2VQ3A

Crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
PKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METALLOREDUCTASE STEAP3
publication title Structure of the Membrane Proximal Oxidoreductase Domain of Human Steap3, the Dominant Ferrireductase of the Erythroid Transferrin Cycle
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.16.1.-:
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vq3A00
1QYDA 5JNLA 3JQ7A 3KSZO 3GDFA 2HJSA 2ZYDA 3GVPA 3DBLB 3MJCA 2E4AA 2UDPA 5L45A 2WE7A 1L7DA 1K5HA 2O3SA 1EUDA 3BHJA 3I9NA 1Z73A 2QZ9A 2GUGA 4XZ3A 2EGHA 3RROA 4DLBA 3DB2A 3DZFA 4EZBA 3C7AA 1ML3A 4U6QA 3GUYA 4BQPA 1Q7GA 1ZUD1 2WMDA 1FDWA 2EGGA 4YAIA 4E5YA 1YE3A 3IDSA 3EUWA 4ZHSA 2O3JA 3ZW8A 4DPKA 4GMGA 3JQ8A 1MG0A 1DO8A 2BGKA 3CXRA 1T24A 2I76A 2EJWA 3WMXA 4L76A 1JDJA 3WIDA 1W6UA 2NWQA 3S55A 4NPCA 3QW2A 1LQUA 1F12A 3V2UA 2IZ1A 4RCVA 1XLTA 2GO1A 4IDEA 3FNGA 4JN6B 3X2EA 2NVWA 1UDCA 4GX0A 3OJ0A 1IL0A 3INTA 1ISMA 4FBGA 5I8ZA 3F6YA 2VRBA 3CMCO 3WG9A 3JQAD 2FR0A 2C5EA 1SEVA 3CUKA 2VYND 2HRBA 3PYMA 1O5IA 4FS3A 4BNIA 5HTOA 3RJ9A 4R5MA 3WQSB 1NYTA 3WBFA 3PQEA 5L7WA 5JC8A 3HZZA 4CMEA 3QP9A 1Z6ZA 3VPHA 5TJHA 3LF1A 4IQ0A 5DF1A 1NTOA 3JQ6A 3JSAA 2G5CA 1BXGA 3WWZA 4AJOA 4CUJA 5JAQA 1GQ2A 3TWOA 3H3FA 2ZK7A 4NJMA 3WJAA 1GEEA 5C3MA 1GV1A 2X5JO 3FR8A 3OJFA 1HLPA 4ND3A 5TRTA 5TX7A 1N5DA 1X14A 1NQAO 2RH4A 4CUZA 4RVDA 3RUCA 3GNTA 3KLMX 5COQA 5I7VA 3DTTA 3BMQB 1NHGA 1NXQA 3DEYX 1VL0A 5A05A 3TL2A 5B12A 5G0WA 3FI9A 3ENNA 4XDYA 1AHIA 4WE3A 5L4LA 1E92A 4M49A 1U8FO 1WDMA 1HL3A 3B70A 2J6IA 3DXFA 1NASA 2W8ZA 1OBFO 1T4BA 3TF5A 1PQPA 1NQ5A 3K5PA 1ZK2A 4HBGA 4BNYA 3WGTA 3HFGA 5DP1A 1HRDA 2JAHA 1LEHA 3VH4A 4MIEA 4RQUA 4E5MA 2VRCA 4YVFA 3V2HA 2PH3A 4MVJA 2X0JA 4YBZA 2ZYAA 3VH2A 5ER6A 3HDHA 2J3IA 4KDEA 4TMFA 1QXSA 2AA3A 3PIDA 1A9ZA 6LDHA 1QRRA 2DTXA 2V6FA 4J90A 1BRMA 1UAYA 1HYHA 3DZBA 4PLTA 2NNLD 4IJKA 1DAPA 1WPQA 4E0BA 3D3WB 5LDHA 5JYEA 1O8CA 1JN0A 1YB1A 3UH1A 1HETA 1MGOA 4BUCA 2ILTA 4P22A 3RU7A 3LK7A 4GKBA 4UVDA 2VWPA 3BHIA 1MG5A 1FDVA 1B16A 4E32A 4CV0A 2VUUA 5FWNA 4U0KA 4AJEA 4D42A 2NVUB 3GNSA 3QE3A 4R1TA 3K8ZA 3GR6A 2CDCA 4CM7A 3AU8A 4A7PA 1OC4A 3VKVA 3KSDO 4CR8A 2J3HA 1ZH8A 3DMTC 4IMPA 4JLWA 5T67A 3AUUA 1LC0A 3ZU2A 4MVJG 5U9CA 3BMQA 2IDZA 1P9LA 2QHXA 1WMAA 1ZVMA 2VZ9A 3NTRA 5HRUA 1V3UA 2YW9A 3PQDA 3DQPA 3WMWA 3ZWXA 5JS6A 3V2GA 5KWEA 2I5PO 1NWHA 5IZ4A 5JAIA 1ZEJA 1MC4A 4YWJA 2W4QA 5EERA 2JL1A 3GAFA 1GZ3A 3BMCB 3RU9A 1T2AA 1ZKMA 3E82A 2P91A 3DBHB 1LSSA 3V1YA 3AWDA 3ITKA 1EBFA 8LDHA 1R66A 1VJ1A 4PG7A 3PWZA 1ZJZA 3AY3A 4IDFA 4XKJA 1C1DA 3RC7A 1Q2XA 4GX1A 5G2OA 3RKRA 2FSVA 2J3JA 4NK5A 4JNKA 2ZJ0A 1BWSA 5I9NA 1CYDA 4OM8A 1YL7A 4QFCA 1ID1A 2PKRA 4XB1A 5L4NA 3OFSA 4Y6SA 3TSCA 3LC7O 5H82A 3KXDA 3ZWWA 4AVYA 4B4WA 4CM4B 3JD3A 5KVSA 4FC6A 4QFDA 3QLJA 3D5TA 4NH4A 5GZ3A 1ISIA 1KVQA 3NGLA 3NJ4A 1R4MB 3GEGA 2A94A 1A4UA 4UVGA 2NVUA 1BTOA 1HWYA 1W8DA 3D7LA 1NWCA 4IGEA 2FHSA 4UVIA 4U5QA 3OJLA 1ZFNA 2YQ4A 5ES3A 3ZHXA 1PR3A 1E1LA 1PJ4A 2HUNA 1UZLA 1V6AA 4N54A 1RYEA 1LRLA 3OMLA 2OXIA 3G0OA 3DC2A 4CMBA 5TT0A 1XQ1A 3ST7A 3X2FA 4F45A 3RVDA 2CY0A 3WTBA 4GVXA 4WLEA 2QZZA 4PLPA 5TS3A 1A72A 4LRSB 5A5EA 1UXGA 1G0OA 2X86A 1VJ0A 3PJDA 4IXTA 4Q3NA 3G49A 5JSFA 2PZMA 1BMDA 4AICA 2OP0A 4Z0HO 1YRLA 1KC1A 3DBHA 4W7IA 7MDHA 1V9LA 4MKXA 5B37A 5GMOA 3RD5A 2P5UA 3TNLA 4LISA 5JCXA 1U7TA 5I8WA 1J49A 1KVSA 2EP5A 1BVRA 4FR5A 3VPFA 1R0SA 3JD4A 3WB9A 4QUKA 2AE2A 3L4BA 2RBEA 2UUPA 3WGIA 1Y8QA 2CMDA 3L6EA 2O48X 1PZGA 3FBTA 5FYDA 4CM4A 5F1KA 1EFKA 4JCOA 2X9NA 3M1AA 1I2CA 1LX6A 2WSBA 5L53A 7ADHA 2H63A 4R9RA 3SJUA 2E82A 3UF0A 1P1KA 1GTMA 1LSUA 1VRWA 4W4TA 2B5WA 3OIDA 1NAIA 2VHYA 3EAGA 3IJPA 3FNFA 4DQUA 4KQWA 1DRVA 2RCYA 5DOVA 3HADA 3LU1A 3U4CA 1LNQA 3MCVA 3PXXA 4TROA 4GQAA 1GCOA 4CLOB 2DBZA 3JV7A 5EN4A 5EMHA 4J7UA 4RF3A 2V6BA 1UAGA 1PGOA 5IZCA 3GN1A 3ITDA 4WOJA 4Z6KA 1PSDA 3BMNB 1GQQA 1KS9A 1T1SA 1UP4A 5L4SA 2NU8A 4BO0A 1AUPA 5GY7A 4R4JA 3U0BA 1KC3A 3NYWA 3GGPA 3VZRA 1E3JA 4BO9A 1EE9A 3L6DA 5G4KA 1Y8RA 4HX5A 5TT1A 3RBVA 3UICA 3NT2A 4RF4A 1GUFA 4CLDA 2ZATA 1GYRA 4HFNA 4XRGA 3CPSA 4NDNE 5JBIA 2Q1WA 3HB4X 4PVCA 2VN8A 3CMMA 3SLKA 4IIVA 1FDSA 2X8LA 1E7YA 3ZDFA 4XCVA 2Y67A 4BNHA 4IJVA 2VNAA 4B3JA 3Q0EA 4FDAA 4MO2A 2Z5LA 3ORFA 4OOFA 2V7PA 5KJCA 1YOVB 4PZDA 1O6ZA 1WWKA 3HN2A 5JXWA 1IYZA 3FWZA 1JQBA 2DT5A 1RM0A 5FF9A 3IUPA 1MP0A 4XEHA 4OYRA 4JX8A 1JVSA 5F1OA 1E1MA 2PFGA 2Q2VA 3IIEA 3LVFO 4JBHA 1FDUA 1GPJA 5BSFA 5EINA 3GMSA 4ZJUA 2RHRA 4ZRMA 1XU7A 3GT0A 1PL7A 1QKIA 1LDEA 1SBYA 2BRUA 4NBUA 4EEZA 4BNVA 1JW9B 3ANNA 4YXFA 3MWEB 5CFZA 1DC6A 3GN2A 5CHEA 3VDQA 4E21A 2AQHA 2OOSA 3L9WA 3BMNA 3AY6A 4ZRNA 3UW3A 1JU9A 1PZFA 4HFJA 5IDYA 3WOHA 5CP8A 1M6HA 2X5OA 3RBZA 3KUXA 1VSUA 4CV2A 1WW8A 2VHVA 2JFHA 1BVUA 4BO4A 2GN4A 3HSKA 3JQAA 3TZQA 4IIUA 4CLXA 5JFOA 1M6WA 2FN7A 3AFMA 4CV1A 4DQVA 1KIFA 5HS6A 3W8DA 2AHRA 3PEFA 2G76A 2Z1NA 3PYLA 3PHGA 2I99A 2YDXA 4IS3A 1UDAA 2W98A 5EESA 3WFJA 4D7AA 3LSYA 3PDJA 3KHUA 1MV8A 1QSGA 1O0SA 3FR7A 3KTDA 3R6DA 4L0QA 3TDKA 4LN1A 4YT8A 1YOVA 1BDMA 2QG4A 4IUYA 2YHUA 2Q1TA 3C3XA 6ADHA 1I10A 1YONA 1IPFA 3GHHA 5G0SA 4AFNA 4EUFA 2I67A 2LDBA 2Y99A 1E7WA 4EDFA 4LK3A 4RPGA 2H9IA 2NM0A 3GRPA 4LW8A 2O7QA 1N1GA 2HCTA 2HQ1A 3BHMA 2FWMX 4Y9DA 1QG6A 4NBTA 2Y66A 1O89A 4BNTA 4Z9YA 2WYWA 4INAA 4ONEA 4J7XA 2HKIA 1I2ZA 3W4IA 3TZCA 1KEPA 4BNJA 1OC2A 4RLSA 1YBAA 3RAJA 4NI5A 4FIZA 1BXKA 4L4SA 4JJIA 3TL3A 1T4DA 1B7GO 2I9PA 4OXKA 4KZPA 4I9NA 3OP4A 5CDTA 1HTBA 5ILGA 4DYVA 4UEJA 3I3OA 1YS4A 5G0UA 2JD2A 2G82A 3DHNA 3CINA 4NBRA 4XWYA 4CPDA 2EHDA 4II2A 4RV9A 3UXYA 4YAKA 1P1RA 3RIHA 3L9XA 4E33A 5L3ZA 1D1SA 3RFTA 1UXKA 2O3RA 1SAYA 4NQZA 1E7RA 3UCEA 3PPIA 2I66A 1DJQA 3O8QB 3CKYA 5K9ZA 3RC9A 3C7DB 3MEQA 3ZNOA 4F3YA 4XIJA 4B7UA 4UUNA 5A9SB 3A9WA 3FPLA 5ITVA 3UOGA 5IDWA 4GGPA 1HDZA 4M54A 5I7FA 1U5CA 4O6VA 4PN3A 1TLTA 1OFGA 3EW7A 3I9KA 2IE0A 1EUCA 4CODB 2CUKA 1HF3A 1JTVA 4ALIA 2Q2WA 1HSOA 3M1LA 3EZYA 4MVJI 3L0DA 1CETA 4OJNA 3F9IA 3PLNA 1F8GA 1PR9A 1TVEA 2GERA 1R16A 4D3FA 3DR3A 4ZQGA 5AYVA 3IKTA 3RASA 2C7GA 1HDRA 3AI1A 4JROA 4QSMA 3U3XA 3W4KA 4WLNA 3ROKA 2ZB7A 3K6JA 4QQRA 2XOXA 5I9MA 1Q7BA 2B4TO 2HRZA 1NPTO 2FPIA 3WNVA 3ANMA 5L40A 2W2LD 1U8XX 5T5QA 2W2KB 4MINA 3ZNQA 5JDIA 3KV3O 3HQ4O 5THQA 2CDBA 5JCJD 5EQDA 1H6DA 1ZMOA 3D64A 4M86A 2YHIB 4Y6PA 1E7QA 4EJMA 3NDIA 1AXEA 3MOGA 4J7CA 3VTZA 3PZBA 5IN5A 1X13A 4B3HA 1Z74A 1VJTA 4BMNA 5MDHA 3QVTA 1QMGA 4W9NA 4BNXA 4PLVA 3H4VA 3GG2A 1NFQA 2DUUA 3IQDB 3GQVA 4WEQA 1O95A 1ONOA 4A10A 1E1NA 4IZHA 5JAZA 4OSPA 1T26A 2NU6A 1EBUA 3C8MA 3PGJA 5DZSA 2NACA 5JLAA 2YDYA 1FF9A 4ESOA 1Y5RA 1R0LA 3G3EA 3JQBC 2Q1SA 2E37A 2O3TA 5HBRA 4IJUA 4HWKA 5A1TA 1PJQA 4CQMD 4BO1A 2JHFA 3N58A 2VTDA 3BTVA 4PCVA 5JDIC 2FZEA 3K30A 3AI2A 3FCOA 1NHWA 3E9QA 4YPOA 5CG1A 1E7MA 1LLCA 2PV7A 3OJEA 4FFPA 1I0ZA 3IUSA 1D4FA 2TMGA 1P44A 2ZTUA 4IY1A 1EVYA 2PNFA 2ZB4A 3BZUA 3PHIA 4TVOA 1XKQA 4YTEA 4RF5A 1Q0LA 3F4BA 4CLHA 4E6PA 2CF5A 5KVVA 1SPXA 4LCJA 3HUDA 4YT2A 4TKLA 3DZKA 4L74A 3VVCA 4R1NA 1ISGA 1P0CA 3JQCA 3KM0A 4BO2A 5JPIA 5K6AA 1DBVO 4I5GA 2ZYGA 4ILKA 3TQHA 1Y9AA 4AJKA 3BYZA 1ISHA 2RIRA 3AOEC 4P4LA 1DRWA 2YHIA 4OQZA 4BVAA 1NNUA 3VVBA 4XGIA 1B2LA 1ZK1A 1KYQA 2PWZA 2J5KA 1LC3A 4I1IA 5EPOA 4AJ2A 4CMKA 1U3UA 2V65A 4N18A 4ZA2A 4AJIA 2VQ3A 1VI2A 4D3DA 3ZWNA 1HEUA 1G1AA 3P2YA 2O2SA 1X0VA 4RPHA 5AXDA 3M6IA 1X7GA 2PZKA 1MLDA 1Q0QA 1JKIA 5JMPA 4LVCA 5BSHA 4IZIA 3SVTA 4B7XA 1LDNA 3FBGA 4JBIA 4J9VA 4RPLA 4BIIA 3GOHA 4UULA 3COSA 1QV6A 1ONNA 1C14A 3I9LA 4BNGA 1GDHA 3E18A 3ZHZA 3E5MA 3O9ZA 3RUIA 5I7EA 4DYDA 2FP4A 3OIGA 5T64A 2G17A 1PU2A 3TOZA 4P8RA 4UEOA 4HXYA 1BXGB 3F1LA 2DPHA 1WMBA 4NJMB 3H9GA 2X23A 4BO8A 2VTEA 3ZV3A 4EGFA 4EJ0A 3ZHYA 5TLSA 4IDCA 4OL9A 5C7LO 1U3VA 1NX6A 3IP3A 5IN4A 1FJHA 4Z9FA 5CDUA 3OEYA 4D79A 4ID9A 3H6KA 3WYCA 1GCUA 4QTZA 4KUHA 1HZZA 1LRKA 3VC7A 2Q1UA 1GQYA 2AG5A 1D3AA 1NVMB 4Z0TA 1Y9EA 2C59A 3BTOA 4BNFA 1EK5A 1YWGO 1YVEI 5HS4A 4NG5A 2Z95A 2P4QA 1PWZA 4E2XA 3WTCA 4FPXA 1QR6A 1Q1NA 1YQDA 2IZZA 4HFRA 2C0CA 4DQXA 5A3VA 5IXSA 3P7MA 1I30A 1FDTA 4GWGA 2HMVA 1U9JA 3G1UA 4FQ8A 4MVJP 3HN7A 3K31A 1UUFA 4XYLA 4NJOA 3H9JA 4LCEA 2JFGA 3RCBA 1AE1A 4E12A 4HFMA 3F4LA 2CVQA 3D4OA 4BV8A 2YV2A 2UVDA 4FFOA 3PJGA 4DPLA 3BA1A 3A4VA 3D1LA 4WCDA 1UZMA 3TRIA 3EK2A 1IUKA 2VHWA 3IL2A 1KVUA 2GRAA 1C0LA 2X9GA 4AG3A 4CL8A 1H6BA 1PS0A 1HE2A 2NU7A 3B6ZA 4YCAA 4K1LA 4F6LA 3AM4A 4IJWA 1X1EA 2D8AA 4KUGA 3VPGA 4M8SA 1C0IA 3RQSA 2X6TA 3TN7A 4JJGA 1DHTA 4NZ9A 2O7SA 3KEOA 3ZN2A 5K0ZA 4GAEA 3H2SA 1QLJA 1EMDA 1DOHA 4NK4A 4CMEC 4E30A 1I36A 2IEDA 2GGSA 3SC4A 4BKQA 2VUTA 1ZW1A 3DTYA 1C1DB 4CMJA 3KOUA 4IQ8A 3ROQA 3L4SO 3UKOA 4DA9A 2EW8A 4P4NA 3RFXA 3GAZA 4OSOA 1NR7A 2D5CA 2NQ8A 5COBA 1PGNA 3U49A 3OBBA 3JYPA 5CEEA 4YRAA 4YR9A 1MUUA 4DBVO 4FGWA 5CPBA 4MVJM 1ZJYA 1HKUA 1MXHA 2CD9A 4L4XA 2XF8A 2D3TA 1MB4A 3DHYA 1J0XO 3H7AA 2X58A 3WGHA 3QVSA 3WGZA 5KJFA 4IM7A 4CM5A 2HJRA 3KYDA 3PZRA 4WECA 2DKNA 1I3KA 5JC1A 3Q9NA 2D0IA 1LUAA 3P5SA 1QP8A 4GPD1 1BGVA 3PFFA 2JAPA 1CRWG 1L7EA 1U2DA 5B4UA 3JYOA 3KYCB 1N9GA 1CQJA 1U4SA 1XQ6A 2OBYA 2O23A 5A5FA 3F3SA 2JD0A 3L6OO 4TKMA 1KEVA 1SCUA 1HE5A 5DNAA 5KJEA 2GN6A 1PGJA 4WEOA 4HNGA 4U0JA 3OA0A 5F3RA 2EWMA 5KJ6A 4YAJA 2ZQZA 4UREA 3I9JA 4I08A 4RZHA 3TZHA 4D41A 4NR0A 1Z7EA 2VZ8A 4KOAA 2QW8A 5FI5A 1X7HA 2JHGA 4PLYA 3ZU3A 4PVDA 4ZU3A 3H9QA 4B4UA 4MVJF 2BKAA 1NVGA 1UR5A 5C37A 1WLYA 4AJLA 4DXHA 3AOGA 1PL8A 3BMOA 1C0KA 3INGA 1T2EA 2AQ8A 2AW5A 3VHRA 4J1QA 2C2XA 3H5RA 1WAMA 3AI3A 1DIRA 4XD2A 2X1HA 1ADFA 4ZQEA 4TRRA 4BNWA 2XAAA 4G81A 2BLLA 2DQ4A 1Y8QB 5F1PA 1XHLA 3CTMA 4HADA 4D43A 3BTUA 3NDRA 4YACA 5IF3A 2YJZA 5EL0A 2FR1A 1IY8A 2I3AA 4R01A 3RFVA 4E2ZA 2IRWA 4WLUA 4K6FA 4MPDA 3GPIA 1UP7A 4XRRA 4BL5A 2EERA 2Y0EA 1DIAA 2OO5A 1HE4A 3EVNA 3KYCA 3GPDG 1F0YA 2G0TA 2QYSA 4PRKA 3R3JA 2DBQA 1DIBA 1O94A 3E48A 3HDYA 3GF4A 3GFBA 3G1TA 3DHEA 1FXSA 4DC1A 1JA9A 4Q3EA 1DJNA 4BKRA 4BNLA 2O3QA 2OL4A 4CMGA 1H2BA 3E5RA 1XEAA 3KEQA 3JD2A 4P38A 2DC1A 5J23A 4IGFA 1RYDA 2R6JA 2VCYA 3U4IA 5KVQA 5DCYA 1UZNA 1Y8RB 2WJPA 4YJGB 1YBVA 5G4KB 1PJCA 3ZV6A 4H7PA 1PJTA 1YQXA 5THKA 4AJ1A 4OO3A 3ETGA 1ARZA 3Q6IA 5U4QA 1DEHA 3TZKA 3W4JA 4EITA 2Y05A 4DTIA 1Q7CA 1GUYA 2D5AA 3LF2A 2G1UA 4GMFA 2AEFA 3HB5X 4KQXA 4CM8A 1PWXA 2VZ0A 1Z82A 2WYUA 2X0NA 1RM4A 4XJSA 4A2CA 2B5VA 4XQCA 4DVJA 2X7HA 4E5PA 1I3MA 2OP1A 4JIGA 4TQGA 2BFPA 5H83A 4B8ZA 3AJRA 2YV3A 3QWAA 4IBOA 5F21A 1SEPA 4ROSA 1PJBA 4PLHA 3SX2A 2AEJA 3NUGA 3QWHA 3W6UA 3NKLA 2NSDA 1F17A 1G0NA 1LI4A 4NFSA 3AM5A 4RJTA 4BNZA 3FTNA 1VE9A 2PKQP 3PHLA 1YBMA 1ENZA 4RVUA 4P4GA 5A4DA 2CDAA 5ILOA 3V1UA 3FTPA 2IYOA 3Q11A 3DBRB 3IC5A 4ZQFA 3VPXA 2B83A 1I3NA 1YDEA 4CQLA 3QQPA 3S8MA 4R1SA 3H5NA 3QIVA 4RVGA 2E48A 5KNLA 3L4BC 3DMYA 2Q50A 2ZKLA 3U09A 1DFIA 2AMFA 1RKXA 4YQZA 4FB5A 4CMIB 1JVBA 4BS9A 1PZEA 2P9EA 3JQAB 1E0DA 1PEDA 4YJGA 4OIMA 3PDUA 5L7YA 2O50A 5KVCA 3I5MA 5A02A 1CERA 5BT9A 3GVXA 3QV1A 3U4HA 1RM3A 1SO8A 4O59O 2BELA 3DBVO 4QO8A 3I6QA 2ET6A 1KERA 1T2FA 1FK8A 4IS2A 5JO0A 3WGOA 3SEFA 5IZCC 2O3UA 2YFHA 4RDHA 2CNBA 3ONFA 4N5NA 3UCXA 1FMCA 1ZK0A 3PFWO 4U8GA 4BGVA 4Z3KA 4U7WA 4ZD6A 4YT4A 1QYXA 1SOVA 1N7HA 2PKQO 4KDFA 4RVHA 4MP3A 5KJ1A 4GX5A 1KY5A 1VM6A 3F1KA 1GFSA 1U3WA 1SNYA 3QWIA 4EEXA 5CEJA 4Q3AA 2RAFA 4R54A 3KO8A 3B1KA 2X22A 3A28A 1D7OA 5TSDA 2NQTA 4CMCA 1A4IA 4RF2A 3SXPA 3DBRA 4EJ6A 4L9RA 2HSDA 2CVZA 2WE8A 2VHXA 3ZI0A 3ZW9A 3V5NA 1MA0A 3B1FA 3OQBA 1CJCA 1HDYA 2EP7A 4J6FA 4FOSA 1UH5A 2DBRA 4CMIA 5L9AA 2PA3A 3GY0A 3C1TA 4WJZA 4WGGA 2PZLA 2VYNA 2X9VA 4OXYA 1A9YA 1R0KA 1L1FA 2A4KA 4MIOA 4MDHA 2Y0CA 5IDXA 3RC1A 4XGNA 3RKUA 1GY8A 1GADO 5CPFA 3WS7A 3GH3A 3MJVA 2YQ5A 2D2IA 3H5AA 1AN9A 1KOLA 3WJ7A 1ZK4A 2PTGA 2FOIA 2I3GA 3ZWVA 1X1TA 5JY1A 1AGNA 4E3ZA 4FFLA 4RQTA 3H2ZA 3ULKA 1J6UA 2JKVA 1TEHA 3GVCA 4YYZA 5A06A 1XIVA 4B4OA 3PWSA 3BAZA 3OH8A 2QQ5A 3GA0A 1ZO8A 4AJJA 4C7JA 3CSDA 2PD6A 1XSEA 1YDWA 2HLPA 4TZKA 2JCXA 3WQQA 4E13A 1R37A 3VOSA 3LZ6A 3VTFA 1PGPA 3UFXA 5HM8A 4GKVA 4J43A 4A03A 1B14A 4DL9A 3NT5A 4RORA 1JWBB 3FNHA 1GYPA 2W90A 3CEAA 4G65A 2OGUA 4CR6A 5C7OO 4MVJD 3H9EO 4YT5A 2H1SA 3FN4A 4YAGA 1ORRA 5KTKA 2TMDA 1S6YA 2C2YA 1VKNA 5ADHA 2C5AA 2GLXA 3F5SA 2BMAA 4XIYA 1JWAB 1BHSA 5BR7A 3ZWOA 1XU9A 4IDBA 3D0OA 4XYEA 2BH9A 4LGVA 3ZNPA 4JBGA 5EJ2A 2WM3A 4CJXA 1GZ6A 5LDGA 2FSSA 1EDZA 3A06A 4Y98A 3VH3A 3ZWPA 3ZGYA 1JAXA 2DLDA 2GN9A 4GX2A 5TGDA 3ETDA 2VWQA 1YXMA 2BGLA 4OH1A 4N7RA 2EKPA 1MXFA 4PLZA 1B3BA 2JCYA 2PLAA 2GYYA 2IEBA 2Q45A 4OOEA 3T7EA 3ONEA 5COAA 2YYYA 5BNTA 4KP7A 4TWRA 4BO7A 2B0JA 3GFGA 1O9BA 1ADGA 3OIFA 1ADCA 1LLQA 4I9UA 2BFMA 2JD1A 2VT2A 4KTVE 4NMHA 5FI3A 3R1IA 1I8TA 4PLFA 5JE8A 3HDQA 5A03A 1IULA 4N5MA 2Y1GA 5MGBA 3I23A 1B8UA 3IKVA 4Y6RA 5BNIA 2HDHA 2PR2A 5FEUA 3GDGA 4W82A 2GDZA 1DFHA 1DAOA 3NX4A 2CF6A 3MOIA 3D4NA 1YB4A 3GHYA 4L73A 4HUJA 5DBFA 3W8EA 2XPCA 4N5LA 2HMSA 3JQFA 1P1JA 3B20A 3FD8A 1TA4A 2P2SA 4RL6A 1M76A 1ZZEA 2NV6A 1WDLA 4ITUA 1GL3A 2B4RO 1WP4A 5ITWA 4I5DA 2D59A 1BG6A 3G17A 1GEGA 5EQFA 2WD8A 1P33A 1DLIA 2ZTVA 1OOEA 3H65A 5HWSA 3TJRA 4J4BA 3BXXA 4II3A 1HZJA 4ALLA 4GI2A 3GC6A 1LTHR 1GR0A 3S1LA 1ADBA 4I9HA 4WCFB 3JQ9A 4AJHA 4MP8A 2DVMA 2VHZA 1GUZA 3DAFA 1AHHA 3WNQA 2FPPA 2D4AA 2Y0DA 3GG9A 3AUAA 2X0RA 1P77A 3TOXA 3K9QO 3MTJA 1VL8A 3PTZA 4H3VA 1E3SA 2B36A 4J49A 4OHUA 3RSHA 5DP2A 1LLDA 1MX3A 3JQFC 5DBGA 2QX7A 4GVLA 3NDJA 5AXCA 5CDYA 2DTEA 3RJ5A 4BO6A 1QYWA 4BO5A 2C07A 4AJ4A 3JD1A 1G6KA 3EC7A 2DFDA 2O2YA 2B69A 4GSLA 2P9GA 5F5NA 1NFRA 1ISFA 1P45A 4WOKA 2EG9A 4CLEA 1HLDA 3NV9A 4JQCA 1E6UA 5ICSA 4IPTA 3UGKA 1N8KA 2NTJA 4I5EA 3JQ9C 3ENKA 3RUHA 4E4YA 4R3WA 1BW9B 3PWKA 4J2OA 1MFZA 1YH3A 4O63O 4W9NC 3PI7A 4WASA 3ASVA 4OMUA 2HK7A 4EW6A 1F8FA 2DAPA 1GV0A 2FMUA 3S2GA 3HG7A 1OAAA 4WPGA 4L4RA 1PJLA 2DM6A 1XG5A 3IOYA 3GRKA 4J1SA 1XELA 3QJ5A 1EK6A 4YAEA 1SB9A 4EUEA 3AFNA 5AOVA 2PGDA 2O4CA 2Q49A 3ADOA 5BSGA 3WBBA 4RGBA 2Y68A 4C7KA 1WZIA 2GR9A 1B0AA 2Q46A 1VKOA 4Y67A 2BHLA 2GZ3A 3QWBA 1ZNQO 1TT7A 2C54A 2R2GA 3ZWAA 3R0IA 4XYBA 3LLSA 3PHJA 3WSVA 4WCFA 1NPYA 3Q9UA 4FN4A 4WLOA 3RUEA 3O4RA 1DC4A 3ZV5A 2FY8A 4BGUA 5DCWA 1U5AA 2ZTLA 1H6CA 2H5LA 1DLJA 3NEPX 3MJTA 4PLWA 4TRMA 5AQ1A 2V6GA 2EF1A 2HMUA 4J9UE 2BFAA 3FHLA 4FGSA 1VLLA 3PJEA 3EHEA 3CH6A 1P31A 1YL6A 3EZLA 4HKTA 4IMRA 5L95A 3WDSA 5K6AC 3W8FA 1E3WA 4R68A 1LU9A 2DFVA 1PQWA 3IP1A 3LC2O 4U6SA 1ISJA 1PL6A 4MKZA 3IAHA 2NVBA 4J0FA 4GL4A 1SB8A 2PY6A 3QVOA 4YA6A 1LDMA 1X0XA 2NTVA 3FPCA 3INRA 1BW9A 1H0KA 2Q4EA 5EIOA 1GU7A 4A5OA 1IPEA 2UUOA 5H81A 3TZ6A 5TIIA 1K0UA 4J1TA 1E3IA 1UP6A 4DLLA 3Q1LA 1PS8A 3W6ZA 4MP6A 4YJHB 5A3JA 3LQFA 4Q39A 2J5QA 2Y1EA 2P5YA 1IB6A 3PYXA 1K89A 3U5TA 4RPKA 4DBZA 4UUOA 3DOCA 1EUZA 4EBFA 1N7GA 3JCZA 2VYVD 4ALMA 5I9LA 2C82A 2HU2A 3JQEA 2CVOA 3UN1A 4E2YA 1OI7A 4IINA 5T6BA 2C7VA 1DIHA 1EQ2A 3F5QA 5JW6A 1KVTA 4XQEA 1LBEA 2BF7A 1YB5A 5B4VA 1GYQA 1YGYA 4D0RA 1GPDG 4R16A 1HDOA 3S2EA 4XDZA 4EI2A 2DU8A 2NUAA 4UUMA 3OECA 2NU9A 1CF2O 1DXYA 2PGLA 4K28A 3JYQA 3ETEA 2Q99A 2EJVA 1P1IA 1H94A 1I2BA 1Z45A 4DIFA 4XA8A 2EEZA 1QV7A 3N7UA 3KYDB 2I65A 3K2EA 2E6UX 1H2HA 4ALNA 2EKQA 3KBOA 1XGKA 1ZSNA 1N9GB 1IE3A 1LXCA 2WD7B 3U62A 4ZN6A 2QRJA 3NTOA 3PHHA 3RWBA 1CWUA 3W1VA 3G79A 1I24A 1VSVA 3HHPA 1ZXBA 3DZJA 1QLHA 2CSUA 3I83A 4M87A 3RUDA 4FCCA 3DOJA 1V3TA 3GDOA 4BO3A 2J8ZA 4M55A 3I9OA 3T4XA 1ENYA 4K26A 1EDOA 4BKPA 5CDSA 1HE3A 2WDZA 4E5KA 4W6ZA 2NADA 3DBLA 4J16A 4YJHA 9LDBA 2C29D 4PFJA 4LVUA 3EYWA 1ZK3A 2QYTA 1H93A 1ZBQA 4I8XA 4JJFA 4ND4A 2ZIZA 4B8WA 5CG2A 3MJSA 4R5HA 3QA9A 3EVTA 3BMOB 3WYEA 5L51A 4QECA 5JDCA 3UUWA 1M75A 4GWKA 3LT4A 1I01A 5B1YA 1U2GA 2F1KA 4PZCA 2HAEA 1Y1PA 4R41A 4XB2A 2JJYA 4QEDA 4LRTB 4JK3A 3GZ4A 3AUTA 3IS3A 2O4UX 3E8XA 4J4HA 1B15A 3ZZNA 2JCVA 2DPGA 5G0TA 3EGOA 3KSUA 1NFFA 3ZWBA 4K6CA 3TFOA 1EEHA 3F47A 4NIMA 1PJSA 1N1EA 4DRYA 1LSJA 3DMTA 1V3VA 1TT5B 3I4FA 2GD1O 1K6JA 2A9FA 2UV8A 2BI8A 3OA2A 4RDIA 4Z9XA 1KY4A 3E1KA 3MTGA 2J3KA 4GLOA 3NAQA 2GNAA 4NU5A 2WD7A 4XQGA 1Y7TA 2CFCA 3GUCA 1E77A 2GN8A 5C7IO 5DN9A 5JDCC 3U4DA 4MVJH 4BNNA 2AE1A 3GMDA 3Q3CA 1KBZA 3LT0A 1EZ4A 3VAZA 3ZHBA 1LLUA 2H6EA 2GF2A 3KB6A 1R6DA 4FOOA 4KWHA 2B35A 4YEDA 2AQIA 4NFHA 5IDQA 4R3NA 2J5RA 3O26A 4KUEA 4OGWA 4DIBA 1NR1A 1N2SA 3ZU5A 4YDRA 3C1AA 3NT4A 1BSVA 1B3RA 1RPNA 1CQIA 2AXQA 2EV9A 2WWRA 4BMVA 5KKAA 4E2WA 4O1MA 1T2CA 1ENOA 4CQMB 4IDDA 3N74A 4CM8B 4CV3A 1UXHA 2OORA 4PG6A 2HMTA 3ROMA 1DRUA 5TJ9A 3VKUA 3AM3A 5DOZA 4AJNA 3ZWCA 4MOWA 1W0CA 2PD3A 2LDXA 4EYEA 5A9RA 1EVJA 1JKFA 2WTBA 3KYBA 4FW8A 1LDGA 1ZMTA 2GCGA 4GH5A 3HNPA 3D4PA 3C1OA 5ENDA 4MKRA 4YJFB 3PQFA 3VZPA 1H9AA 4WUVA 5GZ1A 3WR5A 1TT5A 3RUFA 5FFFA 4WLFA 1SMKA 4PG4A 4O0LA 4WKGA 5AXBA 2W2LA 2DUWA 3DOOA 2EW2A 1IZ0A 4XYMA 3JYNA 4CLRB 1Y5MA 3R3SA 5JCJA 3FNEA 3D3WA 5GZ6A 4CQLB 1V0JA 4G5HA 4TVBA 4Z3DA 1PS9A 3MJEA 1T25A 3EDMA 3GGGA 3LLVA 4URFA 1E6EA 4IXWA 4CR7A 4ND2A 1ZSYA 2QIOA 4J3FA 1ONPA 2VWGA 4CM9D 3SLGA 3ON5A 2EKLA 1VPDA 2RH8A 4PZEA 3DO5A 5KIAA 3HFSA 4O5OA 1WDKA 3LC1O 3U9LA 4AL4A 2ZCUA 1E1KA 4GBJA 1K6XA 4BNKA 4EUHA 1YJ8A 1DB3A 1PX0A 3VDRA 5IXYA 1HT0A 3CZRA 1OZAA 1RWBA 2AQKA 5T57A 1YL5A 3GEMA 4PG8A 3LDHA 2WEKA 3GEDA 1EE2A 1YO6A 4CQMA 4UAGA 4D46A 3GVIA 4QXMA 1D8AA 1P3DA 1PGQA 3LYLA 2B37A 3BMCA 3E9NA 3K92A 4OXNA 2OBNA 3CE6A 3P19A 1NP3A 3WFIA 1RM5A 3ROPA 2DTDA 5AVOA 4ALJA 1Z75A 1QYVA 3PP8A 1MFPA 4YJFA 3TPCA 4Q9NA 2VNSA 1CEQA 2UAGA 4ZQBA 4A73A 3VH1A 1GAEO 5TNXA 5I7SA 2IYPA 3WLEA 4R9SA 1P74A 1B26A 2BGMA 4CLRA 3E9MA 5F5LA 3JQDA 2PD4A 5B4TA 4HV4A 3GLQA 5LCXA 4BMSA 1KVRA 4J91A 1C3VA 3WIEA 4KWIA 3E6AA 4JP2A 4D0SA 1QORA 4IDAA 2GASA 3O38A 1U1IA 1WNTA 4YB8A 1DPGA 4DUPA 1R4MA 3JD0A 1M67A 2YFQA 4KTTE 3DZIA 2P4HX 1W73A 3ZH2A 4TRNA 3UCFA 2FRDA 4FJ0A 4BQRA 1UXJA 4IQGA 3C24A 1DC3A 1F14A 2FZWA 4ALKA 1UJMA 1NQOA 2VOJA 2IZ0A 1KEUA 2ZQYA 3QHAA 3WICA 3GZNB 3I6IA 2VOEA 4M89A 4UUPA 3HWRA 3ADPA 3BIOA 1IZ9A 3ZWMA 1A71A 2Y1DA 3JQGB 4CM1A 2Q2QA 3EMKA 4HNHA 4PG5A 3S2IA 2X0IA 2ZJ1A 4B4VA 5JO9A 4YRBA 1WVGA 3DONA 2VT3A 1ZXLA 4IDGA 4RZIA 4OQYA 4RVFA 5ICMA 1A7AA 3RUAA 3DWFA 1QYCA 4LMPA 2OUIA 1CDOA 4LSMA 3PLRA 4I5FA 4LMRA 1C1XB 4BGIA 4B3IA 1YKFA 1S7CA 3SJ7A 3DFUA 4BNUA 9LDTA 4XQ9A 4ND1A 3MWDB 4PRLA 3PIIA 3FSRA 4Q3BA 1K3TA 3OQ6A 1PJ2A 4DWVA 1PTJA 2OHXA 3VZSA 4YRDA 5A04A 1LA2A 4L8VA 3IJRA 2HO5A 3QVXA 3UHAA 3VPSA 2X5KO 1SZJG 3IMFA 2FR8A 4KMSA 4WLVA 3T4EA 2VYVA 4DLAA 5KOIA 4D44A 1Y6JA 2WYVA 3T7CA 3ASUA 1ZIDA 4WNCA 3AUSA 1Y81A 3EY4A 5JY6A 2D1YA 1H9BA 4CMAA 3K73O 4BOYA 1HDCA 1R15A 4NNJA 1HDXA 5CEFA 1E7SA 3VZQA 3JTMA 4ZICA 4NFYA 3HE3A 3F46A 2E49A 4CLOA 4JXKA 3KVOA 3D5QA 4CL3A 1TI7A 1SC6A 4J4TA 4Q3CA 2OFPA 1U28A 4PLGA 5TF4A 4FFNA 4OAQA 1DHRA 1ZEMA 1LRJA 4PIVA 4UVEA 4R69A 4TZTA 3GZNA 1K6IA 1DIGA 3C7CB 3NRCA 3DZHA 3MJ4A 4JGBA 3ZU4A 1HYGA 2GZ2A 3GK3A 4BKOA 1K2WA 1LDYA 2A92A 3LT1A 4HY3A 1V35A 3L77A 3WSWA 3JQGA 4D3SA 1U3TA 4RLHA 2EXXA 5IFLA 2ZTMA 1IOLA 1A7KA 3AY7A 2PH5A 1NVTA 3STHA 1ZSVA 1OMOA 3WWYA 3RBXA 5U1PA 1M2WA 4BB5A 5JYDA 3OQ1A 4QT0A 3KLPX 3WGGA 1DSSG 3ICPA 2NTNA 4Y8VA 1C1XA 4NU6A 1E5QA 4XYGA 4E31A 3WLFA 3QVWA 4PLCA 5A9TA 1BDBA 1JLLA 3GGOA 5BQFA 5CDGA 5TC4A 3CZMA 2RHCA 1HDGO 2VRCD 1DFGA 5HA5A 3WYBA 1UDBA 2HMWA 2P68A 4HP8A 4BV9A 3KRTA 3FF4A 3WGYA 3H8VA 4MJLA 3UAGA 5T8KA 5L7TA 1IHYA 2IXBA 5C5IA 2PZJA 1TXGA 2AEMA 2I6TA 3A14A 3ABIA 4FJ1A 5LC1A 3WXBA 3TFQA 1NAHA 4H16A 4FSHA 3ZNNA 3UVEA 1W4ZA 1J5PA 1WZEA 3FWNA 4R51A 4FFMA 4DMMA 3FRJA 2YZ7A 2B4QA 4QX6A 5DDIP 1IHXA 3M2TA 1N92A 3AW9A 3KZVA 4S1VA 4AJPA 1R4NB 4WK6A 3OSUA 1XDWA 4A27A 3ONDA 1JAYA 3JYLA 4S3MA 3PRJA 3OETA 1PIWA 2Z1MA 4G2NA 5JAMA 1U4OA 5IG2A 1YJQA 1X7DA 3A1NA 1E5LA 5DCUA 3P2OA 5CAEA 3DL2A 3M2PA 2HK8A 4JP3A 4NBVA 4FC7A 4BGEA 3H9UA 4L75A 4TRJA 4BNMA 2Q3EA 2F00A 5T8KC 5G4LA 4M1QA 5KCZA 4K9DA 3SC6A 2ZB3A 1P1FA 3E03A 5BNFA 4OKNA 2JFFA 2XXJA 2BI7A 4OKIA 3OM9A 1ULSA 3V8BA 4BHTA 2IXAA 5AXAA 3QRWA 4CM6A 4ZGWA 1AXGA 4B79A 1J4AA 2POQX 1PQUA 4XX0A 3SBOA 3NGXA 1I32A 1F06A 4TSKA 2P9CA 2Y93A 1UXIA 2BD0A 2C20A 1I33A 1M66A 4CM3A 4FD3A 5DULA 3RC2A 1D1TA 4B7CA 4DIOA 1H5QA 3PJFA 3OICA 3PGXA 2FPGA 1T1RA 2ZCVA 1HXHA 5G0VA 1Q0HA 1NBOA 2GSDA 4GGOA 4UEKA 2Y1OA 1E6WA 3OHSX 4QO7A 5IAAA 3HDJA 3DAPA 2CZCA 3GNQA 1LQTA 4J1NA 1B8VA 2OMEA 1P1HA 2NLOA 3JQBA 1E3EA 1DDOA 1Z7BA 1ULUA 4CUKA 3NJ8A 3I52A 4YJDA 3OJOA 5KKCA 1R4NA 1I5RA 2SCUA 3B1JA 3MZ0A 4W99A 4D45A 5JMWA 1GD1O 3ICCA 4NBWA 1E3LA 1RJWA 3DDNA 1BXZA 4YQYA 2A35A 1XWFA 3QY9A 2QRKA 3WQRA 2Q4BA 1HYEA 4RO0A 1E3WB 3Q2KA 3CIFA 4W7HA 4A26A 4C4OA 2YUTA 3WGQA 2YV1A 5ER9A 4X54A 1LDBA 3ZCXA 4ND5A 2X4GA 1A27A 4BB6A 4FJ2A 3O03A 4LSWA 3I4CA 5DBIA 1EFLA 1NM5A 4CM9A 3O8QA 4DC0A 1XR3A 1I3LA 1EVIA 1P0FA 2ZB8A 1C0PA 4MVJE 4Z0PA 8ADHA 1TB4A 3OEWA 5A9SA 2VUSA 4MIYA 4DPMA 3AOEA 4ZVVA 3KETA 3JQ7B 4RVSA 4A0SA 4UVHA 3WX0A 4H15A 1GZ4A 3DAGA 4J0EA 5TQVA 4CMHA 3OF2A 4PGFA 1EVZA 3LT2A 3H3JA 1VL6A 2OZPA 1PZHA 3I1JA 4DMLA 1XYGA 1T2DA 3I9MA 2DBVO 3PVZA 5BSEA 2GZ1A 3AK4A 3ANLA 4R1UA 1A5ZA 1ENPA 2PK3A 4WNIA 4FFRA 4J2HA 5DT9A 3DZGA 1NPDA 2R00A 3Q2IA 3BTSA 4BKUA 1WXDA 4DREA 1NQTA 2PGJA 1B8PA 1H6AA 1KEWA 1MC5A 2HK9A 3K96A 4NHEA 3RI3A 4E5NA 1EQUA 1XCBA 1ZCJA 2Y1CA 3K2BA 2UYYA 2BFOA 1V8BA 3JQ8B 4XGKA 1CIVA 1JKJA 2W2KA 4GLLA 4DGSA 3DFZA 2GPTA 4ZQHA 2YY7A 4F6CA 3AU9A 1SOWA 5ENVA 1YQGA 3PK0A 2EIHA 4RPJA 1LJ8A 2AG8A 3GVHA 3ZV4A 2IODA 1X15A 3V1TC 3L07A 4XR4A 2Y1FA 3QWFA 4XR9A 3ZWYA 3NTQA 1KETA 4XJTA 1VC2A 3QSGA 3HJAA 2XXBA 1U7HA 2R00C 1DC5A 2VWHA 1XA0A 4Q3DA 5IJZA 1PJ3A 2QRLA 2V6MA 3D3EA 4GSKA 4WCFC 4F46A 1HSZA 3C85A 3S2FA 1R12A 1LSOA
chains in the Genus database with same CATH superfamily
3P9CA 4RHEA 1QYDA 1WBJB 4MYHA 1YR6A 2HGSA 3IELA 1M2FA 1P2GA 3ROXA 2A5JA 2HJSA 4QFMA 4E88A 2K87A 2KM1A 2ZYDA 3GVPA 4HDRB 2QTFA 3BB3A 3DBLB 3KUDA 3MJCA 3ZXIA 4CDGA 4D8YA 4E4RA 2XMSA 4FM9A 4I19A 3MLEA 3D7RA 4CEJA 1CZOA 2PS9A 3FGOA 2O3SA 5FWXA 5TPZD 1LPPA 4DV0B 3R3HA 5IABA 1I13A 2QEQA 3BHJA 2BWJA 3KR9A 4FFBA 4GECA 4RFSB 2EGHA 3C3AA 4ZREA 3BF8A 3RROA 4DLBA 3DZFA 2FXVA 4ZHQB 3Q8LA 4IHJA 2VYCA 3M4XA 4U6QA 3WV5A 1NRJB 1XF1A 5JTTA 2WF7A 3RRBA 2B34A 4HSEA 5CLFA 3S4YA 4OI2A 2DGDA 2Q07A 2WMDA 1AUQA 1FDWA 3CNBA 5DX8A 1YE3A 2J59A 3DR5A 1C50A 3EUWA 3DQZA 3IE2A 1TIKA 1Y48E 1GKIA 2BGKA 2QTMA 4EENA 3WMXA 1EDEA 4L76A 1JDJA 3FFTA 2I6UA 1JHVA 1DX9A 3KU4A 3K6SB 4B6QA 3DNMA 1Z6GA 4X64B 2VH1A 4MCIA 4CTOA 1Y89A 2ODNA 2YNMA 4JQYA 5FR1A 4LZNA 1XLTA 2GO1A 2LE0A 1NVVQ 4B7AA 4EATA 1N5RA 3PDWA 1E0JA 4DJTA 2WQ7A 5DMXA 3INTA 1NW5A 4FBGA 1THZA 2GKSA 1K6EA 3DJYA 2VRBA 3GNLA 1KZHA 3LUGA 2DKOA 1W85A 2FMIA 2HRBA 3PYMA 4RQAA 1O5IA 4MRMA 4ML3A 1XYYA 3QBEA 2CDNA 3FKSD 2Q3BA 4Q02A 1JAHA 3GFFA 2KX7A 4R5MA 3FJYA 1T9DA 4LZPA 1W87A 3KTAA 4YLYA 5JC8A 5B1SA 1TAQA 2JJMA 4CMEA 5HKOA 2QTAA 3BRSA 4NF2A 4BVFA 3VPHA 1Z6ZA 1GAXA 3O93A 5TJHA 3RJZA 3R6WA 2FTKE 2VA9A 2XVYA 3W5UA 1GRVA 5DF1A 4EHFA 2J7PA 1I4TD 3JQ6A 4NWIA 5DHRA 2O8CA 4K6KA 3IQGX 4AS3A 5LQJA 5LP6B 1AT1A 3DHWC 5IKPA 1RQ7A 1GQ2A 3IOBA 3TWOA 2ZK7A 3SEAA 3USES 3C3WA 3WJAA 1XZLA 4HQKA 5C3MA 3OJFA 5TRTA 1KGSA 2W48A 2AC7A 3AZOA 3GLVA 4DDVA 1AQLA 3WLRA 2O8DA 3E4DA 4J2TA 1WZ2A 1EB8A 2JASA 3GNTA 1YQTA 1L5FA 4JH0A 5CLHA 3HO8A 2AJTA 2CLDX 3MTIA 3WKCA 2I91A 1NXQA 3E2MA 1VL0A 4L2IB 5CYGA 3TL2A 3PFNA 3BWBA 4HNAA 5G0WA 2NUTA 1NY5A 3KFVA 4KBYA 2XYPA 3ZHTA 5DASA 3FXAA 5F77A 1NUHA 3LQKA 1HL3A 3B70A 3DXFA 4GU5A 3V80A 3VSAA 1Z4LA 1O97D 5IVKA 3PLAE 1PQPA 3CJQA 4X6LA 1FP6A 4JU8A 4GXQA 4DNQA 1ZK2A 1BEUB 2H54A 2PMFA 1SVWA 1HX7A 2PFKA 1E1CB 1KZ6A 2JAHA 4NXMB 2CHQA 4M99A 4MIEA 1MB9A 4TWJA 1AQIA 4YVFA 3TOSA 1KYZA 2P0AA 1WOYA 2PH3A 3CQ9A 3OTWA 4GEGA 4J16C 2IIBA 1QNLA 1CNFA 3EGIA 1IIBA 3MILA 3TDMA 1QXSA 1EGVB 6LDHA 4X00A 1OKKA 2GD2A 1BRMA 3DZBA 4PLTA 1HNNA 2I2CA 2NNLD 1GTVA 3EDQA 3KSMA 4IJKA 1U0BB 1Y1QA 5K3FB 5LDHA 3WB0A 1XL1A 4ZOAA 1O8CA 5ARBA 4JI0B 4E3WA 4ZI7A 2ZTHA 5HKBA 3E22B 1H1LB 2R8BA 3BD9A 5DI3B 1WCIA 2ZVQX 4BUCA 3OCZA 4HWPA 4L3OA 1DDIA 4GKBA 1U2GC 5K3CA 1OA1A 3U9SA 3BHIA 3BH6A 2BM8A 4NZMA 3TR5A 1PV4A 3G13A 4E32A 1W8IA 4YRSA 2OY0A 5ALVA 2J45A 1U90A 4YIKA 2I2DA 3TYXA 4JLPA 5HIJA 4OD0A 5A6SA 4D42A 2AVNA 3DVAB 2AG0A 5B53A 1ECJA 1RLUA 3EXEA 3HGQA 4N41A 4NEQA 2IW3A 2R6CA 3PUJA 5K4GA 2PZAA 3IAM6 4R71A 1T9ZA 5F51A 2ZSIA 1VJRA 3B3FA 1QAQA 4CR8A 1C3XA 4BFCA 2EKDA 1LS1A 4N8SA 2ONZA 4XJVA 5KOHA 1F48A 1WW3A 5T67A 1ZNWA 4MVJG 4O4JB 3BMQA 4P5PA 2JFWA 4P5EA 3U7QB 2QHXA 3LVBA 2VZ9A 5CLLA 2OFFA 3NTRA 4JA0A 1B8NA 1YI1A 3D2AA 2YW9A 2I6FA 3KQWA 3PQDA 1VB5A 3ZWXA 3L6RA 2B8WA 3OU7A 4L85A 3RTBA 3RE1A 3V2GA 5BSTA 1NWHA 5IFKA 1T6ZA 1YJXA 4YWJA 1VGQA 5T6MA 3T4PA 3DS8A 2OXFA 5EERA 3RB8A 4B6PA 3GAFA 2WP0A 3BMCB 3RAGA 1JL3A 4OJKA 4W6QA 4LC0A 4QXPA 4EB8A 2B7BA 1RXVA 4HX9A 1JKXA 2HQOA 3EOAI 1VHWA 3GEIA 1USUA 3V1YA 5AK5A 4BPBA 1JYFA 1XTQA 3BEDA 1ZJZA 1IQ0A 2UYQA 3AY3A 1DT3A 3O1JC 4IDFA 1C1DA 4EG7A 3WI7A 3F8TA 1UJ2A 4GX1A 2J6BA 5LP6C 2VEDA 1G7TA 3CZ5A 3K16A 3RKRA 3TB4A 2J3JA 2H1HA 5BQPA 1MIOB 2V5VA 3KR0A 4D9IA 2HIMA 2B0CA 2IBSA 3QU9A 3K9NA 2C4UA 3KJFA 4L27A 5IHPA 6REQB 4Q34A 2QM8A 4INOA 5A4JA 1SU7A 4QWMA 3GD7A 1KPIA 1FFGA 3LC7O 1V25A 4KQKA 2ZSEA 4B3BA 2JCBA 3LOUA 3EFOA 4HRAA 2JLWA 4LXTA 2IDMA 3RHTA 2YC4C 5ESXA 1UFOA 1Q1BA 2P9JA 3B3AA 1DOAA 1SWVA 3D5TA 2G0NA 3K5WA 3G68A 3L7MA 4NH4A 4EHJA 3MTQA 1RXYA 2O06A 1KVQA 4QJ5A 4KHZA 3NJ4A 4LGYA 4YUWA 5BV7A 3CPJB 1MNAA 1A4UA 5B2ZA 4KQMA 1QQBA 4IGEA 3R3YA 2FHSA 4RSRA 3HV2A 3OJLA 5JXIA 5ES3A 5KMGA 1K27A 5AW0A 1E1LA 5HG0A 1ND5A 1PJ4A 1W59A 3MRTA 1MO2A 4BP9A 3ETLA 2G07A 5AM1A 1LRLA 1G6OA 1AS3A 2OXIA 4E11A 1AU9A 3ST7A 2WSLA 1CIPA 1P2DA 3OTHA 4GVXA 4LRWA 5TS3A 3X43A 1A72A 1DRJA 1Z08A 3QEOA 4IIBA 1DG1G 1JHXA 2IHUA 1O4WA 1N8SA 2JI9A 2VSYA 1J0DA 4LRSB 3TOCA 2GUWA 2WU1A 1UOOA 4X41A 2P0YA 5A4KA 3SNKA 2QN7A 3I04M 3K4PA 1BMDA 1CFZA 3R7BA 2ADFA 2OP0A 4Z0HO 5GWXA 5BQ5A 2PUGA 2BONA 4W7IA 4I9FA 7MDHA 1V9LA 4EQZA 2RGCA 3RD5A 2P5UA 4X20A 1G42A 2J3LA 1Z2CA 4QOFA 5EMNA 5T4HA 3TNLA 1UWKA 1GNPA 5JCXA 5ALZA 1J49A 1JEQB 4O2LA 4D5EA 3WGNA 2MTBA 1QG4A 2D2EA 4GOXA 3THRA 4FOTA 1VCIA 1FNCA 2AE2A 3VPBA 2ZIWB 1RC1A 5EHIA 1LI7A 1PF7E 2P0EA 5A5GA 3JRWA 1IXKA 1KZ9A 3R44A 4D6XA 4G4SO 2QLBA 4D99A 3JVVA 3OE4A 5D00A 4N5HX 2J41A 1EFKA 4RX1A 5F1KA 1DPFA 4KN5A 2BEUA 1ODIA 2ID7A 2N9UA 1VL2A 2YKGA 3M1AA 1I2CA 2FMFA 3WIVA 3TUJC 1QWSA 3STVA 4C4AA 3DYIA 4L6IA 1DWUA 1HLGA 1B1CA 1P1KA 4PY2A 2A78A 3GJZA 4FHGA 5AHOA 3RVJA 2VHYA 3EAGA 3IJPA 2YIJA 1L5WA 4YDQA 1E62A 1JG6A 1M2VB 1AGYA 3K9BA 5EPEA 1RPAA 3LU1A 4B81A 1LNQA 1TM3E 3GFRA 3U31A 1GCOA 2BGGA 3BWXA 2JC3A 1DGQA 1PGOA 3QBVA 1T2NA 3HVJA 3ITDA 1L7NA 3QMMA 1PSDA 1Z0AA 3UAYA 4F2PA 5IZCA 1T1SA 4Q4CA 2IZOA 1DBWA 1II8B 3W5SA 3TSAA 1AUPA 1X2BA 2E21A 1Y7HA 3CA8A 4R0NA 5GY7A 3PWTA 5H4HA 3RSSA 5KNBA 2P2ZA 3EGCA 4G0PA 3NYWA 4B3MB 1RR6A 4JUIA 1GQOA 1N3BA 4OEHA 4DOMA 5KX5A 4EO9A 1KRXA 3AILA 1VRCA 3DVLA 4J07A 1N9ZA 1Y8RA 3AR6A 4NZPA 5G4KA 3QLUA 4FBLA 1RAFA 5TT1A 3RBVA 3SI7A 5JSHA 3LT5A 2W6PA 3M9WA 3UICA 4CLDA 1ZUNA 3BE4A 5A6SB 2OCLA 2JCGA 4A6DA 2FWBA 2MWMA 4TSRA 5TR9A 3AFIA 5F2NA 1NURA 3IQIX 4JB8A 3BS4A 4FEEA 4PVCA 1RVV1 4WN9A 4D9HA 5C35A 3SLKA 2X8LA 1E94E 4XXHA 1E7YA 3QVJA 4ZPXA 1JLLB 4ZODA 3HCCA 4DG9A 5BVHA 3EEYA 2P2CA 3O73A 3F73A 5KJCA 4FDAA 4MO2A 4OOFA 4UPEA 5F2OA 3UT6A 4YMWA 5AM3A 3L7JA 1VOTA 4D4KA 2BGRA 4UE3S 4AL4A 3K9GA 2MYPA 3AIKA 1ODTC 3Q12A 4Y2YA 2BM0A 1YRAA 2PRIA 4MLPA 3RTCA 4DV2B 3IUPA 4JJ6A 4OHMA 4DN6A 4RWZA 1IUOA 5F1OA 1C1HA 1E1MA 2Q2VA 2ZP1A 1DJOA 2YZKA 4GFDA 3LVFO 3TQOA 1TYDE 4YAUA 1HQYE 1XO1A 2FRVA 4RLQA 1GVNB 4QEZA 3NDPA 1SU4A 2A67A 5EINA 2KQUA 2WAYA 4RJLA 2KYRA 4ZRMA 3GT0A 1OHHA 4XM2A 1PL7A 4FGLA 1S2MA 4Y2PA 1QKIA 1LDEA 1SBYA 1KZ1A 3L7NA 3QKRB 4HR7A 2F2TA 4KFTA 1RZRD 2PVSA 2R1VB 2AX4A 4F2WA 4TM7A 1DC6A 3CH4B 2EAUA 3VDQA 4NMXB 3ZOKA 5B30A 4E21A 2AQHA 4QDTA 3L9WA 2FPLA 4ZRNA 4P54A 5B64A 1QAOA 3E0XA 5K0JA 3WOHA 5CNKA 1ETUA 3KWJA 4LRXA 2JA2A 1ZAYA 2X5OA 3TK1A 4BQQA 3AFOA 1KSFX 2JGNA 5CAEB 1ZD3A 4F2GA 5IRCD 4PHTA 4II7A 2WW8A 4Q16A 2OCDA 4DIEA 3QNUA 5CA0B 3HSKA 3LIPA 3TE7A 1NT4A 3TZQA 1CD5A 1QS0B 1VJCA 1OYVA 3F97A 3K9WA 3L40A 4C76A 5LP1A 4GPBA 2I71A 4HNSA 2QXYA 1M6WA 4I2NA 1KAEA 4NATA 3U16A 5ED0A 1L8LA 4WJKB 2BUCA 2GBLC 2HSGA 2RJ3A 3GP3A 4D41A 3BL6A 1QLWA 1MPXA 1QPGA 3IV9A 3W8DA 2AHRA 1O3YA 5HZKA 3P5BA 2MYUA 5JWHA 1J2YA 4PX2A 2OENG 2CXHA 1DAIA 2YDXA 1Q19A 3KT6A 2QAGA 4FYXA 1Y37A 2I1QA 1N6NA 3A9SA 4G4GA 2XITA 4C78A 5EJ8A 4I4CA 3SS9X 1ZOOA 3KHUA 4KN9S 1OLSB 2GOYA 2Y71A 3EZFA 3R6DA 4JP1A 3TDKA 1BDMA 2QG4A 5D7NA 3KB1A 3G2HA 1U8EA 3C3XA 1STOA 2G5GX 3VNRA 1QHNA 2FPGB 3LK6A 1SBHA 1TFRA 4KXXA 4URUR 3UK2A 2FSUA 2R6R1 2Y99A 1TM2A 3KZOA 4RPGA 4Y2QA 3RYFA 2ODWA 3VYTB 4LW8A 4BE4A 5DHTA 5B3JA 4LQDA 1E2GA 1N1GA 1R9GA 2H5IA 3M5CA 3R3XA 1FS4A 1E20A 3RV3A 3WB1A 1RDFA 4LYFA 2A3NA 3BUSA 1QE3A 5DYWA 2O7VA 3FAKA 5FPQA 4Z9YA 2WYWA 2Y76A 3C70A 2P35A 2G40A 4J7XA 2V58A 5AESA 2DFLA 3MG9A 2P9QA 1FVOA 1QO0D 2VPPA 3ABRB 1PZXA 4QYTA 1OC2A 1YBAA 1XCJA 3FPHA 4NI5A 3HXTA 3CZ4A 2QD2A 2GXSA 4L4SA 3F3MA 1F0PA 4F5WA 3TL3A 4YMTA 1T4DA 1TYCA 4NYMQ 2I9PA 3AESB 4O4IA 5EJ4A 1E0SA 2BZGA 4K6HA 3BFXA 2B1IA 1V1MA 1Z34A 1VKRA 4I9NA 5IJ9B 4JSRA 1X7ZA 5HGJA 1U0OC 5ILGA 4EYOA 5L3SA 4DYVA 4QIHA 4UEJA 1MO5A 1CULC 1YS4A 2Q2OA 3B3GA 4RSGA 4HVTA 2O2XA 4KG7A 4NBRA 3PENA 4XWYA 4CPDA 4KNYA 3ZQUA 4JEUA 5EXSA 2JB9A 4DYHA 1RWOA 2O5VA 3OU2A 4UZEA 2FNAA 2W6JD 4FZRA 4E33A 2PPLA 4ZIRA 1UXKA 2DETA 4EKGA 4NQZA 8AT1A 3UCEA 3LOQA 4I5IA 2JGDB 1GT6A 4EI7A 1N8TA 1DKLA 2BL4A 4J75A 3CKYA 5DLQC 2DQYA 1MABB 2XGOA 3KX2A 3OI7A 4B7UA 4RKWA 3A9WA 1G8SA 2C2KA 5ITVA 1W0KA 5AK4A 3TVDA 3UOGA 5IDWA 5I7FA 4BDSA 3OZFA 3P9XA 3EW7A 1XA4A 1HF3A 1K8QA 2FDRA 2G1KA 4GMDA 4WINA 2Q2WA 3A7DA 4ALIA 1U3CA 4RK6A 3M1LA 3K0SA 3WLAA 1GN8A 5FD8A 4N47A 3GT3A 4DBLE 2PH1A 2QMHA 3TSZA 4M1SA 1U81A 4OJNA 4QE3A 3F9IA 5FHQA 5I45A 4V0NA 1JLMA 5JS1A 5CA1B 4UCQA 2HIHA 1K92A 1BE1A 2I4IA 2V54A 3CLTC 3IUBA 3V8EA 1GDDA 4NZNA 2F1HA 4JITA 2Y1LA 1NPTO 2YIDA 3ANMA 5L40A 3N2IA 2HPAA 2W2LD 1JKJB 1XX6A 3LP8A 4YRPA 4B3GA 1ECCA 1MVLA 2CWWA 2HNBA 4PANA 5THQA 2CDBA 2HSEA 5M29A 1OFUX 3D64A 2GTPA 2Q4TA 4Y6PA 3PUHA 4EI8A 4G5QA 3BZBA 1RI5A 4RBNA 1L7MA 4R83A 1IY9A 1C9JA 3VR5H 1PHPA 3MOGA 4J7CA 3VTZA 3VYUB 3I64A 4BMNA 2K4MA 4K9OA 1Z74A 4TTJA 2JAXA 3GQBA 3NIGB 4AZTA 1X7WA 1QMGA 3PA8A 5DKFA 2ZRAA 3RU2A 2A9JA 3RQIA 4BNXA 4FHZA 4ZOLB 2P7HA 3A3NA 4RETA 4WEQA 3GQVA 2WHYA 3EIQA 3LNTA 3PDCA 4QEKA 4WZAB 5AKXA 4CZ2A 3E61A 3B9BA 2NU6A 3DEFA 2Q62A 3EVAA 2J6HA 1QGOA 2NACA 1C41A 3SP1A 2OXEA 4LNHA 4ESOA 4MH0R 2QG9A 4JQOA 4R40A 2Q1SA 2I3DA 3IPLA 4JKOA 2XE4A 1QHHA 3DXXA 1CQWA 4NEGA 5IJXA 3P2EA 2O3TA 1KS2A 2PCLA 4NU8X 4IJUA 4HWKA 5KS2A 2RHWA 2PXXA 4DMCA 4Z54A 1XZMA 2JHFA 1LB1B 1MJGA 1GU0A 4PCVA 5M3BA 4PYMA 3K30A 1A5SB 1DE0A 1S8AA 3BCSA 1ZCAA 3DT9A 2YOGA 1S01A 3R24A 4M4SA 5E9WA 1KO1A 3CM0A 4YPOA 3MSXA 4KRXA 1EGMB 1I0ZA 3ADDA 3D3QA 3V3KA 1D4FA 5MN6A 4I6EA 3DOEA 2TS1A 3O2SB 1JU4A 3OT4A 3ZIAD 3T1YB 1XCGB 2PNFA 2ZB4A 4MRNA 3PHIA 1F1BA 1XKQA 4KJXA 4YTEA 3ZV7A 2NMVA 1FNSA 2IUTA 1CFJA 2PBLA 1DXQA 1T6YA 2BR5A 3F4BA 3N5CA 3PVSA 3KL4A 4KRGA 4OGLA 1O95C 1XD9A 1RPTA 2VQEB 1AKRA 1U6KA 3ILXA 4MQEA 4YT2A 3DZKA 3HSYA 3K35A 1G6HA 1F4LA 1RLMA 1ZLXA 2VPXA 3KM0A 2XIQA 4R1NA 2GMWA 3VVCA 1NM5C 4XX1A 4I5GA 4IWYA 5CNMA 2GCEA 1Y9AA 1SG6A 1E2UA 1XRRA 4J0IA 4I55F 4AO7A 4P4LA 1LBQA 1SC1A 1R8XA 4OQZA 1LGYA 1NNUA 1CKEA 1X42A 5CCEA 2H2AA 3DQQA 1ZD5A 2PWZA 5EPOA 1SFRA 4IDOA 1U3UA 2V65A 4IFIA 5EHQA 4DG8A 1EK2A 1L1QA 4MGKR 4D3DA 1QFZA 2NZVG 1VE3A 4EUSA 2IS1A 4E46A 1OROA 3BDAA 3RVRA 4BEWA 2JBAA 2O2SA 5AXDA 4CNQA 1KI3A 4FWTA 2B94A 2YVKA 2PWYA 4MWSA 2VP4A 2QXUA 3NBAA 1ZIOA 4IZIA 4LVCA 4MR7A 5LOVB 3SVTA 4JBIA 4J9VA 3QEBZ 1XALA 1H22A 1YA4A 4UULA 3COSA 3R76A 1Z2EA 4Z7JA 2XQIA 2OC9A 1EESA 3EZ6A 1YR1A 3A1FA 4BNGA 1M2OA 4E08A 2FP4A 3OIGA 1FTGA 3DTVB 5T64A 2XF2A 2KWIA 4BUZA 5BR4A 3S29A 2J85A 4P8RA 4UEOA 1SG9A 2WSSD 3SIPA 4TMWA 1R8QA 1CE8A 1P75A 5A5DA 1BXGB 4NCNA 3HTXA 1XCLA 3HM2A 5BYBA 2UKDA 1JQJC 5AVSA 2QXTA 1RPZA 4LYYA 1CC1S 1PJ8A 2JJ1A 1WABA 3KTOA 1LVHA 4WDRA 2GD6A 4K6MA 4FFVA 3ZV3A 2GN0A 3NBQA 3I2IA 1IJBA 3V7FA 2PS1A 1QK3A 5HF5A 1GZHB 1R0XA 1TFUA 3JXEA 4C0KA 1Q3TA 1VXRA 3FVVA 4ACAA 2J31A 4D79A 3PC3A 4GNKA 5LWHA 2GF0A 2ORYA 3QGMA 3HKCB 3I1FA 4FDLA 3L1UA 3VJKA 2FLKA 3AF4A 1OGYA 1YS7A 4QTZA 1V45E 3ND5A 5CYFA 3AL3A 4Y18A 1HZZA 1P91A 2CFIA 4X1KA 1G63A 1F51E 4PICA 3R7WA 5E6SB 1U2QA 1VI6A 1HMYA 1BMFD 5ALKA 4LX8A 4EUNA 2A0KA 3UIEA 3KOZA 1EK5A 1TW3A 5IEJA 3PL1A 1FMJA 1C4XA 2ZJ4A 3PPXA 3N86A 4GYWA 2Z95A 4MHSA 4B75A 2VHQA 3ECAA 3WYDA 1VG9B 5ALLA 1HORA 4LFAB 1SCQA 3IOCA 2BY4A 2HQSA 1G64A 4BB9A 2D5BA 3QY0A 4L9AA 2IZZA 1FW6A 2C0CA 1JB9A 4RFVA 4P33A 4L3VA 2ZJ6A 5A3VA 4GF5A 3P7MA 1U8TA 3HB0A 1R5JA 2BKVA 4JVMA 4MVYA 2FSIA 3CNLA 1FDTA 1THTA 3M6UA 5L6MB 4DKXA 1U9JA 3MNFA 4URVR 2R6FA 4ME6A 3VU9B 2G7ZA 4MVJP 3B6MA 3HN7A 3BILA 3K31A 3VV2A 1MO4A 4EZEA 2JFGA 3G23A 4GMXA 5E8RA 3K1ZA 3A2KA 4NCKA 3LXMA 3BZWA 5LQAA 2H4ZA 4KDCA 5CCXA 3N2YA 4GKKB 3H87A 1E9AA 1P18A 2Q5FA 3BA1A 1JE0A 3K0FA 4MUIA 3TR0A 3TRIA 2O8FB 4MWOA 4AECA 4ZMSA 3EK2A 3VNBA 1AHNA 4LZZA 2NVOA 1LY1A 4R81A 1KVUA 2GRAA 1C0LA 5JI2E 1WDTA 3M6LA 4Z9AA 3REFA 4CL8A 3B6ZA 1HE2A 2A9OA 1NQXA 4AMYA 3LUJA 3C3DA 4K1LA 4QDKA 1SCUB 3LOPA 1X1EA 1QIHA 4N49A 3RRZA 2ZUCA 1JHZA 1FX0A 5CVUA 5J4KA 2GBGA 4JJGA 1U9CA 4JD5A 3WL4A 4CGYA 5KYXB 4A8JA 2E0IA 1VMKA 1ABEA 3AUKA 2CV1A 2HU8A 4NZ9A 2O7SA 1II9A 4HLNA 4D8TA 4AN1A 1PEKE 3K1JA 5TVKA 4ZEXA 1KPHA 1SBIA 2XDYA 1NXXA 2C2BA 4Q12A 3V8NA 4B6JA 3R4VA 4FFWA 3F6SA 1UFQA 3HEMA 3OKFA 2Q28A 2GGSA 1F6WA 1JHMA 4AG6A 1T6XA 4KGZA 4A6PA 1EIWA 4V3CA 3ROQA 1FW8A 2OB2A 3L4SO 3LQYA 1K98A 4D3XA 3UKOA 2EFCB 1FRZA 2F59A 1YRQA 3CR7A 4GXRA 4QYMA 3KQUA 3RFXA 5FPKA 2AFRA 4ZT2A 3BREA 1U1GA 2FGKA 3PEVA 1ZR2A 1NR7A 2NQ8A 2PUDA 4REOA 2WNHA 1O96A 2AV6A 1MORA 4NABA 4G0XA 4DSNA 1MUUA 4ZGBA 3B2EA 3CVOA 3FUCA 4FGWA 4KAJA 5GP1A 10MHA 5EQJB 4JU9A 2QU8A 1ZJYA 4CKCB 1GSOA 1CV2A 5TGZA 1KH1A 3QELB 4BP3A 2D3TA 2XHZA 4UFPA 5LMNB 3QPWA 2XCSB 5JQGB 1U9YA 1DCKA 2QV0A 3WGZA 4IM7A 3PZRA 3PT9A 4WESB 4WECA 3T5BA 4HDKB 1I3KA 1SCNE 3Q9NA 3P5SA 3V4SA 2A0XA 1W5AA 3AL2A 4ZVNA 5TPWA 1H65A 5CFPA 4DAEA 1FJGB 5JFTA 1NP7A 3C6BA 4IH1A 2OBYA 2QZJA 3QU2A 2YJ3A 4LJRA 1ES9A 4OFZA 3F3SA 4DV7B 1EFRA 2JD0A 2ZZNA 1KEVA 2GCNA 1NKTA 4MUHA 4NZZA 4UTRA 2DG2A 3L06A 4ZAGA 1PGJA 2QR3A 3FRIA 2A9RA 2XT9A 3HXPA 4HNGA 2CZGA 1Z88A 1IOVA 3OA0A 4XWTA 3OIUA 2FMTA 3HC7A 4Y3UA 1UBTS 4UREA 5JS2A 2WTUA 1FDIA 3I9JA 4NC9A 4RZHA 2CUNA 2IU6A 2RAVA 2EIXA 4UBOA 2QJFA 4CIYA 4KOAA 1G3MA 3BJEA 1X7HA 3N8GA 1WPGA 1DV2A 1E8MA 2H4XA 3P97A 4ZU3A 1KE2A 2FE4A 1DADA 3Q87B 3WZ2A 4B4UA 5JNVA 2C31A 4ER5A 1NVGA 3EXIA 5C37A 3SR4A 1TX4B 4Y6GB 1F0NA 4HZUB 4YHBA 1WLYA 4C43A 4DXHA 3AOGA 5IF9A 3ZKWA 4OM7A 4LY9A 2P69A 3PC7A 4ZOBA 5DM0A 4DABA 1T2EA 5K6RA 4RM3A 5DV9A 1AIPA 2Z2IA 3EWNA 4L8FA 4NJEB 4EJSA 1CDDA 2PX2A 1L4MA 1RYFA 1WAMA 2WSYB 4U3JA 4ZI7F 1DIRA 4XVHA 3FWYA 4ZJPA 4CIDA 4TRRA 3QPCA 1RHQA 1MW9X 2DQ4A 2JLSA 4N9WA 1Y8QB 5DYIA 4BNDB 1VTKA 1ZN2A 1T5SA 1XHLA 5F1PA 2NV0A 2RGXA 1LTQA 1I2MA 4MITA 4D43A 5LNK1 8GPBA 2A3RA 1EFAA 4HEA6 1RJEA 1NJ1A 1XA3A 2FK8A 1U0LA 4LOJA 2UVPA 2I3AA 1BN6A 3B6KA 4J0HA 3RFVA 4WLUA 2JLYA 3LBFA 3PCXA 3IGFA 3HRIA 1BDHA 1TJ5A 2ACKA 1CUBA 2REXB 1SIOA 5HUHA 1T35A 1TIBA 1XNGA 3M1YA 4MPPA 2XRZA 1N9KA 2I29A 4ZYVA 2HA6A 3RF7A 3Q0IA 1HE4A 3KYCA 2GF9A 1P61B 2YXEA 3NVDA 5TMEA 2JBWA 3ZY3A 4DJJA 4PO3X 3MCAA 3OY7A 4MGYR 2OD2A 1I6MA 4BLWA 2PX3A 1O1YA 3CB2A 1QF6A 5REQA 2QVLA 3G1TA 1UBEA 4CN9A 2CJWB 3JPYA 3COZA 1JA9A 2P3QA 2QPTA 4OUKX 1SC4A 4Q3EA 2NU8B 4YRGA 3KQPA 3KEQA 5J23A 5AVZA 1RYDA 1GZ7A 4TV9A 4LTNA 1WEKA 2XMRA 5TF0A 2HX1A 1EWQA 5C7YA 3AHHA 4QUJA 5KVQA 1FXUA 2FWPA 3IPYA 3TNDA 1YBVA 4BXOB 2VPYA 1NOJA 2E4ZA 3PX2A 1ESEA 1Z6TA 3MLBA 4JI8B 1PJTA 1UBFA 1YQXA 5THKA 1Z0ZA 1A9QA 1ISSA 2DP4E 2EKBA 3REQA 1CY1A 3Q6IA 2COEA 4BP8A 1HRKA 1NDHA 4FI3F 1XZJA 2Y05A 4EITA 4ZCRA 3J7TA 1J20A 1Q7CA 1RXSA 1AGXA 1GUYA 2D5AA 2JANA 2V7UA 4GMFA 1E2PA 1LW6E 5AJWA 2VDUE 2ZYVX 4KQXA 1USKA 3T34A 1V1RA 4WBNA 1PE0A 5GVSA 4EG5A 2X0NA 1DMRA 1RM4A 2QN8A 4XJSA 3FHJA 1ELOA 4QPZA 2B5VA 3AHJA 4YJ3F 3WGJA 4DVJA 5EHXA 1I3MA 2PRJA 4TQGA 3OPYI 3KAJA 4Z8XA 4E22A 2CCGA 2RH9B 3I2KA 1W0JA 2E5WA 1U0HC 3FPBA 4LZWA 1BH2A 2HMYB 3L1JA 3KQNA 1PJBA 5KDDA 3VJMA 3QWHA 3GCGA 3FJOA 4NFSA 3BRWD 1XHEA 1NXTA 4HZIA 3SM9A 4EVQA 2QE7A 1BHO1 2FN9A 3IEIA 2N46A 1XFDA 2EFJA 1OXXK 2IKSA 1A9XB 4UCWA 3TIFA 4RVUA 3PQ8A 4P4GA 1XMVA 2FW6A 4WK4B 2DH5A 3MA0A 3RS8A 3V1UA 5ILOA 3QF7A 3Q11A 2VH5R 5DTRA 2P2LA 1GPKA 1I3NA 2C5HA 2GPJA 2RG1A 1VJDA 2CJPA 2OECA 3O4GA 3SQNA 3D1JA 4CCYB 5KQMA 4AXBA 3OUUA 4HDNB 3U3ZA 4F21A 2O14A 3E3AA 4N4AA 3B51X 4RVGA 4GQBA 2E48A 1DQRA 2FKAA 4NHOA 1JH8A 1XZEA 3M81A 2P4SA 1H2EA 2PFSA 2Q50A 2XD4A 3DMYA 3IALA 1YASA 1ESCA 4HGPA 3T3GA 1QE5A 2AMFA 1X80B 3CV3A 4QUAA 4YQZA 1GG2A 4FB5A 5KHLB 2Z6UA 3L8ZA 1G2IA 3DP9A 2PZFA 1Z56C 4O2BF 4YJGA 3OCWA 4OIMA 4EY6A 1CZLA 2ZR7A 2HW8A 3GCWA 4MV5A 5EUCA 3G5LA 1MU0A 3FY4A 4F5YA 3G59A 1SH7A 4R1PA 4F3RA 5LA6A 3T35A 3G9UA 2GAAA 3QV1A 3SE0A 3V2IA 2HLDD 3U4HA 4QPDA 1YCHA 1RM3A 3NXKA 2B3TA 1V11A 2Q7XA 2BELA 3FUVA 1SKAA 4G6ZA 1NUPA 1GKKA 3DBVO 2PAFA 5HE9A 4D3ZA 4DNXA 2ET6A 4I1SA 1KERA 3PBKA 1EXDA 5JZSA 3PKJA 4RE6A 1J24A 4PRZA 2P1ZA 3V6LA 5JO0A 1M6EX 4P81A 4KEAA 3T3EA 3UXHA 4GBMA 4U2EA 3RT1A 5TPZA 4RDHA 1I2DA 3WVNA 4RZ2A 2F8SA 1ZGGA 1A88A 2C2HA 1E60A 3CEJA 1FJXA 1CEYA 4U7WA 4YT4A 2BT4A 3G82C 1GG9A 2EX1A 4G1EB 3AINA 1D5WA 1GTL1 4OAPA 3Q9SA 2P77A 4AM8A 3HH8A 5KJ1A 4GX5A 1YQEA 1KY5A 3F1KA 1GFSA 1HI9A 1P4SA 3W34A 5EP1A 1K7SN 1SNYA 3NNSA 4L4UA 4Q3AA 2WG1A 1LS6A 4DTCA 3LKZA 4R54A 3EVGA 2YVQA 3KO8A 1W35A 3B1KA 3HXOA 1GRQA 1E79A 2NQTA 1HY3A 2XZTA 2H7VA 2DOKA 5EFOA 5T4FA 3KVNA 1UPCA 1Z7YA 1VYHA 1TC2A 1YZLA 1T5HX 2DWUA 4LXYA 3B1FA 3T41A 1GLNA 1QQ7A 3OQBA 3OF5A 2WUFA 5KX5F 1CJCA 1HDYA 2EP7A 4FCWA 1DI0A 4J6FA 4Z49A 5DSTA 3M5WA 5BVGA 1KTIA 1O77A 2QSYA 1CW2B 4RDCA 2X8BA 4HB2A 5CNIA 3VO9A 3EODA 4KXFB 1FUUA 2FW1A 2VBGA 1U4NA 1N6KA 2EDCA 3C1TA 3KOYA 4Q1DA 4YREA 1IPHA 4WJZA 2X9VA 3SXUA 4KXWA 2F8MA 4IMIB 2JRLA 5JD6A 2WHEA 1HT1E 4M98A 3FKSA 5GZ1A 4QM6A 2D7JA 2A9KA 3L49A 1X3LA 2OV3A 1GADO 2DPMA 5K8JB 1NBMD 1IMOA 3B48A 4ND8A 3VKFA 3OOHA 3LYUA 3ZR4B 1Q95A 3L93A 3S70A 2GPNA 2KI5A 1RRCA 1AN9A 1KOLA 5DEOA 3WJ7A 1I4EB 2PUWA 4ZT6A 3ZWVA 4EECA 3GLIA 1A8QA 1AGNA 5DTJA 3RYHA 4E3ZA 2O2ZA 4DY6A 4RQTA 3H2ZA 1J6UA 1YNOA 1Z15A 4K6GA 2FW0A 3KPUA 4L74A 3GVCA 4OU4A 5KQPA 1RXWA 1XIVA 3BORA 1AMOA 5LMUB 5BMOA 3W5IA 1H85A 4C7JA 5TQ2A 3CSDA 4YJ2B 3WQHA 3WIOA 3RG2A 2FMKA 1YDWA 4MUNA 4PGMA 4TZKA 1FUKA 5ALJA 2C88A 1R37A 4R1LA 3VOSA 5DM2A 1PGPA 4IMJB 3R8FA 5HP4A 4DW8A 2JFNA 4Q7LA 1JZQA 1P5JA 1E2IA 3COVA 4A03A 4KPUB 1B14A 4QBKA 2FP3A 3U7FB 4LXQA 1JWBB 3KT8A 1NBAA 2FFHA 3LP5A 4PNZA 4WKCA 3B7PA 4IGKA 4EJFA 4YIHA 4MNTA 1M34B 4MVJD 1UZAA 3G2OA 5E6UA 2CNDA 4AKGA 3KDPA 2H1SA 2XI4A 4YAGA 3GRFA 3SHVA 3LFUA 1QHXA 1J23A 4IUBS 2GHQA 2ERYA 3V4RA 1IN6A 2C5AA 2GLXA 1D0VA 2VDLB 4KE9A 1XQVA 4EX6A 5C32A 1ZCBA 4P32A 4I50F 3T12A 3ZWOA 2VK8A 1LPOA 2AL7A 2IUEA 2BH9A 3ACDA 4IDBA 4LGVA 4XYEA 5EJ2A 1IXYA 2WM3A 1ZGAA 2A33A 3FOWA 5LDGA 2E4WA 2FEKA 1NIJA 1MN6A 3ZGYA 1JAXA 1H1TA 4GX2A 4U02A 4S1NA 1BIFA 3C48A 5TGDA 1JI0A 3PQ6A 5EP4A 1Y9DA 3NWBA 2GA9A 3KVRA 3GW8A 2VR1A 3L79A 1F5NA 4OH1A 2YS7A 3CUYA 5LXTA 1B3BA 1TKAA 4Y1FA 3PCTA 3NCTA 2X8JB 4FYJA 2GYYA 2Q45A 3QTTA 2H8GA 3ONEA 5IDVA 3K53A 4EYKA 5BNTA 3J7AC 4TWRA 4BO7A 1ADGA 3NBFA 4PBSA 3PEUA 1VBKA 1I4WA 1R64A 4BLRA 4MRSA 2CKMA 3O8NA 4I9UA 2BFMA 2JD1A 5B7QA 1W4AA 3QE2A 1JFTA 4EW1A 1YK0A 4QOHA 1W25A 4PW0A 3LHFA 2IY8A 4CHTA 1ISRA 3MINB 4QHTA 1FRVA 5BNIA 2HDHA 2PR2A 5FEUA 1ATZA 2ISCA 1W75A 2G63A 3DOUA 4G4IA 3NX4A 4XDHA 3WK9A 2X9QA 4DARA 3IMGA 3HACA 1YB4A 5D3ZA 4EARA 3I5UA 2JH3A 5KMGB 4DCCA 4GQIA 4HUJA 1Z63A 3N6VA 4AU1A 4XB6B 2HNKA 1ID8A 3JQFA 5CIYA 1PWEA 3CG4A 2IW1A 3E7XA 5AVJA 4LRUA 4BAGA 2RBGA 2O57A 3IILA 1ODLA 2IV2X 3B85A 4ZQCB 1M76A 3LNCA 1WDLA 1WS6A 1YZUA 2B4RO 2BBSA 1XXHA 2VBIA 1ULTA 4ITUA 2D59A 4K40A 2IHNA 2W71A 4W1QA 1MAHA 2WD8A 1V7PC 5HWSA 2CB9A 3BXXA 3OPQA 1GFZA 3C3KA 4G5XA 4HL6A 4WZBB 4ALLA 1OXSC 1SURA 2ZI7A 2I2FA 4MS1A 1GPAA 1S2GA 4WCFB 1PR5A 2R7NA 3JQ9A 1WOMA 2VDWB 3BXHA 4MP8A 3ZK7A 4NENA 3UMJA 4D57A 3UHOA 3DAFA 3A32A 3I2HA 3N59A 4O2AF 2R66A 4XH9B 1UAAA 2Y0DA 3GG9A 3U81A 3E53A 1BOOA 3DF9A 1QH9A 1P77A 1X7YB 1Z7WA 2PZEA 3MTJA 3W9BA 3PTZA 4OA8A 1E3SA 3RSHA 3FMGA 5DP2A 1ZL0A 2JAWA 1S2OA 5CLQA 4DLUA 1LLDA 3O4FA 4OK3A 1Y8ZA 5DBGA 4N6OA 2PT9A 3IP8A 2PSHA 3LUPA 3G2KA 2CV2A 4DJDC 1PKEA 4G0ZA 1HPLA 1QH0A 1Z0DA 4NESA 4UOEA 3SSMA 3A4YA 3K1YA 2BPOA 2JBHA 2OFXA 3L4EA 3ZLUA 3UJ6A 4C3VA 1BCRB 1M8FA 1P9NA 1YU6A 2WYOA 3RJ5A 4YYEA 4BO6A 2C07A 3GLHE 3I05A 5KNDH 5DM70 2DFDA 2O2YA 1I6LA 2GHRA 2P9GA 5F5NA 1VYTA 1SUFA 1HK7A 5B6JA 4IV0A 5KSOA 3CLRC 2EG9A 5KKNB 1ZMBA 1EA7A 4KSYA 1HLDA 1TCBA 3FRHA 3KE9A 1NUUA 1TQ6A 1XN4A 3C3JA 1KAGA 3NV9A 4IPTA 4RE5A 5ALNA 5LBUA 3T4UA 5CX4A 3UGKA 3ZE9A 3ZUGA 1A4XA 1G4HA 2CNLA 2ZBGA 1UWCA 2QD4A 2BUBA 4DDWA 3FHTA 2RC5A 2KLBA 4J2OA 2PUBA 3AP3A 1EFPB 5ICCA 1GA1A