2PK3A

Crystal structure of a gdp-4-keto-6-deoxy-d-mannose reductase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
309
structure length
309
Chain Sequence
b'MRALITGVAGFVGKYLANHLTEQNVEVFGTSRNNEAKLPNVEMISLDIMDSQRVKKVISDIKPDYIFHLAAKSSVKDSWLNKKGTFSTNVFGTLHVLDAVRDSNLDCRILTIGSSEEYGMILPEESPVSEENQLRPMSPYGVSKASVGMLARQYVKAYGMDIIHTRTFNHIGPGQSLGFVTQDFAKQIVDIEMEKQEPIIKVGNLEAVRDFTDVRDIVQAYWLLSQYGKTGDVYNVCSGIGTRIQDVLDLLLAMANVKIDTELNPLQLRPSEVPTLIGSNKRLKDSTGWKPRIPLEKSLFEILQSYRQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-6-deoxy-D-lyxo-4-hexulose reductase
publication title The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
molecule tags Oxidoreductase
total genus 117
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 1.1.1.281: GDP-4-dehydro-6-deoxy-D-mannose reductase.
pdb deposition date 2007-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pk3A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2pk3A02
4XD2A 4BKPA 4DIBA 3PTZA 4D3FA 3ZU3A 1TLTA 3SLGA 3PLNA 4K26A 4CLDA 5IZ4A 4XQCA 3HWRA 1NWCA 2GN4A 4RPHA 5BSGA 3ZU5A 4GX5A 4F3YA 2H6EA 3ZWXA 4IS2A 1PR3A 2BGLA 4DXHA 4XYBA 1GV0A 3AI2A 2I67A 2YV1A 3RU7A 3KHUA 3A14A 3H9UA 5B4VA 3PVZA 2Q3EA 2SCUA 2AQKA 2X1HA 5DOZA 3BMCA 4WPGA 1MFPA 3CZMA 1PZEA 3ENNA 3GVPA 3DZKA 4WNCA 5GMOA 3UN1A 3WFJA 2UYYA 4I5GA 1YJ8A 4DQVA 1H93A 1YS4A 1YL5A 3KZVA 1O6ZA 1QYXA 3D4OA 4JGBA 4BNTA 3B6ZA 4YRDA 4PLGA 3WIEA 3H65A 3WLFA 4KWHA 1TEHA 1GUZA 3AUAA 3GAFA 3RIHA 1B7GO 4MP6A 3M6IA 4O5OA 1JLLA 2OUIA 1FDSA 3K5PA 4PLYA 4YBZA 2PWZA 5COQA 2EF1A 3F9IA 3U3XA 3JQ7B 3JQFA 5KOIA 1HE2A 1R4NA 2YFHA 1HDGO 2YHIA 2ZTVA 3ZI0A 3PIIA 2EXXA 1ZFNA 6LDHA 4FPXA 1FK8A 4GLLA 2Y1DA 4E2XA 1Q1NA 5HTOA 4AJLA 4A27A 5JAZA 1IHYA 2Q2QA 1Y8RB 4J1NA 3U49A 3OSUA 1UDCA 2O48X 4XKJA 2CUKA 4EYEA 4TSKA 4B4OA 4AICA 3RBZA 1MLDA 1DB3A 1C1DA 1X7GA 2AEJA 4K6CA 1T25A 1Y8QA 2Y1GA 2P2SA 3RASA 2FPPA 4BO0A 3E82A 3FR7A 3T7EA 1LQTA 1YOVA 4LN1A 3RCBA 5GZ6A 3DZFA 5GY7A 2VUUA 1KBZA 3CSDA 1Z75A 1GQ2A 2C29D 3VPGA 4J4BA 3E5MA 4TKLA 3RBVA 4GVXA 3PWSA 4G65A 2JCYA 4KUHA 3WOHA 3BHIA 4DBVO 2CMDA 1V3TA 1W6UA 2NACA 4OKIA 4CL3A 3FNFA 3VZQA 5ITVA 2J6IA 3AY3A 5BQFA 2JFFA 3E9MA 1GY8A 4IIVA 4GKVA 4IQ8A 5EN4A 3OICA 1KOLA 1JWAB 3I9OA 3G79A 4ZICA 1HWYA 4U8GA 2P5YA 3ZU4A 4B3IA 3ADOA 1VC2A 2Q1TA 5T8KA 4B8ZA 4R51A 4CMEA 5BNTA 5KJCA 3JYLA 3RUHA 1VKOA 2Q2VA 3HNPA 4IQ0A 4WLNA 4K28A 4R1UA 1JW9B 3UHAA 1E7RA 2UDPA 1T1SA 2FR0A 5DNAA 4TKMA 3BHMA 5JFOA 4BB6A 3NT4A 3TNLA 1GQQA 3C24A 2CDAA 4BKUA 3E03A 1NVGA 4R1SA 2VQ3A 3TF5A 2WE7A 1ADBA 5BSEA 4MVJP 1FXSA 5T8KC 1HDRA 1TA4A 3BMOA 3Q2KA 2PZJA 4FW8A 4CMEC 3QJ5A 4L9RA 1ZBQA 2C59A 3VH3A 1Q0QA 3BA1A 2OGUA 4Z3DA 3RAJA 1B16A 3GEDA 3RC7A 4A73A 4D3SA 3GZNB 4L73A 4XDYA 5JCJD 3JYOA 3H2SA 1SC6A 3GNSA 2J3HA 4Q3BA 4R3NA 5HA5A 1W8DA 1LLDA 3VTFA 2DM6A 1NR7A 2DKNA 2YFQA 3DAPA 4Y6RA 4CMBA 4XGIA 3KETA 3JQ7A 3WSVA 5FEUA 2G5CA 2EIHA 1XG5A 3P2OA 4IDCA 1LDMA 3PWKA 3Q9NA 4JP3A 4BO1A 1WNTA 1YL6A 1ZEJA 4E5KA 2C07A 2E4AA 4XA8A 5JO9A 3RC9A 4GX1A 4AJOA 4ALMA 1M6WA 2GO1A 3I9KA 2ZQYA 1K0UA 1YB1A 1WXDA 4E5YA 1Y8RA 1HXHA 1XELA 2FR1A 4KDFA 4NMHA 4L0QA 4XX0A 1SEVA 1YB5A 3BAZA 2PKQO 4QFDA 3NJ8A 4U6QA 2JAHA 1KVRA 1I0ZA 3INRA 1UZNA 4YYZA 5ICSA 3DR3A 3RFVA 2YV3A 3VDRA 2R6JA 5KVQA 3S2FA 2AQ8A 4ZQFA 4IINA 3RU9A 2FP4A 2JFGA 4RPGA 2IZ1A 3RVDA 4IUYA 3AK4A 2Q4BA 3PZBA 4A26A 4PG6A 2IXAA 4NH4A 3ZNNA 4EEXA 1WAMA 4FJ2A 4HADA 4RLHA 1KY5A 2CVQA 1U28A 2Y05A 2JD0A 4LVUA 2IEDA 4E0BA 2QQ5A 5CDSA 4LRTB 1M76A 4MVJD 2GR9A 3O38A 2BFMA 4CMIB 5CDYA 3G1UA 2PK3A 2D3TA 3WMXA 4J6FA 3GZ4A 3P7MA 4YEDA 1RKXA 2BLLA 3PFWO 3KXDA 4CV2A 1A5ZA 4OOEA 4BHTA 4D41A 2F1KA 1D7OA 2HLPA 3F47A 1AUPA 1X7HA 4GMFA 1ZH8A 5DCUA 3H9EO 5COAA 5EINA 4EJ6A 2WEKA 1BWSA 3Q0EA 3AUSA 1F8GA 3NDIA 3JQDA 3UCFA 3EGOA 4FGSA 2EJWA 1I3LA 2AMFA 4M54A 4LW8A 4RL6A 1EUZA 1MXFA 1R0KA 5TX7A 5TF4A 4I9HA 4AJKA 5L3ZA 4XYEA 1PS0A 2OP1A 1NFQA 1Y7TA 3WTBA 2E82A 2CY0A 4XYMA 4CV0A 2O2SA 2J8ZA 2P9EA 4ND4A 1TT5B 1HE3A 4Q3DA 5C7OO 1HDYA 5JCJA 4BL5A 5I9NA 2Q1UA 3GZNA 3QHAA 4K1LA 4R9SA 5C5IA 4UAGA 1I2ZA 3G17A 1EVYA 2DC1A 2IE0A 1XEAA 3PJDA 3K31A 4U7WA 4CUZA 1HDCA 4E4YA 4NU5A 3FBGA 4YT8A 3I83A 3I9JA 4IDBA 4XQEA 4Y98A 1LSSA 5I7SA 1ZW1A 3QLJA 4YTEA 4CM8B 4NZ9A 1L7DA 3FF4A 4W4TA 4FIZA 5AXAA 2BMAA 3SJUA 2HJRA 3IJPA 1SO8A 1NPYA 1DAOA 1CIVA 5DZSA 4ND3A 5JY1A 2V6FA 1XWFA 3JD3A 2V6MA 5DT9A 1VJ1A 2GDZA 4F6LA 3DZIA 2BD0A 1ORRA 1O0SA 4TVOA 1ZMTA 3GN1A 2C5AA 3F1KA 3DBLB 4RF4A 3ZNQA 1X1TA 4MO2A 3R6DA 2YQ4A 1M75A 4YRBA 3W4JA 1WZIA 3TRIA 4P38A 3U4DA 1RJWA 3EHEA 4BO4A 3P5SA 4CUJA 5AXCA 4DMLA 3MTGA 4EEZA 1DRWA 2HUNA 2WD7A 3KVOA 5KVSA 2GGSA 4FFMA 3DXFA 3GVIA 4MVJA 3JTMA 1DIAA 6ADHA 2DVMA 4H16A 4CMIA 1BDBA 1H6CA 3MZ0A 3OJEA 4FS3A 1W0CA 4XR9A 1R0SA 2EKLA 5G0TA 5C7IO 3QWAA 3OJLA 4IDDA 4CR8A 1ML3A 3JQ8A 2WYVA 1EVJA 4A5OA 2YHUA 1P1FA 2X0RA 4YVFA 2WMDA 1EK6A 1MB4A 2PZKA 3LT4A 1MGOA 4INAA 1H9AA 3U4HA 4GMGA 3I4FA 8ADHA 2NVUA 3ZHYA 2WE8A 4IY1A 3HFGA 1P9LA 3H9GA 2VRCD 1XCBA 1EVZA 4UUMA 3A1NA 1GR0A 3CZRA 5IXSA 1E77A 4CM3A 4YJHB 3O26A 1GPJA 5IDYA 1DIGA 1I3NA 4WLVA 4W99A 5TS3A 3FNGA 2E37A 5CEFA 5F21A 4YJDA 1YGYA 4GWGA 3WBFA 4DRYA 3NTRA 4MJLA 1TT5A 3HDJA 2C20A 1Q0LA 1V9LA 2C54A 3F6YA 3GR6A 1I24A 4DA9A 4PIVA 3KOUA 3O9ZA 3W4KA 3WGGA 2FRDA 3OQ1A 3OIFA 2Y1FA 2YDXA 4DTIA 1X0XA 3E1KA 3FCOA 4YACA 5JNLA 1QV7A 4MVJH 1GL3A 2I66A 4QECA 2IXBA 4OO3A 3INTA 1ZJZA 4B3HA 1J5PA 3U0BA 2CDCA 2EKPA 2Y1OA 2P9CA 4CM8A 3C7CB 3FNEA 2VYNA 4JJFA 3EVNA 5TLSA 1NX6A 2GERA 4R68A 4ZGWA 4ZQBA 4LMPA 3S2GA 4S1VA 4J1SA 4BO9A 3RJ9A 1FDTA 3HDYA 2GSDA 5J23A 2BELA 2TMDA 5G0WA 5L4LA 2Z1MA 3W1VA 4RZIA 1NVMB 2Q99A 3HB5X 1CDOA 4UVIA 3T7CA 3DL2A 1P44A 1HKUA 3FWNA 3JQAB 5GZ1A 3DBLA 2EG9A 4J91A 3JQAD 4DLLA 1U5AA 2QRLA 2FSVA 1U2GA 2B4TO 4Z9YA 2ZATA 2BFOA 3B70A 3NRCA 1VJTA 1MC4A 4TWRA 2GASA 4YJGB 1JKIA 1UDBA 4RV9A 5HBRA 2GZ1A 1P3DA 4OIMA 4OQZA 7MDHA 3OJOA 1U7TA 3ITDA 4LSMA 5F1OA 2NUAA 1ENOA 4M49A 3GG2A 1CYDA 1YE3A 4GPD1 4IZIA 4MVJI 5T57A 3V5NA 2AA3A 1V3UA 2JHFA 5I7FA 2ZTMA 3OFSA 1P31A 2OZPA 1MV8A 4C4OA 1D8AA 5TRTA 3ASVA 1IHXA 1Y9EA 3S55A 1HSZA 3AWDA 1K6IA 4FOOA 1QR6A 3I3OA 3WYBA 3KO8A 1DLJA 4X54A 2YZ7A 2ZYAA 4B4VA 2HMTA 2NNLD 1BXKA 2FY8A 3WNQA 4CQMD 4CLRB 4N5MA 1QV6A 2VRCA 1MG5A 1K6XA 2OOSA 3L4SO 2AEFA 3FWZA 3VPXA 4E2WA 3QY9A 3H5NA 4YJHA 3QW2A 1M6HA 3JQ6A 3I4CA 3LT1A 1YDWA 4P4LA 3RJ5A 5BSHA 4Z0TA 1X14A 4IJVA 4WEOA 3KV3O 3TOXA 1P74A 1PR9A 2DLDA 1OZAA 2Y93A 5G4KB 3FNHA 4D46A 5DN9A 4CMGA 1YB4A 3I9LA 4ND2A 4W9NA 1MXHA 2IZZA 3C3XA 5EQFA 4DBZA 1WVGA 3FI9A 3JQBA 1HZJA 3M2TA 4IMPA 3ADPA 3CTMA 4LMRA 4MVJG 3QP9A 1JN0A 5MDHA 1GZ6A 2HAEA 5G0SA 4U6SA 1WDLA 3WQQA 3K2BA 1BVRA 3IKTA 1YO6A 1GV1A 3TSCA 1K6JA 1ZEMA 1C0IA 3HADA 4PZEA 1PSDA 1IULA 2VHWA 1P1RA 4W9NC 3RKRA 1AHIA 3JQBC 5AYVA 4J1TA 4YA6A 4CMAA 4NBRA 3WYCA 1MUUA 2VUTA 4Y6SA 1DXYA 2JKVA 1E1NA 3AM4A 5A05A 5KIAA 3HQ4O 7ADHA 1AHHA 3JQAA 4YR9A 3VOSA 5BNIA 1I3MA 2R00C 3FR8A 3NV9A 3ANMA 1A72A 2PNFA 1D1TA 3B1FA 4FFLA 4JN6B 4YJGA 4GSLA 5U9CA 4U0KA 4OXNA 1GD1O 3B1KA 4TVBA 3H5AA 1T4DA 4NQZA 1NAIA 3LSYA 1QYWA 1DEHA 4L76A 4Q3CA 5TQVA 1J49A 1RM5A 4W82A 3Q6IA 3PGXA 3ZW8A 3IAHA 2O3TA 2VCYA 1N2SA 2B5VA 3MCVA 1PJ4A 3OA0A 4DL9A 1KVTA 3ROMA 1P33A 4IDEA 1X0VA 3SLKA 1R4MB 2X0JA 3LK7A 2H63A 4DYVA 1U7HA 4RVDA 2O4CA 3G0OA 3PYXA 4D45A 4YT4A 1A9ZA 3DBHB 3H5RA 3PEFA 1BHSA 4QO8A 1PGOA 4Y67A 5C7LO 3NYWA 3FTNA 1SNYA 1LA2A 4MVJM 4R01A 4NR0A 3K6JA 4FD3A 1UAGA 3L77A 2W4QA 2VHZA 1NQOA 4NBWA 2NU6A 4QSMA 4DQXA 1DIRA 1XR3A 3DBVO 3GLQA 3KSUA 4BMSA 1MX3A 2UVDA 4E12A 2VT3A 3QWIA 1DOHA 4CM7A 1ZK4A 2GZ3A 3OQBA 1UZMA 4YAIA 4WE3A 2H5LA 2OXIA 5I9LA 1CEQA 3O03A 1YL7A 1E5LA 1GTMA 3H9JA 1TXGA 3ICCA 1GUFA 1FDUA 1E0DA 2Q49A 4GAEA 2VUSA 4TZTA 2EV9A 1R6DA 2A35A 2G76A 4QTZA 2POQX 3WX0A 4JROA 3L9WA 4UVHA 1IOLA 4GLOA 1ISIA 5G4KA 1RPNA 4TRMA 3MJCA 1D3AA 3KYCB 2P4QA 5K9ZA 1XGKA 3FPLA 1WP4A 5ENVA 3O8QA 3NT2A 1A7KA 5KJEA 3RI3A 3GH3A 2RHCA 1A27A 2PH5A 2ET6A 1V6AA 3MOGA 3ZN2A 2NTJA 4I08A 2HRZA 1UR5A 4H3VA 4BUCA 4QFCA 1JVSA 3Q9UA 3OJFA 2I65A 3H3JA 4FN4A 2B37A 1DFGA 4WECA 4WKGA 2Q1WA 1ZK3A 3H8VA 2Z5LA 5A9RA 1RM4A 1RM3A 1R66A 3LC2O 3VZPA 3A4VA 3TWOA 1ARZA 3WGQA 4I8XA 5JE8A 4BO5A 1BDMA 1N8KA 4D42A 3LF1A 4PRLA 3AI3A 4AFNA 2PLAA 1J6UA 4DLAA 2RCYA 4HKTA 2DPHA 4DMMA 1DC3A 1PX0A 5G4LA 1A9YA 4ZU3A 1WLYA 4R16A 4CLOB 3V1YA 4Y8VA 4J0EA 3K73O 3HSKA 3V2HA 3COSA 3NDJA 3CE6A 4S3MA 4E33A 1NQTA 4NHEA 1U9JA 3TOZA 2X9VA 2HU2A 3WBBA 1IB6A 3PJFA 4KOAA 2Q2WA 2DUWA 4OMUA 4B7UA 3K30A 3G1TA 2PKRA 3RC2A 2H1SA 5U1PA 5JXWA 2PH3A 3NGXA 1LEHA 3NX4A 4R41A 1HE5A 1ZIDA 1LRLA 5F5LA 4RPJA 1HLDA 1OBFO 1U2DA 1KY4A 3BYZA 3QVSA 3U5TA 4Y9DA 3KLMX 4TRJA 1QP8A 4Y6PA 4MPDA 1VJ0A 5KJ6A 3JQFC 3LU1A 3X2EA 2AHRA 2B5WA 3DBHA 4KZPA 1JDJA 2Y68A 2IZ0A 3FPCA 3R3JA 1LDGA 5CDGA 4J43A 5FYDA 1DPGA 3VZRA 3DBRB 4EW6A 1IE3A 1ZSVA 2RIRA 1G0NA 4UREA 3B20A 4NBVA 3JCZA 2NADA 4J9VA 3C7DB 4XIYA 4NK5A 5EJ2A 1YRLA 5ES3A 1IYZA 1PJSA 2NSDA 2RH8A 4XCVA 2O7QA 4DPMA 2ZCVA 4TRRA 5G0UA 2GPTA 3VPSA 3D5TA 3F5SA 2PZLA 1M66A 4YRAA 2E48A 3DZBA 4IIUA 5A4DA 1ONNA 4NBUA 3I52A 1I3KA 3D4PA 4IDGA 2CF5A 3HDHA 1XIVA 1QMGA 4PG4A 3KYCA 3S8MA 1F8FA 1HYGA 3DMYA 4BQRA 4EDFA 4DIOA 2PZMA 4NBTA 4Z9XA 1HZZA 3V1UA 4CM4B 1M67A 2BF7A 1SB8A 1PQPA 4O6VA 2W2KB 3TZCA 3DWFA 4P22A 3MOIA 3ZWNA 1TT7A 3EDMA 4E30A 4IJWA 3MJTA 5EESA 2X9GA 1C0KA 3I6QA 4GX0A 5C37A 2C82A 1L1FA 3QVTA 4CV1A 1Z7EA 4E2YA 4O0LA 4A10A 3H9QA 3IMFA 1LDNA 4WOJA 2EERA 4CL8A 1JAYA 3KBOA 2EGGA 1BXZA 3ONFA 5H82A 1GADO 5DF1A 1MP0A 3ZV6A 3BTOA 3OEYA 3GN2A 1BXGB 3JD4A 1GUYA 3G49A 4ALLA 4FR5A 2EWMA 5DBFA 1KVQA 1TI7A 2HKIA 3PZRA 3TN7A 4BGIA 3WR5A 3D1LA 5CPFA 1K89A 1UXHA 4CLOA 3DO5A 4RPLA 4BNMA 3JQ9A 3DZHA 2VTEA 1UXIA 9LDTA 2CZCA 4JP2A 3KLPX 5K6AA 1XLTA 1D4FA 3S2EA 3OP4A 1E1LA 1NPTO 1SCUA 2FWMX 2WDZA 1MC5A 4L75A 4OAQA 1Y6JA 3OHSX 5A9SB 1GQYA 3PQDA 3RWBA 4CV3A 1W73A 3JQCA 1VI2A 4RVHA 5L51A 2G82A 1U1IA 4RQTA 1T4BA 2O23A 4RVUA 1F0YA 3DAFA 4URFA 4E5NA 1KIFA 2I6TA 3R3SA 1PJ2A 4YQYA 4R1TA 3JQ9C 3E48A 3GDGA 4CJXA 1AXEA 3S2IA 3TZQA 4E32A 5A03A 4AJEA 2C2XA 2D8AA 2X22A 2HJSA 2P91A 4ID9A 3RBXA 1DFHA 5JAQA 1GAEO 4OSPA 4D0RA 1F14A 3DBRA 1YQXA 3GY0A 3O4RA 3M1AA 2ZB8A 4ILKA 1DBVO 4TQGA 4ITUA 3MTJA 1VSUA 4Z6KA 2W2LD 2DPGA 5KKAA 3JV7A 1H6DA 1T2DA 3NT5A 3KEOA 3IUSA 4Z0HO 4BNUA 4NJOA 4ZD6A 3WQRA 1NR1A 2AE1A 2VZ8A 3SX2A 3A28A 3NJ4A 1MFZA 2DBQA 3AFMA 3TQHA 4PZCA 2Y66A 4RCVA 4BNJA 3GMDA 4XRRA 1CQIA 1DAPA 1VPDA 3WGOA 1GZ4A 4CM4A 4KQXA 4WCDA 4EUHA 4GVLA 2G1UA 1J0XO 3L9XA 3GPDG 5JAIA 4MVJF 4EJ0A 1X7DA 1LNQA 4DGSA 1Y5RA 2VZ0A 1LLCA 3GPIA 1H5QA 2AQHA 3RROA 4E13A 4UUNA 2RBEA 4J7XA 4BO8A 4ALNA 4BNYA 4BNIA 1PJCA 2EEZA 4HBGA 3WYEA 3WB9A 1K2WA 5AVOA 3IJRA 2QX7A 2VWQA 1I5RA 2AEMA 1BXGA 3DHYA 4FFPA 4I9UA 3KYDB 2B83A 2X5OA 4CM1A 2IYPA 2CVZA 4H15A 4LGVA 1O8CA 3A9WA 3E18A 5KWEA 1MG0A 2Q1SA 5L7TA 5JY6A 2NTVA 3IIEA 4OYRA 3FBTA 4IXTA 3EK2A 4J2HA 3DOOA 2WJPA 4B7CA 2W98A 2X8LA 4FGWA 4QT0A 5ER9A 4R5HA 1UP6A 4BS9A 1S7CA 3BXXA 3WWYA 3PHHA 3RUIA 1EFLA 3D3EA 4NFYA 1F06A 1GFSA 3SVTA 2VHYA 2VYND 5G2OA 5TIIA 5L7WA 3NGLA 4UVDA 2JHGA 4NFHA 3BTSA 4PLFA 2X58A 4LK3A 1JA9A 2ZQZA 4N5NA 4BNFA 1JKFA 5IN5A 4HUJA 3DTYA 2FPGA 1YVEI 5EIOA 1I8TA 5CAEA 1HL3A 5L45A 2DTDA 5L40A 1GCUA 1PJTA 2O4UX 3CIFA 4QUKA 1VKNA 1B8VA 3SBOA 2W2LA 5I7VA 4ALJA 5DBIA 3D7LA 3QIVA 1T2CA 3ZWVA 3PQEA 4HNGA 1NP3A 3KEQA 3P2YA 1EDOA 3H4VA 4TZKA 1DC6A 3KSZO 4XB2A 1RWBA 2HMWA 4YXFA 4R9RA 5DCYA 1R37A 2Y1EA 2JCVA 4BNGA 3PXXA 2X5KO 4PLTA 4OL9A 3EUWA 4CMJA 5JAMA 4WLUA 3ZV5A 1Z73A 3MJEA 4EITA 2IEBA 4J3FA 5JDIA 2W90A 5A04A 2J5KA 4IS3A 2I5PO 3GGPA 4JX8A 2UUOA 3PWZA 4JQCA 4FJ1A 1DJNA 3AY7A 4B4WA 3GDOA 3LQFA 2BHLA 5B12A 3PP8A 4BKOA 1I36A 2VHVA 3GEMA 3HB4X 4UEKA 1B3RA 1Q7BA 1U5CA 3C1TA 3TL2A 5JDIC 3AI1A 2PA3A 4A03A 1SEPA 3GFGA 2O3JA 4IDFA 4ZQHA 2NV6A 2NTNA 4C7JA 5BSFA 2JD1A 4OOFA 3JYPA 3RFTA 2Y0CA 4AJJA 3ZGYA 4JBIA 1RYEA 1BVUA 3VKUA 4H7PA 4D7AA 1I33A 3DHEA 4IJKA 4J2OA 2Y1CA 3ICPA 4P4NA 5ILGA 4PLVA 1ZK1A 4EI2A 5JS6A 4TMFA 5MGBA 4HFJA 1YJQA 4R3WA 1C14A 1Z45A 2AE2A 3LC7O 3PDJA 4ZQGA 5B37A 2CSUA 4ZQEA 1B14A 1U4SA 1JWBB 3MEQA 1ENYA 3UICA 1ID1A 5IJZA 5JC8A 4AJNA 1EQ2A 1DC5A 3GUCA 5DCWA 1Y1PA 2PTGA 3LDHA 4G2NA 1PZHA 3W4IA 1UXGA 3CEAA 3H7AA 1B3BA 1A4IA 4KP7A 3KYBA 5G0VA 3DOCA 2X86A 3PFFA 1GPDG 1PU2A 3VPFA 5F3RA 3FD8A 3FN4A 4RDIA 5L4SA 1H6AA 2HSDA 3ZU2A 2V7PA 1IUKA 4O63O 3SXPA 1E7QA 4MDHA 3F1LA 3ZWWA 1IY8A 3Q2IA 5I8ZA 4C7KA 3QSGA 2X0IA 2VTDA 1WWKA 4II2A 4BKRA 1ZZEA 3GA0A 4EJMA 1T2FA 1O95A 5FFFA 2VWHA 1ADFA 1MA0A 3ZW9A 1LLUA 3JYQA 1ADGA 3E9QA 1P45A 4TRNA 1IZ0A 1N7HA 2CDBA 3JSAA 3VVCA 4LCEA 3NDRA 2WM3A 5A1TA 1X13A 4AG3A 1WZEA 1E3WB 1E6EA 1FDWA 3OBBA 3DFZA 5AXBA 1PQWA 1HYHA 1YWGO 3Q1LA 2NVBA 3L6DA 3LC1O 1GEEA 4CMHA 1NWHA 4EZBA 1IPFA 2EW8A 2PD4A 4PLWA 5JPIA 2OP0A 3VHRA 1DC4A 3TZ6A 3ASUA 3IS3A 3AY6A 1EMDA 3RD5A 4FFOA 4JCOA 3ETEA 4PG5A 2D1YA 1LC0A 3HE3A 4N5LA 5JW6A 2G17A 2ZB3A 1SAYA 2VOEA 3WIDA 1LRJA 5THKA 2CNBA 2ILTA 5IDXA 3ITKA 1VL8A 4U0JA 1OC4A 5BT9A 4XRGA 1ZJYA 1E3EA 2RH4A 4XB1A 3TPCA 4RF3A 4DVJA 3LT2A 1O89A 3ONDA 2PGLA 4FC7A 3V2GA 4MVJE 3GGOA 3MJSA 2DBRA 1U4OA 3AM3A 3GFBA 2GN8A 3SC6A 1ZKMA 3VAZA 5L95A 5CDTA 4J7CA 3U4CA 1SOWA 4B3JA 3UOGA 4J1QA 3OEWA 1EFKA 2TMGA 4MKZA 2PD6A 3F46A 3WGTA 3BMNB 1H0KA 2JD2A 2YJZA 5JYDA 5FI3A 4GWKA 3ETGA 3PI7A 1V3VA 2XPCA 3M2PA 5DULA 3CINA 2EP7A 5CFZA 1WDKA 4YJFB 3NTQA 5JBIA 1HDOA 4XGNA 3UGKA 4NPCA 2BGMA 1HF3A 5LDHA 1CRWG 3D3WB 2EKQA 3DC2A 1L7EA 2C5EA 1ZUD1 3EMKA 4IDAA 3LZ6A 1U3VA 2QRJA 3QWBA 3BMQB 4IM7A 1ZVMA 2O3QA 1WMAA 4P4GA 2GD1O 4M55A 3ROKA 2Y0DA 2QZZA 2YUTA 4ZJUA 4OH1A 1PZFA 1FMCA 3ZV3A 1HT0A 1ENPA 1GDHA 1GYQA 4DLBA 1P1KA 3WQSB 2X4GA 2C0CA 1NYTA 1LSJA 2YDYA 4RQUA 4WASA 1E6WA 1N5DA 4WJZA 2I3AA 3VZSA 3BHJA 3DEYX 4R4JA 4YDRA 4CM5A 3GDFA 1Q7CA 1XQ6A 4PVDA 4A2CA 3GVHA 3E5RA 3F3SA 1DRVA 4R54A 3GRKA 2PGJA 1XA0A 1SPXA 2WD8A 4NU6A 4GSKA 4CQLB 1E3WA 2JFHA 3AW9A 1H2BA 2D0IA 3DZGA 3R1IA 1GEGA 3GVXA 1Q2XA 3NTOA 4FFRA 3K96A 1AXGA 1NVTA 4KTTE 2B69A 3ZHBA 1Z82A 4WEQA 3KSDO 5ER6A 3ZDFA 2A92A 2QIOA 3DFUA 5CEEA 1KEPA 2WWRA 1GYRA 4MP8A 2I76A 2VHXA 2NM0A 3PJGA 4LCJA 1LUAA 1HETA 1R4NB 3WSWA 2P9GA 1JVBA 4RZHA 1I2BA 3G3EA 2OHXA 3A06A 3QVXA 4CLRA 2EP5A 3C85A 3TL3A 2EW2A 5CG1A 3TZKA 4UULA 1ISMA 1YQGA 1UXKA 1VLLA 4MIYA 4CR6A 4HV4A 2O2YA 3PHIA 1T1RA 1ZNQO 5IAAA 1XDWA 5KJFA 3BZUA 2BFPA 2D4AA 2J5RA 3BMNA 1ULSA 4XQ9A 3IOYA 3ROQA 4BGVA 4CLXA 1DHTA 1YOVB 2YYYA 1KS9A 4I1IA 1LSOA 3DDNA 3QVWA 3GHHA 3AU9A 3MWDB 4YJFA 1IPEA 5L9AA 4NNJA 3I23A 4A0SA 3BIOA 3ZHXA 4BO2A 3ULKA 3AJRA 4QO7A 2Y99A 3ZWYA 3D3WA 3D4NA 4CLEA 4JIGA 2R2GA 2Q45A 1NBOA 4WCFB 4NDNE 3AM5A 3PGJA 2QYTA 3BMQA 3JQEA 5BNFA 2JAPA 5GZ3A 3PYLA 4XJSA 4J4TA 1UZLA 1XHLA 4JXKA 1N9GB 1BRMA 1Z7BA 5B4UA 2C2YA 2GRAA 3BTUA 2UUPA 1DJQA 4DREA 1E7MA 4BNKA 4PG7A 1PGNA 1PL7A 3KRTA 4Q3NA 4N18A 3K2EA 1XU7A 1KETA 4N7RA 3V2UA 4UVEA 2ZTUA 2A4KA 1YKFA 2QG4A 2X6TA 4L8VA 1QXSA 3H3FA 5KJ1A 1YQDA 3IC5A 4CODB 3ENKA 4D0SA 1ADCA 1LU9A 1SOVA 4OXKA 3EC7A 4CPDA 4IZHA 1Y9AA 2JL1A 4D43A 5JDCA 3WGZA 1QRRA 3X2FA 4ZHSA 1PS9A 4BGUA 3FTPA 5EMHA 1VSVA 5CEJA 1HTBA 3L4BA 1ULUA 4PLCA 4CQLA 3NEPX 4RO0A 2ZB7A 3WMWA 3PDUA 4IGFA 5JMWA 3BMOB 2FZWA 1A4UA 5CDUA 1M2WA 3WTCA 1XQ1A 4G5HA 3WGHA 3K8ZA 5KVVA 3LYLA 5LC1A 3U62A 2UAGA 4HXYA 3OIGA 5JDCC 1LDEA 1R4MA 4RGBA 4ZRNA 5IF3A 2HMSA 1V0JA 4EUFA 1BGVA 2GLXA 3WGIA 1LTHR 3L4BC 4BO6A 4BNNA 4M8SA 1QYVA 3UKOA 5A3VA 2FOIA 3EY4A 4XJTA 1QKIA 1GU7A 1B8PA 1EBFA 1NPDA 3PPIA 4ONEA 4BOYA 1Y81A 1PL6A 1F12A 4PVCA 1DLIA 4E6PA 3MJ4A 4IBOA 1HDXA 3AU8A 4L4SA 5C3MA 2BFAA 1VM6A 2ZCUA 3HG7A 3T4EA 5CG2A 1PGJA 5FF9A 2J3IA 4XDZA 1IZ9A 4RF2A 4BNVA 4M87A 3JD2A 3Q11A 1X15A 1X1EA 2WSBA 4J4HA 2XAAA 3Q3CA 4J0FA 4M89A 2IRWA 4GKBA 3AUUA 1LQUA 1N1EA 3F4BA 2DBZA 4WUVA 2NU7A 2PV7A 1HE4A 3ZWAA 1DIHA 2RAFA 4AVYA 2NU8A 1FJHA 1NAHA 1B15A 1YXMA 2QHXA 2VZ9A 5B1YA 1VL0A 1BTOA 3QE3A 4RORA 3VDQA 3STHA 2O3UA 4J7UA 3L0DA 4WCFA 3UAGA 5I7EA 3ZWMA 5ITWA 4OJNA 4KWIA 1AE1A 1DHRA 3PJEA 2FSSA 2DFDA 1NXQA 1Z6ZA 3MJVA 1OAAA 4O59O 3E9NA 4Q3AA 1C3VA 2J3JA 1UH5A 2BKAA 1R15A 3ABIA 3F5QA 4G81A 4JBHA 3ETDA 2AXQA 4YAGA 1WDMA 1N9GA 2C7VA 4UUOA 5B4TA 1CWUA 2D5AA 4K6FA 4BV8A 4B8WA 2Q4EA 3EZYA 3TFQA 4E5PA 1R0LA 1PGQA 3GVCA 1E5QA 1KVSA 4JJIA 1KERA 4WCFC 3VC7A 3VTZA 1N92A 4ESOA 1UAYA 2NU9A 1EE9A 5TSDA 4WLEA 3OH8A 4GX2A 3DB2A 2VRBA 3S1LA 3I1JA 3ZWPA 1KEWA 4AJ1A 4DC0A 4LRSB 4XEHA 2O7SA 1NM5A 2WYUA 3ORFA 5CPBA 3W6UA 1PGPA 3WNVA 1P77A 4YAJA 3VH2A 4D79A 4I5FA 5ENDA 1QLHA 2BGKA 5KTKA 1E1MA 2JJYA 1U3TA 3FRJA 5TNXA 3TJRA 5IFLA 5KKCA 3L6EA 1O9BA 2YY7A 2ZYGA 3PLRA 5EPOA 4AJ4A 4ZN6A 3LVFO 1NHWA 2G0TA 4R69A 1U8FO 4BVAA 3FSRA 3IQDB 1K5HA 1TVEA 5L7YA 3VH1A 1HRDA 2BRUA 1HSOA 2EGHA 1FF9A 1SB9A 2VT2A 3CPSA 3QWFA 5K6AC 3C7AA 4PG8A 1ISJA 1EDZA 2DUUA 4XWYA 1DFIA 2VYVD 2OL4A 3GNTA 3EW7A 2IODA 1EBUA 3VKVA 1BG6A 4OM8A 1N7GA 1T2AA 2FZEA 5EL0A 4B79A 2HK7A 5HM8A 3CUKA 3K9QO 3WWZA 4NJMB 3OJ0A 3JQGB 1E6UA 1V8BA 3RC1A 4BO3A 3SJ7A 4CM6A 3GK3A 1NNUA 5A02A 4AL4A 4AJHA 3DQPA 4IQGA 4MKXA 5AXDA 4I9NA 1AGNA 3GRPA 3ZH2A 1E3LA 1H94A 4YQZA 1YH3A 4GQAA 3R0IA 1EZ4A 3E6AA 5T64A 4KUEA 3TDKA 3ZZNA 2GCGA 4DWVA 4R5MA 1LX6A 5IDQA 4HFNA 5HWSA 2Y0EA 4E31A 4NFSA 1LRKA 5ICMA 2Q50A 2B4RO 3U09A 4Z9FA 4HNHA 2PD3A 2J5QA 3WGYA 4CM9D 1GYPA 1C0LA 4ALIA 2FMUA 5DOVA 1NFFA 2CVOA 2RHRA 2V6GA 2W2KA 1EUDA 2WD7B 4BGEA 1XSEA 1LLQA 2HRBA 4RDHA 4Z0PA 9LDBA 4BV9A 4RPKA 2BH9A 2HO5A 1PZGA 1A7AA 2WYWA 5A9TA 2B4QA 5K0ZA 3W8FA 3U4IA 1P1JA 1ZXLA 2DAPA 3DONA 3WICA 3JQ8B 4WK6A 4PLHA 3ZV4A 3EZLA 3NAQA 4F46A 3EAGA 4KQWA 4UVGA 3H2ZA 4FC6A 3N7UA 1B0AA 5JC1A 3NUGA 4HFRA 2NVUB 4NI5A 2I3GA 3OIDA 3OECA 1GZ3A 5HS6A 3UXYA 2HMUA 1CJCA 3HUDA 4OHUA 4EGFA 3VVBA 2VN8A 1XKQA 4BB5A 5A9SA 2QW8A 1TB4A 4GGOA 1EK5A 2AQIA 2PR2A 4HY3A 1UUFA 4M86A 3CMMA 1AN9A 1V35A 3B1JA 3ZCXA 4FBGA 4JJGA 4L4XA 4GBJA 3MWEB 3RUDA 2O3SA 2OBYA 4PZDA 1PEDA 3U9LA 4XQGA 2ZJ1A 1LI4A 1OC2A 1E7WA 4QEDA 4XGKA 1YBAA 2B0JA 3GHYA 2VYVA 3PRJA 5TC4A 1YONA 1VE9A 3LLSA 1EVIA 4MKRA 2DU8A 3PHGA 1F17A 1E3JA 5KNLA 3FHLA 3OQ6A 4NJMA 4D44A 2CD9A 3JYNA 3RSHA 1Q0HA 1WW8A 2X7HA 1C1XB 3JQGA 3LF2A 4PGFA 5EQDA 3RKUA 3UF0A 4ROSA 5JYEA 1I10A 1NQ5A 1PJLA 4YCAA 3N74A 2D59A 3D64A 5IG2A 3CKYA 1T26A 3WG9A 3WDSA 1BW9B 5DBGA 3HDQA 3LLVA 2GF2A 3QA9A 3IP1A 2HK8A 4PLZA 1UP4A 2AW5A 2I9PA 3RFXA 4BMVA 4FSHA 4E21A 1BSVA 3NKLA 3CXRA 4OKNA 1ISGA 3BTVA 4IJUA 3F4LA 3UW3A 4FB5A 4IMRA 3IL2A 4BNLA 1LC3A 4I5EA 4MOWA 2PFGA 4NK4A 4CM9A 5JCXA 3DOJA 4XZ3A 2IYOA 1OOEA 1KC1A 1XYGA 1QYDA 2VNAA 3GNQA 2HCTA 3ON5A 1LDBA 3QRWA 4MINA 4N54A 3DMTA 2DTXA 2O3RA 4DPLA 5DP1A 3WLEA 3UCEA 3GQVA 2C7GA 3ANLA 3OF2A 3W6ZA 2ZKLA 4YT5A 3D5QA 3PHJA 5I8WA 4KMSA 4BNHA 3EVTA 4R1NA 2DTEA 1JKJA 1U3UA 2HQ1A 1PIWA 1E7SA 3V1TC 1G0OA 4PLPA 5CHEA 3ANNA 3IP3A 2UV8A 2O50A 1NHGA 3AUTA 3IDSA 3KYDA 3DMTC 4BNWA 4W6ZA 4JK3A 1GCOA 4CR7A 2QRKA 2FR8A 3WJAA 5JO0A 2W8ZA 1ZSYA 3ST7A 3VPHA 3HN2A 4II3A 4RVGA 5COBA 4U5QA 2X0NA 4EUEA 2WTBA 3K92A 2GUGA 4ND1A 1DIBA 1PL8A 4L4RA 2YQ5A 1P1IA 2ZB4A 5TJHA 1DRUA 4FQ8A 4OSOA 4ZVVA 4F45A 5TT1A 3KB6A 3CMCO 4AJPA 3LT0A 1U3WA 1ZCJA 4RLSA 1QLJA 1ZO8A 1XU9A 3IKVA 4J49A 3T4XA 4RJTA 1T24A 2PKQP 4MIEA 1I32A 5TT0A 5EERA 4ND5A 1H2HA 1UJMA 1PTJA 4YAKA 1W4ZA 5FI5A 3PYMA 1K3TA 3C8MA 4DC1A 1KC3A 3DTTA 4Q3EA 2P68A 1QYCA 3ZNPA 5JMPA 1E7YA 2Y67A 5KCZA 4LISA 1Z74A 1WPQA 2EHDA 3V8BA 4PFJA 4AJ2A 3DAGA 4J9UE 3RQSA 1ZK2A 2FN7A 5JSFA 3UCXA 2FHSA 4NG5A 2H9IA 4QX6A 5A06A 2YV2A 4HX5A 5DDIP 2X5JO 5L53A 5IN4A 3RUCA 1C1XA 2GN9A 2QYSA 3OMLA 2NLOA 2HK9A 1YBVA 2VWGA 3AFNA 2D2IA 1Q7GA 3L07A 3OETA 2F00A 4RVSA 2CFCA 4UEJA 4I5DA 1PQUA 3SEFA 2DFVA 4BNZA 1YBMA 1G1AA 2D5CA 1KYQA 3HHPA 4QXMA 3H6KA 3GUYA 2V6BA 1BW9A 2XOXA 5LCXA 1NASA 4J16A 5THQA 3ZWBA 3UFXA 2B35A 4BNXA 2EJVA 4L74A 2E6UX 1SBYA 1UDAA 3I6IA 1I30A 1T2EA 3EYWA 4CLHA 1EQUA 4GGPA 3ZWOA 1ONOA 1NQAO 3D0OA 3WFIA 4GH5A 1E92A 2ZIZA 1OI7A 4PCVA 4WNIA 4IPTA 1WMBA 4RF5A 1H9BA 4TROA 1HLPA 2OBNA 4JBGA 1B26A 1VL6A 1EUCA 3N58A 3CH6A 2X9NA 1HYEA 5TJ9A 1UXJA 4WOKA 3GC6A 1JU9A 3OM9A 3JD0A 4BMNA 5H81A 2DBVO 2NQTA 1DDOA 1I01A 2OFPA 1ENZA 3KM0A 2A9FA 3C1OA 1ISFA 1SZJG 1LSUA 5KVCA 1PJ3A 2Z1NA 5HRUA 4Q9NA 4DYDA 4D3DA 2XXBA 2E49A 2X23A 5U4QA 4HWKA 4CQMB 3HJAA 4RVFA 1JTVA 4YB8A 3C1AA 4YT2A 5AOVA 1JAXA 4FOSA 3QVOA 1RYDA 3TFOA 2VWPA 5DP2A 4OGWA 1NTOA 1LJ8A 2A94A 1RM0A 2AG8A 5A5FA 4OXYA 4MP3A 5TGDA 3RUAA 3HFSA 1HDZA 3I9MA 3GAZA 4B7XA 2PY6A 1NFRA 2GNAA 2P5UA 1KEUA 1ZXBA 4FDAA 3ZHZA 1PJBA 1PWZA 4BKQA 4BO7A 4E5MA 1CF2O 2AG5A 1EE2A 1ONPA 4LVCA 5BR7A 3GEGA 3O8QB 1BMDA 2P4HX 3P19A 3L6OO 4GI2A 2ZTLA 1R16A 1ZSNA 4OQYA 3QQPA 1E3IA 1H6BA 3ZNOA 4UEOA 4CMCA 3I9NA 1IL0A 5F5NA 8LDHA 3GT0A 3W8EA 1CERA 2LDXA 2V65A 2R00A 1P0FA 4WGGA 2IDZA 1O94A 3GGGA 4ALKA 3RUEA 4MIOA 5LDGA 1LDYA 4JLWA 4Z3KA 4WLOA 5ADHA 1LBEA 3IUPA 4FCCA 3GOHA 3BMCB 4A7PA 3GG9A 4LSWA 2ZK7A 3UVEA 3VH4A 2ZYDA 4DUPA 1P0CA 2HMVA 1OFGA 4W7HA 1A71A 3INGA 2PGDA 2Z95A 1LXCA 4WLFA 5FWNA 4HP8A 4IGEA 2ZJ0A 1ISHA 3WS7A 4KDEA 3SC4A 4EBFA 5ILOA 1DSSG 1HEUA 3OA2A 4P8RA 5H83A 3WXBA 4XR4A 5I9MA 4BIIA 3ONEA 3UH1A 3I5MA 4O1MA 5F1KA 4PN3A 3PK0A 4E2ZA 2YHIB 3GF4A 3DHNA 3RUFA 2DT5A 1S6YA 4CUKA 1I2CA 2B36A 2GN6A 4F6CA 1B2LA 3QWHA 4JNKA 2I99A 4DIFA 1EEHA 5A5EA 1G6KA 4UUPA 2VOJA 4DQUA 3E8XA 4PRKA 3KTDA 3WJ7A 1QSGA 2NVWA 3HN7A 3UUWA 1SMKA 5AQ1A 5L4NA 3HZZA 3PIDA 2BI8A 1C1DB 2BI7A 1C0PA 1N1GA 1U8XX 1Y8QB 4W7IA 4NIMA 3AOEA 4Q39A 1P1HA 3DZJA 1JQBA 4ZA2A 4CQMA 5A3JA 2Q46A 2JCXA 4IXWA 2NQ8A 1PS8A 1QG6A 2FPIA 3AOGA 2YW9A 1E3SA 3GMSA 5T5QA 3M1LA 4BQPA 4XYLA 1CETA 1Y5MA 4XIJA 3TZHA 4GL4A 1CQJA 1ZK0A 2NWQA 2LDBA 1KEVA 1YDEA 1OMOA 2J3KA 4ZRMA 5IZCA 1PWXA 1R12A 2CF6A 4HFMA 5T6BA 5IDWA 4FFNA 5T67A 4KUGA 1J4AA 1DO8A 3PQFA 1KVUA 2GZ2A 4XYGA 3AOEC 4J90A 4M1QA 1D1SA 1FDVA 2OMEA 2VNSA 4QQRA 4CMKA 2XF8A 2OO5A 4E3ZA 4AJIA 3ROPA 1PJQA 3PHLA 4YAEA 2OORA 4YWJA 2HDHA 5JLAA 3ZWCA 4DPKA 1B8UA 4K9DA 5F1PA 1VRWA 4B4UA 1QORA 2QZ9A 4FJ0A 4KTVE 5CP8A 3W8DA 2GYYA 2XXJA 5IXYA 1O5IA 3KUXA 3JD1A 4YPOA 1UP7A 3QV1A 5HS4A 2DQ4A 5IZCC 1ZMOA 1E1KA
chains in the Genus database with same CATH superfamily
3WL6A 5DGHA 3WK6A 4MVWA 3M1YA 3B3AA 2M1ZA 3ZU3A 4TMTA 2ODAA 1GWNA 5IZ4A 2Q5OA 4XQCA 3HWRA 1NN5A 1VHDA 4RPHA 5EWJA 4JLMA 2O8DB 4MW2A 4PSCA 4Q1DA 1UFVA 3IV6A 1G5HA 1WCIB 3EH1A 4TMWA 4G86A 5EYPB 5GIPE 1PR3A 4XYBA 3FFWA 2JAWA 4LXUA 4MYUA 1GV0A 2WU1A 2P6UA 5FL3A 4QTYA 2YV1A 5KMGA 4MQFB 5EZ5A 3K8YA 5B4VA 1QU3A 1ONSA 1VL2A 2Q3EA 1H66A 2BM9A 3SC2A 2SCUA 4CCSA 2H2IA 2VP5A 1Z4PX 1KQGA 5J2UA 4HDNA 1SXJE 1OX6A 2XT0A 4OFZA 2XCLA 4BLWA 4DCGA 1T4CA 4P7JA 4CE6A 2GXAA 4WNCA 3HEAA 3M3DA 4I5GA 1YJ8A 3KV1A 4NF2A 4DQVA 3LCCA 1RC0A 4TL9A 1Y80A 4F85A 5HVNA 4OQMA 1WZCA 1IVYA 3L3BA 4JGBA 3MGBA 4EBFA 2IX3A 3WIEA 1K7XB 3WLFA 5GADl 1TEHA 3LO8A 4U39A 1GUZA 1SXHA 1U1DA 5FL7A 2ORIA 3PTLA 1KU6A 3RIHA 3ENVA 2R84A 2QQGA 3M6IA 2MCFA 1JLLA 5DNDA 1FDSA 3M6UA 3MS4A 2PWZA 2WKWA 3F9IA 1ZJ5A 3JQFA 1R4NA 3N05A 5I51A 5K1ZA 2IPMA 5ESXA 4DC9A 5AVRA 1WHSB 1G66A 1BMFD 1ZFNA 4HH0A 2FF7A 2O8FB 3IQEA 4G0MA 2ZJBA 1XJQA 1SCIA 5AI6A 5E9JA 1RYYA 4E2XA 4DQDA 3B6MA 3FLEA 3OJCA 4LRWA 1Q1NA 5ALUA 1AKUA 1T3GA 3NC0C 4A27A 4ETIA 3A04A 4HDKA 2Q2QA 4J1NA 4G5GA 5CMLA 5D84A 5BXQC 5IABA 3FSEA 3LNTA 2CLSA 4W1QA 2BN4A 2VHUA 5CXSA 5KAMA 4R2IA 4EYEA 5JLJA 4M9XA 2HWXA 3LVRE 1VLVA 4DNFA 4EB0A 3AHJA 3HI6A 3WRYC 2WFAA 4K6CA 5EJAA 4WXHA 4EQZA 1TM3E 1BN6A 2J3EA 4H31A 1BDJA 3TQQA 3DZ8A 2P2SA 2WM2A 3LWBA 1VGQA 2GZHA 2FPPA 5LQJA 4TT8A 1PFGA 4MCHA 4C3ZA 1SQGA 1TIKA 2CLMB 1GTG1 1LQTA 4LN1A 4R83A 3SQOA 3A9TA 1BKDR 4XSHA 3LPLA 4XOUA 3DZFA 2PUFA 2FP4B 1GZSA 3VYTB 3WA6A 1KBZA 1ISPA 2VT6A 1IRIA 2ZETA 3OEHD 3WK9A 2C29D 4Q7QA 1XZDA 4YRZA 2AOTA 4I8IA 1X2BA 4J4BA 1CUIA 4K81B 3TCKA 4ZV4A 4KV9A 2QP3A 4XIFA 4EG5A 4OQNA 3UK7A 1XVIA 1VP9A 2F1JA 2NYVA 3PWSA 4FDVA 2N9UA 4DBVO 5AM2A 4OKIA 1XDZA 3CCBA 4UDOA 4JT2A 3T3HA 4M99A 5EZYA 4UCFA 4I6EA 3AY3A 4YJ2F 4N8SA 5FOTA 4N6NA 5BQFA 4DDHA 2X4IA 1P80A 4QU9A 4QPZA 2BCEA 3WWOA 5IYZA 1ZC4A 3C3BA 1ZU5A 3A70A 3G79A 4PHTA 3ZQJA 1JEYA 2PFSA 3W5AA 3GFSA 1C8LA 3FVVA 3EZGA 4AZVA 3UXMA 4J6EA 3O8RA 3O0DA 1VC2A 1AF4A 2WIJA 5EIFA 1QVRA 2EFHB 5BNTA 1M0WA 1ETHA 1DQNA 2QVZX 2WIKA 3RUHA 2R9VA 3S27A 3ZE6A 4IQ0A 4NCIA 2FUKA 2B6NA 4H1UA 5B3KA 1MO3A 1KARA 2YCLA 5A2GA 3U7IA 2AFHB 2R6R1 1U2QA 3BHMA 3DYBA 4P53A 4Q7MB 4GWLA 3O2QB 1TL7C 2PSHA 1EZZA 1GQQA 3ZBQA 2CDAA 4KRFA 4G1FA 3E03A 3ROEA 2QTVB 5JH7B 1HMYA 2R6DA 3AIOA 4ESVA 1U1GA 2CBGA 2WE7A 3WGMA 5BSEA 1JDTA 5GOZA 2IZ6A 3EEOA 1M8KA 1FFXB 3PFKA 4L9RA 1A9SA 4R1LA 3P0FA 3VH3A 2OGUA 4N49A 3DLAA 3HN6A 1B16A 3GEDA 3RC7A 3Q12A 4ZQIA 3GLFA 5JCJD 2QKYA 3EEBA 2GBPA 1NM5C 1FFBA 3PT5A 4X1KB 1EWTA 4ZV9A 3S1AB 3UT5B 1LLDA 4I36A 3FTDA 2VPZA 2YIMA 4IG9A 4Q5IA 3JQ7A 2WJJA 2NO9A 4XGIA 3T7RA 4CMBA 5FEUA 1B23P 1CX9B 4HRXA 1ECPA 3RJMA 4IDCA 3AMVA 3PWKA 4N4AA 3X43A 4BO1A 3WV4A 2Q5EA 3R9KA 5J58A 1RBYA 4AMVA 5A4AA 5EXEA 4AJOA 5BMVF 4CKEA 4IOJA 4RCYA 2VEOA 1GN9A 3FZNA 1Y8RA 2O0HA 3MMSA 1E2LA 1MZVA 4KDFA 1QIDA 3M4YA 5JFGA 5IN4A 4YV2A 4L0QA 3ZWKA 2YXDA 3UJAA 4TKUA 5F7OA 1YB5A 3MAGA 4PFKA 5EKUA 5I4CA 2PKQO 4YV0A 3U26A 1UFRA 5IT5A 2WG1A 1MR3F 1I0ZA 5EXSA 3A1SA 4YYZA 1YS1X 5ICSA 1Q15A 4H4EA 5LIPA 3FYCA 1GT6A 4GP9A 4M9SA 1GNRA 2G9VA 2J48A 3SQWA 2AQ8A 3QYPA 4FI3F 4ZQFA 3O93A 2ZSEA 1OX5A 2VBCA 1OLUA 4Z9AA 1L7QA 2DHQA 2IZ1A 1DQZA 3PCXA 3AK4A 2Z2XA 5H70A 3OHMA 1S1CA 2VJMB 5F3WB 3PZBA 4I2NA 3I73A 4FE4A 1ETUA 2IXAA 3ZNNA 3S4YA 2GCIA 4RLHA 1IM5A 1E2QA 2CVQA 2Y05A 1U28A 4E14A 1U0FA 2EFJA 1PD1A 2IEDA 1LJLA 2IHBA 4M1WA 2QQ5A 1QJ4A 1CQPA 2X2PA 4POOA 2GCNA 4LRTB 2X42A 2AKEA 5JSKA 2BI4A 4RXTA 3AEUB 3EPRA 3O9MA 3UWDA 2C4UA 3L2OB 5CT5A 4HN2A 3CVYA 1N2CE 1TRHA 2RSLA 3G0BA 2RD2A 4C0WA 3PFWO 4JXJA 5CD9A 3KXDA 1N9ZA 1JAZA 4X3OA 1A5ZA 2J0VA 2XNHA 3AUYA 4OOEA 4XB6B 4JI1B 3GLGA 2OBMA 1AK2A 3RIMA 2BE9A 3IUQA 4UZFA 3LWDA 2ZXUA 3VDXA 4KN9S 1ZH8A 1AQYA 3VYSB 2IFTA 4G5XA 5CJPA 3I5YA 2B82A 4EJ6A 4PX9A 3RVLA 3Q0EA 1OASA 4D9EA 4DDMA 1F8GA 4GBED 1HDEA 1JE0A 3K1ZA 3W06A 4B4DA 1PZNA 5SZHB 3EGOA 3CVXA 2QROA 4JWTA 4X7PA 1GAWA 2AMFA 4M54A 5ELMA 1EUZA 1PL0A 1Q3TA 2B9VA 3QHPA 5AI0A 3FMPB 5TX7A 3N3BC 1VMEA 4BJ3A 1ORHA 5CBKA 5HM6A 3FHTA 4XYEA 5LYJA 3ZU6A 4A8JB 1XQWA 2V7QD 1Y7TA 1YE5A 4IX1A 2YJ4A 2VF5X 4X71A 4G9BA 4XYMA 3MPOA 4HDSA 2J8ZA 2RGDA 3TIFA 3A3YA 5C7OO 4PIMA 1NZFA 1LV7A 1RADA 2LCFA 3C43A 3L7IA 3GZNA 3M6LA 3ZOZA 4COKA 4K1LA 2J9FB 3ELBA 5C5IA 4BZZA 4F9TA 4AROA 1MC8A 4JY7A 4RDXA 2ATIA 3G17A 4WAUA 1FMFA 2DC1A 4ESHA 2AOUA 3AUKA 4M1MA 3FOAA 4MZXA 3W2FA 4KODA 1GRQA 2YJTD 3N2GA 3DE5X 1ORVA 1E2GA 3G8CA 1HE8B 4LNHA 3FVTA 4Y0AA 4NU5A 5CVJA 2YICA 1MVLA 1UOQA 4WBXC 1JHOA 5AJYA 4YT8A 2DB3A 2YIDA 4Y98A 1F2DA 1NVWQ 1FSFA 1L7DA 2AI2A 4OHFA 5JNSA 5A0FA 2VUIB 4DM7A 5CNJA 3U3ZA 1PV1A 2XYRA 5K09A 1WXGA 2MINA 3HACA 4MW1A 5AXAA 5HDQA 1LWNA 2YWXA 3CZ4A 3FMIA 5DYWA 5KAPA 3A58B 1P18A 1WUIS 3L18A 1DAOA 4IHJF 5CCDA 2KYRA 3WGKA 5K3AA 4HMQA 4ND3A 4N0EA 1PG0A 2V6FA 5EXDA 2V6MA 1H2AS 1KGDA 2XB8A 4YXWA 3RODA 3ONVA 3QKUA 1GVNB 3RYHA 4F6LA 2BD0A 2WF9A 2B0CA 3MTIA 3VO8A 4ENPA 3FUVA 4TVOA 4EPWA 3M4ZA 3QENA 2C5AA 4RF4A 3SLRA 2XKKA 3ICEA 1X1TA 2HF8A 3ZXXA 5C51B 4AWXA 3GLSA 1M75A 2ORED 1ESDA 4I50A 4B8YA 4B7ZA 5AI8A 3A3OA 3LH5A 3ZIAA 1L5GB 2TMYA 1RJWA 3B2QA 4WUTA 1H22A 2C3OA 1ZVJA 3VOAA 3L82B 4DMLA 1Y63A 1DRWA 2HUNA 3KVOA 4EEZA 5GJCA 2B94A 2GGSA 4A2QA 1T8WA 3LV8A 3DXFA 4K6HA 4MI1A 3GVIA 4JUFA 4MVJA 2WAMA 3MGCA 4UMFA 4AUEA 2WA2A 4IIDA 3AVUA 1SUEA 4MMZB 4YLEA 5EUCA 4DR1B 2WPDD 2DVMA 1HA3A 4UQPA 2XKBA 4ZTBA 2C57A 2P9JA 5E8RA 5JWHA 3HYSA 1UMDB 3OJLA 5AVQA 1X38A 1ML3A 3F5FA 2WYVA 1EVJA 2W2PA 1NW6A 4A5OA 2IIPA 1P1FA 5J59A 2ZI7A 4JR2A 4EMTA 3HVRA 3EPKA 1EK6A 3NBAA 3GAMA 2A0UA 1DKPA 3IP7A 5A4MS 1GAXA 1MGOA 3ZUPA 4D8VA 3HS3A 4INAA 2J46A 4UNNA 1M2JA 1H9AA 2PVPA 2VXOA 3PUIA 2WUVA 2QUJA 2PRJA 1VE6A 3GRZA 2PQ6A 1A5TA 3ZHYA 2WE8A 2X8JB 3H9GA 3HFGA 4UUMA 4EATA 1E32A 5I4BA 2B6HA 4MA5A 3UG6A 4M6WA 1A5AB 4AK9A 2CV1A 2PSJA 3HU1A 5A2QA 3O26A 4FFBA 3G13A 4BFCA 3UV7A 1I3NA 2IT1A 5C0OE 4GPBA 2DHCA 4JVOA 2P6OA 4DJTA 4DSOA 3V55A 1H1LB 4W99A 1M0EA 5JCOA 5ULLA 3R3ZA 3I45A 2QMQA 4GPTA 2CV0A 2QAGA 1E2NA 4KQ2A 1WUTA 2A0FA 1SY7A 1JDBC 4MJLA 3RS0A 2GCOA 2C20A 1Q0LA 2J4FA 5GV8A 4Q9JA 1U8YA 1UBNA 5KQSA 3U7GA 1Z5NA 5I6DA 1P6XA 1JIUA 4PIVA 4DCOA 1VYUA 3OQ1A 5EGNA 4A1OA 2C94A 2C2BA 4NULA 1JECA 3FCOA 4AS3A 4Y6LA 3AR2A 4YACA 2KLHA 4MVJH 2E55A 4EQ6B 2FQQA 2QNBA 2YWEA 4PSDA 2DFNA 2EX4A 4IDUB 5F12A 1OCEA 2CDCA 4MH0R 1ULTA 3T7DA 2P9CA 3FNEA 2VYNA 3P45A 1GZVA 1MRNA 2BEUB 3PC3A 4JJFA 2CXOA 2OGZA 4R68A 2YYAA 1PLJA 2RHJA 3S2GA 2WUEA 4TXJA 3U7EB 1O94D 3TX6A 3FPGA 5JHGB 1QPGA 4HPWA 2I78A 4RTQA 4AU1A 1U0TA 1SIOA 4GIBA 2BELA 4PPNA 2PUTA 3W1VA 5DW0A 2VLIA 1Z34A 1IM2A 3DE0X 3MF4A 3TS1A 3U6BA 1CDOA 4UVIA 4IUCS 1KBOA 3X1JA 5CB4F 4M21A 3FWNA 1U65A 2RJNA 3DBLA 4LJSA 4DLLA 1JTFA 2QRLA 2FFAA 4PAOA 3V6MA 2B4TO 1IXYA 5DX8A 2BFOA 2CK3D 4R9VA 5TQ2A 4YGXB 1GAQA 1DG1G 4MKGA 1P3DA 2ORVA 4OIMA 4YJKA 1U7TA 4XWAA 4LSMA 2X5NA 1RXUA 2NUAA 2RC6A 3K09C 3LSTA 5KDLA 3S2YA 1M10A 4C7BA 2WF8A 1ENOA 4KXYA 1CYDA 2E2WA 4MVJI 1N2OA 3EEYA 1V48A 1W9MA 3OFSA 1B1AA 3Q7PA 5KPDA 2I7DA 5BOSB 1N2JA 3DTVA 4WBNA 2ZUUA 2FSVC 4KVFA 4AG5A 3HU5A 1U9IA 3HKBA 4INZA 5C1PA 1ORIA 2FW1A 1NJSA 2GCEA 3ASVA 3PNBA 4G9EA 1E1RD 3ZDZB 4ENRA 5SICE 1YZYA 4MR9A 5EMKA 4BFLA 3CT4A 3OPNA 4UEWA 2XTMA 2VP9A 3FYTA 3HI4A 4FOOA 2ZRQA 3KQHA 3ESYA 4WY2A 4LHSA 4JT9A 2L82A 1W1WA 4NATA 4X54A 4OFBA 2YZ7A 3NBMA 1RW4A 1OXXK 1MB3A 4G0ZA 4TMYA 2FY8A 2PRYA 3QUBA 2R65A 2JGJA 5A7FA 4KJXA 3QKIA 4JJZA 4CLRB 4DV4B 5H16A 4R8SA 1H8HD 1K6XA 2OOSA 3GO4A 3ABQB 3G9TA 3VPXA 2O59A 3T94A 4XFDA 2DF8A 4EPYA 4YJHA 3SIXA 2XD4A 3LBNA 3NTLA 3T38A 1FP7A 2QRVA 3AL2A 3FCEA 1KZYC 1XXHB 1E5DA 3EF1A 3I4CA 3KSAC 1ZMXA 4ZVKA 4F3KA 3FIUA 1I4WA 3G7NA 2EAUA 1VMAA 1EFVA 2OM6A 1KMCA 2C8JA 1EJBA 2NO6A 3I2FA 3KUCA 5K99A 3RR2A 2DLDA 2Y93A 1WMSA 4M53A 4CMGA 1IBCA 3PNKA 4KL8S 4U2BA 1DUVG 3PPVA 3OLZA 3RSSA 4P9NA 3HVJA 5KTOA 2WU8A 3C3XA 1TO2E 4JQYA 1Y3IA 2D3WA 2FSGA 2RKOA 1HNNA 4A3SA 1HZJA 3C3AA 3O8NA 4LMRA 1MQ8B 1L5YA 3T1YB 1HM5A 3RK4A 2I3ZA 1L8AA 4BMPB 2O05A 1ZHOA 4PRZA 1IUPA 3LRXA 3ZEIA 1R9NA 2HV9A 4I4NA 4UQOA 3RADC 1AKEA 4KQFA 5DHFA 1K6JA 1O77A 3NRJA 4MGHA 2W43A 1FYWA 3HADA 1GGHA 2HUPA 5F7JA 3RKRA 5AESA 2DCMA 3MS2A 5DNYB 1DWQA 1XZKA 1SBCA 2Q3JA 4O4IB 1U3CA 4MW0A 5J5AA 2YNMA 1NBAA 4XXHA 5CH3A 1E1NA 2C78A 5K5EA 5KIAA 1XPUA 1T5IA 4N8DA 4F12A 4QEZA 1OWNA 2JHAA 1L9XA 3ESCA 3QOXA 2ZS7A 2R00C 3NV9A 3OIYA 3SOZA 1JDVA 2WTUA 4OI0A 1PNRA 1HI9A 3SX0A 2CJWA 4P7GA 2BBWA 3I5XA 3MWKA 4HJXA 4OIFA 3D7KA 3F97A 4GSLA 2BMEA 1DGQA 5FCDA 5C8YB 1GD1O 2X4LA 3H5AA 4TZ6A 1QM5A 4BU1A 3MT0A 1A7JA 1TZKA 2WILA 3K7EA 4P3YA 3L4EA 4Q3CA 1RM5A 5TQVA 3SY8A 3PGXA 3IAHA 1OGYA 4ZT3A 1NBMD 2O3TA 4YRMA 3A0UA 2B5VA 3QJYA 4QUIA 3BDVA 1BVHA 1N1MA 3MCVA 2XUOA 1PJ4A 1RIFA 4BFSA 2GETA 1QCDA 4QBKA 5AKEA 2O8CB 4DL9A 4HQOA 4NBLA 3K0EA 1P60A 5E7JA 4IDEA 1M7HA 1L7BA 4U9UA 1S4QA 2GT1A 2VP2A 4G24A 4M4SA 2B2CA 1V43A 5K8CA 1L7NA 1R4MB 5ETJA 4C2AA 4UTPA 3K0SA 2N47A 3TEFA 4DYVA 1D2AA 3VNRA 2HTFA 4LGMA 2CLCX 4EPVA 1ZGCA 5D85A 4EKEA 1DC8A 5CM9C 4ZYXA 3G0OA 2ZAMA 3PYXA 5CGQB 4YT4A 3P9RA 3VISA 4RTMA 1W85A 3N7TA 2QD1A 3O4HA 4R01A 1LA2A 2GRJA 4K05A 3W6NA 2G04A 1YA6A 3I6BA 1EGQA 2PX4A 3B9RA 1Z26A 1Y1QA 1Z5OA 1QTRA 1X7WA 4YP0A 4DDWA 1J1IA 2NU6A 1JEAA 4DQXA 4XWWA 3DBVO 3MHPA 2RKWA 2XA2A 1SG6A 5LA6A 4BMSA 1MX3A 2QBYA 1WEKA 1E99A 3O95A 4L15A 4IYRA 1VPVA 2GZ3A 2IEYA 3OQBA 3HGTA 1GA1A 5JQGB 1BE6A 1FFAA 2BGTA 3O03A 2H5EA 3PDHA 4HL6A 3IV7A 1KYWA 1TXGA 4Z7JA 1FDUA 2Q49A 1XROA 2VUSA 4XCQA 3X1ZA 2IP2A 2Q9BA 4G5SA 2EV9A 1D6JA 1R6DA 3X1DA 1RZVA 1WA5A 3N0XA 5CT9A 1Y6ZA 3RTEA 3WX0A 1Q7EA 2HPAA 1OWLA 1IOLA 3L9WA 5CHYA 5G4KA 4TRMA 3GCZA 3V4VB 2XB2A 4KQ6A 4XTCS 5GVSA 3OE7D 5K9ZA 1EKXA 1QQ7A 2W5UA 3N6RA 1WP4A 1CRQA 4UBNA 4JIMA 5IHPA 2IW1A 5KJEA 1C29B 3RI3A 3QOYA 2GM3A 2ONKA 4MQEA 1ZH4A 2PH5A 1JB1A 2QL5A 2RHCA 2ET6A 2RJOA 1L5KA 4BN5A 3MOGA 4C0SA 4LJYA 5E38A 2CLDX 3ZYCA 2A7XA 4G8BA 1T2NA 2VJOA 2CDRA 4XWGA 1UR5A 1J9ZA 2OO5C 1NJGA 1TUIA 1WSAA 1VJGA 2EYQA 3ROXA 4ZKEA 1V71A 5BW5A 5M2QA 3FPJA 3UB4A 1MA3A 3SE7A 1F5NA 2I65A 5EIAA 4B1FA 4FN4A 4MYHA 4WECA 5BW4A 2Q1WA 3SZMA 1QS0B 2PCJA 2FOLA 5A9RA 1E9VA 5J1SB 1Y6QA 1RZRD 3H0EA 1ZG3A 5K3FB 3IAM6 4R7TA 3GJSA 2VVTA 2C2HA 1UBFA 3OLYA 4BO5A 1BDMA 4MXDA 4D42A 1I6WA 1RQLA 2I3BA 2HNAA 3OBIA 2FJ0A 4L5CA 1LJUA 1Y8CA 2PLAA 1KDOA 2CMHA 4R9NA 3TRJA 4RKFA 1Z07A 4LZOA 4OK3A 4ZU3A 4DCJA 4ZVPA 5TPWB 1IZ8A 2I8AA 2CNWA 3CHYA 4Y8VA 5ISMA 3RSFA 4J0EA 4U63A 2Z5GA 3ED5A 3BE6A 3OWXA 4JKIA 3V4ZA 3AR6A 4OXRA 1E2KA 5HJ7A 5KNBA 2AJLI 3AZPA 1VKZA 2OT3B 1QO0D 3V00A 1C9YA 5ALSA 4ZVNA 3TOZA 3TRHA 4BMZA 4ZMRA 1KL7A 4LSZA 3ORHA 5JMTA 1RHUA 2JK1A 4P1ZA 1U0RA 1CLEA 3G82C 3HUFA 3S29A 1IATA 2ZUCA 4B7UA 3M3PA 1QIIA 1HQDA 2I4LA 2ZROA 4M1ZA 4IDPA 3B51X 4LI3X 5JXWA 2PH3A 4P80A 1WVMA 4ID3A 2GBCA 3AL3A 3D3NA 3NGXA 2EFDB 4RZQA 4EB6B 4OLFA 1LRLA 1OBFO 2LRHA 2JGDA 4K0KB 3V34A 1R0CA 1QP8A 4G09A 2EOAA 3ADDA 3KR9A 1JHZA 3VSAA 3S3TA 4AYTA 4EX6A 3EXHA 3X2EA 5LLDA 1XTZA 5JS8A 4ZTUB 1KI8A 3IBCA 5DB4A 1RAAA 5TF0A 3FPCA 3EVEA 4WKPA 1C2TA 4BCDA 2VDUE 1UOEA 2DE0X 5CDGA 2F8LA 1XVLA 3VZRA 2BJVA 1LZLA 1K8YB 3MXTA 5DT2A 4QNRA 3TPFA 5AW2A 3JCZA 1CZKA 1I2MA 2NADA 4NL4H 1V5WA 5G02A 3OZGA 5DM60 2QM3A 4B09A 2C5SA 1II8A 3EZFA 3OO1A 2ZWOA 4F9GA 1QRUA 3FJ1A 3UG7A 3GA7A 1MDFA 1FX1A 4TM7A 5FWXB 5G0UA 3TW4A 1YZVA 1DCFA 1O97D 1W49A 3F5SA 4BC0A 3ZVMA 3EWIA 1N2CA 2E48A 1MJ5A 1G8AA 2P5SA 3QYFA 4IIUA 4EMSA 4UAJA 4YJ3B 4O5AA 4NBUA 4JI2B 5KWVA 1I3KA 3D4PA 4FK8A 2PWYA 3VKHA 2CB0A 2F8MA 3O1LA 3CY6A 4PG4A 3S8MA 1F8FA 1HYGA 4C7XA 4NDZA 1AO3A 4P92A 5BNZA 4Z4EA 3ESRA 3KU1A 4MPPA 3F71A 4Z9XA 2WY2D 4HH3C 5AJZA 5DU2A 1XV5A 2JBWA 3V1UA 1YR1A 2BF7A 2D0OB 3QU5A 4GR4A 5B1DA 1M1YB 1SB8A 3A1DA 3TQTA 1DS6A 3KJHA 1XO1A 3UMJA 5HMLA 3TZCA 4JLPA 1A88A 1Y4AE 2ZYIA 3O7MA 4IO0A 5NULA 3EDMA 1H9CA 4FX5A 5EESA 3GGJA 4Z8XA 5JFTA 3FYHA 2YX1A 3O5AA 1I4OA 4RMGA 2OK8A 3VV2A 4JI3B 1L1FA 1NF9A 1BXRA 3QVTA 3S99A 3IA2A 3OZRA 4TQUS 2YASA 4BLVA 4G5OA 1Z62A 3L8FA 3H9QA 4BLUA 4XGQA 2NQ2C 3HPRA 4MUHA 1BXZA 2HMAA 3IMKA 1GRRA 3ONFA 1RZ3A 5H82A 5IF9A 1GADO 1US8A 4WZAE 2A14A 4X95A 3ZV6A 3GN2A 4LZAA 4BP3A 1LTKA 1OFIA 3G49A 4KLNA 4ALLA 2EWMA 2H5JA 3B5EA 2IVZA 2D1FA 1OXTA 1TI7A 2JLSA 2IUTA 1BWPA 2HKIA 3TN7A 1Z2PX 4BGIA 2CJPA 3D1LA 3SQLA 3WR5A 3JYHA 4KRGA 1PV4A 4RPLA 2AD5A 1TCAA 3AYXB 3Q8MA 1FXWA 1U7DA 5GGXA 1VDZA 2QRHA 4V0RA 4IQFA 1HH4A 4MX8A 2X0KA 1XLTA 2QZ4A 4RKEA 3OP4A 1E1LA 1S8AA 1YASA 4L75A 4O4HF 5A9SB 2HJGA 3K9HA 4IIEA 1N34B 2MSDB 3E4CA 4RTNA 2PUDA 1RAIA 3QV2A 3O21A 1K9VF 1XA4A 2YZNA 4D9IA 1DJMA 4NJEA 4YH1A 3U44B 4RVUA 2O23A 3DAFA 3NBYC 4PU0A 1KIFA 3VDNB 1F4PA 2HM7A 3B3FA 1FDOA 5JADA 3UMCA 4LCBA 4YQYA 5BO5A 2RHBA 1OI4A 3I2KA 3R8FA 4OI2A 1M3SA 3EPJA 2YN4A 1XVVA 4BJ6A 2R25B 4AJEA 4IXMA 1G5PA 4YCNA 5DTRA 1ESMA 2PBRA 2EZ9A 3I92A 2C2XA 2D8AA 2IF0A 3HHEA 4B3RB 1WCV1 3RBXA 1IFXA 2BFDB 3EISA 5JAQA 2FPGB 4CKBB 4DKXA 1C9NA 1GAEO 4DR2B 1MJGA 2NO5A 3IBGA 1RE0A 1OA0A 4R9UC 5DN6D 1U7ZA 1RQGA 3OTHA 3MTAA 4UFNA 2OPBA 2YRXA 2R6HA 1UBTS 3GY0A 2BVNA 4QC2A 1JWLA 4HYEA 1DBVO 1PBTA 4P93A 4AYWA 2XWSA 1FMLA 4FM9A 3MTJA 2YS6A 1M1UA 5JTUA 2ENUA 1K7CA 1KDYA 3ORQA 4CCYB 4ENUA 1T2DA 3EZ7A 4BQNA 4C7OA 1YA4A 5JJLA 4WWHA 1RC8A 4MV6A 3BICA 3CYFA 3OIWA 1P9OA 4BNUA 4HVLA 2WTMA 4K9SA 4C6TB 2G40A 2CMFA 2CXTA 3A11A 3QIAA 2R8ZA 3SI7A 2XMBA 2OCXA 4WKOA 4ND8A 2P1ZA 3A28A 4FMPA 4INPA 3NJ4A 5DV9A 3DT8A 5BQPA 1UWKA 1YDGA 1S2NA 2PQ2A 3HBFA 3AFMA 4WFQA 3TQHA 4RZ3A 4C4SA 4QLBA 2Y66A 4RCVA 4G37A 2OHVA 3G8YA 1WE2A 4HLUA 5E4YA 1CQIA 2Z09A 3RYFB 1B4DA 4L5IA 3GQBB 2O8EB 1VPDA 1JR6A 3OCWA 2RHWA 4B3SB 4HT3B 4G5FA 1RYMA 2AUMA 6Q21A 1II0A 3DD1A 3KCQA 4AT1A 4ZEVA 4XLLA 7MHTA 1MN6A 4HVAA 6AT1A 5CNKA 3GPDG 3K94A 2EEPA 2LW7A 3LUAA 4ZAGA 1SQFA 5T6MA 5JAIA 3OCUA 1QE0A 1W47A 1WXFA 4MARA 2AWOA 2I7TA 4B48A 2FQXA 5E6SA 1PDVA 4C2UA 2WFMA 1IQPA 3GPIA 1SCAA 4Q48A 4Y1FA 3TLCA 2XECA 3CR8A 1K3FA 2RBEA 2FJPA 3U7JA 3ZOKA 1GKYA 1YTLA 5KWJA 2QM0A 3ZBTA 4BNYA 1E1CA 2WP0A 1PJCA 4QQFA 4UPVA 4HBGA 3FIJA 3KJXA 4REQB 4CT0A 3C98A 2YKGA 4ZALA 3OQNA 1F0PA 2VWQA 1E8NA 3QKRB 1NOKA 3FGOA 4B87A 4C1BA 1I5RA 2AEMA 2WIDA 4Z49A 2XNCA 1VJ5A 3E22B 1MNAA 2OKCA 3CU5A 3HJHA 1KZGB 3ND9A 4D8YA 2X5OA 3HY4A 3SR3A 4CM1A 4DSAA 2C2KA 2R5NA 2PLWA 2KBFA 3Q5GA 5K8IA 2Q1SA 3EXIB 4ZOBA 1V1RB 5JR3A 2MSEB 5HW0A 5ICFA 5FPYA 1SCDA 2H1OA 3CLVA 3UAWA 2XUFA 4MRPA 1YNSA 2QN2A 4YMLA 5KTNA 1KRWA 3IIKA 2OBLA 4J2HA 4B7CA 2WJPA 4QQ8A 3LY7A 4JEIA 2ZZMA 4YRKA 1W0KA 3D2AA 1M9NA 1V16B 3DL0A 2FPMA 4E70A 5SY9A 4DUYB 1BEZA 4CF6A 1F7VA 1PG5A 2OXRA 2VIIA 4OMDA 3I61A 1GRVA 1GFSA 2AN1A 3GMTA 2VI5A 4O1IA 3SVTA 5LMUB 4DEXA 5KYYB 3IX7A 2BAGA 2IIBA 1M6VA 2REOA 3COVA 3SU8A 3W34A 5BN1A 1ZH6A 2W6JD 2P69A 5L7WA 4GLJA 3BGDA 4R6XA 4PLFA 4QBGB 2IYVA 4LK3A 1JA9A 4PBTA 3TMYA 1IN5A 3DMGA 4EY8A 1PSWA 1Y37A 5KSOA 3X1WA 4X93A 3V32A 2FA9A 3LYHA 5CB6A 3T5GA 3A2LA 1DJOA 3FNRA 5BQ5A 1YVEI 3LAWA 2RMKA 5EIOA 1I8TA 4F8YA 4RVNA 3THYA 1JFVA 1G55A 2C9MA 5FOUA 3EZXA 2O2GA 3ZIUA 2ETVA 2H1FA 2DTDA 4ENSA 1G9XA 3SBDA 1PJTA 3PHBE 4LXIA 2FEOA 2GPNA 1XT6A 4EKYA 2BL4A 2W2LA 3MCZA 1K1EA 2XI4A 4BB9A 3D7LA 1JJAA 5I3CA 4RIEA 3ZWVA 3T1QA 1Q11A 3CF4A 3PQEA 3T5TA 3EEIA 1OSNA 4LJ6A 1NP3A 4JFRA 3NPMA 3NH9A 4I55B 4KYIB 3I2IA 1U1EA 1DC6A 1N6KA 3QFRA 5CA0F 3UK1A 4EEKA 4L9WA 2VR1A 4E46A 1ZMBA 3M81A 4XB2A 4X62B 4R9RA 3K9FC 1HNZB 2HHAA 3M7IA 4FKZA 4PCUA 2JCGA 2WB4A 1XCLA 3IHTA 3AVQA 1XYYA 2D2FA 2X5KO 3OQIB 1OV4A 2C9CA 1UPAA 2QGNA 3LVQE 4B3BA 3VBEA 3H18A 3IVAA 4REOA 1VG8A 3STXA 4CMJA 3EFOA 4XUDA 4YQEA 2VKQA 1BD3A 2GZRA 1N3BA 2W90A 3M6MD 4Q4JA 3KSRA 3A6KA 2DRIA 3PX7A 2BHRA 4KIFA 5DXFA 3JR3A 1E3TA 3L43A 4FJ1A 2QD2A 1I6MA 3IV9A 1AT1A 1K2VN 1X92A 2NAFA 2Q2NA 4HO1X 4BMDA 2BTQA 3VPCA 1F2TA 4D4LA 1Y5LA 3AQ4A 4LG1A 2R86A 2BOVA 4XPIB 1SG9A 3PP8A 4I1YA 3UC5A 5B12A 2VHVA 3EAFA 3P52A 3RT7A 1GZHB 4Q05A 4UEKA 1JDZA 2FU5C 4Q1CA 3C1TA 2GAOA 1UBMS 2OO7A 1VJCA 3CEPB 4OUDA 4X24A 1JNYA 4E5UA 5I9IA 5DM1A 4IF4A 5J4HA 4TTQA 2O3JA 4ZQHA 4B83A 5BSFA 2JD1A 1WQ4A 4QG7A 3JYPA 4ZDWA 1CY4A 2Y0CA 4NYIR 5AKLA 4NPHA 3LDUA 4JBIA 2YUIA 3VKUA 4H7PA 1JMVA 4D7AA 1I33A 4QRDA 1A9OA 3PC7A 2PN1A 3Q8LA 5ILGA 1YCFA 4F6RB 5IJ9B 1FDIA 4CTJA 1AS2A 2J3DA 2DFTA 1EFPA 2PZBA 4TGLA 4ZVQA 4A8JC 4E7PA 1YJQA 4ZQGA 5B37A 4ZQEA 1TEVA 5PGMA 1N33B 3A6EA 1G4AE 3RRFA 3UAYA 621PA 2NO4A 5IJZA 4AJNA 3HRKA 1RTKA 3CNQS 2IDKA 3GUCA 2CW5A 4O25A 4TTIA 2C7PA 5DCWA 4B81A 1X7XB 3JALB 3PUVA 1ULBA 4YYEA 3CEAA 1O6CA 3PDWA 3A9VA 4ZEWA 1U90A 4LOAA 4KP7A 1BC5A 2PS0A 3P9YA 4BHHB 3KYBA 2VJNA 1L7OA 1PR4A 3PFFA 1QPZA 1G8MA 1KP9A 4BRZA 4CGZA 1NUUA 2HSDA 5KS2A 1R4AA 1IUKA 4O63O 1OLSB 4KXVA 4L57A 3ZWWA 1IY8A 3Q2IA 2M98A 4LHYA 4C7KA 5JU6A 4AMBA 3OPYA 1WWKA 2BONA 1SKYB 2IYFA 2NYRA 3HDGA 2ISQA 4OHMA 4HQLA 3GA0A 1KNQA 4NG4A 3G2PA 1O95A 2X3FA 2F1IA 2DWQA 4OHWA 1MRZA 4KQGA 1AOXA 1P45A 1N7HA 2GAJA 3EASA 3JSAA 4K6KA 4QREA 4C76A 2I6FA 4UARA 2R5WA 2WM3A 1X13A 3CUWA 9GPBA 2DQKA 1E3WB 2Q6OA 1NJ1A 3KOXA 4YUWA 1CF9A 3C45A 3H7IA 3M5CA 2ZLBA 5GAJA 2IPAB 4ES6A 3Q1LA 3L6DA 4L3WA 3VRHA 1GEEA 4Z7QB 5FKJA 1FZQA 1Y4ZA 2I6QA 4JB0A 4EZBA 5LU9A 2EW8A 5JPIA 3HBNA 1DC4A 3MJHA 3NWBA 5J4KA 1M54A 3HUEA 3IS3A 1WUKS 3VJLA 1NVKA 3FZYA 3RD5A 4FFOA 3VU1A 3E3OA 4PNPA 4OGKA 4QWWA 1XRPA 4CXMA 3TH5A 1LC0A 2Z56A 4U7FA 2G17A 3C6MA 4E1AA 1SAYA 3FYUB 1WZUA 4LRQA 1DDIA 1AKMA 1N6PA 4ACBA 2ILTA 4M37A 4Q9LA 5DHUA 4RJJA 1D2NA 2CLIB 3DW1X 3N9IA 1OC4A 4RPKA 4XRGA 4C89A 1OFTA 2UVPB 2V98A 2Y0PA 4DVJA 4JENA 1RC1A 1UC8A 2VZEA 1O89A 3REOA 3U3KA 2I2CA 2PGLA 2X1VA 3TO5A 3OQPA 3PDCA 2UZ0A 1HT2E 5FP0A 2QMUA 5GJVC 4CTOA 1UKEA 1H5UA 2INGX 1EU1A 3AM3A 3Q72A 4YCJA 1ZKMA 5E4TA 3WO1A 3LPNA 3ZDYB 3AHDA 4RSGA 3TSZA 3VR5A 4C06A 3DXZA 1Z22A 3IMGA 2ZWMA 3NOOA 2IE8A 2PD6A 5E6UB 1J42A 2OZVA 3KDAA 3TXYA 3WGTA 1J97A 2HA3A 3W9BA 1MT3A 1Y1RA 4AN1A 2J0SA 1MIOB 1H0KA 1VE5A 4TV9F 2JD2A 4BZPA 4X64B 4C3UA 4AKHA 4BVFA 3TLAA 4GWKA 3ETGA 1SKMA 1VYHA 1V3VA 3CINA 1VJDA 2EX0A 3SG0A 1QVZA 2A9QA 4H7DA 1WDKA 2PGXA 3KAQA 4WK2B 1I9GA 3TTWA 1TUBA 4TV8F 1CRWG 2Y0BA 3D3WB 3MWJA 3TINA 3PD7A 2OVFA 1L7EA 4JJ8A 4OJQA 4C04A 2C5EA 2P4UA 3HGQA 1KA9H 3PEYA 2FWJA 2GBLC 2XR1A 2V7TA 2BP7A 3I1FA 3LOQA 2GPYA 3O2SB 2JLXA 2XUGA 3KZCA 3JRWA 5EWMB 3ZJ5A 3L1VA 5F73A 4OLJA 5LXTA 5K01A 1DG3A 1WQ1R 3BBPA 2NXEA 3GB9A 4N5DA 3UHFA 4C2TA 2H07A 3WWPA 1ZUHA 1QH8B 4RJLA 5BR1A 3DZCA 5SYMA 3HXMA 1VHQA 2FSHA 2HQBA 3ZV3A 4X8OA 5FFNA 1JPJA 3KEMA 2CUNA 4WX2B 1P1KA 4QA9A 3WQSB 4X0EA 4PBRA 2KBEA 3LLCA 3OPYI 4D82A 1E9AA 1NYTA 1EAMA 4HAUA 4EHJA 5IUJC 4WASA 2VQEB 3W6OA 5IT9A 2N75A 1XRSB 4WJZA 3AEQB 5ITZA 5JTTA 5FPSA 2F9LA 3SC3A 3BK7A 2MYPA 3VR5H 4L02A 4DJ5X 3G5LA 3T34A 3GRKA 3ZVLA 1XA0A 4NU6A 3NKVA 4Q3LA 2E4YA 4DIMA 2JFHA 3TSYA 1KR2A 3MSCA 2ZIVB 3MTBA 3GVXA 2WAXA 1G8GA 3V46A 5A6SA 3NYQA 4MR8A 3V7WA 1XD9A 3NTOA 3N0VA 3UN1A 4YX9A 1NVTA 4KTTE 4DMHA 4M9ZA 5FD8A 2ADFA 2B69A 2RHHA 3U4AA 1Z82A 4OJKA 2VA8A 5ERXA 1DO0A 4W5RA 2W6CX 3DFUA 4HGPA 3H1BA 1T5OA 5D3MA 1X80B 3N6VA 4FGLA 4PHHA 3KT8A 5AH0A 2IU0A 5K0TA 1KOGA 2ID9A 2OZLB 1MRSA 4RFSA 3UMFA 3PJGA 2RK3A 5AVTA 4LX0A 1DKQA 2VJAA 1CZRA 4C43A 2HHJA 1P2BA 3NORA 2R751 2XUDA 3Q41A 1G8PA 4RZHA 1W2WB 3HFJA 2VDWA 3ZR4B 3H1FA 2EP5A 3KQUA 4YO8A 3QF4B 1R0ZA 5KYUB 2EW2A 1L9KA 2ZZNA 1QO9A 3NEYA 1UOOA 3BT7A 3TZKA 1SU4A 1WUYA 4UULA 5T4EA 4B35A 5CA1F 2W83A 3RB8A 1D2MA 3LWZA 3VHLB 3ICQB 4AF8A 2XNDA 4Q3KA 2NUTA 2C5HA 2VH1A 3WBKA 4CRWB 2JLRA 4L6IA 1SKQA 5EJ8A 1OKKA 3WLKX 4NC9A