2VQ3A

Crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
PKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Membrane Proximal Oxidoreductase Domain of Human Steap3, the Dominant Ferrireductase of the Erythroid Transferrin Cycle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords METALLOREDUCTASE STEAP3
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.16.1.-:
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vq3A00
4D3SA 4TKLA 1PGQA 2BGLA 4J1NA 2ZB4A 4C7JA 1BW9B 2D5AA 1FMCA 1R66A 4DREA 3K31A 4QFCA 1Q2XA 4UVHA 2DT5A 4S3MA 4WCFA 2IODA 4MKZA 4AICA 2AMFA 1WZEA 2UVDA 1KS9A 1MFPA 2DBQA 2YW9A 3ROPA 1EZ4A 2X58A 1YO6A 2Q46A 4ALIA 1WXDA 1LSOA 2FY8A 3ADPA 5F1KA 3UUWA 4DYVA 5JDCA 2FOIA 4BO1A 4ZRMA 4KQXA 4IXTA 2PV7A 2OP0A 2I99A 3ON5A 4BNUA 2PTGA 2NWQA 4WGGA 4XZ3A 4NIMA 1LRJA 1QV7A 4CLRB 4E2WA 5C7LO 3FSRA 3DBHB 1AUPA 2PK3A 2Q2VA 4WLUA 4WLOA 3VDQA 3KOUA 2OL4A 3H2SA 4FN4A 2GYYA 4YPOA 3UVEA 5EIOA 3PQFA 4A26A 1Y8QB 4DIOA 2FZEA 3G49A 4J2OA 3ZWWA 4NBVA 4WK6A 1PIWA 1P0FA 1P1KA 3OMLA 3F6YA 2DTDA 2EP7A 3JQBA 1LNQA 5C7IO 3AUTA 4OMUA 3PJFA 4YBZA 5DP2A 4BO2A 4HV4A 3SC4A 1NQ5A 4P8RA 1KVTA 5HWSA 2CSUA 2VZ0A 3QE3A 4A10A 3GNTA 3LT1A 3QWIA 1B3BA 3X2FA 1MX3A 3RBVA 3DBLA 2Y1DA 3GRKA 8LDHA 1E6WA 2WYWA 4I8XA 5KVVA 5A3JA 2VT2A 4J9UE 2EEZA 4G81A 4B7XA 4D45A 4HNHA 3PI7A 4CQLB 1C1XB 5COBA 5ENVA 4BGEA 1HSZA 1C0IA 1BXGB 2Y1FA 5EN4A 1YS4A 2NVBA 4U5QA 2PZMA 1LSJA 4TRJA 2GERA 1U3VA 3RC2A 2BFPA 3ZH2A 4EUHA 2WTBA 3QY9A 4YCAA 4Z3KA 3N58A 2VWQA 4YQZA 3KEQA 2R00A 4RF3A 4YVFA 1I30A 4XX0A 4F6CA 1T2EA 4H3VA 2R2GA 2ZK7A 3DB2A 3PP8A 3T7CA 1U7TA 3ZNNA 3JQ8B 3PDUA 4PRKA 2AQKA 3EVTA 3WR5A 5A9SA 5HRUA 1K5HA 1LC0A 4RPJA 3WFIA 1GYQA 3PFWO 1HYGA 2PGDA 4OSPA 3Q11A 4R41A 4BNWA 5A9RA 1RM3A 2WJPA 3I9MA 1QXSA 5C37A 1V0JA 4AJ2A 2QHXA 4CLEA 3ZWVA 1E3WB 1D3AA 5KOIA 4M54A 3H9GA 2AG8A 2IYPA 2P68A 3BAZA 3D3WA 2EGHA 1HE3A 2B35A 2D5CA 3DONA 4LVCA 1KC3A 1LDEA 1NYTA 5MDHA 2P4QA 3H7AA 4EEXA 1T1RA 3AM4A 3JCZA 3GHYA 5IN5A 4BL5A 1NR7A 3AU9A 1Z45A 4JK3A 3VAZA 3FTPA 3JQ9A 1I2BA 1KVQA 1ZK3A 5JCJA 1QP8A 3H9QA 1Y5RA 1Z7EA 3HB5X 3RIHA 4DGSA 3IMFA 1ISHA 3DC2A 2XXBA 4BKPA 1XQ1A 1GDHA 2AE1A 5JMPA 5IF3A 5KWEA 1J0XO 2RH4A 4ALNA 3S1LA 1AXEA 4INAA 2NTNA 4A0SA 4AJKA 4PZDA 5A4DA 4Y6PA 3QVOA 5G4KA 5L53A 3B1JA 3O4RA 2X0NA 1V6AA 3K9QO 1X7GA 1U9JA 2ZTVA 4WEQA 2FPIA 2DTEA 4IY1A 3KZVA 5CHEA 3ZWCA 1WDKA 3HN2A 2RAFA 1T24A 2VOEA 2D59A 1ZKMA 3DBVO 4CM7A 4EITA 4NDNE 4JJFA 4DXHA 1LLUA 2A9FA 2X8LA 2C07A 3OQ1A 5BR7A 4YJFB 4M55A 3NT5A 5F3RA 5ER9A 5GY7A 1XGKA 5TF4A 1GQ2A 3M1LA 5CFZA 1K0UA 1HT0A 2JFGA 2ZTUA 4R1TA 2HU2A 2OUIA 4JLWA 5A5FA 3D7LA 4IQGA 3SEFA 4RPKA 2W2KB 4Z9XA 3AWDA 3GG9A 3ZHZA 3ZW9A 3UH1A 4BQPA 3DOOA 3IS3A 3T7EA 1J5PA 1QR6A 2IE0A 3MJTA 5KVQA 2LDXA 3QJ5A 2ZCVA 1U7HA 1GTMA 2CD9A 4J49A 3KXDA 3GOHA 2QX7A 4XJTA 4NFYA 3WLFA 2DBRA 2B4RO 5FI5A 1XG5A 4L4XA 3FD8A 2X22A 2E49A 3Q2IA 1FDTA 2NU7A 4FFRA 1SO8A 3WMXA 1OI7A 3A9WA 5H83A 1HF3A 1YJQA 4CM5A 4Q3CA 5CDYA 4RVDA 4HNGA 5KCZA 1ZW1A 4M86A 1A5ZA 4CMKA 4D46A 4OSOA 3RKRA 4XEHA 3FBGA 2UAGA 4LSWA 4R9RA 3C7AA 4IS2A 3ZU3A 5DBGA 4EGFA 3OQBA 1EVYA 1XDWA 2P5YA 3QA9A 3ZWOA 4UVDA 3FF4A 5JCXA 5F5LA 1XA0A 3H5NA 3ANLA 4LRTB 3SBOA 3PK0A 4YT2A 3INGA 3PGXA 4F45A 4L9RA 3V2HA 4LK3A 3AU8A 3ICCA 3PXXA 4IGEA 4BNVA 4NK5A 3IUPA 4YRDA 4PIVA 1RJWA 2PD3A 3KSUA 3DFZA 2NSDA 4GLLA 5DBFA 3JD4A 2YHUA 4CM9D 2WYUA 2C20A 3ABIA 1VKOA 4WECA 4UUMA 3GNSA 3OEWA 4R1NA 3PWKA 2JAHA 1GR0A 4EYEA 3PHIA 1IZ9A 1I3NA 4XWYA 4Y9DA 2PD6A 4XYEA 1A4UA 1DC6A 1Q0HA 3C8MA 2JD0A 4BNMA 3ZWXA 1PTJA 1R6DA 1YONA 3PEFA 3RFXA 1PL8A 4CMIA 3BMCA 5CP8A 4HFMA 3GFGA 3WGTA 3OF2A 4BNJA 3GRPA 4DRYA 5JYEA 1UDBA 1KY5A 1R4MA 5GZ6A 1ZXBA 1CERA 1WLYA 5F1OA 3IUSA 4N54A 1HDXA 2BKAA 5C7OO 3D1LA 1ZXLA 1IB6A 1VJTA 3GDFA 4A5OA 2Y66A 4L73A 1NASA 1A9ZA 3C1TA 3RASA 1E1NA 3L4BC 4BO3A 4J1SA 1I2CA 4R5MA 3C1AA 3EHEA 4YT4A 5EQFA 3DR3A 4HBGA 4YAGA 1E92A 3DBRA 3GN1A 2RBEA 2V6FA 3TF5A 1DC4A 1YH3A 3SLKA 3E18A 4U6SA 4FQ8A 3OJLA 3ST7A 3VTZA 4WLNA 2G5CA 3TRIA 1BDMA 3I9NA 2C5AA 3FR8A 4YJHB 4AJJA 5EINA 2I3AA 4CV0A 4XCVA 1EVJA 4BV8A 1B8VA 3NJ4A 1B3RA 4B79A 4AG3A 1FDUA 4PZEA 3NRCA 3ANMA 3C1OA 3JD0A 1AGNA 1EFLA 1QYVA 1SB9A 4M89A 4NJMB 1TT5B 4WCFC 4RLHA 3S55A 3EMKA 1L7DA 3NDRA 5K6AC 4Y6SA 1V3TA 2Z1MA 5HA5A 1AHIA 4BV9A 3RFTA 4GGPA 4BNFA 4TRMA 3H5AA 1HE4A 3B6ZA 4TZTA 2OHXA 4PLPA 2DKNA 3TPCA 3OA0A 1H2BA 1WPQA 3RJ9A 3MWEB 3C7CB 4MOWA 4CQMD 1ZMTA 1J4AA 2VHVA 4JN6B 5TC4A 2HK8A 3GNQA 4ILKA 2CNBA 5JAQA 1K6XA 3EZLA 2FR0A 1I3LA 4BNTA 2J3KA 5DZSA 4K1LA 4WOJA 1E6EA 1IPEA 3GG2A 4IDGA 4CM6A 4ND5A 2FWMX 1UJMA 2J5RA 4CUJA 4KTVE 5KJEA 3V5NA 2J8ZA 2YY7A 1NQAO 3BTUA 4LISA 1QLHA 3F4LA 1EE9A 3HDHA 2Y1EA 2OBYA 2CFCA 3TJRA 3QHAA 3WNVA 3AM5A 2Y05A 3B20A 1M6HA 4I5EA 3GF4A 1KYQA 2HLPA 1V35A 2VTDA 2ZCUA 3G3EA 4G5HA 4BNNA 5A04A 3Q3CA 1U4OA 4Z0PA 4N5NA 1SNYA 3ADOA 1PGOA 2P9CA 3P5SA 4IZIA 1PL6A 2ZQYA 4NQZA 4PGFA 2YHIB 5JE8A 5I7EA 3W4JA 4EW6A 3WIEA 5LCXA 3PWZA 5G0VA 1JA9A 3PPIA 3RROA 3ZU5A 4YAKA 2Q2WA 2VUUA 3GZNA 3LC7O 4DL9A 5JLAA 2O4CA 3MEQA 4D7AA 1ZCJA 1BXKA 1PZFA 4LVUA 5A1TA 3JQGB 3KYDB 2NLOA 5I7SA 1PJCA 4FGSA 1ZZEA 4IXWA 3SC6A 4QECA 3PJDA 1MB4A 1IPFA 1R0KA 4XYBA 3TN7A 3RC9A 5I7VA 5ILGA 2CZCA 4DYDA 5CEFA 1JKJA 1XYGA 5AVOA 2GASA 4MVJH 4EZBA 4IDFA 3UW3A 2A35A 3GK3A 3JQAB 1H0KA 5JCJD 5I9NA 3EGOA 3UN1A 3ZWPA 1LTHR 1ZO8A 1C0KA 4R3NA 3TOZA 3SJUA 3WMWA 5I9LA 3PLRA 5A3VA 5LC1A 3E5MA 1VSVA 1ZIDA 4YJHA 1UAYA 1OAAA 4E6PA 1NFRA 1HDZA 1GUFA 1M76A 1O5IA 2E6UX 4Z0HO 1GAEO 2I65A 3JQAD 3S2FA 3DAPA 3L9WA 4OH1A 3OQ6A 3VH1A 1R4NB 1R16A 3NTRA 3UOGA 4ALKA 4W7IA 4J6FA 1QYDA 2Z5LA 4UEKA 3KSDO 4MP8A 5TT1A 2NQ8A 2O3RA 4J3FA 4ZQEA 4A03A 2YQ5A 4AJEA 2O7QA 3DDNA 4WASA 3K5PA 3QRWA 1BMDA 3D64A 4J4TA 2DQ4A 4XDZA 3SX2A 1UP6A 2Q1TA 2J3JA 1DFGA 1ID1A 2VWHA 4B7UA 3GR6A 1AHHA 2WE8A 1LX6A 1NR1A 4XKJA 4FOSA 2CF5A 1EUDA 1DC5A 4TSKA 3PJEA 1BHSA 1PX0A 4WJZA 4YAIA 3K2BA 2BD0A 1T4DA 3KB6A 3N74A 4PG8A 2J3IA 1W4ZA 2GR9A 1HTBA 3PHJA 5JO9A 3GZ4A 7MDHA 2VZ9A 2HKIA 1P0CA 5F5NA 4E32A 3CIFA 4O6VA 1U28A 3W4KA 3EYWA 4L76A 1ZK1A 1PS9A 2AE2A 1PR3A 4FFNA 1UZMA 4YRAA 4IJUA 5G2OA 1ISGA 3LK7A 4CMHA 1VI2A 2G17A 2PKQO 4I9NA 4AJIA 3WNQA 2GD1O 1VJ1A 4TVOA 4UVIA 4JGBA 1UZLA 1ZNQO 1YB1A 2IXAA 4WCDA 2EF1A 2JFFA 2Q3EA 5A05A 3WBBA 5EESA 3K2EA 4PVDA 1ONNA 1R12A 3HJAA 3JYLA 2Q1UA 3ZHXA 1HSOA 2X1HA 3HUDA 4E30A 2OGUA 4QUKA 3VVBA 3GZNB 2NVUB 5T8KA 4O1MA 1CDOA 1M6WA 1ZVMA 4CMGA 5ILOA 3ZV6A 4HFRA 2D8AA 3GGGA 4RLSA 4ZQBA 1LSUA 1YL7A 2P4HX 2V7PA 3DTTA 3WYEA 2YHIA 4TRNA 4A2CA 3FRJA 4II2A 4FS3A 3LT2A 2BI8A 2D0IA 3L9XA 3F47A 1T1SA 2ZIZA 4IM7A 3LC1O 1DJNA 1XLTA 3KV3O 4O59O 4PLTA 2P9GA 1JKIA 1W6UA 4Q3NA 1KEPA 1QYWA 1DIRA 4WE3A 4EJ0A 3GC6A 3PFFA 3IC5A 2DFDA 4W9NA 4AJNA 3GN2A 1EQ2A 4GX2A 4O63O 2FN7A 4PLCA 2O3TA 2J6IA 3A28A 4J9VA 4I1IA 4FFPA 5I8ZA 2PGLA 4XIJA 5L7YA 3JD2A 1NTOA 1PWZA 3WYCA 1EK6A 1BSVA 1GD1O 2B0JA 3GLQA 3NKLA 3P19A 2VUTA 3PDJA 2EJWA 4J1TA 4ND4A 4CLOA 1HZJA 4RZHA 2VTEA 3CTMA 3IJRA 4XYLA 2BI7A 3Q1LA 2IZ1A 4GKVA 1P3DA 4NI5A 3HB4X 1B8PA 1MG0A 3RUHA 5TS3A 1MA0A 2WE7A 4QFDA 2EWMA 3BXXA 3QLJA 4E12A 3LLVA 2PNFA 4BKOA 5CAEA 1HEUA 1X0VA 2B37A 3RKUA 4PLHA 5C5IA 3KHUA 1NAHA 3OA2A 4PN3A 2Q99A 5L7TA 4YDRA 2YJZA 5AOVA 3QV1A 4OQYA 3WSVA 2F00A 4LSMA 3EY4A 3BHIA 1EVZA 1YVEI 3NT2A 3HWRA 4RDHA 2Y0DA 4NJMA 3IJPA 1ISIA 1PZGA 2IRWA 2H63A 3VPXA 2ZB7A 4MVJI 4FFMA 1I8TA 1IOLA 1XU7A 5A02A 3ZU4A 5EERA 4BNXA 4J16A 2X5KO 3FHLA 4R54A 2EIHA 1E7SA 5K0ZA 3AUUA 4AJHA 2CF6A 1BVUA 2W90A 3DBRB 1WMAA 4NBWA 1I10A 4E4YA 4PG5A 1ENYA 1HDGO 1FF9A 2C7VA 1JKFA 4TWRA 3BMQB 3RUDA 2QYSA 4FPXA 4BO4A 3K96A 1YDEA 2X7HA 2NV6A 1R0SA 2WMDA 2YV1A 3JQFC 3ONEA 3DHNA 1NPYA 1ZUD1 6LDHA 4BS9A 2BMAA 5JDIA 1U1IA 2H5LA 1DEHA 4CLOB 2NVUA 2I6TA 5JFOA 4EUFA 2D2IA 1R37A 3EZYA 2Q49A 2DUWA 2BFMA 2HO5A 3LLSA 3I9OA 4PZCA 1VC2A 2UUOA 1WDMA 3AY3A 2HSDA 5G4LA 1RM4A 3KBOA 1VLLA 2D1YA 2RIRA 3FBTA 4BB6A 1E5QA 1VSUA 3FTNA 4LGVA 2RH8A 1HYHA 1CJCA 1P1IA 2VYNA 4EJ6A 5KTKA 5L45A 4Z9YA 1V8BA 4DMLA 1XEAA 3RUAA 4RGBA 4UVGA 2O7SA 3DHEA 3GPDG 1DIHA 3E9QA 3F1LA 3JYPA 2OO5A 3I9LA 1CRWG 2E4AA 1HDCA 1MXFA 5L3ZA 4NU6A 1M67A 1QMGA 2C82A 5ICSA 3OJFA 3BYZA 1P1RA 1WZIA 1N7HA 1O8CA 4HFNA 1CF2O 4NR0A 3JQFA 2O3QA 2AEJA 3RAJA 1LRLA 3WJAA 1LSSA 1KIFA 3GMSA 2O3SA 4ZICA 1I3KA 1ZSNA 3MOIA 3DAGA 1NQTA 1VM6A 5GZ1A 2QRLA 3MJVA 4BKUA 1Z7BA 5LDHA 2H9IA 4E5MA 1A7KA 3V2GA 3Q0EA 5LDGA 1MGOA 4JBHA 4FOOA 5I7FA 3U4CA 1FDWA 4FBGA 4HP8A 1NWHA 1OOEA 2DPHA 2O3UA 4WEOA 4ZRNA 5EPOA 3VZPA 1E77A 2IZZA 3WLEA 1D1TA 4IBOA 4W99A 1IHXA 5HBRA 2NU8A 1ISJA 3FNFA 2Y68A 2W2LA 3V1UA 4CODB 2G1UA 4CL8A 2Y67A 5L4LA 4QX6A 1ZEJA 1GYPA 5HTOA 1B15A 1FDVA 2PZKA 3LT4A 1X14A 3H9EO 3WTBA 1QORA 2WYVA 1ISMA 1F8FA 2C29D 1M2WA 3AK4A 5I8WA 4IS3A 4YJFA 5HM8A 3KM0A 2Q2QA 4LCJA 1HXHA 1S7CA 3GH3A 3AY6A 3NDIA 3JYNA 3PGJA 3ZV5A 2AHRA 3HADA 1ONPA 4BVAA 4ND2A 2GUGA 1KOLA 4PG4A 3FNGA 4TZKA 4QSMA 2P91A 1QG6A 4IPTA 4J2HA 5TT0A 3RC1A 3U3XA 4Y98A 2V65A 5FF9A 5C3MA 2JFHA 4E5YA 3TZ6A 4CR8A 1C1DB 4LN1A 4D42A 2YUTA 3JQ6A 4TQGA 2AQ8A 1R4NA 3KYDA 2CDAA 3JTMA 1KEVA 3NUGA 3INRA 4BMVA 2BH9A 4JXKA 4ZJUA 4AL4A 4AJLA 4JX8A 5IXYA 1SZJG 1DC3A 3U9LA 2XAAA 3S2IA 3ETDA 5DT9A 3OJOA 4YQYA 3GVHA 5L4NA 2DU8A 3RBXA 1JU9A 5IDWA 5ENDA 2DUUA 4RCVA 4CM4A 3Q9UA 4IUYA 3CH6A 3DHYA 2O4UX 1ONOA 4DC0A 5A03A 5TX7A 1XCBA 3H2ZA 2VCYA 5DCYA 4NFHA 1KVUA 3D5QA 2R00C 3AI1A 9LDTA 5U1PA 2PFGA 4J0FA 3I4CA 3BMNB 4RVGA 1XSEA 3ANNA 4A7PA 1DHTA 1PGJA 3ENNA 4DBVO 2PKQP 2CDBA 2CVOA 2WDZA 3DMTA 2XXJA 4DVJA 5KJFA 3W6ZA 8ADHA 1LLQA 1EFKA 1WWKA 4PLVA 1JQBA 3JQ7A 3QWHA 3JQGA 4GX1A 5IZCC 2BF7A 4XD2A 5TSDA 4GWKA 3U0BA 3Q6IA 3WQSB 3KLPX 3U4DA 3G1TA 1K3TA 5JC8A 4QEDA 1H2HA 4Y6RA 3L6OO 2WM3A 1U5CA 3CMCO 3HNPA 4J4BA 1BXGA 2ZTMA 2BHLA 1GZ3A 1RYEA 3PQEA 5TGDA 1C1XA 3W4IA 4D44A 2PA3A 1PJ4A 4OOFA 1EMDA 3SJ7A 1YJ8A 4RVUA 3JQ7B 1MUUA 4L74A 4Q3EA 3VH3A 1Y9AA 4ONEA 1P9LA 2O50A 5EMHA 3BTSA 4R01A 4R51A 4QT0A 2CVZA 2QQ5A 3BHJA 4CMJA 2XF8A 1CYDA 3BMNA 4ZA2A 4GX0A 2G76A 3QSGA 5JO0A 4WLFA 3I23A 1MC4A 2OP1A 3PLNA 3IP1A 5DN9A 4QO7A 2X0JA 4JP3A 3INTA 5CDUA 3IKVA 4FDAA 2GGSA 1B7GO 1UXHA 4R9SA 1UAGA 3SXPA 2D3TA 3DMTC 3WG9A 2VNAA 4IDEA 1HYEA 1NAIA 4MVJF 4OXYA 5CEJA 4HWKA 5JDCC 2ZJ1A 4J0EA 1IY8A 1YBMA 4YACA 2WD8A 1YL6A 4F3YA 1LA2A 4JBIA 4PLWA 1A27A 1IL0A 1ULUA 3L77A 4KWHA 3AM3A 1DSSG 3O26A 4HX5A 2OFPA 4PLFA 4MVJE 2QIOA 4P4GA 2AEFA 5G0WA 4JP2A 3KLMX 1RPNA 2UYYA 2HMVA 4HFJA 3VZRA 1VE9A 3BHMA 5AQ1A 3E9MA 1Q0LA 1T2FA 1W73A 5B37A 1VJ0A 1OC2A 1Y8RB 4WNIA 4ALMA 2GO1A 4BNHA 4KUGA 2NU6A 6ADHA 3QQPA 2EW2A 3EK2A 3DQPA 1HL3A 3PVZA 4IIUA 1HWYA 2DBVO 2VHWA 3E82A 5A06A 5JYDA 4Y8VA 5AXDA 2G0TA 4PCVA 3AY7A 5JS6A 5JPIA 1DLIA 1XQ6A 1DRUA 1FXSA 5H82A 3V1YA 3U62A 1GYRA 1OMOA 3L0DA 4BO9A 3E9NA 5H81A 4JIGA 1EBFA 4R1UA 1GU7A 1LBEA 2O2YA 3MTGA 4TMFA 3CEAA 2X9GA 2B83A 2NM0A 2NVWA 3M2PA 2QRJA 3KEOA 1TLTA 4ZQFA 3W6UA 3GVCA 2Y1OA 3U49A 2X86A 4BKQA 1AE1A 1LC3A 1RYDA 1L1FA 5L51A 1ADGA 1H93A 2EERA 4UREA 1K89A 3JQAA 4QXMA 1DIBA 3GAFA 3DOJA 3OICA 2O3JA 4U8GA 4I5DA 5DCWA 4H16A 5AXCA 2GPTA 4XQCA 4YB8A 5U4QA 3JSAA 2Y0CA 1ADFA 3UXYA 1ZK0A 1PJLA 1UDAA 1QYCA 1YB4A 3JQDA 5BQFA 3ONDA 1KVSA 4FW8A 3ROKA 4CMEA 2EW8A 2DLDA 2J3HA 4E0BA 2X9VA 3P2YA 1NVGA 4URFA 4D3FA 1QLJA 2GRAA 1E7MA 2NACA 3EUWA 1T2DA 3AOEC 4U0JA 3PYXA 4S1VA 3VH4A 3RU9A 3WGZA 2YFQA 1F0YA 2I9PA 4NMHA 4CL3A 5G0UA 1NX6A 1GFSA 1R15A 1XHLA 4RPGA 1SEPA 3F1KA 2RHCA 2NTVA 4L8VA 4D43A 3C24A 5B4VA 2HMTA 5JNLA 2EKLA 3I1JA 3AI2A 5FWNA 1N9GB 2VUSA 5L4SA 4RV9A 1WMBA 5T64A 4MP3A 1PZEA 3SLGA 1WDLA 3L4BA 2VYVA 1Y1PA 2VRCD 5IDYA 3COSA 3H4VA 3T4EA 4OYRA 3ZU2A 4A27A 1XKQA 1DB3A 2EG9A 4PLYA 3RUIA 3G17A 1J6UA 4DTIA 3FPCA 2VN8A 2BRUA 1EVIA 5EQDA 1RM5A 4RQTA 4MKRA 3FN4A 3MOGA 3C7DB 3ZNOA 1VKNA 3CZRA 1EUZA 4BKRA 4ZVVA 2PH3A 3F5SA 1UP4A 3QW2A 4XGNA 3GPIA 1U8XX 4LMRA 3BA1A 3BMQA 2Q4EA 2C7GA 3PZRA 3PYLA 1PJ2A 4KZPA 4YT5A 3ZNPA 4XRRA 2OZPA 1X13A 3ETGA 4ZHSA 4OKIA 2SCUA 3AOGA 2NUAA 4KUHA 4R1SA 4RJTA 4WNCA 4BGUA 2W8ZA 3EVNA 1HLDA 3JV7A 5BSFA 3S8MA 4CLHA 1LDNA 3VDRA 1HLPA 3AOEA 2B5WA 4RDIA 3RSHA 3ITKA 2VRCA 4I5FA 4J7UA 4KQWA 1YBAA 1GCOA 2VYVD 5U9CA 4FR5A 3WWZA 1E5LA 5FFFA 3D4OA 2BFAA 3ROQA 1X0XA 1U4SA 1Y81A 4R69A 2ZATA 2YZ7A 2GCGA 2QRKA 1XR3A 3VC7A 1GUZA 2PD4A 4UVEA 5THQA 1OZAA 2H1SA 5BNTA 5TLSA 5BSGA 2JD1A 3W1VA 2VHXA 4E5KA 2FMUA 1HE5A 3PJGA 3S2EA 1SB8A 2EXXA 3P7MA 4E33A 1NFQA 4XYMA 5AYVA 1I32A 2NQTA 4GSLA 3DFUA 4JQCA 1NFFA 2JAPA 4ZQHA 5JW6A 1F8GA 3ZWMA 3PHHA 1JWAB 2PLAA 2B4QA 4OO3A 4E31A 5COQA 5THKA 1S6YA 4I5GA 2FZWA 5JDIC 3MJCA 2HK7A 3H3FA 4BO5A 3RVDA 1VL6A 3HDQA 1YWGO 1KERA 3I83A 3F4BA 2I66A 4IJVA 2B69A 4CLDA 3WGOA 4BGVA 3DOCA 3GQVA 3D4PA 3NYWA 5CG1A 5ADHA 1DFIA 4GVXA 5IFLA 4IGFA 7ADHA 4Q3DA 2FPPA 3WWYA 1X15A 3CINA 1AN9A 2CVQA 1B16A 5GMOA 3VVCA 1EEHA 4DUPA 3WQQA 1SPXA 5K6AA 4E3ZA 1MXHA 4GQAA 1VPDA 4D79A 1TXGA 1R4MB 1PS0A 4P4NA 2JCYA 3PZBA 4E2YA 4IQ8A 2X23A 5JAZA 2Q1WA 3O38A 2IEBA 2DVMA 5DBIA 5DOVA 3ZHYA 3BMCB 2Z1NA 4W7HA 3R0IA 2Q1SA 4IDCA 1T2AA 3UFXA 2X0IA 4CMIB 1CIVA 1H6DA 1H6AA 5L40A 3KVOA 4OL9A 1ENPA 5T8KC 2TMDA 1D1SA 3DBLB 3HFSA 3RUCA 3WIDA 3PWSA 1W8DA 4L0QA 4BQRA 3DWFA 4M1QA 4CM8B 3KRTA 3TNLA 3DO5A 5F1PA 4NH4A 2VHYA 3DZKA 1XU9A 3E48A 3PIIA 1TVEA 1PJQA 2AG5A 3GUYA 5ER6A 5CDGA 1DRVA 4RORA 4NK4A 3WS7A 4Z6KA 2XPCA 4B4VA 2CUKA 4WKGA 5JY6A 1N7GA 4FJ1A 3E8XA 1O6ZA 3H5RA 3L6EA 4WUVA 2W2KA 4DA9A 1ZK4A 1KETA 4XGIA 5T57A 2VWPA 1PQWA 1HE2A 2ZQZA 2VT3A 3DBHA 4XR9A 1SAYA 1PJSA 2HMSA 3NJ8A 4GX5A 1I0ZA 3GA0A 3JQBC 1WAMA 1H6CA 3FWNA 4YA6A 1M75A 4MJLA 3MZ0A 4NZ9A 1H6BA 1HRDA 1PGNA 2GDZA 4DPMA 4DC1A 1LXCA 1YQGA 1KEUA 1NPTO 1OFGA 5ICMA 2O23A 4FJ0A 1DLJA 3U09A 4AJOA 2VRBA 3F46A 4EUEA 5KVSA 5BT9A 3D0OA 1NHGA 1LDGA 1Z73A 2BELA 2VQ3A 3CUKA 4WPGA 1YXMA 2HJSA 1E3JA 1JVBA 3WGGA 3H65A 5TNXA 4ROSA 4DQUA 4KDEA 2PH5A 3H9UA 3IAHA 4IZHA 1CQIA 3EAGA 1ZBQA 3CMMA 3OECA 2W4QA 2DTXA 1PL7A 4AJ4A 1NHWA 1NVMB 3UKOA 2Z95A 4DLBA 1YOVB 1GPJA 4RPLA 4B7CA 1P1HA 2O48X 3JD3A 4GLOA 3LC2O 2HMWA 2I3GA 3U5TA 4C7KA 3D4NA 1Y5MA 5TQVA 1QKIA 4DLLA 4CV3A 1BG6A 3M1AA 3UCFA 2YDXA 2EKQA 4Y67A 4WLVA 5L7WA 2Q4BA 4OXKA 1UH5A 1MC5A 4A73A 2C59A 2WD7A 1C14A 3Q2KA 3CXRA 4AJ1A 5A9SB 1D7OA 2C5EA 3JQ8A 3UGKA 1P1FA 4KOAA 1F12A 4PVCA 3TZHA 1ZMOA 2C2YA 1HDRA 4KP7A 3FR7A 1ZK2A 4ESOA 1SOVA 1LQUA 3KTDA 2V6GA 1O95A 3JD1A 4EBFA 4AFNA 2PWZA 3W8FA 4E13A 2FSSA 3SVTA 2PKRA 1LLDA 1DOHA 4GGOA 1YDWA 4IINA 1XWFA 4YXFA 1Z82A 1SMKA 4YAJA 1HDOA 3TQHA 2YDYA 1HETA 2QW8A 1EUCA 4EJMA 1PU2A 1GADO 1PSDA 1UXKA 2V6MA 4IDBA 1KEWA 3A4VA 4UEOA 1Q0QA 2VWGA 3GDGA 2BGKA 1NM5A 1PGPA 3UCEA 4YR9A 1CEQA 2ZYDA 1CETA 3BMOA 3TFQA 2C54A 2X4GA 3B1KA 1VRWA 2E82A 1HZZA 4IQ0A 4OHUA 3AFNA 1K6IA 2Y0EA 4B4UA 5IJZA 3HG7A 4MINA 4OKNA 4PLZA 4DQVA 1BWSA 2C2XA 4J91A 1XELA 1AXGA 4CLRA 3OP4A 5EL0A 3UAGA 4I08A 2QYTA 3GMDA 2A92A 4WOKA 4YAEA 3NAQA 4RPHA 1Z75A 1E1MA 1K2WA 3ZWNA 4FGWA 1IULA 5TJ9A 1BXZA 1E6UA 2IEDA 4RVSA 1WNTA 2Y1CA 1E7RA 2NNLD 3EC7A 3H8VA 1H9AA 3O8QA 5DDIP 3ZNQA 3HQ4O 1C3VA 1T26A 1PQPA 1IZ0A 2A94A 1G0NA 1BVRA 1Y6JA 4GAEA 4WCFB 4CR6A 4MIOA 1TI7A 1PJ3A 4DLAA 4L4SA 3B70A 4ZGWA 3CSDA 1BW9A 4BMSA 1Y8QA 4M8SA 3A1NA 3AI3A 5L9AA 3L4SO 3OJEA 4HUJA 4UAGA 1I5RA 2JHFA 3MTJA 4Q39A 5CDSA 1GY8A 1YKFA 3JQCA 3PQDA 1E3IA 2I67A 4N18A 3LDHA 3JQEA 1Q7BA 4GMFA 1KBZA 1B2LA 4IMRA 2GLXA 3ZI0A 2VHZA 3AFMA 1P77A 4OM8A 1M66A 5ITWA 4UUNA 3QVXA 4CUZA 2X0RA 3QWBA 4RVHA 3RWBA 1D8AA 1EBUA 1X7HA 2AQHA 3GGPA 4DIFA 3ZV3A 1GEEA 2GF2A 1GCUA 3K30A 4UUOA 4FD3A 4W6ZA 3H9JA 4XR4A 2QZZA 2NTJA 4CUKA 2EKPA 4GSKA 2VNSA 2QZ9A 3ZV4A 4L75A 2BLLA 3QVTA 3ZWYA 9LDBA 1T4BA 2TMGA 4J7XA 3VKUA 1E7QA 1MV8A 1P31A 1PWXA 2EJVA 1ZH8A 3GFBA 4J4HA 3GVPA 4KMSA 1H5QA 3W8EA 2JHGA 3A14A 4K26A 4U0KA 3FCOA 4GL4A 4JJIA 4BB5A 1JLLA 4EI2A 4CM1A 3BTOA 1LRKA 1O89A 2HAEA 3KYCB 1U5AA 4PRLA 2H6EA 5IZ4A 1YRLA 3HSKA 4JNKA 4XQGA 1JWBB 3OJ0A 2OBNA 2X9NA 4O0LA 2I76A 3BTVA 3VPGA 4BHTA 3LF1A 4JJGA 1OC4A 2OOSA 1UXGA 3IKTA 2AXQA 1WP4A 4BO6A 4NBTA 3H3JA 4PG7A 4D3DA 4KTTE 3NX4A 3ZN2A 1YBVA 2IDZA 3OFSA 1NVTA 4K9DA 1ZJZA 3C85A 3FNHA 4OGWA 1GQQA 3IL2A 2J5QA 5FEUA 1N5DA 1GZ4A 3W8DA 1ZSVA 1MFZA 2EV9A 3NEPX 1JDJA 5JAMA 1DIAA 2GN6A 1QSGA 2O2SA 3ETEA 4BMNA 1PS8A 1K6JA 3QWAA 3K73O 1MG5A 2RCYA 3HHPA 3DZGA 3PHGA 4PLGA 4BUCA 1Q7GA 3TZCA 3PIDA 1DRWA 2P9EA 3GGOA 1G6KA 4K6FA 4Z9FA 4E21A 4O5OA 4X54A 4C4OA 3E03A 1C0PA 2ZYGA 1JAXA 4WLEA 2JL1A 1UR5A 2FSVA 2HRBA 1JN0A 2UDPA 4TRRA 4CPDA 4FC6A 2X5OA 3NGLA 2IYOA 5FYDA 2ZJ0A 3M2TA 4YJDA 3RUFA 4GI2A 2IXBA 3G1UA 4U7WA 3I3OA 4ZU3A 5BSHA 4BIIA 4CV1A 5BNIA 1LDYA 1B26A 2ZYAA 3RD5A 1R0LA 4LW8A 3MWDB 1A72A 2LDBA 4BO0A 3OIDA 2D4AA 2B4TO 1CWUA 5AXAA 3MJEA 5IZCA 4E2XA 3TWOA 3WXBA 4BNIA 1T2CA 1X1TA 3QP9A 5KKCA 1C0LA 2VOJA 5A9TA 2Y93A 4XQEA 3ZZNA 2J5KA 1E1KA 4TVBA 1SBYA 3RC7A 2GN4A 3HN7A 3E5RA 1GEGA 3VHRA 5JXWA 1UUFA 2YYYA 2PR2A 1YL5A 3QWFA 3WQRA 2NU9A 2GN8A 2CDCA 3PYMA 3WTCA 1ADBA 4IJWA 1GUYA 4DMMA 4YEDA 3HE3A 3IP3A 1DXYA 3LSYA 2YV2A 3NTOA 2GZ3A 3OEYA 4OXNA 5AXBA 4MP6A 3U4IA 4CM8A 4K6CA 1Z6ZA 4E2ZA 2WSBA 3ZWAA 4B3HA 2ET6A 4OAQA 2DBZA 3WJ7A 1TT5A 1A71A 5DNAA 4AVYA 1QYXA 5I9MA 3I5MA 4P38A 2W2LD 5ES3A 3BIOA 5CG2A 4JCOA 3ONFA 1Y7TA 1N8KA 5B4UA 4BO7A 1DPGA 1J49A 4HADA 4DWVA 4NBRA 3FPLA 3HFGA 4HKTA 4KDFA 1U3TA 3D3WB 5JBIA 1NBOA 1PR9A 5JAIA 3GDOA 1D4FA 1P33A 2C0CA 4M87A 4NPCA 4CJXA 1IYZA 4QTZA 1E3WA 3F9IA 2CMDA 3VPFA 4Q9NA 5G0SA 1G1AA 2OMEA 1DAOA 2X6TA 3BMOB 4EDFA 4F6LA 3ICPA 3UCXA 3ZGYA 4PG6A 1TA4A 5B12A 4FFOA 5T5QA 1O0SA 1DFHA 4CMBA 4LCEA 3P2OA 2HCTA 1U8FO 2EGGA 4EEZA 3G79A 4K28A 5TRTA 1H94A 1QRRA 1YQDA 5JMWA 1I36A 1PJBA 1X1EA 3TZKA 3ROMA 3D3EA 1WVGA 3EW7A 3GEGA 3F5QA 5CDTA 5F21A 3TL2A 1SC6A 1A7AA 3U4HA 2I5PO 3UF0A 1GL3A 1TB4A 3PTZA 3O03A 1UXIA 4NU5A 4RF5A 5DP1A 4CM4B 4XJSA 1BDBA 3CKYA 3I4FA 1B8UA 2UUPA 4I9UA 4DPKA 2DPGA 3A06A 3LU1A 3ASVA 2GSDA 2VYND 3UICA 4B8WA 1TEHA 1A4IA 3OETA 1DDOA 1F06A 1FJHA 3ZW8A 1CQJA 1I24A 1X7DA 4N7RA 3WFJA 4G65A 4GWGA 3VOSA 4B3IA 5IAAA 2Q45A 1GQYA 3FWZA 4Q3AA 5DF1A 1YB5A 5DCUA 4W4TA 3R1IA 4AJPA 5HS4A 4MVJP 4YWJA 3OH8A 3R3JA 4MVJM 1MLDA 3ULKA 1P45A 4GMGA 2R6JA 1YQXA 5G0TA 1SCUA 2XOXA 5IN4A 3ZCXA 1ORRA 1KVRA 4R68A 2POQX 2E37A 2HDHA 3FNEA 1ULSA 4MIEA 5IDQA 4MVJG 1TT7A 1SOWA 2YQ4A 4YRBA 1L7EA 1ENOA 3DEYX 4MKXA 4I9HA 3G0OA 1JTVA 3QIVA 2GZ1A 1ZEMA 1Q1NA 3DL2A 4BGIA 3MJSA 3QVWA 3OIGA 1N1GA 2PGJA 3KETA 5BSEA 4R3WA 2PZLA 4NJOA 3VZSA 3CPSA 5B1YA 1I3MA 1UXJA 2FP4A 4CM9A 3KO8A 4J43A 2OORA 5A5EA 1G0OA 3NTQA 3TZQA 5K9ZA 3TL3A 1FDSA 4W9NC 2JD2A 2ZTLA 3ZDFA 3OBBA 4DPLA 4YTEA 4UUPA 1EQUA 4B8ZA 1ZSYA 3OHSX 1KY4A 3ORFA 1PEDA 1PQUA 4NBUA 1NP3A 2P5UA 4QO8A 3WDSA 4XB1A 2Y1GA 1Z74A 1EK5A 4OIMA 4XDYA 3TDKA 4IDDA 1V9LA 3WGYA 2BFOA 4XA8A 4L4RA 4J90A 3RCBA 3DZFA 1QV6A 5KNLA 3DZHA 5T6BA 3VPSA 1GV1A 4Z3DA 4R16A 4MVJD 4CQMB 5KIAA 3GUCA 3RQSA 4JBGA 2AQIA 1JW9B 5IDXA 1U3WA 1LLCA 3I6QA 1U3UA 2HRZA 1LI4A 1BGVA 5TIIA 3NV9A 3PHLA 4CMEC 2IZ0A 3IOYA 5G4KB 2AW5A 3GEDA 3VH2A 3DZJA 1P74A 3LVFO 5J23A 2V6BA 3DZBA 2ZKLA 4RL6A 3TFOA 4MO2A 4IDAA 3CZMA 1ZJYA 2EHDA 4RF4A 3L07A 4YJGB 4Q3BA 3B1FA 5TJHA 3LQFA 1E1LA 1WW8A 3HDJA 3V2UA 1LJ8A 4LRSB 3HZZA 1NPDA 1ML3A 2ILTA 4XQ9A 1VL0A 4G2NA 2NADA 4YYZA 3OIFA 4BNLA 1LQTA 4J1QA 1MP0A 3RBZA 4D0SA 4FJ2A 4GPD1 4E5PA 3M6IA 3IQDB 1RWBA 4FIZA 4HXYA 3CE6A 3ASUA 3FI9A 3DXFA 3H6KA 5KKAA 5COAA 3KUXA 4CLXA 2BGMA 2RHRA 4H15A 2B36A 3ITDA 3D5TA 5KJ1A 3O9ZA 5B4TA 3JYOA 4FCCA 2HQ1A 4B4OA 4D0RA 3WGQA 5BNFA 2VZ8A 1NNUA 1E3EA 2DM6A 3KYCA 4J7CA 1JAYA 4ND3A 1H9BA 3WGHA 2W98A 1EDOA 3UHAA 1UZNA 2F1KA 1DBVO 4R4JA 3RI3A 2FR1A 2YV3A 5JC1A 4CMCA 4ND1A 1LEHA 4CQLA 3R3SA 1PZHA 3MJ4A 1NXQA 3KSZO 2G82A 2OXIA 2PY6A 2Y99A 3NT4A 1OBFO 4MDHA 1VL8A 3VPHA 4DIBA 5KVCA 3RFVA 3RUEA 1Y8RA 2A4KA 3I9JA 3HDYA 3VZQA 4XIYA 4CR7A 3O8QB 2UV8A 4UEJA 4FFLA 2DFVA 1I33A 2FPGA 4FB5A 4ID9A 2JCVA 3ZWBA 2HK9A 3E6AA 1ENZA 4MIYA 3BZUA 3LF2A 1NWCA 4RQUA 3K92A 3JQ9C 3IDSA 4P22A 5IG2A 4UULA 1Y9EA 4DQXA 3X2EA 1P1JA 4TROA 4BNYA 1GV0A 2X5JO 5KJCA 4R5HA 4HY3A 1XIVA 4PFJA 4RO0A 5KJ6A 2JJYA 1V3UA 3V1TC 4BO8A 4GH5A 1YE3A 2FR8A 1FK8A 3GY0A 3MCVA 4NG5A 4RZIA 3T4XA 5MGBA 4BNZA 3ENKA 1DHRA 3WYBA 4KWIA 4GKBA 3LYLA 3E1KA 1ADCA 3WB9A 4XB2A 3RJ5A 1SEVA 3N7UA 2HUNA 3VTFA 1EE2A 1N92A 4FSHA 1A9YA 4ITUA 1E7WA 4IIVA 4E5NA 2AEMA 1LUAA 3DMYA 4B4WA 4NFSA 3F3SA 3EDMA 4N5LA 3I6IA 5EJ2A 4FC7A 2DC1A 4M49A 4OQZA 1E3SA 1IUKA 3RU7A 1B14A 5IXSA 3STHA 3JYQA 4BNGA 3S2GA 5CPBA 1YGYA 4F46A 2HJRA 3WOHA 3WSWA 4XYGA 2GN9A 1HDYA 3AUAA 4OJNA 5DOZA 3V8BA 2FHSA 3ZHBA 1I01A 4U6QA 4BOYA 3DAFA 1ARZA 3GAZA 4Z0TA 1LDMA 4CV2A 4KUEA 4XGKA 2ZB8A 2DAPA 5GZ3A 3QVSA 4CMAA 1GPDG 5L95A 2ZB3A 1UP7A 5JY1A 3NDJA 1I2ZA 2QG4A 3OM9A 3AUSA 4ZQGA 3IIEA 4ALLA 3L6DA 1LDBA 2WWRA 4GBJA 1N9GA 2AA3A 2EP5A 2WEKA 1HKUA 4RF2A 1F17A 1B0AA 3KYBA 4CM3A 1UDCA 4II3A 2YFHA 2FRDA 1LU9A 1DAPA 3VKVA 4YT8A 1YOVA 3GVXA 1N2SA 1RM0A 2P2SA 1U2DA 3Q9NA 3K8ZA 3I9KA 4ALJA 3DTYA 1N1EA 3WX0A 2JKVA 1DJQA 3GT0A 1RKXA 2GNAA 3C3XA 2E48A 1IHYA 1O94A 3WICA 3GVIA 2B5VA 5T67A 3AW9A 3AJRA 3TSCA 4TKMA 2JCXA 2Q50A 3DZIA 3TOXA 1Q7CA 3GHHA 4YJGA 3WGIA 1IE3A 1V3VA 4BNKA 5CPFA 1P44A 4ZN6A 3GEMA 4W82A 2PZJA 1GZ6A 4QQRA 4ZD6A 4MPDA 1BRMA 1C1DA 1DIGA 4JROA 4DBZA 4H7PA 2HMUA 2WD7B 4XRGA 3PRJA 1E0DA 5JSFA 3LZ6A 1KC1A 4B3JA 4LMPA 1DO8A 3K6JA 4NHEA 3NGXA 1BTOA 3OSUA 4NNJA 1ZFNA 3R6DA 4D41A 4MVJA 1W0CA 3LT0A 4P4LA 5CEEA 5ITVA 4OOEA 1O9BA 1E3LA 4CQMA 1T25A 1JVSA 1F14A 5DULA 1U2GA 3I52A 3WBFA 1NQOA 5FI3A 1ISFA 2GZ2A 4IJKA 4GVLA 4RVFA 1E7YA 1PJTA 2CY0A 1EDZA 4N5MA 4IMPA 5HS6A
chains in the Genus database with same CATH superfamily
1XJWA 2GXUA 4I2VA 2FWJA 4NEQA 2W4MA 2ZYHA 3BRWD 4DBLE 2BGLA 1N36B 1U0NA 5TMEA 2I71A 4CG0A 3SC3A 1TJ3A 3PEVA 4J03A 4YRIA 1UBFA 4S3MA 4LJ6A 4WCFA 1YBHA 1YB7A 5KCMA 4HXFB 3B12A 4MKZA 3HBAA 1KYVA 1ZNYA 3UNXA 3IMCA 3RF7A 2WZQA 1TL7C 2TYSB 4F8EA 3P9XA 3FNIA 2CFSA 3A6JA 3TIGA 2Q46A 2UXDB 3ADPA 4ASUA 2FY8A 5F1KA 3OLZA 2OA0A 2H1HA 4IX9A 4FYHA 1MA3A 1R88A 4FS8A 3KE8A 3L7YA 4KQXA 4ZRMA 1BHJA 1YVDA 4DF3A 3DULA 4CQJA 2QYOA 2I2CA 2I99A 2FDRA 5J2TB 1ZNXA 5JBQA 1ZD9A 3N8DA 2I3BA 2W83A 1USUA 1C30A 3PGA1 4GBMA 3USCS 5C7LO 5TV2A 3DBHB 2I7VA 2V4ZA 5LYJF 1D2GA 4C0QC 1DJOA 4NLLA 4WLOA 4W5QA 3QXGA 3KOUA 3KTAB 4HZIA 1X42A 3PJRA 2Z3ZA 4PTLA 1BIFA 4YPOA 2W6MA 2FEAA 3PR2B 2Q0XA 3W5HA 1JFSA 4TYYA 4YP6A 4B8ZA 5LL6P 3PQFA 4DIOA 2WV7A 4EMUA 1LS1A 1XJCA 5CCXA 4NBVA 4U9UA 4G4SO 4WK6A 1CE8A 2ONJA 5CLJA 1P0FA 4FMCB 4Q00A 5DXJA 3DKVA 1XD8A 4B7AA 1P5HA 1W75A 4E08A 2C9YA 2E4WA 5C7IO 4AF7A 3PGKA 4OMUA 5DYNA 1T9BA 2I4NA 1BKDR 3ABSB 2GBCA 3OPXA 4BO2A 1D4OA 3NVDA 2W8BA 3RGGA 3SC4A 1KVTA 1WMEA 5DTRA 2Z8XA 3HI6A 3QE3A 1BDIA 4RKQA 3T3DA 1LVHA 2HF8A 3R0VA 4TUYB 1P0QA 3SOPA 4H4CA 4QRIA 5CB6A 3NRJA 1CD5A 2ZW9A 2ZUFA 1PWEA 1KBOA 3CVWA 5BSVA 2DWCA 4WADA 3NC4A 3GRKA 2PNJA 4BQEA 1DDIA 2XMPA 4PHTA 4D45A 4HNHA 1P7ZA 5COBA 3MT8A 1PR6A 4PFQA 3TGPA 2Y1FA 3FWKA 1YS4A 4U5QA 5BUQA 4IIDA 1LSJA 3UHOA 1U3VA 4F5YA 1ZLYA 4EUHA 2WTBA 3CX6A 2JAQA 3CB2A 1JA0A 4GP9A 3KQQA 3VYTB 2WJGA 1YHZA 2J41A 4FZRA 2H92A 4Q4AA 4DN6A 2PYDA 2ZK7A 3ZNNA 3NIFB 3O9VA 1VJDA 4L9WA 4Q7EA 5LBUA 3N8HA 1LC0A 5D2CA 5K0LA 2VCEA 4RPJA 4AP9A 3NHLA 3EASA 2R8EA 1FUYB 1G291 3PFWO 1HYGA 3AERA 4RD1A 2ETXA 1L4NA 1F0PA 4R41A 4BNWA 4LAFA 4MITA 2WTEA 5IU6A 1CZNA 2PFKA 1H85A 4AP6A 3WJ1A 1QXSA 4US1R 4C6TA 2FPMA 1I5EA 1T1EA 3A0RB 3B36A 3PNBA 3SS8A 3TLZA 4ZKDA 3SDZA 4ND7A 4M54A 4ND6A 5M5BA 1C4XA 1IZYA 3MQ2A 4GMHA 3H9GA 1NBIA 1WF3A 2DY0A 2P68A 3BAZA 3IHKA 5CT9A 5K0NA 1HE3A 2D5CA 3AR6A 3D2BA 3DONA 3VR2A 2ZR0A 1V48A 4II7A 4EEXA 4BEBA 2FUG6 1NR7A 4FDLA 1I1NA 2ZJOA 4TX1A 4EG4A 5LJLA 3AINA 1JF8A 121PA 2DWPA 2YJNA 1X7YA 2JH8A 1ZYUA 4S1TA 1ZK3A 1FP6A 1YRBA 1ZU5A 3RRMA 2I2AA 3I73A 2Q28A 3HB5X 4EFDA 4EAQA 3NVKI 4MS1A 4MVXA 1S01A 3VZBA 2ZBRA 1U1DA 1ZL2A 2O0KA 1PYOA 3D6UA 2BN4A 3H2BA 4LYYA 3RVQA 3D59A 5IF3A 4H0NA 2RH4A 4ALNA 2AD5A 3S1LA 2RFLA 4NXNB 2V4MA 3ZWQA 3O8CA 4JCCA 1Z2NX 1COWD 5CAEB 5A4DA 1YAJA 5FB3A 2AR9A 3B1JA 3CG4A 1SIOA 1X7GA 1U9JA 3RB8A 3A36A 3ZWCA 1Y3AA 3HN2A 1TK3A 2ERYA 4GG1A 1D2EA 4ZCIA 1UINA 1T24A 1X7XA 3KZCA 3FGNA 4JXZA 5F35A 3RHFA 4EIWA 3RVBA 4QHYA 1Q44A 2A9FA 5M04A 2R751 3DWGA 3I53A 4IL5A 3EG9A 1UK7A 5IM4A 1TX4B 3BRWA 3VPAA 1EGVB 1JR4A 5GY7A 5TF4A 4LZZA 2HNAA 3M1LA 3N5CA 4PYLA 5K3CA 4OBXA 2GYVA 4Y30A 2VJNA 2ZTUA 3H99A 4R1TA 3RLIA 3RADC 4N6OA 1P9WA 4C4RA 1AKMA 2DJIA 3SEFA 2GHIA 4IQFA 3ZW9A 3ZHZA 5KTSA 2SCUB 2ZI4A 1QWSA 5JRZA 5IAEA 3OZDA 1E2HA 2G0NA 2IE0A 2IOYA 4FTWA 4ZIRA 4PAMA 4PC6A 2GRJA 3A7EA 2O5EA 1C7IA 4BFLA 2WG1A 1GTMA 4J49A 4NYMR 4BRZA 3KXDA 5DFAA 4YECA 4ZTZB 1JNYA 1QCZA 2EBFX 3GLKA 4LV6A 3T1QA 3WLFA 2EQBA 2B4RO 1V5IA 4D0LB 3H16A 1CUWA 1GPMA 1KI4A 3FD8A 4L4XA 3M9WA 3IQWA 4ZVUA 3U5ZB 1IHPA 3B7PA 5LMZA 3A9WA 5BSUA 4EHKA 4IIFA 1P18A 4RVDA 4E1AA 1LX7A 2GEVA 3LAWA 4KAFA 4Z5XA 4UE2A 1ZW1A 2IUEA 4JT8A 1XOIA 4QQ8A 3HO8A 5BR1A 2BEVA 1OH7A 2UAGA 4QGHA 3TEMA 3C7AA 4IS2A 1TYEB 2ZETA 4Q19A 2VBGA 2OESA 2ZYUX 4ZU3A 1EGQA 4EGFA 1ECLA 4EUSA 1OZHA 1EVYA 3KJEA 1OBHA 3QA9A 1UMCA 4UVDA 2ATIA 3VR6D 3PTLA 4QJ5A 1GKLA 2CFTA 4RIHA 5ANRB 1R6BX 3SBOA 2QPTA 4LK3A 4KYIB 1SN7A 3AU8A 2FW1A 2HH9A 3PKZA 2WK1A 3FPFA 3DDZX 1DBQA 2X40A 3MIIA 3N7TA 5LN1A 4NK5A 2QLTA 3EZ9A 4YRDA 3DJYA 3EVZA 2YOHA 2ACVA 4TTAA 1RJWA 4CTNA 4UTPA 3VA7A 4C03A 5DBFA 5LSAA 5T6MA 3MMSA 2V4UA 3W5VA 4YRTA 4YMHA 2XDQA 3I5UA 3ME5A 4WECA 4ZALA 1PKEA 2AB0A 5DHFA 4EYEA 2IBTA 3HYSA 3PHIA 2O7VA 1Z7YA 3IEUA 1A4UA 1DC6A 1DEKA 1Q0HA 3JVDA 4NSNA 3RBAA 3RSSA 3B7WA 4AQDA 2WUWE 1U90A 1EP3B 1JLLB 3ICOA 3ZWXA 1PTJA 1M9NA 1R6DA 4X6YA 4RMHA 3K0FA 3UO8B 4RAOA 1QPBA 2XD9A 4UHBA 1NDQA 4BLRA 1WW3A 5JUWA 4U8HA 1I6KA 1DVRA 1S3FA 2IYAA 1CY0A 3FFWA 3GFGA 5BMVA 3VVMA 1NF9A 3GXOA 3OF2A 2BUAA 4YLGA 1I2DA 3FOWA 1UDBA 1ANKA 4UZFA 1ZXBA 3HY4A 4JLMA 4NG4A 4LJSA 5F1OA 1SZCA 3IUSA 4AY2A 4HTFA 1T91A 2BKAA 5EJ7A 3SZ3A 5C7OO 4ARCA 3B5EA 1IB6A 3GDFA 2FMHA 3JAWB 4JI0B 2Y66A 4L73A 1II8B 3QHQA 3OZXA 1UDRA 4JBWA 1ZD4A 1ZR2A 1NF3A 1T0HB 1XJ0A 2HA2A 4GQIA 3H6HA 3F8WA 1I2CA 3AEUA 4R5MA 2KBEA 3C1AA 1GCIA 3EHEA 3AP2A 1R8XA 2RMKA 3PNLA 1SVSA 3H1PA 4I81A 4V0NA 1YQ9A 4QTUB 5TE9A 3DBRA 1TVMA 3GN1A 3PFCA 1NXWA 2V6FA 3TF5A 1YH3A 3L7NA 4HQOA 4U7FA 5IMBA 3KQUA 4XFDA 1QIIA 3OJLA 1DKMA 4MCJA 3TJMA 1RACA 4HMQA 3VPBA 4FLEA 5ISMA 4CYMA 3WFZA 1DT5A 3FR8A 4YJHB 4AJJA 1KH3A 3CF6R 3QKRA 1QYRA 3STVA 5IKMA 4RTJA 1NLZA 3I5XA 2RB5A 5FWAA 1B3RA 3KZOA 2DWQA 3UJ6A 1G9SA 4PZEA 4ARAA 3S3TA 3NRCA 3C1OA 1T3GA 1AGNA 1JT9A 4BMDA 1L8QA 5CB8A 3NOQA 5MN6A 1SB9A 2WPNA 3F9RA 2CL6X 4FMBB 1TT5B 5M29A 1ZL0A 3COYA 2P0AA 1Y5LA 1ECPA 2UVPA 3WRXC 5K6AC 1JAHA 1V3TA 4Y6SA 5KQLA 1FSZA 1MT0A 3H2GA 4PZAA 4MS3B 2C96A 3QF7A 1OLSA 4GGPA 3BWMA 3COJA 3PWTA 1YA4A 3OOEA 3WGJA 4HVTA 2OHIA 3JXEA 1TM2A 2DKNA 3TPCA 2XV1A 2L17A 4WW0A 2IEGA 2IPLA 2R1TA 5EWLA 2M9MA 3R7NA 3NIDB 3MWEB 4UDYX 2V7GA 4LRYA 3O2SB 3CCFA 4HSEA 1KQPA 1MW8X 1J4AA 2GWHA 1WLSA 2VPZA 2UUCB 1MN6A 3GNQA 4PX9A 5HKKA 1P19A 2CNBA 4FYPA 1Y3HA 3D4BA 5JAQA 2QM0A 3TNYA 4R6XA 2IW3A 2AV6A 2Y8EA 4URVR 2FPUA 1S1CA 4GE3A 2WVHA 3G1WA 4G0UA 2IZ6A 3EUEA 621PA 3NIWA 3C0KA 3OF5A 1P7CA 4KAJA 4OLAA 3FCSB 4KVFA 1J0BA 1EXVA 3CHYA 1PF7E 4G5QA 2JVIA 1UJMA 1F0NA 4WINA 4RWEA 1DEAA 3CC8A 3NHFA 3CRW1 5KJEA 1A9XA 4HRXA 2HT6A 3QJYA 1P91A 3CSUA 1MD9A 4HVCA 4M1OA 2AYZA 4IDOA 2YY7A 3STWA 1JB1A 4V0OA 1NUQA 3ABOB 1FTQA 3DP7A 3KP1A 3QHAA 4DC9A 1RYHA 3MHPA 1WY5A 4M9SA 4LRQA 3TOVA 3ZTYA 1V5EA 4OGLA 1P6UA 1RU3A 1JR3A 2ZCUA 3ZY5A 1M2OA 4DABA 4KITB 1OASA 1UPAA 2XUIA 5PNTA 3GYBA 2P9CA 1MNQA 2XCOA 2E87A 4PGFA 4ZOLB 2YHIB 4MUEA 1ZUWA 3E7WA 1LNSA 4TN1A 1UBSB 3TBHA 2NAPA 4DLNA 4G0WA 2JFVA 3H05A 3WIEA 1E2IA 2G07A 5G0VA 4QODA 1R0YA 2Z98A 2ZT6A 3FWYA 2Q2WA 2VUUA 1Q84A 5AUQA 4UAUA 3Q9LA 4TKUA 3ND5A 2YJ5A 3ZBUA 2OZKA 2PLNA 5SZIA 1V4VA 4LVUA 5IPFA 3AHJA 1WUYA 1C80A 1JZTA 1X7ZB 3QVKA 3U3KA 5I7SA 4D56A 4EARA 3SQWA 1IPFA 1R0KA 1U2DC 2IYSA 3RC9A 5I7VA 1VIAA 4HAIA 3F6RA 1VYUA 1DO0A 3ML1A 5ILGA 5CEFA 1KTIA 2BHRA 2G71A 2GASA 4B6FA 4CCYA 4IDFA 5DASA 1OVMA 2OORC 1H0KA 1P7VA 2C99A 2HIHA 3G85A 3TD6A 3VBEA 2KJQA 3UN1A 1QKKA 1VIVA 3KOWA 1IHUA 4CF6A 1TZJA 3SJUA 5I9LA 3E9DA 4D57A 4TLLB 1FBNA 1VKJA 5J9FA 4KGVA 5I7WA 3A37A 5I48A 3VJKA 1Y48E 4Y3UA 5A3VA 1C1HA 4ZWNA 2OAEA 5FL7A 2UZ3A 1U9YA 4U5XA 4MA5A 3SDBA 3ZCRA 5JIBA 3M5CA 3SE7A 4NMMA 5FXMA 4HDNB 3R74A 4LIPD 2H1CA 1TMGE 3OZTA 2HW8A 3CW8X 1ZOPA 1KNQA 1M76A 1O5IA 1XD2A 2C2GA 3LBYA 4RIIA 1ZNWA 2I65A 1RBYA 2P2GA 3CF4A 4GVPA 4Z0HO 3DAPA 3S4YA 4OH1A 3X2SA 4CRWB 1A9TA 4TTJA 1PLJA 3TR5A 3NTRA 2FWBA 1MTZA 1KSHA 1G64A 3VKGA 4K2AA 4ALKA 1G8FA 1QYDA 5DHAA 1A8HA 2PSJA 2NZXA 3ZXXA 1JSCA 3PEUA 1B1AA 1AGRA 4G2TA 4Y2SA 3T5PA 2BFEB 2PG3A 2CLIB 2NQ8A 3IE1A 3VU0A 1J2UA 4CIDA 2XTMA 4NYMQ 4DCVA 5A3RA 5D8DA 4HCJA 4TL8A 4HQ6A 2O7QA 3M6VA 1T8UA 3GT7A 4QRHA 2GZDA 3D64A 1IN4A 1QMPA 1PD1A 4J4TA 4PAQA 4XDZA 1A7JA 3SX2A 1EESA 9ATCA 2ZJ7A 1ID1A 1T1IA 2VWHA 1EFPB 3MYYA 1AHHA 1B1CA 1JHRA 3OKCA 2D74A 2VDRB 4OGKA 5KYUB 1EUDA 3THYA 1L7PA 1MO2A 3WK4A 2HWWA 3QTLA 3VSEA 4RWZA 2R2AA 4WJZA 1SD5A 3K2BA 1FFWA 2BD0A 2NXCA 3ND8A 4MVWA 5J2UB 2GA9A 2KI5A 1UC9A 3KB6A 3N74A 4EKYA 3MCTA 4PC2A 5F12A 4BRUA 3ZEAA 5KNCA 2M1XA 3PHJA 3T9CA 4JLOA 3TNFA 3MB5A 3MA0A 3FJ1A 4PANA 1G3MA 4W8OA 2GN1A 2V0NA 5BSKA 2HKIA 2A88A 4AS2A 4D80A 3BB1A 1H8HD 4Y2GA 3DOFA 5H0IA 2VDWA 3Q8XB 3L7OA 3V80A 1R18A 5L3QB 1YULA 2WU0A 4E32A 5KX5F 3BZBA 4BJHB 2CL5A 1TKCA 4PZ0A 1N5KA 1PT8A 1TQ8A 1ZK1A 2AE2A 1PR3A 2COEA 2P3LA 3C3MA 3H5LA 3QELB 4I46A 4IKPA 4LBZA 4UAVA 4KRYA 5G2OA 4B1FA 5KU1A 4JLBA 1VI2A 1AQUA 2G17A 3B3GA 3BREA 4EPWA 3W5DA 3AVVA 4JGBA 4NBSA 3QW4B 3BJEA 2XKJE 2Z9CA 1VSQA 2R7LA 4LG1A 4Q1FA 2IXAA 2JFFA 3B1ZA 2Q3EA 4BUJA 1GRQA 3T3EA 5JFTA 2PLWA 1ONNA 3CRRA 4YUAA 1CY8A 1C8KA 1WO8A 2BRUC 1DJPA 3AHFA 1YZVA 5ALNA 3HUDA 3LMKA 2IHJA 3GZNB 4NU8X 5GONF 1ZVMA 3M8KA 3SXUB 1OU0A 3GGGA 4FE7A 3EFHA 4ZYZA 5K0JA 4JI8B 3ZVMA 3LYAA 3MD9A 3DTTA 3R24A 3F9CA 4FOPA 1XMOB 5U4XA 5F52A 3ZK9A 3UMRA 2HSWA 3NP7A 4Q4DA 3I09A 3L9XA 3MMXA 1V71A 1IM5A 3F47A 1NN1A 2O8NA 4Q1EA 1CF4A 1WBJB 1Z17A 4G0PA 4L6CA 3M89A 4KG7A 1RHUA 5DI3B 4BP1A 4B43A 1E2EA 1JKIA 2WW8A 4ZQIA 2W37A 3VI3B 2EL7A 2CUZA 1W5SA 1HK7A 3USES 3B2NA 1KEPA 2FSVC 2VDUE 1MAVA 3G9QA 1NUAA 1EUCB 1AJEA 1F5SA 5HE9A 2BZ0A 4E6EA 4MYTA 1PJZA 4X20A 2C95A 1IOVA 1KO5A 2DFDA 2HBYA 3BIFA 3E22B 3IC5A 3GN2A 4I14A 3GBVA 3QPVA 4W9NA 5IANA 5K8VA 4PLCA 2O3TA 2J6IA 5C8YB 4O2AB 1IN8A 1DV2A 1VLMA 2LD4A 4JIMA 1EPUA 1PG2A 2I78A 3PHBE 3W3AA 4PSVA 4RFLA 4XIJA 4ZCSA 5I8ZA 5FPYA 3T5GA 1VPTA 3CH7A 1WEKA 3NOVA 3OIYA 3HLYA 3WYCA 3L3BA 3GLQA 2RIPA 4B87A 4E6PA 2VF7A 1QOZA 2GEUA 3NKLA 2WHEA 4RZHA 5HFAA 3IJRA 3BK1A 2WWIA 4D82A 1MIHA 4XYLA 4GKVA 1P3DA 1JHMA 1GGEA 3E2IA 4G37A 1P3Y1 1B8PA 1VZ3A 3R2JA 4RCYA 5TS3A 3ROZA 4YV2A 1E9SA 4G0VA 4C7OA 1D2RA 2EWMA 3BXXA 4KYVA 3LLVA 3QPUA 5DGXA 2PNFA 1BD4A 1EIZA 3TPFA 3UBMA 1BMQA 4BU1A 3RKUA 5C5IA 4PLHA 3NHBA 3L04A 3QMVA 1JQKA 1RRFA 3OZUA 1AK9A 3RS4A 1Z35A 3OA2A 1SIUA 3TVDA 4I1PA 2R65A 4UQPA 4OEHA 3C48A 4X44A 3T1VA 3UK2A 4PN3A 5T7BA 2R60A 2YJZA 3ELWA 2OCXA 4PZ9A 5AOVA 2OQRA 3S6JA 4F93B 2F00A 1E3DA 3D54D 4DLRA 3EY4A 4WJLA 1RE0A 3OE7D 3VGJA 3BHIA 2JGMA 4B3RB 1YVEI 4OKSA 2AEEA 2CNDA 1MV5A 4C0KA 4RDHA 5H3HA 4EI9A 1UC5B 3PU6A 3TG2A 2H63A 2YXDA 2J32A 2QJTA 4DR1B 2XTJA 5EWMB 4M6WB 5AT1A 3ZU4A 1M2NA 2IEZA 1N6KA 3L84A 1GITA 2O8BA 2HIAA 2DR2A 4DE5A 1USIA 3X1WA 5AM5A 3EFOA 3HNRA 3M82A 4K0RA 4DHWA 4AQ7A 5L3SA 3VR3A 1Z2AA 3DBRB 3HN6A 1WMAA 3IQXA 1WDWB 5AVWA 3LYUA 1HDGO 1FF9A 2OCYC 2QDKA 1EZZA 4MYCA 1SZPA 5CNIA 2ECKA 2QYSA 4FPXA 5E95A 1P61B 1YDGA 4NX2A 5CA0B 1T0PA 1SELA 1FU7A 2WIAA 4X91A 3R5KA 2DFPA 3FMIA 4HPWA 2SKEA 1NQWA 3ZS9A 2OAGA 2IYEA 2Z6QA 1R0SA 1E5DA 1U8CB 1TEVA 1JRLA 5DW0A 3IUMA 4IO1A 1O57A 3HEMA 3M9LA 3OFKA 3GARA 3I61A 4OL0A 1OFUA 4URYR 3AJ8A 3RIGA 3S1AA 1T5LA 3BXEA 3DOHA 2H5LA 1DEHA 3A32A 2EEPA 3OIVA 5F7ZA 1QZ3A 5H59A 4I5IA 3Q3IA 5BW6B 2GPJA 4EUFA 4AUKA 1HFKA 2MU1A 4F4UA 5EHIA 3HC7A 2Q49A 5KNCD 4H31A 1UWVA 4MJXA 4OJMX 4OIFA 2EZ8A 1MC8A 4H1TA 1R5OA 4BASA 1EK0A 1VCOA 1XZPA 2PMWB 4LY6A 2IUSA 1RM4A 4JJ8A 3GFRA 4PBTA 3BKXA 2D1YA 3AR8A 3I8OA 5AJWA 2W6PA 4NONA 1E5QA 1VSUA 1C3OA 2Q41A 3Q3GE 1TZBA 2ZVQX 4B6EA 1CYEA 2DPYA 2RH8A 1HYHA 1JEDA 2ETVA 2BM0A 4Z9YA 3K8OE 1KRHA 5NULA 1V39A 1UJCA 1TJYA 1V8BA 4DMLA 3WLNA 1ZD3A 4W8GA 1KARA 2XUDA 3Q4GA 1RBMA 4RGBA 2JIQA 1PNRA 2EZ9A 1WXFA 3LD9A 3E9QA 3F1LA 4FSDA 1UEXC 4EJ2A 3I9LA 1ACMA 5CXQA 4MNTA 4UBJA 3X1JA 1C9NA 3HSYA 1ZCZA 1GSOA 4ZKEA 2ZIAA 3QI7A 3BYZA 3SEAA 1N7HA 5JBNA 1JR3E 4HFNA 4WZBB 1CF2O 3UAYA 4DILA 3ZLBA 2XQKA 4EVIA 3AH8A 3GOQA 3R5JA 1ULAA 1LRLA 1YD7A 1EFCA 5KYUA 3U3ZA 2GETA 3OJWA 3DKRA 2JGDA 1KNXA 3FG9A 5EYPB 3H2HA 1PWYE 3O3NB 3CM0A 4JC4A 1U9IC 2OM6A 2XF2A 5FOXA 1NV9A 4JQSA 1Z7BA 4PAOA 5LDHA 1X87A 5F77A 2JDID 4EG6A 2GFIA 1NSYA 4PICA 3BUSA 4S04A 3Q0EA 2X2OA 3KWFA 4XE5A 4KU4A 4X45A 2PUAA 4H6VA 4YP7A 3AR9A 4HP8A 4KJZA 1K1EA 2DPHA 2G9RA 4M2LA 3WLEA 2IZZA 1FFYA 3FTCA 1Y5NA 3K9LA 1SVLA 1EAYA 2DUNA 3DD5A 4N0PA 4F9TA 2AX3A 4LK2A 3QBTA 5LLTA 4KIGA 3WXMA 1W581 5HBRA 1H8EA 1S2LA 1ISJA 4OB7A 3ND7A 4I1UA 2CWWA 2CVPA 3F98A 4AMYA 1YJCA 2W2LA 3EFOB 4GFDA 2GCNA 1UOOA 1UM9B 2YRFA 4GOLD 1M5RA 1RDFA 3K4PA 3SM3A 5A4JA 1B15A 5IBRA 2G1JA 3RS2A 3UMCA 3LT4A 5LQNA 2AG1A 2WYVA 5FA5A 5E3HA 3LGSA 3EVGA 1WMDA 4F5EA 1M2WA 3AXTA 5I8WA 4LHZA 1OW3B 4V0SA 2YFYA 5AI0A 2Q2QA 1S7CA 1IPHA 3MBIA 3O5AA 2V9CA 4AIIA 3PGJA 3ZV5A 2FUG1 2VTBA 1M0TA 3EIQA 5FR2A 3SJAA 1RHKA 5EIBD 3C45A 3DTVB 2WTMA 3P2JA 1VKZA 4PG4A 3OEEA 4B0OA 4TYWA 2ZI6A 4BGDA 4L7QA 4BWVA 5ICEA 4MA0A 5IYZA 4MZXA 4OATA 4Y98A 3N5KA 2V65A 2X8WA 4H27A 1G20E 4CR8A 4QDJA 2V58A 3CRQA 1EE1A 3K16A 4TQGA 4JOCA 3CLSD 1Y0BA 2CDAA 4PX3A 1WXEA 2YNMD 4KI7A 1R9JA 5D86A 4C89A 3JQRA 2NZUG 1F2DA 1YDFA 1RJ9B 2ZULA 5IXYA 2GHTA 1ZUNA 1SZJG 4O4IF 4EO9A 1DC3A 4HDOB 3U9LA 3T4PA 3UW1A 1FNSA 4UBOA 2QR5A 2GLTA 3ETDA 3OJOA 4YQYA 2PANA 4GR4A 4HLCA 1ODJA 2DUUA 3TX2A 3JQQA 1H0SA 5JJCA 1KEEA 2YHBA 3WE7A 1PT7A 3UAXA 4RAQA 2FG7C 1ONOA 4DC0A 1HFJA 5H3LA 1W85B 3LOQA 3OLQA 4OHBA 2WZBA 5JCPA 1VA5A 4MUHA 1QK3A 1VG0B 2J6BA 3D5QA 1Z18A 1IM2A 2R00C 1G6Q1 3KYJB 4J0FA 1WXGA 2Q4RA 3FPEA 4OYYA 4QYIB 1WMSA 4R2HA 5JS7A 2FJUA 2G5GX 2WFLB 6YASA 1KMCA 5IJWA 1DHTA 1PGJA 2FSHA 5DT2A 4DJTA 1CLUA 1UBGA 4Q0MA 2H5EA 5L8VA 5I7UA 3U1TA 3OPVA 3BILA 4FEEA 3W6ZA 8ADHA 1LLQA 1OZFA 2Q6VA 2DRIA 3E5NA 3R5XA 4KW7A 1O6BA 4QOFA 3JQ7A 3AVYA 3FSEA 1N4DA 3BG5A 4XD2A 4GWKA 1V8PA 3Q6IA 3U0BA 3WQSB 5DX8A 3FMOB 4NICA 3SR0A 3U4DA 4CIYA 3W8NA 4XX0B 1N0VC 4AC9A 1K3TA 5JC8A 4F1WA 1F20A 4Y6RA 4YPFA 2CZGA 1ZIXA 2WM3A 4HEHA 1NNI1 3QPBA 3CMCO 3HNPA 1WV0A 3U7HB 4CEHB 3KS9A 1BXGA 3C39A 4QUHA 4C6HA 4ZZIA 3S2ZA 1L4LA 2CYBA 3W4IA 3NWOA 1EFAA 1WRBA 2ODAA 4IMJB 5EJIA 3SJ7A 4ER5A 5DX1A 4GP6A 4YRAA 2PQ0A 3NBXX 3O2QB 2AI3A 4L74A 3VH3A 5HSGA 1XUOA 5AOCA 3AF2A 2IP4A 3RAPR 1Y9AA 4ONEA 1V45E 1P9LA 1SOMA 3Q72A 5EMHA 3BTSA 1T13A 4R01A 4X6LA 4QT0A 3QF4B 4GOJA 3BHJA 4LDQA 1BDJA 1G3IA 3NHZA 3MXOA 4CMJA 2XF8A 2IPOA 5JO0A 2G76A 3L7LA 1QRSA 2XITA 2IQ5A 1MC4A 3PLNA 4Q4HB 3IP1A 5JOQA 1XHFA 3QKUA 2B1IA 3M5PA 4HH1A 3BE6A 2P9ZA 2X0JA 3AKEA 4JP3A 3INTA 5J4KA 5JV5A 2C7QA 1KO7A 4O4HF 1UXHA 3SXPA 1F2UB 3WG9A 1A3CA 2FF5A 2Q1XA 4QJBA 3NASA 2VIIA 4IDEA 3CVVA 1M7HA 1J70A 4QQFA 3CRMA 2LIVA 5JDCC 4YRNA 2JEYA 4EQZA 3FKSD 3B2EA 5IJAA 1K8ZB 2GNOA 2IYFA 1DAKA 1Z8DA 4HDSB 5F51A 4NH0A 2P30A 2YN0A 4YACA 5E2BA 1NI3A 3BD9A 1IRXA 2WIGA 1YL6A 5GOZA 1LA2A 1TYAE 1Q16A 5B1IA 1NU6A 5HPYB 3RRJA 3FIUA 2O7NA 1Q0PA 4TTPA 3Q10A 4AWBA 1DSSG 1QS0A 3O26A 5E9JA 5FYQA 5CLFA 4PYQA 3EXFA 4YDHB 4MVJE 1KZ4A 3JSXA 2VJQA 3THRA 3OG9A 2H4XA 4JP2A 2AFIE 1DMSA 1G3UA 1X7WB 1RPNA 2A5LA 2HMVA 1MABB 1R74A 2NPIA 3KLMX 4HFJA 4MAFA 1W36B 5AQ1A 3PQ6A 4GWLA 1A5BB 1VJ0A 5ICCA 1KP2A 2F2TA 3W7BA 2J9YB 1T3SA 3QQPA 1CY1A 2CNNA 3FOEC 1WSDA 4X93A 3EK2A 4IIUA 4L50A 1HWYA 2DBVO 2JBAA 2VHWA 4ZCTA 3F7MA 3MIZA 3PX2A 4TTQA 3AL2A 1OREA 1W35A 2RHJA 4PCVA 2Z2JA 1RRGA 3QPCA 4FUQA 3UJ9A 5JS6A 1JHDA 1FXSA 2B3TA 5BW8A 5AW8A 3HDTA 2LTAA 3U62A 4CQNA 1M0WA 1Q57A 1JPNA 5AVYA 1OMOA 3NC0C 4OXQA 3ONVA 5F4BA 1GARA 4HDNA 4ZDJA 1CZRA 2QLLA 5FOQA 3PKJA 5HEKA 2O2YA 2NM0A 1SY7A 2NVWA 3PEYA 1Y42X 2QRJA 4E2FA 1RE1A 5LM3A 3F6BX 1W94A 2DOKA 4EHAA 3ADDA 1IOZA 4NENA 4ZCPA 2VJBA 1RYDA 2FFBA 3F3YA 1ADGA 3AEUB 3PR1A 1H93A 4WZ6A 2EERA 5ERGB 3FFAA 3W5SA 4AJ9A 4BTEA 5HKLA 2C92A 1K89A 3LXMA 3P5BA 5DTEA 3LUBA 5AFSA 2B99A 1Y1KE 3T5DA 1W4LA 2ZR7A 1Q1ZA 4ODIA 3W3ZB 3SD7A 4R0MA 4I5DA 2XWSA 3BCUA 1X1QA 4NHOA 1X2BA 1NJ1A 1FLNA 1X7WA 4R2WA 2GPTA 3OPNA 2P77A 4GC9A 1SRRA 2Y0CA 5HMLA 1ADFA 1PJLA 5D1NA 2VQFB 3QX8A 2HLNA 2QORA 1TPYA 4L5BA 3H11B 3JQDA 2HU5A 1KVSA 1OFUX 3ONDA 4FW8A 3ROKA 5BQFA 3EAFA 3LV8A 4ISCA 4KGDA 2GAAA 3QNUA 2ZRJA 5JCZA 2R9VA 5IBQA 1QLJA 2C4TA 1JG6A 3EUWA 5DI9A 4ZAYA 2E2WA 5T4HA 3O8BA 4EL0A 2HU8A 2BMFA 2C5BA 1NW6A 1ZRSA 3O8OA 4U0JA 4U6NA 3DKKA 3O7WA 2ORYA 4YRFA 3T12A 4HVLA 2PPVA 1F0YA 4KE8A 3C6ZA 2FEMA 5E6UB 4NMHA 2BGTA 4JVNA 3OPMA 3UJCA 4CL3A 1ATIA 1JU4A 1N4AA 1XHLA 2I7XA 1N2EA 4RPGA 3MERA 4PZLA 2ZRAA 3O0TA 1QYIA 3UMVA 2NTVA 4D43A 3C24A 1ZRHA 1W36C 3AP1A 5FWNA 4W5OA 1GFWA 1UT8A 5J5AA 1WMBA 4EPYA 4HS9A 5FOTA 5T64A 2AGVA 2X5NA 4P2BA 4PXYA 1GG5A 1WDLA 3WADA 1H2EA 3WL6A 1W4BA 3GDHA 4XLLA 1Y1PA 2FK7A 3KTOA 4IHQA 4OVKA 1QIJA 4OHKA 4JYPA 2ZAYA 4B33A 4A27A 1NIPA 2Q8PA 1LTKA 1XKQA 1MB0A 1BCSB 1L1RA 5K4HA 3C1UA 2C0QA 3ESCA 1DRJA 3RUIA 4BIMA 5E38A 2QL6A 1CR4A 2HLDD 1A7UA 3G82C 1EVIA 4UUQA 3AVUA 3WYNA 3FN4A 1HOTA 3A1TA 5HQJA 2HJVA 4C30A 1V6SA 3D6HA 2QLNA 3P32A 4JAVC 1YDHA 1H2YA 4MWTA 5DM4A 2B7LA 5H7XA 2OPHA 3DVAB 4LHYA 1NVVQ 1RKBA 1KK0A 1XTJA 2D1RA 2EFJA 1P2VA 4RMJA 4L78A 3VJMA 4KXFB 5IEBA 4XGNA 3ZKWA 3N0RA 3Q5DA 4Y18A 1YCGA 4ML3A 4BRWA 4H6WA 1AVTA 3S0JA 3T7IA 4DSNA 1NC3A 1CFJA 4IHAA 4WKCA 4YT5A 4QTTB 3TTUA 4P5PA 5DWDA 4OFBA 4KUHA 4UTOA 4WNCA 2W8ZA 3BWYA 1HLDA 3ER6A 5L6LB 5IF9A 1BJTA 2G7MC 4MW7A 3HXKA 4CLHA 1HLPA 5KREA 3AOEA 2B5WA 2XOKD 1W96A 4J7UA 2VRCA 4C14A 2RI1A 1ZQ1A 2XE8A 5DM1A 2BGUA 3OCCA 3LPAA 1T3HA 6AT1A 4WBXC 1RC1A 2BMEA 1SA0B 2QAIA 4IFIA 5CX4A 3LQQA 3ZZ1A 4QBKA 1X0XA 3K9WA 4Z4EA 1TAQA 1ZZGA 2YZ7A 1TRHA 1ZH0A 2QRKA 3CWCA 3O31A 3K0EA 4IV5A 5DE3A 1DKUA 1WX1A 2Y27A 3OT5A 4Y7DA 2X9LA 2AFRA 4UVEA 1GVHA 3UY4A 1J0AA 1KJ9A 5TLSA 2JD1A 4FR2A 1AUXA 2A5JA 1P0IA 1I4LD 1QHFA 2Z9BA 5KC9A 2I4IA 4FR0A 1SB8A 2IZ5A 3P7MA 3LY7A 4NATA 4M0KA 4M0MA 1J39A 4XYMA 1GRNA 1I32A 4GSLA 1L7BA 2BFFA 3DFUA 2ONZA 4GI7A 1J1ZA 4JQCA 1NFFA 2GK3A 3ILHA 1V5WA 4EMBA 5CVTA 2WQ6A 1F6BA 4OX9Y 3B1WA 3BDAA 5CJJA 1O96B 1JWAB 4OO3A 5DEOA 1N8SA 4FYXA 4DA0A 4F8YA 5ERXA 1BQEA 2IUFA 3HA2A 3T95A 5THKA 1NP7A 3L0PA 3IELA 4F84A 1H2WA 4DJFC 4Z7QB 2FZWA 2FV8A 1U9ZA 2FW0A 3AB3A 3AV0B 1AZWA 2ATCA 2X3YA 3MJCA 4LPSA 4WESA 4YO8A 1XMIA 1L7QA 1FLVA 4EH1A 2SECE 5EEGA 3UPTA 4R8SA 4RU1A 1KERA 1UBTS 2QTNA 3UGTA 4L5YA 1QC5B 1NN3A 3QG5A 4EAAA 5JH7B 2OWDA 4ZREA 2ENWA 1O7JA 1DFIA 1WSAA 2GVDC 1T9AA 3LA8A 3QPAA 4PPYA 4REQA 5C8YF 4IGFA 2RBGA 3N2YA 5T3UA 5EZQA 2MSEB 4G5RA 3E61A 3DL4A 5G1OA 2Q7DA 4EY4A 4RMIA 5MHTA 2CVQA 2WZCA 2ZWPA 2C4MA 4BJ6A 3I2FA 1JDBB 2RGDA 4ANFA 2XUHA 3GJ7A 5CIQA 3HP1A 1C7FA 1E8DA 2IY9A 3GJQA 3QBVA 2OM2A 1EFTA 5JYDA 4E3ZA 4HI0E 1KKUA 4UM5A 2RK6A 3NBAA 3MRXA 3JALA 4QT4A 3GB9A 1PR0A 2B8TA 3P0IA 5JD4A 1UMCB 1FMTA 4CCSA 1RFGE 2Y0PA 3O38A 1G38A 2DVMA 3DAHA 2Q2OA 3BMCB 4KRFA 1Q3KA 3R0IA 5KOYA 2A5FA 4IDCA 1AKRA 4LF5B 3UFXA 1L1QA 4D9BA 1EEXB 2ATVA 3VOBA 2VH1A 2WG0A 4Y2RA 4C2UA 5KYXB 5T8KC 2TMDA 1FXWF 3MB8A 1E2UA 4BFVA 5J3JA 2BEJA 2RHTA 4JOQA 3TMKA 2QIPA 4M1QA 1P73A 3KRTA 4X64B 4ZYTA 5JAPA 1U1EA 2CXNA 4ABTA 2ZUCA 4MWEA 3IRVA 4NOLA 2I4TA 2VHYA 3DZKA 3FRIA 3PIIA 2W8BB 4KV7A 1KJYA 4RSGA 1U0HC 5ESRA 3W7VA 3DYVA 4CL2A 2GZHA 4FMCF 1JQLB 2ANBA 3TD2A 3WS7A 3B7GA 1BN7A 1TW2A 2VDWB 4RSRA 3NOXA 1G8YA 2CUKA 2PKCA 3HO6A 3QXCA 4MB2A 5JY6A 3TLGB 4KPUB 5CFOA 3E8XA 3MGBA 2WINI 2XDYA 3L6EA 1CJSA 3SKVA 1PJ8A 3TXAA 3MGGA 2H1RA 1NV8A 1DAMA 2CCKA 4MWCA 5EKTA 3C4VA 4CXMA 3D6JA 2PT5A 1XRJA 2ZQZA 2VT3A 1TVKA 4R71A 5LOVF 4FHZA 4XR9A 3WK8A 1PJSA 5I7OA 3SK0A 2JJQA 1FYVA 4GX5A 5EG5A 4EG7A 2PSHA 1I4WA 1I0ZA 3GA0A 4GBED 1H6CA 3AKDA 4QDKA 4RDCA 3SMQA 2EBHX 1RNLA 4YA6A 1M75A 2C4WA 2JIZD 3KVRA 3MZ0A 1RPZA 4MQ6A 5EHNA 4DPMA 2F3UA 1C8LA 1HORA 2G8LA 5JXGA 2VJLA 2PA0A 3L7KA 5DHUA 3AHGA 5B1HA 4QARA 2O23A 4FJ0A 4OHRA 3ZDYB 4AJOA 2ASVA 1E8NA 3AVOA 2ORWA 3HKBB 5AR1A 5I7AA 5SICE 2HF2A 5HRCA 1QGDA 1Y89A 3P97A 5BT9A 3D0OA 2NO5A 1NHGA 1LDGA 2NW6A 4A1OA 2Q7OE 1GLNA 1TK2A 1OXTA 3H65A 1W46A 2AJTA 2WHXA 4ZO6A 1F8YA 2J3QA 4FLFA 4DQUA 4RD6A 5C34B 1K92A 3S7ZA 2LWIA 3O75A 2RE8A 3U4QA 4C5CA 4IZHA 1FTGA 3EAGA 1ZBQA 3NEAA 2AJCA 2X1VA 4OH7A 2WHQA 4H18A 4P4SA 1B73A 3F7TA 3UKOA 4ZYLA 2Z95A 3KXLA 3UH0A 2QSJA 1YOVB 4FZJA 2EOAA 2J07A 4IHJF 1P1HA 4B09A 4HK4A 2O48X 1U0FA 4M53A 1RQXA 2I3GA 3IVCA 1J90A 1R0XA 3FDJA 2WYOA 2WY2D 1C7RA 5B2ZA 4ZJPA 5CB4F 4KPFC 3ZK8A 2AN9A 3L1UA 5DHPA 5TQVA 4DLLA 4UEWA 3KSRA 1T8WA 2AZMA 2H2FA 1Z8HA 2CVFA 3FW1A 1UH5A 3V34A 1VYHA 1Q11A 1J99A 3E7DA 2BHNA 2WD7A 3GFPA 1UBJS 4XDGA 3ZS8A 4B9AA