2AK3A

The three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
GASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETSVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE ISOENZYME-3
publication title The refined structure of the complex between adenylate kinase from beef heart mitochondrial matrix and its substrate AMP at 1.85 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase (phosphotransferase)
total genus 70
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 1995-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak3A00
4HZUB 4NCJA 4XVRA 2DFLA 4KYUA 2D7DA 1DPFA 2F9LA 2IF0A 1E2FA 1I2MA 3C8UA 2WV9A 1PV4A 2NQ2C 3QKRB 4QHSA 3W6OA 3E5HA 5CDFA 2WJVA 4GSYA 2G0NA 4HAWA 4Q7KA 1HTWA 4YDSA 3NEYA 3W8RA 2J41A 1U2RA 3TQCA 1N6PA 4P0TA 1FL9A 3DMDA 4Q9IA 4FMBB 5F2EA 3LO5A 1GG2A 2P67A 4OQXA 1Z08A 3VR3A 4LBZA 3SJBA 4OHYA 1V5WA 3IHWA 4HZUA 2QM7A 2L0XA 1YR7A 1HQYE 4KFSA 4FW9A 3KJHA 1E32A 3D31A 4OI1A 3U7EB 3U3OA 2WJIA 3VX3A 1X6VA 1UDXA 4UNRA 1SVWA 1ANKA 1XTRA 3FGNA 4C4PA 1W5SA 3NBYC 1AQUA 2AXNA 1SVKA 4DXAA 3GCGA 4RZUA 1AM4D 2C77A 1S2MA 1R8SA 1GRNA 3GFTA 4NMMA 1P4SA 4JLAA 1R2QA 3ECCA 2AWNA 5DYIA 1Q3TA 3MWLA 1UKYA 4HLCA 4DSTA 1GOTA 3I32A 3HPRA 3NXSA 1TQ2A 4CYMA 1Z6AA 1JR3A 2IXFA 4PC7A 1PUJA 5C2JB 4NYIR 2OFOA 1Z2CA 1KK2A 3BGWA 4I4LA 1BMFD 4XSHA 1TEXA 3MGCA 3R9XA 3EA0A 2R6GA 3RNLA 2HLDA 3ZS8A 4URVR 3W5IA 3ZH9B 2QTHA 3PUYA 1XDBA 3M0EA 4TQAA 4B3BA 3KXLA 4Q7MB 2HV8A 1P7CA 4HUQB 4JVMA 2GAOA 1MRSA 3PENA 2CDNA 3FE2A 3Q7QA 2GZHA 3TAHA 2Q9AA 4GOKA 4QGGA 3UKDA 5CYOA 5J47A 4LPSA 1Z83A 1ZYUA 3SBEA 1KO1A 5KDDA 5H8WA 1WRBA 4TYWA 4Q4AB 1JB1A 2OUKA 4F4JA 2QQEA 1CIPA 4B33A 1Z8FA 4Q03A 3A4NA 3HR8A 4AG6A 3DKPA 1RPZA 4FD2A 1P9WA 4LJ9A 1NKSA 2ZS9A 3QIAA 2W2TA 1IN5A 2AFIE 2ZSBA 5EUQB 5HZKA 4LYFA 1JQJC 1EFRA 1NSFA 3BERA 3QSYA 3EPLA 2ZYVX 1XTKA 4M0LA 3CRMA 3FKQA 2JLRA 3T12A 1IJFA 2QPAA 3IILA 5JJIA 4Q4AA 4WW0A 2GCNA 2X2EA 2PT7A 4BFWA 4G01B 1U94A 4PPNA 5DE3A 2JA1A 4Q5IA 4Q1CA 5IDVA 621PA 3AVWA 1OV4A 4QG7A 5E3HA 2W6JA 1C1YA 3ZLJA 1MV5A 3SEAA 2JJ2D 4PSVA 3AKYA 5IT5A 2HYIC 2VP9A 3B85A 1N6NA 1CR0A 4QGAA 5SZHB 2WWXA 3SYLA 4OQMA 4LDJA 3UIEA 3A1TA 3ADBA 4GL2A 3MWYW 2RB4A 2ZETA 3T5DA 2J0SA 1OXXK 4GBMA 1D5CA 4GZMA 2JLQA 3GJXC 1NVVQ 4HLUC 4PZLA 4P31A 5L3SB 1XJCA 521PA 5HKKD 5FI1B 4KSBA 3W6PA 1AJEA 4E5UA 3NH9A 2AL7A 4H1UA 2R6AA 2R9VA 5KNDA 2GCOB 5DYGA 1KTVA 1M2OB 4IVQA 1YZKA 4II7A 2IWRA 2RGNC 2CJWB 3O8CA 1RZ3A 4Q9HA 2F1RA 4TT3D 4WOPA 5EJEA 3C15C 3A4LA 3V00A 3ZS9A 2GKSA 2R44A 4NYMQ 3VR4A 1KO7A 4LHXA 3CZPA 3V4FA 3OFND 2PL3A 1GNPA 4QKQA 3DEFA 4XIGS 3OEED 3TVDA 1LV7A 2GRJA 3HU3A 3Q9LA 3W3AA 3VHXA 1XD8A 5AJYA 1WBDA 3LXXA 1HH4A 5EE9A 3K0CA 4IOMA 4JS0A 4D0LB 2G9NA 1SKQA 2GCOA 3P20A 4I99A 1Q1BA 2WKPA 1KMHB 2RHDA 2CJWA 1RE0A 1YE8A 4DDWA 2PX0A 1XCGB 3KDSE 2WHXA 3OESA 2NO9A 1KO5A 5H68A 4HDOB 1JBKA 1E2MA 3IBYA 1E2QA 3ND8A 4IDQA 5E7MA 2FF7A 2ZYTX 1E1RD 1KNXA 1NVUQ 4NYJQ 5LB2A 2IEZA 2A5FA 2QMEA 1DVRA 5J4HA 4PC2A 1FW6A 4BFSA 2WWHA 1T0HB 5UKDA 1KMHA 4A9AA 2P5SA 1IXSB 2KJQA 3B1WA 3BWDD 1T5LA 4EQ6B 4C0LA 3FDIA 1S9DA 3L0OA 3AP1A 3ZQ6A 5B58C 2V8OA 2JLUA 3QG1A 1TUIA 4TTQA 1NJGA 4C0JA 4PAQA 2GA8A 5EZ5A 3C7KA 3U7GA 3OEHA 2DB3A 2JJ1D 2IXEA 4N3NA 4EKDA 1LW7A 4IFEA 1G21E 3T1VA 1FTNA 3RS5A 5EQTA 4DWJA 4PSKA 3SZRA 1GVNB 3R9WA 4EFLA 1KZGB 3X1XA 4EQ6A 1Y3AA 3AB3A 4DJTA 4Z51A 5A5GA 4R98A 2ZJYA 4L9WA 2FNAA 2C96A 4Q1EA 3D6TB 2IYUA 3OHMA 5HCIA 2V3CC 4PSAA 4ASUA 4B32A 2IHBA 4AKEA 4KVAA 4BFZA 4CZ2A 3QNUA 3TLXA 4PR0A 1II0A 3K09C 8OHMA 4PHTA 4LI0A 4Q66C 2I1VB 4JLBA 5C1BA 5JEDA 4MH0R 4TLBA 3T1QA 2ZUCA 3CB4A 5LB4A 3BB4A 1QHSA 4LV5B 1UKZA 4PHFA 1NI3A 4D26A 1AA9A 3V4RA 1UBEA 1NKTA 2SHKA 4DCNA 4EPWA 3DL0A 4MGYR 1D2MA 1TF5A 2ZJBA 3DOFA 4X8MA 5AJWA 1P3JA 3WXMA 2BWJA 1ETUA 3B1XA 1KOFA 4IVRA 1M1YE 1W46A 4IDNA 2EYQA 4BPBA 2ZSDA 4QNMA 4G5GA 2ANCA 4M1KA 3AKEA 1XMIA 4LYJA 1JJVA 4URXR 1IJEA 3QEOA 3UWKA 1YZNA 2NMVA 1R5OA 4M9ZA 4N0EA 4MYTA 2FPLA 3CRRA 3KFXA 5DO9A 2OV2A 1WCV1 1P75A 5CIQA 4BLRA 2AX4A 1YR6A 4JVSB 1VPLA 1DG1G 2W58A 1Z0JA 5JI3E 3CRQA 2DHRA 1LF5A 3ZZTA 3VKWA 1UDWA 2GBLC 2DWPA 4TL7A 5EE0A 2RCNA 3RRNA 3RC3A 1EK0A 4ZKDA 3VTKA 5JEEA 1RRGA 3W8NA 1G8PA 4W5WA 3BC1A 3CR8A 3SI7A 4LJ5A 4YMVA 2A5JA 4D0GA 1FX0B 1NLFA 1E4YA 2YOFA 1ODFA 3C41J 4U7DA 4TL6A 5JS7A 1DAIA 3U5ZB 1I4TD 1W0JA 1G5PA 1T3SA 3RWOA 1PUIA 4EAQA 2J0VA 3CWZA 2QP3A 2X8AA 1SHZA 3GEHA 1Q44A 3QENA 4N1AA 4A92A 2FJUA 2A2ZA 4QJ4A 4IDPA 3KFVA 1D2NA 2IHYA 4DSOA 4HZIA 3IIKA 4RKEA 2REOA 4NP6A 3OIUA 3TUIC 4D4LA 3TSOA 2BBTA 4P4UA 2ODWA 1RYFA 4B2LA 4F38A 1ZP6A 4C0AC 2ZRKA 4DLWA 1XZQA 1U8ZA 1DOAA 1N6HA 5BN3A 1BKDR 3QI2A 3KB1A 4MRSA 1S96A 1SXJC 2BHRA 1G3UA 4ZI2A 3WP0A 3GLIB 2FEMA 3KQLA 4M9QA 2AXPA 3KUDA 721PA 4UXHA 1P2TA 4ZDIA 2MMGA 4OQFA 4AK9A 1VG9B 3I1FA 2KB0A 3OZXA 2VA8A 5J4VA 2BEKA 3FB4A 3TKLA 5KPDA 2GCPA 1JR3D 1EXMA 1W1WA 3UG6A 5JRZA 1WB9A 1NBMD 2Q0HA 2ZAOA 3MFYA 4WXPA 3SJCA 4EPXA 4CT5A 1TF7A 3D8BA 5TDHA 1VCMA 1DEKA 2GNOA 3GLIA 1G3RA 2O8BB 4C9BA 1T8UA 1QVAA 1J99A 1QHNA 1RRFA 3GJ4A 1EWQA 2EFCB 1T4GA 4RVCA 5KHOC 4KLZA 3K9NA 2R6FA 4D6PA 2BCGY 1G20E 1VCIA 3CNLA 3QKTA 3A8TA 1WQ1R 1E98A 1N5JA 2CVFA 3IHLA 1CS4C 1GAJA 2HF9A 4JVNA 4A82A 5FTLA 2FDCA 1OLOA 1E9AA 1XMJA 2YNMA 1CR2A 4NL4H 4A6XA 4B3CA 4DVGA 3N2EA 1K6MA 4BASA 1OIXA 1X8JA 2HDNB 4LJ6A 4PAMA 3I92A 2O8BA 2RMKA 4GOJA 1HQCA 2ZIAA 1N5IA 3FMOB 1QBKC 2OAQ1 4JLMA 4N0DA 1CP2A 5FL7A 1JXMA 3W34A 5JJKA 1CJTC 4BZXA 3PXGA 1S9HA 2C78A 2GK6A 3I3SR 3EA5A 5EP4A 2P0EA 1FOEB 1EFRD 3NEJA 4G0NA 2PZEA 2VLIA 1YR9A 1VG1A 1OH6A 4BZQA 2YJTD 1X3SA 2HJVA 1RRPA 4FN5A 2ZRGA 3O8DA 2H8KA 4CDGA 2QBYB 2JATA 4OI2A 4ITRC 2H7VA 4E03A 4UNQA 2ODBA 3WHLA 1A1VA 4NPHA 2PLFA 3CPJB 2OXCA 5BYJA 3LRPA 2ZE8A 1PLJA 4YC7A 1E2HA 5CYPA 2W6JD 1GIAA 1R6BX 1KJWA 3CR7A 1QHXA 1ZBDA 4JL5A 3BH6A 4PO8A 1BYIA 1SQ5A 4IXMA 4MRPA 2QI9C 5FTKA 1HT1E 1W7AA 2J46A 4A0HA 3ZQJA 1OFHA 1XXHA 1Q21A 4Q01A 4PQYA 2OEPA 5CLLA 1KZ7B 5LPNA 1DO2A 4B75A 2G3YA 3W90A 3KQHA 2AK3A 1JR3E 5HE8A 1FMJA 1XU4A 2KI5A 2GJSA 1NBME 1J8YF 1GWNA 1Z6XA 2GEVA 4R2IA 5JWHA 5K8IA 1W36B 2A9KA 2XTNA 1XF9A 3BBPA 4AYWA 1LB1B 3OAAD 4PHHA 3AQ4A 2FSIA 4AWXA 2VP0A 2A5YB 4DCSA 4JT4A 3PJRA 4BFUA 2GEUA 3BS4A 1JQLB 2BMEA 4MYUA 2HJGA 3U6KA 1KK1A 1UAAA 1FMLA 1YKSA 2DBYA 4Q4LA 2K5UA 3CRW1 1ZC3A 2F43B 1WDTA 1KDRA 1YR8A 1P6XA 1UFQA 5AR1A 2RGDA 1NLZA 4LYHA 2FFAA 3EG5A 3K70B 1DAKA 3MWJA 4Q9JA 2GTPA 5JHGB 1JECA 1OFTA 1R0XA 1VMAA 1C9KA 3EC1A 2WTUA 4CEHB 2EVWX 5FOUA 2OCPA 2A3RA 5BWMA 2WPDA 1T9HA 1YRAA 1NVXQ 3WMEA 4JLOA 3RC8A 5G53C 5E7IA 5C46F 1AS2A 1GTVA 4F4CA 1ZC4A 3KQUA 4Q9LA 3U4QB 4BGDA 4EPRA 4D4MA 5KYKA 1L7VC 3QKSA 4DDVA 4B35A 2GBLA 2WSSD 1G4UR 5KSOA 1E2DA 1PLLA 1X8LA 1WE2A 2QPTA 3I8SA 1A82A 2IK8A 2WMNB 4NHOA 2VRWA 1NNEA 2ORVA 3LLMA 3BK7A 4H9GA 1G64A 4CEHA 2IS2A 4MUAA 1SHKA 2G88A 4LGMA 5CB8A 1A4RA 3QG5A 4FCWA 4L5BA 1ZUHA 3U3KA 3RLFA 2Z4RA 4D25A 1XBTA 1T8TA 1TUEA 2Q3HA 1KYIA 1XCMA 5FTMA 4YXWA 1RC8A 3NVAA 1TAGA 4DLXA 1T6NA 2QG6A 4EUNA 1YU9A 1GDDA 1GM5A 1U0LA 1D2EA 1KHTA 3L43A 4FCTA 3TSZA 2IYYA 1H65A 4JBXA 1OKKA 5C4GB 1R7RA 2Z83A 2KBEA 2VEDA 2YWFA 1GUAA 1L8QA 3K9LA 4B48A 2JJ8A 4LRWA 4OKSA 1SXJA 2YWGA 1Z47A 4DCVA 2ZUDA 2JLSA 2HUPA 1AQYA 4BRUA 4TYPA 3K53A 2GK7A 2ZRLA 1R0YA 2ZTSA 2XXAA 3LX8A 3THXB 4R9UC 2O0KA 3HPQA 3AVOA 4QHTA 3F8TA 2UKDA 1YRBA 5E4FA 2VHCA 2PJRA 1N0UA 2YOGA 1E94E 5F9FA 3SC3A 1W2GA 4TL8A 2BVNA 2ZI3A 3OE7D 3SHWA 4EDHA 1GRRA 4IDHA 1BYUA 3DMNA 1I2DA 1VYVA 2EYUA 2CL0X 3FKSD 1X1RA 5TVKA 5FUXA 1MO5A 2C99A 4E09A 1WXQA 1MT0A 1E9DA 1E0JA 3EPJA 1G8HA 3K0CC 3THXA 1XMSA 5FBLB 1IAQA 4QHYA 3N5CA 3AGQA 1EWRA 1OSNA 1DAHA 4JLPA 4LY6A 3B8HA 3K0EA 1ZW6A 2W0SA 4URWR 1P72A 1TX4B 2CHQA 5H1YA 3SN6A 1OB5A 4U02A 3L8ZA 4YMUA 2D2EA 1FNMA 4OHZA 3EAQA 1T3HA 3CO5A 1US8B 2N1BA 1JI0A 2Z43A 1OXVA 1CLUA 1UEIA 4OK6A 2ZSEA 1M6NA 4QL3A 5A4JA 4BEBA 2DFKB 3IPXA 2ZE6A 1P9NA 2GJAA 4PHGA 4DZZA 3THWB 2O8DB 1AK2A 3CH4B 3GLGE 4BFVA 1S1CA 3PCRB 1W5TA 1HY3A 4KU4A 3TJZA 3SBDA 4M1OA 1ZU4A 3CRVA 2YZ2A 2A78A 3FHCB 3ADKA 5CJPA 1KK3A 1MRNA 5LD2B 2TMKA 3RS0A 4F4IA 3UG7A 1SZPA 1US8A 1E9RA 3BORA 1OH7A 2G83A 2IYTA 3QXJA 4YQFA 4Q47A 2XZPA 4JKYA 1HYQA 2ZRMA 5DGXA 2OM2A 1MH1A 2OBLA 5FH9A 1Z6GA 2O8DA 2V6JA 3S1AB 2F7SA 1OIWA 5JRJA 2P2LA 1XP8A 2WZQA 3QKRA 2IEYA 2IXGA 4V02A 3W9YA 4KSCA 1NIPA 2ANBA 4RFSB 5CB6A 5IK2A 1V43A 4ABYA 2HCJB 4QBHA 4B74A 1E99A 4MRVA 4PO9A 1VDZA 3R9IA 2RHMA 3UANA 3PUZA 1A2BA 5JS8A 1N6KA 2NZ8A 1GFIA 3C4JA 3ZIAA 2GJ8A 1ZMXA 2V55B 2BCJQ 3QJYA 3WMFA 2OT3B 2FE4A 4Y0VA 2J1LA 3VU9B 3CBQA 1AS0A 3ONWA 3PIRA 4Q1FA 3S1AA 3T61A 3AVTA 3TE6A 4JT2A 5J4KA 4YDHB 1XMVA 2ZI9A 4RFSA 2ZR0A 1G41A 3PUXA 3VNVA 5FR1A 1U98A 1L2TA 1IN7A 4RD2A 2ZRIA 3Q72A 4IRUB 3TQFA 3CX8A 2G77B 4Q21A 2G0TA 5AJVB 4NH0A 2FSFA 4TSFD 2W00A 3TGPA 4GT1A 4NU0A 1SVOA 2BC9A 2WWWA 3GJ3A 3VU9A 3T1TA 1U99A 5LDDC 2P6NA 4BECA 1Z5ZA 1Q12A 2I3BA 4MYCA 4O2LA 1CJUC 5JJLA 2GEDA 3HWSA 4YLGA 2KSQA 2CHVA 3RS4A 3CX7A 4PO1A 4WA7A 4AIIA 4KITB 1DTSA 2B8TA 3TMKA 4XVUA 1ZAKA 4P4SB 221PA 1SKYB 5SZIA 3RRMA 3H86A 1EFUA 3QPWA 5FTJA 5H70A 2CE7A 3K8YA 2D3WA 3DO6A 2BMFA 2YV5A 4FMCF 2ONJA 2QL6A 2F6RA 2QT1A 2QE7D 3IDQA 2FZ4A 5FL7D 4ACAA 4DIEA 4W7SA 4PTLA 1GKYA 1G17A 2VP5A 4HUQA 3LVRE 5K8TA 3MAAC 5EP1A 3A1UA 1R0ZA 2FZLA 2VYFA 1Q1EA 4BUJA 3W5JA 4HB0A 4ON9A 4A2WA 2JLVA 2QAJA 2F1IA 2F55A 1GL6A 5ANRB 4HDQB 4IOKA 3EW9A 2XZOA 5KSPA 1UEJA 2XITA 4P4SA 2FPMA 5FFMA 4MGZR 4Q7LA 5FBQB 4RKFA 4AKIA 1FQKA 2F3TA 2XTMA 3ZZUA 4Q19A 1IBRA 1VIYA 2FA9A 4TMWA 3PVSA 1A2KC 1YHNA 2WIBA 3KKMA 3L0PA 4ZCLA 3GFOA 4CEJB 2V6IA 1HE1C 3EZ6A 2C9OA 2FSHA 2XOKD 1EFCA 3IO3A 1FTSA 2ZQ5A 3M6AA 4GDFA 1FUUA 1KKLA 2BKUA 2RGBA 4Q9KA 3GFPA 4GMDA 4LWZA 4C30A 2HXSA 2QNRA 2ATXA 4A0GA 2KE5A 4JLNA 4NCIA 2HYDA 4NBSA 3ZGXA 1VHLA 2N42A 2VO1A 4ZDKA 3WY9A 1EG7A 2ZR7A 3I73A 1HE8B 5KU1A 4KO8A 4HAUA 3DZ8A 4TLEA 5FUYA 1VHTA 4DB2A 1TL7C 4Q1DA 4A8JB 4CEJA 3EC2A 3K1JA 5D3QA 3T15A 4B3GA 1ZUIA 1TADA 4D81A 2PX3A 4AI6A 2D4HA 2G6BA 1W0KA 2C9YA 5KPJA 2ZRPA 1OHHA 2PJZA 4S35A 4TTRA 5L3SA 4QBGB 5BXQC 2J7PD 3IO5A 2CHGA 1VCOA 5SZJA 2XEXA 2IF2A 4DLUA 1E69A 3H2YA 2QENA 4A8JA 2QM8A 3QXSA 3AKCA 1QG4A 2QSZA 2ERXA 2AD1A 2C98A 2V1XA 2PT5A 4D0NA 1BH2A 4GMXA 2GHIA 2V7QD 2OCYC 4BQSA 4MYHA 1QHIA 4DC9A 3U3RA 4W5JA 1AS3A 3KKOA 4LC1A 2VP6A 5GJWC 3PEVA 4JJKA 2QMHA 5E95A 4BLTA 2DCUA 4ZI3A 2MSCB 1FFHA 2OZEA 3T1OA 4F91B 3AUXA 3RYTC 1E1QA 2BMDA 5AJZA 3LAWA 1IXRC 1UPTA 1S0UA 3WNBA 3NBXX 4X8LA 2DYKA 1T5IA 4LBYA 4TL9A 2CMKA 1II9A 1HUQA 1R10A 4OJQA 5BQ5A 4QJ3A 3SE0A 2V4ZA 4YXWD 3WHKA 1OE0A 5EXSA 3KTAB 4D80A 1RVDA 2D7CA 3R8FA 1HV8A 4MQBA 1PLKA 1XXHE 2EFDB 2NG1A 1KK0A 2ZITA 3CONA 4PFSA 2B6HA 3ZDQA 4AYTA 3TW4A 1Z28A 2AKYA 3U7HB 2ZRNA 1ZNYA 2GXAA 1M34E 1OKKD 3V9PA 3OF5A 5EXTA 4MDEA 1GZSA 1KI4A 4PANA 3AEZA 3LQRA 3K0FB 4P33A 3LNCA 1SXJD 1Z0FA 3DHWC 2GVDC 4PZYA 2P5TB 4M2LA 2ZROA 3ZD7A 3VQTA 4EFNA 3KTAA 4TQ9A 3C14C 4LV8B 4UNNA 2HT6A 4NCKA 3T5GA 3EIHA 4HB2A 3H1TA 3A1SA 1CR1A 4JLVA 1Z6YA 4HB3A 2XAUA 4I1SA 4JMPA 4TMZA 2ZR9A 3BOSA 4U5XA 3AF0A 1QHGA 2H5EA 3EARA 2BJVA 5J4YA 3K0FA 3WNCA 1Q20A 2PCJA 3GLHE 1KI2A 1ZD1A 4B43A 3DOEA 3E70C 4J0QA 3RS7A 4Q4HB 5DI9A 3GLFE 2P6UA 3PITA 2FX3A 3RHFA 5DIFA 4DB4A 4EPTA 4B2IA 2X1VA 4DKXA 1W36C 1LF0A 1ELOA 3EIEA 4QJ5A 3KL4A 2BEJA 3EZ7A 4YONB 2JIZD 2R65A 2W0MA 3ASZA 4LCBA 1NLYA 3Q85A 4XWKA 1K5DA 1I4DD 3LD9A 3IEUA 4LZZA 1E96A 3JZMA 4Z8XA 4D82A 2OLJA 1IN8A 2GZAA 1MR3F 4IEEA 2QAGB 4GP6A 1M7BA 2ZYUX 2BOVA 4DHEA 4ILEA 2IUTA 4UXIA 1T91A 4Q4HA 1ZNZA 2YOHA 3SYKA 1DE0A 5F3WB 3KKQA 2J45A 2VSOA 3IGFA 3NTUA 4Q7JB 1E9BA 1IQPA 3SQWA 3M4YA 2IWHA 4OK5A 3IEVA 3CWQA 1VYUA 3K70C 5AUOB 2QQ0A 4KVGA 1PJRA 2XSZA 1CTQA 1G7SA 4IKEA 4XVQA 2H57A 4NYIQ 2GETA 4RD6A 3NDBB 1E9FA 4NTZA 2XJ4A 4LHVA 3MSXA 5FUVA 1Z22A 2QU8A 4PQFA 3W3ZB 4X8OA 3BXZA 4LJYA 4F93B 2ZM5A 2ZRBA 5FOWA 4MDFA 5HPYB 4DLZA 3I8XA 1QRAA 4ZIRB 4C2UA 2IYQA 2ERYA 2B21A 2WJGA 2IA5A 3Q5DA 5JSZB 4MKIA 1Q3HA 3RRZA 3MRSA 4V0ME 4O0MA 4KV9A 2MSDB 2Y8EA 1FPMA 1S3GA 4IJMA 4GNKA 2FEOA 2QMOA 5G3YA 3X2SA 4PX9A 4B34A 2DFNA 1FX0A 1SXJE 2XNSA 2ZEJA 1JPNA 5KDLA 5GJVC 1CRPA 3O8RA 1UM8A 2PMDA 3A1WA 1ZIPA 2LCFA 1KKMA 2O5VA 4GI7A 3EWSA 4K46A 4KJZA 2CLCX 5FPKA 2IBMA 1Z0DA 2O8EB 3AH8A 4MKGA 1J7KA 2MSEB 3NBFA 4M1TA 3RDPA 4HATA 5TXGA 4OQLA 2JLYA 4XJXA 1B23P 4OI4A 2ZS7A 2JLXA 1OFIA 5A0FA 2B92A 4LUCA 2WWFA 5HE9A 5GVSA 1ESMA 1Q57A 2P6RA 5JLJA 1I4LD 1XX6A 2FGKA 1B0UA 2HLDD 5AUNB 3CF2A 2ATVA 3A36A 3PUVA 4C0QC 4HDCA 2LKDA 4BWYA 3BFXA 3LW7A 3C5HA 2HCBA 5KSZA 1E2KA 3NBZC 2C8VA 4BEJA 4X8HA 1T3LA 4LJ8A 4MGKR 4DDUA 1GKUB 4B47A 6Q21A 1MO4A 1GKIA 5BN5A 4US0R 2CEAA 1TEVA 3F0TA 2ZRFA 2J3EA 4M21A 2EW1A 1M7GA 2QP4A 1OXSC 2QRNA 3A37A 5JFGA 5CDFE 5K8LA 2CXXA 3DVLA 2RAPA 3KXKA 2HT1A 3RRYA 4LHYA 3FOZA 4TYYA 2BM1A 3DM5A 2P3SA 3WMGA 3SQXA 1RFLA 2LKCA 3UPUA 1G7CA 4LYAA 2QORA 3NG1A 2CCGA 3LBIA 1SVMA 3A58B 1IY0A 4HAZA 3SJAA 1G3MA 3MD0A 1NJFA 5CITA 4US1R 3TUJC 1XRJA 4PC3A 1CU1A 3MWKA 5LBIA 4BRWA 1DAFA 5CIWA 1ZVQA 4URUR 3QF4B 5FPYA 3TAUA 5F98A 3ZD6A 4KAXA 4LK2A 4YMTA 4JLKA 4RZ3A 2C95A 3KQKA 1ONBA 1ZD9A 1ZM7A 1XD2B 2WOJA 4UQOA 1FQJA 4D4KA 2JCSA 3GEEA 3GJ0A 2J9RA 2QROA 4HI0E 4A0FA 1CBUA 1UADA 1W48A 2PLRA 4MITA 4BLPA 5LD2C 1QG2A 3VNUA 4LX0A 2LWIA 2ZI7A 1KSFX 3BJIC 4A0RA 2QBYA 3CH5A 4FMCB 2JLZA 4A36A 3SR0A 1X1SA 1N5LA 3QF4A 3BFVA 4GOXA 1CEEA 2VIIA 1ZD8A 2D62A 2I4IA 4M22A 4TZ0A 3SNHA 1N0WA 3AVPA 1XD2A 4JZKA 1YVDA 3EX7C 4C3ZA 1G3IA 5FI0B 4W9MC 5DN6A 4KBFA 4XTRA 1YZTA 5CLQA 3X1ZA 4DCUA 4QC2A 1KDTA 1XTQA 5EP3A 4LJAA 2QGNA 5FOXA 3WBKA 3BB3A 1NN0A 3MLEA 1F60A 2GWHA 3HU1A 1OHHD 3NHAA 1LS1A 5HKKA 1IONA 3F3YA 4HAYA 2Q9BA 3AP2A 4QNRA 1XZPA 3C5CA 1W4AA 2IYWA 3BB1A 1N6LA 3AF3A 1CF4A 4DSUA 2EQBA 3RS2A 4CF7A 2ZRHA 3QPUA 5KUTA 3WP1B 2WJJA 3IQXA 3LDAA 3H0KA 2IS6A 3THYB 3BAFA 2OILA 3U7FB 3RSLA 4LBWA 2OLKA 1WMSA 3AVQA 3X1WA 4V0LA 3K0SA 1KSHA 1DELA 2VQSA 4FXPA 1ESNA 1P60A 2CK3A 2VBCA 2NPIA 2FFQA 4JYCA 3I4LA 4NKRA 1CJVC 2F43A 4V0NA 2YWHA 4XWOA 2IW3A 1E79A 3SOPA 5P21A 2J7KA 4DIDA 1YJ5A 2P65A 1UF9A 1E1QD 1LNZA 1ZIOA 2E1RA 4ZV4A 3P27A 4WZBE 4PPGA 1KAGA 1NN1A 4V0KA 4ZKEA 2JASA 3TK1A 3QVUA 2XGJA 1G9XA 1KI3A 3OEHD 1NVVR 1E1RA 1TQDA 1ZM3A 3NH6A 3CF0A 1M7HA 1EFTA 3AKDA 3U4QA 1ZUNB 4IXNA 2YWEA 3PR1A 2WJYA 2FH5B 2IC5A 2ZVPX 1R0WA 4OJKA 1P2UA 2C03A 5EXPA 2IUUA 2O0HA 2AN9A 2IYZA 3BH0A 3P32A 4GRAA 1Z06A 4OQNA 4Q18A 4A2QA 5L3QB 1XPUA 2QT0A 4PPQA 2NO1A 2YYZA 3CZQA 2W83A 1LTQA 1Z2AA 2H16A 4B76A 4RCZA 4ASUD 2D06A 2ZANA 3KUCA 4LHWA 3X1DA 2OE2A 3ZVRA 4OHVA 5FUWA 1KI6B 2CBZA 3EZFA 3KJIA 1P2VA 3MUFA 3N2IA 3QXCA 3QF7A 4AG5A 4AD8A 2Z4SA 2ORWA 1A5TA 1IY1A 1TQ6A 2YINC 1LVGA 2GAAA 4Z8YA 3SFVA 3BD9A 4KCGA 5L3QA 1RIFA 1Z3IX 1G8FA 2X2FA 3IQWA 1NN3A 3ADDA 2QZ4A 2WAYA 2BV3A 1G18A 1VTKA 1G3QA 1GL7A 3I61A 1BIFA 3NKVA 3Q8XB 1S3SA 2KWIA 1W4RA 5FBRB 1G6OA 1TNDA 5KO2A 1XEWX 5KNBA 1KI6A 2IUSA 2XNDA 2ORIA 1S8FA 2QPOA 3HDTA 3QBVA 2REBA 4V0OA 4E07A 3B60A 2PH1A 3E2IA 4KLNA 5DH9A 3Q3JB 2BDTA 2ZUBA 2J0QA 1G5RA 2KBFA 3B78A 4JLJA 5DHFA 2X19A 2WBLC 5HR5A 4CEIB 4L9SA 4A8JC 1VECA 2AHOA 2GF0A 4G5OA 3ZVNA 3CKLA 4BFTA 2FOLA 1FP6A 4MA4A 3KX2A 3HYRA 1GNRA 3PEWA 5FPSA 4JSTA 3VX4A 4JKIA 1ZJ6A 4B3FX 4RD0A 3A6PC 3GD7A 1KDPA 3DDCA 5C4MA 3WRXC 1W4CA 1UBGA 4G5QA 5AWFC 4IW3B 2C04A 2F1JA 3PQCA 3PUWA 4JJZA 4WXRA 2CNWA 2OFXA 1F3OA 3C16C 2ZS8A 1PZNA 2CLSA 3GJ6A 3U2QA 5E7JA 1G7RA 1Z0KA 4FWIB 3NC0C 1Z0AA 2FFHA 3G82C 5JBQA 4CEIA 1IN6A 3ZVMA 2UVQA 4JSYA 1F48A 2XSZD 4Z1MA 1TQ4A 2PZGA 3RAPR 1VYTA 1GSIA 1O87A 1RYHA 3QY0A 2V54A 4OYHA 2EWWA 1TMKA 4E22A 4C0BA 1W0JD 1OXTA 5AUPB 4ESVA 2YKGA 1CJMA 3B5JA 4JL8A 2OAP1 2ZJ5A 2OCBA 1DADA 2A5DA 3AVUA 4ACBA 2ASEA 1OH8A 1M8PA 1E3MA 1NMZA 3L8YA 4IOJA 2VTKA 1G16A 1HURA 4LHZA 4KHZA 1UKVY 2FWRA 4KI0A 1NG1A 3ICEA 1W2HA 1E9SA 4EJSB 4PZZA 4K81B 4K8OA 1DO0A 2JGNA 3U3MA 1E2IA 2VHQA 1GP2A 1SVLA 1E2EA 1G8YA 3FWYA 3K9HA 2D2FA 1KI8A 4RZ2A 4TN1A 3JZAA 3DKVA 3FFAA 1NY6A 3U3JA 4DEYA 1R5NA 2RGCA 5EE3A 3QKUA 1DARA 3UXMA 1AKEA 3IBGA 2GVZC 1YZLA 4NCHA 1IM2A 3FTQA 1FUKA 1TPZA 2JDIA 3HR7A 3MJHA 1KAOA 4FCVA 2Z5FA 3GJ7A 5G40A 1SVSA 2AWOA 1OYYA 4XOIA 5B2ZA 1XB2A 4EJSA 1H8HA 3H4MA 4FMDF 2UZIR 1F6BA 1MABB 4B6FA 5HZHA 4DRZA 1P61B 4M1MA 1OFUX 5B57C 3LV8A 3I5YA 4MKHA 4KBGA 5CM8B 4DUGA 4LV6A 1KSGA 1LFDB 2ZVQX 4WZ6A 1N3BA 3RABA 2BMJA 4M8NE 2O8FB 1F2UB 2ZREA 3LX5A 3AF4A 5B30A 1JAHA 1IOZA 4M1SA 1VKJA 4IFBA 2BJWA 4JYBA 1BO6A 4GPTA 4Q02A 2E9SA 1RKBA 2I1QA 2VSFA 2GJKA 2VHJA 2WVJA 1EX6A 1JJ7A 1DG3A 4TWZA 1MABA 1GILA 2C5LA 2NIPA 4JL6A 4M1YA 3ICQB 1QDEA 3EPHA 1NBMA 3PG5A 4MUBA 3TUZC 3WYAA 4M4SA 1Y63A 4ZDWA 4JVLA 1HEIA 1OYWA 4DLVA 2XB2A 3SJZA 1XEFA 3CM0A 1QZXA 4DLTA 2IX3A 1XCPA 5AJXA 4IEIA 1RJ9B 5FOTA 2O8FA 1F2UA 2GJ9A 3CX6A 2WWGA 3LH5A 4M53A 2AD5A 4TMKA 1R4AA 3TR5A 1YQTA 3AUYA 1LY1A 4I1OA 1J2JA 4M9XA 3TSWA 121PA 4EIWA 5B64A 1F5NA 4Q4JB 3KXIA 3H84A 5L3RA 2IT1A 4TLCA 1Q22A 1N25A 1XPRA 1NF3A 2R6DA 3BRWD 3T06B 2QAGC 5KNCA 5TMPA 2D74A 2OESA 3REGA 1E0AA 4WIAA 1KDOA 1W4BA 2NO7A 4S2EA 4PXAA 1Z07A 1K8RA 3RS3A 1RJ9A 4FWTA 3KB2A 3WRYC 2ZJ2A 4HAXA 3RWMB 3T34A 1H8EA 1A7JA 3NHBA 2JAQA 4CT4B 1EGAA 4JIMA 2FSGA 4DEXA 1P5ZB 2IYSA 3CNOA 4OHWA 3LA6A 4Q4JA 4F7WA 3DM9B 1Q0UA 3RANA 4AYXA 4AKGA 2WWYA 2WIAA 1XTSA 2WKRA 3U6BA 4WVFA 2OBNA 1ZCBA 3EIQA 1KIMA 4AY2A 2AKAB 2VHUA 2VF7A 2C9CA 5CM9C 2J59A 1J90A 2IYRA 1DAEA 4LJ7A 3LW8A 3FPAA 3O47A 4FINA 4WAUA 2OFWA 1KI9A 1QVRA 4MKFA 1Z63A 2GDJA 2CE2X 2HF8A 3ZVLA 1U81A 5DI3B 3ZYCA 4KFTA 4NZYA 3VR6A 1EESA 2O8CB 3Q5EA 5DN6D 4OHXA 1QHYA 2XB4A 4L4UA 3GLIE 2NTYC 2AK2A 2ZPTX 3LBNA 1IN4A 1XWIA 4ZCIA 4G5RA 3B1VA 2F9MA 1AGPA 2VPPA 1UJ2A 1AZSC 2ZU6A 5J4LA 1DAMA 5FBWB 3EXAA 1Z6TA 4IHQA 4UNPA 4ESHA 4DDTA 5ELXA 3VAAA 2BBWA 5DI3A 1OH5A 1II8B 1W36D 3NDPA 4A2PA 2QUZA 3OAAA 1BS1A 2O8CA 4D2IA 3UWOA 4I1UA 4TTPA 4I1VA 4KXFB 1DS6A 2R2AA 1R8QA 1VCNA 1DAGA 5DISB 1CULC 2NPFA 5D3MB 4OI0A 2WPDD 1KJYA 2NOAA 5EXXA 4BLQA 2CK3D 4QM7A 1L4YA 1C4OA 2REXB 2YVUA 1U8YA 1VG0B 3SYNA 1TF2A 1II8A 1CR4A 2F3RA 4L15A 1AIPA 2QEQA 2VL7A 1J8MF 1E79D 1S4QA 1G1MA 2YC4C 3K70D 2FU5C 4TLAA 2EU8A 2PMKA 4TYQA 3B82A 1NRJB 3G5UA 4POAA 3GLGB 1E9CA 4WZAE 2B8WA 2CL6X 2Z0MA 4DCTA 1ZINA 5D3MA 3X1YA 2VH5R 2ZSAA 2R62A 1U8AA 1OIVA 1JEEA 3GJ8A 3VHLB 2H17A 1G6HA 2G1JA 3EZ2A 3MCAA 2WSSA 4HB4A 3ADCA 3AF2A 5EE1A 5BW8A 2O0JA 3BFKA 4HEJA 1G5TA 4V03A 2AFHE 3WNDA 2A5GA 5FOVA 4O3MA 4DLYA 2CL7X 3O8BA 1E9EA 1XNJA 3ETLA 3TBKA 1OXUA 3B7GA 4MRRA 3SU8A 2ZXUA 2EFHB 1E2JA 1N2CE 2AR7A 5DHAA 4U00A 5FR2A 3GLGA 4LC0A 5HTKA 2Q21A 3B2EA 4NONA 1NVWQ 3WYGA 1XPOA 3B9QA 2Q3FA 3K9GA 3KZ1E 4CGZA 3LXRA 4GP7A 2NZJA 1U9IC 4O2RA 1KNQA 4LPKA 4G1UC 4GZLA 2QN6A 3FFBA 3GJ5A 4WBSA 3AM1A 4BFYA 4NCNA 4C0KA 1AKYA 4L8GA 5IHPA 5TB5A 3U61B 2ZI6A 1XD9A 3N70A 1E0SA 3SHFA 4HAVA 4QM6A 3GMTA 2ZRAA 1L4UA 3CPEA 2FN4A 1U0HC 3L0SA 2OXRA 5KTYA 1F2TB 1G291 4XD7A 3VKHA 3NIBA 3P26A 4JBYA 2XNDD 3KKNA 2WAXA 5DLQC 4TZ6A 3B6EA 3M1IA 2QMUA 3MJRA 1E4VA 4CRWB 1E0KA 2OO7A 1N5KA 3A4MA 5JZVA 1W44A 2W6IA 3BE4A 3QXXA 2WM9B 1UBCA 1COWA 2ODEA 2Q9CA 3WYFA 4PQRA 3GPLA 2N46A 3FMPB 4P32A 3OE7A 4OK3A 2OSBA 1WP9A 2A30A 1F2TA 2RGGA 3PEYA 3FKSA 4US2R 2GXUA 1QF9A 2DWQA 2UZ3A 2OCAA 1GNQA 4I81A 4XSGA 2CNWD 2QY9A 2BIFA 1P9RA 2F1HA 5FPHA 1CRQA 3R8CA 1NIJA 1O3YA 2QGZA 5FTNA 4A1FA 5CK4A 5IF9A 2CVHA 5DSZA 1Z29A 4MRNA 3QE0A 1NY5A 4B73A 1WBBA 1XEXB 1IXZA 3P1JA 4Z54A 2ODNA 4B6EA 4JBWA 4Z1MD 5JMTA 1WF3A 2QAGA 1N6RA 3FMFA 5JHHB 3U60B 1N6IA 2ZRJA 2QSYA 4RD4A 1RRCA 2OHFA 3OIWA 1WA5A 5JECA 1N6OA 1VG8A 4BLOA 4TMXA 4IVPA 1D6JA 4R2HA 4RFVA 4C0HA 1EFHA 1OJLA 2ZI4A 2BBSA 2RH5A 4G3XA 2H1LA 1XEXA 2RGAA 4QRHA 5C18A 2DWOA 5G3ZA 2X77A 1UKEA 2QTVB 1ZM9A 5GVRA 5IK2D 1VIAA 1XJ0A 2ZJAA 4LJ4A 1U0JA 3TVTA 4ERNA 3FHTA 4QXAA 2HXYA 2NGRA 3VR2A 3IPYA 3ZIAD 2CCKA 2ZJZA 3LFUA 4ZIRA 1MO6A 3OIYA 4RD3A 3TNFA 2FPKA 2JDID 3PV0A 3TR0A 3VFDA 5JSZA 2GF9A 4ZO4A 2GILA 5TARA 1KO4A 5CJ2A 5JCPA 1CJKC 3K0AB 3LY5A 4EPVA 2YC2C 1H8HD 1OPXA 1K5GA 4BZPA 3KJGA 5FOSA 1M74A 1DBSA 3HJNA 4RCYA 5TV2A 5SZKB 2IYVA 2WSMA 1UBFA 2XJ9A 3A1VA 2XZLA 4DUGD 3IUYA 3HYTA 5EP2A 2DPXA 2ZYWX 1ZRHA 3W6NA 5L8VA 3THOA 2IL1A 3VMFA 2Z6VA 1E6CA 4HLUA 2RGXA 1HA3A 2H18A 3NWJA 3QXHA 4DLRA 3F5FA 3RSOA 2O8EA 4TMVA 3P4XA 3K0AA 3L82B 3UMRA 4TLDA 3BIFA 2EFGA 2FV8A 2RGNA 4A6PA 5FBVB 4UKDA 5G41A 3AP3A 1TU3A 1KSJA 1KO8A 1JPJA 3KJEA 1AGRA 1BMFA 4CVNA 4PPFA 4M9SA 4UNSA 5JWRA 1FZQA 4FI3C 1ZCAA 4CW7A 2MMCA 4B44A 3TW8B 4C2TA 4TSFA 5KOYA 5JCZA 1GL9B 3CUEF 3PFIA 1JNYA 1OW3B 1JEDA 5M04A 2PEYA 4KYIB 2R6CA 4FMDB 5EUMA 5BN4A 3I62A 2BBOA 4URYR 2ZE5A 2BM0A 3EWAA 1KJZA 4EPYA 3QOFA 3MMPA 3B13B 3CIOA 2HEIA 4LOAA 2C2HA 5FPTA 4BLSA 1TTTA 3QQ5A 3EASA 4KFUA 3GEIA 3TH5A 2Q3MA 1G7TA 3E1SA 5IRCD 2ZE7A 4Y0AA 3NC1C 4NDZA 1GITA 1YZQA 4RJLA 1D9ZA 821PA 1W49A 1H8ED 2QE7A 1NMYA 1NL3A 2R8RA 4IOLA 2ZRDA 5CK5A 3UATA 2ECKA 2WJHA 2V9PA 4AURA 2EFEB 1ZNWA 2FMXA 4XH9B 4IDOA 2A7QA 3AGPA 3KQNA 1FNNA 1HT2E 1KGDA 5JI2E 4Q1AA 4QBFA 3TIFA 4FIDA 1XXHB 1R5BA 3EPKA 4RD1A 2XTZA 1JAIA 4HYYA 5JWOA 4P4TA 1Z0IA 4ARZB 1AN0A 4B71A 3FMIA 4DBLC 1JXOA 2ZI5A 3EZ9A 3IIJA 5EZ6B 5AK0A 1XTJA 3I72A 1YZUA 1OB2A 4EFMA 1U9IA 4PAOA 2CCJA 3IKJA 2H92A 4Q1BA 5KDOA 1G4AE 4MGIR 2JJ2A 3LVQE 4EJSC 5J40A 2WOOA 2OG2A 3SS8A 4UJ3A 2W2VA 3LWNA 2ZRCA 2XOKA 1T0JB 2PBRA 4DT1B 4QFMA 3UMFA 1E2GA 4OBEA 1P73A 4ARZA 1KMQA 4TMTA 1E2PA 4XWAA 2WWIA 1W0KD 3JVUA 3PEUA 4RSGA 3B1YA 1G8GA 3K09A 2YHSA 4QOSA 3GLHB 2FFBA 4XTCS 2EWVA 3P4YA 2J0UB 4W5HA 2IYXA 3UMSA 1CKEA 2IYLD 3GLFB 1GRQA 4M1WA 4TT3A 4DSNA 3VR5A 1PVOA 2JLWA 4DT1A 4LBVA 5GJCA 1EX7A 2FGJA 4A4DA 3LQQA 4PC6A 3OFNA 4TYNA 4KFRA 2V1UA 2ZU0C 3R20A 3AVXA 1SULA 3ASYA 3OEEA 5AUQA 2GZDA 3CF6R 1LS6A 2J7PA 3AVYA 2QRZA 3GLHA 2IS4A 1NSTA 2VF8A 4Q00A 1NMXA 2J0UA 3FVQA 5FL3A 1D9XA 3QKSB 2VP2A 3UK6A 2JEOA 3GLFA 2WKQA 2BKEA 2GESA 3ND9A 2ZJ8A 3QEJA 4TQUS 3ZZ0A 4D4JA 2B7BA 3GQBA 1N0VC 1SKYE 4C0SA 3AF1A 3THYA 4AC9A 3AV0B 3QPVA 1XFAA 4F92B 4UXJA 2V7QA 4YMSA 3KKPA 1JALA 3RVBA 2Q6TA 4HLDA 2J87A 3QUSA 3CPHA 3QBTA 4ZCMA 1ZM4A 3R7WB 1MOZA 2QTFA 2VSXA 4OL0A 2E87A 3CLVA 4RZXA 5F9HA 3SDZA 1KY2A 4HLQB 4HUTA 3REFA 5BYKA 4DLSA 421PA 1J70A 1YZGA 1SVIA 4QBIA 4A15A 2WMOB 3LLUA 2WICA 1XTIA 3IIMA 2OBMA 3LBHA 3Q7PA 2PCLA 5EE5B 4NYMR 1Q1ZA 1XEWY 4QGHA 5GJBA 1IY2A 1OT3A 1ZNXA 2ZAMA 2ZSFA 2JJ1A 2B7CA 2RGEA 1SXJB 3QVVA 5J5CA 3TRFA 4B2PA 2CLDX 2ONKA 5HCNA 3R7WA 4JLDA 4BFXA 2XXAB 3GP8A 5DNYB 1X86B 2RKOA 3DZDA 2QA5A 4YMWA 4ZPXA 4UJ5A 1KI7A 3DPUA 1D8TA 1JR6A 3B1ZA 1NG9A 2IS1A 4HSEA 4V0MA 3AVVA 2PZFA 4PC1A 2W2XA 4C7OB 5GADl 1Q1QA 1E2LA 3VKGA 3U44B 3WBJA 4KODA 1SGWA 4ZDJA 4BE7B 1NN5A 1RW4A 2GXSA 2FG5A 4XD7D 3JVVA 3FYHA 3L0IB 3BH7A 4NYJR 3HU2A 2VHTA 2DY1A 4RY2A 1P2SA 5TY0A 3CNNA 1QHHB 2GXQA 4H1VA 4O25A 2W6ID 4P3YA 1MKYA 1COWD 4R7ZA 4NE2A 1E2NA 4Q48A 4C7OA 2NO6A 3J81k 3T35A 1MO3A 3U44A 1BOFA 2NO0A 2PEZA 1OF1A 2VP4A 1FP7A 1ZM2A 3MG9A 4GFDA 3THWA 1ZU5A 1U90A 3HP1A 4LSGA 2G1KA 4URZR 1XJQA 1AZTA 2DR3A 5K8UA 4CIDA 2J5XA 3I5XA 3D3QA 4B3XA 1W47A 1P62B 5KSYA 3G0HA 2JIZA 1QHHA 4R71A 3OIVA 2DFTA 1S1MA 2QP9X 1KY3A 3SFZA 1IHUA 4B3DA 1NP6A 2XX3A 3FHOA 3VR1A 1G19A 2ZJOA 1TU4A 4QGFA 1CXZA 1KI1A 3D7MA 4L16A 2O52A 3B9PA 3L2OB 4AKHA 1X8KA 3CW2A 4G5SA 3ZJYA 5L3VA
chains in the Genus database with same CATH superfamily
4HZUB 3ND5A 1CUDA 4J1QA 2QD3A 2F9LA 1TLTA 3IALA 2D1YA 5IBQA 3V6MA 3OD1A 2D7DA 1I2MA 3C8UA 2QPLA 3D4OA 3QKRB 3SEZA 1PV4A 1U28C 3DTVB 1C9JA 1JJFA 2ARKA 3E5HA 5CDFA 2YY6A 3EE6A 4GSYA 2G0NA 3MTGA 2ZVJA 4OD0A 3F2VA 4QELA 2OA0A 3TSAA 4BVEA 1HDCA 4ZJUA 1N1GA 1LK0A 2AN4A 3W8RA 2W8BA 2BKAA 1A4XA 3DMDA 4RTOA 1GA4A 5IF3A 2NU9A 2FFJA 1GG2A 2P67A 1CB7A 4GDMA 1H3FA 1JZSA 1X8XA 3KSZO 4OQXA 2AIRA 4XRGA 2F00A 1P1HA 2GBGA 5F2OA 1V5WA 3KOZA 4CGYA 2XIJA 4LHEA 3K6SB 3Q8KA 3FCXA 2L0XA 2OB1A 3KR1A 1DWOA 3L7YA 4I1IA 6NULA 3BSYA 3MOIA 4FW9A 2GPTA 4OGFA 1RC1A 2A0UA 3K5HA 1R00A 3LLVA 3RUIA 4IAOA 3TXAA 1DWUA 3F1KA 4HDAA 1SVWA 2HSGA 1TZCA 4EYEA 1JNXX 1U3WA 1BHJA 4C4PA 1W5SA 3GEBA 4MDYA 2AXNA 4EB3A 2DULA 1CZOA 1Q50A 2A7XA 2KM1A 4R51A 5K0NA 1SHJA 5TS2A 5FBHA 3TF5A 1R8SA 4C3OB 5KNBH 4ZMBA 4NENA 4NMMA 4LZPA 3O4FA 1OLSB 5C7LO 4PSCA 1NW4A 3ECCA 3W7VA 5DYIA 4YRJA 4B4OA 3QU9A 4O2BB 3VJKA 3A14A 2GTHA 3I32A 1FDUA 1G8KA 1JR3A 1KP9A 2IXFA 2M6SA 2YV4A 4LNAA 3V8EA 4AIRA 5JADA 2OFOA 4KQ2A 3S4YA 1FRQA 3RSQA 4OJNA 1KK2A 3AONB 4I4LA 4JWTA 5TPZD 5U4QA 5KTPA 1C0LA 1NDUA 1SCJA 2Z8YA 3R9XA 2FQWA 2R6GA 2CZGA 4OU4A 3KUUA 1LRKA 3TSCA 3IP6A 3W5IA 1QCZA 4RSRA 1BGWA 4ESOA 2REQB 5JH7B 3M0EA 1P3Y1 4YAOA 2WF8A 1W1UA 1GQ2A 2FQXA 2XE7A 3IT0A 4RELA 5SY9A 4E70A 1YR3A 2JFNA 1P7CA 2FW0A 4JI5B 4DXHA 1T6YA 4TS1A 3Q15C 1B16A 1DZ3A 2ID4A 4U8GA 4JVMA 3K72B 4B31A 3PD0A 2LIVA 16PKA 4M46A 4HMPA 2AI3A 2PLWA 3Q7QA 3LPAA 3TAHA 4GOKA 5CYOA 4FDMA 5AKIA 3WGQA 4WZZA 4HXFB 2ZUSA 5H8WA 4OHBA 4KQWA 1QC5A 1DKPA 1G2OA 1WRBA 2QW1A 1SFRA 2E37A 1K9SA 2OUKA 4FJ0A 4KPYA 1JMKC 3N76A 4CIWA 4IL5A 1CE8B 4WZBB 2UVPB 5AVTA 2V7UA 3A4NA 1YQWA 3JVDA 4BN4A 2JAWA 4C7KA 3DKPA 2XB6A 3MGBA 5A04A 4LJ9A 4DUYB 1NKSA 3KM0A 2ZSBA 2VWQA 5CBPB 4Y8VA 1XDDA 1TA0A 1OY1A 3BERA 3ZHYA 4AL4A 3FG9A 4JR2A 1BN7A 3QSYA 3TL2A 1XTKA 1FFYA 4M0LA 4BNWA 3FKQA 5BMVF 2QOEA 4NFLA 4ZYYA 2QPAA 3FOWA 1CVLA 3IILA 3N8KA 5ECYA 4BWVA 2WRZA 3KK0A 3CSDA 4G01B 4TWBA 4DGQA 1YC2A 4ANFA 1HFWA 4QLBA 5IDVA 1CNMA 4B6GA 5GZ1A 1DJMA 1PK9A 3CFYA 4RPGA 1AKVA 5A6SA 4UTOA 2NYVA 1C1YA 3FUCA 3ZLJA 4E07A 1P45A 1UQRA 1PT8A 1LBIA 1Z5PA 2JJ2D 2UVDA 2XRFA 4HLNA 4QJIA 2C5BA 3E3AA 4UTXA 3W2EA 1I7QB 4Z4QA 3I1YA 3KNZA 3JW8A 4REOA 5FKJA 4ZCRA 3E9DA 4IXWA 3ZWXA 1X9IA 2WWXA 3BEDA 3JV7A 3PGMA 1EVKA 1VKZA 1O9GA 3TZLA 3WE7A 1J97A 1BKSB 3KPYA 3MBKA 1SC1A 3ZKWB 4GZMA 2DBVO 2JLQA 1K3FA 4QEZA 3WFIA 2B0JA 1NVVQ 1TAHA 4HLUC 1ETHA 1QFZA 1XJCA 4V39A 521PA 1DHTA 1JG4A 1T10A 4FC6A 5FI1B 3OZBA 4KSBA 2VTEA 4JJ4A 4KAJA 1DQZA 1TZBA 2PXHA 1UQUA 2R7NA 2OG1A 4XIIA 2R9VA 3MTAA 4OAQA 5AI9A 5KNDA 3PYLA 3Q7IA 3WLHA 4B9EA 4ARCA 4WESA 2CJWB 3TRJA 1YBMA 3BHIA 1NJSA 4WOPA 2BGNA 1PHPA 3A4LA 1PR2A 1SCUA 4DLPA 5EJEA 3ZS9A 1S7GA 3H2IA 4MRMB 4DUZB 4YH1A 1YB1A 2CT8A 3AHJA 1CZLA 1KO7A 4OGKA 5LUAA 4TVBA 1A4IA 1AO3A 3CZPA 3OFND 3V4FA 5A06A 1AKTA 1GNPA 3C87A 1FLDA 3FJ1A 3CN7A 4HDNB 2R1VA 4OQYA 3DVSX 3KKLA 3OZRA 4XIGS 1J0DA 2XUGA 3LC2O 4MV4A 4PYOA 5JPCA 1DKMA 1LV7A 3DT9A 1KYWA 3CNBA 4Z9BA 2HIAA 2X9NA 2YQ5A 8MHTA 4WZAB 4MYRA 1VM6A 4IOMA 4JS0A 1RKQA 4FONA 3OZDA 3PSAA 4HVLA 3KQVA 3D6JA 1E7WA 1RE0A 1Z2PX 4W6ZA 3SDBA 2PX0A 3UC5A 4AICA 4YAIA 4G0UA 2WHXA 3ENNA 3OESA 2HJHA 3A3YA 5H68A 5EJ7A 4HGRA 1JAYA 1JBKA 5J2TA 1PE0A 1DC4A 1E2QA 3CZ5A 3ND8A 1WUYA 3GGSA 4IDQA 3HM9A 2J8ZA 1KEWA 1PR5A 3PF9A 5E7MA 4YMHA 2I2DA 1YI8A 1RJFA 2RK4A 3SSAA 1G8JA 4JXZA 1TW3A 2RIRA 3KSRA 1RXCA 2FZWA 2FE1A 4I9HA 2XWSA 5LB2A 3U4MA 1DP4A 1U2ZA 3K0HA 1HNNA 3KDAA 4PFJA 1XNHA 5PNTA 2XQIA 4YJ2B 4A5OA 3ABOB 3QYFA 2HOQA 1GTG1 1SBQA 1T5LA 1V3UA 1WCYA 2H6EA 3OH8A 5AKKA 2UUCB 4XDHA 3V4PB 1AQ6A 1S9DA 4G63A 3T3IA 5JATA 3D6HA 3O95A 2FQYA 5NLLA 4YQEA 2JG3A 4EBBA 4WN9B 4GH5A 2XD9A 3WLJA 4AJHA 2PSEA 1YZ3A 1J42A 4WECA 2GA8A 3PGXA 5EZ5A 1IAVA 3C7KA 1N9GB 3L05A 3TRIA 3UBTA 4DQDA 2JJ1D 1IVYA 4RJIA 2DB3A 2G4LA 4GX0A 4EKDA 1LW7A 5I9NA 1HT3A 3V48A 4QTYA 5MN6A 1TCBA 2XBUA 2ILVA 3DQZA 1E5DA 3LCCA 3SZRA 3QYAA 1N32B 5EKDA 5LZ7A 4FLEA 1KZGB 4DQXA 3MJDA 3AB3A 5GWXA 3EXG1 1TIPA 4MQEB 4Z51A 4R98A 4QBKA 2FP4A 4L9WA 4MOWA 1IOVA 3TOVA 1LRJA 2O05A 2Z4TA 2IEDA 4FZ3A 4AS3A 1ORIA 4LF7B 3BK2A 2IHBA 3CUVA 3CHYA 4AKEA 5AOBA 1ZUD1 1EFDN 2A57A 3H4TA 3UTDA 4BJ1A 1T9BA 1C4KA 2X0DA 3TE7A 1QP4A 2QR3A 1Y1RA 2A1TR 5BMVA 1XNRB 3GGOA 3K09C 4OUDB 2RHRA 1XLVA 3EQ7A 2DUJA 4DQVA 4JFAA 4MPDA 5FXMA 3L3BA 2RJOA 2I1VB 5CPFA 1JVNA 4QAQA 4G24A 5C1BA 2HL6A 2QGFA 5JEDA 5IC6A 2H9AA 1BU5A 3GVHA 3H9BA 4TLBA 5LA6F 4GKAA 3KT0A 3T1QA 4UTZA 3KB6A 4U4AA 1UKZA 4E5YA 4PHFA 1NI3A 4DR2B 2OBXA 1MH9A 4ALMA 2F62A 1NKTA 4A8PA 2QX8A 3L0YA 3DVRX 1PYGA 3P96A 1JHYA 3PGJA 1TF5A 1ZOSA 1L8AA 2QI9F 4PIMA 2B35A 5FFNA 2QQGA 3R6DA 4MR7A 5HM8A 1L7NA 3NB0A 3B1XA 4IVRA 3ZN2A 1YB7A 1O0CA 4BO5A 1W46A 4IDNA 3EC7A 2L82A 3AUTA 4IDFA 2X76A 3R75A 5CLGA 2ANCA 1LPPA 4M1KA 5HBGA 2QZSA 3AKEA 2WFAA 1JJVA 4FE3A 3WLTA 3HCNA 3NDIA 1YZNA 1KZ6A 3GEMA 4EHNA 2PR7A 4M9ZA 4N0EA 1XWFA 5EOVA 5L51A 3AESA 3PDHA 4MYTA 4KVFA 1PL7A 3FIUA 2QTRA 2NUPA 2OV2A 2EKLA 2UYOA 2VJKA 4WOBA 4F2WA 1ST3A 4BLRA 4QATA 2Q5LA 4FFMA 4CR8A 1CUYA 2O23A 3W2HA 3WGMA 2GRAA 1DJPA 5AXBA 3BCHA 3LZ6A 4D9CA 1NYLA 2VNSA 4XM0A 1OOEA 3GFSA 3CRQA 3PJGA 4ROTA 1PJ3A 1MZPA 3VTKA 1EWYA 4FDUA 3WWEA 2Q4RA 1RRGA 2XQKA 3M6VA 3RI3A 1G66A 3NBUA 3SI7A 1SH7A 2A6PA 2W6PA 2B3TA 4JB3A 4CKEA 1ZQ1A 1E4YA 2YOFA 1O58A 3DFKA 3NV7A 3OKAA 4U7DA 4L1KA 5ERYA 3KE9A 2J67A 3ZK7A 5AKXA 4Y2TA 1T3SA 1MVLA 1PUIA 1KH1A 2QP3A 1SHZA 4KKVA 1B8OA 1NUHA 1UKCA 4NR0A 2FJUA 2A2ZA 2VRBA 3K20A 5TGZA 1FA9A 2YXEA 2G1UA 1DB3A 1QIGA 2IVZA 2I9KA 1D2NA 1Z34A 2BFCA 3MINA 3H0EA 5AI5A 1SBYA 4QXQA 3D4BA 2REOA 5ECWA 3MQ2A 4DMMA 1H23A 1S2OA 4LOJA 1UOQA 1C50A 2BBTA 1RYFA 2ZWIA 4GI2A 4P4UA 4H35A 1ZP6A 1J5XA 2D13A 5T8KA 2ZUWA 4JOBA 4PSUA 1XZQA 3IEIA 4G84A 5EIAA 2JJQA 3NAMA 2IHVA 1CPYA 3HRHA 4BWGA 1S96A 1QGED 5F12A 2OFFA 3SXUA 3ELWA 4X62B 1S4MA 1VBNA 5DYYA 4OCZA 2Z8ZA 1UKBA 1S2LA 2CHFA 2FEMA 2O1XA 3PA8A 4JN6B 4P1ZA 2AXPA 3KHUA 4QO8A 2OORA 4XR9A 3I6YA 4UXHA 1P2TA 4RJ2A 4IO0A 4K9DA 1TAQA 2ZYSA 5E8RA 1KQ3A 1SC4A 3ZWNA 1GGEA 3JY6A 2FG7C 1E3IA 2HJSA 3PDIA 4FVTA 4TUYF 3UWDA 4KO2S 3OCYA 3HA2A 2B1GA 3TECE 2PWYA 1EXMA 3A28A 4V2IA 3TZKA 3NHPA 5K20A 1WB9A 1D7AA 1YC5A 4JITA 2Q0HA 3V7WA 5KVAA 1Q0LA 3AYZB 4QNNA 1WB4A 4KPEC 4IKPA 5FFFA 4AN0A 3D8BA 4AMVA 1VCMA 1DEKA 4IEFB 1X2EA 2GNOA 1VYHA 2FPWA 2SICE 1G55A 5BN5B 3ZZNA 4C9BA 5FV4A 2O8BB 4U9UA 3N6VA 5BP7A 1QVAA 3C7DB 3VU0A 3T5AA 1EWQA 2ZJ0A 1GCAA 1VE3A 4RVCA 5IXSA 2X3FA 2ZT6A 3PC6A 4D6PA 3QPDA 1RHMA 1TDJA 1Y4UA 1AKQA 1L5MA 2BCGY 2HGSA 4HKTA 1EEXB 2BUCA 3IKMB 4CCSA 3CNLA 1ISMA 4Y98A 2P6PA 4CTKA 1V7QA 4KEAA 5C8ZA 3S2ZA 1IH8A 2E49A 4D6XA 1C2TA 1FLVA 1PKEA 3NTOA 3UT5B 3VPAA 4UOZA 5EG5A 4RQTA 4A6XA 3IT3A 1K6MA 3DFUA 4QUHA 1C3JA 4PAMA 5IBCA 3EZGA 4O29A 5FB3A 1XL0A 4ZVNA 3VUEA 1U8EA 1HQCA 4YWHA 1N5IA 1B14A 3O9ZA 3VMMA 4BJ3A 5C18A 1CP2A 4FDTA 1AGNA 1JXMA 1TCUA 2CVOA 2HK8A 3AYXB 3I45A 3PGA1 1JG3A 2X4DA 4P7BA 4BZXA 3VU3A 4WA8A 4GLOA 1S9HA 1SK9A 2AMJA 2C78A 3G5LA 3I01A 3TI7A 4MVXA 5EGNA 5JSFA 3I1IA 2P0EA 1ECBA 1EFRD 4IIXA 2G4CA 3DFIA 1A27A 2VLIA 3FYUB 1ZPDA 2I99A 5E9AA 1TEZA 3T3EA 2DBRA 2V5UA 5TMBA 5ALEA 3L93A 3P0JA 1U2QA 2OVFA 1X3SA 3H2SA 1OH6A 4F8JA 2WUWE 2AYZA 2HQOA 2V8BA 3IDFA 1PDOA 4JA2A 4E03A 5DW3A 6ADHA 2AX3A 4PBSA 3K92A 1N2CB 2FPRA 2FWAA 2ZE8A 1PLJA 2ZR8A 3DE6X 3ZBQA 5CB0A 1UJMA 3WDLA 2FR1A 3HH8A 4BX8A 1GIAA 3ROZA 1KJWA 1ABEA 4JEIA 1QHXA 2FXIA 1ZBDA 2YFHA 1U5BA 1NMQA 1VL1A 4HZGA 5AKGA 1J9EA 3WA7A 4MR9B 1SQ5A 4P2GA 3SBOA 2QI9C 2XEDA 3T9CA 4WFJA 2F1KA 2J46A 3G8CA 3RIXA 1OFHA 3OSZA 1GCOA 2QWXA 2DHDA 3ZQJA 2SKEA 1F4LA 3H83A 4PQYA 4RYDA 1YIOA 5LUBA 4BRSA 1RAEA 2B37A 2ZJ4A 5KNLA 2FY8A 3ESAA 5CHEA 3RSZA 1PVVA 4AZVA 5KQRA 4U3JA 1JDJA 2H0RA 3D4NA 1W29A 2EG5A 3OE1A 1FFDA 1YH3A 4RMHA 3KQHA 1YQGA 2B82A 4PVDA 1QFMA 3PB3A 3QELA 4R2IA 1GWNA 3FD8A 2BHLA 3H75A 2AC7A 3G0CA 4MUEA 1QR6A 4EI2A 2A9KA 2XTNA 3BBPA 3IDZA 3VISA 4BVJA 5F21A 5AKJA 4GRDA 4DREA 5IMSA 4M3NA 1ZXXA 5ALNA 2FSIA 2C2ZA 1HYBA 2A5YB 1YDFA 7REQB 1F4VA 4P3OA 2L69A 1Z0SA 4I4NA 1CEYA 3PJRA 3KU4A 4HNAB 3K9BA 3BS4A 2G9UA 1MX1A 2BMEA 1UC9A 3R6GA 4P2BA 4MYUA 1Z68A 1K2WA 2HJGA 4X3PA 1NBHA 1YKSA 2V9CA 2X5OA 3SYMA 3WKEA 3UT0A 2MINA 3QU4A 3WIBA 3EF3A 3RRJA 1ZC3A 3EGXA 3VYTB 1L7EA 2KX7A 3OLVA 2RH4A 4FEGA 4KN9S 5AR1A 4BNJA 2O57A 2FFAA 2FZVA 4LWOA 4G2TA 1CQIA 1R8JA 1SELA 4Q9JA 2BFDA 3M34A 1JILA 1XKLA 1OFTA 1VMAA 4IYJA 2X9GA 3RHSA 2WTUA 4XRRA 3G2OA 5FOUA 3GEDA 2CDCA 2A3RA 5BWMA 3NALA 2WPDA 3IUNA 3WMEA 3AF5A 3KPJA 3RTEA 2ZYIA 4TPKA 4F4CA 3SWWA 4N3BA 4MCIA 1T34A 1RLOA 3U4QB 3QWBA 4PLCA 3D2LA 3GYGA 4DDVA 1SUSA 4B35A 5KSOA 4I4CA 2RKBA 3SSMA 2XTJA 2QPTA 4LQ4A 4X00A 1HOXA 2IK8A 3KLBA 1SRRA 3EIOA 4O2AB 4WUTA 2ZFUA 3IPLA 4CI9A 3R23A 4CEHA 3O91A 4L85A 5HILA 2POQX 4HX9A 1KHHA 5CB8A 2CV2A 3AWIA 3MK31 3QG5A 1IXKA 4FCWA 2I3ZA 4L5BA 4ZOLB 5EVJA 1L5SA 4OJMX 3ZWVA 9GPBA 1U7TA 1DFIA 5FTMA 1JDSA 1KYIA 4TSKA 4XCVA 1LH0A 4D3ZA 3DE2X 1RC8A 1SA0A 5A9SB 1TAGA 3IRUA 3WVNA 1PTJC 4M9RA 4ZCTA 1RQRA 2CC2A 2L2QA 5HA5A 1GM5A 2HBRA 1U0RA 4V0RA 1UWVA 4Z0HO 4LMRA 1JTEA 4JB8A 5CGZA 1C1HA 2IYYA 1H65A 1NWHA 1RPNA 3ACDA 1OLXB 3RC9A 2G63A 4AN1A 5FWXA 4J1TA 4BO0A 5K01A 4YALA 1O54A 3K9LA 4B48A 4LF4B 3L7KA 3PDJA 1GPDG 3WYBA 4WY2A 2Z9DA 3VC2A 2ZM6B 1CZKA 4KTTE 4DCVA 2RHJA 2VCEA 2VXYA 1B7GO 1A76A 5EJ9A 1KGSA 2R96A 3LT4A 3QH4A 4QRDA 5JMWA 2BR4A 2AGVA 4X0EA 4P58A 1PQWA 2AJLI 1VSQA 3LX8A 5TRTA 3RIMA 2O0KA 1MB3A 1UIRA 2GPYA 1WEKA 4BBZA 3VZBA 5DU2A 4FGZA 3GN2A 1P4GA 2E3JA 1NXXA 3ELDA 3H0CA 3IQFA 3FNEA 1UANA 1YRBA 4LK3A 4N39A 5E4FA 1EKXA 2PJRA 2JRCA 4Q24A 1W5AA 5KTRA 3ER8A 3DEYX 1E94E 3ZWYA 3SC3A 1OBFO 4TL8A 1E3WB 3MCVA 4L5IA 1M6HA 4LIPD 3V9AA 3OE7D 1OXMA 1P7PA 2XNJA 3WB9A 1DDIA 2WTNA 2P2DA 3HCOA 1VYVA 2EYUA 2FW8A 2RH8A 3LDGA 3TFQA 1ZGCA 2GBFA 2PX4A 5HQ3A 3IVCA 5KMGB 4NAUA 1G8HA 1V1RA 3PPIA 5F76A 1XMSA 5FBLB 2AZXA 2CWDA 3J7AC 3P5SA 5BORA 3N5CA 1VLVA 1OSNA 2DQSA 2V7VA 3JARA 3SIRA 3G79A 3PYMA 2OD7A 4WY8A 3PXEA 4URWR 1P72A 2BKVA 3MGAA 2PFGA 1PQ4A 1QZZA 3L8ZA 1MHPA 1NP7A 3UA4A 3NHLA 4OHZA 1QYRA 3H18A 4S1OA 4UTNA 3D0OA 5AVSA 3EAQA 1V3VA 3NNSA 1SBTA 5LQCA 2GK4A 1OXVA 3RAFC 1DJNA 1UEIA 3TJRA 4OHCA 4Q6BA 1LGYA 1FQOA 2A0YA 1E6EA 5KINB 3FPBA 4LZAA 1A7AA 1IG3A 2JI8A 2Z5LA 3IPXA 2GJAA 2HAEA 3LP6A 4NMHA 4O6VA 1E18A 2ZKIA 4AZ3A 5LNK6 4ZVLA 1KFCB 1ZJ5A 2OV1A 3O75A 1EHYA 4M0UA 5IJWA 4ZODA 1XDWA 4G0XA 4IKOA 4KU4A 3ND7A 4NE7A 1EK1A 1ZU4A 2ORYA 3ZOKA 4UUNA 2YZ2A 3ROMA 2VCYA 3FHCB 2LV8A 2YMLA 1KK3A 2XDQB 4L5JA 3SHOA 5ESWA 3USZA 3G2IA 3RS0A 3R0VA 4TXLA 4CI0B 5K0GA 4UAVA 4DR7B 4N47A 3URKA 1SZPA 1US8A 4HF7A 4IIFA 1OH7A 4TTVA 2XUKA 3RTBA 3LYHA 1QQAA 2XZPA 3O7MA 4JKYA 5BQPA 4ARVA 1MH1A 2GARA 3T9DA 4MUFA 3AY6A 3V6LA 4Z3OA 1Z6GA 2OQRA 2V6JA 2SECE 4PGGA 1OIWA 3THWA 2P2LA 4CV0A 4ZHQB 2IXGA 2ZZNA 4PLPA 3HGMA 2YUIA 4D57A 2YWJA 1O6GA 4NJOA 1XVLA 3R9IA 2X0FA 2UUOA 2SBTA 1KBZA 3NR2A 3SAJA 3T6KA 5JS8A 1ICIA 2FCRA 2WT8A 1QYXA 4LE2A 3ZDEA 1GFIA 3ZIAA 1U7UA 4M87A 4Q4CA 1NBWB 2AG1A 4AF7A 2MDTA 5LZ2A 1W4LA 2Y76A 3HM2A 5E9QA 2H4WA 1T2FA 3DUFB 1HQDA 3OD5A 4MQ5A 3JPYA 1NR7A 3VU9B 1OI3A 3CBQA 3ONWA 4BE9A 5MDHA 3OZAA 4IILA 4YO8A 1ZH2A 2IPNA 1WAMA 2WPNA 5JTTA 1XMVA 1SC6A 1WU8A 4N6NA 1G41A 1NDQA 5FR1A 1IOWA 1L2TA 3S8MA 4B2YA 3ZHBA 4RD2A 4L4ZA 3UFXB 3I2JA 3TQFA 2V9ZA 3QMWA 1ZA2A 3EWNA 1HNWB 1U8UA 2G77B 2UXCB 1BJTA 5AJVB 5YASA 5JQGF 1KYTA 1EFPA 3K8ZA 2D2VA 2GEFA 2HEGA 3DOIA 4LVUA 4GT1A 3IH5A 4NE9A 2V3WA 4QRIA 3R7LA 4F4DA 4IIYA 1SVOA 2BC9A 3GJ3A 4JOCA 4KOAA 4M83A 1KEEA 3RIYA 3TN7A 4HS9A 1U99A 3QMVA 5KYVA 5ISMA 2JI6A 5AVUA 2E4YA 5FNVF 1Q12A 3RYHA 4O2LA 1CJUC 1AD2A 4X91A 1A88A 4KRFA 5JJLA 2DT5A 2GEDA 3HB1A 3M7IA 4NICA 1F8UA 1UBMS 3OLZA 2VNIA 5AQEA 3N8IA 4A6DA 4P4SB 221PA 3DXXA 4M86A 1UZMA 2FG6C 2O3JA 4YS6A 3WV4A 3DO6A 1FDRA 2BMFA 2BEUA 3M5WA 4HUJA 2F6RA 2CZQA 2VNJA 2QE7D 3QW4B 4CFZA 4K9RA 4DIEA 4PTLA 1GKYA 1G17A 2X8BA 3C45A 3O8QA 2VP5A 4HNGA 1C8LA 1GTZA 2H7YA 2Q2WA 4PCLA 3UHJA 3I0NA 5LP6B 2XOEA 5EP1A 4G8JA 2HMUA 4EUNA 1I1QB 1TMGE 1V39A 3LKVA 1R0ZA 2FZLA 1IRXA 4WSOA 1FYXA 1UBTS 1E1CB 3LMKA 2QAJA 1JLHA 2AOTB 1RWNA 2Y77A 5K0BA 4PN7A 4RTMA 3EW9A 2H1VA 4MICA 1TD1A 4ZA2A 5KSPA 4BB9A 5GONA 3OQIA 3TZCA 5A4IS 1O8CA 4YCLA 3ZWWA 3RVDA 2F8SA 3JASA 4C20A 2LE0A 1HDEA 4ND7A 2HADA 2VSNA 1RBZA 4IICA 3KVNA 3CR3C 3ONVA 2YXPX 1AKMA 3ZQUA 3CNQS 1H6BA 5A9TA 5JNUA 2B99A 4MNTA 2OO5C 4QUEA 3N0TA 5JCJA 4KR9A 3H42B 5AW8A 3F7OA 5T8KC 5TS3A 2C9OA 3GNLA 2OHHA 2PM8A 3UGKA 1FTSA 4GDFA 2BKUA 2VJPA 4Q9KA 1BEZA 4LWZA 3MTEA 3LPLA 2PT6A 2KE5A 4GBJA 3HVKA 1G9TA 3NPAA 2HYDA 4RNDB 2VAWA 4D4GA 3ESYA 1VHLA 1Y6JA 2N42A 3E48A 1VHQA 2IZ1A 2QJRA 2CYCA 3I30X 3IMKA 4QE3A 3HU5A 1HE8B 3JWHA 4TXNA 1Z35A 1R74A 1T8PA 1TK9A 2AE1A 4TLEA 4XX0B 2IKSA 1NQ5A 4Q1DA 4DB2A 3EC2A 3M1AA 1RBQA 5CGQB 1O95D 4UBIA 1FZTA 4EVQA 4MUHA 2XUDA 1TADA 4HDMA 4ZOQI 3IJ5A 2DKFA 4AP5A 1ZRMA 4Q1VA 2C9YA 2ZRPA 4HL6A 5L3SA 3WZMA 3RYCB 1ZMBA 5BSEA 4FB4A 2V5AA 1QV9A 2LR0A 3IO5A 4N7JA 1FS6A 2OQ2A 1TIBA 4DLUA 3R5KA 2MT9A 3UAVA 1RQ2A 3V3TA 4H3KB 3H2YA 5JAZA 4P5PA 2DPYA 2QENA 3AI2A 4ONEA 4A8JA 2QM8A 4GRIA 4G2NA 1QG4A 4F86A 2ERXA 4YQZA 1YCFA 5D00A 3ITDA 1D1SA 1XVUA 2XT9A 4C6TB 3CEMA 3PNQA 5HEKA 4BL5A 1Y5NA 3BE5A 1SHLA 3BRSA 2GHIA 3T4XA 2OCYC 2Y9PB 4BQSA 4MYHA 3LHKA 4DC9A 1VB3A 1WPQA 3EXIA 3U3RA 4D42A 3OPNA 1R8XA 3W2GA 3WRXA 1AS3A 2B8NA 5LQSA 3KKOA 4LC1A 4EMTA 4JSRA 1AB6A 1IEQA 3LM8A 3OOHA 5GJWC 3V7UA 4BLTA 3C6MA 1L7XA 2G9QA 4OQDA 4ZI3A 4FEEA 1M5UA 4GXQA 4XCQA 4F91B 4EB0A 4G4GA 5BR1A 5HQJA 1DT3A 2BMDA 1MV8A 3GH3A 5AJZA 4YUYA 3LAWA 4ZPJA 5I7FA 3IAAA 4PG6A 2I3GA 4ISBA 1WPGA 4ZAXA 3OOSA 3WNBA 1FVOA 4NEGA 3ZYZA 1QO0D 2DYKA 2K6GA 2EDAA 1RR6A 1MP0A 2ISSD 3TQQA 2CMKA 1R10A 4ZU1X 1TJNA 2GYWA 4WXHA 1WPXA 2Q2QA 4UATA 4YXWD 3UF0A 2RK6A 3KTAB 5B1YA 2GLXA 4I4TF 4NG5A 5EJIA 3UK1A 4JQSA 4JUAA 2KS6A 4MLCA 4BB5A 1FJHA 3CONA 4PFSA 1KK0A 1PR9A 1UP4A 2P9ZA 2B6HA 2P9TA 3ZWDA 4J7UA 3IP1A 4LJLA 4UEQA 3T5BA 4KLRA 1RC0A 2H3EA 1AMUA 4G9EA 5IDQA 4FK8A 4MDEA 4HXYA 3MAJA 1KI4A 4IG9A 4PANA 4BE4A 2R8BA 3LQRA 2Q9UA 2WJWA 1QIMA 4GPIB 3LNCA 4L9RA 4OXRA 5IP5A 2QB5A 1HWYA 1EZ4A 1QCYA 1SXJD 1MOPA 5DM0A 4ZOCA 1R8YA 2NXWA 1WSBA 2ZROA 2DFVA 3TIIA 4E5MA 4EFNA 2H9YA 3H8JA 5ELLA 2J9GA 4NC9A 3TMYA 2BT4A 2PRZA 4UNNA 2HT6A 2ZDHA 2FYTA 3RTCA 3T5GA 5IWCA 1EDBA 1HL3A 1EVIA 1P2BA 3FNGA 1CR1A 2O48X 2J30A 2D1FA 2PMCA 2XAUA 4OFZA 3U9TA 2ZR9A 1LJUA 4U5XA 4JB2A 2NP7A 1QHGA 3GLQA 2FQQA 1T1EA 2NU6A 3CZ4A 4ENVA 2QX7A 1VC2A 2JCGA 2PCJA 4UARA 4TVSA 1KI2A 3SICE 4RHEA 1TA4A 3TLAA 4B43A 3RS7A 4AECA 2V7PA 3LNTA 3UAZA 3VBCA 3JATA 5GGYA 4E7OA 3VPXA 2IZZA 3HCFA 1SWWA 2HBQA 4DB4A 1D2AA 5ES3A 4EPTA 1JA9A 1W36C 1J8VA 4OQ4A 3OQBA 1BX3A 3KL4A 4YP5A 4YONB 4ZT5A 3ASZA 2Z1MA 3N2YA 3Q85A 3L1HA 1K5DA 2ZBEA 2AW5A 3PNSA 4JOSA 3JZMA 4Z8XA 2BYTA 4ZT2A 3MQFA 2OLJA 1K97A 2FFRA 1XZMA 1XE3A 5DWQA 3A25A 1RQGA 2QD4A 1I2CA 4PNPA 5DWDA 4OVKA 1QOPB 3ISJA 4RIFA 2WSYB 4KYTA 2OXTA 3JQFA 1T91A 1MCZA 1RM3A 4BNXA 4CKCB 3SYKA 3AM5A 5EPUA 3KKQA 5FF9A 3K8QA 3NTUA 4G8CA 2COKA 4N9WA 4Q7JB 5EN4A 2V96A 4IS2A 3M4YA 1LBTA 3UICA 3SQWA 4JLUA 3IDOA 4OK5A 1JKJB 3DLHA 3IEVA 1QP8A 1XQXA 2QW8A 3QW2A 2JJMA 1CUFA 1LVHA 2WE7A 5AUOB 1H9AA 1O94D 2XCTB 2XQGA 1J0BA 4KVGA 3EA4A 5T6MA 2BGMA 3C74A 3L7AA 3NTRA 3G0OA 1GGHA 3OTOB 2GO1A 4NTZA 1Y8CA 5COAA 4V1CB 2AFIB 3OM9A 5DNVA 2QU8A 1FF9A 3HNRA 4OREX 5ALHA 3C98A 3VPCA 4ZHSA 3OEYA 1Z26A 1V3TA 4MDFA 3TZBA 5HPYB 3MNFA 2HSDA 4RV4A 1Z17A 4KGDA 1OD6A 1VE6A 4F6RB 5KVCA 1S8OA 1NXPA 3PDCA 1JI3A 2H48A 2BFFA 2Y8EA 1S3GA 1L8LA 3NFYA 2WEKA 1NX9A 2Q1XA 1X7DA 3DTVD 3X2SA 2M98A 2QX6A 2AFVA 4PX9A 3RG2A 2AXEA 1XCBA 1XG5A 3D7NA 3MOSA 3N2KA 4J1TC 3WO1A 5KU7A 2ZEJA 1K27A 1JPNA 2PNFA 3TTWA 5GJVC 1XVTA 2FSPA 2W4QA 2WFLB 1L4EA 1M6WA 4P36A 4P92A 4XDZA 5BW6B 2I62A 5T57A 1RVV1 4AT1A 2QLJA 4IZHA 2I5PO 2ZOSA 4PIPA 2IWRA 1UJ6A 2PD4A 1CUIA 1YU6A 3SZUA 2CLCX 2OV4A 3AH8A 1TM3E 1E3LA 3NBFA 4OQEA 4RPCA 3RDPA 2ZULA 2JLYA 1R12A 4GVPA 4LYEA 1AH2A 3OG9A 2ZS7A 3VJMA 3CRZA 1FLNA 3TOZA 5K4HA 2B92A 4LUCA 4P35A 1UPCA 4GKVA 4UAGA 5A5DA 4MEAA 2QX9A 1I4LD 4DJAA 1IU9A 1WW2A 3TLBA 3FTEA 1XKTA 3A36A 3PUVA 1KKUA 3MRVA 2LKDA 4GPEA 1OILA 2KLHA 2PTHA 3BFXA 1VMEA 5JR3A 3EVCA 1HEYA 5BPFA 4AUKA 5C0OE 1Z88A 4DTIA 3NBZC 3ONFA 4BEJA 3VO2A 4X8HA 1KZ1A 3HSSA 4WLVA 5FEMA 1BDHA 2QL9A 3SX4A 1JKMA 3STTA 4G5XA 4WK0B 1BHO1 2BLLA 3HEBA 2QD1A 2C2XA 1GKUB 3H5VA 1MO4A 2C4WA 3KKEA 5AI8A 4LTMA 3AL3A 1Y8RB 3HHPA 2D0IA 3N6XA 3F0TA 3V55A 2ZRFA 4AZSA 2QN1A 2V6BA 5J2UB 5I7HA 4HR7A 1U11A 1NVAA 4FGUA 4L22A 1KARA 1Y1KE 2AB0A 2QP4A 3DCYA 1JQAA 4MPPA 4ZFNA 1MGOA 4RK7A 5H02A 3LUCA 2GKOA 3EVDA 4R01A 2RAPA 4FIZA 2PY6A 1GQQA 1KL7A 3RRYA 2AZMA 3MHTA 1KVQA 4TYYA 4I08A 1N57A 3FDZA 1RD4A 3U3ZA 5C1IA 3C6BA 4Q3NA 4LG1A 4FM9A 2C2KA 3SJAA 2YYSA 1AK1A 3B12A 1KU0A 1AUPA 2CNOA 1Y3FE 1C9EA 4H08A 1V26A 2XE8A 4US1R 4DTCA 1CU1A 3LBFA 1UXGA 4MUGA 1NUQA 2RI0A 3U26A 2VSQA 1INLA 5CIWA 4YUVA 1EX1A 4Y1RB 2ZTHA 1C7IA 1EUCA 1WKCA 4JLKA 1PIWA 1ZD9A 5IVDA 3VHQA 5K8JB 1ZM7A 3L92A 4UQOA 2YJGA 4X66B 2X42A 4JQZA 3PPYA 1AMNA 1G21B 2COEA 5L6MB 2ASVA 1PBNA 4MGHA 2B5OA 5EJ4A 1DIBA 1OT5A 5LDGA 6CHYA 1H2RS 4HI0E 4OO3A 1V35A 1GR1A 4DMGA 1GZ7A 3D0RA 3GPIA 3IUBA 4R16A 5AK4A 3TEMA 3WWDA 4ZZ1A 2X6RA 4S0ZA 3MERA 2LWIA 5C37A 1KSFX 1TK2A 3P0RA 2VWPA 2JLZA 1X1SA 3KEFA 1A8PA 1TVEA 2VIIA 1L5NA 3F9RA 1U02A 5EQDA 4JUIA 3U37A 1Z37A 4I66A 2VEOA 4JZKA 1UMKA 3AVPA 4YLYA 5FX2A 1W1IA 2ZW9A 1GJRA 3EX7C 4ENSA 1SVUA 4E5PA 4N5HX 5FI0B 2NUTA 4WBNF 3EW7A 4NMLA 1TGVA 5HFNA 4YRRA 4WINA 1XA3A 1F8XA 2WB4A 3R3WA 4EJ6A 2VK8A 3H04A 4F1JA 2C7OA 4I55F 3BGDA 4BMXA 1Y5IA 3B3GA 1KDTA 1BHQ1 5EP3A 4CL2A 1V25A 2QGNA 3H5TA 3I9FA 3C3BA 2YCBA 1Q0QA 3OZFA 1UDRA 3NHAA 2EZTA 5HKKA 1SK8A 4MQLA 1T8YA 2NV0A 3JRXA 1W52X 3ND6A 4GSKA 3ZTWA 4EDFA 1O6BA 1XDSA 3A3KA 3AP2A 3RARA 3O3MB 5C8YB 4OI0A 3RSFA 3BB1A 3RVMA 2GBIA 3AF3A 4AZ0A 1RAAA 4DSUA 1FK8A 5JISA 2GYYA 2ZRHA 2AI2A 2JKYA 1Y9ZA 3DP9A 2WJJA 3PPWA 1MA0A