2AK3A

The three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
GASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETSVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined structure of the complex between adenylate kinase from beef heart mitochondrial matrix and its substrate AMP at 1.85 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE ISOENZYME-3
total genus 70
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 1995-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak3A00
1O3YA 4A8JA 3LW8A 3AUYA 4X8LA 3GLFA 5CYOA 4S35A 5A0FA 3B85A 4HYYA 4NCIA 1KI6A 3Q5EA 1P61B 3WBKA 2IT1A 1D9XA 3SC3A 2VLIA 5FL3A 3VNUA 2WWFA 2VHUA 1UADA 2JLRA 3FGNA 1KMQA 1E2JA 3PQCA 5CM9C 2J46A 4JSYA 4LBVA 3KQNA 1N0WA 5DE3A 5JS8A 1OFTA 2F43A 2P3SA 5FOWA 4LJ4A 4TYQA 4RSGA 2ZI6A 4ZPXA 3RWMB 1OT3A 3B78A 1D2NA 4URYR 2Q6TA 4FWIB 1YKSA 3W5JA 5DI9A 4MRNA 3NVAA 2HT1A 1E2FA 4U7DA 5KNCA 1IXRC 1I4LD 1KDOA 4A0RA 3ZH9B 1XXHB 3ADCA 1QRAA 4NYIQ 3CNNA 4ARZA 4D4LA 3HR7A 4P32A 3FHTA 4Q7JB 4HB0A 4C0QC 1YZUA 1NG9A 3QKSB 2JLWA 5EP2A 2VHTA 3A1TA 3S1AB 4NP6A 2XXAB 2XTZA 2FEOA 2D2FA 4D4KA 2YNMA 4CEIA 1GDDA 1PV4A 1ZNWA 2ZYVX 2VSXA 2WOOA 2B8TA 1I4TD 2OE2A 5G40A 4LK2A 3QG1A 1Q3HA 4I1SA 1BS1A 1FW6A 1NP6A 2O8EB 4PO1A 2EFHB 3QJYA 1J2JA 5J40A 2J7PA 3I73A 1RVDA 3X1XA 2AD1A 2GF0A 2MMCA 5DN6A 1FUUA 2FN4A 2O8CA 5DIFA 4B74A 4JL8A 2A2ZA 2QM8A 4W9MC 1XCPA 1W49A 2WHXA 2HYDA 3NBYC 4XTCS 5FBVB 4NHOA 1PLKA 1L4YA 2CEAA 4OK5A 3GFPA 1RE0A 2IS2A 2HXYA 2PBRA 2W00A 4CF7A 1OB2A 2ZANA 4ZI3A 2NTYC 4IDPA 1W1WA 3L0IB 5KDOA 3T61A 4M9SA 3BIFA 3OEHA 5JECA 3LWNA 2QMHA 2A9KA 1ZM9A 1N6IA 4RD1A 1KO7A 2EQBA 1JBKA 2EFGA 1FTNA 1AZTA 3C15C 4Q1AA 3WMFA 3ZIAD 1JEDA 1XEWY 4MRRA 1JAHA 2BC9A 3P4YA 4G01B 2QP3A 5KSZA 3AVWA 1U8YA 3PCRB 4PQFA 4OYHA 1DO0A 1VECA 1U0LA 3M6AA 5JEEA 2JJ2A 3DDCA 3NEJA 3HU3A 1E2NA 1EK0A 5SZIA 1IY0A 3AF4A 1S9DA 1GFIA 4RKFA 1IN5A 2VA8A 1G3QA 1AM4D 2YHSA 3RRMA 4DCUA 1K5GA 3NH9A 1HT1E 4JS0A 4BECA 5BXQC 2GXQA 4I1OA 3K0CA 2QTVB 1R6BX 2XAUA 1X86B 4B2PA 2IF0A 2C95A 1A7JA 3C5CA 3V4RA 2AXNA 4QRHA 3IEVA 2FPLA 4LRWA 1JALA 1D2EA 4PANA 4QNMA 2P6UA 1XCMA 1R5BA 3QEOA 4HI0E 4TYNA 1DAEA 2RGNC 2VYFA 1TL7C 1CP2A 4GT1A 2CL0X 3W8NA 3CRW1 5JS7A 4KFUA 3CRMA 3CZPA 4M1OA 2HEIA 5DYIA 2Q0HA 1KKMA 3W3AA 421PA 1NSFA 4C7OA 1G291 2QTFA 2AK3A 4C0SA 4M4SA 1E9CA 2ZYWX 3MRSA 4NYJQ 2CNWA 4BFSA 4ERNA 1TF5A 5A4JA 2HLDA 4ZKEA 3OE7D 2HCJB 5EP4A 3ADBA 2VRWA 2IYSA 2P6RA 1E2MA 1KYIA 4LZZA 4DC9A 4LBYA 1D8TA 2W2VA 4OQFA 5B2ZA 3T5DA 4LYJA 3WNBA 4EFMA 4DZZA 1ANKA 1FNNA 2ZJ5A 3UXMA 4V0NA 3VR4A 3Q3JB 1T3LA 2O52A 3QENA 2ZJYA 1P2TA 1IXSB 2ZITA 1E9SA 1M7GA 1MH1A 2PT5A 3B1VA 1UKYA 1PJRA 4TN1A 5HPYB 2GZAA 1W5TA 2CK3A 4P3YA 1F2UB 1YHNA 4TYPA 5CJ2A 1M8PA 4MKHA 3CIOA 5DHAA 3VKHA 2QMUA 3VU9B 1B0UA 4R7ZA 3AVTA 1JR3E 3R8CA 1T3HA 1OXVA 2IYTA 1T3SA 2IXGA 4A6PA 1UJ2A 1ZC4A 3EW9A 3OFNA 1VHLA 4KLNA 2GVDC 4MGIR 1NN3A 1S2MA 5IF9A 3AVUA 1KI9A 2OCBA 5BYJA 5EUQB 5B64A 5F2EA 4EJSB 2R6FA 3QXXA 3I32A 4MDEA 5E7IA 1CKEA 2GILA 2ZRLA 3IHLA 5KPJA 4CVNA 3KKOA 2JDIA 1US8B 3RS5A 1H8EA 4BFWA 1OH6A 1KSFX 3KL4A 2ZUCA 1W36B 4IOMA 1NJGA 2IUTA 1ELOA 4KO8A 1XTJA 3W6PA 2CMKA 1DADA 4OQMA 1Q0UA 5AK0A 1II8B 1DAIA 4M1TA 1G3IA 1GL6A 4M21A 4BLOA 1UEIA 2GCOA 4JBYA 4L4UA 4PC3A 1RRPA 4QJ5A 3NXSA 3WXMA 2XZPA 3H86A 1GUAA 2H17A 2JLUA 4G0NA 1ZRHA 1S1MA 2C8VA 1RJ9A 4IEIA 4ACBA 1IN8A 4LI0A 2VIIA 3QOFA 1OE0A 1ZUHA 3DMDA 3GLHA 3RRYA 1Z6XA 3H2YA 3JVVA 3QUSA 3WY9A 2Z5FA 1V43A 1YR6A 3VHLB 2RGCA 1HTWA 3M4YA 2D2EA 2DCUA 3T12A 3I5YA 4PHGA 4IFBA 5DISB 1Z0KA 2FPKA 1DAKA 3TMKA 2H7VA 1AS3A 4URZR 2R8RA 2JJ8A 4F92B 3NHBA 4Y0AA 3R9IA 4C4PA 2YJTD 3ZVRA 1S8FA 1BO6A 3VX3A 2BKEA 2ZRNA 1GSIA 2F7SA 3AH8A 2X19A 4AYWA 1WBDA 2HYIC 4WW0A 1VG1A 2IHBA 3U3MA 2WKQA 3MJHA 2P5TB 2O8DB 1OXXK 5GJBA 3LY5A 2ZVPX 1Q12A 2OBNA 4QOSA 4BE7B 4Q48A 4W5JA 1VYTA 3T15A 3LVQE 1Z5ZA 2DR3A 1TF7A 2KWIA 3TAHA 3SFZA 4UJ3A 3I1FA 1WB9A 1Q20A 4Z1MA 1KK2A 4KHZA 3QPVA 3T1TA 3K53A 4BASA 2ZR0A 4DCSA 3B2EA 5CITA 3AP2A 3AF3A 2YOGA 4HLUC 3W90A 1SULA 4OI2A 3RS0A 4DDWA 1LFDB 5JSZB 4DSNA 2G0NA 5C4GB 4HZUB 2ZSEA 3JZAA 2BMFA 3CR7A 4JYCA 1SVWA 1YQTA 1JAIA 4AKGA 3EPHA 4NONA 2GBLA 4CEJB 3VR5A 5F98A 4JVLA 5UKDA 4GP6A 1I2DA 1T8TA 3CF6R 1LVGA 2B8WA 3P32A 3I92A 2QRZA 2VHCA 5D3MB 3GLGB 2ZI4A 1CXZA 1Q44A 1SVKA 4LOAA 1JJ7A 4YXWA 4EPYA 2OO7A 4NCNA 5KPDA 2AX4A 2FGKA 1E69A 4IFEA 2ZS9A 5CIWA 1R5OA 2J41A 3R7WB 2QUZA 5EP1A 1XP8A 1BMFD 4JLMA 3ADKA 4D0NA 4DB2A 1P73A 3UKDA 2BCJQ 3OIVA 4MRSA 2DWOA 2YWHA 1XF9A 3HDTA 3CB4A 2OCYC 2IC5A 4TT3A 1ZINA 2QAGB 2P6NA 4V0MA 2ZJOA 3T34A 4L9SA 4GDFA 5JJLA 1Z6TA 2QMEA 1SKQA 5JJKA 3LBNA 4Q03A 5FI1B 5LBIA 3LO5A 3OZXA 1KSJA 2F1JA 4PFSA 1KZ7B 4PPFA 3GQBA 4TLAA 3G5UA 1LS1A 3LV8A 1EX6A 1NVVR 2P5SA 1E79A 1EXMA 2A3RA 2D06A 5E7MA 2BBWA 4AYXA 2DPXA 2IYVA 3P27A 3IO5A 4YC7A 1E2KA 2N1BA 4X8OA 4URUR 5FL7A 4KFTA 5IK2A 1ESMA 3O8DA 2G1KA 2C03A 4DT1B 4GOJA 3L43A 3KQUA 1IY2A 4TMTA 3T5GA 1E2DA 2QRNA 2JLQA 2QP4A 2YOHA 4G5QA 2G3YA 4FINA 5L3VA 4P0TA 3EZ7A 4B76A 4WAUA 4L8GA 3IUYA 2A5FA 1F5NA 2CXXA 2KB0A 5H8WA 4OHVA 1PUJA 1IJEA 3GLIB 3QVVA 2PZGA 4ZO4A 1QDEA 2ZRGA 4V0KA 1M1YE 4KCGA 2XZOA 2ZXUA 1XD8A 1XNJA 3N2EA 4LWZA 4FIDA 4C9BA 1KAGA 4L5BA 3ZS9A 4V0OA 3U5ZB 3BWDD 1UDWA 1N0VC 4HLDA 2QI9C 4FI3C 1DAGA 1HE1C 4IRUB 2E9SA 5JRZA 4BZPA 3SOPA 3NBFA 2EU8A 1OB5A 3BH7A 4WIAA 1ZJ6A 2ZRBA 5JHHB 2FFBA 5HCNA 4QC2A 5KSPA 2YOFA 2FGJA 3S1AA 1XDBA 2O8BB 2ZJAA 1KI7A 2ZAMA 1O87A 3HR8A 3LLUA 1DAFA 4DUGA 4RZXA 1OF1A 1U98A 4TL8A 2OG2A 4A2WA 5G53C 5TY0A 2ZREA 1RZ3A 4DUGD 1WRBA 3PEWA 2X2FA 4W5WA 2XJ9A 3QXCA 4M9ZA 4RFSB 4XSHA 2JLZA 3REFA 2I1VB 3LXXA 1TMKA 3CNLA 2NQ2C 3FMPB 3T35A 2F1IA 4OI4A 3QBTA 2J0QA 5KDDA 4ARZB 1KDTA 4QGAA 5FI0B 1T5IA 3IKJA 4LJ7A 2VSOA 3AB3A 4Q18A 2BEKA 1OLOA 1KI6B 3L0PA 2VP2A 3MJRA 1G16A 3ZIAA 1NLYA 1U0JA 2FV8A 3CNOA 3TH5A 1K8RA 1G7CA 3K0AB 3ICQB 2F3RA 1DG1G 3GP8A 4F7WA 4Q9IA 4UQOA 3TKLA 5AJYA 1E2QA 1P60A 4LY6A 1GNRA 4QGHA 1R0XA 3QXJA 3KJIA 2C99A 5K8LA 3RNLA 1HV8A 4FMDF 4MUAA 1HYQA 5GJWC 1AGRA 1Z2AA 4ILEA 4H9GA 5B57C 2V3CC 1MRSA 3B13B 2YV5A 4G5OA 3GJ0A 4XSGA 1J90A 4A0FA 2ODEA 4PHTA 4PPNA 3SS8A 4OQLA 1N0UA 3E5HA 3IHWA 5AUNB 2ZRJA 3K0FB 3I3SR 2ZE8A 3QPWA 3NH6A 2Q3FA 4W5HA 2FSIA 4KV9A 5E4FA 2FPMA 3UPUA 4OKSA 5KUTA 2RKOA 2ZSAA 5FPTA 2GDJA 5EXSA 2V54A 2V1UA 4KVAA 3M0EA 2QSZA 3PUWA 1W48A 3B1ZA 1SKYB 4BEJA 3RYTC 4C7OB 3V00A 1P62B 4B3DA 3WYAA 1LNZA 2GJAA 5KNDA 5EQTA 2ZE7A 1T8UA 5BN3A 3RRZA 2O8FB 1VCMA 4M9XA 1Z28A 4JJZA 2WMNB 3AUXA 3Q8XB 2ODNA 5H1YA 3X2SA 4Z1MD 5JCZA 4Y0VA 1XTQA 3B5JA 1TAGA 2BM1A 2GXSA 3BFKA 1WDTA 2AHOA 2YWEA 3RSOA 3IEUA 1JQJC 3VTKA 2YC4C 3TQFA 3IBGA 3GEEA 1DO2A 1E9AA 2NO9A 1XPRA 1OH8A 1E9EA 4C0HA 4O3MA 1ZD9A 2VO1A 4PQRA 5LB4A 5FOTA 3VAAA 3K0CC 4XOIA 4MYHA 3L8ZA 1E9BA 1Z22A 1OKKA 3ZQ6A 2DB3A 2O8BA 4QBIA 3IIJA 1GM5A 1XFAA 1OW3B 2JASA 3OHMA 4MYCA 4PC1A 2N46A 2YWFA 4P4SB 3AF0A 4QXAA 1G9XA 3U44B 3GCGA 4YDHB 1KJYA 3IIKA 2FFAA 3IPXA 2WPDD 3U61B 2QSYA 2BMJA 1KY3A 1ZM2A 4F38A 1ZU4A 2GCNA 2QE7D 4RZ2A 1UKZA 2W6IA 4IVQA 4DIEA 1P72A 1CR0A 4ZIRA 4LJAA 1CEEA 3B9QA 4MYTA 3QEJA 1KI4A 2A5JA 2FZ4A 3SE0A 4MH0R 1MO4A 4BRWA 1P9NA 8OHMA 1F6BA 3REGA 4XWAA 1YR9A 5JHGB 1NKSA 4A0GA 1QG4A 2O0KA 4FMCF 1P9RA 4B2IA 2WSSA 4GP7A 3I62A 1J8MF 3FFBA 4U5XA 4QHTA 4AD8A 1ONBA 4JZKA 5B58C 4C2UA 1NLFA 4US1R 2Z0MA 2XOKD 1RPZA 3A36A 4HLQB 2O8CB 2QAGA 2YC2C 3ZD7A 1IJFA 2PLRA 4DSOA 1OXSC 2BDTA 1ZAKA 2G77B 1IN6A 1FMJA 3EA5A 5FOUA 2BEJA 2GRJA 3GEHA 3CR8A 1ODFA 4UKDA 2XX3A 1QVAA 2J0VA 1G8YA 1SVSA 4PHFA 1JQLB 3THXB 2OCAA 3KUDA 3QKUA 2GK7A 2LKDA 4URXR 3KKNA 3T06B 3PV0A 2ZR7A 5ELXA 3GLFE 1G17A 2MMGA 3QVUA 3VR6A 4Q66C 5HE9A 1UBFA 2P2LA 2QL6A 1KO1A 2B7CA 3W6NA 1NL3A 2GJSA 1KNQA 1YZKA 2F3TA 4ZI2A 3RLFA 3OEEA 1G6HA 1KDRA 3CX6A 1LB1B 2BJVA 1DE0A 3EA0A 1RFLA 4NTZA 2ATXA 2R6CA 4HAUA 2ORWA 3DM9B 5TV2A 821PA 1DEKA 2IX3A 5C46F 2HJVA 4G5GA 1II0A 1IHUA 3THOA 5JSZA 2GCOB 4MA4A 2V7QA 1AN0A 3BOSA 3CF2A 1Z29A 1NN1A 2JEOA 3CX8A 1P2SA 5BN4A 3KKPA 4A4DA 1YRAA 4C0AC 2IW3A 2ZSDA 2WWWA 4ZCLA 3K0FA 2GESA 1RYHA 1QHYA 5HCIA 3I72A 3H0KA 2QN6A 1GRQA 4QBFA 4XIGS 1NY5A 3GFTA 2ZI9A 2NPFA 4C2TA 4DLUA 3SFVA 3EAQA 1W2GA 4AG5A 3DMNA 2OXCA 2CCJA 4MYUA 1UAAA 1OSNA 3EZ9A 4PZYA 3VR3A 4E22A 3EPKA 1HEIA 2C96A 5FTLA 1NF3A 2UZ3A 2ZEJA 5FTNA 4TZ6A 5C4MA 4Q9KA 2QQEA 5FTKA 4LJYA 2CL6X 1Z0AA 3HU1A 4LHVA 2MSCB 3CW2A 1HURA 1NBMA 3ZVNA 1AS0A 3CBQA 1OPXA 2ZSBA 1JECA 3GLHB 3RS3A 1VIAA 4KYUA 4PSKA 3EIHA 3IILA 4TLCA 2ZRPA 2GKSA 3OEHD 2WVJA 2XB2A 1DARA 3FB4A 1BMFA 2ZU0C 2QGNA 1N6HA 3PEYA 2WAYA 3ZYCA 4EPWA 2ORIA 2W83A 1XMJA 3ZJYA 1NI3A 3CPHA 2VEDA 2VPPA 2H5EA 3QKTA 3I61A 2JLVA 1Z47A 2WKPA 1KJWA 3HWSA 4JT4A 1E79D 1E98A 4P4TA 1NN0A 1YZQA 2CL7X 4QG7A 1LS6A 5FOXA 1UKVY 4BFXA 2IL1A 1FQJA 1MO6A 3LLMA 2WICA 3GJ3A 3GJ7A 1HH4A 2TMKA 2REXB 4PZLA 3L0SA 3SYNA 4ZCIA 4LHYA 4NBSA 5IDVA 3U4QA 3A58B 3QF7A 3BB3A 4M0LA 3ZZUA 1KI1A 4PAOA 1X8LA 4OQNA 3A1UA 3P1JA 5CJPA 3CH4B 3MGCA 1KSHA 1CIPA 3HJNA 4EFLA 3O8CA 1J99A 3KZ1E 1DAMA 5J47A 1P7CA 1G64A 1ZU5A 5CM8B 1PLJA 1Z8FA 2ZJBA 3DM5A 1SXJD 3IIMA 2Z83A 2DFNA 3KJEA 4JKIA 5K8TA 2XITA 2F6RA 1NRJB 2A5DA 3FDIA 2WBLC 3BORA 4MUBA 4HAZA 1G19A 1UDXA 4D6PA 2DFTA 3QPUA 3AKEA 5JLJA 1GL9B 4Q1EA 2EFDB 3A4NA 4CT5A 1UBGA 1XJ0A 2A5YB 2RAPA 4LUCA 3PG5A 2JLYA 4KLZA 4WXPA 4KAXA 4AC9A 4Q19A 1MABA 3MUFA 1L4UA 1ZUIA 2QNRA 2ZPTX 3WRXC 2HXSA 1E32A 2XB4A 1R10A 5JWHA 3RANA 4Q9JA 4LJ6A 4BWYA 2G88A 4NE2A 2EYUA 3OIUA 5HTKA 4B6FA 4A36A 4ACAA 3JVUA 3ZLJA 2HJGA 5C2JB 4LPSA 3KQKA 2CK3D 3KJGA 1FTSA 3AVOA 1NIJA 4I1UA 3G82C 5AUOB 3GLIA 4HDCA 3QI2A 2PEYA 2V6IA 2CHVA 3PFIA 2VHQA 3O8BA 1G20E 3TUJC 2P0EA 1XZQA 3B1WA 4MGZR 2GEVA 2FX3A 1OIXA 2N42A 2PLFA 4BLRA 1EESA 4EJSC 2Q3MA 2V55B 3IDQA 4MQBA 1QG2A 2FA9A 3ZS8A 1FZQA 4AIIA 1GKYA 4A2PA 4C3ZA 1YZLA 1T6NA 1OJLA 4I1VA 2ZVQX 2Z4SA 1E2IA 1N6NA 4FMBB 3F3YA 4Q01A 2ZAOA 5H68A 4Z54A 4HEJA 4M1SA 2Q9AA 3MD0A 1KAOA 4AURA 3BRWD 3BD9A 2G83A 4LSGA 1KSGA 3RSLA 1X3SA 1P4SA 2H57A 3B7GA 3ZVMA 2XZLA 2J3EA 2IXEA 5JEDA 3EZ2A 5FOSA 1YR7A 4HAWA 1OFUX 4CRWB 3PVSA 4PPGA 2ZJ2A 5AJWA 5FTJA 4E03A 1OV4A 5JFGA 3K70C 2B92A 2C5LA 3WNDA 1GIAA 4HDOB 1JR3A 3NEYA 3OAAA 3GJXC 1QHHB 1DG3A 3CH5A 2QQ0A 5L3RA 3LNCA 221PA 4OL0A 2IBMA 1GG2A 3P20A 1T4GA 1A82A 4AWXA 2GZHA 4FCVA 3T1QA 4LPKA 1COWD 1MABB 4CEIB 3QXHA 1N5JA 4DLZA 2HT6A 3D6TB 3UANA 4HDQB 3KKMA 5J4HA 1W0JA 2A7QA 1YR8A 4TTPA 4RJLA 1FNMA 2AR7A 2BWJA 4R98A 3AVQA 4BEBA 2B7BA 3MWYW 3ECCA 1P9WA 2QPAA 3GFOA 3NBZC 4IXNA 3E70C 3LX5A 1DELA 5FPYA 3SDZA 1E2GA 1L2TA 1OXTA 4DWJA 3KFVA 5GVSA 1G3RA 2P65A 1BH2A 3LAWA 4P4SA 5EXPA 3VNVA 1TU3A 3B1YA 2QT0A 3MSXA 3SI7A 4DDTA 3K9GA 4YMWA 1FX0B 1E2EA 3U3OA 4BUJA 4YDSA 4RZ3A 3AVVA 2XNSA 1AIPA 4HAVA 4ESHA 1U9IA 3K09C 1CJMA 4D0LB 2J45A 1VG0B 5BW8A 4OHXA 1ZIPA 5F9FA 1NVXQ 3EC2A 2ZSFA 3FHCB 1TNDA 5G41A 1H8HA 3SJCA 3U4QB 3CRRA 1OIWA 3VKGA 4DSTA 2F1HA 1DPFA 2GZDA 1TQ6A 2XTNA 3RABA 2ZU6A 4WA7A 3WHKA 2PT7A 2H18A 2IXFA 1VYVA 2FH5B 1TEVA 2NG1A 4JYBA 2RMKA 4TLDA 1EFRD 2LCFA 4LYHA 4S2EA 4BLSA 4Q4AB 1G7TA 1YE8A 5JWOA 4B2LA 4YXWD 1NVVQ 2FEMA 2Q3HA 1EFRA 4O0MA 3ND8A 3MFYA 4M53A 1UFQA 4F4JA 4V0ME 1VYUA 3RAPR 521PA 4XD7D 2PZEA 1D2MA 2VQSA 1I2MA 1S4QA 3CF0A 4JLKA 1RRCA 3ZZTA 2QE7A 4CDGA 2GHIA 1Z2CA 3K0AA 4IDQA 4F93B 3DOEA 4FCTA 3GPLA 5KU1A 4Q1BA 1GITA 2ZJZA 1W5SA 2CBZA 3SBDA 4DLTA 5JI3E 3HPQA 1AKEA 2PL3A 3G0HA 3MWLA 4R9UC 121PA 1Z0FA 4BQSA 4IOKA 5G3ZA 2DY1A 3KB1A 5CLLA 3TRFA 1H8ED 4B3GA 4NYMR 1NKTA 4LYAA 3TJZA 2QP9X 4RCZA 1R0ZA 1EFHA 1IOZA 2AD5A 2ZUDA 3NC0C 1NVWQ 4JL6A 4GI7A 4A6XA 1M74A 1E0JA 3K0EA 3C16C 4WOPA 1OHHD 2CVFA 3NBXX 4F4IA 3QKRA 4Z8XA 1JJVA 2ZE6A 4A8JB 4B43A 3QXSA 5CB6A 1W7AA 4NMMA 1E1RA 2C9OA 3A1WA 5IK2D 1E0KA 1SZPA 3WMGA 1US8A 4NPHA 3ZQJA 1V5WA 4QL3A 1T5LA 1G5PA 1X8JA 2PCJA 3D3QA 3QE0A 4PAQA 3EPJA 3UATA 4OJQA 1ZP6A 4UXJA 2F9LA 3MWKA 1JB1A 1G8FA 3EASA 3U7EB 4EIWA 2VF7A 4CEHA 4GSYA 3THYB 5KSYA 4EAQA 1KZGB 2IUSA 2QM7A 4ZKDA 2DWQA 4N3NA 3W9YA 3B6EA 1KO4A 2ZR9A 1A1VA 1FX0A 3SHWA 1Z3IX 2ZRFA 5JMTA 4MITA 3VU9A 5AUQA 1ZD8A 4YMTA 1G8HA 3PIRA 4Q7LA 2J0UB 4C0JA 1PLLA 1NJFA 2B21A 3FMFA 4N1AA 4ZDWA 1SXJC 1G1MA 4Q00A 1IONA 4LBWA 2CJWA 3ICEA 1ZBDA 3BH6A 3ADDA 3PUZA 5EP3A 3AGPA 4QFMA 4IJMA 4RD2A 4P33A 3FTQA 4EQ6B 3BB4A 4TL9A 2NO0A 1OXUA 4FXPA 2FF7A 2J1LA 2J7KA 5E7JA 1X6VA 4R2IA 3LQRA 4JVMA 3FE2A 2PMKA 1F3OA 2JCSA 3F0TA 1G4AE 1G7RA 2ANBA 5FBQB 2AXPA 2VP5A 2DFLA 3SQWA 4Q1FA 5BYKA 1VMAA 2CHQA 4ESVA 4DLXA 1GVNB 3B9PA 2ERYA 1R0YA 5GVRA 5CDFE 1U90A 1MKYA 4OQXA 1QHNA 1XMSA 3X1ZA 3PEUA 4PC2A 4ZDIA 1RKBA 4XVUA 4AKHA 1LTQA 3RS2A 5E3HA 1DS6A 3O47A 4LJ9A 1ZMXA 3C14C 2ZIAA 1EX7A 1GKUB 3AVYA 1U81A 1JEEA 5ANRB 1M7HA 4QGGA 4B73A 1X1RA 3GJ8A 3R7WA 3THXA 1NBMD 3AM1A 2ZI5A 3U2QA 2EFEB 1KI2A 2V6JA 1MR3F 3DO6A 4FD2A 1L7VC 5FR2A 2NZJA 2VL7A 4NCJA 5KYKA 3HYRA 2WWGA 3CRQA 4OBEA 2ZRCA 2WJVA 1F2TA 1RRFA 4A82A 1KO8A 2ZYTX 4X8HA 1NMYA 4PXAA 4AYTA 4LHWA 4EKDA 5L8VA 3T1OA 1DTSA 4IDHA 2W2TA 2OV2A 3C7KA 4A92A 2IEYA 1HY3A 3FOZA 3THWB 1RYFA 3A37A 3EWSA 2Q9CA 4IHQA 2XJ4A 3QF4A 4ZCMA 4PHHA 2CLCX 3AKDA 2OFXA 5FPHA 1UKEA 3AVXA 4M22A 5EE9A 5HE8A 3L0OA 5SZKB 2NMVA 2EVWX 4GPTA 4I4LA 1AKYA 1KMHA 2O0JA 3K70D 1KI3A 3ZVLA 2FE4A 1XD2B 3WYGA 4HUTA 1ETUA 2AKAB 2WWYA 5FUWA 2JIZA 2J5XA 1FMLA 4FN5A 4MKFA 5IHPA 2QROA 3CZQA 4OI1A 1Q1EA 5D3MA 3GLGA 4H1VA 2IS4A 2NO1A 5TDHA 4JLOA 4DVGA 3UWOA 1FP7A 1RW4A 1SXJA 2PEZA 5EJEA 2YYZA 4XTRA 6Q21A 4IVPA 4BFZA 3K1JA 3CWZA 1XTSA 4CZ2A 1F60A 4W7SA 2HLDD 5L3SA 1CU1A 2QTHA 3A8TA 3PR1A 4TTQA 1E1QA 2VF8A 1G8GA 4ZV4A 1A4RA 5AR1A 4GMXA 1UPTA 1KKLA 3BGWA 3RS4A 2QPOA 1E3MA 1P5ZB 4O2LA 1P2UA 2IYZA 1BYIA 3R9WA 1Z06A 3U7HB 2ONJA 1MO3A 2CNWD 5J5CA 3TLXA 2IYWA 1PZNA 4Q4JA 5A5GA 5C18A 1W4AA 3BXZA 4Q4HB 4C0BA 4PO9A 1XPOA 4EPXA 3VX4A 1Z63A 1TADA 4DBLC 3TSWA 5SZJA 4BLQA 2WIAA 1CR1A 4DHEA 1IY1A 2FMXA 1VG8A 2VTKA 2HDNB 4R71A 3TUIC 3L82B 2KBEA 2QGZA 4C0LA 4ZDJA 2NO7A 1LV7A 4HLUA 1Z0DA 1NIPA 4GZMA 2GJKA 4RKEA 5DI3A 1OKKD 3OFND 2XTMA 4E5UA 3ASYA 2JJ1D 5BWMA 4IW3B 3BH0A 3SQXA 4CT4B 4BFTA 5FUVA 3SHFA 3SEAA 3DHWC 1ZNYA 3U6BA 1CRPA 1G6OA 1G5RA 1U94A 2QMOA 1QHXA 1P75A 5HKKA 1ESNA 1AA9A 2WJIA 2RHDA 1JXMA 4R2HA 1Q1BA 4HSEA 4RFSA 1IQPA 3H4MA 5HKKD 4FW9A 3CRVA 3LXRA 4FWTA 1HQYE 5TXGA 1EFCA 2WM9B 2ZRKA 4UXIA 3CKLA 4B34A 1NN5A 3UMFA 2R65A 2ZI3A 3FKSD 2IYUA 3NIBA 3ZDQA 2AN9A 4LHXA 2FOLA 3FYHA 3SR0A 3RVBA 4TYYA 3KDSE 2RHMA 1SVOA 2FFQA 2IWHA 5FTMA 1OFIA 4BFUA 1R8SA 1YZGA 3LBIA 1XPUA 4M1WA 2Z4RA 4F4CA 2EWVA 4KFSA 4DDUA 1OYWA 4NCKA 1JR3D 3VQTA 3UMRA 1G8PA 4IEEA 3LFUA 2ZETA 3U7GA 721PA 4B33A 2XGJA 1F2UA 1VCNA 1ZC3A 2JAQA 4PC7A 4JLNA 2ZQ5A 1KK1A 4MGKR 2A30A 2RH5A 5BQ5A 2NO6A 2VSFA 1M7BA 3F5FA 3QKRB 2OSBA 3SJAA 4DLWA 4D82A 4GL2A 3SYKA 1GZSA 4UNNA 2QT1A 2FSGA 1W2HA 2FSHA 3Q72A 4Q7KA 2OM2A 4G1UC 1SVIA 1H65A 1K6MA 1VHTA 5AJZA 4D80A 1EGAA 1WBBA 3U7FB 2WWXA 3OEED 4JVNA 2E1RA 3C4JA 2OT3B 3ND9A 1W0JD 3HP1A 5L3SB 5TB5A 3B8HA 1KGDA 2QG6A 1W44A 3A4MA 5IRCD 1HUQA 4LGMA 2PZFA 1SHZA 4N0DA 1SXJB 3IGFA 4JLPA 3EZFA 4B3CA 4EDHA 2XNDA 2VP9A 5FPSA 1UM8A 5KO2A 3P26A 2QZ4A 4QM7A 2GTPA 5KOYA 2FFHA 2NOAA 2XSZD 1ZVQA 3NKVA 4DLRA 2CE7A 3Q9LA 4UNRA 1P3JA 1XTIA 1EWQA 1N2CE 4DLVA 1N6RA 4G3XA 1QHSA 1A2KC 3IPYA 4YLGA 4F91B 5FH9A 2C04A 4Q9LA 4BZXA 1EWRA 1HA3A 1W46A 2O5VA 4QNRA 2W0MA 4Q47A 4LBZA 2EWWA 4HZIA 3PJRA 4P31A 4CIDA 1HT2E 2DBYA 3DL0A 3LX8A 4Q9HA 4GRAA 621PA 3GJ4A 1Z08A 4B44A 5B30A 3KB2A 2GAOA 3FFAA 1YZTA 1AQYA 4Q4HA 1XRJA 4TL7A 4XD7A 1X1SA 1EG7A 3EX7C 3MG9A 4I81A 1AK2A 1Z0IA 1BIFA 1II9A 2WPDA 3GJ6A 4DB4A 2YVUA 2H8KA 2AL7A 4FMCB 4YMSA 3RDPA 2H92A 2IYRA 2GEDA 4BFYA 4JLAA 3CLVA 2WJJA 1N5IA 4TMXA 5DH9A 1TQ4A 4CEJA 1W4CA 2WTUA 4RFVA 3QIAA 3BBPA 5LPNA 3KKQA 4KBFA 3LDAA 4EFNA 4TQAA 2YINC 1Z6AA 1XU4A 2GNOA 5EZ6B 5L3QB 5EZ5A 1Q1ZA 4IKEA 4B3FX 2O8EA 1WF3A 1AGPA 2ZRMA 4M1MA 3TE6A 1UF9A 4EPRA 3U3KA 4OJKA 3DKPA 4U02A 4MGYR 4LV5B 1U8ZA 1G3UA 1IAQA 2VBCA 2RB4A 3VMFA 3DOFA 2A78A 3TSOA 5JRJA 4POAA 1NG1A 3KTAA 4NL4H 2X8AA 1RIFA 2ZRDA 3SU8A 1W4BA 2Z43A 1OHHA 2IS6A 1ZW6A 3GLIE 1LF0A 3IQWA 5FL7D 2R2AA 1ZD1A 2IEZA 3THWA 4DJTA 1RRGA 3TK1A 2I1QA 1E1RD 1ZM3A 1JPNA 3Q85A 1L8QA 2G6BA 1N25A 1XEFA 4TMKA 1KTVA 4EUNA 3UG6A 1B23P 1NBME 2WJHA 4Q5IA 2OILA 1VTKA 2QORA 4GFDA 1EFUA 4LV8B 3FWYA 3KJHA 4P4UA 2OBMA 1LW7A 1ZCBA 2J0UA 1R0WA 2OESA 2RGEA 1KJZA 1XCGB 2QBYB 4JIMA 4AY2A 2D7CA 2R9VA 3CM0A 3DEFA 3H84A 3B1XA 4TLEA 2WV9A 1WA5A 2RGXA 1T0JB 2ASEA 1GRNA 2GJ8A 4NKRA 1U8AA 4XVQA 3AVPA 3EZ6A 4G5RA 5C1BA 1G41A 3RC8A 1TQ2A 1YVDA 2P67A 4IXMA 4N0EA 4IOLA 3VR2A 4B35A 4CEHB 4D2IA 3KQHA 3V9PA 2AFHE 3MLEA 1XX6A 2ATVA 2V7QD 2WJGA 3CWQA 3SN6A 1SVMA 4JT2A 4M1KA 1R5NA 1SXJE 3WRYC 2KJQA 4B6EA 1VCIA 4RD4A 5EE5B 2JGNA 1XWIA 5DN6D 4LCBA 3TR5A 4GOXA 3X1YA 4HZUA 5LDDC 2CCGA 5JCPA 3BK7A 1G3MA 3FKQA 1CTQA 5DHFA 4BFVA 3DKVA 3E2IA 3ASZA 2J7PD 1GP2A 5FBWB 2ZS7A 3EXAA 1N6KA 1NY6A 4UNPA 5CK5A 1YJ5A 5GJCA 1E9RA 2AK2A 1R4AA 4HB3A 5KDLA 3RS7A 4UNSA 2DYKA 3DZDA 3N2IA 1AJEA 3QKSA 1S3GA 4NYIR 3R8FA 2GETA 1E0AA 1W4RA 2IHYA 1WQ1R 2ORVA 4ITRC 4LV6A 1MO5A 4OI0A 5EXTA 3OF5A 4A1FA 3K70B 1TUEA 4PX9A 1G21E 2FU5C 3VFDA 5IT5A 5G3YA 1QZXA 1XZPA 2BCGY 1TF2A 2CLDX 2C77A 1N5LA 5AUPB 1KDPA 4DSUA 4PQYA 1N6LA 3BE4A 3CPJB 2BJWA 3RC3A 4DKXA 1S1CA 2BMDA 4RY2A 5BN5A 3UMSA 3RWOA 1D5CA 4NYJR 1M6NA 3A1VA 3A6PC 1RJ9B 1Z07A 1W47A 1XMIA 2WJYA 2PX3A 4TQ9A 3BS4A 2WWIA 3MMPA 2R6DA 1Y63A 4Q1CA 1C9KA 3AKCA 4TQUS 4HUQA 1Q57A 3AP3A 4HLCA 3TIFA 3K9NA 4O25A 4ABYA 4DDVA 1IN4A 2NGRA 1S0UA 2L0XA 2PH1A 3PEVA 4WVFA 1SQ5A 4RD0A 4MRPA 4GBMA 1KI8A 1W0KA 2IF2A 3AF1A 2JLSA 2J0SA 3TUZC 4TYWA 3W3ZB 1KNXA 2IYLD 3FVQA 2REBA 3VKWA 2QENA 1E9DA 1XD2A 2CHGA 1TPZA 4KU4A 3OESA 4XWKA 4WZ6A 2D62A 1E1QD 3Q5DA 3WNCA 1TX4B 2W0SA 4KSBA 4GOKA 3OE7A 3AP1A 5EXXA 2ZTSA 3X1DA 2DHRA 4DEYA 3EC1A 5HZHA 2IS1A 4B3BA 1ZNXA 5EE3A 3K0SA 2REOA 4ZDKA 2FNAA 4KI0A 1CULC 1A5TA 1GRRA 2ODBA 2J59A 4DT1A 5E95A 3KXLA 4MKIA 2YWGA 4Q4LA 2Z6VA 2G0TA 3IQXA 5DO9A 4XWOA 4TSFA 1XTKA 2R62A 4TTRA 5J4VA 3GEIA 2C9YA 4JLVA 5DNYB 4B48A 4AKIA 4TSFD 3SZRA 1VCOA 1JR6A 3WYFA 3Q7QA 1VIYA 3NWJA 5M04A 1JNYA 2ZYUX 4M1YA 3W6OA 1QBKC 4OK6A 5H70A 3LQQA 5FBLB 5CB8A 1N5KA 5JWRA 2V9PA 1J8YF 4QGFA 2ZRIA 1MV5A 4KYIB 3JZMA 3DZ8A 1P6XA 3DPUA 4Q7MB 4DLYA 1DAHA 1FL9A 2BVNA 3BFVA 1E4YA 1NMZA 2J87A 2OBLA 3L2OB 1Q1QA 2F1RA 3Q7PA 1E99A 4LX0A 2EW1A 3BFXA 3RHFA 4KITB 1KMHB 2OZEA 1XBTA 2W58A 3W34A 4YMVA 1U2RA 2OAQ1 2AKYA 2V1XA 4LJ5A 4LC1A 1CJUC 4TZ0A 3UWKA 4PPQA 5JJIA 1KOFA 3AKYA 1GWNA 4QBHA 2GCPA 1NVUQ 1U99A 2CLSA 2OLKA 4M2LA 2QU8A 2R44A 1YU9A 4CGZA 1FQKA 2QAJA 2GF9A 2W6JA 1VKJA 3KTAB 1IBRA 2D74A 2F55A 1KO5A 2BM0A 3PUVA 1WP9A 2AWNA 3ETLA 3PUXA 4BZQA 4O2RA 2RGBA 2WSSD 4TMZA 1TEXA 4B47A 1KHTA 2NZ8A 3UG7A 2ZRAA 3T1VA 1N3BA 4HB2A 2FSFA 3W5IA 2XOKA 2GBLC 5KTYA 2GXAA 4A8JC 4D4MA 5KNBA 2V8OA 4DIDA 1SKYE 4V03A 2PCLA 3PUYA 1MRNA 3U6KA 4XVRA 4RZUA 4D25A 4QM6A 4Z51A 3QY0A 2PX0A 1CLUA 2B6HA 4JLDA 3AV0B 3NC1C 1S96A 2ZROA 4QJ3A 5HZKA 2QY9A 3L8YA 4EQ6A 1I4DD 4L16A 1PVOA 5DGXA 2HCBA 2GWHA 4YMUA 4JBXA 1SGWA 1VG9B 3CO5A 4X8MA 2RGAA 1F48A 2K5UA 3ONWA 1IM2A 4NYMQ 5LD2B 4QKQA 1QHIA 4J0QA 4RD6A 2H16A 4Q21A 4PC6A 2NIPA 2IYXA 3PENA 3WP0A 1ZIOA 1S9HA 2RGDA 1Y3AA 2R6AA 2YKGA 4H1UA 4D81A 4HB4A 1LF5A 2BKUA 1E9FA 2GK6A 3EG5A 2C9CA 1R2QA 2BMEA 4JLJA 1XTRA 2RGGA 4B3XA 1E96A 2GA8A 2LWIA 4A2QA 4BLTA 5EE0A 2H1LA 2D7DA 5DYGA 5TMPA 2WMOB 1E2LA 2DWPA 4URWR 1XXHE 3LRPA 4MRVA 2CJWB 3U60B 1Q22A 1X8KA 1ZM4A 4EPVA 1Z0JA 3GLFB 3NDPA 1ZYUA 4PZZA 1NLZA 1GKIA 2FG5A 1H8HD 1A2BA 4RVCA 2CE2X 4UNQA 4XH9B 1WE2A 4D4JA 2ANCA 4OHZA 2OXRA 3CUEF 1GTVA 3CX7A 5CIQA 3AEZA 1XJQA 5J4KA 1JXOA 3R20A 3RRNA 1KK0A 4TMWA 5J4LA 3NG1A 3ZGXA 3BJIC 1R8QA 3K8YA 3N70A 3WBJA 5FPKA 5CLQA 4C0KA 4QHSA 4TWZA 3KXIA 3VR1A 1OH7A 1XEXA 4TMVA 1CR4A 1OFHA 5FUXA 2MSEB 2XEXA 2ZM5A 2EYQA 4DRZA 1E2HA 2OFOA 4KXFB 1W36D 2O8FA 2O8DA 4II7A 4A0HA 3OIWA 2JLXA 4L15A 4UJ5A 4HAYA 5KHOC 2BBSA 2C98A 3EWAA 5AJXA 5KSOA 4JMPA 5EUMA 3IO3A 2OAP1 5CK4A 1D6JA 4JKYA 4QHYA 1XEWX 3QNUA 3M1IA 4TT3D 4PSVA 2QA5A 2HF9A 2A5GA 4DCTA 3PITA 2R6GA 1HQCA 1TU4A 2ECKA 4MKGA 4US0R 3THYA 3QQ5A 3FMOB 5P21A 2KI5A 1ZUNB 4V0LA 2BV3A 1M2OB 2JA1A 3FPAA 2JATA 3EPLA 3QSYA 1SVLA 1KIMA 4Q4JB 3TW4A 1R7RA 2Q9BA 2Q21A 5DI3B 5LB2A 1MOZA 1WCV1 3LA6A 3PXGA 2JJ2D 3GMTA 1NMXA 2BIFA 2IYQA 1N6OA 2ONKA 5EE1A 4DLSA 3VHXA 3AGQA 5F3WB 4U00A 2SHKA 5CDFA 3U3RA 1W0KD 5GADl 2IYYA 1E2PA 1AQUA 1ZCAA 2GXUA 3C5HA 3CPEA 2JIZD 4GMDA 3UIEA 3WP1B 4DEXA 1N6PA 4PSAA 3HYTA 2VH5R 1XMVA 3N5CA 5DLQC 2C2HA 4IDOA 3U3JA 1NSTA 3H1TA 2G9NA 1C4OA 1S3SA 4FCWA 4PTLA 2WOJA 3P4XA 2BOVA 4NDZA 1BKDR 2VP6A 2VP4A 3HU2A 3GJ5A 2ZUBA 3B60A 5LD2C 3KQLA 4JLBA 5TVKA 3WMEA 4IDNA 2OUKA 1IXZA 3KX2A 2W2XA 1VPLA 2HF8A 1YRBA 3SJBA 3MCAA 4OHYA 1UBCA 3QG5A 4AKEA 4EJSA 1Z6YA 3TR0A 3B82A 3TBKA 1G7SA 1OYYA 3MWJA 1E4VA 1CBUA 2EFCB 5TARA 1XEXB 2D4HA 2ZI7A 4G5SA 1E6CA 2GAAA 5JI2E 3NTUA 2I4IA 2O0HA 2KE5A 2FZLA 1U9IC 1BYUA 3LVRE 4PAMA 2IUUA 2VP0A 1QVRA 4NU0A 2RCNA 3TVTA 2QEQA 1TQDA 4AG6A 5FR1A 4IOJA 4LYFA 2PMDA 1ZM7A 4RCYA 2OFWA 4KBGA 4ASUA 2J9RA 4BRUA 5K8UA 2UZIR 4PO8A 3TGPA 1P2VA 3GLGE 2QBYA 1GNQA 4JVSB 3F8TA 4BLPA 4OK3A 2OCPA 4AK9A 4ASUD 4KSCA 1G4UR 1XD9A 2JJ1A 2IA5A 2WAXA 4KJZA 1T0HB 4KVGA 4NH0A 2X2EA 3FHOA 4LJ8A 3X1WA 1G5TA 2LKCA 1FFHA 2CCKA 4WZBE 3D7MA 4DCVA 4WZAE 3BERA 2JDID 2WIBA 4RD3A 3UK6A 3SJZA 3C41J 3U44A 1RC8A 1T91A 2BBTA 4LC0A 4M9QA 4M8NE 4QBGB 4V02A 2UKDA 2ZJ8A 3LD9A 5K8IA 2X77A 1KY2A 1XJCA 4BPBA 3TVDA 2BHRA 3IBYA 2NPIA 1EFTA 3FKSA 2IWRA 3TNFA 4D26A 5F9HA 1FPMA 2FWRA 3BAFA 1TUIA 2F9MA 5FFMA 4HATA 1CJKC 3EIQA 1IN7A 2WZQA 4UXHA 4C30A 4CYMA 5AWFC 2V4ZA 3K9HA 3C8UA 4GZLA 1CR2A 1UBEA 4TLBA 3OAAD 1CJVC 4WXRA 5SZHB 1F2TB 4JSTA 4JJKA 3DVLA 4Z8YA 1FOEB 4L9WA 2OEPA 2HV8A 3LH5A 3E1SA 3QF4B 1QHHA 4KODA 5L3QA 1FUKA 1JPJA 2PJRA 1M34E 4E07A 2G1JA 3QBVA 1J70A 2D3WA 3TSZA 1COWA 1NNEA 4FMDB 3SNHA 3KUCA 4US2R 1TTTA 4B32A 3ZZ0A 3KFXA 2AWOA 1U0HC 4NZYA 1YZNA 3LBHA 1D9ZA 2F43B 3CONA 4DCNA 2Y8EA 4ZIRB 1PUIA 5D3QA 1AS2A 2MSDB 1LY1A 3A4LA 1J7KA 4K8OA 2RGNA 4QJ4A 5FBRB 3SYLA 1BOFA 3K09A 1GOTA 3O8RA 1XXHA 2HUPA 1KK3A 5AJVB 2UVQA 4ON9A 1DVRA 1QHGA 4B75A 1T9HA 3ZD6A 1ZNZA 2ZE5A 2KSQA 1DOAA 2CVHA 4TL6A 3OIYA 2VHJA 4KFRA 3TW8B 1HE8B 1Z6GA 2X1VA 2XSZA 2KBFA 1UEJA 4D0GA 3J81k 2XNDD 1QF9A 3FMIA 2QAGC 1G18A 3AQ4A 4B71A 4URVR 3EARA 4YQFA 3TAUA 1DBSA 4Q1DA 5J4YA 1FP6A 2XXAA 4I99A 2FDCA 2I3BA 3A1SA 4HAXA 4HUQB 3D31A 4WBSA 4LHZA 2AFIE 1CS4C 4LDJA 1K5DA 4JL5A 1SHKA 2OLJA 3LW7A 3NHAA 5FUYA 4AI6A 3WHLA 2GEUA 4DXAA 3EIEA 4K81B 3AF2A 3GD7A 1VDZA 1II8A 4K46A 1E0SA 3D8BA 4JBWA 4CW7A 3I5XA 5JZVA 4A9AA 2GJ9A 1Q3TA 1Q21A 3HPRA 1CRQA 1E94E 2CDNA 3I4LA 1XB2A 1Z83A 1GL7A 1AZSC 3KXKA 5DSZA 3V4FA 4XJXA 2ZRHA 2ERXA 3W8RA 1WXQA 4IVRA 3BB1A 2W6ID 3I8XA 3MAAC 3NDBB 4GNKA 5GJVC 4YONB 2BBOA 2GVZC 1OH5A 2ODWA 1JI0A 1GAJA 2YZ2A 3K9LA 4E09A 2FJUA 2WKRA 4NCHA 5FOVA 1CJTC 2C78A 3R9XA 2W6JD 1WMSA 2E87A 2PJZA 2ZS8A 1C1YA 3BC1A 3I8SA 3GLHE 1OIVA 2WSMA 5CYPA 1W36C 2QPTA 1GNPA 4BGDA 1GILA 1CF4A 4MDFA 4Q4AA 3TQCA 3SBEA 4OHWA 1MT0A 2WWHA 2OHFA 4EPTA 4A15A 4Q02A 5JBQA 2IK8A 5HR5A 4PR0A 2DFKB
chains in the Genus database with same CATH superfamily
4D9MA 5JSYA 3CX3A 2ZBFA 3OSZA 3QZUA 1O3YA 2L69A 2HREA 3W5UA 5EGSA 3GIWA 4AP9A 1DP4A 3LYHA 2TECE 3GLFA 3RS9A 2XAAA 4PG5A 1KI6A 1O94D 2OP1A 3Q5EA 4ZOBA 4X91A 3RVQA 3LUFA 3WBKA 4PX5A 3M6UA 3T5AA 2CJFA 1D9XA 2LR0A 2ZKIA 2OKGA 3C8MA 2VLIA 3HV2A 3Q9UA 3QELA 3QVMA 2IVZA 2PK3A 1HDOA 2AC2A 3EEIA 1KE1A 5A3QA 1VE3A 2WWFA 3FGNA 3O2NA 4P2BA 3PQCA 5FNVB 4KWHA 1Z0UA 1HTTA 5JS8A 1EFKA 1OFTA 2P3SA 1EX9A 2O3UA 2QN3A 1EB8A 2ZPUA 3D7RA 3F97A 3LF1A 4TYQA 5D87A 2R4UA 2YHIB 4ZPXA 1A9XA 3RW9A 4RDCA 3C6BA 4FS3A 3U4CA 4UVDA 2VNJA 4ZAZA 1P1FA 3W5JA 3NVAA 3IEXA 5EJAA 4P0PB 1E2FA 4U7DA 4YAGA 3I4CA 1L4NA 3ZH9B 1FDSA 4LWOA 3VSBA 5H02A 4NYIQ 1VSBA 3HR7A 3I9OA 5EJFA 1YZUA 1MW8X 4GM4A 4H2DA 3CLRC 4O4HB 1TM2A 4RMHA 2VHTA 3GOQA 3PNKA 1KEZA 1CDOA 4Y6OA 3DEKA 3A1TA 4L3OA 3S1AB 3ZHRA 2FEOA 1TJ3A 2HDWA 3D7NA 4X24A 4HNRA 2ZYVX 4WERA 1GLNA 5KOJB 1I4TD 3DJYA 3JYLA 2F4NA 1K9VF 3IV6A 4J16C 4R1UA 5G40A 2QN9A 3G2JA 2PL9A 4I1SA 1L6RA 3HBNA 4KK4A 4X7RA 3S55A 3ZHXA 1NVEA 3ELDA 1NP6A 1FW6A 3OX3A 4BMVA 5KMGA 1J7JA 10MHA 4S0ZA 3H4VA 5MDHA 1OTYA 1XLWA 4HGPA 2AD1A 4UPVA 5DN6A 5T3UA 5DJ5A 1MF7A 4MGHA 4B74A 5LKRA 1YS9A 1I36A 3CLTD 5TQ2A 2QM8A 3D0OA 4W9MC 3NBYC 3PL1A 4OLBA 1O8CA 3BICA 1PLKA 1DKPA 2V3WA 4OK5A 5LNK1 3GFPA 1TYAE 2I1LA 2HHHB 4MROA 4HY3A 5ESWA 2C58A 2P4EA 1W9HA 2PZLA 4MA0A 4TV8F 3H2GA 4TOIA 1Z68A 4LRXA 4M0CA 4B3MB 1ZQ9A 3WQBA 1VKOA 1SCJA 1PJTA 3HRIA 4M9SA 5FXMA 2BHNA 4BMDA 2RHTA 2RG1A 1QMPA 2SKDA 1B3BA 4C1BA 5HIKA 2VZ8A 3IUMA 5C53B 4A8PA 3WLQA 2EQBA 1A9QA 3OTGA 4Q1AA 3MLBA 3ZIAD 1N92A 1PP4A 1XEWY 4U2BA 3P4YA 2QRPA 4G01B 2QP3A 1L1EA 5DGDA 3ROQA 3L4BA 4IHJB 4YYEA 4CR8A 5DLYA 5IDYA 3SHOA 5K8JB 4LDNA 4JYAB 4W5OA 1EHIA 4L9RA 4GOOD 1QRUA 2H1CA 2Q5HA 2XUZA 5IP5A 1IG0A 3GPCA 5AKIA 3F9CA 4FZ3A 3NEJA 2Q3LA 2QR2A 1EK0A 1B0PA 1D4AA 2NO4A 4R31A 1AHIA 5DXFA 1S9DA 4BFCA 4P84A 4CMAA 1E3WA 1GFIA 3JZDA 4MA5A 2JGEA 4DQKA 1ABFA 2ISSD 5A3JA 1PR0A 4DCUA 1FCJA 1K5GA 4JA0A 1HT1E 4MK4A 3U4DA 5BXQC 4BO4A 3O90A 4MS3B 1E3WB 4I1OA 2I7DA 4AJ2A 3FZGA 2H29A 5KVQA 3I9JA 5EXDA 1X86B 4B2PA 2C95A 1A7JA 4DANA 1T4MA 3DLCA 2DPYA 4ETNA 4I66A 4G6ZA 1JALA 2IOHA 1PI3A 4QU0A 4WWHA 5FOQA 1XCMA 2FPWA 4ZYYA 4HI0E 3HZZA 4RTNA 4Z4IA 1TL7C 2CL0X 4TWRA 3W8NA 2O19A 1SOVA 5FYDA 1ORVA 3CZPA 3G9ZA 2HEIA 4MUEA 2UU9B 3L5OA 1IHDA 2VRBA 4ER0A 4MVJE 4ZT4A 2FR1A 4TVSA 4LF8B 2ZB7A 1Y9JA 5IJWA 3LY8A 3OBIA 3ZDDA 4HH4A 2E5FA 3OHSX 1VPDA 3HVIA 1VRWA 4JOBA 1OASA 3JWHA 1LBTA 2M98A 3DL2A 3OUUA 4HPJB 3VC1A 4M4SA 1E9CA 4ERNA 4BFSA 2WD8A 5A4JA 5IM4A 1JLRA 4XCXA 3ZY3A 3TIVA 4X3PA 3OE7D 4RK6A 3FVTA 4ROSA 3D2LA 5EP4A 8ATCA 1E2MA 4ARCA 4MWSA 1IBSA 1OX4B 3H7IA 5KKAA 4DC9A 4OJNA 3VZPA 4GL4A 4ETIA 3V33A 1UFRA 2NPOA 3B51X 4Z86A 4DZZA 1ANKA 2MINB 2ZJ5A 4I9UA 3RQIA 2O52A 1TLLA 2OBXA 1JR4A 3H0EA 2ZITA 1E9SA 1M7GA 3GYGA 2XCRB 3QA3E 3VH3A 3B1VA 4RSMA 4C5CA 4DMKA 1UKYA 3K8OE 3MN1A 2G9VA 3MMNA 4RSHA 4TN1A 3H0CA 1W5TA 5LJLA 4MKHA 3VKHA 3H2JA 2JARA 2ZAYA 2DPGA 4R7ZA 1GQ2A 1XZKA 1JVNA 5EIBC 4FFSA 2O7QA 2C59A 2IYTA 4TXJA 4BVJA 4KPYA 2X4IA 2YHIA 1ZC4A 5K6RA 3L1KA 1MJGM 4OHCA 2IV2X 1VHLA 3JS5A 8LDHA 5K8CA 2ZFUA 2AN3A 3L4SO 1I6LA 1NN3A 2Z1DA 4HQNA 4YIKA 2OCBA 4GUDA 3AVUA 1U0TA 5EUQB 2I2XB 1XRQA 4MQLA 3WGLA 4EJSB 2R6FA 3QXXA 3I32A 3IYLW 2A0WA 3ZIDA 3ZU5A 1BJTA 3BTVA 1E1CA 1PV1A 4MW4A 2H1RA 3CRZA 3DB2A 3E5NA 3QWHA 4ZGWA 3RS5A 1KZ4A 4F4UA 4RLSA 2BDEA 4EATA 2I6SA 2DAPA 3A6KA 5GIOE 4PFQA 4MQMA 3GMIA 3KL4A 4MUXA 5K4AA 4AKTA 2VDWB 2UZ4A 4CKBA 3D8HA 3DEAA 4F85A 5LQJA 2QWXA 1U3GA 3GFQA 5EUBA 1UT8A 4Z9FA 4RPLA 4KO8A 1DTWB 16PKA 1VLLA 4NFHA 4UHJA 1ZISA 1G2QA 3G1UA 3JYOA 1XTJA 4IHKA 4P36A 1SN7A 4JI2B 3RSCA 4L78A 3ZK7A 4YQZA 1II8B 1SH7A 1XLTA 5EA2A 1G3IA 3D8RA 3BRSA 3A6HA 3A6ZA 4JROA 2BPOA 1K1EA 2GCOA 2RAFA 4DXDA 5ALJA 3VJKA 2E21A 3R3HA 2XZPA 4JYZA 3ETNA 3ZWAA 1GUAA 2H17A 5EGNA 5IEBA 1C81A 3V8EA 5KYYB 1N2EA 4JI8B 5C8XA 2C8VA 4H4CA 1RBMA 1FFBA 1WDMA 3NWBA 4AJNA 1PQPA 3QOFA 1ZUHA 1GPBA 4X45A 5JNVA 1MFZA 3MBOA 4KTTE 5CD9A 1Z6XA 3MUEA 2D7JA 1WQ3A 3JVVA 3CYFA 4I5GA 4KMRA 5F1KA 1W1UA 2BFNA 2JK0A 3G0DA 2XUOA 2LP4Y 5IVHA 1NMQA 3EXG1 3RFFA 5ILOA 3TMKA 5E6RA 2H7VA 5LVAA 1JBEA 1ENOA 2JJ8A 4PXSA 1YJ8A 1BO6A 2QD2A 2BKEA 1WBDA 1GSIA 2F7SA 2HYIC 3H18A 1YA6A 4CKEB 4RMJA 3PE3A 1XZGA 2WVHA 4WW0A 3QMMA 1Z5VA 2YV4A 1MDBA 2LZ0A 2WKQA 1Z7EA 1CLEA 1HRKA 2P5TB 3IUSA 3NGMA 3KE9A 5AM4A 1XU9A 3CUWA 3LY5A 4MS3A 4BNZA 4RK7A 5JQGB 3QVJA 1VYTA 4ZYUA 5AFSA 1FFCA 1Z5ZA 2ZTUA 2H9IA 3L06A 4H18A 3MMSA 1EAYA 1V4VA 5BQXA 3PTAA 3M34A 4D3FA 2DT5A 4UJ3A 4WLFA 1Q20A 4Z1MA 5IX8A 5CRIA 3UXHA 2VJKA 1L9KA 3R0VA 1TPYA 5IAEA 1K4MA 1CF9A 2ZR0A 3B2EA 5CITA 2G67A 3AP2A 4ND3A 3AF3A 4TTJA 3OU2A 4HEA6 2MR5A 3B53X 2JFQA 2HSJA 5BSKA 1SZDA 3DBRA 3E58A 1TLTA 3EEFA 3OJCA 5HNKA 1KFKB 3HDJA 4DSNA 2ZSEA 1UEXC 2BMFA 4MMZB 1SVWA 3TTXA 5LQAA 4CLOA 3QOXA 1W5BA 4AKGA 2NV0A 1OX5A 5FJIA 4BFLA 3UJPA 2VYVD 5FLXA 2GNPA 4GPZA 1QLHA 2SCUA 5T6MA 4L8VA 4YJ3A 4DHWA 4P81A 4ZV9A 2QTAA 1I2DA 3CF6R 4Z0PA 1LVGA 2B8WA 3QFCA 1VPWA 4FN4A 1SQGA 3GLGB 4D42A 5CA1A 5KQMA 5DASA 1Q44A 4LOAA 2JD0A 2ZRQA 2X8LA 4CKCB 4KC0A 2H2WA 4YRAA 2Q3EA 2YIDA 1QO7A 4UFPA 1M6VB 4JC0A 5FP0A 1Z7GA 4BB0A 5KPDA 4RE6A 4MIOA 2FGKA 1E69A 4R1OA 1WMFA 1R5OA 5EP1A 4DLAA 2HRRA 4CI0B 1Z5WA 1Z9BA 1GFZA 3D5TA 3QWBA 4N6OA 1PX2A 1Y3HA 3AQIA 4LDQA 2X0FA 5C7IO 2BCJQ 1NFQA 3BMNB 3TZ6A 8MHTA 1H1LB 1WXHA 2DWOA 3EXFA 3HDTA 1VL6A 2OCYC 3CB4A 3R09A 4Z0TA 4B8ZA 5K0JA 2QAGB 1CP3A 3AW8A 2QRKA 1T2NA 5DW3A 4GDFA 4G1EB 4IWXA 4JP1A 4RQBA 3KC2A 1N2SA 3V8MA 3UA4A 3L40A 5JJKA 2R7LA 4AF6A 3OLXA 3LBNA 5LBIA 3GGCA 4FFMA 1Z82A 4N9WA 3RUAA 3SEQA 3DOIA 1KSJA 2AN4A 2F1JA 3VR0A 3Q7EA 3ILXA 4DRXA 4JYMA 2FP4A 4PPFA 1UBLS 1VE5A 2XRZA 2RHWA 1LS1A 3IUJA 1EX6A 1OBCA 4L8YA 4IILA 4LOLA 1U9ZA 4AYXA 3EGEA 4I9GA 1F8FA 1TTPB 1OWMA 4UZSA 1GVHA 2OXTA 1E2KA 3N86A 4FX2A 4X7MA 5FL7A 3RC2A 2VQ6A 3FPCA 2Z2KA 4KFTA 3N2LA 2FJ0A 1E5TA 3O8DA 5FFNA 1P7PA 5GGXA 2C03A 3MJDA 5JNSA 2RBKA 4BBZA 2IZOA 3I30X 4FONA 1AX9A 5EWLB 3KQUA 4JR2A 2EBWA 3T5GA 2Y71A 4IPTA 3X43A 2QP4A 2YOHA 3R3UA 4O4IB 3S2UA 2F9FA 2FWMX 3SC2B 3IX7A 3Q8MA 1M6WA 3EZ7A 4B76A 2V4UA 4C3OB 1A76A 4O5OA 2PGXA 3IUYA 4Y9UA 1WXXA 3RH0A 1K89A 5TQ0A 4JP8A 1BX1A 3I2HA 1MFPA 3QLUC 4J7CA 5CLFA 1E20A 4YCLA 4IM7A 2ZRGA 1M1YE 3GVPA 3WVNA 3VH2A 1N3LA 2VVTA 2WUGA 1JA0A 4FIDA 5C8YA 4BAGA 2Y92A 3ZS9A 1E6KA 4JY7A 2OHJA 4YR9A 1AV7A 3G2KA 3WA7A 3U5ZB 4PR3A 1PGNA 2QI9C 4J91A 4FI3C 2E9SA 4QQRA 4B17A 1Q91A 3AUFA 3O4FA 4D7AA 2ROQA 3IERA 4FJ0A 4RHEA 3SOPA 4KVFA 1VFNA 3F7TA 3DR3A 2EU8A 1W581 4BRZA 4KSYA 2JD2A 4WIAA 3ACBA 4ZYLA 5JHHB 5HCNA 5KSPA 1ZUNA 4MVJA 4CM4A 3ORYA 2P2CA 2XVMA 3RBAA 1H5QA 3M4XA 1JRLA 1HTBA 1WMAA 2BEVB 3DE4X 2HOQA 3PC3A 1PGPA 3TIGA 1F38A 4F96A 4NG5A 4CM6A 3D43A 1IRIA 5EJ7A 5JQGA 4TL8A 3CNBA 3D6UA 4NABA 4N4AA 4Y9SA 3HVJA 5G2OA 1QPZA 1ECBA 5G53C 3JZFA 3NDIA 2I67A 5ULLA 3VO8A 1EA7A 2HY7A 2VAMA 4KNWA 4O8CA 4F9GA 1PGQA 1O54A 3PEWA 2RE8A 2GN1A 1MJNA 4ZTUB 1N32B 4OYLA 4UUBA 2XJ9A 1BOOA 2E5WA 1B41A 3G5AA 1ZIXA 3ILHA 4RFSB 2PFGA 4XSHA 2JHAA 3LXXA 1TMKA 1SNYA 1XYVA 2FUG6 3QYPA 4OG2A 3M9LA 1BE8A 3LTEA 1L5QA 4NENA 2BGNA 4YJGB 3GLVA 4ZQIA 5CJJA 3SX4A 5DGHA 3M83A 3P9QA 5F9MA 2G8LA 3WLNA 2FZGA 1CRZA 1D5WA 1SBCA 2JIBA 5FI0B 5FA8A 3SF8A 2BEKA 1C7IA 3N1UA 4KE7A 4U7TB 1U0JA 5CH8A 3S2GA 2BMWA 1YHZA 3JAWA 2ENUA 1PW7A 2ZYRA 3C3DA 1L3CA 3JQEA 4L2IB 2O8VA 2VT7A 3EGXA 3EXG2 1EYZA 1TC2A 1DFIA 1V3UA 2D13A 2DCMA 3VHXB 4E51A 3OCJA 5LLDA 2IIBA 3IXQA 5F2KA 2WZBA 1E2QA 2P9GA 1NVKA 5AJYA 2O3JA 1AD2A 1GNRA 4D1YA 2UXBB 2ETVA 2JW5A 3NWPA 4L57A 3QX8A 4EUSA 1V4BA 3UOGA 3KJIA 5HHTA 5K8LA 5BURA 3ENNA 4RABA 4Q7QA 4OHOA 3A9WA 5GJWC 3ESAA 3DHVA 2JAUA 3GJSA 1Z2AA 4RGQA 4ZQCB 2IPOA 4H9GA 4XVCA 5B57C 1J5PA 3B13B 4AROA 1X7ZB 2VHZA 3GJ0A 4AJEA 4ID3A 3LA8A 3Q1LA 2QTBA 3JAWB 2X13A 4RS4A 2Q1WA 1RAHA 4PHTA 2VQDA 4MQFA 1KC1A 3DMPA 3KLBA 2ZE8A 2GPNA 2DZDA 1QNLA 4BGEA 3KWMA 3QPWA 1TI7A 3NH6A 3HEBA 4HQLA 4LRYA 1QIMA 3RK1A 3WZLA 2EFYA 3C1TA 3WO1A 2C3MA 3HEAA 1ZH2A 4JXJA 5DRTA 3O2QB 3TFQA 3UPUA 4MUIA 3IXMA 3Q7IA 4KVAA 3L1IA 3TLJA 5I4IA 3Q87B 3RK4A 1HOXA 2OWEA 3RGWS 4L51A 3B1ZA 4I19A 4CL8A 3D6VA 4JOSA 2J33A 2FWJA 2IOFA 3RYTC 3ZI0A 1U7WA 4MZXA 4R5MA 4AQDA 2YASA 2FSVA 5EKXA 4KDCA 4KV7A 4MRAA 5DHSA 1ZSNA 2DUWA 5DXAA 2O8FB 1VCMA 2ID7A 1YZ3A 4JJZA 4LW8A 3AUXA 4KPUA 4XB2A 5K3AA 5LKAA 2IH5A 4CNQA 1LSJA 5HIAA 2Z4TA 3TJMA 3X2SA 5IS2A 3J7TA 3WOHA 1ZRNA 3L92A 3WLKX 2GXSA 2G9RA 3BFKA 1WDTA 2AHOA 3VOAA 3IEPA 4U2KA 5CNJA 4H3KB 5COBA 5IZCA 2YVKA 4L95C 5LNK6 1JQJC 4BGIA 1IHPA 3MILA 1QFXA 3TD6A 3PU6A 1M67A 5IMSA 5KTTA 2Y4NA 2YMMA 1E8NA 1XPRA 1E9EA 4UDNA 5D3ZA 3V3KA 4C0HA 2I9KA 1N2IA 4RKRA 5ALNA 4O3MA 2JFWA 1PT7A 1DLJA 4FOPA 5LB4A 3IT3A 3OQMA 2QLMA 1IWBB 4PO3X 4Q1VA 3VAAA 2ZUEA 3L8ZA 5CVVA 1EJ2A 3ZQ6A 1A88A 3DE2X 3IP8A 3ELYA 2JASA 2CFOA 1WG8A 1T4CA 1NC3A 1YOVA 2YWFA 3GN1A 4H4EA 4P4SB 3IP3A 5E0KB 3U4AA 4S04A 1T0UA 3PC4A 3RADC 3IPCA 3U44B 1UZUA 4N0MA 3P9RA 2QIOA 1ZVVA 1Z7BA 2G17A 1MNQA 3IIKA 4FNAA 4JV5B 2VDRB 3IAXA 1JW9B 5KCMA 4I9HA 2GCNA 4PLFA 2QE7D 1Q1GA 1DQRA 1WW3A 1UKZA 5T5QA 2HK7A 2W6IA 4ENTA 1CR0A 1CEEA 2BH9A 5AKKA 5B55A 2CZQA 3PUKA 5B1IA 3VYUB 3QEAZ 5D5QA 5EJ5A 3URKA 1Y3BE 1PG5A 1E8DA 5ENDA 2BD0A 3SBOA 4BRWA 2FSSA 2JFUA 4ZVPA 1P9NA 4C7VA 4DJDC 2VRCD 4EW2A 5AOVA 3RU3A 3LPAA 1YR9A 3DLTA 2QVZX 4QRDA 3ZNOA 1WTAA 4MKZA 4A0GA 3LGAA 3B1FA 1UIMA 1P9RA 1DO8A 4B2IA 1HE3A 3F8SA 2H1OA 3D5QA 3FFBA 3O75A 4QHTA 5J58A 1ONBA 1VP3A 2XOEA 1NLFA 2E6UX 3KT0A 2P2DA 4I9NA 1L5RA 4X1IA 4QLOA 4JLSA 1X1DA 4NOMA 3P0EA 4R1QA 1LU9A 4ARBA 3TCKA 4AF7A 1JWBB 2WU4A 4RA9B 5I4CA 3ZD7A 1WPRA 3D3NA 3QTLA 2N1MA 1IJFA 4WSOA 5CD1A 4R1NA 1LBQA 1ZAKA 4DUZB 2FR8A 1IN6A 1FMJA 5AHOA 3ICCA 3LDGA 2AUMA 2HIAA 4HVAA 2BEJA 3GEHA 4HL6A 4BYMA 3E35A 2F8LA 3EVGA 2XX3A 5AW2A 1J1UA 3L7DA 5DCUA 3EHEA 1GADO 1NUUA 5TMPA 1W8DA 2LKDA 1OT5A 4OGGA 5ECWA 2Q5EA 1K75A 3V2HA 2IPMA 3AESB 1Q2XA 3OD1A 4ARVA 1KIFA 1N9GA 5AH0A 1G17A 1AA6A 1PG0A 1N5MA 3VR6A 3D6NB 1QFJA 4Q66C 4OBXA 1KO1A 2B7CA 2IHNA 2HLHA 4KMOA 2GD0A 2JCBA 3C1UA 5B7QA 2VNAA 1CRLA 1A4XA 2OD9A 3KHUA 3OMLA 4KACA 4N5HX 3OEEA 5K6AC 1OAOA 1G6HA 2GUGA 3CX6A 2BJVA 4YJ2A 2W42A 4C7BA 3TF5A 3F5MA 3OKAA 4GLBA 3W7VA 2ATXA 2ZYAA 3VM6A 1QF6A 3LCUA 3PQEA 5JNTA 1ZJ4A 4B3SB 3NWEA 4O4JF 5BN1A 2ORWA 1ENPA 1UM9B 2J9YB 1TDJA 3DFUA 4ENVA 5C46F 2HJVA 1K8YB 3ZHOA 3NB0A 2VZLA 4U2DA 3TMYA 1IHUA 1XRRA 1JLHA 3DBRB 3PQ7A 4U1RA 5BWNA 1KWGA 1Y0BA 1JFSA 2BF7A 1NYTA 4NNJA 1UK6A 3PTLA 3DBLB 3CMMA 4MPPA 3AUAA 4ZQBA 3KKPA 4A4DA 1YRAA 4W82A 4C0AC 3C4VA 5TNXA 2DHDA 3NHWA 5LR6A 4PGGA 2WWWA 3ZUGA 5HQTA 3OZTA 4LNAA 4LS3A 3RSQA 1QHYA 4U39A 1ZEJA 5GINE 3CVYA 4J7XA 1QX4A 1UL1X 4QBFA 1XZIA 4EUKA 5HS4A 2C42A 3UHFA 5H83A 3GFTA 3CVUA 3U13A 1DKMA 3HB5X 1LX6A 1U3TA 1F7VA 4DLUA 3QX9A 3SFVA 1UH5A 3H7AA 5ERXA 4CCYB 1W2GA 4AG5A 1B8VA 2O3RA 4U2GA 2RHRA 2QJTA 3EZ9A 1AZLA 2HHLA 3IAEA 1HEIA 3P9ZA 4HAOA 2I3DA 1RWOA 1EWTA 2GSWA 2FW1A 3JQRA 3P2KA 1H05A 4KRYA 1WHSA 4F9EA 4LJYA 3MC1A 4QFCA 2CL6X 4LHVA 4MR9A 2COUA 3D3EA 2FDXA 2VWGA 3CW2A 1NBMA 5J43A 2CXSA 1MA0A 1AS0A 3CBQA 3E3MA 4PWZA 4RUKA 1JECA 3FWHA 5K0LA 1RJFA 2BF4A 3RS3A 2E7ZA 4YO7A 3EIHA 4QODA 3DKIA 5C34B 2GKSA 1BEEA 3OEHD 4EW3A 4PRKA 1NOIA 3F5SA 1BMFA 3OLCX 1FFXA 4MWCA 1CZHA 1XFDA 1JWAB 5EMJA 3PFBA 5BMVF 4KPGA 5CVDA 1KJJA 3R24A 4K5QA 1ADJA 3HFJA 4DQXA 3CPHA 1MRZA 4K6CA 2ZSIA 3THRA 2O05A 2Z1NA 3I61A 1E5QA 2WKPA 2YS6A 1O6CA 3GJZA 4QXMA 3FGZA 1YJCA 2PV0A 1T8PA 1UPFA 2NUTB 4Q3DA 1YZQA 4XLLA 2CL7X 5IXYA 1LS6A 2JAOA 3N2KA 3UT5B 3ERCA 4ZEMA 1TMGE 4BFXA 3K8ZA 3B52X 2XTJA 1K2VN 1SEVA 4H3HB 4M8SA 5JSZB 4NV3A 3IL2A 1H2FA 2P7HA 2TMKA 3ROPA 1YB1A 1ECFA 5KTRA 1P33A 2X9QA 2H7YA 2G36A 2QM0A 1GRVA 3U4QA 1ZHOA 1GPUA 1QU2A 3UN1A 2C07A 3PXCX 2BI4A 4RPGA 4NSNA 5ERYA 3PUIA 1QFYA 3AY7A 5TQ0B 1J99A 3BIWA 3KZ1E 4PXYA 5TMEA 1P7CA 1ZU5A 2VDVE 4B6GA 1QP0A 2H8GA 2ZJBA 4FS8A 3JATB 1DC7A 3IIMA 3OT1B 3R40A 4HDKB 5G1PA 5IKMA 3A6DA 2ZB4A 4JI6B 5DU2A 5F2NA 5K8TA 5B7PA 2XITA 4MVXA 1NPTO 2F6RA 1CVLA 4XLTA 4C76A 2HZBA 4PLTA 2POQX 5BRJA 1NJSA 1J0AA 3D81A 4HAZA 3FPGA 4LTMA 1XVLA 1H2XA 3ER9A 1ID1A 2ID9A 4D6PA 2GYUA 4FDVA 1FTWA 2I3GA 1VSVA 3AKEA 4JT9A 3DVQX 1GL9B 4JQCA 1HDXA 5LBTA 5JLJA 4JI4B 3FPJA 4EEKA 2PO5A 3RVSA 1NUSA 3PC8A 2A5YB 1XJ0A 1X9HA 2RAPA 4TLLB 3RFCA 3HB4X 2J9XB 4J1QA 3W8DA 3H9QA 3GV0A 1IWOA 1N2BA 1OA0A 1JP7A 4L27A 3DV2A 4WXPA 5DX8A 2P2ZA 1FUEA 1L4UA 3E3AA 4RQUA 5K3BA 1QRTA 1ZUIA 3FPBA 1O9BA 4UULA 1GUYA 1REQB 3ADPA 4ZVLA 4CE6A 2XB4A 1R10A 1QIKA 2VUUA 4Q9JA 3RANA 2NADA 1P1RA 5SYAA 3K9WA 1UPAA 1IULA 4DJJA 4QDZA 4PLGA 2HJGA 3M9XA 4UM8B 4CMHA 1JIKA 4E31A 4LPSA 1SUWA 3UMJA 3G6WA 1BHSA 3EOAI 3AVOA 4YPFA 3QX3A 5LYYA 3GLIA 1DQZA 1A5SB 3QI2A 1U3DA 1LPNA 4JJ8A 4JC8A 1R18A 2VP3A 3NU1A 3PFIA 4TSRA 2VHQA 3O8BA 4N9QA 2ZSUA 3UCEA 3HB0A 2CNKA 4KI7A 1OWLA 3HJCA 1W2WB 2FX3A 2BZSA 3OCYA 1U9JA 3ELBA 5DM1A 1UK9A 4J9UE 3DVAA 3RRJA 3ICWA 5IFKA 2WT9A 2CHUA 1J2EA 1HMYA 2YYYA 4PYKA 4XARA 3E61A 4ZOLB 5DTQA 1EFVA 1FZQA 2BGIA 2I4LA 2VEOA 4H7DA 3NATA 1Z16A 1S8AA 4I1VA 2P5YA 3HJUA 3RIEA 1BA2A 1Y1QA 2ZIFA 5C0OE 4KR2A 1N6NA 3FTDA 4Q01A 1AURA 4GXTA 4BXOA 2IITA 3WRVA 4B4OA 4M1SA 2Q3BA 1XJWA 1ZN7A 5EIHA 2AS0A 2HNKA 3ZGVA 3D4OA 4NK4A 3EFOB 1OREA 3BD9A 1E59A 4LSGA 5EHQA 1VI2A 1J0BA 5AKXA 1Q7EA 4WXYB 3Q5GA 1GNTA 4IJ5A 5FOSA 4AMGA 3CJQA 4S1TA 3RD5A 2Z2ZA 1HDGO 1R0KA 4W6ZA 4ZVVA 5PGMA 3CZ9A 2WQ7A 1SOWA 4KMSA 4UATA 3QLJA 3RSHA 1EQUA 1J09A 1J1ZA 4HN2A 2QQ0A 4YUAA 2K2QB 3LIPA 4W7IA 3UT0A 2HMTA 2NUBA 3P20A 1T4GA 1A82A 2VKTA 2I8LA 2GPYA 5A05A 5BNTA 4Y2GA 1X42A 3ZE9A 5AW4A 1I1QB 4LPKA 1COWD 2CVZA 1MABB 1YBAA 3Q3IA 3ZWXA 2QXYA 1JKFA 4MLDA 2DY0A 2HT6A 1TD9A 4ZRDA 4QLAA 4DCPA 3UANA 3CW8X 3KKMA 2R2GA 4ITUA 1A9SA 3BWCA 4QXOA 4TTPA 3VV2A 3X44A 5A9SA 4WOJA 3KB8A 5FWYB 3V4SA 3AYZB 3BRCA 3ECCA 3ENWA 1JDPA 1EM6A 1DELA 5FPYA 1L2TA 1NW6A 1UMBA 1CUAA 2JIDA 2Y1GA 1CQIB 3E22A 3LF2A 2X40A 3H75A 2QAIA 3LAWA 1TU3A 1FSFA 2QT0A 3FNBA 4Y2YA 2QVXX 1YOBA 2I2CA 2Q6IA 4DDTA 1KPHA 4YMWA 1KDVA 4O0LA 4I6EA 2D5BA 5HOQA 2XHZA 1AIPA 3EVDA 5IW8A 1NXQA 5BR4A 4X3OA 3BD6A 2Q5FA 3BTSA 5JATA 4ESHA 1U9IA 1CJMA 5M7EA 3IRVA 4QUHA 5H7XA 3IMCA 1L9XA 1VG0B 2PNFA 2VSYA 1TCUA 5F9FA 1LNQA 4XDHA 1I30A 3T7JA 1TNDA 1ZW1A 3HKEA 3CKKA 1VRVA 3QH4A 1OIWA 3R8XA 3RBZA 3HA5A 1VSQA 2V3VA 5DT9A 3L77A 2ZUVA 1DPFA 2GZDA 1TQ6A 4ZEVA 2QN2A 5TPWA 3WKCA 3BXXA 2VYVA 4WA7A 3LT5A 2QRVB 3OJOA 4BU1A 4CMIB 4GKBA 2IXFA 2O8NA 1TEVA 1IJKA 1O08A 2XVXA 3QA9A 3TZKA 1CHNA 3OPYA 5GONB 1GCIA 2QTMA 4K3UA 1OI4A 3ZV3A 4L5AA 4CIVA 5E9AA 4TLDA 1ISSA 1EFRD 2FF5A 2LCFA 2ZIXA 1XUOA 4LYHA 4RE5A 4V0SA 3TBHA 4BLSA 4B2LA 4YXWD 1NVVQ 3AR5A 1DKNA 4I8DA 4BRSA 5C31A 4KYTA 3ND8A 1A8PA 3AIMA 1FRQA 4F4JA 1PJAA 1VYUA 2HJHA 1L6IA 1SCUB 2XTAA 3DOUA 4QBKA 2Y1DA 3WLTA 3ZZTA 3OM9A 4RF4A 3DFKA 1Z2CA 4WCFC 2QW8A 1T1RA 4YN3A 4UEKA 4AY4A 1GITA 4R4JA 1T0PA 1K7YA 2ZJZA 4D45A 1W5SA 2CBZA 4YP7A 5I9BA 3WNVA 4DLTA 3G1WA 4DTCA 1BQ4A 1LJUA 1AKEA 1YC5A 3HNOA 2ZATA 3LQFA 1FDIA 1L5GB 2AJ8A 2DY1A 2V7UA 3KB1A 3UAGA 1H8ED 4B3GA 1NKTA 5JZBA 3CLSC 3E1KA 4LYAA 1ZNQO 3GJRA 3QKIA 2CYBA 1GUBA 2QP9X 4N40A 5IC4A 2BR5A 3UIEA 2C0PA 3DG9A 4FIZA 1COZA 4OPMA 4CIBA 4Q24A 3RF7A 2ZWVA 1L5NA 2QRQA 3K0EA 1GKLA 4X54A 1OHHD 3PD0A 4XPZA 1L8OA 2EKDA 3G2HA 3GMSA 4LOIA 1PDWA 4JB3A 1VB3A 5EESA 3KR2A 5ICFA 3QXSA 4NMMA 2RK6A 2C9OA 5HFAA 5LMZA 5DMHA 3W9UA 1V1RA 5ALEA 1V5WA 4FFNA 3JQPA 1G5PA 1X8JA 4GU5A 4P98A 3RT7A 4PAQA 5J23A 4X65B 1Z6QA 2FE1A 3VTAA 4D41A 2FPUA 4PLZA 1R9GA 4OJQA 4UXJA 4ZJZA 4AMVA 1QGUA 4OSPA 4YP0A 3OQOA 1VE9A 1USIA 1G8FA 4L28A 1W4ZA 3U7EB 2VF7A 4EIWA 3THYB 2IUSA 4ZT6A 4C06A 2HFJA 5LM3A 2AUNA 4GAEA 4N3NA 3VR6D 1JKMA 4KPFC 3CMCO 3KU1A 1LPAB 3QTBA 4MHOA 4DMCA 2ZRFA 4HGZA 5JMTA 4MITA 1WCXA 4GWLA 3V46A 4EYOA 2FWIA 1P0QA 5CMLA 4C0JA 5CB0A 1EVYA 4RACA 1NJFA 5EMMA 5AHXA 3FMFA 4ZDWA 1R4MB 1A04A 1X7YA 1ZMRA 3ZJ4A 1G1MA 1IONA 2WQZA 3WV4A 2CJWA 1TJYA 1ZBDA 4A6EA 3PUZA 2XKAA 5EP3A 2P9CA 2J6BA 1BEUB 1PJSA 5IJXA 2YXPX 3G5MA 4RD2A 1UZNA 3E0QA 3UAOA 1JLLB 1RWPA 3MWFA 4BB9A 4OYRA 2OV1A 1QS0B 4GQBA 1QQ7A 1JWLA 1UZMA 4FXPA 1AG9A 1SQ6A 1XJ5A 3ZWKA 1J5EB 2IBSA 2XMBA 3B6MA 3BJMA 2J7KA 5E7JA 4E2YA 4EY7A 3HVRA 1E3QA 1UM9A 3K9FC 3DLIA 2JCSA 1G4AE 1G7RA 1YO6A 3DFMA 5FBQB 2W8ZA 1J9GA 2XB8A 4P7FA 2DFLA 1ZUD1 3OURA 4AZ0B 4BVKA 4Q1FA 3UJ8A 5JC8A 2CHQA 4RKWA 3P8ZA 2PH3A 4R9SA 4DLXA 4DNFA 1GVNB 5IBCA 4ESVA 4ZZ0A 1I6KA 1NUQA 2JB9A 5CDFE 3OOWA 1U90A 2ZJ6A 3AEKB 4D9NA 1N5OX 1UBMS 4PU0A 3LL7A 3U7IA 4O6VA 3DWIA 4PC2A 5F12A 2PUHA 5LDGA 4L85A 1H1LA 1YNOA 1LTQA 2B4RO 3H6KA 1DS6A 4IJQA 4MW0A 3SZLA 2YMPA 3VPGA 5E3HA 1E63A 2ZIAA 4DBLE 2BFDA 2QYOA 2ADFA 1C1DA 4DMMA 1T5HX 1YB7A 3L7OA 4TQGA 1U63A 2VTDA 3WYDA 2PFKA 3GJ8A 3THXA 1NBMD 2MDTA 4RU1A 1FU8A 1IVSA 2OL4A 5IKOA 2DPLA 2JPDA 1N9ZA 1A98A 5HK8A 5I7OA 2GARA 2IOYA 3BYZA 2XCSB 3HYRA 4NE7A 1JAXA 3ZGLA 4GH5A 5K99A 2C00A 1F2TA 1RRFA 1CUWA 1KO8A 1UPXA 1Z7YA 2IUFA 4JC5A 4UVGA 4EKDA 5F1PA 5DBIA 2W2OA 1XQYA 5DNVA 1DTSA 4FWBA 3AR4A 3BD7A 3QUAA 4ND8A 4RA6A 1XHEA 5A7GA 1SG0A 3BMXA 3K0KA 2WT4A 2GF2A 3RROA 1HY3A 4CG2A 1W52X 4WOBA 2IZZA 2EIXA 3SZ3A 1NTOA 1XZDA 2HH9A 2XJ4A 4ER3A 1EXDA 2G70A 3HBJA 4ZCMA 2OYRA 4DA4A 1UP6A 2CLCX 3AKDA 3BGOS 2E85A 4IIUA 4DG5A 5FPHA 5C5IA 2FHPA 5K8VA 4EOGA 4KR9A 2NMVA 2QI9F 1NUTA 1GPAA 2EVWX 3HU5A 3NPMA 4ECEA 2RK4A 3DAPA 3GDOA 5B3JC 5DTMA 4M0EA 2O0JA 4CKZA 5KSWB 3BZBA 4FFBA 1VHDA 3ZVLA 3ZGZA 3KEQA 4Y1GA 4HUTA 1ETUA 3T4PA 4U2FA 5FAKA 2OECA 5LFAA 4FEEA 5CUQA 4AS1A 2K7ZA 1JDBB 4G4JA 3MPOA 5D3MA 2BGKA 1R6VA 4B35A 5JANA 3GRKA 5TDHA 1JNXX 4JLOA 3VVCA 3UWOA 1RW4A 1TRHA 4XX0A 4LOJA 6Q21A 2SCUB 5AK3A 4IVPA 1U5CA 1MN6A 3FUUA 1FYDA 3CWZA 1TYEB 1J9EA 3ENZA 4KH0A 4RKQA 1KFEB 2TRSB 1SCBA 2YQ5A 3C3WA 1Y98A 1MNAA 2QSJA 4M8IA 4MPJA 1A4RA 5HEKA 4GMXA 1OBOA 3V1NA 3BGWA 3ZNPA 4ER6A 4EX6A 3QBDA 1P2UA 2GD6A 5K0BA 1BYIA 2A0YA 4EYSA 3R9WA 4IIJA 4BNDB 3O95A 5IUNC 1MO3A 2Q46A 4HYEA 4ISBA 4MVJF 5ED4A 2BGLA 1N2GA 4GICA 4AECA 1C7QA 1HNNA 3S7ZA 1EJ0A 3I4FA