA 5H82A 1AQJA 4DQLA 1FUIA 1NVGA 4NBVA 1Q6ZA 4YCNA 4IIUA 3B82A 1LH0A 1SVNA 2KJQA 3UT5A 1C5KA 3B78A 4ZVQA 2XBMA 3T3OA 2XRMA 2XOXA 4HYTA 4QDTA 4G41A 1V45E 1Y3FE 1E9DA 3C8DA 1KI3A 1BJKA 3AQIA 2YW2A 2GILA 4O4JB 1C8LA 4OJQA 1ZH8A 3EXG2 4BNUA 1GU7A 1PT7A 4KLZA 5L6MB 4X7PA 3SC6A 1N4DA 2YIJA 1YS6A 1A98A 2YV5A 1DS6A 1LNZA 3AB7A 4GI1A 4LRUA 4ZQGA 5AVJA 1E2EA 2OCXA 4KGVA 2O2EA 3RLIA 2AFIE 4JCCA 5JADA 4ZXFA 5AW9A 3N70A 2IPOA 1XNJA 3RJZA 1P5FA 3M83A 3A31A 5BYKA 4TYQA 3ZUPA 3D3KA 1NBOA 2EF1A 3R4CA 1Z7EA 4JXJA 2Y1XA 5H9WA 5IFKA 3LBHA 2FR1A 3ILSA 3LTEA 5JJBA 1WIWA 1I6MA 3VNVA 2A3NA 2HCRA 3H5WA 1XQWA 2VA9A 5IH7A 1BDJA 5ALVA 4YT4A 1MENA 3FTCA 2VH1A 2X3YA 1BH2A 2H1WA 2YXLA 4IQ4A 4KPUB 2AHRA 4RK0A 4IMIB 1XZKA 1C3VA 3OT1A 4X44A 3UXMA 4RF4A 1ISPA 1J2RA 4PY2A 3RVJA 4A0HA 3KIPA 3EQ7A 1FFDA 2FSVA 2ZWIA 3KLMX 3OF3A 2QW1A 3W2FA 1Z7BA 5IAKA 5HW0A 4CM5A 1MIOA 1XKLA 3B12A 5JAQA 5C4GB 2HJWA 3GH3A 2EFCB 3AR7A 3DPSA 5LP6F 1B8NA 2RIRA 2XT0A 3C97A 3EGCA 5C1BA 3BTSA 4ILKA 3G2LA 4WNYA 1K5DA 4DDWA 3AZOA 3WL6A 2A78A 5A3VA 1QP0A 3TI7A 3BF7A 3IP7A 2WG1A 1XRMA 4BCDA 5BOSA 3HRHA 4RIGA 2JHGA 1V3QE 2WRZA 3MTAA 4U2FA 1G38A 2F7SA 4IWXA 3COSA 1PR1A 1NL3A 1G0NA 4KQCA 1TD9A 1E1QA 3C6YA 3T4EA 4DV1B 4GUAA 1PG0A 3F0TA 1JZQA 4K7JA 1FX0A 2WF9A 1PWZA 1CJUC 3QQ5A 2A9OA 2ZVQX 2VH2A 3SF0A 1AA6A 2AQKA 2WAYA 3QNUA 3H42B 3GLVA 4UREA 1IHDA 3O2NA 2FZCA 4YAFA 5JYDA 1QHYA 1S7CA 1EUYA 1D2HA 3BD6A 1CJKC 1SG6A 2YZ7A 3OOWA 1ADCA 1YIOA 3DHYA 3FWNA 4OHRA 4R81A 5EJ7A 1YA4A 5JS7A 2WFLB 4CKZA 1KJYA 3PLRA 3EAFA 3F4KA 4KGXA 3RUHA 2HRCA 1AK1A 2Q6LA 4N8DA 1ABBA 2F8SA 1L4YA 3DT9A 4M46A 4G9BA 4TKUB 3V8EA 2DKOA 1GZVA 2BFMA 2JH8A 1M2KA 1TO2E 2Q99A 3MGGA 4ZDJA 2DGDA 1UJBA 1FXWA 3KJFA 1X7ZB 3WWOA 1XAHA 5B7PA 4Z49A 2R2AA 3KSAC 2XXAB 3OECA 1V9LA 1DWOA 5E7MA 4EY6A 5E1DA 2GBFA 4UNQA 2ORWA 3DOHA 2PZLA 3MB5A 4W82A 5LP6A 2OV4A 1KOGA 1DUVG 2H5IA 4X1YB 4OVKA 4PXYA 4D0LB 3VYRB 1GTSA 5JFGA 5IZCC 2GHQA 4C6RA 3F5MA 1GADO 3TQFA 3L8GA 1EJ0A 3DL4A 1ITZA 1JQDA 1IRIA 2IZ1A 2WIJA 3D7RA 3KTOA 1WNFA 3FAKA 4M1WA 5JEEA 2XA9A 3HR7A 2YIDA 1J99A 2ONZA 4MPDA 1QHIA 3FRHA 4K6KA 4YAOA 3G9UA 1JH8A 1SUCA 1PZMA 1TNDA 1WULS 2A0WA 4IQGA 2XVAA 4G4SO 2ZSHA 1R0RE 1EYZA 4INZA 3AF4A 5BWLA 2IHTA 3HLYA 3EULA 5DLYA 3JQ9A 5GJVC 3PA8A 3ZWWA 1VXRA 3RTDA 1TLLA 2YFYA 2JHAA 1X38A 1S5PA 2F62A 3RVNA 4NPCA 3GJ3A 4YRQA 4AN4A 4BO4A 4YN3A 1OWPA 2I7TA 4JT4A 3AY7A 2MOKA 1R4MA 1UF9A 4LG1A 4US1R 3WLRA 5DYYA 2O06A 2JI7A 2W8BB 4EHFA 2QXTA 2ES4A 1CUVA 4LDQA 4X7BA 4HK4A 1E2UA 3IPRA 3BHNA 2BKUA 2N3ZA 2WM2A 2XNSA 1JJAA 5DNVA 3VKHA 3RQSA 5HCNA 5DFAA 5C4MA 2ZQZA 5BRJA 1KSGA 3VGPA 1SKQA 2QM8A 3GRFA 4K6GA 4UE2A 4DC1A 3LDFA 5HDBB 4M86A 1BYIA 5A3QA 3B89A 2BGKA 5FI1B 3UJ9A 5JR3A 3PQ7A 2YV3A 4N03A 2ZANA 1IBRA 2F4NA 1DDIA 3OIWA 2PIDA 4AD8A 3NTQA 1JJFA 1KKUA 1V41E 3DOUA 3M6FA 5JSYA 5LMUB 4KREA 4UTZA 3ZEIA 2FKAA 3FNBA 3A9TA 1AURA 5KTYA 1THTA 1ZOIA 2LDXA 1HYGA 1H0HA 1MQ9A 1AE1A 3U7GA 3THWB 4DBVO 4PN3A 3Q0IA 3L7NA 1ECBA 2HFJA 1LRLA 4G1UC 4E88A 3S6JA 4U2KA 4RPGA 2OCBA 5IK2A 1JEEA 2D1QA 1JB1A 4JL6A 1K3FA 4KPUA 4Q7KA 3L92A 1KH3A 3FFXA 4FQ8A 5FA5A 4AJ9A 4D82A 4Z4HA 1YS4A 3FUUA 4BASA 5AVQA 4A0GA 1D2MA 4J4TA 4B7UA 4X24A 1RNLA 3GAZA 3LT2A 1L5NA 2HR1A 1JH9A 1QNLA 3OFNA 4QO7A 1A4RA 4JVMA 4BKPA 1V9SA 5C7YA 3EPPA 2ATCA 4MP8A 1I30A 1GL7A 1T8SA 1ENPA 1U9IC 3B7PA 3HYRA 1PQUA 4K9PA 1ESMA 3HFJA 2ZRNA 4LZLA 2VJPA 4MS4B 4TWZA 3V4VB 1YQUA 5M34A 5L7YA 3KFLA 1Q95A 3IOMA 3CIFA 4KP7A 2QD1A 3GQBB 3EPRA 3HACA 4U6QA 3ZWXA 2IH2A 4IXMA 1SHLA 2WSLA 3JQ6A 4FFVA 1O87A 1HRKA 1R0ZA 4LJLA 3EG5A 3EVAA 1QXSA 4X7RA 4C30A 1RPTA 4PLCA 4ZHQA 1PR5A 4J2OA 4MJLA 4YRCA 1RC0A 1F38A 4YPOA 2XRFA 4INOA 4JAVC 3AR3A 3W7VA 4XUEA 1KY2A 1L1RA 3WIDA 4O0LA 2EX1A 3RTEA 3EGVA 5LOVF 4DYVA 4Q4HB 4LYYA 3N0VA 3WXBA 4D9NA 5C37A 2WJIA 2ZM5A 3T3HA 3WE7A 2RKBA 5F2OA 1U31A 5KDOA 1CJTC 1LLCA 1U5AA 3IAS1 3K4PA 3RANA 4DIEA 4W5RA 2EDCA 4R2JA 1NUTA 7MHTA 1HE5A 4FX5A 2ERYA 3IXQA 1N2EA 1VFNA 5BSTA 3OY7A 2HHHB 2WD7B 3RC8A 1XTSA 4KWTA 1HDGO 2NTEA 4G26A 5FWYB 4HNVA 4JVSB 3LQ1A 1Q6YA 1ZIOA 1EXWA 2AFIB 1INLA 2JKYA 3R0VA 2AX4A 1W0KD 2BEVA 1XRLA 3BMNA 2QMYA 4A36A 4JHXA 5CM8B 4QTYA 5KVSA 1E99A 4FNGA 4M38A 4FWIB 2AOTA 2GCGA 1HLPA 1RQGA 3ZBUA 4AJKA 4PLVA 3AUTA 1FU7A 4I08A 4JU8A 4ZPJA 4EG1A 2W42A 5CRIA 2JEZA 1OZFA 3DDCA 5HQ3A 2PRJA 4KDFA 2RH9B 2ZAOA 5KYUB 2Z0MA 2QRMA 5GV7A 5LLTA 3J7AC 2ORED 5IABA 1BEUB 1KDTA 5E38A 1N5OX 3I4LA 4D4IA 2QZJA 3QA9A 3H1PA 4NZOA 3ETGA 1G5HA 1RYMA 3DE2X 1WSAA 4GR5A 2QAGB 3ZGOA 5MDHA 3W6OA 2FGJA 4YONB 2V7PA 1CJVC 1H0RA 2AQHA 3ND5A 2IXFA 3DOEA 3I01A 4XWGA 1NPDA 5J9FA 3WG9A 2FUEA 5U4XA 3C0KA 1WXGA 3CLTD 3BQNB 1NBIA 2OHJA 4UPVA 2OBXA 3GRPA 3AZPA 3QX9A 5EIXA 2WF7A 4WOCA 3H3FA 2PUFA 1E3IA 3AFOA 2HLPA 4MUNA 4OA8A 4PZAA 4KR7A 4XQ9A 2WLSA 3VKGA 5BRAA 1DC4A 2EBWA 2B8NA 3MINA 3OZSA 3RJMA 3UHAA 3JD3A 1NAIA 5CG1A 2XEDA 2O48X 4D80A 2Q1TA 4RHUA 2FPPA