2AK3A

The three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
b'GASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETSVTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE ISOENZYME-3
publication title The refined structure of the complex between adenylate kinase from beef heart mitochondrial matrix and its substrate AMP at 1.85 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase (phosphotransferase)
total genus 70
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 1995-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak3A00
2IYSA 1IXSB 1G3IA 4BFYA 4HB0A 4IXMA 3ZZ0A 1ZM3A 1AQUA 3FE2A 4DBLC 4I1UA 1XU4A 2JLVA 4U02A 4HUQA 1Z6TA 4DDVA 4IFBA 4EPYA 1V5WA 1LW7A 1FMJA 2ANCA 2N46A 2WJGA 5DHAA 5DN6D 4LV8B 4PPGA 1WCV1 5LD2C 1NI3A 3M4YA 2WZQA 1GNRA 4IEEA 4KBGA 2P5TB 2QE7A 1T8UA 2OSBA 1TTTA 1TUEA 3BS4A 3VU9B 2O8BA 2VA8A 3DOFA 1E9SA 3OE7D 3HU2A 5IF9A 4HI0E 3WNDA 4XSHA 5KOYA 5B57C 1I2MA 1QVRA 3TW8B 4EFNA 3TJZA 3SHWA 4BZPA 4TSFD 3GJ3A 3K0FB 3NG1A 1QBKC 4LJ6A 4JVNA 4B73A 2O5VA 2ODNA 4ACBA 5H1YA 1R0WA 3R9WA 2XTNA 1CTQA 2DFTA 2Z4SA 4G5GA 5F9HA 1UKYA 2F43B 2X8AA 2KBEA 4MYTA 5JS8A 3F3YA 4FWTA 1NBMA 1FMLA 1KI6B 4F4CA 1Z0DA 4ITRC 1L8QA 4RFSA 2PEZA 3VU9A 4DLXA 2WJJA 2JIZD 2F6RA 4C0BA 1WDTA 1AQYA 1G16A 1II8B 2BCJQ 2R8RA 4Z1MD 3TW4A 1U9IC 4IDQA 1XD8A 1HE8B 1LF0A 3T15A 4KCGA 3K0FA 4H1VA 4LJ8A 3AVQA 3BE4A 3K0AA 1XCPA 2NQ2C 1R7RA 1S1MA 3EPJA 2YWGA 3MAAC 5TMPA 4EFMA 5JSZB 2ZTSA 2HEIA 4HZUB 1AJEA 2FU5C 4I99A 1II9A 2ZR9A 3U3RA 2F3TA 2YKGA 3I72A 1KI6A 2W2XA 5AWFC 3B9QA 4IDPA 1E2JA 1DELA 2YVUA 5IK2A 1I2DA 1E2QA 3FFBA 3QOFA 2QY9A 1II8A 1WA5A 4HDCA 1Q44A 2JASA 4UXIA 3SNHA 1W4AA 2YZ2A 4RD1A 4IOJA 4KODA 3WXMA 1FL9A 1GRQA 1HUQA 1Q3TA 1DAIA 1CR1A 4OK5A 4BFSA 3SEAA 3CRRA 4DB4A 4B3BA 2HLDA 3CF6R 1M8PA 2AKYA 4B3GA 4WW0A 3ZIAA 4W9MC 2A5DA 3CZPA 2P5SA 2QPOA 4F4JA 5AUQA 1U0JA 3IO5A 3TUIC 4PSAA 1JJVA 4Q01A 2CVHA 1SULA 4DDWA 3Q7PA 4CYMA 2NIPA 3PUYA 4WZAE 3VNVA 1FNNA 2P6RA 3C4JA 3QUSA 2RGEA 2C03A 1OXVA 1G8YA 2PX3A 4NCNA 2VIIA 3K0SA 1T3LA 3QKTA 1TF5A 5HE9A 4EFLA 2ZM5A 3SYLA 2QM8A 3NKVA 4EKDA 3KJHA 1ZIPA 2FDCA 3HYRA 2F1RA 3AF0A 2EVWX 4FD2A 3U4QB 1MR3F 3AVUA 4JLNA 2OXCA 1YZNA 1XTSA 2B7CA 3NBZC 4U00A 1E79A 2H92A 4BFTA 1XF9A 3K53A 1X1RA 2IUUA 2ZYUX 3KXIA 1W48A 5HCIA 4PAMA 1Z28A 1NVWQ 1M7GA 1ZU5A 3EA5A 1VG8A 4R9UC 1R8QA 2IF0A 1H65A 2DWQA 4Z54A 3G82C 4PO1A 3KL4A 1LY1A 1RPZA 2DB3A 1QHSA 2JLRA 1DEKA 1RFLA 4W5HA 1G1MA 3KZ1E 4QM7A 1JR6A 4D6PA 4LBYA 3FB4A 4GPTA 4LJYA 1DS6A 2B92A 4LHXA 2IX3A 4O2RA 1IN8A 4U5XA 1IAQA 2GTPA 2ZXUA 2D7DA 5KDLA 2VH5R 3B78A 3U4QA 4GBMA 2G6BA 4JLAA 4RSGA 1VECA 3B1WA 2F1JA 1WB9A 4PSKA 2A9KA 3FMOB 3I92A 3C16C 2X2FA 3PUZA 4GRAA 2QE7D 4TMWA 1W36B 3L8ZA 4A8JC 4EJSB 3KKOA 4AC9A 5K8UA 2QEQA 1G4AE 5JRZA 1VPLA 1RYHA 5DLQC 1TNDA 2OILA 1B0UA 4B76A 1XFAA 1Z22A 2QI9C 4KLZA 4PC7A 4ZKDA 1Z63A 3S1AB 2X77A 1YZQA 3MMPA 3QSYA 1CEEA 2BBOA 4IRUB 4JMPA 4NYIR 4PANA 4B6EA 1KYIA 2NO6A 2VRWA 2ZUCA 5CIQA 4A6XA 2PZEA 3CR8A 1U8YA 5TDHA 1W0KA 2NO0A 4Z8YA 1N5JA 2QA5A 5DHFA 4M1OA 1PUJA 1G7TA 3RRMA 3T1TA 3R8FA 1NBMD 4A2WA 5KSZA 1JXOA 1GRRA 1IN7A 3H4MA 1VG9B 3WRYC 2J3EA 4LUCA 4HSEA 4Q9HA 3O8DA 1E0SA 5FOVA 3WRXC 1T0HB 3BOSA 5DIFA 4B2IA 4G3XA 4ESHA 1P73A 3L0PA 3QXSA 3TE6A 1HE1C 1CR4A 4LSGA 3S1AA 4JLVA 3PUVA 3UMRA 1ZVQA 5DISB 3T35A 4B75A 4EPTA 3ADKA 4LJ9A 2WPDA 1R8SA 4NDZA 2ZRBA 1JB1A 2GEVA 3QQ5A 2BBWA 4UJ5A 5BN4A 1NLZA 4IVQA 2GF0A 4DKXA 1KI7A 1U0HC 1QRAA 2I3BA 2JDIA 1DOAA 3PR1A 4B2LA 4JVMA 1R0ZA 4QBHA 1R0YA 2IYLD 3TVTA 3WMGA 3B2EA 4RJLA 5AR1A 1TEXA 1VG0B 3U6KA 2ZUDA 1W46A 1F2TA 2E9SA 2QGNA 1PUIA 2YOGA 3U7GA 5IK2D 1E2MA 3IHWA 2XJ9A 3NBXX 5D3MB 1NMZA 2NO9A 3WBKA 2G88A 1XTIA 4P31A 4CEHB 4AI6A 1GVNB 3FGNA 2CHGA 2IC5A 3LX5A 3U7FB 2GXAA 4B3FX 2RGGA 3QIAA 4RVCA 1XEWX 3L0IB 1P60A 4BPBA 4M1MA 3ONWA 1OHHA 3GJ8A 3EPLA 5JHHB 1OB2A 3ZIAD 1XWIA 1JNYA 4DLYA 3E5HA 1HURA 3K70B 1Q1QA 3CPEA 4A4DA 3ZGXA 2DWPA 1IM2A 1QVAA 2XAUA 2EFEB 5EP4A 4LHVA 1W5SA 3EC1A 5L3RA 1QZXA 5J47A 1EESA 2NPIA 4Q19A 5EZ5A 3NC1C 3DO6A 5D3MA 1W4RA 2Q9CA 1T3SA 1Z07A 4CEHA 1DE0A 4GDFA 2QL6A 3I32A 4OHXA 5A0FA 4YMSA 4Q21A 2EWWA 2C98A 3FHOA 2V6JA 1PZNA 1OIWA 3TH5A 4BGDA 5C4MA 2WJHA 4LHWA 2JAQA 4DIDA 1UJ2A 1Z6AA 4PPFA 1E79D 1W5TA 4KJZA 1DADA 2BHRA 4Q9KA 5KTYA 2JA1A 2XB2A 4R7ZA 1EFTA 5KU1A 3A4LA 4NYJR 1QG2A 2GBLA 3OIWA 4DDUA 1TAGA 2R65A 1JAIA 4QJ3A 2OCPA 1HA3A 3A8TA 3IO3A 3K8YA 2WJVA 4DHEA 5B30A 3QKUA 1GZSA 2GEUA 3ZD7A 2R6GA 5CM8B 4LPKA 1VCMA 4A1FA 4TTRA 1OH6A 2QRZA 2CLSA 4RZUA 3PEYA 5DH9A 1BYIA 2QTFA 3KJIA 4M9XA 4TLEA 3IHLA 1P62B 4WOPA 5TY0A 4B3CA 4LBWA 4XVRA 1D2MA 2QROA 4O25A 2ZJYA 5FOSA 1ZNXA 2A3RA 1KAGA 1VIYA 3AKEA 2BEKA 5EE0A 2J0SA 2O8FB 4I4LA 3GJ7A 2DFLA 2GXQA 4L15A 2ZETA 1E6CA 1Q57A 4ARZA 2IHBA 3K0CC 4M9SA 2QZ4A 2WMOB 2ZRKA 4I81A 4N1AA 4N3NA 4C7OB 5DNYB 1ZC3A 1JEEA 2YWFA 2JJ2A 3EZ7A 3M6AA 2GCNA 4O0MA 2WM9B 4MRNA 2HJVA 2XGJA 3TSZA 2WKPA 1E9FA 3NEYA 4RD0A 2ZJ8A 3N2IA 4XJXA 3RYTC 2VHCA 1JAHA 2YC2C 1TF7A 4H9GA 4LOAA 1W0KD 4MKIA 3THWB 3UG6A 2J1LA 4MRSA 521PA 1S96A 2G0TA 3OIVA 2ZAOA 1D5CA 2O8FA 3NDPA 1TADA 2WSSA 1CLUA 1YZKA 4C4PA 1W36D 4B35A 2ZRPA 4M0LA 3P26A 2BM1A 2W58A 2A78A 4C7OA 2ZI9A 5JWRA 3RS5A 4FCWA 4M4SA 3B1VA 1KI2A 1J8MF 2EW1A 4PO8A 2CK3A 3TKLA 5JJKA 2WPDD 3H2YA 5FBWB 1E2LA 1RZ3A 4NHOA 1G291 2FZ4A 3WP1B 4DWJA 3SZRA 4DRZA 3SYNA 2UKDA 4QC2A 5DE3A 3THWA 2RGDA 1A2KC 2WWFA 4BECA 3SHFA 4QGGA 1XMIA 3TSWA 1R4AA 3GEEA 4JYCA 1CJUC 4H1UA 2CDNA 1GRNA 1E9EA 3LBIA 5LB2A 4YLGA 1AZSC 4LYAA 5TVKA 4DB2A 2ZIAA 3U2QA 2AWNA 4W7SA 1YR6A 3KX2A 3OIUA 4TL9A 3IBYA 4Q9IA 3FVQA 2WWIA 4UXJA 2IL1A 3CX7A 1CKEA 4UXHA 1G8PA 3OFNA 4C3ZA 1SVSA 5BWMA 2ZSAA 4M9ZA 4Q7MB 1ONBA 2OO7A 3I3SR 4RY2A 2WWYA 1ZNZA 1FPMA 1D2NA 1OHHD 1BOFA 1PLLA 3AF1A 3SQWA 3NH6A 4JJKA 4KI0A 1T0JB 4JLKA 5CB6A 3EX7C 4QM6A 1NY5A 2RHDA 1G20E 1DBSA 1N5KA 2ZE7A 2OFWA 3WYGA 1U2RA 5EJEA 5FH9A 4LY6A 3RRNA 2VP4A 5AJVB 2AN9A 2BBSA 1ODFA 2GZHA 4GOJA 1KSFX 3B7GA 2WKQA 5IHPA 1FOEB 4LI0A 5EZ6B 2CL0X 4LWZA 3HYTA 1XTKA 5DI9A 4IOKA 4CRWB 5JFGA 1SHKA 2AD5A 5FPYA 5L3SB 1E1QA 421PA 4IDOA 5G3ZA 3H86A 1EFRA 5C2JB 4A9AA 3FDIA 2ZRLA 4IDNA 2ZYTX 4BFUA 8OHMA 3GJ6A 1VTKA 1A4RA 4ZCIA 1RJ9B 1FP6A 1E0JA 1YZUA 3K9GA 4Q7KA 5JEDA 2K5UA 4EPVA 1ZNWA 2I1VB 2WWGA 1X1SA 3CZQA 3BC1A 3TUJC 1NMXA 2Q3MA 1AIPA 3LXXA 1JR3E 3ADCA 1KI8A 1W1WA 3BORA 2P6UA 4QBIA 4MKGA 2IS2A 2PZGA 1Z8FA 1Z0FA 3QPWA 5L3SA 2FN4A 4EIWA 4MRRA 5JS7A 3RDPA 2H18A 4IFEA 2ZR7A 2W6JA 3AKCA 3U3OA 4RD6A 4XIGS 1RJ9A 2BJWA 4MQBA 3BB3A 3RWOA 2CE2X 1TEVA 4Q00A 2YINC 3RNLA 2JJ2D 1KDTA 3JVUA 3F0TA 4TQUS 1PLKA 2MMCA 3BB1A 3RWMB 1KZ7B 4E09A 2A5YB 1RRFA 3QG1A 3AP1A 1AS0A 1TQ6A 2D2EA 3Q85A 4TQ9A 4WZBE 2CL6X 5HE8A 4KFUA 2OBLA 3TBKA 1MO4A 4QNRA 3FHTA 3ADBA 3OHMA 3I4LA 3O8BA 4JLOA 1YJ5A 2XOKA 1Q12A 2QORA 3IQXA 1DG3A 2WSSD 4DZZA 4NL4H 1W49A 1WP9A 4UJ3A 4LV5B 5J4LA 2J59A 5HKKA 4EPXA 3QNUA 3VX3A 4Q48A 3ZH9B 5K8IA 4G0NA 3OESA 4B33A 3E1SA 5K8TA 5FI0B 4PPNA 4D4LA 1HT1E 4M2LA 1S0UA 5FTMA 2IXFA 1JBKA 3FYHA 4KYUA 5JI3E 1M2OB 4KFSA 3UPUA 2RAPA 4U7DA 3BGWA 3B8HA 3Q8XB 1OW3B 4JLJA 4BQSA 4LJAA 5B64A 1JPJA 1F48A 1G5RA 5JWHA 4M1TA 4PZZA 1MRSA 1F6BA 2AXNA 2FZLA 1E0KA 2ZEJA 5FTNA 1WBDA 4DSOA 4PC2A 2J45A 1U8ZA 1GKYA 5LDDC 2AKAB 3T5DA 1DO2A 3WNCA 2Q3FA 3RC8A 4TTPA 2HF9A 3OFND 1OIVA 1GKIA 1G17A 2Q3HA 2FG5A 5FFMA 2HXYA 3VMFA 4FMDF 3I5YA 3IEVA 4DEXA 4FMDB 4O3MA 3SJAA 4TT3A 2RGBA 2LWIA 1DPFA 1XNJA 5AJWA 1WBBA 3TIFA 4L9WA 1MV5A 3PUWA 2ZSDA 1UDXA 1IXZA 4L4UA 5JI2E 3EWSA 2GILA 1KIMA 3VX4A 3KQNA 4MGYR 4OYHA 2LKDA 3TLXA 2BIFA 1XB2A 2OE2A 5E7MA 1OYWA 1R6BX 1IJEA 1SVIA 4PAQA 5FUWA 1E4YA 2F7SA 1IXRC 1M7HA 1EX7A 4WIAA 3Q3JB 3MWYW 1E1QD 1EFCA 1MKYA 2C78A 1EFRD 1GIAA 3FKQA 2VSOA 1G3RA 4DC9A 4Q47A 1R5OA 1LS6A 2DPXA 4URZR 1VYTA 4YMWA 3REGA 5FTJA 1ZU4A 2RMKA 1XDBA 2ZSFA 5UKDA 4LYJA 2R9VA 5KSYA 4ON9A 3A1WA 1G3QA 1I4LD 4EPWA 2CJWB 3CBQA 1T5LA 1FW6A 2J9RA 2L0XA 2QN6A 2GXSA 5CYPA 1GTVA 1P75A 2WOOA 1N6RA 4IW3B 3T5GA 4B34A 3CNOA 3KKQA 1G19A 3TAUA 1OE0A 1KJZA 2C5LA 2EFDB 2VP0A 3P1JA 2IYRA 4OQXA 3K9NA 4KU4A 5EXXA 2MSCB 3PUXA 1XXHB 2QP3A 1EXMA 1ZRHA 3NVAA 4NKRA 5KSOA 4XWOA 4JKIA 2O8DA 2IK8A 2OT3B 3LVQE 4B2PA 1CJVC 4HB3A 1ZNYA 5BN5A 1J7KA 1MOZA 4TWZA 3ZDQA 4P4SB 1ANKA 4BUJA 4TLBA 4MYCA 4HLCA 2CJWA 1N2CE 2ZI6A 3QI2A 2V1UA 4NE2A 1GG2A 2J0UB 1E9CA 2PH1A 2ZRGA 4YMUA 5FPTA 4US1R 5GJWC 3EIEA 4P33A 1JR3A 2NTYC 3HPRA 5E7JA 1VKJA 3CB4A 3KKNA 5FL7A 4YMVA 3JVVA 2IWHA 1O3YA 4RZXA 3LQQA 4QJ4A 5BQ5A 2XOKD 1K8RA 2CEAA 1XXHA 3BH6A 1UBGA 3WHKA 2EYUA 2ECKA 3CPHA 5HKKD 3FKSA 1RRPA 3GLFE 3FPAA 1AZTA 4CZ2A 4XVQA 2GZDA 3CRMA 1W2HA 2GBLC 1I4TD 3P4XA 3VKHA 2FPKA 3VR4A 5JECA 1WXQA 1TUIA 2CCGA 2WJIA 1KI9A 2X19A 3UXMA 2BWJA 2YJTD 3QXJA 4BLTA 2J0QA 1OFUX 1H8EA 1UBFA 1IQPA 4JJZA 5GJVC 2V1XA 3CUEF 1DVRA 4OL0A 1IY1A 1IY0A 3P20A 2W2VA 1N6KA 5C18A 3T06B 1X3SA 1Q1ZA 2DR3A 3LW8A 2J0VA 2ZJZA 1D6JA 3W6PA 1FZQA 3K0EA 3WMFA 3DHWC 1MH1A 4BFWA 1A7JA 2QU8A 1Z0AA 4QJ5A 1VCNA 1XPRA 5M04A 2IYWA 4URXR 3VTKA 1DAGA 1XD9A 2V7QA 1G3UA 2F43A 3BFKA 4JBYA 1G8HA 2IEYA 1TQ4A 3KQUA 4TT3D 1E2FA 4MKHA 1Z47A 3I8XA 3GJ0A 1EX6A 1OIXA 2WV9A 1LV7A 3W9YA 2W0SA 1IN6A 1XCMA 2RKOA 3LNCA 1ZC4A 3X2SA 1DO0A 2BCGY 2AFHE 3KFXA 3VR6A 2XNSA 4EAQA 1U94A 1RW4A 2ERXA 3FMIA 4EQ6B 2VP9A 2FSGA 3UANA 2Q9BA 4GFDA 5CK4A 3PITA 5FTLA 5HZHA 2CBZA 3LD9A 1U99A 4NP6A 1T4GA 3IKJA 1OSNA 4V0ME 4Q4AB 3ICEA 1D2EA 4B74A 4ZDJA 621PA 1LVGA 1RIFA 1EK0A 1ZD8A 5JSZA 4PQFA 3IEUA 4HZUA 1BH2A 5P21A 2V55B 2ZAMA 3QENA 5FBLB 2MSDB 1EFUA 2OBNA 2IYVA 1TQ2A 3K1JA 1TU4A 1U98A 3ZVNA 2C95A 3LH5A 1XEXB 3OEEA 3R7WB 2ZRFA 3QF7A 3RSLA 5CDFE 3KQLA 2C04A 3GFOA 3QPVA 1FP7A 2O0JA 4II7A 1XD2B 4O2LA 4OI1A 3SDZA 1U0LA 1R5NA 2AXPA 4PQYA 2GVZC 3RVBA 3ZJYA 3TMKA 2ZJAA 4Q4AA 3ZZUA 3B82A 2H57A 2LCFA 3CWQA 3M1IA 4V03A 1GNQA 4D0NA 1HH4A 1UAAA 2QTVB 2ZRHA 3MD0A 4P4UA 3W6NA 2NO7A 3E2IA 4GSYA 2P3SA 4HLUC 4PR0A 3V4RA 1YR7A 5FOTA 2KE5A 1MRNA 1XEXA 4URVR 2ANBA 2F55A 1LS1A 4JIMA 2IHYA 3EW9A 1QF9A 3CH5A 1X86B 4DLVA 2P6NA 1E9BA 3AH8A 2IA5A 2YWEA 2ORWA 1BO6A 3IIMA 1CF4A 1XD2A 4AYWA 3PEUA 3GEHA 2UZIR 1G9XA 4LC1A 4QXAA 3TQCA 2ZPTX 4XD7A 4BRUA 4WXRA 5EUMA 2QQ0A 4ZV4A 2AD1A 2JLQA 3W8NA 1ZIOA 4ZCMA 1JR3D 3QBVA 3CNLA 2A30A 5FL7D 4RCYA 3NIBA 2CCKA 4PC6A 3LAWA 4PXAA 3UWOA 1J99A 2WJYA 3A1TA 821PA 2FWRA 4B43A 4GMDA 4LBZA 3ZS8A 1ZMXA 5CITA 4NYIQ 1XMJA 5DGXA 1UFQA 1G8GA 3FKSD 2Z43A 4I1VA 2QBYB 3RS0A 3BK7A 3EIQA 1MO5A 4QRHA 4IVPA 5JCPA 2O52A 4G1UC 3CX8A 4W5WA 5J4YA 2D62A 3GLFB 5F3WB 1ZUNB 4C2UA 4A36A 3ETLA 1SXJC 2BJVA 1OH8A 3W5IA 4HLDA 3K9HA 3HU3A 3KDSE 3LLMA 1JPNA 4JL5A 3AP2A 4CF7A 1E94E 1N0UA 3HPQA 3JZAA 4EJSA 2R44A 1H8ED 2QAGC 4WAUA 1P61B 3MFYA 3MLEA 1NP6A 5IRCD 3EZ9A 3AKDA 2QBYA 1ESMA 4URWR 1RRGA 3R8CA 1OH5A 1KO4A 1VDZA 3REFA 1KK1A 1S1CA 4AKHA 4TMZA 4NTZA 3SOPA 2V7QD 3GLGE 1KK0A 3OEHA 1Q20A 3GLFA 1A5TA 4PHHA 4DLRA 4HYYA 2CVFA 1X8KA 2QPAA 1KOFA 5FUVA 3H1TA 2H5EA 1ZD1A 3ICQB 3RS4A 3AP3A 4C0KA 3MWLA 1D9XA 4CW7A 2VEDA 3KQHA 1OXUA 3CRW1 4HEJA 1G5PA 1KY2A 3A1SA 3SFZA 5L8VA 4Q02A 2OM2A 2DHRA 2Y8EA 4KVAA 4Q1CA 3UMSA 5HCNA 2YC4C 1EG7A 2N42A 1FUUA 2HLDD 4LJ7A 4JLDA 1Z08A 2J7KA 5FBVB 4RCZA 4TMTA 1CRQA 2OCYC 1SZPA 1UADA 3C14C 4LGMA 3MGCA 1X8JA 5AUNB 2NGRA 1L4UA 5C46F 2B6HA 3KKMA 3EWAA 5LD2B 1W47A 1J70A 1XEFA 1UF9A 4JT2A 4QHYA 1NIJA 3OEED 1GNPA 1LF5A 2AHOA 2ZJOA 2JLYA 3IPXA 4NZYA 3HP1A 4TYQA 3KJGA 4AG6A 1W2GA 4OBEA 4Z8XA 3EARA 2SHKA 4A92A 3I61A 1GWNA 2JLWA 1T5IA 2QAJA 3FFAA 4K81B 1KSGA 721PA 5GADl 4J0QA 3R9IA 3FMFA 4IJMA 4NYJQ 4HDOB 3B85A 4IOLA 3LX8A 5J4VA 1HQYE 2OAQ1 3B60A 3RS7A 2F1IA 2CXXA 1KI1A 4D81A 4LPSA 3G5UA 1TPZA 3AGQA 4V0MA 3B6EA 1E4VA 4MKFA 1E96A 1C1YA 2R62A 4QHSA 2E1RA 4G5OA 2OZEA 4GL2A 1AGPA 1TU3A 4IDHA 2P0EA 4PO9A 1AKYA 1QHHB 2D06A 3RLFA 4IHQA 2OLJA 4DLZA 3SC3A 1FTNA 3A4NA 2ZJ2A 4Q1BA 5JEEA 3BBPA 3AVVA 4LDJA 4MRPA 1PV4A 1OXXK 3AVTA 2J5XA 3DKPA 5CDFA 1Y63A 1G5TA 2ZITA 4NCIA 4XD7D 2PLRA 3D31A 4Q1AA 1KDRA 5CLQA 2ZJBA 4OQFA 2WWWA 3NXSA 3LV8A 2EWVA 1COWA 2O8EB 3D6TB 2PLFA 2C2HA 1NNEA 4L16A 3C15C 4HATA 3GPLA 3X1YA 2ATVA 3LQRA 2FV8A 1QHHA 2Z4RA 4NMMA 4Q1FA 5SZIA 3ZQJA 2NG1A 4RFVA 2ZR0A 1S3GA 3CH4B 1L2TA 3KTAB 2ZRJA 3L0SA 3OIYA 1V43A 1G64A 1HTWA 1U9IA 1YVDA 1A82A 2JLSA 3DZDA 4LCBA 3CF2A 4US2R 1MT0A 1KJYA 1ZCBA 4ERNA 4ZI2A 4OK6A 3UMFA 2H8KA 1KDPA 5EE1A 5JRJA 1T91A 2JGNA 4XVUA 3THYB 3W8RA 2O8EA 4R98A 2NOAA 2F9MA 4D4MA 3B1XA 4JVLA 1P3JA 4QKQA 1RRCA 3RAPR 1OFIA 2KB0A 3FOZA 1IY2A 5KDDA 1P9WA 3ECCA 4YXWA 5A4JA 4WZ6A 2XB4A 3TRFA 5H8WA 3HJNA 3KXLA 1OYYA 1SKYE 5KPDA 2CMKA 1YR9A 2F3RA 4KFTA 3KTAA 3BWDD 3AF4A 3OAAA 1NN5A 5BN3A 1A2BA 1DAEA 1G6HA 4M1KA 5FUYA 1N6NA 2JLXA 3A1VA 3OEHD 4JL8A 2JDID 5EQTA 1RKBA 3RC3A 3W6OA 1GL6A 1CJMA 2AFIE 2VP6A 2XTMA 4Q7JB 2B21A 2FX3A 3CNNA 4QGFA 2BV3A 2XZPA 3THYA 2VF7A 2PJZA 1SKQA 3GLGB 4AIIA 4US0R 4OHVA 4IEIA 4I1SA 2WAYA 5JJLA 2ZE8A 2I1QA 5C1BA 3LY5A 1DG1G 4PTLA 4B32A 1BS1A 1LB1B 1TX4B 1Z3IX 2GK7A 2GK6A 1CULC 5H70A 1ZM4A 2WAXA 3LWNA 2GRJA 2VSXA 3J81k 3ND8A 2PMDA 2O8CB 4FINA 4TLAA 4F93B 1LNZA 2IF2A 2V6IA 3D8BA 3M0EA 2HT1A 2CCJA 4BLRA 2BOVA 1JXMA 1N3BA 3QPUA 1FX0B 4OHWA 4KSCA 1NSFA 5EP1A 2VTKA 2G0NA 3LBHA 2OXRA 2WWXA 5AJZA 2ONJA 4FI3C 1NG9A 2PT7A 1E1RA 1E9RA 2ZE6A 2BDTA 1XJ0A 3T61A 3VR2A 3GLGA 1N6HA 4TZ6A 4M53A 4P4TA 1JI0A 3Q72A 4GZLA 3DM9B 3SBEA 3T12A 2G1KA 1QDEA 4A8JB 1GM5A 2QM7A 2ZYWX 3I1FA 4P3YA 1NJGA 1GSIA 2ZRIA 5JJIA 4OK3A 3A4MA 1OB5A 1X6VA 3BJIC 4URUR 2O8CA 3GD7A 4GT1A 2C9CA 1DAKA 3QBTA 1RVDA 4TYPA 1D8TA 4CVNA 3R20A 3X1XA 3QVUA 4GMXA 1FX0A 3K70D 2PEYA 2G83A 3BERA 3AF2A 1XZQA 1VCIA 1ZJ6A 4UNSA 3F5FA 2ODEA 1KTVA 4PFSA 2QMUA 2WBLC 1QG4A 3BB4A 4JLMA 2FFHA 2QSZA 4AURA 2VHUA 3ND9A 2IEZA 2G3YA 4PZLA 1OH7A 1E0AA 4TN1A 4AG5A 4S35A 1OXTA 1WF3A 3IQWA 3O47A 2ZRAA 4KLNA 4ACAA 1CR0A 2NZJA 3DMNA 2PL3A 4DSTA 2FOLA 1XXHE 2GA8A 3DL0A 2BMJA 4KVGA 3RRZA 3CW2A 4BEJA 4BWYA 1W0JA 2HF8A 1FTSA 5EE5B 4HUTA 2JJ8A 4FIDA 3K09A 4TYWA 1F60A 1COWD 5EUQB 1UBEA 3I73A 5CK5A 2WMNB 2PX0A 4YC7A 5J4HA 2J87A 2FPLA 3WNBA 4F92B 1G4UR 2FSFA 2V54A 3AEZA 1JQLB 2C8VA 4E03A 5HPYB 4PHFA 2IUSA 1HYQA 2YOHA 1D9ZA 2XX3A 1AKEA 1WMSA 3CLVA 1J8YF 4QGAA 4MH0R 1AN0A 4RKFA 2ZU0C 1KKLA 4HAUA 1EGAA 2A2ZA 2GF9A 2ZSBA 1XJQA 2RGNA 3P4YA 4V02A 4C0SA 2PT5A 1A1VA 1XMVA 3B1YA 4EUNA 3WP0A 4NU0A 5BW8A 4A15A 2QP9X 1E2DA 3QXCA 4XTRA 1GOTA 1W4CA 1GAJA 4B44A 4YXWD 1G18A 3G0HA 3AUYA 2CK3D 1L4YA 1KJWA 2ZI5A 3GLHE 2IYXA 3RABA 2FPMA 3OAAD 3PXGA 4UQOA 3UKDA 5IT5A 3B5JA 2QTHA 1SKYB 3W34A 2ZS7A 2GDJA 4ZPXA 3SBDA 4BASA 2IYUA 3AVYA 2NPFA 1O87A 4LV6A 4LX0A 3U7EB 2YNMA 1BIFA 3PG5A 3CONA 2AWOA 4FMBB 1DAFA 2KI5A 5E95A 3B13B 1OFTA 1GFIA 4AWXA 3MWKA 2IWRA 4ESVA 2GJ9A 3AB3A 3GLIB 1UKZA 2H17A 1G8FA 3TGPA 3Q5DA 1DAHA 4A2PA 1KI4A 2DBYA 3TUZC 1VG1A 1Z2CA 4Z1MA 3C5CA 3WY9A 3X1ZA 4M9QA 3KKPA 5SZJA 2FH5B 3TR0A 5KNDA 1E1RD 1GILA 1Z5ZA 4ZI3A 3T1QA 4JVSB 1YU9A 4IVRA 1G7SA 1S9HA 2BMFA 3SI7A 4MGZR 1MABB 4G5RA 4BE7B 1UKEA 5FOWA 1W36C 1UEJA 3BIFA 3DEFA 5CJ2A 2N1BA 5SZKB 2IS1A 3P27A 5BXQC 4EJSC 1OV4A 3TAHA 4Z51A 2YHSA 4DCSA 4M1WA 4DSNA 1M6NA 4OQNA 4JL6A 2A5JA 2WOJA 1KMHB 4M1SA 1ZP6A 3FTQA 4DSUA 4DCTA 5F98A 1P72A 4NYMQ 5KPJA 4YDHB 2FE4A 4MA4A 1ZCAA 4K8OA 4QNMA 4E22A 1AK2A 5FR2A 2DY1A 2IUTA 2QT0A 1CIPA 4NYMR 2PMKA 2GCOB 2X1VA 4DLUA 3QKRB 2HV8A 1Z6GA 2IS6A 1XCGB 2XNDA 2J41A 3DZ8A 4KFRA 3K0CA 2CHVA 4QHTA 4DT1B 3TNFA 4E07A 221PA 3W3ZB 1XEWY 2V8OA 2AR7A 5J4KA 2YOFA 1WRBA 1EWRA 1YRBA 2ASEA 3L82B 4UKDA 3NTUA 4N0EA 4RZ3A 2ZS9A 5JZVA 1KMHA 1QHGA 5AK0A 2OEPA 2OCAA 4TL6A 3UG7A 4KSBA 3MCAA 4M1YA 4ZCLA 1W0JD 2ZUBA 2W6JD 1XPOA 3O8RA 3ZVRA 2V4ZA 1LTQA 4KAXA 3PQCA 4IKEA 4TL7A 4C0AC 2HYIC 2GCOA 4ZDWA 1P6XA 4JSYA 1VYUA 4HZIA 1CR2A 2OG2A 1KDOA 4DT1A 1QHYA 3BH0A 3QEJA 4FW9A 4BLPA 1KO5A 4BLSA 1KMQA 1PLJA 1NJFA 3W3AA 1F5NA 4C9BA 2VP5A 1E9DA 2D3WA 4C0LA 4POAA 3MSXA 1HEIA 4A0FA 5DO9A 2O0KA 2C99A 4P32A 1NL3A 3MJRA 1SVMA 2RGAA 2KJQA 3D7MA 2DFKB 4E5UA 3AVXA 4ASUA 3EZFA 2FJUA 2FEOA 2OHFA 2RCNA 5EXSA 3R9XA 2R6AA 2WVJA 4JLBA 4R2HA 4D82A 3K70C 4P4SA 3THXB 2CLDX 1N25A 3V9PA 3DMDA 5JWOA 4M8NE 1SQ5A 2J0UA 4NONA 2V9PA 3L8YA 2VF8A 3I62A 4RFSB 2QNRA 1E99A 1EWQA 1NLYA 3GLHB 3ZQ6A 1G41A 4KO8A 1FUKA 1T8TA 4ZIRB 1NIPA 2FFAA 4BLOA 5LB4A 1K6MA 2GJKA 3EAQA 4X8HA 2IS4A 4WVFA 3K0AB 3KUDA 4Q18A 3LXRA 3MJHA 5G40A 2FEMA 4Q1EA 3BD9A 2FNAA 3AUXA 2EU8A 3THXA 5GJCA 1NRJB 4OI0A 1KK2A 4M22A 4CEIB 1XBTA 4PZYA 4LK2A 5DI3B 1R0XA 5A5GA 4GZMA 5E7IA 2GXUA 1S8FA 4GOXA 3BH7A 1T3HA 3GLHA 3NHBA 3VHLB 4CDGA 1YR8A 3L0OA 2IYTA 4RD4A 3W5JA 4MITA 5KNCA 3AV0B 4ZIRA 3U61B 4DLWA 2HJGA 4TMXA 1KI3A 2QGZA 2BEJA 2PCLA 2CL7X 4D4JA 3TSOA 3PJRA 4OKSA 4NCHA 2C9OA 2LKCA 1IOZA 3UATA 2ERYA 3U44B 1KO8A 4X8OA 1Q0UA 1ZINA 3GJ4A 4PQRA 1XZPA 3VR1A 4FN5A 4Y0AA 3U7HB 2KSQA 5J5CA 4CEIA 1Z83A 4AKEA 2IYYA 5E3HA 1P7CA 1II0A 5DI3A 3H84A 3WBJA 1S2MA 2ZI3A 3RHFA 4TQAA 2XTZA 1GKUB 1GITA 1GUAA 3OZXA 2WTUA 1N5IA 3QXXA 1P2UA 3EG5A 5GJBA 3EPHA 3ZYCA 3SQXA 5L3QB 3VQTA 3GJ5A 5F9FA 1CXZA 2ZI7A 3IBGA 3P32A 3BXZA 3DVLA 3GFTA 3KB2A 2G77B 5EP3A 4EQ6A 5LPNA 2JEOA 2BC9A 2XNDD 5B2ZA 4XSGA 2QSYA 2DFNA 3U44A 1G6OA 1S3SA 1G21E 3HU1A 2FSHA 4G5QA 3U3KA 3HR8A 4OJKA 1OJLA 1WQ1R 4QBFA 1RE0A 1DARA 5AUOB 3HDTA 1AA9A 4UNQA 4D4KA 5JMTA 1PVOA 1KNXA 4QL3A 4XWAA 5TXGA 4W5JA 1Q22A 1LFDB 3A1UA 1XTRA 2ZRCA 3EZ6A 3TR5A 3QF4B 1MO6A 4HAZA 2Q6TA 5L3QA 1G7RA 2BM0A 4UNPA 3R7WA 2QP4A 4DCVA 1Z6XA 2VO1A 3QY0A 5FBQB 3THOA 1SHZA 4A82A 3GCGA 4BZXA 1Q21A 2ZVQX 3K9LA 5KUTA 4D80A 2GJAA 4YONB 1PJRA 2GCPA 4CT5A 2MMGA 1NF3A 1HT2E 1TF2A 1NVUQ 3SJCA 4DIEA 4OHYA 4JYBA 1SVKA 4F7WA 4TYYA 4M21A 2DCUA 2W0MA 3QF4A 1J2JA 2B7BA 3GMTA 3MRSA 1XX6A 1N6OA 3AM1A 4ASUD 4LYHA 1CP2A 2HCJB 3SE0A 3I5XA 3E70C 3EPKA 4OQMA 4B3XA 4CGZA 1TQDA 2R6CA 2ODWA 2ZREA 2ZRNA 4MRVA 4LJ4A 5DYGA 4AK9A 4TLDA 2VHQA 1XP8A 4OQLA 1W7AA 1NG1A 4GP7A 2F9LA 4HLQB 3SU8A 1P2VA 1E98A 2XXAB 2XJ4A 4OJQA 2J46A 2HT6A 1U8AA 3CRQA 3T34A 1CRPA 2FGJA 5CIWA 5GVRA 2Z6VA 4AKGA 2FFQA 4R71A 3ADDA 2HUPA 2Z83A 5D3QA 3C5HA 3GQBA 4DLTA 2GHIA 2QMHA 1E3MA 5BYJA 3WHLA 5ELXA 4B3DA 1HQCA 1H8HA 1XJCA 3K09C 4GNKA 1CJKC 1OFHA 2ZSEA 2EFHB 4GP6A 2HDNB 2VPPA 2GVDC 2WHXA 2YWHA 1NLFA 2RB4A 4QBGB 2TMKA 3NBYC 5KHOC 2B8WA 1RC8A 4TYNA 2XXAA 2P2LA 1F2TB 5FUXA 1Z29A 4RD3A 3BAFA 4JLPA 4B47A 1G3MA 2IW3A 1OF1A 3U6BA 2HYDA 3W90A 2VHJA 4FCVA 4HAXA 3LO5A 1ZYUA 2A7QA 4AD8A 3SR0A 1Z6YA 3UK6A 4X8MA 2H1LA 5JLJA 1IHUA 3AF3A 2VLIA 2RGNC 4N0DA 1ZM9A 1SGWA 3GEIA 4HAVA 2RHMA 3CKLA 1ETUA 3X1DA 4MGIR 4A2QA 1MO3A 3VKWA 3PCRB 1US8B 3A37A 4MUAA 1P2TA 4TMKA 2CNWA 5IDVA 1IJFA 4NCJA 1OKKA 3PENA 3IILA 3KUCA 4DDTA 2J7PA 2NZ8A 5LBIA 2CE7A 3VR3A 3B9PA 2GETA 4L8GA 5TB5A 4AYTA 3DM5A 4GOKA 4G01B 4LYFA 4YDSA 1T6NA 4QFMA 4CT4B 2AL7A 2PBRA 1L7VC 3ZS9A 3CWZA 5FL3A 4DVGA 1IBRA 1YZTA 2GKSA 4FMCF 1KY3A 2GJSA 1C4OA 4FMCB 1US8A 4YQFA 1AGRA 1C9KA 1SXJE 4DUGA 4OI4A 5KDOA 4D25A 1ESNA 1NSTA 2PZFA 2QMOA 4L5BA 3I8SA 4NCKA 3Q9LA 3N70A 3KXKA 4XTCS 2W00A 3IGFA 4NH0A 3EC2A 2AK3A 5KSPA 4JBWA 4FXPA 5G3YA 4L9SA 1FQJA 2KWIA 1GP2A 3N5CA 1YQTA 2PCJA 1RYFA 1UDWA 2WICA 3U60B 4KHZA 3RS2A 4LJ5A 4F38A 1Z0KA 2FMXA 3MUFA 2V3CC 4R2IA 2VSFA 4ARZB 3DKVA 5FOUA 4ZDIA 1QHIA 2RGXA 1CU1A 5CYOA 3VAAA 1DTSA 3SJBA 1P5ZB 2FFBA 1NVXQ 2GESA 4BZQA 2ONKA 4AY2A 5C4GB 4RZ2A 5AJYA 2D74A 1M34E 4XH9B 5DYIA 1ZM2A 1NN0A 1JEDA 4AYXA 2ZE5A 2DYKA 4DJTA 3ASZA 4IXNA 4ZDKA 2D7CA 4I1OA 3D3QA 4TZ0A 3EASA 4MGKR 4Q5IA 3L43A 3QVVA 1M1YE 2QMEA 2GNOA 1KSJA 4JSTA 1Q1BA 4LHYA 1KO7A 3MWJA 3JZMA 2C96A 4CIDA 3ZLJA 1ZW6A 5HR5A 2VL7A 2ZROA 1E9AA 2REBA 3RS3A 2H7VA 5EXPA 2Z5FA 5TV2A 1N0WA 3C7KA 3B1ZA 1UKVY 3PEVA 3QJYA 4LHZA 3V4FA 3LBNA 2E87A 4JS0A 2JJ1A 1VIAA 1H8HD 2CLCX 4KYIB 1U81A 3A58B 5HTKA 4JBXA 2BMEA 4YMTA 3F8TA 2C77A 2ZS8A 4LC0A 5E4FA 2YYZA 1E2NA 2G1JA 3NDBB 1QHXA 3TVDA 4F4IA 3VKGA 2XSZA 1Q1EA 2ORVA 1QHNA 1ZBDA 3NWJA 2VQSA 4OI2A 5J40A 1UPTA 3VR5A 1WE2A 3CIOA 3C41J 2IXEA 3AVOA 1E2GA 1YRAA 2ZVPX 2Z0MA 2CHQA 5EE3A 1XMSA 3RANA 3VFDA 1BMFA 1N6IA 3CPJB 121PA 2GJ8A 2Q0HA 2GAOA 2QG6A 3LFUA 3GLIE 3IDQA 4JT4A 2OBMA 2OLKA 3ASYA 1JJ7A 1F2UB 1BKDR 1KKMA 3KFVA 2UZ3A 4WA7A 4WBSA 2FGKA 3HR7A 5JCZA 2REXB 1XRJA 2F1HA 1GL9B 1ZD9A 3LA6A 1VCOA 2A5GA 2ATXA 4PAOA 3TQFA 5ANRB 1OLOA 1BYUA 1Z0IA 3Q7QA 4DXAA 2CNWD 1M7BA 3AKYA 4PPQA 3SS8A 1OKKD 4A0RA 4HAWA 2BMDA 2WIBA 1AS3A 2EFGA 2VP2A 1E69A 3H0KA 2OFXA 4KV9A 2J7PD 3TK1A 4A0HA 3NEJA 1FFHA 2WKRA 1N6LA 4TTQA 4DEYA 3GP8A 1W44A 2IXGA 4HLUA 3T1OA 4MDFA 1E32A 1F2UA 3VNUA 2QUZA 4C0QC 2BKUA 4Q7LA 1M74A 1IONA 3PIRA 4LZZA 4NPHA 1E2HA 4MDEA 1E2IA 2XZOA 4JZKA 2VHTA 2WWHA 3X1WA 3BFXA 2ODBA 2UVQA 4DUGD 2IYQA 1UBCA 4MYHA 3T1VA 1N6PA 2P67A 1XTQA 2WIAA 1KNQA 1GL7A 2EFCB 4ZO4A 1CS4C 3PFIA 3EA0A 4PC1A 3PV0A 4JKYA 1NN3A 3FMPB 1SXJB 2GEDA 2FF7A 2O0HA 4B6FA 2DWOA 2EQBA 2Q21A 2RH5A 3U3JA 4Q66C 1XTJA 4RD2A 1YE8A 4A8JA 4DCUA 4BFVA 2W6IA 4D26A 1J90A 2QAGB 2VBCA 2AX4A 1S9DA 3QKSB 4Q1DA 2WSMA 4KITB 5EP2A 2R6DA 4DCNA 2R6FA 4QGHA 5BYKA 5K8LA 2QPTA 4A0GA 4PHGA 5G41A 5HZKA 4BRWA 2B8TA 2JCSA 2JLUA 1OPXA 1HY3A 2ZU6A 5EXTA 4D2IA 3AVWA 1SXJA 5KYKA 3IIKA 3IPYA 3AQ4A 3SN6A 3SYKA 1SVWA 5SZHB 2D2FA 3EZ2A 1FQKA 4HDQB 4A6PA 1KK3A 3LLUA 4NBSA 3C8UA 4Q9LA 2QAGA 4FCTA 5FBRB 5FTKA 3ZVMA 2PJRA 2ZANA 3NH9A 2OUKA 2P65A 4HAYA 1E2KA 3QKSA 1CBUA 4OHZA 3OF5A 5FPKA 1UM8A 3N2EA 4XOIA 3ZVLA 4GI7A 1NN1A 4K46A 2JATA 1F3OA 2MSEB 3U5ZB 1B23P 1W4BA 1SVOA 3HWSA 1XPUA 4V0KA 4HB2A 1YZGA 2RGCA 2Q9AA 1T9HA 5FI1B 1R2QA 3KQKA 4HB4A 5CLLA 4KBFA 1Z0JA 1IN5A 3ZZTA 1NBME 6Q21A 4EDHA 3BFVA 4C30A 2OCBA 3PVSA 4PX9A 2FA9A 3QEOA 5FR1A 1NKTA 1VHLA 4QG7A 2QRNA 2JJ1D 5DN6A 3PEWA 3Q5EA 4TL8A 3AVPA 1G7CA 3GJXC 4CEJB 1HV8A 1OXSC 4KXFB 1KO1A 2XSZD 4Q4JB 5L3VA 5KNBA 2GAAA 2VYFA 3OE7A 5FPHA 3IUYA 3LDAA 1KHTA 4FWIB 5B58C 2IBMA 3CM0A 4V0LA 2NMVA 1ZUIA 2ZJ5A 5AJXA 4TSFA 4BFXA 1N5LA 4TLCA 4B71A 1BMFD 2QT1A 2ZYVX 1ZUHA 1YHNA 1IN4A 1DAMA 3RSOA 1Q3HA 4S2EA 3EIHA 5TARA 1P9RA 4PHTA 4AKIA 1AM4D 4MYUA 2ZQ5A 2BVNA 2HXSA 4PSVA 2OFOA 3LVRE 1Z2AA 3ZD6A 2XEXA 5EE9A 1R5BA 4CEJA 3UWKA 2FSIA 2G9NA 3AGPA 1TMKA 4Q4JA 1E2EA 4V0OA 2OV2A 1K5DA 2JIZA 4G5SA 4ILEA 1R10A 4C2TA 3WMEA 3EXAA 4V0NA 5AUPB 2QENA 4P0TA 4ABYA 4LBVA 3IIJA 3QXHA 1P9NA 2JLZA 2HCBA 3NHAA 4RKEA 4URYR 3U3MA 5H68A 3FHCB 1E2PA 4MUBA 5G53C 4Q4LA 3CX6A 3CR7A 2REOA 2ZRDA 1I4DD 3DOEA 1U90A 4C0JA 5GVSA 3GLIA 1NVVQ 1TL7C 2OAP1 4DLSA 1JECA 1NKSA 1N0VC 3WYAA 3DPUA 1OT3A 1ELOA 2YV5A 1EFHA 1NVVR 4TMVA 1K5GA 4QOSA 1JALA 4UNNA 5CJPA 5CM9C 5DSZA 5F2EA 2X2EA 3KB1A 1FNMA 4PC3A 5CB8A 2W83A 1S4QA 4Q9JA 1P2SA 5JHGB 2ORIA 1YKSA 1SVLA 1ZAKA 1YZLA 2A5FA 4D0LB 1AS2A 2C9YA 3V00A 5FPSA 2H16A 4WXPA 1P4SA 2XITA 2EYQA 1VMAA 1VHTA 1MABA 1NY6A 2ZI4A 1KAOA 2I4IA 3LRPA 1GDDA 2W6ID 3QG5A 2OESA 1Z06A 2AK2A 3DDCA 2ZRMA 4BEBA 2GZAA 4Q4HB 2KBFA 1JQJC 4C0HA 2BKEA 3O8CA 4F91B 2QQEA 2R2AA 1CJTC 2IYZA 4UNRA 2XZLA 3CO5A 2O8DB 4LRWA 2D4HA 1KSHA 3SJZA 4Y0VA 1VYVA 1Y3AA 2NO1A 4B48A 2IT1A 2W2TA 4XWKA 3FWYA 5KO2A 1NMYA 1SXJD 3SFVA 3CRVA 1KZGB 4ZKEA 1KGDA 3QKRA 4HUQB 3MG9A 3WYFA 3NBFA 3QE0A 3RRYA 4Q03A 3L2OB 4BLQA 3UIEA 3A36A 4BFZA 1UEIA 4Q4HA 1X8LA 4IOMA 1ZM7A 3GFPA 3CF0A 3KJEA 3NC0C 2O8BB 5JBQA 3BRWD 5FOXA 4X8LA 2GWHA 3LW7A 3VHXA 3A6PC 4D0GA 2BBTA 4EPRA
chains in the Genus database with same CATH superfamily
1GZ3A 2YUTA 1GAXA 3GZNB 4IXMA 3PCXA 3ZZ0A 4PYOA 1Y6QA 5K4AA 4A6DA 2FZWA 1V3TA 4PFKA 1AQUA 1JIIA 3A2LA 3FE2A 3UJ9A 4DBLC 2JFUA 3PA6A 5FADA 1FF9A 3M6VA 4XX0B 5EJMA 3WNQA 4DDVA 5JC1A 1THTA 1EDZA 2OKCA 3TXXA 5DHAA 3N2KB 4MWGA 4X1KB 5JNUA 1LI5A 5C9ZA 3JPYA 5LD2C 1O89A 1BOOA 3FF1A 3N86A 4IEEA 3KUUA 5JCJA 4EHAA 2OSBA 2WVGA 4YQYA 4K87A 2C9DA 2VJAA 3RSHA 1BFDA 4HGYA 3UXHA 4M83A 1OGJA 1YGPA 2IEAA 3DBLB 4ZCTA 1TJ5A 5ITZB 4WINA 2O8BA 1E9SA 2AMVA 3UGJA 3MWDB 3OFKA 4QU9A 4Y1RB 5B57C 4I1RA 4PV7A 4XIYA 4P3NA 4EG0A 2HU5A 3SHWA 1LNSA 4BZPA 2D8AA 4TSFD 1M2FA 5G1OA 3K0FB 3W06A 3PLAE 3EB9A 2B1JA 4KC0A 2O5VA 4Y98A 5FFNA 3I9JA 4IQGA 4TVBA 3AJRA 1HNXB 3V48A 1TI7A 2B8EA 2Z4SA 1WLSA 4RVGA 1SUWA 2KBEA 1EWKA 4ABTA 2GT1A 2IODA 4C5AA 2FRVA 3KJXA 2M9MA 4CM5A 4R4JA 1R37A 1GGJA 4PRZA 4CMAA 1BJTA 1ZK3A 2OC4A 4DTIA 2B0JA 2UYQA 3HA2A 3GH3A 2I3ZA 1G2IA 1L8QA 2PEZA 2A8YA 1OX4B 4I36A 4RFSA 4BV2A 1SKBA 2AYYA 3NIGB 4GI3A 1NI4A 1WDTA 1AQYA 4XGKA 1JDBC 2YY6A 5CLJA 2QW0X 2PN1A 1MB2A 3UMGA 4EFDA 4MAMA 2R47A 3CZ9A 2IDKA 3ZU2A 4JQZA 4L5AA 4CG1A 1XTUA 5F1OA 3JTEA 1TM1E 3C3YA 2N75A 3BE4A 2BF4A 1HE3A 3DAPA 2CJXA 3EGOA 3MTDA 3F78A 3QVKA 3UGTA 5GOZA 4CJXA 1S1MA 2G28A 4HDRA 3VDNB 1QH9A 1ZCZA 4S1OA 1WXWA 3C3JA 5EJAA 4C07A 4HZUB 4H7IA 3RJZA 2AOUA 4H3SA 2F3TA 1V11B 2V7UA 2VLBA 2FR8C 5IK2A 3STYA 1I2DA 5DBFA 1AQNA 3FFBA 3LUDA 4MB2A 1II8A 1UODA 3BHJA 2G9VA 2JASA 4UXIA 5LSAA 1GPWB 1VHWA 4FC6A 4EA7A 2LXNA 3BF7A 2FW9A 1STOA 3JV7A 3KVRA 2BN4A 2WQZA 4IOJA 4KODA 4AMVA 1HLDA 3STXA 1MIOB 4UE6A 3Q2IA 4LYEA 5IAOA 1CR1A 4OK5A 4BFSA 5C31A 1O5OA 3RSZA 2ZKLA 4RW0A 3SEAA 2HLDA 1Z33A 3CF6R 4I8XA 1M8PA 4B3GA 3ZIAA 2XWQA 1SCUA 1R0LA 2X2PA 3FVVA 2Q2NA 1XLVA 2P5SA 1BS2A 1U0JA 4XE5A 3TOZA 3OM0A 4K03A 5A9RA 2IVFA 5IF3A 1FNNA 1ECCA 3TXYA 2P6RA 4CV2A 1P0PA 4MV3A 3ET5A 3H65A 2VT7A 3QUSA 4JLUA 1A5SB 1OBCA 1T5BA 2PX3A 2RARA 2BSAA 2V7PA 3O0DA 3NP7A 4NCNA 1YB7A 1T3LA 5CHYA 1TF5A 2FRDC 2I2CA 1IWOA 4G67A 5HE9A 3TLAA 3SYLA 3BZUA 4EFLA 2QM8A 3DTVD 3NKVA 2OXEA 4HEHA 4I50F 3TDKA 3TJRA 1D4FA 2REQA 3JWEA 5HUHA 2WFMA 4DWVA 2FDCA 3PPIA 1JDSA 3JWGA 1OMOA 4FD2A 1GGMA 2BHSA 5KB3A 5G0TA 1UXOA 5CB0A 3JRWA 1FLVA 2HFJA 4MPJA 1R0BA 1YZNA 5HK9A 3G9XA 3KSZO 2H92A 1T6BY 4OXYA 4HQRA 2AN4A 2ZTLA 1DU4A 2ZYUX 5FUQA 1W48A 1NVWQ 1FDWA 4EVSA 5LM3A 1TJNA 4BMCA 3B7PA 5IJWA 5CH5A 4MKRA 4EG5A 1QKJA 2P1ZA 3JQBC 1NSYA 4PO1A 3H1BA 1A9YA 4OJYA 3WLQA 4A91A 4AF7A 5ALJA 5BRJA 1QHSA 3AXTA 1WM1A 3B3QA 2JLRA 1DEKA 3V34A 4W5HA 2PU5A 1D3AA 4MS4B 3BIXA 1G1MA 4OBBA 3O74A 2BFNA 4R41A 3A06A 4I50A 2IX3A 2ZYAA 1L4EA 2ZXUA 1QZ3A 4NENB 2P78A 2H8GA 2EX1A 2PIAA 1WW3A 2LV8A 4LFCB 4C7JA 5DIZA 3B1WA 2F1JA 1HFKA 1LC3A 2HRBA 3URMA 1WB9A 2A9KA 2XNJA 3FMOB 4IIJF 2X2FA 5KNCD 1GZ7A 2I4MA 4FFVA 1J8DA 1RADA 1TUBB 2BI8A 1NF8A 2VPQA 4HNUA 4Y9SA 3HJFA 1N1GA 4CHGA 3TOSA 1FRFS 4A8JC 4EJSB 1K5PA 4RXMA 5K8UA 4JXXA 5LQMA 2QEQA 1G4AE 4P7FA 5DLQC 1YBFA 4MVJD 4RPIA 1S2NA 8ABPA 3PE4A 4B76A 1XMQB 3VVMA 1I5OA 2HGZA 4P3PA 1QV9A 4DNXA 3QFFA 4ND2A 3QSYA 2UU9B 2BBOA 4JMPA 4ZRNA 3O4GA 3QUAA 4NYIR 4DR7B 2HQBA 3L06A 3LBAA 2VRWA 5BN4B 3SIXA 1FW8A 1P0MA 1W0KA 3EXFB 1N5JA 5DEIA 3RRMA 4M1OA 3T1TA 1DO8A 5ALZA 2OAEA 5B7PA 4UQLA 1GRRA 2J4DA 3E9CA 1TT7A 3WRYC 1YQDA 3GGOA 3TNLA 2J3EA 3M4ZA 4ZJYA 4K26A 1SUDA 1Y5MA 2B20A 3C6XA 1U8UA 1IZYA 1MLDA 1TFUA 5AI5A 3R6DA 1I30A 4G3XA 4ESHA 1HLPA 1JP7A 3QXSA 4MUIA 1LVHA 4JP8A 3D2CA 1HE1C 2O4UX 3LU1A 3DCNA 3FNIA 3UQZA 2PWYA 4BKQA 5CXSA 3LY7A 1RHMA 2PKCA 1MJGA 2OBXA 1RWVA 4RNDB 2FJPA 5IP5A 3WZ2A 2GEVA 3QQ5A 5G0UA 4CPDA 4D9GA 1PR4A 1L8OA 1U0HC 1N3LA 1GFZA 1QRAA 3L79A 3PR1A 3LCVB 3ZDYB 1R0YA 4L2IA 4LXHA 5D7BA 1UFOA 4KW7A 4RJLA 3LHFA 3PFHA 5FDFA 4D9KA 1N33B 4L07A 4BE4A 1VG0B 4XGIA 3W3AH 1BA2A 2I71A 2YJ4A 4GPIB 1VJ5A 1FTQA 1PUIA 3OWHA 3U7GA 1E2MA 5COAA 2XJ9A 3NBXX 1NMZA 3PVZA 4X6UA 5T8KC 4J9VA 4CXMA 3ON5A 3DT6A 3PYMA 4CEHB 1TM3E 1GVNB 1ZICA 3FGNA 2BFFA 2CHGA 3FMVA 3LX5A 1UWKA 2NU7B 4H1TA 1VSBA 2NXJA 2X0KA 3PLRA 1HTTA 3MC1A 3BAZA 4B3FX 1M5RA 1K2VN 2AFHB 2IUEA 2A9OA 3FUXA 3L0IB 2HU8A 3ID6C 5FYQA 1PS9A 1WCIA 3IR6A 4GSKA 2E6UX 3R6GA 5JD6A 4HNAA 1XWIA 5HJ5A 1VE6A 2W2LA 3RVKA 3QYPA 1CZRA 2SECE 2PKQP 1C3VA 2PR2A 1QQTA 2DWPA 4IG9A 3U37A 2XAUA 1I9GA 4J1TC 3TSCA 1OILA 4OMCA 2HV9A 1GN8A 3UFBA 5EIBD 5KTKA 1ZH0A 2QIPA 3HV0A 4BMVA 4Z0NA 1JAXA 1E8NA 1NXPA 1W4RA 2HBQA 2QD3A 5D3MA 2IXBA 3V1YA 3HUDA 5E0KB 1RS0A 3F5SA 1R9MA 5DXFA 4HH3C 4GDFA 4WZAB 4ML3A 1YD7A 5A0FA 4Q21A 3EVBA 2GYUA 5HMMA 1NBAA 3FHOA 5FLXA 3H5TA 3WGOA 4RMIA 3HFSA 3RYCA 4BGDA 1GPH1 2PS9A 3H04A 2NVUB 3H83A 2N1MA 3VZSA 2WJHA 4LHWA 1MVLA 4R3UC 3RAGA 3Q8MA 2A9RA 1IWPB 1T34A 2FG7C 3OCZA 2PMEA 4PPFA 4B6JA 4KJZA 4AY5A 1QVVA 3P9IA 3VOBA 2JA1A 3X1MA 5KTYA 2XQJA 3A4LA 2HJHA 4OSEA 4NYJR 4KXYA 4QFDA 2YXBA 4FKMA 4REOA 5CMLA 1E1YA 3OIWA 1UXJA 4MQEA 2HNAA 1TAGA 3DL7A 3VAYA 2R65A 1JAIA 4LG1A 4L5JA 2OCPA 3HVUA 3SIRA 3A8TA 2NLOA 2QTGA 3RWBA 1UL1X 1NMQA 1IM5A 3I37X 4DHEA 2Q46A 1SHLA 4MP6A 5BW6B 4EYKA 3ZD7A 2R6GA 3R3XA 2FXIA 4E5VA 4LPKA 4TTRA 1Z4IA 4I5FA 2W5UA 3IXQA 1K75A 3BKXA 5JMPA 1U3GA 5AVJA 1BCRA 2PBZA 2ZP1A 4B3CA 1NJSA 4PQEA 2O6HA 2VKQA 3LT4A 4LBWA 5LN1A 4O25A 3C1TA 3KPJA 1RLOA 3V4PB 1C7IA 4KQ6A 2OD9A 1V8DA 1Z4PX 2J0SA 1CNMA 4CF5A 1FFYA 1XWWA 2P79A 2GXQA 3THSA 2ZETA 1Q57A 1SOUA 4HDMA 3K0CC 1WPQA 2QZ4A 4JENA 4D7AA 3BE8A 4C7OB 1ZC3A 1EXVA 1RCUA 4P7GA 3EZ7A 3GC6A 2GCNA 1AOXA 3M6AA 3NT2A 2DQZA 4S1WA 3L4KA 5GIPE 3D6MA 2X0FA 1KA9H 1XR3A 5JDCA 1W94A 2YZKA 3Q2KA 2WKPA 3R4VA 3CVJA 2QVGA 1NPYA 4KXMA 3HB0A 2V5UA 2VHCA 3GVHA 3RYTC 3K6JA 4H9GA 1TF7A 6YASA 1MRZA 1O6ZA 4D41A 1Z7YA 3DZGA 3OKAA 1PJ3A 4K9OA 1G8KA 1I7NA 3NYIA 4NFYA 4JC8A 5JNLA 2O8FA 2P35A 2CD9A 5ECWA 1EHYA 1YZKA 3D6HA 4YRLA 2PMBA 2R5WA 3OOYA 1Q0SA 4IS3A 4B35A 1TO6A 3ELYA 1ZW1A 1UBNA 3S2IA 5ILOA 1DTEA 1UFRA 2BM1A 3FNRA 3GLRA 3P26A 4JJFA 4MQFB 3TNYA 1CDEA 2EWMA 4MV0A 5EWJB 1GQ2A 1B73A 1RHQA 3KT6A 2ONCA 2P41A 2GBPA 4TZTA 5DB4A 1QRTA 3S2UA 3RU3A 2XKAA 2WWVD 2Y1XA 2GARA 1GQQA 2PKRA 4WN9B 2WPDD 1D03A 3HZRA 1RPTA 4ZO7A 5FBWB 4IGEA 2IV3A 1VKRA 2EF0A 3P2KA 2XVYA 5LZ5A 3WP1B 4AJJA 4QT4A 5DT2A 3SY8A 4RDXA 2XB9A 2J4FA 2H5LA 2X22A 4DWJA 2PZBA 2Q3JA 1H2EA 1Y6GA 1AKRA 1CQXA 3M3HA 3SYNA 4JB3A 1C0KA 4I08A 2J8ZA 4KO3S 5FORA 4MMXB 1XMIA 2KLHA 3L3BA 4N40A 1JTEA 3HACA 3UJPA 3MEQA 4KQKA 3MA0A 2PYZA 1CJUC 4JB2A 4H1UA 3O8OA 4FD3A 1E9EA 1CJBA 4TKUA 4WLOA 4KHPB 2HDWA 5LB2A 2OOSA 5FV4A 3OA2A 2NQTA 5TVKA 4DB2A 3RC2A 1G0OA 4DBZA 3AXSA 2R6JA 4QWMA 13PKA 4JNKA 2WT9A 3HBJA 3TZQA 2JFQA 2GUWA 2WWIA 5FJJA 1CKEA 1C1DB 1Z2OX 1G8PA 4UXHA 1QNLA 4WN3A 2OHGA 4Q7MB 1YB6A 1C0IA 2AJTA 2OO7A 3LK7A 2CZQA 2P9HA 3COSA 1FPMA 1D2NA 5I7WA 1BOFA 1PLLA 1WKCA 3NH6A 1YRLA 4JJKA 5CX1A 3VTAA 3EX7C 1YRWA 3B7WA 1WZEA 4H7PA 1NZFA 2XE8A 1L5QA 2ZCUA 3BMQA 1DBSA 5FBZA 3WBBA 4LMRA 4UTVA 2ZSIA 4CL2A 2CBXA 1ZHOA 4N6OA 1XNHA 2WZDA 3HY6A 3PQ8A 4GI5A 3UUEA 1YIOA 4PVDA 1UQTA 5JSKA 2Z9DA 4A2CA 1KC1A 2VP4A 3LX4A 4RX1A 2XYVA 1AO3A 2J3QA 4OGWA 5IUJC 2BBSA 1KR5A 1O9BA 1MPXA 2AFRA 2WF5A 3P0FA 4GOJA 4KLAA 3UWSA 3WQBA 5SYNA 2WKQA 1MX1A 5JANA 1HFJA 1CZHA 3HSKA 2Y9MB 4LI0A 4INOA 1T4CB 1DXHA 2AC2A 3HGQA 3H6GA 4OBWA 1DC7A 3QVMA 3C1AA 2CV0A 4QPCA 1O96B 1T0IA 4MROA 5HJEA 2JI7A 2ZIWB 3IYLW 1FU7A 1M67A 3OETA 3P19A 2WU0A 5JUWA 3H86A 1GEEA 1BW9B 1T8RA 4BFUA 3FDIA 4YAUA 4PLHA 1V1RB 2ZYTX 5ESRA 1Y4UA 2DSNA 3GJ6A 5KQLA 3SICE 4IIEA 1A4RA 1DQRA 1KPIA 3HCDA 4BTEA 4ZCIA 1HPLA 1FP6A 3D0KA 2DECA 4LXGA 1IH8A 1YZUA 2WJZB 4UBIA 4F96A 5FX2A 1KH3A 4EPVA 2IFTA 2YQZA 1AF7A 2NYUA 4XDZA 3F1LA 3BC1A 4OAQA 1NMXA 5JAUA 4NMWA 2FE1A 2L19A 3LXXA 3WLAA 4F97A 5F76A 1B1CA 1NVEA 3ADCA 2FWNA 1J8FA 2O48X 3WGVA 3R2JA 1JFRA 2P7HA 3CW8X 3PFNA 4KH1A 4KX5A 4MKGA 4UBKA 5F7ZA 3RUPA 3HDJA 4EIWA 3ZX5A 1E1CA 1M6VB 1IVYA 4FB5A 5KOJA 3GFRA 1Z6PA 3NALA 3SX0A 4C03A 5CA0B 1I7QB 2W6JA 1BGWA 1B8NA 2CNKA 5H9VA 1RAIA 2H51A 4RULA 5I9MA 2GAFA 3PHHA 4DWWA 3UMVA 4MQBA 2P9JA 4HNRA 5IYZF 3RWOA 4QTTB 2BUBA 3KD2A 1RBYA 3ADOA 5E2BA 4BNDB 3JVUA 1TK3A 1UDBA 2WJ3A 3F0TA 2EG9A 3H1GA 5T4EA 4QPNA 3JAWB 4TQUS 5C8VA 3Q9SA 1KZ7B 4K1XA 1EFPB 2JI8A 1A0OA 4WZBE 5ALNA 5HE8A 4IJVA 4RK5A 2OBLA 1NQTA 2PX8A 2O3RA 1TKAA 3ADBA 1QK5A 3JQAB 3O8BA 1ZKDA 4JLOA 1J1UA 5CNKA 2XYQA 5F1PA 4U0KA 2WSSD 1VZ2A 3GFFA 3E5NA 1WP9A 3OCYA 3KPVA 1H2AS 5IJ9B 3RARA 5NLLA 2ID9A 3H2BA 1UMDA 1GPDG 3NS7A 2EKQA 3NONA 4Q48A 3D4PA 3NYWA 2VJDA 1P5FA 4FR2A 1YACA 2Y6VA 3BMOA 5DDIP 2Y1OA 4PPNA 3IKTA 4M98A 3I83A 2BM8A 1UKBA 5DRYA 1JBKA 1OLUB 3BSFA 4HYQA 3N1UA 4KYUA 4MV5A 4RMJA 5J5AA 4CKWB 3IOYA 1P74A 2Z8XA 5JAHA 3DE4X 4WKBA 5JWHA 4I3FA 4G4SO 3WJAA 1RCTE 1LBTA 1PWYE 1CY2A 1NPTO 4UVDA 1CS0A 3IAEA 4PC2A 1EM8A 4KXLA 2CNNA 2F17A 1IZ8A 2QVLA 2JRCA 2JIRA 1NVAA 4TKVA 3WNCA 1AXEA 1R6AA 4UE3S 3RC8A 2NSJA 2LGJA 4TTPA 4S24A 1RWPA 2MR6A 4NMXB 4WDQA 1NNUA 5DBOA 1E64A 1XWFA 3NRCA 2FG5A 5K5EA 1XNRB 3WQRA 2XQFA 1SK9A 1JHYA 2A1UB 2GVNA 2WM3A 3IEKA 4FMDB 3SJAA 1UKCA 2INGX 2HMVA 2NZ2A 3PUIA 4TXJA 3MGBA 4JIGA 1WBBA 5A5FA 1WCYA 4UDYX 5JLAA 3KUKA 3EFBA 1NV9A 2YV4A 3VX4A 1NHWA 1U2ZA 2CLIB 4IIGA 2ODTX 4MGYR 1ZLXA 3F90A 3LC0A 5F5LA 3U5TA 2ETXA 1FVHA 3CEHA 1E5DA 1GT6A 2CXPA 5E7MA 5CDGA 1CVLA 2UUBB 5JCXA 4G5YA 5AT1A 1IXRC 5BR1A 2CMDA 3A28A 1XVUA 2BCEA 3FOBA 3KR1A 1K7XB 1EX7A 1XVAA 2IXTA 2JIOA 4FW8A 4TWBA 1E89A 1AXGA 4MMYB 5BV1A 4KXVA 3TYXA 2R7NA 3FD8A 3D0OA 5F73A 1CJCA 3AJEA 2MSKA 3PDCA 4FOTA 1NF9A 1G9SA 3JQGA 4Q47A 1H9BA 2GBIA 1LS6A 2DPXA 4Q3NA 5F1YA 2BF7A 2G9ZA 3U2QA 7YASA 2C00A 3CLRD 1RR6A 3K20A 2EFJA 5I4BA 3GK3A 2G17A 1T24A 1YJCA 1L7DA 2BFCA 2K2WA 3C8MA 3REGA 4CTJA 1ZU4A 3FLEA 4FKZA 3UJDA 5A6SA 1XDBA 4KI7A 5A3SA 3PL5A 4MJ7A 1L4LA 4O1IA 2W2KB 5BN5B 1G3QA 2VDMB 3V55A 1IXKA 1QAQA 3CBQA 1Y1QA 1T5LA 3ZE8A 1TVEA 1YV9A 2HWKA 2J9RA 2YXDA 4JOCA 2ICAA 3CBGA 2YHBA 3VR0A 3M6IA 1JVBA 4WK6A 3C3PA 2WOOA 3TQSA 4IW3B 4PLVA 2DXIA 3HQ4O 1BS9A 4A26A 3KKQA 4XPIA 2VP0A 1TYDE 2IYRA 4N6NA 3LGSA 1EUYA 4BLVA 4H27A 1ZRHA 4EM6A 4PSUA 4XWOA 1SG6A 3VV2A 2DQKA 3CJRA 5FULA 3ZI7A 4B2PA 5EINA 1ZNYA 3ZDRA 4EYOA 2PL9A 3B89A 1J7KA 3RUAA 4YJGB 3TQHA 4C06A 4BYMA 5C1OA 4TLBA 2IHZA 2KX7A 3UT5B 4MYCA 4BNKA 1LH0A 1NQUA 1HDXA 1RQPA 4MWCA 1PR1A 1Y6ZA 4UM9B 2EJTA 4W5OA 1B15A 2L18A 4NE2A 1I3NA 2J0UB 3IP3A 4YMUA 3DO5A 3ZBUA 5I7VA 3GB9A 1FFDA 3CISA 3P9XA 1JW9B 4FFNA 2F67A 1MXHA 4KMOA 3TB6A 4P33A 3OU6A 4YMVA 1EDEA 5FL7A 4HRAA 4L50A 2IWHA 1VIMA 2X0DA 3UCEA 4OO3A 3KYCB 4RVHA 5BQ5A 2XOKD 6NULA 2B4RO 4X44A 8GPBA 5IZCA 3ITDA 1ZRMA 4EYQA 5KMGA 1UBGA 2W6OA 5DN9A 3UJHA 3F9RA 3WSVA 4GM0A 2J31A 2Q45A 2XQIA 4YCDA 2PRJA 4EHBA 5HKKD 1RRPA 1FLNA 1E6WA 1TQ8A 4F8YA 2O14A 5MGNA 1RYNA 1ZKMA 2P5YA 1MNQA 4BEWA 2GBLC 1PDWA 4HGQA 3BDAA 3D8RA 3CH6A 3RSSA 1ZGZA 3R40A 3FVWA 1YL5A 1NOJA 2CCGA 2ZCVA 4DIOA 3WKEA 2BHLA 2O5RA 2IHUA 3KQOA 3KYIB 2BWJA 4WCVA 1H2RS 1C50A 3DEIA 3E4CA 1QB8A 3AI1A 3JQAD 3UVEA 2J0QA 1OFUX 3LLCA 5GJVC 4WZBA 3CUEF 4GGOA 2W2VA 2HMUA 3T06B 1IBLB 4ZYZA 1Q1ZA 4COOA 5JMOA 3PC8A 3Q40A 4L9RA 5C7LO 1FZQA 2P4HX 4E1BA 2IEGA 3D6AA 3WMFA 4N7JA 4DG5A 3S8YA 1VLLA 3L0ZA 2QU8A 3MWFA 4BFWA 4BU1A 2O3SA 4B8WA 1SCQA 2H29A 3ZN2A 3GA7A 3VTKA 3WRWA 3IPRA 3EH2A 4HDNB 3G6WA 1M8JA 2F43A 3ZKWB 3PQ6A 3PHIA 1EMDA 3PQ3A 3RLIA 3LXUX 1W93A 2IIBA 4B8ZA 2V6MA 1UIRA 1VL6A 4BRZA 2JBWA 3I8XA 1ECGA 1EX6A 2JZCA 2WJWA 5IANA 3UMYA 2RKOA 3C6ZA 1PGNA 4P35A 3X2SA 4IJQA 1DO0A 2BCGY 3UCXA 4DN6A 4EI7A 4C4ZA 2PYIA 4B9AA 3VR6A 4EAQA 2QUAA 1U94A 3C24A 1IRXA 4RGBA 1Y0BA 1EVEA 2ERXA 3FMIA 3JQQA 1L3IA 4XM2A 3BSYA 1Z26A 2FP4A 5FTLA 5HS4A 2CBZA 3MF4A 3AJ8A 1CYDA 4YECA 1DBQA 1X19A 4V0ME 2YHUA 3AETB 4ZAFA 5EPEA 4RJTA 1IK4A 3C7DB 1A7AA 4B7ZA 5JSZA 2O7SA 4PQFA 3IEUA 2F3QA 2V55B 3VPSA 2MSDB 5IKEA 4A7PA 3QMVA 1S5PA 5F9HA 1U98A 3LGAA 3ZVNA 1DKNA 1EQAA 1TUGA 2ZIXA 1VPDA 5IKPA 1AO0A 4PSCA 5KNBH 3DEAA 3L7AA 3OEEA 4J2OA 2AB0A 4PZEA 2GOYA 1ZGJA 5EPUA 1SB9A 4B6OA 3QF7A 2GZSA 3GFOA 3ZU4A 1FP7A 4ZCSA 1F20A 5ICMA 5J1SB 2NPOA 2J5RA 1NJ6A 4ZODA 4NBNA 5I7EA 3IP5A 1EGHA 3D5TA 1U3CA 2M98A 4FFRA 5J9FA 2D1YA 3CE9A 5GM2A 3PFKA 4M86A 5HA5A 3SJ7A 1H22A 5IG2A 1NUAA 3B82A 4EBBA 3SLRA 2H57A 3M1IA 5COQA 1YMQA 3D54D 4U2GA 4B7XA 4OQEA 1GNQA 4RLHA 3SM3A 3JVDA 3ICCA 3V1LA 4QZVA 3LSYA 3CRNA 2KM1A 2NO7A 5E6UA 1Q6ZA 2EAUA 2Y68A 4HLNA 3OOSA 1MEJA 2Q7OE 1YR7A 1SAYA 2NQ8A 3L8FA 1XEXA 1CQWA 2QV0A 5H59A 3WTBA 1KAQA 4X45A 4JIMA 2IHYA 2J0EA 4DCPA 4K6HA 2COKA 3QTBA 4Y7DA 2ODAA 1EE2A 4D9HA 1ZBQA 1ZN2A 2OYCA 4PYLA 3MTIA 2D00A 5HZMA 2ZCJA 3H3FA 3TQCA 4TPKA 1ODLA 3U26A 3ES9A 5EUMA 2QQ0A 3QXGA 4PN7A 2C82A 1DDIA 1NOKA 4UU7A 4Z86A 5AXBA 4JXZA 4Z0HO 2SKDA 4CF3A 4EG6A 3C6KA 3G2IA 1N2CB 3NIBA 1G5FA 2W8ZA 3UWOA 2PXCA 1T8WA 1M8FA 2G71A 2LP4Y 2V3VA 3CUVA 4FM9A 1H1DA 1YS6A 1LLDA 3GQBB 5EJ8A 3ZS8A 3LLVA 2A14A 4X93A 1MB3A 2WPNA 1YR3A 4UOZA 2NV2B 5BOSB 2ZBVA 2GPAA 1UFQA 2D0DA 2N3ZA 4RKQA 4Z1OA 1OD6A 1TVKA 2X3UA 1UFVA 2A9JA 5HM6A 5JCPA 5AM2A 5KCZA 1ZVKA 4U0JA 4RIFA 4UM9D 2B1IA 1ZUNB 2F1OA 3DUFB 3ETLA 3WHPA 1QJ4A 3JAKB 2BJVA 3S2ZA 5JYEA 3KTDA 3CLTD 1JJAA 2SBTA 2Z3ZA 3DONA 3R0VA 4KBYA 4PGHA 3FAZA 1D2GA 3HPQA 4KIUA 4QQNA 3WADA 4FOSA 4XEHA 3WV4A 3MFYA 3MLEA 2OCDA 3Q12A 3AMVA 3W2EA 5L4SA 5EFZA 3EZ9A 2VK2A 1NF2A 4PRYA 1SC3A 1F4PA 1XMXA 1KRXA 4NR0A 4G4SP 2ZAIA 4YAJA 5A5EA 2G4CA 2CWDA 4HDSB 4L0CA 2EXXA 3KSAC 1S1CA 5CRIA 4ZAVA 1YNOA 2R8XA 2QW8A 1J2UA 1KK0A 3OEHA 3PR2B 4LSMA 4PHHA 5E6SA 4DLRA 3QFRA 1J7JA 1KFKB 2OORA 4IFIA 1U8TA 1W35A 4ZRDA 5LQCA 3B3FA 3GLQA 1PSWA 2QPAA 5AK4A 4FR0A 3RROA 3I2YX 2PWBA 2H5EA 1ZD1A 1B2LA 3H1TA 3GAZA 3RS4A 4BNVA 3ICQB 4QG3A 2QQ5A 3EXHC 3DOCA 4HX9A 1L5KA 3BTSA 1O94A 3W78A 1X14A 3D9QX 3O4IA 1YOVB 1VQ1A 2P4EA 4HEJA 4Q1VA 2WM2A 1G5PA 1C30A 1KY2A 3A26A 2HNKA 2YV1A 1R4MA 3EEQA 4YDRA 4QQKA 3KLPX 3UMSA 3B3AA 2YC4C 4R2LA 3ETJA 4R68A 2Z2IA 1FYEA 3O82A 4JU8A 5TQJA 3CVUA 3GJSA 3BCRA 5AKHA 4KZKA 4LJ7A 3N76A 4RGYA 2BGKA 2H54A 2X6TA 3QJGA 3RUEA 1WHTB 1UADA 2ZSJA 5JY1A 3U3XA 3NYRA 5AKLA 1F4VA 5HBRA 1IE3A 3MTQA 5AUNB 2NGRA 4NNJA 3DFKA 5KNLA 5C46F 1E5QA 3PWSA 4MRMA 2WD7B 4H35A 4YRAA 4PZAA 1W47A 4PG8A 2CZCA 2VQ3A 1XEFA 1UF9A 4GKAA 1ETHA 4JT2A 3BN3A 2QRHA 1BXRA 5EPOA 1XCOA 4RIIA 3VSDA 1N2GA 2DR0A 2H00A 2XUKA 1SBQA 1NP3A 1J1ZA 1QZZA 4NZYA 5BVHA 1EB9A 3KJGA 1FRNA 1W2GA 5LA6B 3DTNA 1BFUA 2SHKA 3JZFA 3PYXA 4Z99A 1PJQA 2WJ6A 4ZN6A 5I7SA 4K81B 3H13A 1QH8A 4D0RA 1Y6JA 2JAWA 3SXPA 3FMFA 4X6LA 4DFDA 3SF8A 1S4MA 1SXGA 2O50A 2X0NA 3SOZA 4WFQA 3B85A 3LX8A 1HQYE 4WASA 2DULA 2Q5LA 2FMTA 3C85A 2FB9A 1VE7A 1TPZA 1W19A 3AGQA 3HXKA 3N8KA 4V0MA 3DB1A 4KE8A 2WU1A 3W1EA 1C1YA 5B4TA 2PGIA 1IUNA 2BKAA 2A33A 3Q5GA 4FGWA 3LDGA 5FWAA 2HK6A 3OUZA 4IHQA 4LY9A 2R8OA 2WYHA 4NBWA 3IQDB 3IP8A 3LX6A 3GIWA 4AXXA 2HDHA 1RRVA 4LSZA 5JEEA 1NR7A 1FDUA 4AJOA 1IULA 4JXKA 2I62A 2YJGA 4GRDA 1G42A 2QMZA 4RK7A 5CLQA 1G5TA 5BQFA 3G8YA 4GOLD 1WB6A 1EGQA 3F6CA 1KDRA 3IA7A 1BVRA 4JBHA 4OQFA 5I8WA 3BHIA 4K6MA 3OLYA 3FRIA 4WLVA 2EWVA 5GM1A 1M76A 2W4IA 3D6TB 2I22A 3R76A 2EF1A 1JX6A 4MR9A 3B5IA 3TZHA 4EJ0A 1DBIA 2C2HA 2EQ5A 4P98A 3UJAA 5BNIA 2EV9A 4NXNB 4I9FA 4JJ4A 1RPNA 2CLLB 4LMPA 3AZQA 5JNSA 3TG8A 2ATVA 4S1TA 5KWSA 1QHHA 4W99A 4Q1FA 3UQYS 4WKPA 1KAEA 2NG1A 4NOLA 4YJKA 1WO8A 2HA4A 5K03A 1L2TA 1M2JA 1NW4A 4NEGA 2FKAA 5DKFA 5DYWA 3BFPA 5FNVB 1E1DA 2R751 3GX1A 3OIYA 4ZVRA 2Y1KA 4RQUA 2B35A 4RM2A 3DZDA 1N5DA 3L7MA 1MT0A 5CH3A 1SQ0A 1F5SA 3QU7A 1Q50A 5EUCA 5I3CA 2ZWPA 1Y7PA 2NXNA 4NMHA 5CNIA 1ACJA 3ERCA 4RJKA 2GBCA 3GDOA 3OQIA 5EE1A 1ST2A 3IOEA 1T91A 2JGNA 1XQWA 4FNOA 4K86A 5JRJA 1YK0A 2JLCA 5LP6B 5K0FA 4QBTA 3P2JA 5LVAA 1BVYF 1A9ZA 2BP7B 4AKTA 4QKQA 1RRCA 4FUTA 4QBKA 5C34B 3RAPR 4OPMA 4TM7A 1IY2A 3NTXA 2C88A 5KDDA 1E7MA 1Y34E 2VF4X 2KHZA 3T5TA 3ZDBA 2AMLA 1R50A 2CSUA 3HJNA 2X6RA 1SKYE 1FIUA 3LI2A 1YR9A 1ESDA 2F3RA 4OFXA 1SXPA 3KTAA 3BWDD 3WGLA 4M36A 3I3OA 3OAAA 1SXHA 2ORED 4PPYA 5BN3A 2CV2A 2NTJA 4EK9A 1QO0D 2HA0A 2JLXA 1U6JA 3R7BA 3IMFA 2FPRA 4WD3A 3AFIA 3WWYA 1A97A 1QM5A 1Z35A 2AFIE 2V4MA 2XTMA 2B21A 4Q7JB 4QGFA 2ACWA 2BV3A 5E3IA 1KOGA 3VNAA 4AMBA 4G41A 3GW8A 2VF7A 2PJZA 1SKQA 4RDIA 3FNBA 3WK6A 4I1SA 2WE8A 3OMLA 2YXPX 2BFOA 4F85A 5JJLA 3AHEA 3LY5A 1UC8A 3CT4A 3HUUA 2GK6A 3HKBA 3BTOA 1T3GA 3KDPA 3LWNA 4CM3A 4F84A 4ETNA 2V03A 2YH2A 4F86A 4Y9TA 2O8CB 2CHFA 2P9QA 4I5GA 2P69A 4GNRA 2ZJ6A 4M9CA 5H02A 4KE6A 2F4NA 4RQAA 4GGPA 4JJ7A 2HT1A 4BB9A 3B9BA 3PFFA 3AZPA 1N3BA 3BMCB 4O4HF 5C7YA 2OB1A 4OHWA 4BBPA 2MDTA 1QNFA 1WEKA 3F6BX 4MWSA 4V1CB 1GV0A 2G0NA 2NW6A 2ONJA 4FI3C 4HQ0A 3K5WA 1ZR2A 1XK7A 2ARKA 2BDTA 4QAJA 3LMKA 2GPSA 4CV0A 7MHTA 4CLHA 1OBFO 3MMZA 2YBEA 1UT5A 4JYPA 5EEGA 3TMYA 3A2MA 3C5WP 3CLSC 2P3LA 2GM4A 2QVZX 1BSVA 4CF6A 1GXSB 2P2ZA 4RYDA 5H80A 1U1GA 4ZI7B 3ZWPA 1F8XA 2AS0A 3LCUA 1PQWA 3OX2A 5DP1A 4G0QA 2AG6A 4R16A 1M2KA 1SUBA 1R4NA 1X6VA 2G7MC 2R8EA 3BJIC 2JGFA 3A14A 4GT1A 1W73A 1ULSA 1LGYA 1O4WA 3E18A 1XELA 4TYPA 1GZDA 5BSVA 3R20A 4M60A 1ESZA 1D2RA 3CKYA 4I1IA 4YR9A 1D6MA 1A8HA 3FUCA 4PG7A 4WJZA 4GR4A 4O4HA 3K70D 1AKQA 5CURA 4BO7A 1XPJA 1XZQA 1ZJ6A 5ILGA 4UNSA 1G5QA 4KEAA 1I3LA 5G02A 2HRCA 3F5FA 1JEYA 4P1ZA 1JLSA 2QMUA 1N78A 2EBFX 2FFHA 5A6VA 1JFLA 2QSZA 2TMYA 2VHUA 3B3GA 3KQVA 4AURA 2A94A 2G3YA 1OH7A 3I9OA 1YGYA 3I6BA 2GN1A 2EATA 3MJDA 4AG5A 1K92A 2H4YA 1P81A 4GWLA 4MI9A 3AFNA 3JYOA 1BMDA 1KARA 2YXEA 4M0KA 4ZQHA 3TD2A 1AXRA 4ACAA 4DSTA 2NZJA 2XZTA 1W88B 3ZPXA 4ZEXA 2FOLA 1AB5A 1XXHE 3RVLA 4FLMA 3RRZA 3ZHBA 4B6RA 4W9NA 1NW3A 3CW2A 4WNAA 1LJLA 4ITUA 1EH5A 4EJMA 1W0JA 2NACA 1WZCA 5EE5B 2WR8A 2ZIUB 3WK5A 4LZWA 1XC7A 4LKOA 5EUQB 4XQEA 4AP5A 1ORRA 1RMQA 1DAOA 2HBZA 1PW7A 5B1YA 5E9WA 2BMAA 5CK5A 2O3QA 3ORFA 4R6WA 3VZPA 3E3AA 1WZIA 1JU4A 2EERA 1FBTA 1N2XA 1WW2A 4ZVKA 1JQLB 2C8VA 2WP8J 3ZE6A 3JWPA 5LMZA 2GB4A 5B2FA 4FHZA 3CUSA 4D79A 5I7RA 2YOHA 3HABA 1D9ZA 2FR0A 3RIYA 2B2NA 5EHGA 2Q4TA 2RD2A 2WKSA 4ND1A 3JALA 4UTNA 3USCS 3NCTA 3UWMA 1UFKA 3R1IA 1I1OA 2A2ZA 1G2QA 1JUDA 2XMGA 2YJNA 1ZMRA 2GZ3A 2XDWA 2ZSBA 3DLPX 3P4YA 5FWNA 4QUIA 3KG2A 2PT5A 3F8SA 5KJCA 4EUNA 1O95C 3BE6A 3Q8KA 1I6WA 1LBEA 4J4HA 3AJAA 3QXCA