4M1TA

Crystal structure of small molecule vinylsulfonamide 14 covalently bound to k-ras g12c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
163
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 63
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1tA00
1DG1G 1CJTC 1CR0A 2IC5A 4DSOA 3CB4A 2O8FA 2ZVQX 3BC1A 2W2VA 4YXWD 3U4QA 4B74A 3KXIA 2QZ4A 2VQSA 3QKRA 4UXJA 4V0NA 5CK5A 1QG4A 2ORIA 1Z2AA 4BWYA 4GBMA 1CR1A 2QPOA 4M9SA 2IEZA 3AVQA 1XEXB 1TQ6A 1XD2B 3C7KA 4KODA 4UNSA 5CM9C 3FFBA 1ZUNB 5E3HA 5J47A 2BCGY 2FE4A 2NPIA 4LJ5A 3SEAA 1LY1A 3Q7QA 1M8PA 4GMXA 3SBEA 4IDQA 1R2QA 2F1JA 1COWA 5E7IA 2EFEB 3KXKA 2VHJA 3BAFA 3X1DA 1G21E 3W6OA 2P6RA 4CEIA 1ZNWA 4ZI2A 2XXAB 3QF4B 4I1UA 1RPZA 1UAAA 4K46A 4CT4B 5E95A 2K5UA 1J7KA 1Q1EA 3PJRA 4QJ5A 4BLSA 4LBYA 2I4IA 2FSIA 1VCMA 4M1SA 3THYA 1RRFA 4BFSA 2NPFA 4GMDA 5AUPB 2PJZA 4W5JA 4Z1MD 4KXFB 1G6OA 1KHTA 4B33A 5KPDA 4AG5A 5JMTA 1GNPA 3QOFA 2AD5A 1JBKA 4Q4AA 1A82A 1UKZA 2EFGA 4DLSA 4Q4LA 4CYMA 1W4RA 1N6LA 2ZITA 1J8YF 3CNNA 4RD4A 1ZIOA 3DL0A 4HUQB 2QGNA 3CLVA 4V02A 5EP4A 3THOA 3VR2A 5L3VA 2ZYWX 1WE2A 1X86B 1YRBA 2CHQA 1VG9B 4MYHA 3GEHA 2O8DB 1R0YA 3B85A 1W4AA 1IXRC 2XSZD 1SZPA 1ZNZA 1G17A 5KTYA 2HV8A 4C2UA 2AWOA 2FEOA 2HXYA 1FW6A 2R65A 4EPWA 4KVGA 4B44A 1OIWA 4WBSA 2X77A 1RRPA 3TR5A 3ADCA 1JB1A 4I4LA 4LPKA 1IN7A 4X8HA 1OXUA 4MGZR 4A92A 5DI3B 5ANRB 2W00A 3LX8A 3OZXA 2IYXA 4OQNA 4TMKA 5L3QB 4C7OB 4TYYA 3B1VA 5EXXA 4DT1B 5DI9A 4JBXA 1CTQA 3GFOA 5FR2A 1VG1A 1JPNA 4KO8A 3GLIA 4LHZA 3REGA 2AK3A 4GNKA 4LBWA 2HF8A 4OHXA 2ZUBA 5FBRB 1E2JA 5KNCA 1GVNB 1XXHA 1DELA 4IKEA 3SQXA 1YR6A 3A1UA 4MA4A 1VCOA 3OFNA 1RJ9A 4EJSC 3RHFA 1N6IA 3RANA 4L15A 1PVOA 3LY5A 4OJQA 4KBGA 2WIBA 4JBYA 2ZJ5A 3QXXA 4R98A 3K9NA 1II0A 4HAXA 4N3NA 4D0LB 4R2HA 4LHVA 3VU9B 4M9QA 5LPNA 1SVOA 1D6JA 2YZ2A 3T34A 3QKTA 2JA1A 2NO9A 1GOTA 4D6PA 4ZCIA 1CF4A 1EFRD 1G7SA 5A4JA 2IL1A 4PPGA 2JLWA 3WYGA 1XDBA 4QOSA 1GSIA 1JPJA 4KSCA 4JMPA 3SYKA 3KUDA 1LS6A 2FN4A 2GEDA 4Q7JB 5EE3A 4Q5IA 1NN1A 3BORA 3AF2A 4Q4HA 1KKMA 5GVRA 1ANKA 2OLKA 4HATA 4US1R 4DDVA 4PHHA 1LV7A 1YR8A 2QQEA 3TUIC 2HCBA 3LNCA 1B0UA 1IJFA 1HUQA 3I61A 4K81B 3WMFA 3B9QA 4URWR 5HTKA 3FKSD 4PSVA 5GJCA 4CEHA 2JJ8A 1EWRA 1TADA 3SE0A 2QSZA 3BJIC 3K70B 5GJVC 4G0NA 2DHRA 1VYTA 3ZQJA 1JI0A 2IS2A 3PXGA 1FNNA 3KB1A 1G3IA 2GCOA 3HDTA 4C0SA 1WA5A 1T5IA 2WWXA 3PUXA 2GF9A 4FMCB 3GLIE 5JJLA 1AGRA 4URYR 4JZKA 4Q7KA 4L9WA 1TTTA 1E9FA 3AGPA 1CXZA 2R6DA 2WPDA 1XWIA 1WBDA 2XZOA 4XVQA 1U0LA 1G16A 4LHWA 2FGJA 2WAXA 4TT3D 1W5TA 4ZCMA 2P5TB 3IHLA 1L2TA 2ATVA 2P65A 2Q21A 4C0JA 4D26A 5FL3A 4XSGA 2MSCB 3ZZTA 1A2BA 4W5HA 2BEKA 2G0TA 1OT3A 1CRPA 2F9MA 4V0LA 4B6EA 3GLGE 5KDLA 2JJ1A 4PHGA 5GJBA 5LB4A 5FUWA 1UKEA 5HPYB 1Z5ZA 1G5TA 3FMIA 4V03A 4RKFA 4YONB 4OI4A 4D4LA 4JIMA 2FPLA 1DOAA 3B8HA 1XB2A 3ZQ6A 1Z07A 4LPSA 1AKYA 4NP6A 4A9AA 2ZEJA 3LFUA 1KJZA 1IM2A 2E87A 4GP6A 4R71A 1OH6A 2W0SA 1XTJA 4NZYA 3M1IA 2IF2A 3CW2A 3GLHB 1I4LD 5J4VA 4DLVA 2PCLA 2G1KA 4FMBB 3THWB 3VAAA 3AKEA 2VIIA 4AKIA 4PHFA 2ECKA 3NH9A 5E7MA 1KY2A 2FH5B 4I1OA 3ZS8A 1E32A 2BCJQ 1PJRA 1KI2A 4P4TA 2ZJAA 3PVSA 5JSZA 5IT5A 2R6GA 2GVZC 2YHSA 2BVNA 3CF6R 3C15C 1GL6A 1U0JA 2GXQA 2WWHA 3CKLA 1IY0A 1Z2CA 1QHNA 4G1UC 2XNDD 3ZGXA 4B3FX 1HH4A 4YMTA 1DE0A 1Z29A 2CLSA 4F38A 4JYBA 1DAMA 2GNOA 3VR1A 3WHKA 2GXUA 1XZQA 5HKKA 3FMFA 4NYMR 1VYUA 4NONA 1LS1A 2GCNA 4RFSA 2GESA 2D06A 4IEIA 3GJ0A 4G3XA 4LJYA 4DXAA 2MMCA 1DAHA 4NYMQ 1XEXA 4QBGB 2IYLD 4TSFA 1XD2A 3WMGA 3KB2A 3SYNA 3I1FA 1V43A 1DEKA 1MH1A 3NHBA 4H1VA 1NVWQ 1NG9A 1FTNA 4H9GA 1A2KC 4N1AA 3LX5A 3PFIA 1H8ED 2VP2A 2J0UB 2ODBA 4YMVA 2JATA 4PQFA 1ZM3A 3B9PA 4DEXA 2XXAA 3QF4A 1G8FA 1VTKA 3DOEA 2CNWD 1OFHA 5JRJA 2YC4C 3E70C 2LKCA 4PSAA 4HLQB 5E4FA 1M74A 1IN4A 1W4CA 1N6PA 1II8B 2QTFA 2CK3A 2DFNA 2P3SA 2P6NA 4Q9KA 2PLRA 4KHZA 4B2IA 4QM6A 3W8NA 4Q1DA 1KYIA 1UBGA 1XF9A 4LWZA 2J87A 1GZSA 1OSNA 2V9PA 1U2RA 2EWVA 3W34A 1GITA 5KOYA 3EX7C 1YR7A 4O25A 4RD3A 1CBUA 1RYFA 4TLDA 2IA5A 3F0TA 4EPXA 1D9ZA 5CYPA 3WBKA 2W6JD 3A1SA 4XWAA 3V4FA 1G6HA 2FSHA 1XCGB 2YNMA 4IW3B 4HUQA 3TK1A 3ZD6A 3AUXA 1SQ5A 5C46F 2V6IA 1RC8A 3L8YA 1GKYA 4RZ3A 4OK3A 5EP3A 4JJKA 2CLDX 2ZUCA 4C3ZA 4D2IA 4TZ6A 1R4AA 2WICA 2OILA 4DCVA 3R9XA 4DIEA 2XNSA 3TAHA 3U6BA 5DLQC 2ZYTX 1E1QD 4MYCA 3A4MA 3HWSA 1Z08A 4TLAA 5KO2A 4C2TA 5DE3A 1FPMA 5EUQB 1G18A 4NPHA 5BQ5A 5DI3A 4B34A 1UDXA 3MMPA 1KDTA 4D81A 4C7OA 4E03A 1N5LA 2RKOA 3CIOA 4DT1A 2BMDA 4O2RA 4XWKA 5EXSA 4CDGA 4NCIA 5TXGA 4DCSA 1MO3A 1OIXA 4KCGA 3AF0A 4PAMA 2FZ4A 2WV9A 1X8LA 4TLBA 2FFQA 4MYTA 3ZD7A 1U98A 2WKRA 5K8UA 1OB2A 3RVBA 2QAGB 1E2IA 5DGXA 2ZSAA 2GWHA 2C5LA 1P73A 4OKSA 4PPNA 4A6PA 2OBNA 4MRRA 2MSDB 3LXRA 3NG1A 4TMXA 4KFTA 1GAJA 1MOZA 3DO6A 1HEIA 4UNNA 3I72A 2AR7A 3K09C 3GCGA 1JR3E 1YZLA 4KSBA 3HYRA 3KKMA 1G3RA 3NBXX 4D4KA 4EJSB 4XD7D 1XMIA 4GOJA 4BFYA 3TVTA 1WRBA 2HT1A 1N6RA 4L16A 4RD1A 1E79A 3PUWA 3MCAA 2IYWA 4BZXA 3LXXA 4AURA 4HLDA 2H92A 1AS3A 1JEDA 1QHGA 2W83A 3FMPB 1IHUA 2X2FA 3LBHA 3X2SA 2QT1A 4PSKA 1UADA 1HV8A 2XJ9A 1RKBA 3EPLA 4AYTA 2ZJ2A 1W0JA 3BFVA 4JLAA 3UG6A 2RMKA 4DLUA 5F2EA 2RAPA 3SJZA 3RS2A 4YMUA 3WMEA 3K53A 1XMSA 5FPTA 1Z0AA 4HLCA 4BQSA 3SNHA 2CBZA 2W0MA 2ZU0C 4OQLA 5DISB 2QN6A 4JLMA 1Z22A 2QM8A 2W6IA 1J2JA 3BFKA 1OH5A 2WJIA 1AZTA 3CRMA 1C1YA 4PC2A 1FP6A 3EG5A 3RRMA 1LW7A 1P62B 2AXNA 3BH7A 1GNRA 5FBLB 1F2UA 1OYWA 1UJ2A 3EXAA 1E98A 2O8CA 3EIQA 1P2TA 5IDVA 1SVWA 3BD9A 2PH1A 3SU8A 3NC0C 2R2AA 5G3YA 4TL7A 1NVUQ 3W9YA 3EA0A 3AVXA 4YMWA 4HAVA 2DFKB 4IXMA 3BGWA 5CLQA 1AKEA 2PZEA 3RC3A 2XEXA 1G4AE 3AVTA 1ESNA 2J46A 2G0NA 4RKEA 5KYKA 2ZE6A 2ZRGA 3TQFA 3OEED 2IHBA 4LCBA 4TYNA 4JVMA 2FDCA 4UNQA 1PV4A 1TX4B 2YVUA 2BM1A 1LFDB 3UWOA 4LJ6A 5CJPA 1SULA 4WXPA 2PX3A 4DJTA 5TMPA 3HYTA 1FMLA 2RGAA 2OV2A 4F4CA 1KDOA 1N5KA 5D3MB 3KKOA 4LYJA 2QMUA 4BLPA 1LF5A 3I92A 4BLTA 3U3KA 2Z43A 1I4DD 2DR3A 2ZSBA 221PA 1W48A 2F6RA 1KI9A 5JHHB 2QPAA 1DPFA 4TYQA 3RSOA 3GLHA 1FX0B 5KUTA 3IKJA 2WSSD 3AVOA 3THWA 3GLGB 3PCRB 2WMOB 1E2QA 1RIFA 3I4LA 4Q21A 2GJ9A 1DAIA 2PL3A 4HDOB 2ASEA 4W9MC 4F4JA 4HDCA 4Q1CA 3I62A 4PO9A 2OXRA 1Z0IA 3O8RA 4LDJA 1Y63A 3BS4A 1G41A 2IF0A 2BMJA 4V0KA 1NMZA 3FFAA 3DM5A 1KO7A 3L0IB 4LHXA 1UFQA 2OCAA 4W7SA 1GKIA 4LJ8A 1IOZA 3I5XA 1E9CA 5LDDC 2Q9BA 3T5GA 2ODEA 3DZ8A 1I2MA 4GPTA 5IK2A 1XEWX 3E5HA 2HF9A 3PUYA 3NH6A 4KYUA 1MRSA 1BS1A 2XJ4A 3CWZA 3V9PA 1IXSB 5FH9A 1GDDA 4MRPA 4BFUA 4BRUA 4URVR 2I3BA 3IBYA 4QGHA 3TMKA 3CX7A 2FOLA 4QL3A 1Z6YA 4WXRA 2DWPA 5FI1B 2CDNA 2FEMA 3QQ5A 3T61A 3AF4A 3SR0A 3UANA 1N3BA 1BKDR 2IUTA 2C99A 3ASYA 4MUBA 2ZM5A 2EQBA 1ZBDA 2WHXA 1KSFX 2J0UA 3C41J 2HYDA 2D7DA 2V7QD 4PO8A 4US0R 4RSGA 4LY6A 4WW0A 3R7WB 3PUZA 1E1RA 3EZ2A 1NMXA 4JL8A 4IDHA 3CRW1 4E22A 1II8A 4JJZA 3SJAA 3H2YA 4FXPA 4LJ4A 3MUFA 3MWLA 3NEYA 2QL6A 1IN6A 3OHMA 1W1WA 2C03A 2IYVA 2CE2X 3KQLA 3OF5A 3CPJB 2EYUA 3REFA 4IOMA 4B3BA 3JZMA 1X1SA 5KSOA 2O0JA 3TLXA 3U3JA 1P75A 4ZPXA 2G88A 2JEOA 4PX9A 4OK6A 1X8JA 4KJZA 3C4JA 4UQOA 3ZH9B 621PA 4Z54A 2PLFA 1JQLB 2HJGA 5FFMA 4JLVA 4F92B 2ZS7A 5JJKA 3TH5A 4HYYA 2NG1A 3CR8A 2DFLA 4XOIA 2H17A 4CEJB 1NBMD 2HXSA 4Q7LA 1X8KA 4PC1A 2KBFA 2HLDA 2VBCA 5H70A 3PQCA 1SKYE 2UKDA 2ZANA 3TUZC 1ZM7A 2REOA 4KV9A 4D4MA 5JEDA 2F9LA 2GILA 4IOLA 2PT5A 1UKVY 5EXTA 1ZD1A 1NP6A 4P4SB 1OXTA 1ZINA 2ZYVX 3P1JA 2NO7A 1RYHA 1YZNA 2OHFA 1ZM2A 4LC0A 4LYHA 2QAJA 4QRHA 3CO5A 4N0EA 4M1TA 3CX6A 3N2IA 5FL7A 2GKSA 4MKFA 5H8WA 521PA 4LOAA 1LNZA 3IHWA 1CR4A 1RVDA 1Q57A 3K0SA 5HE9A 1KSGA 2OM2A 5BXQC 2ZI3A 3C8UA 1NLYA 2QAGA 3UPUA 1JAIA 1E2KA 2YV5A 4JSYA 1G9XA 4Q1BA 5C4GB 2XZLA 4B73A 3DMNA 1E3MA 1MO6A 3B5JA 3QXHA 2J0VA 4A4DA 4GOKA 4PO1A 2QEQA 2QBYB 1QHYA 3A58B 1RZ3A 3PG5A 2LKDA 5SZKB 3T1TA 5FBVB 1EG7A 4O0MA 4EJSA 2IYSA 4GRAA 5CITA 1R0WA 3KQNA 2XB2A 1XTQA 4PHTA 3VR3A 1VG8A 2X2EA 1N2CE 1YZGA 4DLRA 1GP2A 2WJHA 2F1HA 1COWD 2XZPA 4KU4A 3DPUA 5H1YA 1F2TB 1NF3A 4B43A 2GJ8A 4ASUA 2QG6A 2IYUA 1P61B 2BBWA 2CJWA 3AGQA 4CRWB 5EQTA 2FJUA 5BYJA 2VTKA 3AKCA 1DTSA 1AQYA 1W36D 1TMKA 2DFTA 2YOHA 3N5CA 5CIWA 3ZIAA 4A8JC 1NKSA 3MWJA 3QEOA 3NDBB 2QP4A 3KQKA 4NU0A 2ZPTX 2J45A 1G7TA 5DSZA 1KO5A 1R6BX 3GFPA 1GL9B 3EC1A 3D3QA 3CRVA 2ANBA 3H1TA 1FFHA 1NY5A 2Z6VA 1S1CA 1KJWA 3U5ZB 3QNUA 1AS0A 4M1OA 3Q9LA 3GJ4A 1QF9A 2ODWA 1OHHD 2OUKA 4GZMA 1DVRA 4Q9LA 1ZRHA 1QG2A 3TAUA 1XPUA 4LBZA 3CNOA 2GRJA 3GD7A 1CP2A 4HAZA 4FN5A 3LV8A 4Z1MA 4EDHA 3LRPA 1KK1A 2H8KA 4U7DA 4DB2A 2R6FA 1Z06A 1N5IA 4LJ9A 4RZUA 4WZ6A 4UJ3A 3W8RA 4DEYA 5FR1A 3SDZA 1BYUA 1Z83A 3KZ1E 4JLJA 2GZAA 1SVLA 1R7RA 1US8A 1VPLA 2JLXA 2ZR7A 4I1VA 1U94A 2OAQ1 2REXB 2QTHA 4OHVA 1E4YA 4BFVA 1PLJA 3L0PA 3CH5A 5D3MA 1F3OA 2XSZA 3T06B 4C0LA 2ZIAA 3TSWA 3OEHA 2A5JA 4ZO4A 1DAFA 2XAUA 2B8WA 4ARZB 5FPKA 2CL7X 3D31A 4PC6A 5A0FA 5CB8A 2RGBA 2W58A 2GTPA 1DADA 1Z0KA 4BECA 5JRZA 5DHAA 3DKPA 1S3GA 2WAYA 3AP3A 4FMDF 1G4UR 2B8TA 4D0NA 3GLGA 3LLMA 4NBSA 4YQFA 1UKYA 3A4NA 2Z5FA 2IXEA 1G8PA 2ZAMA 4TLEA 1HY3A 3BXZA 3NBYC 2WIAA 1VCNA 3ADBA 3LLUA 4MKGA 1W0KA 3IQWA 4QFMA 2BIFA 2GHIA 1E9RA 2ZROA 4FI3C 4M9ZA 3LVQE 1G19A 4KLNA 2V1XA 1AS2A 1XX6A 2A5DA 3WNBA 4OK5A 1E0JA 3BB4A 1G64A 2Q3HA 1LVGA 3K0AB 4TWZA 4WZAE 2G3YA 5J4YA 4X8MA 1XTRA 3VR5A 4Z8XA 1NKTA 2O5VA 2V54A 3QPVA 5CB6A 1XPOA 2NMVA 1VYVA 4A2QA 1OIVA 2RGDA 1XCMA 1QHHB 1EX7A 1YHNA 3KJEA 3ICQB 4BFZA 2NTYC 4HZIA 1YKSA 3QEJA 1KI1A 2PEYA 4QG7A 4J0QA 2GJKA 4UNRA 3AEZA 1E6CA 3O47A 4C0QC 1EFRA 2H18A 4A0RA 2V3CC 4L4UA 3KFVA 4UKDA 1YR9A 3PR1A 4IEEA 4BGDA 1KSJA 3QY0A 2RGEA 2O0HA 3GEIA 2OO7A 2ZRFA 2OCBA 2C2HA 2ZJOA 4B76A 3R7WA 3IIJA 1S9HA 1W36C 2F1IA 3FOZA 4M22A 2BJVA 1OKKA 3EZFA 3R8CA 1M2OB 2AXPA 1U8AA 3CUEF 1M6NA 2CHGA 3O8DA 4HB4A 4M53A 1XD9A 1E2HA 3IPYA 1XTIA 5BN3A 3FE2A 3IILA 5FPSA 3ZS9A 2C04A 3AKDA 1N25A 3AP1A 1KK2A 4PC3A 2VPPA 1JJ7A 4PQRA 4G5RA 2REBA 3AB3A 2WPDD 1S2MA 3M6AA 3UMFA 4CZ2A 4QKQA 2NZ8A 5EJEA 5HZHA 1EWQA 4RCYA 4V0MA 2BDTA 5B57C 4WZBE 4BLRA 2QY9A 1ZCBA 1ESMA 2ZAOA 5KNBA 4B6FA 4NYIQ 4IHQA 2VP9A 3GQBA 3UXMA 3ETLA 4Q19A 4KBFA 1DO2A 2VLIA 3WP0A 2RHMA 3KJHA 1QDEA 4CEJA 2RH5A 3P4YA 5GJWC 4LV5B 4Y0AA 3TUJC 5KSYA 1KI6B 4RD0A 1E94E 2QE7A 3NC1C 4WAUA 2VF7A 2JCSA 2VEDA 3QG1A 4XH9B 2PT7A 1E2DA 3DMDA 1R10A 3K1JA 1QVAA 2Q3FA 3U3MA 4A2PA 4TQUS 2C8VA 1TU3A 1CULC 1NIPA 2FG5A 2ZU6A 3NVAA 1NN5A 3OIWA 4GOXA 4P4SA 3HPQA 2BEJA 2TMKA 4AY2A 4FCTA 1OPXA 1UM8A 4NHOA 3VX3A 5JZVA 1II9A 4RCZA 3L8ZA 3Q5EA 1ZVQA 4F4IA 2CXXA 5CDFE 3DDCA 1JJVA 2C77A 4S2EA 3LDAA 1FMJA 2MSEB 4KLZA 4Q7MB 4Q01A 5JJIA 2P2LA 3LQRA 2F43B 2ZI7A 4GSYA 5FPHA 2ZSFA 3BIFA 3SOPA 3B1XA 3IGFA 3VQTA 5K8TA 1TL7C 4DLXA 1Z0JA 3K0FA 4P4UA 5EP2A 4BEBA 4II7A 3K9LA 4M1KA 1AM4D 4TLCA 2JLUA 4D25A 1SKYB 4JVSB 3BBPA 1AZSC 1ETUA 1G5PA 3SFVA 2J5XA 4JLNA 5AJYA 4A0HA 1NN3A 2FGKA 2OBMA 1E0KA 4E09A 2QBYA 1T4GA 5AK0A 4NE2A 4P33A 4EKDA 5HKKD 1PLLA 2WBLC 4OJKA 3T35A 1T3SA 3L82B 3G82C 4OQXA 2R62A 1XD8A 2JASA 2IYRA 2JJ2A 2XB4A 5LB2A 3B82A 3I3SR 1XMVA 3D6TB 2G83A 3K09A 4XVRA 2J1LA 4V0ME 2XNDA 2Z4RA 1XEFA 2YWFA 4Q1AA 3SZRA 4FW9A 1P6XA 3EZ6A 1ZC4A 3TKLA 1KDPA 1F2TA 1LF0A 1V5WA 2ONKA 3NBZC 3RS4A 4ERNA 2ZRPA 5B58C 1GRRA 3GJ7A 5F98A 3NKVA 821PA 1E69A 3B1WA 1OFIA 2IYYA 3EPKA 4JLPA 4PC7A 3FWYA 1NRJB 2A7QA 3QE0A 1JR3A 2EYQA 4G01B 3A1TA 3FHCB 2VP5A 4BUJA 1KI4A 4D80A 3TRFA 1YZQA 2VP4A 1E2NA 4B32A 1Z0DA 3MFYA 4IFEA 4CGZA 3U7GA 1SGWA 1FQKA 4TYPA 1HTWA 3CZQA 4EUNA 2IUSA 2QI9C 1PUJA 2CNWA 3IIMA 3CM0A 2GVDC 4A8JB 5HZKA 2VSOA 4IOKA 2ZVPX 3CRQA 1OJLA 1NI3A 2IT1A 2C95A 5KDOA 3IIKA 3FPAA 1OXVA 1E9EA 3RRZA 1KI8A 2E9SA 1HURA 1U9IC 5L3SB 1KJYA 2O8DA 3DOFA 2P67A 4M2LA 4S35A 3GJ6A 1JEEA 1F48A 5LD2C 1P72A 2HDNB 1QZXA 1W44A 4NCJA 4DDUA 2OG2A 2RGNC 4IJMA 3UWKA 1RFLA 4AD8A 4JYCA 2A78A 2F55A 4OQFA 3X1ZA 1QBKC 3CX8A 1CRQA 1U0HC 1S9DA 4KFSA 3RAPR 4TTPA 2BMEA 3SJBA 2BOVA 4NL4H 5L3QA 2D2EA 2YJTD 5AR1A 2F3TA 4HSEA 4BZPA 1XEWY 4TMWA 1TF2A 3H84A 1RRCA 1TQ2A 1Z6AA 421PA 4QNRA 1QRAA 4FIDA 2VHUA 4LYFA 4EIWA 4LV6A 5FTMA 2BV3A 4B71A 1AQUA 1Q22A 3LVRE 2FA9A 3SJCA 4ARZA 1BIFA 3RYTC 4BFTA 5A5GA 1ZCAA 1FZQA 1JQJC 3QKSB 3GJ3A 2A9KA 4A6XA 4GDFA 1EGAA 2IS4A 5K8LA 4E07A 1G8GA 1D2MA 1XP8A 1ZYUA 5FTJA 1Y3AA 4TZ0A 1EESA 2QA5A 5CM8B 5FBWB 3TSOA 2JLVA 2QU8A 3M4YA 2DWQA 4UXHA 4P31A 1GFIA 3NTUA 2C78A 1NLFA 3VU9A 1J8MF 2ZSEA 2ZI4A 1BO6A 2IS1A 2B7BA 3QF7A 1XBTA 4EAQA 4HDQB 1SXJD 3OIVA 1FP7A 3PEVA 3K0AA 2QMHA 5J4LA 2OSBA 4A82A 3QG5A 1NMYA 4FINA 5JI2E 1QHSA 4ACAA 4OI1A 4U00A 2Q9CA 4JT2A 1Z47A 2KI5A 1QHHA 2WJJA 1JXMA 3G5UA 4XTRA 2NO6A 1H65A 2EW1A 2ZQ5A 1W0JD 3KDSE 5JCZA 4BE7B 3GJ8A 3PV0A 1YZKA 3Q72A 2ZXUA 5AUOB 1NVVR 1W5SA 5JCPA 2KB0A 1KO4A 2J9RA 2RB4A 5TV2A 4MDFA 4ESVA 3T1QA 4RD2A 4ZCLA 2IUUA 2IBMA 4U02A 2W6ID 1A1VA 1K8RA 1NVVQ 1W46A 5JBQA 3A6PC 1D5CA 2ZRHA 2J3EA 5TVKA 3TNFA 2O8BB 1MO5A 3FKQA 1E2LA 5FTKA 3I8SA 1E9SA 1KZGB 2ZI6A 4DWJA 1OH8A 1CU1A 2YYZA 1EFTA 2GK7A 3K70D 3EC2A 1BYIA 1NJFA 1WMSA 5C4MA 3H0KA 4L8GA 2ZJ8A 4NH0A 4OI2A 5FOWA 3S1AB 2IK8A 4DLYA 2JLYA 1DARA 2Y8EA 5DYGA 5KU1A 2Q0HA 5DNYB 3ASZA 5KSZA 1W36B 1W2GA 1A4RA 1IQPA 3B6EA 1ONBA 1S0UA 3K0CC 1UEIA 2IXFA 2ODNA 3IEVA 1Q20A 2JDIA 3FGNA 3KJGA 2H57A 3B1ZA 1Q1QA 3AVUA 2AWNA 2CHVA 4WOPA 4AI6A 2QSYA 2O8EB 3JVVA 4P0TA 4LI0A 1DO0A 4QXAA 3CBQA 1E4VA 4HLUA 2ZR9A 3EZ9A 5BN5A 1KI6A 4TL9A 3CRRA 4XIGS 4GI7A 1ZU4A 3RS7A 3IQXA 5KSPA 4Q18A 5DHFA 2VHQA 1FQJA 4DRZA 5AUNB 3MRSA 3AVPA 2JLQA 3E2IA 4I1SA 4MYUA 4EFNA 1P4SA 3H86A 4OQMA 3UK6A 1L4UA 4RZ2A 4TL6A 3Q8XB 4M1MA 4Z8YA 4EFLA 3ZVLA 1E9AA 4BPBA 2XOKA 3LD9A 3OIUA 1JXOA 4OL0A 4C0AC 3VHXA 4DC9A 2ERYA 4ZDIA 2F43A 5CK4A 3B13B 1YVDA 2W2XA 5E7JA 4KVAA 3U2QA 3VKHA 4X8OA 2FZLA 1ZD8A 2ZETA 2ZRIA 3EARA 3GEEA 3LBIA 4IVPA 5UKDA 3VKWA 4Q4JB 2BKUA 3DVLA 2A30A 1RW4A 2HCJB 1NG1A 1Q0UA 3LAWA 1G3QA 5AUQA 2WWYA 3U61B 1CLUA 2WMNB 1M7BA 1P9RA 1Z6XA 1BMFA 1TQDA 1U90A 3ICEA 3T5DA 1SXJC 3UATA 5IK2D 721PA 4QGFA 2F3RA 2RGGA 1CIPA 2F7SA 1WBBA 4R2IA 5EZ5A 4DDWA 1SHZA 2KJQA 2Q6TA 2FPKA 5F3WB 3RS0A 2AD1A 2G9NA 3IBGA 5J5CA 1R8QA 1A7JA 2JIZD 5G41A 4KFRA 1HQCA 3KFXA 1EK0A 1P5ZB 4LGMA 3R8FA 1KDRA 1T0HB 2KBEA 1VIAA 3WBJA 2R8RA 5FUYA 1WCV1 2H1LA 4ITRC 4GFDA 5DN6A 2BHRA 4HB2A 2ZR0A 4B35A 2OLJA 1GIAA 1NJGA 1QVRA 1ZM4A 3CPHA 4IVRA 4NMMA 1E1RD 3AF1A 1M7GA 4DCTA 2LWIA 2A3RA 2GCPA 1AJEA 1VHLA 2J7PA 2GJSA 4G5GA 4B3GA 1YZUA 2OCPA 3K70C 5F9FA 1TPZA 4OYHA 4R9UC 3KKQA 3K9HA 4FCVA 2QP3A 5JI3E 1JAHA 4KI0A 4QC2A 4CEHB 3OAAD 3TGPA 2JAQA 4Q48A 1Q3HA 3QPWA 4C9BA 1JR6A 2VSXA 1J99A 1GUAA 3BH0A 3T1OA 4A8JA 1SKQA 3CF2A 4RVCA 3W6NA 5L8VA 2Z83A 3ZDQA 3FVQA 4LZZA 1P2VA 1F6BA 1H8HA 1SVSA 2GCOB 3EPJA 2XITA 3X1XA 5L3SA 3OE7D 4QGGA 5B30A 3AP2A 3P4XA 4DIDA 3QI2A 2CMKA 5CJ2A 2RCNA 2WWIA 2KE5A 4YC7A 2HT6A 4JS0A 3SS8A 3AVYA 4A0FA 3WHLA 4D4JA 1VIYA 1O87A 1C4OA 2DWOA 4TTQA 3QENA 2JGNA 2QORA 1X3SA 3RC8A 5EXPA 2KWIA 5LD2B 3MGCA 3WNCA 2BBTA 2GZDA 4EQ6B 5FPYA 1IY1A 1GKUB 5CIQA 3QBVA 3LBNA 4MITA 3KKNA 2X1VA 3J81k 2VP0A 5FL7D 1NBMA 3ADDA 4U5XA 1Z3IX 4AWXA 4QHSA 1G7RA 1GNQA 2ZRMA 4LRWA 4PAOA 1OFTA 3LO5A 3QJYA 2WM9B 5GADl 3KJIA 2O0KA 2QPTA 5SZJA 3U7FB 1EXMA 1YJ5A 3KTAB 3PEYA 2YOFA 2P5SA 2GDJA 2VHTA 1D2EA 3GLFB 3AKYA 1DAEA 1S3SA 4RD6A 4X8LA 2XTZA 3GPLA 3L0OA 3VHLB 2NO1A 1JALA 1XMJA 2XTNA 3BRWD 1XJCA 3RS5A 2FFHA 2NGRA 4XJXA 2QNRA 3AVVA 3LA6A 3VNUA 2QRNA 2DY1A 5TY0A 2GBLC 3MD0A 4Q03A 1FUUA 2VA8A 3N70A 1CJKC 3CPEA 3D8BA 4RZXA 3WYFA 1IBRA 4DUGA 3A36A 2FV8A 5FOVA 3FHTA 1M1YE 2J59A 3F5FA 4K8OA 5B2ZA 1IY2A 1AIPA 2YOGA 1TF7A 2MMGA 4M4SA 4F93B 4YXWA 1Z8FA 4ZI3A 4LV8B 2BKEA 4ASUD 3QSYA 4RFSB 3U7HB 3SC3A 3D7MA 1OW3B 1WXQA 3ZLJA 1D8TA 1OLOA 2OBLA 1O3YA 2BBOA 3NXSA 1T3LA 3TW8B 3P27A 3RS3A 2GEVA 2ZRCA 4KFUA 1ZUHA 3ZIAD 2O8BA 3TBKA 1DS6A 3PIRA 4B3XA 1ELOA 1ZIPA 3X1YA 1G3MA 4XSHA 2W2TA 3AM1A 2IHYA 4HAWA 2FF7A 4G5QA 3ZYCA 1ZP6A 2I1QA 4YDSA 5J40A 4QM7A 2N42A 2X19A 3U7EB 1KMHB 2OT3B 3S1AA 1E2PA 2R6AA 3VTKA 1XJQA 4TMVA 1SVKA 4MRNA 1NBME 3CH4B 1LB1B 2IXGA 5G53C 3QPUA 1DBSA 2C9YA 2R6CA 3IEUA 4NDZA 4Q47A 1R0ZA 5AJXA 1Q21A 2XX3A 3Q7PA 4CVNA 5F9HA 1L4YA 1XCPA 4LHYA 1T91A 4DCNA 1FOEB 4I99A 1OE0A 5C18A 1OB5A 2OFXA 3EZ7A 2V8OA 3HU1A 3SBDA 1NNEA 1YU9A 3I8XA 3VR6A 1GM5A 1IONA 1N0WA 2O8EA 3QKUA 1OHHA 4AC9A 2G77B 2QENA 4ZIRB 4URXR 2FPMA 5KPJA 3W3ZB 4BLOA 3WRXC 2CL6X 4ZDKA 1ZU5A 1RRGA 2EFCB 3FDIA 3MWYW 4V0OA 2P6UA 3E1SA 1GG2A 3FHOA 4BZQA 3OEHD 4EPYA 2GAOA 5FI0B 4M1WA 2YWGA 2DB3A 4JLOA 5M04A 4ILEA 1ZW6A 5TB5A 4TMZA 3W90A 1KI7A 3OFND 1OXXK 5CLLA 1W7AA 1FX0A 1ZNYA 5BN4A 2BM0A 4D0GA 3EAQA 5L3RA 3IO5A 2GXAA 2QAGC 1MABB 5BWMA 1TF5A 1N6HA 2ZE5A 4Y0VA 4FMCF 4HI0E 1E2EA 3TQCA 4A36A 1SHKA 1W0KD 4AYWA 4KYIB 5C2JB 3L43A 2GEUA 2ZJBA 4Q4JA 3AV0B 3UMRA 2VO1A 3G0HA 4I81A 3EIHA 1NL3A 1UBEA 2PZGA 4MGIR 3NDPA 2ZE7A 4BRWA 8OHMA 4PR0A 3C14C 1KY3A 3U60B 2PEZA 1Q12A 5EE0A 4AKEA 2VHCA 2EFDB 1FNMA 4FCWA 3CF0A 3EWSA 4PZZA 4HZUB 1E96A 1UPTA 1TAGA 4DHEA 1KO1A 5CDFA 4TMTA 4TL8A 2OZEA 3DZDA 1SXJB 2PCJA 2ONJA 4IVQA 2ZRNA 2WJGA 2OFOA 4JT4A 2ZREA 1UF9A 3ADKA 5K8IA 1CJUC 4UXIA 4Q9HA 5J4KA 1T0JB 4PFSA 3HP1A 3AH8A 1LTQA 1N6NA 1T9HA 2HJVA 4AYXA 3U6KA 2PX0A 4IXNA 3KQHA 2XGJA 4M0LA 1DG3A 2QGZA 4AKGA 121PA 3THXB 4JL6A 1L7VC 5P21A 3MG9A 1OKKD 4Q9JA 2ZRAA 1VMAA 2QQ0A 4ESHA 3KXLA 3KKPA 1ZM9A 1UBCA 1FL9A 4RFVA 2JLRA 1YZTA 2CVHA 2JLSA 2HEIA 3KL4A 5TDHA 4QNMA 4M9XA 4FWIB 1XNJA 5AWFC 3Q5DA 4A0GA 3FKSA 2OESA 4NYIR 1HYQA 2UZIR 5BW8A 4GT1A 3R9WA 3A1VA 5AJWA 4FMDB 2B92A 4IDNA 3KUCA 4BLQA 5H68A 1F2UB 2O8CB 2C9OA 4A15A 2JJ1D 4DLWA 2FWRA 3QIAA 4BASA 2X8AA 4DBLC 1XPRA 2VRWA 5FBQB 5AJVB 3C16C 4M1YA 1AGPA 1AK2A 3TJZA 4URZR 3I32A 4TT3A 1TU4A 1UBFA 2J7KA 2QE7D 1XXHE 3SHFA 2OCYC 3ZVNA 3RWMB 3EPHA 1VG0B 2YKGA 1ZMXA 1U9IA 3GMTA 3QXCA 1R0XA 5JEEA 1UEJA 1N0VC 3WNDA 3LW7A 4GP7A 3LQQA 2NIPA 3NIBA 4MGKR 4EQ6A 2RGNA 4WIAA 1IAQA 2AX4A 2D74A 5EZ6B 4EPRA 2CVFA 4B2LA 2Z4SA 2PBRA 1G8HA 4NKRA 2N46A 5HE8A 4F7WA 4ZDJA 2BJWA 4HB0A 1G1MA 3BB3A 4CIDA 3KTAA 4DSTA 2VF8A 1T8UA 4XTCS 1XU4A 3QXSA 4DB4A 2OAP1 2WWGA 4Z51A 3P32A 2IEYA 3EASA 3GLFA 3VX4A 1XTSA 2E1RA 1G8YA 3PUVA 4QBFA 3VFDA 2ZJZA 4C4PA 4B2PA 3GJ5A 1TEXA 2GF0A 1W49A 4DSUA 1YE8A 4ON9A 4US2R 1Z0FA 2FNAA 1WB9A 1KO8A 3A4LA 4JLDA 1N6OA 5EUMA 5G3ZA 5JHGB 4HAYA 1T6NA 1P9NA 2BC9A 3AUYA 2QUZA 2NZJA 1KK3A 4LJ7A 4TSFD 1KGDA 1A5TA 2WZQA 2JJ2D 1CJVC 3W5JA 3HU2A 5JLJA 5FTNA 1E2GA 3R9IA 1HQYE 1E2MA 1T8TA 2V6JA 3V00A 2ORVA 5EE9A 3HU3A 3TE6A 1KNXA 3CR7A 4FWTA 3RNLA 1T5LA 1SVIA 5C1BA 3NBFA 1NSTA 4Q00A 1KK0A 4B3DA 3ZZ0A 4RJLA 1XRJA 3ZJYA 1GILA 1KOFA 3BH6A 1JR3D 2CE7A 3FMOB 4Q1FA 2UVQA 5DO9A 3W6PA 4E5UA 3FB4A 2LCFA 5JECA 2QTVB 1MRNA 2CK3D 4PZLA 3U44B 2R9VA 1D9XA 1QHXA 1YRAA 4OBEA 1PLKA 1H8EA 3I73A 1IN5A 5JWHA 1EX6A 4LK2A 2KSQA 4IOJA 4IFBA 1KTVA 2WJYA 4RY2A 2Q3MA 3WXMA 1MV5A 1KMHA 2GAAA 4L9SA 2A5YB 1KAGA 5J4HA 3IDQA 4URUR 4LJAA 2YWEA 3Q85A 3ZVMA 1OH7A 4P32A 3PITA 4IDOA 1CKEA 1OYYA 2BBSA 3PENA 4PANA 4EPTA 1YQTA 2AFHE 5SZHB 3WP1B 4G5SA 4Q9IA 2IYZA 1P2UA 4CT5A 2A5GA 3GLFE 4AKHA 4P3YA 2R44A 4OHZA 4A1FA 1U81A 2L0XA 3RABA 1IXZA 1HE8B 3JZAA 1E0SA 1S96A 4QHYA 3W3AA 2W6JA 2AFIE 1KZ7B 4ZIRA 3K0CA 4FD2A 3ONWA 2Q9AA 2BWJA 4B47A 3NEJA 4M8NE 4MKHA 3RSLA 3M0EA 2QROA 4POAA 4UJ5A 2D62A 3VR4A 4QJ3A 2FX3A 3T1VA 4JLBA 2EU8A 5JS7A 3TR0A 4DSNA 3CONA 5JS8A 3ND8A 1EFCA 4LYAA 2ZI9A 2HUPA 3O8BA 4M21A 4OI0A 1E1QA 3MJRA 4TTRA 5KNDA 4DLTA 4QBHA 1GWNA 5KDDA 3C5HA 3QBTA 2AN9A 1XJ0A 2C9CA 1TUIA 3ZVRA 2VL7A 1OF1A 1U8YA 1K5DA 2DBYA 4PXAA 3CZPA 2ANCA 4JVLA 3CNLA 4PQYA 2D3WA 1MABA 1NN0A 4NCNA 4IDPA 1S4QA 2NO0A 4HUTA 1KKLA 3P20A 2J41A 2QT0A 1F60A 3BERA 1JNYA 2V4ZA 3B7GA 4WVFA 2FU5C 2CEAA 2A2ZA 3RRYA 5FTLA 4QBIA 3TIFA 2FFAA 1ZJ6A 2ZE8A 1P2SA 1E79D 1TEVA 1Q1BA 2ZJYA 2CCGA 1UDWA 4WA7A 4DDTA 3GFTA 3MJHA 1Q44A 1T3HA 2ZRLA 1D2NA 1EFUA 3A37A 2UZ3A 2PZFA 4Q66C 2D4HA 4MDEA 3F3YA 4IRUB 1M7HA 3KQUA 2QMOA 2O8FB 4C0KA 3QXJA 2IYQA 4HZUA 4AG6A 3U4QB 4A2WA 3QKRB 2ATXA 5HCNA 4O2LA 1VHTA 1NVXQ 4XD7A 1RE0A 3K9GA 4NCKA 3B1YA 3F8TA 4DZZA 1N5JA 5HCIA 5ELXA 2IYTA 2ZI5A 4ZKEA 1W4BA 1SXJA 5IRCD 3W5IA 5DH9A 5TARA 1BOFA 3JVUA 2B21A 3BE4A 2GK6A 2O52A 1OV4A 3HR8A 1NY6A 2GZHA 3BWDD 3GP8A 1VCIA 4PPQA 3SHWA 4AK9A 4CEIB 3DM9B 3THXA 2ERXA 3NHAA 1NIJA 4XWOA 4D82A 1R8SA 2F1RA 2NOAA 3B78A 1F5NA 4N0DA 2CJWB 4BFWA 1X1RA 1J90A 2C98A 1WP9A 4OHYA 4C0BA 4MRVA 2IS6A 5FUVA 3LWNA 5FOUA 2CCKA 1ZD9A 1KAOA 1VECA 3THYB 1TUEA 4PAQA 1XFAA 1Z63A 4JLKA 1HT2E 1R5NA 1FTSA 1E0AA 1I4TD 1Q3TA 1P9WA 1BH2A 2FFBA 4DVGA 3VNVA 4MH0R 2ZS9A 2XTMA 2RGCA 3IUYA 3PEUA 5FOTA 2JDID 4MGYR 1ZNXA 5AJZA 4C0HA 4OHWA 2N1BA 4PTLA 4Q4AB 2EFHB 1IJEA 1I2DA 2ZYUX 4JKYA 1AN0A 3K8YA 4C30A 1DAKA 2H7VA 1ZC3A 4DKXA 3VKGA 4PZYA 1IN8A 1NSFA 2PMKA 2RHDA 1XTKA 4LUCA 1Q1ZA 2WOOA 3R20A 1K5GA 2WWFA 3Q3JB 1AA9A 4HB3A 5BYKA 2VH5R 4TQ9A 5EE5B 2CLCX 4JKIA 4HAUA 2VSFA 2WSMA 1FUKA 2QM7A 4JBWA 2V55B 2ZRBA 4NYJR 1E2FA 1DAGA 1SVMA 4NTZA 3OEEA 5JWRA 3DHWC 5DYIA 2ORWA 5EE1A 4NYJQ 5JFGA 3EIEA 1NLZA 1US8B 3GJXC 4G5OA 2V1UA 2GJAA 2XOKD 1P7CA 2AL7A 2ZS8A 2A5FA 1KNQA 3GLIB 3EWAA 6Q21A 1SXJE 3NWJA 2G1JA 2AK2A 3FYHA 3HJNA 3UKDA 3SI7A 3EW9A 2ZRKA 2FSFA 3U3OA 4JSTA 1U99A 1W47A 3EA5A 5JWOA 1E99A 1XXHB 2VYFA 3ZZUA 4BEJA 3BOSA 5D3QA 1P3JA 5FUXA 4ABYA 1RJ9B 5IF9A 3UIEA 2OXCA 2WSSA 5LBIA 5KHOC 1KSHA 1Z6GA 2JLZA 2IWRA 5GVSA 1E9BA 1BMFD 4F91B 3QVUA 1J70A 4YDHB 1EFHA 1ZUIA 2P0EA 1B23P 2WOJA 2Z0MA 3A8TA 4LSGA 2FSGA 2WKQA 4KAXA 1GL7A 5HR5A 2B6HA 3DEFA 2WTUA 4R7ZA 3TSZA 4EFMA 3WY9A 3AQ4A 1WDTA 3WRYC 4ZV4A 1HA3A 2AKYA 2BMFA 3RLFA 3T12A 1GTVA 2C96A 4QHTA 3VMFA 3N2EA 2GBLA 2NQ2C 2OE2A 3T15A 1CS4C 4W5WA 1W2HA 3IO3A 5B64A 4AIIA 4MKIA 4JL5A 5DN6D 2QP9X 2RGXA 2FMXA 2EWWA 3RDPA 4Q4HB 1E9DA 3RRNA 2CL0X 2QMEA 1N0UA 1TQ4A 1GRQA 1Z6TA 3U44A 2J7PD 3L2OB 1KI3A 1C9KA 2JIZA 1KMQA 4GZLA 1ZAKA 3OIYA 2DCUA 2DPXA 1G7CA 3A1WA 4ZDWA 4ZKDA 4DLZA 2V7QA 3SN6A 4MRSA 3U3RA 3IPXA 3SQWA 3CWQA 4H1UA 3RWOA 4TYWA 3SFZA 3MLEA 2D7CA 3K0EA 2J0SA 1CJMA 1X6VA 2YINC 4QGAA 2WJVA 4LBVA 5G40A 1S1MA 4Q1EA 2HYIC 2ZUDA 1HE1C 1G3UA 2AKAB 1H8HD 3OESA 3O8CA 1MO4A 2WKPA 4UNPA 5FOSA 1WF3A 5FOXA 2GETA 3SYLA 2ZTSA 3TW4A 3L0SA 4EPVA 2HLDD 2EVWX 1MT0A 3QVVA 5SZIA 3BFXA 4YLGA 3OAAA 2PMDA 2WWWA 2ZRDA 2OFWA 1K6MA 1R5OA 1GRNA 3HR7A 4JVNA 4B3CA 3GLHE 3P26A 4HLUC 4YMSA 1R5BA 4Q02A 2DYKA 5EP1A 2QRZA 1CEEA 2YWHA 3BB1A 1XZPA 4L5BA 2GA8A 3HPRA 2J0QA 2B7CA 3H4MA 4LX0A 3AVWA 3UG7A 3TVDA 1PZNA 4B48A 2H16A 1M34E 2ZSDA 1JECA 5IHPA 3OE7A 1CR2A 3B60A 4B75A 1KIMA 2GXSA 3QUSA 5DIFA 4O3MA 2ZRJA 3MSXA 4XVUA 3BK7A 4QJ4A 3AF3A 3ECCA 2IX3A 1QHIA 3UMSA 3QKSA 2H5EA 1OFUX 1Z28A 2AHOA 3PEWA 4CW7A 4HEJA 2IWHA 1MR3F 3C5CA 3DKVA 4LC1A 4BFXA 1N6KA 1ODFA 1L8QA 4GL2A 3KX2A 2I1VB 2YC2C 1OXSC 2CCJA 2G6BA 3WYAA 2PJRA 1VKJA 4CF7A 3V4RA 3LH5A 1WQ1R 3LW8A 1G5RA 2VP6A 1PUIA 1U8ZA 3FTQA 1G291 4TN1A 3X1WA 1P60A 4ACBA 4MUAA 3MWKA 4MQBA 1MKYA 1S8FA 5CYOA 3ND9A 4TQAA 3MAAC 2D2FA 5JSZB 1VDZA 3K0FB 4PPFA 4NCHA 4DCUA 4DUGD 2SHKA 1HT1E 2WVJA 3I5YA 1G20E 4KITB 2IW3A 2OEPA 3B2EA 1TNDA
chains in the Genus database with same CATH superfamily
1DG1G 1KZ1A 3D7RA 2IC5A 3PJGA 4RXMA 2NADA 4BNDA 4CCAA 3ZCUA 2W2VA 4YXWD 3PFKA 2VQSA 1U0RA 4UXJA 5E6UA 3OLVA 5JSQA 2ORIA 1BD3A 4BAGA 4GBMA 1Z15A 1CR1A 1PYGA 4MWBA 1R1DA 2XUDA 2PVSA 3BRSA 4V3CA 1SXHA 2C8LA 3LU1A 1ZN2A 4JBHA 5F35A 4FE3A 2QX6A 2PUJA 1X7XB 3KU1A 2FDXA 4FWBA 1S8NA 2AOTB 1H2YA 2GHRA 3R3YA 3Q7QA 4GMXA 4D3DA 3URMA 1R2QA 3GAMA 3VOBA 1I2AA 2ROQA 4GF5A 3BAFA 4IP0A 2WD8A 2A3NA 1QK5A 2PUHA 3NV7A 4RM2A 4XI9A 3D7NA 3FLAA 3ZYZA 3W6OA 1H4QA 1P1IA 2P6RA 3NRCA 2PBZA 5CD1A 2QTGA 4AT1A 4ZI2A 4CF6A 3TBFA 4I1UA 1RPZA 4JUCA 3MIZA 1AN9A 1XNRB 1E59A 1RQPA 4CT4B 1BN6A 2XOEA 3QUQA 3PJRA 5HKBA 4K03A 3COSA 1NULA 4TV9F 1FP2A 2I4IA 4EUSA 3THYA 4WY8A 3VR5A 5HGJA 1BW9A 3OM1A 4LF7B 2NPFA 4NNJA 4W5JA 4TRJA 4EA8A 3L4BA 5JDCC 4P92A 1MTZA 3HUUA 2JIMA 5AYVA 4XX0B 1KHTA 4YQEA 5TC4A 5A6VA 1Q7TA 5JMTA 2RBGA 1GNPA 3QOFA 2AD5A 1JBKA 2WILA 1A82A 1V7CA 2FCRA 3KZKA 4KX3A 4DLSA 4Q4LA 4CYMA 1G59A 4KPYA 2IQ5A 1IWOA 4QDKA 4GOND 3VDRA 1X0XA 5CH5A 3DPIA 4RD4A 2FUG6 2FY8A 2FP3A 5DTIA 1ZIOA 4QO8A 5EJ9A 4HUQB 4V02A 2ZIEA 5EP4A 3THOA 5L3VA 2ZYWX 5LXTF 1HGXA 5J2UA 1OXMA 1CUCA 4OHRA 5INTA 2PMWB 1C1DA 2AA3A 3B85A 1IXRC 1ZNZA 3K6SB 3MMSA 4BXOB 1R9MA 1PV2A 4NEGA 2CC2A 4YJ2A 1VC2A 4C2UA 2FEOA 5B1YA 3I04M 1KEKA 1A9PA 1Y0BA 3QSGA 2NACA 4R1TA 4ND6A 4I4LA 3IS3A 2P75A 2NXCA 3WLIA 1EVLA 5DI3B 3HQ4O 3OZXA 4B3HA 3AL2A 1CUJA 2IYXA 3KZNA 3LO8A 5F5LA 5AW5A 4EL5A 3IVCA 2CDCA 3ICCA 1NNSA 2XMQA 4NNPA 1JHPA 3TOXA 3Q0EA 3GFOA 4J8PA 1VG1A 1JPNA 4R2LA 1ZI9A 1F20A 1NFFA 3EDCA 3TD2A 3PE6A 3AT1A 4Y8VA 3RSGA 3T0FA 1C7IA 3FJYA 4LZNA 2B98A 3INYA 4UM9D 3JCZA 5CVDA 4OHXA 3P9IA 3ZWAA 5LQRA 4IQ4A 2WM3A 2FEPA 2VUIB 1G98A 5JFTA 3DNMA 1DO8A 3RTDA 1GVNB 5BQFA 3SQXA 1GPNA 3TD9A 1N75A 4ND8A 5K0GA 1E6KA 1EDOA 4HHEA 3DF9A 4MA4A 2RI1A 2I5PO 2VJMA 4L3VA 3R7AA 4EJSC 2VUTA 3KKKA 5GGYA 4ZYVA 3NHUA 3PDIB 1A76A 1PVOA 1LI7A 2Z04A 3LY5A 4C7MA 3GT4A 2GNAA 4JBYA 1R8JA 1ENYA 4MK4A 4DV4B 2PSDA 1II0A 4HAXA 3BHNA 3VTFA 4N3NA 3RODA 4D9NA 1RD4A 1D6JA 1MIHA 1SVOA 1WMDA 4MI9A 2NYRA 1DI0A 3RM3A 3O2NA 1H0KA 2R8EA 1HNNA 1SHLA 4JA0A 3TRIA 1ADFA 2EARA 3WGZA 4UHDA 4Y98A 3H3FA 3WYGA 1Z5VA 4JR0A 2XT0A 1K6JA 4JMPA 3KUDA 4ZODA 2FN4A 1XAGA 1QO9A 2VLBA 3MUNA 4D5GA 1FXUA 3JQDA 1ICIA 3EIWA 4YRIA 4BEVA 3FZGA 4AX4A 1NN1A 3DH0A 4YRSA 3R5JA 5LXTB 4MKRA 3I2YX 3SR3A 2I76A 2J30A 2VR1A 2WTNA 4RW0A 1YR8A 3RIHA 4WKBA 3DL7A 4DBLE 3LY8A 3EPPA 1FYEA 5ULLA 4EP1A 1YVUA 3ESDA 4YCCA 1TO1E 2I6TA 1A77A 4FCCA 3UMBA 4BMVA 4OP2A 4URWR 5HTKA 5CB0A 3AHHA 4J3FA 5TSDA 1E8DA 1TADA 2C4VA 4KJXA 3HVRA 1NVBA 2BRUC 3MCZA 2QSZA 1P5JA 2NU7A 3WK7A 3ZV6A 4G67A 3N7TA 2RIPA 3GGGA 4MQ6A 1OZHA 2WVAA 4M6WB 4U6NA 4XZ3A 3RC9A 4E88A 1G3IA 1JZTA 2FZCA 2GCOA 3HDTA 3H97A 4S12A 3RIGA 5KYWB 4QECA 3GLIE 1CCWA 5JJLA 4RMGA 3ORSA 2WUDA 3OJEA 2ZPUA 4K40A 5A4KA 4H6VA 4TMFA 4DA8A 3BJEA 4P58A 2WPDA 4YCNA 1ORTA 3WSVA 2XZOA 4XVQA 1DOZA 1HQDA 1R4NA 1W5TA 4ZCMA 2UUAB 2P5TB 4HQRA 1L2TA 1W93A 4C0JA 2EXXA 1BVUA 3L6EA 2PXXA 4U39A 4W5HA 2BEKA 4DQXA 1CRPA 5CVUA 1NGSA 1L7DA 1WTCA 1OAOC 2H3EA 3QYFA 2GFQA 2IOQA 4PHGA 3HDVA 4F9GA 5AM3A 3TCNA 2GD1O 3FBGA 3KPVA 4PZPA 3DW1X 3AF6A 3BMQB 2X42A 1IPHA 1GXSA 3GVCA 3AJRA 5BN5B 1U4SA 1KXJA 1Y7IA 1WZCA 4J0FA 4CCWA 1T8YA 4JIMA 4D4LA 4ENPA 5B3LA 5LQDA 3C8MA 3O4JA 1YL5A 1LCIA 4F46A 3A10A 3ZQ6A 2A1UB 1ISGA 3G7UA 1IM8A 5CT8A 2PQMA 3NAQA 2LZ0A 1N1MA 3KS9A 1OH6A 4C07A 1A3CA 3W79A 4O8CA 3AWDA 3CW2A 4DR2B 5HUHA 1KL7A 1NXPA 1YRYE 2QYHA 3FOBA 2PCLA 5C80A 4RLHA 4FMBB 1DLIA 2AZDA 2QXYA 3SVTA 4S05A 1I2ZA 3VAAA 3AKEA 1G63A 2VS1A 4L8FA 1XO1A 1STOA 4ZAVA 2GDZA 5BWOA 1JH8A 3ZS8A 2BCJQ 2XUIA 4X61A 2CXUA 4LDAA 1RI2A 2VJYA 3JASB 3KOWA 2R6GA 4MR7B 2AJ8A 2B1GA 3PX2A 4K2HA 4CWAA 1PDWA 1T0UA 4CHTA 4D8XA 2VYNA 3C15C 2J9XB 4NECA 2WT9A 5C5IA 2GXQA 3ETDA 4GOMD 1QNLA 2MU1A 3CKLA 3ZGXA 3KOZA 4YMTA 2XNDD 3BA6A 5LOVB 1CZHA 2JLZA 4F38A 1Y3BE 1DAMA 1P74A 2GNOA 3KAQA 3WHKA 2I2BA 5K2OA 4C06A 2XA2A 3IAFA 4AJ9A 4MVJD 1C7ZA 1LDBA 3H9UA 3PWKA 4G4SP 2XTAA 2ZYRA 3KG2A 2GCNA 1V2HE 2GESA 4TQGA 2D06A 3QLUA 4HMPA 3CR3C 3OFVA 3NQ41 4DXAA 4F3YA 1DAHA 4K6CA 4NYMQ 5BO5A 2LXNA 1FBTA 1D1TA 1ZUWA 4NX2A 3KB2A 3SYNA 1NVEA 2ODQA 1RE1A 1FXWF 3TF5A 2VT3A 3ENZA 1DEKA 3KJFA 4OHPA 1QQAA 2DP4E 1Q0ZA 4V0QA 4CDMA 1QIHA 4ENTA 3BWVA 1TD9A 2G17A 3OQ1A 5B7NA 1SELA 3JXEA 1UBHS 3E18A 2VJAA 5ALJA 3VPAA 3L4KA 2C9DA 4J76A 3ENKA 4YMVA 1FDSA 2JATA 1GPUA 2W48A 1H5QA 3I6BA 3WQBA 1ZM3A 4AMUA 2PMBA 3Q2IA 2WPNA 4V39A 2ETVA 2CNWD 1QFJA 1OFHA 1T6BY 3KYJB 2C5GA 2QMZA 1VIMA 3K6RA 1Y9AA 3M81A 1A7UA 5ESDA 1UMKA 1C4KA 1V3UA 4P2GA 4B8YA 1Z9BA 3OKPA 1N6PA 4F1WA 4W7HA 2P3SA 2I2FA 3MXOA 4Q1DA 4Z4EA 3L79A 4LWZA 1H6CA 1C7QA 1N8TA 4IO0A 3YASA 5LA6F 4EBBA 3Q11A 3ROKA 2FMKA 4FFLA 1YE5A 4MW5A 3W34A 5TEVA 3ZTWA 2YJ3A 3Q88A 4I08A 2WUFA 2R3SA 3GBPA 5E2BA 4RTRA 4HEHA 3A4IA 4RD3A 4F2HA 2IA5A 3WBKA 5FWXA 3PXEA 1N9ZA 2XD4A 4XWAA 3A1SA 2XA9A 4DL9A 4E4YA 1MJ5A 1KAMA 1KEVA 4GXTA 3WC4A 3TB4A 4DIUA 2R79A 2NV6A 3IQFA 1KF0A 4P34A 5TQVA 3ZD6A 3KZVA 4XB2A 5ES4B 1NYQA 2J48A 5AVTA 4PRLA 3WB2A 3ABIA 2BY4A 1GKYA 5EP3A 6REQA 3UMMA 1XWFA 1DX6A 4JJKA 2W6OA 2AJDA 1YZHA 1M0SA 3CVOA 4IV0A 4KPUA 1R16A 2JZOA 3WICA 1SXIA 3GNSA 3R9XA 4DIEA 2AC7A 2GZSA 2JB9A 4K86A 2EKLA 4QTZA 2A14A 1M2FA 4GE0A 5IHXA 3WSTA 3HWSA 5KO2A 4TLAA 2LDXA 2Q3BA 5L9AA 3ILSA 3O92A 4C2TA 2V0CA 1XYVA 4JI7B 1TIKA 4FFBB 4B34A 3IE1A 4KQ2A 3ANTA 3AV3A 3H65A 5C53B 1BCSA 2JIQA 1GZ5A 3BFJA 2IE8A 2MOKA 1N2OA 3TQIA 5EJ8A 4DT1A 2UYYA 1NI5A 4ZVPA 1CNFA 2DUMA 4XWKA 1L6RA 5IT0A 1K7FB 3FNEA 1EJ6A 1Z5NA 3HVJA 4E32A 4JLUA 4OMUA 5TXGA 3JQGB 4DCSA 1MO3A 1OIXA 3IMEA 5YASA 3ZY5A 1NR1A 5BQXA 1ES9A 3A9SA 4MYTA 3ZD7A 1U98A 1YJAA 5K8UA 6YASA 2XVAA 4X3OA 2QAGB 1JPVA 2UU9B 4JASB 1FLDA 5F4BA 1V35A 1J2UA 2ZG6A 1P5FA 3P2KA 1DWPA 2GWHA 5DGXA 1P73A 5T4EA 2KYRA 4A6PA 3KPJA 1T13A 5JAHA 4MRRA 3EXIA 1IUNA 3ED5A 2IOFK 3LXRA 2R1TA 3CJQA 2C2GA 1K89A 1O6CA 2W93A 3NONA 3X1MA 1Q3KA 1DBIA 2HA2A 3I72A 5CTJA 4ZAZA 5IAJA 3GCGA 2HQOA 3ELWA 3IOMA 2L82A 3O1JC 4KSBA 3BKWA 4O6VA 3DBLA 1IZ0A 3OECA 2BT4A 2QUIA 3DBHA 4OUDA 1VJ1A 4BC0A 1EZ4A 3ZDYB 4D4KA 1XMIA 2J3LA 4G65A 3I09A 4BFYA 2H9AA 4BO5A 4RD1A 5BWNA 3M70A 2NVBA 2X9QA 3M6WA 4U7TB 1KEPA 2D5CA 3I28A 2ZDQA 3IVMA 4X63A 3W4IA 5LA6B 5BR8B 3CVUA 3PUWA 5DIZA 3H05A 2IYWA 3ND5A 3LXXA 4UEJA 3F73A 1N7IA 3OX3A 3NVKI 2F8MA 4OATA 1UC4B 2WFLA 5KJEA 4Q1VA 4BN0A 4PFQA 3FMPB 4IHJF 2X2FA 3E58A 2MYUA 2OZVA 4MUNA 4X5OA 2WY2D 4PSKA 3R5HA 3UWPA 4DJFC 2BGKA 3VU0A 1YS6A 1ODTC 1C3JA 2AOVA 1GJRA 4R5MA 4Z0HO 3MW8A 2ZJ2A 3HN6A 1W0JA 3FR8A 3V7YA 2R8XA 3UG6A 3ORHA 4DLUA 5F2EA 4FGLA 3HDYA 3K53A 3S6JA 3WMEA 1G5IA 1XMSA 8LDHA 2P5YA 3NC4A 1XQ1A 5CT4A 3VYUB 4TYMA 2EX4A 4RJTA 1GYRA 4D6XA 4Z7NB 2ZU0C 5DISB 2HW8A 2KS6A 4JLMA 4O59O 5BSMA 1J2JA 5BP7A 1OH5A 4QYXA 1GTMA 1SOAA 2G8LA 4CCYB 1Z74A 2HX1A 1DEOA 1W87A 1GTSA 3GBSA 4G81A 1T8PA 1LSOA 2P0AA 3EG5A 3U9SA 2C88A 3WOVA 2IPLA 1SCQA 2AXNA 3BH7A 5JPCA 2CB9A 2FHSA 3HA7A 1LJ8A 3DHEA 1P1HA 1EGVB 2IHUA 3AJ8A 3K8ZA 2FF5A 1PWEA 1VE5A 2CFCA 2I7TA 2Y27A 1OMOA 3JVEA 4QQFA 4WKNA 3T3EA 2NUBA 4BO4A 1P2TA 1A2QA 1SVWA 1JIXA 1OI7A 2PH1A 1Y42X 3QVGA 4YV1A 5BV8A 3J80A 2YICA 2IBSA 4KDEA 4JUFA 4RH0A 4ZT2A 2QLJA 1JJIA 4OSOA 1NVUQ 1Z5PA 5EJ7A 3OP4A 3DUFB 5IAAA 1H69A 2W43A 4X6XA 5C8DA 1O95C 4JHXA 3KJNA 3VVCA 1TKRA 4I6GA 2W2OA 1V16B 2IUFA 3EXHC 4UPVA 3F7OA 5H9VA 5HYVA 2FSUA 2HD4A 1Q19A 2PZEA 4BQEA 3JQQA 1XZFA 2ZXEA 4QRIA 5IC6A 1WLSA 2J46A 1Y4ZA 3PNYA 5TJHA 4TYNA 2FDCA 4DXDA 3LBYA 2HRRA 1A88A 4UNQA 1UJCA 5K09A 2I4NA 3CW8X 1TX4B 5HTOA 2A94A 1S7CA 3DUWA 4WLNA 1I2CA 1RI4A 3OKAA 4RTPA 5ETJA 2HMYB 2B9EA 2NQ8A 2WM2A 4WXPA 2PX3A 5K45A 5TMPA 1EVKA 1F6DA 2PZMA 3PC8C 1C30A 1Y4UA 3VYVA 3AK4A 4F4CA 4W6QA 1UIMA 2JGDB 5ES3A 1NATA 3UAWA 4F60A 3W8EA 1JFSA 3Q15C 3TL3A 3U3KA 5ITVA 1I3LA 3OWXA 2DR3A 4IHJB 4WBNA 4X85A 1PS9A 3CURA 4JR1A 5EWMB 4OB6A 2V7TA 4WZBB 5E7QA 1Q0PA 4EMSA 5F7XA 5KUTA 2FRXA 2QLBA 2Z2IA 3PQEA 4XQGA 3SX4A 3HXKA 3WHIA 4ZOLF 3AVOA 4XGQA 3FWKA 5LZ4A 2FMUA 3RAEC 3ITEA 2BFWA 4DDKA 1BWPA 5CB4A 3T5AA 3H8JA 1J4AA 1JG3A 1OQAA 4CLEA 5CW2A 2GJ9A 5KTNA 4XQCA 1J42A 1U0SY 4F4JA 4HDCA 3DP9A 4PO9A 4HDMB 3ZJUA 5I9LA 2YHUA 2FW0A 1O94C 3IC5A 1D4AA 4JQCA 2F8LA 4LDJA 4R5HA 3OVMA 1H2FA 1QFXA 2F4NA 2VDQB 1DBWA 2IF0A 1B8OA 2BMJA 4V0KA 1YQEA 3RIMA 4AMYA 5FEUA 1KEEB 1UDRA 4GI5A 1NUPA 1QLHA 4ENUA 3UAXA 4UHHA 5ESXA 5ADVA 1GKIA 1CRZA 1IOZA 2QRMA 2WIJA 3KYCB 3LFHA 4Y1RA 2Q9BA 2ODEA 4ZEVA 3UAOA 1I2MA 3L8GA 3F9CA 4OXIA 4B6RA 1XEWX 1XLUA 3E5HA 2HF9A 4KYUA 2W22A 3B36A 3CWZA 1IHYA 1H2EA 3C3BA 5BOVA 1IXSB 3EY4A 2YCLA 1GDDA 1XAIA 3IBCA 4O29A 5TQ2A 1LQUA 4CKZA 4B4WA 4YALA 3K73O 3KSZO 3TMKA 4BNVA 3C1UA 2ORED 5AHWA 3X43A 1UXIA 4ZYUA 3LOQA 4N5NA 5DLPA 2IUTA 3VXKA 3G5AA 2ZP1A 1AQJA 2FDRA 3KYIB 2HPZA 3S1AA 4R7TA 2EQBA 1CJCA 3P9RA 1ZBDA 1KSFX 3C41J 3GGOA 2E0IA 2H2WA 3AETA 5B3JA 1N34B 2QY6A 4PYMA 4JYPA 5I51A 4MIYA 4US0R 1H2WA 1V8OA 4IUCS 1SWWA 2B7LA 4LY6A 2N3ZA 4RSGA 4L75A 2JFFA 3PUZA 5KREA 3U9LA 2ZB8A 1NYRA 2YZGA 4TT8A 1NMXA 2Y67A 5AJUA 1UBLS 2EZ9A 4JL8A 4ARSA 4E22A 3ZXXA 1II8A 4PSCA 3G2OA 4KQ1A 4DYVA 1CUZA 4GGPA 2B5WA 1USVA 4XDGA 5FJJA 2OK7A 2JKZA 3AW9A 2FRDC 3NEYA 3PDWA 4GI3A 5A06A 2VWGA 3KELA 4MWDA 5IM5A 3OHMA 1W1WA 4ZXPA 5KX5A 2A5LA 2IYVA 1KYXA 3KQLA 2J6IA 4EKYA 5AKIA 2EYUA 4I0WB 3K5WA 4JLSA 2BAGA 4B3BA 3E5RA 1T5SA 1YBMA 3JZMA 4GOLD 1A27A 4J0JA 4YRFA 5KKAA 3RD5A 3TLXA 4ALNA 3UT5B 4ZOLB 3JQ6A 4OK6A 4CTOA 5JD4A 1I7QB 1X7GA 1AA6A 3EEYA 3Q6MA 5BWCA 4DM4A 3GQBB 2JFVA 4UQOA 3RVMA 2X8BA 3G0IA 4DUZB 1FYDA 3FOCA 1PNOA 2PLFA 2X9NA 4Z4HA 2HJGA 4JLVA 3RVJA 2HOQA 2RH8A 5EMNA 4HYYA 2O7NA 2NG1A 3CR8A 1X2BA 4UM7A 5CFLA 5IFKA 4CEJB 3GEPA 4Q39A 1SBYA 3WFIA 4CMHA 1IY9A 3GA0A 3UJ3X 1AUQA 2KBFA 3AEXA 2PD4A 3PQCA 3G0DA 3GA7A 3EDRA 3SS7X 4Q15A 5IU6A 1KZ4A 3WRXA 4CM9A 3N8HA 1Q16A 4ZMRA 3DB2A 1WM1A 1I7LA 2ZATA 1QTQA 1UM9A 3OOHA 2E89A 3EXEA 2VEOA 4AECA 3TBHA 2JIBA 3OPYB 2YZ7A 2AKEA 2NO7A 1YZNA 3PE3A 1DQPA 1ZM2A 3BDVA 2QAJA 4FNOA 3ZDDA 3AEKA 4XOUA 3N2NA 2JGRA 1SHTX 3AZPA 3DXYA 1EXVA 1QCCA 1HDGO 1RHUA 2J5QA 2JEYA 4MKFA 521PA 1X42A 3EE6A 2BGLA 2I4OA 5BVHB 1Q57A 4G97A 1JDSA 1F4LA 2B4TO 4ITVA 4Q3KA 2ZI3A 3TSAA 4I9HA 4OJTA 3UPUA 1JAIA 3C3KA 2FEWB 4L57A 1G9XA 4Q1BA 5K4HA 1DRVA 2EIHA 2XCUA 4YMGA 2HTEA 2WWRA 1LDNA 4UHEA 1MO6A 3B5JA 3CG0A 1RLUA 3MK31 4TXHA 3DBRA 3HYNA 1JILA 3BMCB 4PO1A 4XQ0A 1ZA2A 2H1HA 1TIPA 1I51A 1F14A 5FFFA 5I7SA 1MOQA 1WZ2A 3MAJA 3VO9A 3ZH2A 4AJ4A 4QEZA 4LFAB 4GRAA 4EGSA 2DAPA 1R0WA 1W19A 2DUUA 4IMPA 1PQUA 4PHCA 2QZ9A 4DQVA 1T4DA 2X9GA 1XROA 2PSJA 5DBEX 1XN4A 1YJXA 5TX7A 2DFPA 2X2EA 3VO2A 4GNRA 3TKAA 1SBHA 4UE2A 4BYMA 5ALMA 1EFDN 1O08A 1UXOA 2BM8A 1I1OA 1PHRA 3AQIA 3DPUA 3F74A 1ULHA 3FUVA 2WVHA 1FW8A 2YY5A 4LQCA 3V9AA 4TRRA 4PTYA 1RYMA 2VDUE 4B43A 4F8JA 3KLMX 3F5DA 2Z58A 4UVDA 1H3NA 1LWNA 1NA5A 1DKMA 1P61B 5DNUA 2HMVA 3AGQA 4B83A 2H65A 5KMGA 1IVSA 3SM9A 1V5GA 2P7HA 4DR4B 1SWVA 1W36D 3B3AA 4LDRA 1TM7E 4HNUA 4LXYA 3MWJA 1JE1A 3QLTA 1ZL0A 3ZV5A 3WL5A 1OTHA 3DCJA 3KQKA 2BFPA 3MBKA 1KVRA 1RRVA 1U7HA 1G60A 3AKZA 1XDUA 1OLXA 1NT2A 1TVCA 3WQSB 5L53A 4DCOA 3GFVA 3ZTTA 3FETA 3MA0A 5IKXA 4M87A 5FFNA 3EY9A 3EG9A 3QNUA 1R00A 3U5ZB 4C7OB 1O5OA 3PFFA 2YV4A 3QOWA 2E21A 3RBAA 3ZHZA 4D9KA 3R40A 2YFYA 4MI1A 4Q9LA 1JGTA 3NBKA 3OFJA 3VR2D 1QG2A 4YAKA 3TAUA 1U3FA 2UYQA 3CNOA 5B4TA 5LYJA 3RSHA 1CP2A 3C7AA 3F3MA 2R48A 3NHZA 4HAZA 4IJ6A 4N5DA 4QT4A 5IMSA 4RACA 5COAA 5EJ4A 1RTTA 4ZC8A 2OGWA 5TMDA 4U7DA 3H5RA 4NBTA 3HNPA 3G13A 3M4NA 2IPAB 5DHUA 3TPFA 5BRAA 2ZQYA 4WZ6A 4EFLA 4UJ3A 3ZZNA 1QX3A 3K2EA 4MXDA 3SDZA 3KZ1E 4RQBA 2TMGA 4O4LB 3TN7A 1Z38A 2W37A 5EWJA 1A95A 1R7RA 1VPLA 3EXHB 2JLXA 2ZR7A 5DHQA 2OAQ1 4X84A 5JAZA 1PZXA 1A9RA 2AW3A 2PGOA 2Q7XA 2REXB 5K0NA 3V34A 3FUTA 1VHJA 3DP7A 2J0EA 3IAHA 4BFVA 2I7XA 3F67A 2E4UA 5D3MA 1IRIA 2WTBA 4OH7A 2ZIAA 5CG1A 4NENB 3OEHA 5KC8A 5HKLA 5THXA 4EG6A 2B2XA 2XDWA 2Q5QA 2XAUA 4N18A 1XZHA 5HJ5A 4NXNB 4LXIA 3D31A 4PC6A 4PLYA 4YDQA 4ZHQA 1YUMA 2D7DA 2CXSA 1Z0KA 3E7FA 3WNQA 4U9IS 5JRZA 5HIKA 1NYTA 3L7IA 4NHEA 3EWIA 1D6SA 2FMTA 4YQFA 3BN3A 4JGGA 5CA1F 3D54D 3A4NA 3MCVA 3HCCA 3VPXA 1MJHA 3FF4A 3NBYC 5A1JA 3G85A 4E31A 3O3OB 3EZYA 1ZHFA 2AN4A 5JZOA 1NV8A 5ALSA 5C81A 3RYHA 3IQWA 1MT3A 4Y6GB 2Y71A 4FI3C 4M9ZA 4X65B 1VPEA 4O4IF 3SKXA 2DBQA 2BFEB 3GFFA 2CLEB 2VZ0A 3CZRA 1AS2A 3PUJA 4XIFA 5ERXA 4GBED 2V0NA 3DCYA 4BO3A 4CKCA 4H1WA 2Q3HA 4TWZA 1CY7A 1XK6A 2HBQA 2PL5A 3VR5H 5FDFA 5J4YA 1JIIA 2VHWA 1XTRA 4KIFA 2Q8PA 3DO5A 1BEEA 1NKTA 3A04A 3OOEA 3QPVA 4UD2A 4Z8XA 3D8RA 5CB6A 4PYLA 3ZK8A 1OWPA 4MVJP 2D3TA 3H8WA 4BP9A 1QHHB 1TZJA 2C5HA 1HMYA 3LPDA 3KR0A 1YKSA 3QEJA 2YRWA 3I01M 1ZGJA 4INJA 2XCIA 2P69A 4MUGA 3TLGA 1EA7A 1EFRA 4N40A 3U1TA 2IGBA 2VTBA 3AINA 2CKDA 3MAGA 2C94A 3FVWA 3SQDA 3OFKA 5SICE 3OT5A 1D2RA 4WN9B 4W63A 1ESDA 3MC1A 3PR1A 2O05A 1DFGA 2JHGA 5IJ0A 3H17A 2W6ZA 1KSJA 1U8FO 5EVCA 4FTWA 4GG1A 4N4AA 3GEIA 2OO7A 3KOUA 4HGPA 2C2HA 4PYKA 4DNFA 3EBLA 4JOBA 1MEEA 4FHEA 3TXYA 1GPBA 5C5CA 3ER8A 4I50A 3DW3X 3ZWCA 4DZRA 1ZGHA 2AXPA 3SKYA 1QU2A 3CUEF 2CHGA 3ESQA 5BR7A 1TCUA 5HF9A 3IKVA 1OWOA 2X8WA 2C97A 5FPSA 3JPWA 3TNDA 3UJBA 3ZY2A 2C04A 3LTNC 3MGBA 4NAUA 3AKDA 2QU7A 1UC8A 4IO1A 2WB2A 5G4LA 2VRNA 1TYDE 1WDLA 2REBA 4G5RA 4PQRA 3CUUA 3UMFA 5IJ9B 1D2GA 1H6BA 1T2NA 3KTFA 3OPNA 3LPLA 4JJEA 4RCYA 5HA5A 4WZBE 3V8NA 3UCXA 3ZWQA 5B57C 2HSEA 3M4JA 1ZCBA 2O3QA 2HRBA 1ESMA 2XYQA 2ZAOA 4MRMB 5BNFA 4JI2B 3G1WA 3IQHX 2MINA 1CE8B 4IHQA 4D79A 5CA1B 1XMXA 3ETLA 4Q19A 5LIRA 1Q0TA 2F8SA 1DO2A 3A1FA 1QGUA 3EDMA 4TSKA 3S28A 4DBZA 3R77A 5CFMA 1VLHA 1P1CA 2C7PA 1J9GA 3QBEA 1JDBC 2RH5A 3FPHA 3G2HA 2GBCA 5GJWC 2DF8A 1P8AA 2VZ9A 4Q9NA 1HO3A 2AG5A 4FYMA 3I05A 4O4IB 2ZJ1A 4QDUA 4RD0A 3NC1C 2GPAA 2JBHA 1SCJA 3NFRA 3VH3A 3K7EA 2PQ2A 1TCBA 3RHTA 3QI7A 2Q3FA 3U3MA 1E1MA 2OO5A 3BE5A 4TQUS 1RLTA 1MENA 1WPQA 4DR7B 5LN1A 1TU3A 3A6FA 1CULC 3NVAA 1JFRA 2FG5A 4M38A 1NN5A 4P4SA 4GOXA 4ZO7A 4MAAA 2G4CA 1IHDA 4QDZA 5LZ8A 1PYOA 3VX3A 4E3WA 1II9A 1Z6ZA 3GGJA 1YB7A 1RHRA 3R44A 3T7AA 2HIGA 2ZTMA 4BQRA 3Q5EA 4F4IA 3T94A 2CXXA 4C20A 5CDFE 3G02A 5LYYA 2CKMA 1FMJA 2H85A 3ENVA 2NUTB 4D56A 4Q01A 4IXTA 3HKCA 5AOVA 3CCFA 3GMIA 2D8MA 2YRXA 3Q8MA 3BIFA 1C3XA 1T9BA 3B1XA 4XEUA 4Z3OA 3HV0A 4G0OA 4HVLA 1Z0JA 2E7ZA 1CEQA 2IFTA 5FHQA 3AB8A 3D8NA 1GYQA 1M1NB 1NASA 4TLCA 4D25A 1AZSC 1DTWB 1HEUA 1YRLA 4JLNA 5AJYA 4A0HA 5A4MS 3D5EA 1Z88A 2OBMA 1E0KA 3GVIA 3EISA 4CN8A 2JFUA 2SKCA 5CCDA 4DJJA 1X1DA 1U1EA 4KEAA 5AK0A 1T8WA 3IA7A 3LRTA 4NE2A 1XZBA 5I7AA 2IZ1A 1PLLA 3R5KA 1V26A 4CJXA 3S1LA 3UB4A 2BKVA 1GFZA 3HRHA 1NNLA 5A4FS 1FMTA 1C9MA 1NOJA 2AEEA 2PZAA 2VI5A 2IYRA 3AG6A 1WF6A 3KQWA 4AY6A 1XTVA 3AOGA 3B82A 3KQVA 4UPEA 3O03A 4LFBB 3K09A 2G83A 2BFFA 3PNSA 3VSDA 5BWBA 3HXMA 1WVIA 2YZNA 3GPDG 1D4ZA 2AVDA 2HLNA 3RRXA 1XEFA 4Q1AA 1L7RA 3G17A 3WGHA 2CDBA 3QA3E 1C9EA 5LDGA 3F98A 3FYCA 1VKRA 4L2IA 1KDPA 2G36A 4AWAA 3GT3A 4ID3A 5HBGA 3O94A 4YRDA 2PE5A 3ZDFA 4Z2AA 3E9QA 3NKVA 1XMQB 3ZWNA 3B1WA 2YVQA 1OFIA 3W7AA 3PGA1 3FWYA 1SUFA 4ETWA 1M8FA 1JR3A 1F17A 3SC2A 3BCSA 1QAQA 3FHCB 4RMJA 4D80A 4F6RA 3CJRA 4HKTA 2PKRA 1YZQA 1ZRMA 4NOJA 2WRZA 4TKVA 5CBPA 4XIYA 1FUIA 4PIMA 1Z0DA 3L4JA 4V1CI 2QVXX 1Y3IA 2IPOA 4IFEA 2RKWA 5LM3A 2NYAA 1XDZA 3MJDA 2D6FA 2HJSA 4FHDA 3IP8A 1N2CB 1TA4A 3ZI7A 3STVA 3FVTA 3CM0A 1BMQA 1GVHA 2ZT6A 1BA2A 2Z09A 3K6JA 1NR7A 1HLDA 4FI3F 4MVWA 1R12A 5FP0A 5GY7A 3RUIA 5IDQA 3LF2A 5G0WA 2C95A 4C21A 1RAGA 1OXVA 1T0PA 1E9EA 3MT7A 3KJQA 3SQLA 3IR5A 2ZDHA 4C88A 5BV0A 1CUWA 2O8DA 4LXHA 2Z6QA 4X97A 1HK7A 1MC5A 5HOQA 1L8LA 1JEEA 1F48A 3CUKA 3UOGA 1P72A 1LD3A 1WUHS 1IZZA 3B52X 2B20A 3BIXA 2VRBA 2BUCA 2YWRA 3G9QA 4RVDA 4HWGA 4N6GA 5T64A 1Q5PA 4AJJA 2QV0A 2VXBA 4AD8A 5FAKA 5KNDD 2BFDB 3CX8A 1GDHA 1S9DA 4KFSA 4NXMB 3RR2A 3R0JA 3MOGA 1BXRB 2LNDA 5DHSA 2BOVA 3A9UA 2HMSA 4NL4H 3AR7A 3LQYA 1MPTA 1K6IA 1BHQ1 3D43A 2GD6A 1NVAA 4TMWA 1U7PA 1EDDA 5AI8A 1TF2A 3U7QB 1TQ2A 5EYPB 1DL5A 2WEKA 4FIDA 3A2KA 3QNWA 2VHUA 2A7XA 4LYFA 5TQJA 4EIWA 5AKLA 3ANXA 1IRXA 1JMVA 1Q22A 1GZ4A 3E7WA 3HKEA 3LVRE 3N9IA 3OHPA 4MO9A 4ARZA 4F96A 1RVV1 1RP1A 1FVFA 5A5GA 2AW5A 4E3ZA 4QATA 3QKSB 3GJ3A 4ESOA 2A9KA 4OMCA 3FHLA 1KIFA 2GLTA 3HDQA 4DZTA 1QP0A 5C7IO 4A6XA 2DEUA 1TECE 3AERB 3N8KA 4N12A 4UDXX 4E07A 1KWGA 4MNTA 4BIIA 1EESA 2XCTB 3CWCA 3WMRA 3GIWA 3E9EA 3QTTA 1AKRA 1X70A 4TWIA 1QZ3A 2RGUA 5TJ9A 1EUDB 2Q49A 3H9JA 3JQCA 4J1TA 4Z4FA 3L5KA 4P31A 5DTRA 4LRYA 4WOBA 4ZVKA 3A1EA 1YMVA 2C9ZA 3TRHA 3VU9A 1OFVA 2ZI4A 4P0QB 2IS1A 4AKGA 4EGCB 2PZKA 2H2HA 2IYOA 2X6TA 1LU9A 2NW6A 4FYPA 5FBKA 1XBTA 4AM8A 1YQXA 3OX1A 4HDQB 3A28A 5J2UF 1GGVA 3ZWPA 1ECPA 4RFLA 2DPMA 2R87A 4YJ2F 3MBOA 3RBXA 4A82A 5BNIA 1QGED 2ZSIA 1WVMA 2FHPA 1P8JA 3GJTA 4OI1A 4ACAA 1BD4A 4MVXA 2KI5A 2XODA 4YUZA 3WR5A 3S99A 2PGNA 3FPEA 3V4VB 1V1MA 2P7IA 1QYVA 2EW1A 2QYOA 2ZQ5A 3IJRA 3M6IA 5JCZA 5G0VA 4M1EA 1E4OA 3BT7A 5HFAA 3B3GA 2I4RA 3ZC3A 2ECOA 1ZJYA 4P2BA 3AIKA 4PGMA 2GN0A 4BO7A 4F56A 3PC2A 2J9RA 3ZHQA 5TV2A 1AMOA 4MDFA 2OVFA 3ORRA 4ESVA 1VMEA 2GR9A 3NHFA 2XUZA 2IBMA 1A1VA 3ILVA 1W46A 1X87A 5D1HA 5FUBA 5FTKA 4ZJYA 4NMLA 1E9SA 1A4IA 3E1GA 3M2TA 4YAWA 5TF0A 5K6TA 1OH8A 3QUTA 1I1QB 3T52A 3VOSA 4L0CA 1GNTA 1O5IA 3D6UA 3VNRA 4FNMA 3H0KA 1A96A 3NT2A 4KI7A 5FOWA 2CN1A 4DLYA 2VATA 3WBBA 4D0SA 2JLYA 2KLHA 4NFLA 5ED0A 2DPHA 1FFSA 5CT5A 2GD0A 2BL4A 1OBFO 4WK2B 4KV7A 2Q7DA 1PD1A 2HMTA 4BYGA 4HDKB 5DEOA 3KDPA 2VK1A 1IQPA 1TJYA 4NCBA 2JHCA 1HL7A 3OMWA 1UEIA 1H2XA 5AK3A 4OXYA 2ZIXA 3SX0A 4DNXA 4CL0A 4TTAA 3OPQA 1UT8A 3FGNA 1MMFB 2QVYX 2ZJFA 2I87A 3KJGA 2PH7A 2FPGB 3B1ZA 3EEIA 1FFCA 2AWNA 3BZBA 3N28A 2JHAA 4QYWA 4UHBA 1X13A 4LI0A 2Y1CA 3V1KA 5HKOA 4Z4GA 1ZOLA 3CSDA 3CBQA 1E4VA 1ONPA 4QDXA 4YI5A 1T2UA 3JQFA 3EZ9A 4ZVVA 1KI6A 2Y77A 1RBZA 3CEPB 1QB8A 1J5EB 3CRRA 2O5CA 2IYPA 2Z1MA 4G23A 5MDHA 2QJFA 1QO0A 4KACA 4KN8A 4M54A 1BDHA 2ZIFA 3OF3A 5EI5A 5KSPA 4H3KB 1FQJA 2HHLA 3R7DA 2QJOA 2VYVD 4BBAA 3MILA 1GUZA 3EVGA 1U2DA 3LUDA 1NM5A 3PNPA 1P7PA 4NPCA 4RTMA 1P4SA 3UK6A 3WLOA 2C59A 5CP8A 5DOVA