4M1TA

Crystal structure of small molecule vinylsulfonamide 14 covalently bound to k-ras g12c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
163
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 63
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1tA00
1J8MF 4DIDA 2XZOA 1JI0A 3A58B 2ZS7A 4DRZA 1A5TA 3PVSA 2YHSA 2GZAA 1VKJA 3AF1A 1IAQA 3AF0A 4KYUA 4ESHA 4B33A 4BFUA 4EPWA 1KSHA 5AWFC 5B2ZA 2RHMA 3OEHA 3TSZA 1FMJA 1KOFA 2G3YA 2RKOA 3NBFA 1YZGA 1I2MA 1QRAA 1RE0A 2ZSDA 4ERNA 5FBQB 4BLTA 5KNCA 3X1YA 3K0SA 5FFMA 1UAAA 4HATA 3PXGA 2J5XA 4TL8A 1CBUA 2OFWA 5JCZA 4D0LB 4O2RA 3BFKA 4QNMA 4OQXA 1C9KA 1XMSA 2CNWA 3OEED 4DCTA 2D74A 3QIAA 1XNJA 3K1JA 2OXRA 1E2LA 1SXJC 2OAQ1 2CCGA 4BLQA 2ZS8A 1UBFA 4MGYR 2DB3A 2W2TA 5DN6D 2O8CA 1E9DA 2O8DA 1DG1G 1W49A 3NEJA 4RZXA 3AVYA 1F48A 2IYTA 2QAJA 2XAUA 3EZFA 2Z4SA 2CLSA 1DAMA 2JA1A 3N70A 4Q9KA 2FF7A 4D80A 2DCUA 2QE7A 2F3RA 2V6JA 2A5FA 3C16C 5FOVA 3REGA 2YYZA 2GEUA 2BOVA 3V00A 5BQ5A 4CEJA 4FW9A 1E2EA 3IIMA 3I5XA 1Z0FA 4PQFA 1VMAA 5FOXA 4A82A 4DC9A 4M8NE 2OE2A 1RRGA 3MWLA 2ZUCA 3O8BA 1R8SA 4C0HA 5LDDC 2O8FA 1D2EA 1NIPA 2QRNA 4HLUA 5GJCA 3HPRA 3DZ8A 4P4UA 1NL3A 3RWOA 1SKQA 1NKSA 4KU4A 3ADCA 2XXAB 1A4RA 3THOA 3LWNA 3NTUA 3JZAA 4KBFA 3U4QA 2C9CA 1OFTA 3NKVA 3VX3A 4JVMA 1BMFA 4JBYA 4B2LA 4LJ9A 4KFRA 3T5GA 2O8BB 4TL9A 3U6KA 3IBYA 4MRPA 2QPTA 4MGIR 2YJTD 4L4UA 2I1QA 2CE7A 4KSCA 4Q47A 1XZPA 2VLIA 2QY9A 1P5ZB 5G41A 1RYHA 3A1UA 3WYFA 4BEBA 2O8EB 4Q03A 5TARA 2PCJA 1ZUNB 1ZW6A 4C0LA 5IK2D 1A2BA 1EG7A 1TUEA 4RJLA 4ZI3A 1P6XA 4A8JA 2VYFA 4TMKA 2H17A 2ODNA 5SZKB 3U3JA 1M6NA 4RZ2A 4JL6A 3I8SA 4OI2A 2JLQA 2CJWB 1I4LD 4MRVA 4R7ZA 4DHEA 5FBWB 2V1UA 1NG9A 3CWZA 1E2QA 4XTCS 1E2JA 3AVXA 1KO1A 1XTQA 4M1KA 3MWJA 3T1TA 2GCOB 3OE7A 3QG1A 3PUVA 3QF4A 1KO8A 1LF0A 3Q7QA 1ZM4A 4J0QA 1CR4A 4NU0A 3IDQA 2Y8EA 4DB4A 2ASEA 1P61B 1E2KA 2F1RA 1IOZA 1U0HC 1PVOA 1ZC4A 2CHQA 3EPKA 1XD2A 3RS4A 1M7GA 2VPPA 3PG5A 4KLZA 1ZINA 2D7CA 3BOSA 4U02A 2PJZA 3A4NA 2R6AA 2WJVA 2BM0A 3K0AA 4DSNA 3AB3A 5KNDA 2ZJYA 4LX0A 1GAJA 4PC6A 4QFMA 3DKPA 2CLCX 3B1YA 4GOJA 4B34A 2XNDD 2ZRPA 3AKCA 1DADA 5C4GB 5ANRB 3ZGXA 4YXWD 2ZYTX 2WJHA 3NH6A 3NHAA 1WDTA 4LJYA 5CK4A 3ZVNA 3ZQJA 1TAGA 2QMOA 4ZKEA 2EVWX 5DI9A 4IDNA 4MYCA 5FTKA 1GRQA 3BB1A 3W8RA 3U44B 4K46A 4PPNA 2FPMA 4AK9A 1DAEA 1VCOA 5JJLA 5GJVC 3T1OA 4A1FA 1S1CA 4JLJA 4HB3A 3KQKA 1LS6A 1Z08A 5AUPB 4QBGB 1XF9A 3QKRA 5BN4A 1R10A 5C2JB 2GTPA 3P4YA 4LV6A 2W6JA 4M21A 1H8HA 2PMKA 4Q4AB 1E1RD 4MYTA 3IEVA 5AJZA 1KJYA 1U0JA 3OIUA 2X77A 2CL0X 2FPLA 3A36A 1ZIOA 3BB4A 3BXZA 4PZYA 2IXGA 1AK2A 2YNMA 2J3EA 3AVVA 1I4DD 5FUVA 2AD1A 1JPNA 3BS4A 4URUR 4YMWA 2IX3A 3CM0A 1CULC 3MWYW 4DLWA 4F4IA 4D26A 5UKDA 3ZIAD 3AF3A 1II0A 2Q3MA 4TMXA 3R9WA 2RGEA 2F7SA 1OH8A 1SQ5A 1W36C 3IIKA 2OG2A 1EX7A 4RD1A 4KHZA 3GCGA 1P9NA 3K70C 4MDFA 3I62A 1F6BA 4LYJA 1E2MA 1P62B 4JSTA 1XTSA 3B85A 4MH0R 4PAQA 3GP8A 2BMJA 1DVRA 2NO9A 2VP5A 3KXLA 4G01B 4Q7LA 4TWZA 2GF9A 1T0JB 3VMFA 4ZKDA 2C8VA 1DAKA 4CDGA 1GOTA 1VECA 1MV5A 2X8AA 4IRUB 4OQFA 1TL7C 1ZP6A 1W1WA 3SOPA 2YV5A 3UANA 1KNQA 1LNZA 1Z2AA 1LB1B 2ORVA 2O0JA 2Q3HA 3RS0A 3KFVA 3BIFA 5BN5A 3AQ4A 3CUEF 1GZSA 4TMZA 1T6NA 2JJ8A 3H0KA 4YC7A 3SFVA 5EE3A 1Z6AA 1NLYA 2FG5A 2AWNA 4ESVA 2IYSA 1G16A 2JJ1D 5IRCD 1S9HA 4EFMA 4H9GA 4NH0A 1GNRA 1MOZA 4HEJA 1JQLB 2QZ4A 4HUQA 5HCNA 2EU8A 2JJ2D 2O8BA 1XP8A 1OPXA 2NPFA 4D25A 1P60A 2IYUA 2VSOA 4OQMA 1YZQA 3QQ5A 4A0GA 1ZD8A 4DBLC 1OFIA 4UNRA 2R6FA 3TAUA 1AJEA 1KI8A 2ONKA 2QM8A 3IIJA 1PLJA 3TH5A 4EDHA 1TU3A 3MFYA 3AVUA 2VSXA 2YVUA 1KZGB 3FGNA 3PUXA 2HF8A 3DPUA 3SDZA 3ZYCA 2IS6A 3NBXX 4IOJA 3DO6A 3ADDA 3PIRA 2WMOB 1R0WA 4PR0A 2CE2X 5EUMA 3WHKA 3P1JA 3VR5A 3I8XA 2CJWA 3QG5A 1LW7A 1OYWA 2XJ9A 1R5BA 1YZLA 2V1XA 2Z6VA 3CRW1 3EIHA 4V02A 1Z6YA 3BGWA 2FWRA 1KI2A 5KPJA 1D6JA 1TF2A 4GOKA 3TK1A 4AYTA 2DFKB 2QSYA 4Z1MD 3CPHA 2YWEA 4W7SA 3AKDA 2V55B 3U3RA 3BERA 4MKGA 3QSYA 1NN0A 4XJXA 2IWRA 4XSGA 1W4CA 3AVOA 1AQUA 3EZ9A 1UJ2A 1X8JA 1ZM7A 4PHGA 1NMXA 3U3OA 5FPHA 2J46A 1M1YE 2ZM5A 1KNXA 2W83A 1PV4A 2WMNB 4PAOA 4DXAA 4NCJA 3X1ZA 2AD5A 5JEEA 1TU4A 2DFNA 3IO5A 2WAXA 3AVWA 2NTYC 4OYHA 3KKNA 3RVBA 4C0BA 4LJ6A 2VQSA 1E4VA 4HLDA 2ZEJA 1E0AA 2V54A 4K81B 1TEXA 4JSYA 3T15A 5LPNA 2DWQA 4MRSA 2BWJA 2F9MA 3EWSA 1MR3F 3CBQA 4F91B 1G8HA 3CR8A 5CITA 5BWMA 4BFZA 1KSJA 5FR2A 1FUKA 2CEAA 2A5YB 2GXUA 5FOUA 1KTVA 1XMIA 2BKUA 2ZI6A 4ITRC 1E3MA 3HPQA 4KVGA 1YHNA 3ZVLA 2FN4A 1BIFA 1Q0UA 2WKRA 1T3HA 4GZLA 3AGQA 1ZM2A 3Q5DA 4P3YA 3EIEA 1TPZA 1IJFA 3ND8A 2ZAMA 4BRWA 2G88A 4KSBA 2ZRLA 1VG0B 4Q4AA 4I1SA 2QNRA 5L3RA 2LCFA 4OBEA 4PC2A 5EXSA 1KI4A 1G5TA 3IPYA 5TVKA 5DGXA 5EP1A 1UEIA 2AL7A 3CLVA 4M1OA 1TQ2A 2WV9A 3BH0A 3N5CA 1JJVA 5HCIA 4W5HA 3P32A 1RRFA 4HLUC 3AM1A 2FMXA 5DO9A 2ERYA 3D3QA 1IM2A 3KQNA 4KBGA 1R5OA 1NNEA 4IFEA 2FPKA 2RH5A 1JALA 4M1TA 3CF2A 2OCBA 1KO7A 1FMLA 1OHHA 3CPEA 1R0XA 1W36B 4MUBA 1NVWQ 4EQ6B 2IW3A 3QI2A 1SXJA 2HCJB 5LD2C 1X3SA 4LPKA 1ZU5A 1ZUIA 4HSEA 3VNUA 1WF3A 2H5EA 4LOAA 1DO2A 3KB1A 4DLXA 3LAWA 5C1BA 3KTAA 1AIPA 1H8ED 5KSPA 1G7TA 1AKEA 1E9EA 5FPYA 1E79D 3GLGB 1R0ZA 4HAWA 4NCHA 2ONJA 4W9MC 2EWVA 4BZXA 3GJXC 1EFHA 3SJZA 4YMTA 2G1KA 4L8GA 4YDHB 2WAYA 2QROA 2KBEA 5KO2A 1E2GA 1GFIA 4CF7A 4PXAA 4IVPA 4I4LA 3ZLJA 1Z0JA 2XX3A 3CX6A 5EQTA 3MMPA 2OLKA 4B44A 2ZRFA 2EFEB 2ZUBA 2EW1A 4D0NA 1LTQA 1B0UA 4W5JA 1Y3AA 2FFHA 4QM6A 4C9BA 3GFOA 2D3WA 2BMEA 2PMDA 4LHYA 5KDOA 2WTUA 2Z43A 3RANA 2VHJA 1S2MA 4B48A 2OEPA 2C77A 2ZI9A 1TADA 2Q9AA 2H18A 4NHOA 2F1JA 2ZRHA 4LYAA 1XEWY 3TBKA 1QZXA 1CJVC 1UF9A 3VKGA 1G7CA 2A78A 1EWRA 4RKFA 3TUZC 1N5LA 4L15A 4PZLA 1YZNA 4TTPA 4AURA 2C2HA 4WVFA 3U3MA 5FR1A 4LBZA 2IXFA 4A4DA 3KJEA 4E09A 1YZTA 3BORA 3EZ2A 1QHSA 1WP9A 4NP6A 1VG8A 3CX7A 2R9VA 2GILA 4OHXA 3HR8A 4AKGA 4HDCA 1G3QA 2MMCA 2IT1A 1OH5A 5DHFA 2AR7A 1Q3TA 2CL7X 2MSEB 4NYIQ 5FI1B 1DELA 1VIYA 3W5JA 1YR7A 2BDTA 3U7GA 1XJQA 3LO5A 2D4HA 5HE9A 5FL7A 3S1AA 3VR3A 1WQ1R 1RIFA 2FDCA 4QGAA 3D8BA 3QBTA 1NVXQ 2NOAA 1T91A 3LRPA 4WA7A 5KOYA 1XTRA 1G17A 2XB2A 2X2EA 2IUTA 3FKQA 3H1TA 4P4TA 2IS2A 1Q1QA 2VRWA 2XOKA 3BJIC 4WZAE 4K8OA 2O5VA 5L3SB 5BYJA 4OJKA 3ADBA 4KYIB 2G1JA 4HB4A 2Q6TA 3B13B 2WWGA 3WMEA 1ZIPA 2TMKA 4Z8YA 3BH6A 2VA8A 3EC2A 4ZCIA 4UKDA 2HYIC 3OFND 3F3YA 2IK8A 3JZMA 4JLOA 1D2MA 1IN7A 1N5IA 4GMXA 3WY9A 4DLTA 4B6FA 1ZBDA 4ASUA 3PUZA 2OLJA 3VKWA 3GD7A 4NL4H 3TUJC 1N2CE 2GNOA 1CKEA 3VHLB 2R65A 2CCKA 2ZETA 4OJQA 1ZUHA 1OKKD 2YWHA 2C95A 3RSOA 3WRXC 2OZEA 4US1R 3SJBA 2QBYB 3FPAA 1KDOA 2NZ8A 2OT3B 3HWSA 4MA4A 4RVCA 4ZPXA 5KDDA 3QJYA 5B30A 1MO4A 2EYUA 3T35A 2PLRA 1UEJA 1V43A 2WWWA 3IQWA 2EYQA 2OFXA 5FI0B 3ZVRA 1GUAA 2JGNA 4DCSA 4PX9A 1FFHA 4GRAA 1FTNA 2XTZA 3W3ZB 3AVPA 4XVRA 4Q1DA 4DT1B 4TQAA 1XEXB 4MRNA 1GRNA 3KQHA 3VU9A 1Z07A 1KSGA 5CYOA 5TB5A 4EPVA 1Z0IA 3I92A 4JJZA 4BLOA 4KJZA 4EAQA 4FCVA 1UADA 4JJKA 1T3LA 2WZQA 2QN6A 4GI7A 1E2PA 2J9RA 3K0CC 2Z83A 5LD2B 5EE0A 2ZRAA 1YQTA 1Z3IX 3DHWC 3LQQA 3QXHA 1E9SA 1X8LA 1W4RA 3KKMA 2B8TA 4NMMA 3TE6A 2J0QA 4FXPA 4Q21A 4CW7A 1IN4A 1CJMA 3TVDA 1KIMA 1OXVA 1V5WA 4TYPA 4M9SA 3CWQA 2GWHA 5FPTA 3R8FA 2GXAA 1DAGA 3C7KA 5AR1A 1DO0A 1OE0A 1P75A 2G0TA 1HT1E 5FBVB 4HAYA 3D31A 2BKEA 1BH2A 3B2EA 1O3YA 2VHUA 4POAA 1T5LA 4NKRA 2ZJ8A 2GEDA 1XZQA 2Q21A 1T8UA 1CLUA 5GJWC 2QPOA 2F43A 4LCBA 2P6NA 4XVUA 3AKYA 2BBOA 4LPSA 2QP3A 1DAFA 1VDZA 1M74A 1R5NA 3CZQA 3ZD7A 2ZI4A 5AUNB 4NE2A 3H86A 3GQBA 1JAIA 3WNBA 5LBIA 2P5SA 4ZV4A 2HT6A 1PUIA 3QKSB 1U8AA 2A30A 3EARA 3QEJA 1E1RA 4O0MA 4EPTA 5JMTA 5JEDA 2YC4C 2FEOA 1ESMA 4LHXA 3ZD6A 4O25A 4LDJA 5CIQA 1WCV1 2AKYA 4OI1A 3EX7C 5CIWA 3ECCA 3Q7PA 2BJVA 4NCNA 1QHHB 2BMFA 3WRYC 1NN3A 1W4BA 3RS2A 5KUTA 2J41A 4OQLA 1OIWA 1SHKA 1XMVA 4CEIA 1OFUX 3SS8A 1RRCA 4NYMQ 2R6CA 4I1VA 2C9OA 3NIBA 1XBTA 2PEYA 1U2RA 4C0JA 2ZR0A 4FWIB 1QHXA 3PENA 4HLCA 5EXPA 5CB8A 3I5YA 1GSIA 3THYB 3QPUA 3PUWA 121PA 2ZITA 2IBMA 1JPJA 2V7QA 4RCZA 4HZUB 3KJGA 3RS5A 5DISB 3QEOA 4QC2A 1E9BA 4D0GA 2PEZA 3L0PA 1G6OA 4ZCLA 4RD3A 4G0NA 4QHTA 1SVOA 4A0HA 1ZRHA 1K8RA 1Z22A 2MMGA 3TKLA 3A6PC 3BAFA 4IVRA 1GDDA 1FUUA 1G8PA 1E9AA 3L8ZA 4JKIA 3TQCA 4XWOA 1RVDA 4TSFA 3G82C 3UK6A 2EFHB 5HKKD 3MD0A 2D62A 5KNBA 1Z0DA 1IN5A 2JATA 2VHCA 3ONWA 4XSHA 4XWKA 3H4MA 2J87A 2J0SA 1GNQA 1E1QA 1YRBA 4F4JA 2B7BA 2FZLA 3TRFA 3UWKA 4QGFA 4BLSA 5JI2E 1ZYUA 1FOEB 1IN6A 3W5IA 4RCYA 5TXGA 4GZMA 4QL3A 2ZVPX 1D9ZA 4URXR 3UKDA 4PO9A 2QBYA 2EWWA 3TQFA 3CH5A 4Q01A 1HQCA 5A4JA 2ZSEA 3VR4A 3GEHA 1CRPA 1IXZA 4FMBB 3SHFA 3ASZA 3K8YA 4DZZA 2IWHA 4D82A 3WBKA 1BOFA 2BEKA 5SZIA 4DUGA 2VHQA 3KJIA 4YMVA 2DWPA 3UPUA 4HB0A 2D2EA 1DEKA 2XSZA 2FX3A 3R7WA 4AKEA 4DLZA 4G5SA 1RC8A 4OHZA 4C0KA 3MG9A 2F55A 2ORWA 3DVLA 1N6OA 4DLUA 2WHXA 1JR6A 3A37A 4DT1A 5D3MB 1XEXA 5EP3A 4WAUA 3H2YA 4Z8XA 4LBVA 3THXB 3I73A 3ICEA 3CF6R 2F6RA 3LD9A 3FMIA 3CW2A 4UNQA 4ACAA 4D4MA 3SJCA 5EZ5A 3VR2A 4D4JA 3WYAA 2J0UB 3DM9B 1A82A 3LW8A 4KAXA 1CEEA 2QTFA 4W5WA 2GAOA 1VCNA 2FGKA 4Z1MA 5B57C 4JLKA 4ZI2A 1OW3B 1EFRD 2AX4A 1ZMXA 2P67A 1GM5A 3VR6A 1CR0A 1XMJA 4KODA 1Q21A 2EQBA 1UBCA 4PHFA 4IHQA 5SZJA 4A0FA 4BASA 4TZ6A 4IDOA 1N0VC 2GXQA 2IYVA 3LBHA 2GEVA 2WJJA 3EWAA 5DI3A 4IW3B 4ZIRB 4FD2A 2WKPA 1TEVA 3DMDA 1A1VA 1Q22A 4Q9IA 4DKXA 1Q1ZA 3O8DA 4V0LA 1MO3A 2QUZA 1ZD1A 4LY6A 3SNHA 1KSFX 2DYKA 1GRRA 4LRWA 3WYGA 2CHGA 4LUCA 3IUYA 2BCGY 2DFLA 1PJRA 3ZQ6A 5BYKA 4UQOA 5CDFA 3FWYA 3N2IA 4RD0A 4GP6A 3TSWA 1E94E 4TT3D 3W34A 5J4YA 3FKSD 4EPXA 2GKSA 1XFAA 4B2PA 2NPIA 4TQUS 3VTKA 2W6ID 2REXB 1P2TA 2OBLA 1Z6XA 2I4IA 4Q02A 1XD9A 2ZSFA 1QHIA 1W5SA 3QKSA 5CM8B 2RGNC 1S96A 1YR8A 2AFIE 1Q57A 4HAVA 4A2WA 4JS0A 1DOAA 2CK3A 3B1WA 1W46A 3K70D 3E2IA 2OBNA 2C98A 1GKIA 3ZS8A 3WP1B 5GADl 1QHHA 4KI0A 4B76A 1NVVQ 1N0WA 1GL9B 2CVHA 4Q4HB 3E1SA 4QM7A 3U2QA 1ESNA 4V0ME 1RKBA 3ETLA 1T5IA 1US8B 1IJEA 4IFBA 4XD7D 3C14C 3HJNA 4JLMA 3L82B 4Q66C 3WMFA 2CHVA 4V0MA 4LJAA 2WBLC 3EPJA 3O47A 3ND9A 1AGPA 4HZUA 4C30A 3AVQA 1E9CA 3RRNA 1G18A 2RGXA 3GLIB 4DCUA 5FTJA 1J99A 3PUYA 2ZPTX 1NBMA 4M22A 4OHVA 3EIQA 3UXMA 1SVIA 1U8YA 1H8EA 4C7OB 1TNDA 2HLDD 2G0NA 1AQYA 1G9XA 1QVAA 1XU4A 1IY0A 3LX8A 3CPJB 4Q1FA 2F1IA 4CT5A 1F2UB 3DL0A 3WHLA 4N0EA 2ZU6A 1J7KA 3QENA 4B73A 2B6HA 4KITB 4S2EA 2DBYA 2NO6A 3B1VA 5AUOB 2R8RA 4PC7A 3FOZA 3BFVA 3RSLA 2REOA 3FHCB 3I32A 3RDPA 1YR9A 3ZH9B 1OH7A 4BEJA 1CRQA 2WSSD 3OIYA 4AG5A 5J47A 4AY2A 2JIZD 4QG7A 5TDHA 5B58C 3CRRA 2EFGA 1QG2A 3EG5A 2UZIR 3PEUA 4JLDA 2HXYA 3EZ7A 4KXFB 4LJ4A 3FHTA 3M1IA 3MRSA 3RWMB 4E03A 3QXCA 1ANKA 2VP0A 2JLYA 2DFTA 2I3BA 4B74A 2VHTA 5J4LA 3MAAC 1UKVY 2ATVA 1W4AA 1JB1A 2JLRA 2PT5A 3HYTA 1N6NA 1CR2A 3UG7A 3QNUA 2F9LA 2Z0MA 5D3MA 5JZVA 1SVMA 1W0KD 2ODBA 1XTIA 2MSCB 1KAOA 2QSZA 2XJ4A 3GJ6A 2IF0A 1XPRA 1BO6A 1NSFA 1X86B 1VYUA 4DCNA 3IILA 1G8FA 1Z29A 2ZE6A 4G5GA 2XXAA 2V9PA 4M1SA 2IYZA 2W0SA 4P33A 2CCJA 3UMSA 5H8WA 2B8WA 3RC3A 5FUXA 5KSOA 3OEHD 1R0YA 5E4FA 1T9HA 4D2IA 3B1ZA 2ECKA 3KXIA 4Z51A 4TN1A 2BJWA 5FTNA 5EP2A 4TLBA 1XDBA 1GL7A 4PZZA 1E2NA 5AJXA 3K0CA 1ETUA 4A2PA 4ACBA 3X1WA 1YRAA 1ZM3A 2O8EA 5E7JA 4ZIRA 2ZJOA 4ZCMA 4IOMA 3EPHA 2QGZA 2CNWD 3REFA 3OAAA 1UDWA 1S3GA 2PX3A 2H92A 1WRBA 4P0TA 3TGPA 2RGAA 3DOFA 5EXXA 1ZD9A 4V0NA 3B78A 1VHLA 2ZS9A 3GEEA 3KJHA 3QXSA 3EASA 3E70C 1SKYB 4YMSA 4L9SA 1OIVA 4HI0E 4EUNA 4QBIA 1ODFA 4CGZA 2BMDA 2PCLA 4Q5IA 2DWOA 3IQXA 3FTQA 1MABB 4EKDA 3RABA 2QE7D 3THWB 2GCOA 2ZRDA 4DLSA 1NP6A 2QMUA 3VX4A 2C96A 2ZU0C 2CXXA 2DR3A 1OXXK 4B2IA 1E0SA 5TV2A 3GJ0A 4QKQA 3MUFA 5FOWA 2HEIA 2KI5A 1E2IA 2IYRA 1QG4A 1H65A 2OHFA 1ZU4A 1Z06A 4JL5A 1VYTA 1KKLA 2VP9A 1NLZA 1KK0A 4GFDA 3I72A 3G0HA 1TX4B 2DHRA 5KTYA 3T1VA 1OIXA 3K0EA 5J4VA 1BMFD 4B3DA 3A4LA 1HYQA 3KDSE 1LF5A 3SR0A 1L2TA 2BBSA 3U7EB 4G1UC 4RZ3A 2GZDA 1T3SA 1KI7A 5EE5B 2ZR7A 2B92A 1US8A 1XCMA 4TLAA 4N3NA 4DJTA 4E5UA 1Q1EA 8OHMA 1II8B 3LH5A 4URWR 1Z83A 1UKEA 1IQPA 4GP7A 3U44A 3A1SA 2QA5A 3LX5A 2WWHA 3K0FB 4L16A 4P32A 2P6UA 3GLIA 2V6IA 3AEZA 3ASYA 3ZDQA 1WA5A 1IBRA 1Z8FA 2IF2A 4GPTA 3RHFA 3SFZA 4C7OA 1OJLA 4AYXA 4TLCA 2DY1A 5BN3A 5JLJA 1F2UA 1TQ6A 3LY5A 1XXHB 2WPDA 5L3VA 5FPKA 1KDTA 1SVLA 3IHWA 3NWJA 4RZUA 1P3JA 1KMHB 1GITA 4UNNA 2ZYUX 3TJZA 4I1UA 1NI3A 3RNLA 2ZYVX 1ZJ6A 4NONA 2O52A 1HEIA 2PBRA 1W0JA 4UNSA 4FWTA 1DG3A 3GLFB 1KDRA 2IYQA 2LWIA 5LB4A 4BFTA 2RGDA 1SXJE 2IYXA 4JIMA 4QHSA 1QHYA 1C1YA 1XX6A 3K9NA 1GVNB 1P2UA 2CBZA 3KQLA 5F3WB 4Q1CA 3NEYA 5F9HA 1AA9A 1JR3E 3FFBA 4O2LA 4Q7JB 1J8YF 3GJ5A 2A5GA 1S8FA 2E87A 3QOFA 2ORIA 5A0FA 1U81A 4US2R 2IL1A 1JR3A 2V4ZA 2GJ9A 2ZR9A 3M6AA 2PZEA 3RS3A 4DDTA 3LXRA 3ZS9A 1NY6A 3U60B 2BBTA 4JZKA 3QY0A 1E98A 2LKDA 1HURA 4Z54A 5E3HA 2CVFA 1XCPA 3V9PA 1P9RA 2GA8A 4Q00A 2VF8A 4NZYA 4DEXA 3GJ4A 3MCAA 2ZRGA 4KV9A 5K8UA 5JJKA 2J7PA 4OHYA 3B82A 4QOSA 3I1FA 3CONA 4NYJR 4YQFA 1Z2CA 2W6JD 1XPOA 2VH5R 1H8HD 4AC9A 1KAGA 4IJMA 4NBSA 4B3CA 5DE3A 3DZDA 1T0HB 2BV3A 3CNOA 2QENA 3QKTA 2LKCA 5A5GA 2NG1A 3K09A 1U0LA 2VF7A 2IEYA 1RFLA 1SVSA 2FOLA 1XB2A 2HF9A 3I3SR 3L0SA 4UXIA 2JLWA 1Z6GA 1MKYA 1FQJA 1LS1A 2QP9X 2OXCA 5JS8A 1QF9A 2RCNA 1N6RA 2A2ZA 3PEWA 4Q1BA 1KGDA 2JDID 1G21E 4QXAA 1MO6A 1E4YA 3AF4A 3MJHA 4JT2A 2ZAOA 1WBBA 2FFQA 2IA5A 1G3UA 4HZIA 2X1VA 3K9LA 3OZXA 3NDPA 3EA0A 4RD4A 4BLPA 5JFGA 1MABA 5JS7A 1D8TA 1OB2A 4AKIA 1VYVA 1M34E 2ZJAA 3EZ6A 1KKMA 3L43A 4EJSC 1FW6A 1X1SA 4RFVA 2QG6A 1G19A 2ZJ2A 3KKPA 5DIFA 4KO8A 2YOGA 3OEEA 4RD6A 5HR5A 2XB4A 4C2UA 3QVVA 1Z47A 2FSIA 3LA6A 5JSZB 1N6PA 2A9KA 5M04A 2ZYWX 2PLFA 1SVKA 2J45A 3W8NA 3IGFA 1RW4A 3A1VA 5DN6A 1ZM9A 2ZANA 3GLHB 3SEAA 3BC1A 4BZPA 5DH9A 4ZDIA 1Q20A 1NY5A 2AFHE 2RGNA 3OF5A 2FJUA 2YINC 2VEDA 1EXMA 1DBSA 4LJ5A 3QUSA 4YONB 4F93B 3KUCA 2PJRA 3K53A 3TAHA 2EFDB 1PUJA 2JCSA 2FGJA 1DAIA 2OO7A 3KXKA 2GHIA 1Z6TA 3WXMA 3D7MA 4HLQB 1II8A 1HQYE 3TLXA 2XEXA 2PT7A 1CR1A 2P3SA 4M53A 2H8KA 1YZKA 2VO1A 3AUYA 1N5KA 1CF4A 5H70A 3K0FA 1HE8B 4PO1A 2AK2A 3LVRE 5FBLB 4A6XA 4BPBA 5K8LA 2GJ8A 5BXQC 3L0IB 2A5JA 1Q44A 5JWOA 2DPXA 1G3RA 4BGDA 1LVGA 5G40A 2WIBA 5JRJA 3GEIA 4N1AA 3AV0B 1QHGA 2OUKA 4R71A 5JJIA 1XXHA 2IUUA 2X19A 4IEIA 2QAGB 2WOOA 4LJ7A 3LDAA 5C46F 1KMHA 4OL0A 3FHOA 3NH9A 2BEJA 4QHYA 4C0AC 1UBGA 2WKQA 1W2GA 2Z4RA 4X8OA 5IK2A 5CLLA 4HYYA 2JLXA 1N6LA 4CRWB 3NC0C 5FL3A 3TW4A 1W47A 2MSDB 5CM9C 4R9UC 4NPHA 3WP0A 2O8DB 3IEUA 1KDPA 4EQ6A 1G8GA 2WM9B 3B60A 3C15C 5EUQB 2ZQ5A 3T12A 4B75A 4I1OA 3C5HA 1AS3A 1G5RA 3CNLA 4KCGA 4RY2A 4O3MA 3GLGE 3V4RA 2VTKA 3C8UA 4A36A 4ON9A 1JBKA 3UIEA 1AZSC 1HTWA 1P2VA 3EAQA 3P20A 3GLGA 4B6EA 2A3RA 1MRSA 2W2XA 4MDEA 1SGWA 3HDTA 2V8OA 2FFAA 1U9IC 3C4JA 3PEVA 4PPFA 3F0TA 4R2HA 5H1YA 5DNYB 3E5HA 3NXSA 3BWDD 2WIAA 4BLRA 4WIAA 1QHNA 4TYWA 3U4QB 4ARZB 3JVVA 1KI6B 1N6IA 2IS1A 1NVUQ 1ZCBA 2XNDA 4N0DA 3X1XA 4YXWA 2FSHA 1NMZA 5H68A 1NMYA 4BFWA 2WWYA 2ZRCA 2OBMA 1MRNA 2FA9A 2GETA 2OESA 2QT0A 3FFAA 3KX2A 4II7A 2NO7A 1RJ9B 3AVTA 4IOLA 4MITA 1XEFA 3GJ8A 2A5DA 4X8HA 2ZJBA 2GAAA 4Q4JB 1L8QA 2P0EA 4D81A 1VCMA 4QNRA 4IXNA 1D9XA 4UNPA 2PZGA 4PC1A 4V0KA 2GBLA 4A8JB 1AZTA 4NCKA 2JASA 1KY3A 2OCPA 4UJ5A 1OHHD 1X6VA 5EE9A 4B71A 2ZREA 4JLAA 1GWNA 4DDVA 4BFXA 2YOFA 3ZZTA 1SXJD 1JXMA 2PX0A 4MQBA 4QJ4A 2HJVA 4QBFA 3L8YA 4TZ0A 3ZIAA 2AXPA 3RRMA 4DLVA 1JEDA 4DVGA 1G5PA 1OXUA 2HV8A 4FCWA 5CB6A 1WE2A 5TMPA 1CIPA 1OH6A 1G64A 1XD2B 4TQ9A 5JSZA 2N1BA 1HY3A 3T34A 2J1LA 4BECA 1IHUA 4EJSB 4PSVA 2ZRJA 2FZ4A 4HDQB 3AP1A 4M9XA 3GLHA 4FINA 3SE0A 1VG1A 1E0KA 5JI3E 2QRZA 2FNAA 3T06B 1UKZA 3HU1A 5L8VA 4LHZA 3BBPA 5K8IA 5L3SA 4C2TA 1IXRC 3G5UA 4XWAA 1NVVR 2QTVB 3PFIA 1XEWX 1T4GA 3SZRA 3T5DA 1Y63A 1ZAKA 5EE1A 3K9HA 3BFXA 3OESA 5CJPA 1KI9A 1KI3A 2NO1A 2RGGA 1U8ZA 1CJTC 4NCIA 4I99A 2KJQA 5DYGA 5F98A 1UPTA 1TMKA 1KY2A 2JJ1A 4FMCB 1DPFA 2H57A 1CXZA 5G53C 4GSYA 4Q7MB 1ZNWA 3QKRB 4MYHA 1KK1A 3QF7A 2RGCA 1E2HA 4QRHA 1LFDB 2JJ2A 3DOEA 1IXSB 2E1RA 821PA 4IKEA 1U99A 3N2EA 1K5DA 3SQWA 2CLDX 1CJKC 2QAGA 4P31A 2W00A 3LNCA 1G8YA 1NN1A 4GDFA 1ELOA 5J5CA 2G83A 4E07A 3EW9A 1KYIA 3NHBA 4DDWA 1EFTA 4IDPA 4A9AA 4DSUA 1OV4A 4PANA 5FL7D 1UDXA 3VFDA 1M8PA 2CMKA 2GVZC 5DLQC 1NG1A 3AH8A 4TTRA 5DYIA 2PL3A 2O0KA 5HZKA 1U98A 3CRVA 4PSKA 4URVR 1NJFA 2FH5B 1XWIA 4Q1EA 2BCJQ 2UVQA 2XOKD 3F8TA 4ZDJA 3KKQA 1IONA 2ZSBA 2UZ3A 3K09C 2KSQA 2QTHA 3LV8A 1VPLA 2OM2A 4FMDB 3UG6A 1D5CA 3LLUA 1RZ3A 3X1DA 2HJGA 4AD8A 2CDNA 2QEQA 2R2AA 4Q4LA 1R4AA 4CZ2A 5HTKA 1G3MA 3TIFA 1A7JA 4BZQA 3RYTC 1N6KA 4UJ3A 2QM7A 1GKYA 2YWGA 4ASUD 3GFPA 4Q9JA 2N42A 1ZNXA 4ARZA 2JLZA 1KI6A 1P7CA 4M1MA 1COWD 2YZ2A 4M2LA 1L7VC 5CDFE 4YMUA 5G3ZA 4HUQB 4EFNA 2OSBA 4PQYA 5FPSA 3LLMA 1AM4D 2ZI3A 2GCPA 5FOTA 2ZRNA 4GL2A 1TQDA 2NGRA 3GFTA 5FUYA 3QBVA 2AHOA 1KI1A 3VNVA 4RKEA 4BE7B 1RJ9A 3EPLA 2ODWA 4JLVA 4A15A 1Q3HA 1VCIA 4Q4JA 4X8MA 1R7RA 3TMKA 3CRMA 2WWFA 1FNMA 3TR0A 3SU8A 1HH4A 3BH7A 5IDVA 4JVLA 4OQNA 1MT0A 1GKUB 1XD8A 2R62A 2RB4A 2D7DA 4M1WA 3U61B 1W36D 4L5BA 3B9QA 1E6CA 4ZO4A 5AJYA 6Q21A 1WBDA 1TF5A 1G1MA 4JBXA 1CP2A 3QPWA 5LB2A 3VR1A 1XPUA 2ZRIA 4JYBA 3SYKA 3Q9LA 1NKTA 4UXJA 4LV5B 4PTLA 4LHWA 4FMCF 4LSGA 1W5TA 5DSZA 1NIJA 1P73A 5CJ2A 4WBSA 1S9DA 4F4CA 3EA5A 4G3XA 2P65A 3MSXA 2P2LA 5L3QB 1M2OB 2AWOA 1TQ4A 1PZNA 3THYA 1JEEA 4EJSA 5AJWA 3L2OB 3LW7A 1O87A 1G6HA 3U7FB 4BFSA 2JLVA 1NBME 521PA 2SHKA 2ZROA 4V0OA 2IHBA 1NF3A 1VIAA 1QVRA 4R2IA 1SZPA 3FVQA 3TUIC 1FZQA 2VP2A 1HT2E 1D2NA 2AKAB 1U90A 4HAXA 2QGNA 2ZE5A 3LVQE 3C41J 3Q3JB 4CYMA 5KHOC 3RRYA 1KHTA 5IT5A 3ZZUA 1E79A 4JBWA 4JLNA 1M7HA 1L4YA 2G9NA 3UWOA 2VSFA 4PQRA 4F7WA 3FB4A 4WW0A 4IVQA 3HR7A 3DEFA 3R9XA 3DM5A 2QPAA 2QQEA 2IS4A 1EWQA 1GL6A 1UFQA 621PA 1GG2A 2WVJA 1AGRA 2R6GA 1S4QA 2WWXA 4C0QC 4ABYA 4FMDF 1JECA 1TF7A 1KO5A 1KK3A 4E22A 5C18A 5D3QA 1E96A 1I2DA 4WXPA 3LFUA 1ZCAA 5E7IA 1S1MA 2C99A 3SBEA 4U7DA 1OF1A 2GJSA 3M4YA 5HE8A 2ZVQX 1Q12A 4LBWA 5HZHA 4U5XA 4MGKR 4EPRA 1IY1A 5FH9A 1DARA 2ZRMA 3NBZC 3W3AA 4WOPA 1FQKA 2RAPA 4DCVA 4M0LA 4OI4A 4HAZA 4MRRA 4FIDA 5FOSA 3NDBB 2JDIA 2NIPA 1ZC3A 3A8TA 3CX8A 4DLRA 3THXA 2GESA 2IUSA 2V7QD 3OHMA 1EGAA 3KL4A 1SXJB 5DHAA 1HUQA 1KK2A 2ODEA 5AUQA 1W2HA 5GJBA 2WJYA 3H84A 2L0XA 3QXXA 2ZTSA 5JWHA 2IC5A 2JLUA 2J0UA 2IYYA 1KMQA 5IHPA 2ANCA 3KTAB 1LV7A 2D06A 2R6DA 4URZR 1FX0B 1P72A 2H7VA 2NQ2C 2J59A 4RSGA 1HA3A 2XZLA 1E32A 2XGJA 4CVNA 1WXQA 1NSTA 4TSFD 1YE8A 3LQRA 5FBRB 2XTNA 4JKYA 5KYKA 1BYUA 1OYYA 1WMSA 2PH1A 2GBLC 1C4OA 5GVRA 3VAAA 4JLBA 3GPLA 5E95A 1E1QD 3EC1A 4RFSB 2N46A 3A4MA 1VTKA 2NO0A 2JLSA 2A7QA 3FDIA 4DLYA 3NBYC 1U9IA 4LZZA 1ZNYA 2C03A 2ANBA 4A0RA 4C3ZA 4EIWA 2QMEA 1PLLA 2ZJZA 1R6BX 5GVSA 4M1YA 2Q0HA 3QKUA 4PC3A 4D4KA 2H16A 3AGPA 5C4MA 4HDOB 1XCGB 4XH9B 3HYRA 2RGBA 2VP6A 3OFNA 4JVNA 5CK5A 4C4PA 2J0VA 3IPXA 2WSMA 4DUGD 1M7BA 3KKOA 2XTMA 1FNNA 3W6OA 4Q19A 4A2QA 2XSZD 2OAP1 1QDEA 4XTRA 2HCBA 3LBNA 4IDHA 3PR1A 4LV8B 4B47A 5FTLA 4PHTA 3KFXA 1OKKA 421PA 1TUIA 2ZXUA 4TLDA 4M9QA 2HT1A 2QP4A 3EXAA 2ZSAA 1OLOA 721PA 3MGCA 4PSAA 4WZBE 2E9SA 3MLEA 1LY1A 1MH1A 2RMKA 2ERXA 5E7MA 3SYNA 2QU8A 1G4UR 4P4SB 2ZI7A 4Q9LA 3SBDA 4G5QA 4Q4HA 4WXRA 1U94A 3PV0A 3P27A 4NYIR 4GMDA 2WWIA 1E9FA 2P5TB 5L3QA 3IO3A 1G4AE 2C9YA 3S1AB 4CT4B 3ZVMA 3BB3A 4OK3A 1R2QA 2PZFA 3RS7A 4FI3C 4S35A 5EJEA 5F2EA 3GLIE 3B7GA 3NVAA 1YVDA 1N6HA 1OFHA 1DTSA 3BK7A 4DDUA 3B5JA 3TW8B 1EX6A 2AK3A 2K5UA 4M4SA 4B32A 4AYWA 1E0JA 3C5CA 1FPMA 2C04A 4HAUA 3U3KA 1NLFA 2ZJ5A 1SULA 1N5JA 3CRQA 1E69A 3KB2A 2QAGC 4BWYA 5KPDA 4Q9HA 4OHWA 1P4SA 1HE1C 2KWIA 1W48A 4PAMA 1G7RA 2GK6A 4LGMA 3U5ZB 1XJ0A 4DWJA 3NG1A 2VL7A 2FSGA 4BRUA 4FN5A 2GDJA 3OE7D 1NRJB 4GT1A 4LBYA 3PJRA 2BC9A 2B7CA 3P26A 3ICQB 3IHLA 3WBJA 4LI0A 4JVSB 4KVAA 4QJ5A 5FUWA 4Q48A 4CEHB 3DDCA 3VHXA 2O0HA 4TLEA 1K5GA 2F1HA 4TMWA 1F2TB 3KZ1E 4B35A 2CK3D 4IOKA 2FFBA 5CLQA 2QT1A 4KFSA 2IYLD 4BFVA 2YKGA 2UKDA 3ZZ0A 5SZHB 3I4LA 4MUAA 4Q1AA 2HUPA 1B23P 1G41A 4H1UA 3PCRB 1JNYA 4MKHA 1KZ7B 5BW8A 4OK5A 2FV8A 1JAHA 3W6PA 3W90A 1Z28A 4GNKA 1E2DA 4LHVA 3TVTA 3CR7A 4JL8A 1QBKC 2REBA 2QQ0A 5FTMA 2KE5A 1IY2A 3B1XA 1GTVA 2ZE7A 3NC1C 1BKDR 1YJ5A 2R44A 4ZDWA 1AN0A 3SYLA 3T61A 4QGGA 1XTKA 2OILA 3VU9B 3KUDA 3K70B 1OSNA 2G77B 1G20E 1IN8A 3PEYA 4QBHA 2WJGA 5JRZA 2H1LA 1F5NA 1VG9B 4KFUA 3VKHA 1NBMD 3CIOA 4L9WA 1ZNZA 4PHHA 2OV2A 3L0OA 1KJWA 1XTJA 3SN6A 4JYCA 3F5FA 2XNSA 1FX0A 4EFLA 4B3XA 3RAPR 5J4KA 3Q85A 3OIVA 5JWRA 4OI0A 4DB2A 1EFCA 2J7KA 4A6PA 4IEEA 4I81A 1N25A 2KB0A 4LYFA 1EFUA 4F38A 3Q5EA 5KSZA 3IBGA 4IDQA 4A8JC 1OB5A 4MGZR 3TR5A 2ATXA 4Q18A 3BE4A 2NMVA 2OCAA 4RFSA 2OFOA 5TY0A 3U6BA 4PPGA 3D6TB 1DAHA 1SKYE 4PFSA 3TSOA 4ZDKA 2GJKA 2CL6X 3O8CA 1HV8A 1P2SA 3CZPA 3SHWA 2GF0A 4A92A 1J90A 1XRJA 2F43B 1RRPA 2VBCA 1L4UA 2ZI5A 1W44A 1R8QA 3SC3A 5HKKA 2QMHA 2HDNB 4Y0AA 4OK6A 4KFTA 3THWA 3HU2A 4NTZA 3GMTA 3LBIA 5IF9A 4LJ8A 4F92B 2XZPA 4JLPA 4TYYA 1GNPA 3FYHA 2HYDA 3QPVA 3A1WA 4C0SA 2GJAA 2ZRBA 3AP3A 4DSTA 4JMPA 3V4FA 4TTQA 1BYIA 2WOJA 2AN9A 3RLFA 4Q7KA 5JHHB 3ZJYA 3W6NA 1YKSA 4AWXA 2IEZA 3U7HB 1UM8A 3FMOB 5JECA 2C5LA 2FU5C 3AF2A 4P4SA 1OXTA 4G5OA 3K9GA 4HB2A 4CEIB 4TMVA 4B3GA 2JAQA 2V3CC 3I61A 3CH4B 3TNFA 2G6BA 3FMPB 3UMRA 5EXTA 5KDLA 4NYMR 5J4HA 2HXSA 1FP7A 1N3BA 3SI7A 3UMFA 4MYUA 3VQTA 4M9ZA 4QJ3A 3B9PA 4LWZA 1GILA 3W9YA 3OAAD 4TYQA 3DKVA 1S0UA 2VIIA 1RPZA 4X8LA 3RRZA 1XXHE 2JEOA 1A2KC 1BS1A 1EFRA 3PITA 2GVDC 5JBQA 3RC8A 3AKEA 2IYWA 4BQSA 4D6PA 1Z5ZA 2IHYA 1J70A 4EPYA 3CF0A 2FSFA 4V03A 4GBMA 3P4XA 3GLFE 2ZIAA 5JHGB 3B8HA 4LC0A 221PA 2NZJA 5J40A 1G7SA 1GP2A 4CEHA 2EFCB 1COWA 3CKLA 3GLFA 1TTTA 1F2TA 1G3IA 1CU1A 3HP1A 2O8CB 1F60A 2VP4A 2XITA 2YC2C 4DEYA 1NN5A 2Z5FA 1DS6A 4PPQA 1GIAA 4TT3A 1JXOA 5F9FA 3CNNA 3FKSA 1ONBA 4Y0VA 2X2FA 4RD2A 3Q8XB 3QXJA 1Q1BA 1YR6A 2W6IA 4CIDA 3B6EA 1NJGA 2KBFA 3R7WB 4U00A 3QVUA 4IXMA 1RYFA 4CEJB 3JVUA 2Q9BA 1AS2A 3HU3A 1WB9A 2O8FB 1T8TA 1CJUC 4NYJQ 3SJAA 1SHZA 1Z0KA 1FL9A 3LXXA 2F3TA 4BUJA 1VHTA 1X1RA 2D2FA 1G291 4URYR 1E9RA 4JT4A 5B64A 1KO4A 2FE4A 2BBWA 2BIFA 4LK2A 3GJ7A 4R98A 4TL7A 3T1QA 2Q9CA 4XOIA 4QGHA 2OCYC 1YZUA 3DMNA 4H1VA 3A1TA 3R9IA 4AIIA 1SVWA 4XD7A 1CS4C 1OT3A 2GRJA 3AUXA 2WPDD 2GXSA 2P6RA 1N0UA 2W58A 4YLGA 4YDSA 5DI3B 5P21A 5EZ6B 2W2VA 3CB4A 4B3FX 5JCPA 4HUTA 5KSYA 4DIEA 1W0JD 2WICA 4LC1A 1J2JA 2BM1A 4BFYA 4XVQA 2QI9C 3AP2A 4NDZA 1KJZA 1AKYA 2QL6A 2HLDA 2ZUDA 5K8TA 4XIGS 1YU9A 1ZVQA 3KQUA 3O8RA 1I4TD 3QE0A 2C78A 4AKHA 2Q3FA 3FMFA 1II9A 2BVNA 3MJRA 5HPYB 2ZE8A 4KLNA 2GCNA 1JQJC 3ADKA 1E99A 3M0EA 3PQCA 3WMGA 3QF4B 1FTSA 1XJCA 4ILEA 4OKSA 3WNCA 2ZRKA 4D4LA 2YOHA 1JR3D 1UBEA 1F3OA 2B21A 2QORA 1MO5A 4TL6A 1JJ7A 4MKIA 1UKYA 1OXSC 1Z63A 3GLHE 3MWKA 4PO8A 1CTQA 4MKFA 4B3BA 3BD9A 2WSSA 1K6MA 4US0R 1P9WA 2FEMA 3Q72A 5AJVB 2JIZA 3K0AB 4UXHA 2RHDA 2GZHA 4LYHA 2GK7A 3OIWA 4B43A 2J7PD 5CYPA 1S3SA 5ELXA 1W7AA 2BHRA 1X8KA 4GOXA 3IKJA 4TMTA 3J81k 3CO5A 4WZ6A 1EESA 4AI6A 4DSOA 2YWFA 4TYNA 3SQXA 1FP6A 1E2FA 3R8CA 3X2SA 1AS0A 2WJIA 5AK0A 3FE2A 5EP4A 3UATA 1DE0A 4AG6A 3GJ3A 4FCTA 3WNDA 2W0MA 1W0KA 1PLKA 3R20A 5KU1A 1Z0AA 2AXNA 1EK0A 2IXEA 5G3YA 3BRWD 2I1VB 4G5RA
chains in the Genus database with same CATH superfamily
4AS3A 4LY9A 1ZQ9A 1JI0A 4DRZA 5MDHA 4KYUA 3ER9A 1F8YA 4RPJA 2VYNA 3U0VA 4BFUA 4M60A 2Z2YA 1KSHA 1EIWA 3QE2A 4OSOA 4URFA 4AZ0B 3OEHA 4IGFA 1K5PA 4QG3A 3L7IA 4GF5A 1RE0A 2ZSDA 3FAZA 3UJ8A 1UKBA 4L3OA 3PRYA 4HFMA 4ND7A 2I6FA 5KNCA 3X1YA 5FFMA 1VE9A 2LDXA 3R3YA 4HATA 1VSUA 1G8SA 5BQPA 5ALVA 4O2RA 4WLOA 4R40A 5ALHA 3CNHA 2VDMB 1V3TA 2CNWA 4FYKA 2G5TA 4DCTA 4MR7B 2Q2WA 3QIAA 4K0KB 3K1JA 3QK7A 1M2VA 3HY3A 3M6VA 4MGYR 3MTAA 2W2TA 1KF0A 4BB6A 2C7QA 1KZ4A 1SY7A 2C0CA 1Y4SA 1DAPA 2XRMA 1DG1G 1EFVA 5JMWA 2O8DA 1OZFA 1K08A 2Z1DA 2IYTA 3TSYA 1SZDA 3C1TA 1VPWA 4FYJA 1CQJB 5LIRA 4Q9KA 1H85A 2VDNB 2P2ZA 2B3DA 3F9IA 4IUCS 4UD2A 4O2AA 5FOVA 4EZEA 3RI3A 2J9GA 2X41A 3ELDA 3WGKA 2GEUA 4ARVA 1SFRA 3QX9A 2AMLA 3FYCA 1ZFNA 5BQ5A 4KRXA 1JXAA 1VMAA 4DC9A 1ADBA 3MWLA 5JLAA 4WUVA 1R8SA 1SC9A 1UMDB 2O8FA 1DQSA 3ESBA 5GAJA 2HBYA 4RESA 1M6VB 2YUIA 3DZ8A 3WWCA 1SKQA 1JIIA 2CFCA 3OKAA 4P7GA 5HUJA 3THOA 1JDZA 1EM8B 3JZAA 5AI6A 2C4MA 2O0MA 2OCIA 1OFTA 2QN1A 3NKFA 1M5RA 1DBWA 2BD0A 4WNAA 1R4MB 1V6CA 4PTYA 4KFRA 3IUBA 2QPTA 4MGIR 3VZDA 3WX0A 4NQZA 4L4UA 3VSAA 1C9YA 4NXNB 1U2SA 3O3NB 4P5EA 1U0NA 3GRUA 2QY9A 1P5ZB 3LK6A 2YJ3A 3WYFA 1V71A 1WHSB 3OQHA 3QUQA 3UJCA 2AKEA 1ZGHA 4KHPB 4Z0HO 2JRCA 4NR0A 3VTFA 4D3ZA 1PF7E 4AZWA 2HMUA 3UWPA 2WYHA 1JVNA 1LUAA 3PTZA 2OCKA 4C43A 4R54A 4RJLA 1M8KA 3RJZA 2JAOA 3HMKA 2H17A 4TMKA 3LT2A 3U3JA 3KZOA 4C21A 2YW9A 3I8SA 2DLDA 4OI2A 1KC1A 2CJWB 5CX1B 3K35A 1YRQA 4MEBA 3WGZA 1FXWF 2IOYA 2YJNA 1QUEA 2B0JA 3G2JA 4OIFA 4QOGA 2OA0A 3X0DA 6YASA 1EJBA 1TTQB 2N3ZA 2NU8B 3BL8A 1XTQA 4X95A 3CXRA 3MWJA 4P5DA 4BWFB 1V6AA 2RK3A 5I8PA 3QF4A 3T1TA 3DEIA 1LF0A 5LZ7A 4AXBA 4GXNA 4ZC8A 1I1HA 3PQ7A 4RTRA 4DB4A 2ASEA 2QR2A 2WABA 1P61B 5ALUA 2WW8A 4EGCB 2WJAA 1SUEA 1U5AA 1Y5NA 2CHQA 3HCDA 4PLZA 2G40A 1U28A 2JEYA 3AI1A 4R6XA 2D7CA 1VHWA 3BCRA 4WKPA 5EN4A 3ZHVA 4DSNA 5L45A 3K0AA 2BM0A 3QLVC 1CFJA 3H5VA 3AB3A 1NBEA 2AFIA 2ZJYA 3N2KB 3WS7A 5KNDA 2OLEA 3KT0A 1LJ8A 4J0GA 4PC6A 4HEQA 4NEHB 3C8HA 1JQKA 5DT2A 3QU2A 4BLUA 2ZVDA 3U56A 1XE3A 3B1YA 2YFHA 3LDHA 1TA9A 4D9FA 1JHVA 1RQ2A 1T3ZA 2IYOA 4R1NA 4WGFA 1DADA 1KRHA 5ANRB 4W5TA 3DO5A 1JVBA 5IC4A 3MJSA 4ALMA 3RC2A 5DMHA 4E08A 5EJ5A 1T6BY 3LWZA 4XSVA 3RVSA 5FTKA 2Q28A 1GRQA 1SB8A 4B6JA 4EW3A 2JANA 3DE0X 4QFBA 4J07A 2ES4A 4K46A 4NMLA 2C2GA 5ECWA 1ZH4A 5EHIA 2CUTA 1GA4A 1U7DA 4L4ZA 1S1CA 4JLJA 1Y6ZA 4S1NA 3WIVA 2Q5QA 5C3UA 3KQKA 4BLWA 1NW4A 3DR3A 4QBGB 4EGJA 5BN4A 1ZK0A 3R9KA 1HQDA 2CBGA 2VTDA 1H8HA 2F8MA 2PMKA 3DDZX 4Q4AB 2OXTA 2BYTA 5KWJA 3IEVA 4O4LA 3G2MA 1KJYA 2ORED 5FNVB 1P8AA 2QLNA 3A36A 3BXZA 5MGBA 4DV7B 4PZYA 3WO0A 1AK2A 1RYDA 1SK9A 3OTHA 3CEAA 3N6VA 1I4DD 4Q3LA 4ZEWA 3DUFA 2C94A 2YHBA 2GHTA 4YMWA 5ALEA 2X2PA 5F4BA 3KQWA 4BQFA 4R1QA 5UKDA 4EI7A 1YDWA 1T5HX 2YN0A 1B3BA 2EFJA 1VPTA 3E22B 3L4SO 3V1TC 3R9WA 3U1VA 3HZZA 2I7CA 3GLUA 2RSLA 4B7UA 3BGOS 5EZYF 4BATA 1XL1A 1OH8A 4D43A 1F38A 4P86A 2EDCA 1P9NA 1COZA 2PMCA 3QMPA 4OQZA 4BX8A 3D4BA 2TSYB 4I3FA 1F6BA 1S8NA 1EUDB 1E2MA 3OJEA 4JSTA 5FA5A 2V59A 3WLPA 2QVYX 2CZQA 2NO9A 4G01B 4P93A 4Q7LA 2C4KA 3O21A 1ZCJA 4PV7A 3P9IA 4EL5A 2H4YA 3PNBA 1GOTA 1VECA 1MV5A 3COZA 2RBGA 3L41A 3QV2A 3G8AA 1UM9A 2P75A 4HMOA 1E8MA 3D7NA 1O95D 4ZHSA 2B1IA 2YV5A 4UPEA 1LNZA 1SC6A 2F4NA 2WA1A 2ORVA 4GXRA 4H17A 3I9NA 5C80A 3WA7A 1HQKA 3KFVA 3WWZA 3CUEF 4CQLB 1UK7A 2VQDA 4TMZA 2GB4A 4YC7A 3SFVA 1CQZA 2Y0CA 3FPLA 2F1OA 3F78A 1NUAA 1OWLA 3JTEA 4YQZA 5LOVF 1YQDA 2JJ1D 3OZCA 4J43A 4JJIA 1M2HA 4HRVA 3VZQA 3E9YA 5CLHA 5CFZA 1PT6A 2AQ8A 4RYDA 1RIIA 4H9GA 5ALGA 3TQOA 4HDKA 2HFJA 2HPVA 1MOZA 3ESXA 3KJXA 4D8UA 3ZCVA 1KXJA 1TYAE 5TMBA 1JQLB 2NADA 2EU8A 3HRHA 2O8BA 2BEWA 1CK4A 3NO4A 3L9XA 2IYUA 1HFKA 3QQ5A 5G0WA 1WCIB 3UAZA 5DX0A 2H2IA 4DBLC 3D8SA 3TAUA 4WDRA 3IIJA 2NSYA 4NG4A 1PLJA 5JZ9A 1F6WA 2NUTB 3D6HA 1LEHA 2VSXA 4JASB 1EB9A 3CPSA 4C6HA 4O5OA 3AVUA 2BR3A 3FGNA 1E77A 3PUXA 1S4MA 5HG0A 1JSXA 1R50A 3IAXA 5KMGB 3F6SA 5BORA 3WHKA 3RYHA 1KU6A 5ITZA 3DEZA 1JHXA 1YDFA 3IVAA 3MRTA 3M70A 2XJ9A 1R5BA 2OHGA 1G21B 5EERA 1M2JA 3CRW1 3EIHA 1SOVA 5LQDA 1PJBA 2VQ3A 3BGWA 5C8DA 4H1TA 3ZJVA 5KPJA 2BLLA 1TF2A 1RI5A 1YS1X 2H4JA 1N9KA 1Q7BA 2UZAA 4GOKA 4JK3A 4ZVKA 3TK1A 3W5VA 2HJHA 2FUG6 2YWEA 3SKXA 4E11A 2WU0A 3U3RA 4NI5A 5BT8A 3BERA 4FNMA 1A97A 1NN0A 1Y42X 1PQPA 1Y1RA 4XSGA 2GN8A 1M34B 4ATNA 1W4CA 2WZDA 3UT5B 2INGX 3R24A 2C3UA 1N75A 1UJ2A 4RV9A 4DILA 1ZM7A 1W581 3K71B 1OREA 4RJTA 1SN7A 3PGLA 3UF0A 2RAUA 1A77A 1PR1A 4P3XA 2JFQA 3ONNA 3G0GA 4FSDA 2I4MA 3DDWA 3L04A 4C6TB 2ZM5A 1N5RA 2WWVD 3D5EA 3B53X 3IT0A 3X1ZA 4FFMA 3S2YA 4X45A 1KDYA 2XZOA 2NACA 3IO5A 2IV3A 3TGWA 5CXQA 3RVBA 4C0BA 3WB9A 1ZITA 3F8WA 4HLDA 4N49A 2ZEJA 3VR0A 1Y0BA 2NU7B 4K81B 4PGAA 3RREA 2BWJA 4X65B 2F9MA 1Y8RA 3EWSA 3GPIA 3O9VA 1G8HA 4C03A 1GV0A 1B43A 5FR2A 7ABPA 4MV6A 1RCUA 1RI2A 5TQJA 2V0NA 5EWLA 3R2JA 2GXUA 1KTVA 1XMIA 2LCIA 4MGEA 1UFVA 4FHDA 3HEMA 1HDRA 2VUHB 1E3MA 1L5YA 4AJOA 3IODA 1YHNA 5F21A 3ZVLA 1IHYA 3ITDA 4AWAA 1GTSA 1HETA 4P3YA 1TPZA 3DE1X 4UHJA 4QXQA 4XI9A 1HEUA 1DWPA 2G88A 1VG0B 2ZRLA 2ZUWA 2KX7A 3OPMA 1MNQA 2D5LA 4ME6A 5DFAA 2QNRA 2OP0A 2LCFA 2OAGA 5D87A 1A8HA 4FQ7A 4B6GA 1KI4A 3LHIA 3LYUA 3IPYA 3MQFA 5TVKA 4DMCA 2PUCA 4KVFA 3WQRA 1GYRA 2DPLA 2YZKA 4M1OA 3CLVA 2C59A 1TQ2A 4RDXA 1YDHA 3IS3A 3N5CA 2ZUTA 3U17A 3DOOA 5DGTA 5HCIA 5JVDF 1XQYA 1TLFA 2E37A 2QJFA 2I7XA 4HLUC 2AZ4A 4LMRA 2IIBA 2ERYA 2KMLA 1DKNA 5TPZD 1ZRNA 3FMGA 4PZ9A 4U6NA 3KQNA 2FN8A 1R5OA 4KBGA 4XVHA 4AVYA 1NNEA 3AG5A 5NULA 4U39A 1W36B 1NXXA 3W2HA 3HJGA 1I14A 1BXRB 1HZZC 3L6CA 3RGGA 4MUBA 2IW3A 3DQQA 1Q17A 4L4YA 2RFLA 3EIUA 2O5RA 3AJ8A 3HR4A 3LYLA 1XZBA 1ZU5A 1ZUIA 1IC6A 3TW6A 3N3BC 3T7RA 5AVVA 1WF3A 2I6SA 5B12A 3ZQUA 1TKAA 1DO2A 3KB1A 3PHGA 1NVTA 5C1BA 4L08A 3NATA 1U5BB 4MAMA 1E9EA 1XKLA 4BO7A 1E79D 2QBYA 1R0ZA 4HAWA 4W63A 1ZRMA 1WMEA 4N47A 1DBIA 2EWVA 1YFKA 4MJ7A 4BZXA 1SCUB 3T4XA 1D2HA 2G1KA 2JFPA 1RXCA 1DGQA 1ISHA 1P81A 3EXFB 2PKXA 2G1PA 4P83A 5E9WA 4IJ5A 2ZATA 1XUOA 2JFFA 3SLRA 3BMNA 4MS3B 4JJ8A 5G4KA 5EQTA 4Z4CA 1NQXA 1P7VA 2EFEB 4KQHA 4GPD1 4ETNA 1TXGA 4C4ZA 1PQWA 4YAKA 3JWPA 1VB3A 3ZTTA 2VJQA 3BSYA 1C4XA 4B84A 1AN9A 4MQFA 4FR5A 4C9BA 4HADA 1L3IA 2PMDA 3ROKA 3DS8A 1SIUA 3IAS1 4TV9B 2OCXA 1BHSA 2OEPA 2ZI9A 3UUFA 4C7MA 3VVCA 4NHOA 3EXEB 5AW3A 4PR3A 2ZRHA 4UU8A 4V2UA 2P9YA 3ABIA 1XEWY 3D8HA 4Y18A 5CRIA 2E5WA 3SDSA 4FLEA 4DM3A 2M32A 1TJ5A 3QYPA 5G1OA 4J3JA 2YH2A 1V5IA 1SUDA 1A27A 5K01A 4TTPA 1UXOA 4JOCA 4WVFA 1ZOSA 4J4TA 1L7BA 1DJNA 4UPDA 1PWEA 4DFDA 2PMWB 2XMZA 3OF2A 4JMLA 5JT1A 3LUKA 1YZTA 3EZ2A 3A70A 1G5IA 4NP6A 4XPIA 2QZ9A 3CX7A 5EFOA 3EBOA 3EUEA 4NARA 1G3QA 4R05A 1G60A 4BIMA 3UOAB 5DP1A 2AR7A 1Q3TA 1QKIA 2CL7X 1W52X 2FQYA 2RJ3A 3JZDA 1CY1A 4FPXA 1DELA 2B94A 4Q3DA 5FI1B 2QX4A 2YJ4A 4G1VA 2EKZA 1W87A 2MT9A 4K6MA 3W5JA 1RHKA 3SR3A 3LO5A 5IW8A 4WY8A 2FPSA 3FGPA 4ZEXA 1IBLB 5FL7A 3PGA1 3S1AA 4QTYA 3P2MA 4PQGA 4LCBA 2BFEB 3C3JA 4CWAA 2FZGA 2FDCA 1E3WB 3ETHA 4QE3A 4GLFA 2HA0A 4Y1RB 3WDSA 5HYVA 4WA7A 5KOYA 1XTRA 2QZZA 1SCJA 1FDWA 3ET4A 2D2VA 2HNBA 3BJIC 4M0DA 3WSTA 4AJPA 2IDMA 3JPWA 3H19A 4HVLA 3L7JA 3NM4A 1DUIA 3E53A 2IYAA 4NU6A 4Z9AA 4OJKA 1QZZA 1MG5A 3O83A 4FUQA 4REQA 5B3AA 5A3SA 3ADBA 3C6ZA 3RRBA 4E7OA 5K6AA 3AM5A 1Y6FA 2ATEA 3DE4X 4FJ0A 2VAXA 3H4VA 1F51E 1P5JA 2ZFUA 4ZCIA 1EU1A 2PX6A 2WUFA 4HZGA 1Y9EA 4CM5A 1ML4A 2HYIC 5TGTA 2IK8A 1RP7A 2PFSA 2PVPA 4JLOA 3VBEA 1JG3A 4X3OA 3DWIA 2W48A 3WY9A 3OJ0A 4B6FA 4IIFA 4ZVQA 4CODB 4F72A 2C54A 4PYQA 3PUZA 4ASUA 4OB8A 5B58T 1NBAA 3GD7A 4NL4H 4UFOA 3DMPA 1E64A 1N2CE 2GNOA 2P9FA 3WZ2A 3Q40A 5JAMA 2QY6A 3DEKA 2RJNA 5IVIA 3A6ZA 3R3XA 4N5MA 1TO1E 1J0BA 1ZN9A 2CCKA 1F8FA 2ADFA 1NOJA 2YWHA 3QM1A 3IBFA 3RSOA 3KLOA 3SJBA 2QBYB 4QWWA 1TA0A 2OT3B 5DW0A 3R3HA 4MA4A 1P1CA 2JGLA 3OLQA 4PG5A 2OZPA 3QJYA 3IP1A 3P9KA 1IZ0A 3EY4A 3O94A 4RK4A 4R3UC 2GBGA 2PLRA 2OYCA 3T35A 4ZZ1A 1UEJA 2IZ5A 2HJRA 8LDHA 1AV6A 4DG9A 3SICE 5IDWA 1WB5A 3PNSA 4UREA 3I2KA 2EYQA 5ALIA 4J2HA 1QPGA 3F7OA 4OO3A 3H2ZA 1UINA 2P2CA 2XMSA 1WUKS 4GYYA 4EGQA 4GRAA 4W5NA 4K6GA 5FD8A 3I34X 1Z73A 1BVUA 3DQPA 3I58A 4P7KA 4L0QA 2FPWA 1VRCA 2W4MA 4RZSA 3HK2A 1JLHA 3CLHA 4I66A 4LX8A 3QPBA 4UBLA 3FPKA 3KQHA 1F7VA 1Y33E 4I55A 3D6NB 1G6KA 3IDOA 5CYOA 4EPVA 4MRMB 1ULBA 4RK7A 3ETJA 3AIOA 3LXMA 4KWHA 2QL9A 2TMYA 2X3YA 1F9AA 1MIOB 1SZJG 2W6CX 4HXFB 4M0FA 2DUMA 1GUBA 2FWNA 5GQSA 1WSDA 3ROGA 4EAQA 5DCWA 1T3LA 2C8JA 2REQB 1JQ3A 2WZQA 3G6WA 3H1PA 4GI7A 1U3DA 4ZCPA 3W7BA 1KBZA 2P77A 2Z83A 5DT9A 2H2GA 5TQ0A 4RQBA 3G85A 1BCRA 2FQQA 3L6EA 5BMOA 5T4EA 3VSEA 1Z3IX 3LQQA 3QXHA 1HFWA 3E9ZA 3QVJA 5CT6A 2Q62A 4AQ7A 2DOKA 2QW8A 3L8DA 3ZE2B 4OAOA 4NMMA 5KNLA 1RD4A 2A1UA 1ZHHA 4CW7A 4KE9A 1IN4A 3CH6A 1T1GA 4TYPA 4M9SA 4MLPA 1AMOA 1DG9A 3C7KA 3EEBA 3V2GA 2C8KA 4RENA 1BN6A 1H23A 2AV6A 4G86A 4MIYA 5BV8A 2BH2A 4DABA 2G0TA 2HA7A 4OHUA 3W4IA 5K4AA 4LI3X 5CFQA 5IKMA 3B2EA 5L6MB 3ZDXB 3SSMA 3I2HA 1HE5A 1YCDA 3MJEA 1NLUA 3TTYA 1YIDA 1DKPA 4E6PA 3BHNA 3IALA 1XZQA 3PGKA 1KRXA 5JRDS 1YE5A 2AZDA 4XVUA 2P6NA 4QQRA 3SKYA 4MP6A 4V38A 5A9SB 1QE3A 3OCVA 1AXGA 2XECA 3CZQA 2I7TA 2PS0A 1NHWA 4FILA 4YRTA 2CW5A 3AOEA 4LMBA 3M9LA 4BX0A 2CVOA 3K4HA 1VE1A 1YKFA 2XE7A 2FKAA 1DQNA 1PJ4A 3GQBA 3H86A 5AI8A 5DRYA 4ALJA 1F0NA 1PUIA 1VE3A 4UAGA 1U8AA 1Y8CA 3C7TA 1NXWA 1KH3A 2J32A 3L7CA 4IWNA 4M38A 3ZPXA 3BJRA 1X7GA 3MGGA 4LRYA 4O0MA 5JMTA 1M73E 1KH2A 1BU8A 3S3TA 4O25A 5CIQA 1W88A 5FWXA 3P2YA 1DPGA 4LNHA 3UJ7A 1GLNA 1WCV1 2Q1YA 3T9EA 5IVPA 3IUEA 3ECCA 3T9CA 5K0TA 2C7GA 4DARA 2UVPA 4PF1A 3K31A 4HCJA 3WRYC 2E85A 5ALQA 1NN3A 2PKYX 3HFGA 3RS2A 1YJXA 1WOYA 4RGQA 4Z2YA 2EZTA 4DLPA 1XMVA 3DFKA 1OFUX 1QFMA 2R6CA 4I8DA 1GEGA 5E9QA 2FK7A 4UEWA 1P74A 4J4BA 4KBYA 1Q0TA 2UXDB 2AXQA 1PKEA 1PNOA 1P1FA 4HLCA 4MPPA 3I5YA 1PP4A 1UBRS 3UK7A 2G0AA 3VU1A 1MOSA 3MW8A 121PA 3RT1A 3TF5A 4OU4A 2YWDA 4N6GA 2HRDA 4PWYA 5C34B 3TMAA 3G2HA 3QELA 3RS5A 1KYZA 2FSPA 4AZ3B 1DZ3A 4IJKA 4QC2A 2P7IA 3R1IA 3WLMA 1ARZA 5FORA 1DTWB 4ZCLA 6REQA 4G0NA 4A6DA 2R48A 1X39A 3B51X 3KYIB 1V2GA 4PLHA 5CVEA 3A6PC 3PQ4A 3O74A 1AQNA 1BCSA 3WJAA 3HTXA 1E9AA 3L8ZA 4JKIA 3TQCA 1SPXA 1C3OB 2PK3A 2QMYA 3FNBA 3GVPA 4TSFA 1JP7A 5JYCA 3ZHXA 4NS4A 5KNBA 3HWX1 3TLKA 2SCUB 1X1AA 1ZDMA 3T3DA 3MTDA 3OPYB 4PGFA 1MHPA 3EZXA 4B4WA 3PT9A 1YTUA 1TCVA 4GE3A 4D3XA 1YRBA 2GUWA 2C9BA 3X3HA 2H8GA 2YL2A 4R9VA 4I19A 4DV2B 2I8CA 3OFVA 4KAFA 5AHWA 5JAUA 3BFPA 1PR4A 1LBEA 1UMKA 4E2XA 2X4GA 3EGEA 3CLTC 4YLYA 4B6OA 3ZXYA 1ORTA 4ZANA 4MCAA 2P6OA 3DAOA 2YJZA 3CJTA 3QPDA 5AK4A 5A4JA 2VT7A 1Q5PA 3GEHA 1IXZA 1LI4A 1AQJA 4KH0A 4F4FA 1POWA 2IWHA 3TPFA 5K3OA 5LA6B 2AZTA 2VHQA 2QV0A 3KJIA 4ZVOA 2EV9A 1JTFA 5CX4A 1PL0A 3OQIA 1YUBA 2DR0A 5FWDA 2FX3A 5BPHA 3N2GA 4G5SA 1RC8A 2QB5A 2F55A 1QRUA 2YHIA 2DWUA 2QJOA 3BHIA 2Q2QA 4HR7A 4RWZA 2YIDA 5ECDA 5ALOA 4AUNA 4NH4A 4BQRA 4BX2A 4DT1A 1JR6A 1JUDA 1U0RA 1XEXA 3AU8A 2D1SA 4Z8XA 3H2YA 1I24A 5EP3A 2QD2A 1S2DA 4RL6A 1YC2A 3LD9A 3FMIA 1A9SA 1PSDA 4ACAA 1PQUA 1GCOA 4IS3A 2WG0A 2WVAA 5JQGB 1C7FA 1UBTS 2DTDA 3H1AA 4L9RA 5EZ5A 3VR2A 3DMTA 4AQDA 3WMXA 4EH1A 2CNOA 5JVDA 3EFEA 5D51S 1NQVA 2E4YA 1ODJA 1A82A 2ZIVB 3DM9B 5HGJA 4EEZA 3CT6A 2QTFA 2PYZA 4D9IA 1O97C 5B57C 4JLKA 5BV2P 4ZVPA 1NXTA 2P0AA 4CN8A 4GI2A 1CUUA 1YWGO 3QIVA 3N0WA 2XT9A 1EFRD 2AX4A 1T9ZA 2P67A 4LISA 2BGWA 4GWGA 3VR6A 4L4XA 4PHFA 4KODA 4A0FA 3TG8A 1HO3A 1MPXA 1UBCA 4IHQA 3O91A 4KTTE 2QNBA 2B3TA 3OQ1A 3Q0TA 4IDOA 4IQ4A 1YDGA 2QUBA 3LBHA 2WJJA 3ZD9A 5DI3A 4I4TA 3LX6A 1SR8A 4JLSA 1JJFA 2WKPA 5CBPB 4IL5A 4O1MA 4W8HA 1W1IA 1EWKA 2EZ9A 3C3PA 4Q9IA 5IT4A 2XUZA 1OILA 1TYEB 4JBNA 4J2TA 3UC9A 1RJDA 2XMDA 3N6XA 3FCEA 4LY6A 2XVZA 2ZBFA 4OXIA 2Q6LA 3D4PA 4DJJA 1XRMA 3WYGA 2CHGA 4JLWA 3VAZA 5KYXB 2JK1A 3BGVA 5DMXA 1PZGA 4POOA 4B3RB 3K6SB 3P5SA 2Q5FA 4UQOA 5CDFA 3IVMA 1SURA 4MA0A 1QCCA 4GP6A 4TT3D 3H17A 3BHMA 5REQB 3V7FA 5J4YA 4EPXA 3NVMB 4HYQA 2I33A 2QN7A 1XFAA 3QA3E 4DMLA 4CHTA 1EI9A 2FI1A 2Q5LA 1MX9A 2REXB 3A6EA 3DE6X 5E4JA 3VTKA 4KI7A 3WAJA 3BGDA 3ZLTA 1GAXA 2XCUA 3OTIA 3JZFA 1YJBA 3WSVA 2H0AA 4EB3A 2EDAA 1QHIA 4J9UE 4KIFA 4NBRA 2RGNC 1S96A 2AFIE 1OVGA 3KOOA 1GN8A 4NEQA 2CK3A 2XD4A 3ZQKA 1U7OA 2OHVA 3B1WA 4Y9TA 3E2IA 2OBNA 2C98A 3LLSA 4HS4A 4LE0A 3RC9A 2JD2A 3Q3GE 3UAVA 4UDNA 1VL2A 2QLLA 4HX2A 1YAHA 2X8JB 3E18A 3WLFA 1BQEA 1GKIA 4B76A 1T1EA 1N0WA 1X7DA 1QB7A 2JHGA 3F5QA 1CZOA 1GL9B 1OMOA 1R3DA 2PUWA 3BQ9A 3LGXA 3NONA 4IF4A 3BRQA 2G8LA 4L02A 4Q4HB 4R9RA 5LMNB 4ZAZA 4G9EA 1I10A 1RKBA 1NUUA 5BR1A 4XQCA 3DEYX 3C14C 3ZWAA 3HJNA 2AIRA 1AF7A 2BI8A 2AW5A 3KR0A 2CHVA 3NETA 2QDKA 3SCZA 3WMFA 4LJAA 4ZYXA 2WBLC 1TZJA 2K7ZA 2V7VA 2LD4A 4ZHQB 4X1OA 1E9CA 2Y3IA 2YBEA 5LM3A 3AX6A 3GLIB 1GVHA 4BPRA 1SXQA 1J99A 2Z2ZA 2P9TA 1NGSA 2ZPTX 4M22A 1EYZA 3NUGA 1O94C 2PS3A 4RPCA 3RJMA 4C7OB 1H8EA 1EAMA 1K92A 3I05A 4PRKA 1WXFA 4BTLA 2G0NA 1G9XA 2NQTA 2YUTA 4KPGA 1QVAA 4O4JB 1JQEA 3LX8A 1MBZA 4NC9A 4TPKA 3ZY6A 5IH7A 1E2UA 3CLUC 3DL0A 1OXKB 3CKYA 3BRSA 4HGOA 3G2NA 4I9NA 3R0JA 4AKTA 3F6YA 1BDIA 3ZDBA 2DBYA 4MV0A 3ZDRA 4N7RA 3QA9A 3BE6A 2BGLA 1WZIA 3V55A 4TGLA 5DB4A 1B73A 2R8RA 4G5XA 3PX7A 1NVKA 3BFVA 3D7LA 2EJWA 2B98A 3F3SA 1SC1A 4HQ0A 4RY8A 4H35A 2JHAA 1OH7A 2YMMA 5B5SA 5BO5A 2Z6AA 1LDYA 1FNCA 1K6EA 2W6ZA 2WSSD 3A2MA 3JYNA 2IHTA 3OIYA 4UHKA 3WGMA 5J47A 2PS1A 2RAVA 3AERB 4X3CA 3RVKA 5TDHA 4WCFA 2YZMA 4BWVA 1G66A 2EFGA 3CRRA 3YASA 1T36B 2CY0A 5FPPA 5JALA 5AESA 4U9UA 3OPVA 3E23A 3QGMA 4KXFB 3JQCA 2QXTA 3FHTA 4F5EA 4XDZA 2NZVG 1CQJA 3I0MA 3MRSA 5C1PA 1ANKA 1Q92A 4I14A 3AL3A 3NALA 3EB9A 1QOPB 4UMVA 2ATVA 1W4AA 3O31A 3IVGA 1CR2A 1RXSA 4FDUA 1XZEA 4FCCA 3QNUA 1CEYA 4MB0A 4KP7A 2F9LA 5T7BA 1SVMA 1CY0A 1V1MB 2QSZA 2XJ4A 3AEKB 1QG0A 1I2CA 2MSWA 3IILA 4YALA 4B8YA 2Q4DA 3WBBA 3KUUA 1G8FA 5K51A 3ILSA 2ZE6A 4G5GA 3RVJA 4RK6A 1XZAA 4MYRA 3LO8A 4OQDA 2IYZA 1G20B 5HBGA 3NTQA 4B0PA 1TM2A 3QEBZ 1Y5IA 3HKDA 1B7GO 3LT4A 4S1WA 1ADYA 4HAOA 5FUXA 3KKEA 3RC3A 1T2AA 2EW8A 1T9HA 5KSOA 1JLMA 2FOXA 3LKVA 4U6SA 3C8MA 3BXXA 1Y1KE 3M5WA 2BJWA 4MKXA 1L1QA 1K3FA 1ODLA 1CCWA 2ZW9A 5FO1A 2DUUA 4KQ6A 4TTIA 1OWNA 2PZMA 2QM0A 3CVJA 2JGAA 5E6SB 3OQ6A 2NYVA 1G8MA 2YYYA 2ZWOA 4JXJA 4ZIRA 2VQEB 3WG9A 3EPHA 3HVIA 2BHSA 3RH0A 1U8TA 3OAAA 3A6HA 4ODIA 1EX1A 2H92A 1AK9A 1WRBA 4BTEA 4KX3A 1AKWA 1TCAA 3AUAA 1ZD9A 3MHPA 2XYRA 4IUDS 4HYTA 3GPCA 3Q2IA 2JZOA 4BO6A 3O82A 3EASA 4IP0A 3RF7A 1U6JA 1SKYB 3DBHB 4YMSA 4FM9A 4XIIA 2H3HA 2H2AA 3B3GA 4FXOA 4HI0E 5SY9A 4K9KA 1YA6A 1ODFA 3COPA 5B7PA 3NP7A 5ITWA 1VBNA 2PCLA 1YI1A 2XE8A 3I39X 1BQ4A 2Q8PA 4MGHA 4D80A 5ADVA 1JDPA 1MABB 4E5KA 1G98A 3ORHA 1QU2A 4P80A 2QMUA 3VNRA 4LQ4A 4E5PA 2DR3A 5GOTA 3RU9A 1E0SA 2G09A 3V8RA 3LKZA 4OGLA 5DBEX 1L4KA 5EJ9A 2HFKA 2AZMA 3RVOA 3NJ4A 4PCVA 1E2IA 2IYRA 3MRXA 1QG4A 1R4ZA 4CDRA 4F8EA 4LYGA 1Z06A 3JSXA 3VOTA 1VYTA 1YRLA 1NLZA 3KQQA 3I72A 3G0HA 4DR6B 1TX4B 2DHRA 3ZY3A 1OIXA 3K0EA 4MW2A 4ZODA 3ZGYA 3IKTA 1QPZA 3DVRX 3ZXIA 1QE5A 1XZHA 4UVDA 1XTBA 1CQIA 2HRZA 2AZXA 1LF5A 3U7EB 1L2TA 3ZX4A 4JP8A 3KQYA 1FTYA 1K2WA 1KI7A 2ZR7A 2B92A 3Q6MA 4YECA 4N3NA 1U0TA 3HUUA 1WNTA 1EP3B 4E5UA 4N40A 4AJ1A 1H2XA 4DY4A 3FIUA 5CW1A 3LH5A 3VTZA 4URWR 1Z83A 3AEQB 1IQPA 3KEMA 2GK3A 5CT5A 3A1SA 2PUHA 3LX5A 4G0MA 3H9BA 1AZWA 5FWYB 2Z1MA 4D8YA 4PYIA 5AVWA 4BX3A 2W6PA 2WJ3A 3ZWVA 3ASVA 4MWZA 4IIXA 3ZDQA 1D2CA 1U3FA 4C5AA 2V7GA 3RHFA 1GUDA 3BZUA 3FR7A 2X42A 4JJ6A 1X0XA 4P2GA 5L40A 3PPVA 4TLCA 2PUTA 1T6YA 5IEBA 2EX4A 3JYHA 5CFNA 5BN3A 3LA8A 3HCCA 2R1VA 5B7NA 3RT9A 1ECJA 4IDEA 1XXHB 3FOEC 4ENTA 4EX7A 3P0RA 5FPKA 1KDTA 1SVLA 3HA7A 3IHWA 1I3OA 2Q0QA 3LX4A 1P3JA 4RZUA 1C1XA 1F14A 4UNNA 3A9RA 2HU2A 3TJZA 2CV1A 1EXNA 1NI3A 5AM1A 1ZZEA 2YDXA 3NX4A 1HEIA 5H4GA 1L5HB 3NBAA 3NOQA 1IOLA 1GZDA 1KDRA 2IYQA 3EIXA 3HWWA 1EUDA 3PKZA 3NFRA 2ID4A 3F6BX 5LB4A 4URVR 1MVNA 2IYXA 5AW7A 2CYAA 2XQIA 3S7ZA 3OCWA 4PXSA 5TS2A 5ESXA 3ZI4A 4CFZA 1IZZA 1NF9A 5F3WB 3NEYA 2W6NA 4MVJM 4QEKA 4Y6QA 2FRDC 1M0WA 2XUIA 1ITZA 1WABA 1QFSA 1ZBQA 5MGNA 4GKKB 2VNHA 2A5GA 4NLLA 5F1PA 3K9FC 2BP7A 3QOFA 5A0FA 1NRWA 4ZYLA 2I0FA 2NTVA 2ZRQA 3S29A 5A71A 5LYJF 3EF3A 4I5DA 4OM8A 4FOPA 3FYUB 4MVJI 3RS3A 3LXRA 1GU7A 4GP9A 3EPRA 4JZKA 4B82A 3COWA 4AJLA 1HURA 3JYLA 1S5PA 3TOXA 1RNLA 4G81A 5K0ZA 4YO8A 3EVGA 3GJ4A 2ZRGA 3DC7A 3MCAA 5JJKA 2JKVA 4QLBA 1DBRA 1SBCA 1FLNA 4M8SA 4R8RA 3I1FA 3CONA 4NYJR 4PM4A 5EXDA 1GUFA 2G5GX 5EJAA 2YWBA 3PFGA 1JKXA 1ZNQO 2W6JD 1P44A 2WLSA 1UC4B 5DLPA 5I4KA 2FPXA 3OOHA 3RUIA 2P90A 4PZAA 4RJKA 4HWKA 4B3CA 3I6BA 1AQIA 1P1KA 1V1RB 2VJYA 2WIGA 3KOYA 3OJXA 1RLMA 1Z15A 2BV3A 3OCJA 4JFAA 4OXXA 2OGUA 3M49A 4P5PA 1OLSA 4OBBA 2QENA 5E4YA 5EEHA 4DWVA 2LKCA 2CNKA 3NIGB 4C20A 1OYOA 4K05A 3WK8A 1E5LA 2HO4A 4X3PA 3V8QA 2E18A 1GGNA 1XB2A 1XK6A 3BRWA 1D7OA 3L0SA 2NUTA 1LH0A 1DJLA 1Z6GA 1MKYA 1E1KA 4NPCA 1FQJA 2QP9X 5AKEA 1I33A 5ENVA 4I50F 5COBA 2AN1A 3FX2A 5KMGA 3A1EA 3WWOA 4LF6B 5IAKA 1ZEMA 1T24A 2VAWA 2VHYA 2JDID 4BUZA 1N33B 1WR8A 1XHLA 3I4FA 1I01A 2R8ZA 4Z7OB 2CFIA 1OFGA 1ZWKA 2JGIA 3MT0A 4JT2A 1KERA 1G3UA 2HV9A 3K9LA 4FYXA 1V8PA 2QLBA 1DU4A 6PFKA 1RBQA 1K7CA 1RLOA 3EA0A 3L7YA 1PYOA 3R7SA 2XKBA 5JS7A 4M86A 1LLCA 3A9VA 4BC1A 5LKRA 2OB2A 3JCZA 2ONYA 3CQ9A 3MN1A 1ACLA 1C8KA 1H94A 1KKMA 3OD5A 3U7QB 4CIXA 2OK7A 4ZOCA 5DIFA 3FNQA 2ZJ2A 5HR5A 4RVNA 1BA3A 4JT8A 4QBKA 3TIGA 3TSAA 4AULA 3QVVA 1Z47A 2W2PA 4RFLA 1M34A 5JSZB 4BQNA 3UT5A 4YCLA 4JP3A 4E51A 1EZ4A 3RVMA 1BE8A 2J45A 4HTFB 3EBPA 5F52A 3DCYA 2Q3EA 3GLHB 4O4HB 4BZPA 4F60A 4YHHB 5CUQA 4C6TA 1HF3A 2AFHE 3OF5A 4R8SA 5DBGA 5MFPA 4LFBB 2W2MA 3NHSA 2VEDA 4KNVA 1DBSA 2WD7B 3R4CA 4LJ5A 1AGYA 1E0DA 5CNJA 3LHSA 5IARA 5EEGA 3RHSA 2JG3A 1QVZA 4NPAA 3JYOA 2IRWA 3WL3A 2EFDB 1M9NA 3DVQX 3HO8A 3OSUA 1FZTA 5LJLA 2NU7A 1U7PA 1DAIA 2OO7A 3C6XA 1MAVA 2W11A 2PGIA 5KHLB 2FDRA 3WXMA 1JEQA 2Q46A 2OO3A 1H2HA 3OIDA 3IPLA 1U2GC 4BMCA 1II8A 4Y67A 5HNKA 1KEPA 3OLYA 3Q98A 3DP7A 2DX7A 3K0FA 1VP3A 1HE8B 2C00A 3UCFA 1K66A 4JYMA 3WWPA 1UP6A 2G07A 1KWKA 3K8ZA 1YI8A 3LQYA 3MYRA 3WK5A 4BPBA 2CEKA 2PQMA 3KT3A 4CKXA 5BURA 3L0IB 2A5JA <