4M1TA

Crystal structure of small molecule vinylsulfonamide 14 covalently bound to k-ras g12c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
163
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
molecule tags Signaling protein/inhibitor
source organism Homo sapiens
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
total genus 63
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1tA00
1ZUNB 2ZRDA 2PX3A 1NN1A 2QI9C 4M0LA 5CITA 1XPOA 1E0AA 1GNPA 2JEOA 4HEJA 2R8RA 2IUSA 3KJEA 1ZM2A 1MO3A 3FB4A 3ICQB 1SKQA 2ZRPA 1XX6A 5EXPA 4R9UC 5FUYA 3UMRA 4XWAA 2ORWA 1BMFA 2QP4A 3NIBA 4NYMR 1KAGA 1N5JA 2CLDX 1AS3A 1GP2A 4KBFA 4ZDWA 2Q9BA 4BEJA 1NIPA 2FZ4A 4BLQA 1FFHA 2D06A 1G6HA 4XSGA 5SZKB 2PJZA 3TGPA 2IYQA 2J87A 4IOLA 4DLYA 4M21A 3NBZC 2RGDA 1AS0A 1S9DA 4M1WA 4QGFA 1LW7A 1VCNA 2ORIA 1JAHA 4BUJA 5IT5A 1NN0A 1RKBA 4JT2A 5SZHB 3KKOA 2QMUA 1A82A 1VDZA 4QXAA 4G1UC 3C15C 1G3MA 4A6PA 4KXFB 5HPYB 3WBJA 3PUXA 4EFNA 2GF9A 4OHWA 1NSTA 3BJIC 4KFSA 4E5UA 3DZDA 3ZJYA 2BCGY 1DAMA 2YOHA 5JECA 2GF0A 3AVOA 3WHKA 5M04A 4CEJA 5BXQC 2GEUA 3KZ1E 2MSCB 3QF4A 3SC3A 4B33A 2FFBA 2XB4A 2VRWA 2HT1A 3MGCA 1E4VA 4US2R 2ZJYA 2ZSDA 5JLJA 4BGDA 5TMPA 3T5GA 2BJVA 1HQCA 1VPLA 2ZIAA 2A5JA 5A0FA 4DEXA 3AVWA 3W6PA 3TUJC 3ADCA 2V7QA 3B1VA 1ZCBA 5D3MB 1XEWX 3NH9A 1G19A 3ZD7A 2ZRNA 3ZGXA 3FTQA 4HLUC 4K81B 4MYTA 4MKIA 3BD9A 2QAGA 4HAZA 3VHLB 3TE6A 3ZZTA 1RRCA 3PUWA 4MKHA 1DBSA 1G20E 1IBRA 4IOMA 4Q18A 4MDEA 4F4IA 5KSPA 1KO7A 3K70D 2LWIA 4A8JA 4ZKEA 1K5GA 3AVQA 3TW8B 2ZYTX 1NKSA 2JDIA 1KSHA 3WRXC 2BEJA 1GAJA 3AF0A 3E5HA 1QHGA 1AGPA 4I1UA 4JMPA 2DWOA 1XF9A 3JZAA 2O8DA 1Q21A 3EARA 4DLTA 1TEXA 4ZKDA 4V0ME 4Y0VA 4DB2A 2JJ1D 3CRW1 3K9NA 4PHGA 3MWLA 2ZSBA 1XP8A 4Q9IA 4BFWA 5FOWA 4B3XA 1EX7A 2BJWA 4QHYA 4LYJA 4DB4A 4AY2A 1EK0A 2ODEA 2JLZA 5K8UA 4F92B 4RKEA 2G83A 4A0FA 2V55B 1ZMXA 5DHAA 3UG6A 1N6OA 1FMJA 4RKFA 1E69A 3TIFA 4TLAA 2NOAA 1ZVQA 5EE5B 1YZKA 3MWKA 1CRPA 4QFMA 2GEDA 2ZYWX 4NYIQ 3QBTA 4P31A 1JAIA 1WMSA 1JECA 4HDCA 3A37A 5CYPA 4Q66C 1LS1A 2ZRGA 4N3NA 1Q1ZA 3CWZA 4UJ3A 1CLUA 2R44A 3AP2A 4CEIB 1M7BA 2QPOA 5IDVA 2FGJA 2PT5A 1CJKC 2IBMA 3SU8A 2FOLA 4FMCB 1K6MA 1YR7A 1P62B 1II8A 4GZMA 1KK3A 4JLKA 1CJMA 5L8VA 1W0JD 2YINC 2HYDA 4W5JA 2A5GA 4DLXA 1CF4A 1GUAA 2BIFA 2VP4A 1CKEA 1BO6A 4YXWD 2ZJOA 5F2EA 5HE9A 2PJRA 2RGGA 4A0RA 3RRNA 1M1YE 3OHMA 3PENA 4DWJA 2WPDD 3AGPA 3QXCA 4A36A 3GLFB 1U90A 1E0SA 2XZLA 1E2GA 1OF1A 2BM1A 2FSIA 1YZNA 4DDVA 1IONA 2FF7A 1LF5A 1UFQA 3KQNA 4LV8B 1UBEA 2WJGA 1VYTA 5KSZA 5FTNA 1Z6YA 1Z47A 3PUZA 2ERXA 4D4LA 5HCIA 1OIVA 2AR7A 4I1OA 2ZROA 2CCGA 2F1IA 3IPXA 1S3GA 2IXEA 3PEUA 5A4JA 3CPJB 1VHTA 4NDZA 2V6IA 1OFIA 2NO1A 1OH6A 2NGRA 2ZYUX 3RYTC 4OQFA 5BN4A 1SVLA 1P5ZB 3IIMA 4LV5B 4GMDA 3RNLA 721PA 3CX8A 4E07A 4LC1A 2JCSA 4KYIB 3NC1C 5CJ2A 4RD6A 4HYYA 2IXGA 2IYWA 2OXCA 4TN1A 1CJTC 2PBRA 1D2NA 2CVFA 1G16A 3OAAD 4ZPXA 4PX9A 5FPSA 4GDFA 1BMFD 5KPDA 421PA 4R2IA 4BEBA 3QXJA 2KJQA 3I4LA 3KKQA 1ZNYA 4Q4JB 3X2SA 2IYYA 4GT1A 3UK6A 3NBFA 5JHHB 1YJ5A 1WQ1R 5K8LA 3FHTA 1D2EA 1E2HA 4NMMA 1KDOA 4BFSA 3EZ7A 5JZVA 4QNMA 4XVRA 4ON9A 3CX6A 1X3SA 2D2FA 3OAAA 2W0MA 2NO7A 5JSZA 2R6DA 3LNCA 4D80A 1KI8A 2I1VB 3NVAA 3O8BA 2OBLA 4TQAA 3VR6A 4B71A 3WHLA 1XDBA 3GQBA 4JS0A 1G5RA 4HB0A 4D4KA 3EW9A 1CR1A 2P0EA 2ASEA 2VSOA 3DKVA 4A92A 2PT7A 4B6FA 5IF9A 5HZHA 2W6ID 1OT3A 4NYJQ 4DDTA 1Q44A 4LGMA 3VNUA 3U5ZB 3PR1A 2OILA 4IOJA 4KVAA 4W7SA 5KPJA 3EZFA 1YZTA 3MFYA 2VIIA 3P27A 4Q1EA 4B43A 1G17A 3QQ5A 3LQRA 4JVNA 2ORVA 3KB2A 5KNBA 1FQJA 3VKWA 2ZI5A 4EPYA 3T35A 2FX3A 1AM4D 2ZVQX 3KXKA 4L5BA 4AYWA 3L0OA 2F9LA 3ZH9B 4OHZA 1PZNA 3PUYA 1HH4A 2JLWA 3IHLA 4LYFA 3ECCA 3HU3A 2HF8A 2JLYA 4Q4AA 1KJZA 3NEJA 5AR1A 1W0KA 3FHCB 3GP8A 4FMBB 1VCIA 5FH9A 3NDBB 2JJ1A 4Q7KA 2OCYC 3SS8A 4DIEA 1XPRA 4Q1DA 5FPYA 3LVQE 3EAQA 3BOSA 3AKDA 2ZSAA 1KMHA 1AJEA 3Q7QA 1RFLA 2BHRA 2IS4A 5AJYA 2IS6A 2R6FA 1E1QD 1XD2A 4RZXA 4DEYA 5HCNA 3RABA 3TNFA 4ARZA 2ZUDA 1OHHD 4C0LA 4Q1CA 3U7GA 3HR7A 2IC5A 2QMEA 3LV8A 4MRNA 4ZCLA 4TLCA 2J0QA 1OSNA 1W4CA 1CXZA 2XOKD 5EXXA 1L2TA 3EZ6A 2YJTD 4URUR 3U44B 1NVVR 1SULA 4LJ9A 4Q7MB 2O52A 2CHQA 1GNQA 4FMDB 1FMLA 1KOFA 2YV5A 1U0LA 2VP0A 1XMJA 3L8ZA 3MG9A 3SN6A 2WWHA 1VMAA 2OLJA 2QZ4A 3PCRB 3B9QA 4XVQA 4LJ8A 1KO4A 2E87A 3SJZA 2VTKA 1P7CA 3GJ4A 3T12A 4UNQA 4DZZA 1GFIA 4IRUB 4OI4A 3FMIA 4KAXA 3RS2A 3GLIB 4DDUA 2DBYA 3K0CA 3KB1A 4OI0A 1P60A 4YQFA 1CEEA 1FPMA 4RFVA 1B0UA 2QPAA 4TSFD 5KNCA 2AXPA 1NBMA 2GA8A 2TMKA 3C41J 3MUFA 2ZSFA 3LA6A 1R7RA 4DSOA 2FMXA 2ZRFA 3KXLA 1YU9A 4F4CA 5KHOC 4F91B 2YYZA 2ZRHA 5P21A 1U8YA 1BKDR 5CDFA 1JR3D 3I5XA 2OFWA 5FI1B 5LB4A 2VL7A 2AN9A 1AA9A 2IYVA 2AK2A 4NL4H 3MRSA 5J4HA 3MWYW 2J41A 3L0SA 3TR5A 2YWGA 1CS4C 2IA5A 1GL6A 3CRMA 3MAAC 2WTUA 5H1YA 1JNYA 4PC2A 4BRWA 3KL4A 4BRUA 4NONA 3V4FA 3KUCA 1N6KA 4HLDA 4JL5A 1UBFA 1W4BA 3GFOA 5G53C 4AYTA 5B64A 3EPHA 1SHKA 3FKSA 2JIZD 1QG2A 4EUNA 2QBYA 2FPMA 1VYUA 4LC0A 3VKHA 2VP2A 3U2QA 1TMKA 4TTRA 2WSSA 1KZGB 1U0JA 2QAJA 4ZDJA 4ESVA 3AB3A 3AP3A 3QF4B 2H17A 2OT3B 5E4FA 2Y8EA 2OAQ1 5FOTA 2IYRA 4HB3A 1DO0A 3VFDA 4B73A 4CRWB 1VHLA 2ODBA 5DLQC 2Z4SA 3KTAA 3AKEA 4OI2A 1FOEB 2HYIC 2DWQA 2WKRA 4TZ6A 4L4UA 3LBHA 2WMOB 1X1RA 3IDQA 4D4JA 1MRSA 3SYKA 4C0QC 4LX0A 5HKKD 4EJSB 4M9QA 4OHVA 1E79A 4XIGS 3OZXA 1AGRA 2ZS8A 3G5UA 2AKAB 4EPWA 5LD2B 4MYCA 3BH7A 3M6AA 2BVNA 1TX4B 1X8KA 2HF9A 5FOVA 4DCSA 3FE2A 4M1MA 3AGQA 4IW3B 1E99A 4PC7A 3V9PA 1I2MA 5FL3A 3WP0A 1H8HA 3I5YA 4B3GA 4HSEA 1GRNA 3CBQA 3RS4A 2HT6A 4IXNA 3KQHA 2MMCA 3M0EA 3PVSA 4B2PA 4A9AA 4WZ6A 2EQBA 1HA3A 1XEXB 2H1LA 2BBSA 1SHZA 3W34A 3OFNA 1VECA 1D6JA 3C8UA 4PZLA 3SR0A 3OIWA 2G0NA 3I72A 5DYIA 4D0NA 4O3MA 2UKDA 4UXIA 4FN5A 4UNNA 3H0KA 4MDFA 4R71A 1E94E 2KB0A 4P33A 3CNLA 2IUTA 3PEWA 3U3JA 1H65A 4NTZA 3ZYCA 4C4PA 2WAYA 3CRRA 2X77A 1DAIA 2REBA 3BXZA 1UEJA 4M1OA 5AJZA 4TT3D 4QC2A 3RWOA 2IYZA 3TUIC 4A82A 1QZXA 2OV2A 3KFVA 2YHSA 5FUXA 4D26A 5SZJA 4JVSB 3SDZA 3LO5A 1QVRA 2AD1A 1Z0JA 4ESHA 1UPTA 5FOXA 1G5PA 2P5SA 1GNRA 2JLRA 4M8NE 3I8SA 4M9ZA 1IAQA 5JS8A 3BGWA 5LB2A 4EFLA 1G1MA 1W5TA 4TMWA 5JRZA 1NRJB 3IO3A 4TYWA 2ZRCA 2XOKA 5LDDC 4D25A 1NN3A 3ADDA 3HR8A 1VTKA 2W6JA 2GXSA 1IXSB 2VF7A 3GLGE 3R8FA 3LX8A 5CK4A 2GCOB 2NTYC 2DY1A 4Q4HA 4QBIA 2FV8A 3UWOA 2ZRLA 5DHFA 1MOZA 3ZS8A 4Q4HB 3QVUA 1E2FA 5F3WB 3P20A 4WXPA 1ZU5A 3DHWC 5ANRB 4QGAA 5UKDA 5LD2C 4AG5A 4JLDA 4CF7A 2PZGA 4QOSA 5AJXA 4BQSA 1KSJA 1RW4A 1SXJD 2BKEA 5JFGA 5TDHA 2J3EA 1UKYA 4JKIA 4YMWA 1KO8A 2Q3MA 1NBMD 4JT4A 4Q4AB 1FL9A 2CL6X 4UNSA 4P4TA 3U4QB 1I4TD 1QHHA 1N6RA 2GJKA 1RRFA 3EA0A 4Q03A 1GL9B 2F1HA 4JLPA 3U6KA 4TYNA 2QP3A 1D5CA 3LFUA 3REGA 5JS7A 2AK3A 2F3RA 3RAPR 1TQDA 1IY0A 1G3IA 1TUEA 2QENA 5FUVA 4LUCA 5BYJA 3AVTA 1YQTA 4MH0R 1IN5A 2WKPA 4MYHA 1Q22A 4DUGD 4PHHA 4RD2A 4WA7A 3DVLA 1TQ2A 3D31A 4KJZA 1JJ7A 1YZQA 1W2HA 1G21E 3JVVA 1NLYA 3HP1A 4DBLC 4KFTA 3W5IA 1G7TA 4ZDIA 1IJEA 4LRWA 4M53A 4Q9KA 4FMDF 5EP4A 1XMSA 4MRSA 3MMPA 3CM0A 4IVRA 2R2AA 3B13B 4LHWA 3T5DA 5CB8A 3OIVA 4A6XA 3QPVA 2RMKA 2R6AA 4LSGA 2AFIE 2B8TA 3U7FB 3AVYA 1LTQA 3RS3A 3IGFA 2VSFA 3CF2A 3LH5A 5FTKA 3FKQA 2JJ2D 2BV3A 2QSZA 3VNVA 3LXXA 1Q20A 1EFUA 2LKDA 821PA 5AJVB 4PANA 2J7PA 4LPSA 3S1AA 2F6RA 3EXAA 2YVUA 1NF3A 2ONJA 4K46A 3TJZA 5CK5A 1KMQA 1KIMA 1SVWA 2VP6A 3GJ0A 4QJ5A 2O8BB 3HJNA 4UXJA 5E7MA 1Z29A 1J70A 1MO4A 2WV9A 4FD2A 2OFXA 2DHRA 2QMOA 3F5FA 2QGZA 1DVRA 2ZJZA 3GCGA 3T34A 2O8CA 1J8MF 2WJYA 1UBGA 2RB4A 2C99A 2PH1A 1F3OA 4W9MC 1R6BX 2KSQA 2IUUA 2GESA 4C0JA 4DT1B 4URXR 3I61A 1O87A 1P61B 1FX0B 1DADA 3H86A 3F0TA 5EXSA 1YZUA 2RHDA 5J4KA 4LZZA 2EFCB 4C0KA 5L3SA 5H8WA 1KJWA 2CXXA 3EIHA 2YOFA 1I4LD 3SOPA 3SZRA 4DJTA 1G9XA 3OE7D 2HXYA 4TMTA 3GJXC 4KLNA 5TXGA 1OXXK 1P2UA 2F1RA 3ADKA 3L8YA 1UF9A 3C5HA 1KI3A 3D6TB 4HZUA 4C0HA 2H7VA 2ZUCA 2WSSD 4G5QA 1OH5A 1HE1C 3U3OA 1AQYA 2BMEA 1XJ0A 1KK2A 1YZLA 3C4JA 4BWYA 2QRZA 1ZNXA 2GBLC 1GWNA 3DEFA 3Q5EA 4HAWA 3HYTA 3SJBA 3UPUA 4TQ9A 4GBMA 4JIMA 4V02A 4PC3A 2QA5A 2I4IA 1E9DA 2EYQA 3HDTA 1N25A 1QBKC 1YRAA 2CBZA 3EA5A 3GJ6A 1SVIA 2GNOA 3D8BA 3IQWA 4HAXA 1W47A 3R20A 3QKUA 4BFYA 4CVNA 2RH5A 1Z0IA 1XD9A 3TRFA 1Y3AA 5L3VA 2WKQA 4Q7JB 4DHEA 3UANA 1ZP6A 4HDQB 2CJWA 2WHXA 1W2GA 2H5EA 4MUBA 4TT3A 4ITRC 3G82C 1ZD9A 3Q72A 4RY2A 2GEVA 1IN8A 2B92A 3HWSA 3PEVA 1UBCA 3VU9A 4I1SA 1G3QA 1D9XA 3NHAA 3O8DA 4GP6A 2F9MA 1KY2A 1N6NA 2GXAA 2OM2A 1G4AE 3U3RA 3SQXA 3NXSA 4NCNA 2WWYA 1NVXQ 2V1XA 621PA 4IDQA 3DM9B 2CJWB 2HEIA 1YR9A 4PSVA 4AK9A 1WB9A 4CT4B 3OFND 2Q0HA 3CZQA 1FP6A 2QL6A 4KVGA 4R7ZA 4UQOA 4EAQA 5L3QA 2CK3D 4GOXA 1R8QA 4JLOA 2IYLD 4D4MA 3ZQ6A 2VHUA 4FW9A 2O8DB 3EZ2A 4KI0A 1N5KA 2DPXA 1VYVA 5CM8B 1E1RD 1SVKA 3LY5A 2KBEA 2WBLC 2BWJA 1TQ6A 2G1KA 3K9HA 3CF0A 4NHOA 1SVOA 1CU1A 3V00A 2CL7X 1WE2A 3EG5A 3QG5A 2RGXA 3OIYA 1R4AA 2YC4C 1OXVA 2SHKA 3QJYA 3QY0A 2QAGB 4ZCIA 2AD5A 5AUPB 5DGXA 1CTQA 2KBFA 1N0VC 1T3HA 4Q00A 5EP2A 1KI7A 1Z0FA 1YRBA 4FMCF 2ANBA 4Z8XA 3MJHA 4I99A 4PZYA 4NCJA 1OYYA 1E2MA 4PC6A 2C9CA 1S2MA 2NMVA 5L3SB 2Z6VA 4YC7A 2ZQ5A 4DDWA 3AEZA 3AUXA 2IYTA 1L4UA 3AVVA 3MSXA 5GVRA 4B3FX 1WF3A 4IDHA 4ACAA 2DFKB 3K9GA 3QUSA 5JI2E 4IHQA 3AF4A 2O8CB 1CJUC 3QF7A 3OF5A 1C4OA 1NJGA 4KYUA 4BASA 3EX7C 1RJ9A 1U81A 2P5TB 2QROA 1IJFA 1T9HA 2QT1A 2D4HA 5DN6A 3ZIAD 1OFTA 1GVNB 3VHXA 1DPFA 3AKCA 3TH5A 5G41A 2N42A 1MT0A 1U9IA 2YOGA 4NH0A 4WBSA 1PLKA 1E9FA 1SKYE 1ZW6A 1EFRA 5H70A 2YC2C 1VCMA 4ERNA 3LDAA 3TKLA 3IPYA 4IEEA 1AS2A 3BFXA 4OJQA 1OKKA 5KOYA 1RJ9B 2GZAA 3KTAB 5EZ6B 4LHYA 1ZINA 3QKSB 3T1QA 2W6IA 3A1WA 2OCBA 1M74A 5FBWB 2FPKA 2OESA 1UDWA 1Z06A 3BBPA 1ZIOA 2H16A 3PFIA 4F93B 4BFUA 2ZI6A 1W36C 3IQXA 1NI3A 1NL3A 3QSYA 1MRNA 2JA1A 1JQLB 3DOEA 2RGEA 1XXHB 1Z2AA 2GDJA 1P9WA 1WP9A 521PA 3QXXA 5FTJA 2VH5R 2B8WA 1ZRHA 4OQMA 4XTRA 5FPKA 3MCAA 4G3XA 1KY3A 4PTLA 4RD0A 5HTKA 4M1TA 1CR0A 4QG7A 1N5LA 2VHJA 2GXQA 1WRBA 1EWQA 3A4LA 2FH5B 1B23P 1GDDA 3L0PA 3BB3A 2ZSEA 1VIYA 2QTFA 3M4YA 4OL0A 4DLRA 4YMTA 3W6OA 1AQUA 1ZNZA 2J5XA 3K70C 4BFXA 2ZEJA 5DNYB 1P2VA 1T3SA 4RCZA 4EQ6B 5B30A 5BWMA 3GLGA 1DAEA 1DAKA 2D7DA 5EQTA 1E1RA 1JPNA 1T8UA 1TF5A 1E2QA 3BB4A 3MWJA 4GPTA 2Q3FA 4URZR 2HLDA 1G8FA 5CB6A 1UEIA 1J2JA 4I4LA 4P3YA 1T91A 4TLEA 1Z6TA 4WVFA 1W0KD 1GKYA 1PUIA 2XGJA 1BH2A 1E9EA 1II8B 2Z4RA 3BC1A 3QIAA 3CKLA 3IEVA 1DELA 3E1SA 1XTJA 3IO5A 1SXJE 4C7OB 3OE7A 4RJLA 2IHYA 2XEXA 1VKJA 5JWHA 1E2IA 1TPZA 4ZI3A 4Q02A 1R5NA 3TAUA 4RZUA 2WJVA 3X1DA 2DFLA 5BN3A 2OXRA 1E9BA 2FFAA 2RGNC 5J4YA 4X8OA 5AJWA 3RC3A 4OYHA 4O25A 1C1YA 3VR2A 2J0UB 2WWWA 1G8YA 1Z5ZA 4CZ2A 5EZ5A 4MUAA 4D82A 4DLVA 2ZITA 2BC9A 2IXFA 4V0NA 2W0SA 3CH4B 2W2TA 4AKEA 4B3BA 2QSYA 4NE2A 2V4ZA 2WJHA 3G0HA 1NLFA 2VP9A 1SQ5A 1NP6A 2IL1A 3R7WA 4EPTA 2ANCA 4U7DA 3ZD6A 1Z0AA 1Z22A 3CX7A 4QGHA 4ZO4A 3U3MA 4A4DA 3QPWA 2A30A 4YMUA 1W36B 4OK5A 4Q7LA 4QBGB 4AIIA 4Q1AA 5A5GA 1IY1A 2ECKA 4QBHA 2XZPA 3VMFA 3KQLA 3WMGA 3R9WA 4RFSB 5C4GB 3AM1A 4DSTA 3B85A 5KUTA 2W2XA 2KE5A 3GEEA 4UXHA 2ZTSA 5C18A 4WZBE 4DIDA 2FGKA 8OHMA 1OW3B 1Q3TA 2FSFA 3E2IA 3N70A 4M1KA 1VCOA 1E96A 2ZUBA 3GLGB 1NVVQ 3SQWA 2JAQA 2OFOA 2J0SA 2OO7A 4DKXA 1H8HD 1JXOA 2OCAA 4I81A 5JEEA 3R9XA 2A5FA 5J4LA 3W9YA 4QBFA 5DN6D 3TQCA 3A8TA 2ODNA 4EPRA 1SKYB 2EWVA 3B60A 2LKCA 2BMFA 3VTKA 3NH6A 1GTVA 1GIAA 1P4SA 2QMHA 3FOZA 1MV5A 3SEAA 2HJVA 4RD1A 1FUUA 2PL3A 4PQFA 4C0AC 4YLGA 1J7KA 1XXHA 3IHWA 3FWYA 1U99A 2A7QA 1WXQA 1E98A 3KKMA 2OZEA 1OB5A 3WNCA 2CDNA 3FDIA 2XB2A 3QOFA 1Q12A 1G291 5JRJA 1DARA 4JLVA 1PV4A 3WMFA 3LBNA 3CR8A 1E2KA 3MLEA 2VHQA 3OEEA 4A2PA 3QKSA 4LBYA 1R0ZA 3B1ZA 1EXMA 1KNXA 4WZAE 4GRAA 2HJGA 3DM5A 4LJ5A 4BZXA 3RDPA 3BK7A 3FYHA 4A1FA 2XNDD 2AL7A 3S1AB 3UATA 4DLWA 3BERA 1G8GA 2RGCA 3E70C 3KJHA 4PR0A 3PUVA 3P26A 1L8QA 4KITB 4M22A 3WYFA 2NZJA 1W48A 3LQQA 5LBIA 3WP1B 1RIFA 5GJCA 1NG1A 3QNUA 1WBDA 2QTHA 4C2TA 1X1SA 4DCUA 1KJYA 4UNRA 4ZDKA 4TYYA 4EPXA 4PPQA 2WWXA 4HAUA 4TLBA 1P72A 4FWTA 4QHTA 2REXB 1XEWY 1AN0A 3W3AA 4A0GA 4OKSA 2WJJA 2UZIR 4QM6A 4KO8A 3B9PA 4B48A 2OCPA 1TTTA 3EC2A 3GLIE 3X1WA 1A4RA 3BS4A 2QEQA 4N0DA 2HLDD 4BFVA 3SFVA 1UKVY 4P4SA 2JLVA 4Q47A 1QHIA 1HY3A 4H9GA 2PEZA 4HI0E 3PIRA 2XJ9A 3KKNA 3HU1A 5GVSA 3ZLJA 2IYSA 3ZS9A 1OFHA 2GJ9A 1P3JA 1UKZA 1ZIPA 2PCJA 4RZ3A 5TVKA 2Q21A 2IK8A 1NLZA 1S9HA 2UVQA 1KK0A 2ZJBA 2J0VA 2X2EA 4EPVA 3EIEA 2FSGA 2ZR7A 2BM0A 1PJRA 1T0JB 3LBIA 4FXPA 3I1FA 3QEOA 5SZIA 3V4RA 4AKHA 1XCMA 3GLFA 3AKYA 2D2EA 2V7QD 3CO5A 3GFTA 4CEHB 3BRWD 5DISB 4IVQA 4QNRA 3GLIA 1EX6A 2ZI7A 1IHUA 3SBEA 2E1RA 1OFUX 1N2CE 2XSZA 2JLXA 1U8AA 5KSYA 4NYIR 1OLOA 1X8JA 4US0R 1LNZA 4R2HA 3ZVNA 1M7GA 4BLRA 4HATA 3THXA 2O8EA 3A4MA 4FCWA 3H84A 3BWDD 1VIAA 5CJPA 4DCTA 4M9SA 5F9HA 5TB5A 1CRQA 4LJ7A 1A2KC 1ZUHA 3SBDA 5HZKA 4OHYA 2GETA 4PAMA 4PPNA 2CLCX 1T0HB 2Q9CA 5J47A 4O2LA 2WIBA 1GZSA 5AUQA 1SGWA 1ZCAA 4D6PA 4URVR 3A1TA 3KX2A 3B1WA 2EFDB 3EPJA 4GL2A 4KSCA 2GCPA 2ZRMA 1I2DA 3QEJA 4A8JC 3B82A 2F43B 1Z63A 2VF8A 4QGGA 2NG1A 3P32A 4X8MA 1G6OA 1IN6A 1FUKA 2WWGA 3NBYC 3A6PC 2GVDC 1JPJA 1N6PA 4DXAA 4D0GA 5EE1A 1TL7C 2V9PA 5BW8A 2CL0X 2RGNA 1W46A 3R8CA 1R5BA 1DG1G 1UDXA 1ZM3A 2CNWA 2OUKA 3B5JA 4JLJA 3CIOA 3BE4A 4LPKA 2FEOA 1NSFA 3F3YA 2Z83A 3U7EB 1W5SA 4UKDA 1AK2A 1G7CA 1SVMA 1ZD8A 3BFKA 3R9IA 4TMKA 3JZMA 2QQEA 3VKGA 3AVXA 4Q1BA 1HTWA 1XB2A 2B7CA 2G6BA 4D0LB 4NP6A 3HPQA 2YWEA 2ZRAA 1IOZA 1CR4A 1RYFA 1XCPA 1R10A 2WZQA 1XRJA 2DYKA 1I4DD 3T61A 1T4GA 5FR2A 4D81A 1BIFA 1F2UA 3PJRA 2BKUA 3ICEA 4IDNA 4P4SB 1J8YF 3OEED 3N2EA 1Y63A 1TEVA 2Q9AA 4MYUA 1OXUA 3DKPA 3IUYA 1RYHA 5EE3A 4PZZA 2AX4A 3TSOA 4BECA 2C5LA 4FIDA 1P2SA 3QE0A 1EFRD 4V0MA 5JI3E 1D8TA 1DEKA 2C03A 1G8PA 2RGBA 3CZPA 4LI0A 2G9NA 3WY9A 2AXNA 2ZJAA 1FX0A 4FCVA 1M7HA 4M4SA 4V03A 4PHTA 4TLDA 4PPFA 5CM9C 4PSKA 3AP1A 4AURA 5CLLA 4CEJB 5JWRA 3QKRB 4G0NA 1CIPA 5EE0A 5EUQB 1KO1A 1RVDA 3FPAA 4Z1MA 2MMGA 5DH9A 2ZU0C 1KKLA 3GJ3A 1R5OA 1SVSA 2AWNA 3NEYA 1OKKD 2OBNA 2HCBA 2RGAA 3AF1A 3DO6A 1DAGA 2C77A 3FKSD 3IIJA 4XH9B 2A78A 4ACBA 2FN4A 3K0EA 4R98A 4BPBA 1XEFA 2GAAA 4K8OA 3TAHA 1BOFA 1T8TA 4RCYA 1II9A 1OYWA 3T1TA 1A1VA 1FNMA 4PQYA 4XD7D 1E9AA 3TSZA 4XWOA 3WBKA 1QRAA 1XTQA 5KDLA 1Z08A 4LBWA 1QHNA 4B34A 5KO2A 1GRQA 4HUQA 3RC8A 2QBYB 2JLQA 3EASA 4FI3C 4M2LA 2R6GA 1XU4A 2WOOA 5GJBA 5FFMA 2C9YA 1W7AA 5DIFA 4BZQA 3UWKA 1AKEA 1U2RA 2A5DA 3QXHA 1R0WA 1O3YA 2OG2A 4GZLA 3J81k 2CCJA 1TF2A 1N0WA 1Z2CA 2FNAA 1DO2A 4AKIA 4TTPA 5C2JB 5E3HA 4GOKA 2ZE5A 3UMFA 3O8CA 2D7CA 2EWWA 2BMDA 4JKYA 3WMEA 2OHFA 2XNDA 4Y0AA 4IDOA 5KDDA 2X2FA 3L82B 1IY2A 4NPHA 1CJVC 3O8RA 2REOA 3ZIAA 4GMXA 4KLZA 4RFSA 2XITA 3ETLA 3Q9LA 2Q6TA 4HUQB 4S35A 2I3BA 1SZPA 4ABYA 4H1VA 4LY6A 2DCUA 3CRVA 4KFRA 4OHXA 5E7IA 4G5SA 3ND8A 2XSZD 4LK2A 1UJ2A 4AG6A 1N6LA 2DWPA 1GRRA 2FA9A 2A2ZA 3CUEF 3A1UA 1ZJ6A 2AFHE 4OBEA 4TMVA 4BFTA 4EKDA 3CF6R 4HAVA 3TMKA 1LF0A 1OV4A 3T1OA 3NKVA 4MGYR 4IKEA 3PXGA 2GILA 3RS7A 4DCNA 4QKQA 1KDPA 4JSTA 4M1YA 2EYUA 1KDTA 2J0UA 2V8OA 4N1AA 2H57A 2J1LA 2WWIA 2JLUA 3GPLA 3U44A 3DDCA 4BFZA 2RKOA 4LOAA 3THYA 1COWA 4DSUA 1KO5A 2IF2A 3ND9A 1J90A 5EUMA 1W36D 1LS6A 4AD8A 2P2LA 2QY9A 3WNDA 1RC8A 2WSMA 2QORA 1Z0DA 2GCOA 2EFHB 3TW4A 3P1JA 1XD2B 4LHXA 1G8HA 3EPLA 1MH1A 5J5CA 3GLHB 3SHWA 2J9RA 4EDHA 2JATA 4LHVA 5KYKA 1SXJC 1ZUIA 3TVDA 4L9SA 2JGNA 4GP7A 4FWIB 1PUJA 4M9XA 1JR3A 3B6EA 3CR7A 4JSYA 3ZDQA 1HEIA 1WBBA 1KI2A 3UMSA 2J7KA 1F2UB 3QI2A 4L8GA 4W5HA 2DB3A 3WYAA 1Q57A 1RRPA 3GEIA 1XMIA 4YMVA 3BH6A 4C3ZA 3H1TA 5K8IA 4P4UA 4Q4LA 2O0HA 1X6VA 2Z5FA 2ZS7A 3NHBA 5DSZA 3EWSA 1XTRA 4XWKA 3NC0C 1AZTA 2NO0A 3EWAA 2ZU6A 5DO9A 3LX5A 2NQ2C 1KI6B 1SXJB 4LJ4A 2N1BA 3RHFA 3IILA 1VG8A 2XXAA 4HB2A 1U8ZA 2CK3A 1PVOA 1HYQA 1EGAA 4TYQA 1Q1QA 4HZIA 5F9FA 1NMZA 2VSXA 4PC1A 2B6HA 4PO8A 2X8AA 2HXSA 4XSHA 2ZE7A 4MGZR 1TNDA 3X1XA 2O0KA 3NWJA 5FBVB 4DSNA 3K0SA 4AYXA 2L0XA 5FL7D 1RPZA 3A4NA 1KI4A 1Z07A 3THWA 1KYIA 2EU8A 2JLSA 4JJKA 4NKRA 4I1VA 1AIPA 4NYJR 4HLUA 5FOSA 3FFAA 5JCZA 2QTVB 4OQXA 4E03A 3K0CC 2XTNA 4AKGA 1N6IA 3SE0A 2WICA 2ZPTX 4N0EA 3SFZA 1K8RA 1V43A 5JMTA 4KCGA 1P6XA 2QU8A 3KDSE 5TARA 1Q0UA 2IW3A 2PLRA 2WWFA 3SHFA 1PLLA 5J4VA 4B74A 2AKYA 1NVWQ 2IS1A 2R62A 5JHGB 1KGDA 2Z0MA 1NN5A 2PZEA 3TSWA 3I62A 4JLBA 1UM8A 3KJIA 4IVPA 1JXMA 1T3LA 1LY1A 1YR6A 3DMDA 2YWFA 3GJ7A 4PO1A 3SYLA 2ZJ5A 1S8FA 3KXIA 4B75A 4OQLA 4PAQA 4CEHA 2QP9X 2V6JA 4TZ0A 2HCJB 1KSGA 4FCTA 4F4JA 5AUNB 1S0UA 2C9OA 5FUWA 3TR0A 3EZ9A 3D3QA 5JJKA 3U61B 3A1SA 4H1UA 1E2PA 1LFDB 2RCNA 2NO9A 1XMVA 3TUZC 1W49A 4U5XA 2ERYA 2GJSA 1CR2A 1TAGA 2KWIA 2FFQA 4LJ6A 5FI0B 4EJSC 1IM2A 1NVUQ 1QHXA 2RHMA 1P2TA 5J40A 4B3CA 1JALA 2NPFA 1G64A 1N0UA 1E2DA 2R65A 1US8A 2WJIA 1FP7A 2CLSA 3NDPA 3K0FB 1IN4A 3ONWA 3FFBA 4QL3A 4Q9JA 5FBQB 5TY0A 3NBXX 4Q48A 4XVUA 1Z6GA 2QGNA 2ZI3A 5JBQA 1MABB 1U0HC 4U00A 2WMNB 3GD7A 3LVRE 3U3KA 4LJYA 1G41A 4PAOA 3CONA 3L0IB 4Z54A 5FTLA 2GVZC 4PXAA 2QAGC 4BLOA 1JBKA 1V5WA 4IOKA 3X1ZA 3OESA 2DR3A 2VHTA 2D3WA 4OK6A 4WIAA 4JBWA 4LHZA 1MR3F 2JASA 1FNNA 5G3YA 2OLKA 1KK1A 3Q5DA 3OIUA 4QJ4A 4QRHA 1KZ7B 3W8NA 1AKYA 4ILEA 5CYOA 1UAAA 4HLCA 2WVJA 2GJAA 5L3QB 2PMKA 3RVBA 4B2LA 4TL9A 4BLSA 1UKEA 3LW8A 4CEIA 2P3SA 1LVGA 5IK2A 3PEYA 1XNJA 4GI7A 1XXHE 5CLQA 3WNBA 1GKIA 1COWD 4FINA 2KI5A 2PEYA 4BE7B 2HUPA 2NO6A 4YDHB 5GJWC 5KTYA 5CDFE 4LBZA 3CRQA 4DLZA 3THWB 2YNMA 1ZNWA 4OJKA 3VU9B 3RSLA 4O0MA 1XBTA 1E4YA 4HDOB 3WRYC 2GKSA 5HKKA 2YKGA 3I73A 1E2LA 2R9VA 1ESMA 5BN5A 1G4UR 3K70B 2GZHA 3Q3JB 2V3CC 1U94A 1D9ZA 2H92A 4ARZB 4LV6A 1Z8FA 3RANA 3RS5A 1LB1B 3U7HB 1XJCA 1M8PA 2G88A 1QHSA 3ADBA 1IXRC 4JL6A 1YHNA 2WIAA 2ZS9A 1ZM9A 1R0XA 2O0JA 4KV9A 1HT1E 1VG9B 2OE2A 3QXSA 1ZC4A 3SJCA 1A5TA 1OHHA 3JVUA 3CLVA 1D2MA 5E7JA 3C14C 4A8JB 4MA4A 3FMFA 3RRYA 5C4MA 5FTMA 3UIEA 4G01B 2ZJ8A 2D74A 3U60B 1XWIA 1F2TA 2ONKA 2CE2X 2JJ8A 3AQ4A 1OXSC 3RLFA 1E3MA 5DI3A 1OIWA 4CIDA 2J46A 3FGNA 3K8YA 2CHVA 1KTVA 2C95A 4C30A 2FE4A 2ZR9A 3BIFA 1OJLA 2PX0A 3UXMA 3KKPA 2DFTA 3GLHA 2ZAOA 5F98A 3GJ8A 4Q21A 1GOTA 5FL7A 3TK1A 4X8HA 4E09A 3KQUA 3VAAA 3LLUA 2ZR0A 2QRNA 2NIPA 3I3SR 1OB2A 3Q8XB 4PO9A 2ZAMA 5AUOB 4Q5IA 3W6NA 4IDPA 2EVWX 2XTMA 4M1SA 1S3SA 3GLFE 4IEIA 3THYB 4LYHA 5BQ5A 3VR3A 2FG5A 2OAP1 2D62A 1G3RA 2X1VA 4Q19A 4TTQA 5FR1A 1Q1EA 4B35A 3RS0A 4PQRA 2XX3A 4UNPA 4A15A 2GTPA 3L2OB 3MD0A 2VP5A 3K53A 2AHOA 4OQNA 4C7OA 1JQJC 121PA 4YXWA 4BLTA 1F5NA 4Q4JA 1Z0KA 3T15A 4URWR 1ZYUA 5C46F 4II7A 1E0JA 1FW6A 1N6HA 4IFEA 4G5GA 4MQBA 1G7RA 1XTSA 2W2VA 2OBMA 4MKFA 4JBYA 1EFCA 1CP2A 2GK6A 4LYAA 1E2JA 3UG7A 3RRMA 3TVTA 3B8HA 2ZXUA 1JR6A 2JIZA 2OSBA 3ASYA 2IT1A 1ANKA 5B2ZA 4F38A 4HLQB 4C0SA 5K8TA 1PLJA 4POAA 4O2RA 3SI7A 1DAHA 3IIKA 4XOIA 3VR5A 4JYBA 3NTUA 4DUGA 4HB4A 4B76A 2FPLA 2PZFA 3RSOA 4DCVA 1MABA 3IBYA 2IYXA 4JLNA 3FVQA 4NCKA 4KHZA 2F3TA 2FZLA 4V0OA 1OH7A 4JJZA 2C8VA 2XAUA 2CHGA 3QG1A 4X8LA 2Z43A 1L4YA 1Q1BA 5LPNA 3LD9A 1E79D 1KHTA 1H8EA 1QDEA 1EWRA 4LWZA 1QF9A 2QE7D 2ZI9A 2ZREA 3CPHA 2VA8A 5G3ZA 2QE7A 2ZE8A 5E95A 3I8XA 2P6RA 2XTZA 4TQUS 4KFUA 2NZ8A 1RE0A 2W83A 4B3DA 1CBUA 3K0AB 2ZM5A 2EFGA 2ZRIA 2G1JA 2A5YB 5C1BA 2BDTA 1QHHB 3W8RA 5EP3A 4US1R 3DOFA 2BOVA 1NMYA 2F1JA 4L15A 4MRPA 1XZQA 1E2NA 2ZE6A 3DMNA 3GJ5A 4JZKA 4RD4A 5BYKA 1XTIA 3ZZUA 3U6BA 3LRPA 1S96A 1NY6A 3IBGA 2VLIA 3DZ8A 2ZVPX 1XPUA 2C2HA 1E0KA 5HR5A 2O5VA 3Q7PA 1G5TA 3KFXA 1GL7A 2VPPA 5FBRB 4TMZA 3OEHA 2WPDA 4GFDA 2GJ8A 3HYRA 3BB1A 1EESA 4NCIA 3GFPA 1BYIA 1ZU4A 2O8FA 3KQKA 1ZD1A 1IN7A 1G7SA 4OK3A 2C98A 1GKUB 3A36A 2ODWA 3VQTA 3WXMA 1A7JA 3K1JA 4B47A 1NIJA 1JEDA 1L7VC 4YDSA 2QPTA 2UZ3A 4TL7A 5JEDA 2IWRA 2AWOA 2BBOA 3Q85A 4J0QA 3HPRA 2GZDA 3BAFA 4TL8A 3GEHA 3F8TA 5CIWA 1HQYE 1MKYA 3BORA 2CNWD 1RRGA 1ZAKA 4CDGA 4ZIRA 2QM8A 2GHIA 2PCLA 5JCPA 2C78A 2BCJQ 2H8KA 1RZ3A 1M2OB 1CULC 1E1QA 2GXUA 4F7WA 4XJXA 3SYNA 3AUYA 1HE8B 1XZPA 1KAOA 3RRZA 2C04A 5DYGA 2XXAB 2GCNA 4IJMA 2A9KA 1KI6A 1SXJA 1OIXA 3T1VA 1HURA 1DAFA 1KI9A 3C5CA 4UJ5A 1EFHA 5D3QA 2ZANA 2BBTA 5AWFC 5L3RA 3THOA 1F2TB 4A2QA 2ATVA 1IQPA 1E9CA 1JB1A 1M34E 3H2YA 3LLMA 3P4YA 2P65A 2LCFA 2FEMA 4JLAA 4NCHA 1F48A 1BYUA 5FPHA 1YZGA 2QN6A 4V0KA 2IEZA 4Q9HA 4WW0A 3ZZ0A 5EXTA 1BS1A 2H18A 2XNSA 5EE9A 5JJLA 1Z3IX 4ZIRB 4JYCA 2HDNB 1TU3A 1E32A 3TQFA 2BMJA 1ETUA 1JEEA 2W58A 4LJAA 1XEXA 2IHBA 3B7GA 3GLHE 1W0JA 2VO1A 4TSFA 3I92A 5D3MA 4MKGA 1F6BA 2FSHA 2V54A 5G40A 1XD8A 4A2WA 3WYGA 4C2UA 1VG1A 2CE7A 2F7SA 3LAWA 4ASUD 3UKDA 1T6NA 2ZETA 4G5RA 4URYR 3N5CA 4G5OA 2QT0A 4ZCMA 4KSBA 4TYPA 2O8EB 1EFTA 4PFSA 3DL0A 3QBVA 4IXMA 3TLXA 3VR4A 5KNDA 1C9KA 1NY5A 4WXRA 5EP1A 4OI1A 4WOPA 4IFBA 5DI9A 2IF0A 2GAOA 3QPUA 5KSOA 4PSAA 2FFHA 1FTSA 4XD7A 4EJSA 1EG7A 3PITA 4B6EA 3ZVMA 4YONB 3EC1A 4RD3A 4Z51A 1A2BA 5IHPA 3ASZA 3VX4A 4AI6A 2ZRBA 3NG1A 4PHFA 2ZJ2A 1ELOA 1W4RA 1WA5A 3A58B 1AZSC 4Q1FA 4RSGA 4WAUA 1G18A 1NMXA 1G3UA 1KNQA 2FU5C 1MO5A 2P67A 4LCBA 3EIQA 5B57C 5FBLB 2GWHA 1YE8A 2NPIA 3P4XA 4EIWA 2QQ0A 3SJAA 1NNEA 1M6NA 2OEPA 1N3BA 5IK2D 1DS6A 3A1VA 1XCGB 3I32A 1DOAA 4QJ3A 4CT5A 1KDRA 2QM7A 1YR8A 2E9SA 4JLMA 4GOJA 4HZUB 1QG4A 1NKTA 1LV7A 1GSIA 4PPGA 1WCV1 3SNHA 1J99A 1UADA 1ZM7A 3H4MA 3K0FA 3VR1A 4RZ2A 1DE0A 5KDOA 1T5IA 1TADA 4CW7A 4LBVA 3CNOA 1S4QA 4DVGA 4E22A 4NZYA 4KODA 1S1MA 3C16C 3GMTA 4GSYA 4NYMQ 5ELXA 4Q01A 1U9IC 2CCKA 1XFAA 2R6CA 4D2IA 4Z1MD 2VYFA 3N2IA 3B78A 4DT1A 1W1WA 3AH8A 3CB4A 5GJVC 1N5IA 2B21A 3IKJA 3QVVA 4B32A 2CMKA 4XTCS 4Q9LA 2YWHA 3BFVA 1P9NA 4GNKA 1VG0B 4A0HA 4KBGA 3QKTA 5CIQA 4TL6A 1R0YA 2O8BA 5H68A 3K9LA 3PQCA 4CYMA 3CH5A 5B58C 3M1IA 1OH8A 1Z28A 3HU2A 5KU1A 1YVDA 1QHYA 2J59A 3QKRA 3KUDA 4DLSA 2C96A 3AV0B 3FHOA 1K5DA 1KKMA 2IEYA 3K09A 4AC9A 1H8ED 1NJFA 3BH0A 1F60A 4V0LA 3W5JA 2WAXA 1P9RA 3C7KA 4QHSA 3O47A 5TV2A 2RAPA 4P32A 1X8LA 2FDCA 1QVAA 2A3RA 3W90A 4AWXA 1ZM4A 2K5UA 5GADl 5FPTA 5HE8A 4QM7A 2ATXA 3VX3A 1ZBDA 1KMHB 1Z83A 2FJUA 4HAYA 1JR3E 3RWMB 5JWOA 2IX3A 4TWZA 5DI3B 2P6UA 2MSEB 3LWNA 1DG3A 2GBLA 2WM9B 4MITA 1GITA 4JBXA 2GRJA 1GG2A 4B44A 4U02A 4BZPA 1II0A 3CNNA 3KJGA 2FWRA 4NU0A 3ZQJA 4BLPA 1IXZA 2W6JD 1HT2E 2IYUA 2XJ4A 3CPEA 2X19A 1YKSA 3B1XA 1T5LA 1R8SA 1R2QA 3FMPB 2N46A 3B2EA 2Q3HA 2VEDA 3L43A 4MGIR 1E9RA 2WOJA 4YMSA 3R7WB 2JDID 3TBKA 2MSDB 2B7BA 2YZ2A 1OXTA 2F55A 4ZV4A 5DE3A 1FQKA 1KSFX 3CW2A 2QG6A 1XTKA 1W44A 1Q3HA 1WDTA 3MJRA 2ZRKA 4L9WA 4MGKR 5AK0A 3U4QA 2DFNA 5EJEA 2CVHA 1FTNA 2G77B 5JJIA 2HV8A 4DC9A 3OEHD 2F43A 3CWQA 2G0TA 2IWHA 1ESNA 2CEAA 4W5WA 2G3YA 3LXRA 4CGZA 1NBME 3REFA 4C9BA 2ZYVX 3T06B 1E6CA 2P6NA 4ASUA 4S2EA 4JVMA 2W00A 4TMXA 5JSZB 2BEKA 3AF2A 1JI0A 4JVLA 2J45A 3AF3A 1HUQA 4L16A 4RVCA 4EFMA 3QENA 2O8FB 1DTSA 1TU4A 3AVUA 4Z8YA 4C0BA 1GM5A 1OPXA 2V1UA 4DRZA 1ZC3A 221PA 4HUTA 1E9SA 4JL8A 2QUZA 2PLFA 4MRRA 3ZVRA 4KU4A 2GK7A 3D7MA 4P0TA 3LW7A 3THXB 4ZI2A 1P75A 4DLUA 2PMDA 2JJ2A 3AVPA 3IEUA 1Z6AA 2EW1A 5FOUA 3W3ZB 2VBCA 2ZI4A 1Z6XA 3K09C 1KI1A 1W4AA 3K0AA 4EQ6A 1NG9A 1ONBA 2ZRJA 4NBSA 1E2EA 1ODFA 3FMOB 4MRVA 3PV0A 3ZVLA 4B2IA 4LDJA 1P73A 1XJQA 1TQ4A 3X1YA 1MO6A 2IS2A 1JJVA 3DPUA 1X86B 2I1QA 1US8B 2VQSA 1GILA 1TUIA 2EFEB 2QNRA 1HV8A 1U98A 3B1YA 1TF7A 3PG5A 3EPKA 1OE0A 2BBWA 2XZOA 6Q21A 1FZQA 5IRCD 2J7PD 2VHCA 1S1CA
chains in the Genus database with same CATH superfamily
2ZRDA 1SM4A 3F49S 3LWBA 5A6SB 3TLGB 2EGGA 1JSCA 1X94A 4RVSA 2FW1A 3HKEB 4OMCA 4X7BA 4ND3A 2OYCA 2WD8A 1DX9A 1NPDA 2WTMA 2PMWB 3VPAA 5CD9A 3N2GA 3A9UA 4BX9A 3ICQB 2J5BA 2O1WA 1LDMA 3EVNA 2ZRPA 1XX6A 4IILA 2XEDA 3SZOA 1M8KA 5FLKA 4R8VA 3EXFB 4XWAA 3VH1A 2OPHA 1SCNE 4LAFA 1BMFA 1C50A 2NLOA 2QP4A 4JLWA 3V8QA 2Z08A 3M34A 3KK0A 4JB3A 1I2CA 2BEUA 4UPVA 3HGMA 2YIMA 4XARA 3C3BA 3WLAA 1ZO8A 4LQCA 2YRXA 2V0GA 3EYWA 2D06A 1L4NA 2JRLA 3EBOA 3OTHA 5D01A 4H7PA 5SZKB 1JLHA 2HSGA 3TGPA 4PLCA 1QC5B 2V7PA 3D5QA 4JBHA 5A3JA 1ZJWA 5BUCA 5EMHA 4GKAA 4FYPA 5E4YA 5F51A 4EUSA 1FIUA 1VCNA 1RWMA 3HCNA 3OLVA 2ORIA 3PCTA 4XWYA 4IXDA 2ZR8A 5HOEA 3HVRA 4L4ZA 4RIIA 1P1RA 4CMAA 1RLOA 1YRHA 3C15C 3RSQA 1LNQA 1Y34E 5LWHA 3WO1A 4G24A 3PUXA 1YCFA 4GWKA 1Q74A 4R9VA 3WX0A 4BLWA 2GF9A 2V6FA 4TS3A 2CF5A 1KYTA 2Q2VA 1NSTA 3IRUA 4M86A 1AQLA 5BMVA 5M04A 1PCXA 3QTBA 5JNUA 2GEUA 1Z35A 2MSCB 2PZKA 4H18A 1NVBA 5CIYA 5AHOA 2XVAA 2VRWA 1Y4UA 4HMOA 2WTNA 2ZJ4A 3PHGA 3RSSA 4US2R 4R9NA 1AKUA 2ZJYA 2ZSDA 4L85A 1UBLS 5TMPA 3PGXA 1ACMA 4K9DA 4LMBA 4HN4B 2C9ZA 1R4MB 2A5JA 4Q12A 4UZEA 5A0FA 1VZ2A 4AIRA 1CUGA 1CUSA 2E4YA 2HA2A 4TV8B 5HYVA 2C83A 2G9RA 1ORIA 3BRQA 1ZCBA 1QH1B 1XEWX 2Y1EA 1XYGA 2Q28A 3ZDZB 2C97A 3AESB 2QLNA 3Q0TA 2QUIA 2YMMA 4MKIA 5T4BA 1GZ3A 4B84A 2QAGA 1LXCA 2ZWAA 3HYNA 4EATA 3PUWA 2UYGA 2DTXA 2V8BA 1DBSA 4JI7B 1C9NA 2XKAA 3BHJA 4IOMA 4ALKA 4I2NA 1CQIB 2PJDA 4Q18A 4F4IA 2IBSA 2EDCA 2LWIA 1D6NA 5KCMA 1CB0A 3NANA 1NKSA 2JDIA 3K94A 1EXWA 3KZVA 3WRXC 2BEJA 1NKVA 2YXEA 3AF0A 3D2LA 1U80A 4FVTA 2ZRQA 4LRUA 1IQ0A 2Z9DA 4O2BA 1WKCA 2FQYA 4JMPA 4CM5A 2O8DA 1N2HA 3JZAA 4AT1A 1SHTX 3AESA 4DV5B 1IOWA 1OI2A 1WIWA 2H9YA 3HO8A 4L7VA 4DLTA 4V0ME 3M1YA 4IP0A 4DB2A 1CYDA 3OT1A 4HG2A 1MB3A 2Y27A 3WZLA 1O7JA 2OP1A 2ZSBA 2AMJA 2IU3A 1XP8A 3RJTA 4Q9IA 2EKPA 2K7ZA 5TEWA 2IQ5A 2AN4A 2H6EA 4LE1A 2PLNA 1EK0A 2ODEA 2JLZA 1B8PA 2AI2A 5K8UA 4F92B 4MNTA 2G83A 1NPTO 1MEJA 2J07A 1K08A 1CF2O 5DHAA 3FOBA 4QUEA 4RKFA 2DJIA 3KQVA 5FT9A 1UXJA 5K6TA 3K0SA 4M0MA 4TLAA 4DXHA 5EE5B 3OC0A 2FHPA 4QFMA 1NXTA 4MCIA 4V1CB 4YGXB 1JECA 2X5NA 4HDCA 3I39X 5CYPA 6ABPA 1RJEA 3FLAA 1LS1A 2H4ZA 3KO8A 5REQB 4CV1A 4OH1A 1BDIA 1JMVA 2QPOA 2V6GA 4BX0A 2G0AA 3WL4A 1TTPB 3P5SA 3M4NA 4N65A 4ZCRA 3GDFA 4AMVA 1TXGA 3IV6A 4C2BA 1U3TA 1KK3A 3D8HA 4JLKA 1CJMA 1F8GA 3NAMA 4MQFA 5EFOA 2I9KA 3FSGD 5TMDA 5L9AA 2VZ8A 5BT8A 2YINC 4W5JA 3W4JA 2O5EA 2A5GA 2AHRA 1WABA 5B1EA 4PONA 1MPTA 1EX9A 4CU2A 4EHBA 2R87A 4MCAA 2EKBA 2PMBA 3H2JA 5HE9A 1XPJA 2QI9F 4HF7A 3WSTA 4DBLE 3H9GA 3FDFA 1H5UA 4EJ2A 1Y5LA 4B0OA 1TYEB 1TCVA 5CYGA 1CV2A 2IOQA 2G70A 3AGPA 3EVGA 4GBED 4P0QB 2HBQA 1J8VA 4XR9A 3QEMA 1K6EA 1U7UA 2R68A 1SK9A 4R68A 1LZLA 3N74A 1PFQA 2Z5LA 3TOCA 1WXHA 5F1OA 1PU2A 1LF5A 1UFQA 1NOKA 1XMPA 1USKA 2B3TA 2WJGA 4ZOBA 2KPOA 5DTMA 4C6TB 5HKOA 3E8SA 1CFJA 4RJ2A 3UKJA 1BXKA 3HKEA 3RO7A 3ZWKA 4I1OA 4NV0A 2CCGA 1HDXA 3ONDA 4FFSA 1GT91 1S3GA 3FROA 5JDIC 1JSRA 2V6IA 2YZKA 2EQAA 3USZA 3CQ9A 4ZOLB 2VUSA 2ZYUX 2GSDA 1SVLA 4XGQA 2JFVA 2LNDA 3BAZA 3ASUA 2FPIB 5C4IA 4D42A 3KKKA 3L4BC 4LC1A 2H9IA 3S44A 1A9QA 4KQ6A 1PWHA 2PJUA 3LPLA 3NHPA 1LI4A 2B0CA 3IMEA 3WLMA 2IXGA 1URPA 1YS7A 3MYYA 3DBRB 4KYVA 2GYVA 1G16A 2R4UA 3OAAD 4Q05A 4F2DA 4MUMA 5DLPA 4DLPA 4PX9A 3IE1A 3WGGA 2PZBA 2CXTA 1QE3A 2P9CA 2VSQA 4HPWA 2J3KA 4DV1B 5IKOA 4BEBA 5H4GA 3QXJA 1D2HA 3UGKA 1U7PA 3JU3A 1BAPA 3T8YA 3KKQA 4JH0A 3O1JC 1V1RA 3FD8A 2IYYA 1OU0A 3UK6A 1BS9A 5JHHB 4QQFA 1AC5A 1SU4A 5K8LA 2XKKA 1I30A 3HJTA 4JBIA 1BXGB 5DXJA 1MA0A 2OHGA 4BFSA 3VMMA 4MP8A 4ARCA 3EZ7A 3BJEA 1MRZA 4Q3LA 5JZVA 1OWNA 1FRQA 3EVTA 4ON9A 3CEHA 1VYHA 1X3SA 2F1KA 2D2FA 1E1DA 2NVBA 2W0MA 2GRAA 1C0EA 2PMFA 4UHKA 4Y6QA 4D80A 2I1VB 4UHCA 3O8BA 1SJ9A 2Q5OA 2FLKA 3A3NA 5HG0A 4CN9A 2MHCA 2PWZA 2B61A 1XDBA 4TTIA 4CKEB 4WLOA 4JS0A 4I8DA 3KVNA 5T41A 3ICPA 3BMQB 4JWKA 5ALIA 2QYOA 1CR1A 2ZYHA 3CLTD 3RBZA 4G0VA 5IF9A 4A92A 3PPVA 1PFWA 2JS7A 4QBKA 3SS9X 1XNRB 4LGMA 5CDFA 3SIRA 7ABPA 5FNVB 2H1WA 3PRYA 5I7FA 2FQ1A 3KC2A 4AS2A 3GYGA 3EZFA 1YZTA 4YUVA 1M6VB 1B6RA 2ZBVA 3QQ5A 1QYIA 3AG6A 1CX9B 1RLUA 3B51X 3LQRA 3RKUA 3F3KA 5DNAA 2V7TA 2NU9B 2PVPA 3VKWA 1VSUA 2AVDA 1IM8A 5IAEA 3CKYA 2C94A 4NG4A 4B3TB 3SZGA 3N59A 5DM2A 5EZYB 3IMCA 3C3AA 3F7NA 1EA5A 2Z2KA 3C5WP 3JQBC 3S4YA 4G07A 3V7UA 3DO8A 3L0OA 4W5OA 5LXTB 5FPPA 3QX8A 3IHLA 2C54A 5IYZA 5AVYA 1F1BA 1V96A 4LGCA 4B6OA 1L7OA 2NYVA 3GN2A 2Y1CA 1EGVB 2LXNA 1JTEA 3PSAA 3NDBB 4GI2A 1XXLA 3TR6A 1UBSB 1CEXA 1V9SA 2JJ1A 3PLRA 3A31A 4IZIA 1PGPA 2PLAA 3LX4A 4Q1DA 3U1VA 5CAEB 4AP6A 3T6KA 4QQKA 4N01A 4MUGA 1AJEA 1R4NB 2AR9A 5EVJA 3EIFA 1PD0A 1RPNA 1E1QD 1UXIA 2FZGA 3U17A 1CZUA 4DEYA 5HFNA 5HCNA 5EGNA 3RABA 5LZ7A 3WAGA 1GRVA 1K7SN 2MU1A 4ARZA 1PX2A 5IMBA 3DC7A 4OFBA 2OHJA 4R1TA 4HDRB 4A0QA 4YUXA 1CXZA 4PNZA 1EE2A 3JY6A 4ROTA 3EZ6A 3FMVA 5ALUA 3TDMA 4P3PA 4B3MB 2G09A 3NRJA 4XPZA 1VI5A 4URUR 1O96B 4I55B 4MQUA 5GPBA 1DJQA 3QVJA 4LJ9A 1NFFA 1TZKA 2YUTA 4Q7MB 2X7XA 4LE0A 1KOFA 1C1DA 3SLGA 1Y7TA 3USCS 1XMJA 3MG9A 5HIIA 1WPRA 3O4FA 5B3AA 4IMPA 1VMAA 2BZ0A 5EPEA 5CUQA 1F4VA 4QUKA 1TYAE 3T12A 1P7CA 3RUAA 3ZV4A 4DZZA 2JI7A 3MJFA 4JAVC 5I9IA 1EE9A 2GLXA 5IDYA 1QB8A 4MVJF 1GPH1 2GAJA 4BZWA 2VAVA 3RQSA 1P17A 3P0JA 4QDXA 1G2IA 4FHCA 4Y1RA 5KNCA 2AXPA 1G20A 3PK0A 2TMKA 1F0PA 1Z33A 4H0CA 3WQSB 4EM6A 2RK4A 4IIDA 2OGWA 4MR9B 3LA6A 3WG9A 1OMOA 1JXQA 3EYAA 5LYJB 1BMTA 1R7RA 4DSOA 3TOVA 3DYBA 4NFHA 2VQ3A 3M6MD 5A04A 4HNSA 1A4UA 3MLBA 2YYZA 2FUG1 3ENQA 4DRXA 4LCEA 4BO1A 2WJ4A 4AZ0B 1DRWA 1JR3D 1Q83A 2VEOA 4OPMA 4RLHA 4ZTBA 2VL7A 3VZSA 1VIMA 2AK2A 4NL4H 3KOXA 3MRSA 2C20A 1JKIA 2P41A 2Z2YA 4OA5A 4OM7A 2J41A 2VDUE 2UYYA 3T9BA 1BD3A 2W37A 4D9CA 5J5VA 1J2UA 3EF3A 1GL6A 2WTUA 1GZ7A 1L5VA 3KL4A 5AW7A 4BXOA 2Q8NA 3KUCA 1N6KA 4UAJA 4JC8A 3GFOA 1W4BA 3V4FA 4AYTA 1M2JA 4BJ3A 2AZDA 1H6BA 3NDRA 3W9UA 1VYUA 4LC0A 1JBQA 3U2QA 4EKEA 1KZGB 1UWCA 1ID1A 1SNYA 2NUPA 2QAJA 3IAM1 3ROZA 3I45A 1KETA 2H17A 3QF4B 4G1MB 3D8NA 2Y8EA 4LDAA 2QX8A 3WWCA 1KZ6A 1N0HA 5IABA 3KNZA 2RONA 1AQJA 4KQJA 4UUPA 4ZANA 4HB3A 4A5SA 4BVAA 4JNCA 3WYBA 5JCJD 3B1KA 3YASA 4N47A 3BF8A 1V8FA 4OUDB 4HN9A 2EJBA 4DCPA 1OWPA 2BI7A 2ZVDA 3AKEA 2DWQA 1M73E 2WKRA 2E6KA 2WMOB 2OV3A 1TECE 1GNVA 3I3OA 4E5YA 4HADA 3IDQA 4D4JA 2VC2B 5AW8A 3BUSA 4EUHA 1J7JA 2JD1A 4PLHA 4MLCA 4M9QA 3E8MA 3FCOA 1AGRA 1MVNA 1UK9A 2ODTX 3G5UA 2XWPA 3ZZ1A 4HYQA 1ABBA 3BH7A 3DHVA 2XB6A 2HF9A 1HDEA 3UT5A 5DSXA 2VUIB 3RVPA 2J5QA 4ZQGA 3RUIA 3BQNB 4CIAA 1E99A 4PC7A 3V9PA 3ESQA 3V4SA 3WP0A 1C7JA 1UKAA 2W4QA 2ZQYA 3G2MA 3NMUF 2QL9A 4R2JA 3QJ5A 4P3KA 1Y89A 2P9ZA 3M0EA 4DF3A 3EZYA 1TE2A 2YASA 4A9AA 4M37A 2TSYB 2EQBA 4I46A 1HA3A 2YVLA 4X1IB 4KXWA 4BNDA 3P2YA 1ZRMA 3T3OA 1FLDA 3GDHA 4KNWA 4P8RA 4Y0NA 3T4EA 3N39C 4PZLA 3OIWA 1YFKA 3A9VA 1ZGHA 3DVRX 2RKBA 1MTOA 4D0NA 4O3MA 3JYNA 4UXIA 4FN5A 2W93A 2XVMA 4ZEMA 4S05A 7REQA 1YA6A 3BKWA 4CUKA 1TVEA 3CNHA 3FYDA 3ME5A 1UT5A 1JSXA 2ZTHA 3L0ZA 1YA8A 3E2PA 3JV7A 4DN6A 1QIEA 4BBPA 1GTG1 2K7FA 2WAYA 1F8UA 2HPZA 1DX6A 1DAIA 3LIIA 4MWEA 4OB7A 3ZNNA 3CJRA 4ENTA 1RC0A 3WGHA 4QC2A 3B6IA 3FPFA 4G84A 3T54A 4J49A 3N8NA 5LKRA 5IVKA 2AFRA 3OE5A 3E58A 5A7FA 3P0EA 3TUIC 4BS9A 1OC2A 1QZXA 2YXBA 2O7NA 3KFVA 4FGZA 4S0ZA 4D26A 2P62A 3JYQA 4AKSA 3DTTA 3UJ3X 4JVSB 4IKPA 2BGTA 5FHQA 1LK5A 5FYQA 3RC1A 3ND7A 3HSKA 1UPTA 4ESHA 2QK4A 1G5PA 5B2EA 1XP5A 3X1JA 1CUIA 2RCYA 4BX2A 4N41A 4BGIA 4ND6A 1W19A 4ZVLA 2W4IA 4L6IA 1SUSA 3LTNC 3Q4GA 5LB2A 3AM3A 1W5TA 3N75A 4S12A 1QR6A 4YDRA 3ETJA 4YQYA 2BN4A 2JHFA 4JC4A 5LDDC 4D25A 3WDSA 3DQQA 1P9OA 3CNBA 3HR8A 3ADDA 2RHCA 1U3CA 2GM3A 5JSFA 3LX8A 4J0HA 5YASA 4M8SA 1U0BB 3UWOA 2FV8A 3LZDA 3NPMA 4IHJF 1KYYA 8ADHA 1L8OA 5IAKA 4C4XA 1XVVA 4DIOA 4YEDA 1NQWA 3GGCA 3DHWC 5ANRB 3KPYA 1GPAA 4JLDA 1YI0A 5JY1A 4AQYB 4CF7A 5JYDA 3FIJA 1Z82A 2NYUA 2PZGA 3AR7A 3OZEA 1N8KA 2OM6A 4ZO7A 2BKEA 3SF8A 4UDNA 1ST2A 3PC3A 1PRYA 5TDHA 2J3EA 1UKYA 2DM6A 4MROA 5LP1A 4YMWA 5LWQA 1DC3A 2LZ0A 3C85A 2X5KO 5KTRA 1QMPA 1QIJA 4X7RA 1U65A 1HKUA 1RI4A 5KKAA 4DDMA 4MP3A 4EUEA 1GADO 3H7IA 5U9CA 3U4QB 1YBFA 2WSLA 3BXOA 5SV2A 1MG5A 2X9QA 2GJKA 2XDQB 1UZAA 1WKVA 3EA0A 3H65A 4JLPA 3SFTA 4E5MA 4TYNA 4XGRA 1N7GA 3I34X 5BSRA 1T36B 1FTGA 2F3RA 2I6QA 3W6PA 4UREA 1FFAA 8AT1A 4GX5A 4BO2A 4PG8A 4MH0R 1IN5A 2WTEA 2QYSA 4FKZA 1OYOA 3I01M 5JADA 2IP4A 2VHWA 1VGRA 2C7PA 3DVLA 4N49A 4WSOA 4ONEA 3ZV3A 5IZ4A 3D31A 4EO9A 1JJ7A 1O8BA 4II3A 4TVSA 1ACJA 1G21E 1U7HA 3JVVA 2FG7C 4IPTA 3HP1A 3L0CA 4DBLC 3W5BA 2MT9A 3ANLA 3W5IA 2Y1DA 3KL2A 4EHJA 2CFSA 3K1AA 4M53A 3ZK9A 4U4AA 1RABA 1JLRA 1XMSA 1QVVA 4EG3A 4MV6A 3VO2A 4HHEA 5KWJA 1T6BY 4Y1EA 3B13B 4LHWA 1XJWA 3T5DA 2I2BA 1KWKA 2R5NA 2ZJFA 5IVIA 2VBGA 3IJ5A 4WVLA 3QPVA 2FUEA 4UQLA 4J2TA 3WLOA 1OVGA 2RMKA 3BYZA 3GAAA 2SKEA 3M6VA 4NJEB 4YHBA 3WE7A 4R2MA 3ZHBA 5TGDA 3LNTA 1X1EA 1Y8RA 4MX8A 1ABEA 1GTL1 3IGFA 2VSFA 4UOQA 3RS3A 4Y1FA 1HQDA 3LH5A 2ONCA 1MX1A 3AIIA 1L7XA 4KBYA 2I4TA 2WUGA 5BSKA 2PX8A 1KHHA 2Z1DA 3T9CA 1POWA 5DGTA 3DE7X 2WILA 3D0RA 4ZC1A 2JAXA 4FOLA 4CM4A 3S1AA 2X9VA 3SEZA 4B3IA 4IDCA 4NE9A 1KARA 4UUAA 4EY4A 2GCGA 2Q4BA 1NVEA 2YVUA 3EXAA 4FR5A 1KERA 4ZU3A 5CK5A 2ONJA 1CPYA 3GJ0A 4J07A 3FUWA 4GIBA 5HQ3A 3VPXA 3WISA 4YI3A 2WHPA 4FD2A 1W4ZA 1XVTA 4KK4A 3KQSA 4EPVA 1FUIA 3FHJA 3TIVA 1TD1A 2IHVA 3ABZA 2WJYA 1NVKA 1UBGA 2P4EA 4YHHB 2C99A 2PH1A 4W9MC 1NXVA 3AI2A 2PNJA 1ORWA 4C0JA 3Q40A 3N2YA 1G2PA 4X93A 1ZSNA 3U37A 1M2HA 3OZFA 3L05A 1FQWA 1YZUA 3IXMA 3ODPA 3GLUA 1C3VA 1XHLA 2G28A 4LZZA 2EFCB 3IBFA 4FOOA 5J4KA 1X9IA 4OH7A 2Y0CA 3JRXA 3NDJA 3DLAA 4X0EA 4YCNA 4JOSA 1KJWA 1V48A 1LKZA 3EIHA 3SZRA 5L51A 1MQAA 2X4IA 3RS8A 3GJXC 1NNUA 4EF6A 1V11B 3IT2A 3WIOA 3L8YA 1YBHA 2IGBA 4FNMA 4UW9A 1KI3A 1RADA 2NNWB 1AOXA 1N2CB 3AUUA 3O6VA 4XDZA 4BMDA 3GQVA 2D4AA 4C0HA 3KSMA 1YS4A 2FPXA 3H9EO 1D4AA 2QUKA 1E1CA 2QRZA 2WP0A 1ZNXA 1NP3A 2R8PA 3V33A 1WXEA 4TQ9A 1H1TA 1W5BA 4W82A 4PC3A 2QA5A 2W2LD 4RVDA 3BE5A 2C4KA 1J42A 5KNDH 4FDUA 3JQFC 2UZAA 2UYHA 4J2HA 5LYJA 4NOLA 3IDZA 1UANA 4CM8B 3D8BA 4O4IF 4BFYA 2R6HA 5HW0A 5KTOA 5CVCA 1YKGA 5F21A 3CUYA 1EVKA 2XMGA 1D1SA 1F8XA 2GEJA 4IQ4A 4I5FA 4Q7JB 2I5PO 1PKXA 1V41E 3JQPA 4S2UA 1FSGA 3OWXA 1M1NB 5CVTA 4Q3CA 3REQB 2CJWA 3OQOA 2HWXA 3G2IA 4C5BA 3IT3A 1UPFA 4XIYA 3UQZA 2YWBA 2BGMA 3OD5A 1ZD9A 2H07A 3BD7A 3Q72A 4RY2A 5EYPB 4EMSA 3P8ZA 1U8XX 2P9BA 3MGGA 3PEVA 4RK1A 1UBCA 1POXA 4L6CA 1QIIA 1PK7A 4URFA 3R7BA 4I1SA 3VOBA 4EB6A 3W5UA 3GOQA 3BX1A 5KJFA 3EFOB 1NXSA 2I62A 2QLJA 2EHDA 2REQB 2W4MA 3AHCA 4GYKA 4MKXA 3TEJA 3EGWA 3V1NA 4NFLA 4UMFA 4EEXA 1K88A 1LGYA 3HB5X 3FUCA 1Y6RA 3EEBA 4IDQA 2HEIA 4G97A 1QYWA 4O4HA 4PSVA 3RW9A 4AY6A 2VSYA 3ZH2A 3LHIA 2Q0HA 2MYUA 5GONA 2B98A 3CZQA 2HK7A 4LZJA 4EAQA 3G02A 4JLOA 2B4YA 1P1FA 4LJKA 3FM9A 1MX3A 4Q7EA 2VHUA 4FW9A 4CV3A 1WPQA 2Z8XA 1JVNA 4S1WA 2HRBA 3RIEA 3WLSA 1NBHA 4TV9F 1IK4A 1UJBA 2WBLC 2BWJA 3C1OA 3K9HA 1NQAO 3V00A 3A27A 3RK4A 2RHWA 1M34B 3LY7A 1BN6A 4HNQA 3ZQKA 4LECA 3U0VA 4OL9A 2B25A 1WOMA 3VZQA 3EMBA 3Q2OA 5BORA 3KZKA 4J75A 4Q3DA 2VDNB 3OIYA 3TSYA 1NFRA 1R4AA 2FQWA 3HJHA 1I7NA 5C80A 1TO1E 3QY0A 1FTWA 4YMGA 3U56A 3QVXA 2QAGB 3Q9SA 2AD5A 2HF7A 1CTQA 2RHGB 1N0VC 4B7AA 2AN1A 3KPWA 2BGRA 2WNSA 3OMLA 1DU4A 4UUOA 1QUFA 2QQFA 4IJ6A 2PRZA 2ANBA 5IC5A 2P7HA 4DCCA 4E32A 5L4SA 3Q98A 3MMXA 1A3CA 3NP9A 4YCLA 1E2MA 1ZR2A 3TQRA 1GZ4A 5HHTA 3KVOA 4K2AA 1M2OA 2BR3A 4K6OA 1JKFA 9ATCA 3ZK8A 3MF4A 2ZQ5A 4JUIA 5EG5A 1TK2A 2R8YA 3B2NA 1VMIA 3OX3A 4R8SA 5T7BA 1Y8ZA 1F0KA 1L4UA 3JQFA 4DNQA 3MSXA 3WGJA 5GVRA 2JIDA 5ALKA 2PUCA 2B36A 2IJGX 4F85A 2KLBA 4GLBA 4F3CA 2HR1A 4X65B 3IVGA 1KH2A 1WCYA 1X9HA 1EVEA 4IHQA 2O8CB 2VLBA 1V3TA 3QF7A 3OF5A 4F2WA 4Z4QA 3SR3A 4CUZA 5D84A 5IC4A 3DDOA 4KYUA 5K51A 1CVLA 1KEPA 1IMJA 2QROA 2WHPB 3GCDA 2VF2A 2ZDGA 4N7RA 3SSNA 2AN5A 4A6DA 2P5YA 3L7KA 1NLMA 3BGDA 4UPDA 2EBUA 4BFLA 3E1KA 2HWYA 1Y9DA 1ODCA 1EP9A 3PEFA 4HRAA 3O3CA 3RPEA 3PBKA 2P6OA 1C9MA 2MJLA 3GVHA 1EFRA 3F5QA 3ONFA 2GASA 3ZJUA 3I5AA 5JT1A 2CKMA 1KZHA 2H4YA 2YC2C 2X0RA 1VCMA 1I51A 2GBGA 3K6SA 1EK5A 4CU5A 1QRRA 3IPYA 4Z3KA 5KQSA 3KCQA 4WEQA 4MTCA 4QXMA 4QYWA 5KOYA 3UMVA 1UJ4A 3KTAB 1RAHA 4XYLA 4LHYA 1T2CA 2G1AA 3A1WA 3V1TC 1QGOA 4ZFNA 1RHMA 4EKNB 5FBWB 3TD9A 4B6GA 2C2MA 1XHEA 1L7AA 1ZI8A 2JGDB 2OYSA 4QGSA 13PKA 1ZK2A 3ST7A 4GBJA 1D4OA 4BFUA 5K3AA 1AVTA 1JG6A 4YQEA 4WQMA 4LZPA 3NTLA 3QSYA 1MRNA 5CXSA 1DJMA 1SB8A 2DETA 1ILEA 2ZIZA 2WINI 521PA 2VH5R 1C0PA 1Y6ZA 2B8WA 4IHJA 4MI1A 4MUFA 4OQMA 2FW8A 4G3XA 4XTRA 5AHKA 2EFJA 3JWIA 1JE0A 2D0PB 4TSKA 1FSFA 4QG7A 1N5LA 3EY4A 2CFIA 1K7EB 1JA9A 2R66A 2MDTA 4GE0A 2FH5B 4QREA 1I3CA 1B23P 1XCBA 1HK7A 1EGQA 3L0PA 2SNIE 3BB3A 1MD9A 1VIYA 1R88A 3A6LA 1AQUA 3CJTA 3B9BA 4KRXA 2GEFA 2HRRA 2JFZA 4XFKA 4BFXA 4LK3A 1O97D 4FFDA 4XM0A 1DAEA 2O0MA 1DAKA 3BD8A 3QNMA 3PNPA 5EIEA 2D7DA 4EMTA 2CXHA 4MJXA 3R9KA 3DVQX 3E7PA 4GPTA 1OLXA 4O1HA 3KYBA 1WZEA 4DIMA 1WQ4A 4OGKA 2Q0QA 1B76A 1G8FA 1IM5A 2BEVB 5J1TB 1CERA 3IP9A 4EI9A 5BSFA 1TIBA 3PGLA 1VRWA 1T91A 2ZZKA 3CMMA 1J8FA 3K6KA 4ENWA 3UFXB 3ACBA 2QW1A 3C7AA 4DWOA 1F9EA 3OOJA 1CUBA 3ENWA 2J5KA 1XVUA 1BH2A 1II8B 5F5NA 4NNPA 4AWBA 3CKLA 3TMAA 1G1AA 1DELA 2PIAA 3E1SA 1E58A 2P6MA 4RJLA 2IITA 2YQ4A 1UC4B 2PYZA 2XEXA 1VKJA 3ABIA 1E2IA 1TPZA 2Q2NA 1GN9A 2QX9A 4ZI3A 2AN3A 4Y98A 1ZMTA 1AMOA 1K9VF 5M34A 2IDJA 4WOKA 3PWZA 2WJVA 4KDRA 3X1DA 4ER5A 5FV4A 4R16A 3ZE0B 3HCBA 2JHCA 1E9BA 2OXRA 2JANA 5J4YA 1H85A 3C45A 3F6EX 3RC3A 3HCWA 1J25A 1P9LA 4CF5A 1ESDA 3W2TA 5HS4A 1C1YA 2J0UB 3F3SA 2WWWA 5AVZA 2VJKA 1Z5ZA 5E6UA 4E21A 1NUTA 1OXBB 1U0NA 4BJ5A 4FFRA 1I2AA 3JQ9A 3QHPA 3RARA 5JFTA 3OLZA 2OB1A 2XNHA 2BC9A 1OFVA 1CJCA 2W0SA 4GM0A 3L4KA 1EX1A 4QTUB 3UBMA 4MZDA 1L5KA 2QSYA 4NE2A 3RF6A 4B3BA 3I6MA 3NBMA 3WFZA 1PDOA 4MGEA 5LP6A 2WZCA 1DKMA 3OX1A 4AJPA 3L06A 5CNIA 5A7HA 1X0VA 5COAA 2NT4A 4E5SA 1W36B 2DTEA 4N9WA 2R0QC 1DCTA 5IKPA 2MCFA 4D56A 4JYAB 4WTOA 1EHIA 4O2BB 1DWOA 3D43A 1EMDA 3A28A 3D8SA 3AM1A 2V7VA 1V3VA 3QWAA 4H16A 4PVDA 2BRUA 4E14A 4QXRA 1ULUA 3WDKA 2GZ1A 3RIXA 4BJ1A 4FI3F 2GVNA 2CYCA 1Q3TA 4E13A 3N70A 1VCOA 1E96A 3QH4A 1V37A 4TPKA 2JAQA 2OFOA 4X94A 2B4AA 3S2GA 1JXOA 3KQQA 2LV8A 4HFNA 3FSRA 5TPZA 3DAOA 2W90A 3R9XA 3AWDA 3VNQA 4U3JA 4U7FA 3L3BA 1YKFA 4QBFA 5E3JA 4YWHA 5KQLA 1Q6ZA 1GGKA 1V1MB 3SF0A 1DBRA 1L4BA 3TQCA 1SKYB 5IBQA 2PUFA 3B60A 3AY6A 1RAGA 2BMFA 3HJBA 3PC2A 3SEFA 3UXHA 4ARVA 4ARIA 1VKOA 4LXUA 2WAOA 1MV5A 1LJ8A 2H29A 3LOPA 1RAFA 2H1HA 2HDOA 1UDRA 4OAOA 4AKTA 3DL2A 3T9EA 2HAEA 4GZ5A 2Q45A 2R2GA 2PFKA 5CX4A 3S40A 4OLBA 1IDOA 4YLEA 4DANA 3UGQA 5BRNA 4ARSA 5JRDS 1U99A 4P81A 3R0QA 2A7QA 2Z8ZA 4KPUB 3EN0A 1U0FA 1FRNA 1YQDA 1ZN7A 2XB2A 4JIGA 1J39A 3QOFA 1Q12A 1G291 3USES 1LW6E 3IIIA 3FSGA 2PVCA 4YP9A 2BUAA 1PV4A 4B85A 3KOWA 4TKVB 3T9AA 3JW8A 3LBNA 3CR8A 1W6UA 4G1VA 4C7MA 5ITZB 3K15A 3GJTA 4OLJA 1SQ6A 4FONA 5FP0A 3OEEA 3ZBUA 4F9GA 3TG8A 1J0EA 1ND6A 3QKSA 4LBYA 2A58A 2XQKA 3SY8A 4GRAA 4RXTA 1AHPA 3UV6A 2EBHX 3SC2B 3UBTA 4LMPA 2VP3A 4NWIA 3H5WA 2AL7A 3EVZA 1XZNA 3SZMA 3WBFA 3BERA 2RGCA 2YS7A 3TNJA 1ZJZA 3E70C 5EWMB 1L8QA 2O2XA 1OI4A 2PV7A 2HHJA 2P3LA 3P19A 5A3VA 3WYFA 2Y77A 3L92A 5I7OA 4XGNA 4D5EA 4UHDA 1NG1A 4ZZ0A 3FPHA 2HCTA 4JT8A 4XE5A 2EIXA 5JJBA 1E9VA 4UNRA 3LUDA 4ZDKA 4EPXA 4AZSA 1L7PA 3DF9A 4KOAA 4QHTA 2REXB 2ZQZA 4UEKA 1AN0A 1C3OA 2P5UA 4OKSA 4HX2A 2OXFA 2BZSA 2ZUFA 1T9DA 1UOEA 4UCFA 4WZAA 3EC2A 2WM8A 1I9GA 1XAHA 3W6ZA 2Y1KA 1CUZA 3MCVA 4JOCA 3KAJA 4JD5A 2PHZA 2E4XA 3DZCA 3W8EA 1QGUB 1S2OA 2HLDD 4YCSA 2WFAA 4MVXA 1ZIDA 1HWYA 1VB3A 2X3YA 3MTDA 1YR1A 4H9GA 5K8CA 4HI0E 1A71A 1ZCFA 3PIRA 2XJ9A 5CVDA 1J4AA 4O4HF 4YN3A 3ZS9A 4CLDA 4X60A 1UKZA 2VYNA 3D6HA 3R7DA 1NASA 2A35A 3BFPA 1T2EA 1WW3A 3IYLW 3PNKA 3W1EA 3ZPXA 2BTOA 2FSGA 3OQVA 2A4KA 3AUSA 3WGTA 1ZZEA 2B78A 1SRQA 1UL1X 3V4RA 1E1NA 1O4WA 1VSBA 2QVLA 2R5WA 1XCMA 3QEMB 5JAIA 2D2EA 3CO5A 3TTUA 4G4SP 3PFKA 3HUTA 1RI5A 2GN6A 3ZJTA 3AW8A 4I4TF 4ER0A 4YAWA 3CVXA 1EX6A 3R0XA 1I7LA 9GPBA 3PX7A 1ODLA 5IT0A 3SSOA 1FK8A 1S3IA 1T2VA 1OBVA 2VT6A 2WG2A 5KSYA 2WF7A 3A11A 1X8JA 3NM6B 5EWLA 1UMBA 5AVWA 2OO5C 3IVXA 1M7GA 5MGNA 1Y4AE 4BLRA 3HUUA 1X80A 3NKLA 4JEUA 4ZQHA 2WR8A 5TQ2B 1GTJ1 3A4MA 4WKPA 2WYOA 4DCMA 1UJNA 7MHTA 4RX1A 2HBRA 5K6AA 4BO6A 4WXYB 4YCAA 5F9HA 5TB5A 4YP7A 4LJ7A 2Q5JA 2VQFB 5AJHA 4ARAA 4Y2XA 5DGCA 1U9JA 3SBDA 1K0UA 2GETA 2JIPA 1Z4NA 5E1MA 2CLCX 1WDLA 3DVSX 4ZT3A 3TX6A 5CVUA 3K9BA 4Q9AA 4B5LA 2Q9CA 4O2LA 4Z4CA 4KP7A 2RHBA 1SGWA 1ZCAA 4BVKA 4D0GA 1E7YA 1QQ5A 3KX2A 1JJAA 4K6FA 3UJ8A 1OV6A 1G8KA 2QJRA 4KSCA 4AAYA 1ZMRA 3L6DA 3VUEA 2F43B 1M75A 1KYVA 1PJBA 2VF8A 3UHPA 1MF7A 3L7IA 4BO4A 4DJFC 3GGSA 3NBYC 1ECLA 4FB5A 2X22A 3A9TA 4QEZA 1JPJA 1N6PA 3K6RA 4HP8A 4KYTA 4RL4A 1ZOOA 5BW8A 2X1MA 1Y82A 3LT5A 1U2EA 1R66A 1ZM3A 1DG1G 3BIJA 3OSZA 2HEGA 4JLJA 1QTQA 2G5TA 2A9PA 3CIOA 1GZUA 4LPKA 3F3YA 4UKDA 1AK2A 3DLPX 1A8QA 3KS9A 2IIBA 4KO4S 3EVDA 3E9MA 3JZMA 5LJLA 3ER8A 2SCUB 1PK8A 3A26A 3CG4A 3IVCA 5IW8A 1HTWA 3MIZA 2PKCA 5D5QA 4DDKA 4QAQA 4TXMA 3UFBA 2E5FA 1CR4A 1G4HA 1UM9A 2EOAA 3DE4X 4E2XA 1O95A 4Z9AA 2OKGA 3C6ZA 2H08A 1CUXA 2GPWA 3PRJA 5AW1A 1BIFA 1YRWA 2BKUA 4MIOA 4YAIA 3PJRA 3ICEA 1YVEI 1FNBA 1I10A 1DDOA 2VPXA 1Y63A 5AQEA 3W5DA 3M7IA 3DKPA 5C32A 5AW3A 1RYHA 2WHQA 2X9LA 3NUQA 1MEEA 1QG0A 1S8AA 4G9BA 2AX3A 3QE0A 5JI3E 1O94D 4EB3A 2C03A 4ZYVA 4M0KA 2O23A 3UNXA 2WDZA 3IUEA 4BNUA 2HLHA 3PGKA 1OWLA 2PQ6A 4Q4DA 4X6YA 2OY0A 1CETA 4JI6B 3H0CA 4PG6A 2ZJAA 4M4SA 4FCVA 3IEPA 3T3DA 3OLQA 4PHTA 5DYNA 1FYWA 5CM9C 3UV7A 2G7ZA 3FDJA 1T9GR 2I6FA 1XRQA 3AP1A 3F96A 3ELYA 4INAA 4PSKA 4LFCB 1QIKA 1ZWLA 1M2VA 1XU7A 3V7WA 1M0SA 5I7HA 5KTSA 5JWRA 4G0NA 1OBFO 4IG9A 5DYTA 4RKWA 3FPAA 1SZJG 2MMGA 2YY7A 5CCBA 1GZDA 1I4OA 2A94A 4Z7OB 2J6BA 4U7WA 3VPCA 3RVMA 2H7CA 2OBNA 2HCBA 2RGAA 3DO6A 3IIJA 3NHKA 4H1TA 4LRQA 4XH9B 3RE1A 3X2EA 2DKOA 3ABSB 4R98A 1M33A 1DNPA 4JI8B 3TAHA 3HRHA 4RADA 4J1SA 4UM7A 1T8TA 4O33A 1DIOB 3H2ZA 4RCYA 5THKA 4CM4B 2DWCA 3JQ8B 4RMIA 4PQGA 1NRXA 4XW2A 5D3KA 1E9AA 3U49A 5K05A 1QRAA 3FFXA 3DDNA <