2VQ3A

Crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
PKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Membrane Proximal Oxidoreductase Domain of Human Steap3, the Dominant Ferrireductase of the Erythroid Transferrin Cycle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords METALLOREDUCTASE STEAP3
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.16.1.-:
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vq3A00
1XU9A 2WWRA 3WICA 4CM6A 5U4QA 3PLNA 1BSVA 3F9IA 2BFPA 2E6UX 3E18A 5JO9A 5TF4A 3BHIA 3FSRA 1LSUA 4IJVA 4KWHA 2HKIA 3JQBC 3PIDA 1HDRA 1UAGA 3NKLA 4NJMB 1OZAA 3GZNB 3DBRB 1YJ8A 2HK9A 4AFNA 1SO8A 1ID1A 2DUUA 1LDYA 2O7QA 3H5RA 2FSSA 1IHYA 2Y1FA 3Q9NA 1SB9A 3PQEA 4CV2A 4H15A 1LDMA 3NAQA 4LSWA 3JCZA 2Q2WA 3F46A 1UDBA 3O8QB 3QP9A 1XELA 1F8FA 1NHGA 5BT9A 1F06A 5A4DA 1GEGA 1A9YA 5L45A 4KP7A 1HKUA 5F5LA 4BV9A 1TT5B 2YDYA 3MWDB 1HYHA 2UV8A 2X23A 2I3GA 5L7TA 4RPGA 3TRIA 2AQHA 4TRNA 3RJ5A 4ZVVA 4A27A 3NT2A 3DMTC 4FJ0A 4BNUA 4XGIA 3QVSA 3D3WA 1IB6A 4UVGA 3KSDO 4E5KA 5EERA 3GVHA 3L6OO 4GI2A 3GAZA 2HK8A 1ZIDA 3S8MA 4WGGA 1H2BA 3D0OA 4CMEA 2VWHA 2W90A 3W6UA 1ZEMA 2OHXA 3DL2A 2OUIA 3CMMA 4R41A 4D0RA 4B4OA 5K0ZA 2JCXA 4YAGA 6LDHA 1I36A 3AOEA 1MLDA 3DZJA 4MVJP 1ML3A 1O94A 1U3VA 1N7HA 1PX0A 1U9JA 1UR5A 5T64A 4WECA 3GHHA 4GMFA 1LUAA 2TMDA 1L1FA 1YBMA 1O9BA 2I5PO 2NVUB 3VPSA 3X2EA 2E82A 4B3JA 3C7CB 1DSSG 2G5CA 1SZJG 2CF5A 3WGYA 3D4PA 3E82A 4PFJA 4ZRMA 3DBHA 4XJTA 4E33A 3JQ7B 4WCFB 2XF8A 5AXDA 3RBZA 2DU8A 2W2KB 5IN5A 1LI4A 4RVUA 4TKLA 1MB4A 5HA5A 3KUXA 3GN1A 5JYEA 2R2GA 2NQ8A 4Z9FA 5B4TA 3KSUA 1MV8A 2D0IA 4M86A 2Z95A 4JN6B 4PRLA 4S3MA 4Y98A 4MDHA 5KJEA 1LLCA 1QSGA 3BIOA 3I9NA 1YVEI 4L74A 3PJGA 1ORRA 5AXAA 3CH6A 3ZU3A 1YOVB 3AUSA 2Y67A 4MIEA 4CM8A 5JMPA 1MC5A 4Y6SA 2B83A 4XYGA 2DBVO 2C20A 4DMMA 3GHYA 1PJSA 1AN9A 3H3FA 1T2AA 2YY7A 4MVJD 4AJ2A 4FBGA 1WWKA 2Q4BA 4NK4A 5CDGA 2WTBA 2JAPA 3EVNA 2QW8A 4XIJA 3TFOA 1BW9A 3H6KA 4CMGA 4DLBA 4MP6A 4B8ZA 1S6YA 3WOHA 5IF3A 5EPOA 4KQXA 4LVUA 5L4NA 3K73O 1Y6JA 3ZU5A 2OO5A 3PTZA 4KUGA 1I8TA 5ER9A 4YT2A 3JYLA 4O5OA 1PJQA 5U9CA 3F5SA 1MG0A 2NVBA 3UCEA 4GGOA 1PL8A 5IDXA 1O5IA 1GYQA 1NAIA 3VVBA 2XXBA 1QYCA 3ST7A 3BYZA 4D42A 2UVDA 3C8MA 5DP2A 4R1UA 1Z7BA 2O3UA 2CF6A 4GLOA 3ZHXA 2X9NA 2HRZA 3NEPX 5DCYA 3N58A 4G65A 5CG2A 3AWDA 1UXIA 4W4TA 4PLHA 2RAFA 3FR8A 1NFRA 2Q50A 3KM0A 1HLPA 1B7GO 4R1SA 3AI2A 3T4XA 3V2UA 2E4AA 2FR0A 1CDOA 1DEHA 3M2PA 4BOYA 2RH8A 1X0VA 2BFOA 2CVQA 4GWGA 5A04A 3WNQA 1QLHA 1CF2O 4MKRA 2PGLA 4M89A 3NGLA 2GZ2A 2BHLA 2BI8A 2P4QA 1ISGA 4PLFA 3RFXA 3OQBA 3QE3A 2R00A 4GH5A 1EBUA 4CV3A 3OJFA 2ZB8A 3DTTA 3O9ZA 4C7JA 1BXZA 2ZIZA 1IL0A 4JNKA 3JQ7A 1DJNA 3DZHA 2EHDA 4CR6A 2AXQA 2Y66A 2PWZA 3GEDA 4DYVA 1U1IA 1IZ9A 3IC5A 4KTVE 1DRUA 1DC5A 5JAQA 4R16A 4E4YA 4NR0A 1GD1O 5CG1A 4NBRA 4GBJA 4EGFA 1YKFA 5EL0A 1M76A 3H5NA 4Z3KA 4AJNA 4E5PA 1WZIA 1I2CA 5A9RA 2AQIA 1K0UA 4AJPA 1IOLA 4BB6A 1TVEA 1Q7GA 4G81A 4YTEA 3RBXA 1FDSA 4NDNE 4PZEA 4A5OA 4EJMA 5BSEA 2ILTA 4JP3A 1I30A 4AL4A 4HWKA 5FWNA 3ZWVA 1I3LA 8LDHA 3VH3A 4Q3CA 4ZQFA 3MTGA 1R15A 1W8DA 4J0FA 5EN4A 3G3EA 3WGQA 2IDZA 4B4WA 4PG5A 1PZHA 1NPYA 1SCUA 1JKFA 3RUDA 1I2BA 2JD1A 3ON5A 1JA9A 3FD8A 4LK3A 4CLOA 5U1PA 4XGNA 4BO7A 1O6ZA 1A4UA 4DQVA 1EBFA 3I1JA 2DKNA 3RC7A 1LDNA 4XWYA 1TXGA 1D8AA 3B6ZA 4RDHA 1YONA 4F46A 3HDJA 3TPCA 4KMSA 3VVCA 3WSWA 1ZJYA 2FY8A 3GFGA 3LC7O 4FD3A 2GUGA 3DEYX 4L0QA 1HRDA 3DZKA 3S2EA 5EESA 1XCBA 4CUZA 5BSFA 5JCJD 4D44A 1U7HA 2NTJA 3LC2O 4KWIA 1J4AA 3ONEA 3FBTA 3I9MA 4M87A 4BNGA 4RVGA 4Q3EA 2X4GA 3WJ7A 1Y5RA 3ZWMA 2Q1SA 1SOVA 3TOZA 4H7PA 3QW2A 2GR9A 2EEZA 5DBFA 4CLEA 4W9NA 4BNYA 2A4KA 3OETA 4BKOA 3HDYA 5JMWA 2Y05A 1K6XA 5DBIA 1QYVA 2OP0A 3TNLA 3GG2A 1NBOA 1Y8RA 2O2SA 5KCZA 2A94A 3MOIA 3RFVA 2I6TA 4CLOB 3RUFA 4OHUA 1NYTA 4WASA 3GNQA 2PKQO 3H2ZA 4E32A 3BTVA 1JVSA 4PG4A 1GQQA 1IE3A 1X1EA 2X5OA 3IOYA 2B4TO 4IS3A 2ZB3A 2QX7A 3LF1A 4CLDA 2YHIA 2ZB4A 4RPKA 1H6CA 5GZ6A 4MO2A 1G1AA 4B4VA 4FC7A 5TGDA 4Z9XA 1ZZEA 4Q3BA 4W6ZA 4QT0A 4OXNA 5FEUA 1XA0A 1E3EA 2J3KA 1R4NA 1EQUA 4D0SA 2B4RO 5JFOA 1T26A 3N7UA 1VJ0A 3D64A 4FPXA 1QXSA 3OJ0A 4BO9A 1AXGA 4LCEA 4L75A 3ULKA 3WGTA 1CQIA 1AHHA 3M2TA 5BNFA 2YUTA 3SVTA 2EW2A 2C0CA 5ITVA 2OBYA 1Q0HA 2G17A 1E1KA 2Y1CA 2C5EA 2ZJ0A 1V3VA 2PNFA 5CDSA 2ZCVA 2O4CA 1P44A 4CMCA 1ADGA 2NU8A 1PQPA 3P7MA 3VOSA 1Y9EA 2Z1MA 3GMSA 5EJ2A 1PIWA 1ADFA 4E13A 4R5HA 1SEPA 3IKVA 3TZHA 4B7CA 1WDLA 2YQ5A 3UW3A 4JJFA 3JQ9C 3Q2IA 1E3IA 2YDXA 1BW9B 4J2OA 4EYEA 3O26A 4IGFA 1R37A 3FNGA 1Q0LA 5KVVA 1HE3A 3K30A 1LSJA 4MVJG 3E48A 4K26A 2DVMA 1VL6A 4DIOA 4Z6KA 2PZKA 3MJTA 4BNIA 4PG8A 4E2WA 4FFPA 4L4SA 4AG3A 5K9ZA 3PZRA 4GSLA 4RQUA 4IMPA 2EKPA 3BTSA 4IS2A 4UVDA 3EY4A 4NQZA 2BFAA 5JW6A 1EQ2A 1PGOA 3F3SA 3G1UA 1A4IA 3GA0A 3VAZA 1T2DA 2PK3A 3DHNA 2YV3A 2WSBA 4XGKA 3RJ9A 2P9EA 2WM3A 3TWOA 4MIYA 2VOJA 1PS0A 4J43A 5F1OA 3EMKA 3DTYA 3M1AA 1R66A 3B1KA 5C5IA 3OJLA 5JAIA 3TZQA 2PA3A 3ABIA 2X0IA 4CL8A 4M55A 1XU7A 2BF7A 4W99A 5MGBA 1PZFA 3VDRA 3WGIA 3OA2A 1JTVA 1NVMB 1O8CA 4WE3A 3BA1A 1PEDA 3DMTA 3GH3A 4NZ9A 3I5MA 3CUKA 1U5AA 2CDAA 1HSOA 4YB8A 2GN8A 2PH5A 1WLYA 4H3VA 1EK6A 1IUKA 1HDOA 3FWNA 2HK7A 5KKAA 1G6KA 1U28A 2D3TA 2B35A 3GVCA 1JKIA 4UEOA 3Q0EA 1ZXLA 3LQFA 3H9GA 4J9UE 1F14A 3GK3A 1R0KA 4EUHA 1U3TA 1K6JA 2B69A 1D1SA 3OH8A 1P33A 4IJWA 3GUYA 1PWZA 4DPKA 4RVDA 1KC3A 3DO5A 3E6AA 2AMFA 1IULA 3LYLA 2IZ1A 4UUPA 3C7AA 1DC6A 3CKYA 3E8XA 3ORFA 1DHRA 1DLIA 4OSOA 3JQGB 1GDHA 3PXXA 3JQFC 2C07A 4IMRA 2DBZA 1N5DA 1JWBB 3H9JA 1QYXA 2CFCA 3H2SA 3E9MA 3RC2A 3ZNPA 4YCAA 3GZ4A 4WLOA 4J4TA 3U5TA 1NAHA 2X7HA 3P19A 1E92A 4MJLA 2Q1WA 1KOLA 4Q3NA 4JIGA 5DBGA 1Z6ZA 2D5CA 2FSVA 4KQWA 1UJMA 3VHRA 3L6DA 2WD7A 4IINA 2OMEA 3NRCA 2R6JA 3BMOA 5H83A 4D3SA 5BR7A 1E5QA 2C82A 1H6DA 1JN0A 1KETA 3DOJA 1TA4A 4XYLA 3NJ8A 4CUKA 1DAOA 1YH3A 2PD4A 1DRVA 4BMSA 5A3JA 2GYYA 3RUCA 4L4RA 3JD1A 4FS3A 4AJLA 5CEEA 2HMVA 5B12A 4B8WA 3I9OA 1ISJA 4NBTA 3T7EA 3INGA 3GFBA 1M2WA 1NQOA 3KBOA 4XR4A 1T2FA 1SPXA 2B37A 3PWZA 4ESOA 2FMUA 4OOEA 1OAAA 3A4VA 1EMDA 4IDDA 3WDSA 3LT0A 4MOWA 1YXMA 4XRGA 4I8XA 1Z82A 3I9LA 1ZSNA 3O03A 5G4KA 3G49A 5HWSA 3Q9UA 2C2XA 3W8EA 1PS9A 2WE8A 1FJHA 1LRLA 3KZVA 5MDHA 2EGHA 4DUPA 4YT8A 5JE8A 3FNFA 4FOOA 1LX6A 2QYTA 4BO3A 1E3JA 1YB4A 1BMDA 1BG6A 3AUAA 2VZ8A 4BGIA 4ZQHA 2DBRA 4CM5A 4A10A 5EQFA 1ZVMA 1UDAA 1MXFA 4II3A 4WLVA 1E1MA 4R5MA 1HE2A 3ZHYA 1GTMA 3BTOA 1SB8A 3DAGA 3F1KA 4QECA 3ZWYA 2EG9A 2FPGA 1Q2XA 4HADA 4P4NA 4UVEA 3FR7A 3PHIA 4WLNA 5G0WA 5LCXA 4O6VA 4A26A 5DCWA 3L77A 1A9ZA 3H5AA 2O3RA 4DA9A 2FOIA 2NTVA 2VNSA 5HRUA 3TDKA 3LT4A 3WNVA 1GUYA 1RKXA 3GVIA 3KB6A 3OM9A 4HY3A 1LDBA 1ZK1A 4R9RA 1CJCA 4JP2A 4OQZA 5C3MA 4XIYA 4M8SA 5JC8A 1YB1A 5A3VA 1B3RA 4BL5A 5IAAA 4BNFA 5IFLA 2EGGA 5THQA 4N54A 4E5YA 2YQ4A 4HBGA 1JKJA 4D3FA 1G0OA 4AJIA 1Z7EA 3HZZA 3R3SA 1HXHA 1VRWA 2Y1EA 4JJGA 3MWEB 3FPLA 2Q46A 3PJFA 3ETGA 4MIOA 3CE6A 3CZMA 4ID9A 3PGJA 1PJ2A 3RC1A 2VQ3A 1M75A 1ZBQA 1GZ4A 3OSUA 3GT0A 3CEAA 3E5RA 4J6FA 4MVJA 5JY1A 2Q4EA 3HDHA 3U4DA 4CJXA 4TSKA 1BRMA 1D7OA 4AJHA 5CP8A 1UP4A 5K6AA 1XQ1A 4O0LA 4EJ6A 1A7AA 1MGOA 1GAEO 1P1JA 3IQDB 4RF4A 3WWZA 1VJTA 2HJRA 2Z5LA 2PR2A 2PTGA 5B4UA 5I8WA 4IDCA 1E7QA 3PHJA 3V1TC 1HF3A 2Q1TA 1Q0QA 3KLMX 1PL6A 4IDGA 4IQ8A 1DC3A 4J9VA 5EIOA 4ZQGA 5A5EA 2QRJA 3WIEA 4ALMA 1QRRA 4ZQEA 1E7MA 3GEGA 3P5SA 2JCYA 1WVGA 2G82A 4D7AA 1LNQA 1UP6A 4BO8A 4PZDA 3SEFA 1HT0A 2X0NA 3IIEA 3ZDFA 2PKQP 3L4SO 4O59O 4D43A 4ALLA 1UUFA 2AE1A 4XKJA 4AVYA 2I65A 3I4FA 4R9SA 4ZJUA 4FFLA 1VKNA 4BO5A 2VRCD 1RM0A 4UEJA 4BNTA 2Q3EA 5HTOA 2NVWA 3BAZA 4OKIA 1YBVA 2V6MA 2Q1UA 3DBRA 4JK3A 1GPJA 2JL1A 4INAA 3W1VA 5A9SB 1T4DA 2OGUA 3AI1A 4ZHSA 2CSUA 1SAYA 3WFIA 1EDZA 4ND4A 4DC0A 4NI5A 3A28A 2H1SA 2X86A 1I01A 3OICA 1NFFA 3DZGA 3TJRA 4KOAA 2OFPA 4K1LA 2UUOA 1ENOA 4BKUA 1NVGA 4DREA 4XEHA 4KUHA 1MG5A 1WMAA 1EUZA 4E2YA 3PYLA 4FB5A 1AE1A 1PJBA 4FSHA 1VPDA 2DPGA 4NBUA 3G17A 4PIVA 4YRAA 3WMWA 2P9CA 4RO0A 1UXKA 1PR9A 4BB5A 2YV1A 1WPQA 1U7TA 1TB4A 1VLLA 3ZWCA 3QLJA 3U62A 3WIDA 1Q7BA 1KBZA 2SCUA 1MC4A 5JDCA 2EP5A 2HCTA 1P1FA 2IEDA 1B8PA 2RH4A 3E9QA 2NQTA 3D1LA 4OAQA 4FDAA 4WOKA 2POQX 4WPGA 4YVFA 4CLXA 1E3WA 3IUPA 4Q39A 1X0XA 2QHXA 5F21A 3ZU4A 3EZYA 1EZ4A 1T2EA 2QZZA 4DIFA 2P5YA 3EDMA 3PJEA 1B26A 1K3TA 2AEFA 2DM6A 1C3VA 1LLDA 4WUVA 2BH9A 2ZK7A 2G1UA 8ADHA 4R68A 2D8AA 3Q11A 2ZCUA 3MJ4A 3V2GA 4D3DA 4BGUA 4F6LA 1PU2A 3HJAA 3FNHA 4LMRA 1PR3A 2EERA 1H9AA 2FR8A 4YJGA 3WYEA 4Q3AA 7MDHA 1XKQA 2I99A 4WKGA 3X2FA 3DHEA 3IJPA 3K92A 4R1NA 5I7FA 4JGBA 5HBRA 2EIHA 1P74A 2EJVA 4RJTA 4BQRA 2P68A 1YDWA 3FWZA 1DIAA 2FRDA 4EW6A 3NGXA 1Y1PA 2Y1DA 2V7PA 3VZQA 1UH5A 1AGNA 2O4UX 3JYQA 5KNLA 2CUKA 5TT1A 3PP8A 2PY6A 4LRSB 1YJQA 3EAGA 3BMCA 2FPPA 4IJKA 4WCDA 3L4BA 4PVCA 2PKRA 3KOUA 2J3HA 1ENPA 4CMAA 5L51A 2O3QA 1DO8A 4RPLA 4GX2A 9LDBA 2Q99A 1FF9A 3A14A 3QVTA 4GVXA 5JCJA 2FPIA 1E6WA 1WAMA 4ZA2A 3RUHA 1EFLA 1P1KA 1LA2A 3AM5A 1VJ1A 1UAYA 5CPFA 2FHSA 3ONDA 5ILGA 2CMDA 4A73A 2IXAA 2WD7B 2JAHA 5DNAA 3RUIA 3S55A 4OXYA 2ZTLA 2C54A 2PD6A 4CQMD 5IXSA 2HMUA 3AW9A 1SEVA 4ALJA 3DR3A 4OJNA 3GQVA 2I67A 3UGKA 5A9SA 3INTA 5KJ1A 2WYVA 4CR8A 4R4JA 1NP3A 3Q6IA 1BVUA 1VL0A 3ZWXA 4BNXA 4YEDA 3P2OA 1QLJA 1DIRA 2C29D 2VN8A 4R1TA 4B7XA 6ADHA 4UREA 4CM9A 1JAXA 5FYDA 4YPOA 4E6PA 1DRWA 2GGSA 4N7RA 4EJ0A 3U0BA 1HLDA 5G4LA 1H6AA 4BO6A 1VI2A 1YL6A 4NFYA 2PFGA 2FWMX 4CM1A 1B14A 2VT3A 4KDEA 5L7YA 5CAEA 3PHGA 1I3NA 3WMXA 2WMDA 3LLVA 3RFTA 4GX5A 1DFHA 1O95A 3ITDA 4CLHA 2ZATA 4Y67A 3U3XA 4UULA 3AFMA 3PLRA 2VYND 5DP1A 1ZH8A 4RORA 3WTBA 5CDUA 1I3MA 4EEXA 4D46A 2TMGA 2O23A 3ZW9A 2NUAA 1P0FA 3GAFA 4OMUA 3WLFA 3DBLB 4PLTA 3JQ8A 1C1DB 3CMCO 1BWSA 2QQ5A 3WG9A 1U4SA 2VTDA 3LK7A 4BO4A 3GC6A 3WGHA 4CQLB 1JLLA 3JYNA 3FTNA 1K5HA 5JNLA 3RD5A 3G0OA 3KETA 1N1GA 1VL8A 1GPDG 3VPXA 2BLLA 3HE3A 5IDWA 3ZN2A 3JD0A 4DBZA 5KKCA 4CL3A 3ZNNA 4E5MA 3DFZA 1K6IA 1XHLA 2EXXA 2VRCA 4ZQBA 2YZ7A 3FI9A 2C7VA 2IRWA 3GRPA 2GASA 4ALIA 1F12A 4QUKA 3AFNA 1QV7A 3KO8A 3M6IA 2NLOA 5GZ1A 4OYRA 1QYWA 2FR1A 4XD2A 3QRWA 3JQDA 2BGKA 2DFDA 1JDJA 5G0VA 2D4AA 5TQVA 1B8UA 3JQ6A 1LTHR 4DXHA 3OJOA 1FXSA 4F6CA 2VUUA 2X1HA 3UUWA 1NVTA 1YQDA 5L4LA 9LDTA 3I6QA 4NH4A 2WEKA 2G0TA 3DAPA 4JLWA 4BNMA 1XQ6A 1ZSYA 1ZO8A 2J5KA 3IP1A 2PZMA 2NACA 5L4SA 5COQA 4YYZA 2PLAA 3CTMA 4YBZA 3WWYA 1LBEA 1ZK2A 1IZ0A 1MP0A 1GV1A 3H4VA 5JS6A 3GNSA 3L4BC 4QO8A 1ADCA 2C7GA 2NVUA 4TKMA 1B15A 2Y1OA 3HHPA 1VE9A 4IXTA 1MFZA 1CWUA 4TZTA 2ZYAA 1L7DA 3U09A 1V3UA 2CVZA 2GZ1A 5C37A 2CNBA 3QA9A 1J6UA 1YB5A 2BKAA 2Y1GA 3AJRA 3BHJA 3BMNA 3O4RA 2CDBA 3WQSB 3IUSA 2AEJA 3HG7A 4DWVA 3K31A 3PIIA 4A0SA 3T4EA 1GZ6A 4JX8A 2D5AA 3VPHA 4LRTB 4URFA 4PGFA 4U5QA 4GAEA 4Z0TA 2JCVA 1H9BA 4RDIA 3ZGYA 3HFSA 4BMVA 2PZLA 1JAYA 4RVSA 3ETEA 3QWHA 3DDNA 3KEOA 4CMJA 3WQQA 1ENZA 1DIHA 1VKOA 4L9RA 4TRMA 1C0LA 1P1RA 2NTNA 3ZV4A 2B5VA 3JQ8B 2NU9A 3OECA 3RKRA 3W4IA 1DIGA 2ZB7A 4L4XA 4NU6A 4XYEA 3PYMA 2X5KO 3AUTA 3HADA 1OFGA 2O48X 4DL9A 3DAFA 3NYWA 2CY0A 1IHXA 4HV4A 4ILKA 1Z75A 4DVJA 3ZWNA 4FIZA 4WNIA 3QWFA 4JBGA 3PPIA 1UP7A 4A03A 3BMOB 5A02A 4J1SA 5F1KA 1UZNA 2ZKLA 4QFDA 3QWAA 2VHWA 4E3ZA 4CPDA 3K8ZA 4XQCA 4L73A 2DUWA 5FI3A 2WYWA 4U7WA 4PG6A 4BGEA 4AJJA 2GN9A 1KVUA 4J49A 4FR5A 5JAZA 3LDHA 3F1LA 1X15A 2YW9A 1XYGA 1WDMA 2VTEA 3PQFA 3RBVA 3K2EA 2DLDA 2G76A 1T4BA 3GRKA 4YJFB 1X7DA 2VWQA 3JD4A 3HNPA 1U4OA 4MKZA 4R3NA 4CMEC 3ETDA 3A06A 2AG8A 3ZU2A 1I3KA 1KEWA 3NJ4A 3GF4A 4GKBA 1JVBA 2W2KA 1EVZA 3ZI0A 4Z9YA 2QRLA 1KVRA 4CMIA 5CDTA 1R6DA 3GDGA 4DMLA 1DFGA 1BTOA 4GQAA 4RL6A 1EVYA 1E5LA 1RYEA 1KIFA 5KJFA 1NFQA 3W4JA 1F17A 4XDYA 4RZHA 1E7YA 3O8QA 2GDZA 1EVIA 1K2WA 1NR7A 4FFNA 1BDBA 1PGQA 2NU6A 4GL4A 3OIDA 1M6HA 4AJKA 4FCCA 3L6EA 4HFMA 2V65A 3TZKA 4PLVA 3WX0A 1LSOA 5A06A 5K6AC 1ULSA 3DZFA 4N18A 4JXKA 2J5RA 5CEJA 1JQBA 3SLGA 1NX6A 2W98A 1AHIA 3GDFA 4OQYA 4OM8A 1WXDA 4RLHA 2UYYA 4WNCA 4HFRA 4JJIA 2FN7A 3N74A 5KJCA 2NM0A 5IG2A 4DLLA 1A27A 2O50A 3OIFA 3VH2A 2EKQA 3D7LA 1YGYA 1YL7A 4FOSA 4XYBA 1GUZA 3P2YA 3V1UA 3ADPA 5C7OO 4DGSA 3ROMA 3DHYA 4NFHA 1V6AA 1D4FA 4ONEA 1PS8A 1OC4A 5L7WA 1L7EA 2YV2A 3OF2A 3PHLA 1X14A 1HYEA 1WP4A 4J7UA 4BIIA 5TIIA 1D3AA 4IGEA 2RBEA 4QO7A 3H9QA 4EEZA 4E21A 1V3TA 2FZWA 1P1IA 5G0SA 1KVQA 1YS4A 1WNTA 3L9XA 1R0SA 3KYDB 4DTIA 3R1IA 2O3SA 4HX5A 3EK2A 4I9HA 4XQEA 5HS6A 4FJ2A 1FMCA 1N7GA 1O0SA 4MINA 5ITWA 2NWQA 3BTUA 4DIBA 1MXHA 4R69A 3TL3A 2X5JO 1RM4A 3NDIA 5ADHA 4J1NA 4IDBA 1NASA 1KERA 5F1PA 4J1TA 5KVQA 1XDWA 3PEFA 5KJ6A 4BNNA 4IDAA 2B36A 1GCUA 1TEHA 3O38A 4Y9DA 4PLWA 3WGOA 4BNLA 4E0BA 5G0TA 4E31A 4ROSA 1NHWA 4PLCA 1Q1NA 2Z1NA 1ZK4A 4BKQA 1BXGB 3WR5A 1ZK3A 2NSDA 3NTQA 4JBIA 4NHEA 3DWFA 3ZV3A 3WS7A 1PL7A 5I9LA 1T1RA 2E48A 1ISFA 4KZPA 1ZKMA 4NJOA 3PRJA 2RCYA 3PDUA 3JD3A 4RPHA 4CQLA 4ZICA 3GDOA 1NNUA 3LC1O 3KYCB 5CPBA 1GYPA 4KUEA 1E6EA 3FRJA 3HDQA 2VWGA 2ET6A 4R51A 1GFSA 4BUCA 4DBVO 3ROPA 2B0JA 2VHVA 1GL3A 2AEMA 4CQMB 3RC9A 3JYOA 4L8VA 2C59A 1EFKA 3VZRA 2FZEA 3RUAA 4BMNA 2HUNA 3FF4A 3E03A 5DDIP 1UXJA 2JFHA 3A9WA 4LW8A 1ZJZA 2QIOA 1UXGA 4YJGB 2GO1A 4IJUA 5AQ1A 3HB4X 1QR6A 2GNAA 4TVOA 2I3AA 1DFIA 2AA3A 2X0RA 2OOSA 3KTDA 3OIGA 2YHIB 1PZEA 1FK8A 5DF1A 2YYYA 4H16A 2J5QA 1ZK0A 2CZCA 4J3FA 1EEHA 4IQ0A 5JPIA 4GPD1 1W4ZA 2VYVD 4TWRA 3Q3CA 3V2HA 1W73A 2V6FA 1NQTA 4YJHB 1Z73A 3NT4A 3UAGA 3RUEA 3STHA 3LF2A 1OOEA 4I5DA 3DBHB 4O63O 4A2CA 5L95A 4WLUA 2JHFA 4GSKA 3DMYA 4X54A 5F3RA 2IEBA 2VHXA 5FFFA 1N8KA 1Z74A 4L76A 3QIVA 3DBVO 4U6QA 3OEYA 3NUGA 2XPCA 4YR9A 1DJQA 4DPLA 3JYPA 1NPTO 2W2LA 4XQ9A 1QKIA 3MJVA 4E2ZA 4J91A 4NJMA 2IZZA 1C14A 4I1IA 3PK0A 4RVFA 4LGVA 3JQAA 3VPFA 1LSSA 3EHEA 2OL4A 1E3SA 3GGOA 3TZ6A 3H9EO 2J3IA 3EGOA 5ES3A 5JLAA 2WYUA 4G2NA 3ROKA 1GADO 3UFXA 4UUNA 4JCOA 2HMSA 5I9NA 4CMHA 5BNTA 5CHEA 4ALNA 1ZW1A 4J4HA 4ZGWA 4IUYA 4YJHA 3PJDA 1H6BA 2A9FA 2Y0EA 4WEOA 3HQ4O 3NV9A 2O2YA 3GR6A 3EVTA 4YAKA 1DLJA 1ZUD1 4Y6PA 5COBA 2JKVA 1P31A 1H0KA 2FP4A 4II2A 3FTPA 3QWIA 1B2LA 4YAEA 5A9TA 3TQHA 4EZBA 4YAIA 1IY8A 1RM5A 3GGPA 5A05A 3UN1A 1K89A 1EUDA 2VCYA 4TMFA 1ZNQO 1P9LA 4ND3A 4UAGA 4AJ4A 4Q3DA 1GQ2A 4EUEA 1ZXBA 1A72A 5JDCC 3CXRA 5G4KB 3VTFA 4CV1A 4EITA 3QQPA 2QG4A 1PQUA 4UVIA 1OI7A 3H7AA 2C2YA 1T25A 2ZQYA 4GGPA 3MOGA 3JD2A 4RV9A 4YRDA 3IS3A 5F5NA 4AICA 3PYXA 4P22A 1HDGO 5TRTA 3COSA 2HSDA 2HQ1A 3DBLA 4I5EA 3S2FA 3C3XA 1P3DA 3HWRA 3IL2A 3KXDA 3AU8A 3GZNA 2NADA 4BNVA 1BVRA 3RVDA 1HSZA 2DTEA 4E30A 3SXPA 3OP4A 1N92A 5I7EA 2JFGA 1E1NA 2W8ZA 1ZEJA 4YACA 4BQPA 4NG5A 1PJ4A 3BMQA 1TT5A 1F0YA 1EUCA 3S2GA 2VNAA 1HYGA 3UH1A 3D4NA 3ZCXA 1HDZA 2DPHA 5IZCA 1H93A 5BSGA 5ER6A 2OZPA 4XR9A 4Z3DA 4TROA 3RQSA 1LC3A 3H65A 4S1VA 5T8KA 3WBFA 2ZJ1A 3F4BA 3IAHA 5L3ZA 2J8ZA 3B70A 1IPEA 5DOZA 3W4KA 5G0UA 1HETA 3IDSA 4BVAA 1B8VA 4IIVA 1XIVA 2GF2A 4J90A 2ZQZA 4XJSA 4A7PA 1HE4A 1Y9AA 3JQCA 1XLTA 1GZ3A 1XG5A 1GYRA 3CIFA 2P4HX 5A5FA 3PFWO 1A7KA 1ISHA 2D2IA 3BXXA 4EI2A 1GQYA 3E9NA 3JQ9A 3JQAB 3PFFA 4FJ1A 3IJRA 4LISA 4OO3A 4K6FA 4FFRA 1HDYA 3K2BA 2VYNA 4IZHA 4YQYA 3W8DA 1S7CA 2D1YA 2X58A 2ZYDA 3L9WA 3B1JA 3AM4A 3PI7A 3K5PA 3KLPX 3WXBA 4HP8A 2J3JA 1C1XA 2YFHA 5H82A 3WLEA 1PJ3A 1ZMOA 3M1LA 4U6SA 4ZD6A 2O3JA 3R0IA 5I8ZA 5KWEA 1U2DA 4RVHA 1PQWA 3UOGA 3VPGA 4NU5A 3D3EA 3WQRA 3UICA 4PZCA 3AK4A 4PVDA 4XDZA 1NPDA 1HTBA 1SC6A 5B1YA 5KOIA 4MP8A 1N2SA 2HAEA 4JROA 2PH3A 1U8XX 1ADBA 2A35A 1KYQA 1UZLA 4IDEA 4IQGA 3GVXA 4K28A 3AI3A 5AXCA 1ARZA 4KDFA 1P0CA 3NX4A 2XXJA 1YOVA 3LZ6A 3GPIA 3TF5A 1JW9B 3RKUA 4CODB 3GNTA 2CVOA 1Z45A 2H6EA 3VZPA 1QYDA 1CQJA 4I9NA 1R4MB 1FDTA 5IDYA 1LRKA 3KYDA 5EINA 3HUDA 5ICSA 1U8FO 3MJCA 1I10A 4AJOA 1LLUA 1IPFA 3GY0A 4D41A 1PGJA 4P38A 1A5ZA 1C1XB 3I9JA 3UKOA 2VHZA 4J16A 4YDRA 1GEEA 2B4QA 3KYCA 5JY6A 4ZU3A 3I3OA 3WGGA 3D5QA 3PGXA 1HDXA 4MVJI 5THKA 1PWXA 4B7UA 3E5MA 3SC4A 1DAPA 1O89A 3OQ1A 1V0JA 1J5PA 1M67A 1OC2A 3RAJA 4XB2A 4FGWA 4K6CA 4J7XA 5T67A 1M66A 2QYSA 3HFGA 4Y8VA 3DB2A 5KVSA 3SJ7A 2HRBA 3ZNQA 4WEQA 1DBVO 1XGKA 1N9GB 3HSKA 2IODA 1V9LA 3KRTA 4M1QA 3WBBA 2RIRA 4MVJE 1F8GA 1WMBA 1EK5A 4F3YA 5CDYA 4DRYA 2VRBA 1JU9A 3K96A 3KHUA 4LCJA 3GEMA 3AY6A 1XWFA 4HFJA 1VSVA 4BO1A 3C1OA 3JSAA 3V8BA 3AOEC 1BHSA 2HMTA 4XRRA 5ENVA 3F47A 1B3BA 5TJHA 4YRBA 1I2ZA 4N5MA 3ZW8A 1H5QA 1LLQA 2DBQA 2GERA 4BO2A 4P8RA 4QFCA 3K9QO 1OMOA 1HEUA 4PCVA 5T57A 1RWBA 1ISMA 1ZMTA 3GLQA 3ICPA 3VKVA 1ULUA 4XB1A 5KIAA 1LQTA 2E49A 4RF2A 1J0XO 1Y7TA 1E7SA 1E3WB 5DULA 1PGNA 3U49A 3LU1A 3MJSA 4QSMA 2EP7A 2PD3A 2QZ9A 4E2XA 3OJEA 3VTZA 4LMPA 2VOEA 2UDPA 4G5HA 2EF1A 3F5QA 4QX6A 4DYDA 2RHRA 1CEQA 2P91A 4FW8A 3I23A 2DC1A 4MVJF 3EYWA 3KEQA 3AUUA 2I9PA 2IXBA 2CDCA 5C7IO 4TRRA 3QY9A 4CMKA 2BI7A 4B3HA 1R0LA 3RCBA 5IDQA 4ITUA 2IYOA 4J4BA 2GLXA 4YJFA 5JDIA 4RGBA 1J49A 5C7LO 4NMHA 1RYDA 4NBWA 2WD8A 4I5FA 4XQGA 3D3WB 3PZBA 2O3TA 3BMCB 1CERA 4K9DA 3TOXA 1YQXA 3C7DB 3R6DA 4CMIB 3SJUA 1CRWG 2UAGA 3B1FA 1BDMA 1UXHA 1VSUA 1Y8QA 1X7HA 3RSHA 1LXCA 4UUMA 3ZWBA 1Y81A 3JQBA 3WJAA 3LT1A 4MPDA 4OL9A 3ROQA 1NM5A 3VC7A 3QV1A 1V8BA 4ND5A 1JWAB 2P5UA 1RPNA 3GPDG 4CM7A 4HUJA 1DPGA 4HNGA 4IIUA 4N5NA 4WOJA 4BO0A 2QRKA 3V1YA 2H5LA 4NK5A 4BHTA 3JQAD 1DIBA 3NDJA 4BS9A 5TJ9A 4TQGA 3F4LA 2AQKA 3ZHZA 5HM8A 4YA6A 1YWGO 1Q7CA 2DAPA 4MVJM 2Y93A 3LSYA 3QSGA 3ENNA 2HU2A 4QXMA 4UUOA 3DQPA 1H94A 1AXEA 3NTRA 4TZKA 4FGSA 3U9LA 4W7HA 1LRJA 4AJEA 1HL3A 3AY7A 5L9AA 1DXYA 1I32A 4KTTE 3I52A 2XAAA 5T5QA 2H63A 2V6BA 5H81A 1EE2A 4WJZA 2RHCA 3RASA 1EVJA 4YWJA 2WE7A 2X6TA 4YXFA 2P2SA 3FN4A 1P45A 3NTOA 3RU7A 1NWCA 3JTMA 3MJEA 4OH1A 4PLZA 4ALKA 1I0ZA 3DOOA 1U3WA 3E1KA 4CM8B 3PWKA 2LDBA 4HFNA 3ZWAA 4DQUA 3WYBA 5TX7A 1NWHA 1QP8A 3QVOA 3ANNA 5JC1A 3BZUA 3U4HA 1QMGA 3JQFA 4BGVA 4U8GA 4GVLA 2DFVA 1A71A 4PLPA 4B4UA 4RF3A 2EV9A 3SC6A 5A03A 2Y0CA 1QG6A 4D45A 1EDOA 1DHTA 3DC2A 3TSCA 2VZ9A 3TFQA 4RCVA 3WGZA 5TNXA 1C0KA 1RM3A 1KVTA 4GMGA 4IBOA 2PZJA 1YO6A 2PGDA 3ANMA 3TN7A 3LLSA 1E0DA 1ONOA 1YL5A 3GVPA 4LN1A 3VH1A 2EWMA 4F45A 5A1TA 3UF0A 2J6IA 2W2LD 3QVXA 5AOVA 3UCFA 3KVOA 3OBBA 2GCGA 3BMNB 4J0EA 1V35A 5J23A 4DQXA 3TL2A 1GY8A 4FQ8A 2OP1A 1LEHA 3GG9A 4R54A 4YT5A 1VM6A 4TRJA 3SBOA 2BMAA 1PJCA 2D59A 2V6GA 2ZTMA 3OMLA 5B37A 2NNLD 3CINA 2EW8A 4E5NA 1PSDA 1CETA 1P77A 5JDIC 4U0KA 3LVFO 3OFSA 4JQCA 1X7GA 4CM3A 3KV3O 1ONNA 4C7KA 1I24A 3DZBA 3UXYA 3UVEA 4PLGA 1CIVA 3GOHA 1E7RA 3WFJA 3ONFA 2WDZA 4IZIA 1R16A 5I7SA 4CM4B 5DCUA 2X0JA 3IKTA 1Y8QB 3ZV5A 2I76A 1NTOA 1WZEA 1E1LA 1RJWA 3AM3A 4U0JA 3RWBA 3G79A 5JSFA 3ZNOA 1ZFNA 2JD0A 1AUPA 4LSMA 4W9NC 5JBIA 1T1SA 3ADOA 2GD1O 1LC0A 3FNEA 4PLYA 1YBAA 5COAA 2Y0DA 5TC4A 3C85A 4BV8A 7ADHA 1C0PA 1G0NA 1FDUA 2PV7A 3IMFA 4DPMA 3EW7A 3RI3A 1NR1A 2BFMA 1TI7A 4HNHA 5FF9A 2VUSA 3ZH2A 4FFMA 1DDOA 3VH4A 1DB3A 3ASUA 2A92A 2BGMA 2WJPA 3PHHA 2Q2QA 3MEQA 2OORA 2I66A 5JAMA 3G1TA 1N1EA 1KEVA 2XOXA 4CV0A 3H3JA 5ICMA 1WDKA 1H2HA 1EE9A 4NBVA 1U5CA 4ZN6A 1Y8RB 3NDRA 4YJDA 5IXYA 1C1DA 4Z0PA 1UZMA 1E6UA 2Y68A 2Q49A 4RF5A 1W0CA 3ENKA 3ZWPA 2DT5A 1PJLA 1ISIA 3DFUA 2JHGA 3FCOA 5I7VA 5TLSA 1HZZA 3W8FA 4BNHA 4BNKA 3B20A 4GWKA 4WK6A 2W4QA 4NPCA 5AYVA 2VWPA 4E12A 4R3WA 4P4GA 1E77A 2HO5A 3UHAA 1GUFA 3PWSA 5DN9A 1W6UA 1U2GA 5TS3A 4EUFA 3U4IA 3SX2A 4IY1A 1HE5A 4RZIA 2HDHA 4YAJA 3ZWWA 2BELA 2HJSA 2IE0A 5IZCC 3VZSA 5LC1A 4CM9D 3MCVA 1SBYA 3CSDA 3FPCA 3ZZNA 3UCXA 4ZRNA 2O7SA 3OHSX 1MX3A 1PZGA 2F1KA 3WYCA 5GMOA 3JQGA 4Q9NA 5G2OA 4MVJH 3T7CA 2R00C 3QHAA 3RU9A 2CD9A 2NV6A 1HWYA 2UUPA 5BSHA 1ZCJA 4XCVA 1U3UA 4FN4A 3WTCA 3OQ6A 4BNWA 3PDJA 1DOHA 4M49A 4Y6RA 1SOWA 4RPJA 5T6BA 4CLRB 5CFZA 1NQ5A 4I5GA 3SLKA 4WLEA 1LU9A 3QVWA 3OEWA 2H9IA 1YE3A 1TT7A 4CM4A 3V5NA 4EDFA 1LDEA 3JQEA 1KEPA 2AW5A 2HLPA 4IXWA 1KY4A 2IYPA 1NXQA 3S2IA 4OSPA 4BKPA 1X13A 3OA0A 3HN2A 3F6YA 2YHUA 3FHLA 4RQTA 3WSVA 2AHRA 2DQ4A 1Y5MA 2F00A 4BNZA 4O1MA 2BRUA 1KS9A 5L40A 4WCFC 3BMQB 4MP3A 4GX1A 4TVBA 2X22A 2X8LA 1P1HA 1B16A 1MUUA 3EC7A 3AOGA 1R4NB 2AE2A 4FFOA 3MZ0A 4OOFA 3JV7A 2GN4A 3L0DA 4WCFA 1T24A 1ZSVA 4FC6A 1HDCA 3WB9A 4M54A 3Q1LA 5I9MA 2GZ3A 4PN3A 4RLSA 2GN6A 3GUCA 2PGJA 2OBNA 5ILOA 3I6IA 4J1QA 5KVCA 3MTJA 1YRLA 4OGWA 5KTKA 3AU9A 4J2HA 3H9UA 3W6ZA 2JFFA 5EMHA 4XA8A 2NU7A 3L07A 2LDXA 1ENYA 5B4VA 4CR7A 2AG5A 4IDFA 4NIMA 4XX0A 3U4CA 5IN4A 3S1LA 4OXKA 3DXFA 1XSEA 3H8VA 2P9GA 5TSDA 3ASVA 5FI5A 4GKVA 5DT9A 1X1TA 1KC1A 4UVHA 5JYDA 1FDVA 4HXYA 3D4OA 2GSDA 3PQDA 4OKNA 4PRKA 3ANLA 3HB5X 3QJ5A 4UEKA 5AXBA 4DLAA 1M6WA 5LDHA 4I08A 1GU7A 1YDEA 1DC4A 3GGGA 4ND2A 5JCXA 2YFQA 5AVOA 5L53A 1QV6A 4YQZA 2EJWA 1LQUA 1LDGA 3LT2A 4CQMA 4QQRA 4W7IA 5IJZA 1T2CA 3I4CA 3ZHBA 3RIHA 4XZ3A 4DC1A 3INRA 3DOCA 3BHMA 2GPTA 3A1NA 3K6JA 3NT5A 1KEUA 5DOVA 5T8KC 2ZTVA 1TLTA 3EUWA 1R12A 1ONPA 4PG7A 4CMBA 4WLFA 4D79A 3C1AA 5BQFA 3ZWOA 1BGVA 1IYZA 4XYMA 4NFSA 1XR3A 3CPSA 2HMWA 2Y99A 2BGLA 4I9UA 3I83A 3IP3A 5IZ4A 2VHYA 4EBFA 5ENDA 4Z0HO 1PJTA 1PGPA 1QORA 1GR0A 3C1TA 1BXGA 4IM7A 1I5RA 2X9GA 1R4MA 1SNYA 2Q45A 3HN7A 4JBHA 1NQAO 2B5WA 3CZRA 1I33A 5EQDA 4ND1A 5JXWA 3KSZO 5BNIA 2ZTUA 4B79A 3RROA 2VUTA 2X9VA 2ZYGA 4CUJA 3PVZA 2DTXA 4W82A 2DTDA 3DONA 1MA0A 4GLLA 2EKLA 4R01A 3DZIA 1PTJA 4B3IA 2GRAA 3D5TA 3Q2KA 3FBGA 4BNJA 4CLRA 1D1TA 3VDQA 3TZCA 2BD0A 5LDGA 3EZLA 4BKRA 5CEFA 2VZ0A 4GX0A 4NNJA 3R3JA 2JJYA 1KY5A 4J7CA 1CYDA 1MFPA 2E37A 4IPTA 4MKXA 1SMKA 5TT0A 4QEDA 1C0IA 3ZV6A 3GMDA 2OXIA 1BXKA 5GZ3A 5DZSA 4QTZA 1GCOA 1UDCA 3C24A 1N9GA 2Q2VA 1FDWA 1KVSA 1XEAA 3QWBA 3KYBA 3GN2A 1E3LA 1GV0A 1OBFO 3ICCA 3AY3A 1YQGA 4OIMA 1B0AA 2VYVA 5HS4A 4AJ1A 2YJZA 2IZ0A 2AQ8A 1WW8A 4HKTA 2C5AA 3ITKA 2VT2A 1E7WA 1LJ8A 4N5LA 2JD2A 4P4LA 3I9KA 5JO0A 1HZJA 4LVCA 5GY7A 4YT4A 4C4OA 1VC2A 3VKUA
chains in the Genus database with same CATH superfamily
2YYAA 3O73A 1I9CA 3IPCA 3EZXA 5DMHA 3VYWA 1BSVA 1T8WA 1IZ7A 1SU8A 3F9IA 3KHSA 4UDXX 5D3ZA 3HUUA 2R5WA 5TF4A 1RHMA 3N86A 4QOHA 3TIGA 4EY8A 1Z16A 3QVGB 4WZAE 4O3MA 4NECA 4IFTA 4IJVA 2FAXA 2H3EA 3N8NA 4KWHA 4WN3A 5AW5A 2N1BA 4QDKA 1NZFA 1S3SA 1BMFA 3BM5A 4BJ6A 3OOWA 1MW8X 1YZNA 1PBTA 4AFNA 3ZY2A 3LDAA 1KS2A 3AIKA 3DLPX 3Q15C 5FJJA 4K86A 1IHYA 3FJOA 1QJCA 3G0BA 2NO7A 3KYJB 1CCWA 3NAQA 2AN5A 2A5LA 2IHZA 3KOWA 4FDMA 2Q2WA 5P21A 4DLZA 2KHZA 3VR1A 1DTWB 3U44A 1F8FA 1NHGA 1F06A 2AK2A 1M1NA 3PDCA 1G60A 2BUCA 2V3WA 4I4LA 4DJEC 5KYWB 1AB5A 2DQKA 3I0ZA 3T7KA 5GV7A 4FMDF 1RWNA 1HKUA 1OFUA 4EO7A 2VDVE 4AJ9A 1REQB 4YRIA 2H4WA 2QTHA 4Y6LA 2EF0A 2R62A 1EGVB 2Z09A 2H2IA 3HVJA 4RPGA 5EWMA 5L7TA 3CX4A 3OWHA 4JLDA 1USIA 3FGZA 3ND6A 4MWOA 5DYIA 2FB9A 2QK4A 4II7A 4ZVVA 1ICEA 1TA9A 1TD1A 3QVJA 1PV4A 2APJA 1ZHFA 2RIPA 3L92A 4M0CA 3WP1B 4E5KA 2MMGA 3KSDO 4TS4A 4ZVSA 3SHWA 3GAZA 2VDQB 2BI4A 3FPAA 5CHYA 4F97A 2VTBB 5FV4A 2VK1A 4FYWA 1KSGA 2XTMA 3D0OA 2VWHA 2W90A 4GUAA 4M6WB 4P4SB 2XZPA 4CMEA 3AKZA 1ZEMA 1KJWA 2OHXA 4PWYA 4QUHA 4R41A 3U3ZA 2H5IA 4YV2A 3OOSA 1WEHA 4R1OA 3H6GA 3MQFA 2IEAA 2Z9CA 3T7RA 4D0RA 6LDHA 4DGQA 5BVHA 1M74A 4YMLA 1AUXA 4M1YA 5T4BA 2G04A 1N25A 1JALA 1I6WA 2GBPA 3OLXA 2Z57A 1AQIA 1IUOA 5BWBA 4FDVA 1YTUA 1N7HA 2AD5A 5AKJA 4N3AA 4MWDA 1U9JA 1UR5A 3LDGA 3H1PA 5T64A 1HI9A 3EJWA 4INOA 5BWCA 5IH7A 1YI8A 4WW0A 1F7VA 4GMFA 3KZXA 4Q37A 3ZQ4A 5ANRB 2VQEB 4P4TA 2C9MA 2I5PO 1L4YA 3TAXA 2E82A 2WA1A 4DV4B 1HX7A 3P71T 2WG1A 1KJNA 2ZB2A 3JQRA 1U2PA 2M32A 1SZJG 2CF5A 2GD6A 3OE4A 1GGMA 3DWEX 4AY6A 3E82A 3JY6A 1H2EA 1Z36A 4B47A 2JFYA 1JHYA 1FX0B 1BHQ1 3JQ7B 2R48A 4N82A 2PNJA 3RBZA 4C0LA 3QLVC 4O4LB 2BSXA 1T2VA 3S99A 5LP6C 1PW7A 3LK6A 2HNBA 2OHFA 4B6GA 5JZMA 1G3UA 4Z1MA 1DV2A 5TMPA 3LHSA 4B9AA 4C04A 1VRCA 2NQ8A 1V71A 1XA4A 5FLEX 4JUCA 5E6SA 3PUKA 5DHQA 3JVUA 2NU7B 3VM6A 2A1IA 1KQ3A 3PSHA 2YN2A 2ZXUA 4IHJB 3BWEA 1T5DX 3H5WA 4AYTA 4F2GA 2D5LA 3HYRA 5KTSA 2QTWB 1QS0B 4G5FA 2CWWA 2UVPB 5FX2A 2DBVO 1P1BA 1LI7A 1GARA 2C20A 5IC6A 4U1RA 1LFDB 3OU2A 3GHYA 5E6RB 4INPA 4QRHA 3HU5A 4X5OA 3EIQA 1V11B 2XBLA 2Q07A 2YY7A 3CN9A 4OYYA 4Q4LA 3IMGA 2Q4BA 4FBGA 4EL0A 5CB4F 3OOHA 4QBHA 5CDGA 1X7XA 1V5GA 2QW8A 3PFGA 4JT9A 4LA4A 3H6KA 1JFFA 1L4GA 1DMSA 1A95A 2FPUA 2P35A 4DLBA 2WIFA 4KQXA 4MAFA 3K73O 4DN6A 1VOTA 3PTZA 5ARBA 1I8TA 2IWRA 1BZYA 1O3YA 3V6MA 5AW9A 4B09A 1NBMD 1O6GA 2AYZA 1PJQA 1PNTA 1TVKB 4RTMA 4GPEA 1R10A 5H3HA 3RK1A 1LS1A 5DU2A 2C5HA 1K4MA 1OROA 2QTVB 3NAMA 3SHTA 4Q4DA 3VVBA 1RQPA 2YMQA 4JT4A 4PSAA 3UK6A 1RKVA 2XA9A 3ST7A 1R9JA 2FFQA 4LHVA 4D42A 4E22A 5IWAB 3I01A 1HZZC 2WWXA 3FA2A 4MKGA 3F7TA 2QUHA 3A27A 3A4NA 1M7HA 4GLOA 2RHLA 4HAOA 3UMSA 2OLJA 1AKVA 4KVAA 3HI4A 4R2WA 2OORC 3PUYA 3MGKA 4FYXA 1DCMA 3NEPX 1XZKA 1HTWA 3N58A 1V48A 3AWDA 3KQYA 4W4TA 4PLHA 4C4YA 4DABA 4EKEA 1P7ZA 1TFRA 2EAUA 2JAXA 1ODKA 2Q50A 3L41A 3L0ZA 3CZ4A 4RMNA 4Y2JA 4Q82A 1ONSA 3BOSA 5EMJA 1DEHA 4RD2A 1L8QA 5FUVA 5HZGA 1THGA 2WT8A 4ECAA 1RJ9B 2BVNA 4COOA 4N65A 4QOIA 5A04A 4ZYLA 3WNQA 4BRZA 1T5SA 5K0NA 5F4BA 1KKLA 1CF2O 4PPYA 4Y6OA 2PGLA 2BGRA 3NGLA 4KRXA 2NUTB 3UB2A 1Z2EA 4C4TA 4XWOA 1FLVA 1VLQA 4EABA 4B3SB 2P4QA 1ZUWA 13PKA 3UB4A 5I01A 4GDFA 1ISGA 3B1YA 2XD4A 2TMYA 3QE3A 4LVOA 4AF6A 1RI4A 1FPMA 4S35A 5G40A 1QV9A 5D5HA 3L79A 3ESBA 2MR6A 1EJBA 4C7JA 2ZB8A 8ATCA 2IYNA 2RJ3A 4MB0A 2WSSD 2FF7A 3PD7A 4REQA 3RSSA 2QTAA 5CFOA 3N2YA 2F2TA 3V4SA 2I7DA 2EHDA 3DZHA 2AXQA 2AH5A 3E3OA 4BB9A 4EY7A 1OXXK 2ATXA 2B3TA 3L7AA 3KTOA 4DSTA 3FSGA 3LY7A 5CURA 1V39A 5HDBB 1G4UR 2IIQA 5JANA 2QMUA 5A6SB 2DERA 3RSQA 3TM4A 4E4YA 5AVKA 3E22A 1CHDA 5DJ5A 2OPBA 3SQXA 5FEMA 3KQNA 4XCXA 1DINA 4WCVA 4G5RA 5IH3A 5C5EA 5K3OA 3VYRB 5I4BA 5FI0B 4YECA 4IQ4A 2AR7A 5BOSB 2SBTA 3M83A 1Q21A 4DJJA 1H4SA 3ENWA 4PC6A 3Q8XB 5GJVC 1W75A 3ER6A 1NW4A 2IYYA 1WZIA 1I2CA 3NTXA 2AQIA 1K0UA 3EOAI 3ZD9A 1R0XA 4X44A 4P0QB 1TAGA 1Q7GA 3G5AA 2ZWOA 3U7RA 4GT1A 4H17A 2P9YA 4MUEA 4PZEA 4A5OA 3KQMA 2ILTA 5BSUA 1I30A 1X7XB 3EIFA 3IEPA 4HI0E 3ZCVA 8LDHA 2ZIXB 4ZQFA 2B25A 4QM6A 1FE8A 4QYIB 1W8DA 1YZKA 4G0QA 1O8BA 4P3PA 5EN4A 5A71A 1JTFA 3WGQA 4D9KA 2F4VB 3LI2A 3V46A 4PG5A 3VU8A 4CF5A 2G08A 3DDWA 1JKFA 4FHZA 4OSEA 3RUDA 1XJQA 2WJ6A 1I2BA 3TTWA 1QKJA 3ON5A 3EX7C 3FD8A 5F51A 4UHFA 1JB1A 2MDTA 3DZDA 4QIHA 3RIEA 4CLOA 1SBIA 1L8LA 2UYHA 4O8CA 4B3RB 4DQVA 4RDCA 3H9CA 1VJGA 4AZ0A 3HJBA 4GMDA 1LDNA 1E2FA 3R3UA 2OILA 2ZJYA 1KFBB 2GB4A 2P62A 2IY8A 1W88B 5JEDA 2JEYA 5JJKA 2F62A 3WLOA 1CB0A 4BVHA 4KMSA 3M7IA 3KAKA 5H8WA 4ZDKA 1EXNA 4B9EA 1ZJYA 1UXOA 2FY8A 3LC7O 2VXOA 4RH3A 1QRSA 2CE7A 3IH5A 5ICEA 2X7JA 1J8FA 1II0A 4XIGS 2R7NA 4GRAA 2EQ5A 5KVAA 3PCXA 3F74A 3ONEA 1TU0A 1FMFA 1GSIA 2ZE7A 4GNKA 2I3ZA 2CBXA 3NHSA 1CY1A 2W6JD 1MJ5A 3DUFB 1V1JA 4Q3EA 4BNGA 3WJ7A 5C0OE 1Y5RA 3LAWA 1XLWA 2Q1SA 2DUNA 4IH4A 3TOZA 4EYKA 3KV1A 5DBFA 4D9MA 4CLEA 2QN3A 1HA3A 1KJZA 1Q20A 2A0XA 1JR3D 2FFAA 1AQ6A 1NURA 2J7KA 3IUJA 2HDNB 1BJKA 5EZQA 5KNDA 3N2IA 1N0IA 3GG2A 2I55A 3QU4A 5KCZA 1TJ3A 2XXAB 3DNPA 3T61A 3OX2A 3A1UA 5DASA 1XJWA 2AIRA 2R8RA 1KAGA 3T1TA 3B1XA 1EESA 5BVHB 3GNQA 4ZI7F 3AVTA 2IS6A 1A9TA 2BGUA 2FW1A 4MI9A 4C4ZA 1XEXB 1K08A 5DI3A 1K75A 4G4IA 3WGLA 4F11A 1O96B 1UBSB 1ZH0A 2HA0A 1FJGB 4N0EA 1E2QA 3UENA 4TMWA 1P2GA 2IU4A 4TQ9A 3KOOA 3AFHA 4GS5A 1QF7A 1A04A 2LWIA 2ZSKA 1OAKA 3TAHA 2E55A 3E27A 5FPYA 4B85A 1G1AA 3T5AA 2Z9DA 3SS8A 5TVKA 4Z9XA 4FHCA 1J00A 4Q3BA 1Z4NA 4W6ZA 4QT0A 1X1RA 4JASB 5G3ZA 1N5MA 1R4NA 1TUEA 3V7UA 5I8PA 1Q22A 1YIOA 5AM0A 1T26A 4J07A 3BGVA 3BH0A 1FP7A 2AOXA 2YMPA 3SJCA 4BO9A 2YXLA 1FB5A 1UBKS 3SHVA 5BV0A 2YWDA 1U0OC 1XROA 2QD2A 3M2TA 1AKQA 5BNFA 2CLMB 1THZA 4JITA 3CBGA 3TR6A 5KB3A 4BAUA 2GXAA 5JJCA 1Q0HA 1V2GA 2G17A 1RI1A 2JI6A 3DAHA 2Y1CA 1OX5A 3KB8A 5K0LA 2PNFA 2OV8A 2VCHA 3E0QA 4M1ZA 4R1PA 1ZOOA 5A6VA 1VIDA 1RP1A 5I5GA 1DRJA 1EWRA 3W90A 4AS1A 3RVSA 3G02A 4HEQA 2PGIA 4DCJA 4CEJB 3G8AA 1HL7A 3MTAA 4G9GA 4C2AA 1WPGA 4ZVNA 3S5JA 2YX1A 3HP7A 4FZRA 3DUWA 1OB5A 3MMPA 3ROTA 4LJLA 1O77A 3LWBA 1Z0IA 4DA7A 1ADFA 3F5FA 3NASA 3R5KA 3H86A 2JCSA 1WDLA 4MITA 1XPUA 4QARA 3ZHUA 3TQRA 3RADC 2QOEA 5EE9A 4EG1A 3N53A 5JECA 3MYYA 3HFJA 1NLMA 4ZVUA 1O94D 1R37A 4IGFA 5KVVA 4U7JA 5CYFA 3CV3A 4UW9A 2R79A 4YV0A 2VG8A 5BW6B 4K26A 5KWSA 3F0TA 1N1MA 1X8JA 3C3YA 1VL6A 3EOBI 3N0TA 3L05A 2XF2A 3MJTA 4DCMA 2DKFA 3DLTA 2C8JA 1KDZA 4QGAA 2Q4RA 4AG3A 3GJQA 3KQPA 1ANKA 4C29A 4WA8A 2A0KA 1NJSA 2HJVA 4FZVA 3WO1A 1T5HX 3L01A 4UVDA 2RAVA 4IS2A 3EY4A 4NQZA 3KXIA 4XM0A 2FCRA 3F3SA 2QZPA 3PC8A 3B2NA 1JDUA 1WKVA 2AFIE 3VAZA 3NVKI 1DAEA 3DKIA 1RXYA 2PK3A 3ID6C 2Z8ZA 2ZKIA 4U02A 5F73A 3EA0A 1JMYA 4XGKA 2O8EA 3GP8A 2WM3A 1ABBA 3DE7X 5D8DA 1PS0A 4DT1A 4M0DA 2QZ4A 4NZMA 1WDTA 1QCDA 2B5OA 3MS2A 2GJKA 4X3CA 4BV3A 4IOMA 5B3AA 3RVRA 1ES9A 3P9KA 1GNTA 2J6BA 1BE0A 3RTDA 1EE1A 2G09A 3AMVA 2QZSA 2X0IA 2JIRA 2DCUA 3WYGA 4DSZA 1D4OA 2BF7A 4W99A 3UA4A 2JJ2A 5ALEA 3V33A 1JB9A 1E69A 2BFNA 2QQGA 1HE1C 2N46A 5C8VA 1T36A 5HKOA 1CSEE 1PZFA 2GN2A 3WZMA 4S04A 3I01M 3ZUGA 1NVMB 3WJ1A 1KYVA 5FULA 3WL4A 1LVHA 3BA1A 1JV2B 3IALA 5HFJA 2CXQA 3GH3A 3W78A 4EECA 2QTVA 1A0OA 2CDAA 1AZLA 3B3AA 3PX3A 1VKJA 1HG1A 4CG3A 1HDOA 3CVYA 3R7AA 2GK7A 3A0UA 1G6KA 3AF5A 2LGJA 2FN4A 3NHFA 6YASA 2D3TA 2QQ0A 3OCJA 2HRDA 3FZNA 4IIJA 1CF9A 3KG2A 4G5GA 2Z2IA 2WFMA 1R0RE 1XZCA 1ZXLA 2J6HA 3KKZA 5KHOC 3OSZA 1S2GA 1F14A 2AG1A 3GK3A 4ZYUA 2BGGA 1GRQA 1KFKB 3EGXA 2VPTA 3BDAA 4IEFB 4EUHA 1K6JA 3DCYA 5ITZB 2HHLA 3BIXA 1P33A 3VJMA 3M49A 1KC3A 2L82A 3DO5A 1O97C 3E6AA 4LXHA 4MI3A 1KZ1A 2ZUSA 3PGKA 3MTIA 3W06A 4LJ9A 3S1SA 1URPA 4LS3A 3CUSA 3R5JA 3ESAA 2JAUA 4GBED 4X41A 5EPEA 1R5JA 2FFRA 2Z3WA 2VDJA 4FYMA 3TW0A 3MWFA 4K7JA 1JWBB 4BYGA 1CY7A 3QXXA 3TXXA 4ZI3A 1JLKA 2FOLA 1XEFA 3WL3A 3HY4A 5GONF 1NW6A 1Y98A 4YCAA 3GZ4A 1OD6A 4WLOA 1RLJA 2QTRA 5JRZA 3VXKA 1NAHA 1LW6E 2ZI3A 1GPAA 2ZJ3A 4JIGA 4Y1RB 5KBYA 3DE4X 2D5CA 3VHRA 1WY5A 1LK7A 1JQAA 1A88A 3L6DA 4J75A 3PNQA 4OHOA 3U7JA 2OMEA 3OM8A 3ET4A 4LXGA 2K7FA 2FEPA 2Q8NA 4WBSA 2R6JA 2VS1A 3KDSE 1EX9A 5BN3B 5H83A 4UDYX 5G1OA 3K8YA 1MMFB 4BZZA 1WXGA 3WLKX 1KETA 2DCMA 4G67A 4XYLA 1E4YA 4M1EA 2PLWA 3H42B 3VVLA 1DXHA 2PD4A 4BMSA 3AXSA 3JD1A 3P5BA 1M1NB 2FFBA 3A1FA 2GF9A 2BTEA 3GCXA 2BTOA 2FMHA 5B12A 5JARA 4MGIR 4A91A 1ULBA 4EMUA 3P0IA 2BP7B 4R8LA 3UFBA 2BGWA 1QIDA 1Z5NA 2GZRA 3INGA 4NBTA 4PR3A 2CLKB 3BCRA 1ZOLA 3T5BA 1M2WA 4BVLA 1NQOA 1QYIA 1WCWA 1SPXA 2B37A 2DQSA 3GELA 3LPAA 3PU6A 3PWZA 4LE0A 2FMUA 3GQBA 4PSDA 3SQLA 3O4GA 4OLAA 3WDSA 1EHCA 2ZJOA 3K70D 2ZUVA 3T54A 1YXMA 1KKMA 1Z82A 3W3AH 4ETIA 1NNSA 1WF3A 4O4HF 2WE8A 1FJHA 3W8EA 4LXUA 2H54A 2AZXA 5D1NA 3V7YA 4CHTA 2XVZA 1C9EA 2OQRA 2QVGA 4DUPA 4DV1B 3ESXA 5JE8A 4FOOA 1WB6A 3KEGA 3KJHA 3RGGA 2QYTA 2QM7A 3VRHA 4HRXA 1BMDA 1BG6A 1MOQA 1K86A 3AUAA 2ZETA 1JVNA 1XMSA 2DBRA 3ZY5A 1NN0A 1QMPA 2FSGA 2W7TA 2XIQA 3BGSA 1Q0PA 1UDAA 3K0AA 4XTCS 4EELA 3ZQ6A 1F20A 2W11A 3SFVA 4EF6A 1U7XA 5FWYA 4O02B 1SBHA 3UWOA 1FNSA 3ZHYA 4XIFA 4M8IA 2GF0A 2NOAA 4EMTA 3F1KA 3DAGA 1KI1A 4B17A 1UQUA 1JG7A 3ZWYA 1TRHA 4TT3D 4WGFA 4HADA 3PENA 1UQTA 3T0FA 4DV7B 2EIXA 1NKSA 3HLKA 1E3TA 3H5AA 5AKZA 2O3RA 4GWLA 3NWOA 5AHRA 1OTYA 3QE4A 3M6UA 1D2AA 2FOIA 2NTVA 5HRUA 1L4EA 2X8JA 5DNDA 3LT4A 3PFIA 1PCXA 1W46A 1TO2E 4QA9A 1JAZA 5IXJA 2YWEA 5LZ8A 3QU2A 4N9QA 4CCSA 5K0GA 4N7MA 4JP2A 4OQZA 4WRRA 2KI5A 5C3MA 3B8HA 2HLDA 2XCTB 1Y4AE 4RA9B 4X63A 2G4VA 1B3RA 1XD2A 3BWXA 5IAAA 5JXGA 5FJIA 5THQA 4Z7NB 5EUMA 1FL9A 4HBGA 5LR6A 4ND6A 2P6RA 3WL5A 3ED5A 1GGVA 1G0OA 3AUYA 4D3FA 1C4WA 2REXB 5EG5A 5EJFA 2FG6C 5EWJA 2ODEA 3EA5A 2O05A 3H87A 3V1KA 1PF7E 4KL8S 2C2KA 3R3SA 1SCAA 5TQ0B 4FFVA 1OTXA 3SU8A 1B1AA 5H4HA 1G6OA 2YCLA 4MIOA 3CZMA 3ANTA 2DWUA 2FKAA 2I6SA 3UJBA 5A7FA 1AO0A 4WNAB 5K0FA 2HPHA 3K4QA 3DBOB 4X97A 3UGTA 3U7IA 2PZFA 3OSUA 4FN5A 4TYWA 3K0FA 3GT0A 4MAAA 1JIKA 3E5RA 4WT7A 2RG1A 4LF4B 2X76A 1KJJA 4CJXA 3CF2A 4FT2A 2OGSA 1SKQA 4TSKA 5CP8A 3GJRA 3KLBA 3FCSB 5CFRA 3T3IA 1MGOA 4ZAWA 5C80A 1CIJA 1S2MA 3SFTA 3RM3A 1ZIOA 5P8WA 4GE0A 4CU2A 2E89A 4A1FA 1KDPA 1XRNA 4P35A 2FLWA 1YVRA 4LNUB 2JH9A 1UBGA 1E8MA 2Q1TA 2J5BA 1Q0QA 1AB6A 5K6TA 5FLKA 3QKWA 4IDGA 3U17A 4IH9A 4NMWA 4J9VA 2F1OA 1E9DA 1SFRA 1XALA 3E8MA 1TRKA 1WMSA 4ALMA 1PWYE 1PR0A 1QRRA 1O0CA 2P41A 5I3CA 1LPMA 2BEUA 2JGNA 3JVDA 1D2MA 3T7TA 2PRKA 4D7AA 1RW4A 1RZUA 1G7SA 4QTYA 1RT9A 2V6JA 1A77A 1SUEA 4F3KA 1QZZA 4RQBA 2P5TB 3MTQA 2WV7A 3ZDFA 2PKQP 3L4SO 1VYUA 3NHUA 2HXSA 1NY6A 3O7WA 3ZXUB 2QD1A 4ALLA 4AVYA 4RTJA 5MHTA 1IOVA 2I65A 5KMGA 3ITEA 3AUFA 3UAXA 3C3EA 4MQUA 3RYHB 5DVZA 2VRCD 3EA4A 4UE6A 1THTA 3CKKA 3N0VA 5AVRA 4C7OB 2OVBA 4ERNA 3O2NA 1KORA 621PA 4JI7B 4NZPA 2UXBB 1A69A 2RGNA 1FU8A 3UWSA 4JK3A 3UT6A 2ZSFA 4IUBS 1NI4B 4EHKA 3PA6A 2ALJA 3B7WA 4OMFG 4CF3A 4ZHSA 1QGYA 5LYJA 2CSUA 4DWJA 1SAYA 4R2KA 4Q3LA 5AI0A 3WKDA 4DC0A 4MR9A 1H23A 5FFMA 1WCXA 2D1QA 5FQNA 1L2TA 3C48A 1XN1A 2XDQA 3TJRA 4KOAA 2OFPA 4AURA 3CF0A 1KZ9A 1W85A 5J58A 1JFSA 1NVGA 1RMQA 1DBRA 2AR0A 4ZKEA 4EG7A 2XTAA 4LHWA 5JOQA 1P6XA 4WN9B 1MG5A 2D0DA 2HADA 5AI8A 4ZCQA 1KI9A 3EFBA 1PI3A 3QOYA 4C20A 2GA9A 2VJLA 4NBUA 1OR8A 3V8QA 5LVAA 3BPSA 3M33A 1NIPA 5M04A 2C8KA 3E05A 2W37A 1IG0A 2RJOA 4MGHA 3VO2A 1E96A 4RHXA 5CA0F 2GAIA 2YYSA 4Q9KA 1KPIA 1QK5A 4FQ5A 4MV3A 2XUZA 3WIDA 4RULA 4EY5A 2SCUA 1M6VA 4WZ6A 2EP5A 4XIIA 2RH9B 2HCTA 3W9SA 1P1FA 5KOJB 5C51B 2OECA 4EJ2A 4FHEA 3E9QA 3ZHVA 2FX2A 1SD5A 4QRIA 3KPVA 1CJSA 1F6BA 3BWBA 3V1LA 1N2ZA 2PRZA 3D6JA 1BC5A 3I2HA 3WQBA 3OOJA 4QOJA 1E3WA 1OJ7A 3ZD7A 5D87A 1PRYA 3UT5A 1YBHA 2QHXA 2CCKA 4HN2A 1UPCA 1IY9A 3AI7A 5JAOA 2ZVJA 3EZYA 3IMEA 1QCCA 2XT9A 5EIXA 1EFUA 1C9YA 4IGAA 4DIFA 3EDMA 3UTCA 5DN6D 2AEFA 2DM6A 1C3VA 4WUVA 3UMMA 1WD5A 5CVJA 2IELA 3J80A 2C9ZA 1ZI8A 4D3DA 4LQ4A 5LQRA 4BGUA 5ELXA 4TS1A 3EQ8A 4LMRA 3SYMA 2D8MA 3UNXA 2WYOA 3DP9A 4PGMA 3VZBA 1A9OA 5AHWA 3ZS9A 5FUYA 5CLJA 1MTZA 2HA5A 1AT1A 1FTNA 2VJOA 4ND8B 5AM3A 1AU9A 1W4AA 5JQWA 2I99A 5DHAA 1PYOA 3DLHA 2CXPA 3AQIA 2RHHA 3TMAA 3NOVA 1E6KA 2AJTA 1MDBA 2HF7A 2FEOA 3PGVA 3W9YA 4DMCA 3AXTA 1MAAA 3TVTA 3TTXA 1F1BA 2Q3BA 1BWRA 1P74A 4PYMA 1N2XA 2Q9CA 3V4RA 2C7QA 4BQRA 3EVZA 5DIZA 5C1PA 1FYEA 5EHXA 2ZZNA 4EW6A 1C7ZA 1T1IA 3QOWA 4DV3B 1AGNA 4ZT3A 3KLOA 2QLBA 3N0XA 4YWHA 2VDUE 4E08A 5KNLA 2CUKA 4A8JC 2PY6A 4WACA 2VSQA 3BIFA 1TM1E 1YOBA 1JJVA 3OTOB 3EPKA 3L4BA 2FQYA 1HOXA 2P30A 1EX1A 3E9DA 5T3YA 1G6Q1 2PKRA 5F2KA 1DV1A 1W0KD 3KXLA 1TZBA 1TZKA 3AFOA 4WERA 1ZIXA 5DLEA 5FWYB 1DO8A 4C89A 4RPLA 2ODTX 3GEHA 3PXGA 3AETB 2Q99A 1FU7A 1ZU4A 1AF4A 5B53A 4N7JA 3A14A 3QVTA 4GVXA 1Q83A 2DHCA 3RPEA 1QVAA 5JAPA 1Y6FA 3SFZA 1WAMA 3H2GA 1YCFA 2OR3A 2VHQA 4YMIA 1IXSB 2HA2A 4W5HA 1DQYA 2AV6A 4B82A 4UNNA 1IOWA 3G8YA 4G8BA 4UM9D 3PLAE 3ONDA 2O2CA 4BEVA 2WD7B 1ZLXA 2JAHA 4Q4CA 5TPZD 2C54A 5CX4A 4HTFB 1G16A 4OV6B 5IXSA 5CK5A 2HMUA 3SQNA 4JBYA 2IBTA 3L0CA 2GFIA 4OJNA 3ZCRA 4LF6B 5KJ1A 3OM0A 1NSFA 2WYVA 1PFUA 1VL0A 3DD5A 3Q6IA 2QPTA 4BNXA 3DXXA 2C29D 1YA6A 4B7XA 6ADHA 4UREA 1SXIA 2HSWA 4YPOA 1KO7A 4EJ0A 2G9RA 1DWPA 1CQIB 1H6AA 1OZFA 5CLQA 1YL6A 2GD2A 4TLMB 4ZC8A 2PFGA 5CNJA 3VVMA 1ZD2P 2P2CA 3ZIAA 1S3IA 4F2HA 3VU0A 1IM5A 2VT3A 2XCOA 4Q6WA 2PWBA 1HC7A 4KDEA 5CAEA 3PHGA 4MQ6A 3W6NA 2HW8A 2R8BA 2H06A 1U5BA 3LLVA 4UUQA 3V55A 1WW3A 3ZBPA 5K05A 4AXXA 2VA8A 3ITDA 2FX3A 4CLHA 1NRIA 3AY0A 5CTAA 3T8YA 1GQOA 4DMFA 1CQPA 4ZI2A 2G7MC 1FS4A 4I2NA 3L49A 5LQJA 1KWKA 3UJPA 3U6BA 1TM7E 3FPHA 2FSUA 3KXKA 4YGXB 2EZUA 3RU2A 2QMZA 1NBAA 3FHCB 1P17A 4MQFA 2JLBA 2O23A 3HWSA 2HF8A 2NUAA 4OMUA 3GAFA 1OGJA 1RU3A 3JQ8A 7GPBA 3CMCO 1BWSA 2JNWA 3LG2A 2VTDA 4JC0A 4K9NA 3U16A 2RD2A 3DJFA 2Y71A 4CQLB 4L6AA 3FTNA 2HCJB 3VOTA 2ATVA 3WIVA 1P4JA 5J3JA 1TZMA 3NBFA 1SIBE 3ROZA 1VL8A 3AKEA 2XGOA 5F1YA 2AF4C 4DQLA 5KWVA 4EPWA 4MUBA 2I4OA 2PSEA 3HJTA 4PS0A 4YUWA 221PA 3ZN2A 3NS7A 5BW4A 5KKCA 3HL4A 2XCIA 3GAAA 5ICGA 3T0GA 1RACA 4EOGA 3ZNNA 1DKMA 1VBKA 2I34A 3DFZA 3I5AA 3OQHA 1XHLA 3O3NB 4NOKA 3O4FA 3X1YA 3RHZA 1K9VF 2C4VA 4HNRA 1UOPA 2PA0A 4XDHA 2YZ7A 3IAM1 3EXFB 2Y1WA 1Q3KA 3GCGA 2IRWA 4E09A 2YOFA 1YRWA 2O8NA 1QV7A 2V54A 2VP5A 1JXQA 3F90A 4OQFA 5BUSA 1M2HA 2FR1A 2WKRA 4XD2A 2DFDA 4X7PA 1Q1GA 4QHSA 4HUQA 3MC1A 1B8UA 4PANA 2P8JA 3JQ6A 4U2BA 4DXHA 1EDBA 2HF9A 2GNOA 1FXSA 1ZRNA 3K0KA 3TVYA 3VGPA 1Y6QA 4M0KA 3CGWA 1NVTA 4UNIA 1NUHA 5DYWA 5HJ2A 3ZLUA 3O94A 4EFNA 9LDTA 5L4LA 1P4AA 2WEKA 4BNMA 4YUAA 1ZSYA 3T1NA 4RELA 3X1WA 5JQGA 1K4YA 5KEIA 2WY2D 1WW2A 4QU9A 2PLAA 5TPWB 3J7TA 3SX0A 3AUXA 3CIOA 3FLAA 3OZXA 1KYYA 1ZK2A 2CDRA 3AKYA 3WWYA 1NMQA 5JS6A 1CS4C 2PH1A 4U7TB 3Q8WA 5KI6A 4GC9A 1M1YA 1C2YA 3HHPA 2XE7A 3SOZA 3ENQA 1VE9A 4HAWA 3HWX1 1NVXQ 4M83A 3AR2A 1XNJA 3UAOA 5J1SB 4L9SA 3S2UA 3T34A 3HCBA 4DM3A 3A6PC 5HKKA 1E98A 3TO5A 3KIPA 4MWSA 2IX3A 1PTJC 5HR5A 4IVNA 2CNBA 1CUFA 1YB5A 1NW9B 4Q1BA 4X1IA 3O4RA 3D8UA 2CDBA 1HNXB 1HE8B 4WINA 3IUSA 3KT6A 3HG7A 3QYJA 5L3QA 4U2GA 4CKWB 1DU4A 4B48A 4BJ5A 1IUNA 1DNPA 4XUGB 3T4EA 1B73A 2BUAA 3KQUA 1Z8FA 4IHAA 2D5AA 4PQGA 3VPHA 3CEMA 4PGFA 5JSHA 4U5QA 3HV2A 3ISJA 2JCVA 4Z0TA 2HU8A 4RDIA 3ZGYA 1VGRA 1QRTA 4RM3A 1JAYA 2P5SA 4RVSA 2QRQA 3TGWA 2GM9A 1TIKA 2XB8A 5K45A 3A6KA 1EG2A 1MVLA 2QSYA 4KE7A 2C61A 4CMJA 3R9XB 3SC3A 5E1MA 3PNYA 5KNCA 1DIHA 1VKOA 2OQIA 3LGSA 1C0LA 3QE9Y 2WWFA 3EB9A 3ZV4A 2OO7A 2CCJA 3FTQA 4RJLA 1XFDA 3DB1A 3MUOA 4H1HA 5DW3A 5FV7A 5K3BA 3RKRA 3CNBA 4J16C 3W4IA 1FNBA 1UOEA 3FUXA 3KZCA 4FGJA 4XYEA 2CNWD 3NIDB 3PYMA 5E9AA 5KDDA 1JILA 1Y33E 2ZRAA 5AMXA 5B6IA 1OFGA 3EF3A 3DAFA 3NV7A 1U7ZA 2CY0A 3A6EA 1IZZA 1EGAA 4D9IA 5CVTA 4XJVA 1EFAA 1BN7A 4F85A 3QGMA 4I66A 2DXIA 3PPIA 1UP7A 3NFRA 4QFDA 3RS5A 4JC4A 4MUFA 1TTTA 4RKFA 3OPXA 3O0DA 4AKTA 1VB3A 4XQCA 4L73A 2HPVA 3U2QA 3VSAA 4LKOA 3CW2A 3ENZA 2QW1A 4JVSB 3Q3VA 5DTJA 4J49A 5LDDC 2IPNA 3ISTA 1YHNA 3FYTA 2P2LA 1ZINA 3EY9A 3P9CA 4MMYB 5EZYB 4QGSA 1G5PA 4CCYA 5JAZA 1I4EB 3LDHA 1Y1LA 4YJ2F 1BS9A 1WDMA 2HX1A 2VTEA 2VJPA 3PQFA 2ARKA 3QBDA 3RBVA 2O0KA 1X7DA 4MZXA 3MUNA 3PR3A 4Q7MB 3JD4A 3TLCA 1M5TA 3NO4A 1MA3A 1U4OA 1T29A 1AKWA 4I4NA 1X74A 3ZU2A 5FOQA 3D54D 2R8ZA 4GP9A 5LKAA 1I3KA 1KEWA 2IDMA 3C98A 3K9HA 1QH1A 3NJ4A 4LJ7A 4MS4A 3CSUA 3IBGA 1IVYA 4H9GA 1K7CA 1O4VA 1U1CA 1I4DD 3EGVA 3IOMA 4GKBA 3ZI0A 1DEOA 3NH9A 2JI9A 1YACA 4FT4A 3RT1A 1KVRA 4NF2A 4U7GA 2OD7A 3THXB 2DJ5A 5LN1A 5CDTA 3RIXA 2C2MA 1ND6A 1R6DA 4WMLA 5JWOA 3DMDA 3UMYA 5BN5A 3C3AA 4DMLA 1DFGA 1OVMA 1PEAA 3IHTA 1ZGAA 3B1VA 3Q5GA 2PLRA 1E5LA 5CB4B 3DT9A 2BFCA 1PT8A 2H9AA 1M5UA 2DPYA 1RQXA 2VTVA 2E7ZA 3D4LA 1F17A 1UJ2A 4OY3A 3TLGB 4PINA 5TPZA 5FL7D 3ODPA 2ADFA 1Z4QA 1T3HA 4JX9A 1BDBA 4J76A 2JJQA 4KLRA 3OIDA 1M6HA 4AJKA 1FUYB 4BLUA 3TZKA 3L6EA 4KH1A 4FLMA 2QTMA 1CR6A 1XD9A 1Z5OA 2PV0A 3LBIA 4O2BF 4YCBA 1ULSA 5CEJA 1M1XB 2J5RA 2J30A 1JQBA 1X7WA 1XDGA 3OBIA 4JXKA 2FPGB 4AMGA 2HSEA 2I8LA 2W98A 2XNDD 3FGOA 3HU3A 4IIEA 1Z34A 2FWNA 4F6RB 1AHIA 3GDFA 4M99A 4OM8A 2ZSEA 4A9AA 4JJIA 2Q3CA 5FPSA 5DXAA 4R84A 3FUUA 1Y6GA 4DLLA 5EVJA 1YQ9A 5ARDA 2HSJA 1MAWA 3ZBQA 3BB1A 5AIAA 3HZHA 1Q7RA 1DPFA 4JJKA 4CKEB 4M22A 1U80A 2BH2A 5FYQA 1W0JA 4XYBA 3UQZA 5IM5A 1ZGJA 3K53A 4Y2HA 1UMKA 2ROQA 5AP9A 1V6AA 1ZI6A 2EBWA 1YKSA 1C30A 1Q7TA 3GGSA 4NJEA 1L7EA 2YV2A 1VQ1A 1GPH1 1E5VA 2QAIA 2XRYA 4IOJA 4BIIA 1CY8A 1JKJB 1F6WA 1G8PA 4QPPA 5CM2Z 3ETHA 2JGRA 1B43A 2RBEA 3L7BA 4FW9A 4QO7A 5IVIA 4DBLC 4OI1A 1U0RA 4K6OA 4GEGA 1JPJA 3IVRA 5TQ0A 4C4AA 1JPVA 2RGDA 4AO6A 3HCOA 4N5HX 1GG8A 5AHKA 3E4DA 1FFSA 1R0SA 2YOHA 4X93A 3Q7TA 4TL8A 1IY0A 1KJIA 5HS6A 1WCYA 2RBGA 2P8SA 2N3ZA 1RRKA 3K9WA 3N39C 4FJ2A 4BV2A 4KFRA 1DO0A 3N0WA 3ZS8A 1AVTA 4QOGA 5LYJB 4MINA 5ITWA 2NWQA 2WSSA 1G41A 5LNK1 3FYSA 3NEYA 1IJFA 3PQ8A 1FC0A 4H6PA 4PXYA 1ZN2A 4ZOLF 3VISA 4UUBA 3ZY6A 4JNCA 4HTFA 2X5JO 1DIOB 3QNUA 4PC7A 3DLBA 2QIPA 1ZL2A 2Z3ZA 4IDBA 3D4BA 3R5TA 4N0QA 4UOZA 5EE0A 5FHQA 4J1TA 2GVZC 4L8WB 2XGJA 3OFKA 1JLRA 3RSOA 4XVUA 2JVIA 4NYJR 1H0SA 3I6MA 4IDAA 4BNNA 5LMZA 4HEJA 1KOFA 2WHPA 5ALZA 3T9BA 2MWMA 1TEHA 3FPJA 4IFEA 1BD3A 3O38A 4OQMA 4DZTA 1N2HA 1VJRA 2HA6A 4Y9DA 3VSCA 2WDPA 2FW7A 3FTCA 5AICA 1QAOA 2GZAA 4GQBA 3OC6A 4E31A 2JZCA 1T0BA 4M0LA 1Q1NA 3ORRA 2I62A 2IYTA 3UA3A 6Q21A 5K8UA 1NF2A 1F3LA 2IYZA 4BKQA 1QF6A 4JDUA 4QXOA 3FAKA 4IEEA 4G36A 3WR5A 1X8LA 2VIIA 1RI2A 1UEIA 3DPIA 1YB7A 3O8BA 2Y1XA 3B89A 3FCEA 3IX7A 5CW1A 5GVSA 1ISFA 4GICA 1ZIYA 2G25A 1AHPA 2YJ5A 3PPWA 4FSXA 4P5DA 3K70B 4ZICA 2BKUA 2W71A 2Z2XA 3GDOA 1Y4ZA 1XCPA 1GYPA 2OAP1 2HBZA 2EZ9A 5LLSA 3VJLA 1TM4E 4JLSA 2I8CA 2JI4A 4Q1DA 4DBVO 4MV8A 4JP1A 3DAOA 5C46F 1UMDA 1ESDA 2AEMA 3ZX4A 2CXRA 2J0UA 2Z30A 5HP4A 3RC9A 5HVNA 2E21A 4QKQA 2BCGY 3WB2A 3HBAA 3ZC3A 1IXKA 4MKIA 1VA4A 3ILXA 1ZJZA 3IQZA 2QIOA 4D3ZA 3SE7A 3PKJA 4IJUA 1DKLA 2SICE 5AQ1A 3U26A 5FPPA 5T4HA 3ILHA 2IHKA 4C4RA 1XDUA 2Q0XA 2YVAA 4V1CB 2I3AA 1EVQA 2CXTA 2AA3A 2QM0A 2IP1A 1Z7GA 2OOSA 2X4LA 4KQ1A 1OYVA 2CHUA 5EHGA 2X9LA 2YYYA 4EGAA 1ZK0A 1F0PA 1SVOA 3ASYA 1CJKC 2QW0X 3CLTD 3MBOA 4MWZA 4GPD1 1W4ZA 4TWRA 4PIMA 3A9VA 4QL3A 1EJ6A 2M6LA 1GZUA 3V2HA 2G9ZA 1HDIA 1V5WA 2Y77A 1Z73A 2BMWA 1XJ5A 3SBEA 1BDJA 3UAGA 4ZEMA 1Y3BE 1G42A 3RUEA 5FNZA 3STHA 1TF5A 16PKA 1RJGA 2C0PA 2CXXA 1XAHA 4I1VA 3CO5A 1M2NA 4WLUA 2JHFA 4GSKA 5CNKA 4BFWA 2WUEA 4RS4A 2AOVA 2A9OA 4HDSB 3FCCA 1P18A 1W0KA 1RABA 1J8DA 2VHXA 5FFFA 4BN0A 4ZYVA 2HEGA 4JOCA 4QNRA 2XVYA 1VMDA 1ODSA 1Y3IA 3KFVA 4MRRA 4Y9SA 2O14A 2VI5A 4ZMBA 4YR9A 1JNXX 1Y3CE 5BQ3A 2NQ2C 1DJQA 4PPQA 4WUTA 5JQGB 4NWIA 3VR4D 3JYPA 1CFZA 1NPTO 3FWYA 5J43A 4X7BA 1QKIA 2ODWA 1B1CA 3PFHA 4HMQA 4J91A