2PK3A

Crystal structure of a gdp-4-keto-6-deoxy-d-mannose reductase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
309
structure length
309
Chain Sequence
MRALITGVAGFVGKYLANHLTEQNVEVFGTSRNNEAKLPNVEMISLDIMDSQRVKKVISDIKPDYIFHLAAKSSVKDSWLNKKGTFSTNVFGTLHVLDAVRDSNLDCRILTIGSSEEYGMILPEESPVSEENQLRPMSPYGVSKASVGMLARQYVKAYGMDIIHTRTFNHIGPGQSLGFVTQDFAKQIVDIEMEKQEPIIKVGNLEAVRDFTDVRDIVQAYWLLSQYGKTGDVYNVCSGIGTRIQDVLDLLLAMANVKIDTELNPLQLRPSEVPTLIGSNKRLKDSTGWKPRIPLEKSLFEILQSYRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GDP-6-deoxy-D-lyxo-4-hexulose reductase
publication title The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
total genus 117
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 1.1.1.281: GDP-4-dehydro-6-deoxy-D-mannose reductase.
pdb deposition date 2007-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pk3A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2pk3A02
1F8FA 3AY6A 3NKLA 3G3EA 2DFDA 1X7GA 1XQ1A 4W82A 3HADA 4HFJA 4OO3A 5DCYA 4U0JA 1OAAA 5LDHA 4R16A 2FP4A 3EUWA 4C4OA 2QRLA 1DJQA 1N7GA 3BTVA 4OYRA 3E1KA 4EDFA 3JQEA 1NP3A 1DC3A 4IDAA 3RUDA 2DUUA 2JL1A 4E21A 1X0VA 3K31A 4CM5A 4BHTA 2V6BA 2Y67A 5L9AA 3JQ8B 5TNXA 5HM8A 1U5AA 1TT7A 4Z9XA 3WTCA 3W4IA 3WFIA 1UUFA 2HK8A 4DBZA 2FR8A 2G5CA 1PJQA 4HXYA 3VPGA 5HS6A 4B3JA 3DHEA 2C59A 3DHNA 1DJNA 1UH5A 4EI2A 2AA3A 2E82A 1YL5A 2ZJ1A 1HYEA 2AMFA 4JX8A 5JC1A 2DVMA 2JHFA 3PJDA 3GN2A 3AM5A 3PHGA 1CRWG 1Y8RA 4H16A 3KUXA 4IJKA 3ZWBA 1LRKA 3KOUA 5JDCC 1SOVA 1DFIA 4CQLA 3U4HA 3DZHA 3GG2A 4BNYA 5GZ6A 1J0XO 4D79A 3UCEA 9LDBA 1JQBA 4IZHA 3WGHA 4DUPA 4E4YA 5KVVA 4Y8VA 3U5TA 5CG1A 4GKVA 3PZBA 1HZJA 4GX1A 2VZ8A 4XZ3A 4LSMA 4XB1A 2WD8A 3X2EA 3RUFA 5LCXA 3PYMA 2C20A 3I9KA 3RBVA 1DO8A 3ANMA 3QP9A 3JD1A 1NHWA 3JQBA 1ONOA 3ZV4A 4ZQFA 3WGYA 3GOHA 1LDGA 3EAGA 1WW8A 1SCUA 1PL7A 2NLOA 3HDYA 5TC4A 3RC9A 3QA9A 4XA8A 3I6IA 4MVJD 3ULKA 4YYZA 4KWHA 3AOEC 4ID9A 4H15A 1UR5A 3ROMA 5DOVA 2VOEA 2B36A 4I5DA 3FR7A 4TRRA 4Z0PA 1R4MB 4CM7A 4BNHA 1YOVA 4XIJA 1UZLA 3EMKA 4PLHA 2NACA 1LDMA 4IIVA 4D46A 4Q9NA 4FBGA 1PTJA 3TFQA 2D5AA 2Q1TA 2J3JA 2DBVO 3HB4X 4CV2A 4CQMD 4FJ2A 3HSKA 2DUWA 2W98A 1X0XA 3ZGYA 3T7CA 1TEHA 1PR9A 4CLEA 2AEJA 3ZWMA 1RYEA 3V2UA 3AUSA 3ADOA 3RBXA 3ON5A 3QWAA 3CMCO 4OGWA 5A9RA 1QLJA 1NVMB 4B4UA 5I7VA 2C0CA 1J49A 3U62A 3WB9A 4NU5A 2PZKA 1FF9A 3D4OA 1ZMOA 4OSOA 3D0OA 5EIOA 3RBZA 1R66A 2PGLA 2UDPA 1KVRA 4L4SA 1V9LA 3SLGA 4JIGA 3RROA 2ZB8A 3K6JA 4PN3A 4W6ZA 3I9JA 2W2LD 5A05A 2OORA 3RKRA 1D7OA 3DBRB 1HSOA 1E7MA 2BF7A 1D8AA 1A9YA 2NTNA 5BT9A 4D45A 4FPXA 1LEHA 4LRTB 5THQA 2GYYA 3BIOA 5F5LA 1T2DA 5TJ9A 1LDNA 1NQTA 2CVQA 3F6YA 1YONA 3WNQA 2HK9A 4ALNA 3HJAA 1CIVA 4IDFA 4YT4A 5KIAA 1FXSA 3OSUA 5HWSA 4P8RA 4Z9YA 1CETA 3BZUA 1W73A 2EIHA 4DGSA 2FMUA 3JQ7B 4NPCA 1YVEI 4PG6A 1C0LA 1UP6A 4UULA 3H7AA 4J49A 4BO9A 3AU9A 2Q1WA 3P5SA 4J1SA 4KDEA 5KOIA 3A14A 1UXGA 3IQDB 3MWEB 3OBBA 3ZWWA 2YHUA 1YXMA 1R0SA 3Q6IA 4KDFA 1LSSA 4PZDA 4DMLA 1Z45A 2P2SA 1PSDA 1LSUA 1YBMA 2J8ZA 4LCJA 4Y67A 2H9IA 2PTGA 4ZQBA 1IPEA 3OEWA 4GSLA 4Y6RA 3ONDA 4B4WA 3AFMA 2BMAA 4D7AA 3UXYA 4LMRA 1I30A 1BW9A 3ADPA 1O95A 3I23A 4E2YA 5JMWA 3TRIA 3D64A 1DFGA 3EC7A 5DBGA 2VYND 2O4UX 3QE3A 4D3FA 7MDHA 3RWBA 2W8ZA 3VDRA 4QFDA 2VYVA 1ID1A 1ZSNA 4HFMA 3R3JA 3LF2A 5DZSA 5DDIP 2ZTUA 1L7DA 4FN4A 5ADHA 2AQIA 3K8ZA 1LTHR 1HL3A 2AQKA 4NNJA 5DBFA 3TZQA 2EWMA 5CDUA 3UW3A 5I7SA 4RQUA 4JLWA 4NJOA 2DPHA 5IG2A 4HP8A 3K92A 2YY7A 2POQX 1SB9A 3ZV5A 1A9ZA 1SMKA 4H3VA 4BMNA 4UUOA 1ENOA 5ILOA 5JNLA 1PJLA 4NMHA 4FGWA 5CDYA 3IIEA 3E82A 2PD4A 4XRRA 3GY0A 4OKIA 4N7RA 3OMLA 3LLVA 4WGGA 1D3AA 1XWFA 4ITUA 4RLHA 3KEOA 4G65A 4PCVA 2VTEA 5JXWA 3GPIA 5CP8A 1R4NB 1VL0A 4R41A 4ZQHA 1WLYA 3K5PA 2B69A 5TF4A 5L40A 2VHYA 2GLXA 3GEGA 3WGOA 4U8GA 1VE9A 4RDIA 4BGIA 3E5RA 4GKBA 4DC1A 3TPCA 2W4QA 4ALKA 3WSWA 2GZ1A 1DFHA 1DHRA 2VWPA 4ND5A 5L3ZA 2P5UA 1E3EA 1U7TA 3NTOA 2BFOA 1DXYA 1VL8A 3OIDA 3WGQA 2Q45A 2P9GA 4ND1A 1Y81A 5T57A 4EZBA 3V1UA 3L9WA 3DHYA 3RUCA 1PGOA 3LC1O 2QHXA 5H81A 2BGMA 5KNLA 4M49A 1WPQA 4P4GA 4B8ZA 2HK7A 1ZBQA 3A28A 3FD8A 4EEXA 5ICMA 5JY6A 1ZCJA 3R1IA 4BO2A 2O3JA 4B7XA 2EV9A 3KZVA 5FWNA 4BB5A 1X13A 9LDTA 4I9HA 5DCWA 3GT0A 3VAZA 4YR9A 4CR8A 1RWBA 1KERA 3OA2A 1R4MA 3Q9UA 4R1UA 3WOHA 4CMEC 4O59O 3WS7A 2NQ8A 3PIIA 2CDBA 8ADHA 4L9RA 5T64A 1ISGA 1T2EA 3WLEA 4GLLA 3M6IA 3MOIA 1DIHA 3GVXA 2CUKA 1BXGB 3PZRA 2X9GA 2P4HX 4JNKA 4ROSA 3ZNQA 4BGVA 4D3SA 2ZQZA 4IXTA 4N18A 4K6FA 5JFOA 4CR7A 5HRUA 3F4LA 2RCYA 1HDCA 2PLAA 4F45A 3UFXA 3GMDA 1T24A 4YAJA 4KMSA 3PFFA 2NU8A 4YB8A 3BMCA 3AWDA 1U4OA 4QFCA 5TS3A 4MINA 4CM9D 1LDEA 1GUYA 1P1FA 1YDWA 4RPJA 2I66A 3NYWA 2AW5A 3WWYA 1B0AA 4OXNA 4BO7A 1PL8A 3FR8A 1DIGA 1S7CA 1Z6ZA 2X0RA 3U4DA 3HFGA 2C5AA 1NPDA 3FHLA 4IXWA 2CD9A 2Y1EA 4XWYA 3WWZA 4WLOA 2X0IA 2FPIA 1K2WA 1DIBA 3UF0A 1ULUA 4LVUA 4TSKA 3DTTA 1U2GA 2EXXA 2YFHA 2I6TA 2VHZA 1T4BA 3KLPX 3QSGA 1UAGA 1XG5A 4AJNA 2I3GA 1E0DA 2WWRA 1Q7BA 2RHRA 1GU7A 1W8DA 2PKRA 4WECA 4R1TA 4J0FA 4XRGA 4JBHA 3JQ7A 2X5JO 5L7WA 2CY0A 4BL5A 7ADHA 2A94A 2X9NA 1QMGA 2JAHA 1B2LA 1E77A 1LC3A 2Y1CA 3ZWXA 1UJMA 4YJHB 3P19A 1GPJA 3V5NA 3CE6A 2ZCVA 1WXDA 2GNAA 4Q39A 3ZWNA 1RM4A 4GAEA 2GO1A 2LDBA 2RAFA 2FR1A 1YS4A 3BMOA 3WLFA 4BO0A 1LA2A 3ZHXA 4MVJM 3BMQB 3AY7A 1HE2A 2Q4BA 1UXIA 4RCVA 4RDHA 1LJ8A 2YUTA 3L6DA 5JYDA 4PG8A 1BWSA 2P5YA 2JFFA 3IUSA 3H65A 4E5MA 5JYEA 1ZFNA 2HQ1A 3M2PA 1U8XX 3V1TC 1HDRA 1Y9AA 3E03A 3VPFA 1VLLA 2HMUA 1N92A 3EY4A 4ALMA 1UDCA 1E3WB 2G17A 2QYTA 1WWKA 2BFAA 3WQRA 4OIMA 2WMDA 1XU7A 1U2DA 3C24A 4E2WA 1DC5A 3ASVA 1T2CA 3IOYA 1YB5A 1QLHA 1NTOA 3KYDA 1K6IA 1CYDA 4M8SA 2FHSA 5A9SA 4D43A 1IL0A 1HETA 3HHPA 5AXCA 2QRJA 5JDIA 2OL4A 1C1DB 1MB4A 3HN2A 3ZU3A 5HTOA 3RASA 5EL0A 1MLDA 2YDXA 3N7UA 4R68A 4FFOA 3RVDA 5JC8A 6LDHA 5IF3A 4OXYA 1KY5A 1DLJA 5CEEA 2CDAA 3PGXA 2XF8A 3VZPA 4AJEA 4TRJA 1R4NA 3TDKA 1RYDA 1Z7BA 2JFGA 1MG5A 3MCVA 3PHHA 4XIYA 3HE3A 3F5SA 4XYEA 3AJRA 4BMVA 1O8CA 3PJGA 3RI3A 3PHIA 1HE5A 2EGHA 4M86A 1FK8A 5FF9A 4DYDA 5B12A 1HDOA 4PLZA 4OH1A 4FW8A 3WFJA 3GC6A 3BTOA 4DWVA 4E32A 5CG2A 1ZZEA 4A2CA 1UZNA 3IJRA 3IP1A 4OSPA 3NJ8A 1OC2A 1QYWA 4BMSA 3F1LA 2AG8A 3JQAB 3OH8A 3H5NA 1C3VA 1O5IA 1FDVA 3FNEA 3STHA 4FOOA 1PGQA 1PGPA 2YV1A 1J4AA 1F17A 2P9CA 1PZHA 1DBVO 4WCFA 4H7PA 2CMDA 2Q1UA 3FSRA 3GN1A 5L53A 2AG5A 2WEKA 2Z1MA 4N5MA 3NT2A 1LUAA 2GUGA 4E2ZA 4NJMA 3NT4A 1Q2XA 3D3EA 3PQDA 4DIFA 1MV8A 3S2IA 4MDHA 3VPXA 1R0KA 4KTVE 3UAGA 2TMDA 5JY1A 1BXGA 1DAOA 4WLVA 2IZ0A 1TLTA 3L07A 3OQ6A 4IINA 1XELA 2OXIA 4E5YA 4IDEA 3I9OA 2DLDA 2YV3A 3DFZA 1EUZA 4E12A 1QYCA 3QWHA 3OJFA 3WBBA 4GX5A 4XX0A 1PJ3A 3E48A 1DIAA 1ZEMA 1KOLA 3GMSA 3RU7A 1GEGA 1WDKA 2Z1NA 4NI5A 3LT4A 1EE2A 2D59A 3JD2A 3QLJA 2ZB3A 1A7AA 1GQ2A 1ONPA 2EP7A 4G2NA 1EDZA 1C1XA 1VM6A 2CDCA 3U3XA 3G17A 3NUGA 3ONEA 1I3LA 1MG0A 3WDSA 2HDHA 4NK4A 4RPLA 4RQTA 4BNGA 5COAA 5JAQA 4II3A 4BNUA 3ZDFA 5G0SA 1KVTA 3DBVO 3RSHA 1B16A 1OI7A 3K9QO 3S8MA 5BSGA 1OC4A 1C0IA 2VRCD 3JQGB 4JQCA 1V6AA 4AJJA 4I9UA 4CLHA 1NNUA 1TI7A 1Y8QB 1XA0A 1KIFA 4M87A 1XQ6A 4I5FA 4R4JA 2Q49A 4BNFA 4CMCA 2FN7A 4R69A 4Z9FA 5DT9A 2DM6A 1GYPA 1GCOA 4RVHA 1V35A 4D0RA 5TRTA 4YJHA 5BNIA 3GFBA 1KEVA 3R3SA 2B35A 1QSGA 3PIDA 1Z74A 1M76A 4BKUA 5K9ZA 1E1KA 2VQ3A 2Y1FA 3DOCA 3EZLA 4Y6SA 5C5IA 5FEUA 5IZ4A 2G76A 1DC6A 3BMQA 3NV9A 3OP4A 4WLFA 4MP6A 5L4NA 1XIVA 1Z73A 3LDHA 2DTDA 3L6OO 3KB6A 1EUDA 4JN6B 3OF2A 1U4SA 4AJLA 5IAAA 4BNVA 2NNLD 1UP4A 4ZRNA 5CAEA 1ZKMA 2ZCUA 1GFSA 1V0JA 3ABIA 4YJFA 4CQMB 1E6EA 4UUNA 5LDGA 3OIFA 4QTZA 5F5NA 2ET6A 4ZN6A 5B1YA 1OZAA 3BXXA 1P45A 1E3WA 2XPCA 1QKIA 3SXPA 3G79A 5ENDA 5KJ1A 4IDCA 1ZNQO 5FI3A 2QZZA 3WBFA 1YWGO 1YQGA 2HSDA 5B4TA 4ZA2A 1T4DA 4MVJP 3WYEA 2BFPA 5AQ1A 3VDQA 1OBFO 4MOWA 4D42A 3JQAD 1T25A 1UZMA 5KWEA 1QORA 3A1NA 3GVCA 1K3TA 2XXBA 4FD3A 5CDSA 1PIWA 4ZD6A 4W7HA 1D1SA 3ZHYA 4U5QA 4IPTA 1J5PA 3OETA 3ICCA 3PPIA 1X15A 2X1HA 4FJ1A 4J7UA 3H3JA 1QG6A 1LLUA 3PQEA 5GMOA 4CM8A 1R12A 4KOAA 2J3IA 4BO8A 4HADA 1R15A 1BGVA 1PGNA 3ENKA 4HNGA 2PNFA 4OXKA 5A5EA 1V3UA 2WSBA 2VNAA 1P1JA 3AI1A 4CMIB 4Z0HO 1NBOA 4NBRA 2R00C 4G81A 3L6EA 3V2HA 3H4VA 4IGFA 5G0UA 4D0SA 4ND2A 2X23A 3TOZA 1HRDA 3DL2A 2O7QA 3UVEA 1WZIA 2YYYA 4DPMA 1WMBA 5DF1A 4GVXA 3F5QA 4HFNA 1UXKA 2CF5A 3JQFA 3COSA 1T2AA 2FRDA 3H8VA 3IDSA 3UKOA 1LI4A 2WDZA 3AY3A 3ETDA 4N54A 3UCXA 1VKNA 4YAEA 5G2OA 1AGNA 1E7RA 3UICA 2C2XA 3QY9A 4J3FA 2BH9A 2NTJA 1Y5MA 1B8PA 3NDJA 1T1SA 4OAQA 4CV1A 2IODA 3W1VA 2CFCA 2ZKLA 3M1AA 3ORFA 2JCXA 3TOXA 3QV1A 1IUKA 1P33A 1NXQA 5CFZA 3L9XA 1PS0A 2JJYA 3EVTA 3I52A 2PR2A 1I3KA 1JWAB 3DTYA 2HLPA 1I2CA 3PWZA 4AJKA 2X6TA 1JN0A 1DRWA 3WNVA 1ADBA 3IMFA 4L4XA 3VH4A 1G1AA 1V3VA 1YL7A 3RKUA 3ZNOA 1VC2A 5CDGA 4R9SA 3KM0A 3VKUA 3WIDA 3NX4A 1ZIDA 3DXFA 1LDBA 5FFFA 4J9UE 3FCOA 3S2GA 2EW2A 4NBTA 3OQ1A 1DSSG 1XKQA 1FDSA 1A27A 4MJLA 3JYOA 3LSYA 1A71A 2IXBA 3PLNA 4XQEA 3O8QA 4BQPA 1EUCA 4A73A 2BI7A 1EQ2A 3JTMA 1BMDA 3ITKA 4XGKA 1EQUA 4YA6A 3I5MA 4BNXA 1AHIA 2Y0DA 4UAGA 4BNTA 2YQ4A 1HLDA 5IJZA 1ZSYA 3DZGA 3E6AA 4CUJA 2D8AA 1PS8A 4RVSA 2B37A 3BMNA 5IDYA 1H6AA 3R6DA 4I1IA 3PXXA 2E37A 3RQSA 4CL3A 4LN1A 5BSHA 3WTBA 1U5CA 1ZK2A 1M66A 1UDAA 3PEFA 3L4BC 2YJZA 3UHAA 4DQUA 4R9RA 4U7WA 2O3UA 2C54A 3E5MA 3VPHA 3DB2A 5L4SA 1Q0QA 2BKAA 4AJHA 2JCVA 4Q3BA 2G82A 5JAIA 5TIIA 4MVJA 4WEOA 2JD2A 3F46A 1MC5A 1JAXA 2PH3A 3FI9A 3K30A 4F6CA 3VH3A 1NAHA 3GF4A 3KBOA 1CWUA 5EMHA 2VUTA 2A35A 3AI2A 4UEJA 4YJDA 1IY8A 4Z0TA 3G1UA 3JQ9A 3RJ9A 3W4KA 3DAPA 4I9NA 2CZCA 2GZ3A 5BNTA 1F06A 1UXHA 3OFSA 3ROPA 4JBIA 3I4CA 3ASUA 3KV3O 3LF1A 3O26A 4CQMA 2EJWA 4A7PA 3KLMX 3R0IA 5ER6A 4PLGA 5DP1A 1HLPA 3A9WA 3PI7A 3BAZA 4K28A 2HAEA 1K6XA 4WNIA 2OUIA 2B0JA 3CKYA 1R0LA 5T8KC 4AJPA 4HV4A 2BGLA 4JBGA 5F3RA 4WE3A 1VSVA 2Y0CA 3HDQA 1ISFA 4GL4A 3QVOA 4MKZA 4BNJA 3WYBA 1QR6A 4FCCA 4JK3A 1ISMA 3GNTA 1U3WA 1WZEA 3MTJA 2IXAA 1X14A 1YH3A 2W2LA 1DEHA 4BKRA 1IOLA 1GYRA 4XDYA 4O1MA 6ADHA 2DBRA 3NTQA 1I24A 3OJEA 4D44A 4PRKA 3B70A 1OOEA 1KC3A 3CXRA 1IB6A 3GR6A 3G49A 3ZI0A 5I9NA 1AUPA 2YDYA 1E7SA 4RZHA 2WE7A 4RV9A 3T7EA 2BFMA 2WYUA 1MA0A 1MP0A 2AE1A 3AU8A 1FDWA 5JMPA 2OHXA 3VTFA 2X9VA 1PZFA 3MTGA 4FIZA 1I3NA 4RVDA 2DQ4A 4MIEA 4B4VA 2NU9A 1N9GB 1VJ1A 3JQ8A 2A92A 2ZQYA 3TWOA 3QIVA 5EPOA 4CM1A 5BSEA 1WNTA 3VZQA 2HU2A 3UN1A 4GX2A 2J6IA 1K5HA 4KUEA 3C7CB 3D4NA 2AE2A 1AE1A 3JYPA 3IS3A 1GUZA 4J4BA 4MKXA 1B3RA 1XSEA 4PG7A 1ADCA 4FSHA 4Y6PA 3KYBA 1B14A 1W4ZA 5ICSA 5H82A 2Y66A 4BNWA 4FC6A 1QV6A 1A4IA 1NVGA 5JDCA 2VRBA 1GV1A 1JTVA 3KHUA 2H5LA 1ENYA 1YB4A 3PQFA 3QHAA 3MJTA 3E9QA 1YBAA 2VYNA 4EJ6A 3M1LA 5AVOA 2WE8A 4NU6A 2VWQA 2RBEA 4CUZA 1SNYA 4BOYA 2PY6A 3HFSA 3JYNA 4I08A 3SJUA 4TRMA 4KQXA 5HS4A 4K1LA 1T1RA 2PZJA 3H9GA 3KO8A 5COQA 3ZU5A 3U4IA 4HFRA 4A0SA 4F6LA 4LW8A 5K0ZA 5T6BA 2O7SA 1DPGA 3JV7A 3PRJA 4B7CA 2AQ8A 4BB6A 5G0VA 3DMTC 4CM3A 3ROKA 3HQ4O 1PX0A 2B4QA 1VSUA 4R3WA 4J7XA 3RC7A 2HKIA 4RGBA 5KJEA 1D4FA 1AN9A 5DOZA 4CM4B 3ANNA 4YT8A 1GQYA 1PL6A 3KTDA 5JCXA 3DBLB 4DL9A 3LQFA 5A3VA 1C14A 3NRCA 2NTVA 1Q7CA 1Y6JA 3I4FA 4IGEA 1U7HA 1U3TA 2OO5A 4CODB 1VKOA 1LRJA 3GLQA 5DCUA 3GUCA 1IHYA 1E1MA 1NFQA 3ONFA 5TT0A 2GDZA 3ANLA 4I5EA 4CMHA 2FZEA 1KEUA 3AM3A 4R3NA 2ZTLA 3JQCA 2ZTVA 4NH4A 3C3XA 3HN7A 4YRBA 4ZJUA 3W6ZA 3ZZNA 5GZ1A 4BV8A 1TA4A 4J4TA 3ZN2A 3AUTA 4R01A 5CEFA 1CDOA 4DVJA 1SAYA 3ZWCA 3FRJA 4YRAA 2X7HA 3K2BA 3KRTA 5BNFA 1XLTA 2PK3A 1P77A 2FSSA 3WJAA 5BQFA 2HCTA 3AM4A 3EK2A 4LCEA 5T5QA 3WJ7A 3WYCA 3SC4A 3KSUA 1I8TA 1NASA 4DLBA 1MXFA 1WVGA 3WMXA 3DBRA 4HNHA 3IP3A 3V1YA 2NSDA 1B15A 3HZZA 1PWZA 4ALJA 1KS9A 4GMGA 1RM3A 3GZNB 4PLYA 2D2IA 3MJSA 3VOSA 3GNQA 1Z75A 1QV7A 4R1NA 5K6AA 4Q3AA 1OFGA 1EBFA 1GZ3A 4B8WA 4WPGA 2NWQA 5TSDA 1BVUA 3G1TA 1HT0A 4D3DA 2Y1OA 1SEVA 2GN4A 4MVJI 3D1LA 4WK6A 1HXHA 3IKVA 1XDWA 4CMJA 2GF2A 1H9BA 4LSWA 4CPDA 2Z95A 2I9PA 3DAGA 2NU7A 3G0OA 3FNFA 4NK5A 1HF3A 1GY8A 1J6UA 2PD3A 1TXGA 4NDNE 3VHRA 4R5HA 1JAYA 1F14A 1NWHA 4F3YA 1P44A 2EKQA 1PQPA 5AYVA 1Y5RA 3BTSA 3I9MA 1I33A 4MIYA 1EBUA 4XQCA 3A4VA 3CTMA 3MJ4A 3OEYA 4KUGA 4A03A 4CJXA 2UYYA 4GX0A 1F8GA 3BYZA 2WD7B 3T4EA 1L1FA 2HMTA 5ENVA 1EVJA 4UVDA 4AL4A 2BD0A 1TT5B 3LZ6A 4YT5A 5KJFA 1ZMTA 2E49A 3WX0A 4PGFA 3C1TA 1JKJA 4PLTA 4R5MA 3GH3A 4GSKA 3H2SA 3B1KA 2YQ5A 4BKOA 4CV3A 1PZGA 1YRLA 2F00A 4HKTA 4J1NA 1Y7TA 4AVYA 1JVBA 3U49A 5IN5A 1ZJZA 4XQ9A 1UXJA 3U4CA 4GPD1 2GN9A 1FMCA 3AI3A 3DO5A 3JD4A 1L7EA 3EGOA 5C3MA 4J1TA 3MOGA 1N9GA 2O3SA 3PJFA 1F0YA 2VZ9A 1RM5A 3F3SA 3WSVA 5TT1A 2PKQO 5G4KB 3QQPA 2E6UX 4M1QA 2B5WA 1MXHA 2H6EA 2I3AA 1KBZA 3SX2A 1R16A 3QVXA 3ETGA 1PJSA 1CQJA 1E92A 3LT0A 2V7PA 3NJ4A 4HWKA 3NAQA 1DRVA 4JXKA 4NFSA 4O6VA 2ZB7A 2GR9A 4XDZA 5H83A 3P2OA 1DIRA 1K6JA 1TVEA 1ZK3A 5EINA 3W6UA 1P1IA 2IE0A 1G0NA 3ZWOA 4P4LA 2QZ9A 4IS3A 3LU1A 4PVCA 3PHJA 3VVBA 1ORRA 1UDBA 3KYCB 4W9NC 5I9MA 2Q4EA 3TQHA 3UUWA 2AEMA 1KVQA 3GAZA 1R6DA 3GDFA 3H9JA 1XYGA 4IQ8A 5EERA 1IULA 5A9TA 3BHJA 1X7DA 2PKQP 2X86A 3DONA 5U1PA 3DZBA 1Z7EA 2H63A 3HDHA 4FJ0A 4IMRA 2EEZA 4E5PA 1ZO8A 4L76A 1DAPA 2O48X 1HZZA 3GEMA 4P22A 1EVZA 1ISIA 2FWMX 2HO5A 2V6FA 4YRDA 4EITA 4RORA 3SBOA 4K26A 4CLDA 2YZ7A 4PLFA 2C5EA 2EJVA 3DZFA 3FBTA 1E3IA 4CMEA 3TFOA 5TJHA 5JS6A 4DPLA 1PJCA 1SO8A 2WTBA 4CMGA 3I9LA 4IMPA 4KTTE 2CNBA 1BSVA 2O3QA 4QSMA 4BV9A 5F21A 2GD1O 3DC2A 3W8FA 5KJCA 2DU8A 3BTUA 4CMKA 1AXEA 3LT1A 3GZ4A 2XOXA 1ISJA 4ESOA 4YCAA 3TL2A 2O23A 2D0IA 3RUHA 4AJOA 3RUEA 3ETEA 4DQXA 4NIMA 2E48A 4YTEA 1X1TA 1S6YA 1NWCA 4RPHA 4EJ0A 1BXKA 1U8FO 5L51A 1I32A 1WP4A 2EERA 1EZ4A 4YAIA 3CPSA 4RVUA 1I01A 1H6CA 4HUJA 5ITVA 3QWFA 2HMSA 3VKVA 3E18A 1I5RA 4BKQA 3RCBA 4U6SA 3Q11A 4BIIA 4OM8A 3GGGA 3JYQA 3T4XA 3PDUA 1EMDA 2EW8A 3UOGA 2X22A 3VH2A 4FFMA 1XCBA 2J5KA 4FQ8A 3JQBC 1LQTA 2F1KA 4W7IA 3RFVA 2XXJA 4Q3EA 2G1UA 1QYVA 2ZK7A 5AXDA 2QYSA 3X2FA 3P7MA 8LDHA 1XHLA 4ALLA 4R51A 4XYLA 3AUAA 4BNKA 1SB8A 5KTKA 1YOVB 2VCYA 5A06A 1ZJYA 4JP2A 3FNHA 1GL3A 3TSCA 1EFLA 2QX7A 4IQGA 1EE9A 4KUHA 3H9UA 2Q3EA 5I9LA 1ZK1A 1PEDA 4S1VA 3TZKA 3VZSA 3ZNNA 2PGJA 3GA0A 3DEYX 2Q99A 3QVTA 1JLLA 2Y1GA 5IXYA 4LVCA 2JD1A 2PA3A 4M54A 4RPGA 2VTDA 1P31A 4UREA 1I10A 3C1OA 3RUAA 2IEBA 4YPOA 3RC1A 4F46A 4TWRA 5CEJA 5ITWA 2ZATA 3SLKA 1LSOA 5TQVA 4YXFA 5IZCA 5DBIA 2ILTA 4GWKA 5JCJD 4ND3A 5B37A 3HG7A 3DZKA 3TNLA 3S2FA 4CMBA 4WLUA 5KVQA 2EF1A 3OJ0A 3W8DA 2RHCA 4EBFA 2NM0A 1PS9A 1IHXA 2EGGA 3JD3A 4S3MA 4E33A 2QW8A 2PFGA 1DHTA 3DFUA 2VRCA 4OOFA 2JCYA 4BNNA 4AG3A 2OMEA 3GAFA 5TLSA 4RJTA 1LC0A 3CINA 1DLIA 3Q0EA 1NR1A 3QWBA 1P1HA 2ZB4A 3SC6A 1QP8A 4FC7A 4FFLA 1ADGA 1HDYA 1HKUA 4IDBA 1C1DA 4WASA 1H2BA 3PYXA 4TKMA 1KEPA 1ZW1A 4IQ0A 5LC1A 1U3VA 1U1IA 5G4KA 1NPTO 1VI2A 2ZJ0A 3C1AA 1ZK4A 2Q2WA 1ULSA 3PDJA 4NQZA 1HTBA 1Y9EA 2OFPA 5AXBA 5FI5A 3CH6A 1H6DA 2Y68A 2UUOA 4I5GA 1YQXA 2UUPA 3NTRA 4Z6KA 4INAA 2O2SA 2DBQA 3D5QA 3EVNA 4MO2A 5THKA 1H94A 3F9IA 4QO8A 2Y05A 3GK3A 3Q3CA 4LRSB 2RIRA 2O3TA 1EK6A 3CUKA 4XQGA 2VHWA 3DZIA 4XEHA 3KYCA 5BR7A 2UV8A 1JA9A 4OL9A 4DC0A 4L74A 1I36A 1EK5A 3H3FA 1NQAO 1SZJG 4PVDA 2GZ2A 5JE8A 4IZIA 1YJQA 2EHDA 1GPDG 3TL3A 4ZICA 4HX5A 2O2YA 1FDUA 4MVJG 3DAFA 2V65A 1IZ9A 3PWKA 1NM5A 1RPNA 1HE3A 3C7DB 2QRKA 2JKVA 2FR0A 3TZHA 3JQAA 4IS2A 4DXHA 1E3LA 2CVOA 3D3WB 4TKLA 1XGKA 4NZ9A 4UUMA 1HDZA 1BDBA 4UUPA 4ONEA 1KETA 4MVJF 3DOOA 4E30A 4Y9DA 1BHSA 1M2WA 1GCUA 4NBVA 1QYXA 5JO0A 4J90A 3OICA 1E7QA 1P0CA 4DPKA 3PLRA 3L77A 4YJGB 2FPPA 1NHGA 3RIHA 3E9NA 2D4AA 4DREA 5GY7A 2VUSA 3CSDA 1CQIA 4TVOA 3RFTA 4OJNA 1LX6A 3OQBA 3PFWO 4OQYA 2YV2A 2VN8A 2PV7A 2QIOA 4UVIA 2IYPA 1AHHA 4PLPA 4WOJA 4PG4A 2ZIZA 3FNGA 4XR4A 4CLRB 4GGOA 5L7YA 3CZMA 4FOSA 4ND4A 1GUFA 2NVWA 1PQUA 4QEDA 4GGPA 2DBZA 5IN4A 3IJPA 4BO3A 2I99A 3KEQA 1EVIA 1ZXBA 3GRPA 3QW2A 2W2KB 1NAIA 1X7HA 1XR3A 3QRWA 2FOIA 4LK3A 1YJ8A 1QYDA 3F47A 5JPIA 4U6QA 3AOGA 4BNLA 2B5VA 2P4QA 3PGJA 4Q3NA 4AJ4A 5L95A 3AFNA 1LSJA 3DWFA 4FFPA 3EDMA 3GVHA 1C0PA 3INTA 3E9MA 4XYMA 1V3TA 3GVPA 3DBHB 2NV6A 2X58A 3PK0A 5EJ2A 1WDLA 4ZU3A 1RKXA 3LT2A 4MVJH 1GADO 4TZKA 1UAYA 4YEDA 5DNAA 3VTZA 3U09A 2OBNA 4CLXA 3JQGA 3DR3A 1GEEA 1A7KA 1DDOA 1CEQA 4BS9A 1Y8QA 2D3TA 1GZ6A 3JQ6A 1KVSA 3OIGA 1R37A 4FS3A 1M67A 4BGEA 4RF4A 4C7KA 3C8MA 3C7AA 2GSDA 4BNIA 2C7GA 2VT2A 3WXBA 3W4JA 3WR5A 5I8ZA 3W8EA 3EW7A 4YVFA 2GCGA 1SOWA 3QVWA 3OJLA 4AJIA 3JSAA 1Q1NA 3PYLA 2HMVA 1X1EA 1DRUA 2PH5A 2NVUB 4J2HA 4QO7A 3BMCB 3ICPA 3ZV6A 1CERA 3B1JA 4KWIA 2B4RO 1H6BA 1N5DA 3GGPA 5EESA 4AFNA 2JAPA 2VHVA 3S1LA 4EYEA 3RUIA 1IE3A 1EFKA 4HBGA 4E5NA 3EYWA 5J23A 1VPDA 1YBVA 3GHYA 4ZRMA 4BNMA 1D1TA 4MP8A 1PJ2A 3O9ZA 4J9VA 4WCDA 3KSDO 1G0OA 4B79A 2C82A 4PLWA 3WGIA 2DTXA 5KCZA 3H9EO 3CEAA 2XAAA 3U0BA 1ZVMA 4NBWA 4UEKA 3FF4A 4Q3DA 2GPTA 2VZ0A 3WIEA 1NFRA 2VYVD 4G5HA 3UCFA 4AICA 4FR5A 4WKGA 4XB2A 1SEPA 2JFHA 1BG6A 5CHEA 4J7CA 1Q7GA 2Z5LA 1GYQA 3FWNA 3GEDA 2EP5A 3QVSA 2WYVA 4GVLA 2AQHA 4FDAA 4BO1A 2BGKA 1FJHA 1LLDA 2OBYA 1V8BA 1EEHA 2OZPA 4ILKA 4YBZA 5TX7A 5K6AC 1HDXA 3DZJA 4RF3A 5IFLA 3GDOA 1NYTA 2NUAA 4E13A 4U0KA 4J6FA 1E1NA 3ZU4A 5EN4A 1ML3A 2IRWA 3AW9A 3F4BA 1LQUA 2I67A 1PWXA 5U9CA 3OJOA 1EVYA 4NFHA 3BMOB 1DB3A 2BRUA 3S2EA 3N58A 2C29D 4DA9A 3QJ5A 1ADFA 5ES3A 2FSVA 1YKFA 1G6KA 4QXMA 3JYLA 4C7JA 1HEUA 2R00A 5T67A 4CMIA 3NDRA 3LLSA 1BTOA 3EHEA 1YE3A 4XR9A 4XGIA 2Q50A 3RJ5A 4E5KA 2GN8A 2JD0A 4MVJE 2WM3A 1E5QA 2JHGA 3GFGA 4CV0A 4P38A 3WICA 3H6KA 3Q2KA 1E6WA 1F12A 4E31A 3MJCA 4IBOA 5ILGA 3IL2A 3HB5X 1A72A 2R6JA 3AK4A 2PZMA 3KYDB 4JROA 5A9SB 2BLLA 1I2BA 3FTPA 5IXSA 3KXDA 2Y1DA 3D3WA 4GMFA 1BDMA 5G0TA 4RF2A 5JLAA 3RU9A 4CUKA 2IZ1A 2OP0A 3FPCA 5JDIC 1JKFA 4CLOB 5KJ6A 1LXCA 4O63O 1ZK0A 3INGA 2HJRA 4Q3CA 5IDQA 3I1JA 2R2GA 1GZ4A 1I3MA 3MJEA 5C7OO 4YJGA 4RPKA 4UVEA 4W4TA 4OMUA 4QT0A 1ENZA 1M75A 2CF6A 2V6MA 3FBGA 2UVDA 2QQ5A 4UVHA 3C85A 3FN4A 4J2OA 4WLNA 1Z82A 4RO0A 1SPXA 1NX6A 2O50A 2YHIB 5F1PA 1TB4A 4J16A 1I0ZA 4CLRA 1ENPA 3BA1A 3ROQA 4QUKA 3GGOA 3JD0A 3RAJA 5I7EA 3AOEA 4RVGA 2FY8A 4WOKA 3ITDA 1LRLA 4WUVA 2BI8A 5B4UA 2D1YA 2W2KA 4DLAA 3SEFA 1JDJA 1LBEA 4J1QA 2GRAA 4A26A 3PHLA 2ZYDA 1M6HA 1LDYA 3IC5A 1CF2O 3B6ZA 3CIFA 4Z3KA 3OM9A 2W90A 4NR0A 4YAGA 3SVTA 3S55A 1DC4A 4NBUA 4R1SA 1NPYA 4E3ZA 4XJTA 1ZXLA 1PZEA 3RFXA 3DBHA 3PVZA 3FTNA 3M2TA 3LVFO 4FB5A 1WMAA 4L73A 4WCFB 4Z3DA 5CPBA 3WGGA 4EUEA 3MZ0A 4TMFA 3ZU2A 4WCFC 5KKCA 1JVSA 1AXGA 4NJMB 2AHRA 3VC7A 2V6GA 4O5OA 3BHIA 5MDHA 5FYDA 4A27A 4W99A 4CL8A 1BXZA 2VNSA 2RH4A 3Q2IA 3MJVA 4WEQA 4QECA 5L4LA 3L4BA 2DKNA 2NQTA 4PZCA 4L0QA 4CR6A 3ZWYA 3HWRA 4EJMA 2PWZA 5COBA 4J43A 2A9FA 1HWYA 2H1SA 3JQDA 5A02A 3D7LA 2I76A 3GUYA 4ZQEA 3JCZA 4MPDA 2SCUA 1N8KA 1U3UA 3GRKA 3ZWVA 1E6UA 1PQWA 1GR0A 4XYGA 3OA0A 4JGBA 2FPGA 2GN6A 4YDRA 5MGBA 3ZWAA 5C7LO 2NVUA 4R54A 2J3HA 3RC2A 3TN7A 4CMAA 4IJVA 2DT5A 3CMMA 5U4QA 1B3BA 4A10A 4AJ2A 3F1KA 3FWZA 3TJRA 5C37A 2BELA 3K73O 4BKPA 1QRRA 3UGKA 4XYBA 2UAGA 2Y99A 1SC6A 1H93A 4ZQGA 2IYOA 1C1XB 3QWIA 4MKRA 3D5TA 5C7IO 4B4OA 4J91A 5JW6A 1B8UA 4NFYA 3VVCA 2CVZA 1YB1A 4DLLA 5DN9A 5T8KA 1GQQA 3KETA 5EQFA 5A3JA 3L0DA 2IDZA 2DAPA 3O03A 3HUDA 3A06A 1Q0LA 1ZH8A 4YQZA 2NU6A 4CM9A 4PFJA 1KY4A 3IAHA 5AOVA 1ONNA 2X5OA 3GG9A 4EGFA 5IDWA 4XD2A 3GQVA 3PP8A 1H2HA 3HDJA 1YGYA 2RH8A 5JAMA 2DC1A 5G0WA 3VPSA 1BRMA 3B20A 2NVBA 4I8XA 3VZRA 1E7YA 1ZEJA 4TRNA 3WG9A 4MP3A 3TZ6A 5DP2A 5CDTA 4M55A 1KC1A 2VOJA 2C07A 4IUYA 2X8LA 2BHLA 3ENNA 5A4DA 1BVRA 1SBYA 2OGUA 4JP3A 1LLQA 2HRZA 3P2YA 1P3DA 4ZGWA 4QX6A 2P91A 1YL6A 1YDEA 4N5LA 3IUPA 4EEZA 1MFZA 4D41A 2EKPA 1H0KA 3U9LA 5IZCC 1CJCA 1H5QA 1IYZA 4URFA 2P68A 4J0EA 3IKTA 4IJWA 1E3JA 4YJFB 3NEPX 4OOEA 5TGDA 4GQAA 2O4CA 4GH5A 4OKNA 1OMOA 3UH1A 1PJTA 1U28A 3NGXA 3I83A 3E8XA 3B1FA 2B4TO 3I3OA 4N5NA 1MFPA 3D4PA 3ZHZA 3TF5A 5KVCA 5I8WA 3L4SO 1A5ZA 2PD6A 1PU2A 4WNCA 3K2EA 2YFQA 1RM0A 2O3RA 1HDGO 4WLEA 5EQDA 5JO9A 1GV0A 1UP7A 4PIVA 5JAZA 1N2SA 1O9BA 3NGLA 4DIBA 4CLOA 4PLVA 2D5CA 1DOHA 4ALIA 5L7TA 2NADA 1FDTA 1U9JA 1JU9A 4EUHA 1LU9A 2I65A 3ZWPA 1O6ZA 3DMYA 4IJUA 3WQQA 4TZTA 4EW6A 1VRWA 2X0JA 4CM8B 2PGDA 2J5QA 3V2GA 2Q2QA 3GHHA 1MGOA 2LDXA 5AXAA 1E1LA 2VWHA 1T26A 2HJSA 2OP1A 1ISHA 1P1KA 3DMTA 3KSZO 2YHIA 5A1TA 3H5RA 3BHMA 5I7FA 4LGVA 1IPFA 4B3IA 1MUUA 1Y1PA 5BSFA 2HMWA 2GGSA 4BGUA 4DBVO 4Y98A 4BVAA 5JBIA 1O89A 2TMGA 5HA5A 1NR7A 3NDIA 1NFFA 4ZHSA 1O94A 3MEQA 2Q1SA 3WMWA 2VUUA 4AJ1A 4UEOA 1JW9B 1B7GO 4CM4A 4DRYA 1K89A 4DYVA 1GTMA 1E5LA 5L45A 3PTZA 4M89A 2B83A 4X54A 3DBLA 4E6PA 1VJTA 2Y0EA 1W6UA 1T2FA 5G4LA 2HUNA 2Q2VA 4BO4A 1KEWA 2WJPA 5A5FA 4RF5A 4E0BA 1Y8RB 1P0FA 4PRLA 5GZ3A 1N1GA 1YO6A 1ARZA 3INRA 1P74A 3K96A 3WGTA 4BQRA 2J3KA 1B8VA 4CQLB 3O4RA 3Q9NA 2AXQA 3JQFC 2ZTMA 3GPDG 3WGZA 5F1KA 5JSFA 4HY3A 3PWSA 1PGJA 5F1OA 5A03A 2C7VA 5HBRA 1E3SA 2AEFA 4IY1A 4KP7A 4XKJA 2X5KO 3LC2O 1PR3A 2E4AA 1GAEO 2A4KA 4GLOA 4L4RA 3ZW8A 3O38A 1HYHA 4BO6A 1YQDA 4KQWA 2I5PO 2FZWA 2P9EA 4B7UA 4B3HA 2X0NA 1I2ZA 4FGSA 4DTIA 5DULA 3VH1A 2IEDA 1A4UA 2PZLA 3GZNA 4DIOA 4GI2A 4YT2A 1HYGA 4II2A 3FPLA 4YWJA 1M6WA 3ZNPA 1H9AA 1MC4A 3RD5A 4KZPA 2QG4A 2ZYAA 3LK7A 4OHUA 3AUUA 3ST7A 4GBJA 1GDHA 4IIUA 4TROA 3LYLA 2DTEA 1VL6A 2J5RA 4RL6A 1C0KA 3ZH2A 2G0TA 1JKIA 4P4NA 3O8QB 3DQPA 4YQYA 4IDGA 2X4GA 4BO5A 1LNQA 5KVSA 1P9LA 3GNSA 5CPFA 2ZYGA 4NG5A 4NHEA 4IDDA 4LISA 1ZSVA 3DOJA 4FFRA 2VHXA 3Q1LA 1EDOA 3OECA 3SJ7A 4CM6A 4K9DA 1NQ5A 4TVBA 3BMNB 1PJBA 1E7WA 1HSZA 3MWDB 2IZZA 2EG9A 3V8BA 4E2XA 5KKAA 1NQOA 3DDNA 2WD7A 3N74A 3GVIA 2VT3A 4XCVA 1ZUD1 1LLCA 4JJGA 1N1EA 1O0SA 1TT5A 2DPGA 3CZRA 3TZCA 4JJIA 3ZW9A 4L8VA 3NT5A 3H5AA 4JJFA 5A04A 4IM7A 4OQZA 4TQGA 2GERA 1P1RA 4PG5A 2Q46A 2HRBA 1PJ4A 1XU9A 4LMPA 3ZCXA 4K6CA 4J4HA 1JWBB 4O0LA 4A5OA 2WYWA 3JQ9C 3ZV3A 2OOSA 3EZYA 4PZEA 1WAMA 4XGNA 3H2ZA 1Q0HA 4EUFA 3KVOA 3H9QA 4QQRA 4RLSA 4ZVVA 4XJSA 4YACA 1NVTA 3PJEA 4WJZA 4DMMA 4BNZA 4DQVA 3LC7O 4YAKA 4L75A 1QXSA 2EKLA 5IDXA 3ZHBA 1MX3A 4BUCA 5B4VA 2DFVA 1WDMA 4FFNA 3WQSB 5JCJA 3HNPA 1HE4A 1RJWA 1K0UA 1KVUA 1XEAA 4RVFA 4W9NA 1B26A 4JCOA 3GDGA 4RZIA 3OHSX 2YW9A 4PLCA 3I9NA 1GD1O 2C2YA 2GASA 2CSUA 3I6QA 1BW9B 1VJ0A 4UVGA 2Y93A 1KYQA 1N7HA 4MIOA 1W0CA 5ER9A 2VWGA 1IZ0A 4GWGA
chains in the Genus database with same CATH superfamily
1II8A 3DPIA 5DBHX 3ZJYA 2IS1A 1F8FA 2O7VA 1B76A 2BSAA 3ZX5A 5K2OA 5E0KB 1O0CA 4ESVA 1RKQA 2WU1A 1KQOA 2HJGA 3ESZA 1NRJB 3Q8WA 1FNCA 2JAQA 1E2GA 5KSZA 5DCYA 3RYFA 4J3NA 4QT4A 1YA8A 4NY1A 1ZRSA 2BRUC 2XGJA 1N7GA 3SR0A 1R6VA 5AKIA 4I1UA 4A15A 1SCNE 2JL1A 4OHYA 4E21A 4YRTA 3K31A 1MHTA 5HQTA 2NYVA 2Y67A 3N28A 4XM1A 2C1ZA 4US1R 5D3KA 3VHQA 5HM8A 1AQIA 4O33A 3FCUB 1J0DA 1UUFA 1OZ0A 4DBZA 3H05A 4GNKA 3P0RA 1VXOA 5JAUA 4HXYA 5ENZA 4MRVA 2NG1A 2ONZA 1DJNA 4D8TA 4TMWA 2HBYA 5KSPA 3VU9A 1GA1A 1UBLS 3I6MA 1M72A 1Z6PA 2PLNA 2W2NA 1HEIA 3GW8A 5M3BA 2W22A 3DM5A 3C0KA 1F2TB 1M1YA 2AMFA 4KRYA 5DWDA 2DVMA 1BAPA 4PPQA 3PJDA 4KQGA 1VZ3A 2A9JA 2XCOA 1JJVA 1N7IA 1G5QA 3OX4A 5JROA 2PCJA 4FMBB 3AETA 3F98A 2AI1A 4IYJA 2I2AA 3ILVA 1BJKA 1GGFA 5DYWA 1PX2A 3GG2A 3MGAA 4KIWA 1Z62A 4L72A 5GZ6A 4G0OA 2C88A 3IEKA 4R2IA 1MO5A 2ZSFA 5KWSA 2E7ZA 3DVLA 4QNNA 5JXHA 1TDJA 1ZR2A 5JD5A 3HM2A 5CG1A 2WTMA 2OV2A 5AM0A 1CFJA 4O1IA 1RMQA 2OKGA 3C2QA 1X39A 4PPYA 3RUFA 3CW9A 4RPIA 2C20A 3I9KA 3RBVA 1WQ4A 5AJUA 2Q3CA 3QLUC 2ZQ5A 1OZHA 4TM7A 4XWGA 1AKUA 2W6ID 3QP9A 1NHWA 5JATA 2DJ5A 2QW1A 1OX5A 1MDBA 4P82A 2PXHA 3O9MA 4QG3A 3EAGA 5CVJA 1WW8A 4RH1A 5JLJA 2WKWA 1RZRA 4DR7B 4ES6A 4EG8A 2KLHA 4XA8A 3I6IA 4YMSA 4MVJD 4ZJPA 1JP7A 4ID9A 5FDFA 4KO8A 3NWBA 2HRQA 3H19A 4B81A 2HF9A 3LKZA 3ZXSA 2PG3A 2EL9A 2B36A 2VOEA 3DVRX 3RYTC 3TKAA 3HRHA 3KQUA 2EEPA 4ZTBA 4L5AA 3NNDA 1VE3A 2OM2A 1UZLA 4I81A 1U9YA 1PJAA 2QTWB 3I37X 3KSBC 4OU5A 4RFVA 1LDMA 4PZUA 3KQNA 1ZVJA 3AINA 3KHSA 5BOVA 4Q9NA 4KGVA 5DGIA 3OU2A 2G9UA 4RJKA 5FPQA 3E35A 2D5AA 1D2RA 4MQFB 1UKZA 4C7VA 1P0MA 1J90A 1J25A 1RXSA 3COZA 4OQDA 1HUQA 2CLHB 1U65A 4Q3KA 4R40A 5EIAA 2DZDA 2VRNA 4RD2A 1L8OA 1TJ5A 4CKXA 5FT9A 1SC3A 4CCWA 4CQMD 1K9SA 3HSKA 3PE6A 4WK2B 2W98A 2R6GA 3ZGYA 3DLIA 2HT6A 1E32A 4U7PB 4ZYTA 4CLEA 4CN9A 2AEJA 4KW7A 1RYEA 3ZWMA 4OUDA 3UWSA 3ADDA 3RBXA 3CWZA 3R5JA 1YAHA 4IHJF 1PNTA 3WIBA 3HKCA 3CX8A 4B4UA 3HS3A 1J2UA 2JLRA 3A32A 4MV8A 2ST1A 2C0CA 5J47A 4NU5A 4ILEA 4RV4A 2PZKA 5T4FA 3D4OA 4GFDA 3TUJC 1ZGCA 3IOBA 4OSOA 4WY8A 3ZK8A 4ASUD 2R87A 3PDHA 4CMBA 3MVEA 5EIOA 3E9EA 1Q19A 2PGLA 2UDPA 3MUEA 5KREA 5GPBA 4XD7A 1V9LA 2UKDA 3SLGA 3RROA 1HY3A 2W2LD 4Q9KA 2OORA 1HQYE 5E7IA 3DBRB 3WB2A 3MJHA 1VDMA 4OLJA 1E7MA 3GJTA 3WIOA 5EJ6A 3IIMA 2ETVA 5FR1A 2ZYHA 4HVAA 5J63A 4LRTB 1P2BA 3CXUA 2OWDA 1T2DA 4Y7DA 2F43B 3IQZA 2MYTA 5TJ9A 2EX4A 1LDNA 1NQTA 3ZD8A 2CVQA 1V8DA 3WNQA 3HJAA 4LG1A 1EYZA 3OPYI 4HAYA 3KQLA 4LY6A 4MRPA 3V4VB 3EGVA 5ED0A 3JARB 5T4HA 1C4XA 4A3SA 4Z8YA 5HGXA 2BFDB 4DGSA 3H4MA 2FMUA 3RW9A 4CTNA 1YVEI 3WL6A 2ONJA 5JTUA 4AKHA 2ALJA 1P6QA 2Q1WA 3V1MA 3VAAA 3MC1A 5HZHA 1JS1X 4KDEA 1SG0A 1L3CA 1YFKA 3SICE 5D3MB 5DHAA 2DWCA 1DUVG 3ZLTA 1QE3A 4EHBA 5E1MA 1RRCA 3ZWWA 3DEJA 2YHUA 2KBEA 4CVNA 4MQ4A 3AB8A 1KXJA 1LSSA 3CEHA 3EIXA 4BWVA 4D02A 1R9JA 1Z45A 2GAAA 2P2SA 2Y77A 3LRPA 2J8ZA 4Y67A 4UCXA 3U39A 3UGQA 4CPDA 2H9IA 1TQHA 2PTGA 3PC2A 1XPJA 5C8YB 1UJNA 1WUTA 3O3CA 3RYIA 3FYTA 2NP7A 4G3XA 1Z63A 1XU4A 3DPSA 4Y6RA 2HQBA 3ONDA 2A1TS 1M0TA 3AGPA 3V4LA 2F9FA 3VR6H 4DNXA 4DADA 4NV0A 5IVKA 1VSQA 2AN1A 2FSIA 3ADPA 2E18A 4E2YA 1F1JA 1F0NA 1WKVA 3TRIA 3UMGA 4F3KA 2PZ8A 5KKNB 4RKQA 3ILHA 4QULA 3RWBA 3ZI4A 3AILA 3WZLA 2DMRA 2OV1A 1J8MF 2VJLA 3QOFA 1ID1A 5A4MS 3KD2A 5AKYA 5DZSA 2Z2JA 5DDIP 5JS2A 4DCCA 1ZW6A 4IW3B 5ADHA 1H2FA 2AQIA 2IP2A 3EXAA 2XVAA 1LTHR 2Y76A 1RLOA 5BR8B 4NNJA 2WBLC 4PYIA 5DBFA 2EWMA 1MTOA 4BBPA 5I7SA 1XTJA 2OD7A 2BZ1A 2NO7A 4H18A 3N0WA 1OT3A 4PU0A 3QFFA 4NJOA 3TTYA 5IG2A 1Z6YA 1E8MA 4Q05A 1RRPA 2ZSUA 2J9XB 3FHCB 2POQX 1Z8NA 3HWSA 3KXPA 1LBHA 1P72A 2JCSA 3R6WA 3F96A 3ZV5A 1NBEA 4HR7A 2LV8A 4PX3A 1ENOA 3KZCA 1M1NB 1CRZA 5JNLA 3Q12A 3TBFA 4NZZA 2BIFA 2CXHA 4B44A 1WCWA 3IIEA 1ZDMA 1E2JA 4OKIA 1G21A 1KZYC 4N7RA 1OX4A 4QDOA 5I3ZA 1D3AA 4RLHA 3KJEA 1B8OA 1W0JD 4G65A 1TKAA 1Q2UA 5JXWA 4N5DA 3HL0A 1K8QA 1KK1A 1QDUA 2ATXA 3AIKA 3C3PA 2D2EA 4R41A 4ZQHA 4YUWA 1PFQA 5TF4A 3AHFA 1YZYA 3K1YA 3WGOA 2JGDB 3E2MA 1VE9A 4Q3OA 2WAYA 3E5RA 5IEJA 5FBLB 4UNIA 1A82A 4KPGA 2B20A 2ASVA 2FEAA 4GKBA 1J2RA 2VDUE 1GGEA 2FV8A 2HFJA 4QRHA 2PXXA 2GZ1A 1DFHA 1DHRA 5BORA 1K4KA 4ND5A 5FPYA 2FB9A 1GQSA 1U7TA 4TTVA 1DZIA 4TMVA 4URVR 3TRDA 4OQPA 3WGQA 2XUPA 1MIOB 2G77B 3D8SA 3FBWA 4V24A 4HWPA 1EGVB 5FIUA 4LF9B 1UMCB 1ISPA 5CX1B 2JFZA 5LVAA 3CH5A 3LC1O 4E1VA 3QBEA 1AK2A 1HZZC 2DCUA 2EWVA 5ICMA 4EEXA 1FDIA 4EQZA 1S96A 3MS7A 1YJBA 2WM8A 4CZ2A 8AT1A 4URHA 1T9KA 1A3CA 4OJTA 3TD9A 5LA6B 2ORVA 4I9HA 5DCWA 3UO8B 5CNJA 3VAZA 3PC4A 4CR8A 4EFDA 1HURA 2QTVB 1YQTA 2P2CA 4YH1A 2ZW9A 1VHTA 4X97A 4H4CA 4IUCS 4PN7A 4FYVA 4CMEC 1JI0A 1R5BA 1VFNA 1QHHA 3BCSA 5FADA 3CY6A 4L9RA 5AKLA 3MQ2A 5TQ0A 1ISGA 1JDUA 3G0CA 4GUAA 1H1TA 2Q6KA 2Z9DA 2ZE5A 3WLEA 4D57A 2FPWA 3KZXA 2CVFA 1O2DA 5E7JA 4I4CA 3SYRA 2AWNA 3OQVA 4IVQA 4JNKA 4D3SA 3X0DA 3GJ3A 1L1EA 2ZQZA 3DYBA 4I4NA 4IXTA 1NUTA 3NUQA 2X2FA 4N18A 1XZNA 3LP6A 3RVOA 5JFOA 2QQEA 4J07A 2PRZA 2MOKA 2PA0A 1CHDA 3EDRA 3Q15C 4FD2A 4D6YA 3RC8A 2P6MA 4QC2A 3GMDA 3K0HA 1WUIS 2NU8A 4TKVB 1RXVA 3AHEA 1L4YA 3BMCA 3IH5A 2KI5A 2PH1A 3AESB 3AWDA 2ZIEA 2PUBA 4OQQA 2IZ7A 4IGKA 4M0MA 4QFCA 4RUKA 3HY6A 5HJ7A 1ABBA 3W3AA 1ZHFA 3FF1A 3K20A 3MD9A 4Y2HA 5EE5B 3WWYA 5FWYA 3KD3A 3O82A 4WT7A 1PL8A 3FR8A 1K7YA 1Z6AA 5EIWA 2C5AA 1NPDA 2GCNA 2FMHA 2XCUA 3FHLA 2DSNA 4I4LA 2FPIA 1XO1A 3S3TA 1K2WA 4EY3A 1DIBA 3PPWA 5HIMA 2WIJA 4ER5A 5D8DA 2PU7A 1BWQA 4TSKA 5LB2A 3DTTA 3T3EA 3VR3A 1WMEA 2NTEA 2VDQB 3H42B 2IOFK 3D02A 2YWRA 3M7IA 3ROEA 1T5IA 1FVFA 2WU3A 1U1DA 1TF2A 2B4AA 2I6TA 2QN1A 1IXKA 4QYIA 3O9VA 1JR4A 1UADA 3QSGA 3ZC3A 2DFPA 3NBMA 5A4JA 2V4MA 2YVAA 3V4FA 1N1DA 3Q9LA 2RHRA 2BFFB 3AFGA 3H75A 1W8DA 4QXPA 5B3AA 3ZH9B 1Y1SA 5A6SA 4UKDA 1EVQA 1BN6A 2D74A 1QAQA 2EIXA 2F9MA 2C4NA 2V7UA 3VDNB 4M0FA 4M6WB 3JQ7A 2X5JO 3GRYA 5G40A 3G9UA 3FB4A 2QUJA 3FMPB 5L7WA 4ZOLF 1NT2A 4BL5A 4ETWA 1KNXA 4MRRA 2X9NA 2OGWA 2JAHA 2Y1CA 3ACDA 5E38A 2OXFA 4BASA 1W5BA 3DE1X 1Y7PA 3P19A 4WY2A 1Q17A 3KLBA 2ZCVA 1WXDA 3GFQA 4BQNA 2J0SA 1KFBB 3AP1A 4FOTA 1IWPB 1PBNA 1WW3A 1GGNA 1GITA 1YS4A 3UY4A 4ZTZB 4HDMB 4BO0A 1LA2A 4MQUA 3V4PB 5E3IA 1LJ8A 1TCCA 2YUTA 5JYDA 1Y34E 5F5XA 1R6XA 2X4DA 3PT5A 3ODPA 3ZCVA 1L4UA 2P5YA 4UPEA 3BB3A 1Q11A 4CEIB 2ORWA 1TU3A 3G0BA 2HQ1A 5CAEB 3W2TA 3A27A 3V1TC 1YB7A 2FF7A 3S29A 3ROTA 5AVTA 2FLVA 2OENG 4QREA 5CVVA 1KH2A 1OFHA 1CY7A 1P9NA 1N92A 1VLLA 3VPFA 3R9WA 1UDCA 3F6BX 3WQRA 1WWKA 3NTVA 1FZQA 1QFXA 3GZJA 1DT3A 1L7NA 1S9HA 3OKFA 4RIIA 4Z1MD 1U2DA 2ZJ6A 3T9CA 1GKYA 2W48A 1QLHA 1K6IA 3QPCA 4M8SA 2FHSA 3TX6A 4RL4A 2J08A 1HETA 2FFJA 4PAGA 4Y2PA 1WBBA 1GPYA 2CZQA 8ABPA 4XB6B 2OL4A 4FMDF 2QMEA 1UC9A 3THSA 1G9SA 3CIOA 2R4TA 3ZU3A 3B89A 3R8CA 2D5LA 3TZBA 4EHKA 2Z9CA 3C16C 2Z8ZA 1FFCA 2QSYA 1QG2A 3BERA 1R6BX 4I7EA 5JC8A 1VGVA 3K4QA 3KWJA 1A0OA 3SXUA 3DKIA 4DIUA 3HKEB 5IF3A 5EWMA 1JJAA 1G7CA 1SXJA 3FCSB 2RHDA 5EC8A 1DLJA 1S1CA 4KGXA 2CDAA 1GNQA 4X41A 3K3PA 4IDQA 3TLXA 3CZQA 5FA8A 4PAQA 4TRJA 1M5UA 3V8RA 4BLOA 2WHYA 2AJBA 2B25A 2JFGA 2JF0A 2Z58A 2VNIA 1Z0SA 1UT6A 3LI2A 3EQ2A 3NGMA 4M0DA 4XIYA 4EKYA 1HQCA 2FWNA 4BMVA 2ACEA 3AJRA 1UFKA 5J40A 1I6WA 1S2DA 2BM1A 1O8CA 1EP1B 3TLCA 1CKEA 2EGHA 3PHIA 2EBUA 1C3LA 1Y3FE 4GI1A 3FUWA 1NC3A 2CLIB 3EXEA 5L3SA 1JJ7A 3U3KA 2C77A 2O1WA 3QMVA 1PR0A 2ERCA 1E8DA 3KSMA 2CL0X 4PLZA 1Q74A 4BX0A 3ZDXB 2DPXA 3WRXA 3DLAA 3BTOA 3ICVA 2HCFA 4QVKA 3QFCA 2PGIA 4H17A 5B6JA 1Q20A 4GUDA 3BFPA 1BD3A 1P5RA 2B1GA 2HIAA 3MLEA 3NJ8A 4TLDA 5HW0A 3OH8A 1H2XA 1ABEA 1G8PA 3STHA 4FOOA 2JLSA 5LLDA 1F17A 1KU6A 2ZVJA 4A91A 4A1OA 3ZJVA 1PZHA 1DBVO 4AUKA 1W5EA 2RAUA 4WCFA 5IJXA 1PK8A 1MX9A 4ZO9A 1CHNA 3BQNB 5L53A 1JQEA 3GN1A 1G6OA 4F4JA 5JRZA 4N5MA 2FMTA 3ZIAA 4E2ZA 1LUAA 1G8YA 2GUGA 3OZVA 5DHPA 3PQDA 3P9IA 3V7FA 2FPPB 3TB4A 3VC3A 3MWLA 4UW9A 4D9IA 1XE3A 4R2HA 5FTWA 3TR0A 5FUXA 3VPXA 4PN3A 1N32B 2VHJA 4TYMA 3OO0A 3BXHA 3GWGA 3PQ8A 1WETA 1T91A 2RGAA 3OT4A 1BXGA 1VMAA 4S0XA 5JY1A 4IINA 4E5YA 1G9XA 1NBWB 5ADUS 3TX2A 2D1TA 2DLDA 3FZYA 4F9EA 1EUZA 5D86A 3QWHA 3WBBA 4ZT2A 2WSSA 1YDFA 4PYOA 1WPRA 3D59A 1MPTA 4OBBA 4ZCLA 3SR4A 3E48A 1N5MA 5HP4A 1IZZA 2I1LA 2WJIA 3R77A 4FONA 4UQPA 1XHFA 2WSIA 1GEGA 4IOJA 3RTCA 3L43A 2LRHA 5AI9A 5JSZA 3EW9A 4C76A 4G25A 2GZRA 2QV7A 4FYXA 3JD2A 3CO5A 1A7AA 1P75A 3KPUA 3D4BA 2AL7A 3HKDB 1VM6A 4GDFA 1CC1S 1I3LA 1WJGA 3EAFA 3DFIA 1YGPA 2C57A 3HB1A 3O8OB 5J2TA 3L0BA 3H0EA 1MJGA 1LVUA 2Q27A 3GA7A 5COAA 5B57C 1A5TA 4BNUA 3F9RA 5CVCA 1AO0A 3LH5A 3HU1A 4YREA 3R8FA 1PYGA 3KQSA 3ZNPA 2C3OA 3QKRA 2W5UA 3TBHA 1C7ZA 2V6IA 3GLTA 2YIMA 3MWJA 5ALMA 4JQCA 1UJ6A 1OIVA 1YR3A 5K51A 4MPPA 5L3RA 4DMKA 2W42A 4YUYA 1QMPA 1YZTA 2FWBA 2QLMA 4R4JA 3RIMA 5HJ5A 4YY3B 1L8XA 4BNFA 3UQYS 2FN7A 3D3QA 4R69A 3OPYA 2PRSA 4B85A 1UPFA 2TMYA 2IC5A 4LHEA 4XE5A 3C3WA 4G37A 1QC5A 2P8JA 4Y9UA 3R76A 4N0PA 1CQWA 5TRTA 4YJHA 2H1VA 2C5FA 2I6FA 2J9RA 5BNIA 3GFBA 2ZZKA 3R3XA 4IDHA 1Z6QA 4RHTA 5HKKA 2B35A 2GFIA 3H6GA 1QSGA 3LT5A 5AW3A 2C7OA 2QBYB 1GUDA 1K8YB 1ZC3A 3VSCA 2IHUA 5FEUA 1OYYA 2C2GA 5C5IA 3VM6A 1THMA 2C4UA 3BB4A 3GLHA 1DC6A 1RI3A 1WXXA 1XCLA 3BMQA 3N59A 3OP4A 4QHSA 5BN5A 5L4NA 3PEWA 3OZBA 5LQKA 2BGWA 5LWHA 3DDOA 1ZQ1A 5C81A 3KB6A 4PTZA 3HVRA 2LCFA 5CH3A 1RAFA 2X0DA 4DR6B 1THTA 2CFIA 1R4ZA 1UP4A 2NNLD 4GXQA 2Y4NA 4EYKA 2ZBPA 3AKEA 3DLCA 4CQMB 1EFUA 3ABIA 3BRSA 1ND5A 5F5NA 2ET6A 1S2LA 5B1YA 1OZAA 1AKYA 2FFAA 3CPHA 1E3WA 2K2WA 4KLAA 4KRXA 1WHTA 5DTIA 1AOXA 1QKIA 2XPCA 3H83A 4HGYA 4PS0A 3CU5A 3G79A 4RMNA 5KYUA 5FI3A 4ZO4A 4LJ7A 3RTAA 1JG1A 1FYDA 1RAEA 1YWGO 4G8BA 2FW7A 3WLJA 4L3OA 1UODA 1AGPA 4OG2A 3IEUA 4EGQA 2GK6A 3PL1A 4HRAA 4W9MC 1T6XA 1VLJA 1UZMA 5KWEA 5C8ZA 1K88A 1ZNYA 3IAXA 4UNNA 2VJYA 1OQAA 1TF7A 3TI9A 4UTOA 2I62A 5CDSA 1PIWA 1Z5UA 2H4ZA 5FJJA 1T43A 2BGJA 3PNVA 3PC6A 4NKRA 4RYDA 4W7HA 4B6SA 1VLQA 1XQXA 3ZHYA 3CEJA 5D85A 3CJRA 5E2IA 3C7KA 5LBIA 1LLFA 2E21A 1OI3A 1XN1A 3OEEA 4LHVA 1AS3A 2Z30A 4TVSA 3RGWS 2V98A 3UBTA 4CM8A 1LLUA 3PQEA 5DTQA 1VGQA 3UOAB 3SVLA 3ID6C 1NW6A 2QV0A 2X8JA 4BO8A 3QVLA 4HADA 2FZCA 2WJZB 1JDPA 1RZUA 4HNGA 2KE5A 4Q15A 4AMBA 1X94A 1V3UA 4GOND 1DKRA 3P8ZA 5SZHB 2FSVC 3KK0A 4DEXA 1NVDA 1WUYA 5IKMA 1P1JA 2WW8A 4CMIB 4HWRA 1Y8ZA 7REQA 3L6EA 2HPZA 5J5CA 1RLIA 3MMPA 3SX0A 3HO1A 1FMFA 4PX2A 4TN5A 3EIEA 4BKMA 2Q5LA 3H1AA 4F85A 1WSWA 1XZAA 5EAIA 2HU5A 3TCXB 3NYIA 4OGGA 3KTOA 1BVHA 1ZIOA 5DM60 4ND2A 4HK4A 5CJPA 1U63A 3JAKB 1WSBA 4WI1A 1HRDA 1ZM4A 1E4VA 2QRGA 2KW5A 1XTTA 3DL2A 3ZOZA 3B9PA 3JQRA 1ABFA 1O96B 4QXAA 2ACVA 1PYDA 1F20A 1JJIA 2QLTA 3ZGVA 5JH7A 3NEAA 2W7TA 2RGGA 5C4GB 2RGWA 4I0WB 1TEVA 1X7XA 3JATA 4GRDA 3LYAA 1WMBA 4GP6A 4CCSA 4HAOA 1DCTA 1UKEA 1ZS9A 3MT0A 1GG9A 3U7FB 2NNWB 2WJGA 3JQFA 3A3YA 4NAVA 1T2AA 2FRDA 1GSHA 5CFQA 5DCLA 3G59A 1IBKB 2AIRA 2A0UA 5FXMA 4F9TA 1J8VA 2PKYX 3KR9A 4W6QA 4F4CA 4G85A 4N54A 2G8NA 3UCXA 4UEWA 1NT4A 4BX3A 1OAOC 4F97A 1XEXB 4JD5A 1KMHB 3NHSA 4EBBA 1J2YA 1V43A 2REQB 3ANXA 4WBNB 1ETHA 2AFIA 1AGNA 121PA 2KS6A 2XMZA 4NYJQ 4GPIB 2B34A 4ME6A 5DNUA 2A1IA 4M36A 4HH1A 1B8PA 4YLEA 4KPUA 1T1SA 3L7KA 2Q3FA 1WG8A 4JDPA 4X3OA 4PW0A 3U3DA 4CKYA 1ITZA 4LBZA 2VSYA 3H1EA 4WKNA 3G2PA 3R5SA 2QMQA 1IUKA 3QV1A 4GYWA 1RBYA 3U7HB 5LMNB 1PS0A 2AX4A 4UJ3A 3I52A 3MK31 1C3XA 3U17A 3HMKA 4J16C 4BP9A 4DSAA 2N75A 3EH2A 4DV6B 4LJYA 5BOSB 3AHJA 3W5SA 4UHBA 3WNVA 1ADBA 1DBQA 4L4XA 5C5EA 3HCOA 1NSYA 3M1YA 1V3VA 1YL7A 3HVJA 3SSAA 1VC2A 3TOVA 1E2DA 3KM0A 3QF4B 5LP6C 2ABWA 3SQOA 5CLGA 1Z37A 3VKUA 3WIDA 5BQ3A 2IBTA 4YNBA 1XKXA 3G2JA 1ECJA 3N2EA 3BMXA 4J9UE 3LUGA 1JAHA 3FCOA 4A8PA 3S2GA 1E1RA 2EW2A 2R751 4K9OA 4RIFA 1CR0A 1GVNB 1Z29A 4BEBA 3WGJA 3OX2A 1P5FA 5TQ2B 4AAYA 3LSYA 1M6YA 1I7SB 4NZOA 4ZEXA 3PLNA 3CLVA 4IF4A 3I34X 3O8QA 1EUCA 1QIMA 3TCKA 4EITA 4XGKA 1BMDA 4G1VA 1EQUA 4BNXA 3KJQA 4JZYA 4BNTA 4X61A 1HLDA 4CNQA 1JIUA 1YMVA 2EX1A 4KXLA 3B7GA 3K4HA 2ZM6B 5E6UB 1H4SA 1VG8A 4ARVA 1U0HC 4IDXA 4WZBE 1TJPB 3OJCA 2GT1A 4MGYR 4BHHB 2QSJA 3R6DA 3PXXA 4RA9A 4O02B 4BECA 4LN1A 5BSHA 2XRMA 4IOMA 4QDTA 1ZK2A 3WYGA 3THWB 3K0KA 3PEFA 4II7A 1KA9H 3TLYA 3UHAA 5KQLA 1VCIA 4R9RA 4B4KA 4FKMA 2SCUB 2CJXA 1OYVA 2BTOA 1O08A 1TZKA 4KN9S 3F8WA 4FE7A 4OAOA 3PXDA 1W88A 2ISCA 3EIUA 3PEUA 3R09A 4AJHA 5JAIA 4MV1A 2WTUA 4X91A 2PH3A 3K30A 3VH3A 2CHUA 4ZOCA 3QMPA 4YJ2A 1Y3CE 2OZEA 2LGJA 2GQ0A 5A0VA 3W1WA 2IV7A 3QXXA 5LIPA 3RJMA 1PR1A 1FDRA 3TSAA 3TNJA 1IY8A 2HN9A 4Z0TA 1BJRE 2QU7A 3B1WA 3OTHA 1I5OA 3G1UA 4KMMA 3NFYA 1DMRA 2Y1LA 4Q1EA 4QBHA 5DT9A 3DAPA 1UJ4A 2XWQA 3RJ9A 3UB3A 3W4KA 1TE2A 1JV2B 1XP5A 1Y4AE 4ZU1X 1F06A 1L6RA 1UXHA 2FG6C 2IYZA 3C8ZA 3I30X 4JJ8A 4KQ1A 4MS1B 5D2CA 2PYDA 3FUVA 5JZBA 2J9FA 2EJWA 2VJOA 4Y0NA 1QGUA 1VXRA 3KLMX 3R0IA 5ER6A 4A7PA 3G9TA 4PLGA 1D7AA 1GAJA 1IVYA 1WMFA 1CZUA 3RARA 3UMMA 4KAXA 1QQ7A 2HAEA 1K6XA 2ZWPA 3FVWA 1AUVA 3ZDZB 5AVZA 3DUFB 4REQB 5DBOA 1X19A 4I1OA 1HE1C 3K8QA 1R0LA 4BWFB 1U9ZA 1HT3A 4JBGA 4MI6A 4RABA 1JQ3A 1N5IA 4MV9A 5IVIA 4ZVNA 4BNJA 2QJTA 4FNGA 3GFVA 5EMJA 1D0SA 1XZMA 3ETLA 1GAWA 3GCDA 1QR6A 2COEA 1DG1G 2AN3A 2VDWA 1U3WA 1K92A 1WZEA 1CR4A 3K35A 4HI0E 1X14A 3GLKA 4Q82A 5H02A 3VGPA 3VR6D 2OLJA 3LP5A 1EXMA 3MFYA 4UQLA 1DKUA 3WRWA 4MQ5A 1I1HA 5I7UA 2B8JA 4XDYA 3AR5A 6YASA 4QATA 2QROA 1I24A 4OK3A 2W11A 1S9DA 3A36A 1OOEA 4EHAA 3I2IA 5I9NA 5SZIA 1FB5A 1YV9A 2YDYA 1WKBA 1ZCFA 2GSWA 4IIFA 4LKOA 4HB0A 4JV5B 2WE7A 2C92A 4EYGA 3M8KA 5BYAA 1MP0A 2W4MA 2M6KA 4TYNA 3U1TA 1FDWA 2FGJA 1GM5A 1E2PA 2CEAA 3X1YA 1MBZA 3LBNA 5I5EA 2IYRA 4EO7A 5IHPA 4G0VA 4XVHA 4RVDA 4HVLA 3CTPA 3D6UA 3AEZA 3T61A 5J4HA 1OB5A 4OK5A 3AUKA 3N8NA 4DR3B 3V7YA 3DDSA 1T8RA 1V1MB 1OXSC 4RZSA 5FL7D 2PLFA 3UK2A 4G86A 3UN1A 3ZR4B 3AY0A 3B9QA 3BIWA 1K5HA 2LUOA 3C7CB 3WLNA 1I7QB 2CL5A 3JYPA 4B48A 4KNWA 4ENWA 1U28C 4HDNB 2FDRA 3AF4A 2X3FA 5KU7A 1BGXT 2PS0A 3SM9A 1F2TA 1FFDA 1N6NA 1P73A 2YRXA 1AS0A 1P18A 5H4HA 2FPUA 2G0AA 2C4VA 4BNWA 3WGUA 3W5HA 5BV8A 4X65B 1PT8A 1QV6A 3U7JA 3P1JA 1FU4A 1UK9A 4WZAE 4FEAA 3IB6A 4TV9B 1ODFA 3PQFA 5EP2A 4DIEA 3RAFC 3MJTA 2JZOA 4GOLD 2FX3A 1NLFA 2MSKA 4EJ6A 3AR3A 2CYBA 5AVOA 5MN5A 1FFYA 4Y0AA 4KE8A 4ZAWA 1QGAA 2C1EA 1IHUA 1FW6A 1WTCA 5EYPB 1P7WA 3JYNA 1KYWA 3A04A 4TRMA 4KQXA 3KQTA 1U1EA 2BGNA 5HS4A 4K1LA 1T1RA 4O3MA 1S0UA 3DP7A 2BMDA 3HN6A 4QUIA 4TVKA 1SCIA 4HFRA 1O97C 5K0ZA 2RGUA 5BN3B 2O7SA 3PRJA 4ZWNA 4KG7A 1NBIA 1U8CB 3NAZA 3UXMA 1UJ2A 4BB6A 2O5CA 2EWWA 1G291 1JXAA 1NYLA 1YS1X 4MGHA 4YLGA 2IX9A 2HA4A 3KZ1E 4DLWA 2AK3A 3HA7A 4G0ZA 1LPNA 1RADA 2B4QA 1VSUA 1Z8HA 1JFLA 3CF0A 4J7XA 3EOAI 2IP1A 3OCZA 3PR3A 3TW8A 2JJ2A 3VBCA 2BGTA 4FB4A 3D6MA 2HKIA 2PMBA 2FRXA 1TMGE 1D4FA 2QZ4A 1AN9A 4M9SA 4OL0A 3WHPA 3M6FA 1AUOA 4E22A 2F3PA 4GOMD 4NU8X 2DB3A 1PL6A 4Y2VA 1UZAA 2AHOA 1DAKA 3TRKA 5JCXA 1PNVA 4G4JA 1MO3A 5A3VA 2EARA 4O29A 5F51A 5GVSA 1SIOA 2R6AA 3QU5A 2NTVA 2OAP1 1KZ4A 1NOKA 2QVXX 1OSNA 2R1UA 3O75A 3QPDA 4MQFA 1U7HA 4S1TA 4CODB 4UDYX 1VKOA 2PLRA 2FSUA 3P9KA 5IHXA 3GLQA 1XPUA 3DE7X 1CJTC 1KOJA 5K0NA 3GUCA 2EF0A 4MKIA 4P93A 1ZJWA 1E1MA 1JFFB 2PKWA 3QH4A 5B3LA 1E6CA 3IHTA 4CMHA 1QIEA 3ZVLA 5BWBA 3W79A 1TVKA 5J3JA 2YWXA 4JI1B 3H0KA 1WZ2A 4BV8A 3SYTA 1CTQA 4J4TA 4JA2A 4L3VA 1NUPA 1CDOA 1NVXQ 4EJSB 5J1TB 1W581 3GFFA 2Q62A 2FCRA 2X7HA 3AV3A 1ECBA 2N47A 1XLTA 4M9UA 2BJHA 4UHKA 4KWTA 2P0AA 1M2VB 2IZ5A 4B5LA 1I4TD 1V45E 2IIBA 2EAUA 2QLBA 2ZPTX 4YRLA 1XBTA 3S28A 4AN0A 4AIRA 2CL6X 3DT8A 3D0RA 3SFTA 4A0FA 5BXYA 4KKVA 2JRCA 3G88A 2O20A 3CZPA 3B8HA 3P9XA 2A59A 1C9MA 2NPOA 2YZGA 4S2UA 4N7MA 3WMXA 3DBRA 1UBTS 3IP3A 3V1YA 2ASEA 4NEQA 3W8NA 1PR6A 1PEYA 1PWZA 2ZUBA 2JBAB 4XVUA 4ZIRB 2GTPA 3R3HA 4PLYA 1E6MA 1RJEA 1TCBA 3VR5H 4F7DA 2LKDA 4HQLA 4ANFA 1IQUA 2ZT6A 1A4XA 2HPAA 3MJSA 1Q0SA 2ZRHA 4LPKA 4DIKA 1Z75A 3P45A 4G2TA 2B2CA 3L1HA 3SG0A 2C2OA 2PLWA 1J1ZA 1GZ3A 2WFAA 4EF5A 4F4DA 2GZDA 2IH4A 3KOOA 4IJ6A 4WPGA 2NWQA 4GEGA 1ZINA 4YK7A 2B9VA 2VH5R 3BWXA 3G1TA 2YH2A 4FYIA 4F71A 5FOQA 4YRNA 3UAVA 4MQLA 4AIIA 4MVJI 5AM1A 3IKVA 5NULA 3NAMA 3WIVA 3HYNA 5D3MA 2Z95A 2I9PA 3DAGA 3FNFA 4RNDB 1CUCA 3FPGA 1J6UA 4JB0A 1G8JA 3A9UA 2HRCA 3VNSA 5LMUB 1W36C 3TFOA 1OBVA 2R68A 3CT4A 3VO9A 4AF8A 1NWHA 4F3YA 3DV9A 4IV5A 2GN1A 2AVDA 3GL9A 3P2JA 4O2RA 4F2GA 5C8YA 2LW7A 3T3NA 2RSLA 3FDFA 4Q37A 5AYVA 5E4FA 3D1JA 2D0OB 2BFBB 3OLXA 3WWPA 1EBUA 3C14C 3CTMA 4A03A 3OEYA 3R4CA 4MB0A 5FOVA 1QUEA 2XEDA 3EWNA 5KSWB 1JGTA 4OJKA 4K86A 3GDWA 3T4EA 3QVJA 3RVBA 3TRHA 3UC9A 2CHEA 3B3FA 1CLEA 3TB6A 1BVYF 1T15A 2I4RA 3I9FA 3B6EA 3AUFA 3FHOA 4CU2A 1EVJA 1CVIA 5HFJA 4UVDA 3UV6A 2VH1A 2WHPA 1TT5B 3E0QA 2ZCJA 1KHTA 4ZDWA 3CNHA 4PLTA 1V6SA 1WXIA 4GSKA 3H2SA 3L7BA 2YQ5A 3EDCA 3DL4A 1JSRA 1PZGA 2QK4A 3HJCA 1CY2A 3QELB 5AK4A 4HKTA 4NOMA 5HE9A 1XAIA 4CHTA 3ZHTA 1DTEA 1GLVA 3MB5A 1ZJZA 4GPD1 1BE8A 3S44A 3LWBA 1OLUA 3DO5A 2C4TA 1L7EA 3EGOA 3F8TA 1S3IA 1DQRA 4QXRA 2CXSA 3L1KA 1AV7A 4BLPA 4YJ3B 3V8MA 1XOIA 4MUGA 3QQPA 1YBHA 4ACBA 4KR6A 4M3NA 4RDCA 1YJXA 1M1NA 5AOCA 2I3AA 1R5NA 4KDRA 4DR4B 3PL5A 2OD9A 4RW0A 2HTFA 3INNA 1E92A 1OV4A 3NJ4A 2Y2UA 4M37A 1DRVA 4NFSA 4O6VA 3HJBA 1W76A 3WYDA 4RAQA 2IXTA 4BFCA 3PFIA 5G3YA 1JHVA 3E4CA 3Q8MA 1K6JA 4DG9A 2ODBA 2V03A 5AHXA 1TVEA 1ZK3A 3ZD7A 3W6UA 1P1IA 3IALA 1JHYA 1MZVA 1NLZA 4L16A 4XJXA 4IS3A 4M38A 3PWTA 4NENB 4RZ3A 2JGDA 2ZBEA 5F3WB 2IITA 1QG0A 2ZSEA 2Q4EA 2JZCA 3Q9SA 5EJAA 1KEZA 4M53A 4KRFA 1YZ3A 2AEMA 5FA5A 5H1YA 1KJ8A 5ESRA 3THYB 3IE0A 4HAIA 4EW2A 1XYGA 2CNLA 1QIGA 4IQ8A 2I2BA 4XPZA 4HQKA 1T9HA 4ZV7A 1JVNA 4I1VA 3S4YA 1IB0A 4X62B 3BHJA 2CFSA 2X86A 3DONA 1BFUA 1WVIA 3LHDA 3MCUA 3A4YA 1PEAA 2VJQA 3BA6A 4NATA 1I4OA 4XIGS 3QOYA 5E2BA 4H0NA 2JIQA 1Z7EA 5CA0B 5IP5A 1UMCA 3IDFA 1QR2A 2EEZA 2Y1XA 4IDOA 4E51A 2ADOA 1M0WA 1DAPA 4QUAA 1JPUA 4QNMA 2PMEA 2O48X 3KFLA 1EZ1A 4P22A 4NSNA 2YN0A 3OE1A 2HO5A 1P39A 1DTSA 1FNMA 1I5EA 2FXIA 4KREA 4RORA 3OTOB 1RQLA 1ECCA 3KVYA 4AURA 4P7JA 3GT4A 4LVNA 3SMVA 1DE0A 1TGYA 1X8LA 5CTJA 5LA6A 2Q0QA 3LHSA 4O2BB 4G09A 3CVOA 3GUZA 3MT7A 3VNQA 2QTVA 5TJHA 4EHDA 5JS6A 2E4WA 2Q7DA 2OG2A 2E85A 2Q6VA 1QRTA 1FXUA 4TXJA 3I9LA 3D2AA 3AUJB 3B1VA 4JL5A 2O3QA 4Q7QA 5F21A 3UMFA 4DILA 1K8RA 4X71A 1F9EA 1NNSA 3W8FA 1MRSA 2DU8A 5KJCA 4PC6A 4RHCA 4ZI7B 2OFXA 2GVNA 1JBKA 2JVKA 2RGNC 1PKEA 3TL2A 2O23A 1Z2OX 4URZR 2N1BA 1P0QA 5TXGA 1CUXA 2DWUA 3ETEA 1H9CA 3LPNA 4QASA 4MEBA 1G5TA 3AQIA 4M1KA 2I78A 1JG4A 1S6YA 1NWCA 2BZGA 1KE2A 1BXKA 4ACAA 4EJ0A 4ZK6A 5A4KA 4F96A 3L7DA 1QF7A 1UBCA 1BO6A 1CE8B 1FRZA 1KORA 1S02A 2OOKA 2QYOA 3CPSA 1CS4C 4RVUA 4ZQCB 2HMSA 3AESA 1DO2A 4WXYB 1VMKA 2FPXA 4B35A 3RCBA 4BKQA 2WK1A 3B5EA 2VTKA 3VRHA 3Q11A 5M29A 1JNYA 1YUBA 4CQJA 2GAFA 1GUAA 2H51A 2OGZA 3JYQA 4KLNA 4O3FA 2EW8A 3FJYA 4JLSA 1P8JA 4DJFC 3I39X 1OF1A 1TTHA 4JEUA 1E9DA 4M9ZA 2X40A 4P3NA 5ULLA 1XCBA 4YCLA 4FQ8A 1KQFA 4OD0A 1FRVA 1N6RA 5AKEA 2FWIA 3RFVA 4W7IA 1SU6A 4JFRA 4C0BA 2V1XA 3IVCA 1Q0TA 4GOXA 1Z26A 3THXB 4PSCA 2QYSA 1ZGGA 3EVBA 4AQDA 5C35A 4QIHA 1EM8B 5JQWA 1MQAA 3V46A 4HT3B 3KKKA 1TAQA 1FS4A 5EPUA 3F71A 5AUOB 5KTKA 3AVXA 4MKFA 1YOVB 2VCYA 2XR1A 3H18A 2BFFA 1B6TA 1DAHA 3JWGA 3W7AA 2JI6A 2QX7A 4IQGA 1OYOA 1VIAA 4DDHA 1EE9A 4CBVA 3H9UA 2PZGA 2XUHA 3LFHA 1OWMA 5IAJA 5I9LA 4M6WA 5HM6A 1E1CB 5EJFA 1M2EA 3GH1A 3A31A 2O2CA 3E58A 4LMBA 3VZSA 3GA0A 3ZXXA 4GXNA 3ZZMA 1BYUA 2Y1GA 4EY6A 5AVSA 2BMJA 2JD1A 4M54A 5IXYA 4CEJB 5ELXA 2VTDA 4RTRA 3ZGZA 4U2GA 2EFDB 3KKZA 5BUZA 3O8DA 3GRCA 1DJPA 3T5MA 3QA3E 4R71A 1EFRD 2IEBA 2WG1A 4N0EA 4DV4B 4HNAB 4CKWA 3RC1A 5CEJA 5IH7A 5JH7F 5MF6A 2O59A 1ZXXA 2H4XA 1VQ1A 3FDJA 4HDMA