4FFSA

Crystal structure of 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from helicobacter pylori with butyl-thio-dadme-immucillin-a
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
232
structure length
232
Chain Sequence
EFMQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MTA/SAH nucleosidase
publication title A Picomolar Transition State Analogue Inhibitor of MTAN as a Specific Antibiotic for Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 88
structure length 232
sequence length 232
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ffsA00
3MMSA 4DA7A 1Z5PA 1V48A 1PR5A 4TYMA 1YBFA 4R2XA 3INYA 1RFGE 1JDSA 3KUKA 1RXUA 4LNHA 1QE5A 4BMXA 4P54A 1A9TA 4G89A 3C74A 4WKOA 1PBNA 3DJFA 2OC9A 2HWUA 2AI3A 3OF3A 1A9OA 4YJKA 4NS1A 1PK9A 4YO8A 1U1FA 1Y1TA 1A9RA 4MCHA 3PHBE 1RT9A 4GMHA 1CG6A 1TD1A 1JE0A 2HRDA 3E9ZA 3OZEA 2AC7A 1PR6A 1VMKA 1YQUA 3UT6A 1Y6QA 3NBQA 1PR1A 4GLFA 3ONVA 2OXFA 4M7WA 1U1DA 1ZL2A 4RJ2A 4TS9A 5B7NA 5ETJA 1Q1GA 3GB9A 3P0EA 4EARA 3KVYA 4JWTA 1T0UA 4OY3A 4QAQA 4EB8A 1ULAA 3BGSA 3NM6B 3U40A 1ODIA 1ULBA 1Z33A 4IP0A 1A9PA 2I8AA 1T8YA 3UAYA 3O4VA 4OGLA 1RYZA 5CYGA 4D8XA 2OC4A 3NM5A 4X24A 1SD2A 4LZWA 4QFBA 1LX7A 4M3NA 2IQ5A 2A8YA 4JOSA 5B7QA 3BSFA 1NW4A 4OEHA 2AI1A 4QEZA 4GKAA 4PNPA 2PGAA 4I2VA 5FAKA 4MARA 4TXLA 4LDNA 2QTGA 2A0YA 1ZOSA 3FNQA 5F77A 1JDZA 4BN0A 1YRYE 1M73E 4K6OA 5JPCA 4WKBA 4TXMA 1WTAA 2B94A 4L5CA 4G41A 3DDOA 4LKRA 1PK7A 2A0WA 1A9QA 1C3XA 4TXJA 4DARA 4DABA 3OZDA 4BMZA 4E1VA 5K1ZA 1V41E 4M1EA 4L6IA 3KHSA 1YR3A 1JP7A 1TGYA 4L0MA 4LNAA 1OU4A 3EUEA 4YNBA 4DANA 1A9SA 3IOMA 1YQQA 3BL6A 2RJ3A 1RCTE 4TTIA 2OECA 3O6VA 3OOHA 1OVGA 4D98A 4G8JA 5CCEA 4PR3A 5EFOA 4DA6A 1NC1A 3TL6A 1V3QE 5I3CA 1ODJA 2BSXA 4F2PA 3UAXA 4TS3A 4TTJA 3FOWA 5F78A 2QTTA 3DF9A 1Z5OA 1U1CA 1T8RA 4TTAA 5CXSA 1A69A 1N3IA 3SCZA 4DA0A 2QDKA 4WKPA 5IFKA 1K27A 1T8WA 5B7GA 1Y6RA 1RXCA 4BMYA 4D9HA 1LVUA 5F7ZA 4L5YA 5CYFA 1V45E 4D8YA 3MB8A 3LA8A 1G2OA 1PW7A 1K9SA 4F3CA 1TGVA 1V4NA 5F7OA 1ECPA 4UC0A 4L5AA 3QPBA 1PR2A 4GLJA 2A0XA 2GUWA 1JE1A 3OOEA 1Z36A 1VFNA 2P4SA 2QSUA 1JPVA 3F8WA 4QARA 2HN9A 1RSZA 1VHWA 3E0QA 1PR0A 4JP5A 1Z34A 3GGSA 1PR4A 2I4TA 1CB0A 4DA8A 3FUCA 2ISCA 4F3KA 4KN5A 1RR6A 4D8VA 5DK6A 4MCIA 1Z37A 1B8NA 5F76A 5CXQA 3LBAA 4YMLA 1LV8A 3ENZA 3PNPA 2ON6A 5B7PA 4TXHA 3E9RA 1OUMA 5CCDA 3LGSA 4DAOA 5F7JA 2H8GA 3DP9A 1U1EA 3EUFA 1VHJA 4OGKA 1TCUA 1JDVA 4NY1A 1SJ9A 3UAVA 3T94A 3NM4A 3OZBA 4QATA 1OTYA 1PWYE 4QASA 4R2WA 1Z5NA 3K8QA 3BJEA 1V2HE 1OTXA 3KVRA 4TXNA 5EUBA 4OF4A 3IEXA 3ODGA 5C80A 1T8SA 3FB1A 4WKNA 5KB3A 1K3FA 3K8OE 1Z38A 2AI2A 1FXUA 1JDUA 5EPUA 1I80A 3P0FA 1PF7E 1RXYA 1SD1A 1Y1SA 1OV6A 1Y1QA 1Z39A 3D1VA 5IU6A 1SQ6A 1PKEA 3UAZA 2HSWA 3DPSA 5F73A 3FWPA 1ODKA 4DAEA 2Q7OE 3PNSA 3PHCA 4F1WA 2XRFA 3KVVA 3UAWA 1Y1RA 3FAZA 3OCCA 4FFSA 3OZCA 1NC3A 1ODLA 1JYSA 4ECEA 1TCVA 4R31A 4OJTA 3EEIA 1Z35A 4NSNA 4U2KA 4WKCA 1B8OA 2QPLA 1RXSA 1XE3A 4H1TA 5F7XA 1U1GA 1JDTA 3EMVA 4F2WA 3OPVA 3KU4A
chains in the Genus database with same CATH superfamily
1Z5PA 2EFHB 1D7OA 1Y5MA 3MK31 4FMBB 3OEHA 1P9LA 4G9EA 1D6SA 1MEEA 1PT9A 3ORSA 1SC3A 4MGKR 4NMMA 2IUFA 3FUTA 4LI0A 1QV9A 3G68A 1E9DA 1JDSA 3FTQA 4YRDA 4JEIA 1XDGA 3PVCA 4BMXA 2FYTA 5CYPA 4OQYA 2JLQA 1L2TA 3V7FA 4CQMD 1ZIPA 2GVZC 2TRSB 2FFRA 2FFJA 1GNQA 1SXJB 3SEAA 1C7ZA 2Y1WA 3DAYA 4AY3A 4YRIA 3Q11A 3LRXA 3UK2A 2EF0A 4MO2A 3TMYA 2FSSA 2GPWA 3DJFA 3O3NB 1I7NA 4DR6B 1LJLA 5YASA 4ENPA 4ND6A 1FQWA 5BSTA 4H35A 1NUUA 3EZNA 4YAOA 4AUNA 3TW8A 1K4YA 4A36A 4AKIA 4MZDA 1M67A 1VPEA 4BUCA 1M76A 1BNCA 2CL6X 1O95D 4GXTA 2C96A 2HQBA 2UUBB 4KHPB 1W52X 1UT5A 3ZUPA 4A4DA 2O7RA 3DZIA 1MP0A 4KX5A 5IS2A 3OIVA 2QJFA 2HRDA 2X9QA 2RH4A 2YBDA 3O73A 4LJKA 3RFFA 3W2EA 2EZ9A 1W73A 2X6QA 2C3OA 3O0DA 4OGWA 1D6NA 3HJHA 3U4IA 1C4OA 3E1GA 1MQAA 5KNBD 1VMKA 2YZ7A 1IB0A 1P39A 4C4OA 4ZQBA 5LN1A 3WLTA 1QH1A 3VDRA 5KYYA 4PLZA 1NF3A 1PEKE 1XQVA 2IHBA 4RK1A 4RADA 5AKLA 3VR4A 1PR1A 1DPFA 1U7UA 3PFCA 5EIEA 8ATCA 2E87A 5IX8A 1LFDB 1U1DA 5JY1A 3RRNA 1RQ2A 5JCJD 1WY5A 2VSYA 2WJYA 1ZL2A 3B3JA 1G7RA 3G89A 4BNYA 1TLFA 1GKLA 5DCLA 4HAWA 3LZCA 4GVLA 1IJKA 3PE6A 4NRDA 4QIHA 2G8NA 1XKXA 4RZHA 3BIFA 5LQJA 1KYIA 2MJLA 2ONKA 5PNTA 3LFHA 5SZHB 3UF0A 2YYZA 3LECA 1M6YA 1QGYA 1CB7A 1E1LA 2C1XA 3M3PA 5BSRA 3GEIA 1IWBB 3G0DA 2NVBA 4PXYA 1F8FA 4UUBA 4KH1A 3G0GA 1RZUA 5LQNA 1RRVA 2B78A 1ML4A 4H08A 5DOVA 5HRCA 4QAQA 3HU1A 1CPYA 3FI9A 3DMTA 1T0HB 3RUDA 4D6YA 1HDYA 2GKGA 2C3PA 4TLBA 3GMIA 1SHJA 1H4QA 4HEA6 4MDYA 1ULBA 2ATXA 1A1SA 3N2KA 2PTGA 1CR2A 1NA5A 1UP4A 1U3DA 4W5JA 5JECA 2DWUA 3FKSD 1V8ZA 3GRAA 3EXHC 3CVOA 3NAZA 1LVHA 2QM0A 3TX2A 4ZD6A 2P2LA 5DDIP 2ZPUA 1WV0A 3MMPA 4IHKA 2RHLA 1H6BA 5I6DA 3LBIA 4KVAA 3DPUA 4PYOA 3ZWOA 1KKUA 3AJ9A 4YK7A 4GQBA 4OQNA 3RROA 5AOVA 1R5NA 4M0CA 2AL7A 5TRTA 4O2LA 4TV9B 4MCJA 2FU5C 2H1LA 4RU1A 5ALYA 3TPCA 5L3QB 3S8EA 4KE7A 5H68A 5CH3A 4IIJF 4HJRA 1XC7A 1XFAA 4M3NA 1TKRA 5A9TA 5I7AA 2IYXA 1X3LA 1G5RA 2LNDA 3ZWPA 3DV9A 2O8FB 4JQSA 5JQGB 1XRSB 1DRKA 2D0DA 1FMJA 2I4NA 4KVZA 1NJ6A 1I2BA 4FMDB 1GKIA 3WQRA 2BELA 2BFBB 2CD9A 4OX9B 4YHBA 2PU7A 4HNQA 2QG4A 2HA6A 2EBWA 2I6QA 5JXIA 3P32A 1CEYA 4M1SA 2FQWA 4YWHA 3X1KA 4R84A 1ZJ4A 4K46A 3UJCA 4EITA 2XGGA 3GARA 4FOOA 3OM8A 3FPHA 4LYJA 4B4DA 1GGJA 3Q5EA 1RJGA 3KEGA 3WI7A 2Y2VA 2AWNA 3SE0A 2EYUA 5AI5A 3VTAA 2EF1A 2A30A 1YSCA 2G4VA 2YYSA 3L1HA 1U9IA 3T7EA 2CNBA 4OXRA 3CZ5A 3S70A 4ETMA 2YN2A 1DLJA 5KYTA 5LPNA 5F98A 3NJ4A 5FOUA 5BSUA 5JFTA 1UBNA 1KAGA 1JRLA 2FZKA 2NTYC 3Q8WA 4HYQA 4D4GA 4I4IA 3QXSA 4DF3A 3O8QB 4DM3A 4FU0A 4G2NA 3BE4A 1DEOA 1LVGA 1VM6A 3Q10A 4GMFA 2AG5A 1OH8A 3D8HA 4LJ4A 3GH1A 1F2TB 1DOZA 3VSCA 4JP8A 4JBIA 2GTIA 1V8FA 5LBUA 4BLQA 1O4WA 3INNA 1XTIA 4PC1A 1XPJA 2TMGA 1T4GA 4HYYA 2WMYA 3FR7A 1VBKA 5A9RA 2B21A 5ADUS 3PKIA 3ZIAD 2VT2A 4KNYA 4LRQA 2L2QA 1NIJA 5I9MA 4XLLA 5EJFA 4ZZ1A 1IBKB 5G41A 4TKZA 3OOSA 2W2KA 1JP7A 1KOLA 2JFWA 2H9AA 4L0MA 5A3QA 4DMFA 1TF5A 5JZ9A 1I6MA 5GONB 1NN1A 3EH2A 4V03A 4DEVA 1OX4B 1Y3IA 5MN5A 4FGJA 2PLAA 4HQLA 4O4HB 5FTLA 4M8NE 2CV1A 4F92B 4DEXA 1ZU4A 3RBVA 4EVRA 4DC0A 2I91A 2ZQZA 4R0NA 1FVHA 5EIBD 4QGHA 4P4TA 5IJ0B 2NM0A 3U16A 1RCTE 3KLMX 3ZCQA 1M2OA 1N2JA 3LVBA 4TTIA 5CGQB 2VWPA 1N36B 4JP2A 3HYTA 4MYSA 1D03A 1Z6TA 1Y5LA 1NW3A 4J6FA 4R2HA 4CCWA 4YJHB 4DZZA 5IKXA 4U7WA 1B0AA 1NURA 1E1KA 2FPSA 1O5OA 3CUWA 2YWGA 3PE3A 5IC4A 4YP1A 3D6NB 4UTRA 2ZAYA 1OJ7A 2C2YA 4H3HB 4UPDA 4P4SB 4DMHA 2BMEA 5BVHB 4MQLA 4WINA 4RZIA 2D1QA 3V2IA 5KHLB 1L7RA 1Q0ZA 3TYXA 1UJBA 2WKWA 4UOZA 1NI3A 3CNHA 2WJHA 1Q1NA 1RBMA 3QOXA 4RX1A 4WE3A 5C1DA 4YJ3A 5T67A 1V5EA 5LA6F 1ZW6A 3QNWA 4GPEA 5A5FA 5KYVA 2PKCA 5FOSA 2NU9B 3L7YA 5A04A 3DKRA 3KJGA 1W59A 2V4UA 1HI9A 4MA5A 4CMHA 2CZQA 1SZJG 1NU8A 3KFLA 1JMKC 4MQFA 5J63A 5BYBA 4ZVOA 3WK7A 1E7QA 5K6AC 3CZAA 2AMLA 3AF5A 4WN3A 1JXMA 3R0XA 3P27A 3D6JA 2QK4A 2WFLA 1A9YA 2WTXA 3EAFA 2O2XA 5HG0A 5EZYF 4O3MA 2G6BA 1SCKA 3WRYC 3HWRA 3R40A 3ONFA 2JHGA 1FRNA 5BR1A 1LTHR 3RG8A 4LC9A 3OZRA 2PS0A 3HP4A 4MV8A 4ZO4A 2QTFA 1UP6A 4CTMA 1A7KA 5THQA 1BG6A 3FCOA 1X70A 3R7DA 2XWQA 2DTDA 3NTVA 3WQSB 3PK0A 4EUEA 3IAXA 4MQUA 1UPUA 1VC2A 1Z5VA 2GCPA 5K8TA 2BYTA 5F9HA 3AEQA 1N6PA 3DQZA 3G2LA 3MWDA 2WG0A 3RRMA 3K6SA 4TYWA 3VNBA 1Y8ZA 3CM0A 3UHJA 3K92A 1C4WA 1LS1A 2Q28A 5TMDA 1FNBA 2O14A 3JZDA 4FYPA 4QQ8A 1PR2A 2J5RA 3GA5A 3FWNA 4LPKA 3G9ZA 1MEOA 1QYRA 2PZAA 2IEYA 2I6SA 2I54A 4A6DA 5JFGA 3S2UA 1LX6A 2W6IA 4DM7A 1V1RA 4OLBA 2V9CA 4AJIA 4TGLA 1G20A 1AE1A 4UQLA 1RJFA 1RM5A 4UM7A 821PA 2QF7A 2JLZA 4LRYA 2PRZA 2JFHA 3TFQA 4IQ4A 1JPVA 4I6JA 4ZCLA 1MAWA 4HUQA 4AZ0B 4AU1A 4EY4A 3TR5A 3C3XA 1W96A 4CQMA 5JSHA 4JDPA 3VHQA 1XZEA 1Z16A 1PZNA 3KEQA 3FNBA 3L0CA 3OZXA 3RRFA 2ZP1A 2ZYVX 1N4DA 4D80A 4GPZA 5K4HA 1CUWA 4MGEA 1PWEA 1RLUA 4JJ6A 3T9AA 3ZC3A 1ZHFA 2DQ4A 5B1EA 3AYXB 4XM0A 2CNLA 3RSGA 5D86A 2IOFK 2VKQA 3BPSA 3OPXA 4JU9A 3QXXA 1KWKA 2WWHA 4A1FA 3R9XB 3KJEA 4B9EA 1O95A 5DM0A 3MPUA 3W8DA 5FDFA 1GTMA 2P6OA 1QHYA 4LC1A 3TLJA 4K0KB 4KLCA 2FZ5A 1RHKA 3VHRA 5A2QA 2GFHA 1N9GA 2D5IA 4ARSA 1YNOA 4YTEA 4WESB 2ARKA 2CHUA 2VXBA 5F76A 2V97A 3DOIA 3DLCA 1YV9A 1O0CA 121PA 1P7PA 1GFZA 2WFZA 2XNJA 3BJRA 3WYFA 1W8DA 3O2JA 1R6BX 5A5EA 1NN0A 3IPAA 4G67A 2TS1A 3EC1A 1J70A 4QXPA 5ILQA 4DCOA 4YFYA 5DNDA 1W88B 3ZGVA 4UUOA 4L9RA 3NCTA 4W1RA 5HFNA 3STYA 4KFSA 4IQGA 4PF1A 4C6RA 4WY2A 3SF0A 3AVWA 1J21A 1NQWA 4XFKA 2C04A 3BWMA 3OI7A 1OJLA 1V5WA 3NWEA 2WF5A 2ZYRA 3OKCA 1LA2A 3SR3A 4TYNA 2ZJYA 2ZIEA 3B9RA 3FDZB 4D9BA 3B85A 3THXA 2PU5A 2Y9MB 1B76A 1J0DA 2FMIA 1GZHB 5AKEA 1Y33E 1JLRA 5FB3A 1V16A 2YQZA 4RORA 2MSLA 2JLWA 2IYPA 1TCUA 4G5GA 2PS1A 1EUZA 3JAKB 2N75A 2C5FA 1PL8A 1SJ9A 3EIFA 1PVVA 2PMCA 2W93A 4NZOA 1DIAA 3T94A 1V8OA 3EEBA 4V0KA 2FX2A 1CR0A 1VMEA 4HL6A 1T9DA 2JJQA 1F0KA 3LXUX 2PGDA 3NC4A 4E12A 4EB3A 2ZRIA 1RHJA 4BE4A 1ENYA 2CNOA 5KTMA 1U8AA 5EEGA 3HR4A 3JS5A 2IF2A 1OI4A 1WMDA 2QRPA 2GARA 4OBWA 1PI3A 3PTLA 2YRXA 3D5EA 5MDHA 4CEIB 1A71A 1TUIA 3WGLA 2EW8A 2J32A 3QVGB 5KAMA 3VU3A 4NCNA 3V55A 5BT8A 4IV8A 5EE9A 1I9GA 4O2AF 3WK8A 2K2WA 3EXG1 3CLRD 1CYEA 4V02A 1EFKA 1QFYA 3ROXA 3BCUA 3GPIA 3K9QO 1DJNA 2Q99A 2HPAA 3GRKA 1NXVA 3MCZA 4BUJA 1K92A 3U7JA 5DHQA 2I2DA 4Y2GA 4MS3A 1ISPA 5T8KA 1LF0A 1VGVA 3CF2A 3CNBA 3GAMA 3Q9LA 4IKOA 2PSHA 3BA1A 3H4TA 4WKNA 4X7MA 2UZIR 3H4VA 5NULA 1LRJA 1QC5A 1K3FA 2HHJA 4EH1A 4O1MA 5IDQA 2QR2A 1A7JA 1E0SA 1U7TA 1GDTA 3DLHA 1RWMA 4U2BA 1ZJ5A 1A2OA 1N2EA 4IW3B 4WH0A 3U5TA 4CCSA 1RYNA 3O8CA 5FX2A 3KPJA 2D5AA 2JASA 5A6SB 2WRZA 1Z0AA 3QBEA 2PUBA 3IEKA 3PR1A 3LPAA 1JHXA 1E63A 2DHEA 2HA0A 2E37A 4EHJA 1X0VA 2NV6A 1ISSA 1DO8A 4LBYA 1Q84A 3VDMA 2X6TA 3BRWD 3BXFA 3H5VA 4DV6B 3A2KA 4AS1A 5AIBA 3M8KA 1QH8A 1JJBA 4LSGA 3UAZA 3PQ2A 1BHO1 5KOJA 2AR7A 3DE1X 4LG1A 3PFWO 4TRRA 1YDEA 2AOVA 5A0TA 2RKBA 1IAVA 1R16A 5D5QA 3TIGA 4I9HA 3UG6A 4BP1A 3AFIA 4XYMA 1MB2A 3UJ7A 3WDMA 3ZZNA 3I3OA 1IIRA 2TSYB 4XD7A 4ZVRA 2EJTA 3D4BA 3HEMA 3ID6C 4XCQA 1U2DC 4MRAA 5CLGA 1Z8NA 3CLUC 2FUNB 2V5VA 1ZVMA 4BVKA 1PWZA 1JEQA 3RB8A 5K0LA 4LBWA 2F1OA 2RB4A 3LDAA 1FCJA 5IMBA 1CFZA 4TMTA 4UHEA 1U65A 4BMOB 4HXEB 1AGXA 4E5DA 3ESZA 3PV0A 5ERGB 4MRRA 1JKJB 3RABA 3H9EO 2CL7X 1QZTA 1H2XA 1TADA 1X7XB 1OU0A 4Y6QA 2RAPA 1X94A 1TJPB 1XLUA 3UUGA 1DQNA 1VGRA 3WADA 4LECA 4Q9AA 4ZYXA 3KWMA 4ZPXA 2FK8A 4I55F 1CRZA 2OCIA 1REQA 4DXHA 1L3IA 4U2KA 5JZMA 2V65A 4W9NC 4OX9Y 2QRGA 4HMQA 4DYHA 2XB9A 2QL9A 2PGNA 1XAGA 3Q7PA 2TMDA 1R5JA 3HRKA 4BN5A 3HCCA 1KK0A 1VL8A 4V0RA 5DBOA 1ZRHA 3SKYA 3ME5A 4HQRA 3EGOA 4TS1A 4LGMA 3IQFA 4LZZA 1MTZA 1KOFA 5AYVA 3PQ5A 1E58A 2CMKA 4MVJA 3HSYA 4XJVA 1M6VA 1S1CA 2GXSA 1EWRA 4EGSA 3GLHE 3SJ7A 1E6UA 1Z68A 2EATA 3V3TA 3FHCB 3OKPA 4UNIA 5AVJA 3V6LA 4Y6SA 5ESXA 4H7PA 1KXZA 1K88A 4LY0A 3ONEA 4LCEA 4ETNA 2IFTA 5B12A 1E1QD 5CU7A 4FMPA 3KXDA 3PEFA 4B44A 2NSJA 5E6UB 1WSDA 1XG5A 1FBTA 4IGAA 2PAFA 2ZZNA 3VHLB 3SQDA 2YMLA 4LYHA 3WGUA 4C89A 4Z4HA 3UWKA 2DB3A 3WIVA 4L8FA 1ECCA 5CBPB 3WYGA 1BS9A 4MVJM 5E1MA 3Q8LA 4YO8A 2QZPA 2ZRAA 1GSAA 1HLPA 3OZGA 4PLWA 5ABPA 3DLAA 3IP5A 2ZVPX 3O4GA 5J3JA 1C2YA 1PL6A 4G1UC 1JHRA 1IU9A 2V9PA 3OE7D 1K06A 2GHRA 2Q6LA 1SH7A 2IPOA 2QPOA 2WKSA 3HCDA 3KQMA 4PNHA 3I1FA 2YDXA 3IQGX 3V5NA 1KP2A 2O2SA 4IS3A 4PPFA 3U19A 1KS9A 4XWKA 1BOFA 1E2GA 1L4MA 4OBEA 1X3SA 3DBLA 1KE2A 2HK6A 1MAUA 2V6MA 1EFVA 1X14A 4J16C 5KX5A 3AP1A 3MUNA 5KS2A 2PD3A 1YQUA 1ZNXA 5DIFA 2QUKA 5IDVA 4EYGA 1YCGA 2XCTB 2G1PA 1HYGA 2YV3A 1A2KC 3I9OA 5E0OA 5JVDF 2UZ0A 1FDVA 4CBVA 2ATCA 2FPPA 4IO1A 4P4LA 4QRIA 3O95A 3CY6A 1ADFA 3DBRA 2O20A 4HPXB 4NL4H 1F6DA 4FFVA 2JBAB 1Z3CA 3I53A 1ZQ1A 3HJTA 4OHOA 3DDSA 3BZWA 3P0EA 5BN4B 4EARA 1CFJA 2JFGA 2OG2A 4G86A 2AOTA 3KV3O 1FSSA 1UANA 4Q9LA 1CUAA 3UAOA 1P0FA 1SUIA 3L92A 1SVWA 1DB3A 4NG4A 2ODNA 3VPGA 4UCXA 1WY7A 1TZBA 2DQSA 3AHDA 4X1IB 4ZGWA 5TC4A 2QQGA 1JZQA 1BX1A 1J4AA 4MJ3A 4LHSA 1RE0A 4HAZA 5EHNA 1KH1A 5GMOA 4Z9YA 3EGIA 5E4JA 3CIFA 2NX2A 1A9PA 4C7OB 2WWTA 3ES9A 1KEKA 1RHRA 1OPRA 3AW9A 5BO5A 4YDSA 1P1HA 1P7WA 2DFPA 4IOMA 4RDIA 1JXQA 1H1LB 1Q91A 4KH0A 1P0QA 1YUNA 3C5WP 4RLQA 4Z4FA 4OU5A 1ECJA 3MAGA 4A92A 2EFJA 3NPMA 5TQ2A 2UXBB 3H2KA 4Q12A 4GX5A 4IG9A 3EVFA 3PGVA 4EG3A 4PYNA 3KT0A 1P2UA 5L4LA 3WGYA 1FYEA 4KQCA 4QBTA 4XH9B 5KNLA 3UBTA 2F00A 3IQWA 4F3NA 2GASA 4IEFB 2J7PA 2ZM5A 3H11B 3QFSA 4C9BA 1VHLA 1EUDB 1RJ9A 1NFQA 2G28A 3HDTA 2OESA 2VAXA 4HMOA 4TUYA 1Q0HA 5GOTA 5JH7F 4KXXA 4L57A 3VO2A 1PUXA 2PWBA 3C3BA 1M6WA 4NH0A 2F43A 2IIBA 4C30A 2P4UA 1RADA 1RI2A 1TW3A 3F49S 1MQ9A 1C1XA 3G0CA 1UFOA 4MYCA 2IH4A 2C2KA 4GOND 4BNGA 4OFXA 4CV0A 1NX6A 4YGXB 2J9XB 3TJMA 4BFCA 5IXYA 2HEIA 4MAAA 1LWOA 1STOA 4GI3A 2EVWX 5HS6A 1SXJC 1R1DA 2F59A 3QWBA 4PZYA 4KQKA 4AULA 1WCWA 3IALA 2PX5A 2C8LA 1RLMA 2MYUA 4BDSA 3ZEIA 3IV9A 4B6PA 2EJVA 1RQNA 5K0EA 4KIWA 3RV4A 4CR6A 1P80A 1TM2A 1GVNB 4EPVA 1P3Y1 1NR1A 3JQDA 2QYOA 1QGDA 2JGRA 3NKLA 5IKMA 1EK0A 5LXTF 4X8LA 2CD7A 1D3AA 4E13A 2QL5A 4JJAA 2WSBA 5BW8A 1L7MA 2MYTA 1D0SA 1N2ZA 5LQCA 2QX7A 3U4MA 4TKUA 1T0JB 4YJGB 3AR6A 3ZHVA 2R00A 2IQIA 1YJ5A 2UVQA 4Z4QA 4F12A 2AG8A 4WZBA 1R7RA 1YCHA 5CW2A 4FZ3A 3ZJ4A 4RZSA 2H52A 3DOOA 3EXFA 1HEIA 1HQCA 1JWBB 2BFEA 1RHQA 2ST1A 3GG9A 4RXTA 2VJQA 3CV3A 2AZDA 4M1EA 1U9CA 2P27A 4C4PA 4E3WA 1L0BA 4MV7A 5ALIA 2CLOB 2WJ3A 3OZUA 3A1EA 1JIUA 2O4UX 3HMKA 4M21A 3ANYB 4C7KA 4LNAA 5H8WA 3QKUA 3FOBA 4KXWA 4Q4AB 4AJJA 5KIAA 2OXTA 4JASB 2E49A 2IX9A 3II6X 2PZLA 3NKVA 4RZ2A 4H6VA 3TI7A 5K3FA 1KIMA 2AX4A 3L1KA 4R2MA 1FS4A 3R0IA 3SDBA 2ZR8A 1UC4B 3EW9A 3RF7A 3P0JA 4BZPA 3K73O 4A8PA 2PWAA 1RWPA 3PLNA 1P4RA 1DXHA 5FUWA 1UBCA 2J4DA 5EJ5A 5EGSA 1WCIA 1JG7A 4OYHA 4P0QB 2G08A 1G6Q1 4H6PA 2VT7A 1MABA 3IHTA 3PPIA 4LTNA 4M1YA 4M1ZA 5F2NA 1KZGB 4F5YA 4DMLA 4DVJA 2OVBA 2VP6A 1AHNA 5AHOA 1LW6E 2JKVA 3C4JA 2LDBA 5CCXA 1FFEA 4LTDA 4Q00A 3KYBA 5KVSA 3P0IA 1CY8A 5EWLB 2QN7A 3EXAA 3UHOA 1RLTA 2JA2A 4AXBA 3BRWA 1P91A 3D2BA 4I1RA 4S1PA 2GXQA 4DSZA 5BMOA 2ZUSA 4WX2B 2H51A 3LO5A 2CEKA 5DNAA 2A78A 4IH1A 1FQOA 1T8RA 3R09A 4M7PA 1I1QB 4NYJQ 5GGXA 2AEJA 3U0VA 2QTAA 4UPEA 2YZNA 1JLSA 3Q1LA 1RFLA 4KLAA 3AERA 2PQ0A 5F21A 1GPLA 2I2BA 1N3IA 3JVDA 4ONEA 3ICOA 5ECWA 2EJCA 3HADA 2QDKA 5ALLA 3RC1A 1X1QA 4WKPA 5LCXA 1LDGA 2VF5X 4NULA 5LYJA 1XQ6A 4IRUB 2DWCA 2OYSA 2P90A 1SXJD 2VJKA 2GAJA 2ZJ8A 4K26A 5TS2A 5LOVF 2BMDA 4RHFA 4HTAA 3HO1A 3JQFA 3DD1A 3ETLA 1PLLA 3DXYA 2WWVD 5BOSB 2YZ2A 3IUEA 3ZWNA 5K20A 1UBEA 4GMXA 3BYZA 5AM4A 3O8BA 4MR9A 1JKFA 5GM2A 3GPDG 1JVSA 1O9HA 5TQ0B 2NT4A 3LA8A 1JHUA 3IAUA 2D59A 4PZCA 1Q0TA 3ABSB 4MICA 3ZCRA 1YKGA 3JWHA 3PRYA 1L5OA 2WD8A 3V4LA 1GPAA 1FP1D 1WB5A 2HMTA 2REBA 1PJ3A 1LBHA 4NOLA 4JB8A 2XUFA 1KSFX 3LAWA 4JA2A 2QVGA 4WL0A 4UU7A 4KR2A 4GZMA 4ZOQI 5D3MA 4M0EA 5LQDA 1W35A 3C8UA 4UBIA 4DQDA 4IMPA 1OKKA 5JRJA 3RIXA 5FIUA 2J0EA 3AVUA 1OYYA 3LVRE 4GZ6A 1NPTO 1PFGA 3CXUA 4R6XA 3T3GA 1IXKA 2G1KA 3ZDCA 2GUWA 5DBGA 3DD5A 3NC1C 4LHVA 1Y7IA 4LMBA 4MUHA 1LCIA 3VM6A 1XYGA 1PW5A 4W6QA 2R6GA 5H82A 5DVZA 4MWCA 2Q4BA 2OLKA 1GEGA 3C3PA 3PYMA 2WTNA 2A4KA 4B3IA 4MVWA 2QMUA 1YH3A 3RVQA 5HQ3A 3MBIA 1TM1E 4TZTA 1QYXA 1NPDA 3LYHA 1T2DA 1E1QA 1O7JA 4J7XA 5ALVA 3VX3A 3T7JA 1R6AA 3LHFA 1BH2A 4ZODA 3WZMA 1U3TA 2WAOA 1KI6B 2QVLA 3N8KA 1U7OA 2YN0A 3P5SA 2DCMA 3PR2B 3JD2A 3N2YA 2J46A 3DEAA 4MV0A 3SJZA 3R6GA 4G25A 2GX6A 1UPAA 3T1YB 3DHWC 3KG2A 3ABIA 4XTCS 2JGAA 5DM70 2O5RA 4BVAA 3K0KA 4NDNE 1NTRA 1S3IA 2OV6A 3I1YA 3E5NA 3V1UA 1EIWA 2IH5A 1ZD4A 3RSLA 3FUCA 3OE7A 3SBXA 2WJZB 3EVEA 3IBYA 4BFWA 4IO0A 4WOPA 3K0SA 1JR2A 2W6ZA 5DHRA 1EG2A 1KVUA 4AM8A 5DK6A 2UZ1A 4COKA 4LVCA 4AECA 1RRKA 1XAIA 2IXFA 3DDNA 3K5IA 5IAGA 5GZ3A 1SBQA 1PP4A 1CJBA 1A7UA 1ZD9A 4C4TA 2IZZA 3FUVA 4MS1A 1Z56C 3B48A 1TEXA 3CONA 3T8YA 4Z4GA 2Q1UA 4POAA 4WBXC 4J3FA 4QAJA 1UZLA 1PSZA 2JAQA 2O8DB 4C5CA 2HWKA 4FFPA 5B7PA 3ZBPA 4G9BA 1RWVA 1F9EA 2DZDA 3BCHA 2X0KA 3NFRA 4YAFA 5BQPA 3FROA 3RSZA 2W58A 2XPCA 1ESEA 3JPWA 4G97A 1VKRA 2KQUA 1U2TA 4U5QA 1W1WA 1QF9A 1QVRA 3A1FA 1Z4OA 3B38A 1H8ED 3LU1A 3ULKA 4F85A 1AB5A 4I8XA 3GLGA 2ZB8A 1JW9B 2O3QA 1IK4A 2HIHA 3LCMA 3MG9A 4ZVTA 2F1RA 5H9VA 4F6RA 2NO7A 2VOJA 1S9HA 1YHZA 4CZ2A 5LSAA 2AFRA 1D04A 4N3AA 4BVHA 4P5EA 5K8UA 1H0HA 4ZAFA 2GBLC 1RAFA 2OMEA 3D4PA 3KPUA 1WXWA 4JXKA 5DIZA 3WNVA 1ZCAA 2FWBA 4AJLA 4F04A 4FIZA 4Y0NA 3ELUA 4C4RA 1HNWB 2W0MA 2SCUB 3TLEA 4YUWA 1Q1ZA 2A1TR 3JVEA 4PRLA 3QUAA 4OGFA 3UFBA 2JHFA 4UCFA 4ZO6A 3BFPA 4FUQA 2CXOA 4R2WA 3E1SA 2IS1A 1GQYA 2AF3C 2FGJA 2XYVA 3PXGA 3AR9A 1Y42X 2FN4A 3NDRA 3PKZA 4IOLA 3PR3A 4KO3S 3R5HA 2XOKA 2YV1A 3N2GB 1TE2A 4F06A 1U90A 2PZ8A 1Y9AA 3P9QA 1C30A 2CUTA 3C98A 1P6XA 4ND4A 1BQ4A 3IEXA 3AEZA 2JIRA 2OOKA 3KQOA 4CLOB 2I6UA 3BGDA 1FTNA 1WD7A 1EFUA 3GAFA 3OA0A 2DERA 1LLUA 2WICA 1UEIA 2Q6IA 3LY8A 1M0TA 4PQEA 3V48A 4HGZA 1M2EA 2G4LA 2LZ0A 4DQKA 4X1KA 2C7VA 4NJMA 4PNZA 4YRZA 1Z07A 4OXXA 3T1HB 3DOUA 2ZZMA 1ORHA 1NRWA 3D5QA 3P9CA 3KETA 2P9QA 2E7ZA 5JSYA 3IBFA 4HSEA 2PX4A 1UMKA 5A62A 5IAKA 1XZLA 2FUG1 1OWMA 2HYDA 3G5UA 3HDGA 1VIYA 1YD7A 2VN8A 4B4KA 4REQB 2J5KA 3L6UA 4KCGA 3F67A 3GFQA 3IVMA 2ZLBA 5ALWA 4RKEA 3LCJA 3MCAA 1KU6A 2MYPA 3VX4A 4TL8A 4RLFA 4F2HA 5AVUA 1A0OA 2X3UA 1KAMA 3DZKA 3KYJB 3PWKA 1HQKA 4M1OA 4JI4B 4NMHA 4A8JA 2BUAA 1XD2A 3HM2A 3LQKA 7REQB 4GZ3A 1DG1G 2X0JA 2X5NA 1XNGA 1Z3IX 1E6EA 3MFQA 2NVUB 1RRMA 1UAGA 2C78A 2SICE 3D54D 3IVRA 4JVOA 1NVXQ 5HXAA 1ATIA 3L4BA 4FWTA 1ZNQO 1X1SA 1C9NA 1THTA 4WADA 4YR9A 4V24A 3T1VA 5I7RA 2YVQA 3S2EA 1V4BA 1ZUNB 1NJSA 4JFRA 4WJLA 1FFSA 4B2IA 2B25A 2QTBA 3L8EA 4KUEA 3QYAA 4DJAA 3WFZA 2JJMA 5HS4A 4P3KA 2OXRA 3KQWA 4PYRA 1HNZB 2YJNA 3N6XA 1J00A 2VK1A 4DLBA 2CGEA 1FNCA 4FNGA 1OGJA 4Y30A 1VSQA 3JQ7B 2PUVA 2V55B 2XBMA 3PQEA 1VIMA 2E6KA 4TKVA 2DSNA 5LMZA 2XOXA 1UM9A 4YCLA 5DLEA 4XUCA 2QX4A 2Z3WA 2ECQA 2YQ5A 2OHJA 3E9MA 3UOWA 3WRWA 4UHDA 3TTTA 2FR8C 2Q6TA 3EY4A 3HBFA 1NVVQ 1CZUA 4L9SA 2QAGA 3FTFA 4HX9A 5IMSA 2XB4A 1RC1A 2XX3A 1Y82A 1VSVA 4MS4A 5IEBA 4CF3A 4V2UA 1WSWA 2Q3HA 1LNZA 1ZCJA 5TGDA 5CLIA 2W2QA 4JVSB 1ORTA 4Q9NA 2G04A 2GSWA 3C3MA 1N2XA 4EX7A 4HVCA 2BE9A 1YOVA 4LHXA 4X6UA 1QZ3A 4B45A 4BNDA 2KW5A 3QK7A 3UJ3X 5B3KA 2MWMA 1S02A 4K28A 4LJ5A 5D2CA 4V2IA 1S4QA 2PL9A 3LS2A 4HDSB 2FVYA 3M2TA 4IDEA 1DEKA 3SJCA 3EASA 4RXMA 3KEFA 1KAHA 1QVVA 2O2EA 3FPJA 2JAPA 1I33A 3PDJA 2CXQA 3T1OA 1I2MA 3TPFA 3AHFA 3G8YA 5DCYA 3QPVA 3OEED 2WU8A 3PNVA 3R5SA 4UVGA 5EN4A 1XZKA 3AESA 2AJLI 2B8TA 3HFSA 3ZOZA 1UBSB 2AV6A 2OB1A 4JKIA 3HC7A 3IP7A 1KQPA 2CSXA 1A04A 3MRXA 4PO1A 1LBTA 2Q5JA 4KO4S 3X2SA 4AJEA 2CF6A 1EFAA 3OTHA 2FTKE 3HO8A 3RS2A 1OY1A 5CGZA 2I7TA 3QU9A 2V6BA 1SQ5A 4B6JA 4S2EA 4RNDB 4WXEA 2GCIA 2X7HA 3L1IA 3EX7C 4OTZA 1Q19A 1E1NA 2AI3A 2TMYA 4EUKA 2FSVC 3EYAA 1DBPA 1QIFA 1T1IA 2M1ZA 2UDPA 4J0GA 4XDZA 3TXXA 1ZN8A 4EQ6A 4ZYYA 4OQDA 1J8VA 3WMEA 2NSLA 4R8SA 4BECA 5IK2D 4AWBA 2BF7A 5TPWA 2X1HA 4XXHA 5CDGA 1RKVA 3IXLA 1TQHA 1XHFA 4CMCA 1EDBA 5KTPA 4MEAA 1JZTA 3E9ZA 3ADDA 3BRQA 2PO5A 2YWRA 3MERA 2NNWB 3PGLA 4LJLA 4F5WA 1NOKA 5K3EA 4TZKA 1T2EA 3VR6H 1VRWA 3G59A 2PWYA 1SIWA 1AURA 4MITA 1PJ2A 2F6RA 1ST2A 2FJPA 4TWIA 5FHQA 3V4ZA 4XA8A 2E4WA 1E1MA 4R16A 4MUKA 1J23A 1C14A 1MB3A 3WB9A 2PUGA 1M72A 4E14A 2IEIA 3C43A 2AT1A 1L8XA 4M88A 5CM9C 3QEOA 4ESVA 2DC1A 3P9IA 1C8LA 3PUWA 4H7KA 3AKDA 5CB4A 2BMVA 4R7TA 5L6MB 2ZBPA 4AMUA 1UOOA 2JJYA 3E4CA 1U9IC 2OCKA 3GB9A 3IB3A 4PPGA 4R54A 2R751 4ZU3A 2Z8XA 1S1MA 4OQZA 2AJTA 3DUWA 4WCDA 2DFKB 3ER8A 1IN4A 4FONA 4JIGA 5HJEA 3OTIA 1KR2A 4EI9A 2X15A 2QU8A 4RPLA 2R7KA 4F0JA 1Z2NX 5COQA 4Q4LA 2B69A 4D9FA 1DAOA 1YZGA 2C61A 2Q2WA 3CR3C 3EDCA 4QJIA 4ZZIA 4K81B 1V6AA 5ESDA 3G3EA 4DB2A 4DCCA 1KO1A 5C0OE 3UHAA 1EE9A 1TKAA 3ETCA 3H4IA 3I34X 4G36A 4LMPA 2DBVO 2NQ2C 3BQNB 5C8VA 1Q92A 3WL4A 1SCBA 1R4MB 1U8CB 4L4ZA 1TZJA 5JQWA 4IF4A 2YY7A 3QE9Y 2GAIA 1XXHE 1H2WA 1W2GA 2AJ8A 2FPLA 1TCBA 3UV3A 2X9NA 2ILVA 1ZH4A 2J08A 3P8ZA 3Q9SA 2R4QA 3NHMA 4WV3A 1BHJA 1CJTC 5LWQA 1O6GA 3TJRA 4ETWA 4KRYA 1J2TA 4L27A 3K3PA 4KQ1A 4Q1DA 3I12A 4E03A 3ABRB 4MKRA 1FYDA 3WSWA 2J3JA 1VL1A 5JS6A 4HWOA 1GTRA 1YOBA 2W2TA 3EEQA 3SZLA 1BXGB 3TI9A 4JKYA 4NU8X 4YFVA 5IHXA 1KEEA 1FB5A 1XD8A 1TUGA 2A8YA 2YASA 4WNIA 1PEAA 4N8EA 3DMFA 4UDNA 1EFTA 2IYEA 4A0SA 5JHGB 5JNUA 3B9PA 2OVFA 2XKJE 2EG5A 3R77A 4HRXA 1DKPA 5ALGA 2AXQA 4OFBA 4YUZA 4TV9A 3PRJA 2DG2A 3A6LA 2VSQA 2HOQA 1QCDA 3L7MA 4KWEA 2ZIXA 3PZBA 1B0PA 2O52A 3Q2KA 1RVV1 1GFSA 1XWFA 2D1FA 1K86A 2JK1A 1UKBA 2VLIA 1W2WB 3I0MA 4FFBB 1OFIA 3R3XA 4JB2A 3RK0A 3MW8A 3MWEA 1OFUX 3BF8A 1SGWA 2YHIB 2MR6A 1ESDA 2BVNA 5CFNA 1T6BY 1H8EA 4B79A 1L8QA 1OZ0A 1FFDA 3C3YA 3EZYA 1VPVA 1XHLA 3UQZA 4K6OA 4BKPA 3IELA 1CP3A 2CVQA 5IJZA 1Z88A 3RRXA 4R1MA 4B2YA 4R1PA 1DEAA 1UJMA 3JQGA 4H31A 4G1BA 1KSJA 4YH1A 1I0ZA 5BRAA 4DTIA 2JJ1D 3FGPA 5JZSA 4DLXA 1UMCA 4DHWA 1E6MA 1EA5A 4NE7A 2A0WA 4NX2A 3NXKA 4O8ZA 2O1XA 2D1SA 2GAFA 3MJCA 4IJKA 3OIYA 3FZNA 3AXSA 1EUCB 1JEDA 1KZ7B 3A26A 1IFXA 3E23A 2YIJA 3P7MA 3L04A 3TEMA 4CQLA 1IPFA 5ALQA 4HWGA 2NP7A 3NORA 2W6JD 1UADA 3AKYA 2HDWA 2P9ZA 3ELYA 3G9TA 2C4NA 1HYQA 4BFTA 5ITVA 3TTVA 1L7NA 1CJMA 3GDFA 3W6PA 1F17A 3SVLA 1M1UA 5J2UA 3QVUA 3P9NA 4NU0A 4XJSA 1I7DA 3W90A 1MX9A 4EIWA 2PGJA 5DYGA 3U9TA 3KRTA 1A4XA 4O4JB 4B3FX 3TTSA 3PSHA 1YQQA 2XADA 3GYGA 1H22A 3PUVA 1JS1X 4FCCA 2BD0A 4MA4A 3KPYA 5I7FA 1V96A 4BKUA 4MVYA 1O6BA 2JGFA 2KX7A 4JLJA 3OOHA 5D51S 3LHDA 4FNMA 4TV8B 1EJ0A 2XKBA 5BN5B 1OX4A 4BO6A 4C2AA 1IRIA 2QVXX 4MRMB 3U2QA 5JROA 1G66A 4G37A 2I6XA 3EYWA 3HY6A 3FA2A 3K9WA 2WHXA 4TTSA 5G0VA 2F1HA 5ALEA 4YMVA 3GLIE 5FULA 1YRBA 1SG0A 5FPTA 2FPKA 2KPOA 4EEZA 1ODTC 4I6GA 3BMCB 3ST7A 3MJTA 3H1FA 1ACLA 4CM4A 4BZQA 5C4IA 4FGUA 5JY6A 4NXMB 1P29A 1YR7A 3FH0A 1K7CA 2K87A 4F2PA 4UFOA 4I8DA 3RVMA 2R11A 4H7EA 5ALRA 1DAGA 4JX8A 1BU8A 1U1CA 4TV9F 5LKAA 4F3TA 1G3UA 2BCJQ 5KYGA 4BVJA 3PEVA 2ZSDA 1ZMXA 2P9EA 2ZJBA 4QBHA 3EPJA 2WWFA 5THXA 3KIPA 5JQGF 5KVAA 4KB5A 3CGWA 4D3FA 2Y1LA 5C3MA 4FMDF 3KPVA 4UZFA 3DUFA 1I24A 2VUSA 3QFTA 1SKMA 3OO1A 5B7GA 1VL2A 4IVNA 3N58A 4P0TA 2QV0A 4PZUA 3OAAA 4V1CA 3R24A 3O38A 4D9HA 4GEKA 1H85A 5B5SA 621PA 3S27A 1GL7A 4IKEA 1GXSB 1M66A 5F1KA 3P2MA 5TLSA 1F6BA 1V45E 1L7VC 1Q12A 2FPIA 1U5AA 1T6YA 3DSRA 3F5QA 3IMKA 4KLNA 4PCLA 3S5UA 4B75A 1JHQA 2PV7A 4LCJA 2NUAA 2OLJA 3EXEB 4RHCA 3G9QA 5B2FA 2CVOA 1RP1A 3DE7X 4UMDA 3U7QA 2CNWD 3SDZA 1L7PA 1KK2A 4C3ZA 1ZOOA 2NP6A 4N3BA 5AVYA 4QPCA 2VBFA 4HX2A 5CX4A 1MLDA 1NMXA 2ZUDA 1VECA 1NDQA 5I7UA 4LOJA 1D8TA 2QGNA 5L6LB 1U80A 2J9ZB 4G0MA 2WNHA 4YPFA 1AA9A 1ZISA 3PEWA 1JXOA 1BX0A 3E03A 1KIAA 2O48X 3TR6A 4B8WA 3W5JA 5TR9A 3CC8A 5LDGA 3H16A 5I45A 1DOHA 2AE1A 1R9NA 4FOTA 1KH2A 2BKLA 5I51A 5IWAB 3LQRA 1Z36A 3KD2A 1ITZA 5JSUA 4K1XA 4E08A 1Y9ZA 2OCBA 3OOJA 3R7NA 4CKBA 1IXRC 3I5MA 2GNPA 3G85A 2CLIB 2ZXFA 3ZVRA 1F38A 3LHKA 2WAXA 1OFGA 6GPBA 4E51A 2OEPA 3H0KA 3T06B 5JNVA 5FQOA 1G8PA 2X9LA 2WIFA 2EG9A 3RSCA 5GONF 4BNUA 1SOUA 4O4HF 1Y9JA 2P2NA 1CEQA 1LI5A 1Q1AA 5AMXA 5EMMA 2HCTA 3N7UA 3PHGA 1T1SA 3TEJA 2WAYA 4J0JA 5LU9A 1P72A 5A02A 1NWCA 3KZ1E 1N2CB 2EHJA 2AQHA 3DT9A 4N18A 2XE7A 4IHJB 4YY3B 4NZ9A 4EHDA 4RIHA 2RHHA 2ISCA 2PBRA 1DBWA 3JQ8B 1XZNA 3VOTA 1XKTA 3A6GA 1L7OA 3T7KA 1OLUB 1S2MA 4B7ZA 3GFFA 3HDJA 4PG4A 3HP7A 4YVFA 2GD0A 3RHZA 2ZBQA 3GJ4A 3FYSA 1Z37A 3F9RA 1IEVA 1KY5A 2D5BA 1FSGA 2Q5HA 2VYND 1IBLB 4O0MA 2X9VA 4RDHA 5JR3A 1X80A 2W2OA 3ZDQA 1CY1A 1XQ1A 1YHYA 4QPJC 5IW8A 2PFKA 2VHZA 3QM1A 4PQYA 3B1JA 1BEEA 1P0PA 3RHTA 1GAWA 1TJ3A 3GI1A 3KR1A 1FDOA 3BK7A 2FFQA 3OIGA 3SC6A 5GJVC 1FW8A 5B1HA 3ITKA 4OP1A 1TYEB 1VJ1A 1QHEA 3EDQA 5JCOA 4YUVA 2GQ0A 1JU3A 3H83A 3ECCA 3U09A 2HRCA 1YJAA 2VJCA 1BDJA 2ZRCA 4HGRA 3OT1B 2IDZA 2ECPA 4BGIA 1OC4A 3L4EA 3C16C 4CIWA 5L3RA 3FYUB 2IYFA 4CM8A 1HH4A 4LJ9A 4O4IB 4UM8B 2QEQA 4OD0A 2IS4A 3DCJA 4LOIA 1QLJA 1HTTA 3ZWVA 4BBJA 5ALPA 3CTPA 4HDQB 1GTVA 3K8YA 1KO4A 4ZQIA 3FNFA 3TNDA 3IQEA 3KEMA 3PU6A 4JUAA 4IEEA 4WBSA 2JLVA 3SZUA 1T29A 4HFRA 2QR3A 3S2IA 5EUQB 2Q0QA 4GPIB 2HSJA 3K8QA 2Q7XA 1FX0A 4RVSA 2HXYA 4DT1A 1Z63A 2A5FA 3OE5A 3MT8A 1UKAA 3IDZA 3QELA 3O82A 4BKMA 2O8NA 1NQUA 5MGNA 4TMXA 1Q7TA 4O3FA 3AHJA 5EUBA 3A2MA 3EBPA 4DLSA 4G4GA 1I30A 3FNRA 1RMYA 5ER9A 3GLHA 3ZIUA 4FYYA 5KPJA 3DFMA 3G2MA 1E7SA 1LPAB 4FHFA 5DJ5A 2PSJA 4RSGA 3CUSA 2VS1A 1TECE 3P97A 4LVOA 2DYKA 1YGYA 2WNSA 2QWXA 3S4YA 1G8JA 2GN9A 1NAIA 3OQ1A 2C4KA 4QUAA 5DASA 4BYGA 1AXEA 1SBCA 3K8OE 5IYZB 1ZAYA 4GUDA 2ZSHA 1EFRD 4OA8A 4D9KA 1R4NA 4YMIA 1CZRA 2E82A 1Z0ZA 3A4NA 2C84A 4HN9A 5JU6A 4ZDKA 3M6WA 3VUEA 4EELA 2H85A 3WMFA 5B37A 3D6TB 2Q5CA 4QTTB 3OLWA 3PFIA 4O2RA 1U3WA 3UK1A 2QM3A 1AHIA 2WYWA 3DE4X 3DFIA 3K0BA 5E4TA 1RKBA 4NEQA 3WLHA 4JOBA 4GM0A 1AQLA 1Z39A 4LFAB 2F2TA 2EP7A 4U2DA 1KGSA 4D4IA 1MNQA 2AN5A 2G1AA 2OE2A 4US1R 5F35A 3WA6A 1KDOA 1Z2OX 1VHQA 4XW2A 5DU2A 4DIMA 4Z9XA 1DC3A 3QX9A 3RYFA 1VE3A 2JJ1A 2IEBA 1JI3A 4FT4A 1EGQA 1YB7A 2Q3LA 4FXPA 3S2YA 4ZICA 4JGIA 1IVYA 1T5SA 4B8YA 2ZJ7A 4TKMA 1RLOA 2O2CA 1YQDA 5THKA 5BSKA 1VSBA 2J85A 3QFHA 3PNSA 3HZOA 4PQGA 3P0HA 3AEUB 3VI4B 4BIMA 4KTVE 3AEYA 1NDHA 4NMLA 5CG1A 1XTKA 4KQHA 5HTKA 4WZAB 3ZV5A 4LJ6A 1KI3A 3C7CB 4QODA 3FCSB 1KVRA 3SF8A 3TQIA 3WRXA 1MVOA 3E9YA 1DBQA 4I3GA 5EP1A 3FD8A 3PUJA 1DEHA 2I22A 2GZAA 5IARA 3VH1A 1EHYA 1TLTA 1BA2A 2VJOA 1A27A 1VE5A 1KEPA 4G5HA 4WK6A 1RZVA 2C9MA 3P5BA 2IZ0A 1AMUA 3DV2A 1HDXA 1U28C 1XTBA 3L0IB 4MKXA 4NONA 3AZPA 1E9EA 4ZVUA 2OAP1 5ELLA 5JXJA 3F4KA 2XCIA 2V1UA 3NDBB 2H1WA 4LZNA 2DPYA 1JYSA 1QGUB 1U81A 2XLCA 3A27A 5C4MA 1EK2A 4FBGA 2AQ8A 4JSYA 2J4CA 3DAGA 2UAGA 3KJHA 3TTXA 2Y8EA 5BMVB 5IN4A 3TCNA 1M8FA 1KNXA 1PQYA 3KFXA 3LXMA 5HE8A 4X66B 3CZ9A 2YWHA 3QBVA 4QT4A 1B8OA 4YJFA 5JMPA 3D2LA 5AM1A 3CGGA 4P5PA 4L2IA 2LVBA 4CMIB 3GJ0A 4ON9A 2PEZA 2EGGA 3C3AA 1CCWA 3JATA 1NL3A 1J0CA 4YRCA 3C39A 1E3EA 1DKMA 1EKXA 2YINC 2Z30A 4QOJA 5FWXA 5GINE 1WSAA 2HBZA 1CUVA 2LD4A 2P8JA 2BHTA 3MMSA 4N0EA 2XZDA 1VB5A 3ZD7A 3QEAZ 4RNCA 5FV7A 1V5GA 1A95A 3Q0TA 1EP3B 4Q7KA 3Q6NA 5LIRA 5FPYA 3INYA 3MUEA 1M7HA 2W6QA 3ZNQA 1CVLA 4D3SA 1A82A 3AJRA 2WU4A 5A3VA 3OTOB 2DR2A 3QF7A 1IXZA 4JS0A 4XSVA 1X1EA 1NE7A 3O31A 4TQUS 3SM3A 4W1SA 2PZBA 1Z0KA 4KWHA 3TWOA 1U7ZA 4C6HA 2G9VA 1VKZA 5JRDS 4LV6A 3HYNA 5A71A 4DR4B 1BU5A 2WHPA 1Y6ZA 2GK6A 2Y1DA 3PITA 3KSRA 4Q4JA 3SX2A 4DQ0A 1JQKA 1IVSA 1AVTA 2ZTSA 5C8ZA 1KFJB 5LD2B 4RPHA 1ZGZA 4QJ3A 3L6BA 4XYGA 4H0NA 3ZV4A 1FU4A 4FDVA 3MHPA 5ECYA 4EHBA 1B26A 2W6PA 3N53A 1W48A 1DRUA 3FUXA 8GPBA 4B3BA 3TH5A 3ZU4A 2WUDA 2G9QA 1CG6A 4Q37A 4DR3B 1PZXA 1V95A 1J22A 2QJOA 3ANMA 4YQYA 1K66A 1U7HA 3EN0A 3GU3A 1UBLS 3DV0B 4BX9A 4EUSA 4GP7A 3TRIA 6NULA 3FPKA 4FN4A 4ARZB 1UK8A 2YFKA 3D43A 1W76A 4JT9A 4PG5A 4MROA 4L5IA 4LYFA 4RSRA 1K7YA 2CWDA 3GN1A 3ORYA 3Q3JB 3AVXA 4QVGA 3UC5A 4B35A 1PYDA 2CNWA 4GLFA 4XTRA 3KKNA 3LP8A 2BMFA 5FNVA 2QMEA 4Y6LA 2YVUA 4NCJA 1TJNA 3L7KA 3V1MA 5J4VA 9ATCA 5JANA 2OBMA 3SZOA 3LQ4A 4EDFA 1FE8A 2Q3FA 2H2AA 3B7PA 3U3KA 4JI1B 1KC1A 1DC7A 5MN4A 2Q0SA 2JKZA 4PSVA 5FOTA 2GJAA 4JWTA 2SKCA 2FUCA 3A4LA 4K3UA 4UUAA 1ZESA 1M1YB 3MTQA 4F9TA 1QRTA 3O8LA 1SMKA 3VKWA 2MSWA 2R5FA 3NB0A 1N2GA 5BYKA 4RKRA 4HDRA 5EJAA 2VPXA 4FS3A 2XDWA 5BN4A 3J81A 5ITZA 3D3KA 4GKBA 2E18A 5AK0A 2PKQO 5KPDA 2JAWA 5GP1A 1F4PA 1Z33A 1RYBA 2DRIA 3IPXA 1RPZA 1SCUA 1MPXA 1XHEA 3NDIA 3E5HA 5EVJA 3K20A 3ZZMA 2EKZA 2Q50A 3W7VA 4A6EA 1Q3TA 4MB6A 1T8YA 3JZMA 2JI7A 3LIPA 4M98A 1OFUA 5CPBA 1E0KA 1XK6A 3F5FA 3V80A 5FQNA 1MW9X 3W4IA 1VQ1A 4AZ3B 1DX6A 2PAAA 3K5PA 4X97A 1SD2A 4AY5A 4EFMA 2PT7A 5BQ3A 5L8VA 1OLSB 1QYCA 4LZWA 4UUNA 4ZHQB 3T3EA 1Q0LA 4JOSA 3THWB 5B53A 4DJTA 2VYNA 2PSSA 1UWCA 4DLNA 2ZI9A 2MSKA 1XPUA 2A9QA 2NO4A 2VJPA 4BBPA 5H02A 3T5GA 1WU7A 1Q15A 1FP4B 4HAYA 3HB7A 5JS2A 4AKHA 4UZSA 1IUPA 2DUNA 2PGAA 3HUFA 5DBFA 3N7TA 3DEKA 4MVJP 5P21A 4FZJA 1EUDA 3IVGA 1FS6A 3V1YA 2B99A 2PH5A 4M6WA 4IUCS 1SA0B 2IF0A 3RKSA 2GFQA 2DAPA 4KIUA 1HE5A 1H5QA 2FDRA 5K3CA 3BGIA 3T7SA 2BGLA 2G5TA 2XQKA 5LZ9A 4Z3DA 2C3MA 5EIOA 1FC0A 2IA5A 3UWDA 1YRYE 2EGHA 4WLNA 5EA2A 3I2IA 4B81A 4P93A 1SIOA 4P7KA 4KXMA 3T34A 2BFAA 4XGNA 5BWLA 2Z2JA 4PO3X 1AKYA 1SOWA 5IBQA 1HQYE 1B1CA 1I4OA 1PTJA 3NP9A 1EVZA 1OZFA 1JLMA 3P2YA 2IYTA 4X94A 1SC9A 2CJXA 2X8LA 1DNPA 2BFDB 2Z95A 4ZQEA 1VI6A 5CB0A 4UDXX 3A6DA 1B8PA 3O92A 9LDTA 3FPSA 3MJFA 2O6HA 5EKXA 2RHMA 3RAPR 4P2GA 3NDPA 5I9BA 6CHYA 4WRRA 2QM7A 4YBRA 1FTSA 2FQ1A 2QYTA 3QI7A 4CJXA 3MUOA 3R2JA 1U1IA 2IHUA 4XWAA 4WIAA 3REFA 3LT4A 2A4MA 3ZTTA 1HV8A 1BCRA 5JJ5A 4UTVA 4JP1A 1M2VA 5AI0A 2YW9A 2XVAA 1KQNA 4FE3A 4K9MA 3IUJA 5C8XA 3OMWA 3IAM1 3S2ZA 1NMSA 3QG5A 4HCJA 1N7IA 5LB4A 1MRZA 1Z7GA 3UA3A 2O3RA 1THGA 4BPRA 3D0QA 1S4MA 2OCLA 2G40A 2GWRA 4US0R 1A9SA 2LPMA 3HJFA 3IOMA 1BW9B 1ZSVA 1T5OA 3S1LA 2HK7A 4BQFA 3DMRA 3G5MA 2AFIB 3LZ6A 2AVDA 4Y2YA 4EVSA 1M1YE 2ZTMA 5HWSA 2VHCA 2ZR7A 4RVFA 1JJIA 3E2PA 5C2JB 1I3LA 5JDIC 1EFRA 5CCEA 1KEZA 1U2GA 4L73A 1NNEA 2JVIA 3FZEA 4LVUA 2O50A 4JNCA 4OV6B 1PJSA 5FYDA 4PAQA 4GMDA 3W8NA 3ZLVA 4FKMA 3L0SA 2H11A 2HRZA 1B42A 5BT9A 3U3DA 5JISA 1MJHA 1SKAA 4RH3A 2HRRA 3WL3A 1QHHB 1T25A 1ZJ6A 2FI1A 3ED5A 3DLTA 3L6DA 5C31A 5I3CA 4D3DA 4BEVA 5HIKA 3CCFA 3ZVMA 4C7MA 1F14A 1V2GA 2EJBA 1L7BA 1BCSB 4M89A 4QBIA 3SQMA 4MWSA 4G0QA 4TS3A 1CDEA 4FQ8A 4F97A 2F67A 4U6SA 3BXXA 4Y2TA 1K1EA 5FL3A 4H1WA 3DR5A 2R97A 3UYLA 1B74A 1U2EA 4LW8A 1LSOA 2GM3A 2NTEA 1RLJA 2P2CA 1KDPA 4IXDA 4J49A 4X0EA 3UK6A 421PA 4BFZA 1H2BA 3M6UA 3Q1KA 5HFJA 3SYTA 4OM8A 1K8ZB 2R85A 3FMGA 4KNVA 3SCZA 2NZUG 4YIHA 3TFOA 2R1VA 3FYDA 4QOSA 2A5LA 1KKLA 3OJLA 5TV2A 3OCUA 1AZSC 5KVCA 2Z5VA 1K27A 2P78A 2QN2A 4MWTA 2CZCA 1LDBA 4CMAA 4QXOA 3QLJA 4KQMA 1VG9B 2V7BA 4KI7A 4JB3A 5CIWA 1DAPA 1ZNYA 2BGTA 2EAUA 4JSRA 4JU8A 4Q15A 5BNFA 4BLSA 4WN9A 4ZAVA 3RSOA 4KQGA 1NLFA 4XWTA 3JARA 1JG1A 4TM7A 2E89A 2OGSA 2NO6A 3EIQA 4JJ4A 1VXOA 1Z6PA 4IJVA 1QR6A 2X8AA 1XRQA 3AB8A 1NVGA 1AXRA 2FP4B 2ODPA 3I3SR 3OD1A 2B9EA 2QTLA 3GBSA 4RKFA 4YT5A 3ZZ0A 2BGMA 4ALIA 2R8XA 1GVHA 4AKGA 1IBMB 1GV0A 4DDKA 4DY4A 1UDAA 5DI3B 5IUJC 3TQSA 1K97A 5CBKA 4OL0A 5IKPA 5AK6A 5FKJA 2C9OA 4PQRA 4UAUA 4KR3A 1DMRA 1CE8B 1L4UA 3OFNA 2V7VA 4X91A 5B2EA 4PTLA 3N74A 3NI2A 10MHA 4KACA 1GZUA 2V0GA 3R7WA 4J43A 3D64A 2QKYA 4GBGA 3PPWA 1J8QA 1QBKC 1NNLA 2HZBA 1JE1A 4OYRA 5L3SA 1PDWA 1CZHA 2ZB4A 3A6FA 3COZA 3BXZA 5FL7D 3S3TA 5BN3A 1FYVA 3JWEA 2IC5A 4G0VA 3DNFA 3CRMA 1YFJA 4UEJA 1NVDA 5BW6B 4P7JA 2BEVB 3IT1A 2R7LA 4LRTB 4C0WA 1MQ8B 2NU6A 3KZCA 2JIDA 2VC2B 3LKVA 5BSVA 1TO2E 3CVWA 2D13A 5J5AA 1XTRA 1XZIA 4D56A 3UM9A 4QG3A 3AJDA 3MILA 3P2IA 4UFNA 5A9SB 1RWBA 4ZEWA 4NYMR 5HIIA 2MMCA 4F72A 3AFMA 5CUQA 3PX7A 1NLYA 2RBGA 2ZITA 4I46A 4GOLD 3BE6A 2OORA 2PCLA 3K9HA 4HH4A 2J0UB 7ABPA 1CNEA 3BULA 3FNEA 3WYAA 1Y63A 4EG1A 2OCDA 4AURA 2AFIE 3FF1A 5AW9A 3L0YA 5E9AA 1T4CB 1ZUHA 1K08A 3VV2A 1GNTA 1PR4A 4PXSA 4Q34A 1HNNA 1T8TA 4B71A 1XN1A 3OM9A 4G0NA 4UM9D 4JUBA 4MKIA 4DQVA 3B70A 5SY9A 4FBLA 1FUYB 4OXQA 3LC2O 4WHMA 3OD5A 5EC8A 3MIIA 4N7MA 2WI8A 4NNPA 4PU0A 5FI0B 5TGZA 4XCXA 4C5AA 1N7HA 1SAYA 1UBRS 3AY7A 1PAUA 2PJDA 5FA8A 3BSWA 2I1VB 3A1CA 4K6HA 1X1BA 2AJDA 2DVMA 2Y1GA 4P83A 3LBAA 4V0NA 1H6CA 1WHTB 1C7IA 2IBTA 3R3JA 3NBZC 4LMAA 3VV3A 3S28A 1ODCA 3ENQA 1PT5A 3QXGA 2OCGA 4GX1A 3NPAA 4R1UA 1N5KA 1J2RA 3PT9A 2G5PA 5E8JA 4FOPA 4UBMA 3U60B 3R9WA 4WAUA 4N0DA 1CJCA 1PJQA 1S96A 3EXIB 4KC0A 4K9PA 1IOWA 3QV1A 2QV7A 2VEDA 5EL0A 3TLAA 3NMUF 3JQEA 5CCDA 1MH1A 2ZSBA 1R4AA 5HKOA 1XNJA 4HLUC 1BKSB 4YR7A 2Z5GA 3SIWA 3W2FA 5I8PA 5F7JA 3U6KA 2C4MA 3AO0B 2EX0A 4X6YA 1DFGA 2BW0A 1S8NA 4QOHA 2CNDA 4V0QA 4CR8A 1H3FA 2IK8A 1W7AA 1N6HA 1OAKA 3FW1A 5J47A 4IDAA 5K0TA 5E6SB 5EHGA 1AGPA 2V7GA 4KMSA 3AQ4A 2ZE6A 3ABOB 2AYXA 5AW2A 3ABZA 3F3MA 1EM8B 1SN7A 4HXGA 3PFNA 1VPDA 4M9SA 4ZAZA 4CTNA 4IIHA 3WL8A 1JHYA 4DV2B 1QKKA 3E4DA 3KKPA 4Z49A 3GRFA 1BVUA 2B1GA 2VXYA 4Q1FA 4YB8A 6REQA 4M9CA 3TG2A 1HL7A 1HMYA 5AW6A 2ECOA 2H2WA 2P9GA 4B33A 3GELA 1ZUIA 4Y2PA 4ZVMA 1Z5ZA 2VQFB 3B5JA 4X65B 1AB6A 5GQSA 2BSAA 2C95A 5HSGA 2GZ1A 2FG6C 4FGLA 4NV1A 2H06A 2DBRA 3F0TA 2PX2A 2CV2A 1R00A 5G1PA 1XOIA 1RCUA 1E9SA 3ODGA 2BTQA 3GT3A 4G07A 5ILGA 2O3UA 2W48A 4EYSA 1ORVA 4YUYA 3HVRA 2HA5A 3W1WA 2R4TA 1WZCA 3IEVA 1UOEA 1NY5A 3W8EA 1W34A 4TMYA 1W5TA 5KB3A 4R40A 4KQ9A 5G4KB 4EYQA 3D59A 3NWJA 1LZKA 3U3MA 1H9AA 2WF9A 4Y2JA 4CLOA 1ILEA 2XRZA 1QOPB 2O1EA 4TSRA 1SU7A 2DGDA 4D0GA 2FSFA 3ZDDA 2DFDA 2P5TB 2JFOA 2YJ6A 1VJCA 3PXCX 4KMOA 3U9SA 1MOZA 1KFEB 2JW5A 2GK3A 2H5IA 3L4JA 2FUKA 2AEFA 1YDFA 5IFLA 2HSZA 2QUBA 3I5YA 4LZOA 3NH6A 3GFSA 3H97A 1YZKA 3H4MA 3QNMA 2ZRLA 3QBTA 1ONPA 4MWBA 5IF3A 4L22A 3V00A 1KZ9A 2NO5A 4OHVA 4W1PA 1IE3A 2BR3A 4JUCA 3GP5A 3LCRA 5K8IA 4B6RA 2FUG6 1D09A 1EFCA 2HDHA 4RDCA 2VPWA 1SQ6A 1YZUA 4I50A 4AP6A 4DL9A 5SY4A 2W90A 4HDNA 3L8CA 2B9VA 1M2HA 2O2ZA 4KSYA 2WB2A 2NXCA 1N1EA 1NP6A 2DHQA 4ECAA 3U4AA 2I99A 4OHRA 1KZYC 2PBZA 3OM0A 5LUBA 3ZW7A 2NNLD 4RWZA 1KEWA 1XLWA 4Y18A 1G4HA 1XEXB 3QYPA 1U2SA 1LBQA 2G76A 2XQVA 1EWKA 1DC8A 1X7ZA 2PQ2A 1DP4A 2A5JA 4C3VA 3QKTA 3UH1A 4LWOA 2D2FA 5CDFE 1OB5A 1JVBA 2HC9A 3B5EA 2A58A 3L7NA 3CKLA 3I76A 3OX2A 4FLEA 4PQFA 4QXAA 4OHBA 5A7GA 1QU3A 1XMPA 4KXQA 4HH1A 4DR1B 1VRVA 3I92A 4L02A 3DH0A 3CSUA 3HA7A 2WVAA 3OZCA 3W2TA 3HCBA 3I8SA 1IMOA 3O8NA 3A28A 2NMVA 3ZBQA 1NFRA 3GA0A 5ES3A 3AF3A 1EBFA 3JQ7A 2W22A 2Y1XA 4GR5A 4M83A 5I8ZA 4I3HA 3TQHA 1GUZA 3U0BA 4LOHA 4MJXA 3PC6A 3T61A 4L85A 5JHHB 3FYUC 2OR3A 3GF4A 4YPVA 2XWJI 5DN9A 3IUQA 1XXHA 4MI3A 2B8NA 2FPOA 1POWA 3K0AB 4TMFA 4HDKB 4P8RA 4ZTBA 5KTSA 3HB1A 3GT4A 2J3HA 1G63A 1IHOA 4ILKA 5DWVA 1UXIA 1JZSA 2XVXA 3NONA 4RSHA 5HCUA 4QULA 2OSBA 1WVGA 1UJ4A 4U9UA 3HCAA 2E0IA 3NO4A 4QPPA 1RJDA 3BWXA 1J24A 4KEAA 5DE3A 4CEHA 1EE2A 1QTRA 1QYDA 1ZGGA 1OBOA 2OD7A 3PC8C 3Q3EA 4U7TB 3U1TA 3Q8KA 4D8TA 4LJ8A 1IPHA 4WVLA 4DMUB 2D2VA 1XJCA 3L07A 4GL4A 5JC1A 2FW9A 1XZBA 5TF0A 5KUTA 2M6RA 1C2TA 4OH7A 1C7RA 4OB7A 2QLFA 3AUUA 1RYFA 4G89A 4RZXA 2CCGA 4C01A 5HYVA 3C74A 4KXFB 3IUBA 5EMHA 1PBNA 2HADA 4AJPA 3C15C 3QE0A 1FDIA 4S24A 1S2IA 4N3GA 5JW6A 4DBLE 4P86A 3PF8A 1A50B 5CLJA 3DFKA 4HNUA 4FHEA 5FUXA 2ZULA 4YJ2B 1YB4A 2E4ZA 3OHMA 3ORHA 3L82B 3QW2A 5LL6P 2XCSB 1Y37A 5CXUA 1NVEA 5DXAA 3M5CA 4MCHA 3ONNA 2OAQ1 3GRRA 4JLSA 4LZLA 3CO0S 4ER3A 1QO0D 1LPSA 1QOQB 4UTNA 5DXFA 3V2GA 1IAQA 1Y8RB 3KK0A 4TQ9A 2RG7A 3FFAA 4UHBA 3RARA 5F2OA 3KDPA 1XDWA 3R7BA 4U9HS 3T52A 2AMVA 2AC7A 3I0NA 4HAUA 4KYVA 3ZKAA 1LC0A 4YYEA 2SECE 4FILA 4IFTA 1GFWA 3CKKA 4ISBA 4N03A 3CRNA 1L5YA 2PPLA 2R62A 1KHTA 4I1OA 4EUHA 3A3OA 4OOFA 3CZ4A 1EVIA 1HT1E 5CA0B 2CFCA 1XV5A 4JT8A 1AQJA 1G3MA 2QA5A 3U5ZB 1PNTA 1MB9A 4X63A 4BYMA 2XDQB 2JGDB 4TS9A 1L5HA 4IJUA 5ETJA 3RC3A 4NU5A 4RGQA 3IUMA 2J67A 3CUKA 1RMQA 2D7CA 3BB3A 3HBAA 3SNHA 4GECA 3IB6A 4HEQA 3A1WA 4ENVA 1AS2A 2Y0DA 1U9ZA 3KALA 4TZ6A 1R6XA 1O94D 1NSYA 1IY1A 1KJYA 3KHTA 3NHPA 4RXUA 5F5NA 3ZDRA 4E7OA 4TMKA 4V3CA 1U5BB 5A3JA 2PV0A 4RKYA 5FL7A 4BVGA 2P9FA 5CLQA 2HF7A 2VTBB 3JWJA 2PBFA 2GF9A 2LP4Y 1VG1A 4OMUA 3FCCA 3OPYB 5KNCH 4ESHA 1SQSA 1GSOA 2ZUVA 2R8EA 4MQEB 3DFFA 3P96A 4KQJA 3LMKA 4HXYA 5BWCA 4S1WA 2VI5A 3NETA 1X9IA 4RETA 2O0JA 2X5XA 3VUFA 4PNEA 3ICQB 1MG5A 3KC2A 1Q0RA 2MDTA 4BLWA 2A9KA 2BJHA 2G7MC 2R25B 4MPDA 4UHJA 2HBRA 4GPTA 2OILA 2REQA 3GLIA 3GJYA 3DGEC 3HACA 2HMAA 4HWSA 1E3JA 2IHYA 1CUSA 1PG5A 4BZZA 1D0VA 1DFIA 1SC6A 3VZDA 5D1NA 3N8HA 2PX0A 3ZIDA 1TVKA 3G2OA 5CT9A 4YI5A 5CR9A 2IQ5A 3GCWA 4UATA 3WKCA 2QLLA 2FEPA 4YCAA 4ENSA 5JARA 1LQ2A 3T4PA 4B09A 2H7XA 3BSFA 4BGEA 4A73A 4R8VA 2A9RA 1QDLB 4DJFC 3P4YA 3L6EA 4URUR 1VKOA 3C3EA 2RAVA 1IK6A 4F46A 1BXGA 3BMQB 1SUFA 3JRWA 2QMQA 2C3UA 5EJMA 5AP9A 3N2IA 2ODAA 3GIDA 2JNWA 4UVHA 3BB1A 2JBWA 4GM1A 2NXEA 2D2EA 2ZSEA 2CXHA 3A6JA 3BTUA 5HIAA 3OZVA 3PJDA 1L5QA 2PT5A 4G8BA 4D97A 2ZM6B 1AM4D 4MKGA 5F77A 3TNJA 1L1EA 4BAGA 2SHKA 1GG8A 4F21A 1FZTA 3X1WA 3UGJA 2IIVA 5K0JA 4RIGA 4MUBA 5LD2C 1R0BA 3MUFA 4MWZA 4CE6A 3NIWA 5M2QA 1ZGBA 4FFBA 2OO5A 2VDUE 1P75A 2WG2A 3NIBA 2CXRA 3LC1O 3N6RA 4J0KA 4TXMA 3C3JA 2NPIA 1TAQA 1WOMA 3E48A 4BB9A 4X7PA 5A4AA 4KGVA 3GLFB 3QFFA 3NT4A 3I0ZA 3DLPX 3KTOA 4NJEA 4MJ7A 1A5AB 2A1UA 4INAA 3ZK8A 1D9XA 5AXBA 4KFRA 5IULC 1SHLA 4H18A 3VOSA 3IRVA 3WB0A 2NAPA 1V1JA 2JC3A 2Q5EA 1SRQA 1XZQA 3I39X 1WD5A 4KJXA 4UDOA 4HI0E 1T0PA 2WPDD 1R27A 3SQXA 2GD6A 1D1PA 2PXHA 3ESYA 3LI2A 2B1IA 5AFSA 3K32A 5EI5A 3NAMA 1SQ0A 4HNGA 4X7BA 5TMBA 1CEXA 1WXFA 1TMOA 1JFLA 4ZAGA 3W2IA 3OCYA 2AIRA 2R8OA 1NVUQ 1KIFA 3E3MA 4QDXA 4CF7A 1AO0A 3K70B 3T9FA 2EW1A 1BGWA 1KI7A 1NBME 3GRCA 1CQIA 4M49A 3G9XA 4FYXA 3FRIA 4HWKA 5EQDA 2GM9A 1LBSA 2RGEA 4Q18A 3QVSA 5TF4A 2Q07A 2NTNA 3E61A 2RAUA 3NX4A 2ERCA 3ZWXA 3ML1A 4ZVLA 1ZJYA 2CCJA 5SYAA 5EP2A 3DXXA 4TRNA 3E7PA 5TX7A 4DPLA 4Y7DA 3FIJA 4LBVA 3SXJA 1E5LA 4PYJA 4LSZA 1E2LA 2JAUA 1MJNA 2VNAA 1AKEA 1Z2EA 1NC1A 4ITUA 2WE7A 1PX0A 4H16A 2PWZA 4L5BA 4WLEA 2P69A 3ZW9A 4DCSA 5C18A 1QO9A 2HQRA 2FSIA 1WW2A 4B2PA 4X20B 5AQ1A 3CLSC 4DG5A 5IPFA 3AUXA 4FSXA 3W9BA 3HCPA 1EX1A 5TPZA 1FZQA 4IXTA 3LK6A 3ZWCA 3GUVA 4EB0A 3F5MA 4N6OA 2R6R1 5JI3E 1K8RA 4KL8S 1AUXA 3M9LA 4G5YA 1AQIA 1R10A 1M0WA 2WOJA 3K9LA 3UGKA 4CM5A 3M2PA 1V6SA 4M0DA 4IR7A 5AKKA 2FRDA 1PG2A 3ZHTA 3HJUA 3WLIA 3P9XA 3NTXA 4QECA 3QWIA 1YB1A 3Q98A 3RSFA 4JFAA 3IJPA 3L7CA 4GYYA 3TW0A 2E4AA 3IR5A 4PYKA 5TEVA 1Y7LA 1CLEA 1EGMB 3NAQA 5IM4F 3TIXB 1PIWA 1MBZA 1YJCA 3QZUA 3FNGA 4MPJA 3GGOA 3VH4A 3VPFA 3VZPA 3UXMA 3AR8A 3OH8A 4H60A 3FMOB 3D7KA 4I4NA 4DB4A 2CV0A 3L0BA 1O8BA 3C8HA 2R1UA 1Y7HA 3KAKA 1LJUA 4FFOA 3ZDZB 4B73A 4DXDA 3GRZA 3SC3A 1NUAA 4IDQA 5A4IS 2QDXA 1E4EA 3G8DA 3LWDA 1UXJA 3W7BA 5DLPA 1NM5A 5EJ8A 3EBOA 2ZXEA 4PC2A 4Z7OB 4MLZA 2BPOA 1UOQA 1B23P 4Q1AA 2X41A 5DT2A 3ZPXA 5KTYA 1RTTA 1W1UA 4M0UA 2VHJA 2CK3D 3N8NA 4ETIA 3FN4A 3MVEA 1P3JA 3KHKA 1CY0A 1QLWA 3BXEA 5JCOC 2YWCA 5KCMA 4BWVA 4CL2A 2GD1O 1JYFA 4FSDA 4V0SA 2AG0A 4M87A 1MOSA 1EA7A 1MF7A 2XCQA 2OGZA 3PFHA 3R3HA 1ZH0A 4N12A 1JV2B 3BH6A 1VCIA 3KX2A 4F5EA 1XALA 1W5BA 5KNDH 1S3GA 3ONWA 4GFDA 1CQJA 2BEWB 3IDFA 5EGNA 2NYUA 2NO0A 2P4SA 4L3WA 3MYRA 1JPNA 2BM9A 1NIPA 2YH2A 2J33A 2ZQ5A 5MF6A 3R6WA 3SM9A 2I3GA 2HJSA 5I7HA 2J9YB 1YUBA 1N5OX 2NPOA 3UKJA 1V8DA 2ZR0A 4DGSA 1FLVA 1UBJS 2PH3A 3W1VA 1Z75A 5IHPA 2AS0A 4JP3A 4O4JF 2ZUTA 1W36C 3EH1A 3H7AA 5BWBA 1NI5A 4LJSA 1GDDA 1GPMA 2JCVA 2QMZA 2Y1KA 4JP5A 4OK3A 3SIRA 2E5WA 2AFVA 1DIGA 3JALA 3PXEA 4LDAA 1L4FA 1KMCA 2HPZA 4YAIA 4Y3UA 1T2FA 1L1FA 3ZWBA 4TV8F 1C7FA 3I4LA 4DFDA 1IHUA 1ONBA 4FKBA 3H9UA 4PZ9A 4YRSA 1PVOA 5HJ5A 1JSZA 1Z6GA 3CLSD 5FPPA 1DJPA 3CNEA 3CEHA 2YXPX 2ZVJA 5K8LA 4MUXA 1UPFA 4BCCA 4DVGA 3IO5A 2A2ZA 2EQBA 1BXRB 2YFHA 3RYHA 1U9JA 3IS3A 1N3YA 4OLJA 1ENOA 4O5OA 3WMXA 4CM6A 3CUTA 1AC5A 4W5QA 4CDRA 3K35A 2F3SA 2QXYA 1YIOA 1XTJA 5JSQA 2GERA 4R1LA 1CEEA 3CEMA 3DEIA 1GNRA 1GKUB 1RRGA 2O3JA 5CIYA 3S1AA 1RKQA 2PIAA 4MIKA 4UEWA 3E9RA 4D4MA 3AWDA 5GJBA 2X8BA 3FSRA 4QYIA 3LXRA 3VSEA 1QZZA 1L5FA 3C45A 5IZCA 2GETA 2C3YA 3HUDA 3UB2A 1T9AA 5FTNA 2H0QA 2BGKA 3L18A 1MX1A 4MA0A 2AFHB 5CAEB 4E4RA 4EUFA 4D9CA 4FB5A 1D2CA 3O26A 1G2PA 2H8GA 1Y5IA 2JRLA 1V35A 1O94A 2J87A 1U1EA 2Y99A 4KK4A 4MDEA 2BAGA 4B83A 3HE3A 1H2FA 1I3OA 4TSFD 5BNTA 1ZOPA 2GPSA 3HSSA 1BWRA 2YJ4A 4MINA 4R05A 4FHCA 4HH3C 4QEKA 5A7FA 1KEUA 1DDOA 1ZH2A 4H1VA 4AW9A 3QUTA 5C5DA 4GRIA 1PWYE 2FZGA 3EPHA 3GP8A 2FPUA 4OJKA 1YRHA 3ISVA 1DKUA 2FEKA 1RXIA 2O3SA 4KDRA 4CETA 5E2BA 1D2EA 3TRFA 1QTQA 2IP2A 3WRXC 3KOYA 2GM5A 3E3LA 2PKEA 3ZGXA 5D6OA 1GKKA 2WY2D 1EESA 4F86A 1TCAA 1MJ5A 2YV5A 2JCYA 1G21E 3RBZA 1TQDA 2GLXA 5AW5A 3EXG2 4EKGA 4OIFA 1INLA 1ZZEA 3KVRA 5E1OA 5FUQA 4E70A 3WR5A 3OPYI 3A3KA 3K6KA 3QJYA 4JZKA 4J1TA 4HLQB 2IPLA 2ODBA 4QICA 4P53A 1OXSC 4GNRA 5TT0A 3SMQA 3PJEA 4BEBA 4LQDA 1P62B 1AKVA 3HN2A 1PZEA 4H3SA 4NICA 4D5GA 5KQRA 3E70C 1C3OB 1VKJA 4D44A 3V7YA 4FPXA 3J7TA 3OZTA 2X5KO 1ZMTA 2VYQA 3ISTA 2PNJA 2P40A 2Q0HA 1PFWA 3BWCA 3DJYA 2P0EA 3I42A 4R9RA 1SKUA 3BHJA 4G0XA 5H16A 1BQEA 2IUYA 4E6EA 3E3OA 3I64A 1ZYUA 2Z6AA 5CFPA 5I9IA 3JYHA 3AVYA 1W0CA 2Q5FA 2V59A 4PR0A 5ULLA 3VR6D 1S8FA 4ITVA 4PAMA 5BRJA 2ERYA 3PPXA 2Q46A 3A70A 2W2NA 3DLBA 2EKQA 1IEWA 5DTEA 4DV7B 2O3TA 1Z4IA 5EXXA 3VPAA 3RGWS 1C8KA 2OZLA 1QU2A 5GVRA 2IY9A 1NYQA 3KKKA 4O0LA 3IP9A 4EI7A 1Y1QA 1N92A 1X1AA 4L8LA 4YT4A 5M3BA 4W9RA 4IHJF 1KSGA 4LXTA 2WSSA 4Z6KA 4NBVA 3EEOA 4L16A 4DJ5X 1XZ8A 4NHOA 1UKEA 4B85A 3MOGA 4XRGA 5AUNB 2I9PA 3IQHX 4ARUA 1WHSB 1NGSA 3HEBA 3KHUA 1I3KA 4KQEA 4M36A 4ENUA 3QVVA 2ZANA 3WGVA 1K6IA 3CPEA 2Q3MA 1QSGA 4ENRA 1Z08A 4REOA 1UK7A 1CY6A 2KMLA 2VCEA 5HA5A 1OBHA 3FLBA 2WPDA 4URWR 1BE6A 3RIHA 4F9GA 2QTVB 3NNDA 5B36A 2C0PA 5EVCA 2XMCA 2BGGA 3OCXA 4DIFA 3KVVA 4HDMA 5AW1A 4IIVA 1YR1A 3G0OA 5EJGA 3RVSA 1GNVA 1BFUA 3OQIA 2BP7B 3IP6A 3A36A 4XASA 4CG0A 2GA9A 4D8WA 3NVMB 3CG0A 2ZOSA 3DBHA 5FYQA 3VO8A 1ABFA 4CKEA 1FJXA 2HXGA 3V9PA 1NC3A 3M34A 4AXXA 4B76A 4TLDA 5EMKA 5J4KA 4BUZA 2F1KA 3ISJA 2VF7A 4FM9A 1EXDA 1NHWA 2W6MA 2GPJA 1NRJB 2GJ9A 3E35A 1WP9A 3Q6IA 4JZYA 5HGJA 4B7XA 4YV0A 2W43A 1GYQA 2I29A 3M4ZA 4O29A 2P6RA 3G2PA 2YC2C 4O4IF 3DPIA 2WM3A 1GUBA 2JRCA 2QPLA 3PGKA 1ZG3A 3B1YA 1ZPDA 4R1QA 5ESWA 1QP4A 5FI1B 2C9CA 3FHTA 1ZP6A 1E2BA 4ME6A 5FUYA 1BE0A 3KQPA 4PN7A 2FEMA 5I4BA 4ZVSA 3E7XA 5D87A 1PG0A 1HRDA 1V1MA 1XZDA 1ZC3A 3IKLA 2BKVA 3OPVA 4BTVA 3EHDA 3H1EA 5LP6A 3MTGA 5DBEX 4FBMA 1P1RA 2QTWB 4HD8A 3MSXA 5JV5A 2BLLA 2NZXA 5JDCA 1ZD5A 2IIQA 1UZNA 4Z9AA 3RSQA 4PFKA 3K5WA 1MPTA 2XXJA 1WXGA 3C7TA 2IKSA 3FVTA 2IHTA 1SWWA 1LLQA 1ATZA 1T0BA