1I6LA

1.7 high resolution experimental phases for tryptophanyl-trna synthetase complexed with tryptophanyl-5'amp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
326
structure length
326
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution experimental phases for tryptophanyl-tRNA synthetase (TrpRS) complexed with tryptophanyl-5'AMP.
pubmed doi rcsb
molecule tags Ligase
molecule keywords TRYPTOPHANYL-TRNA SYNTHETASE
total genus 114
structure length 326
sequence length 326
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1i6lA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1i6lA01
4MWDA 1TQ8A 3DV2A 4Q16A 1YUMA 5LFAA 1R6UA 3IUBA 1H3FA 1ZUNA 4U7JA 1FYDA 3FHJA 1ZH6A 1JIKA 1NP7A 2E0IA 1NURA 1JEDA 2VXOA 4Q93A 4NDAA 3P0JA 2D54A 2A88A 1N2IA 3CLRD 3IUEA 4QREA 5TS2A 1LI7A 3NV7A 1U3DA 3HMQA 3FOCA 3I05A 5JBNA 1B6TA 3ISJA 5LLTA 1YIAA 1O97C 1U7XA 3VGJA 3CLUC 2CUZA 3SZGA 4EG8A 3KFLA 1QRUA 1I6MA 1EUYA 2QTRA 1QTQA 3LCJA 3IVCA 1D2RA 1CT9A 2D5BA 1VBKA 1JIJA 3SZ3A 3F3MA 4OUDB 4JFAA 1WXEA 1KH1A 1NUQA 3A4IA 1WOYA 3G5AA 2WQ6A 2ZUEA 3MMXA 1QRTA 4WSOA 1VL2A 1N2EA 3X1MA 1WZ2A 2YY5A 3NBAA 1KQNA 4EG7A 3IDFA 4E1AA 4KR6A 4MW5A 3GMIA 3MXTA 4CDNA 2NZ2A 3Q12A 3CA8A 4EG4A 1GTRA 2A4MA 2I1LA 1X6VA 4MULA 1I6KA 4MW0A 1QRSA 5FO1A 1KQOA 1F9AA 2IP1A 1TYDE 2E18A 3K9WA 1PFYA 2CYCA 3PRHA 2CV1A 2CFOA 1WXFA 1ULHA 3AG6A 1EFPA 1QJCA 2V0CA 3IMEA 4MW4A 4XFDA 1O6BA 1MRZA 1RQGA 3N2YA 3RK1A 4HJXA 3K32A 3H05A 2D13A 2QUHA 4MUFA 1TEZA 2Z3VA 4NAHA 3HFJA 2X3FA 1N75A 3INNA 1KH2A 3BL5A 1JHDA 1PG2A 3VRHA 1OD6A 1J09A 2RD2A 1MJHA 4MUJA 3CLTC 3FNRA 3G59A 1U7DA 1NYLA 1KKUA 2E21A 3CR8A 1OBHA 2PZBA 1G8GA 3GLVA 3IH5A 1J70A 1MOPA 3D6UA 3QTTA 2EJCA 3QTBA 4MVWA 4JXXA 4MUIA 4ZT4A 2QTNA 2X1MA 4K0RA 1O5TA 2XRZA 4U63A 4DDMA 3TS1A 4K03A 4ZCSA 2YXNA 3H97A 1F7UA 3PNBA 4ZT6A 1ZJWA 1JMVA 1YUNA 4UZFA 1JGTA 4KPUA 4PBTA 3AG5A 1ZH0A 3D6VA 1R6TA 1K92A 1LI5A 3ND6A 2QUKA 4XFJA 3S3TA 4HK4A 1M8FA 3SEZA 2IELA 1N1DA 5DEOA 3RHSA 4OJMX 3AKZA 4ZT3A 1BS2A 4AQ7A 3AFHA 1ILEA 3UOWA 3ZGZA 4MVXA 3CLUD 1QU2A 3UMVA 1TYCA 1UFVA 5FNZA 4F3RA 1TFUA 2GOYA 2DUMA 1PFUA 2QJTA 5J58A 2A1UA 1M8PA 2DLCX 1I2DA 2QUIA 1VLHA 3IOBA 1S4MA 1Q77A 1J20A 1G8HA 2OV4A 2ZP1A 1T6YA 1KAMA 1N2BA 5DB4A 5LM3A 4KR9A 1KQPA 1IQRA 4YBRA 3AIIA 3NBKA 1VBMA 3CVXA 3RBAA 4EG5A 2H29A 1O94D 3N9IA 4MW6A 1X8XA 2HGZA 3IVXA 3Q10A 4GRIA 3DLAA 3FG9A 5HUHA 4MWEA 3FY4A 2V0GA 4MUNA 3COYA 3L92A 4XSVA 4YP5A 5AHWA 1M1ZA 1N2OA 2DETA 4EG6A 3TZLA 2WQ7A 4ZCTA 3IMCA 1LW7A 4X0EA 2CT8A 1IRXA 4HJRA 3N8HA 4EG3A 2QJOA 3UC5A 4PBSA 3ZIUA 2E89A 2ZUFA 1Q19A 1GTSA 1COZA 2VTBA 2QJFA 1NUTA 1XJQA 1O96A 1N78A 2WSIA 1J1ZA 2CSXA 3E27A 1V8FA 4DE5A 3CLSD 1OWPA 2BTEA 4KR7A 5TEVA 4MWCA 1JIIA 3L93A 4KKVA 4I6JA 2AKEA 4AS1A 3SYTA 4CDMA 5F23A 1OWNA 5K0SA 1EUQA 2PZ8A 4ZCPA 1KH3A 1M8JA 1IFXA 1YI8A 3COZA 1O96B 2DR2A 4H3SA 4RPIA 1N2HA 3P52A 4PY2A 3LOQA 1T9GR 2EL7A 3ND7A 3MUEA 1EXDA 3A04A 2DEUA 4MUHA 3FWKA 2NSYA 2JAXA 2JA2A 2Z09A 1K4KA 4HPWA 3JXEA 1A8HA 3FI0A 4A91A 2A84A 2RE8A 4MUEA 2J08A 3SDBA 3P0IA 1KP2A 2GM3A 1QNFA 3ELBA 2A1TS 2Z08A 2TS1A 2X1LA 1GN8A 4OUDA 5K0TA 1NI5A 1EJ2A 1HYBA 2B7LA 3CLTD 1MAUA 4ZT7A 4MVCA 2VTBB 1T9GS 3ZJTA 1IQ0A 2YWCA 1WJGA 4NZPA 4MUKA 4PBRA 1F4LA 4YMIA 3TNJA 3FIUA 4I6GA 5TEWA 1J1UA 3KT3A 1GPMA 3OP1A 1EFVB 5HUJA 1G59A 3MLBA 2J09A 1JECA 1PFWA 4ARIA 4ZCQA 1IVSA 1WQ4A 3HL4A 3IMGA 2PIDA 2PZAA 1N77A 1OBCA 1WQ3A 2AG6A 2O8VA 4ZCRA 3CVYA 3SP1A 3X1KA 1NUPA 3FDXA 4F4HA 4CQNA 4MQ6A 1KP3A 1OWLA 4ND7A 1H3EA 2DPLA 5TGTA 2J4DA 1O94C 2IJGX 1JZSA 5BNZA 4GU5A 4R2MA 1FFYA 2HMAA 2A1UB 4CT0A 1QU3A 1Y42X 2GKSA 1N3LA 1R6XA 2C5SA 3IVGA 3UY4A 4G5FA 4J75A 3OTWA 3Q4GA 3PNVA 1OWOA 2XRYA 4L2IA 1SURA 3ZJVA 5DASA 4MLPA 1MC1A 2PFSA 3LE8A 4G6ZA 4JYZA 1O0BA 2CYAA 2CYBA 5J5AA 3HZRA 3N05A 3IOCA 3G6KA 3FETA 3GUZA 1QQTA 3HGMA 4JZYA 2A86A 3PXUA 2A7XA 1IHOA 2H2AA 3H99A 2CV0A 5IJXA 1O0CA 1J21A 5FO0A 2DXIA 1T6XA 2AZXA 4NX2A 3CVVA 1EE1A 3MLAA 4MW2A 1KR2A 4BWVA 3P0HA 1WXGA 4NAUA 4DDKA 1T6ZA 2R5WA 2JANA 2CV2A 4JXZA 3ZXSA 1M8GA 4P2BA 3CLRC 2HZ7A 5EKDA 4TS1A 2QTMA 4U8HA 3SEQA 1GAXA 1KORA 3IODA 4ZT2A 5IHXA 3DPIA 2G36A 4DJAA 1MB9A 2WB2A 1G8FA 1NUUA 1WY5A 3KT0A 1Q15A 3ZXIA 4MAFA 3M5WA 3DO8A 1KAQA 1VBNA 1WXHA 1IQUA 4ZT5A 5H7XA 4EGAA 1XNGA 1PG0A 2J5BA 2QUJA 5KWVA 1K4MA 3TZEA 3COVA 1H3NA 4YP6A 4I6EA 1WXIA 1F7VA 1EFVA 5H16A 4DLPA 1NSYA 1WKBA 1OWMA 2O5RA 3RK0A 3U1VA 3ZUGA 3ILVA 3CLSC 4DDHA 4R0NA 2A1TR 1JEEA 4G5YA 2DERA 3C8ZA 1N2GA 1U0BB 3COWA 4MW1A 3TQIA 1V47A 3QE4A 3X1JA 1O95D 1GLNA 2BYTA 1P7PA 1M8KA 4YP7A 5J59A 1MBZA 1EFPB 3A05A 5DK4A 4MWBA 2X0KA 4EF6A 2J07A 4J76A 3CVWA 4L2IB 1O97D 1H1TA 4MVYA 4ARCA 3RFFA 4DNXA 3PNYA 1N2JA 1GZUA 1Q11A 4RUKA 1NUSA 3ND5A 1K97A 4EG1A 4EFKA 3H9BA 1O95C 2PG3A 1M83A 3VU8A 4FZJA 1U3CA 4KPUB 3UK2A 1MB2A 3RJZA 4QBTA 2OQ2A 1NZJA 4UZEA 3ZJUA 3CVUA 1XNJA 4MW9A 3H9CA 4NATA 1TYBE 1YULA 5KCMA 4QRDA 5HG0A 3KT8A 3TQOA 1DNPA 1MAWA 4WNYA 2YWBA 3KT6A 3A2KA 4MW7A 3HV0A 3AL0C 4R2LA 1IH8A 4MUGA 1JILA 1XNHA 1YIDA 4S1OA 1PFVA 5KHAA 2PXHA 1I6LA 1JZQA 3FH0A 1TYAE 3IOEA 4ND6A
chains in the Genus database with same CATH superfamily
1X92A 1J0CA 3MXOA 5G1OA 2I4TA 4MWDA 9LDTA 1HDCA 5JPIA 3F6CA 2XNDD 3NGLA 1L7PA 1YMVA 2WD7B 3B3JA 4FYYA 4Q9KA 2GEUA 4XPZA 2AJTA 1BE8A 3IP7A 1I10A 4DC0A 3D4OA 1U8CB 4HB0A 4JROA 5IWCA 3HRHA 3ZS9A 1GZ5A 3AR6A 4IXDA 4C3ZA 5EJ6A 1CCWA 2VFAA 3CU5A 4J0IA 2Q41A 4L02A 1AGXA 1KPIA 1TCCA 3TLKA 4GX1A 3KJIA 2CL6X 1U28A 2PY6A 4RIGA 4AJ9A 1OLSA 2VUSA 1J22A 2VPWA 3OX4A 1PEDA 4MWZA 4C78A 5EHGA 5HF8A 3O3NB 4ZPXA 2IYTA 5HCIA 3GAAA 4PYLA 2MSNA 3EIOA 6GPBA 3UK1A 5JD4A 2GD1O 2WYIA 3ZE7A 1JEYB 4YVFA 4ZVSA 2WU0A 3QVJA 2W11A 1TL7C 4IY1A 4RFSB 1PLLA 1RRGA 3F6RA 4KODA 4XYBA 5E1MA 4ZKEA 3TTWA 3OTOB 1EUYA 3RYCB 1V6SA 2ZXUA 3I3OA 1XD2A 4DV0B 2VF2A 3DDNA 4D2IA 2RIRA 1C0PA 1P7WA 4E5UA 1DKMA 2FSPA 1ILWA 4CBVA 5BVGA 1DCTA 1PDWA 2ZS7A 2A9JA 2IW1A 2WHYA 4HWSA 4DJEC 4FIZA 3BKWA 3LUDA 4LRQA 1M6HA 2VR1A 1EXVA 1V7CA 2PYZA 1T0UA 3GA7A 4XCVA 2Z2YA 1ZUHA 4WSOA 3R8CA 1A0OA 3SHVA 3P9YA 3ZKWB 1W2WB 4O1IA 4HNGA 3X1MA 3IB6A 4U7GA 5JPCA 2Q6IA 3K2QA 2AMJA 3O0TA 3LDUA 2V59A 1MAHA 2AWOA 3B7PA 4AFNA 3I92A 1WUTA 3C3MA 4JLAA 1X15A 1K3FA 1RAHA 5IUNC 3BILA 2QS9A 3NHMA 1GU7A 4MPJA 3ECCA 3PNKA 3ADBA 4RKFA 3LT0A 3RS9A 2NTYC 2ERYA 4JKIA 2VPYA 4LF5B 2PSFA 4ZVNA 5CM8B 1XA3A 5CXSA 3MJDA 1RYFA 3HM9A 4I2NA 2LCIA 1QFXA 2C07A 3ASYA 3IEMA 5EP2A 1ULHA 3STWA 1QJCA 1TQ6A 1T3LA 1UZUA 3AFIA 3HL0A 1AM4D 4NV1A 3LYUA 3KWJA 4N7RA 2VWPA 1C3LA 1VHJA 2XDYA 2R6DA 2HHLA 3TAXA 2QRUA 2TECE 1T1GA 1IVNA 2V7QD 3HFJA 3NVAA 2HRQA 4FILA 3KV3O 4HY3A 1KMMA 4Y6GB 2VDWB 1VI2A 3M5PA 2IOFA 2V6IA 3VO8A 4C7BA 1WV1A 4EX6A 1PG2A 3ZGNA 5JMOA 4O6VA 4ZA2A 5IH3A 1JTFA 5AJZA 4BL5A 3R9WA 3V4FA 1SCBA 4EI2A 1T5HX 1ORTA 4UTNA 1KJWA 3HR4A 4CUKA 3H13A 1D0SA 4P0PB 3I64A 4R41A 4C2BA 1H2EA 3T9DA 4REMA 2FUG6 2YJ4A 3AU9A 3E6AA 3OQ1A 4JEIA 3WWEA 3GA0A 1RC1A 3WX0A 1ODFA 4P9NA 3RCBA 3HCPA 2H7VA 3GLGA 2NP7A 2R4UA 3R7LA 2FHSA 2ZPTX 4ZT4A 2BHTA 1YZHA 2YYYA 4LS3A 4WOCA 5CG1A 2EX1A 4BEJA 4WUTA 4B3CA 4UNIA 2DZDA 3ESCA 1OGIA 4CKBB 3IL2A 1WX1A 3GY0A 4YDRA 1H4VB 4GOJA 3CW2A 4PFKA 2JAOA 4B74A 4BO4A 2AQIA 2PPLA 3Q0TA 3ROMA 4HNTA 2Z5GA 4ZAVA 4PCLA 2UVQA 4BRUA 3NTRA 5J1SB 3T7DA 4WXMA 3WWZA 3JQ8A 2HKIA 5AM0A 5EERA 1E6KA 1HLGA 5K8TA 1JQAA 1RLIA 3KEQA 4N9WA 3EVDA 4YRZA 3AFHA 5DEIA 3C3DA 1ECCA 4AN1A 4YJGB 3ELDA 1J0AA 2FEMA 3A2NA 3KUCA 1SXJA 4NY1A 1A4RA 2H3HA 1P75A 4TYMA 5IWAB 3COJA 1P77A 4ENUA 3UMVA 1TYCA 1NBIA 3V4SA 4C04A 3LQ4A 1MO4A 1XDZA 4UHEA 3GRZA 3EGOA 4BZXA 4FE3A 1M1NA 4Z2AA 1SHZA 2GGSA 3NOOA 4ZQEA 4CLRA 5K8IA 1M5TA 2AW5A 2JGLA 2VP4A 1Q3TA 2WJPA 2N1MA 3EULA 3N8GA 4LOIA 3ZTTA 5FWNA 1E8NA 2SKEA 5DB4A 4A10A 3FTCA 1QPZA 1DUIA 3L2OB 3V2GA 1HF3A 3FJOA 2HIAA 4I1PA 2C4NA 1IEQA 1C30B 1QAQA 3FR8A 5E3JA 4F5EA 2P5UA 3OH8A 6Q21A 3PHIA 5KQLA 3VV3A 3JQBA 4TYQA 1U7UA 3IVXA 3F5MA 3SQLA 4CG2A 2WP8J 3N7AA 4YMVA 3NM5A 2VZ0A 4KH0A 2ZFUA 4YH1A 2LXNA 4ND8B 3A6FA 5EMHA 4B44A 2WZBA 5IJAA 3FYHA 1FTWA 4GBJA 3KHUA 2NV6A 1HMPA 4BJ6A 3AKEA 2VDMB 2R6CA 3L0ZA 2Q6OA 3COYA 4EEXA 4LHWA 3T1QA 4DMRA 4P3OA 3C8HA 2JC3A 4YRLA 1T15A 1UFOA 3H2SA 4JLPA 3LDAA 4D6XA 1QHFA 2OXRA 2R7LA 5THKA 1DRVA 2X1VA 3GEDA 4BRZA 5B1SA 2V7WA 4JV5B 1CB7A 4Q3EA 2ET6A 1CUCA 3F47A 5K99A 4P08A 4ZQFA 1KDTA 3LPDA 2V7BA 3O94A 1IBCA 4KQMA 5IASA 2B5VA 2Q2OA 3RG8A 3GOHA 3S70A 1QSGA 3UJPA 2R8XA 4UEQA 4LOHA 4FKZA 3VDRA 1SUCA 4OI2A 5AW8A 1PS0A 3IVMA 1CPYA 5AI0A 2V6GA 3M9WA 2FDRA 3ECAA 4JBWA 2R8EA 4G41A 1ZWKA 1J1ZA 1XJWA 2NYVA 5EJ8A 1CQIB 4Q1VA 4XGIA 5I7UA 4E15A 4QGAA 4KR7A 3OZUA 5EIOA 1X1CA 4A8JB 3C3PA 1VA5A 3H7AA 4X85A 1TVMA 1EGVB 3G79A 4KKVA 5FPYA 3RIGA 4CDMA 3SBXA 5HRAA 5K2MA 2DCMA 3BZWA 5F1OA 3OSZA 1JPVA 2Q2WA 3THRA 1T9KA 2VDQB 4PGHA 4RYDA 2DR2A 4ZIRB 2OCAA 2QT9A 3OCXA 3TDKA 3H2YA 2AMLA 3O90A 3FNBA 3LOQA 5EIBC 4MVJI 3EQ7A 3TPCA 4DM4A 2QNIA 3J7AC 3M8KA 1EXDA 4NF2A 5TQ0B 2C59A 4B7AA 4BY9E 1SXHA 2JAXA 3Q7IA 4LE1A 1HUQA 5DGCA 5CDTA 1IXSB 5KKAA 1JBQA 4NU5A 3TFQA 2G17A 4RLQA 1QK5A 1QIFA 4GYYA 3M4YA 3OG9A 3EBOA 4MUEA 3WJ1A 4YC7A 2ZRQA 3JALA 1A2KC 2GM3A 4Q15A 4YAFA 2OHHA 4YMWA 3IA7A 4LXIA 1JB9A 4FMCB 1RXIA 3DFZA 3OHMA 4R40A 3VC3A 4FDLA 4EEKA 1J8QA 3LW8A 1E5VA 3QA9A 3DTTA 3PD1A 4I8DA 1BH6A 2QVBA 3E8XA 2A9QA 2QW1A 3PFFA 4UMDA 4Y2QA 3PXAA 5HQTA 1X9IA 2QPTA 1K89A 3EN0A 3QBJA 3T4XA 1U5BA 4KXFB 2IZ5A 1J5EB 2JLVA 1WB6A 4Y1FA 4WFJA 2H5IA 4RU1A 3SC2A 1YS2X 3C4QA 4NJMB 3LY7A 1ZGGA 5BYJA 1D3AA 3ZY2A 2OCIA 3TW8B 4BMVA 4IIGA 4R8SA 1RI3A 2Q6TA 5EZQA 1H23A 4CIAA 2BKUA 4M0KA 1UAAA 1ADYA 3MQFA 4CM5A 5KX5F 4TN5A 4XRRA 1ULZA 1G59A 1OXXK 3WDLA 2O8DA 4ZRDA 2PFKA 4GL2A 4U2KA 1RRVA 3ANXA 1Q0LA 1J07A 4MP6A 1XG5A 3FYCA 1WQ3A 1KA9H 4HQLA 1EFRA 5ALHA 3EFHA 4MYTA 1N1GA 3GARA 3V6LA 1KS9A 5JT1A 2YJ6A 4QGBA 2GN6A 2ID7A 5EC8A 5DHRA 1T4CB 3LP6A 3NEPX 3V2HA 1MOSA 1QH0A 3H8JA 3UJCA 3W9SA 8ADHA 1X87A 4F11A 6LDHA 1OWLA 1W73A 3I9JA 3TN7A 1CSEE 5FBHA 3MG9A 4MP3A 4FCCA 1NVVQ 3FFAA 1EK6A 2YR0A 3KOWA 1J39A 3JD3A 2I78A 4IO0A 2P9QA 4MVJG 2WZDA 4I1RA 4B79A 3SLGA 3O8NA 3L7BA 4DDVA 2GZSA 4RTJA 3L7OA 3LPCA 4RETA 2I2BA 2BHSA 3ROPA 1RQNA 3T5CA 1SKAA 2YMPA 2Q1UA 4KR2A 2OV8A 2VF4X 3RAEC 1Y4AE 1G8JA 4UDOA 2YWEA 1S3IA 1X8JA 3GW8A 4D80A 1T5BA 4WINA 5G1NA 2CXRA 1AKMA 2JKZA 4WY2A 3VTKA 3DXFA 3AEQA 3BGWA 2O2IA 4P3NA 4TLEA 5AK4A 1NVAA 3NORA 3OJOA 1ZIPA 4UE2A 5BVHA 4C4AA 4M8SA 2HDNB 1E69A 3BFPA 3D1JA 2AC2A 5HZGA 3A1DA 3HZRA 3D5TA 3PJEA 3PS9A 1CR0A 1CQJA 1R8SA 3PXBA 4KEAA 5CD1A 3EFBA 4JI0B 5L4LA 2UU9B 4IOKA 4AJIA 1RPZA 4BV3A 2X8AA 4URVR 2YTZA 1Y9AA 2BSQA 4RJTA 1Z88A 3TLBA 1AUXA 2A7XA 3WQQA 1Q0HA 1BE1A 1XB2A 5A9TA 4RQUA 1H0HA 4JITA 2YS6A 4II3A 3ZWXA 3HKDA 2C3YA 4H17A 3WJ2A 5CA0B 3ZU4A 2Z57A 3FYTA 1EVIA 1D07A 4RZIA 4TUYA 3JZAA 4DDKA 2V96A 5LYJF 3VNUA 4QEZA 4JXZA 2YBEA 3K09A 4YRPA 1G2PA 2NU9A 4Y2SA 2VDLB 2QYTA 2BEWB 3PDIA 3GF4A 3IKJA 1SVWA 2W58A 4D8TA 3RSOA 2XUGA 2WE7A 1U0HC 2PRZA 2PWZA 4EA8A 1LS6A 4ZGWA 1KORA 1FRNA 4TV9F 2CLKB 2DSNA 4LXXA 4BNVA 3EVFA 5FUQA 3OF3A 5EJAA 4G2NA 5IX8A 4LG1A 1XRLA 4QOSA 4ICIA 1ZOSA 5CB0A 1W5TA 3NLLA 3URMA 4JLWA 3C6QA 5LNK6 2W6OA 4JASB 2QZZA 4BQOA 1EVZA 1YKSA 4HGZA 4ZANA 4MGYR 2C5HA 2H6EA 2GAJA 3ZNOA 1YCGA 3ETCA 1FXWA 3GRRA 2GSDA 5G41A 2DF8A 1EXMA 1Y7LA 4LMAA 1WCV1 2ETVA 3HMKA 2PRIA 3DZGA 3QLUC 4PLPA 4PO1A 2PWPA 3VPFA 1VRVA 3BJZA 1M6WA 1T25A 4FWBA 4LW8A 1GTG1 1RP1A 4DAOA 4X64B 3G2IA 4Z7NB 4EYEA 3BXGA 1OWMA 3EAQA 5AKXA 4BFXA 4BZWA 1MQSA 3MMSA 4GX2A 4DVGA 7GPBA 2P1ZA 2PH5A 2DQYA 4NYMR 1SVLA 5DT9A 3RYFB 1NVKA 3ABQB 1AHNA 2YV3A 3IPRA 4IKPA 1L1RA 1K66A 4MA0A 1BCRB 2VP6A 4B3RB 1N2GA 1VP9A 2XZPA 1BMTA 4RK6A 3HDYA 2O2XA 2WU8A 4S04A 2OXFA 4Y9UA 1E7MA 4KW7A 1S9DA 4CKCB 1BN7A 4PPQA 4R98A 3V00A 4YT2A 5KQGA 4Z7QB 1MV8A 2HV9A 3E15A 3QVMA 3N3AC 2ECKA 4QULA 4MYCA 3M6FA 1JL3A 3T6KA 2WYHA 3EASA 3INYA 1WZUA 2ZTVA 1UMKA 3ILYA 3SHOA 3UMBA 3ZHBA 4QGSA 3VJLA 4HB3A 4ARZB 5D84A 1KDVA 4DLRA 1Z4KA 2JK1A 3LM8A 5ABPA 1UC9A 2WJHA 3S2ZA 2ZZNA 2G9ZA 3LWBA 4RPJA 2FMHA 1J2JA 3CF4G 1E9VA 1ZBDA 3ZK7A 4ZVPA 5BUCA 2P2LA 3RJMA 1BWSA 2HCBA 5HW0A 2PZEA 5C32A 1Z2OX 1S8FA 1CDEA 1A1SA 1NTOA 1OAKA 4NYJR 2YOGA 2QRGA 4FZJA 2IZZA 3CZPA 3AU8A 3BDIA 4YDSA 5LDDC 2GTPA 4E11A 4F6RB 4CIXA 3JAWB 2C1ZA 2IC5A 4Z49A 2DKOA 5JATA 5M5BA 3LXMA 4IS2A 3BEDA 5H3HA 4IWNA 1U8EA 3WP0A 2JGFA 1NG1A 2CVZA 1M2VB 1ZC4A 2CL7X 3FOBA 1TQ4A 3FTNA 3OBIA 3JWGA 3K72B 2GXQA 1XZAA 1RPTA 1Q1AA 1SOAA 3ICPA 2W6JA 4QQFA 3WOHA 1H8ED 4DIKA 3H2BA 3MQ4A 5BN4A 2GJKA 2HXYA 3U7QA 3V32A 5ITWA 5TMDA 3BXOA 4V0KA 4DZRA 3LT2A 5HKKD 621PA 4GPD1 4AD8A 4FVTA 1D2NA 1I6LA 1JZQA 1A7JA 2VWQA 2MINA 4G5QA 4R8MA 1RXUA 3DZCA 3HUDA 4JUCA 5A0VA 4QYTA 3S5UA 1TQ8A 1D6MA 1P8AA 3IQDB 3IRUA 1NW5A 4B2LA 2BDUA 5I7OA 4RXUA 1MB0A 2TYSB 3CH4B 2W2XA 5E0OA 3UAYA 1ATZA 1NJ8A 1QUEA 4O63O 4U7JA 3R6GA 1NXSA 1CDOA 3KVNA 4RK0A 4YASA 4RANA 2A88A 4CEHB 3AUJB 3LX4A 5D85A 4Z4CA 1T3ZA 4JLUA 4F0JA 5MGBA 4ND8A 3NV7A 1U0GA 4QWMA 2EGHA 4BUJA 4YJ3B 5LB2A 4DQXA 1BS9A 2FYTA 3ISJA 3I45A 3EUWA 3OD1A 4OBXA 3U40A 5AH0A 4S12A 3HKCB 4TWJA 3NH6A 5FH9A 1EX6A 1TLFA 2BE7A 2OC4A 3H0KA 4N41A 2JZCA 2VIIA 3VYUB 3L7NA 3HA3A 5F76A 1C41A 3UPTA 3FVQA 1DG9A 4ITUA 1BAPA 5HFJA 1P5ZB 2SCUA 2XGSA 2P69A 4UMEA 3ZW9A 4NC9A 4YCSA 1F51E 2BFBB 4ZI3A 1YAHA 3BB4A 4OMUA 5F52A 3IEVA 5LYJB 1WU7A 4RPHA 1JIJA 2R6FA 1RLUA 2YHAA 3GHHA 3SS8A 2D7JA 1Y8CA 4ZOCA 5B3KA 4U7DA 3OQIA 2XCLA 3TRHA 2FMUA 3ZH9B 4OUDB 2IHVA 1YHZA 5HBGA 3OA0A 2FQQA 2LKDA 3LSYA 2CLIB 1OILA 5DI3B 1AU9A 3FYUB 2HSJA 1VL2A 4NJEB 4DQUA 5AW0A 3OQNA 5JJLA 3E8SA 1CRLA 3WVNA 1IBMB 3DZHA 4YT5A 5G3YA 3AUSA 2XCOA 1KY2A 2QLMA 3BSYA 2JI9A 2QENA 5KSOA 5E6UA 3HRIA 4UHCA 1QANA 2W6IA 3AEKA 4FMDF 1N9GB 2JGAA 4Z4EA 2HW8A 1V9SA 3IUQA 3H2ZA 3PC8C 1FFXB 4FYIA 1C1YA 3B1YA 3OZFA 3PIRA 1R27A 2DLNA 3KOOA 4P81A 5BRAA 5L53A 2XKKA 4A0RA 1AA9A 4LFCB 3C3XA 4F71A 1LSUA 5T8KA 5JCOC 1RC0A 1X38A 3V1UA 4Z0HO 5ELLA 2GI4A 1L8LA 5FOUA 4ZVQA 2E48A 3TWOA 4TKUA 4D82A 1J06A 2DT8A 3NHKA 4PC3A 3EPLA 1TCUA 3AVVA 4BB6A 5C46F 4FFNA 4AYWA 1II8A 4DCGA 1TIPA 3T1NA 1B41A 1SHLA 1RQGA 5TPZD 4ME6A 4G86A 2BTOA 2OORA 3CUEF 4IIJB 2J3EA 4FYHA 4HXGA 1T0PA 4RZSA 2HADA 2ZBQA 3QX7A 4EHLA 2VYVA 1CS0B 5ERYA 3HXKA 1MJGA 1BTOA 1EX7A 1YL5A 2B36A 3K8ZA 4NU0A 1RHKA 3IAFA 3IIKA 4DT1A 3DFUA 3L8ZA 1RWBA 4AO6A 4QT4A 3ZXYA 1GQYA 3Q3HA 5EWLB 1BW9A 3ZCXA 4FYMA 4KXNA 3G0BA 4QXQA 4R9VA 3VYVA 5KVVA 3NZEA 4JLBA 3TQCA 2P4QA 3KYJB 2B21A 3C4VA 4YQFA 2PV7A 1OT3A 2NG1A 4ID9A 2XYQA 2F1KA 1WBDA 3FWZA 4FJ1A 2UZ1A 4GS5A 1EE9A 1S96A 2B92A 4OLBA 1CUIA 1DLJA 4ZO7A 4BEWA 2G71A 4HAYA 2DB3A 1DOAA 1LPBB 3PGVA 2BGUA 4DLWA 4EA7A 1I5EA 2Q8PA 2JFHA 2HF7A 4RSHA 1R9GA 3EVNA 4K0RA 4XYMA 3WYNA 4EHBA 5CX1B 4FD3A 1U3WA 5JCPA 4Q7EA 3CNBA 2A5FA 1GP2A 4Z3KA 1U2DA 3LUGA 1PNOA 1V3QE 2AC7A 1Q6ZA 3BCRA 4UZFA 1G4HA 3CRNA 1Y7HA 3L6EA 4H7FA 4FFBB 2D4AA 4HEQA 1KMHA 1O89A 1FTSA 3AK4A 1R12A 1E9BA 4X6UA 1ZHHA 3D54D 3DOIA 5CXXA 4ZO9A 5DTJA 1VJ1A 3LUFA 3I5XA 2FUEA 4AMUA 4W6ZA 1FK8A 4CMGA 2NW6A 2FZLA 3Q11A 2OYRA 3M3DA 4IOMA 3SJCA 5IC6A 3U4DA 4EKYA 1E59A 2FA9A 4Q4DA 1N1DA 3KBBA 3QUAA 1O2DA 5F1YA 2CC2A 2FSIA 3K1TA 1DDIA 3LZCA 4EKEA 3AKZA 4ZTZB 2XYHA 2O59A 1HDZA 5TMEA 3JTEA 2AT1A 3R41A 1YS1X 4MWGA 2B3DA 4RELA 1RD4A 4LFAB 4XIGS 4KQEA 2ILVA 1ZOLA 4O4JB 1YJAA 4DILA 2QV0A 2DUUA 1Z5VA 3DL0A 5K09A 2E4AA 4UEOA 5AXAA 1I8TA 4Y98A 4D3YA 4GMKA 2UUAB 2MDTA 3TJZA 4DLSA 1JJVA 3KQVA 5CX4A 4YRJA 3QEAZ 3LPLA 5EMNA 1ML3A 1YMUA 2M6RA 2JJ2D 4RD4A 4Y2HA 3WRYC 2VQEB 1E1YA 1IQRA 1L7NA 3QKWA 3KQUA 1IVYA 2LDXA 3GUUA 3B3FA 4X90A 3WL3A 4E3WA 1GGFA 1VJ0A 5JMTA 4HNRA 4I3GA 3DG9A 3R0XA 4M6WB 3EIUA 2HQBA 1WSDA 2ISQA 4ZO8A 2YXDA 3G6WA 4GICA 4MLZA 5TQ2A 1LDNA 1MJNA 1IXZA 1ZGCA 3EUEA 1PK7A 1RI1A 1S2NA 2N42A 4G0XA 2PCJA 4ZCIA 3TE6A 2VDUE 1LFAA 2QE6A 5AQ1A 1H8HD 4MUNA 1EG7A 2O2SA 2YJ5A 3C0KA 1IL0A 2O7SA 3R5JA 3G0CA 2GQ0A 3NP9A 1EVLA 2JJ8A 5BWBA 5BNTA 5SZJA 5E2AA 3DYBA 2EFDB 4RL6A 3N6XA 1P0PA 2P5TB 2ZJYA 4MICA 2G1JA 1VKNA 3UC5A 1KQ3A 1WUHS 2CMFA 3AHHA 1D2GA 1XLVA 4IDGA 4U39A 4BFWA 4KAJA 5JCJD 5JY1A 4A82A 1W48A 5KOYA 3LDFA 2H0AA 2R9VA 3OC6A 2YV4A 2PMFA 2AFVA 3LFUA 2O2YA 2VJMA 3TR0A 2P0EA 2NTEA 1KU6A 1O96A 5HRUA 4MDFA 1COWA 1S01A 1W4BA 3ZD8A 1AMNA 3FCOA 3KXDA 1UDRA 4XUEA 4UOEA 2JDIA 2QE7A 4DV2B 2CSUA 4XEHA 2LBPA 3IGFA 4J4HA 2HMUA 4BX3A 4EKIA 4LHZA 5A9SA 1XTRA 4HQ0A 3D8SA 2LR0A 4M49A 2Q5JA 3WLOA 3M82A 3ZV4A 4NDZA 5JR3A 2W93A 2XOXA 1P3DA 1HEYA 3NX4A 1B3RA 2Q9CA 3VXKA 5AM1A 1PJ8A 3NYWA 2IUUA 4F7WA 1UMBB 1LU9A 3CT4A 1SKUA 2CB9A 1N34B 3PPIA 2F1IA 4GWLA 4ZV4A 1O54A 4IV0A 3W2FA 3U4QA 3VKGA 4EHKA 4H9GA 2ZR7A 3OX1A 2GNOA 1SIOA 2D2VA 4I5GA 3INGA 4H18A 1WAMA 3RIEA 5LP6F 5LPNA 4N65A 1QX4A 4ZZ2A 2MCFA 3BS4A 4GZ3A 3BJMA 3O8DA 3V55A 2VAPA 1Z82A 3I0NA 4ECEA 4QUHA 3Q3CA 1IIBA 3R75A 3K6SA 5BPFA 2VS1A 2WKQA 1P7VA 2R8ZA 3DOFA 4O2AA 3IDQA 5BT9A 3SZMA 1S7CA 1SUBA 3JQAD 4OX9B 2GZHA 3DTVA 2I6TA 3NHFA 3CX8A 3D4IA 1TCAA 4TXJA 2CMDA 3DE5X 3GK3A 2VOEA 4ZC1A 3ZOKA 3KU1A 2EWVA 1VYUA 1TIKA 1SUPA 1G42A 1GZ7A 3TGWA 5IPFA 3IDAA 1BGXT 4KVFA 1MAUA 4MV8A 5ALJA 4P4TA 3SQMA 1C4XA 2GHTA 4Z7OB 4JJGA 3UNXA 2Q9BA 1XQYA 2GVDC 1DBIA 1SD5A 3R9XA 5ESDA 1RXSA 1C7IA 4HN9A 2C77A 4MUKA 1XRRA 5L4NA 4DV1B 3K0BA 1LPMA 2QRHA 2AFIE 3A6ZA 3GH1A 5DW3A 1GPNA 4D0NA 5IVKA 3O4FA 4C06A 1H0KA 3V9PA 1SOUA 2VSQA 3VX3A 1U2GA 3JYLA 1PFWA 1W94A 1LPAB 3AOEC 3B85A 4J9VA 2NAPA 4PAQA 5KKCA 4GOXA 5BOVA 3RU7A 3GU3A 3I09A 1AN0A 2F43A 5K3FB 2PIDA 3TR6A 4D4HA 5CFPA 4JI8B 3QKSA 3EZ6A 5E6RB 1XCLA 2NT4A 4WERA 2ZSIA 4Z4QA 2Y1LA 2ZI9A 3RUFA 5ALWA 4QFBA 5TVGA 3EF3A 4LRXA 1VIVA 1HYGA 2F67A 2UZAA 3B1VA 2H8KA 2GBCA 3RS8A 3T4PA 3D64A 3V48A 1YZNA 4EPWA 3DEKA 2E5FA 4GLLA 5KUTA 3DZDA 3C6ZA 1MFPA 4GQIA 5FYQA 3BXEA 2OAQ1 2PSDA 1SUSA 2HNAA 2IJGX 2RHGB 3D7KA 3HJFA 1R4ZA 1A82A 4ATNA 1A69A 4D4KA 4X66B 3T1YB 3SQDA 4XPIA 2RGDA 4R8KA 3UWKA 2BMDA 4UPVA 4V0ME 1AT1A 4DEXA 3RRNA 2OO7A 3W3AH 1PG5A 1PWYE 1G5FA 4YRQA 1VHWA 4R51A 1WXWA 1B0AA 1DJLA 1Q16A 4IFEA 5DYYA 1U80A 3OE7A 4ZREA 1D4FA 4NLLA 3ZJVA 3NRBA 2O5CA 4Q4HA 2ZIGA 5BNFA 4FDUA 3R6TA 4YONB 3KOMA 2O52A 3GLIA 5GONF 4WCFB 4KITB 5E1DA 2PJRA 3C24A 4OBWA 2V8BA 4FOTA 5HTKA 4YJ3F 1KO4A 4QICA 1SVUA 1VHQA 4RZ2A 3GUZA 3AJ8A 5EJ7A 1UT8A 5LQSA 3MINB 3HADA 5F12A 1U5CA 1L1EA 3NFRA 1NLUA 1V11A 2AEJA 3QQPA 4NZYA 4DY4A 1N5IA 3JSXA 2F43B 1ZO8A 5K3FA 2F90A 2WD8A 3NJ8A 5CFZA 1NMYA 5HUQA 1RWVA 4WACA 4MWTA 3OFKA 3OM0A 1DU4A 2VXCA 2ORVA 2X0IA 5JZSA 4MEAA 3RHFA 1JLRA 1NXXA 3DE7X 1NMQA 1ZICA 1MQ8B 4RZUA 4AU1A 1Q95A 4P2BA 1E9FA 4RK4A 1R0RE 2JCYA 4MWSA 3F8WA 5GV7A 5KNBA 3UFXB 5L51A 1OZFA 2V7EA 5JALA 4DL9A 2CNDA 5FF9A 1G7SA 2NAFA 1GZ6A 1LRJA 7REQA 5FUMA 1SPBS 2FVYA 2P2YA 1VOTA 4RY9A 1UL1X 4BV8A 5KWSA 1D1QA 1Y6ZA 4JJKA 1MCZA 1KS2A 2WJ3A 4RM2A 3RF6A 3EG9A 5JSQA 1KY4A 2ARKA 3HSKA 3ORYA 4EWLA 1TU0A 5TY0A 3M2PA 3U81A 1GGJA 3DO8A 3EYWA 4JUAA 5B64A 3TGLA 4KJXA 4EMBA 3IUMA 4C0SA 1SZDA 5IK2D 1E3WA 4G56A 4OI4A 3RROA 5TS3A 2C1EA 3OI7A 3PNOA 3FF4A 2H5LA 1FY2A 3IFSA 4XA8A 2QM8A 1QHNA 2GXSA 2EW2A 2Q5OA 3SF8B 3EIXA 5D8DA 3LDHA 4NPAA 2HQOA 4QFDA 2KPOA 4JD5A 4H7IA 5H5JA 1WZIA 3ILVA 5F5XA 3D1LA 2GPAA 3ADCA 1TEVA 3TE7A 1T5TA 4KLCA 4BV9A 1PKXA 2OMEA 1N6LA 1COWD 3LTEA 1Y5IA 3AR4A 2P9FA 4KQCA 1IOLA 3DVQX 4BMCA 1L5QA 2Z6UA 4KN9S 4E6EA 3EZLA 2VDVE 1Z73A 1H0RA 1NBOA 2IYRA 3QIAA 4K2AA 4IXTA 4WGFA 4FFVA 3M4ZA 4YXFA 4QOEA 4CM9D 2AW3A 3SQWA 3DDSA 3TQQA 3G2LA 1PT7A 3E9YA 3LO8A 5DK4A 3OY7A 4WZAE 3NHJA 4YCNA 1DBRA 3B5JA 2NXWA 3QMPA 1ZW6A 5CRIA 2OCDA 3RRZA 5LP1A 4W1SA 1YVPA 4KQIA 1CUXA 3I83A 2AF4C 4MVYA 2BKEA 4EYGA 1K2VN 1OI4A 1V7PC 4ARCA 5KOJA 1MHPA 1JHXA 3RIYA 3FZGA 3TSOA 2Q07A 1G8SA 2ZI4A 3KQNA 3AFGA 3R5TA 4RUKA 4US0R 5LMUB 2VHJA 5JAQA 5KREA 3V1MA 2VYFA 4MPDA 4LVUA 3WY9A 4N1AA 1Y80A 3G1UA 3T9AA 1VA4A 3QVSA 3CR7A 3SHFA 1SXJD 1G2QA 1GPKA 5L40A 2WZQA 5EZYF 4R9UC 3KXPA 1XP5A 1L6RA 5KINB 4JJEA 4TLAA 3MM4A 3BT7A 1CUAA 4CCYA 4ZV7A 5DIZA 4HTAA 2RGNA 4RCZA 2D8MA 3L0CA 4JX9A 1CNEA 4H7EA 2DGDA 4N7JA 4BNNA 3UT5A 1U02A 3FNHA 3FPAA 2UYHA 3IKMB 2ODAA 4XGQA 3L0OA 1HSOA 5BVGB 4KYUA 4RBNA 2JH8A 4YLGA 3LVQE 4DMUB 4R1NA 4BNHA 2QX9A 3PQCA 4MQ4A 5EJ9A 121PA 3MCVA 3A58B 3W8RA 3QELA 2EZ4A 4OXNA 4QA9A 1P9LA 1VDZA 4RA6A 4UQOA 3U3KA 3GEHA 4UUQA 3VR4A 1Q1NA 4NPCA 3SVZA 5JY6A 1RM4A 4MIYA 2KHZA 3OQPA 1TQHA 4N0QA 3ZBUA 4AKSA 1XLTA 4B71A 4HLUA 4HVTA 1BXRB 1NF9A 3RANA 1A9SA 3KOUA 5FFMA 1Z0ZA 2GRAA 2H7CA 3RVNA 5A02A 1YD7A 4J2OA 3VR0A 3CUSA 3NANA 4Q6BA 5EKTA 1G41A 5FPHA 2B9VA 3A10A 1U9CA 3CLRD 5BOSA 1B16A 2K5UA 1LI7A 4CTKA 1T91A 2WU4A 3NTVA 2JKYA 3ZJUA 1KBOA 2YOFA 2O0MA 5AVZA 3V4VB 1VGVA 1XZEA 2H1SA 4FDMA 4C0QC 4B32A 4MITA 5KSWB 4M1WA 3RVMA 5DKFA 1HDRA 1TTHA 2PLNA 2CKMA 2W6PA 5FL7D 3M1IA 2OWEA 4M1KA 2BONA 4UCWA 3U2QA 1UBOS 2VNIA 2YIVX 3ABZA 1MT0A 4C0AC 3E4CA 2I33A 1W5SA 3FSJX 2PO5A 4HDNB 4K9MA 4W7HA 1E1RD 3RVQA 1HFWA 4UUOA 1MEJA 5D3MB 4EF5A 1W36C 1C29B 5T41A 4EW6A 1X7YA 3JWPA 5K3SA 3IVCA 4E5PA 2Y0DA 2CK3A 3GNLA 3TD9A 3ZVKA 3IBGA 2WUVA 1JP7A 4LJ7A 4PPGA 5CT4A 3V8NA 3TCNA 2IYSA 3L0PA 1I32A 1Y3BE 3F4BA 5TT0A 3RC9A 3U7GA 2IYQA 4WKGA 1B7GO 2PBZA 2QTWB 3JQ7B 5EFZA 1UZNA 3RRBA 3VVMA 3BHJA 3IAUA 5BR1A 3UKJA 6CHYA 3OE4A 1ADJA 1UQTA 3FPSA 3HO8A 4BECA 1U3VA 2CNOA 5AW2A 5ALTA 1SHJA 5LMZA 3DBVO 5BSRA 3WTBA 5CDFA 3OM8A 3WYCA 3DO6A 4AY5A 4JDPA 3AVXA 4QXAA 2XCUA 1K0UA 1F12A 1BIFA 4Y2YA 3UWPA 4JFRA 1TYEB 3H0EA 4O25A 3ZWQA 4EFMA 2X15A 1HQYE 2CJFA 4MV7A 3FPCA 4L1KA 4UHBA 4FP9A 3U7EB 1DWPA 4GRAA 2A0UA 4CF5A 2AB0A 2DFPA 3L41A 5KNBH 1NI4A 5EZ6B 5AP9A 1CJMA 4L9AA 5L8VA 3AX6A 4D9JA 1TADA 4K6CA 3MBOA 4Y6RA 3T1TA 4TKUB 2BM9A 2BZ1A 2WSLA 3LZ6A 5JSZA 4DRZA 1C9EA 2KI5A 2GF2A 4KVGA 3AFMA 5HQJA 4EPRA 5FTLA 2QQEA 1S2GA 2VDKB 4KBFA 1U5BB 1H94A 1MRZA 2JD0A 5ITZA 4EY4A 5LQRA 3RK1A 1ELOA 3U16A 3T7CA 1B15A 4G0WA 3ZY4A 4YIHA 2QUHA 1GCIA 4IIHA 1Y3DE 4NPHA 1TZ2A 1JIQA 3ZBPA 2P9CA 4FMCF 5EZYB 3TM5A 4PZYA 2AYXA 1LA2A 1PJAA 1SFRA 4MI9A 1Z36A 2R6ZA 4IQ0A 4Q9AA 2BBTA 4C4OA 5LNK1 3CLTC 1GSOA 1YOBA 3ACBA 2B4TO 2FKAA 4JBYA 4FCVA 3U3MA 5DI3A 3CV3A 1FQOA 1KKUA 3NKVA 4Q03A 4D57A 4DEVA 5JXHA 4N8EA 3RC2A 2P0YA 3H4TA 2F17A 2WWGA 5I9LA 5JECA 4N6OA 4P5DA 1J2TA 2HHAA 4GBMA 1P5HA 2HAEA 4G0UA 3R09A 2QRKA 1ZVKA 4C0LA 1TRHA 1TJ3A 3RUCA 5C1OA 3H9GA 2FPSA 5ARBA 1PLKA 4UJ3A 1OFGA 4EJSC 1GSHA 3T52A 2H52A 2ZXEA 5IKOA 2SCUB 3NEJA 4MK4A 1QCYA 1GY8A 3KWMA 5T64A 4HS9A 1FYVA 4JL5A 2IIQA 3G8DA 2C7PA 3MCTA 1IHUA 3MCWA 2ATXA 2IEAA 3SS9X 2O54A 1APBA 1YGYA 4IH4A 3T38A 2OXEA 1BMFA 1L5YA 1F0NA 3HCOA 4K6OA 2V1XA 4RTLA 3QKRB 4W1QA 4NCKA 3KVVA 5ECDA 1WB5A 1P1KA 3P45A 1GGEA 3P97A 5EXDA 3UG6A 4AN0A 4D4JA 4ENSA 4MKIA 4IDAA 3EISA 5JPDA 1ISPA 1N9KA 2FEOA 2H2WA 2OOSA 3BA6A 1Q1QA 2JCBA 3EIEA 3FDJA 3IX7A 3KSRA 3EZYA 1ZCAA 4IQFA 4C22A 1ZD3A 1ILEA 2I1QA 1ZHFA 4LCEA 3OCCA 4PRKA 1Y5LA 2QF7A 3K0EA 4TXLA 5BSVA 1P1CA 2I2WA 1A5AB 1KJ9A 1QGYA 1R8QA 3MYRA 3QA3E 4I50A 3W9UA 4ZYZA 2IPMA 1YF3A 5C53B 3HBNA 2GFQA 1P1HA 3OE5A 4DM7A 1VMEA 4KH1A 5L45A 4ZI7B 1Y33E 4HPXB 4Q4HB 4E5KA 2UXBB 4OHCA 2OY0A 2DLCX 1ACMA 2QUIA 3N76A 1GTZA 3JPYA 2CHVA 2NUAA 4LYEA 2IF2A 2ZWMA 4HNUA 4N47A 3U1BA 3IT0A 2MSCB 4MGIR 5AI8A 2OT3B 3X2SA 4Q18A 3UAZA 3O8CA 4GDMA 4R1UA 1MENA 1YRAA 1EDEA 2N47A 3GZNA 4LRTB 4YBRA 3SF0A 4YPOA 1GD1O 1YJ5A 1ZRHA 2QW8A 2UYQA 3N9IA 5EEGA 3B5EA 4YRCA 5GZ6A 4AZ3B 2GTIA 4DMMA 1G4UR 2BM8A 2XNKA 5COBA 1UKZA 4ISBA 4J3NA 3LK7A 1P4GA 2XWBF 3WMGA 1M1YB 1DG1G 2R8RA 5FV7A 4I5DA 4NMMA 3P2EA 1KOLA 3VMFA 1UADA 4U5XA 2BBSA 4G8JA 4H0NA 3TNDA 4F60A 4Q4AB 1E2MA 3KHTA 1R0YA 1VKOA 3M6WA 3SMVA 3F6EX 4X1IA 1QG2A 5GV8A 3OPXA 3A7DA 1AUQA 1CRZA 1WL8A 4HUTA 3FTDA 4ZYUA 1TF5A 2QN8A 3JRWA 5IU6A 2VEOA 1I3OA 4HOYA 1SQ0A 3J80A 3QFRA 3RJ5A 3HY6A 2IS4A 1HDEA 4BO3A 3CCBA 3QE3A 4FC7A 5TXGA 1JQDA 3VO1A 5JYBA 4TRMA 4L76A 1QWOA 3CN9A 3RS7A 5AVXA 3GLUA 2ZJ6A 3HNRA 4B3GA 4V2UA 3LBFA 4J1SA 5JZ9A 2VXBA 3EFOB 3OWHA 4G0QA 2V55B 1C7ZA 1EJ0A 2P4HX 5DSZA 5FPSA 2O19A 1PEAA 3WQHA 1KYVA 4IIBA 1RRFA 3CLSD 5ECWA 5EE9A 5ILGA 4Y2VA 4AN4A 5JD5A 2Q3MA 1SC6A 3PHCA 1AX9A 3FRIA 1UAYA 1EU1A 5JSZB 1DAMA 4WA8A 1XTTA 2G72A 2M6KA 3W1VA 5JFOA 2DM6A 3OLQA 3N58A 3JZFA 2EQBA 3WWYA 1JVSA 1D5WA 1RR6A 1T13A 3KYDA 4E2XA 1L4BA 4YAOA 5MN4A 4HATA 2V7GA 4OJTA 4ZHQF 4RTRA 1JR6A 1Z0FA 1TM2A 5LIRA 1Z6ZA 3UUFA 2VJBA 3WBBA 1BCRA 3IQXA 2DY1A 1UZLA 4D44A 3I5AA 1XNQB 5FOSA 3KWLA 1CUSA 1LV8A 4YP1A 4KQHA 1A1VA 4K9OA 1W0CA 4BMYA 1NHGA 2GRJA 1B00A 3N59A 2W6MA 4NBTA 4NABA 3F49S 3THOA 4TWRA 4LYHA 1GQ2A 5EVCA 1QGED 3GUYA 4AUKA 3GVCA 3D8NA 1NN5A 1JHPA 2HDOA 2HH9A 3ELBA 1GPH1 1BDHA 1XPOA 3NH9A 5IRCD 2QLLA 1SG9A 4QM6A 2IW3A 1CEEA 2FR0A 2VVTA 4RZQA 4TV8A 2VHYA 1GUFA 2XTMA 1JDBC 3BL8A 3MTEA 3U3RA 3DNMA 3ERCA 2EIHA 4P4NA 1N2CA 2VBFA 2GWHA 1SU4A 1UJCA 3H1FA 4B2PA 4CL2A 1ID1A 4DR5B 5D3MA 2JJQA 1T9GS 1PD1A 4PFSA 1WJGA 4JJZA 3OURA 5KVAA 2PMKA 1V1MA 1UM9A 3BREA 4MTLA 2DBZA 4QDUA 4EI9A 3SHWA 3AEXA 3KT3A 4G26A 2Q5FA 3EZNA 4LMPA 4XXHA 3RVJA 3TTYA 5K0CA 3B2QA 1WUKS 1OH8A 3VR4D 2BSAA 4ARIA 1BMDA 4M1QA 1PR5A 2A0XA 4CT5A 3T5PA 1E2GA 2ODWA 4LYYA 2VI5A 1PR3A 4LYDA 1PYGA 4DXDA 4XDGA 1T4MA 2FETA 4RTNA 1JLLA 4FOLA 3PIIA 2X0JA 1LSJA 4Y8VA 2NTJA 1PV4A 3RAGA 5U9CA 4TUYB 3X1KA 4B76A 1IN4A 5JI3E 2VC2B 5M3BA 2WNHA 5LMCA 2CXNA 2EG9A 2HUNA 2NSHA 3C6MA 3KLNA 1KP3A 4WFKA 3RH0A 1YA6A 4WZBB 1VKRA 2GN2A 1RYEA 4YS6A 3X1DA 2FEPA 4KGDA 2Q2NA 1AK9A 1IWOA 4DCSA 4OA5A 5REQB 4BJ1A 4BX8A 3VHLB 3N7UA 5TGZA 3KB6A 2GN1A 2WINI 3FWHA 1HA3A 1QBKC 3JYQA 4J75A 4CKEA 4E0BA 2P9YA 3Q4GA 4IEFB 4IBOA 1KAOA 4NOLA 1SIBE 5FHQA 3UXHA 3DV0A 3VNBA 1XLUA 2PUHA 3MQ2A 4KTTE 4KWTA 4MLPA 5ALUA 2WR8A 5I7HA 1Z28A 4UREA 3IULA 4BASA 3D3WA 2C9MA 4OL0A 2P3SA 5EMMA 3AQ4A 2YUTA 3JQ6A 1R5JA 4RVNA 3FXAA 3VC7A 3WBJA 3IOCA 2O57A 4TZKA 3ZWBA 3FETA 3L5KA 3TEMA 3J81k 4U7FA 2WM8A 3KPVA 4IICA 1GPYA 1Q5PA 3SM3A 2O0HA 1IWPB 3DW1X 2QN7A 3WIVA 1ZVQA 2HSWA 1KIAA 1YRBA 3FF1A 3JCZA 1P2GA 1XGKA 2CF5A 3P19A 5HEKA 2CV0A 1J21A 2X7HA 5IXSA 4NCBA 3FYSA 4Q05A 3QOXA 3CLHA 4NBNA 1EK2A 3UWSA 3PR1A 3S2UA 4F3CA 3ILHA 3E9MA 4OSEA 1VL0A 1XBTA 1Z8HA 4GPAA 4L22A 1GCUA 4UBMA 4YJHB 5EE1A 4LDJA 1LRKA 2BT4A 4FDAA 1OC4A 3THWA 4PLYA 1GL7A 1MG5A 4QIHA 1F48A 1K3TA 5KTPA 2ZTMA 1L9XA 2RI0A 1N6HA 3I8OA 3ST7A 4C7KA 4XVUA 5HJ5A 3F9CA 2J3QA 2TRSB 4JCOA 5AHRA 3DXZA 5LN1A 3K7EA 3ZS8A 3W2HA 4A8HA 3TW8A 2P75A 2WB2A 4ENTA 5TMBA 3OT4A 5TPZA 2EBUA 3M5WA 1Z8NA 4F04A 2Z6AA 2BRUC 1R15A 4PRLA 2HA2A 3N0RA 1K88A 4Q7JB 2WIGA 1A98A 1W0JD 3LLUA 1QGUB 1M34A 3HYRA 3PDWA 2PSEA 2VK8A 2FQYA 2RHDA 4YCCA 3CEHA 3JSAA 4UU0A 1X42A 3TMYA 3VNQA 4BO5A 5E38A 1FP7A 4JL6A 5B37A 2I29A 3HCNA 1F7VA 1P44A 1GKUB 3K1YA 1DEAA 2FXVA 4IG4A 1VMAA 4QPZA 4CUJA 2FPOA 4M86A 2GZ3A 2AK3A 5A2QA 3I61A 1HO3A 4YN3A 4LJ5A 5AHXA 1IONA 2HM7A 4X7RA 1CR6A 3QV1A 1NJ6A 1UOQA 3K0HA 1VLMA 2LNDA 4QVIA 1RW4A 4MUAA 1LK5A 4NCXA 3X1JA 3Q2KA 5B57C 2BYTA 1XTVA 3OZRA 4A4DA 1M8KA 4BP3A 3NC1C 1XCOA 4YHHB 1XDBA 4UBLA 4B17A 5I9BA 3DKPA 1FUYB 4LDQA 4MWBA 1YQ9A 1CERA 4M54A 4FR0A 4LY9A 1NQAO 3LMKA 4FPXA 4C4XA 4D8VA 1NAIA 1PE0A 4JOBA 1OBOA 4N7MA 8ABPA 3DULA 1TOAA 3PDCA 3BIOA 3ZEIA 5CXUA 5J2UA 1NJ5A 2MYNA 4Y67A 5CH3A 4MI1A 2B94A 2OLEA 1LK0A 4W9NC 3VUFA 2RB4A 1VG0B 2RSLA 3IPCA 2XDAA 2ON6A 3DS8A 3LY5A 3O26A 1CDDA 4HDCA 3UICA 4OIFA 3HB9A 1IZYA 3DUFA 4G63A 4EVQA 3TMAA 5KBYA 1NN3A 4BZQA 4QBHA 3VSBA 1NNSA 3SFZA 1AKQA 2WTEA 1KO5A 1NZJA 3BUSA 4ABTA 2FWMX 3KYBA 1QFSA 1P0MA 3CXRA 2XGMA 3MN1A 4XIIA 4BO7A 2IVZA 3W79A 3KT8A 3ENVA 3TQOA 4IZOA 5HP4A 2PTHA 2ONYA 3NHAA 2C2HA 2XMQA 3HI6A 1FFHA 2QJRA 4NE9A 5AHOA 5KSZA 3BWCA 2Z5LA 3QEOA 4AMGA 2CHQA 4BQEA 1NE2A 2IYZA 1MJFA 2I2XB 4NNOA 1W52X 4MUGA 1ZI8A 3O3MB 1G21B 2QVYX 2DH5A 1PFVA 3RG2A 5IJ9A 2AA3A 2Y2UA 3K71B 4LSGA 1YS7A 3AIKA 1YS6A 2F59A 4CHTA 3MAGA 4H1TA 5C81A 3RFUA 1NRXA 4IJ5A 8MHTA 2Z2JA 4NZ9A 1OXUA 1FEZA 4TM7A 1LBTA 2NVOA 3DHNA 5IUKC 1IBRA 1CE8B 3ASUA 4Q16A 4URHA 2J32A 4CHGA 1EI9A 2GPSA 3KQMA 1QIGA 3MWYW 4N49A 3Q7QA 3MTJA 4KI0A 4HP8A 2H00A 1F6DA 4UXIA 2D54A 3BIWA 3MPOA 4WZBA 2FUKA 4X6YA 1EVEA 2G63A 4RTMA 3TM4A 3EC7A 4B0OA 2ZVDA 3THXB 4OGKA 1A5BB 4OG2A 3K15A 1R8XA 3HN7A 4KXMA 5JO9A 2WSSD 4IVRA 2GILA 1H8HA 3RUIA 4DIDA 5BUQA 3DE6X 5AJWA 2YKGA 1LH0A 1QG0A 4FEAA 3BBPA 3IIJA 2XUPA 1OPXA 3FFXA 1J23A 2JAUA 3G88A 3W78A 2XCRB 3C1OA 3KS9A 1J7KA 3LBIA 4ZJYA 4BHTA 3HB1A 3C45A 1E2NA 4AWAA 1R4NB 2GPBA 4I55B 4MEJA 3IIEA 2IL1A 3AUFA 4MV4A 4ZAXA 2JLQA 3VFDA 4GPTA 2P2GA 1VSTA 1FMFA 1AZSC 2YQ4A 2HJHA 2QZ9A 5B3AA 2WWWA 1EFLA 3VYRB 1B1AA 2XMGA 5DXAA 2NOAA 2Y6VA 3RSZA 1XTPA 5A4AA 2IYLD 4BYGA 3ET5A 3QF4B 4QE3A 5EG5A 1QHHA 3CUTA 2DKNA 1J5PA 2QTHA 4LXUA 1IHXA 2C2WA 3F6YA 4BOYA 2ZSJA 1KE2A 3GEBA 1PBTA 2FZEA 1QZUA 3FOEC 2O8FB 2VOJA 1E58A 4EFDA 3WLAA 1DBQA 1TLLA 4JODA 1RTTA 4QFCA 1I7LA 2CMHA 2DX7A 2ILTA 5THQA 1ETUA 5EI5A 3T9CA 4EG4A 3F67A 1BX0A 5JAPA 5HBRA 4D8WA 2ZRNA 2VNKA 5EQDA 5B1DA 3T5TA 2Y77A 3NUQA 3U13A 3ZXUB 3IEXA 4D98A 1AK2A 5C5CA 3ESYA 3FUUA 5IK2A 3T7SA 1FVFA 3OMLA 3PKIA 4RF2A 1DKOA 4Z1MA 1V5GA 4CQLA 3W3ZB 1WXFA 4PANA 4FGUA 4WXYB 4HFRA 5EQJB 2ROQA 4BVEA 4F2GA 1A4UA 3OOWA 4PX9A 1JYSA 3HXOA 3L7DA 2FE4A 1XRNA 3A1EA 3K70D 2W9XA 4E09A 4TKVA 3ZI7A 3QU7A 2O7RA 4WY8A 1KRXA 2OECA 2B35A 4LCBA 4HXEB 2NO9A 1TEZA 3L8EA 1KZ4A 1QOQB 3MHTA 1BFUA 3QOYA 1SC4A 4OXKA 1WXXA 1F2TA 2ZAGA 5C7YA 4J0JA 2PUTA 1MW9X 1Q0ZA 2OHFA 3FVTA 4GLFA 4C29A 3TL2A 1KK2A 1W88B 2ZYVX 2VXYA 4BFSA 1YRWA 5JHHB 2ZUDA 4KXWA 5K8LA 2B5OA 2FRDA 1M5UA 3AL2A 4M7WA 1VE9A 1C4WA 3ECSA 1QHHB 3M6AA 4M0EA 3SBOA 2BFAA 4CU2A 5MFZA 2PX4A 1J8YF 2PZBA 2IY7A 1B73A 3M4XA 3GLVA 4B3XA 2GETA 2JIQA 4EOGA 4F4FA 1JKIA 2ZE8A 1Q7RA 3Q0IA 3I4FA 3RASA 3RPEA 3TOVA 1WUJS 1EJ6A 4KYTA 3V3KA 3VKUA 3TLJA 3A9WA 4TLBA 2C4UA 5AJVB 4O4JF 4OHXA 3NWBA 1TW2A 4KWIA 1A88A 4MYDA 3MJCA 3E0XA 1NFRA 2YN4A 3KQHA 4K03A 1JHRA 4PFJA 4WHMA 5DK6A 3R3UA 1AHPA 1TI7A 4MS4B 3K6SB 5CTJA 1L7OA 1ZJWA 2FG6C 1UJ5A 3U7IA 3AG5A 4LVOA 4HT3B 3SYMA 2VRNA 4KFCA 1AF4A 3OZWA 2DSTA 1I01A 1LLDA 4DCTA 3RWMB 2HDHA 4DBZA 3BK7A 2HLHA 4D8YA 3DAOA 4BVHA 4XFJA 1L8OA 1QXSA 2G4VA 4EPTA 1E3MA 1U8FO 2IFTA 5TPWA 4NVRA 3UWOA 5ADHA 4WXPA 2OENG 2ZW9A 1JLHA 3RHSA 1UEIA 4WCDA 1T3SA 4FE7A 3JAKA 4GWGA 3DQZA 1V96A 2C82A 3K1ZA 3BAZA 4B5KA 2C9OA 4E2FA 1XDDA 1ANKA 1KOJA 2VUTA 5IJ0A 1P0FA 3DE0X 3UOWA 2EWMA 2IDMA 1IAQA 5DIFA 2OD7A 4K5QA 4ZTBA 1AG9A 5CB8A 2DWCA 4YJFA 2PKXA 3E22B 1V11B 4GMXA 4GXTA 4HR7A 3O95A 4OJYA 1U7HA 3ND9A 4X8MA 1RSZA 5IDVA 1FJXA 4ZI7A 1SBNE 1EGMB 1STOA 2P78A 4JY7A 3VZQA 1I2DA 1WMDA 2XECA 3T7TA 3ZWDA 1Y9ZA 5G0VA 3VZPA 4UNPA 4MV5A 4NENA 3INTA 3SQXA 1VCNA 3H5WA 2Q0SA 1KJ8A 4PTZA 4TTJA 1ZVVA 3L6CA 2WDPA 4UPDA 3G17A 4EO9A 3A28A 1NXTA 2JFVA 3DVAA 2Q4OA 5K3CA 1SQGA 3B78A 3CJTA 4NIMA 2V7PA 1RLOA 2VYCA 3T35A 3EEOA 1JH8A 2G7ZA 2Q4BA 3A14A 1W49A 2R7KA 2PMWB 1YZGA 4TN1A 3K5HA 5ADVA 3HYLA 1PQWA 1A04A 3DOJA 3I8SA 3FY4A 5CA0F 2EV9A 2WVGA 5AHWA 5KCZA 3EXEA 4BAGA 3KL4A 4L4ZA 5ARDA 2PR2A 2YUIA 4LNHA 4YWJA 3ZBQA 3KQLA 2WQ7A 1MIHA 3A6HA 1UKVY 2J3DA 3RAJA 4QTYA 3G0OA 5C3MA 3IQGX 2REQB 3N8HA 4HVLA 1XZ8A 1LNZA 2Z56A 3N86A 4AO7A 5BRJA 3RJ9A 5DTIA 2E89A 2JFXA 3EA0A 3IEKA 1OFIA 4B3JA 1KVUA 4OYYA 2W48A 2YV5A 2R8OA 2HLPA 1R0WA 2PYDA 3PQ2A 3TD2A 4BVLA 5IARA 5KYYB 4A27A 2WSIA 4B3FX 4RVUA 4UCFA 1PU2A 3UH1A 4TTRA 3N2KB 3GEPA 5J47A 2GAFA 2AC4A 1VYHA 2PWBA 2JA1A 1II8B 3I39X 3QY0A 3A6PC 1HQKA 3RSFA 1VPEA 3W3AD 2AHRA 2NYRA 1WW2A 3EOAI 3VPAA 4HMQA 4DR3B 3MJ4A 5K0SA 3JWEA 1X2EA 2BDTA 2OZLB 2WHPA 5BQFA 4CI9A 4B87A 3DR5A 2HRBA 1PVDA 1M34E 2NADA 3ORRA 1YRLA 5J5CA 3SBDA 2A92A 4UBJA 4YYEA 4PC6A 2HPHA 3FLMA 3LT1A 3CO5A 4HC4A 3HYCA 5DT2A 3QYFA 4TQUS 3ZTWA 2EL7A 1E0KA 1T2FA 4EGSA 4DLKA 4L4SA 2OB2A 4EG0A 4LY6A 4DV3B 2XUJA 2YOHA 1Y3IA 4HGOA 2HO4A 5JMWA 4QVGA 3OIYA 4Y3UA 3EMKA 3ZDAA 3S44A 3E7WA 3IHWA 3N2LA 4G5OA 3SX0A 1YVDA 4F1JA 1U8UA 3T9BA 4HNAB 1OHHA 2QX6A 2Q3HA 4V1CI 1P18A 2BEVA 3GPBA 2PXXA 3OT1A 3NALA 4C5BA 2VYVD 3BYZA 1CHDA 1GN8A 3LHSA 2POQX 3KOXA 1HOTA 3OQIB 4CE6A 1ZUNB 2ISCA 4J7XA 1J24A 4BRSA 3L9XA 3BM5A 1XZQA 1ZZGA 4DXHA 2WIFA 4AYTA 4JK3A 1RJ9A 1YK1A 1ZD1A 4XWTA 1VCIA 1NVFA 1BJTA 4NDNE 1U0SY 1D7OA 2GEJA 5BQ3A 2I1WA 2XB9A 1YJQA 2QDXA 1I0ZA 2VP5A 3AF5A 4Z86A 4GE3A 3ROKA 5F3RA 4MR7B 3SS7X 1AKYA 1VIAA 2RCNA 2ZRFA 2ZITA 4M2LA 2NYAA 3MLBA 1DTEA 4O2BB 1CJCA 4JS0A 3ZGLA 4P36A 1WQ4A 1IVSA 2FN7A 2JFNA 4PC1A 2Z1DA 4D4MA 1KJZA 4AO8A 2IHNA 1GUYA 4JVLA 4OGLA 1E6CA 3NC4A 2PX5A 1W2GA 4GM4A 4NCHA 3EW9A 3TNLA 3S1SA 1NMZA 1CNFA 1X13A 2CXQA 2PBRA 2XVXA 1L6IA 3WK9A 2OM2A 4AS2A 4RTQA 1Y89A 3HEAA 2B8EA 3ZZUA 2O7VA 5HF5A 5FI1B 1BJKA 4F4HA 2QI9F 3A6LA 1WDWB 4QBIA 3TIFA 3BSSA 1NF3A 5A06A 1KI7A 1ADCA 1GADO 1FNNA 2Q45A 1WLSA 1ZIDA 1YR9A 2KMLA 5FXMA 4MLDA 4PO3X 4TXMA 5HM6A 4OKNA 3QTLA 1FSFA 2BZSA 2EERA 5CGQB 2J3LA 3GX1A 1HLPA 3OECA 4ID3A 3UK0A 4ZRNA 4NCIA 4NG4A 4PLTA 1TVKB 3EPHA 3K5WA 5HRCA 3ZV3A 4S24A 5LQDA 1KEWA 5AJUA 1M1UA 4V2IA 3ODPA 1U2DC 1DJOA 3MAJA 1JYFA 2E87A 1Z35A 3LBNA 4M8LA 4NMWA 4YV1A 1E5QA 1I0IA 3P9XA 4RD0A 2OQVA 2R1VA 3KL2A 5ENDA 5GZ3A 3RBVA 5HKLA 4DCMA 2HEGA 1RAAA 3PT5A 4OQLA 2XMBA 4PW0A 1XQWA 1II0A 3TZBA 1OGYA 4IHJA 1P62B 5BYBA 2X3UA 1JIUA 4ZC8A 4AB1A 3T0GA 1IDN1 3H99A 2B2CA 3V8EA 3X43A 4MS4A 1B1CA 1H65A 1ZCFA 2J0EA 4EI8A 2KLHA 4XGNA 4X41A 2ZR8A 2HJ9A 1TECE 4AJJA 3KKOA 4D1YA 3PIDA 4ZQHA 2RCYA 4IGFA 3H16A 1QCZA 4ETIA 2B8NA 5IKMA 3DL2A 2E3JA 1PDVA 4G9GA 5EUCA 1AKNA 4EH1A 1BEEA 4FNMA 4KZKA 1V1RA 4P38A 1WKCA 3KUKA 4PZEA 3TO5A 2QTMA 1Z4LA 3I9LA 3E1KA 2BJHA 5DOVA 1GPWB 1FUEA 2H4XA 3ZCTA 1M33A 2XA9A 3LJKA 3PDUA 5GM2A 3K4HA 1DUSA 2G36A 3IR5A 1VMKA 2O3SA 4M1EA 4KNWA 3C3KA 4MGHA 4ZOAA 4ZKDA 5CCXA 1TRKA 4URWR 3KQOA 1NUUA 1GKYA 4GLJA 1UR5A 4CQLB 1XQ9A 4FBGA 1X7ZA 1FFCA 2R8BA 1G4AE 1SHTX 2W6NA 3QLVC 3VKVA 4A16A 4M0LA 3MMPA 2FF7A 2VPPA 1WXQA 3UJAA 1IQUA 4QASA 2XQJA 1ZJJA 3H6HA 1HDOA 2BHLA 3OIDA 3OO1A 4MUYA 4OGFA 2EWWA 4WK6A 1RZUA 3HJCA 4TL7A 4TUYF 3DYIA 1VM6A 3N1UA 5F33A 2GZDA 3TAUA 3RV3A 1JTVA 1RCTE 3U4GA 3WJ7A 4BGVA 1TKBA 5DM1A 2J3IA 1Q22A 1V45E 4JUBA 4UVDA 4WEQA 3BA1A 2O1SA 2Q50A 3IE1A 2NSLA 3GPDG 5I9NA 5AESA 2E4YA 1XDGA 3LV8A 4XX0A 1ORIA 4DDHA 3N2EA 4CM3A 1AZWA 3EBLA 1P4RA 1IN6A 1R66A 4RF3A 4XKJA 4WKOA 5DCUA 5FL7A 4DT1B 1XCGB 3LCUA 4BYMA 1FNBA 2QQ5A 4EUEA 1BVHA 3DLCA 1R0LA 1G5TA 1PQYA 1GRNA 2XIQA 3DF9A 3DMYA 3FNGA 3QK7A 4LJSA 2XSZD 4X7BA 1GLNA 4MZXA 5C80A 1P7PA 2JHCA 1E3WB 1I3KA 2YJTD 1LKZA 3WKDA 2FLVA 3I2KA 1DAPA 5T4FA 1S0UA 2PU7A 1AURA 4LK3A 3K0FA 1GARA 3EXHB 1OX4B 4L4YA 2E4WA 1EWRA 2X9GA 3S0JA 3W1EA 3RNLA 3OEED 5AVUA 5GADl 2GR9A 1N2SA 3SG0A 4B81A 4XIFA 4BE9A 2RHTA 3PNYA 4LYFA 1WNTA 4EARA 2BLLA 1P72A 1Y6JA 2V54A 3H9JA 1KI1A 4HZUB 4Z4GA 2DAPA 4IIUA 4X8HA 1KBZA 4I8XA 1A7UA 1N8NA 4I55A 1MP0A 3HKDB 5EY5B 1J0DA 2VSNA 3QH4A 1C0IA 3DAGA 4ESEA 4A0FA 3K1AB 3RVPA 1JR4A 1XAGA 3SYRA 4WI1A 3W3AA 3CPHA 2J9RA 1RMQA 1Y34E 2WTMA 2JGDA 3E9DA 4R54A 1TYBE 2WUGA 3GD7A 1EX9A 3AINA 5AM4A 4HLNA 4IDOA 1N0WA 2BFNA 3AVOA 3TD6A 3VNSA 4PHHA 2XYVA 1GA4A 4TMXA 1A77A 3Q7RA 1XAHA 2JEZA 4XASA 3ZN2A 3DLIA 1ABBA 2X5JO 1RFGE 1WSBA 2WFZA 1SU6A 4AZTA 4BE7B 1K7CA 3MB8A 5ALQA 2CD9A 4S1OA 2BBOA 2ATCA 1E6LA 4CEJB 4CNBA 2AN5A 4X94A 1XXLA 3OCUA 2OBBA 3D2BA 4LECA 3JQAA 5LYYA 1SMKA 2J3KA 3DV2A 5BSFA 4RAOA 3FMGA 3GRAA 4PG7A 3E8MA 3GWGA 4RA9B 1MNQA 3KHSA 4ZAFA 2QKYA 4UDXX 3R6WA 4B8YA 1OV4A 1U7WA 1YUMA 2AYYA 2QHXA 2RAFA 1TCBA 1HG1A 3L7MA 4GYJA 4X60A 3QI2A 1H3FA 1OBVA 3V4RA 1ZRSA 2BUAA 2RKWA 1WDLA 3Q7PA 3ZC3A 4DF3A 3PJRA 1E92A 4L8GA 3GXBA 3JRNA 3EAGA 1JTEA 5AVJA 4QAJA 4DSOA 3TEJA 3DOUA 5FULA 4QU0A 4KIGA 2XGJA 4URXR 1KC3A 2H92A 2O8CA 2R1ZA 3M6MD 4DV7B 3RVLA 2SECE 3HP1A 3HMQA 1I3MA 1HYHA 1B6TA 2FKNA 2O5EA 5G4KB 1O97C 4NE2A 4ZYWA 4XE5A 1MT3A 5H9WA 3Q98A 4EG8A 2UUPA 3U31A 1LPPA 2O07A 4NONA 3HACA 4JB0A 3T5MA 3ZZNA 5FTKA 3MJHA 1CR1A 4TKMA 1EXWA 3PICA 4D43A 4D9GA 4UBOA 1RAGA 1HFKA 5TC4A 4YRNA 1GL9B 1V5WA 2VAWA 4WT7A 2GBIA 2QTRA 2PXAA 3F2IA 3SC2B 4REQB 3V1KA 3ZXXA 4EQ6B 3BMCA 2YW9A 3S68A 1B74A 2M1XA 1BCSA 1FDUA 1LDGA 2VT6A 4TMTA 2ZE6A 2E6KA 5HYVA 3ZIDA 4C05A 4RORA 3GB9A 4U02A 4BNGA 3ELYA 1OX6A 1R5NA 3ZIAD 4FFSA 4TV8F 1IOWA 1ZRMA 2D0OB 2WJVA 2ZSEA 3BH7A 3G85A 3RTDA 1YVEI 3ABRB 4O4LB 4B75A 4DBVO 1JI3A 3JALB 5JARA 3T5DA 3D8BA 1Z4OA 1PBNA 1WCIA 2HFKA 2XYGA 1Z4QA 3CEAA 4Y2GA 3NBAA 3WLIA 1XTJA 2OAEA 1JKJB 4R3WA 1V5FA 5FWAA 3S55A 3VI3B 3FBWA 2WVHA 4D9MA 3JZDA 4QUAA 3HC7A 4FLFA 4J43A 3M83A 4H35A 4PYOA 5EL0A 5JTTA 4UTPA 3KSBC 2M32A 3D8RA 3PG5A 1NYTA 4RKWA 4X00A 5HK9A 1UKEA 2UYCA 4TVBA 3PXCX 5HVNA 2Y0BA 1K63A 1TAHA 1KQOA 3QMWA 4IGEA 3LA6A 1YE8A 1D9XA 2QW0X 1U11A 2XH8A 1CR2A 4KX3A 2G09A 3ZLBA 3ZI4A 3GFPA 2P8JA 4OHMA 1OAAA 2GNPA 3TUZC 1MJ5A 1PWXA 1QF9A 2H1HA 1A72A 1XZBA 1OJLA 1Y1RA 3DJYA 3JZMA 4LYAA 2DBQA 2BI4A 4OXQA 4QJ3A 1NN0A 1RPNA 1GDDA 4XIYA 4F4IA 2R7AA 2YZMA 1OYYA 2P6NA 3A9VA 3EC1A 3HXPA 4K9PA 1BKSB 4LRYA 5A7HA 4DWVA 4LF9B 3K2EA 3BZUA 3NTQA 4EQ6A 3ZHSA 1OXKB 2EKLA 1UC8A 2J1LA 5DLDA 1DKPA 2RGYA 4JIGA 1FSPA 2DHCA 2FGKA 3LY8A 2H2FA 1E3IA 1YKFA 2VBGA 3O1JC 3OX3A 5SZHB 3WNQA 2FWBA 4GQAA 4LTMA 3X1WA 3ZZ0A 1NBEA 5BSTA 3QP9A 3WNCA 4BB0A 3CWCA 4KHPB 1H6DA 1J8MF 1E3LA 3H4MA 4NEHB 4RDIA 4D6PA 2AH5A 2RGBA 1EP2B 1OBHA 3KJNA 3CMCO 4KFTA 3ZGVA 5K2OA 4MSUA 4RULA 3W04A 3QMMA 5A4KA 5HKAA 5GTDA 1VQ1A 4KXUA 3BG5A 4LI3X 4I1UA 2YXBA 1AO3A 2PE5A 2RBEA 5EIHA 4V0MA 1Q7EA 1UDBA 2AVDA 3CE9A 3OPMA 3DAPA 3UO8B 1D03A 4OHYA 1YTUA 4FI3F 1A8IA 3N5KA 4M9CA 5G40A 1CIPA 3EJ6A 1KF0A 3MJSA 2WPNA 5F21A 2GEBA 4FS3A 3OFJA 1FX0A 1RZ3A 5DHUA 1H69A 2BL4A 2W2MA 3ZDDA 1ZH0A 1HT3A 2BZGA 1LI5A 3GNQA 4QX6A 5JRJA 1SR8A 3AEUA 4FUQA 2CLHB 1W19A 4GNRA 3ADDA 1RRPA 4TQGA 4ARSA 4B6SA 4BFTA 1T9DA 4YBZA 2G8LA 4YP0A 4BEVA 3DKVA 3WL6A 3C5VA 1IE3A 3V6MA 1W46A 3VR2A 1M1NB 2R6AA 2JCVA 2OPBA 2VL7A 8GPBA 4QBFA 3NT4A 2PKWA 5J9FA 1I1QB 1P2DA 1LTQA 5SY6A 5FEUA 3OUUA 3DZFA 1XN4A 1E66A 2J9GA 3MW8A 4FSDA 2PUCA 4MVXA 3UQZA 4D9NA 5B4VA 1QU2A 1IY1A 3RQIA 1NQ5A 1XEAA 3JD2A 3KLOA 4Q7MB 2WUDA 3EGCA 1PFUA 4BBJA 1URPA 5KTOA 4ZOLA 3GGJA 3ZHOA 2IH2A 1GT6A 1TZCA 2HWWA 2VDOB 4RCVA 3QGMA 2IYYA 2H08A 2FEKA 4FSXA 1X9HA 2OV4A 3GGOA 1QFZA 5EXTA 5BN5B 2VSFA 5LM3A 3M1LA 1O87A 1YS4A 3G0HA 2ZXFA 3UGKA 4GEKA 3JYOA 3U17A 4PHFA 2ZI5A 1OXBB 4EG5A 1O94D 2FOIA 1L4KA 2QIPA 3NOVA 5DM70 2AQ8A 2FR8A 3IA2A 4AZWA 1LSSA 3U9TA 1ODLA 2LCFA 2O05A 3K0CA 1KO1A 1X0XA 1BRMA 5HMMA 5HUHA 2EVWX 1QRRA 3H8WA 2PS1A 2WIKA 3B2EA 2GO7A 1N8SA 3KDAA 3TCXB 3WRWA 1KMHB 3H1BA 1U6JA 1X7DA 3HYNA 4RKEA 5KTKA 3AI1A 1SKMA 1Q1GA 4TOIA 3GGCA 4EUNA 2AOTB 1P7YA 2PVSA 1XZCA 4F8YA 1SKYE 4MKXA 1KDZA 1TTPB 2R1TB 5THXA 3OMWA 3K70B 4GOOD 1SBYA 1IRIA 3DBHA 4HN4B 1K8ZB 1UBSB 2C4TA 1DZIA 3DTYA 3P8ZA 4GD3Q 3RTGA 4YCDA 2DE0X 2QJOA 5AKHA 5C5IA 1I4WA 1CUWA 3E2MA 3E5NA 5J2TF 3OLZA 5C37A 1GZSA 3LU1A 4MKRA 5B1IA 1QDEA 1JSZA 5BNWA 2Q46A 3ENKA 1W5FA 3C6KA 1THMA 4B80A 4F46A 5AXBA 5JS6A 4N82A 1ECFA 2MSKA 3TVYA 2J0UB 4BRWA 1W0JA 1UBJS 1CUUA 2ONCA 1Y3HA 3EZ2A 4LGVA 4WL0A 2X0EA 1AH2A 2FPWA 4PIPA 1PVVA 4DE5A 4K9KA 4IHKA 4FMPA 4MWCA 2AK2A 3N8NA 2G7MC 5TRTA 4PCUA 3OKFA 4DA4A 3RFCA 4AS1A 2V45A 5CU7A 5TQVA 1N5RA 1V26A 2Z8YM 1QVZA 3MPUA 3ROXA 1Z74A 2FEWB 3IV7A 2EP5A 2AR9A 3SLKA 1RHQA 2O8BB 3MERA 1H85A 4H3SA 2D7CA 5BWNA 4BKOA 5GJWC 1SO8A 1AQLA 1PK9A 2WVJA 1Z39A 3A04A 1W59A 3I1YA 5CLGA 2Q49A 3RSLA 1VTKA 2FJUA 4IIYA 5KVQA 1EFAA 3VH4A 5TARA 2V1UA 3AP1A 3BXPA 3AJDA 4FB4A 3PQDA 5I8PA 2A84A 3FHOA 2J5QA 3IBCA 4WEOA 1KKMA 2H51A 4IHQA 3HJGA 3ZE0B 2RE8A 3W4IA 5JJBA 2FRDC 4JLDA 1R8JA 1TA9A 4IDEA 2P11A 2AR7A 4X7PA 5DXJA 1S2LA 2BSXA 1W6RA 1S3GA 3BGVA 4UTVA 2F8SA 1XXHB 2NZJA 2XT9A 4F9EA 1OB2A 1DO0A 2WG2A 5K0GA 3FYUA 4NJEA 3FRJA 4BDTA 2VZLA 2QDKA 2QBYA 1Z3CA 2F3TA 5COQA 2FPIA 1H93A 4QYWA 3ZGOA 3K6JA 5HDQA 1L4EA 1ODIA 2AFIA 1F17A 2L2QA 2QX8A 2WU1A 3PYLA 3A6EA 2GFHA 5KJEA 1U9ZA 4NTZA 2J33A 3RDPA 4ESHA 1CQIA 1IC6A 1NRIA 2OP0A 2RGCA 3I2FA 3M34A 4PX5A 1XQVA 2XNJA 1SQ6A 1C3OA 3GI1A 3I04M 3G9XA 3NCTA 4TLDA 5IKEA 1U9JA 1C3EA 2V6JA 2C58A 2VWGA 2JK0A 4R81A 3VM6A 1OBFO 1QH1A 4CG1A 4EJ2A 1VHTA 1IMOA 1GNVA 3OEHA 4NNJA 4R2HA 2C2YA 3RO7A 1FJ2A 1OLSB 3LA8A 2W2KB 1EDBA 2SKCA 3LG2A 4QUJA 4AY6A 3GJXC 5KZMB 2PT5A 2VNHA 1SQ5A 3HKCA 1IDOA 3GUHA 5DHAA 1P2TA 2WJZB 2CK3D 2X5KO 1PJBA 2OO5A 1HDGO 1D5CA 4IXNA 1RVDA 3GMSA 4M1ZA 4P86A 3S8YA 2NUAB 3O38A 1FQKA 1JZSA 1U7TA 3PEVA 2RHCA 4XQ0A 2XVAA 1A3CA 1GNQA 3SSNA 1G0OA 1U9IA 3N5CA 1Y42X 3CRRA 1N3LA 2ID8A 1E4OA 2ZROA 3HJRA 1L7VC 2BZ0A 3KEOA 2FUCA 5LD2C 3OQBA 4Y9RA 4ZHSA 4CTOA 4GHWA 3PQ3A 1G21A 2CCJA 3D3NA 1JEQA 1SD2A 3EVGA 3LXXA 3PNVA 2H2IA 5FOXA 2DG2A 2M1ZA 2X42A 3VAYA 3K0SA 3L77A 2AOXA 2FMXA 5CVUA 3CINA 4MRMA 4AJKA 3FE2A 1YJCA 1WD5A 1BC5A 4J0FA 1PNQA 2PQ0A 3X2FA 4WA7A 5FJIA 4EY7A 4EYKA 4FOOA 1PUJA 2Q9AA 3KJHA 4QU9A 2LIVA 3CTPA 4AY4A 4I3FA 4F38A 1KK1A 1C3OB 2ZBFA 3I6ZA 2VSOA 3BD7A 1WTAA 3HRKA 2X8WA 2O2JA 3D43A 3TJRA 2GCOB 1VCMA 2C9YA 2ERXA 1SUFA 4B3MB 4DZTA 5IJXA 4LDNA 2I6FA 3VKHA 2I66A 1C9DB 3U0VA 1U2SA 3DYVA 3F2VA 2I2CA 4ARBA 5IMSA 2DP4E 4K6HA 5GONB 3VOTA 5J2UB 1LGYA 1WUYA 3F74A 2ZRHA 4DR6B 4I1VA 4OU4A 4PYKA 4UHKA 3FUTA 4TMWA 4L9RA 4E3ZA 4WD3A 5KU7A 1VB5A 3WO1A 1T9ZA 5AOVA 4UFNA 4MRVA 2XQKA 1G18A 3QEMA 4JLKA 4LVNA 2YNMD 2FZ5A 1VRWA 3AUTA 4RLHA 2LCQA 3QV2A 5CLQA 1XMSA 5JXWA 1DCFA 3FLAA 4ZVTA 2ZJ7A 2L0XA 2QYHA 1WP4A 4JP3A 1GN9A 1Y5RA 1KVTA 2GBFA 4HDSA 4Y6OA 4ARVA 1TM1E 4GVLA 4ECAA 5CDHA 2O8BA 5JYDA 5AT1A 1LJLA 2ZDGA 4EELA 1R4AA 4BVJA 3UK6A