4M1TA

Crystal structure of small molecule vinylsulfonamide 14 covalently bound to k-ras g12c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
163
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords K-Ras GTPase
total genus 63
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1tA00
1P7CA 1K6MA 1PLLA 1N0VC 1TMKA 2P5TB 2WIAA 2BHRA 2PCLA 4LV5B 1EGAA 4Q9LA 5CYOA 2GRJA 2ZRPA 1YZLA 3I1FA 1EK0A 1IOZA 4MDFA 1E2EA 5EZ5A 2FPKA 2BBWA 2QPTA 1XCMA 5IK2A 3LWNA 4A9AA 4RJLA 4MUAA 4M9ZA 4P4UA 3P4YA 3AVOA 4MGIR 2XJ9A 3RS2A 3B7GA 4KAXA 1EFCA 1KI9A 2RGNA 3W5IA 1KKMA 5DISB 1N6NA 1RRFA 3HR7A 2CHQA 3AB3A 1UF9A 4M1OA 1A1VA 1W44A 1DAGA 4JLDA 2G9NA 1W0KA 4NBSA 5H8WA 2HYDA 1U8YA 1E9AA 4QGHA 3VR3A 2ZR9A 5JECA 3KZ1E 3W8NA 3A1VA 1J70A 3T15A 4DC9A 2ODWA 4I1UA 2BC9A 1SULA 3KFVA 5F2EA 4R71A 1D9XA 1HY3A 4NKRA 4XD7A 5JEDA 4FMCF 2WJIA 4ESVA 4JYBA 4D0LB 2G0TA 4KLZA 3KQKA 2ZJYA 4Q1EA 4B44A 2XNDA 1QHNA 2OFXA 1VCOA 4RCZA 3WNCA 4AURA 4BFYA 4JLAA 3SR0A 3GQBA 2ECKA 3CLVA 4WOPA 2CCGA 1VG0B 2BMEA 1T5LA 3QPWA 3IQXA 3M0EA 1CRQA 1R7RA 4CRWB 3ZJYA 2VF8A 4ESHA 3K9GA 4R2IA 2WZQA 4IKEA 4BEJA 2JLUA 5TARA 1VDZA 2QRZA 3UMSA 2V54A 1G3QA 1SKYE 3I5YA 2QUZA 3GEIA 2IXGA 2ZPTX 4W5JA 4BQSA 2UVQA 4DCUA 2EYUA 1WQ1R 2OZEA 4DLUA 5BW8A 2QZ4A 2BV3A 3TLXA 4C7OB 4B6EA 1U99A 4Z1MA 2O8EB 1Q1BA 2ONJA 4NP6A 4TYYA 2G83A 3CPEA 4A8JC 1U9IC 2ZRFA 1BOFA 2W6JA 1YR9A 4KBFA 4DJTA 3ZVRA 3EZ2A 3H2YA 2KWIA 4A0HA 1E9RA 3PUWA 4JSTA 3CPHA 3TBKA 2A5FA 4OHVA 2GXQA 3D8BA 1NNEA 1LFDB 2JLRA 4HI0E 3QKRA 5AUQA 1Z0IA 1EESA 1VMAA 2JLSA 4QNMA 2ZRMA 1F2UB 4QOSA 1Q1QA 4ASUD 1KI6A 1NKSA 4NCIA 4G0NA 2V7QA 2B7BA 2FN4A 5EE3A 2IYQA 1W36B 4C0QC 4JLOA 2HT6A 2GILA 4KSCA 1G16A 1W49A 4TMWA 3W90A 4C0BA 5KDOA 2IC5A 2ZYTX 5E95A 5LBIA 1S9DA 1N6PA 1YRAA 1AKEA 1FNNA 1G291 3ONWA 1VHTA 1KIMA 3F8TA 1YVDA 1GKUB 2F7SA 1LVGA 4P31A 4LJ7A 4TLAA 1GRQA 4F4CA 5GJWC 1Q0UA 3ZVMA 1IJFA 3TRFA 4HAVA 2P2LA 1LF5A 4B74A 2WJJA 1ZCBA 2OFWA 3FKQA 3LRPA 5JCZA 2J9RA 1FUUA 1AA9A 3MLEA 2ZRIA 3WMGA 5ELXA 2R65A 5JHHB 2I1QA 3HYRA 3VU9B 2O52A 2UZ3A 3EA5A 1CEEA 1SXJB 1F5NA 3P20A 2G0NA 3CRMA 4KSBA 2W2VA 2OV2A 2ZE8A 4YMSA 4K46A 2VPPA 1XWIA 3SU8A 1II9A 2GBLC 1KO4A 1UBEA 1Z5ZA 4HLUC 3KKQA 1E69A 4TT3A 4A15A 3I8XA 1WA5A 3KXKA 1OXSC 3AVYA 1JAHA 1QHYA 2ERYA 1ZM2A 1GNPA 1EFRD 5AUPB 2GF9A 3AVWA 1SGWA 1FP6A 2NO6A 2XNDD 1H8HA 4V0OA 3TVDA 3AVVA 1CR4A 2CCJA 2NZ8A 2AKAB 3NXSA 1LNZA 1RYFA 2W6IA 4PTLA 2PJZA 3PJRA 2B21A 1CR2A 4ZO4A 1E2NA 2PCJA 2GJAA 2XB2A 1C1YA 4Q18A 2NO9A 1VECA 4X8HA 4DLSA 3D31A 5KUTA 3VHLB 1T3SA 3O8DA 4DCTA 2QAJA 2QNRA 2ATXA 2W0SA 3MWLA 2WMNB 5FBQB 2J7PA 1US8A 2FFAA 1VIYA 1VHLA 2FV8A 4TL6A 5TV2A 4DT1A 5E7MA 3FDIA 4B2LA 2Q3HA 4L15A 2IHBA 4Q5IA 2A7QA 1G8PA 3B1XA 3NG1A 3PV0A 4P4TA 1Z8FA 5CB6A 1RZ3A 2PBRA 721PA 1GG2A 1JECA 2VA8A 3CO5A 2BBSA 4WIAA 3SJCA 3U60B 4M1MA 3SEAA 1IN6A 2X1VA 1WXQA 4YMVA 1XTQA 3PCRB 4EAQA 2DBYA 2CLSA 2ZUBA 4M9QA 4TL8A 2XZPA 1NLZA 4IFEA 1VYTA 5EP3A 4LSGA 4TMKA 5BN4A 2NMVA 5JJKA 2OCYC 2YWFA 5DLQC 1ZUNB 2VHUA 3ICQB 3KTAA 4DLZA 1Q20A 4FMBB 1G17A 1OIVA 2F9MA 5C18A 3I62A 4CW7A 1MABB 4ZCMA 3NBXX 1P2VA 1OH5A 1NG9A 1KO7A 3SOPA 1Z6TA 2GWHA 3B85A 2AKYA 2ZM5A 2H18A 2IX3A 3NC1C 4FMDB 2XXAA 1N6LA 2ZRLA 2IYWA 4QKQA 5CJ2A 2AN9A 3Q7QA 5C1BA 3VTKA 4MQBA 1Z6GA 2OAP1 3KKMA 3AP3A 4M1WA 1TPZA 3B1WA 1LY1A 1R0WA 5M04A 1IONA 3AP2A 3HU2A 3RS4A 2GVZC 4BGDA 3RC3A 3WXMA 1UDWA 3L0SA 1MO5A 5UKDA 2AFIE 3KB2A 4TTRA 4B3CA 5EE9A 4BFVA 3VKHA 2NZJA 3U7HB 4XOIA 1RC8A 4MYTA 2R6FA 3E2IA 1IHUA 4LV6A 1BMFD 4DVGA 3TNFA 4Q9IA 1TF5A 3H86A 1OE0A 2QQEA 2RGBA 2WOJA 3DEFA 1XCGB 2C77A 4AG6A 3QOFA 1XMIA 1VG1A 1SXJE 1LS1A 1NMZA 2EQBA 1ELOA 3K70B 3DKPA 4N3NA 3EWSA 1T91A 2Z4SA 3I72A 1KSHA 2VTKA 2O8CA 3KQLA 1G6OA 1GRNA 3TK1A 6Q21A 5CYPA 3IHWA 4PC2A 2VP0A 2VIIA 4DLRA 4Q7KA 5JSZA 3DMNA 1FTNA 1XX6A 1YJ5A 1X8KA 1E9EA 2X2FA 4O25A 3UK6A 2XXAB 3WYAA 3PFIA 2FEMA 1OIWA 1GKYA 2ASEA 2XNSA 4MYHA 4NONA 4Z1MD 3TR0A 4TL9A 1E2HA 2C8VA 2BWJA 2G3YA 5B30A 4E09A 3PEVA 3CNNA 4L9WA 2GEUA 3C16C 5LB4A 2KE5A 1T8TA 1RYHA 2C04A 2IYUA 4HZIA 2Y8EA 1U94A 2ZVQX 4Q1BA 4V02A 4D4MA 1YZGA 2QMOA 2AR7A 1SVKA 5B64A 4JJKA 1KJYA 4PHFA 5SZKB 2ZSDA 1T3LA 2WBLC 3B82A 4Q9JA 1EX6A 5J47A 2BJWA 2DR3A 1XCPA 1QHHB 3EZ7A 4QHSA 4QNRA 3RRZA 2JLWA 1ZRHA 1T6NA 1YRBA 3LLUA 2FPMA 3GLGE 2BKUA 2CL7X 2OFOA 1SHZA 1U98A 1KSGA 821PA 3KQHA 1ZYUA 2W6ID 4HAZA 5CDFA 5KDDA 2FF7A 3MMPA 1S0UA 3C5HA 1KJWA 3QKUA 2WKRA 1RRPA 3NDBB 2ZYWX 1K8RA 1JAIA 3BB1A 2XOKA 1ZD9A 3KJGA 3K0AA 2QSZA 2VRWA 3QI2A 4OJKA 1TQ6A 5JI2E 4JBXA 2GXSA 1IQPA 1QBKC 1I4LD 3R20A 2OE2A 2OESA 1KOFA 1F48A 1E2DA 3OFNA 2V55B 5EXTA 2O8FB 1Z07A 5FBRB 5FTNA 1BYIA 4RSGA 2OBMA 3QQ5A 2GJSA 3K0FB 2X2EA 4JLMA 1G7RA 3T1OA 2EFEB 2FU5C 2PZEA 1DS6A 4RCYA 1EWQA 1NVXQ 5F98A 1AM4D 1HA3A 4YMTA 3K70C 4QG7A 3K0FA 5JFGA 5FR1A 1HQYE 1BYUA 2FZLA 2X77A 4Q02A 4R7ZA 2F1HA 2FFHA 2CLDX 5FR2A 4EFLA 3U44B 4H9GA 2RHMA 2JGNA 5BQ5A 2VP4A 3SDZA 4AKHA 3RLFA 1P2UA 1DG1G 1DAHA 2YWHA 4C0JA 1KO5A 1ZMXA 4HSEA 4QL3A 2GHIA 2PX3A 1M74A 1ZD8A 2IHYA 1JQJC 1FUKA 3BRWD 1KI1A 4TQAA 2QQ0A 3ETLA 2DHRA 1IN5A 2B92A 2BM0A 2KBEA 4Q1CA 2RGGA 2IF0A 3B9QA 4D25A 4HZUA 4LBVA 3LO5A 1GM5A 3RAPR 5KO2A 1OXUA 1UM8A 2IL1A 3CR8A 2GCPA 5DHAA 1P62B 3EZ9A 2A78A 4BLSA 4PO8A 2WWIA 1HEIA 4A6XA 4B43A 3U7GA 4A2QA 3OZXA 1KK2A 4FMCB 5FOTA 5JRZA 2BBOA 4CEJA 4DSTA 4OK6A 3KUCA 4RD6A 3SHWA 1RPZA 1W36D 4Q03A 1U90A 1A7JA 4Q7MB 3SBEA 2VEDA 5JJIA 2CK3D 4LRWA 1IJEA 1XEWY 2YHSA 1XP8A 1HUQA 3O8BA 1XPOA 4A0FA 1DAIA 2OCAA 2VP2A 2CJWA 2ZAMA 2RHDA 3WBKA 4O2LA 4NCNA 5DI3A 4ZV4A 1KDOA 3RC8A 1V43A 1R2QA 2QTHA 3BFXA 5DN6D 2X8AA 3IHLA 4A0RA 4OQLA 4B3FX 4ERNA 2I4IA 4PHHA 3QKRB 1OJLA 1IY2A 1G3RA 5FL7D 4II7A 2F1IA 2XTNA 3S1AA 3T1TA 3N70A 1OFUX 1TU3A 4D0GA 4I1VA 2QSYA 1W4RA 2YV5A 5DSZA 2J0QA 5CIWA 3GLGB 2FH5B 2JDIA 3CB4A 5TY0A 4OHWA 3ND9A 3WP0A 5FL3A 4BUJA 1VYVA 2V9PA 4W9MC 1ZNZA 4QBGB 2NG1A 1OT3A 1BH2A 3KJEA 4FXPA 2DFLA 1I4DD 4CEIA 1TTTA 3A4LA 3BK7A 2ZSEA 3F5FA 1Z2CA 4NH0A 1G8FA 1ZC4A 4RKEA 5P21A 4CYMA 5L8VA 2IS6A 2B8WA 1GSIA 4DCVA 2ZI5A 4M1YA 3L2OB 3JVVA 5JWRA 5IHPA 1Z6XA 2PX0A 1M7GA 2RGDA 5CK4A 3K9NA 2VF7A 5FPHA 4TYNA 1XZPA 1Z28A 3B60A 3OESA 4JLBA 3HJNA 2Z6VA 2C95A 4BECA 1G4UR 3LBIA 3VR5A 1OXXK 3THWA 2ZE6A 1N25A 1RE0A 2IF2A 4OQFA 3ZZUA 3ECCA 3LBHA 4QHYA 5AWFC 3AGQA 4OI1A 1ZIPA 1GKIA 4E22A 2ZVPX 3K1JA 4MA4A 2IS1A 2D3WA 1TX4B 2D2FA 1A2KC 4UNRA 3AF0A 2QM7A 5G41A 4DDUA 1II8A 1NVVQ 1JJ7A 3EA0A 4OI4A 4YONB 2ONKA 3UG6A 3Q3JB 1W5SA 4LYFA 1M2OB 1E99A 2AD1A 2ZJOA 4FIDA 1ZNXA 4WZBE 4GP6A 1II8B 3W34A 3Q72A 4PC6A 2EW1A 1IXRC 2H5EA 2VP6A 2WWHA 2F3RA 5FTMA 1XXHB 3TW8B 1NBMA 1XEFA 1N5LA 3RNLA 3L8YA 3M1IA 1GP2A 2CLCX 5FBWB 2GJ8A 4B3XA 3RSLA 2BDTA 3FMPB 2EFHB 3X1YA 4ZDWA 1YZQA 2CNWD 4NMMA 1QHXA 4PSKA 1XTRA 3RS0A 2ZI6A 4Q01A 3UXMA 1U81A 3PEWA 2O8BA 4DKXA 2PZFA 2A5GA 3ADCA 2YC2C 1US8B 4ZPXA 1CJUC 1E2FA 2BVNA 4LUCA 2XSZD 3MUFA 2ODEA 3NIBA 1Q21A 3CIOA 5HCNA 2OILA 2J41A 4CZ2A 4D26A 2ZUDA 3AM1A 2HLDD 3EPJA 4TSFA 3PUYA 5K8UA 2E9SA 3X1WA 3PEYA 4PR0A 1KZGB 1F2UA 3T06B 3CF2A 4WZ6A 1D2MA 4GZMA 4JLKA 4BE7B 1ZM9A 3D3QA 4DHEA 3UKDA 1KI4A 1BO6A 5L3QA 3IO5A 4QM6A 5CLLA 4LYAA 5FH9A 3ZVLA 5KHOC 1VIAA 3MJHA 2W0MA 1NMYA 2W00A 1R5NA 5LD2B 4JKYA 1AN0A 2J1LA 4HDQB 1BIFA 3NBFA 1Q57A 3GLFE 5J4HA 2V4ZA 1XB2A 1ZCAA 3PG5A 4IEEA 4IXNA 4C30A 1MT0A 3CZPA 4JVSB 2QN6A 3MWYW 1HE8B 2IYXA 3A1WA 4JLPA 4XSHA 4OK5A 3B13B 4HLQB 3HYTA 2ZETA 2YOFA 1KI8A 2MMGA 3GJ6A 2BEKA 3LW7A 1D9ZA 1Z0AA 1G1MA 3L0IB 3L82B 3PUXA 4DEYA 4C2TA 4UXIA 5JBQA 5FUVA 4C0AC 1XPRA 4Z54A 2JJ1A 4LC1A 5FI1B 1F60A 3AVUA 3O8CA 2D2EA 3A8TA 2H17A 2DFTA 2PH1A 4DB2A 1XNJA 3W9YA 1Q12A 4RFVA 2JJ8A 2B8TA 4B34A 2J45A 5AUNB 3C41J 4AY2A 2W6JD 3CF0A 1W2GA 3I61A 1FP7A 1Q3TA 2HCBA 3A1UA 3FFAA 2FSGA 2QRNA 1R0ZA 1LW7A 2WJVA 4ZIRA 5D3MB 1CJVC 3PUVA 2QAGC 5FPYA 1GIAA 1D5CA 1XJCA 1NIPA 3BJIC 1P2SA 3ADKA 2IUUA 2GCOA 2LKCA 2H57A 4GMDA 3RWOA 3RRYA 2JLYA 3QPVA 2V3CC 3RS7A 3FHCB 4Q4AA 1LV7A 2BEJA 4RD2A 4NYIQ 2UKDA 3NH9A 4K81B 4G3XA 2BCGY 1Z22A 4Q66C 2ZI7A 4MYUA 2C9OA 2YINC 4QGGA 1FTSA 3ZZ0A 3SFZA 4JLVA 1ODFA 3MGCA 2ZS9A 5JWHA 3CZQA 5AJWA 1P72A 1U9IA 4DRZA 1I2DA 3REFA 5JI3E 3E70C 5AJYA 1GOTA 2XX3A 5F9FA 5HTKA 5EUQB 4Q1AA 2E87A 3OF5A 2W2XA 1DEKA 3CF6R 2O8DB 5C4MA 1DO2A 1JEDA 2JLQA 2NTYC 3OEHA 3MFYA 5DIFA 2VHQA 3R7WB 121PA 1M6NA 3WBJA 2J0SA 4ARZA 4DCSA 1TQ4A 2G1JA 1N5KA 3WYFA 4ZDJA 1U8ZA 4RZXA 1X3SA 3DHWC 4V03A 2P6RA 3FMFA 1A82A 4F92B 3L8ZA 2H7VA 4TLBA 5TDHA 4G01B 3U3RA 1M8PA 1OH7A 2YWGA 1G7SA 1AGRA 4JMPA 2NO1A 2W2TA 2WSSD 3FE2A 4JIMA 4URUR 4OKSA 3DMDA 1NJFA 3B78A 4MRSA 1L8QA 4Q47A 4JKIA 5IK2D 2QTFA 3AVQA 3DZDA 5E3HA 2ZYVX 2I3BA 1YZUA 2G1KA 4LHWA 3BH6A 5KTYA 3THXA 5L3SB 1PUJA 2ZQ5A 3SJAA 4PPFA 2A5YB 4MYCA 5CM9C 1HURA 3CRRA 4JZKA 4B71A 1ZIOA 4DXAA 1NKTA 4KYIB 1OHHA 3KJHA 3FKSD 4EKDA 1XMJA 4KCGA 4XH9B 1YU9A 5EXPA 1COWD 1ESNA 1Z63A 2YKGA 3K9LA 1MR3F 4QJ3A 2WSMA 5E7JA 3U3JA 5EP2A 4UNPA 3WMEA 2ZREA 2BMFA 3GFTA 1QG4A 2Z83A 4DSUA 4WA7A 5KPJA 1WB9A 4OI0A 3SE0A 5EUMA 2FG5A 2DCUA 2RCNA 2F1JA 4UQOA 2IXFA 3X1DA 1ZBDA 4C2UA 4M9XA 3G82C 2QMEA 3L0OA 2L0XA 4KODA 3EAQA 4MH0R 1KK0A 4OQXA 1V5WA 1MOZA 4HLUA 1U0HC 1R5OA 4HDCA 2GF0A 4HB4A 3W6PA 5B58C 3QXSA 5FPSA 3TSOA 4LJ5A 3JZMA 3TUIC 3EXAA 1KNXA 2GCOB 1TUIA 3IBGA 4PPGA 2WWFA 4B3BA 4R9UC 1G19A 3IIJA 2KJQA 3NC0C 5CK5A 3LBNA 1R10A 1YR6A 1ZU5A 2ZTSA 4DDTA 1NRJB 1TL7C 3THOA 3OEHD 1NVUQ 2O8CB 1ZJ6A 3T34A 1ZM4A 4LV8B 5JS7A 2WPDA 2WV9A 4FN5A 4FCTA 1MV5A 3SS8A 3QUSA 4RY2A 5FPKA 2WIBA 3THXB 5AJVB 1S9HA 4GDFA 1S1MA 3DPUA 4HZUB 1JALA 4LWZA 3C8UA 4W5HA 2ZRJA 2C2HA 3U6KA 5BYKA 4Z51A 4D82A 4UNQA 3GLHE 4O3MA 1VCIA 3IBYA 1ZC3A 1T8UA 5TB5A 3H0KA 1XF9A 1S96A 1L2TA 1SVOA 3CPJB 2K5UA 3L0PA 1CJKC 1D2NA 4M9SA 2CL0X 3LQRA 4LJ8A 5BWMA 3CNLA 4EPRA 4BLOA 4EPVA 1GITA 1G9XA 2DY1A 3OIWA 1TEVA 3AKEA 3KL4A 5K8IA 2HV8A 1S2MA 1KSFX 2IYRA 1TQ2A 1DTSA 3LAWA 4JT4A 4KO8A 1N0WA 4YXWD 2QP3A 1E2PA 1XD2B 4V0ME 3U3KA 1NN1A 4PAOA 2CJWB 3GJ4A 3RSOA 4AC9A 4CVNA 4ILEA 4DLVA 3R9XA 1JXMA 5J4LA 1XD9A 4KFSA 4DDWA 3QG5A 5KYKA 1Q44A 2WJYA 3PR1A 3VHXA 3WYGA 1W1WA 2KB0A 5SZHB 1GNRA 5KSYA 1KJZA 5KNCA 1K5DA 2C9YA 2EWVA 2ZJ2A 4Q48A 4YXWA 4L5BA 4ZIRB 5LPNA 5J4KA 1Z0JA 2GKSA 1AS2A 3BFKA 5DH9A 1UBFA 4JL6A 4X8MA 3TMKA 1KI3A 4HB0A 1YZNA 2IEZA 1VG9B 4XVRA 4DT1B 2OXRA 2PLFA 1O87A 1R4AA 2ZANA 4IOMA 5EQTA 3NVAA 5B2ZA 3U7EB 8OHMA 4KITB 2PT5A 2QROA 4N0DA 4A0GA 2PL3A 3ZDQA 3IIKA 1MH1A 4Q4JA 4FCVA 4YC7A 4AYXA 3SHFA 2GDJA 3CX7A 521PA 1X1SA 2FNAA 3T12A 1IN8A 1ZNYA 3GP8A 3AP1A 2IYVA 1HV8A 5HE8A 1WMSA 4B3GA 3VNUA 1ESMA 1NSTA 2D7CA 1MO6A 1GZSA 1PLJA 1J99A 4OHZA 1K5GA 1OXVA 3I3SR 2HJVA 4BRWA 4XWOA 3FTQA 4HLDA 2W83A 4JT2A 1SXJD 1PLKA 1VPLA 3SNHA 3VAAA 3ZZTA 1OH6A 2OCPA 3CONA 1OKKA 4BLPA 1Z2AA 1G4AE 2Q6TA 3K8YA 3IPXA 4Q7LA 3HR8A 1HH4A 1ZVQA 2VO1A 4TLDA 4IDOA 3VX4A 3BFVA 3HPQA 1CBUA 4IOLA 4BFSA 1NN5A 2OXCA 4WW0A 4TSFD 2AX4A 2R6AA 2ZSBA 4DLWA 4E5UA 3K0SA 4GOJA 4PZLA 1E1QA 3AV0B 4G5GA 1N5JA 4PQRA 3NKVA 1T4GA 1W0JD 4S35A 1OFTA 1ONBA 4LOAA 5DYGA 2F43B 5JEEA 2FA9A 4GRAA 4QXAA 4E03A 1IY1A 3NEJA 1Y63A 5CB8A 1T9HA 1E2MA 2A2ZA 1JJVA 2JAQA 2KBFA 1EXMA 2O8FA 2HXSA 5BYJA 2OT3B 2IWRA 3VR2A 2VHTA 4BEBA 4P3YA 2P65A 1DO0A 3OHMA 5L3SA 4JVLA 3L43A 3THYB 2JLXA 1VTKA 4LY6A 2ZSFA 1G7CA 4DLXA 2A9KA 1O3YA 2JCSA 2NQ2C 4PPNA 3WNDA 4B6FA 3SI7A 2CVHA 4EDHA 2V1XA 1UBGA 4DEXA 1Z06A 4A36A 4Z8XA 2XOKD 3Q7PA 1QHIA 2C78A 5C46F 5HKKA 1UFQA 3LY5A 4KYUA 2O8EA 3FHOA 3B1ZA 3C5CA 1XD8A 2YZ2A 4DZZA 3EIQA 221PA 4QHTA 3VFDA 3T5DA 3SC3A 2R44A 4ITRC 1F2TB 1DELA 2QP9X 5LDDC 1JR3D 5FTJA 3QY0A 2NIPA 4XTCS 2N1BA 1W47A 1TEXA 1E2QA 4U5XA 3AVXA 2FSIA 1NY6A 5GJVC 4U7DA 4HUQA 3KKPA 1G3IA 1B0UA 2BOVA 2WMOB 2OBNA 5JHGB 2RH5A 1HQCA 1X8LA 3OEED 2F43A 3QENA 2G77B 2JJ2A 2AHOA 4NYJR 4QRHA 2NO0A 2VBCA 3PEUA 3R8CA 1CTQA 1YZKA 1E32A 2AK2A 1SVWA 1U0JA 2Z4RA 4XJXA 1T3HA 3CH5A 2PEZA 3A4MA 1IBRA 3NDPA 3QXXA 1AKYA 3AQ4A 3LVRE 1LTQA 2RGAA 3A1TA 3J81k 2GK6A 4ON9A 2D62A 3CRW1 3FWYA 2SHKA 3MWJA 4G5SA 4Y0AA 4L8GA 4AIIA 3UMRA 1LS6A 1EFRA 1CU1A 3KXLA 3W8RA 5KNDA 3VR4A 2IK8A 3K0CA 3QVVA 1Z47A 4L16A 1OXTA 3FFBA 1WF3A 4D80A 2ZYUX 3LQQA 4YLGA 3AF3A 4C0HA 3LNCA 5J4YA 1GWNA 4G5OA 1CIPA 1NVWQ 2QAGA 2R9VA 4JBWA 4D4JA 3GMTA 1OB2A 4GT1A 1H65A 3ASYA 4CIDA 1W7AA 1HYQA 5DYIA 3F3YA 1OYYA 4LI0A 4NCKA 2FGJA 3NHAA 4JLJA 3TE6A 2WKPA 2D06A 2DWQA 4GFDA 2WWYA 2AXPA 3EX7C 2HF9A 2UZIR 1Z6AA 1E0KA 4RKFA 3IEVA 3AKCA 2N42A 4YDSA 2OBLA 3U2QA 3DM5A 3K70D 1NBME 1X8JA 3R9IA 1QF9A 1N6KA 1UJ2A 4EPTA 1EX7A 4GPTA 4HAUA 1AZSC 3GFOA 3BS4A 4NPHA 2Q9BA 1L4YA 1ETUA 2OAQ1 3DOEA 4MGKR 3BOSA 5EP4A 2IA5A 1W4AA 1M1YE 3QNUA 4G5QA 1I2MA 4BFZA 2J59A 4JYCA 5A4JA 3PQCA 4RFSA 4M8NE 4TYPA 2XSZA 2YWEA 4PANA 4PSVA 1GL9B 4OQNA 4NL4H 1XEWX 3SFVA 1EFHA 4OHXA 4MKIA 2CE7A 3WRXC 2ZS7A 4OK3A 1J8MF 3FMOB 1SQ5A 3RRMA 5HKKD 2TMKA 1DPFA 2P5SA 1C4OA 3N2IA 4TLCA 1R8QA 1BS1A 1J2JA 1M7HA 3QKTA 1MO3A 2JEOA 2ZRDA 3TKLA 4JVMA 4Y0VA 1E4YA 1P6XA 1JEEA 1FOEB 4IVRA 4CEHB 4PC3A 1SVLA 4H1VA 5KNBA 4ARZB 1ZU4A 1I4TD 2J0VA 3A37A 3PITA 1E79D 3V4FA 4NYJQ 1XPUA 5DO9A 1DAFA 4ACBA 2BJVA 4IVPA 3C14C 4OI2A 1Z6YA 1XDBA 2YC4C 2V8OA 3IGFA 4EIWA 2V7QD 2FOLA 1CJTC 1NLYA 4D4LA 1ZAKA 2CDNA 4LJ6A 2DFNA 5G53C 3GCGA 4YMUA 3BC1A 1CR1A 3BB4A 1GFIA 4C0LA 3A6PC 3IO3A 1MO4A 2P3SA 2WVJA 1JQLB 2MMCA 1XXHE 3I73A 1S4QA 2IYLD 1II0A 1B23P 1LB1B 1JB1A 1COWA 1NJGA 2HDNB 4B3DA 4GL2A 3ZVNA 4NYMQ 2ZRAA 5H68A 1N5IA 1FQKA 2ZR7A 3WMFA 4EJSB 1OYWA 3UG7A 3RWMB 3WHKA 2ZI4A 3EARA 5AUOB 4IDHA 2EFCB 1UDXA 4UXJA 1GRRA 3JZAA 1R0XA 1OFHA 4NE2A 3X1ZA 3ZS9A 2J46A 2QGNA 3KQUA 3H4MA 2WM9B 4I81A 3QEOA 5HE9A 2ORVA 2OCBA 4EQ6A 3QF7A 4PQFA 4PC7A 5CITA 2B6HA 1XTKA 2FFBA 1WE2A 2ORWA 3EC2A 4LJAA 2ZEJA 1DE0A 1UBCA 4LBZA 4QGAA 4BPBA 1E2IA 5AR1A 2OG2A 4TLEA 3CWZA 3BD9A 5CDFE 4DDVA 3H1TA 1FQJA 5FPTA 3W6OA 3N5CA 1OF1A 1AIPA 2FSHA 1Z29A 3T35A 3IIMA 3GJ3A 2FE4A 4W5WA 2AWNA 2H92A 5HZHA 3E1SA 4IRUB 3SYNA 3SYKA 2FGKA 5GJBA 2R8RA 4IDPA 2NOAA 4LPKA 2P6NA 2WAYA 2FZ4A 3W3ZB 1E9DA 5BXQC 2OLJA 4MRVA 1QRAA 5L3VA 1SVMA 4NCHA 2N46A 3T1VA 3CW2A 5IDVA 5SZIA 2VHCA 1SVSA 3BAFA 4KHZA 5B57C 1CP2A 5EXSA 1KYIA 2O8DA 5DI9A 4ZI2A 2V6IA 4PHTA 5IF9A 1Q3HA 2JDID 1RJ9B 4OBEA 3DZ8A 1TQDA 4U00A 2ZROA 3DM9B 2QGZA 4L9SA 4A6PA 3BERA 2GESA 2QBYB 2ZRGA 3C4JA 2VP9A 4BZQA 4OJQA 1XD2A 1UKEA 2CHVA 5AJXA 1AQYA 5FOXA 4EQ6B 3RVBA 2J0UB 3OE7A 3BH7A 3TQFA 3U6BA 2EU8A 2QBYA 4PC1A 2IYZA 3NEYA 3IPYA 4HAYA 2O0HA 4UNSA 3DO6A 4EPYA 3MWKA 3TSZA 1U8AA 4KFRA 4LC0A 5LD2C 2XB4A 4JL8A 1P4SA 3KTAB 3Q5DA 1M34E 4A2WA 1X1RA 2CNWA 2ZS8A 3TH5A 3RANA 5G3ZA 3ADBA 1G21E 2Q21A 3ND8A 4EPWA 4ZDIA 1E1QD 4M1KA 4IDQA 2AK3A 1OSNA 3OFND 3U4QB 2R62A 2QMUA 1P3JA 4LDJA 1OKKD 4W7SA 4HYYA 3SQWA 3FKSA 1NLFA 4B76A 1TAGA 2FWRA 4BZPA 3VR1A 1XJQA 3EW9A 2O0KA 5BN3A 2O8BB 1GNQA 1XXHA 3E5HA 4IVQA 1W5TA 1WP9A 2QM8A 1N6OA 4LBWA 1GUAA 3K09C 2GA8A 5EZ6B 5KOYA 4RVCA 3IUYA 3FVQA 4M0LA 4M2LA 4DWJA 4C0KA 4L4UA 2JLZA 1WBBA 3C7KA 2CHGA 2XITA 2FMXA 3F0TA 4LHVA 1QVAA 1UEJA 2EYQA 4KU4A 1G41A 4URWR 3U44A 2QY9A 4A92A 2QORA 2J7PD 5H70A 2FJUA 2YJTD 4Q4LA 1Z83A 2OEPA 3N2EA 3A58B 1OHHD 2C03A 4IFBA 4KLNA 5EXXA 3Q8XB 1FMJA 1FNMA 5L3RA 3U61B 3GD7A 1RRCA 4AKIA 1E1RA 1TUEA 4V0KA 2ZAOA 4HLCA 5DHFA 5L3QB 4HAWA 1ZUHA 3JVUA 4XVUA 1SKQA 1E0JA 4PZZA 3CR7A 4B48A 3B1VA 3RS5A 5FOSA 5GADl 3IILA 1W0KD 2GJKA 3X1XA 3NTUA 5FUWA 4ABYA 1UADA 1H8EA 2P0EA 2EFGA 2OLKA 2RMKA 3P26A 1NSFA 3IEUA 2V1UA 2ZSAA 3O47A 4M1TA 3CUEF 1FFHA 1KDRA 2EFDB 3LLMA 4DSOA 2Q3MA 1NN0A 3ZIAA 4RD4A 3BXZA 1GILA 5FL7A 1H8ED 2DPXA 3KFXA 1J7KA 2NGRA 2IW3A 4IOJA 4QBIA 3GLIA 4B32A 1JR3A 1RFLA 3B2EA 5TMPA 1AJEA 2BM1A 3I92A 4TMXA 4F7WA 3MG9A 4E07A 1G3MA 1AZTA 2REBA 4D81A 3ASZA 1ZD1A 4P4SA 5K8TA 5E7IA 3AH8A 3UATA 2WWWA 3ZQ6A 4PO9A 2J0UA 2VQSA 5SZJA 4POAA 3LV8A 2IYSA 4HAXA 3U7FB 4PO1A 5HR5A 1AK2A 1RRGA 3LH5A 3REGA 3AUYA 2CK3A 3TUZC 1A5TA 1RW4A 1TNDA 3ZGXA 2CL6X 4F4JA 2ZIAA 1T5IA 2BMJA 1KKLA 2HUPA 3LVQE 3UMFA 3VR6A 1VKJA 3CNOA 4FW9A 5D3QA 4BASA 4TTQA 3GLIE 1KGDA 3NH6A 1MRSA 4NU0A 4HDOB 4HUQB 1G5TA 2QP4A 4Q4AB 2ANCA 3UIEA 3WRYC 2IUSA 3LFUA 1SVIA 4YMWA 4A4DA 1PZNA 1W36C 1E96A 3TUJC 2KI5A 3KJIA 3MAAC 1TU4A 3TAHA 5EJEA 1IY0A 4F93B 4GOKA 1FMLA 1E2LA 3X2SA 4DSNA 3P4XA 1YE8A 1EG7A 4UNNA 1NG1A 4WBSA 5IT5A 3CKLA 1QZXA 3ZQJA 5JSZB 1E1RD 2GETA 2HYIC 3DOFA 1T0HB 3TGPA 3SZRA 3HPRA 2GBLA 5G3YA 5EE0A 2C96A 1OW3B 5KSPA 1NI3A 2FFQA 3T61A 3CX8A 1FZQA 4Q4JB 3BGWA 3HU1A 3QSYA 1XTJA 3B5JA 4LHZA 4MRPA 3R7WA 4A8JA 2ZR0A 4DUGA 2XJ4A 3WP1B 4C0SA 2GEVA 2A3RA 2C98A 3BBPA 5KSOA 1CF4A 1EWRA 4XIGS 2FDCA 1QHSA 3GJXC 3G5UA 4Q4HB 1XZQA 5KDLA 2CBZA 2JIZD 1XJ0A 1W0JA 2VH5R 1N6RA 2Z0MA 3VNVA 1ZP6A 3B6EA 2ZITA 2J7KA 2DWOA 3DL0A 4LHXA 3W5JA 4MDEA 2R6DA 4BRUA 4R98A 1QG2A 3FPAA 1YZTA 4LYHA 2RGXA 2FPLA 1WCV1 3GJ5A 2XZOA 3I5XA 3B9PA 2ZI9A 3DKVA 4PAMA 2Q0HA 5CJPA 4KFTA 3EPKA 1CJMA 2WWGA 3AGPA 4UJ5A 4D4KA 2YVUA 3SJBA 1W48A 3QG1A 1D6JA 1HT2E 2R6CA 4BFUA 1D8TA 2NPFA 3EPHA 1E0SA 3FMIA 1X86B 4AG5A 4YQFA 1OLOA 1LF0A 3AF4A 4PQYA 3AVTA 3NBYC 4MUBA 2WOOA 2HLDA 3QXJA 3A36A 2AFHE 4LGMA 3PUZA 4C9BA 4DLYA 4TMVA 3VX3A 4BFWA 2GVDC 4HB2A 2D74A 2P6UA 4XSGA 5F3WB 4ZKDA 1AQUA 1DOAA 4EFMA 3RS3A 4UJ3A 3MJRA 1U2RA 2FSFA 4TQUS 3AUXA 2R6GA 2ZRNA 2DB3A 2HF8A 2BIFA 2HEIA 4B73A 4V0LA 5F9HA 2RKOA 1S1CA 4BFXA 2ODNA 4FWIB 4UKDA 2OSBA 4F91B 1P73A 3GPLA 1GVNB 1M7BA 1DARA 1N0UA 1L4UA 4C7OA 1CRPA 1E9BA 2LKDA 1JR6A 4Q21A 3CBQA 1IM2A 2WICA 3K9HA 5EP1A 4M21A 2XAUA 1FPMA 2Q9AA 1F3OA 1CULC 1Z3IX 2OM2A 4CT5A 1GDDA 3GLFB 1DG3A 1JNYA 1JR3E 2LWIA 4LK2A 4Q9KA 4RZUA 4KBGA 4FCWA 3RDPA 2QE7A 1R5BA 2VHJA 2JJ2D 1JI0A 3FYHA 1XMSA 2JA1A 4KXFB 4WZAE 3VQTA 1XRJA 3A4NA 4JJZA 2YOGA 1AGPA 1P61B 5JMTA 1XFAA 3VKGA 5FBLB 3AEZA 3TW4A 2JASA 2CXXA 4EFNA 4TT3D 2PMKA 4KI0A 2C5LA 1MRNA 4TZ0A 4ZCIA 4UXHA 4O0MA 2HT1A 3CRVA 3LXXA 1KAOA 4EJSA 1E98A 5E4FA 4TMZA 4LYJA 5KPDA 4Q7JB 4AYTA 1EFUA 4B35A 4TTPA 1N6HA 4Z8YA 1KY2A 2B7CA 4PHGA 5C4GB 1KMHB 2C9CA 1SXJC 4WXPA 2REXB 1F2TA 2OUKA 4G1UC 4P32A 2CCKA 1IXSB 2RGCA 2ATVA 3SQXA 3GJ7A 3I4LA 4ACAA 1N6IA 2ZRHA 4BZXA 4MKGA 4P0TA 2IXEA 3CRQA 5J5CA 3Q5EA 3VKWA 5KU1A 1G8GA 4GZLA 4Q4HA 4CDGA 3K0EA 1GL6A 3HU3A 1GL7A 2CMKA 4BWYA 3THWB 4JBYA 4A2PA 5JCPA 1YHNA 5FTKA 2FX3A 2MSEB 3LXRA 2HXYA 3VU9A 4M1SA 3QKSA 1UKYA 2EVWX 5KSZA 3UPUA 3C15C 3Q85A 1ANKA 4I4LA 1Z0DA 3NBZC 1SXJA 4QBFA 3W3AA 3HDTA 3TR5A 2IEYA 4MRNA 1E4VA 2IS2A 5FOVA 3K0AB 2D7DA 4M22A 1G7TA 5DGXA 4DLTA 1E9CA 2VYFA 5GVSA 1DADA 3U3OA 5FOWA 1N2CE 4KVGA 3FHTA 2ZE5A 3R9WA 1YR8A 3QF4A 3S1AB 4BLRA 5DN6A 4BLQA 1QVRA 2JIZA 2ZRCA 4K8OA 1UKZA 4CF7A 5GVRA 2G88A 4B33A 2PLRA 2ZJAA 4BLTA 2F3TA 1IXZA 4P33A 3GLHB 1W4BA 3HWSA 1Q1EA 5IRCD 1A4RA 3TVTA 5JS8A 4GI7A 3ZYCA 4AYWA 3PXGA 3UWOA 3SN6A 4G5RA 4Q00A 3TSWA 2Q9CA 2QG6A 2VSFA 2QI9C 4Q1DA 3KXIA 2WHXA 4XVQA 1E3MA 1Z0FA 5J4VA 1KMHA 2ZU0C 5JZVA 2GZAA 4ZKEA 2X19A 2GAAA 3GEHA 4AKGA 3I32A 2QT1A 2GJ9A 5CIQA 3SBDA 3LX5A 3IQWA 3GEEA 3OIYA 4QBHA 5HPYB 3CH4B 1TF2A 1VCMA 2WJGA 2QTVB 1KO1A 4HUTA 1WDTA 5EE1A 2ZE7A 1G8YA 4PX9A 1P2TA 2V6JA 5TXGA 3HP1A 2YOHA 1Q22A 2J5XA 1J8YF 4MITA 5FFMA 4J0QA 4HEJA 2JATA 4PAQA 2WSSA 4R2HA 3UWKA 4AI6A 3OE7D 1G8HA 4B47A 3B8HA 4LBYA 1XTIA 5JJLA 4D2IA 1S3GA 2IYYA 4OYHA 4TYWA 1TADA 1BMFA 1ZUIA 4LJ9A 3UANA 4ZDKA 5HCIA 3CWQA 4GNKA 1X6VA 2P67A 2GZHA 4TWZA 2GZDA 3OIUA 2GXUA 3Q9LA 1FL9A 3U4QA 2CEAA 2IBMA 2GK7A 4HATA 1E2JA 5H1YA 4QJ4A 4FD2A 1P60A 4RZ2A 4I99A 1UKVY 1KI7A 3NHBA 3I8SA 3G0HA 2BCJQ 1E9SA 4D6PA 4DIDA 4EUNA 4GSYA 1ZW6A 3THYA 2O5VA 3ADDA 1G5PA 2RGNC 3FGNA 2QU8A 3BWDD 3QVUA 2VSOA 3PIRA 1CR0A 2D4HA 4PFSA 2Z43A 2GXAA 1R0YA 2OHFA 2WPDD 3IKJA 2CVFA 3K0CC 3LW8A 4U02A 4DIEA 4GP7A 1R8SA 1YKSA 3U3MA 1VCNA 1E6CA 4H1UA 3WY9A 1NY5A 4FINA 3O8RA 4FI3C 4JLNA 3EWAA 2IS4A 2F9LA 2QL6A 3OIVA 1BKDR 3BORA 2RGEA 3KX2A 3QKSB 2NO7A 5HZKA 3ICEA 2H1LA 2BKEA 1KI6B 3MD0A 5K8LA 2PJRA 3U5ZB 1Z0KA 1MABA 3A1SA 4F38A 1S3SA 3M6AA 1AS0A 3IDQA 3WHLA 1UPTA 2EWWA 2QE7D 2DWPA 3EIEA 3RHFA 3EPLA 1E79A 2J3EA 1JXOA 1A2BA 1XTSA 4I1SA 3D7MA 4B2IA 3ZD7A 1ZNWA 2XEXA 1P9NA 2GTPA 1OH8A 2F6RA 4IXMA 1CXZA 2QEQA 2GNOA 1OIXA 4US1R 1JBKA 4YDHB 3PVSA 1OFIA 3RYTC 1G3UA 1SHKA 3QBVA 3OEEA 2W58A 1XBTA 3QEJA 2JJ1D 5LB2A 3ZIAD 1XMVA 3AF2A 1PVOA 3KQNA 1HT1E 3TIFA 4EPXA 5JWOA 4BFTA 1VG8A 2PZGA 3H84A 2ZUCA 1IAQA 2PMDA 4JS0A 4P4SB 2JLVA 1KDTA 2E1RA 3K53A 2C99A 1CLUA 2ORIA 4JL5A 1W4CA 4TL7A 5GJCA 3GLIB 1KZ7B 1XEXA 2QPOA 2LCFA 2IYTA 3QXHA 3V9PA 4TMTA 3RRNA 3T5GA 4QFMA 3RABA 3SYLA 3V00A 5FTLA 1DAKA 4DUGD 1QHGA 3EC1A 1IN7A 2ZRKA 3VMFA 1CS4C 2XTMA 4LJ4A 4AKEA 4US2R 4C4PA 1YR7A 4TZ6A 4QC2A 2YYZA 2VL7A 1L7VC 3EIHA 1NN3A 2F1RA 5DI3B 4I1OA 1G6HA 4DB4A 4KFUA 5G40A 4LHYA 2R2AA 2WTUA 2QA5A 4WAUA 3TQCA 4AK9A 1NBMD 4KV9A 1J90A 4FMDF 5J40A 1RKBA 3P1JA 4URVR 5FOUA 1U0LA 2GCNA 3OAAA 4ZI3A 4Q19A 1DAMA 2AXNA 4IHQA 2QPAA 1FX0B 4QJ5A 5A5GA 1KI2A 1RIFA 2DFKB 4OL0A 2MSCB 1QDEA 3KDSE 4IEIA 2KSQA 4LCBA 4XWAA 4NHOA 4D0NA 1KY3A 4RFSB 1FW6A 4PXAA 4Q1FA 2AD5A 2RB4A 3LD9A 5CLQA 4IJMA 1WBDA 5FUYA 3AKDA 4A82A 1UEIA 5BN5A 4CEIB 1SKYB 5CM8B 1SZPA 1G18A 1GAJA 1KHTA 2FEOA 2ZJ8A 3ZD6A 1PV4A 2PEYA 1F6BA 3LDAA 4A8JB 1JPJA 4S2EA 1RVDA 4RD3A 1C9KA 4CT4B 3GLHA 1NL3A 1KNQA 4N1AA 1E94E 2AWOA 4JSYA 4QM7A 3FB4A 2A30A 4LX0A 4IDNA 3FOZA 1KSJA 2A5JA 2G6BA 2VSXA 4V0NA 4A1FA 3EZ6A 2ZXUA 2WWXA 1QHHA 4LZZA 421PA 4AD8A 2GAOA 4IOKA 4RZ3A 4NDZA 4M4SA 3MSXA 1N3BA 4RD1A 1E9FA 2WKQA 5AJZA 4NCJA 4C3ZA 2ZJBA 1NVVR 3EASA 1D2EA 2ODBA 2QAGB 1G20E 2REOA 2O0JA 1OV4A 3GJ0A 1VYUA 3PENA 4CGZA 3TAUA 2IWHA 4MRRA 1CKEA 1P5ZB 2CE2X 3GJ8A 2F55A 2RAPA 4NYIR 1AS3A 1ZM7A 2ANBA 2BBTA 1FX0A 4LPSA 4GBMA 2VP5A 4GMXA 3QJYA 4DBLC 1NIJA 5DE3A 4OQMA 4GOXA 2Z5FA 5TVKA 2H16A 2VLIA 3ZLJA 2QENA 4LJYA 3KUDA 2Q3FA 1P9RA 2QT0A 4B75A 4KJZA 4MGYR 3SJZA 5JLJA 2GEDA 2ZI3A 1UAAA 4DCNA 1KDPA 4Q9HA 3TJZA 2HCJB 3T1QA 1W2HA 5EE5B 3AVPA 1E2KA 4TYQA 5A0FA 1W46A 1G5RA 1KMQA 4NYMR 4V0MA 1KAGA 5ANRB 1IN4A 3BB3A 4URXR 4CEJB 2H8KA 1KO8A 3D6TB 4F4IA 1E0AA 2XZLA 2WAXA 4O2RA 3GLFA 1GTVA 3AF1A 1ZINA 4PZYA 3P32A 3GFPA 3EG5A 1TF7A 3KB1A 4N0EA 3LA6A 4TN1A 4XD7D 3ZS8A 2BMDA 2AL7A 3KKNA 2ZJ5A 4MKFA 4CEHA 1P75A 4MGZR 4IW3B 3OAAD 4MKHA 4B2PA 3NWJA 4JVNA 5FUXA 2IUTA 2I1VB 1OPXA 1P9WA 2ZJZA 3QIAA 1S8FA 3M4YA 4URYR 4EJSC 3V4RA 3ZH9B 3DDCA 4PSAA 2DYKA 1H8HD 3QE0A 3LX8A 1EFTA 5DNYB 2J87A 1PUIA 1NP6A 3KKOA 5AK0A 3CX6A 4URZR 621PA 2YNMA 1DVRA 4RD0A 1G64A 4XTRA 3BH0A 3P27A 4WXRA 3K09A 1RJ9A 1T0JB 3QXCA 3CM0A 2XTZA 2NPIA 3B1YA 3BIFA 2XGJA 1MKYA 1PJRA 1NMXA 2OO7A 3QBTA 3EZFA 1DAEA 1Z08A 1E2GA 3BE4A 4TQ9A 4M53A 3WNBA 1KK3A 2HJGA 4X8OA 4X8LA 4ASUA 4XWKA 1XEXB 4HB3A 4QGFA 2ZU6A 2ERXA 4WVFA 2A5DA 1YQTA 4PPQA 5JRJA 1HE1C 2QMHA 5FI0B 2MSDB 1JPNA 1WRBA 4OHYA 3MCAA 4US0R 4ZCLA 2ZRBA 3R8FA 5C2JB 3QPUA 4AWXA 4KVAA 2WJHA 1DBSA 1Q1ZA 5D3MA 1KK1A 1XU4A 4NZYA 2IT1A 1KTVA 3DVLA 3W6NA 1HTWA 1NF3A 3MRSA 3AKYA 4FWTA 4NTZA 5FBVB 1R6BX 2PT7A 1Y3AA 1OB5A 3QF4B 3GLGA 1ZM3A
chains in the Genus database with same CATH superfamily
4C5AA 1EVEA 3D8TA 2P5TB 3IP9A 4JJIA 4N7BA 4UQPA 2GLUA 1EGAA 2VKTA 4TQGA 3LCRA 2ZRPA 5EKTA 1EK0A 1Z2DA 4TRNA 4A8PA 2Z5VA 1YQ9A 2XGSA 1XCMA 3UPTA 3Q5GA 4W7HA 5IU6A 4CL2A 3LWNA 3LTNC 5ES4B 5CCBA 1VJ1A 2JIPA 4D9JA 2HRZA 1MDFA 3G3EA 3OCVA 4DREA 2XJ9A 4J4TA 4B7CA 1TW2A 3B7GA 4PICA 4WZAA 4EUEA 3R5FA 5JD4A 3DEAA 1KI9A 2RGNA 2JK0A 3HFJA 1XAJA 3BGDA 2GWRA 5GONA 4KUGA 2AI1A 3ANTA 1R74A 4TMFA 1EUYA 2A59A 1RRFA 5CT8A 2BT4A 2I1WA 3AB3A 3EXIA 4M1OA 4EGSA 4E4TA 1GPBA 5LQAA 2PJUA 3GZNA 3MINA 3JWEA 1K3TA 3ORHA 4ZAGA 1K6XA 4BO5A 1J0AA 5E8JA 5D8DA 5TE9A 1IEQA 3AY7A 3A1VA 1DKNA 4ZVQA 4YO8A 3T15A 4DC9A 1DQYA 2BC9A 1UDRA 3GRUA 4R71A 4X6XA 1BROA 1F0NA 1B8UA 1RCFA 1M6YA 5ITZA 1TZ2A 1RE1A 2G0TA 3M8KA 1PZEA 3SHVA 1BE1A 2I03A 4XSVA 2FMIA 4I08A 5K0TA 2C07A 3I9MA 1EJ6A 4OHRA 2XWSA 4C4OA 3NHKA 1OAOC 4JEMA 1JIUA 1JDBC 1JEJA 5KNDD 2MOKA 4S12A 3U7IA 2WIDA 2ZLBA 3V1UA 2JBHA 4KI7A 1H1LA 1XQ1A 2EIXA 1T5LA 2AG1A 1B6TA 4LVNA 3QPWA 1R9JA 3M0EA 1R7RA 3NCTA 4ESHA 4W5TA 3OPQA 3QLJA 3S2SA 2K6GA 1FVHA 3N2KB 3SZMA 4CV1A 2MSLA 4OX9B 5IJ9A 3JYLA 1ECFA 3DL4A 4R0MA 2OXFA 1NM5C 2PXXA 1GNVA 4DWVA 2QUZA 3I5YA 4KQ1A 2JI4A 4W5JA 4BQSA 2V7PA 3CVYA 4DCUA 4D4HA 2EYUA 4CDMA 2XQJA 2OZEA 1IMOA 3VNBA 3I2KA 1V2GA 3H5IA 4H3KB 4PFKA 5GMOA 5BW8A 1V1MA 4REMA 1KAMA 4KRYA 4Y9TA 3Q1LA 4KQWA 2G08A 3FH0A 1KS9A 3LT4A 2A14A 4TYYA 3CPEA 3B2QA 4K26A 3GW8A 4KLRA 4C43A 5CCXA 1U6IA 4H77A 4MQMA 3ZDZB 4P58A 1Y8AA 4ZV9A 3DWGA 3EZ2A 3ZVRA 3PZRA 3OD5A 2JHAA 5H80A 1DBPA 1SB8A 2KWIA 2NZWA 2W6PA 2B5WA 2IITA 1HOTA 3PQDA 4IIBA 3PUWA 5ARCA 5A5VA 1VCHA 4JV5B 1RLTA 4M0UA 2A5FA 2NNLD 4OHVA 1GUFA 2L69A 3D8BA 4N5MA 4ZVOA 5B53A 4DABA 5AUQA 1EYZA 1BGXT 1AHIA 5F77A 1VMAA 5WRFA 2CVPA 1KDYA 1F2UB 2BGKA 4KWCA 1KI6A 3REQA 4NJEA 4G0NA 5AVVA 3V55A 2B6NA 2P8JA 2B7BA 1D0IA 5C1IA 3VPDA 5CLJA 3CJRA 4BNXA 1BA3A 3FCCA 3KEFA 4ETIA 2IYQA 4KO4S 5JFOA 4L8LA 1BDBA 2JAOA 1AZWA 1O4WA 1HLFA 3NC4A 2HT6A 2GILA 3JTEA 4E7PA 4WJLA 1G16A 4RJIA 1HMPA 1TYCA 1W49A 4TMWA 3CLHA 4WXYB 3W90A 2ORED 4DIBA 2ZYTX 4ZO8A 1TMYA 4B45A 4BPRA 2J6HA 1A9XB 2NVUA 5ER6A 5EHGA 1CZKA 1YRAA 1AKEA 1VHTA 2VJQA 5DOVA 3WGZA 3DL7A 1YVDA 3E4CA 1GKUB 3M1YA 1PJ3A 1BQ4A 2QL9A 2TS1A 4P31A 8ADHA 5ALUA 1GRQA 1MPTA 1A2OA 2OHVA 4UEOA 5FNVA 3ZC3A 4DCCA 1BHJA 1QH1B 1GNLA 4D79A 1OZGA 3PCTA 4HAVA 4CMJA 5JCZA 4B74A 3FKQA 5C81A 3KTDA 2F64A 1IG3A 3PXEA 1V5EA 1AA9A 1QV9A 2R65A 3RUPA 2A9QA 3O4GA 4E5KA 2I1QA 1JKFA 3HYRA 3CWCA 4D9GA 4DYVA 4CLRA 2O52A 1FP2A 4QPZA 2UZ3A 5CW2A 3EA5A 1AXEA 5JSYA 1CUGA 2ODPA 3VR6D 3CRMA 1XAGA 2AEJA 4HWSA 4S05A 1UIMA 2PO5A 3AIIA 2ZE8A 1I3OA 3HB4X 1DBVO 2VPPA 4YUVA 3GHHA 1XWIA 3SU8A 3LYLA 3LPNA 4IIJF 5KREA 2OZVA 1N0IA 1UBEA 4HLUC 4TT3A 1E69A 1UWKA 1ZGZA 1WA5A 2QGFA 2HWYA 1QHYA 2ERYA 1ZM2A 2Z04A 5HJ7A 5LXTF 1YZFA 2JGFA 3QU9A 4CQNA 4AY4A 2GF9A 3AVWA 2XNDD 1H8HA 1JAZA 2YCLA 1PI3A 1Q14A 3C1AA 1CC1S 1CR4A 2CCJA 1PE0A 2BKVA 3P7MA 4X6LA 2VP3A 2A6PA 2XWJI 3UJ3X 1RYFA 3CCFA 2W6IA 2A86A 4ZREA 4A73A 2PJZA 4HLNA 5K0BA 4MR9B 2XNCA 3CGWA 1ODSA 3DLIA 2VSNA 2PCJA 4Z9BA 1AO3A 3QVMA 1SA0A 1U7ZA 2BYTA 2AXEA 1NVEA 1RYEA 4Q18A 3KSZO 1N9GA 3WICA 4DM3A 5KUTA 2WP0A 4HQ6A 4UBOA 1FU4A 4XXHA 4XARA 4A6EA 2XMZA 3R5XA 1YQUA 2FUG6 3GOHA 4WLVA 3QWAA 4FVTA 1FSZA 1BXGA 3AC0A 3MMZA 2WWRA 3TCXB 1IZ0A 4HTFA 4TL6A 4BVFA 3ST7A 5HGXA 3U9SA 4FEEA 1ENPA 3FDIA 4F0JA 2Q3HA 2CMDA 3E9YA 3GG2A 3EXEA 1VI6A 3PV0A 4P4TA 1U4NA 1Z8FA 1EP3B 1DXQA 1CRWG 2CZCA 2O2JA 1CG6A 2ODQA 1LTKA 2H5LA 4M6WB 3AF6A 2LD4A 5CXXA 4CM1A 1JQ5A 1O08A 2ASVA 2QYHA 3IXQA 3JD4A 1WPXA 3RKUA 3WQRA 1IEWA 1HTBA 3U60B 1P4RA 4RJKA 3SEAA 4N3GA 1YACA 4B6OA 2X1VA 3ZXXA 3P71T 3LC1O 5I7HA 4D46A 3UFXA 4H7DA 4R16A 1OAAA 1XTQA 1RHQA 3EGOA 1QOQB 3PWTA 3R7AA 5BR4A 1QYDA 2CLSA 3DCJA 4RHCA 3KEGA 4QT0A 3EVFA 3L0YA 3LCVB 4TM8A 2XZPA 4HYTA 1PNQA 4L57A 2XD9A 3O26A 5BN4A 1XZHA 5LA6A 2V4MA 4BNUA 2OCYC 2YWFA 5DLQC 4Z3DA 1ZUNB 3DBIA 1QCYA 4NECA 3WO0A 3PF8A 4GICA 4C4ZA 1UOPA 2W2OA 1AUQA 1Q20A 3ICQB 3LX4A 3OOWA 4GF5A 3LYHA 1K4MA 3I62A 5I9BA 5BPHA 1KO7A 3KSAC 1T4DA 5IMBA 2B4YA 4CM4B 3O1IC 3AHDA 3EVBA 4LDAA 1R00A 2AKYA 1MH9A 2PL9A 2ZM5A 2E7ZA 2ZWAA 5CXQA 1BCRB 4FMDB 1ISRA 1T3GA 2GPJA 4IXWA 4QKQA 4YRKA 2R7NA 3L4BC 3Q7QA 4JBGA 3K94A 5AW3A 1RWWA 1AK9A 3AINA 1RI2A 4M1WA 3DWFA 5D87A 1R0WA 2H08A 2IIPA 3HU2A 4YLEA 1SCDA 1HNNA 3RCBA 4BGDA 2DERA 1XZCA 5A06A 4MUYA 3EQ6A 5IBPA 5LMCA 2WAOA 4PYNA 1KKUA 1OLXB 2HA6A 3ILSA 4B3CA 2ZM6B 1H42A 2NZJA 4WZBA 3OE1A 5LP6C 4XIYA 2XR1A 3B3AA 2PZBA 3BAZA 1IHUA 4LV6A 1NUQA 5LMZA 1ZA2A 4UZFA 3CUSA 4ENSA 4Z86A 2QDXA 2I91A 1S2IA 1KYZA 3PD0A 4WFQA 3GDWA 5CB4B 1U63A 3Q7EA 3Q6NA 1KAHA 2WOJA 1WHSB 5CXUA 3JQ8A 2BW0A 2C77A 1SBCA 4RKQA 1QRUA 4HDRB 3DE4X 3FCUB 3EFHA 3G59A 3Q6IA 1MNAA 3ZHXA 2ZXFA 3EIUA 2PUAA 3DE1X 5EEGA 1NMZA 2EQBA 3UY4A 4AAYA 2PN1A 1T91A 4P2GA 2ZBGA 4OG2A 4ISBA 2VTKA 2YYSA 5BO5A 1KAQA 4EKGA 4P4GA 4A26A 4N40A 1T4CB 1G6OA 3TK1A 1DT3A 5IBQA 4YUAA 4CM9A 3IHWA 4K1LA 2VP0A 2A57A 1ZR4A 4U6QA 1FP4B 3PJGA 1Z7BA 4H0NA 1XX6A 2X2FA 2DAPA 5DTEA 5F12A 1M83A 2TRSB 3F46A 3PFIA 4PIMA 3SZOA 3VU1A 3WYAA 1OIWA 3YASA 5J43A 1AXRA 3D8SA 2HNAA 1RTTA 1TMOA 5E2BA 3TR0A 2OAGA 1AHPA 4R1OA 5ALEA 1JIKA 1UZNA 1QC5B 3T5AA 4IIJB 2IHKA 5AW7A 1OOEA 3PEVA 2R6JA 4CODB 1SUBA 4OHCA 1SKMA 4WNAA 4DC0A 1VE5A 4K0RA 1JU4A 3NAQA 5LB4A 1V8OA 2EW2A 4FGKA 5D1HA 1RYHA 2C04A 2IYUA 1J24A 4XJSA 5IKPA 4RF2A 2H4JA 3GWGA 2OXEA 2Y8EA 1O94D 1QP4A 3LC7O 2V5UA 3PHCA 3BJZA 3GUVA 2BTQA 5DEIA 3UJDA 1KJYA 4PHFA 2Q9UA 4ZTBA 4EYQA 4HGOA 2FSUA 2FPUA 1T3LA 4XR9A 2WABA 2XYVA 4Q9JA 4AULA 2BJWA 2VUUA 3PFHA 2UZ1A 4E13A 4FJ0A 4EBFA 4ZAVA 4Q3EA 3L05A 1H4VB 2GYUA 1GEGA 1SBQA 2NUBA 3D6FA 3RYCB 4HSGA 1VXOA 3GLGE 1V71A 3Q9SA 5J5AA 2XCLA 1U98A 3T7IA 821PA 2ACEA 3C3DA 1L5NA 4N3BA 5I4BA 2D2VA 2XKJE 3FYUA 4ZVUA 2W6ID 2YY5A 3OZDA 5CDFA 3JPWA 3VTZA 5KDDA 2FF7A 3H5VA 1N2EA 4ALIA 4WBNB 4OFWA 1KYYA 1GQFA 3E9CA 4MVJF 2PLWA 2WKRA 4Q6WA 5JPIA 3CT6A 3T95A 3BB1A 3QVJA 4FEAA 4AF6A 1XK7A 2Q4TA 4YJ2F 4GYWA 1H22A 1Q0HA 2QSZA 3OPVA 5JI2E 4HXFB 4BKQA 4G0ZA 2GXSA 3KC2A 5IVDA 4DWWA 4K28A 2OE2A 1DJLA 3TJMA 2YL2A 1F48A 2DHDA 4HD8A 4Z4QA 3OFNA 3P8ZA 3GLRA 4K9MA 4EB6B 1Z07A 2BFFA 4MLZA 3A70A 1BYIA 2FPGA 4RSGA 1T2CA 1L1FA 1O9GA 2H2WA 3K0FB 4JLMA 1NM5A 3SX0A 1G7RA 1R9NA 4BO2A 1N2IA 3T1OA 3IVGA 4NENA 1CDEA 4LFCB 4CDRA 3HQ4O 1EWQA 5F98A 4IS2A 1HA3A 1ECGA 1FNSA 3BXGA 2I6XA 3I12A 4JODA 5L7TA 2IPNA 4EY5A 1YJXA 3OURA 3QW2A 1RLOA 5FR1A 1HQYE 3GP3A 5B1EA 1BYUA 1R88A 5FR2A 1QYIA 5LJLA 3L01A 1PEDA 1NWHA 1J39A 1O9HA 4EG1A 4WERA 1FIUA 5IH7A 1XKLA 2VP4A 4DGSA 1VBNA 4AKHA 3MTAA 3HA3A 4I9GA 1DAHA 2YWHA 4MW1A 1BMQA 1ZMXA 8LDHA 2LW7A 3I0MA 3RUAA 1ZSYA 3GI1A 4I50F 1JQJC 1KI1A 4LAFA 4TQAA 4KSYA 5AOAA 3ORQA 2C5FA 2DHRA 4QVGA 1SIUA 3QWHA 4IJ5A 4K86A 3E82A 4OOFA 5KCZA 4H59A 3U4MA 3TQTA 2PA0A 1W35A 2VRCD 3HJHA 4HZUA 4XVCA 1R6DA 4DNFA 1Q95A 1MGPA 3NEPX 1OXUA 4I19A 1UM8A 4WGGA 4QRIA 1Q6YA 3EZ9A 1WSBA 2HMWA 4URHA 1C14A 1XLTA 2BZSA 4PO8A 4BLSA 1RC0A 2Y93A 3I0NA 5IWAB 5BY2A 3K73O 3OZXA 4FMCB 5FOTA 4P3XA 1XYYA 5HFAA 5BVGB 2NM0A 2Y66A 2BBOA 2NT4A 3A1NA 2L17A 3RC1A 4DSTA 4OK6A 3SHWA 2A0FA 2C7OA 3UKOA 1FYWA 4JBNA 3K16A 1YZYA 3ADPA 5ESRA 1Q84A 3ELWA 8ATCA 3KR2A 1TA9A 2CK3D 4NBUA 1NUUA 1NBAA 4LRWA 2Z9CA 3INTA 4NENB 4OQQA 4QXRA 5DWDA 1H3EA 3QLUA 5DBHX 3WGUA 2JA2A 5FLKA 1XEWY 3RAJA 4AMZA 1HUQA 2RC6A 2WU3A 1TYAE 2XXBA 4E15A 1XPOA 3A6HA 3RIHA 3V5NA 4D99A 4O4IB 3E9EA 4G07A 5CTJA 3N2GB 3DZKA 3TOVA 4PX2A 4DA4A 3DS8A 4XGKA 3EZNA 4FT4A 4G2NA 3IA7A 3DHVA 2FP4B 4LRXA 4RNCA 1R2QA 4UE3S 1DKQA 3BFXA 1E7RA 5A6SA 5LOVA 3QWBA 2X8AA 3IHLA 3MJTA 1PS8A 4B3FX 4ERNA 3C5EA 5ALPA 2CXQA 1PT8A 1T5HX 3MCTA 3QKRB 4YCJA 4ZP1A 2AV6A 1C4XA 2FP4A 1EFPA 3RI3A 2XGOA 4DA7A 5COAA 1TJ4A 3ZHOA 2F1IA 3N70A 3PVCA 2I76A 3KB6A 4I1VA 4N6GA 1GQYA 5DVZA 4BMOB 4D0GA 4EMUA 1J5PA 3AI7A 1DKRA 3AERB 2H59A 3OX3A 3UYLA 1ZJWA 5EMKA 3TLBA 4NS1A 3CNQS 1H9CA 2I7XA 4AUNA 2BSXA 3L6UA 3KLBA 2NTJA 4AUKA 1QH1A 3CB4A 3GJTA 1MVOA 2G9RA 3PWKA 3P9XA 3IR7A 4N03A 1YC5A 4P7BA 3V80A 3ND9A 4D43A 2V9PA 4U2FA 1FF9A 3HM2A 3KJEA 5BVGA 1FW8A 1XQ9A 2BEVB 1I4DD 1JFFB 3NTQA 1KEZA 1TTTA 3TSYA 2WHPB 4FC6A 2BMVA 4KV7A 2AZXA 3HXPA 1Z2CA 4NNPA 1G8FA 4NH0A 1FVFA 1PSDA 2Q5EA 4ML3A 4WNAB 4CYMA 1F38A 5B2EA 4I4IA 4QXOA 4DCVA 2D13A 7REQB 3TZLA 4ND4A 3L2OB 4OU4A 5F7XA 5J2TA 1Y4AE 4P84A 4DJJA 4FGLA 2VG8A 2GI4A 4FGWA 3IE2A 3Q88A 3PU6A 1WJGA 1DTWB 1UBSB 2Z6VA 1G4UR 4CM8A 4BECA 2GUWA 1OXXK 3G8YA 2PUCA 1Z2PX 4PG4A 1RE0A 4OQFA 4EECA 3ECCA 4OI1A 1D4FA 3C3MA 3ITKA 2FKNA 4MJ3A 4D56A 5C3MA 2EBFX 2HHJA 2AMJA 3HNOA 3TPFA 4YAFA 1PTJC 2QZSA 1GPLA 3IQZA 3ZWOA 3FOFC 3GUCA 4O08A 2D3WA 2B34A 1J9ZA 1P1HA 1RQGA 1ZXLA 1LQTA 3MJCA 4FX5A 3STTA 4A7PA 4NOLA 2R8ZA 4XGRA 4P4LA 1II8A 3F7NA 1DT5A 3TIGA 2W2LD 1NVVQ 5JY1A 2IPXA 2QAIA 2WE8A 3QOXA 4OI4A 4GEGA 3UG6A 3Q3JB 2FZKA 4RA6A 1V0JA 3MTGA 1QANA 4WZBE 2FXIA 1E7YA 5ICMA 5HSGA 4R8MA 1TCBA 4ARVA 5EERA 2WWHA 5FTMA 1IMJA 5SV2A 4HNUA 4LDRA 4CETA 2SCUA 1RM0A 3N5KA 2G1PA 4LQ4A 1RR6A 2JI6A 4M0DA 3L8YA 3M1IA 5FBWB 4MICA 4B3XA 3RSLA 5CVDA 3H9GA 2AMYA 3V2HA 3C5VA 4R1SA 3VHRA 4ZDWA 3CLUC 1YZQA 2P4UA 4NMMA 5G2OA 2XF8A 2X0RA 4PSKA 3QI7A 3N2KA 1MOPA 3RS0A 3S0JA 3KSMA 3ZI7A 2P9HA 2VJKA 1U81A 3MRXA 2GLTA 4I55A 4DKXA 1BQEA 1XVLA 2PZFA 3PEWA 1GKLA 4YJ3B 1TO1E 3RE1A 3JAWB 2Y0BA 5EGNA 3ZGNA 1CJUC 4M8KA 3ZQ4A 5A71A 2QTNA 1ZMOA 1HXHA 4UEKA 4BL5A 5DFAA 2J41A 4CZ2A 4D26A 3QU4A 1ZGAA 1X94A 2E0IA 2J3JA 2HLDD 3D2AA 2PRZA 4XDZA 3P9YA 1LJUA 4XYBA 3RIEA 4FEYA 2E9SA 2UVDA 1KVQA 3X1WA 1S2LA 4PR0A 5EXEA 4F3KA 9LDTA 4C6RA 1GYRA 2B82A 3OUUA 3DYBA 3F3MA 1LVHA 3HN2A 5BMVB 1F4LA 3ORYA 1PQYA 1XI2A 2EL9A 1L8AA 3H5OA 5E3IA 5DGTA 1IQ0A 2YBEA 4WZ6A 1D2MA 4GZMA 4BX2A 4BE7B 2VRCA 1XHFA 5B1YA 1ZM9A 2WVAA 1ACMA 1SZCA 3UKDA 1KI4A 2Q3DA 2IP4A 2BGLA 1THTA 1YBMA 1BH6A 2X7XA 1RZRD 4QO8A 1T2AA 1LPPA 2W0MA 2GZRA 4JKYA 4HDQB 3GUZA 1CNFA 1NPYA 1EVIA 3EBLA 2OGWA 4MP8A 2PUGA 1TCCA 4K6FA 3TO5A 2Q8NA 3HUTA 4JX8A 4EEKA 4RSHA 4OXKA 4LHEA 4QFDA 4R9SA 5TGDA 4GKAA 2CXUA 1P44A 1T3TA 2HRCA 4BVJA 3AR5A 3VSCA 4CLXA 1RCUA 4FJ1A 3LDGA 4HLQB 5GWXA 1AOXA 1XL1A 2MMGA 2YOFA 4WCFC 1FSFA 3VMMA 1JLRA 1Z0AA 1QE5A 2FWBA 2GNPA 3E3AA 4PR3A 3L82B 3PUXA 3A2LA 1SRRA 4UXIA 4F9EA 2HJSA 4P53A 1VRWA 5JYCA 4FGUA 3OLXA 4YJ3A 3L8DA 3TLCA 4LC1A 1U8XX 4NK4A 4K6MA 1F60A 1XAIA 4O3FA 1K9VF 2WKSA 3HABA 2H17A 3SZLA 3TCKA 3AVUA 4UDOA 5JD5A 5KIAA 5CEFA 2DZDA 2NP6A 1Q12A 2IHNA 3RVSA 4B6SA 2B8TA 4B34A 3T3IA 4D9CA 4AY2A 5CM2Z 3CF0A 1XNRB 2RI1A 1FP7A 3I61A 5FJIA 4PCAA 4D42A 5U9CA 1LW7A 2R1VB 4O8CA 5DJ5A 1NDQA 1NVBA 5CH3A 4WT7A 1ZUWA 1JKJA 2I6SA 3DMPA 1DC5A 5FPYA 1XJCA 1U3DA 1YK0A 2D00A 3LA8A 1I7LA 2IX9A 1M1YB 2GCOA 1WHSA 1RXIA 2PLNA 2WB4A 3DAFA 1ONPA 4UTXA 4B6GA 3VH4A 4WASA 3RUFA 2BGGA 1FTWA 2O2SA 5LDHA 4MR9A 1K7CA 4GGPA 1WUTA 1AGYA 4E5NA 2H2AA 1YNOA 3QPVA 3RS7A 3FHCB 3NQ41 1SOUA 4W1RA 1LV7A 3E2MA 4K81B 1O0BA 2O2GA 3V1NA 4HP8A 1EFPB 1EQUA 2ZI7A 4MYUA 2H3HA 2C9OA 4JU9A 2YINC 2JGJA 5JPCA 3ZZ0A 1P7VA 2PA3A 4ES6A 1KH3A 3FCAA 1DX9A 1V4VA 3LBAA 2EHJA 3NDJA 3PZBA 3R6GA 2N47A 4TVBA 5JWHA 3RIYA 1U9IA 3HFSA 4DRZA 5AVSA 2J9FA 4D3XA 3OCCA 3AOEC 3OQJA 3G02A 4EVRA 5JVDF 2CDCA 1AVTA 1SPXA 3QXGA 2XX3A 5PGMA 3VYUB 5F9FA 1PK8A 5JZSA 5HTKA 1YCFA 1PWYE 1QIEA 3B1KA 9ATCA 1IRIA 1HOXA 2D6FA 3OEHA 1DKOA 1T10A 4HWRA 1CUFA 4KIJA 4S1OA 5EZYF 1H2YA 4YI3A 3HMKA 2ZDQA 3BWCA 3CSUA 3IP1A 4HDNB 4I8IA 4DCSA 1SXIA 2G1JA 7REQA 1N5KA 5DM4A 5F7JA 4ZDJA 3T94A 3NETA 1U8ZA 2DKFA 2O3RA 2C97A 3N7AA 2WUEA 4RZXA 1SC1A 3WGQA 1WSDA 3JRXA 5FA6A 2V5VA 3MBOA 1Q77A 2M1ZA 5TDHA 5F4BA 1M8PA 1G7SA 4A2CA 2NO1A 1QJCA 4N9QA 2W2TA 2WSSD 3FE2A 4FYYA 5IS2A 1M1YA 1FBTA 1XTBA 2O1EA 3D6HA 1VGQA 2ZIUB 5ITVA 3HCCA 4KQ9A 4Q47A 4WV3A 4B83A 4Z7QB 2QTFA 4E4YA 4FKBA 3WZ2A 3VPHA 2E4VA 4LVUA 2OHOA 1YU6A 2ZYVX 4LHWA 3JARB 3NUQA 4LISA 1ENZA 5EHIA 2WHYA 4WOJA 3ETDA 4PPFA 3SJAA 1EPUA 1QONA 2IPOA 1SU8A 2MSWA 4Z9AA 3AEUA 2VBGA 3DW1X 3LPCA 1B8NA 1HURA 1PBTA 4FW8A 5DLEA 4DXAA 1ZIOA 1NKTA 2YXBA 1DDGA 2J5RA 3D54D 3FZEA 3KJHA 4XH9B 1YU9A 3UTDA 3QHAA 1E7SA 1XVIA 4FU0A 3MHTA 3E3MA 3FDXA 1PS0A 3K9LA 4RIHA 5CX1A 3T0FA 1MR3F 3BRWA 4E0BA 4IF6A 5EP2A 4PS1A 1NOKA 4X62B 2QG9A 1OI4A 1V8BA 4L2IB 3C24A 4B3HA 1L4GA 4DPKA 2CLLB 5KPJA 5BW5A 2Y0EA 3K1ZA 5EUMA 2DCUA 3AMVA 1GPUA 2GD6A 6AT1A 4C2UA 1EMDA 1N7HA 2IPMA 2Z1MA 3G82C 1QORA 4C4XA 2I4LA 2L0XA 4N47A 4ZO6A 1UXJA 1J4AA 4OQXA 4QREA 1V5WA 1UJMA 4Y0NA 3LZ6A 1GPYA 2FZGA 1O5TA 2VDQB 1I6LA 4Y67A 1X7YB 3VYVA 2I6TA 4YCSA 4CJXA 1NW5A 1IOLA 5JROA 2QX4A 3EXAA 2AOVA 4L07A 1KNXA 1Q0PA 5LDGA 1DP4A 1TUIA 4PPGA 4B3BA 1JP7A 3RSHA 4J9UE 1Z4JA 3KUKA 3OJLA 4M0KA 4QUIA 4R9UC 4XR4A 4U6NA 5CK5A 1P1RA 5HQJA 1YR6A 4OM8A 4A5OA 4AT1A 1L4EA 2JBWA 4M9RA 3FWZA 1TL7C 4U2EA 1T5OA 5FV7A 2X23A 3THOA 3URMA 3TECE 1W34A 1O0CA 2VYQA 2QUAA 2V59A 2EDAA 1ZM4A 1RJFA 3A14A 3K9CA 2WPDA 5JS7A 3LWBA 3FTDA 1MV5A 3SS8A 4E46A 3DH0A 5CP8A 1SR8A 2FUG1 4NE9A 2WIBA 2DJIA 3HACA 3E61A 3THXB 4IHJB 5C0OE 5DM60 1VSTA 4HZUB 1B7GO 5JNRA 3C8UA 4D3YA 4FYMA 1G5HA 4HFRA 2C2HA 3DFIA 2NVUB 1YJBA 3U6KA 4KMRA 1P1FA 4RHTA 4UASA 2QK4A 5HMLA 2Y1GA 3JQQA 1XF9A 3NUGA 3ZWAA 4BDTA 3GBSA 1SVOA 3L0PA 1M2JA 4Y9UA 5IARA 3OIGA 4P3NA 4OP1A 2NUPA 1QZ3A 4RXUA 5E0KB 2QTVA 1NONA 2LDXA 2AOUA 3OIWA 4M1ZA 1P77A 3KL4A 1NA5A 5I3CA 3Q8MA 1V11B 2PUHA 2J32A 2HV8A 2BFWA 2OKGA 3MCVA 2YUTA 4EP1A 1KSFX 1BHSA 4DV0B 1TQ2A 1O94A 4MYDA 5AKZA 1FE8A 3LAWA 3QFCA 4G0XA 2P9EA 4P9NA 1E2PA 4KGDA 1NN1A 4PAOA 1FB5A 4LTNA 2O3SA 1IC6A 2YR0A 3STWA 3AB7A 1QO9A 4II3A 4ILEA 4DLVA 4B1FA 3RU3A 5A1TA 5CA1F 5J4LA 3L7MA 4AZ0B 3CX3A 4BMZA 1AGNA 3C8DA 3PR1A 4P5DA 5BRAA 5KSYA 1W1WA 1M2WA 1GNRA 2HB6A 3ROXA 1KJZA 1LQ2A 2EWVA 4WBNA 1EB9A 4L5BA 4EF4A 1T6XA 1MJGM 1TEHA 4GVXA 1V45E 3QPAA 5J4KA 2IPLA 3LUAA 2GKSA 4H35A 2PQ2A 4J29A 3HA2A 3AJAA 3PX3A 4HUJA 4XIJA 1EDDA 4A0SA 1QAMA 4B5KA 1ORWA 1P80A 5F76A 2IU0A 1VG9B 4KAFA 4XVRA 4IDBA 2OXRA 5EQTA 1O87A 4DT1B 5KKAA 1C9YA 3CNEA 2PT5A 1NATA 1PVVA 2QROA 4I9FA 4LXQA 4FFBB 3ZDQA 4DV7B 2AZ4A 2PAFA 3HSSA 1ZS9A 2V7TA 1RYDA 1XHLA 4AYXA 4CBVA 3TRDA 3GEDA 1IN8A 3GP8A 4B3GA 3AP1A 1HV8A 3B7PA 4UOEA 1BGVA 3W9BA 3P97A 1NSTA 1XVUA 2D7CA 2QF7A 3GEPA 1WDLA 5E7QA 2VAWA 2ZR8A 3RTAA 4MYSA 1ZIDA 1J99A 1OROA 1K5GA 1OXVA 2VYVD 4RQAA 4F2HA 4HDSB 5TC4A 4BRWA 2GKOA 4I14A 4R1LA 4XWOA 2I3DA 3FTQA 4EO4A 3IULA 5D7NA 4OFXA 1PJ2A 1VPLA 1PLKA 1COZA 1OH6A 4ZYWA 1WB5A 1TC2A 3AOEA 3CONA 4I3HA 1WW8A 2V98A 1G4AE 3G0GA 4PVDA 5FUMA 1A77A 3IPXA 1MB0A 4W9NC 3HR8A 2XY4A 5HBRA 1ZVQA 4MKZA 5CEJA 2I62A 1YRQA 4PGMA 5FYDA 1R66A 4IOLA 5K0ZA 2R6AA 1K0FA 2WINI 2NVWA 1YFJA 3AQIA 1QDLB 1E1QA 1RAIA 1E6WA 5FDFA 1WF6A 4HQLA 2EIHA 1N5JA 1TECE 5LU9A 3NKVA 2ID4A 4ER7A 3HCDA 2HWWA 1XYGA 1OFTA 1R1DA 1UKAA 1ZHHA 2GLXA 2ISCA 3C6BA 3D7LA 5BN4B 2F43B 1SJ9A 2GPYA 3CN7A 4JR0A 5JEEA 2V0CA 2X0KA 2XYGA 1IY1A 3EEFA 4UAVA 2WP8J 3NRJA 1FNDA 2ZCUA 4DIFA 2A2ZA 4EJMA 4IG4A 3HLYA 5ALFA 1EXMA 1FVXA 1L6RA 1T9ZA 2HIHA 2O8FA 1GPKA 1CQJB 3LUPA 4PSCA 3VDMA 3IP3A 4P3YA 1EWVA 3BD8A 4JUAA 4KQ2A 1YGYA 1X1AA 2W9XA 3AWDA 3CF4A 3LOPA 4OMDA 3P2YA 2JCSA 1QGUA 4PYIA 3WNDA 1TIBA 2CVHA 1TW3A 2JW5A 4FKZA 1RHRA 5MFZA 3Q7PA 3R7LA 1JT9A 1UJBA 1YRWA 4FSDA 1K88A 2Y4OA 2QUHA 5HKKA 2AG6A 3GARA 5JIBA 2R66A 3D4NA 4JBIA 1UMCB 5DCLA 1NAIA 2G1UA 4KVZA 4HWKA 2YZ2A 3PFFA 3M4XA 2G76A 1OBHA 4FBLA 4OOEA 1QZTA 1EVKA 2JZNA 4QUAA 4YBRA 4YRQA 4N5DA 2LCQA 1QLHA 1XCLA 2WQZA 3BM5A 4PINA 1DELA 3AEYA 2B0CA 1ORTA 1MORA 2WKWA 2VCEA 4PSDA 3RKRA 3TKAA 4BGIA 4WCVA 4E5SA 2Z8YM 3Q8WA 5FB3A 1Y1PA 1Y8QB 2NW6A 3FW1A 4NPCA 721PA 2DQ4A 3AVXA 4L50A 2FSIA 1C5KA 2YW2A 1NY6A 1F6WA 2EZ9A 2ENWA 2OP1A 3G5TA 1PWEA 4Q37A 4DILA 4U7DA 2WMOB 2BOVA 2G72A 4DMGA 1VIMA 4M0MA 3MILA 4WKNA 2RH5A 1HQCA 2R00C 4W5OA 5ALLA 2JHGA 2F43A 1M0WA 3QENA 1ISHA 2G77B 3PFWO 1PR6A 3DF9A 1U7UA 4QODA 3OEWA 5KMGB 3S40A 1YJAA 4ZT4A 3CTMA 4EHIA 1YZKA 2PGIA 1U0JA 3AW9A 4YUZA 2PGLA 3PPYA 3A6EA 3NDPA 5HFJA 1AKYA 2V9CA 1SG9A 1Y4DE 2AEMA 2FQYA 2J4CA 3FWYA 2SHKA 4TTJA 3VM6A 5THQA 1JL3A 4YUWA 2D5CA 1T1IA 2PVSA 4BNFA 4G5SA 3M3DA 2QTTA 3KO8A 5JNUA 3B7WA 1Q7TA 4AIIA 3UMRA 3M34A 5I7WA 2XCOA 5AXDA 2G7MC 5K1ZA 5K3EA 1KH2A 5KNDA 2HCTA 3BE6A 3NIFB 3QUTA 1EHYA 2RD2A 1VPWA 2OMEA 1FFBA 1EFVA 3K0CA 1Z47A 3NNSA 4IFIA 4L16A 1CS0B 1WF3A 5CTAA 5BQPA 5DNWA 3IB6A 1U02A 2ZYUX 1W5BA 1YA8A 4EYGA 5EGSA 4AUEA 2P62A 3VR6H 3LHDA 5JC8A 1V95A 3A9WA 3EGVA 1CIVA 1EQAA 3LNCA 1LEHA 1NVWQ 1QDUA 2R9VA 4JBWA 1C8BA 1CUDA 3ER9A 1PJTA 2LPMA 2XB9A 4CIDA 1I4EB 5E1MA 4R2WA 4GQIA 2DKOA 3M6VA 3FTCA 4LI0A 1TKRA 3DMFA 3IX7A 2QN7A 1WUYA 5TEWA 3TE6A 2YRXA 4E5MA 4G8JA 1K5PA 2FWIA 2DWQA 1X39A 1AE1A 4WVLA 2WWYA 5K3OA 3N39C 3X43A 2FDXA 1Z6AA 3TD6A 4RM2A 1DQNA 1EH5A 5E4YA 4YDSA 2N42A 3PUKA 4C0WA 1SXGA 4JAVC 4NJEB 3E9MA 3RYCA 3U2QA 3K9FC 3E9DA 3AEXA 4BQNA 5K0SA 1X8JA 2ZFUA 1UBMS 4BJ3A 3G9ZA 2JVJA 1ADJA 3EG9A 1Y5MA 4HX5A 4RYLA 1AZSC 1ST2A 3WXBA 3DOEA 1ETUA 2OAQ1 4DUYB 3TPZA 5CAEA 3OZSA 3LCCA 2ZYAA 5KX5B 2CT8A 4BFZA 1GGJA 4YYZA 3FNQA 1AK1A 3TTWA 2BGMA 3OZBA 4M8NE 4TYPA 4RIFA 1KEPA 4D8TA 3WDSA 3SXJA 4ZT5A 3SFVA 3CKKA 3Q3GE 5CNJA 5DSTA 3BN3A 4LZNA 4WMLA 3I01M 1TFUA 1J8MF 2ZUVA 3FMOB 4YCLA 1APBA 2AQKA 1SB9A 5BSUA 4PBTA 3N2IA 4E2XA 1JDPA 4IJVA 3ROFA 1BS1A 4MDYA 1OWOA 1MIOA 4ZVKA 3DQQA 5DNEA 1M7HA 4DLPA 1HT3A 1MO3A 1CW2B 2I2AA 2JEOA 3QKTA 4JVMA 4XWGA 1E4YA 1PL6A 4HVAA 1JKXA 1JEEA 2DR0A 4U7PB 1FOEB 2NSYA 3IAAA 2GCGA 4OKIA 2J31A 3L6EA 4ARZB 1ZU4A 1JG2A 2J0VA 2XLCA 3O9MA 3WGKA 4OSPA 3V4FA 1XPUA 5CU7A 2X4LA 1UIRA 1C50A 5FORA 4Y2XA 4MQUA 2ZUWA 4IVPA 4BLVA 3C14C 3GRYA 5JZBA 2I54A 3KAKA 4GIBA 4MCAA 1AUPA 10MHA 2V8OA 3SLRA 2FEPA 3KHUA 1YHZA 2FOLA 1CJTC 2C7RA 4D4LA 1I3KA 5LFAA 3RRJA 3JALB 1NFRA 3B52X 1LRJA 1PQUA 1U3CA 1OXKB 1A04A 3NHSA 1OVGA 4WLEA 4XE5A 5G53C 3GCGA 1PSWA 3BB4A 1GFIA 1LWOA 2N0SA 3PX7A 3LZDA 2RH9B 2ES4A 2RAVA 4JI4B 3PGXA 1GSAA 2FZWA 2QN8A 3KVOA 1UKCA 2P3SA 2MMCA 2BI7A 2W2KB 2WVJA 2OV1A 4OGGA 4YJGA 3R7FA 4ALLA 5JYDA 1P45A 4CMIA 3F6PA 5F7OA 1WAMA 1B8OA 1LB1B 4TRRA 1G8AA 1Y1RA 2VJYA 2Z1NA 3A9TA 3ZCQA 1SD1A 4YCM<