2VQ3A

Crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
b'PKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLOREDUCTASE STEAP3
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structure of the Membrane Proximal Oxidoreductase Domain of Human Steap3, the Dominant Ferrireductase of the Erythroid Transferrin Cycle
pubmed doi rcsb
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.16.1.-:
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vq3A00
1VLLA 5G0UA 1B3BA 5A9RA 3K2EA 1L7EA 2YQ4A 1YBVA 4AJEA 4HBGA 8LDHA 3JCZA 4E2ZA 1X7GA 3WGOA 4BKQA 3T7CA 4IGEA 2BD0A 1C0PA 2VYVA 2Y0DA 3KZVA 4DRYA 2GGSA 2R00C 3OJLA 2AEFA 4OH1A 4QEDA 4QFCA 3INTA 3G1TA 3RC9A 5IZCC 1E6UA 3BTOA 3C7DB 1GUZA 1PJTA 3UXYA 2OHXA 5BQFA 2O3QA 3D3WB 4GH5A 1DRVA 1YRLA 4PLYA 5KJ1A 5ITVA 5JC8A 5JAZA 4TZKA 1Y9AA 5IDWA 4W7IA 3TZKA 3LU1A 3WLFA 3E5MA 3ZV4A 1GAEO 3GNTA 2IRWA 3DAPA 1HKUA 2JKVA 4QTZA 2E4AA 1LLUA 2WDZA 1PJBA 1D3AA 1ZK4A 4BKOA 3IQDB 1AE1A 3O38A 2WMDA 5IN4A 2UUPA 4JK3A 3UOGA 4K1LA 2OUIA 4CM3A 4DA9A 3PHIA 3PIIA 2UDPA 1PWZA 3RQSA 5AXDA 1A4UA 4OXKA 3RWBA 4BNIA 1JQBA 3PWSA 4Q3NA 5CPBA 3DR3A 1MLDA 2OP0A 3E6AA 5JPIA 4P4LA 1VL0A 4IDBA 2FR0A 1ZIDA 2B0JA 3ICCA 1UJMA 3G0OA 4HY3A 4PRKA 2O3RA 1W0CA 4YYZA 2X5JO 4CL3A 2P4QA 4R69A 3P7MA 3RROA 3N58A 4MOWA 4E31A 1FF9A 1NWCA 5EQDA 2J6IA 4NBRA 4LGVA 4RPGA 1U5CA 2DPHA 5JDIA 4AJ2A 5I7SA 3QWFA 2R2GA 3AY6A 1X13A 1Q7BA 4LVUA 1QMGA 1A9YA 1WW8A 4J0EA 5EESA 5G0WA 1PGQA 2P2SA 4K26A 3PHLA 1BSVA 3DTTA 4O59O 1D7OA 3OBBA 3C1OA 1T2FA 3L9WA 4HADA 4R9RA 4RF5A 1DPGA 3H9QA 5T67A 3HB4X 1JVSA 1KC1A 2D4AA 2Q50A 1C3VA 3CXRA 4L75A 4JQCA 2Y1EA 1P3DA 2RCYA 1PZEA 3KTDA 3R3JA 2Y0EA 2DBQA 2VHZA 3AY3A 2HCTA 4YAJA 5DP1A 3ZNNA 1BMDA 4BNMA 3TNLA 3MJVA 1PQUA 3U9LA 2PKQO 3ZWBA 3WJAA 4OYRA 1OZAA 1PQWA 3EVNA 3MOGA 5CPFA 2Z1NA 4S3MA 3QVTA 3RC2A 3WYBA 1X1EA 3IUSA 3MJCA 3E18A 4RZHA 1LX6A 2QZZA 4A26A 3G3EA 3RBXA 3CMCO 4XQEA 4TZTA 4IS3A 3QVWA 2Q2QA 4F45A 3WIDA 4LRSB 4H7PA 4IJWA 4XGNA 4R5HA 1M66A 4YJHB 3E9QA 2NTVA 4IM7A 4BMNA 2ZB8A 3EC7A 3GRKA 4CUKA 5FI5A 2ZYAA 2ZTMA 4M1QA 1IHXA 4OO3A 1HYHA 1EVIA 1XSEA 4FD3A 4ZU3A 3LC7O 3Q0EA 4IGFA 1LTHR 2GPTA 1U9JA 5JY1A 1XHLA 4YWJA 1Q0LA 3MWDB 2ZJ0A 2FP4A 1NTOA 1WP4A 2ZCVA 4YQYA 2CF6A 1T25A 2X5KO 2DT5A 2TMDA 2C07A 2HU2A 4MINA 4KDEA 3S1LA 3TFOA 4RDIA 1VM6A 3WX0A 1Y8QB 3ANMA 3I9MA 3MWEB 3S2EA 1DXYA 1V0JA 3UN1A 5HBRA 1U5AA 2P5YA 4BOYA 4R1TA 4PIVA 5I7FA 1SBYA 2C59A 4AJ4A 4ESOA 4IJVA 1NFFA 3BIOA 3DZGA 3H5NA 1SB8A 2UYYA 1Y81A 1P77A 5ILOA 4AL4A 1DFGA 2HJRA 4AJHA 1O9BA 1M67A 2VQ3A 1LDEA 3DMYA 4NJMB 3GVIA 1CF2O 4YTEA 3UGKA 3Q6IA 3EAGA 3GAZA 3UVEA 1PGJA 3VPFA 3ZH2A 2J8ZA 5AOVA 3RFXA 1WDMA 1DIRA 4GWGA 2UV8A 4EJ6A 5HWSA 2CVQA 5HA5A 2D2IA 2YHIB 3HZZA 3F4BA 3ZW9A 2AQHA 4ZGWA 4YJDA 3IL2A 1H93A 3CEAA 4BB6A 4D79A 2W8ZA 1N9GA 2LDXA 4DLLA 4C4OA 1IE3A 4GGPA 1DFIA 4L4XA 3JQBC 1KC3A 3CIFA 3F4LA 1GZ3A 3HWRA 3VZSA 4ALLA 3O9ZA 1IYZA 3GZNA 5HRUA 3JD2A 2VZ0A 3VVBA 3PQDA 1X14A 1MG5A 2XXJA 1JAXA 1MC5A 4RVGA 4E5PA 4GQAA 1ISIA 3F6YA 4PLTA 3RUDA 2EW2A 1T2EA 3FRJA 1I24A 5L7TA 2ZB3A 1N9GB 4DQVA 2VWHA 4W9NC 4OOEA 1PJCA 3QVXA 1CERA 4BNJA 3MTGA 4TWRA 5G0SA 4CMJA 2RBEA 3U4DA 1ZBQA 1GUFA 3GLQA 3VZQA 1DHRA 1VSUA 1OC2A 1QLJA 2NLOA 4MP8A 1E3SA 3WBBA 3PYXA 1DRWA 1I3KA 5B37A 3ZU2A 4R68A 4BHTA 4ALJA 4JGBA 1HTBA 5IZ4A 3KYDB 4J1NA 2WE7A 3PRJA 4BNTA 4TRRA 2H9IA 5JNLA 5TIIA 1DAOA 1LJ8A 3BTUA 4P22A 5CP8A 5G4KA 5KJ6A 1LDBA 1HYGA 1BVRA 1PWXA 1H6CA 1Y7TA 5FYDA 1GQQA 1SEPA 2DVMA 3QVSA 1LLQA 4PCVA 5FEUA 2Y1OA 4LN1A 2BLLA 4WLUA 4J9UE 2QZ9A 4Y67A 4TMFA 1U1IA 3RCBA 3C1AA 5I7EA 2FSSA 1NFRA 2PZMA 5COAA 4N5LA 1PZHA 1SO8A 2V7PA 5A03A 4ALNA 2EGGA 2VUTA 2OORA 3I5MA 3JQAA 3E1KA 4N54A 3PHGA 4CR8A 4BNWA 1FDSA 4DLAA 2HMWA 1BG6A 3ASUA 1RJWA 5JDCA 4CLHA 4BNZA 3AFNA 1VPDA 4GKVA 2F1KA 3C1TA 3SJUA 3AOEC 1U2DA 4JP3A 3UCXA 3AUSA 2UAGA 2NVBA 4D44A 4NFHA 4KOAA 1UP6A 3WG9A 3A06A 2C20A 4OKIA 1HE5A 3P2YA 1KY4A 2NUAA 2WM3A 1Z73A 3DBHA 3ZNOA 1SEVA 3ST7A 1GZ4A 1GEEA 1JKJA 5JCXA 3DBRA 3U4IA 1NP3A 3FHLA 3I4FA 3VTFA 1KEVA 2C2XA 1BDMA 1EMDA 2VRBA 3AI3A 5EPOA 4CQMD 1HLPA 1QLHA 2IZ0A 2PH5A 3GNQA 5DOVA 1CWUA 3K6JA 1GPJA 1PJ4A 2EV9A 2QX7A 2BHLA 4RPLA 2VOJA 1E7WA 1LSOA 2P4HX 3OA0A 3CUKA 4WLOA 4OOFA 1HRDA 1A5ZA 4I5DA 4CLEA 4MVJG 3EVTA 2PGDA 3MJ4A 3QVOA 1H2BA 4CMCA 4LMRA 4L4RA 1ADBA 3BTVA 4CMAA 3TRIA 4CLXA 1GFSA 2I5PO 4RJTA 2GDZA 4FCCA 1LXCA 1JW9B 4FSHA 3GFGA 5DN9A 1HZZA 4O63O 3OJFA 3JYOA 3W8DA 2QRJA 5KIAA 3OJ0A 3KRTA 3H2ZA 3DHYA 3EW7A 1XCBA 4NR0A 4YEDA 4BB5A 2C7GA 3KYCB 4FIZA 5JC1A 2AQKA 1I3MA 2DBZA 2JFHA 1E3WA 4NH4A 4E3ZA 1GCUA 1DIAA 3QA9A 1EFLA 3ROQA 3P5SA 4BQRA 4XDZA 3QWIA 3ZDFA 4PRLA 3OMLA 1KIFA 2I65A 3DL2A 3GZ4A 4CMEA 2CVZA 3KSUA 3GY0A 3LT2A 4BO2A 4RF2A 4YACA 3DHNA 4DIFA 3AY7A 4CR7A 5T6BA 5IFLA 4FC7A 2ZTVA 1XEAA 1P1KA 4DPMA 5F1OA 3FNEA 1GU7A 3JD4A 5JXWA 1WDLA 4PFJA 4EUHA 1SAYA 3LF2A 1EUDA 5L7YA 3VAZA 1V3VA 3VHRA 3WTBA 1C1XA 4FR5A 2VNSA 4HNGA 3W4JA 5JMWA 3P2OA 1GV0A 3ETGA 4GSKA 1MB4A 1W73A 2D8AA 3RAJA 3S8MA 3DTYA 3JTMA 4U0KA 4OSPA 4IXTA 4CM9A 1WMAA 3B1JA 4MVJM 2B36A 3OQBA 4R16A 3JQ7A 4BGUA 3VPXA 1D8AA 2Q99A 3BTSA 4MVJD 1N1EA 2AW5A 3ZWXA 4E4YA 3D1LA 3E9MA 3GF4A 4L76A 2WE8A 1P1HA 2PWZA 4M8SA 4AVYA 5L9AA 4YRDA 2Y68A 4MKRA 4HFRA 1TVEA 4E0BA 1MA0A 2B4RO 2GF2A 1TA4A 2AQIA 3BMNB 4FGWA 4Y6SA 2YFQA 2HK9A 4RF3A 3VH1A 5JFOA 4U7WA 3GT0A 4WECA 4YT2A 1I10A 1P33A 1E7YA 3N74A 2PR2A 2P68A 4TKMA 2QHXA 4XIJA 2AXQA 2H1SA 4GX1A 3AUTA 5DBGA 3KO8A 3RBVA 2B83A 2DQ4A 3IC5A 3I6QA 4Q3EA 1S7CA 2Q49A 4XYEA 4PN3A 3PWKA 4YB8A 1DFHA 4ZRNA 1NQ5A 5IDQA 1UAGA 3BMNA 4D46A 3A1NA 3IP1A 5TLSA 5ER6A 2GASA 4EI2A 3TF5A 2E82A 3QJ5A 4II3A 2BH9A 3A9WA 4TQGA 3S2GA 2HQ1A 2VHVA 3C3XA 1I2ZA 2O48X 1UP7A 4AJ1A 2P9GA 5H83A 4J1QA 1HDRA 2FR8A 2PH3A 3CTMA 3KYBA 4NMHA 2I67A 4UULA 2AHRA 3OHSX 1Z7BA 2JCVA 3QIVA 1ZO8A 1PL7A 3IJRA 2CDAA 3IKVA 1Q0HA 3HN7A 4QO8A 1HWYA 4MO2A 5JDIC 2DC1A 3BA1A 3UH1A 1P45A 4RQTA 3NDIA 3U0BA 2HUNA 5FI3A 3RKUA 1H0KA 3GUCA 4MVJH 1PX0A 5L53A 4L9RA 5TSDA 1DLIA 1Y8QA 2CF5A 2Q1WA 2FY8A 5EINA 2V6FA 4WKGA 4B4VA 1PJQA 3AI2A 1ARZA 3GNSA 2W4QA 5EIOA 5IJZA 1NYTA 1GUYA 1LDNA 3V1UA 1SB9A 4HV4A 1JKFA 4JX8A 4MIOA 3M1AA 1MFPA 1VSVA 3TWOA 1O89A 4K6CA 1K2WA 1ZEJA 2VN8A 4ZQFA 2VTEA 1YGYA 1RM0A 4LSWA 1TI7A 4XX0A 5KJEA 4XWYA 3UW3A 3GN1A 1YDEA 2WSBA 3I1JA 4FJ2A 4AJLA 4MVJI 4CQMB 1OBFO 4FN4A 5EL0A 5I8ZA 1XGKA 3RFTA 1RPNA 4I5EA 4I1IA 3L0DA 3W6ZA 4D41A 3WJ7A 1DBVO 2PZKA 5DBIA 3GPIA 3F5SA 4W99A 1JVBA 5ICSA 1DEHA 1XG5A 5TX7A 4OXNA 1SOVA 4J7UA 4J1TA 2CMDA 5KVSA 1GPDG 2EHDA 7ADHA 1X1TA 2IODA 2PY6A 3RFVA 9LDBA 4XRGA 4JJFA 5DCWA 4BO9A 4HFMA 5KOIA 1NXQA 1BXGB 1QYCA 3PGXA 2JL1A 1LC0A 3IIEA 5LDGA 3CH6A 1LUAA 2GZ2A 4XYBA 3H9JA 5BNFA 1ENYA 4OM8A 4Z0PA 1ZXLA 3FTNA 3I9LA 1E6EA 1U3TA 4QSMA 2OO5A 3DZHA 3I9JA 1U2GA 4UVEA 4E33A 1MG0A 1JKIA 3O8QA 1F17A 4H15A 3SC4A 4LK3A 3ZGYA 4RF4A 1PJ2A 1S6YA 2JHGA 3DO5A 1U7HA 3MEQA 4ALMA 4S1VA 3D5QA 1LLDA 2IXAA 2A94A 1ISMA 1YL6A 2VWPA 4IQ8A 2IZ1A 3NUGA 1PEDA 2DU8A 4BO4A 3SC6A 5G0TA 5TT1A 4ND3A 1EZ4A 1DJNA 1HLDA 1LC3A 1VE9A 4J3FA 1T1SA 2VUSA 3PHHA 3ZCXA 3SLGA 4XJTA 1Y1PA 1GD1O 1HZJA 4DC1A 3L6OO 2HAEA 3WQSB 3TZ6A 3C24A 2IEBA 1LDMA 3GVXA 3I9NA 3PTZA 4D45A 1NQAO 3HFSA 3JQAB 3GDOA 5JBIA 5EERA 2P91A 4J91A 5A04A 4XB1A 1UAYA 3ETDA 3HSKA 4CODB 1Y8RB 1SCUA 3TJRA 4AJIA 4CMGA 1QSGA 2PA3A 3PYMA 1MGOA 4XZ3A 2CNBA 3FPCA 5COQA 3W4KA 4FS3A 2WD8A 1WAMA 1HL3A 4NG5A 3TZCA 3QY9A 2BMAA 4N18A 3TDKA 4D3SA 4FOSA 5KVQA 3BHJA 2GSDA 4F6CA 1ZH8A 3I6IA 3GN2A 4KUGA 1TXGA 3KXDA 5A3VA 5IDXA 4RCVA 1X15A 1QYDA 4PLPA 4KDFA 4CM8B 4WLEA 1YE3A 1JTVA 3I52A 4ND1A 1QV6A 1UR5A 4XQ9A 1RYEA 3U62A 1O95A 3OH8A 3DC2A 3Q9NA 4J2HA 1J49A 4MKZA 1J5PA 5F21A 2YJZA 2NTJA 1JAYA 1EUCA 1ZK1A 4NU6A 3AWDA 1C0KA 4L73A 3V2GA 4EITA 1K5HA 4HWKA 4NHEA 3W1VA 4I9NA 1Y6JA 1FDWA 4CLDA 2EJWA 2Y99A 2B37A 4LRTB 3Q9UA 1R4MA 3E5RA 2IDZA 4XR9A 1A72A 2CDCA 5K0ZA 4RZIA 2ZYGA 4IZIA 1P0FA 3V8BA 1N1GA 2Q2WA 1KVTA 1YL7A 1GYRA 2X58A 4UUNA 1NPTO 2OFPA 2JCYA 3GMSA 5JAMA 4GLLA 3TSCA 1XU9A 2V6BA 3DAFA 3NJ8A 4KWIA 3ROPA 3JQ7B 2P9EA 4GKBA 1AXEA 1QKIA 1BTOA 1NHGA 2GN6A 4WCFC 2BF7A 1Y5RA 1YB5A 3IDSA 2PKRA 2JCXA 2GR9A 3WGTA 2EP7A 3DDNA 1E7QA 4EUFA 3KB6A 5CEJA 1DRUA 3GEGA 2J3HA 4WEOA 1N2SA 4ND4A 1NVMB 1TB4A 4IZHA 4CMIB 1DIBA 3ONEA 3JQGB 3H4VA 6ADHA 1A7KA 3FWZA 1B8UA 4E5YA 1E7RA 1IPFA 1K6IA 3D3EA 5T8KA 4ZD6A 1ZZEA 3DXFA 5U4QA 1PZGA 1NPDA 5JYEA 3DHEA 5CEEA 4JJIA 4JCOA 1KBZA 4GVLA 3IJPA 3WGGA 2DTEA 2BFOA 1X7HA 1X7DA 4XQGA 2VYNA 2DFVA 4RPKA 1F06A 4D7AA 5I7VA 2JAHA 1V6AA 5ILGA 3PDUA 4U6SA 2FMUA 4BO8A 3H9GA 1AGNA 3ASVA 1TEHA 5EN4A 3VH2A 3L4BA 2X0JA 3AUAA 3KHUA 1KYQA 4A7PA 1V3UA 2DAPA 4Z0TA 4XJSA 4NBUA 1PJSA 3WDSA 1DIGA 4EBFA 3RBZA 3TZHA 4DL9A 3BZUA 4GBJA 2QYSA 1F14A 4E30A 4PVCA 5KKAA 4YJHA 1DSSG 3ITDA 4B4WA 4DTIA 1JU9A 1QR6A 1EBUA 1ADGA 2AEMA 4QXMA 4ALKA 4NDNE 3EGOA 4HXYA 3HE3A 2DM6A 2V6GA 3FR8A 3PJGA 3SBOA 1I8TA 5JO0A 3I9OA 5ENVA 4FB5A 4ILKA 3SXPA 4DQXA 2ZTLA 2JD2A 5AQ1A 4RGBA 2WTBA 4U8GA 5CHEA 3OETA 1R66A 2VOEA 2C29D 3GG9A 2ZB4A 4IXWA 1CDOA 1UDCA 4NK4A 5BT9A 5L3ZA 3NT5A 1E3WB 4GGOA 4W7HA 5B4TA 1E1MA 3K30A 4CM4A 2VT3A 4OSOA 3WNVA 2D3TA 2HSDA 2OL4A 1JLLA 4WEQA 2H5LA 5IZCA 4TRMA 3GVHA 3V5NA 1WWKA 3WGHA 3VH3A 2VRCD 2EXXA 3Q11A 2O3TA 5G4LA 4MVJF 3VDRA 4Z6KA 3VOSA 5GZ3A 2I3AA 1SOWA 1WNTA 3QP9A 4B3JA 1YJQA 1PL8A 5T5QA 5H82A 2DFDA 4R41A 1TT5A 3PHJA 3WB9A 4AG3A 1FDUA 3GUYA 2I6TA 3H3JA 1Q7CA 2DKNA 2GNAA 1DAPA 2YHUA 3GMDA 5L51A 4IDAA 3MZ0A 4R1SA 1MUUA 1LRKA 3VKUA 1BXGA 4UEKA 4ZQGA 5ENDA 3ZWPA 1UXIA 2WYWA 5ES3A 2WJPA 2HLPA 4GX0A 2CVOA 2YV1A 3HDYA 1YOVB 3RIHA 1H6AA 4Z0HO 2ZTUA 3HQ4O 2Q4EA 3DZFA 1XKQA 2YYYA 4PLGA 3AOGA 5JCJA 3SEFA 3UAGA 2NU7A 3U3XA 1R16A 4E5MA 5IAAA 3FSRA 1OAAA 3PLRA 3ADOA 4XRRA 3RD5A 5C5IA 5CDTA 5HS4A 5B1YA 1HE4A 3ZHXA 3PK0A 4GX5A 2H63A 3P19A 3HDJA 1EFKA 4A03A 1WDKA 3TOXA 3PJEA 4A27A 5KKCA 1PGOA 4QX6A 1MXFA 1HEUA 2X9GA 3R6DA 4RPHA 5DT9A 4OQYA 1PJLA 4FFLA 1E1KA 4JIGA 3LC2O 1UXGA 3ZWAA 1ZW1A 4HFJA 3H65A 4E13A 3VC7A 3WYCA 4CPDA 4IQ0A 1YS4A 3JSAA 1YVEI 4CL8A 2JJYA 1D1SA 1YKFA 4UUMA 2RHCA 2A92A 1G0NA 3V1TC 4B79A 3JQFC 5L45A 5FF9A 4GLOA 4CMKA 3U4CA 4P8RA 2CY0A 2QRKA 1PQPA 4I08A 2GLXA 1BWSA 3PFWO 2X5OA 5CG2A 3CKYA 1YXMA 1T2AA 4BKRA 4C7KA 2QG4A 3WFJA 4FFOA 1XIVA 5L95A 3Q2IA 2HDHA 1O94A 2VHWA 5BNTA 3PVZA 1IB6A 4AJOA 4NBWA 4OXYA 5KWEA 4J9VA 2PLAA 2G5CA 3TOZA 3KV3O 1DC3A 2BFPA 1YONA 5JAIA 4PG6A 2O4CA 5AXAA 3ZU3A 1IZ9A 2ZQZA 1TT5B 1WPQA 2D5CA 4TVOA 1W4ZA 4DBVO 1ZSVA 2HMVA 3MJTA 5CDGA 3GZNB 4WNCA 4WPGA 1BW9B 4MVJE 1F8GA 3AI1A 2J5RA 2IZZA 4EJ0A 3ZW8A 4FJ1A 2O4UX 2PGJA 2RH4A 3U49A 4DLBA 2IEDA 4DUPA 1U28A 4IS2A 4BNFA 2NACA 3DBRB 4OKNA 3D0OA 1YBAA 1FJHA 1MV8A 3VKVA 2BKAA 3NDJA 1NQOA 2J3JA 5IG2A 3FCOA 3E03A 5AXCA 2ZK7A 1AHIA 2AG5A 2EKPA 2X0IA 3ICPA 1I3LA 3QRWA 1JWBB 1PR3A 4IDEA 2Q1TA 1J4AA 1DC4A 1TLTA 1WZEA 1HT0A 2TMGA 2YQ5A 2HMSA 3DWFA 3ONDA 1VKNA 4IIUA 4Y6PA 2PFGA 4NK5A 4WLFA 2QQ5A 2NQTA 3O8QB 1G1AA 1R15A 3F46A 1HDOA 4Z3KA 4CV0A 5EQFA 1ULUA 4DGSA 1U4SA 1MFZA 5TT0A 2FZEA 4PLCA 1QP8A 4BO5A 1ZVMA 1GDHA 1P1IA 2Y66A 4H3VA 4IPTA 1R37A 1VJ1A 2W2KA 1B14A 2HK8A 4B4UA 1NQTA 3OQ6A 2Q1SA 2NU6A 1VRWA 2AE2A 3AM5A 1AUPA 1UDBA 1CETA 2XOXA 4KP7A 1NX6A 1BVUA 3UUWA 5JE8A 2RIRA 4KTTE 5ICMA 1R0KA 2Y1DA 1ENOA 3A28A 1CQJA 3MJEA 4Y98A 4DXHA 9LDTA 5C7LO 2AA3A 4CM7A 3U4HA 4DMLA 5IF3A 2PZJA 1ONPA 3HN2A 4XQCA 3CZRA 5BSEA 3PLNA 4EJMA 1XQ1A 4BO7A 4B3IA 3OECA 3NGXA 3DB2A 3D4OA 4PG4A 4B7XA 4LW8A 3TL2A 1Q1NA 1T24A 4I5GA 4MJLA 3RUCA 2Y1FA 1H9AA 2J5QA 3ORFA 3WOHA 1ONOA 3JYPA 3NRCA 1XELA 4KUEA 3SVTA 2E37A 3PFFA 3RUIA 3JQ9A 3UKOA 3KETA 3BHIA 1Z75A 2DBRA 1NM5A 1NFQA 4EUEA 2P9CA 1PSDA 4MP6A 1PR9A 1KEPA 6LDHA 2GO1A 4DC0A 1DO8A 4M49A 1RM5A 4OIMA 1NAIA 2PK3A 3DAGA 3JD1A 4QFDA 3AW9A 2Y67A 2R6JA 1IOLA 1ZMTA 2VUUA 3ETEA 3PJFA 1HSOA 1ONNA 1QYWA 4XDYA 4A73A 1IPEA 2NSDA 4Y6RA 4IMPA 4R3NA 5A02A 3D64A 5TF4A 4WLVA 1EK6A 4UUOA 4XA8A 1LRLA 4XIYA 4Q3AA 4Z9FA 3QV1A 1JA9A 2FRDA 3H9UA 2QW8A 5IXYA 5KJCA 3AFMA 4GSLA 4PGFA 4B7CA 4ZQBA 2G76A 4YJFA 2DUWA 3I3OA 3VH4A 3WGZA 2PD4A 4TRJA 4B8ZA 3HNPA 2GZ1A 2FPPA 3EYWA 4QO7A 4E2YA 1VKOA 1N7GA 2BFMA 2B5VA 3IP3A 1XA0A 5JLAA 2D1YA 1GV1A 4HUJA 5I9LA 1I2CA 4UVDA 2Q46A 1ZFNA 4RDHA 4TSKA 4U6QA 4D3FA 4DYVA 1JWAB 5J23A 4DYDA 1NAHA 4FFRA 3KVOA 4IY1A 4OGWA 2G0TA 5DCUA 1QORA 4GI2A 1BW9A 4F6LA 3IKTA 4J4HA 4JNKA 3KOUA 2J3IA 1UXJA 1ZNQO 3Q3CA 2H6EA 2AEJA 3OIGA 3T4EA 4J6FA 3PPIA 3RUFA 1K89A 3H9EO 1HE3A 4FQ8A 4AJPA 1HDYA 3BMQA 4UVHA 2Y1GA 1OOEA 4CMIA 4CLOA 4UVGA 2B35A 2WYUA 1LBEA 3GGOA 3WIEA 4R01A 3CMMA 4PG8A 3NGLA 1M75A 3PEFA 4MDHA 4BNVA 1KEUA 5K9ZA 3ONFA 3K9QO 5T57A 4QT0A 4BNLA 5U1PA 2W98A 4AFNA 1R0LA 4YAKA 4LCJA 4NIMA 3CE6A 1YL5A 4CQMA 3GDGA 2NVUB 4BNKA 4YT5A 5BSFA 2O50A 2GYYA 4JROA 1O8CA 1B8PA 4PG5A 3ROMA 1N5DA 1JN0A 5C7IO 4HX5A 1B0AA 1YOVA 4BNXA 5BNIA 2NADA 1QYXA 1X0VA 7MDHA 1U7TA 2YV3A 5B12A 1LA2A 4RVFA 4IINA 4A10A 4UUPA 4YAIA 3JQ8B 4CM1A 1VL6A 4CMBA 2Q1UA 2WD7A 4UVIA 3WQQA 1E1NA 1XWFA 4Q39A 4BGEA 1LQUA 2VYND 3ANNA 3U5TA 1B2LA 1PS8A 1ZUD1 3PDJA 4IDDA 2X8LA 4DMMA 3KEQA 3LYLA 4WUVA 4EDFA 5I8WA 4W4TA 1AXGA 5MGBA 1T26A 1GZ6A 2J5KA 1CQIA 3NJ4A 1PU2A 4UAGA 4IDGA 1YQXA 1TT7A 3B20A 2B69A 3JV7A 3PWZA 4TVBA 2C0CA 2FPIA 2Z5LA 4ND5A 3ZN2A 1LU9A 4B3HA 2CUKA 2IXBA 1E7MA 3BAZA 1Y5MA 1GY8A 4RVUA 3TFQA 3L9XA 3TZQA 5A5EA 3F9IA 2EIHA 5F1PA 4OAQA 1HF3A 1BXZA 1ZSYA 2PD3A 5DF1A 3JYQA 1XU7A 4ITUA 1KETA 4CUZA 4YAGA 2BI7A 2UVDA 4FFMA 1DDOA 2RAFA 4W9NA 1LI4A 5HM8A 5COBA 4QECA 4RVSA 3RKRA 3VPGA 1NWHA 5K6AA 5TGDA 1PS0A 1ISHA 1NNUA 1RWBA 3PXXA 2EG9A 3D4NA 3GQVA 1R12A 1QXSA 2OZPA 4KZPA 1T1RA 2WYVA 5I9MA 1M6HA 4WOJA 4CM9D 3NTQA 1T2DA 3ZZNA 3LK7A 1P9LA 1A4IA 1R6DA 4CR6A 2ZATA 1C1DA 4WASA 4YXFA 1I36A 2XF8A 4BV8A 5A9SB 1IHYA 1OC4A 1FDTA 2FSVA 3JQDA 3LT4A 3DONA 1H6BA 4B4OA 3K92A 2GUGA 2POQX 1F0YA 3RUEA 3ZWYA 4ZRMA 3NTOA 5DBFA 1E7SA 3V2UA 2ZCUA 2Y93A 2Q2VA 4CV2A 1RM4A 4BGIA 5CAEA 3PYLA 3WNQA 5TNXA 5U9CA 4JBGA 4D42A 3N7UA 2VWQA 3B1KA 4BIIA 1P74A 3FNHA 4F46A 2W2KB 3A4VA 3F1LA 4IDFA 5TRTA 4CQLB 3AM3A 3G79A 2AE1A 2FR1A 1ISGA 5GZ1A 3K2BA 4ZQEA 3NT2A 2HRBA 2W2LA 5A5FA 1A7AA 4KQXA 2D0IA 2X22A 4FOOA 1M6WA 3WICA 4EYEA 1V8BA 1EE2A 1T2CA 1HETA 2F00A 3K96A 3AOEA 3RSHA 4LVCA 1VJTA 1HXHA 2V65A 2AQ8A 4J4TA 3LLVA 3L4SO 3DZIA 4J7XA 3BMCB 4AJNA 1KERA 4ZICA 3ON5A 4QQRA 1EQ2A 3R1IA 4ALIA 1HDCA 2C54A 3BMOB 1N92A 4WCDA 2HMTA 3V1YA 1A9ZA 4ZHSA 5JS6A 3ULKA 4IMRA 3ZWMA 4XEHA 1BRMA 2EF1A 1ZK3A 4I5FA 5EJ2A 3JQFA 3OJOA 3MOIA 4MIYA 4R4JA 3PZRA 1LRJA 1Z45A 4NU5A 4O6VA 4EEXA 4J2OA 4UREA 1H94A 1P1FA 1RYDA 4NPCA 1XYGA 3FI9A 1R4NB 2EJVA 3TN7A 1Y9EA 4A2CA 4E5KA 4FFNA 5IXSA 3C85A 3H2SA 1KVRA 3FNGA 1YWGO 1HYEA 2Z1MA 3OIDA 2BI8A 3DQPA 3G49A 2GN4A 5JYDA 1XQ6A 2Y05A 4ZN6A 1K0UA 3DOOA 5IDYA 4DPLA 1RKXA 1ZSNA 1ZCJA 1K3TA 4NZ9A 4E2XA 3GHYA 1Z6ZA 2D59A 2OBYA 2XXBA 3WGQA 3DBVO 3H6KA 1QG6A 3F1KA 1BXKA 2YZ7A 4WJZA 4TROA 2BELA 3WQRA 4E32A 4EGFA 5KNLA 3GEMA 5H81A 2EKQA 4K28A 2FZWA 2EKLA 4O5OA 2HJSA 2AMFA 3D4PA 5THQA 3H3FA 3I4CA 3EZLA 1M76A 4CV1A 2CDBA 3QLJA 3S2IA 3EK2A 4RO0A 3WS7A 3UCEA 3ZHBA 1NVTA 1GCOA 4DVJA 1ZKMA 3HFGA 3WLEA 3GGPA 1L1FA 3NV9A 2EW8A 3I23A 4I8XA 5G2OA 4YRBA 3QWBA 5L40A 4FC6A 4W82A 1F8FA 2X0RA 1B26A 2J3KA 2X4GA 3HB5X 2A4KA 3JQBA 4HFNA 2B5WA 4II2A 3FNFA 3D7LA 1NR1A 3BYZA 4M87A 2HK7A 2ZIZA 3ZWCA 4WOKA 5GMOA 3SLKA 3PQFA 3FBGA 4RL6A 4IJUA 3RJ5A 1U3WA 4Y8VA 3WMXA 3HDHA 1WLYA 4HP8A 3WXBA 1YO6A 3GPDG 3ITKA 2C82A 2OMEA 4R51A 1SMKA 2JHFA 3WSVA 4NBVA 3ZU4A 4BO3A 2O7QA 3D5TA 4E12A 2X6TA 2NM0A 1YBMA 2Q45A 4R1UA 5C7OO 3GA0A 5FFFA 4PVDA 1ADCA 4E21A 2IYOA 5DNAA 5DZSA 4M89A 3E9NA 1ADFA 3PQEA 4CLOB 3AK4A 1K6XA 3NDRA 4YJFB 3LVFO 4GWKA 2GRAA 1EUZA 4FBGA 4TRNA 3H7AA 3WR5A 3RJ9A 1UUFA 4UEOA 3EUWA 5ER9A 1IZ0A 4JBHA 3BMOA 4CUJA 4L4SA 3GAFA 3W6UA 2XPCA 2CD9A 2NWQA 3S2FA 1E3EA 4Y9DA 3OJEA 1GTMA 4LISA 1SZJG 3B70A 3IS3A 4J16A 1BDBA 4E2WA 1L7DA 2VWGA 5AXBA 3FBTA 4J43A 4CV3A 1LDGA 4PZDA 1WZIA 3QW2A 1NVGA 2V6MA 1ENPA 4BO1A 1E0DA 4KQWA 1E3JA 1F12A 2X23A 1E3IA 3V2HA 4YRAA 3ZWOA 4KTVE 3VVCA 4XGIA 2EWMA 4DQUA 5JDCC 2I9PA 2CFCA 5HTOA 4BKUA 4FW8A 1I32A 2VT2A 3WSWA 4Q3CA 3BMQB 3OIFA 4TKLA 3UF0A 5ADHA 3GR6A 1EQUA 4K6FA 3L77A 1XDWA 3GGGA 1U3UA 2QIOA 3LSYA 1E1LA 3T7EA 2GD1O 3X2FA 3M1LA 2PZLA 4KUHA 1ENZA 5K6AC 1ORRA 4Q3DA 1AN9A 2P5UA 1GEGA 3DBHB 1G0OA 5BSHA 1GADO 4PG7A 2OBNA 4OL9A 4OMUA 4BNHA 3KSDO 1NHWA 3VPSA 4MP3A 1CYDA 5AYVA 3OQ1A 4IUYA 1UP4A 5JAQA 3LT0A 2E49A 4NFSA 4DIBA 1VC2A 2OOSA 2W90A 1C14A 3VZRA 1MXHA 3DMTC 1HSZA 2I99A 4WLNA 2VYVD 3FPLA 3VTZA 4CM5A 2Y0CA 4OHUA 2X0NA 3WGYA 3KEOA 3LC1O 4PLZA 3C7CB 4YJGB 4CM8A 1GQ2A 1R4NA 4ROSA 4MKXA 3Q2KA 2WEKA 4PLHA 2DLDA 5L4LA 4RPJA 4JXKA 5A4DA 2JAPA 1E5LA 3QSGA 2IYPA 4X54A 1D4FA 1C1XB 4J49A 1A27A 3B1FA 2XAAA 2YV2A 2QYTA 4WK6A 5KTKA 2FHSA 3GH3A 3JQGA 3KM0A 4PZEA 4BKPA 4EZBA 2ZYDA 3F5QA 4YJGA 1O0SA 2O3SA 1DC6A 4G2NA 2ZB7A 2C2YA 2VZ9A 4YT4A 3GVCA 1NPYA 5F1KA 1E3LA 1N8KA 2C7VA 1DOHA 1EK5A 3OEYA 5LC1A 1ZJYA 4BVAA 1SC6A 4YT8A 2LDBA 4EEZA 4G5HA 4JP2A 4CMEC 4BUCA 4BV9A 1ML3A 4N5MA 1UZMA 3KSZO 3G17A 4Z9YA 3D3WA 1EEHA 1ISFA 5CEFA 1FK8A 3ENKA 5CDSA 3K73O 3GFBA 4I9HA 1DHTA 4R5MA 5A9TA 2I76A 3GRPA 4BL5A 3BHMA 5THKA 4U5QA 3GEDA 3NT4A 3TL3A 1EDZA 5JW6A 1ISJA 2D5AA 4GMGA 3ROKA 2ZKLA 3HUDA 4MPDA 2O2SA 1W8DA 4INAA 3INRA 2DTDA 5C37A 2DBVO 3SJ7A 2FOIA 1PS9A 5TJHA 2ZJ1A 3PJDA 1HDGO 3M2TA 3GK3A 4P4GA 3OSUA 1Z82A 4YCAA 1YDWA 4IJKA 5CG1A 4FGSA 4J4BA 1DLJA 4ZJUA 5AVOA 1WVGA 4AJJA 1H2HA 1U8XX 2NTNA 3AJRA 1ZK2A 1OI7A 3DBLB 4DPKA 2PNFA 1V3TA 3L07A 1I33A 4H16A 2BGMA 3FR7A 1IULA 2HMUA 3IUPA 5DDIP 1Q2XA 2PV7A 4DREA 5G4KB 1UXHA 2OXIA 1NR7A 3ADPA 3W4IA 3B6ZA 5A1TA 1EVZA 2BGKA 1UZNA 1T4BA 3NKLA 1EDOA 1EE9A 3LZ6A 4D0RA 1E77A 3ZV3A 5A3JA 1GR0A 1MX3A 2O3JA 3ABIA 3DZBA 4RLHA 1OFGA 1VI2A 5BSGA 2HKIA 2AG8A 2WWRA 2Q3EA 3ZI0A 3UCFA 3KBOA 4Z3DA 3QE3A 5KCZA 4FDAA 1U3VA 2RHRA 3MJSA 1KY5A 3T4XA 4IQGA 5LDHA 1M2WA 2X7HA 3E8XA 3OA2A 3ZWWA 4D43A 3ZHZA 3FTPA 2YDYA 1FDVA 3MTJA 1O6ZA 2JD1A 3GOHA 3IAHA 3GDFA 4LSMA 3OP4A 4JJGA 3G1UA 4CJXA 5B4UA 4FPXA 1PZFA 5CFZA 1N7HA 4WE3A 4B7UA 2NVWA 4M54A 1C0IA 1FXSA 1KVUA 5TJ9A 3RASA 2YY7A 5BR7A 1P1RA 2ZQYA 3UICA 2VTDA 1B3RA 2O7SA 4BS9A 1YB4A 1B15A 5F5NA 4JN6B 2GN9A 5FWNA 1YB1A 1EVJA 3TQHA 4RQUA 3UHAA 4NJMA 2NNLD 4CM4B 3E82A 1CEQA 1H6DA 3CZMA 4DBZA 1JDJA 1HE2A 1E6WA 3U09A 2VHXA 3K31A 4IIVA 1X0XA 3QWAA 3O26A 3DEYX 3S55A 2JFFA 4YAEA 3FD8A 4XKJA 2GZ3A 5DP2A 8ADHA 4XR4A 1IL0A 1KEWA 2A35A 3NYWA 5L4SA 5LCXA 1P44A 2PD6A 3ANLA 1ZK0A 3UFXA 3H5RA 5JCJD 1XR3A 4GVXA 1LNQA 3O03A 4O1MA 1HDZA 3RC1A 2C5AA 3DOCA 3DOJA 1B8VA 3R3SA 2EERA 3JQ8A 1YH3A 4JBIA 3ENNA 4L8VA 4CQLA 3E48A 1R4MB 3L6EA 4I9UA 5GY7A 1PIWA 4XYLA 4RV9A 1K6JA 4WCFA 4D0SA 1CRWG 4BO6A 1GQYA 2Z95A 1LSSA 4NQZA 3SX2A 4CLRB 4O0LA 1UZLA 4NJOA 1GL3A 4OQZA 2VRCA 4YPOA 5HS6A 2G1UA 1IUKA 4DIOA 1J6UA 1SNYA 1B16A 3RVDA 5T8KC 5TC4A 2NU9A 4XD2A 3EHEA 3ZU5A 1I5RA 3ZNQA 2NVUA 3DBLA 3H5AA 2PKQP 5JY6A 3GC6A 3PIDA 3AM4A 4GL4A 1ZXBA 3PI7A 4U0JA 1BHSA 5JSFA 2R00A 4ZA2A 4F3YA 5CDYA 2HRZA 4E6PA 1LEHA 1P0CA 2UUOA 5CDUA 1EBFA 1PJ3A 3ZWNA 3JD0A 4AICA 2FPGA 1Y8RA 1BGVA 3LDHA 5TS3A 2JD0A 3FF4A 4ID9A 4C7JA 3PGJA 3EZYA 3DMTA 2O2YA 3ZV5A 4XYMA 4AJKA 1I30A 3RI3A 3A14A 2WD7B 3IOYA 4J7CA 4FFPA 2JFGA 1A71A 1GYPA 3PP8A 3RC7A 3NX4A 4BGVA 1MC4A 2DPGA 1MP0A 2E6UX 3DZJA 3LT1A 4XB2A 4OJNA 5A05A 1I01A 3HG7A 3QHAA 1PTJA 1AHHA 4MVJP 4DWVA 1Q7GA 4YR9A 2NV6A 2YW9A 5C3MA 1IY8A 4URFA 4YDRA 5JMPA 3QWHA 3STHA 2B4TO 4HKTA 3KLPX 2C5EA 5KVCA 3I83A 4P38A 3IMFA 1ZJZA 2DUUA 3WYEA 4A0SA 2DTXA 1J0XO 5ITWA 3W8EA 4E5NA 3HHPA 4D3DA 2PTGA 4XCVA 5G0VA 1WXDA 4LMPA 1LLCA 2YDXA 1OMOA 4NFYA 4BNGA 2RH8A 3WBFA 3I9KA 1U4OA 4RLSA 1WMBA 3OF2A 2VZ8A 2G82A 3LF1A 3KYCA 4GMFA 3VPHA 1O5IA 2Y1CA 1H9BA 2X1HA 1XLTA 4QUKA 3O4RA 4G81A 3OFSA 1FMCA 1PGPA 1ID1A 3LQFA 3NTRA 4N7RA 2O23A 3EY4A 2CSUA 2FN7A 3RUAA 4XGKA 1KVSA 3HDQA 4IDCA 3AU9A 3JQAD 4YVFA 2G17A 3DFZA 3Q1LA 4WCFB 4IBOA 3W8FA 1YQDA 4YBZA 2X86A 4PLVA 1PGNA 2SCUA 3KYDA 1C1DB 3OM9A 5A9SA 4PZCA 5GZ6A 2VHYA 2W2LD 2A9FA 3COSA 4N5NA 1DJQA 1KVQA 1VL8A 3RU7A 2NQ8A 3M6IA 1LSUA 5F3RA 4Z9XA 1SPXA 1NBOA 1KS9A 1ZEMA 3WMWA 3WWZA 4LCEA 3HJAA 1ULSA 2VNAA 4ND2A 3ZV6A 3WTCA 3AU8A 3GG2A 3VDQA 4RVDA 2GCGA 4ONEA 3RU9A 5A06A 1KOLA 1D1TA 1C0LA 1E5QA 3GHHA 4GAEA 1I2BA 3FWNA 4PLWA 4ZVVA 1ZMOA 4YA6A 2B4QA 4CMHA 1I0ZA 1UDAA 1Z7EA 2YHIA 1DIHA 3ZNPA 4CM6A 4BQPA 4P4NA 3JQ9C 1GYQA 2E48A 1P31A 1PL6A 2PGLA 3BXXA 1B7GO 4R3WA 3WFIA 4L74A 3PZBA 4HNHA 1VJ0A 3F47A 1QYVA 5DCYA 2Q4BA 2GERA 3H8VA 1YQGA 4BNYA 2ILTA 4J1SA 1V9LA 3JQ6A 5DULA 1QV7A 3JQCA 3F3SA 5L4NA 3CSDA 4R54A 4XYGA 4GX2A 4WGGA 3R0IA 4W6ZA 4G65A 4KMSA 4YQZA 4A5OA 4M55A 2X9NA 2IE0A 1LDYA 2YUTA 3EMKA 2OGUA 3K8ZA 2I3GA 2YFHA 4M86A 2EP5A 4Q3BA 4J0FA 3X2EA 3OEWA 1UXKA 4BO0A 3WWYA 2VCYA 5KJFA 2BGLA 1G6KA 3KUXA 3C7AA 1Z74A 4BNUA 1Q0QA 4BMVA 4CLRA 1LSJA 2EGHA 1H5QA 5B4VA 1V35A 2I66A 4ZQHA 1NASA 1DB3A 3JD3A 5L7WA 5MDHA 5DOZA 3WGIA 3JYNA 1EVYA 3L6DA 4NBTA 1R0SA 3TPCA 3AUUA 4PLFA 2X9VA 1I3NA 1CJCA 1HDXA 4JLWA 4UEJA 2BRUA 4R9SA 3MCVA 3ZWVA 4GPD1 4Q9NA 3DFUA 3INGA 1CIVA 3L4BC 3DZKA 1T4DA 4NI5A 4EW6A 3OICA 2FWMX 4L0QA 2NU8A 3JQEA 5T64A 3C8MA 5JO9A 4J90A 5IN5A 3JYLA 1UH5A 4WNIA 1YJ8A 4RORA 3ZHYA 5EMHA 1U8FO 3NAQA 2EEZA 3HADA 2GN8A 3NEPX 3CPSA 1W6UA 3BMCA 3KLMX 2CZCA 4BMSA 4BNNA 5I9NA 1DC5A 4MIEA 2HO5A 2QRLA 3LLSA 3CINA 3EDMA 4FJ0A 1P1JA 4MVJA 2O3UA 3RUHA 1E92A 3FN4A 4RVHA 5KVVA 1QRRA 4K9DA 3QQPA 5TQVA 5F5LA 4R1NA 2ET6A 3VZPA 4B8WA 1LQTA 3M2PA 4NNJA 3K5PA 3GVPA 2BFAA 2OP1A 4KWHA 1RM3A
chains in the Genus database with same CATH superfamily
5G0UA 1L7EA 2YQ4A 1N1DA 1YBVA 5ITSA 3TCKA 2CWDA 5T4FA 5K8TA 1A5AB 4E2ZA 4OHVA 2BCGY 2HA6A 3T7CA 1PD1A 3LX8A 3T5MA 4DLRA 3VFDA 2WINI 2XIJA 2AEFA 3HJHA 1Z8FA 2AMJA 1QUEA 5E4YA 3INTA 4OMDA 2YOFA 2D5IA 2JCSA 4PTZA 1G9SA 1GUZA 3K0HA 2WHXA 3L6RA 3PI6A 2OHXA 2OO3A 1CFJA 4LZLA 4ODIA 1BFKA 1AH2A 3OZ7A 2O3QA 4AZ0B 1DRVA 2BGRA 3H0KA 3S3TA 3G2IA 3L40A 4OQNA 4W5TA 1C8BA 2CHUA 5EKTA 5CXQA 5KJ1A 3IP8A 4YP9A 5C51B 1T9BA 3UMYA 2WLSA 5DSZA 1UM9B 4IHAA 4QUDA 3VHXB 1GFWA 2BBWA 3TZKA 4TSFD 4UAVA 2IRWA 3VDMA 3WLQA 3ZKWB 2O8FB 2G83A 3IH5A 3G8CA 3EQ9A 4DS3A 3F6BX 4LJLA 2RE8A 3SFTA 3EX7C 3HB1A 1RYZA 3KVVA 4EWLA 2R6AA 1U0BB 1T3SA 2WMDA 4HRAA 1MO6A 4KXXA 5CH8A 5ALNA 4B0PA 5DNWA 3EMVA 1TJYA 2Z98A 3NB0A 1O54A 3PHIA 1ZGCA 2UDPA 1KTIA 5BSKA 3TRHA 3RQSA 1A4UA 2HR1A 1W49A 3NHKA 4BNIA 1DX4A 1RHQA 3A6EA 3KEMA 1HY3A 1VCNA 1U8EA 3PWSA 3ETHA 4H7HA 4Q3NA 1GGJA 2A5JA 1CJTC 1I4EB 1MLDA 3DR3A 3E6AA 4KFTA 5CPBA 4QTTB 3SHWA 1AK2A 1NRJB 4IF6A 4ENQA 5IAGA 5FPQA 1I3CA 2P3SA 1U9CA 3ZQKA 4EABA 3JTEA 2PBFA 5HE9A 3SDZA 1NIJA 1P2GA 3QVUA 4EMBA 3BJRA 3IB3A 4C07A 3G0OA 3A2MA 1XNRB 2BGGA 2NTEA 5DBEX 3PQ6A 1A88A 3H99A 5FXMA 5FNVB 2NSJA 3RVLA 2BHRA 1KHTA 3H1AA 2XMBA 4R69A 3RROA 3N58A 3FFXA 1E96A 5LJLA 4L5YA 5E3HA 1BX3A 4RPGA 2UYGA 4G5XA 3QX7A 3UMMA 3PGMA 4AJ2A 4IV5A 5I7SA 2D1SA 4C87A 1W0JA 3GPCA 3IT3A 4FMCB 2IW3A 2BTQA 1V7PC 4CTJA 4AKEA 2HQBA 5EESA 7AT1A 4J0EA 5FUMA 1PGQA 4WBXC 3Q6MA 1M7GA 1J21A 4IGIA 4UMFA 2DF8A 4UTZA 4C88A 3H2GA 3N05A 2MSDB 3DFKA 1JHXA 2IC5A 4I3HA 4Z4CA 3RHSA 1T2FA 2WVJA 4C4XA 5CW2A 3BE8A 1LPAB 3C74A 4FE4A 4RF5A 4OX9B 3H9QA 2P27A 2C5FA 4B40A 1ZRSA 1LV8A 1D9XA 2AK2A 5CM9C 5E8RA 3K15A 2FPSA 1KAHA 2ZUVA 2FG5A 4EW3A 4PFSA 3Q5EA 2RGUA 2ZCJA 2Y1EA 1Y89A 3VQTA 2FX2A 2RCYA 5E1OA 4ZV4A 5L3SB 2VHCA 3K71B 2O2HA 2DBQA 3ESQA 3U7JA 1FSFA 3CF2A 2G77B 3FOBA 3OU7A 4KGXA 5DU2A 3VNQA 3ZNNA 5T3YA 1V8FA 3NXSA 1IQUA 3QF4A 1FS6A 3QMWA 3VU9A 4YR7A 1X80A 3RRFA 4OIFA 3WAJA 3GA5A 3CPEA 4AKGA 3EQZA 1GKLA 2AFHB 3MOGA 1J2EA 2C8LA 3RC2A 2F1IA 4DLPA 5H9VA 3P9RA 2REXB 4YRFA 3IMKA 3EGDB 3ND9A 3E18A 3I37X 3EAQA 4H60A 5JAPA 1ZHHA 2VF8A 2L19A 5EKSA 1R5JA 2J9RA 3CMCO 5WRFA 3ZHOA 4KXYA 2R84A 1USIA 4EBBA 2XUOA 2AYZA 3DM5A 1SXJD 3ZD9A 1UJNA 5EYPA 3UAYA 3IQZA 5JBNA 3E9QA 5EWMA 4IM7A 4AKSA 4BP9A 4BMNA 1UEIA 2XA1A 1GZSA 4HEJA 1QQ5A 5B1DA 4CUKA 2ONZA 3BWCA 2ZI7A 3W5VA 5EXSA 2HSEA 1TFUA 1T34A 4BGDA 1RZ3A 2X5NA 1IHXA 3S99A 1W52X 2ZAGA 1EVIA 3K9WA 3K20A 1U9IA 3W5DA 5AIAA 1Z2CA 1LTHR 3AEXA 3O8NA 2J3QA 4V2IA 1CQZA 3R8CA 5JY1A 3MT7A 3QBJA 4JJ6A 2BM1A 1FYEA 3HCPA 1ORTA 4YWJA 1W581 1I4LD 1Q0LA 1RBZA 2PPLA 1K5GA 1BCRB 2PSHA 1TMYA 3EULA 3MMPA 3VA7A 1S8FA 1NTOA 4WCVA 2ETXA 1WP4A 2A7QA 2NPIA 2PX2A 4URHA 5F9FA 1QHHB 1BVYF 3U3MA 1V1JA 2CF6A 1T25A 4H7DA 3NFYA 1DJMA 3FAZA 4KREA 4Y2JA 3W06A 5L3QB 3RYHA 2ZUBA 5E1MA 3A1WA 3DYBA 2CUTA 3TFOA 2CBXA 1HYBA 3BXEA 3OTHA 3WX0A 1Y8QB 1H2RS 3I9MA 3A4NA 3K35A 2G9ZA 1KKUA 2JDIA 5JNRA 2CLSA 3RRXA 2XE7A 1U5AA 1A82A 2AN5A 4BQFA 3GYBA 4BVHA 2R8EA 4FYVA 1FDRA 2UYYA 1G21B 3DCYA 4Y2UA 4AJHA 2JVJA 1SG9A 4DHEA 5KREA 3GJXC 3U7IA 1LDEA 4E5UA 3E35A 2QMEA 3N5KA 3UBMA 4NJMB 3VM6A 1CF2O 4YTEA 2SICE 3EAGA 3Q6IA 3VPFA 2ZG6A 3WYDA 2I6UA 1IXSB 3KAPA 2VIIA 1QYIA 3FTQA 1CUAA 4GWGA 1RC1A 2UV8A 2I8CA 2Q4TA 4QUAA 4I4NA 1HMPA 3D8RA 3ZLUA 1WQ4A 3SDSA 3OFVA 1TVCA 1XNGA 2FGJA 2PSFA 4D79A 2W8ZA 1KK3A 2YL2A 3S1SA 2QYOA 4QBFA 3FYUC 1IE3A 4C4OA 3IPAA 2IKSA 3IE1A 1ESDA 2Y2VA 1DTEA 4L4XA 4OK3A 1RAGA 2QWXA 1KC3A 2AJ8A 3CIFA 1JT2A 1OAKA 4PS1A 1Z15A 4ALLA 1OWLA 3GZNA 4QBIA 4UTNA 1QVAA 2NO1A 2PT6A 2VZ0A 4WK4B 2QT1A 4NJEB 1K7SN 3FHCB 5JR3A 3SHOA 1XTVA 3OZAA 4Z53A 5DYNA 4Q21A 2PUDA 1O4WA 2GZDA 4GQAA 5FWYA 1ISIA 1MX5A 3F6YA 4L15A 1T2EA 3FRJA 1BMQA 3I2HA 4IHJB 4N0DA 3BDAA 1UJ5A 3KQUA 1LZKA 3OQPA 4Q19A 3FKJA 2BDUA 1AF4A 2PL5A 2EFJA 2X7JA 2NZ8A 1M1NB 1RACA 1NM5C 1TCVA 2CBGA 2ZT8A 1TF7A 3DBIA 3KFLA 3LXRA 3MTGA 5G0SA 4CMJA 2RBEA 5HP4A 3U4AA 4P4SB 5AW0A 1WUKS 3UGJA 3RYCB 2HA4A 1XRQA 4HNAA 2X3YA 3W5SA 4FGZA 4MP8A 2NU9B 5HR5A 2FDXA 1E3SA 4DCUA 5JTTA 1GTRA 1I3KA 2QRPA 2A58A 2EZTA 3NTLA 3ZU2A 2WT9A 2C97A 2ZI3A 1NW6A 4R68A 1QB8A 4PYQA 4ALJA 4ARBA 4CEHB 1ZN8A 1QGZA 5FORA 1U5BB 1SU6A 3T9EA 3THRA 4PBRA 3PRJA 4M83A 3TLYA 4BNTA 3JPYA 5JNLA 2TMYA 1WUIS 4QOEA 5CP8A 1OGJA 4Q3OA 1PWXA 1H6CA 1Y7TA 1E79A 1ZNXA 3N2ZB 1GQQA 4GEKA 1Q7TA 4IDNA 3SF8B 4B2YA 4C5CA 4ZANA 3VOTA 4DARA 1KJJA 2VBFA 4ED9A 4MUMA 1LLQA 4HB2A 4TMWA 4EVSA 4EP1A 3ABQB 2FUKA 4WLUA 3V8VA 3SE7A 3WO1A 2PZAA 1W88B 5I7OA 2VK2A 4BX9A 1HORA 4HMPA 3BH6A 1Q77A 4L5CA 4GQBA 1GL6A 3A32A 1P5ZB 2ZVDA 5A03A 5LZ4A 4IO1A 1J70A 2QVGA 3QHPA 4DLAA 1FDSA 2N42A 1BG6A 3ASUA 4CEIB 1A2BA 3BQMB 1Z2NX 2XQGA 3LM8A 1RJWA 1IB0A 4CLHA 4BNZA 4KL8S 1VPDA 3ND5A 1Z4MA 4X95A 5AI6A 2VJQA 1CJBA 4K46A 2P3OA 1AD2A 1QQ6A 1U2DA 1V5EA 3AOEC 1KIMA 4ZFNA 1SKMA 5KQRA 4BEJA 1T6NA 3H5OA 3FWHA 5FOUA 3V8MA 1ZITA 1G9XA 1S3FA 2MSWA 2QRNA 2FEMA 4NFHA 4L07A 4GKKB 4AS1A 4D8YA 4OKIA 2PEZA 1HE5A 2Q5LA 1TAGA 1BGXT 4JLPA 2WT4A 3ESBA 2NUAA 1U3CA 1F2VA 1VKHA 2WM3A 3DBHA 4UHFA 5CVDA 3RIXA 1XFAA 1VDZA 1HBJA 1TK2A 2I7TA 5EZ5A 1H2EA 1N2XA 1PJRA 3R7WB 4D98A 4W5OA 3DBRA 6ABPA 1XCPA 4DMHA 1Y37A 2FQYA 4FS8A 1T5IA 4PAOA 2DUNA 2QX4A 1T4GA 1JHUA 2XY4A 4OHMA 1G7RA 1KEVA 1KDZA 3SFZA 4BMCA 1ZCBA 1BDMA 5B64A 5AW4A 2VRBA 3O8DA 1GPWB 4HNRA 2ZE7A 5JADA 4AURA 2BEKA 1PNVA 2XKBA 2C7PA 1E62A 1MAHA 5DOVA 2XWJI 3MJFA 4RYLA 4C1BA 2QX7A 1JFFB 2BHLA 3HN6A 3P9QA 4RPLA 4M9ZA 2X0EA 4JT8A 4ICIA 3O31A 4NATA 2XCOA 3C8HA 3IBSA 3WK6A 1LSOA 2GCEA 2H5JA 1WKVA 3LHKA 2AN3A 3EDRA 5JASA 3T5BA 1NF2A 1A5ZA 2WOOA 3LXMA 4I5DA 4EHLA 4MQ4A 4QJBA 3CLTC 3UWDA 3ER6A 3MCAA 3EVTA 3FYTA 4QM7A 4ZK6A 3MJ4A 3M8KA 4W5JA 3OE1A 4DY6A 1IK6A 3D31A 3LYUA 4ECEA 2FMFA 2DT8A 1KYWA 3H3XA 3NYQA 1IUPA 4L4RA 4QE3A 3VUEA 3U5ZB 4CLXA 1GFSA 5JMOA 1IY2A 2LWIA 3ANTA 1YUNA 3DEIA 2GJ4A 3BX1A 4NZOA 4FSHA 2YS7A 3GFGA 4KQGA 4JWTA 4O63O 4EAAA 4DGQA 2G67A 4B3RB 1Y63A 4MHSA 5DJ5A 1U5BA 2GAOA 3PFNA 4YJ3F 3KRTA 1Z5GA 3NEJA 1BXRB 1WBJB 1XCBA 2NQ2C 3OM1A 4BB5A 4FIZA 5E6UA 4WBNA 4DV5B 1LX7A 4JVNA 2YHSA 2PX0A 4C08A 4IEFB 3RU3A 3V9PA 1GCUA 1NY6A 5ESXA 1EFLA 3TLBA 1VZ2A 3ROQA 3P5SA 3ZDFA 5PNTA 3OMLA 1NATA 1U8CB 5ERGB 3GZ4A 1JHAA 5EIFA 4IHQA 4FYWA 1W4RA 4PM4A 4RF2A 4XSVA 5EA2A 4DIFA 3QSYA 1C3XA 2J45A 2B2NA 5T6BA 2EU8A 2YXDA 1A04A 1RU3A 3AEYA 3DWEX 1DBSA 5IFLA 1TUGA 5K0CA 1KOGA 2YJ3A 4HO1X 2AI2A 1XEAA 1YVPA 3HJCA 5F1OA 2VBIA 3LDGA 5ESRA 3SXJA 1U0FA 1DJLA 3CXUA 1GU7A 4Q3KA 3DGFC 3W34A 3CNOA 3G5AA 1C7ZA 3LZDA 5H1YA 1V3VA 4LK2A 4MUHA 1C3OA 5LZ5A 5HOQA 3ZDYB 1TNDA 2UYQA 3W0LB 3GJZA 1KAQA 2NZYA 1HT3A 2RGEA 3AP1A 3ETGA 5JRJA 1B0UA 1CJKC 1MB4A 3CM0A 5KYNA 1G5QA 1C3LA 3N7TA 4OSPA 3H6HA 3ZVLA 1ZLXA 4CM9A 1VE7A 5K0LA 3B1JA 2B36A 3OQBA 3JQ7A 4LHEA 3B9PA 2Q99A 3Q7SA 1W4LA 4PO8A 4KW7A 3I0NA 3UGTA 2ZSJA 1KK2A 4G0NA 2WAXA 4KIWA 1MIOA 4IIJF 1GRCA 4I8DA 4HNAB 2Y68A 3FTCA 2C4KA 2RHMA 1MA0A 2GF2A 4CI9A 1TA4A 4WZBA 1PNQA 5DHQA 4LKRA 2WFAA 3VR6A 3BMNB 5K8JB 2YFQA 1BVHA 2B6NA 4RF3A 3VH1A 8MHTA 5IMBA 1I10A 1P33A 4IDPA 5EAIA 2JAQA 1GIAA 2P68A 4TMVA 1WTAA 3I2YX 1DV1A 3IUNA 4XIJA 4XJVA 2H1SA 3TSAA 2SECE 3L7DA 5EMJA 3RBVA 1FW6A 1MPXA 4J16C 1CUXA 1FFDA 4Q3EA 5GM2A 3QOXA 5HKAA 4FZVA 4IL5A 4JELA 5HFNA 3PWKA 4YB8A 5AI5A 1AX9A 3AEKA 1JG7A 4MDYA 1MAUA 1JJVA 5CURA 3BMNA 3VX3A 2ZSUA 3GGSA 1UWVA 5FT9A 1NMYA 2PMBA 4F3NA 5CGQB 4INZA 1G2OA 2E82A 3QJ5A 4II3A 5JVDA 2BH9A 4GM0A 3KQPA 1T9ZA 1O08A 1I2ZA 3DL0A 3FOCA 1FUIA 1AS2A 1LI5A 1I4OA 2EJCA 3NIDB 3NFRA 3ORYA 2G72A 1G6HA 2D74A 1HDRA 2FR8A 2HJGA 1VLHA 2PH3A 4FILA 4J1QA 1O87A 3OHSX 2OHOA 3L0IB 2Z2YA 1ZO8A 5DBOA 1RAAA 3N59A 3IJRA 3J7AC 4Q4AB 1W5TA 4RABA 3RGWS 1V7QA 5JS7A 5IRCD 2R4UA 2WSYB 2VQEB 1T8UA 3MTIA 4MO2A 2HYIC 5JDIC 2DC1A 1T3GA 3BA1A 3EIWA 1GZVA 4WIAA 1IJKA 3H16A 4RQTA 3ZE6A 1N3LA 3I6ZA 3LL7A 4MVJH 5CFMA 3JALA 5TSDA 4CGZA 5DWDA 1KSHA 1TKAA 3HBLA 1Y8QA 2Q5IA 2FY8A 1BE6A 5EINA 2IVFA 4LF7B 3G0DA 5CU7A 1WCXA 2ARKA 1PJQA 2KLHA 2QN2A 3GNSA 3TIXB 1IBRA 2AOVA 3AQ4A 4QJIA 2XV1A 3TXAA 2E5LB 1XQWA 3I09A 3N3BC 1NYTA 1GUYA 3I92A 3UWMA 2C57A 3TGLA 1BS2A 2COEA 3MPOA 1LDNA 3AX6A 3LLMA 4LTMA 2QM0A 1G7CA 1SB9A 3DD1A 1OX5A 2VJBA 4MUXA 3Q8WA 5KYGA 2ZJ4A 3S5JA 2NZJA 1LWNA 3F90A 1XNJA 1GJRA 1K2WA 4UU0A 2VTEA 1YGYA 1GQSA 1TI7A 3W8RA 3B1YA 1BNCA 3UW3A 3ZYZA 1YDEA 1XQXA 1HFJA 2WSBA 4OGLA 1H0RA 4DJEC 3FCUB 2AK3A 1PT8A 2K2WA 4HAWA 4UZFA 3RFTA 1PT9A 1RPNA 3GFTA 3C6BA 3B3QA 1T2NA 3SNHA 4KBYA 4QUBA 2HU8A 2PZKA 4OLAA 5DBIA 3GPIA 2YWEA 3K70C 4NYMR 3B7PA 4MPRA 4QXPA 3ZUGA 4EY3A 1JVBA 4MB6A 4ZI5A 3GBSA 1QFZA 1NYRA 1RWMA 3ILXA 2VH2A 4ZAGA 1RJEA 5C2JB 1QIEA 3GX1A 4OQLA 3CWQA 3I61A 2R6R1 9LDBA 2IODA 2PY6A 2IP1A 2PGIA 1SIUA 4BO9A 4TTVA 5KOIA 4LWZA 2G9RA 4OD0A 1TQ8A 2V4UA 2VDWA 3U13A 4MHOA 1QYCA 3PGXA 4N3NA 2R66A 4IG4A 1ABFA 1NU8A 4OUDB 5E7IA 2VLIA 4RHXA 1DO2A 2DY0A 3H9JA 1ENYA 1PYGA 3Q1KA 2H48A 1ZXLA 3FTNA 5IT4A 3ZK7A 5A4MS 1KJYA 4YCDA 4MGYR 4TT3D 1U3TA 4C3OB 2AIRA 5BRJA 2NV0A 1M1YE 5HK8A 3ZIUA 3GLGE 1U2GA 1YS7A 2PUHA 3IUJA 3VJKA 1RHRA 1F17A 1X74A 2QVBA 4K86A 3QNMA 2LV8A 3GQBB 3AEKB 5B58C 1TM3E 2G5TA 1TJPB 5E6UB 3W8NA 3EXEA 4ALMA 4EHIA 4S0XA 3SYTA 1P39A 1X2EA 1LLDA 4FNAA 5HE8A 3RVOA 2I8AA 2IZ1A 1BFUA 5SICE 4FXOA 3COYA 2JAUA 4QGHA 3S8YA 1NE2A 1U0TA 3HYLA 1FUEA 3LL4A 4HWTA 5CCXA 2GILA 5AM2A 5H3CA 2O6LA 3SC6A 4WX2B 5G0TA 3MUOA 1D5WA 1XEFA 1YA8A 1JB1A 1DC8A 2YBEA 1JQAA 1GG2A 1VSBA 4EUNA 1OF1A 5KDOA 3IVMA 5ALOA 3EUAA 1ANKA 2YV4A 3CNEA 3EFOB 4XJTA 5DLPA 3ROZA 3AP3A 1GD1O 1HZJA 4GP6A 2FJ0A 5FNZA 3C24A 4B76A 1JSCA 1HE1C 3B1XA 3LP5A 3A6GA 1GPLA 1T5BA 2CXRA 3IE0A 5AJUA 4D45A 4E7OA 1UBEA 5D01A 2B1QA 3JQAB 1SM4A 4ABTA 2MYTA 5FFMA 2WTAA 1QNLA 2YRFA 3ICOA 3AXTA 4P54A 4DM7A 3WL8A 5A04A 4ZTUB 1M34E 4N4AA 3I6BA 3HSSA 4KE8A 1Y8RB 1YQWA 3CLKA 1VP9A 3JRNA 1EGAA 3IGFA 1QSGA 2IOFA 2ZVPX 1IJBA 1QF9A 1W46A 2BJVA 1RBYA 2EWVA 1J56A 2QMUA 3Q10A 3PYMA 1UOPA 1MGOA 4C7BA 5HRCA 2HPZA 2Z8YA 4P93A 2PX4A 4FS3A 2P3LA 4HT3B 3SE0A 4EGAA 1N3YA 1M5TA 4W8GA 1HL3A 1UDWA 1P9NA 2QTNA 2QRQA 3FYUA 3NAMA 1XZNA 2X4DA 3TZCA 4KACA 1KMCA 1DL5A 4FOSA 4G63A 3E4CA 2GSDA 2JJMA 3I04A 1P81A 4IYJA 4M76B 2E3JA 3A6KA 3A4MA 2AKYA 2B9EA 2FV8A 3I6IA 3SQLA 3KXDA 4MARA 4DQ0A 2RGDA 5IDXA 1RP1A 4JI1B 1SVLA 1JTVA 2R8XA 4FFBB 4HDKA 1IEWA 3PGA1 2AJLI 2EJUA 2I4TA 2VUIB 5GOTA 4BMXA 4NZZA 4E07A 3OH8A 3DC2A 2C3YA 3NUZA 1KFJB 4DKJA 4MLCA 4EX6A 2E5WA 3M5CA 1DKMA 5TS2A 2FE1A 2NTJA 1KYVA 1EUCA 1SIWA 4NU6A 4W5RA 1QS0B 1XZHA 1CDZA 4I81A 5FJJA 1X94A 3KPWA 5FWXA 3V2GA 3VU9B 2CUNA 4HWKA 4C6TA 3TG2A 3JAMA 1G59A 4PYIA 4DAOA 1J06A 2FXIA 3CNLA 1Y82A 1NY5A 3BE5A 2BEUA 3GEBA 5IJ0A 2YRXA 3R5TA 4OP3A 4NC9A 1DTSA 3Q9UA 4DNFA 2DFPA 1N2CE 3T1QA 2ZYIA 1Q2UA 3PKZA 4Y2VA 4AYTA 4PX2A 4HVLA 2CDCA 3TO5A 3ZXUB 5K0ZA 1VRVA 3AB8A 3D6UA 2ZIFA 5AI0A 5BOSB 1JYEA 3KU4A 2VF5X 3O82A 5ALLA 5K1ZA 4B47A 4DM4A 3V8BA 1WKBA 2Q2WA 2GTPA 2ZWVA 2X58A 1OH7A 4A9AA 1PNRA 2IDJA 4ERNA 2OFPA 2JCYA 5K3FA 3SY8A 3DDHA 4GLLA 1DE0A 4ZGGA 3DAFA 2O2JA 1L4MA 3KJHA 1E69A 1KEZA 4OJMX 4GKBA 1QDEA 3KJEA 4XDGA 3I45A 1QGOA 2VHUA 3NHWA 4WCFC 1YB5A 1AURA 5C1IA 4H1VA 5TF0A 5IAEA 3DUWA 4F93B 3OWHA 2PKRA 2PT9A 1IG0A 3A8TA 1CS0B 2JCXA 3WGTA 3DDNA 4EUFA 5CEJA 2HJHA 3EQ7A 5E6RA 2H06A 4KKXB 4RMNA 3TQFA 2F9MA 4FZ3A 1XPUA 4PW0A 1Y7HA 3D1JA 4LQ4A 4RH3A 1IMJA 2RI0A 4X45A 1FRQA 2RK3A 3JQGB 3NHMA 3NPAA 4HWRA 5AUNB 4MPTA 6ADHA 1A7KA 1X9GA 4OMCA 3FUXA 1EA7A 2JNWA 3CEHA 1T1IA 3KDPA 1AGYA 3D3EA 1UMBB 4HYEA 2FW9A 3DXFA 4RL4A 1KIAA 2VTBB 3BB4A 3ZHTA 3EG9B 1QWSA 1G3IA 1KBZA 3NNSA 3RREA 4AY5A 3GLFB 2Y4NA 2BFOA 3EQ2A 1X7HA 2VDQB 4XUGB 4XQGA 2VYNA 3DR5A 4KV7A 1RC8A 4RPKA 4EHBA 2I4IA 1Z25A 3EYAA 3OOSA 2JAHA 1V4VA 5ECDA 4RMJA 1V6AA 1RI2A 2C5BA 3EH1A 3RABA 3BMXA 3QXXA 1X1QA 4FZJA 3VH2A 1CZHA 3L4BA 3NC1C 3DEZA 5LP6A 5JROA 4BNDB 1FFYA 1N75A 4WZZA 1MJHA 3I5YA 2DAPA 3SQXA 3X1XA 1CY6A 3UTCA 2X5XA 4XJSA 4KVZA 4G5FA 3DKPA 4NBUA 3WDSA 1PVOA 4MXDA 1DIGA 1N0IA 1FYFA 1SUPA 4EBFA 2DY1A 3HVJA 3KR9A 1Y6RA 2QUIA 3MJRA 1YZHA 2OXCA 4DL9A 4TKVA 2ES4A 4RPCA 5EIBC 5EZ6B 3KR2A 2QN8A 4M8KA 4WZBB 4MUAA 3WV5A 2XUZA 2XUIA 4HXEB 4PHFA 1QIDA 4FX2A 3OURA 2OD9A 1JU9A 1R1DA 2HM7A 3G88A 2FB9A 3DV0A 1S3IA 3DPSA 4QXMA 2FUG6 4ALKA 5KNCA 3EF1A 1L9XA 3EGOA 3G5MA 4I3FA 1FEZA 3HZHA 5HF6A 1PYOA 2Y76A 2DM6A 4MYHA 4C78A 4M0MA 2V6GA 5E9JA 3K1ZA 4EY4A 1JLLB 1UPXA 3PHCA 1T0PA 1R18A 2A3NA 1BWRA 2IY9A 1AA9A 2VPQA 3I9OA 3LYHA 1QO9A 3SXPA 4UNPA 1NJGA 3KOOA 4U8GA 1HNWB 1EVEA 4FNMA 2VOEA 3H5TA 4C3ZA 3T5PA 3OKAA 1NDHA 1V26A 3GG9A 3G8YA 3ZD8A 2WZCA 2OLEA 3UHPA 5CJJA 2OHJA 4QYIB 1T0BA 5KVAA 2J0QA 4ZVLA 2O5RA 4RANA 1E3WB 1H8EA 1YZLA 1A9OA 2Z9BA 1UDXA 5EIAA 2ERYA 5B4TA 3NASA 3VJLA 2FMXA 2C5LA 2L42A 1ZUNA 3CZAA 4PYKA 2HSDA 2H1RA 1IHOA 1JLLA 1YCDA 3QFCA 4H27A 1GG8A 4F9FA 5JNVA 5M29A 3C3DA 4RSHA 3ZXSA 2OKCA 3PV0A 3VH3A 2EXXA 1Z4JA 3O47A 2YZ2A 1UBHS 1JI0A 4IJMA 5HHTA 1MOSA 4TZ0A 2P2DA 2Q7DA 1PL8A 4MQLA 4WNYA 3F9RA 4LRQA 1TT5A 3ADBA 3HI4A 1Z2EA 3WLIA 2Z57A 1FSPA 2HREA 3H04A 2I6TA 2QV0A 4CDMA 1DAFA 4RX1A 1DAPA 3BRWD 3GMDA 3O83A 2R8YA 4I9GA 5FADA 5H9WA 5L51A 1KJQA 4RXTA 3VHLB 4DLWA 4A6DA 3VKUA 1E6LA 1YZNA 2I7XA 2I3BA 3OUZA 5ENDA 3HH8A 1D4OA 4ZVTA 3DL7A 3FIJA 5I7HA 2WJPA 4QVKA 1RIFA 2HLPA 3H9BA 4TT8A 1KSFX 2Z4SA 4C2UA 2OHVA 3RIHA 2J9YB 4Z0HO 4YHBA 2G28A 4EYQA 6YASA 4CVNA 3DZFA 2BR4A 4PAWA 1OXXK 2YYYA 5EHIA 3HYTA 3UAGA 4IOKA 3AJ8A 3FSRA 2DEUA 1AKMA 2XKKA 3ND7A 3L7IA 2OXRA 4XOIA 4B35A 5C5IA 3E58A 5HS4A 2IYLD 2P9YA 3CO5A 4MS4A 1OU0A 1M2FA 1R8YA 2X9QA 4L0MA 3HDJA 2OHGA 2OSVA 2NAFA 4A03A 3ED5A 3TOXA 4BX3A 4MWSA 3NKFA 2FN4A 1UQRA 2AJDA 2OE2A 2ZEJA 3MN1A 4G41A 4JUFA 4JQYA 1B8NA 5EHNA 3UV7A 4OHWA 1HEUA 4G1CA 1WIWA 3T1TA 5AI8A 2ODPA 4FFLA 3U4QB 2Q5CA 1ZI9A 4M7OA 2FW6A 1K7YA 1UXGA 3R9IA 3ZWAA 1VHQA 1XHEA 4UHKA 4LC1A 2BTOA 4HFJA 4ZYLA 1DG3A 4D2IA 3FWPA 2XA2A 2GHTA 1YS4A 4TTRA 4BP1A 4DR6B 3LAWA 4CL8A 2JJYA 3COPA 3LQ2A 4D4JA 3EWNA 1Q21A 3BSFA 1G0NA 4BJ1A 3OZFA 3KKNA 4KR9A 4FHDA 1A5SB 3ZCPA 4B79A 5I8PA 5L45A 1QFSA 1SUSA 3UAVA 1A8HA 3KQHA 1W36D 4Q9KA 1WXHA 4IIJA 4P8RA 5FI1B 3TKLA 3WE7A 4RKEA 1BWSA 3RVSA 3PXGA 3VMMA 2X5OA 3CKYA 3U31A 4WOCA 3W5AA 4E3WA 1D2CA 2CJPA 1E5DA 2EBWA 3L5OA 2O0JA 2ZSFA 3SF0A 1O94A 4LE0A 3SCZA 4ARZA 4PF1A 5KSWB 4F5DA 3PVZA 3TTUA 1NI5A 4CKWA 3TMYA 1M2VA 1T9GR 5GGXA 4J9VA 1SBCA 3TOZA 4RDXA 3EPLA 2O2DA 5G41A 2ZJZA 1YONA 3DO8A 5YASA 1JQLB 3T35A 1IFXA 1XMPA 2XGSA 2PVPA 5AXAA 2P4SA 1Z38A 2L18A 3A9TA 3ZWKA 5KYUB 2YNMA 1TJ5A 4H3HB 1WL8A 2BGUA 2C3MA 2X6RA 1EYZA 4CKYA 3RLIA 3SKXA 1W4CA 2ORYA 4Z4FA 4Y1RB 3WGLA 4KN9S 3TQRA 2CD7A 4COKA 3KWLA 1FJGB 4PR0A 4LV8B 4WDRA 4LHXA 4I6JA 1FNDA 3ZW8A 2QK4A 4MRVA 2PGJA 1HDIA 3U49A 4DUPA 2IEDA 3AKDA 5BWCA 4IS2A 1PTJC 1XTSA 2J7PD 3PE3A 4QT4A 4PSVA 2PWPA 6REQB 1YBAA 1FJHA 3HA2A 3U7GA 1MV8A 1N5KA 1U1CA 4FB4A 3M4NA 5BSWA 1NYQA 4F4DA 2XMQA 2PX8A 3EXAA 3OTOB 3CVXA 3QENA 2C3PA 4JD5A 3E03A 3IAS1 2GCIA 3GLRA 2Q6TA 3Q9SA 1KSJA 2DLNA 3A9UA 1ECPA 2JGNA 3P9PA 4LA4A 5JXGA 3ICPA 3JRWA 3DP9A 1I3LA 6Q21A 2QDKA 2G4LA 1I7NA 1JWBB 3QYFA 5D1HA 5M3BA 3OMXA 3R7DA 2V03A 4K8OA 2I29A 1GVNB 4CN8A 3MELA 2TMGA 3GLGA 3B9BA 3DWFA 2CHVA 3FJ1A 1APBA 1D2EA 4R8RA 4YFYA 4NK5A 3MGGA 2EVWX 4WESB 4WLFA 2P9HA 3HP1A 2A59A 3P71T 5HNKA 1L7VC 3BDVA 2HBYA 2OZLB 2PVSA 4ZALA 3BERA 1BE0A 2X13A 4UHEA 2IYRA 5CM8B 5EQFA 3ZEIA 4BJHB 2BT4A 1U4SA 3NHJA 1NXOA 1NL3A 5TT0A 3BC1A 1TU4A 4YMUA 4HLDA 3WWOA 3LKZA 4IPTA 1ZESA 2QMZA 1SUBA 4BB0A 2A1UA 1NQTA 1JG4A 5FA8A 3E1GA 1ONBA 3K0EA 4OQDA 5TPWB 4LWPA 5K3AA 3O5AA 3UKDA 4W5HA 3WWPA 4NE2A 2PS3A 1XD2A 1EAYA 3I8SA 1UDBA 4TV9F 4G97A 5IM5A 1C81A 1V16A 4CF6A 3ZGLA 5DYWA 4JEHA 2RIRA 4FYYA 4JLAA 1CT9A 4KE7A 1WY7A 3GCDA 2WIDA 1RYMA 5A5DA 1NJ8A 3RAEC 2ZRBA 1GITA 5EHXA 3A28A 3MD9A 1J39A 3P45A 5F3WB 1BIFA 1FFGA 3K6RA 3RVBA 2BBSA 4MEAA 5LA6F 3U1TA 1BMFD 4R2HA 1Q3KA 4CM7A 1M34A 1CLEA 4DCCA 1P80A 4LVOA 4HG2A 3HKEB 1EUDB 3EVBA 2N46A 3D8BA 3HCWA 4BO7A 2F62A 3K1JA 3OUUA 4B3IA 2BSAA 4DCTA 3VO2A 2NZWA 3TAXA 4DG5A 1CUDA 3RTEA 1RS0A 1VG0B 2XMRA 5D00A 3PF9A 3RUCA 3K6SB 2QORA 2V59A 1H9AA 2IYZA 2Y1FA 3OLZA 3WOHA 1ONOA 3COJA 1XMQB 1XMSA 1KEEB 4KUEA 1RXIA 1Q6YA 1XZPA 2GHRA 3HP7A 3GDWA 1VYTA 1JHPA 1TVKB 1Z75A 1N2GA 2DBRA 2HF2A 3TD6A 3WYFA 5JEDA 3TAHA 2DXIA 1V9SA 3C3WA 1KEPA 3WLMA 3FSJX 4DC0A 5BQ5A 4QOIA 2BLNA 1VBNA 4GNKA 4RFVA 1V37A 1MJGA 4ZHQA 2PK3A 4KR7A 1U31A 2DWQA 1P18A 1P2TA 2JKZA 3JD1A 5B3JC 2NN3C 2NSHA 4Y2HA 3ZK8A 5C4GB 1IOLA 2Q27A 4NAUA 1HSOA 2CB9A 1M72A 4I1SA 1G41A 1IPEA 2Q28A 3EIUA 3LX5A 4XDYA 2V55B 3NTVA 5F7ZA 1GGNA 1VTKA 3V4OA 4D9GA 1KRXA 1CIJA 2P6OA 4P98A 4WLVA 2QN7A 5IKXA 2Q6KA 5HVNA 2FVYA 1CY2A 2HUPA 1KJ8A 5B30A 3NKVA 2WUFA 4RTKA 4HPJB 4Z9FA 1M1ZA 1ATZA 1MF7A 1ZL2A 3BK2A 3TTTA 2FRDA 2J85A 3S2UA 1A9TA 1G8MA 1AB5A 4C14A 3JWEA 3EGEA 5JIBA 3D4IA 5BQXA 3OQNA 4B7CA 3I3OA 4A6EA 4XFJA 5LB4A 3F2IA 4TRJA 4AWXA 2H29A 3NHLA 4WXYB 3STXA 4U3JA 4E2YA 3ZE8A 1W5FA 2YJTD 5BSVA 2H9AA 2QAIA 1JH8A 2ONYA 4UE3S 1XA0A 4LYAA 5DTIA 1SIOA 5C52B 1P4HA 1JQJC 1QCCA 1YDMA 1I2CA 4HB4A 2WY2D 2Q46A 1EM6A 4PFKA 1N2HA 4N39A 4LOAA 4RDHA 2FE4A 3OX1A 1S96A 5J23A 1YC5A 5CLQA 1K0FA 1FU7A 2CZGA 2XBMA 2OC4A 3WAGA 3IAS6 2G8NA 3LHDA 2FEWB 4OGWA 5DYYA 3IMEA 2ZXUA 4AU1A 1XUOA 1G8GA 2A9VA 1NG1A 1XJ0A 2BFFB 3JZAA 4H4EA 1BW9A 3KOUA 3CE9A 4E5VA 2J3IA 2R1ZA 1JXMA 3DLTA 2JIOA 1CUZA 3IBTA 1E0SA 2CYCA 1A7UA 2LCIA 2QD2A 2W22A 1F2UA 3OIGA 4J6FA 3T4EA 4HH0A 5KB3A 4I4IA 2ZBPA 3LJKA 3L8EA 4GIBA 1G18A 3ISTA 4Y6QA 1OU4A 4C22A 1CQPA 2FZGA 5EE5B 2Y1GA 4EFMA 1KP3A 2I4NA 4HPXB 4H1HA 4QDUA 3ONVA 4YRQA 5ALQA 4YMHA 1I9GA 2B35A 2IH2A 2ZW9A 2WUVA 1MO2A 4XVUA 2GT1A 3A3OA 3WIEA 5BRNA 2ZSHA 2VTBA 2WHPB 3S1AB 5KTSA 2ON6A 1VG1A 2M1ZA 4NYIQ 4G4JA 1UFQA 1X7XA 1LNSA 4TYPA 5T57A 4QT0A 3C3JA 1KEEA 1RJFA 3CG0A 3C3BA 1VA5A 3AVOA 2PUVA 1USGA 1YL5A 2BFNA 4YT5A 2IHJA 3GFSA 5JRDS 2XRYA 1E64A 2GYYA 4KODA 3X1JA 1M2NA 3LRXA 2R7AA 2G80A 3F8SA 4MJXA 3ZQ4A 1O8CA 2BBOA 2R751 2WAAA 1G3UA 1GUAA 2C84A 3U3OA 1VXRA 3VR5H 1JN0A 4AQ7A 1FFAA 2QX8A 3LUFA 2C3OA 1M0TA 3QG1A 1RCTE 2N0SA 2YXLA 1AKEA 4PQYA 5CVUA 5LN1A 4DC9A 2YV3A 1XZEA 2B61A 4WACA 2GQ0A 4IINA 2P2CA 1G5TA 3P27A 2O8FA 3DKIA 3JQ8B 3U48A 2EFGA 1KZYC 4TV8A 5FPSA 3C3MA 2IUYA 2QXTA 1ISRA 1E1NA 1DBQA 4Q39A 1RI3A 3IUBA 4HMQA 4JC4A 2XWBF 1V16B 4MGHA 5BWMA 3PX3A 3PDJA 1AM4D 4IDDA 2FZ5A 5F35A 2E0IA 4KVGA 1T4CA 2JLZA 5REQB 2F3UA 3C8UA 4WUVA 1CLUA 4HQ6A 4W4TA 4PZUA 5KWIA 2P77A 1FZQA 1XZDA 1T3HA 1EIZA 3B51X 3T3MB 2CLHB 1VBKA 2CW5A 2RB5A 2GAFA 4HNSA 1EFUA 1XLWA 3B20A 1NUPA 5I9BA 2B69A 4C4SA 3PWZA 4GI5A 4DV0B 2RHLA 3KTOA 5JJIA 2Y1WA 1G8PA 3BL8A 4LIPD 1N0VC 3TEFA 4UUBA 4B3HA 4JJZA 2CUKA 2IXBA 3I42A 2WJAA 1SXJE 1NURA 1Y5MA 2H0QA 2QNRA 4RVUA 3L9XA 2DWOA 4G1EB 3HDVA 3LPDA 3LTEA 4OQFA 4PO9A 3TZQA 4WBNF 2EIHA 5HSGA 5I7AA 4OAQA 1QPGA 4YI3A 2PD3A 3FZGA 3IYLW 3UH0A 1XU7A 5G1NA 3BRSA 3PJRA 4YAGA 2QBYB 2UVDA 4RVOA 5HG0A 3G82C 4HQOA 3OKPA 3ZE0B 1RPTA 4ZDIA 3LBNA 4LZNA 3VPGA 1NWHA 1NXSA 3AG6A 1SXIA 2B94A 2HADA 3DMNA 1PS0A 1Y6FA 3C87A 4RA6B 1Z5VA 3DKKA 5D86A 1QBKC 1TJ3A 3DTNA 3PXXA 4KXLA 2EG9A 3OTWA 1O7JA 1JJ7A 2E2WA 4JBYA 2X41A 2WJZB 4KZPA 3C6QA 1JLKA 1I3OA 3KDSE 4CM9D 4FT2A 5LQSA 3WO0A 1WBDA 3PDWA 1UZUA 2NG1A 1R6DA 3V7YA 4CR6A 2ZATA 5A9SB 1E89A 3N2IA 1ESCA 1GPAA 4MRPA 4PO3X 4WBSA 5IAJA 4BV8A 4DR7B 2UYHA 4RESA 1FDTA 1K9SA 3V80A 4CNBA 3LT4A 1XZLA 4NOKA 5IVKA 1O9GA 5K8VA 1Q1QA 4ZRMA 3BJIC 1E7SA 2RCNA 4CN9A 5D3MB 5IVHA 3WKBA 2DZDA 5JH7F 1EIWA 5K8CA 2OCIA 2VR1A 2HQSA 3QEOA 3Q7QA 3PYLA 3UJAA