2VQ3A

Crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
PKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLOREDUCTASE STEAP3
publication title Structure of the Membrane Proximal Oxidoreductase Domain of Human Steap3, the Dominant Ferrireductase of the Erythroid Transferrin Cycle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.16.1.-:
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vq3A00
3IKVA 5F3RA 3GC6A 2JCXA 2NVWA 2DC1A 1YB5A 5H82A 1UR5A 2Y1EA 1YS4A 4WCFC 4CLRA 2W2KA 3LC7O 2FY8A 4FC7A 4CM7A 1B0AA 4DIFA 3FBGA 4L8VA 5G2OA 2Q1SA 4AJ1A 4D44A 1HDCA 4A5OA 4DLAA 3D64A 1JWBB 1QP8A 2BELA 3C1TA 1NFQA 1QR6A 4CL8A 2EV9A 1MV8A 2BF7A 1NVGA 2W8ZA 4YACA 3VC7A 5JY1A 1Q7GA 1GYRA 4OL9A 4CQLB 4WEQA 2G76A 5EESA 4BGUA 3TFOA 3GMDA 3GVPA 3QW2A 4GL4A 2P9GA 1I2BA 2HAEA 1C0IA 5GMOA 4EGFA 1YWGO 4KP7A 4IDEA 4AFNA 2BI8A 3AM5A 2VUTA 1EDZA 1ENZA 1G6KA 4GPD1 3BYZA 2CF6A 3NDIA 4IDCA 2E6UX 4MIOA 4IZHA 4BB5A 2VZ9A 2WSBA 4JBHA 3RUIA 3I5MA 3EZYA 3ZWWA 5CEFA 5JXWA 3R6DA 3ZWOA 2Y0CA 3HE3A 4BKOA 1HRDA 2EGGA 3ANLA 1GDHA 1DJQA 3RAJA 3VOSA 4YTEA 3IS3A 1PGNA 1R4MA 2Y99A 3P2YA 5L7WA 1Y9AA 3UAGA 1T2FA 3U4IA 4PZEA 4CUJA 5A9RA 3ANMA 4CMHA 3EY4A 1U4SA 4WLFA 3S2GA 5U1PA 2NQTA 5I8WA 4QEDA 1PR9A 2NVUA 4JJGA 4Z3DA 1A4IA 3WGGA 5IAAA 3FPLA 2FPPA 4IGEA 3GAZA 4GI2A 4P4NA 1P0CA 3COSA 1A71A 2Z5LA 1EUDA 4CQMB 4R9SA 1JAYA 1EZ4A 5U9CA 1C1DA 1G0OA 3M2PA 5CDTA 1XGKA 5JS6A 1VE9A 4AL4A 3SEFA 1LTHR 1TT7A 5COQA 1VI2A 2HMWA 4R1UA 4OXYA 2VT3A 5KJEA 2OMEA 1PJSA 5FFFA 3UF0A 4DIBA 2Y1CA 1GD1O 4GSLA 3RUFA 1RKXA 1WZEA 2HLPA 3G49A 4KTVE 1CQJA 3DEYX 4R41A 1PQWA 3RBZA 3WGOA 2GASA 4GSKA 5KNLA 1U7HA 3DBRB 5TIIA 2I65A 5T8KC 4DC0A 5K9ZA 1NQOA 1HDXA 4CMIB 1YL6A 1BXGA 1YOVB 5COAA 4IMPA 3F6YA 3ZCXA 4K26A 5ILGA 1I10A 1FDVA 1YO6A 2JCYA 4H3VA 2GF2A 4ZU3A 4CLHA 3UXYA 5JO0A 1QRRA 2YFQA 3GPIA 5A03A 3P2OA 1UP7A 4TROA 3VPSA 3RSHA 3W8EA 4AJOA 3JYLA 1NASA 3ZWXA 3WSVA 3BZUA 1EMDA 1P1JA 3DONA 1SOVA 2Q3EA 3U4DA 1K6JA 2X6TA 1PGJA 2DT5A 3H3FA 5A1TA 4GKBA 1V3UA 4CUKA 4JX8A 1LLDA 5I8ZA 1P1KA 2AEMA 3ZDFA 3TRIA 4PLGA 5F21A 3JQAB 2HUNA 1K0UA 3H4VA 4YJFA 4ALKA 2FWMX 4C4OA 1ZMOA 4BKPA 3I3OA 3SVTA 1KBZA 2B5VA 3D7LA 3PWZA 4U0JA 3O03A 3T4EA 1EE9A 9LDTA 1AE1A 4R5HA 2JKVA 2HDHA 2O48X 2PR2A 3FCOA 3PDJA 3PK0A 4WLOA 4YJDA 1L1FA 1V0JA 5B37A 3DAGA 3DHYA 1P1HA 2CVOA 2YY7A 1DOHA 3PWKA 1NPDA 4EJ6A 4NHEA 4FPXA 1J49A 1ZZEA 2GLXA 4XB2A 4CMGA 1EBUA 2OGUA 3ZNPA 4L0QA 2X0NA 3DBHA 4ALIA 3FF4A 4FB5A 4S3MA 3PFWO 3JV7A 1ARZA 1IHYA 2UVDA 4E3ZA 4YDRA 1HXHA 1H93A 2Y1DA 1Y1PA 5DP1A 2FSVA 2HRBA 3L9XA 5G4LA 2EKQA 3GN1A 3KLMX 4IZIA 2EXXA 1LDEA 5TNXA 3LZ6A 2CDCA 5JDCC 2EP5A 5L95A 1JLLA 1P9LA 4I9HA 3JYNA 3DWFA 3EYWA 1E0DA 4JIGA 5JAQA 5IDWA 3R1IA 1H2HA 4O6VA 4BNXA 4L4SA 2YDYA 3DZIA 1FDUA 2NU7A 5G0WA 1KS9A 2QIOA 3DB2A 3DDNA 4E33A 4RLSA 4WUVA 4K1LA 2CMDA 1ZKMA 4DBZA 4XJTA 1A27A 2WYWA 1PZEA 1ZFNA 1EDOA 1KVSA 2QZZA 4WNCA 2C07A 2QZ9A 3KM0A 4BNZA 1ISGA 1UP4A 2FR1A 1MXHA 4GGOA 2ZJ1A 4LW8A 2W2LA 5HS6A 4PG5A 3ZW9A 4CMCA 5I7SA 5A9TA 2AG8A 4CQLA 3BA1A 3KYDA 4HNGA 4ALMA 4KOAA 4G5HA 5EN4A 3FTNA 4QO8A 1MG5A 5G4KA 2E4AA 4HV4A 5DP2A 1E5QA 4P8RA 8ADHA 5IZCC 5HWSA 3W1VA 2PY6A 4AICA 1E77A 3ITKA 3WGZA 1MG0A 1TB4A 3JQ9A 3C85A 3E9NA 3L07A 4EUFA 1UAGA 3FNFA 3PPIA 5JE8A 1IHXA 4FSHA 1YE3A 1WPQA 3K73O 4FJ0A 3DO5A 3SXPA 4NG5A 3ROMA 3ZN2A 3U09A 7ADHA 2P5UA 5A3JA 1EQUA 4NDNE 3VH1A 4FJ2A 3WBFA 4PRLA 1E7SA 3WLFA 3OICA 1OOEA 4YBZA 1W6UA 1JN0A 2GYYA 3VVCA 2Q4EA 2PZKA 1KY5A 2DBVO 4E5KA 5JAMA 1QYWA 2Z1MA 4R9RA 3I9KA 1J4AA 3SX2A 3GRKA 1Y7TA 2A35A 3KB6A 3I9MA 2HU2A 1QG6A 1QYCA 2W2LD 5COBA 4AJLA 3WS7A 1PL6A 1ZEMA 1ZMTA 4FFLA 4O5OA 2BLLA 4L73A 5HA5A 3JCZA 5FF9A 3RKRA 5L9AA 3EAGA 3MJCA 5KTKA 5A5EA 4NJMA 4MKRA 3RFTA 1U5CA 1MP0A 2Y0EA 2QYSA 3GA0A 2RHRA 2HJRA 4OHUA 1P3DA 2AA3A 1I3KA 4TQGA 2O2YA 3LT1A 4R16A 3P7MA 2EW8A 3VPGA 4MIYA 3H8VA 2Y67A 3GR6A 2OO5A 3U0BA 2IYOA 4RO0A 2Y93A 2Z1NA 3ULKA 3LVFO 3AUUA 4DIOA 1B8PA 2YQ5A 4Z3KA 3B1KA 1XR3A 5JNLA 3QWAA 3LF2A 4Y6RA 1E92A 4J1NA 4CUZA 2J3HA 3NGXA 4QQRA 3SJ7A 1EEHA 2ZYAA 3MOGA 4CMIA 4FJ1A 1C14A 1F0YA 1U8FO 1FMCA 3AK4A 3DTTA 3I9LA 4OKIA 1CERA 1EFKA 1ZK3A 2UUOA 3NX4A 3U5TA 5DNAA 4OO3A 1PJTA 1ZVMA 3TWOA 1HLPA 5A9SB 2VUSA 1DBVO 4ZRMA 2GN6A 3O8QA 4LRTB 4KWIA 1X7DA 1ZK2A 3GZ4A 4WCFA 1E7QA 1Y81A 2NM0A 5TQVA 3TZHA 3KBOA 4F6LA 4U0KA 4ZN6A 5B12A 4DPKA 4EUHA 3DZGA 3JQBC 2OBNA 3JQ7A 1GV0A 5F1PA 4BO1A 1O9BA 1CF2O 4URFA 4G65A 3PDUA 3TPCA 2D0IA 4IPTA 1NFRA 4CL3A 1PS0A 2B35A 4EI2A 4P38A 2EKPA 2BFOA 1LQTA 1E1LA 3AM3A 5GY7A 4K28A 1PL7A 2BMAA 1FDWA 3JQAA 5AVOA 1KVTA 3D3WB 5L4NA 2IZZA 4UUNA 3W4KA 2QX7A 2DKNA 1E3SA 2GZ1A 4OGWA 2V6MA 2O50A 1DEHA 3N74A 1G0NA 3HDJA 3RJ9A 2O3RA 2VHVA 5GZ3A 2ZK7A 4PZDA 1ML3A 1K3TA 1W73A 1XLTA 4P4LA 4AJPA 2YV1A 3FR8A 4CMBA 3FI9A 5DBFA 2OFPA 2ZATA 4RPHA 2D8AA 4J43A 4PLWA 5TX7A 4BNLA 3LLVA 1T25A 2BFMA 2OUIA 3H9UA 4KDEA 3TL3A 4B7CA 1T2CA 4QFDA 1EFLA 5AOVA 1W0CA 5ER6A 3HDHA 5KJCA 2OXIA 3JQEA 4LCEA 4M49A 4BNVA 4LSMA 4B3HA 3ZWPA 3GN2A 2XOXA 1UAYA 3G1TA 4I5DA 3JQGB 4HX5A 1HYHA 2VUUA 4RDIA 3TQHA 1JKIA 4J7UA 4Q3BA 1B15A 4RVUA 5IDYA 1AHHA 4NI5A 5U4QA 1LSUA 4KDFA 3KV3O 2Q1TA 4EYEA 3OF2A 5DZSA 5LDHA 3JQAD 3RUDA 2CFCA 4YCAA 5KJFA 3I9JA 3ZWYA 5ITWA 4EJ0A 4BNTA 1DLJA 4XR4A 1Q2XA 3DZFA 2RAFA 3T7EA 1ZEJA 5I9LA 1Q7BA 1W4ZA 2V6FA 3EMKA 1BSVA 1IE3A 4PGFA 1MFPA 5ES3A 3K92A 5T5QA 1LSJA 2FR0A 3INTA 5DN9A 3ZH2A 1WMBA 3IKTA 3FHLA 4H15A 3DC2A 3DHNA 1K6XA 2PH3A 4BO5A 2GZ2A 3Q11A 4BKRA 3M1AA 5JCXA 3GUYA 5T8KA 8LDHA 5BNIA 3MTJA 4ZQGA 2ZTMA 4BGEA 1M6WA 4I5FA 4R68A 4UUMA 3S2FA 2ZTUA 1PJ3A 3UICA 7MDHA 4A03A 1CEQA 4F3YA 4FQ8A 4WASA 1NWCA 3CH6A 3STHA 2WYVA 1U4OA 4JCOA 1GZ6A 4PVCA 4BMNA 1HYEA 1U3TA 3D1LA 4DREA 1JA9A 4PLTA 1YB4A 3V1UA 4AJJA 1EVIA 1GEGA 3ETEA 4OXNA 3V5NA 2W4QA 1WVGA 2OP0A 3L6EA 4YAKA 3UN1A 3S55A 1CETA 1N8KA 2HO5A 4CV1A 1QYXA 2H5LA 4JQCA 3EUWA 1E3EA 1EVZA 3GHYA 4PLVA 1LX6A 3ZU5A 3JYOA 4FOOA 3WGQA 1QSGA 3WICA 5CG1A 1GUYA 3FR7A 3DFZA 4B8WA 4HADA 4EW6A 2JL1A 2A4KA 3UCFA 3ZU3A 3O26A 4TMFA 1PGOA 1OAAA 1VM6A 2RHCA 2ZQZA 3AY7A 3ZNNA 3T7CA 2YZ7A 5L53A 5G0SA 1RM3A 1C0PA 1DPGA 2VYVA 3ETDA 3NV9A 1Y5RA 1HTBA 2OHXA 1GU7A 2UAGA 5KJ1A 2I99A 3HB4X 1J5PA 1DIRA 4JROA 4IIVA 3S2EA 1P74A 5T64A 2VNSA 3BTSA 4ND3A 5L45A 4RPJA 2NACA 2O7SA 4XIJA 4AJ2A 1YBAA 3RUHA 4X54A 1IYZA 3PIDA 5AXDA 3CSDA 4GLOA 5IN4A 2TMDA 3EVNA 3CINA 1Z6ZA 5A06A 2GO1A 1NTOA 1HZJA 1DDOA 1N9GA 1BWSA 2VHWA 4ND1A 2CSUA 5A9SA 4BO3A 1U3VA 3GDOA 2DUUA 1U28A 3G0OA 1UXHA 3CZMA 1PJQA 4LISA 2X0RA 3OIFA 4YT8A 2H9IA 4E2WA 2VRCD 1D1TA 1UXJA 3P19A 1R37A 1NWHA 1QXSA 1U2GA 3PYMA 5JAIA 4BNFA 1Y9EA 1ZO8A 3FWZA 3AOGA 2VYVD 1DRWA 1QLHA 1SEPA 2D1YA 3WYEA 4DBVO 3E8XA 1DB3A 3PGXA 1OMOA 1R0KA 1ULSA 3VKVA 4B3IA 5TJHA 2CVZA 3VPFA 1LC3A 4M1QA 1S7CA 1PX0A 2W98A 4XX0A 2O7QA 3GDFA 4RGBA 4U7WA 4QUKA 4FFPA 4CMEC 3MZ0A 1KOLA 5HTOA 1H0KA 1JKFA 2X4GA 3IUPA 3PQDA 3WYCA 1RWBA 5IZCA 5JW6A 2NNLD 5DCYA 1R6DA 4YB8A 4J9VA 1M75A 5KOIA 3JTMA 2BFAA 4UVHA 1GADO 1SAYA 2VN8A 2I3AA 4NH4A 3H9QA 4J7CA 4MKZA 1DRVA 2PD6A 1Y8QB 5KKCA 3PZRA 3AUSA 1GQYA 3BTOA 2H63A 3MJTA 4IQGA 4OM8A 4DQUA 2O3TA 1P77A 2GDZA 4KZPA 5GZ1A 4JNKA 5JFOA 1PGPA 1NFFA 1M66A 2Y1GA 4IQ0A 3LT2A 5DOZA 2GN9A 4NBTA 1XU9A 3VZSA 3JQ8A 2JFGA 1YVEI 2WD8A 2AQ8A 1VRWA 3JD3A 1ZSYA 3GLQA 1I3NA 1HE4A 4M54A 3QVTA 4CODB 4H7PA 3IJPA 4PFJA 2DFDA 2D4AA 2HK8A 3NDJA 5THKA 1NQAO 3JD4A 3PJGA 3OBBA 2VOEA 2E49A 3GK3A 2R2GA 3ST7A 1BGVA 1U3UA 3K9QO 4OSOA 4BNIA 1YL7A 2NSDA 3KVOA 3WXBA 4CR8A 4D79A 4BO6A 4YT2A 1ZJYA 4RF3A 5KKAA 3DZJA 4LCJA 4A0SA 4TRRA 2X5KO 1UZNA 3CIFA 3IMFA 2X0IA 1BHSA 2FZWA 4HXYA 3GUCA 4RQUA 4L4RA 4CM8A 3AW9A 3FNEA 4FFOA 2O3JA 4YAIA 1EUCA 5JBIA 1HDYA 2O3UA 4J4BA 4G2NA 3D4NA 4WJZA 4CM3A 2NU8A 3HWRA 2PFGA 1R0LA 2P68A 4NBUA 5TRTA 1F14A 5CDGA 2DTDA 4D7AA 1B8VA 1LNQA 3A14A 2ZJ0A 4IDBA 4YQYA 3OJ0A 3NUGA 4MOWA 1GTMA 3ORFA 4PVDA 4R54A 4F45A 2QRJA 5F5LA 3F46A 4IJUA 3LU1A 2P9EA 2WJPA 1CRWG 1DFIA 2VZ0A 3D5QA 3WNQA 4WOJA 3H9JA 5A5FA 5L51A 3GOHA 2O2SA 3QQPA 2OP1A 3IAHA 1NPTO 4Q3AA 1ISHA 3JQBA 2NTVA 1LUAA 4RVSA 2PGJA 4MP3A 4XQGA 1MC4A 1ULUA 1UDCA 2SCUA 5IFLA 2ZQYA 1QKIA 1F8FA 2ZB4A 4MO2A 2HMTA 2ZTLA 4Y67A 4N5LA 4LVUA 3UW3A 1A4UA 3AUAA 5J23A 2H1SA 2J5RA 3ANNA 1GQQA 3K31A 4GH5A 1ISFA 2X5JO 4DMLA 3BMOB 4Q3EA 3IOYA 2IXAA 3A1NA 3EK2A 5T67A 1JTVA 4M8SA 4MP6A 4YA6A 3A9WA 1E1KA 2IEDA 3CMCO 4QT0A 4XCVA 4AJ4A 1ZXLA 1PZHA 5F1OA 2PZLA 2R00C 1QV7A 2DBQA 2YHUA 1AXEA 3ROQA 4Z9YA 2PKRA 2R6JA 1LQUA 3TJRA 1WMAA 4CLDA 4D42A 4E6PA 2C2XA 3OIGA 1MX3A 2JD0A 2B4TO 3AWDA 1NBOA 1Z45A 1PS9A 5ICMA 3ASUA 3DTYA 3PQFA 1IPFA 4WPGA 2ET6A 1BXKA 3H5AA 4OYRA 1UZMA 3HSKA 1KIFA 2D2IA 2HRZA 4BO7A 2NLOA 2J8ZA 2B4RO 4P4GA 4BNUA 4CV3A 1F06A 2GERA 1DSSG 3GGGA 3I1JA 4XYMA 1ISJA 3RKUA 4CPDA 3ZNOA 3ZV6A 1GY8A 2DQ4A 3B1FA 3TFQA 4WECA 1FDSA 1U7TA 1E5LA 1HETA 1ZK0A 2H6EA 1KC1A 1N5DA 3ONDA 4WLEA 2QHXA 1V35A 2WMDA 1D8AA 1NYTA 3GVCA 3V2UA 3W6UA 2YYYA 3DBVO 3Q1LA 2XPCA 4KMSA 4J0FA 3PHLA 5C7LO 4K6FA 3K96A 1PR3A 1F12A 3M1LA 4UREA 1XEAA 5KIAA 3DBLA 3FSRA 2E48A 2X9GA 2AE2A 3IDSA 1NR1A 4Z9XA 3SC4A 4RVFA 4RV9A 1H6CA 5CDSA 5JCJD 2C29D 4ONEA 3HFSA 1Z7BA 3PHGA 3ZV4A 1VJ1A 2B0JA 4NK5A 3NYWA 5IDQA 2CVQA 4FGWA 2ZCVA 3O38A 1GPDG 1QMGA 4B4OA 4F46A 1E3IA 1PGQA 3PYXA 4NIMA 3INGA 2JAPA 3KYBA 4KUEA 5DULA 1NPYA 3FNGA 2OZPA 4IDFA 5B4UA 4Y8VA 2X58A 4R01A 4L75A 2EHDA 3E9QA 1VC2A 1DIGA 3BMNB 4YRAA 1PQUA 4DXHA 1XIVA 1ZK4A 2FPIA 4NQZA 2AE1A 3OJLA 4D45A 4BVAA 1T2DA 2PD3A 2QG4A 3WOHA 4C7KA 4YPOA 1LLQA 4GMFA 3T4XA 1MLDA 3BMCA 1D4FA 4EDFA 4BHTA 3TF5A 2UUPA 3R3JA 3ONFA 3BAZA 4XGNA 5EQFA 2Q2QA 3BIOA 4XQ9A 1ZSNA 2FMUA 3I83A 3PXXA 2HJSA 3ETGA 1DC6A 2PD4A 2QRKA 3ZWAA 4MVJI 3VH3A 2VTEA 2IDZA 2JD2A 2Y1OA 5LC1A 4KWHA 5F5NA 3KSUA 1SBYA 1Y6JA 3KHUA 2DU8A 4FBGA 1YBVA 1N1GA 1D7OA 2BI7A 2NQ8A 4BO4A 5HM8A 1OC4A 1G1AA 1Y8RB 2D3TA 3I4CA 3RUEA 3GRPA 2C5EA 3HG7A 5EMHA 3GVIA 3QSGA 2P5YA 4JBGA 1M76A 5BQFA 3GDGA 2VWGA 3AI2A 1B3BA 1B3RA 4LRSB 4A27A 1X7HA 4ZHSA 1GEEA 5AXBA 2LDBA 1YQXA 2PK3A 3HB5X 4J2HA 1ONPA 1YRLA 2RH8A 3V1YA 2AQIA 3G1UA 3QRWA 4E0BA 2V65A 1I33A 1E3LA 4MVJM 3WWZA 3DQPA 4Q3DA 1YB1A 4YWJA 5CP8A 1RJWA 4R1TA 5L3ZA 2LDXA 3LSYA 1KC3A 4RDHA 5JO9A 1VL0A 4TVBA 1X13A 3LK7A 2GD1O 4UEJA 2B4QA 2C0CA 3ASVA 4NR0A 3WSWA 3NDRA 2VTDA 1HWYA 1BW9B 2FOIA 4KUHA 2F1KA 3GQVA 3H2SA 3MWEB 3W8FA 1LU9A 1JU9A 5FYDA 3TZCA 3RBXA 4BQRA 5DT9A 1QYVA 4TVOA 3JQDA 4GX1A 1FK8A 2VWPA 1N1EA 3H7AA 1WDKA 4YYZA 5A02A 3OEWA 4MVJE 4I08A 3SC6A 5JC1A 1ZJZA 2GR9A 2Y68A 3PEFA 1YGYA 4MVJD 5A3VA 3W4IA 3WJ7A 4CMEA 1IPEA 4E12A 1V3TA 4CQMA 2V6GA 2PKQP 2NU9A 4LVCA 4R4JA 4BO8A 3I6IA 1VSVA 5JYDA 4QECA 1ADBA 3KOUA 4OXKA 1E6EA 2I6TA 4XWYA 4BO2A 4DGSA 3PJEA 1UXKA 2VQ3A 3HHPA 5A05A 3QVOA 1LDBA 3C1AA 1GCUA 1A7AA 3TSCA 1IY8A 1NR7A 1ENYA 1XG5A 4XRRA 5EERA 1YJ8A 3GG9A 3UCXA 4DPMA 3KYCB 3LLSA 1XA0A 4CM4B 4MKXA 4XYLA 4E4YA 3WBBA 4YJHB 1T2EA 5FEUA 3DBRA 4CLOB 1QORA 1ZUD1 1P0FA 3EGOA 4E5NA 3OSUA 2X7HA 4PLYA 1YOVA 3E03A 1Q7CA 2I66A 4J91A 4B7XA 4MVJH 3GEMA 3NTOA 3PFFA 2AEFA 2JAHA 4L4XA 5I7FA 5BR7A 4CM6A 1NVTA 1WNTA 3B70A 4NFHA 2YV3A 4ITUA 4RVHA 4B3JA 3BTUA 1PS8A 1JAXA 4ZQHA 4XYGA 4B8ZA 4AJNA 4OKNA 1XQ6A 1Q1NA 3JD1A 1XWFA 5IZ4A 1Z75A 1HEUA 4CQMD 2AMFA 3ADOA 4NPCA 1T1RA 1XYGA 1ADFA 1WDMA 1P1RA 3L9WA 3ZWBA 2Q46A 5THQA 4E30A 1YQDA 1R15A 3LQFA 3R3SA 3NT2A 1M6HA 1QYDA 4L9RA 4M86A 1SZJG 4B79A 1ZW1A 3UCEA 3OA0A 2AQHA 4FIZA 1BMDA 4NJOA 2G1UA 4TRNA 4BMVA 3IUSA 4HFNA 3RD5A 4ZRNA 3VZRA 3ZHBA 1LLUA 2X8LA 4JXKA 4NK4A 4XYEA 4BNJA 5AXCA 2HMVA 2C20A 1KERA 3U49A 5KCZA 1DAPA 1K2WA 2GN8A 4GKVA 2NUAA 3BMQB 4ZD6A 4W7HA 1KVRA 5T6BA 3GGOA 2GGSA 3JD2A 4PLHA 2DBRA 3DMTC 3IQDB 4Z0PA 3UOGA 2W90A 2ZYDA 4BQPA 4J9UE 4HFRA 2EGHA 4I9UA 1ZBQA 4TZKA 1JW9B 1T2AA 2A92A 3GEDA 3N7UA 3PWSA 2X5OA 3ENKA 5TJ9A 1OFGA 2JCVA 3OQ1A 2EP7A 3DFUA 3GEGA 6ADHA 1E1MA 3K30A 2DTEA 3L77A 5KVCA 3RC2A 1DHRA 3HUDA 1ZK1A 2AHRA 5C7OO 3VZQA 1H9AA 3VVBA 4B4WA 4IDDA 1ADGA 1HE2A 4ILKA 3E48A 4CLXA 3QIVA 1N92A 2CY0A 2IZ1A 1YBMA 5FI5A 4W99A 4CM1A 1SC6A 4NMHA 5G0TA 5L40A 2HK9A 4M87A 1ENOA 2JHGA 4W6ZA 1SMKA 4WLNA 2VZ8A 1Y8RA 1KVUA 2HSDA 1S6YA 2R00A 3WR5A 2HMUA 4IS2A 3WDSA 3FBTA 4EZBA 3QP9A 2JFFA 4ZQBA 4QX6A 5JDIC 1B14A 1N7GA 2Q45A 1UXGA 4BOYA 4OSPA 4XQCA 1MFZA 3WMXA 3MJEA 5TT0A 3UUWA 1V3VA 2WM3A 4LN1A 4Z9FA 4TKMA 3Q6IA 1O6ZA 4LMPA 3HQ4O 3UHAA 4AJKA 2FR8A 3F5QA 3JYPA 3K8ZA 3W6ZA 4CM9A 2PKQO 4J0EA 4PG8A 1LRJA 4CLEA 4JLWA 3KEQA 2UV8A 4QFCA 5KVVA 2BGLA 3V2HA 1R16A 3Q2KA 1LA2A 4L74A 2XF8A 1GZ4A 3INRA 5B1YA 2Q4BA 4BNYA 4PZCA 3GPDG 3PJFA 4UVEA 4OQZA 2GUGA 1SB8A 4W7IA 3A4VA 2YUTA 3C24A 2YHIB 2X86A 3DXFA 4U8GA 1BW9A 3PGJA 4BNGA 3HDYA 1MC5A 1U1IA 3WIEA 1KY4A 1RM4A 1ZCJA 3AI1A 5TGDA 1IZ9A 2I67A 3U9LA 5I9MA 4PCVA 4FFNA 4MIEA 3UKOA 1NX6A 4D41A 1DLIA 1OC2A 1WLYA 2X22A 4J4HA 4LSWA 3NJ8A 4RZHA 5FI3A 4C7JA 2VRCA 4BMSA 1PJCA 1VL6A 4FC6A 4ID9A 5DCUA 1P45A 4CM9D 2C59A 4O59O 4A2CA 4E32A 1Z7EA 2DUWA 3H2ZA 3Q0EA 2CNBA 1JWAB 4R51A 4EITA 4TZTA 2J3KA 1FF9A 4PLZA 5H83A 4FGSA 4CM5A 1PJLA 4K9DA 4YAEA 4YT5A 4RCVA 2IYPA 3KETA 2OORA 5IN5A 2NVUB 2RBEA 3TNLA 5DDIP 1I2ZA 4CM4A 4Q3CA 5I9NA 4YXFA 4JP2A 1E6WA 3IP3A 1U3WA 2PZMA 4YJHA 3RC9A 3VH2A 2Q2VA 1FJHA 1PTJA 1EBFA 3CUKA 1EK5A 4WKGA 1MGOA 1CQIA 4IJWA 1C1DB 1X15A 5TS3A 3DOOA 2J3IA 5IXSA 4TRMA 2EJWA 5MGBA 5EJ2A 3LF1A 4OQYA 4BO0A 3RFVA 2QQ5A 4IJKA 5JDCA 4HFMA 1UXIA 1TVEA 2PV7A 5ER9A 1LXCA 2DPHA 2GN4A 1XKQA 2O3QA 4FFRA 3VHRA 4DL9A 4E5YA 1B2LA 1PZFA 1YL5A 5TC4A 3F47A 1EK6A 4CMJA 2P2SA 3BHMA 4WE3A 3U62A 5C5IA 1CYDA 3JQFC 2GCGA 5L7YA 1LDGA 2FRDA 3WG9A 5EPOA 2OBYA 3S8MA 3FRJA 1WXDA 4ALLA 3WWYA 1DRUA 1BXGB 3HN7A 4JN6B 3OP4A 1X14A 3NT5A 4WCDA 3ZI0A 3U3XA 5BSHA 3ZWNA 1K5HA 4FW8A 1N2SA 4PLCA 1JVBA 3MEQA 3D3WA 3ITDA 1EQ2A 2J3JA 5BNFA 2RIRA 1WZIA 1PQPA 4KQXA 5LDGA 3WGTA 3BMQA 2XAAA 4MJLA 3AFNA 2JJYA 5BNTA 2D59A 5IXYA 3I6QA 3E18A 2PGLA 1I30A 3VZPA 4R1NA 1V6AA 3OQ6A 3OIDA 1HF3A 3DOCA 1E7RA 3WGYA 1WWKA 3GG2A 1BRMA 3AFMA 4GWGA 5BSEA 2PZJA 2VOJA 1XELA 3G17A 4YAJA 4NZ9A 4YJFB 4OMUA 2CDBA 3PJDA 3H6KA 4GX0A 3CPSA 1I8TA 1VLLA 2AG5A 1A5ZA 4HY3A 4XYBA 3ZV3A 4U6SA 3WYBA 2QYTA 4IMRA 1Q0HA 4E5MA 3JQGA 4JJFA 1YONA 2B5WA 3HJAA 1LDYA 1BTOA 3KEOA 3QWIA 4PIVA 3TOZA 3U4HA 2FZEA 1C0KA 1VJ0A 4FN4A 1L7DA 4XDZA 1PJ4A 3AU9A 4UVIA 3IL2A 4IUYA 3DBHB 4D3DA 2VNAA 3VTZA 4IXTA 4QTZA 1I0ZA 1TXGA 2Q1WA 3QWHA 1FXSA 1H2BA 1WP4A 3F1LA 3UGKA 4QXMA 3AJRA 1PL8A 1KEWA 2WTBA 4BNHA 1E3JA 4TWRA 2X23A 1NNUA 5EIOA 3X2EA 4DQVA 2AXQA 3IJRA 3WQRA 1BVUA 3OM9A 3TN7A 3JQ6A 4FR5A 1KEUA 5BT9A 4GBJA 3E9MA 3HZZA 3C8MA 4XQEA 3S1LA 2PH5A 4YR9A 4Y98A 4GVXA 1K89A 2GZ3A 5CG2A 3PQEA 3WMWA 1UH5A 4YEDA 3NJ4A 3AU8A 4JGBA 4XDYA 3DZHA 3V8BA 4TKLA 1DC3A 2PNFA 2GNAA 3NKLA 3PI7A 3GVHA 3K6JA 3SBOA 3LT4A 1MXFA 4D0SA 1P1IA 1T26A 1VPDA 3ZWMA 3SLKA 3H65A 2BD0A 1DXYA 3L4BC 3QV1A 4O0LA 2WE8A 3WNVA 2J6IA 1I2CA 3KYDB 3ONEA 4S1VA 4U5QA 2YHIA 3WLEA 1I3MA 1X7GA 5FWNA 3LC2O 2IODA 3NEPX 4N18A 4Y6SA 3RI3A 5G4KB 1T24A 4GWKA 1EVJA 3OHSX 3RJ5A 1D3AA 3GZNB 3ZHZA 3RUAA 1UDBA 2I5PO 2VT2A 2YV2A 2Y0DA 1NQ5A 5ENVA 1DO8A 3FN4A 3PIIA 2Q50A 3ZGYA 1T4BA 1UUFA 2WE7A 3ZNQA 3CEAA 4INAA 2G82A 3A28A 1BDBA 3N58A 1WW8A 1EE2A 1F17A 1P33A 3ZU4A 4UUPA 1LC0A 4UUOA 3DAFA 3VPXA 4ND5A 3ZV5A 4ND4A 1JQBA 4AJIA 1HYGA 3QWBA 4HFJA 2AEJA 3DMTA 5HRUA 2DM6A 1E1NA 4A7PA 1NAIA 3MOIA 3LC1O 5G0VA 3DMYA 4MVJG 2VYNA 2D5AA 3HDQA 4U6QA 5AQ1A 5ILOA 2IXBA 5JC8A 3IP1A 1O94A 4W9NC 5JCJA 1T4DA 5L4LA 3GHHA 1P44A 1GUZA 1PSDA 3UH1A 5IJZA 1GL3A 2ZKLA 3B1JA 3RFXA 3WJAA 5C37A 4ROSA 3EC7A 3WB9A 2G17A 4M89A 1RPNA 4NJMB 2HMSA 3KZVA 4XB1A 3F4LA 1KEVA 3QY9A 1XQ1A 1GV1A 1GCOA 1AN9A 3TDKA 3GH3A 4YVFA 4M55A 3NTRA 2DFVA 4I1IA 1CWUA 3O4RA 1CJCA 5TT1A 1T1SA 1VSUA 4A26A 3D3EA 4OJNA 3VDQA 1I36A 1XDWA 2XXJA 3E1KA 3BTVA 4ZVVA 4XJSA 1HKUA 4Z6KA 3GVXA 4DLLA 1ENPA 3FD8A 5HS4A 2POQX 4J1TA 4O63O 3NAQA 4PRKA 5CPFA 3CE6A 3WGHA 3RVDA 3V1TC 2BHLA 4RF5A 1NHGA 1HDGO 1M2WA 3CTMA 5JPIA 3QVWA 4LK3A 1U5AA 2VYND 1PJBA 4E2XA 1ONNA 5JDIA 1NXQA 1YDEA 3FNHA 2AQKA 3O8QB 1X0VA 5K6AC 4WCFB 2NWQA 1I01A 5MDHA 5CFZA 3V2GA 4DC1A 2BGKA 2WWRA 4XR9A 3EDMA 1PIWA 3W4JA 4OAQA 5ITVA 2WDZA 2PGDA 4I5GA 1YQGA 3JQ7B 2F00A 2A9FA 3DHEA 2X9VA 2I3GA 2B36A 4FD3A 2EEZA 1GR0A 1GQ2A 4UVGA 4WLUA 4I5EA 4IQ8A 4R3WA 3WTBA 2C2YA 5CPBA 1MUUA 1NP3A 3D4PA 1Y8QA 1PEDA 4IXWA 2Q99A 4NBRA 1H6DA 5JLAA 4UEOA 1DIHA 2A94A 1SEVA 4GLLA 3TZKA 3C7DB 3UFXA 4NBVA 4NFSA 1XCBA 1DIBA 1GYQA 1LI4A 1JVSA 3NRCA 4J1QA 4I9NA 1DHTA 4AVYA 2UYYA 4O1MA 1HE5A 4PG4A 3ROKA 2JFHA 1V9LA 4AJEA 2EWMA 1AGNA 4YAGA 2P91A 4P22A 3E6AA 1KVQA 1U9JA 3GF4A 1LBEA 3RU9A 2EIHA 4JBIA 1RYDA 3KRTA 1TI7A 2OL4A 3NT4A 4PLPA 5BSGA 4EJMA 4ZICA 3WQSB 1I3LA 3C3XA 1IB6A 1VJTA 4DUPA 2CD9A 4BL5A 1SB9A 5ADHA 1GPJA 2E37A 1A7KA 4XA8A 5T57A 3ZWVA 2GSDA 4BGVA 3AM4A 4DMMA 1C3VA 4DPLA 1B7GO 2NVBA 1GUFA 1SO8A 2IEBA 4E13A 4Q3NA 5JMPA 4PN3A 1E6UA 2VHXA 4KQWA 1E7WA 4MVJA 3JYQA 2X9NA 2BH9A 2TMGA 4XGKA 1XU7A 4DYVA 1TT5B 3NTQA 3ICPA 4J2OA 1U8XX 3LYLA 2DAPA 3PP8A 5TSDA 3EZLA 1LEHA 3KUXA 2V6BA 3GFBA 4IDGA 3GNQA 4BNMA 3ADPA 3GY0A 1HDOA 4N5NA 5KVQA 3MWDB 3BXXA 4B4UA 1UZLA 5DCWA 3ZW8A 2PA3A 4J49A 3Q2IA 5JSFA 4WK6A 4PG7A 3SJUA 2AW5A 4FCCA 3AY3A 4WGGA 2DVMA 4LGVA 2WD7B 4XEHA 2XXBA 3E5RA 2NADA 1PWZA 3BHJA 1GZ3A 2NU6A 3JQFA 3ROPA 2E82A 1N7HA 4D43A 4II2A 2ZCUA 1MB4A 4J16A 4NU5A 5A04A 3TL2A 4F6CA 3GZNA 3H9GA 4K6CA 1ZXBA 2BRUA 1J6UA 2HKIA 3EVTA 4Q9NA 4RPLA 4EEXA 4EEZA 4IINA 2DPGA 2O3SA 2ZB8A 4HUJA 1OBFO 3KLPX 3PYLA 3Q3CA 3L4SO 3CMMA 3HNPA 1O5IA 2P4QA 4HBGA 3BMOA 1R4NB 2RCYA 4FS3A 4MVJP 2BFPA 2GRAA 1ZNQO 3K5PA 4R1SA 4YQZA 1H6AA 1NAHA 2FSSA 3I4FA 5EQDA 1Z74A 3DL2A 3FWNA 4RPGA 3FPCA 4MINA 1HSZA 3QLJA 3VKUA 2ZTVA 4A73A 3F9IA 3F1KA 1QV6A 3O9ZA 3AOEC 1E3WB 1ZH8A 4WEOA 5B4TA 1O0SA 4OIMA 2FPGA 4UVDA 3KSDO 1B8UA 5I7EA 4WOKA 1GAEO 1O95A 3L6DA 1A9YA 1XHLA 4R69A 3UVEA 1WAMA 4RF4A 3WTCA 4D46A 2EG9A 4DLBA 4WLVA 1DFGA 4FOSA 4AJHA 1H5QA 3M6IA 1KEPA 4Q39A 5ICSA 1TEHA 4RL6A 1JKJA 3ENNA 3GFGA 4Y6PA 1ONOA 3RASA 2O23A 1A72A 2Y66A 4DA9A 2G0TA 4BNWA 3RIHA 3GNTA 1C1XB 1EUZA 2B37A 2VWHA 3D5TA 3G3EA 1ID1A 3OA2A 4W82A 5H81A 5TLSA 3OETA 4Y9DA 1Y5MA 3JSAA 3M2TA 3WFJA 2NV6A 4J90A 2RH4A 1NQTA 1O8CA 2HK7A 3Q9NA 3KTDA 3LT0A 4ND2A 5CDYA 5CDUA 1IL0A 1E7YA 5C3MA 5G0UA 4D3FA 2FN7A 4UEKA 1HSOA 1AHIA 1N9GB 3F3SA 3OECA 5LCXA 4RLHA 4XGIA 3BHIA 3C7CB 1GYPA 2P4HX 1U2DA 3TOXA 3PVZA 2WYUA 1LRKA 1IZ0A 5K0ZA 1MA0A 1X1TA 2Q2WA 2PWZA 3WGIA 2X0JA 3OJOA 5JAZA 4DYDA 1DC5A 2IRWA 4RVDA 1YKFA 3P5SA 3ZHXA 3DZKA 3CKYA 4ZQFA 3D0OA 4ZA2A 5TF4A 4CMKA 1I24A 3H9EO 3BMNA 4G81A 4ZQEA 3L0DA 3L4BA 4DWVA 4RQTA 1H6BA 2G5CA 2IZ0A 2B83A 1R12A 3OMLA 3D4OA 5CAEA 3RWBA 3HN2A 4XIYA 1KYQA 3WFIA 4GMGA 1TA4A 4YJGB 4J4TA 1SOWA 3MCVA 4BS9A 9LDBA 4J3FA 4OOFA 4HWKA 4HP8A 3I9NA 4UAGA 4YRBA 3DR3A 1SCUA 3RROA 5HBRA 1IULA 4GX5A 1LRLA 5BSFA 4FFMA 2DLDA 3IIEA 4KUGA 4A10A 3K2BA 3AY6A 5I7VA 3W8DA 2B69A 3NGLA 3JQ8B 4QO7A 1K6IA 4D3SA 4E2YA 4RF2A 4XD2A 2JHFA 1JDJA 1R66A 1DC4A 3G79A 4JJIA 3RU7A 1PU2A 1BVRA 1X1EA 4W9NA 4ALNA 4N7RA 3ABIA 3RUCA 3A06A 4I8XA 4MVJF 1NM5A 1AUPA 4IJVA 4B4VA 2HCTA 4IY1A 2CZCA 1GFSA 4CLRB 2W2KB 1M67A 1TT5A 3PLRA 4PLFA 2Y05A 1J0XO 3VTFA 2O4UX 1NHWA 5AXAA 2PTGA 2QRLA 3JD0A 4ZJUA 4D0RA 4N5MA 1W8DA 2C7VA 1ORRA 4ESOA 2BKAA 4GAEA 4BUCA 2ZIZA 3MJSA 3E5MA 4BGIA 5DBGA 3WIDA 3CXRA 4RPKA 4CM8B 5EL0A 1Q0QA 2VHZA 4R5MA 2JD1A 1BG6A 3Q9UA 1HDRA 1B26A 2OOSA 2HQ1A 4BV8A 2J5KA 2WD7A 4DVJA 4DTIA 2C54A 3JQCA 6LDHA 4FDAA 1LLCA 2QW8A 3MJVA 2VHYA 5IDXA 4E2ZA 2VRBA 3GGPA 1HL3A 3QVSA 4E21A 1WDLA 2CF5A 1Z82A 4YT4A 4Z0HO 1DAOA 4IBOA 4II3A 3PTZA 3X2FA 2C5AA 3QE3A 2Z95A 2WEKA 4J1SA 4GQAA 1OZAA 3PLNA 4H16A 3WQQA 1R0SA 5CEEA 3CZRA 5F1KA 5KJ6A 1H9BA 3B6ZA 4XZ3A 5K6AA 2EERA 3AI3A 4TRJA 1R4NA 2C82A 2EF1A 5CEJA 4IIUA 5L4SA 3MJ4A 3QVXA 1RYEA 2NTNA 5DF1A 3SLGA 5KVSA 2ZB3A 1R4MB 1VKNA 1P1FA 3PHHA 3VPHA 4BIIA 1YDWA 1YJQA 3U4CA 4CV2A 1ISIA 3OJFA 4HNHA 2YQ4A 3H5RA 4BV9A 5JYEA 3OQBA 4J6FA 4JK3A 3TZ6A 5DBIA 4CR7A 2C7GA 3FTPA 1RM5A 4NU6A 4BKUA 1E3WA 3HFGA 5B4VA 3QA9A 3K2EA 2YW9A 3GT0A 1LJ8A 4MP8A 1EVYA 3F4BA 4OOEA 3ICCA 2Q49A 4E5PA 3KYCA 2I9PA 2ILTA 3I23A 3VAZA 2CUKA 4EUEA 1DFHA 3HADA 5KWEA 2D5CA 3EW7A 1PZGA 1IOLA 3I52A 3RBVA 4CR6A 4CLOA 2GPTA 1VL8A 1NVMB 4DQXA 2BGMA 1FDTA 4L76A 4XRGA 4KTTE 4MDHA 3OFSA 1HZZA 5IF3A 3PZBA 5EINA 3C7AA 1AXGA 1H94A 1CIVA 3ZWCA 4PG6A 1LSOA 4BO9A 3QWFA 3GAFA 3TZQA 1KETA 3EHEA 2EJVA 1C1XA 3ZU2A 4NBWA 4LMRA 1E7MA 2ZYGA 3F5SA 2V7PA 2Q1UA 3DOJA 4RORA 1SNYA 3DZBA 1ADCA 1V8BA 5DOVA 3RC7A 4R3NA 4BB6A 4UULA 3S2IA 4OH1A 3E82A 1LDMA 1PWXA 4YRDA 4N54A 5CHEA 1ISMA 1BXZA 2YFHA 4AG3A 3C1OA 1QLJA 2J5QA 3RQSA 1UP6A 5JY6A 4W4TA 3RCBA 3JQ9C 3VDRA 2FHSA 4EBFA 4IS3A 3DAPA 1HDZA 3RC1A 4HKTA 3QHAA 4RVGA 1I5RA 2EW2A 2ZB7A 3ON5A 2VCYA 3R0IA 3VH4A 2I76A 3L6OO 4NNJA 3WX0A 1L7EA 4ZGWA 3B20A 5L7TA 1LSSA 4GGPA 3KSZO 3H5NA 3LDHA 3PHJA 4E31A 3DBLB 3IC5A 2VWQA 1A9ZA 3H3JA 2YDXA 3KO8A 3MTGA 4JP3A 1Z73A 4RZIA 4CV0A 4CJXA 1SPXA 4IM7A 4GVLA 4GX2A 4BNNA 1DIAA 1RM0A 4IDAA 5AYVA 2CDAA 5IG2A 4XKJA 3OEYA 2P9CA 4Z0TA 1TLTA 2DTXA 1D1SA 1F8GA 4CMAA 2FP4A 4YJGA 1ZSVA 2UDPA 3QJ5A 4DRYA 1LDNA 4B7UA 1B16A 4BNKA 3OH8A 3GNSA 2Y1FA 4J7XA 1O89A 4WNIA 1XSEA 1DJNA 1YXMA 1HE3A 1C0LA 1IUKA 1CDOA 1YH3A 2DBZA 4NFYA 3GMSA 4QSMA 2EKLA 4RJTA 2IE0A 3AUTA 5JMWA 1OI7A 1I32A 4TSKA 4MPDA 2PLAA 3OJEA 3PRJA 1UJMA 1HLDA 3ZHYA 5A4DA 2NTJA 2O4CA 4ALJA 3ZZNA 5C7IO 2X1HA 3BMCB 4BKQA 4IGFA 1HT0A 3AOEA 3KXDA 1PJ2A 1BDMA 1UDAA 3PHIA 1X0XA 3I9OA 5GZ6A 1P31A 1Q0LA 5ENDA 1VKOA 1ZIDA 2YJZA
chains in the Genus database with same CATH superfamily
2VQDA 1W5TA 2FSPA 3IKVA 3LY7A 3DE6X 3AILA 2NVWA 3O2NA 4HXGA 4PRZA 5F3RA 3K05A 1B6RA 5H82A 5BQPA 3TK1A 4PYNA 1D4ZA 2CSXA 4KLNA 2ATCA 2P9YA 4WT7A 1NJ5A 4CLRA 1T0HB 3LC7O 4BCDA 2OBXA 1PVOA 3N2GB 5DYGA 1Q0ZA 4J29A 5JASA 1YZVA 1RQRA 5BWNA 1UBEA 1WY5A 4BP3A 4UCFA 2VQ6A 4YI3A 4A5OA 2N1BA 1JWBB 1QP8A 4KFUA 1EH5A 1FCJA 4PAQA 1FXWA 5ALNA 1QR6A 1ZLYA 1AO3A 2RGCA 1MV8A 1Y98A 4B82A 4YACA 2W8ZA 5HOEA 4QICA 1Q7GA 2IV7A 4CQLB 4LBYA 2XOKD 2G76A 2R68A 3RT9A 1H23A 1AKEA 3D7RA 4BGUA 1Y8ZA 3BK2A 4FR2A 1AZLA 1NNEA 4H17A 3CW8X 3QZUA 2HPZA 2VJCA 3KL4A 3WO0A 1C0IA 1HQYE 2ZTHA 2RBGA 4ILEA 5EKTA 3QVVA 1LPOA 2EGUA 2HMAA 1ZNZA 2JVKA 2R6ZA 2YXPX 3C8ZA 4FSDA 4IDEA 4KP7A 4R1LA 2VUTA 2QEQA 3HCRA 1GA6A 4JLOA 4N8DA 1ENZA 1G6KA 3MTIA 1FLNA 3G59A 4PCAA 5E1MA 3BC1A 2CF6A 3MQ4A 2E6UX 4MIOA 2KLHA 4QHYA 4B9EA 4X5OA 2WAMA 4JBHA 4V38A 3ZJYA 1NOJA 2Z1DA 5HJ2A 1ZGZA 1R3UA 2Y0CA 3BFVA 3DNMA 5F5XA 2J4CA 1BIFA 5CNKA 1L4BA 5J5CA 3UUGA 1GRQA 2IQIA 4WBNB 1DJQA 2VRNA 5LFAA 5EIEA 4YTEA 5A2QA 2Y99A 2VYQA 2QOEA 2QMZA 1SXJC 1QX4A 2IXFA 2ZLBA 2B21A 2ZR0A 3O1IC 4RNDB 4LJYA 4C0LA 1T2FA 4BEJA 3U4IA 5A9RA 1O77A 1LVHA 1GDDA 1N75A 3EY4A 4PX2A 2BM9A 5BWCA 2FEPA 1GJRA 2PSFA 2YXDA 3IAM6 2AF4C 4UU1A 2FCRA 1W1IA 4GDFA 3LLMA 5U1PA 4EX7A 4M1ZA 2NVUA 1V5EA 2Q3LA 4F04A 5IAAA 3WGGA 3T15A 3OUZA 2JVIA 4ITRC 1D2AA 1OYWA 1W8IA 4OHOA 4TMVA 1P0CA 1A71A 3OT1A 3P9PA 1WU8A 4IAOA 2VJLA 4OK5A 2XMCA 3QUAA 1BJTA 1ZRSA 2GHQA 1XGKA 3RYFB 4O2RA 1VE9A 5HCUA 4OBBA 2I22A 3A36A 2BDUA 5EXSA 2QVXX 5D5PA 3CB2A 1KH1A 1CRQA 1QPGA 2PV0A 2EU8A 3COWA 1EM6A 3L43A 1JG2A 3VJKA 3ESDA 1O96B 2HMWA 4PO3X 1SKAA 5KJEA 2I4MA 2OMEA 1C1YA 3ILVA 3HBAA 4MXDA 3EFOB 3UF0A 4EARA 1RCTE 2YHBA 3OOHA 5AW8A 2OY0A 2PUHA 4GSLA 5CA1F 2XYVA 1IOVA 2VJOA 3V55A 2CXXA 1CQJA 3VPCA 2YJ3A 3DXYA 3HR7A 1GIAA 3VR6A 1I7QB 4K5QA 2J9ZB 3ZS9A 4LWPA 2CT8A 4C6HA 5TIIA 1W49A 2J87A 4HOYA 2J33A 4HQNA 1T5BA 1GGFA 1HDXA 1MNAA 3P26A 4X66B 1BXGA 2GEFA 2B25A 4IMPA 1FPMA 4MB2A 3ZCXA 3WHKA 5IK2A 3K5HA 5FLYA 3LQ4A 1AKWA 2ORWA 1UMDB 4X3CA 3WDMA 1KR5A 4XDHA 1I10A 2FSUA 3C3BA 2GF2A 4ZU3A 3AHJA 3UXYA 2BH2A 2YFQA 2PIAA 5GADl 3W8EA 1SG9A 2BFCA 1NASA 1TF5A 4ZOAA 1D7AA 2B30A 4MRSA 1EMDA 3WSVA 3NETA 5A4MS 2WVHA 4FZ3A 4BGDA 1P1JA 1SUWA 3DONA 1NATA 2O20A 2RC5A 2Q3EA 1E2FA 3QNMA 1K6JA 4FGZA 2ZUVA 2IHTA 3ET4A 4YNBA 5CYOA 3A9RA 4EYOA 3UV6A 4X63A 1NW6A 4BX0A 3CX3A 4CUKA 2BE9A 2DQKA 1QTRA 1LLDA 4C1BA 3OIWA 3GZTB 3I53A 1ZD8A 1PHPA 3LNCA 2V7QA 4JQSA 2P77A 4DLNA 4PLGA 5MFPA 3UC5A 5BP7A 1X7YB 3H4VA 1I80A 4JELA 4QYXA 1JJAA 2C97A 5EP1A 2FWMX 3IPYA 3O8NA 1QO9A 1ZMOA 4KZKA 3TEMA 2IPOA 2IV2X 5K6RA 3ZEAA 3D7LA 2BY4A 3PWZA 3O03A 3IAXA 2Q3MA 4LOAA 1AGRA 2NUAB 3PK0A 3PDJA 3SHOA 1BVYF 3QI7A 3SIRA 3F6SA 3W7AA 4B6PA 2QRVB 6REQB 5LQAA 2ZWIA 1ABFA 3DWEX 5B37A 4X84A 3HYSA 2QUIA 3OZWA 4TKUA 2CVOA 2YY7A 1DOHA 2VJDA 3CB4A 3V8QA 4EJ6A 5C2JB 4NHEA 5EJ6A 4X7MA 1W5SA 2VPIA 4E09A 5DASA 2IE8A 3ZNPA 2CBXA 5AW1A 1BOFA 1U1FA 2OFWA 2IYYA 3NKVA 2JEZA 3AR4A 3R5KA 4B5KA 2IVFA 5K2OA 2UXBB 3EPKA 4EAAA 3DLHA 5KNBH 4FHDA 2Q62A 1BDJA 1FQJA 2XY4A 4HVTA 5TMPA 5DWVA 2Y1DA 4OHWA 3PTAA 2PEZA 2VP0A 3KEFA 4CCYA 2HRBA 5ECYA 2QM8A 1RKQA 3GBVA 2EKQA 2C9BA 3M1YA 4RJLA 5L6LB 3AESB 3EIOA 2VA9A 4B45A 5TNXA 1WXGA 4MAFA 1FNNA 3L01A 5JR3A 1P9LA 4D81A 3ZGZA 3F8TA 4G9GA 4AM8A 2IH5A 2Q5FA 3T0IA 1L5HA 1OZGA 4O6VA 4BVBA 2YDYA 2Q6VA 5LPNA 2I71A 1KIMA 2QIOA 3DB2A 4EYKA 4NECA 4B3XA 3FOZA 1NVUQ 2RHDA 1YDHA 3UWOA 4EG3A 4DNOA 4A1FA 3OHMA 4UM9B 2O6LA 3RT7A 2Q0XA 4OSEA 1VMDA 2A33A 2YOGA 4K05A 3ELYA 2R751 5CFQA 4IO1A 2ERXA 2G04A 3B53X 1VYHA 4LW8A 5HS6A 1SGWA 4PG5A 2VATA 1UT6A 3BA1A 2GEVA 2WKWA 1P81A 2FX5A 3EPJA 1C8VB 5CJJA 3FTNA 4FT4A 5G53C 5FPSA 4BMYA 1C30B 4BJ6A 4P8RA 5IZCC 2PY6A 3E84A 2JA2A 3D9QX 1L7PA 1E77A 4D9BA 3ITKA 1Z35A 4MDEA 2P62A 2Z5VA 4Q15A 1VB5A 2VUHB 3STWA 2D00A 4EUFA 1J0AA 1XZCA 3FNFA 4NEHB 3PPIA 5JE8A 4DGQA 4FSHA 3G0DA 3A4MA 3SVZA 3I64A 4FJ0A 4V1CB 3SXPA 5MN6A 2RB5A 1AF7A 3ZN2A 3SZUA 2D06A 4JB0A 5C9ZA 4DNPA 2AD1A 3RVKA 4FLFA 4MUFA 1U7UA 4F0JA 1AGXA 1KOFA 2BOVA 3PC3A 1OASA 4FMCB 4EL0A 1W76A 3HGTA 2J31A 1SZDA 4TM7A 1F5SA 2VO1A 2AMJA 4YBZA 1WPXA 4H4CA 3VVCA 1WBBA 1ACMA 3JWJA 2Q4EA 4L72A 2AUMA 4IG9A 4E5KA 3P9RA 121PA 1QYWA 2IF2A 1RZ3A 3FHOA 1Q7RA 3GRKA 1LF5A 3RU3A 2QJFA 4AQDA 1P3JA 3I9MA 2EJCA 1G8JA 2HU2A 4H7KA 1S2NA 5FTWA 3RO7A 4AJLA 1EESA 4Y7DA 1PL6A 4FFLA 1ZMTA 1QB8A 4CF3A 5HF5A 2R6CA 4QUHA 2GM3A 2IVZA 1R18A 2OLEA 1H0SA 3DKPA 3FFWA 4AKGA 4QGHA 5KTKA 4JC0A 1I6LA 3A1FA 4MKRA 4NJMA 3U3MA 4HYQA 1BS1A 2P6PA 2VAMA 3Q10A 3NIBA 1V2HE 2RHRA 3W8RA 5AKXA 4AKTA 4F71A 2HJRA 3DYVA 5B7NA 1KQFA 1I3KA 4Y2TA 1W85B 2O2YA 2RHHA 4A0RA 4WXRA 4JXXA 2ZBPA 1VMKA 4MIYA 3DL7A 3H8VA 1AUXA 1SU7A 1JQ3A 2ACWA 3BFJA 4JODA 3RIMA 1NXPA 4KE8A 3TS1A 3LCCA 1U0JA 2IYOA 2PEYA 3ELUA 2E21A 4QDUA 4KKVA 1QWOA 2YFYA 1F20A 2CXTA 2ZBDA 4RTNA 5KYXA 5LNK6 3HP7A 5CW2A 4R9NA 2XCQA 4DSUA 4WCVA 3USCS 5JNLA 1QC5A 3QWAA 4GPIB 2GAOA 4ER7A 1XVIA 2CLCX 2AJDA 4CUZA 2J3HA 3DAYA 4JKYA 2QAGB 5LYJB 4PR3A 3SJ7A 1QU2A 5K0TA 2C8KA 2O07A 5U4XA 5DHRA 4EK9A 3DTTA 1L6IA 1MAHA 1QDLB 2A3NA 3I9LA 1EFKA 2AUTA 4OKIA 2W2VA 4D2IA 2WTNA 1WXHA 2GQ0A 3LKVA 5DNAA 4KIWA 3TLGB 3VHLB 1RC8A 1RMYA 1HLPA 1TGYA 4ZRMA 1KE1A 1B0ZA 1E5TA 2E2WA 3ZDQA 1X7DA 1SVWA 3GZ4A 4YO8A 4BKMA 1WHTB 1T9CA 2VDUE 2NM0A 2O1XA 3FRIA 1Z2EA 3K0AA 3KBOA 2FGKA 3I5XA 1Z4PX 2BUCA 2OKGA 2WU4A 2YN2A 4IKEA 3LXMA 2OBNA 3EAQA 2CNOA 2IXGA 3FPBA 1HH4A 1Y4SA 3LHKA 4RVNA 2ZAIA 1O9BA 4EKDA 4EUNA 3QXSA 5AJYA 1D2HA 2OCAA 2RGNC 2D0IA 4IPTA 3TX2A 5D7BA 4CL3A 2OLJA 2W6ZA 3MTEA 1GAXA 4P38A 5JWOA 1LPAB 4BXOB 1E1LA 3AM3A 3AQIA 5G02A 2ZT7A 2ORIA 2JGIA 2BMAA 1E9DA 3IPAA 2AOUB 5AM0A 3U44B 1NBMA 1Q21A 5AVOA 1XK7A 3D3WB 4PM4A 2GYWA 4UUNA 2WFAA 2XSZD 3IT1A 2GD2A 4KR2A 1ECJA 1XNHA 3R20A 3N74A 4CKWA 1G0NA 3BWCA 3KL2A 1FSZA 1PT9A 2MOKA 2BE7A 2HNKA 2P8JA 5IM4A 1RXWA 2BEKA 2PVSA 1Z5NA 4TMZA 3UC9A 2FMIA 1ML3A 2C3YA 1NRJB 3GCWA 3IUJA 1TYCA 1FL9A 3PPWA 5J2TB 4KGDA 5KOJB 3GLFB 4FWIB 3W5IA 2Z56A 3SDBA 3FI9A 4GR9A 3ZE8A 1DJLA 2D8AA 4J43A 3LRPA 3JZMA 1NLZA 4MHOA 5HGXA 3M9LA 2BCGY 5AR1A 5HK9A 1YRAA 2WD9A 1O94C 3H9UA 3QBDA 1CF4A 3URKA 2QORA 4QFDA 3ZWQA 2OZLA 4OP1A 2C9ZA 4F4JA 3HBMA 5I7RA 4CG0A 2UZ1A 3SE0A 2YWJA 4RBNA 4PBSA 5EEHA 5KJCA 3N0WA 1PR4A 4M49A 5BO5A 4DV1B 3ZWPA 2QM0A 3EOBI 1UAYA 2VXCA 5FUWA 1VSQA 1QMPA 2GTIA 2VUUA 3TQHA 3M4JA 4G24A 4Z49A 1WPRA 5JNUA 3M6MD 3HCCA 5IDYA 1HQCA 3LCVB 1B1CA 1OWLA 4X60A 2I6SA 4MEBA 3ESBA 1PSWA 1QO7A 2HDWA 4S1NA 5ALVA 4EY4A 1O03A 1AC5A 2JJ2A 1WTAA 3JQAD 3PUWA 4MVYA 4YCAA 3RU2A 3VGJA 4F5WA 5KJFA 3I9JA 2D1FA 3ZWYA 1UL1X 1Z5UA 4FEEA 4LSZA 5H70A 3QVGB 3JRNA 2FWPA 3H6HA 1RMTA 3EVDA 1AQIA 1DLJA 1Q2XA 1V71A 2XE8A 1HNZB 1ZWLA 5A62A 2GILA 3G0GA 4LYFA 4OREX 2YBDA 3GXOA 1Q7BA 2P65A 4MUMA 1N8TA 3HKBA 2YTZA 2V7UA 4B0OA 1NLFA 1MFPA 3GAMA 3LQQA 2OCDA 3OJCA 2XGOA 2A9PA 4L85A 4PC3A 1W5BA 2JH9A 1X1CA 4IRUB 5T5QA 2FR0A 1V7ZA 2J6CA 2V4UA 4Y2RA 4O4LA 3S68A 5EHIA 3DHNA 1FS5A 3N53A 4LRXA 2F1IA 4MX8A 4ZVRA 2Y27A 5KTTA 4BO5A 1REQA 1SHKA 3L8CA 2BN4A 1EFPB 4OHFA 5JCXA 1ORWA 3A04A 5BNIA 3MTJA 4ZQGA 2CNWD 4XEUA 5F76A 1B6GA 3JZFA 2G4LA 1M6WA 1OX4A 1VSBA 4V0QA 2ZRIA 2F17A 4BATA 3RSFA 2ZSHA 4FYMA 3F3MA 2X76A 2CJPA 2P1ZA 5AJUA 3KV1A 3NHYA 3HO6A 1ZGHA 2GHIA 3SQMA 1CEQA 1NI4B 4F3YA 2C2ZA 3ELWA 2O2HA 1TMOA 5DB4A 5ESWA 1NWCA 3CH6A 1J56A 3OWHA 2P2LA 5EXXA 3STHA 1F2VA 1U4OA 2JBAA 5AHRA 1Q3HA 4QLOA 1JEJA 4N5IX 3ZZ1A 4BMNA 3UYLA 1U3TA 3D3JA 5M04A 5ITZA 2Q5LA 4DREA 3TEJA 3OM1A 4MITA 4PLTA 3V1UA 2VKQA 1EVIA 3H6GA 2J3LA 1WKBA 2P40A 3Q7PA 4LRWA 4O25A 3T1YB 3KPJA 4Q7LA 3W3AD 3T9FA 1TTTA 4YAKA 3S55A 1S2GA 1CETA 2LIPA 2XWJI 2GX6A 3D8UA 5DM0A 3F3YA 1Q0RA 2HO5A 3J80A 2NO9A 5F9FA 1VCOA 1E3EA 3L5KA 1JXOA 1QF7A 1KAHA 1KY2A 4QNNA 5B2FA 3O0DA 3PXBA 3EB9A 1ULAA 4IJ5A 3QE2A 4MGEA 3PNMA 1OT5A 3AUXA 1XRMA 3QTTA 4MLCA 5B1EA 4KR9A 1EB9A 4B8WA 1Z4LA 4DAEA 1QVZA 1U0EA 2AOVA 1GG2A 4X6YA 2WJZB 2CJWA 5KOHB 1CUHA 4WESB 1PGOA 1CE8B 1OAAA 1VM6A 3CC8A 1DWQA 3AY7A 3DEJA 3GJQA 3T7CA 1YCFA 4XPIB 4CFZA 2QJRA 1C0PA 1DPGA 2PFKA 2VYVA 1NDQA 1JZSA 3FMGA 2X40A 3U4MA 5K4AA 4B3GA 1XXLA 2WZQA 2OHXA 3RS9A 2QMHA 4XARA 5BQXA 5KJ1A 4OHYA 1H8HA 3U7FB 2B7LA 2FMHA 2I99A 1DIRA 3FIJA 4L27A 3S2EA 4ZMRA 1TYEB 4N47A 1HR0B 2AMYA 1X92A 3N2EA 1N3IA 3RVMA 4AY2A 2ZIGA 4L4ZA 3UT5B 1Q15A 2O7SA 5LQJA 5C53B 2ZSKA 2XQKA 1VGQA 3L4EA 1YD7A 3SS9X 4AJ2A 4UTRA 1K5GA 1M1ZA 1U4NA 2ICAA 2MT9A 1UMCA 1AMNA 5AXDA 1OROA 2RHWA 3HEMA 4MKFA 3UO8B 4GLOA 4EPWA 5JEEA 3DEZA 1E3TA 2WAYA 2ZVPX 4RKEA 5AM1A 3VNQA 1LLFA 4C0BA 1M72A 1HZJA 3F5MA 4TTAA 1JP7A 1HE8B 4DLYA 1U02A 4Z53A 5A9SA 3L8HA 4W1QA 1E69A 3QLUA 2C78A 1XDDA 1X1DA 1ZN2A 2YVLA 4RYLA 4BZWA 4L78A 1DQSA 1XAHA 3GDOA 1CY7A 2DUUA 1O5OA 1WB9A 1GTSA 2A9RA 1IWBB 1Z4NA 3IQEA 4AG6A 4QPDA 1B8NA 1N5LA 2H9IA 4HTAA 5ALPA 4YT8A 2VRCD 1UXJA 1NWHA 1QXSA 3OCVA 1UWCA 3TRHA 5JAIA 5JQWA 4BNFA 1Y9EA 1JQ5A 2GMWA 4XVHA 2CL6X 2JGLA 3U37A 3CRRA 1Q3TA 1PR0A 3DKIA 3CUVA 3QPCA 4NY1A 4YCNA 4Q19A 3H05A 3FGOA 4MYCA 5TJHA 5H02A 3HY6A 2RB4A 3A1UA 1P5FA 1LC3A 2ZIXB 5DM1A 3RSCA 1MW9X 1QBKC 4AMUA 4XX0A 4AXXA 4LF7B 2HW8A 2OHOA 1TVKB 2XKAA 2O7QA 3GRFA 1QFSA 2P3QA 3GDFA 4RGBA 4LJRA 2FW6A 4URVR 2H48A 1KOLA 3RRJA 3RNLA 1JKFA 2Y4OA 1FFEA 1PX2A 2GAIA 4J9VA 1M75A 3DLTA 1XQWA 2A1UB 3JTMA 3NC0C 4I6JA 4QTTB 3CSSA 1MH9A 4BLTA 4BWVA 4MQEB 1PYGA 4P5PA 1SAYA 3CYFA 1ZD1A 2M9MA 5TPWA 3HU1A 3KTAA 1XI2A 5G1OA 2LUOA 1YA6A 1Y8QB 3VV3A 3PZRA 2QRHA 1KJ9A 2RH9B 5DTQA 3AEXA 2JAXA 1W88A 5KZMB 5LSAA 4KPYA 2GDZA 1UBNA 1E3DA 2MSLA 4G0WA 2P8SA 3DCIA 4OLBA 1V7QA 3EW9A 1NFFA 2C2MA 1CG6A 3N0RA 3OE7A 2HXGA 1GLGA 5DOZA 1Z4QA 2GN9A 3K0KA 4GPTA 1L8QA 1AQYA 3ZDBA 4LK2A 1INLA 3JQ8A 1R4AA 3VZSA 1CUVA 1ZM2A 2P5SA 2AQ8A 3ENZA 1I6KA 1YKGA 4FI3C 1KO1A 2WUVA 3GFPA 2SBTA 4PO9A 1HE4A 1OHHD 2G1AA 2C77A 4JKIA 1UJ4A 4ZANA 3NWEA 2IU3A 5GPBA 1G16A 4H7PA 1LZLA 4PFJA 3K9GA 1TKCA 2YYSA 1T3SA 2HK8A 2ODPA 3NDJA 3OBBA 4AKIA 4JJ7A 2I91A 3NHZA 2Q5IA 2ZQ5A 5ERGB 2R2GA 1R6XA 1VA4A 1BGVA 1U3UA 3NMUF 5B1SA 2CXUA 2NSDA 2W83A 4NYMR 2VJNA 1ZICA 3BSYA 2ZUEA 2QN3A 3O2QB 1SCNE 5JWRA 1MDBA 1NE7A 1EM8B 1URPA 2DSNA 1ZJYA 3RT1A 5K45A 5HBGA 4A82A 3AGPA 5IUNC 4DKXA 2ZIUB 4FDUA 1K06A 3DZCA 3WXMA 5JYBA 3GLFE 1R0BA 3KUKA 3WGMA 3IMFA 4BP1A 4RQUA 3CRNA 1I4EB 1V1MA 4OFZA 2R5NA 4BV3A 5DMXA 4U2BA 5CDHA 4FFOA 4AYWA 1EFVA 1I1NA 1V5IA 2O3JA 3AV0B 5DX1A 2H1IA 4RHFA 3V3TA 1EUCA 4TS4A 2YXEA 5ES4B 2ZYTX 3T52A 4O4LF 3EIWA 3QXXA 3U2QA 1IBSA 3SR3A 2NU8A 3HWRA 4DW8A 1EGVB 3AHDA 4MR9B 2JHCA 4NBUA 4JB3A 1BU5A 1P8AA 2ONKA 3KOOA 2AS0A 4HB0A 4OB8A 4TWAA 5CDGA 1RLJA 3A14A 4ZVSA 2NPFA 1OFVA 3NUGA 1PCXA 1GTMA 3OJ0A 3KKEA 1R8YA 4R54A 2HQOA 2JFBA 4Q48A 1TIPA 2QRJA 4INPA 2L42A 4KSBA 5AHOA 3V6MA 2VL7A 4B2IA 3LU1A 4D5EA 2P9EA 4HH1A 4OPMA 4MSUA 4R2HA 3CLRC 1CRWG 1DFIA 1ECCA 1WLSA 1R5NA 3CJRA 3BEDA 4WOJA 3H9JA 4K3UA 1SBTA 5KNDH 3T5PA 1XA3A 3W2EA 4EY8A 5K8UA 2O8EB 2E85A 5D00A 1L5FA 2HTFA 2OP1A 4OJQA 4NZZA 3N5KA 3DJFA 4WY2A 2VA8A 4HHEA 1ISHA 3KZCA 1MAUA 1P6UA 1RJGA 1TIBA 2NU6B 4G0PA 4RVSA 3Q8XB 3JALA 2PGJA 3O4HA 4CKBB 5B1DA 4GFDA 1GN8A 2O8BB 4FEYA 3W04A 5IFLA 1QKIA 3HB1A 3D8TA 4WY8A 3R4VA 4Z8XA 3TR5A 4QVGA 3TNDA 1MA3A 1W0JA 2DUJA 3PA8A 4WTOA 2RG7A 2ZTLA 4Y67A 4N5LA 3PT5A 2BISA 3K35A 3UW3A 4BCBA 1A4UA 1WB6A 3K9LA 2H1SA 3KXLA 4HDAA 1ISFA 2X5JO 1V6SA 4HLUC 2CBZA 3BMOB 2QAIA 1UJBA 4R2MA 1XEFA 2ZPTX 3TJMA 4DN6A 1DXHA 4QEKA 5F52A 2GFHA 3PFKA 2I4TA 4A6PA 1KPIA 4YMWA 1KXJA 3HKDA 3RK4A 5AESA 2WIKA 1YBHA 1AKVA 4V3CA 2IEDA 3E2PA 3O93A 1Z07A 5BYJA 4KSCA 1ZXLA 4EDHA 1WUTA 2B3DA 3AG6A 1FRFS 3EH1A 2DBQA 4R31A 1ZVQA 3C1UA 4ARZA 4Z9YA 1UBKS 2PKRA 5C3UA 2VSOA 3ZGNA 3WFZA 4JSYA 1KI2A 1LQUA 1WMAA 3UV3A 4A0GA 1WD5A 2XZLA 1W48A 3WQHA 2FPGB 1JEQA 4E6PA 4TS3A 1XZAA 2C2XA 3TPZA 1MX3A 1V1JA 2FQQA 2JD0A 2CNLA 2V8OA 4GZLA 4B8YA 2WBLC 1N2EA 4H08A 3SF8B 1NBOA 1G5RA 5ICMA 2JLYA 7ABPA 2UU9B 1IPFA 1WXEA 4GOMD 5HF9A 3WZMA 2IC5A 2D2IA 4MRRA 3A8TA 1F4VA 2NLOA 3IIIA 2B4RO 3P0RA 3Q3HA 2LE0A 1XE3A 1D03A 4JP5A 3GGGA 4XIGS 4BNUA 1M6NA 3I1JA 1RLMA 1O6CA 4J0KA 5DM60 3RKUA 1DUIA 1A8UA 2AT1A 2BM8A 3ZNOA 4JBYA 4A8JC 1DG9A 1GY8A 3K1TA 2IIPA 4M7PA 1E32A 4IZOA 4QJIA 4DSOA 1QFZA 2DQ4A 3H16A 3GPBA 3QFSA 3TFQA 1FDSA 2Y1XA 1E5LA 2H6EA 3UUFA 2FHPA 1R0ZA 1TUGA 2P0AA 1S2LA 5GONB 3S5JA 4F72A 4XUDA 5TVGA 2CLLB 3R75A 1SFRA 1Z6QA 2ZB2A 2AEEA 2CUTA 5AD1A 3BXEA 2Z5FA 3W6UA 2YYYA 1E2NA 1BXRA 2X8AA 2WDPA 1H4TA 1FDIA 4TL6A 3CR3C 5TARA 3THRA 4BCCA 5BMOA 3EIEA 4G5OA 4J0FA 5E1OA 5C7LO 3EQ9A 2VJYA 3IR5A 1J22A 1PR3A 2I8AA 4B46A 2QMEA 1OWOA 1JIXA 3M1LA 1Q16A 3N76A 1J99A 4KXVA 3O9MA 4OLHA 4DA7A 1L5MA 4FFVA 4X0EA 5C51B 3FSRA 2YWFA 1SIOA 2E48A 2X9GA 4HDSB 3I8OA 4KL8S 4V2UA 1NR1A 2OVFA 4Z9XA 5CK4A 1XDBA 3SC4A 1TM5E 1ZH4A 5K09A 3L1UA 1FFXB 1X70A 2AOTB 3QKUA 3OJXA 4QDKA 2V7EA 2X3YA 3TE6A 2B0JA 4C7BA 1D2EA 3NVDA 1E66A 4FGWA 5IDQA 2WK1A 3OEHD 2FPOA 3ZH9B 4ZDKA 1UKYA 1F7VA 4UW9A 2RGAA 4G5FA 2E4UA 3INGA 3G9QA 3BGWA 3SXJA 1NPYA 2B7BA 1AKTA 4B33A 1AURA 1JGTA 3CH5A 2PX2A 1AK1A 3PQ6A 4LKRA 1G20A 4Y7CA 4G4SP 2C4UA 4L75A 5HQ3B 1ZHOA 2OCPA 3C3KA 1BH2A 1HGXA 1U2SA 2FQ1A 3BMNB 3OZUA 3ZCRA 4D6YA 4D99A 4Q7QA 2KMLA 4DXHA 2OORC 3QPUA 3SU8A 2QVLA 5LD2C 2FFAA 1QF6A 5CNJA 4D45A 4BVAA 3FLEA 2QG4A 4AY5A 4FILA 4OAOA 2E3JA 3NHUA 3F7TA 1UKZA 2WWFA 4DQKA 4C7KA 1NDHA 4LQ4A 3R6WA 3H1EA 3C3JA 1LJLA 1M2JA 1SCAA 1A9OA 1VCMA 1PTJC 3BCRA 4X8MA 1M2HA 1Q12A 4FYHA 3WK7A 1TL7C 4BHTA 4EDFA 1R1DA 2UUPA 2OXEA 4FZ5A 2VSQA 2BPOA 3LHDA 2OOKA 4H18A 2AFVA 3I6ZA 4MYTA 2WP8J 5I7HA 4U7PB 3U0VA 3NKFA 1ZSNA 4FTWA 1QO0A 5CHYA 2HJSA 3DTVD 1YT5A 4QFMA 1W2GA 2VTEA 2IDZA 3B82A 4JEIA 1ATIA 2PXAA 4I1YA 3E3OA 3G0IA 2MR6A 4FYPA 3O7WA 3NHFA 4TL8A 2QU8A 5BSRA 3PFGA 1D7OA 1ZOSA 4K0RA 4CU5A 2QB5A 3MYYA 1G1AA 3RLIA 4F1KA 1RYNA 2BFWA 2BLNA 2OECA 1ESMA 2C5EA 2KJQA 2XLBA 4XW2A 4JBGA 1M76A 1Z0AA 1E2KA 1U6KA 4TPKA 1ZKDA 2VWGA 4KAJA 5FQOA 1S3SA 1BCSB 5AVXA 2NO6A 2BJVA 2FWJA 3QKRB 3LX4A 1RYBA 2XXAB 4IHQA 4U3JB 2DPXA 5I3ZA 3CKLA 4ZHSA 1KI6B 3L79A 4KVAA 3GRAA 2FMXA 1GEEA 2V5UA 1PR5A 2PK3A 3HB5X 5AXBA 1DTEA 5JZVA 4UOZA 3UWMA 1O5TA 2ZT5A 3QRWA 4O0MA 3M49A 1FLDA 4IX9A 2IDJA 2V65A 3MOSA 4GYWA 1QV9A 2ODTX 1POWA 3NBZC 1HDEA 4OXRA 3DQPA 3Q85A 1O57A 1USUA 1RJWA 2ZJ5A 2TMKA 2C9CA 3EA5A 4M0EA 3VRHA 3X1XA 3ZBPA 4JT2A 5L3ZA 3UAYA 2XQVA 1L3BA 3OZXA 1NSTA 3HB7A 4AZ3A 4MLPA 2YZKA 3OTGA 3RC3A 2XB2A 1TCAA 4GRDA 3L0YA 1TKAA 3VO8A 4JR1A 2Z8ZA 3B5IA 3SM3A 3ASVA 1RKUA 2V9ZA 3RARA 3VR0A 5LR6A 1BGWA 3SC3A 2VTDA 2GHRA 5KYKA 2FOIA 2GESA 1L8LA 2G25A 5ADVA 1VECA 2GPNA 3B78A 5HJEA 2BR4A 2CUZA 2F7SA 3TCNA 1XNGA 1X19A 1FRQA 3L6BA 3L0OA 2N75A 1QYVA 2F4VB 3KXPA 2EFCB 2VWPA 1NUPA 1N1EA 2XUJA 2AZXA 4CDGA 1VHLA 2P6RA 1KDTA 1GAJA 1E99A 2FE4A 2LXNA 5JC1A 4KVFA 5E1BA 2GR9A 2GPBA 4MQFA 4MVJD 4Q3LA 4ZODA 2P1DA 3FMVA 2OHVA 4CMEA 3L4KA 4GVPA 1LGYA 4E12A 1V3TA 3L0SA 3FRHA 3FOCA 4NCXA 2CYCA 2V6GA 1CZKA 2PKQP 2NU9A 2C4MA 3MXTA 4LVCA 5J9FA 1L4KA 3U19A 4UHBA 4R2JA 4I1PA 3NRBA 2ZRJA 4CNQA 3Q15C 2YRWA 4JLBA 3I6IA 2V9CA 1K86A 1OTYA 2BGNA 2HSEA 5GAJA 2H1VA 2W2MA 3K70D 4XSVA 1G8YA 4BO2A 4DGSA 3DH0A 1UKAA 1Q1AA 1UXKA 2VQ3A 3QVOA 4MUNA 3WK4A 2OGWA 4N0PA 1GCUA 1WCIB 2VXOA 5AW7A 4N8EA 3HJNA 1ENYA 1W94A 1XG5A 4XRRA 2J0UA 3DOIA 1XA0A 2WM2A 1QCZA 1E64A 1NT4A 3DLPX 2BF4A 4AZTA 4E03A 5FEUA 4RGQA 4MUBA 5FTJA 2HH9A 4E5NA 2WTAA 3JVIA 1KFBB 4ECEA 4URZR 1JQAA 2I66A 2AHOA 2YFKA 4LYYA 4MVJH 3QEOA 3GEMA 3NTOA 4EHJA 2AEFA 2YC2C 1L5LA 4L4XA 5I7FA 5BR7A 1IN8A 1I51A 1N5IA 3KZKA 4TKVA 1M1NA 3KWJA 4G4SO 4ITUA 4RVHA 3BTUA 2WUGA 5IWAB 3FROA 3O92A 2L18A 2N0SA 3KB8A 1CUFA 5FOTA 5CA1B 5IZ4A 1SH7A 4Q05A 5DO9A 4UJ3A 5E6SA 3PI6A 1C50A 4NPCA 1Z4MA 4B32A 1ADFA 1P1RA 3D3KA 3EAFA 4DKJA 1DCMA 3EUFA 1TW3A 5J4YA 3EGWA 1YQDA 2O1WA 1R15A 1FS6A 4WRRA 3PJRA 1E1RD 3F7MA 1DARA 5FDFA 3I32A 1DZ3A 1SZJG 5AI0A 5KU7A 4NAHA 4ZPXA 3T3EA 3QYAA 2BBTA 4ZOCA 1SCKA 2XUOA 3RD5A 3KLBA 4ZRNA 5FAXA 3N59A 2X0DA 4ICIA 2RARA 4JXKA 4OKSA 4DV4B 1FBNA 3DWIA 1KERA 3SYNA 2PXXA 4FYVA 3AL2A 5KCZA 1O2DA 4RU1A 1K2WA 3CO0S 3OPQA 1XN1A 1P3Y1 1PAUA 4W7HA 2C7RA 2GGSA 3JD2A 3KFXA 2DBRA 2VR1A 3MB8A 3DL0A 1O3YA 4DR5B 2A0UA 3O74A 4J9UE 1ZN8A 4KWEA 2IPAB 1ZBQA 1T2AA 4PEVA 3OWXA 1L7OA 1SOAA 1Y3IA 2QTLA 2A14A 1X6VA 3N7UA 3NIWA 1UJ2A 3GLGE 1ZIXA 3RSGA 3GCDA 5J43A 3WKEA 2JCVA 4K87A 1JMKC 5HE9A 4MA4A 3RAGA 1E1MA 2PAAA 2DTEA 1ESEA 5KVCA 4TXHA 1Y89A 5JLJA 3LFHA 3ND8A 2DWCA 4P1ZA 3NC4A 4F2GA 5FUMA 2AHRA 3HSYA 4QBHA 1DAHA 3RRZA 4EHAA 4IDDA 2IPXA 2QMOA 3A7DA 2W8BB 3CW9A 4BJ3A 4YH1A 1E0AA 4CLXA 1KO5A 4HDQB 4BP8A 4R2KA 2IGBA 1OXUA 4U7JA 4W99A 2V97A 2HA7A 2OHHA 1SC6A 5LQKA 3WZLA 2Q6TA 4QUDA 2ODWA 1N2BA 4IW3B 1EFDN 1USGA 2I2FA 4Y0NA 5JTTA 3NWPA 1ZD4A 3QV2A 5KOIA 3BT7A 1C8KA 1XDUA 2JIZD 1WV1A 4QHSA 3FYTA 2WHQA 3WR5A 1T36B 4B48A 2IYZA 3RIXA 1EIZA 1FYWA 2HMUA 1E1YA 3IXQA 1TJYA 3WDSA 1A3CA 3GJYA 4HVAA 3FYCA 3C5VA 2GTHA 2ZE8A 2IXDA 4PS1A 3SKVA 4MICA 5C1DA 3TLAA 5JDIC 3PR1A 1KI7A 1NXOA 2Q45A 3A0RB 1ZY2A 3EA0A 3GOQA 3KR2A 4OSPA 5AQEA 3T99A 1FIUA 2EDCA 5TT0A 3WMXA 2WM3A 4DUZB 4LN1A 4Z9FA 4ETMA 3CPHA 4FGLA 1O6ZA 1V1RA 2XODA 3B7GA 3HQ4O 3JSXA 3K8ZA 4GI7A 4ZEMA 2PKQO 2PSDA 4I4IA 4WOCA 5B6JA 3JQRA 4TWJA 1U0HC 4CLEA 3AF3A 2IOFA 2R48A 2C9DA 1M5RA 4JLWA 3L2OB 2UV8A 4M22A 3CZPA 3O3MB 4OA5A 4QFCA 4X92A 5FPQA 2OV2A 3VDNB 4BFLA 2BKUA 4YAOA 5MFZA 5JS1A 4L74A 2XF8A 2QN8A 1CHDA 1GZ4A 1XC7A 1GCAA 5B1YA 1J7KA 1OZFA 1IDN1 1JJVA 1Z5GA 2IUSA 1E6MA 1OFHA 4GW3A 1VE6A 5FH9A 1J24A 1P0MA 3MK31 5H68A 4NBLA 4UVEA 5F7JA 1I9GA 1BO6A 3D1JA 4W7IA 3J81A 3GT4A 3S8EA 4KHZA 3DXFA 1MB2A 5HZMA 1BW9A 4AKHA 3CONA 1RIIA 1L7RA 1UFVA 2BR3A 2C4TA 4R0NA 3H2KA 4MV1A 2AJ8A 1SZPA 1V26A 1JECA 5FHQA 3VSDA 1RM4A 3SZOA 4AUNA 4EKNB 4HPWA 3U7GA 1W6RA 4JA0A 2OO7A 4XWGA 1DKMA 3BJMA 4IUDS 2GZMA 4NWIA 1VKJA 1SXHA 1QWSA 2XA9A 1L9KA 3NTXA 3U9LA 5C18A 4G5RA 3HCWA 4PCVA 2PJZA 1T0IA 4FFNA 1KAQA 2QL9A 1T5LA 2YUIA 3BRCA 3JASA 4FYKA 1DLIA 1OC2A 1DS6A 1WLYA 2YVQA 3IPRA 5FI3A 4EQ6A 4TZ6A 4J94A 4ID9A 3MUNA 4CM9D 1QDEA 1XLUA 1TC2A 3AR3A 1M2KA 3I2FA 4HRYA 4O59O 2ODAA 1AKMA 3HDGA 4JYCA 4QOJA 3HVIA 1ZMRA 2X1LA 4TZTA 1GGHA 2W2TA 1EYZA 2KLBA 3MT8A 4DIEA 4G0NA 4PLZA 3HKCB 1PJLA 4K9DA 1W0KA 4E1BA 1JQKA 1PFUA 1XROA 4D9FA 2PZBA 5FXMA 5IN5A 1XEXB 2PSSA 4IRXA 2NVUB 4JWKA 3IUBA 4Z7OB 2WF6A 4RMNA 3TNLA 5DDIP 3CX6A 3LVRE 1I2ZA 3ZI4A 1KR2A 3MCZA 4CM4A 4IRMA 4EJFA 1GLNA 1TX4B 1NF8A 3G2LA 1X86B 3RC9A 1U3WA 3OLWA 3UV7A 2R8XA 2Q2VA 3K9NA 1FJHA 1JLRA 1P2BA 3OT1B 1LZKA 5CFLA 3OD1A 3FPSA 5BYBA 1CZRA 1JT2A 3RVOA 2FLWA 3L6UA 5TS3A 1XD2B 2O2GA 1S89A 3ER9A 3KU1A 1TK2A 2QT0A 2HFKA 3VR5H 4ABYA 2VPXA 4RTKA 5E9QA 4P3YA 3FUCA 4XGQA 5IJ0A 3PKIA 1TEVA 2C42A 1DX6A 1WUKS 2OKCA 3FWPA 4QOEA 2WW8A 5EZSA 3CNQS 1Y1RA 3X1MA 1WXFA 5EE5B 1D2GA 4RH1A 3VYUB 4HL6A 4IFIA 3FF1A 1A4RA 1VFNA 2QYOA 3IAAA 3UJPA 1M2VA 3L06A 3ONWA 4WE3A 3RS5A 1CYDA 2F3PA 1C9DB 2GCGA 3DMFA 4P4UA 2BHTA 4HGNA 5L7YA 4GZ6A 5EPOA 4IJQA 3EDYA 4J16C 3S8MA 1QUEA 4GPAA 5J2UF 4ACAA 4CXMA 1T1GA 1YQQA 1OXBB 1BXGB 1NMSA 3HN7A 4QXAA 3GDHA 3VC2A 2Q21A 4F38A 1CX9B 3G2IA 1SUEA 1M1YA 2BRUC 2Y77A 4MUGA 5E2IA 4BQOA 1C4XA 2I6FA 4WKCA 5KSOA 3WISA 4DJFC 1NZFA 4BTVA 1N2SA 2WZCA 3R3ZA 4ZI5A 3MEQA 1L3IA 1R64A 3MD9A 4IX1A 4DMKA 2ZM5A 3ISTA 1WE2A 4FZVA 4ZKEA 3ITDA 3EIQA 4C2AA 4G07A 3KR1A 1T15A 1U0NA 2RIRA 3IXMA 4RVOA 2G4VA 1YIOA 3BF7A 3A27A 2XAAA 4MJLA 1J5EB 1BU8A 1QHGA 2OQVA 4QU5A 4DLVA 3VUFA 1U8AA 3UBMA 3WNBA 2SICE 2XT0A 4J0IA 2D59A 5IXYA 1TKRA 4YP1A 1CC1S 1D1QA 1T3ZA 2PGLA 5CLLA 2V