4M1TA

Crystal structure of small molecule vinylsulfonamide 14 covalently bound to k-ras g12c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
163
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords K-Ras GTPase
total genus 63
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1tA00
4RZ3A 4WA7A 4RCZA 4A9AA 4WZBE 1VDZA 2BOVA 2N1BA 3T61A 5J5CA 4CEHB 1JQJC 3NH6A 4DDUA 2ZSEA 1OIXA 5JSZA 2D7DA 3ASZA 2JJ1D 3O8BA 2BJWA 1BO6A 1E1RA 3LRPA 4FIDA 5CIQA 3L82B 1YZQA 1T3HA 1G3MA 4V0MA 3B8HA 3B1ZA 2JGNA 4AIIA 1L4YA 3VKWA 2VYFA 1R0XA 4TN1A 3THXB 5JJLA 3GQBA 1W2GA 1QF9A 2G1JA 1DAFA 4KXFB 4P32A 5FL7A 3T1VA 2YC4C 1Z47A 2QTVB 4AD8A 1GDDA 5GJVC 3ZS9A 2NZ8A 4DVGA 3PR1A 4M1YA 4M9SA 4HLUC 2C96A 1ETUA 4EAQA 2B8WA 5KDLA 3BRWD 3GLGB 3Q5DA 1W49A 2Y8EA 1JEDA 2YOFA 4ABYA 4NCJA 4QM7A 4D26A 4PSAA 2D06A 1G9XA 5AR1A 3CM0A 2Q9AA 1M6NA 1P72A 3THYB 4A4DA 1A2KC 4LHYA 1F2UB 2ZI7A 2HLDA 1T8TA 4NCIA 1K5DA 4IJMA 4LV6A 5C4GB 1Z0JA 3RS0A 1E2EA 4ZDJA 2QENA 1QHGA 4AKHA 4YONB 4BLOA 4ESVA 1A7JA 4JJKA 3BK7A 1Z29A 2EU8A 4LV5B 2YV5A 1NJFA 2JJ2A 3RSLA 2HF9A 1Z22A 2CCKA 2GK7A 1WBDA 2WIAA 3T06B 1N6RA 5L3QB 1W44A 4XVRA 1G7SA 1VG0B 4BWYA 3D31A 1E4VA 4A1FA 4Q4HB 2G6BA 1N6KA 2ZITA 3TW4A 4EFLA 4LHXA 5K8LA 3LW7A 2YYZA 4LC0A 5FPSA 1MR3F 5IDVA 3IUYA 4V0KA 2D74A 4AG5A 4DRZA 2HF8A 1UEJA 4ITRC 4L9SA 2C9CA 4TQ9A 2XZLA 5EZ5A 1KZGB 5ELXA 1VMAA 2R6GA 4QC2A 4Q18A 4KBGA 5BN5A 2ZU6A 3AP3A 4DT1B 3GP8A 4KFTA 5LD2B 1XPRA 2WPDA 1FNNA 4BGDA 1I2MA 1TU3A 3MGCA 3RDPA 1XD8A 1HQYE 2IK8A 1NF3A 4M1MA 2XGJA 1G4UR 2FA9A 2ZREA 4B2PA 3LV8A 1U0HC 2WZQA 4F38A 4QM6A 1S4QA 1TF5A 2RGDA 4URUR 2GKSA 3QI2A 4MUAA 5GJWC 3U7HB 3DO6A 4CW7A 2RHDA 2BKUA 3GLFB 1N5IA 4OBEA 2J59A 4C4PA 4YDSA 4IXNA 4EPYA 4KLZA 1UJ2A 1JALA 2ZXUA 4LWZA 2FFQA 2FFHA 4OQFA 2FNAA 2QTHA 3DEFA 1GRNA 2BVNA 4ZPXA 4X8MA 3K0CC 2YVUA 3X1WA 4RD1A 3T35A 3AH8A 2AXNA 4S2EA 2Q21A 5KPDA 1IY2A 1QG4A 5FTJA 2BMJA 3SC3A 3B1YA 4HUQB 1LNZA 5K8TA 5EE9A 1P73A 3JVUA 3TVDA 1E2KA 5KHOC 4X8LA 2R6AA 3CW2A 2JJ1A 3K0SA 1N5JA 4BEBA 2RGEA 4NKRA 4O3MA 2XSZD 3GEEA 5E7MA 3C15C 2HXSA 3OIUA 1E9AA 1IBRA 1M7GA 2IL1A 1N25A 4OQNA 1F2UA 1Z6YA 1RFLA 5EP3A 3ND9A 5B30A 3K9GA 3N5CA 2FSGA 2PEZA 4B32A 2QU8A 3QXHA 4OHXA 4C2UA 2YWGA 1N6IA 1RIFA 5DE3A 4XOIA 4U7DA 2H8KA 2CVFA 3EPHA 4PPGA 3NBYC 2OHFA 3A4MA 3K8YA 4WZ6A 2EFEB 2IUUA 4M9QA 2RGBA 4LI0A 1E2FA 4TLAA 4EQ6A 1HT1E 2IXEA 3D3QA 5FOVA 1K6MA 3CPJB 3D6TB 2XTMA 1CJKC 2Q0HA 2C04A 4B3DA 4H1VA 3CRQA 5AJZA 3VAAA 2F3RA 2C95A 2ZR7A 2P6NA 1TADA 2NOAA 3V00A 4HAZA 4JZKA 4PANA 4Q1CA 1P3JA 4TMWA 4Q19A 1YVDA 1UM8A 3AUYA 3PV0A 4QBFA 2ZROA 3TSOA 4MDEA 1X1RA 1OYYA 1EFUA 3OE7D 3X1DA 5KTYA 4BLQA 1E1QA 1E9SA 1EFCA 1NN0A 1NI3A 3BJIC 4DEYA 3HPQA 2ZJOA 4PAOA 1KK0A 1Q1ZA 1UDWA 2O8FB 1FQKA 2E9SA 2FEOA 2QROA 3KFXA 1SHKA 4I4LA 3HJNA 1JPJA 4NYIR 5JMTA 4Q66C 3LBNA 2X2FA 4TQAA 4C0LA 4PSVA 3V4FA 4E03A 3IDQA 1RYHA 2CE2X 1R6BX 3C7KA 3NC1C 4Q01A 3MAAC 4DLXA 4Z1MA 2PZEA 1H8HA 2HEIA 2OLJA 2PJRA 1ZVQA 5J4YA 4TYNA 2J7KA 2ODBA 1DAIA 4HLCA 4EFNA 5EE5B 3D7MA 4LYJA 1RRFA 3CONA 1RYFA 2VHQA 1JR3D 1XD2B 4JVMA 1H8HD 1Q21A 4ZV4A 4BLTA 3DVLA 2JAQA 2CCJA 1WQ1R 2NTYC 3CLVA 3O47A 3B9PA 4Q48A 5LBIA 2JLYA 1KDOA 4PPNA 1Z0KA 3REGA 4DCUA 2XX3A 2ODEA 1G8GA 1XMVA 1JJ7A 3AEZA 1T9HA 3DZDA 3JVVA 2IWHA 2EYQA 3AVXA 4L5BA 1ELOA 1BYUA 2P5SA 4EQ6B 4HYYA 4HDOB 2G77B 4CDGA 4QL3A 4OHYA 1KKLA 1E3MA 5KU1A 1KI9A 3FB4A 2W2VA 4LJ8A 4ZKDA 1FZQA 1OPXA 5EQTA 1LY1A 2JLWA 1A5TA 4JSYA 1LS6A 2D2FA 3ZVNA 3EC2A 3Q7QA 1SKYB 5AWFC 4PTLA 5AUNB 1NVVR 4UKDA 3U7EB 4IW3B 3RS4A 2WSMA 1XZPA 1CLUA 4GRAA 3PEVA 4Z54A 4V03A 1LF0A 3R9WA 4HB0A 2JASA 3SHFA 2YINC 3BC1A 4RVCA 2J9RA 1TU4A 3NEJA 4ZDWA 1W1WA 4H1UA 4I1OA 4XD7A 4QGGA 5DO9A 1KAOA 5CM9C 3CKLA 4A0GA 1XTRA 4CEJB 1GSIA 3CZPA 3KJIA 2AFHE 3HPRA 4MRRA 2O8CA 2ZJYA 3GJ5A 4PHFA 1R8QA 3P4YA 2WMNB 2OFOA 2B8TA 1N6NA 2CLSA 3RNLA 2RCNA 2C78A 3DM9B 4B44A 3VKHA 4LK2A 4QGFA 2QTFA 3A1WA 4B3BA 4D6PA 3TH5A 1AQYA 4ILEA 1J90A 4BRWA 2KWIA 5KDDA 2A78A 2XOKD 4B2LA 1DPFA 3P1JA 3WHLA 3MFYA 2VEDA 1P2TA 4IDOA 4LJ5A 4ZI2A 3KKOA 3L8YA 2QA5A 5FBWB 3UXMA 4YMWA 1QDEA 2V9PA 3QJYA 4NH0A 2QM8A 3EC1A 3UWKA 5JFGA 5B64A 2RGNC 2WPDD 1T6NA 2ZS9A 2CLCX 4JLMA 3W5IA 5BN3A 4PC7A 3FPAA 1QVAA 2R65A 2BDTA 5FBQB 2Q3HA 3OAAA 4OI2A 4IEIA 3MCAA 2C03A 5FTMA 1ZBDA 3H1TA 2BMFA 3R9IA 4ZIRB 3I73A 4M2LA 4MITA 1XD2A 5AK0A 2ODNA 3SEAA 1DADA 1WP9A 2ZYVX 2ATXA 4A2PA 1OHHD 2ZE6A 3OIWA 3IQXA 2WHXA 2QBYB 3G82C 1GL9B 4ERNA 3ZDQA 3H86A 4R2HA 3REFA 3LY5A 4JLDA 4NYMR 5TVKA 1XCMA 5JRJA 3VR3A 2WV9A 2ONJA 1P9WA 1JBKA 4N3NA 4ZCLA 4BQSA 3EG5A 3MUFA 3CBQA 4IRUB 1E2PA 2SHKA 4CEJA 1Z83A 3WYGA 3DL0A 1D2NA 1Q1BA 3PFIA 4RD0A 2V1XA 1GKUB 3IGFA 2XNSA 1OFTA 2CMKA 1U81A 5JI3E 2ZYTX 4V0ME 2J87A 4JBYA 4XTCS 2J3EA 4Z51A 3O8RA 2BBOA 2O0HA 3B5JA 2OBMA 4RFVA 4BPBA 1XXHE 4PO1A 1US8B 1AS3A 3X2SA 3OESA 2DPXA 5H8WA 4HUTA 3U4QB 1S2MA 2UKDA 1XRJA 5AJXA 3RS5A 4B71A 4G1UC 4DIEA 1ZU5A 3T5DA 3PENA 4QGAA 2J7PD 2REXB 2ZRMA 2ZVQX 4KSCA 4OI4A 2WWHA 4TMTA 1ZRHA 4B48A 1KHTA 2G0NA 2FU5C 1A82A 1NBME 4LBYA 2GESA 3ZIAD 1JXOA 2AXPA 1LW7A 2RHMA 1T91A 4UNRA 2F43B 1MV5A 3R7WA 1W4CA 1MRNA 3BBPA 1VCMA 2ZI6A 1L2TA 2CHGA 1VIYA 3Q5EA 1FPMA 4RSGA 3BOSA 1FP6A 1U8ZA 2ODWA 3V4RA 1P2VA 1JQLB 4YMUA 3VNVA 3NTUA 2YKGA 1XU4A 3GJ0A 3WNBA 3F8TA 4K46A 4P31A 3WY9A 1NKTA 2PMKA 1T3LA 4BFSA 2YWEA 5DIFA 3G0HA 1G8HA 2MSDB 3KQKA 4UJ3A 1XJCA 1FNMA 1SZPA 3W3ZB 1J7KA 3Q9LA 4FD2A 3NBXX 3CNNA 1NVWQ 4NCNA 4D82A 2F6RA 3WRYC 2DFNA 3OAAD 1IN4A 4IFBA 3PEYA 2F1RA 2IYYA 4LBZA 1KJWA 2R6DA 1RJ9A 2X77A 1KI8A 3ZD6A 5HPYB 3TGPA 1XEXA 4AURA 4FCVA 1XB2A 4NYIQ 4A8JA 1UKVY 1Q3HA 3F3YA 3MWLA 1FX0B 4B74A 1P2UA 3U3MA 1AA9A 1L7VC 2WSSA 1BS1A 5HCIA 4BFWA 1TTTA 3K0FB 4Q4JB 2BIFA 1CF4A 1ZM9A 3QEJA 3F0TA 4OL0A 1OLOA 3AF2A 2B6HA 4Q1AA 5D3MA 1S0UA 5E7IA 3KJEA 4G5QA 1OKKD 4OHWA 3EARA 1KO5A 5BQ5A 4C0AC 2H57A 4DCTA 1CRPA 1G8FA 3B2EA 5FUXA 1YR9A 5E95A 4A2WA 4YXWD 1SVIA 5FOSA 4JBXA 3FFAA 4MYUA 1DBSA 1NLFA 2OXRA 2CCGA 3UG6A 5LPNA 4QRHA 4A6XA 4A6PA 2DWQA 3TAHA 2XJ4A 4L16A 4TLBA 4WXRA 2C99A 2VO1A 5CJPA 2PBRA 1C9KA 1AJEA 1QHHA 5AJYA 3FMPB 1NG9A 4KO8A 1JI0A 3SS8A 1W48A 4Q9KA 1YZGA 4Z8XA 3M6AA 5AJWA 4M1SA 5G3YA 3TUZC 2XAUA 2QAGC 1HA3A 3FWYA 4JMPA 4A8JC 4KFSA 4GT1A 2QMOA 2YZ2A 4TTRA 1EWRA 1NVVQ 4FI3C 4MKFA 3QKTA 3EX7C 1M8PA 2I1QA 4JLJA 4M53A 4WBSA 5J4HA 4WOPA 2XEXA 1U8YA 3L43A 4LZZA 4Q9LA 1N0WA 1FQJA 3FKSA 2P0EA 1XEWY 2WICA 2P5TB 4F4JA 1ZW6A 5DN6A 1J8YF 3GJXC 1AS0A 3AF1A 5HZKA 4C7OA 4KITB 1ANKA 1UBFA 3W6NA 3DMDA 3BORA 1AK2A 1BIFA 1EFRD 1T5IA 1SHZA 3CNOA 5FOXA 1IXSB 1T0JB 1N0UA 1NNEA 3ZLJA 1Z6TA 4LHVA 4IOLA 4PXAA 1IJEA 1EFTA 3K0FA 4Q4JA 4RZXA 2ZSAA 1NIPA 3TKLA 1G1MA 2NPIA 1PLKA 4DSUA 4FMBB 1CULC 5HE9A 4B3CA 1NVXQ 5CYOA 4V0OA 3LQQA 3T1OA 4HB3A 2JLXA 1YR7A 4JT2A 1YHNA 3KUDA 1W2HA 3FOZA 1D8TA 3CUEF 4XJXA 3TMKA 1RRCA 2VHCA 1DG1G 2VL7A 2QAGA 4OK3A 1TUIA 2Z83A 1JR3E 1AQUA 3QPUA 3I3SR 2ZANA 4EPRA 3K70B 3THWA 5BXQC 2IS2A 4DLVA 3SBDA 2FWRA 4AC9A 4K8OA 1QHHB 2P67A 1GZSA 4KU4A 1IN5A 4EPVA 2O8EB 1W7AA 2O5VA 3PJRA 4F91B 1NBMA 1PJRA 2GZDA 3LVQE 3VHLB 1Q3TA 4C0KA 2EWWA 2AK3A 3FHTA 2AX4A 1GITA 3K09A 3QVVA 4DJTA 1C1YA 2H18A 2GJAA 1Z2CA 3C4JA 3AM1A 4WXPA 2IWRA 3NHBA 4UJ5A 3VFDA 4F93B 2GJ9A 4OK6A 2J0QA 2ZE8A 3EWSA 2OAQ1 4H9GA 5CJ2A 4US2R 3GLHA 4HLQB 1TAGA 2BHRA 3KJHA 4NYMQ 1KSJA 5GJCA 3LBIA 3UMSA 5JHGB 2CEAA 5FPHA 1OW3B 1NN1A 3BFKA 1WCV1 1NG1A 2CNWD 1R5NA 2QMUA 3KB1A 3LWNA 4WW0A 1KSGA 1ZCBA 1RC8A 2GCPA 4K81B 4LX0A 1DS6A 1IONA 1OIVA 5JJKA 5HKKD 3OEED 5J4VA 1FTSA 2MMCA 2KBEA 2QGNA 3GFPA 3SDZA 2IYSA 4EUNA 2IBMA 2QT1A 4XSGA 2OZEA 2WWGA 3SYNA 1IN6A 1F2TA 3T1QA 3ADCA 3QXCA 2MSCB 1QHSA 2O0KA 1T4GA 1YZNA 2W83A 3ECCA 4B6FA 1MOZA 1N5KA 1L4UA 1GWNA 3PITA 1II0A 5JWRA 1M7BA 3PQCA 421PA 1KO4A 4XD7D 1KGDA 4D4JA 3BD9A 4KVAA 2XB2A 4JKIA 4AWXA 1LV7A 1YE8A 4BUJA 3THWB 4AG6A 2Z4RA 3CX6A 4AKEA 1US8A 1G41A 3NBZC 1EK0A 1ZU4A 2J1LA 4ESHA 4LYFA 2CDNA 4UNQA 1G21E 1S1CA 1QHXA 1IY1A 3TRFA 4PHTA 4YMSA 3I92A 3U7GA 5TARA 5DH9A 4TT3A 4LJ9A 2FE4A 3WRXC 2IW3A 3IQWA 3AKCA 2AN9A 2O8DB 4FINA 1G8PA 1JPNA 2R44A 3PEWA 1KNQA 3SYLA 3RHFA 1G16A 2C9YA 1FUUA 2ZVPX 4NZYA 2P3SA 1FFHA 1Z6AA 4O2LA 3CX7A 3M1IA 1JJVA 2YJTD 5E3HA 4Q1BA 1QBKC 2ONKA 1E2MA 2ZRFA 3UMRA 4YC7A 3BIFA 1T8UA 1U99A 4LJ6A 2ZS8A 3ADKA 2D2EA 1MT0A 8OHMA 5JWOA 3W8RA 1AM4D 1X8JA 1E2HA 4P33A 3I61A 5FTNA 2CJWB 3TAUA 3VU9A 4DDTA 1T3SA 1LB1B 1OV4A 1XMJA 2V8OA 4S35A 3U6BA 3ETLA 2FN4A 2EVWX 1UAAA 2FEMA 3KX2A 3WMEA 3HU1A 3B7GA 3L0PA 3NWJA 3I8XA 4QG7A 1ZD8A 4LPKA 3PVSA 2OXCA 1HTWA 2FFBA 2GXSA 3BE4A 1Q1EA 2GF0A 3SBEA 4US0R 5FTLA 1Y3AA 1NP6A 4O25A 4EPTA 2VP0A 1W4RA 3C14C 4V0LA 3KJGA 1W4BA 2LKCA 1KKMA 5L3SA 3GD7A 1GTVA 2NG1A 2QSZA 4M1TA 1ZAKA 4Q1FA 4MKIA 2GEUA 1XFAA 1II8B 3AVOA 2IYVA 5EXPA 3TBKA 1MO5A 4KI0A 1DAGA 2VA8A 2FPKA 4NYJQ 4I1UA 1OIWA 3QXSA 1E1RD 4CEIB 4L4UA 5P21A 3TR5A 2H5EA 1TMKA 3QG5A 2PZFA 3DHWC 2G0TA 1W0JA 3FKQA 2WJVA 3ADDA 5BN4A 3X1ZA 3IILA 1ZP6A 1E2IA 2BBWA 3QBVA 4FCTA 1IOZA 2ZRPA 4DLTA 2RGCA 2F9MA 4G5RA 4EPXA 4HZUB 1UKYA 2BMDA 2W2TA 3CRRA 2A7QA 4QBHA 3AVQA 1KJZA 1JEEA 4WVFA 5CK5A 1HE1C 2ZRAA 1CBUA 3NH9A 5F9FA 4OI0A 1R10A 1XX6A 1IHUA 2BEKA 4Q00A 5FTKA 2J41A 2UVQA 4PAQA 3MWKA 3WHKA 4URXR 3UK6A 3ADBA 4C2TA 3AVVA 2CJWA 2ZI3A 4CT4B 4F92B 2WKRA 1G5RA 5J4LA 2A2ZA 3MLEA 1UPTA 2WWFA 1EXMA 2FMXA 1R0YA 2LWIA 521PA 4EJSC 2BCGY 3K0CA 3W9YA 5C18A 1RZ3A 1XCGB 4N1AA 1XZQA 3EZ9A 2F7SA 3WNDA 3MSXA 1OT3A 2TMKA 4GP6A 3SJZA 2J0UB 3CPEA 3ND8A 3SJBA 2O52A 4BFYA 4Q9IA 2Z4SA 1HH4A 1IY0A 2OUKA 4XWKA 2V7QA 1QHNA 1ZNXA 4TYYA 2FPLA 3A1SA 2W00A 2VP9A 3KQNA 4GBMA 2OEPA 4PQFA 2PJZA 3AKDA 3K0EA 3QKSA 3GLGA 3ZH9B 1OXUA 1ZM7A 4ZKEA 1OH6A 4PHHA 4V02A 1YRAA 3FMFA 4DSNA 4Q21A 5JZVA 3LLUA 4AK9A 4RFSA 3KZ1E 3S1AA 1E69A 1Z28A 4JBWA 2ZETA 4AYXA 3THXA 3U7FB 4J0QA 1D5CA 2OBNA 1XNJA 5KO2A 821PA 1II8A 1BMFA 1Z0AA 3UIEA 4W9MC 1A4RA 1CJUC 2O8FA 3DOFA 4IDQA 5KSYA 5B2ZA 2BCJQ 3M4YA 4PSKA 1AIPA 1H8ED 2G9NA 3A4NA 1ZINA 4DDWA 2RGXA 3TW8B 1YZLA 1SVOA 1E79A 1CJVC 4QGHA 1KDPA 2GHIA 3HU2A 5G3ZA 1W0KA 3T5GA 1YR6A 1D9ZA 5KNDA 2FJUA 3I72A 3U3KA 1VYUA 2R8RA 4OHZA 5CLQA 1W5TA 3IIMA 1UKEA 1E98A 3H2YA 4PZYA 5LB2A 1LF5A 1ZD1A 5H68A 1B23P 2NPFA 1SQ5A 2DWOA 3QF7A 1G7RA 4D80A 5ANRB 2H16A 1ZUIA 1E32A 4FMDF 4MRNA 5DN6D 1E96A 1N6HA 3HR7A 4RKEA 3CR7A 3W3AA 4P4SA 5K8IA 3GFTA 1UBCA 3NKVA 3AVTA 5E4FA 5GJBA 4TT3D 2IS4A 1GRQA 1RJ9B 3TIFA 5J47A 1V5WA 1N6LA 2WWYA 1WXQA 2OFXA 5HCNA 5KSPA 4A36A 4GOXA 2HV8A 2ZSBA 4RJLA 1ZNWA 4M1WA 5BYKA 4Q47A 1LVGA 1P2SA 4QJ4A 3UANA 4NPHA 2EWVA 1E94E 5FUWA 2W58A 2JLRA 4P4UA 4ZDKA 2ECKA 1OSNA 2VBCA 4MRSA 5D3MB 2ZR0A 3KXLA 3WBKA 2HUPA 2ZRKA 2N42A 1UADA 1KMHA 3RABA 2A9KA 2QPOA 2ZUBA 1D2MA 3TJZA 1GNRA 1OXSC 3ZQ6A 3GLFA 2GWHA 1F3OA 3VKGA 3AGQA 3T15A 4A92A 3EPJA 5IK2A 2DCUA 3AP2A 1IXRC 1OF1A 3CH4B 3M0EA 1CS4C 4CIDA 1Z8FA 3A1TA 1P9NA 3FYHA 4LV8B 4Q9HA 3SQXA 2NGRA 5BYJA 4U02A 1OH5A 1G7CA 3EPKA 2W2XA 1T5LA 1ZD9A 4CGZA 5DHAA 4UXIA 3A6PC 2GVDC 4RD4A 4Q7MB 4QJ3A 1H8EA 3B13B 3Q85A 3PUXA 1ZIOA 3WNCA 1KDTA 3A37A 1K8RA 1NLYA 2W6ID 1PUIA 2JEOA 1NSTA 5CK4A 3VQTA 3NEYA 1RRPA 1HEIA 3HYRA 3SJAA 5SZJA 3C16C 1KI6A 2XB4A 2QG6A 3L0OA 1OYWA 2IC5A 1W0KD 2XTNA 3EZ7A 2NO9A 4BECA 5JHHB 2BBTA 2I1VB 1U2RA 3RSOA 2EW1A 1X86B 2J5XA 2CK3D 1ZC4A 2Q6TA 3AB3A 1UF9A 1YKSA 2ANCA 3BB3A 3GJ8A 3LXXA 3MG9A 3T34A 4QNMA 3ZVLA 4Q4AA 4QJ5A 4NYJR 4HB2A 2PCLA 3K1JA 4ZO4A 1OFIA 4FXPA 1Z3IX 1Z63A 1YZKA 5EUMA 2PMDA 4RD2A 2NZJA 2AK2A 4XWOA 3UATA 1Z07A 4ZCIA 3AKEA 3UPUA 1F60A 4BASA 1EX7A 4XVUA 4TL6A 5CB8A 2QUZA 2BMEA 5DYIA 4R7ZA 3K53A 4CEIA 3GLIE 1W47A 3WP1B 4C0JA 4EFMA 5EP1A 1P62B 2C2HA 4I99A 4FN5A 4ZI3A 4P0TA 2XZOA 2WWXA 2OSBA 1KIMA 4KLNA 4NCKA 4GOKA 5D3QA 1WRBA 4JJZA 2PCJA 2QQEA 5F3WB 5F98A 1WA5A 1G20E 2GF9A 3T12A 2X8AA 3UWOA 1VG8A 5HTKA 2JLZA 2YNMA 3FTQA 2I3BA 2KE5A 3TNFA 3FE2A 5C2JB 1EESA 2WIBA 1KY3A 2ZJAA 4MYTA 1GKIA 2Q3FA 3QVUA 3AVYA 1M7HA 1WF3A 1II9A 3CWZA 3OEHA 1GP2A 4M8NE 2O8EA 2OCAA 4PAMA 4B76A 5JWHA 4HSEA 4EPWA 1TEXA 5F2EA 4C30A 3ZVMA 2IUSA 2WJJA 1IXZA 3BB4A 3LO5A 3AVPA 2F55A 1KMHB 1QG2A 1XJQA 2GAOA 2LCFA 3BH6A 3GLHE 3KKNA 2A30A 2XOKA 3TLXA 2GJSA 3QIAA 3UKDA 2IYXA 5KDOA 1WDTA 1PLJA 3I1FA 3KKPA 4Q4HA 4FWIB 4QKQA 2ZU0C 5SZKB 3IIJA 2GJ8A 4TYQA 1U90A 5IT5A 5IK2D 3OE7A 1O87A 3VTKA 3CF2A 3U6KA 4RD3A 4LBVA 3GLHB 1IN8A 2B7BA 3TQFA 3IEVA 2ZI9A 4N0EA 3ZVRA 1X1SA 2W6JD 3BB1A 1NSFA 3H4MA 3K0AA 1NL3A 3JZAA 1Z08A 4TYWA 4MGZR 2QE7A 2WSSD 2V7QD 1OB2A 1EGAA 3MD0A 1S3GA 1R4AA 2YOGA 2H17A 3KKQA 4NL4H 4D0LB 2VSOA 4D4MA 1SVKA 2WAYA 1TQ6A 1FMLA 5DI9A 2XXAA 2OM2A 4TLCA 3ZZUA 2JLVA 2F1JA 4KBFA 3U5ZB 1JAIA 5JCPA 1KI7A 4OHVA 3J81k 5CITA 1E9CA 4TLDA 4NMMA 1KO7A 5CLLA 3EZ2A 4Q4AB 3EPLA 1XPOA 3LBHA 2GBLC 5L3VA 1RPZA 3KQUA 1I4LD 4BLPA 1G3UA 2B7CA 1UBEA 5FPKA 2FGKA 2G1KA 3F5FA 1KK1A 3CH5A 4YLGA 2HXYA 2WJYA 5H70A 1DVRA 1RE0A 3MWYW 1U9IC 3FFBA 4GOJA 4M0LA 4E5UA 1P61B 2AD1A 2X1VA 3ZQJA 5F9HA 3VR4A 3LQRA 4OYHA 2R2AA 2CE7A 1ZIPA 1PVOA 3IO5A 3TE6A 4C0SA 1UBGA 1LFDB 3BFXA 4HAUA 3AKYA 2G83A 1MRSA 3B9QA 4DIDA 2RKOA 1Z0DA 5J4KA 3EASA 5G53C 2LKDA 3OHMA 3A4LA 2CHVA 1R5BA 4DCNA 1S96A 4UXHA 2ZJ5A 5DHFA 4M21A 3VR2A 2F9LA 3CWQA 2QQ0A 4TTPA 4PC2A 2JLUA 5AUQA 2QP4A 4TSFD 2WAXA 1HY3A 3FVQA 4HUQA 2QBYA 4JL6A 2OV2A 2JA1A 2QI9C 2OLKA 4QXAA 1UFQA 4KV9A 1R0WA 2PL3A 3RAPR 3CRW1 2GTPA 3P32A 2GBLA 2NQ2C 5FUVA 2BM0A 4PC6A 3ZYCA 4RCYA 2QN6A 1TEVA 4CYMA 4JLOA 2IHYA 2OAP1 2ZE5A 2ZIAA 4U5XA 5FBLB 1CTQA 1VG9B 3Q3JB 3R20A 5FR2A 4DLUA 3P4XA 3SFZA 2B21A 1U9IA 1DAKA 3U2QA 1BH2A 5KYKA 5JEDA 2ANBA 3QOFA 4HAWA 2ZRJA 2JCSA 4B2IA 1XBTA 1I2DA 3VX3A 1YQTA 2J45A 1QRAA 2NO1A 1IQPA 4US1R 1E1QD 1SXJD 3BAFA 4DLRA 1NY5A 4NTZA 4IKEA 3SN6A 3AVUA 5JECA 1HV8A 3U4QA 2FV8A 3NC0C 5KPJA 4I81A 2YC2C 3KKMA 4ASUA 4C0HA 3KQLA 3SU8A 3E5HA 2QMHA 1NN3A 2HJGA 5KOYA 4MGYR 2D62A 4D2IA 1E0AA 2RGGA 3QENA 2X19A 1U0LA 2PX3A 4MKGA 3LNCA 3LH5A 1KMQA 2A5JA 1E99A 5JBQA 4GZLA 2QRNA 3EZFA 2QAGB 2OCBA 3GJ4A 3AUXA 4GL2A 3RRNA 3GPLA 1TPZA 3KQHA 1OFUX 4DDVA 1EFHA 4NE2A 3Q72A 4IFEA 3B1VA 2QMEA 2FDCA 3B1WA 3GCGA 1NBMD 3PIRA 4WZAE 1XP8A 5FR1A 4TL9A 1F6BA 1R2QA 1FMJA 2ATVA 5K8UA 1VHLA 4BFVA 4M4SA 4W5JA 2PEYA 4FW9A 3VR6A 2BJVA 2F1HA 1ZC3A 3L8ZA 3E2IA 1G5TA 4JVLA 3PCRB 4Q02A 1M1YE 2W0MA 1FL9A 1VG1A 1BKDR 2EFGA 4QOSA 5EE1A 4GMDA 3CZQA 3DMNA 5HZHA 2AWOA 3VR5A 1G6HA 5SZIA 1XEXB 1J2JA 3BXZA 2PZGA 5A5GA 3MWJA 1NRJB 3TVTA 1DO0A 3BFVA 4PZZA 5JRZA 3RC8A 4G5OA 4P3YA 4XTRA 2HCJB 4HZIA 2VF8A 3LA6A 4DT1A 3K09C 3VR1A 1N5LA 2RH5A 1E9FA 2ERXA 4MGKR 4OQLA 3AVWA 1ZCAA 2VHTA 3IEUA 4UNPA 4OQXA 1KDRA 4C3ZA 1ZNZA 4U00A 3ZIAA 1M2OB 2OE2A 3IPYA 2ZJ2A 2EYUA 1GILA 2ZI4A 3HR8A 1AZSC 3HWSA 5DISB 1YZUA 2FSFA 3PUZA 3AF3A 1XEFA 5LB4A 2C5LA 1RKBA 3HYTA 2JDIA 1KI3A 2CHQA 4XSHA 4BE7B 4RFSB 4F7WA 3MMPA 3O8DA 4A2QA 4DUGA 3A36A 3SR0A 2WWIA 4A0HA 3QQ5A 3OZXA 2O8BA 3W5JA 2CL0X 1E0KA 2VQSA 3QF4A 2GCOB 2DB3A 3CO5A 2KI5A 1G19A 1PUJA 2BV3A 3BWDD 1JNYA 1I4TD 3SYKA 1G17A 2PLFA 1JXMA 2ZRDA 1BYIA 4A15A 4URWR 1TQDA 2NO6A 2GZHA 1SULA 1P4SA 4LPSA 4Q7JB 3RYTC 4NDZA 4BRUA 4D0GA 4JT4A 5FBRB 4IOJA 4GFDA 5EE0A 1N6OA 3ONWA 4X8HA 4GNKA 1MO3A 5G41A 2ZQ5A 1NMYA 2A5FA 1Y63A 2A3RA 2W6IA 1FOEB 4ZIRA 4LHZA 1W5SA 2GEVA 5EUQB 1AKYA 3B60A 1NIJA 3PUYA 3W8NA 4KAXA 5EXSA 1Q22A 4AKIA 4C9BA 2FZLA 2H1LA 2AFIE 2GDJA 1XTSA 5JLJA 2WVJA 5IHPA 3GLFE 1KK2A 1G8YA 4DZZA 2REOA 4M9XA 4JKYA 3QPVA 4Z8YA 1GL7A 5HR5A 3SE0A 3I32A 1TL7C 2FFAA 4URVR 5JS7A 1W36C 2WM9B 1DAEA 3D8BA 3QE0A 2K5UA 2VLIA 3IHWA 3MJHA 4II7A 4LRWA 3TR0A 4HLUA 1OJLA 4GZMA 2HT6A 3TK1A 4R71A 4CEHA 2ZRLA 3TUIC 4D25A 3HDTA 4PR0A 5DGXA 3EA5A 3KDSE 4R98A 1IN7A 1S3SA 3EW9A 2NO0A 1TF2A 3JZMA 121PA 1IM2A 1FW6A 1CKEA 2CK3A 4QBIA 1EG7A 4TTQA 1A1VA 5TY0A 3QKUA 5JCZA 4PPFA 4YXWA 5FL7D 4B35A 1E2GA 1M34E 3UG7A 3I5YA 2WJGA 2XNDD 1SVMA 2XSZA 3WYAA 1KTVA 4GSYA 4KCGA 3FHOA 2ZAOA 3I8SA 2YWHA 3N2IA 1Z0FA 3QKRA 3P26A 2ORVA 2Q9BA 2IT1A 4PQRA 1MKYA 1U94A 2XNDA 2ZRHA 3KUCA 1RRGA 3WYFA 1KY2A 1E9EA 1XMIA 5J40A 4D0NA 4DCVA 1GAJA 2Z0MA 4B47A 1G64A 1LS1A 1LTQA 3WMFA 2HT1A 2OFWA 1GG2A 1SVWA 2FG5A 3QSYA 3NBFA 4MH0R 3O8CA 1S9DA 4RKFA 2GA8A 2YWFA 4TMKA 3RVBA 5IF9A 2CBZA 1KOFA 1N6PA 4GPTA 4N0DA 4DEXA 1DAMA 2J7PA 3Q7PA 3KXIA 1GRRA 1WMSA 1SGWA 3A58B 2ZR9A 4DLZA 3IPXA 3B1XA 3MRSA 4JLVA 4DLWA 2W6JA 3VMFA 4ZDIA 1VCOA 1E2LA 3VX4A 4DKXA 3SOPA 2AKAB 4HDQB 2GXUA 3EIEA 4UQOA 1G7TA 1YJ5A 2Z5FA 4KJZA 1L8QA 5FOWA 1CR0A 1TQ2A 3R8CA 2IX3A 2QP9X 4LGMA 5JJIA 3DDCA 5E7JA 5GVSA 2QNRA 1MO6A 2I4IA 1G4AE 2PLRA 2GJKA 5G40A 1UKZA 2IUTA 4DLYA 4L9WA 1KNXA 221PA 2FGJA 2W0SA 5DLQC 3GLIA 2JJ2D 4TLEA 1DELA 2RMKA 1UEIA 3K70D 2AR7A 1P6XA 5DI3B 2ZRNA 2QEQA 2F1IA 1R0ZA 3CF0A 1N2CE 5GVRA 4E09A 3V9PA 5DNYB 1DOAA 3ZZTA 3A1UA 2D7CA 1A2BA 1VPLA 3LX5A 2GNOA 4XVQA 5JEEA 4IOKA 4Q9JA 2V54A 1N0VC 2P65A 3QKSB 3KTAB 5AUOB 3H84A 1QVRA 2QORA 3IBGA 2ZI5A 4MUBA 2J0VA 3MJRA 5DYGA 1KZ7B 1HURA 1KSHA 4HAXA 1JAHA 5TDHA 1G291 2VH5R 1DTSA 1Q0UA 3C5HA 5LD2C 1XWIA 2WKPA 3IIKA 4DSTA 3NDBB 1RW4A 4PO8A 2J0SA 2VSXA 4QHSA 1BMFD 3W90A 3UMFA 4MA4A 2WWWA 1VECA 2FSHA 2JLSA 3CB4A 1XPUA 2NMVA 4FCWA 2ZUCA 2A5YB 3SJCA 1VIAA 2GZAA 2D4HA 4X8OA 3KL4A 3QPWA 4HDCA 4DBLC 2MSEB 3BS4A 3DM5A 4IDPA 5KNBA 4TZ6A 1Z2AA 2D3WA 1H65A 3CX8A 2RGNA 1KJYA 3CPHA 3GEIA 2V3CC 4G5SA 1Q1QA 2BWJA 1NVUQ 4G5GA 1SKQA 3CIOA 1BOFA 2QGZA 2V55B 4HLDA 4UNSA 4OQMA 3U61B 2WMOB 2J46A 3CR8A 1IAQA 1TX4B 1U98A 3SFVA 4CZ2A 1X8KA 1G3QA 3DOEA 2B92A 2GEDA 2NIPA 1GKYA 3AF4A 4A0FA 3TQCA 2YOHA 4C7OB 3HP1A 5FPTA 3AF0A 2DHRA 3LVRE 4RY2A 3GLIB 1QHYA 4GI7A 4DC9A 5C1BA 3BH0A 3Q8XB 4LJ7A 4IDNA 2IS6A 2EFHB 1VYVA 3QXXA 1OH8A 2EFDB 5H1YA 3X1YA 1XD9A 1WB9A 1NN5A 2XZPA 1DAHA 4WAUA 4BZQA 1NJGA 1PLLA 2AWNA 2XXAB 3U3JA 3ICEA 2R62A 1DEKA 1T0HB 4JYBA 2DBYA 1VHTA 1P9RA 4ACBA 1CR4A 2VP4A 2ZUDA 4TL8A 3SI7A 2HJVA 3WBJA 4PX9A 3CF6R 3U60B 1ESMA 4UNNA 2CL6X 1HT2E 1XTKA 4EIWA 3SQWA 4G0NA 2Z6VA 4DWJA 4HZUA 4P4TA 3U3OA 2DYKA 3EXAA 4UXJA 5L3SB 2IF0A 4E07A 4F4CA 3RS7A 1W36B 3SHWA 4LSGA 2O8BB 3PG5A 1ONBA 1E2NA 2GCOA 5LDDC 4JVNA 1NMZA 2CVHA 2GXAA 4AYWA 4BFUA 4O2RA 4JL5A 3GJ7A 4QFMA 4LCBA 2CLDX 1ZUNB 1G5PA 1CR2A 1JB1A 4O0MA 2IEYA 5CYPA 4IDHA 1EX6A 4Q7LA 3KFVA 2IS1A 3EZ6A 3ZJYA 4B3FX 4BFTA 2H92A 4Q7KA 4Q5IA 1EWQA 3ZGXA 1VCNA 4MRVA 4GMXA 2WJIA 3DPUA 3U44B 3GMTA 4OI1A 4RZ2A 4PFSA 1E2JA 3R9XA 3BH7A 4F4IA 2QE7D 4B33A 4NHOA 1N3BA 2F43A 3QY0A 3LLMA 3L0IB 4LBWA 1QHIA 4HAYA 1XEWX 4MQBA 2VF7A 4GP7A 4HB4A 1ZYUA 4DSOA 1GM5A 5FOUA 2QY9A 1TUEA 3LW8A 2DY1A 3B6EA 3NHAA 4KYIB 4A82A 1MH1A 1ZUHA 2HYIC 2ZM5A 2ZSFA 4G01B 1KI2A 4YDHB 5CDFA 1TNDA 3QNUA 4BLRA 1KI6B 4L8GA 2Q3MA 5FPYA 1XJ0A 4AKGA 2GVZC 3RS3A 2VP6A 1FTNA 4G3XA 3WXMA 2KSQA 2VHJA 3NDPA 1O3YA 2GK6A 4TMZA 3RRMA 4JIMA 1E79D 1KO8A 2IHBA 2IYQA 2QZ4A 4KYUA 1KSFX 1PV4A 1JR3A 2WOJA 4M1OA 3E70C 2OCPA 4TZ0A 5FI0B 3LDAA 1KAGA 1OH7A 1NLZA 4PO9A 4A8JB 1RVDA 5DSZA 2J0UA 1TF7A 1W4AA 5KSZA 2RAPA 2IYZA 3KB2A 3S1AB 3AQ4A 1R5OA 2DFTA 1CEEA 1XXHB 5B57C 4KSBA 1G6OA 4JVSB 2FF7A 3K9NA 2V6JA 2ZRBA 4D4LA 3OIYA 1F2TB 2AHOA 2JDID 1X6VA 4JLAA 4AI6A 2ZRCA 4DB4A 1E6CA 2ORWA 4IOMA 4TWZA 2GXQA 1XMSA 4FMDB 1XDBA 4ACAA 4W5HA 2KB0A 2FPMA 4IVRA 2HLDD 4LJYA 3RANA 3H0KA 1R7RA 3QKRB 4MRPA 2V4ZA 4M1KA 2X2EA 1S1MA 2OG2A 2ZJ8A 3CRMA 3RLFA 1YU9A 2IYWA 4BFZA 4LYHA 4RD6A 1YR8A 1XTIA 4PZLA 4POAA 4XIGS 2BM1A 3PXGA 2JLQA 5BW8A 4BLSA 3LXRA 3RWMB 2Q9CA 1I4DD 2ZYWX 3CRVA 3KXKA 6Q21A 2QPTA 3RRZA 3L0SA 4B75A 3FDIA 5C46F 3AP1A 2AKYA 3VU9B 4PPQA 3T1TA 2F3TA 1CXZA 3U44A 1P5ZB 4HATA 4EJSB 3IKJA 3I4LA 1F48A 1V43A 2C77A 2E1RA 4NU0A 1AZTA 2G3YA 2ZSDA 4ARZA 2IF2A 4IXMA 2KBFA 3W6OA 4BZXA 1E0JA 4Q1EA 2OILA 2WBLC 4XH9B 1DE0A 4LHWA 4ASUD 3N2EA 3TUJC 1E9RA 2WTUA 2A5GA 3ASYA 5CB6A 3EWAA 5BWMA 4LDJA 3A1VA 3TSWA 4YMVA 5DI3A 4E22A 1DO2A 1SXJB 2PT5A 4KFRA 4GDFA 2YHSA 4W5WA 3VNUA 4YMTA 2QM7A 1AS2A 1XF9A 4DHEA 1XTJA 1ZM2A 3C41J 1Z5ZA 2ZPTX 2OT3B 3PUWA 2PH1A 3KTAA 3LFUA 2FSIA 4NBSA 2VTKA 1SXJE 2OO7A 3OEEA 4I1SA 4B34A 3QEOA 5JSZB 1AGPA 3LX8A 3U3RA 4LY6A 5KUTA 2ZYUX 4QBGB 1OXVA 1NKSA 1CU1A 4OJQA 621PA 4KFUA 5EZ6B 1X8LA 5FI1B 1XXHA 2QRZA 3LAWA 3IBYA 2BKEA 1VCIA 3PEUA 4KHZA 4Q03A 1J8MF 5L8VA 1D2EA 1HE8B 2CNWA 2P2LA 2G88A 2RGAA 2HCBA 1Z6GA 5FBVB 4OK5A 3ZZ0A 4B3XA 3P27A 1U8AA 2EFCB 2QSYA 2R6FA 1KK3A 2P6UA 1SVSA 2HYDA 2JATA 4DB2A 3OFNA 5EE3A 1F5NA 3THOA 4R9UC 3K9HA 1U0JA 1OFHA 5CM8B 2PT7A 2V1UA 2EQBA 3C5CA 3EA0A 3WMGA 1ZM3A 2ZE7A 4CVNA 1EFRA 1Q20A 4LJ4A 3ZD7A 2VSFA 3R7WB 3ICQB 3OFND 1COWD 1GNQA 2P6RA 4TSFA 1W46A 4MYHA 2ZRIA 1SKYE 2FH5B 2E87A 3ZS8A 5KSOA 4HI0E 1QZXA 2R6CA 3FKSD 3VHXA 3NG1A 1NY6A 4IHQA 3GJ3A 1DG3A 1SXJA 2ERYA 4URZR 3WP0A 4M9ZA 4MYCA 2IXFA 2MMGA 2BEJA 4DUGD 1Z6XA 4QHYA 1E2DA 4IVQA 4LOAA 1FUKA 2CL7X 4MDFA 4ARZB 3FGNA 1KYIA 2A5DA 4FMCF 3G5UA 2IYLD 3EAQA 5FFMA 5C4MA 1PZNA 5HE8A 2OBLA 4KVGA 1E0SA 1Q44A 2GILA 4Y0AA 1P7CA 2AL7A 2ZS7A 3NXSA 4JL8A 4AYTA 1FX0A 1GFIA 4MGIR 5EXXA 4C0BA 3FMIA 4V0NA 4MKHA 5AJVB 4Y0VA 2IEZA 2VIIA 2ORIA 1WBBA 2DFLA 1MO4A 5AUPB 2IYUA 1ODFA 2O8CB 1G18A 1FP7A 4LJAA 3B82A 3OIVA 3IHLA 4A0RA 2IYRA 3AV0B 3EIHA 1E9DA 4PC1A 1KO1A 3BERA 4IEEA 4JSTA 4TYPA 5B58C 4CRWB 2O8DA 2H7VA 5KNCA 4JYCA 4DXAA 1WE2A 2HDNB 4NCHA 2IXGA 4R2IA 4BFXA 4LC1A 1SXJC 4QNRA 5M04A 1CJTC 3L2OB 2REBA 1ESNA 2FZ4A 4RZUA 4JLNA 4HEJA 4EKDA 1E2QA 5HKKA 1GUAA 4ZCMA 1OE0A 4JS0A 2QP3A 3GEHA 3E1SA 2ASEA 2DFKB 3K0AB 4CT5A 4NONA 1SVLA 2BBSA 2BC9A 2VPPA 2VP5A 3FMOB 4QHTA 5EJEA 5EXTA 1S8FA 4URYR 4TL7A 3SZRA 4JLBA 1UDXA 1P75A 5UKDA 4DCSA 4TMXA 2QL6A 3GLGE 3PUVA 1ZNYA 3I62A 3K70C 4Q1DA 1NMXA 1OXTA 4HAVA 1E4YA 4P4SB 2XTZA 2QT0A 4PC3A 1J70A 2DR3A 1Q57A 3P20A 2ZJZA 3RC3A 1MABB 5FOTA 5EP2A 3RS2A 1P60A 4ON9A 4CF7A 2L0XA 1VKJA 1Z0IA 1YZTA 2KJQA 3RRYA 4B3GA 1IJFA 3SNHA 1D6JA 3OEHD 1YRBA 2UZIR 5L3RA 5TMPA 3LD9A 1GL6A 1JR6A 2V6IA 4IVPA 2FX3A 1CR1A 3BGWA 1GVNB 2C9OA 1VTKA 4I1VA 3X1XA 2ZTSA 1J99A 4DLSA 5SZHB 2O0JA 2GETA 2VHUA 3A8TA 3DKVA 1G3RA 4JLPA 2WOOA 1Z06A 2OCYC 5TV2A 2ZAMA 5EP4A 3RWOA 1AN0A 1XTQA 2ZRGA 5A4JA 1TQ4A 2AD5A 2IYTA 4OJKA 4B43A 2PX0A 1HQCA 5CIWA 2JJ8A 1CP2A 4B6EA 2C8VA 1COWA 3QBTA 3QXJA 5TXGA 4D81A 3EIQA 721PA 4L15A 3R8FA 1KI1A 1ZJ6A 1C4OA 2WKQA 2ZEJA 4D4KA 4C0QC 2C98A 2XITA 3DKPA 1OB5A 1Q12A 2Z43A 3IO3A 3HU3A 1W36D 4FMCB 1XCPA 3NIBA 1JECA 1M74A 3C8UA 1HUQA 3QG1A 3QF4B 5A0FA 5JI2E 1R8SA 3OF5A 2JIZD 4TQUS 2N46A 3NVAA 1CRQA 4B73A 1HYQA 3I5XA 3N70A 3QUSA 1E9BA 5FL3A 2ZJBA 4KODA 4AY2A 1GOTA 5FUYA 2GCNA 2JIZA 4LYAA 1D9XA 4NP6A 3GJ6A 2DWPA 2R9VA 4OKSA 3B85A 1CIPA 1S9HA 5TB5A 2OESA 4YQFA 4EJSA 2GAAA 3K9LA 3THYA 1B0UA 1OKKA 3W34A 2XJ9A 3CNLA 3GFOA 4LUCA 2RB4A 1GNPA 4BZPA 1MABA 1DARA 2WJHA 4EDHA 3AGPA 4W7SA 1VYTA 5GADl 2QPAA 3FHCB 4JLKA 1ZM4A 4PHGA 1K5GA 4Q4LA 5FH9A 5JS8A 2UZ3A 2VP2A 1GIAA 1AGRA 4XWAA 5CDFE 4FWTA 1G3IA 2VRWA 4WIAA 5IRCD 2IA5A 4BEJA 1ZMXA 1W0JD 2NO7A 5L3QA 1OXXK 4TMVA 3DZ8A 1KI4A 1CJMA 3TSZA 2CXXA 2GRJA 1X3SA 3B78A 1AKEA 4M22A 3W6PA 4Z1MD 2FOLA 4PQYA 2QAJA 1OHHA
chains in the Genus database with same CATH superfamily
4ZVMA 4JJEA 4RZ3A 4OXQA 4RK5A 2QTRA 4A9AA 1SCKA 4UFNA 4B6QA 3LRTA 4H4EA 2CF5A 3NH6A 4IHAA 2CFIA 5IWAB 4C2AA 2ZSEA 3CVYA 3VHRA 4JOSA 5I5GA 3AESB 1LLFA 2Y71A 1NRXA 5ADHA 2RK3A 2BJWA 1G63A 1E1RA 4JC0A 5CIQA 1VJRA 3G2OA 4WJKB 3U39A 2G7ZA 4B8ZA 2P27A 1JLRA 2FW0A 5DWDA 2AMJA 3B1ZA 1JA1A 3Q88A 3B5IA 1RBQA 4TN1A 3VKWA 1SKMA 4HRAA 1W9MA 2G1JA 1K8XB 3RVQA 1O7JA 1Y8AA 1C0PA 3ZHCA 5J2TF 3ZVKA 4HGOA 3QVJA 3PQ5A 3EGWA 1GDDA 4N49A 4UVGA 4AD8A 1M34A 4X65B 5DM2A 2IEDA 3OVMA 3RUIA 2FY8A 4N3GA 1JLLB 2D1SA 3O84A 3LP6A 3HDQA 5L4LA 4KOEC 4L27A 5KDLA 5U4QA 1G55A 1EGMB 2HJHA 5ICCA 4PNPA 2BGNA 1YGPA 2NTVA 4ZJZA 1B8VA 3IP5A 1M6NA 4ENWA 3THYB 1CJBA 2IIBA 2AQ8A 3PT9A 3WJ7A 2I3ZA 3IA7A 4GM1A 2ZI7A 3SX4A 4IJMA 8ADHA 3IA2A 2H5LA 3JQFC 4J0IA 4KXUA 4ZDJA 3MYYA 2QENA 3ICWA 4RIFA 1QK3A 2QVGA 4AKHA 1W8IA 3DZCA 1A7JA 2ZYIA 1O6GA 3O0DA 3D7LA 4Q3BA 1Z22A 2VYQA 2WG1A 4IFIA 4ZHQB 1MIHA 1WBDA 1EE9A 1KJQA 4P7GA 5FWNA 5L3QB 3O3OB 4KPYA 1VG0B 1IATA 2FB9A 2OR3A 1JG4A 2ZBRA 5FAXA 5GM1A 1E4VA 1O0SA 1SWWA 2G36A 4HQFA 4FFWA 4KNWA 4A1FA 4MULA 2AFIB 4EFLA 5IG2A 5K03A 4LHXA 3WAKA 2BR3A 2YYZA 1AT1A 3VZDA 1AGNA 1TU0A 5L40A 3QFSA 5AI9A 4L73A 1MR3F 4B40A 2HK9A 3EQ8A 5IDVA 5K4AA 2WWVD 3T9EA 3J7AC 1EQUA 1L5MA 2BI8A 4DRZA 3WAJA 1JVSA 4QEDA 4Y9UA 3B51X 2C9CA 3F67A 3OFVA 3WA6A 5EZ5A 1VMAA 2PRKA 2R6GA 4OFBA 1C50A 1XO1A 2P90A 2J3DA 1V45E 2ZU6A 3ZH2A 1UWCA 4QTUB 3OZSA 5BMVB 3OCYA 1TIKA 1V26A 2CMGA 4IMIB 5IKXA 1DWOA 2P9CA 4UU8A 1E66A 1FNNA 1RABA 4EKNB 3MGCA 3RDPA 3B9BA 1XD8A 1BHO1 1HQYE 2CFTA 4C87A 1ZESA 3I0MA 2WZQA 3FNIA 3FPHA 2NP6A 1PEAA 2R8OA 4A0SA 3DOIA 1CVLA 1TYBE 3L8DA 4Q6BA 3DDSA 4G41A 4WUTA 3WYCA 3IXLA 1P81A 4O4LB 2RHDA 3KOMA 1DOZA 4FMPA 3GLFB 1N5IA 3NDRA 4EPYA 4M55A 2A8YA 4O29A 2A9RA 2PWPA 1U7PA 2PX8A 1UK9A 1Z35A 1UJ2A 2OO3A 1JALA 2FPGA 3IUEA 4UULA 2V8BA 2FFHA 1SU7A 4O4JB 2W43A 3DEFA 1GNLA 3KG2A 3GMDA 4O6VA 2XBUA 1F4PA 4FGZA 3BWEA 5B5SA 2HK7A 4RVSA 4S1WA 4NOKA 1UJMA 1QANA 1YNSA 5AM2A 5K0JA 2Q21A 5KPDA 3WO0A 1UOOA 4YMIA 5A4DA 3TLBA 4LDRA 4HUQB 5HGJA 3SC3A 1IMOA 4CNBA 5EE9A 2FPIB 1P73A 3B3JA 5EJAA 3TVDA 3WRWA 1E2KA 2JIDA 2PXAA 2N3ZA 2Z1MA 2ZIFA 2D8MA 3E9MA 3HKBB 5F77A 1W94A 3F8WA 1IEWA 2A88A 4G56A 2PSEA 2J07A 3K0HA 4XPZA 3BD6A 1JLMA 2X8WA 4BCCA 2H1VA 3PNOA 1YFJA 4O3MA 5CA1B 1WXDA 5E7MA 3ZJ4A 4F6RA 3BWYA 3OLCX 4OQNA 5BUSA 4RKWA 5AW0A 4B3TB 5B30A 3K9GA 3N5CA 4HN4B 4I8XA 1PL7A 4JD5A 4NI5A 4C2UA 2ZZKA 1YMVA 2PGNA 4JA0A 3ENZA 1N6IA 4YAWA 4XYEA 3NHRA 5DE3A 4N7JA 1TKCA 5GP1A 1XVIA 4AVYA 4BO3A 5KTTA 4FSDA 3EPHA 1DNPA 1YVUA 1CF2O 1T5BA 1TYCA 3OZVA 3K8YA 2GRUA 1DXHA 3URMA 3WSWA 2IUUA 4AMYA 4M9QA 4BCBA 1QHFA 1S5PA 2J32A 1CV2A 2OHVA 1IRIA 5ENZA 3W5BA 3GG2A 4EQ6A 3A6KA 3AUAA 2YV2A 2Y66A 4O3FA 5HEKA 2XTMA 1P44A 5L3ZA 1E4EA 3W4KA 2C7QA 1CJKC 2Q0HA 1NVBA 1Y5RA 1E6LA 4IIBA 4MUYA 2A9FA 3G88A 3VAAA 1QKKA 2C95A 2F3RA 2ZR7A 5LA6B 3TZCA 3V00A 3J7TA 4HAZA 4Z7JA 1QFJA 2QW0X 4OCZA 5LKRA 5GV8A 4TMWA 4KQJA 4M8KA 5CW1A 4YR9A 3EZNA 3FYDA 5A4KA 4OSEA 3GGCA 1X1RA 5BWNA 5H83A 3L5KA 4LC9A 4BLQA 5IAGA 1HQDA 4XAQA 2I55A 1CUWA 1EFCA 1NN0A 1NASA 3BJIC 2I4NA 2HBZA 2FSVC 3V80A 3F2IA 3NKLA 4V0RA 2E9SA 2VAXA 2QROA 2NSYA 1SHKA 3KFXA 4I4LA 4DADA 4DDHA 2Q3DA 1KH2A 4G26A 3DWFA 1GNSA 1OGJA 3GRFA 2D2IA 1P7WA 1T25A 4JB2A 4TS9A 3H0CA 1VHJA 1X0VA 1O03A 2X2FA 3LBNA 4J94A 2IZ0A 3U40A 3UMGA 3V8PA 4XARA 4G5FA 4ISCA 4WJLA 2CE2X 4J3FA 3DT8A 3KVVA 3RKUA 4TT8A 4U63A 5FBHA 5DBIA 4B6OA 1DIAA 1T13A 3OY2A 1Q7BA 1YQXA 1ZVQA 5J4YA 3GGOA 4D5GA 3H99A 3GRZA 2R8BA 4EFNA 1GSHA 5C51B 2HA3A 3QUBA 3FNRA 3D7MA 3OTOB 1RRFA 2IGBA 1RYFA 3HLKA 1Q15A 1SZCA 1JR3D 2VHQA 1NXSA 2EG5A 5LZ5A 3U7JA 1B16A 4DY4A 3GX1A 3LT1A 2NTYC 1WQ1R 1QOZA 3CLVA 4EGQA 4MWEA 5LBIA 1Q14A 3P0RA 1KDOA 1QRRA 2I2CA 5AKEA 5B1DA 1GKLA 3G89A 1G8GA 4PXSA 1TMOA 1JJ7A 3AEZA 1T9HA 2X15A 5LBUA 2VXYA 3EF0A 4RL4A 3KFLA 4N9WA 3WLQA 3TLYA 2JGDB 4O4LF 3NV7A 3PIIA 2ORED 4BCDA 3E3AA 4UBNA 1U2GA 4QL3A 1I6KA 4OLJA 4JITA 4GC5A 3DEZA 4GR5A 4ZKDA 3QELB 1SM4A 4L2IA 4NK4A 3IAHA 5ALTA 4LDZA 3F6RA 1A5TA 2B4QA 4U7FA 2D2FA 3BMQB 3SX2A 4N40A 3W04A 3BIJA 3NHPA 1SKYB 5AWFC 4DDMA 1J09A 1DJLA 4UKDA 5G4LA 4IW3B 1I7LA 1RWMA 4ZCTA 4RV4A 4X6XA 1CLUA 5B3AA 4CL8A 2Z8YM 3GLSA 1H6DA 1GQQA 3OCCA 3SHFA 3WL4A 3BC1A 3KE8A 2J9RA 3AJ9A 3NEJA 3QMVA 4ZDWA 1T1IA 1P1KA 4EG6A 2GFQA 3D1LA 4KUEA 4XD7A 4Q4DA 5DP2A 4YWHA 4MLDA 1VBNA 5DO9A 4WK2B 5I5EA 1GSIA 2AG8A 2P2YA 3KPVA 3NVDA 3HL0A 2DLNA 1BEUB 4UUMA 1FDRA 2GERA 1H85A 4OXKA 2Q3BA 3EXG2 3GA0A 1YQ9A 1PBTA 3H1BA 2AJ8A 5JFOA 2JCGA 1WDMA 5ALLA 3SIXA 3ROEA 1ZIXA 5KX5A 2CLSA 1O95C 2LD4A 3DUFA 5TGDA 3TIIA 2XUJA 4I8IA 4LFCB 4B44A 4DOMA 1Z2PX 4KEAA 4YAGA 4MV0A 4QGFA 3U4HA 1W6RA 2DAPA 4YP1A 1DPGA 1L5GB 3TH5A 2JIRA 3BREA 2P3OA 3PD7A 2A9JA 3RIXA 7ADHA 3CT4A 3ORQA 3VJMA 3WYBA 1U2GC 4B2LA 2EBFX 2AG5A 3P1JA 4INOA 2O4CA 5AJUA 1F6DA 3RUFA 4OLHA 3USZA 4I0WB 4GVLA 4L78A 4LJ5A 1SA0B 2Q4BA 3WLSA 4F71A 3SHTA 2BEWB 1TCCA 3N75A 4BMPB 4ZI2A 1E5LA 3DD1A 5AO9A 4U2BA 1ONPA 4YMWA 1PGQA 2PG3A 5I7FA 2UXBB 2Y1FA 3PPIA 5A9TA 1V37A 1XZIA 3EC1A 3UWKA 1ARZA 5JFGA 1TGVA 3A14A 5TS3A 5TQ2B 1TUBB 4E15A 4PC7A 3FPAA 1QVAA 1FS4A 2R65A 1MBZA 2VT6A 3AFHA 3AY6A 2VPZA 5FBQB 4IZHA 2Q3HA 3TKAA 4IEIA 3MCAA 1ZG3A 4ZOEA 4HX2A 3V4LA 3H1TA 1N36B 1OBFO 4G4SO 3D4IA 4F3NA 1N8TA 3B3QA 4JUBA 4N5DA 1BWPA 4MITA 5T4BA 2PKEA 3PNPA 2ZVJA 4KPUB 2I62A 1P6UA 3SEAA 4ZYYA 2ZIZA 2DHCA 4WRRA 2ATXA 2I1LA 3SLRA 3JQPA 2YBDA 1OHHD 4FQ8A 2HNKA 1QVVA 2AN5A 4YFVA 1P2FA 4R2HA 3REFA 4R1UA 3VNRA 3JSAA 5TVKA 4MICA 3VR3A 2ONJA 1P9WA 3KT0A 2OXEA 4N3NA 5EIHA 2QX4A 3GB9A 3EG5A 1SC9A 4IRUB 3TLAA 1PFVA 2IUEA 4N48A 3E84A 3L4BA 3B52X 3HCDA 4FGWA 4P83A 1JEYA 3DL0A 2CXPA 4Q3KA 2PPVA 3FMVA 1Q1BA 3PFIA 3QELA 4LW8A 4QRDA 4J1SA 2OFFA 3SMQA 1MH9A 1WKCA 1R18A 2C84A 1EZ4A 1XT6A 1JHRA 5AK5A 3L0BA 1BFKA 1TJNA 2Q4DA 2PUFA 1U0BB 1OFTA 2CMKA 5FOQA 2ZYTX 4V0ME 1MZPA 2GSDA 5GOTA 4PLWA 5BQ3A 3QVWA 5TX7A 3GLVA 2XUDA 5FPPA 2V5AA 4UBOA 3SWWA 4X3CA 2FUKA 5F5LA 1CIVA 3WLIA 3EGXB 1IH8A 1HFWA 1G66A 3BE8A 3L77A 3IR7A 4AP9A 4QQKA 1BVRA 4MP8A 4ZN6A 4JI6B 5H8WA 2B98A 4IV0A 1PP4A 2O7VA 1XRJA 1TD9A 2LW7A 2YHAA 3GZNA 1O96A 1TT7A 4IKPA 3TIGA 4BY9E 4OKIA 4BJ5A 3AOEC 4BMDA 2NN3C 1V7ZA 3IOYA 4XUGB 2Z09A 4FX5A 3I9V6 5PGMA 2QLMA 1IAVA 2SKCA 4YP6A 1GUDA 4B31A 2Q5CA 1QVZA 1CS0A 1YCFA 5FBZA 1ZRHA 2G0NA 4RTSA 2P4SA 1QH0A 3HBMA 3I04M 2ZIWB 1L5HB 4KC0A 4DIOA 1OAOC 1DLIA 5ER9A 1Z62A 1JXOA 1H6AA 1L7QA 1MAAA 2A9QA 1FC0A 2B4YA 2AXPA 2R8YA 2RHMA 2WUGA 2GCEA 5BWLA 1YDHA 2RGWA 1MV5A 2OK7A 3FCXA 3SMVA 4WK6A 3BBPA 2ZI6A 1L2TA 2RIPA 1LPMA 1J0EA 3JD4A 1VIYA 5K51A 3GUVA 3Q5EA 4MV1A 3OMXA 1FP6A 3DE5X 1L5RA 1U8ZA 3NIFB 2Y6VA 2VJQA 3ZWWA 4IXDA 3OIDA 3VNVA 1XU4A 2O7RA 3WNBA 3BVPA 4P31A 3G0HA 1U3FA 2JJYA 5REQB 3E81A 4IH4A 2PZJA 4LVCA 4QSMA 3UXHA 4LZAA 3H7IA 3ZUPA 3VYSB 5EPUA 4NJEB 1J7KA 3KSRA 3Q9LA 5KMGA 4K6OA 3CNNA 1YRYE 5L7YA 3A6EA 2F6RA 2WFLA 1KERA 1D0SA 1THGA 3CGWA 2YZKA 4GI5A 4IFBA 1VOTA 1GQYA 5AI8A 3KT6A 2YJNA 2ZUVA 1KJWA 4B0PA 5K99A 2D0DA 3ETDA 3JU3A 4UDXX 3ZD6A 3TGPA 3KLNA 2YCLA 1FS5A 4MYRA 5IC4A 2BFMA 3K0KA 4K1LA 2CSXA 3EWIA 3JQBA 1NHGA 2FUNB 3IH5A 4A8JA 3RBZA 2JVJA 3DCNA 3M6MD 2XPCA 5TNXA 4B74A 5JS6A 1U8UA 5JQGA 2WSSA 2HY7A 4HEQA 4X97A 2JCVA 2O2CA 1TTTA 2BIFA 2XYRA 1TO1E 4B6PA 1ZM9A 3E27A 1CF4A 2VUHB 3G13A 3NOXA 2G5TA 2OHIA 3O4RA 4NBNA 4Q1AA 5ALOA 2VWGA 5ALDA 3UHPA 4FC7A 1NVFA 3E22A 1IWOA 4RK0A 1WZCA 4RH0A 3B7PA 2IY9A 1YOBA 4D97A 2B35A 2IZ5A 5FUXA 3H11B 4WLFA 1OX5A 1RP1A 4W8GA 2ZM6B 2AFVA 4YXWD 1PFUA 1PK7A 4UHHA 1ZWKA 2W8ZA 3K6KA 3MMZA 5LP1A 2OXRA 2CCGA 3X0DA 4F2DA 2O50A 4O5OA 3PQFA 4MHTA 3H4IA 2HIAA 3K5PA 3U1TA 4IAOA 2DWQA 2IOHA 5DBFA 3TAHA 1DFIA 4DGSA 4TLBA 4BKMA 4WXRA 3A31A 5AVWA 1X74A 2VO1A 3REOA 2PBRA 2VSYA 1AJEA 1QHHA 3ZWYA 3LUKA 5AJYA 1P3DA 5A4AA 1XRLA 4DV5B 2ZJ6A 1GUYA 1W48A 2PKWA 3GZNB 4N54A 4Q9KA 1MDBA 1RXUA 4JDPA 3SS8A 2OCXA 1LPPA 3MHTA 2QIOA 3MOSA 3NAMA 4AULA 4G8BA 2J4CA 3KJQA 2XAUA 1GEGA 1R9MA 1U04A 1R0SA 2JL1A 2QAGC 2Z56A 3DDUA 3HACA 4RHFA 1P1FA 2VRBA 3NS7A 3PFGA 4JMPA 4GT1A 2REQB 3G7NA 3WIEA 1P5JA 1Q11A 2WF7A 4EKGA 2FW9A 4LX8A 4I9UA 4KXMA 3MRTA 1BRMA 1C3VA 4WBSA 2NTNA 3DE2X 4RQUA 1TXGA 2IYAA 4YX9A 4G2NA 3F3KA 1FQJA 3FKSA 2P0EA 1KFKB 3ZPXA 2P5TB 2WHYA 4ITVA 4QQFA 4EA6A 1LBQA 3BHJA 5DN6A 5HM6A 3VSBA 4OA8A 2WJ4A 1AS0A 1RLIA 3AF1A 3FRIA 1J22A 3R6GA 4C7OA 4BJ1A 1ANKA 1P8AA 4PWZA 3ZOKA 5HRAA 2HTEA 1EFRD 4R2LA 4ALKA 5EPEA 3OCXA 1FP1D 1KFCB 1PJLA 5M5BA 1T0JB 1TO2E 1KQOA 1PR6A 5ADUS 3T5AA 1S2IA 1QNFA 3LP8A 4PXAA 2UYCA 5FV4A 4RZXA 2PU5A 3GA7A 5GM2A 3PL5A 1G1MA 3TKLA 2XCRB 4XCQA 1IBCA 1VPDA 2ZDHA 2QYHA 3H9UA 3U5TA 4UM5A 5AW1A 5JAOA 4FMBB 5HE9A 3JYHA 2HJWA 1QB7A 4D0SA 1NVXQ 2ET6A 5CYOA 3ODPA 2UUPA 3P19A 1BD4A 1MAWA 4K7JA 1ND6A 3VDNB 4RK6A 1IB0A 1YZYA 2PRZA 4HB3A 1N2IA 2WZCA 2JLXA 3WLMA 4GI3A 4RELA 1W76A 1YHNA 3KUDA 2AV6A 1W2HA 3R09A 3QWBA 1D8TA 2H0RA 3CZCA 1EDBA 3CUEF 5FPQA 4XJXA 3UWSA 1J23A 3GN2A 5IT4A 1RRCA 4H3HB 3UO8B 1OJ7A 2R8XA 5KTNA 3OPYA 1QRSA 3O8RA 2ZANA 3GJSA 1Z6PA 3MS4A 1ATIA 1NULA 2IS2A 3AR5A 2RJNA 1U3DA 4HN2A 2B34A 4IDEA 5F33A 2P67A 3GBSA 1X87A 3NOOA 4CPDA 4YNBA 3BKWA 3EYWA 5E1BA 1XRRA 5EUBA 5CA0B 4P3OA 2YZNA 4GGMX 2EWWA 2QW1A 5FULA 4F4DA 5DTJA 3WL8A 3WZMA 2AX4A 4JYZA 2VDKB 2RIRA 2WI8A 5TT0A 3H11A 4TTAA 4U2FA 1KRHA 5DBGA 4UEWA 1DTEA 1F8GA 4YB8A 1MIOB 4S1NA 2XWBF 4CFSA 2E55A 1HFJA 1GZ7A 2IWRA 4UJ5A 1TAUA 1GGEA 2J0QA 1J97A 2PKXA 2ZE8A 2ZVDA 3K6JA 3VOSA 4H9GA 1KEWA 5DCLA 3RUDA 3GLHA 1EEHA 1P1IA 2QUBA 2WE8A 2XLBA 2BHRA 2PLNA 3KJHA 1KSJA 3WWYA 1WVMA 3LBIA 4DXDA 1VHQA 3EXEA 3KPWA 4YGXB 1X13A 1NN1A 1W4LA 5AXCA 4DM4A 3BMXA 5BNWA 3GJRA 3DHEA 1FXWA 4PVDA 3VPCA 3KB1A 4WW0A 3MTGA 4QIHA 5JROA 1DS6A 1TW2A 3JAKA 4J0DA 4DN6A 5HKKD 3EFHA 3OEED 4QULA 5TQJA 1FTSA 2IRWA 4KQFA 1EUCB 1X14A 1U2DC 2I7TA 2FN8A 1DRJA 2YFKA 1ODJA 2DUNA 2QT1A 3SYNA 1XWFA 3QXCA 2MSCB 1PR3A 4G1VA 3PQ7A 4JQYA 1JXAA 1T4GA 4UVHA 5A6SB 3VYUB 3LUAA 1EM8B 2O3JA 1T9CA 1MOZA 3JATA 4P1ZA 1K9SA 1GWNA 4AN4A 4E3ZA 1DWQA 1II0A 2FG7C 3HY3A 1Z4OA 1EXVA 4ZO9A 3MT8A 3F98A 3PQCA 421PA 5IASA 2Z58A 4ALLA 3W6UA 4GSLA 4XD7D 2G8LA 3C39A 3BD9A 3GW8A 4DA4A 5CDGA 3E15A 3DL4A 4FKBA 3ZX4A 1LV7A 3B5EA 5KYWB 4RM3A 5IJWA 1DQSA 3PHJA 1ST3A 3K0BA 4AG6A 4BRSA 5A3QA 4KNYA 2IP2A 1DKQA 1EK1A 1XZLA 1ZU4A 4WMLA 5E8RA 4ESHA 2CDNA 3E0XA 1S1CA 2B2CA 1QHXA 3WGMA 3DDNA 2BTEA 4B2PA 2C7OA 4PHTA 3STUA 2QLNA 1MX3A 4GX5A 4QNNA 3KK0A 2RHBA 5LC1A 2O54A 4LJ9A 5TGTA 5F9MA 4RLFA 2IW3A 4UQPA 1I7SB 4DIBA 1JZQA 1ZGGA 4BUCA 2O8DB 4FINA 3S2YA 1PG2A 1G2QA 2R44A 2VOEA 3PEWA 3I0NA 3R0QA 3RHFA 4BE9A 8GPBA 1FUUA 3L41A 2ZVPX 4D9CA 1FFHA 1NR1A 2WG0A 2XWQA 3CX7A 5DRYA 1MP0A 1WKVA 3TRKA 5F23A 2YJTD 5HKAA 2Y1LA 2ONKA 5LM3A 4URFA 2QRKA 3QV1A 5G1PA 4YC7A 3BIFA 2C4UA 3F6YA 1DI0A 1T8UA 3JTEA 3QVGB 1HE4A 1H05A 3FDZB 3S4YA 4LJ6A 1XC7A 3ADKA 2D2EA 4DC1A 4KHPB 4BV2A 4HCJA 1X8XA 2OCDA 2C88A 2YQ5A 4FFBB 4MIYA 4UASA 5CA0A 1AM4D 3K1ZA 4DRXA 1UXOA 1X8JA 4P33A 3GVCA 2ES4A 4GR9A 2YHIA 3B1JA 4DCJA 3T0FA 3R7AA 5JNRA 1ZRNA 3G0IA 4WLOA 4G65A 1RWBA 3JWHA 3VU9A 4DDTA 3NCTA 4N39A 3FZQA 1LB1B 1OV4A 2V8OA 4MQUA 5IBPA 3I28A 3WB0A 2EVWX 3B7GA 4MPJA 1T4BA 3LC1O 1L5FA 3PVSA 1NFQA 4CQLA 4JCCA 3M6XA 2Q2QA 4BXOB 3SBEA 1Z7BA 3GLTA 4J4BA 2OD9A 2XUGA 3TPCA 3K1AB 2IUYA 4N7RA 2YHUA 4B3IA 1HE2A 4CKYA 1HRDA 1PDOA 1LI4A 1M8JA 3C14C 3TOSA 4LI3X 4PGHA 4V0LA 1EHIA 4MQFB 4MKZA 5KYGA 2VCEA 4W1RA 4FDUA 3JAKB 3FJYA 1YFLA 2H9IA 1GTVA 4M1TA 3AR3A 4CM7A 4JJFA 2DFPA 1IVNA 3L7CA 1XFAA 5EXPA 2KM1A 1UK7A 2QLBA 5IF3A 2AOUB 2WTAA 5JT1A 1UT6A 4NYJQ 1GCUA 1OIWA 4R81A 4CIVA 4AZ0A 2FMUA 2H5EA 4OSPA 1ODCA 4M6WA 3ZCUA 1ACMA 1MENA 3DHWC 2UUOA 3BRSA 4YJFA 2VBFA 3DNFA 5G2OA 3ZWOA 2WJVA 5LCXA 3O1JC 3EC7A 2ZBVA 3GRYA 3X1ZA 3IILA 1ZP6A 3FHJA 2BBWA 3ADOA 2P9YA 2R7MA 4D8WA 2GGSA 1UJBA 2BFNA 4HZUB 1UKYA 2BMDA 2I2AA 1C80A 2RHJA 1VE9A 5H3HA 3S2IA 4E3WA 5JPDA 3RYCB 5EIBC 3KVYA 1JEEA 1APBA 5CK5A 3PUHA 1HE1C 1VRCA 2CJXA 2WZDA 2DHEA 2ZRAA 2GN9A 2ZDGA 4OXRA 1MD9A 2HO4A 1R10A 2SCUA 3QPAA 3D4NA 1IHUA 1F17A 1Q3KA 1UAYA 3PLRA 4JUIA 1L8AA 5ELMA 3RH0A 2FMHA 4AJKA 3A3OA 4PYLA 2P1DA 4CM6A 4HY3A 1BW9B 1Q7GA 1PJ2A 1UJ5A 1K7YA 2FPOA 3MWKA 4U5QA 3SS9X 3WHKA 1YNOA 3D4PA 3DGEC 3GT7A 4XUEA 3PR3A 4ETIA 3ADBA 4C2TA 2ZI3A 4XR9A 3U13A 1JG3A 4D8XA 4F92B 4B80A 5K8VA 2WKRA 1J21A 1U02A 2PT9A 3AI1A 3MLEA 2DTXA 5GV7A 1A2QA 3DMTC 3BWVA 1HBJA 3RK0A 5LQSA 5JUWA 1R0YA 3K0CA 3T7JA 5ECGC 4OXYA 1RWKA 4HZGA 2YDXA 3E9NA 1JILA 4QTTB 3MSXA 3D4BA 1KYXA 3RS9A 4GLLA 3HCNA 2X5JO 2I8CA 3VI4B 4G0UA 4ZAXA 1TYDE 2DZDA 1QUEA 1LQTA 2J5RA 4RVDA 4DJAA 2RK6A 3SJZA 3F1KA 2J0UB 1Q92A 4JGBA 4LQLA 3SJBA 3CG0A 4BFYA 2IEAA 3LUDA 3QMWA 4J2OA 1S3IA 1C3OA 2OUKA 2PD6A 2VP3A 4U9UA 1QHNA 4ARAA 1U8EA 3M5WA 4TYYA 1OILA 4WLNA 1LZKA 2JC3A 4HHEA 3I9OA 4JI1B 3VTAA 1ID1A 3KQNA 2OEPA 4LOLA 5CBPA 4XCXA 4ZT6A 2F62A 3KJNA 4JXZA 3AYZB 5GPBA 2ZXFA 2A1TR 3GLGA 2J67A 4UUPA 3AHIA 4ZKEA 2VXBA 4GOMD 4L0MA 4PHHA 1IVSA 1E92A 1QYDA 5HW0A 1YRAA 2PH5A 4LNAA 5KNCD 3VYRB 4Y2GA 3LLUA 1X7ZA 5CLGA 4MROA 3ZE7A 4RFSA 1UMCB 5D5PA 5E1OA 3ZZMA 4ZAGA 3IAXA 2GHTA 1ENYA 1A9SA 1DRUA 1DIOB 1M10A 3NGMA 3S1AA 2VPIA 4AYXA 2ZETA 1WCYA 1WNFA 4HTFA 1HYBA 1M2EA 2OBNA 3LU1A 2G08A 1T9KA 1H2HA 2FFJA 3UIEA 1A4RA 1CJUC 1DJNA 3WAGA 5KSYA 5AT1A 1CDOA 2BCJQ 2VJYA 3KKZA 1XQXA 3M4YA 4R2MA 5KZMB 5HILA 1U7HA 3FVRA 1BE1A 1I0LA 3DPSA 2P5UA 3U4IA 1O5TA 3F2VA 5ECWA 4MPDA 3EULA 4XWTA 2EBUA 4IIYA 3KQYA 2FPSA 1UOEA 4ZQBA 2F59A 3G7SA 3D8RA 4P3KA 4UMDA 1QLJA 4RK1A 2I33A 1IPFA 2XQFA 3HU2A 4AG3A 1YR6A 1CDEA 1YU6A 2J6HA 5HF8A 3ROKA 4MS3A 2J8ZA 1XI2A 3I72A 3BAZA 4MVJI 4XGNA 4EA8A 5ITZA 4YO7A 1YS4A 2IW1A 2YL2A 1NXXA 1WHTB 2FSVA 3N0TA 3WWZA 3H2YA 5EKXA 5SY4A 2BI7A 2DE0X 4B7CA 3X2EA 1SK8A 3EDYA 1OX4A 5LB2A 3ON5A 1ZD1A 3SXUB 3GPIA 1RLTA 5E2BA 3VNSA 4NATA 4JXJA 5DYYA 1G7RA 5KQLA 5ANRB 4ZXPA 5BN5B 5CD1A 3AHFA 3ZGNA 1B2RA 1L1EA 5JS2A 3AM4A 1BCRA 2XDAA 4FMDF 3WK9A 3LC2O 5CVJA 1E96A 5ALKA 5GGYA 4GW3A 2R1UA 2D5CA 4ZZIA 5JR3A 2O2GA 4XOUA 1O4WA 2AN3A 4FYMA 4W5RA 4HSGA 4RLQA 5E4FA 1VSBA 1EXWA 1JIUA 5H16A 1CG6A 2CV2A 2IS4A 3CPSA 3JCZA 1KJ9A 2QLFA 1M0EA 3ER6A 4B4OA 4TKVA 1CUDA 1IIRA 2NSLA 1EFVB 3D0QA 4NBRA 4U39A 1JEQB 3TIFA 4BB0A 4QPDA 2WWYA 5IT0A 4PXYA 1WXQA 3DW3X 3OLYA 4D3ZA 1E8MA 3DV0A 3HK2A 1D6MA 3IMCA 1V5FA 4A36A 3OLXA 2HV8A 1XZ8A 4GOXA 4RJLA 4AQYB 3KQQA 2JAUA 2C92A 2XNHA 2Y0PA 2WAOA 1ZD2P 3MOGA 5FUBA 2XXAA 1BROA 2X9VA 2Y9PB 1MEJA 3DP9A 1PW5A 5FUWA 4R68A 3KCNA 1YZFA 3N53A 4GD3Q 4P4UA 3ZTTA 1PFYA 4B6RA 4EO9A 3TZBA 4DFDA 1LPSA 1P9OA 1N9GA 3ZV6A 3E9YA 3WBKA 3D2BA 4EMBA 4ZJYA 1ULTA 3STYA 2XLCA 1Z39A 2N42A 2PRJA 5BORA 2R96A 3LI2A 5CA1F 2A9KA 3FZNA 2QPOA 1L7NA 2GM5A 1C8KA 3KXDA 1OXSC 1XVTA 2Z2YA 4ZANA 1FSSA 3IVRA 3ZQ6A 4BWVA 1SG9A 4EKYA 5KX5B 3VKGA 3EPJA 5TQVA 1UMCA 1IXRC 3ETCA 1CS4C 1CQIB 4XR4A 4CIDA 4CLRA 3FYHA 4IV8A 1C30A 1B8NA 1WD5A 5BYJA 1G7CA 3BA1A 3ZGYA 5HXAA 1A8IA 3H2KA 3KWLA 1VYHA 2W2XA 4UEKA 3CEMA 4G5YA 2P2DA 3QSGA 4LDPA 3FOBA 4CGZA 5DHAA 1FNCA 3MQ4A 4WOJA 4DJDC 1SBHA 4TVBA 1UZAA 3PUXA 4ZXFA 1LV8A 3WNCA 4NFSA 2X8JA 4CMBA 3FSGA 4MR9B 3GCXA 3LQ2A 5L7WA 1PUIA 4MLCA 5CK4A 1LBHA 4ZQGA 2YNMC 3NEYA 4F3YA 4HYTA 3I2YX 3L40A 1ABEA 3F49S 2PS9A 4I14A 2AI2A 1TT5B 3OC0A 1WUJS 1W0KD 1H5QA 2GPYA 3R0JA 1Y3HA 4BECA 1FVHA 2I1VB 3OE1A 6LDHA 1PE0A 1ZH8A 1L5OA 3RSCA 2J5XA 1WHTA 1BS9A 2O2EA 2CNNA 1FTQA 2CK3D 2VT2A 4PG4A 1UK6A 4MV6A 1E5QA 1VKZA 4P8RA 3MG9A 3UPDA 2MSLA 4QNMA 4FFDA 1DZ3A 3NYRA 4NYJR 4ZO4A 1BRTA 1OFIA 4QYMA 4V38A 2VA9A 4FKZA 1U9JA 1T10A 2QUKA 4XWOA 1Z07A 3DTYA 3KYCA 2FRDC 3ANSA 1F60A 2QX9A 3IPAA 3N8HA 4KRXA 2XCQA 4XVUA 5CB8A 3D6AA 2FWMX 3DV2A 3QLJA 4PN3A 2PS0A 1EHYA 3K53A 2IPAB 3OZDA 4WBNA 2CJPA 3Q3VA 5CRIA 3RFUA 3WP1B 3HCFA 3GLIE 3U17A 4EFMA 1H3EA 2RFLA 3CLSD 3LZDA 3K20A 5AVVA 1SXQA 4FN5A 3FR8A 4OM8A 4P0TA 3CVVA 2OSBA 1Y8RB 2QTCA 2G63A 3LJKA 4RQTA 3RUAA 2V7UA 1NJ2A 1EFVA 3TLGB 1SELA 4JJZA 4BVLA 2PCJA 4QTYA 2BGKA 2GF9A 3K32A 5B37A 2ECFA 4WNIA 1KKUA 5HTKA 3T12A 9LDBA 3DV0B 1U80A 3FTQA 5MFPA 4PQEA 1KU0A 1DX4A 1SO8A 2WIBA 2ZJAA 3QP9A 4MYTA 4HADA 5AOVA 3GQBB 5K09A 2BSAA 3WFJA 1WHSB 3E7PA 1QB8A 1ZI6A 2N47A 1M7HA 2Q5FA 3L46A 1II9A 3CWZA 4WN9B 3UA4A 4YDQA 2B78A 3OEHA 2O8EA 4P38A 4RX1A 1QGED 2QM3A 4C7XA 4EPWA 5C8VA 1TEXA 4L6CA 3ZVMA 3BB4A 4X3PA 2HLPA 3GLHE 2PGLA 3B6KA 3EXHC 2XOKA 2E5FA 1JE0A 5WRFA 4XYGA 3JPYA 3UKDA 2UUBB 3DWGA 4WFIA 1K92A 1CEYA 1HOXA 4Q4HA 4FWIB 4ROTA 5F4BA 4IM7A 2XY4A 2EL7A 3HCOA 3NLLA 4F5ZA 1N57A 2O2HA 3DFUA 5IP5A 4DR4B 2XB8A 4S3MA 4UUAA 4GEKA 5TR9A 2A0UA 5KTMA 2GZ1A 1LCIA 2HPAA 1ZJ4A 2QVZX 3QNMA 5DGHA 5JD3A 4K9RA 1K89A 1I4EB 1NDUA 1QIGA 3ORHA 4N0EA 4EITA 5JANA 3FVVA 1KS9A 3OEWA 1NSFA 3Q2OA 4HOYA 5KSWB 3GEPA 2LCQA 1PDWA 2G04A 3BZWA 3E3MA 3LBAA 4U7PB 3JZAA 4MUHA 5IZCC 1UAGA 4KQ9A 5L95A 1SCAA 1AV6A 4MB0A 4LEIA 3QFFA 2QE7A 4QU0A 4R2JA 1UP4A 1LLCA 1VLJA 1YVRA 2ONZA 1EGAA 2FR0A 1FTWA 4R8KA 1XDGA 1GQFA 2O48X 2H17A 1YVPA 1MNAA 3UXEA 5DGDA 4PGMA 3VAYA 4A6EA 2OM2A 2YVKA 1YIAA 2C4KA 2EOAA 3IUMA 3IODA 3OT5A 4KBFA 1U2EA 2RK4A 4C4RA 4WLVA 5DGTA 1KI7A 1OLUB 2Z1NA 1E9CA 4TLDA 4ER6A 1ZN8A 1PHRA 1QV7A 1KH1A 1T9AA 3D0OA 1XPOA 4P7JA 2CUKA 1TECE 3CCBA 4JEIA 5L3VA 4E09A 1K86A 4P98A 3K5IA 1I4LD 4EFDA 2JI4A 3P9SA 3ZXXA 5KHAA 3M82A 2AG6A 3AR2A 4NARA 3F5FA 2R8ZA 3O8QB 3QTTA 1YL5A 3LTEA 1ZS9A 3PE4A 3GUHA 2BMAA 3ZW8A 1NPTO 1HZZC 4OMFG 2X1VA 3K9WA 2VJDA 3RTEA 4DR7B 1SH7A 2VAWA 1UWKA 2C29D 1TEHA 1EG2A 3HKDB 4DR5B 5F9HA 1WUHS 3AJ8A 4BP3A 3I5UA 3DH0A 4OYHA 5AKYA 2FEPA 2X14A 3IO5A 4JOQA 1BCSA 4TXNA 4Q9AA 3TPFA 2VJAA 5F78A 5ERXA 1LFDB 1S3FA 4H7HA 4UU1A 3AKYA 3NBUA 3B9QA 4UDOA 4JNCA 5HZMA 3X3HA 3BPSA 1LA2A 2IXAA 2IYNA 3MGAA 2JK1A 4F8YA 3U48A 1HE5A 2LKDA 2MYUA 4EHLA 3N0RA 3OHMA 3Q2IA 3HVHA 4WJZA 4E4YA 3PRKE 4OL9A 1BKYA 1HDZA 5DHFA 4B81A 1FP4A 2P2ZA 1AURA 2MSWA 1FIUA 1C2TA 1LX7A 1PGOA 4KH1A 2QP4A 3G9QA 3F6CA 3PYMA 1P2DA 2Q2OA 3FWKA 2QI9C 2OLKA 5F1OA 2ARKA 4EUSA 1UFQA 4KV9A 1EM6A 5KYNA 3CRW1 5U1PA 4WECA 2WJ6A 4C89A 4MQEB 2ONYA 4U2DA 5COBA 4PC6A 3MCVA 1NZDA 3T7IA 3ZU5<