4M1TA

Crystal structure of small molecule vinylsulfonamide 14 covalently bound to k-ras g12c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
163
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1tA00
2W6IA 3LBNA 3LBIA 4PZZA 1TF7A 2IYTA 5FOWA 2NO1A 1X86B 2ZSEA 3I73A 4L8GA 4QHYA 2Q3FA 3GFTA 3AV0B 2IXFA 1OKKD 4HLUC 1E0KA 1ZMXA 4B3CA 2ZYVX 3OE7A 4NZYA 2EFDB 4HLDA 1AM4D 4EPTA 5LDDC 2C78A 4QNRA 2PX3A 3VKWA 4PANA 2XB2A 5TVKA 1VYUA 1V43A 3E5HA 1HA3A 4M1SA 2LKCA 2ZYUX 4C2UA 8OHMA 3OFND 1KI3A 4YMTA 1NF3A 3F8TA 4IFEA 3THWB 1JR3E 2AL7A 2WIBA 3M1IA 1EFRA 2QE7A 2AKAB 2F55A 1GSIA 5HKKA 3DOFA 4DVGA 5LBIA 4U7DA 3U4QB 2P0EA 3NHAA 3PG5A 3W3AA 3QF4B 3AVTA 1JALA 3KKPA 3KUDA 1DEKA 4V0LA 2ZPTX 2WBLC 3LQQA 4D4LA 4OHWA 1Z6YA 1DO2A 2CNWD 3W90A 2GEUA 3CF2A 3U44A 1NVXQ 4M9QA 3AQ4A 1CU1A 2ZR0A 4A15A 4YDSA 2J0SA 2YOGA 1AS2A 4IVQA 2VYFA 2WAYA 1UBCA 2BMDA 4PO8A 2X2FA 1JEDA 3R8CA 3KQHA 1SVIA 3W6NA 2BDTA 2CHVA 4M9XA 2BCJQ 2ZE7A 2EVWX 4IHQA 3BIFA 3EW9A 4BFUA 2GILA 2ANBA 2V4ZA 4ZV4A 4BWYA 2REBA 5FOTA 4DSUA 1Q12A 4Q7JB 1NMXA 2BEKA 3CRMA 4A8JB 3AVYA 3IIMA 3BORA 2OSBA 3B5JA 3C15C 1J8YF 4M2LA 5G40A 5CM8B 4C0LA 4AYXA 1QBKC 3PV0A 3SBEA 1DELA 221PA 2FEOA 2NZ8A 4V02A 2FPKA 5DO9A 3FMOB 4G5GA 5TV2A 1NBMA 2FPMA 1IN4A 4JMPA 1B0UA 2EFHB 2IYLD 1Q1EA 3CX8A 2V6IA 4BGDA 3GLIE 1S9DA 1XMSA 2F6RA 1S3SA 4MRNA 4HATA 1Z2AA 2GZHA 4PQFA 2FEMA 2OCYC 3DO6A 2QENA 3RRYA 1OJLA 1KO5A 5FUVA 4KLZA 3TGPA 4DRZA 1KKMA 2C5LA 2IYXA 4JKYA 5DE3A 3O8DA 5KSOA 2QM7A 1KO8A 1S96A 1QHXA 3I72A 3FHOA 2A5FA 1II8B 1HE8B 1ZINA 4BFSA 1NN1A 2PEZA 1G3UA 2H16A 1VKJA 3B6EA 4OJQA 3T61A 5E4FA 4AYWA 2CBZA 1R6BX 4HLCA 3LH5A 4D26A 4V0NA 3N70A 2ZRJA 2O8BA 1FTSA 2Z0MA 2FV8A 5IHPA 3IEUA 5A4JA 1E2FA 5HZHA 2GKSA 1W4CA 2IX3A 2RGAA 1ZD1A 1ZNXA 2GEDA 1DAKA 1AQYA 4GSYA 4PC7A 4Q9LA 5J40A 3U7EB 3AF2A 4IRUB 4TN1A 4C0BA 2J0VA 4UKDA 1GVNB 5DSZA 3KUCA 1U98A 4LBVA 1P2UA 2CVFA 4Q21A 1N5JA 4ZCIA 3AP2A 1Z3IX 4ZDJA 4NE2A 4V0MA 1PVOA 4AIIA 2GCOA 3MSXA 2PLFA 1U8AA 3AKDA 4BLOA 3KKOA 3EIEA 4EFNA 1AQUA 1P72A 1N0VC 3FFBA 1KSJA 3GLHB 4AG5A 2DYKA 2ZU6A 2A9KA 2F9MA 5FUYA 1IN8A 1BO6A 4XWOA 1UAAA 4JVSB 3K8YA 2V7QA 4Q4AB 4II7A 5FI1B 4MGKR 1G8GA 4IDHA 4YONB 4ZDIA 4DLSA 2FZLA 2F3TA 5FFMA 1GZSA 5JI2E 3M6AA 1J70A 4LHZA 4ZCMA 2L0XA 3NXSA 3E1SA 4JLPA 4FN5A 2VP2A 3K70B 1IM2A 1T3LA 1R5OA 1NLZA 1PLJA 3K09C 1N25A 3RS5A 1OIXA 4YMWA 5J4YA 1FQKA 1E69A 1Q1BA 1XMVA 4IDOA 1UFQA 4DB2A 5B2ZA 1KMQA 4KBFA 2H5EA 3VTKA 2D06A 3REFA 1FUUA 1ZD8A 2IBMA 1ZYUA 3DZ8A 2XSZA 4Q1DA 4OQFA 2IA5A 2WJGA 1GRNA 4JLOA 2QTFA 3NDPA 2FNAA 4R2IA 4JLDA 2XGJA 4LHXA 1W36C 3AVXA 2O8BB 2GNOA 1AA9A 5LD2B 4GPTA 1RKBA 2D74A 1MABB 4TL7A 4R71A 2D62A 2W83A 4L9SA 4DCUA 2G1KA 1CBUA 4Q9KA 2O8DA 2FPLA 3CH4B 4OJKA 1NJFA 1OPXA 3MWLA 3FMFA 3A4MA 3B1XA 5KTYA 3RAPR 1C4OA 2R65A 2GCOB 3CPEA 4PSVA 4GRAA 4F38A 3EX7C 4QJ4A 4B44A 4B6EA 1TEVA 1GIAA 3RS4A 3GEIA 5JWOA 3E70C 3FVQA 4AY2A 1Q3TA 4M53A 3FKSD 1E9FA 4R7ZA 4KFTA 4WZ6A 1G16A 1DO0A 4ERNA 3GEEA 3PIRA 3EPHA 2J5XA 5H1YA 2JLQA 1G8FA 2GWHA 2FMXA 2WKRA 4MKFA 2CK3D 3BK7A 4HAXA 2QN6A 2OT3B 4M21A 4PTLA 2OBNA 3R9IA 2ZITA 3NBXX 721PA 1WBBA 1GRQA 2D4HA 2D7DA 2V9PA 1A82A 4PZYA 3B85A 1N6OA 4IVPA 3W34A 4G5OA 4DLXA 1E2PA 2QP4A 1K5GA 1CJVC 1S4QA 1KO7A 4KFSA 2E9SA 2ZJZA 3ADBA 2QQ0A 1ZM4A 5BYJA 2AR7A 5JCZA 2HT6A 2VH5R 1J99A 4XVRA 1M8PA 4LHYA 2REXB 2MSCB 4UNRA 1A2KC 1XBTA 1YR9A 4FXPA 2GZDA 1QZXA 3RYTC 4KVAA 4IDQA 3EARA 4DB4A 2OAP1 3C41J 1GRRA 2V8OA 2ZE6A 3CH5A 1WA5A 5EE5B 4A0HA 3PCRB 3U3KA 1KY2A 3EG5A 1IY0A 2LKDA 4QC2A 4A6PA 2O8DB 4ASUD 3H84A 4M1OA 1P9NA 2QGNA 3LW7A 3AVWA 1NSFA 1N6HA 5JFGA 3A1TA 5AJYA 1N6LA 1U81A 4NYMQ 4PZLA 5FBLB 4DSOA 1P61B 4IDNA 5JS7A 1FW6A 3H2YA 1G8YA 1E3MA 4NTZA 2DPXA 2XEXA 3UIEA 2O8EA 2BKUA 1VTKA 2HLDD 5HPYB 3CPJB 1HTWA 4BPBA 5E7JA 3UG7A 4MKIA 2VSOA 2Z5FA 1JR6A 3QXXA 2YC2C 3NHBA 4LJ4A 1II0A 4LV8B 1W4BA 1Z22A 4I1OA 3KB2A 3ZH9B 2XB4A 1XF9A 5BQ5A 4PXAA 3VR2A 4OQMA 2GJSA 3ICEA 4LBWA 1R0YA 4XTRA 1G21E 2HEIA 2J0QA 1IAQA 1PUJA 1XD2B 3AP1A 4PSAA 3GLFE 1JAHA 2OZEA 3L2OB 4Q4HA 2VTKA 3BWDD 2DWPA 3A36A 3P1JA 1T8TA 2PMKA 3V4FA 3HPRA 2CL6X 4C4PA 4HDOB 2KE5A 4AWXA 2QMEA 4Q9HA 4PC3A 1P2VA 2XTMA 2NGRA 2XZOA 1TQDA 4ZDWA 1OFUX 4KCGA 2FE4A 3GD7A 1Q21A 2JLSA 2ZAOA 3FGNA 5EQTA 3SFZA 1AKYA 2A3RA 4E5UA 2BV3A 4Z8XA 4LSGA 3TJZA 4KHZA 4HAVA 2YKGA 3DZDA 2H7VA 4GFDA 1VIAA 3A4LA 4JLVA 2YYZA 4PC6A 4W5WA 4F93B 3EIQA 5FBQB 2GTPA 1SULA 3QY0A 1XD8A 2F3RA 1VG8A 2BKEA 2WKPA 2NG1A 4UXIA 1HUQA 3PQCA 3A8TA 4NL4H 1G18A 4LYHA 4F91B 1Z83A 2BM0A 3RC8A 3GJ4A 4LWZA 2OEPA 5SZKB 4QXAA 2F43A 3DMNA 1TADA 2D2EA 2V54A 1AS3A 1AZSC 5FOUA 2EFGA 1IN6A 2DFTA 4EPVA 2G1JA 1UKYA 1Z47A 1JECA 2J41A 4RCZA 1T5LA 1Z06A 2ORIA 3A58B 2BMEA 2WTUA 3K0CC 4HLUA 2RGXA 4HDQB 1SVOA 1M6NA 1XEWY 1H8EA 1XTJA 3SFVA 3IQWA 4F4IA 2ERYA 2O8CB 2NO9A 1P73A 5B30A 3HR7A 4J0QA 2A5JA 4JT4A 2C9YA 1BYUA 2ZXUA 1U90A 1M1YE 1G20E 1QHHA 3I62A 1TQ2A 2DBYA 2BVNA 3R8FA 2GDJA 1IOZA 2QGZA 1WRBA 621PA 2IF0A 2QMHA 4MRPA 2ZEJA 1E2EA 3UPUA 4UXHA 2W00A 1E1RD 1EFHA 3SJZA 4X8OA 1E9CA 3CIOA 1P4SA 3GLGE 1N6RA 4TL6A 3D8BA 3EXAA 1ZBDA 2QM8A 1JAIA 3LA6A 3FMIA 3AF4A 4LCBA 4NYMR 3VX3A 1KYIA 1Q1ZA 5EE1A 3BAFA 1YZLA 2J45A 2PX0A 3K9NA 1U8YA 4WOPA 2ZYTX 2V1XA 1KDPA 4RKEA 2EW1A 3DPUA 2C04A 4WVFA 1T4GA 2LCFA 4TQUS 2O8FA 1IJEA 2BWJA 2F43B 1KZ7B 1VG9B 5EUQB 1XTKA 1IXRC 3CM0A 3VU9B 4TYQA 1WQ1R 1NN3A 4CEHB 1L4UA 2NOAA 2B6HA 2JDIA 2WHXA 2X1VA 4BRWA 2A30A 3ZS9A 4CRWB 2J3EA 1NMZA 1T6NA 4LJ5A 3BB1A 1GNQA 1Z5ZA 3N2EA 4X8MA 2CHQA 2QT1A 1Z07A 3FTQA 1IONA 2CLSA 2TMKA 4CDGA 4EDHA 4UNPA 4D82A 4GT1A 4XTCS 3B8HA 1PLLA 3AUYA 2CCGA 2J7PA 3MUFA 3JVUA 5KSZA 2AWOA 1JI0A 3AVPA 1OW3B 3U3JA 4YMVA 3PJRA 4Q1AA 1Y63A 1CJMA 1XXHA 4FCTA 4RD2A 1KY3A 2PLRA 4LZZA 2CE7A 2JIZA 1E2QA 2D3WA 2QUZA 2VP4A 2GEVA 1GKIA 1U99A 1F5NA 3O47A 3BFKA 2ECKA 1TQ6A 2RGNA 1N5LA 2OBLA 4KVGA 5JS8A 5K8UA 4LJ6A 1E2LA 2Q3MA 2DCUA 5K8IA 3GPLA 1LNZA 1QVAA 3I5XA 1W0JA 4M22A 1IJFA 3BFVA 3ND8A 1CXZA 4D2IA 1I2DA 1EG7A 1G1MA 4PO1A 4MYHA 3QPVA 3VR1A 2ZR7A 4Q5IA 4XD7A 3L0SA 2QAJA 5EE3A 3RDPA 5FTNA 2O8FB 2WM9B 1SVLA 2WPDD 4ZI2A 4P31A 2XNDA 2UZ3A 2IUUA 1HT2E 2DWQA 1NIPA 1W0KD 2QPOA 2ZSBA 3D6TB 1IN7A 3EAQA 3IUYA 3TMKA 2MSEB 2OFWA 3RS2A 4CEJA 4OHYA 1YU9A 1Q22A 2X8AA 4QM6A 1VPLA 1VMAA 2FGJA 2FG5A 4HYYA 4IOMA 2R6CA 2B8WA 1CTQA 4CT4B 3AKYA 2P3SA 4E22A 2REOA 4TLCA 4EPWA 3EA0A 2VLIA 3SS8A 2RGCA 2WWXA 4Q7LA 4GP7A 3UMRA 2EYUA 1UBFA 4UNQA 3TNFA 5K8LA 4NCIA 1XXHB 2XX3A 4LC0A 3N2IA 1KTVA 2FSFA 4LI0A 1R8SA 2GK6A 2ONKA 2Y8EA 3DEFA 4HI0E 4RZ3A 4B2LA 1VDZA 4E03A 1RPZA 5JZVA 4DUGD 4XSHA 3HP1A 4LGMA 2HXYA 3CLVA 4KSBA 4AKHA 4LHVA 3THXA 1E1QD 2VEDA 1W4AA 4E07A 2V6JA 2IS2A 1OH6A 2GXUA 1KI6A 4QNMA 1E79A 5L3QA 3LX8A 1JPNA 3IEVA 1FL9A 2ZS7A 1MRNA 3GFOA 4URWR 2D2FA 3K9LA 4URZR 4N3NA 2C9CA 1Z6XA 4HUQA 4B33A 2B7BA 1ZU5A 4Q00A 4D0LB 2GESA 4JBXA 2VPPA 1AJEA 3EA5A 1SQ5A 4TMXA 2KBFA 1EXMA 4QHTA 4G01B 1XEXB 1D9XA 2ZRGA 1VIYA 1ZUIA 2B92A 2YC4C 4CEJB 1ZJ6A 2KSQA 4PX9A 4QGAA 4S35A 2ZI7A 1DAGA 4B73A 821PA 1W44A 2W6JA 2JJ1A 3I5YA 1U0JA 5EP3A 4TQAA 1W36D 4B2PA 2PZFA 2C8VA 4M1KA 2IUTA 4Z54A 1GOTA 3WRYC 4GNKA 4W7SA 3KJEA 1IXZA 1RW4A 3K9HA 3AF1A 3KKNA 3MJRA 4C0AC 4DEYA 3H4MA 4XVUA 2A5GA 3QF4A 1XPUA 3KJHA 4IXNA 2GXAA 2WWYA 5IK2D 5F98A 2I3BA 2OFOA 3I1FA 4HAZA 1OB5A 1D9ZA 3BGWA 1M7BA 4MKHA 4A2PA 1MV5A 5FTJA 4WXRA 1G17A 3ZD7A 1A7JA 1YHNA 2R8RA 2GK7A 6Q21A 5FTLA 3TR0A 4HSEA 2FSGA 3RS3A 2N1BA 4URYR 1OH7A 4C2TA 3ZJYA 2MMCA 2ZI3A 1XFAA 1KI6B 4Q1FA 3QIAA 5L3QB 4YXWD 4OI2A 2OHFA 2WOJA 4WIAA 3IIJA 1Z0KA 1T3HA 4A8JA 3QPUA 2X19A 4IFBA 3AB3A 4HUQB 3GMTA 1UDXA 4M0LA 3W9YA 1NLFA 4AKIA 1UBEA 1E94E 4BZQA 3NKVA 1FNNA 2ZRCA 4GOKA 4OHZA 3RRZA 4BUJA 5D3QA 1NVVQ 2ATVA 1J2JA 5G3YA 4A0RA 5J4HA 3DKVA 3OAAD 1ZNYA 1P6XA 5KDLA 4E09A 1XZQA 4ZDKA 4LJ7A 4JYBA 2BBTA 3ECCA 4P0TA 4ACBA 1SKYB 1L8QA 5CLQA 1IHUA 5EP4A 1T0JB 2HCBA 1SXJD 2A7QA 1JQLB 1OXVA 1T9HA 3D7MA 2XOKD 4NCNA 4PHTA 3SI7A 4EIWA 1II8A 2Q9AA 3AVOA 4BZPA 3X1WA 1G41A 2BEJA 1NN5A 3DM9B 4ZIRB 4TQ9A 4ZKDA 1U94A 4TWZA 1KI4A 1P3JA 4CGZA 1HEIA 4LYAA 2P6RA 1E9AA 4PFSA 3KX2A 1NP6A 3RSLA 3A6PC 4Y0AA 4Q9IA 1QHGA 1YJ5A 2ZSDA 1XTIA 5HTKA 1CRQA 1G8PA 3EASA 3ND9A 4RFSA 2ODNA 4OI0A 3QF7A 1IBRA 1M7GA 2EU8A 2JJ2A 4U02A 2OLKA 4AC9A 1J90A 3OHMA 1NBME 2ONJA 3T15A 5H8WA 4OBEA 3WY9A 2AWNA 4QHSA 5G41A 2ASEA 3SJCA 4EJSA 3ZLJA 1E2KA 4NH0A 4AKGA 1G291 2G6BA 3Q5EA 2FFQA 2QA5A 1U9IA 4M1YA 4FINA 5C2JB 1MH1A 3DDCA 2RAPA 2VRWA 1ZIOA 3GLHA 4HAYA 5FPHA 3ZZTA 1N0WA 5C4MA 5FH9A 2W58A 3W5JA 121PA 3GJ0A 4BECA 3U6KA 4Q4AA 1H65A 2EQBA 3KXKA 3U2QA 5IRCD 4LDJA 2IS6A 1FUKA 1Z0AA 4OK6A 4Q9JA 4AKEA 2RGEA 4BEJA 3N5CA 5JJIA 2K5UA 3ZYCA 4PPFA 2J46A 1OYYA 3CB4A 1OLOA 3OIWA 3PITA 1W5SA 4RCYA 3U3OA 5KDDA 2DB3A 2D7CA 3TKLA 2WSMA 3BBPA 3KJGA 1FP6A 1Z0JA 5DHFA 3QPWA 3KFXA 4KBGA 1P9WA 4WZBE 4PSKA 3X1ZA 4TYYA 2IYUA 2ODBA 3NBYC 3F3YA 1KI1A 3WMFA 4LY6A 5JWHA 2XZPA 5CK5A 3MCAA 4V0ME 1MO4A 1JR3D 4Q4JB 2QTHA 1CLUA 2I4IA 1PZNA 1MABA 3SC3A 2CCKA 2W0SA 1G8HA 3A4NA 3CX7A 4RFSB 4FMDB 4TMVA 3WNBA 3EWSA 4AD8A 2GJ9A 2YWHA 3PUZA 4LV5B 4BASA 4HUTA 4XWKA 4TTQA 4TYWA 1XB2A 2ZE5A 1YZGA 4JLKA 2ZETA 1L4YA 4EJSB 1I4DD 2AXPA 3SEAA 2G88A 2OO7A 3IPXA 2W2VA 4DLYA 3OIYA 4Q1EA 4B3FX 1II9A 2E1RA 3GJXC 4A0GA 2W2TA 5JHHB 3LV8A 2CHGA 3L43A 1JJ7A 1G6OA 2QSZA 3D31A 4AG6A 1NBMD 3EC2A 1NVVR 5CB6A 3SHFA 2A5YB 3E2IA 3TSOA 2AX4A 3OF5A 4YC7A 1U8ZA 3GJ5A 1SZPA 1FQJA 1XCGB 1O3YA 3VQTA 1HV8A 1LS6A 2YWGA 3MRSA 3AH8A 421PA 2OAQ1 2QNRA 4TSFD 3UANA 1ONBA 3A1WA 3S1AB 1TPZA 2P6UA 4BLTA 3FE2A 4V03A 1IN5A 5EXPA 1GITA 4MGIR 4DCVA 5GJWC 5HCNA 4A2QA 1V5WA 3VR3A 4KSCA 3FKSA 3ASZA 1GKUB 1KK2A 3CR8A 4KV9A 5DGXA 2LWIA 2C77A 5AWFC 5J47A 4TMKA 3Q8XB 4RZUA 1E99A 3LVQE 3GJ6A 3QVUA 5KO2A 3EZ6A 4CVNA 1LY1A 2BIFA 3EZ9A 2CL7X 3RANA 2NIPA 3K53A 4A92A 1IQPA 2R9VA 1Q1QA 2I1VB 4PO9A 4CT5A 3Q3JB 4BLQA 4JYCA 2Q6TA 5A0FA 2WWIA 3W3ZB 3KQKA 1LV7A 3GLIB 3SYLA 5TARA 5AUPB 3BE4A 3PUYA 5BXQC 1X3SA 3UMFA 4FMDF 4LPKA 1Q20A 5J4KA 3WMEA 1D2MA 4NHOA 1KK1A 4NU0A 2RGGA 5KHOC 3EPKA 1X1RA 3GJ8A 5FUXA 3NC1C 4EFMA 1XJQA 2C95A 1GDDA 3ZZ0A 3CX6A 2FA9A 1ZAKA 2V7QD 4US1R 4HZUA 4G1UC 1K6MA 3QUSA 4MYTA 3T06B 4QJ5A 2NO0A 3BH6A 1ZUHA 4MDEA 3HR8A 5CM9C 3ICQB 4GL2A 3CNNA 5AJVB 2ZRLA 1D2EA 1KJYA 1XJCA 1YQTA 2XJ9A 4MH0R 5HR5A 5ANRB 1G7SA 1R4AA 3T1QA 1XMIA 1XD2A 4A4DA 3CNOA 3I8XA 3K0FB 5M04A 5FOSA 2GXSA 3IGFA 5EZ5A 1KO1A 5AJXA 4NCHA 1KKLA 1XTSA 2GF9A 1CEEA 4ITRC 1F2UA 4Q01A 3LDAA 1AK2A 2XSZD 3IDQA 4UJ3A 5KSPA 1P75A 4TZ6A 4C0KA 2FF7A 1OYWA 1LB1B 2MMGA 1E2HA 1HYQA 1SXJC 2GBLC 2HJVA 4OHXA 3KDSE 1OXXK 1ELOA 1KI8A 3GCGA 3FWYA 1GP2A 3F0TA 3QEOA 3NDBB 2VHQA 1EK0A 1QF9A 1M2OB 3CUEF 2Z43A 5FBWB 3VMFA 4IOLA 5DYIA 5JRJA 3RABA 1TF2A 3SDZA 4POAA 4FW9A 4H1UA 2ZE8A 4HEJA 1FMJA 4L5BA 2QRNA 3VNVA 1VCNA 4JJKA 3THYA 2ORVA 3T5DA 5FR1A 4C0HA 3FHTA 3FHCB 5EXSA 2QRZA 4C3ZA 4PC2A 2RB4A 3K0SA 4HB3A 4MA4A 4DIEA 4JBWA 4HZUB 3QE0A 4JLJA 4U5XA 2EFCB 4MGZR 4D25A 4CYMA 1VHLA 521PA 2ZUCA 2PCLA 2QAGC 3EZ2A 4Q03A 1E2DA 2FGKA 2BC9A 4A9AA 1NG1A 3LX5A 4OQXA 1JB1A 3I32A 3OIUA 4JVMA 2C99A 3EPJA 3CF0A 1YVDA 3BS4A 4UXJA 1KSGA 2O8CA 2WJVA 3KXLA 1D6JA 2AD5A 1KOFA 5AK0A 4DLWA 2OLJA 4L4UA 1NIJA 4RZ2A 2GJAA 2ZAMA 1DAHA 5TXGA 1VG1A 2CCJA 1DTSA 1NY5A 1RE0A 1RIFA 1F2UB 1MKYA 1RRFA 4DDUA 3WRXC 3M4YA 3QEJA 4Q4LA 3V00A 1IXSB 3TAHA 1UKZA 4LJAA 1ZIPA 3A1VA 3EZFA 1PUIA 1ZM9A 3ADKA 1E9EA 1FTNA 5FL7D 1GTVA 1S1CA 5LB2A 4QGHA 3I3SR 4QGGA 3WNDA 5GVSA 1CP2A 3QKSA 4LOAA 4TMWA 2WSSA 2GRJA 5FL3A 4A82A 2R44A 2ZVPX 3CW2A 1I2MA 3UWOA 4EPXA 1G7RA 3DHWC 1BMFD 2O0JA 5EUMA 2JLWA 1EGAA 1UPTA 4LV6A 3CR7A 2OCAA 5BN3A 3GJ3A 5CDFA 3THYB 1F2TA 4DCTA 1UF9A 3EPLA 2XZLA 5GADl 5EE9A 2NTYC 4TLBA 2HJGA 4TT3D 1SKQA 2RH5A 1A4RA 3VU9A 3ZIAD 2VSXA 1EFCA 3QXSA 4B3XA 3ZVMA 4CEHA 1KO4A 5FPTA 1R5BA 3H0KA 1R5NA 1F6BA 3WYFA 2IEYA 5E7IA 2GF0A 1MR3F 4ZI3A 4F92B 1GG2A 2Z4RA 4YDHB 1FOEB 1EFTA 2KB0A 1E0JA 1Z8FA 2PH1A 4A6XA 4PAOA 1E32A 2CL0X 3KB1A 3PUVA 4BFXA 1E2IA 2IYRA 4KITB 2BM1A 2WWGA 1KK0A 2EWWA 4G5SA 2G9NA 3K70C 3A1SA 3MWJA 1W5TA 3OEHD 1JQJC 3HWSA 1TAGA 3U7HB 2AXNA 2J87A 3K0EA 3KTAB 4L15A 4B2IA 1DG3A 3QOFA 3AKEA 2G83A 3VNUA 4JLAA 5BYKA 1Z2CA 3QBVA 2UZIR 3QSYA 2ZUBA 4IOKA 1YZQA 3MG9A 1L2TA 1QHYA 1NG9A 2H57A 3VKGA 3QKSB 3CRRA 2F7SA 3RWMB 1DARA 1P2TA 2JEOA 3NC0C 4FMCB 1CULC 3F5FA 3OIVA 1OFIA 3O8CA 4D4JA 5LD2C 3SYKA 3UKDA 5JSZB 1BOFA 4DKXA 4AURA 3P26A 1OV4A 1XTRA 1L7VC 4B3DA 1F2TB 1S2MA 3SQWA 2IC5A 2QZ4A 3GLFB 1W49A 4O2LA 3T12A 2FDCA 3SZRA 4YMUA 5EE0A 1BS1A 5CLLA 2Q9CA 2EYQA 2WKQA 2WWHA 5DH9A 4DDWA 1ZUNB 1TU4A 2WWFA 3HYRA 4A0FA 1SHKA 1E2JA 3CZQA 1ZW6A 3IO5A 1G4UR 2HV8A 4N1AA 1RZ3A 2VP5A 1ESMA 4LBZA 1XXHE 1EX7A 4MUAA 4HAWA 2GCNA 3UG6A 4XWAA 3L0IB 3AVUA 3CONA 2QU8A 3REGA 1R7RA 1NJGA 2CE2X 2JLRA 1DADA 4LUCA 4D4KA 5DN6D 5DIFA 5E7MA 1TL7C 4C0QC 1WXQA 4DCNA 3SNHA 3WNCA 1KJZA 1W2GA 1NSTA 1A1VA 2ZM5A 3HU1A 4FMBB 3QJYA 3RS7A 1A5TA 3AF0A 2UKDA 3C7KA 1FFHA 4QM7A 2ZRAA 2QQEA 4M9SA 4IKEA 1DAEA 1A2BA 1H8HA 4LX0A 3BD9A 1DVRA 2R6DA 2CJWA 1AZTA 1R0XA 4JSTA 3WXMA 2VHTA 2IYSA 2YINC 3U7FB 2VHUA 3ZQ6A 4MRSA 4US2R 1NY6A 4TTPA 3ZVNA 1UADA 2H18A 3QKRA 5C1BA 1K8RA 4MKGA 1XPOA 1VG0B 4GMXA 2H1LA 4KI0A 4FI3C 2FFHA 2F1JA 2ZRPA 1XWIA 4DUGA 5EXXA 2G3YA 2ZVQX 5HZKA 2H92A 3PUWA 1TUIA 1G5PA 3QQ5A 2R2AA 4WW0A 5BW8A 1XEXA 2BBWA 2ZJ5A 4OK3A 1E1QA 2ZI9A 4Z1MD 4US0R 4KYUA 1N6NA 2JDID 4PHFA 3B13B 3TVDA 1OHHD 2KWIA 5J5CA 2YV5A 3WYAA 3KKQA 3Q7QA 4QBHA 3TSZA 4DDTA 3GLGB 3KQLA 4Q66C 4FCVA 3NIBA 2CLCX 2WMOB 2QP3A 4DLRA 3SR0A 3U61B 3K09A 1TF5A 2GVDC 2XAUA 3EZ7A 3RLFA 2AKYA 1IY2A 3RC3A 2O0HA 2JLVA 1CF4A 2JAQA 2ZQ5A 4L9WA 3LD9A 3ZVRA 1DG1G 1DE0A 4CF7A 2XTNA 1UEIA 2P65A 1Z63A 4Q19A 2VQSA 2ZJ2A 2AD1A 3ETLA 2FFAA 4QKQA 4B75A 1QHSA 4HAUA 1CRPA 3B1YA 2BJWA 2CJWB 1R2QA 3MMPA 1SGWA 2A5DA 4JL6A 1W4RA 1FZQA 3MWKA 4QGFA 4B48A 1RVDA 4XJXA 1ETUA 3KKMA 3L8ZA 4M4SA 3L0PA 1E2NA 1M7HA 3B1ZA 1XCMA 1C9KA 2CVHA 2QI9C 3HU2A 3MFYA 3QKRB 5AUNB 1LTQA 5CIQA 3TW4A 1W48A 4RVCA 5IK2A 2JLYA 3OEED 4A1FA 3B1VA 3IIKA 4Q7MB 1GAJA 1ZM3A 2QROA 4LK2A 4M1MA 2PMDA 4PQYA 3LLUA 4NYJQ 2R6GA 4HZIA 4WA7A 3UXMA 1AN0A 1MO3A 2Z4SA 3CO5A 1US8A 4BEBA 4BE7B 3FMPB 3CWQA 4D80A 3I92A 2ZRFA 3LLMA 5AR1A 1X1SA 1XD9A 2ZRDA 2YWFA 1XPRA 4JSYA 2GJKA 3C5CA 4ILEA 1WBDA 2PT7A 2HF9A 1BIFA 2EFEB 2CLDX 2QL6A 4JLMA 1JXOA 3VAAA 4QBFA 2AK3A 1WDTA 2RCNA 4LJYA 4MRVA 3BRWD 4OK5A 4PHGA 2V55B 1AGRA 5KPJA 4BFTA 1P5ZB 2JA1A 4ZIRA 1OKKA 2ZR9A 3CZPA 3KL4A 3MAAC 4LYJA 5AUQA 1S0UA 3RHFA 1UBGA 1QHIA 1BYIA 3OAAA 2WJHA 1Z6TA 3QI2A 4XVQA 2PZGA 3X1XA 2DFLA 4OQLA 4D4MA 5CB8A 1DAFA 1RRPA 2DFKB 3T34A 4ABYA 2Z83A 5JECA 3OFNA 3A37A 3RS0A 1K5DA 1OSNA 4RD3A 1CR4A 1W36B 1SXJA 2KJQA 3NTUA 4BFYA 2FH5B 3VX4A 1X8KA 3WBJA 4ACAA 1NVWQ 2XOKA 4LJ9A 4BFZA 2ZRMA 3R9XA 4TYNA 1Q0UA 1RYHA 2IHYA 2YOHA 1XRJA 3VR6A 1E79D 5CYPA 1YZTA 1N6KA 4ESHA 5AJZA 1YZUA 2OXRA 1OT3A 1JBKA 2BMFA 1GFIA 2IYQA 2CNWA 1GL7A 2Q0HA 3HPQA 5KYKA 2VL7A 2XNSA 2ZSFA 2GVZC 4ARZA 3NVAA 2ZROA 2BBOA 2IWRA 4B74A 3RRMA 5IT5A 2I1QA 1DS6A 3W8NA 4FWTA 3T5GA 1WMSA 1VCIA 3AF3A 3VHLB 1US8B 1G3MA 2JLXA 4RD0A 3X1DA 1OF1A 3FPAA 1COWD 5F2EA 1MO5A 2KI5A 2WAXA 2IXGA 3CRQA 4ZKEA 5FBRB 2OG2A 2FSIA 1T0HB 3ZD6A 3VHXA 3PVSA 2R6FA 1YZNA 3B60A 4W5JA 3DKPA 2JJ1D 3PEYA 4Z51A 3JVVA 4QOSA 2QAGA 5L3SB 1Z6GA 4URUR 1CIPA 2J0UB 1XEWX 3C14C 3K0AA 5KNCA 1S8FA 1OIVA 5DLQC 4EPRA 2WJIA 4LJ8A 4RJLA 2GA8A 2QEQA 3FB4A 3QNUA 4G3XA 1OXUA 4NP6A 2VP9A 2W0MA 1LF5A 5DI3A 3PEWA 1PV4A 5SZIA 2WZQA 4JVLA 1CJTC 4Q4JA 4DBLC 4TLAA 2ODWA 4NPHA 4PPGA 2NMVA 1Z29A 4NCJA 1CR1A 1KJWA 2BCGY 3GLHE 3Q85A 4PPNA 4OYHA 3B82A 1SXJB 4F7WA 4QBIA 2B7CA 1ESNA 2WMNB 4P4UA 3TUIC 1CR2A 3TQCA 1NN0A 5JEDA 4QL3A 5F9HA 4AYTA 5FOVA 3WP0A 1WE2A 2OCBA 3CRVA 3AGQA 4R98A 1XDBA 4BRUA 2XTZA 4NYJR 3WMGA 2W6ID 4KXFB 1QHNA 1KZGB 1OFHA 1JR3A 1X8JA 2YNMA 5LB4A 4ARZB 4C0JA 1ANKA 2YOFA 5GJCA 2FSHA 2QY9A 3OE7D 1E2MA 1GUAA 2C2HA 2F9LA 2RGBA 1R10A 1N3BA 4O25A 1EESA 4RD6A 4DLZA 4XH9B 1GNRA 3FOZA 3S1AA 1E4YA 2PT5A 1AIPA 3BC1A 1S3GA 3K0CA 2QAGB 2ZRNA 2AFHE 3T1TA 1OIWA 4G5QA 1NKSA 1EFRD 1XCPA 2QE7D 2ZS9A 1YKSA 1GNPA 4P32A 1GL6A 3K0AB 5HKKD 3FDIA 2JATA 3UATA 4ZCLA 3R7WA 2H17A 1Q3HA 4Q1CA 5CIWA 1Z0FA 4YMSA 5L3VA 4RKFA 2V1UA 2OBMA 2VBCA 2ZANA 5DI3B 3SQXA 3AGPA 2R62A 3PR1A 1KGDA 3AP3A 3TLXA 2IT1A 4TZ0A 1ODFA 2YWEA 2SHKA 4TSFA 3G0HA 2OUKA 2PCJA 3UWKA 2J7KA 3CRW1 2C96A 2PJRA 2RMKA 4AI6A 2JJ2D 5DI9A 2Q9BA 3ZS8A 4BZXA 1G3QA 4O2RA 2NPIA 1NI3A 2OESA 3GLIA 1YR6A 1KDTA 3NH9A 4IVRA 2B8TA 1WP9A 2HYDA 4HDCA 3WYGA 1E9DA 4EKDA 2WOOA 1X8LA 1KI2A 1WF3A 4P4TA 1TU3A 2QMUA 4OKSA 3TBKA 4DZZA 1AS0A 2E87A 2RGNC 3U44B 1Z08A 4GP6A 5JCPA 2VHJA 2Q3HA 3SN6A 4EQ6A 5JRZA 3ADCA 2QTVB 2VP0A 3QKTA 1BH2A 1N0UA 1SVSA 3TQFA 5JLJA 1N6PA 2WV9A 1P9RA 4TTRA 1GM5A 3P4YA 1P7CA 4FWIB 3B9QA 3H86A 5HE9A 4B34A 4D0GA 5JI3E 4B3GA 1G7CA 3Q5DA 1HE1C 1W2HA 5DYGA 2IF2A 3U3MA 2P6NA 3MLEA 3K70D 2VF8A 1W46A 3W6PA 4EPYA 2HCJB 2ZRIA 3ADDA 4K8OA 5KUTA 3U60B 2JASA 4OI1A 4RD1A 1Q57A 3ONWA 3PENA 3RWOA 1XX6A 3MJHA 1ZP6A 3BOSA 3K0FA 4M9ZA 3W8RA 3VR5A 5C4GB 4PPQA 3SBDA 1EWRA 4RFVA 2G77B 4BQSA 1VCOA 1N6IA 2KBEA 3R7WB 5CJ2A 3TIFA 4NKRA 1FPMA 1U0HC 2CK3A 4OHVA 4WXPA 3UMSA 4B76A 4JLNA 1KI7A 5L3RA 4Q02A 2F1RA 5EP1A 3QXHA 1PLKA 4W5HA 3O8BA 4S2EA 4H1VA 2IEZA 2ZUDA 2NO7A 2DHRA 4B43A 4ZO4A 1XJ0A 2OXCA 1MRSA 4JZKA 4K46A 3LAWA 1ZVQA 2O0KA 4GMDA 3TH5A 4L16A 1ZNWA 4RD4A 3T1OA 3DMDA 3ZGXA 1XTQA 1E6CA 1I4LD 2GCPA 4YLGA 4GI7A 1G3RA 4PAMA 3CNLA 2OILA 2ZI6A 1WB9A 1E9RA 1OE0A 4Q1BA 2UVQA 1NL3A 4EQ6B 1SHZA 1YRBA 1R0WA 2DY1A 3T1VA 1T8UA 2FU5C 4LYFA 1J7KA 1SVKA 4HB2A 2IYYA 4Z8YA 3ASYA 5B64A 4F4CA 5FUWA 4ASUA 2IYVA 3GEHA 1J8MF 3NBZC 5FPYA 3KQUA 1TEXA 3SOPA 4UJ5A 3WHKA 1I4TD 1W1WA 4OL0A 3QKUA 2ZREA 4DC9A 1MOZA 2GXQA 1D5CA 3KZ1E 1RC8A 2RHMA 3LY5A 1B23P 2YVUA 2FOLA 1P62B 4K81B 3O8RA 2HLDA 2Z6VA 4TMZA 1OH5A 1N5IA 4QG7A 4MUBA 3IQXA 4ESVA 1HY3A 1BKDR 1F60A 1JXMA 2CXXA 4B32A 3K1JA 1C1YA 2JLUA 5E95A 2ZIAA 5G53C 4NCKA 3NBFA 4YQFA 1G5RA 2DR3A 3OZXA 1KNQA 5A5GA 2PEYA 3PEVA 3IHLA 1IY1A 2HT1A 1YRAA 1XZPA 4QFMA 1MT0A 2AHOA 1KIMA 3MWYW 4C9BA 2OV2A 1AGPA 2GAAA 2BOVA 3LRPA 1GKYA 4TLEA 4G5RA 1VYVA 4KU4A 1ZNZA 4R9UC 3I8SA 2GHIA 3PXGA 2GZAA 3P20A 5FOXA 4DSTA 1T3SA 3LQRA 2IS4A 1LF0A 1E0SA 4I99A 5FTKA 4W9MC 5JEEA 4CEIA 2ZS8A 4CZ2A 2N42A 4U00A 3I4LA 5FL7A 1G4AE 3GFPA 3AVVA 4AK9A 5FPKA 2HDNB 4LC1A 5AJWA 1TNDA 3TRFA 3V9PA 2IYWA 2NQ2C 3GQBA 1QDEA 2J1LA 4IDPA 4QBGB 3W5IA 2NZJA 2WIAA 4I81A 1ZC4A 1KK3A 3B2EA 3FKQA 3HYTA 4D81A 3BH7A 4A8JC 2QBYA 1GL9B 3EC1A 4GZMA 3IBYA 3SHWA 2IUSA 3THOA 1BMFA 1W47A 4I1VA 3ZDQA 3QBTA 1Y3AA 1G9XA 3IHWA 3LW8A 3NEYA 1KSHA 4KLNA 4B6FA 5FPSA 2ZJOA 5FI0B 1NRJB 2F1HA 5IDVA 3BERA 2QPTA 2XITA 3M0EA 5JBQA 2WVJA 5KNDA 2J59A 1UKVY 3Q72A 3Q7PA 4JT2A 5GVRA 2IW3A 1EFUA 4HLQB 4TT3A 4DT1A 2BJVA 1KAGA 2H8KA 3ZIAA 1DBSA 4D0NA 1NMYA 3JZAA 3P4XA 3KTAA 2XXAA 3TAUA 1FP7A 3P27A 1D8TA 5BN4A 1XEFA 1E9SA 1TX4B 1F3OA 3WBKA 1G19A 3B9PA 1CJKC 5HE8A 4TYPA 4JVNA 2QT0A 4MITA 3K9GA 1R8QA 1KMHA 5CDFE 4PQRA 3EIHA 3FFAA 5FTMA 2ZTSA 1P60A 2VIIA 1E4VA 2ZRHA 1E98A 1CKEA 2ORWA 3AVQA 2VO1A 3TK1A 1G3IA 4BLPA 3SE0A 1JJVA 1M74A 5JJKA 1JNYA 3BXZA 4XIGS 1SVWA 3IO3A 2PBRA 2QMOA 2VSFA 3OESA 3RNLA 4QRHA 5JSZA 3OEHA 1F48A 2GETA 3UK6A 5JMTA 3HDTA 4P33A 4V0KA 1OXTA 4DJTA 4CEIB 2NO6A 1AKEA 4LBYA 1VYTA 4C7OA 3J81k 3GLFA 2IS1A 3I61A 2C03A 5D3MA 1E1RA 2ZSAA 4JIMA 4MYCA 2ZI4A 5CJPA 2XJ4A 4Q7KA 2CDNA 1S1MA 2GAOA 1E2GA 3LNCA 4EJSC 4A36A 1G5TA 1U9IC 1WCV1 3WHLA 3WP1B 2QBYB 2C9OA 1FX0A 5TB5A 2QORA 3QG1A 4JLBA 1YZKA 1LS1A 2FZ4A 2WJJA 3IBGA 4FD2A 2ZJ8A 4IXMA 3V4RA 1DAMA 1LFDB 2O8EB 3DM5A 2PL3A 5B58C 1KI9A 3B1WA 2YZ2A 5SZHB 5JWRA 3TR5A 2DFNA 4DT1B 1T91A 2P2LA 4NYIQ 1OFTA 4DLTA 3IKJA 3A1UA 2XXAB 3G82C 4Q18A 1G7TA 2ZJYA 5C46F 4IW3B 1HQCA 2JGNA 2VF7A 2ZI5A 3LO5A 3AUXA 5E3HA 4JL8A 3AEZA 1HH4A 5KNBA 1Z6AA 3C4JA 1KMHB 3GJ7A 5GJVC 2WJYA 5DN6A 4JL5A 3RVBA 2WSSD 3LXXA 4I1SA 2ATXA 2A78A 3BFXA 4Q4HB 3L8YA 2C98A 4JKIA 2ERXA 2W2XA 4X8LA 1UKEA 4I4LA 4NDZA 4EUNA 4URVR 4IOJA 3R9WA 4X8HA 1T5IA 5JJLA 2ZYWX 4V0OA 3DOEA 5F3WB 2AFIE 3ZVLA 2AK2A 2ODEA 1G64A 4MGYR 4MRRA 5IF9A 4TL8A 3X1YA 1M34E 2X77A 4NBSA 4C7OB 4M1WA 5K8TA 3DL0A 1ZCAA 4D6PA 2JLZA 1W7AA 5D3MB 1DPFA 1QVRA 1RRGA 1CR0A 5KDOA 3HU3A 2X2EA 5EZ6B 1OB2A 2IK8A 1O87A 3QVVA 1NNEA 4C30A 2ANCA 1FX0B 2FFBA 3SJBA 1OH8A 4G0NA 1TMKA 1QG4A 4XOIA 1R0ZA 1H8ED 2B21A 5L8VA 4MDFA 2P5SA 2Q21A 3GLGA 4WBSA 2QP9X 1XU4A 1KNXA 1UEJA 3VR4A 3TVTA 3CF6R 1FMLA 2BMJA 4GOJA 3LXRA 5TY0A 2WPDA 3X2SA 4DLVA 4GDFA 1N5KA 3U7GA 3CWZA 4OI4A 4B71A 5ELXA 4Z1MA 1TUEA 1QRAA 1W0KA 4KAXA 3L82B 2VHCA 4BLSA 2FJUA 1GILA 5KPDA 5TDHA 1YR8A 1VECA 2ZU0C 4Q47A 4KFUA 3B7GA 2QG6A 3RSOA 2R6AA 2ZRBA 1OHHA 1KDOA 3KXIA 2VP6A 1KAOA 2RHDA 2GJ8A 4KO8A 3VKHA 3PEUA 4BLRA 3CBQA 1XP8A 1QHHB 1CS4C 1QG2A 4WAUA 4B47A 1RYFA 4URXR 2HXSA 5G3ZA 1D2NA 3G5UA 3C16C 5BWMA 2P5TB 2O52A 1DAIA 2O5VA 1JPJA 2RKOA 5DNYB 3SYNA 4FMCF 1ZM2A 5H68A 3QG5A 2OM2A 3AKCA 5CITA 3NWJA 1RRCA 1HT1E 2G0TA 2A2ZA 3SJAA 5SZJA 1CJUC 4O3MA 4TL9A 1Z28A 5P21A 3PUXA 3MGCA 3GP8A 3T35A 2RGDA 5CYOA 4IEEA 3OEEA 1E0AA 2FN4A 2ZJAA 3MD0A 4PHHA 4DIDA 5UKDA 2J9RA 3HJNA 3NG1A 2JCSA 4DDVA 3IILA 2J7PD 3TE6A 1EWQA 3C8UA 4FIDA 5F9FA 3AM1A 4DLUA 4DCSA 4UQOA 1OXSC 4NYIR 4H9GA 1DOAA 1XNJA 3ZZUA 2MSDB 2N46A 1ZC3A 1KHTA 3CKLA 2JIZD 3BB4A 2FX3A 1HQYE 1LW7A 4CW7A 1PJRA 1NVUQ 4KYIB 2HUPA 5EP2A 4B3BA 4EFLA 1RJ9A 2AN9A 1E96A 1H8HD 1NLYA 5J4LA 2WWWA 3D3QA 3TSWA 1KSFX 4UNSA 4MQBA 3ZQJA 2OFXA 4DXAA 1LVGA 1ZU4A 4DHEA 2ZRKA 4XSGA 5EXTA 3W6OA 4P3YA 1W0JD 4TMTA 5DHAA 3U6BA 1HURA 2DWOA 2FWRA 4Q48A 2HF8A 4HB0A 1KDRA 2WICA 4TLDA 4RY2A 4PR0A 2CEAA 1JEEA 1ZCBA 2CMKA 4I1UA 4KFRA 3QXJA 1RFLA 4N0EA 4M1TA 4XD7D 4F4JA 5BN5A 1TQ4A 1FNMA 1SKYE 4DSNA 4LRWA 2BBSA 3H1TA 5C18A 3CPHA 2BHRA 2IYZA 1YR7A 2XNDD 4LHWA 5J4VA 4NMMA 1Q44A 3BH0A 2JJ8A 3QXCA 5KU1A 1UJ2A 5AUOB 5CK4A 5DISB 5H70A 1ZM7A 1Z0DA 1X6VA 4RSGA 1E9BA 2ZJBA 1G6HA 4LPSA 1ZRHA 1U2RA 4IEIA 4P4SA 4YXWA 3TW8B 3TUJC 4DWJA 4C0SA 4EAQA 5GJBA 4R2HA 2NPFA 5L3SA 5LPNA 4PC1A 3P32A 2HYIC 2J0UA 4RZXA 4IJMA 4JBYA 4GZLA 3LFUA 5FBVB 4ZPXA 3U3RA 1SXJE 2YHSA 4BFWA 4BFVA 4KJZA 1COWA 1Z0IA 4OQNA 4PAQA 2PJZA 1VHTA 5KSYA 2IL1A 4ON9A 5HCIA 1ZD9A 4JJZA 1UDWA 4GBMA 4WZAE 1GWNA 1RJ9B 3Q9LA 4JS0A 3LVRE 4O0MA 1U0LA 3THWA 3IPYA 2QSYA 2GBLA 1SVMA 3LWNA 4A2WA 4Y0VA 5FR2A 5B57C 3U5ZB 1P2SA 5KOYA 3VFDA 2QPAA 3U4QA 4N0DA 1TTTA 4NONA 2OE2A 5TMPA 1EX6A 2F1IA 4KODA 2EWVA 3C5HA 3TUZC 1XMJA 3KQNA 1MO6A 3KFVA 3B78A 3NEJA 5JHGB 2YJTD 4DEXA 3LBHA 3NH6A 4QJ3A 2VA8A 2PZEA 1N2CE 3EWAA 4FCWA 3JZMA 4GOXA 4UNNA 3SU8A 5EJEA 3QENA 4HB4A 1S9HA 3DVLA 3THXB 2IHBA 1YE8A 1VCMA 2IWHA 1UM8A 3RRNA 3R20A 2G0NA 2IXEA 4B35A 3BB3A 3KJIA 3L0OA 4CIDA 1NKTA 2V3CC 4M8NE 2OCPA 3FYHA 3PFIA 4P4SB 2P67A 2W6JD 4MYUA 3BJIC
chains in the Genus database with same CATH superfamily
5ENVA 2XCLA 4ND2A 3LBIA 4PZZA 5A03A 1TF7A 4L95C 4XB2A 2B1GA 4L8GA 3ACCA 3O8OB 1ECGA 5HKBA 2X86A 1P1KA 4XI9A 3UJAA 4ALJA 4PZPA 4XX0B 4B3CA 4ETWA 3LCCA 2EFDB 3QUCA 3B5IA 1RAHA 5HUQA 3E1GA 4Q1VA 4IIJF 3IVMA 2P4SA 4G41A 4JAVC 2EX4A 2HPVA 3D3WA 1LK7A 3TLGB 1V43A 4MW2A 1RWOA 1MB0A 2C9BA 1L6IA 2XNJA 2Q62A 3AU8A 3WRXA 2HX1A 5LZ4A 1KI3A 2I3AA 2OAEA 4G0MA 4MGEA 4ES6A 5B36A 4LNHA 3F8TA 4NG4A 3TX2A 4L51A 1E5DA 1LU9A 1QO0A 3FN4A 3MPUA 4EY7A 1V5FA 4INPA 4YAUA 2AL7A 3O1LA 4MHOA 1EFRA 4F1JA 2AKAB 1HL7A 3I2GA 4RM3A 4DSZA 3QOYA 2QVZX 5LBIA 2ZRQA 3NHAA 3TQSA 4DR2B 3AVTA 3Q87B 2LDBA 4D4LA 4ZK6A 1W35A 4OHWA 2Q29A 2WYUA 4Z0NA 1KYYA 1N3YA 2GEUA 4H6WA 4JP2A 1JSZA 4LRTB 4W7IA 1RM0A 3U44A 4CHTA 4IHJF 1QV7A 2BMDA 1IBSA 4PO8A 4RA6A 1TVMA 4LMRA 3Q0EA 1JHUA 4HS4A 4NBUA 4DM7A 5AO9A 5KYUA 4M9XA 1M54A 1KJIA 1OFUA 3AJDA 2GILA 3P2YA 4QYXA 4BFUA 4BWYA 3G8AA 4P86A 2CDAA 2REBA 5KJEA 4I46A 4XYEA 2JGLA 4DSUA 3K1AB 2KPOA 1RKQA 4HKTA 1GUBA 4UCFA 4YJHA 5EVJA 4YCMA 2Q6KA 2EJUA 1OVMA 4MVJH 3A2KA 3H1GA 5A7HA 3QW2A 1J8YF 3GGOA 5G40A 4RETA 2P6PA 1QBKC 1J8DA 3MYYA 3PV0A 4OXNA 4OXQA 4PX3A 2JB9A 3SBEA 1Q19A 2XY4A 1K3TA 2WVAA 3WSVA 1KY4A 3PRKE 1IN4A 4CTNA 2EFHB 3VTAA 1Z5OA 1ZN9A 1ODTC 3CX8A 3M5WA 1EGHA 2WP8J 2GD1O 3SS9X 1YUMA 3SZGA 3TIXB 1QU2A 2F6RA 4UTXA 5DHPA 4HATA 5L40A 3BYZA 2ZPAA 3E5MA 1JU3A 1FS4A 2FEMA 2AE2A 4R2JA 2NV6A 1GA4A 2HQOA 1A9SA 2BGTA 3PWTA 4E94A 4XRRA 4B4WA 4BKQA 5FUVA 4TXHA 2EF1A 2C5LA 2QJTA 2H9AA 3IEPA 3OFSA 5DE3A 4OLFA 1JAZA 3KALA 1TCAA 3MS2A 2ECPA 1YOVB 1YA4A 3I72A 1KJJA 4F9TA 3L8MA 1W5FA 1YA8A 4IQ0A 2PEZA 2JGMA 1NONA 1DKMA 2NVOA 2PVPA 1WOYA 4OJQA 2EX1A 4IJKA 4AYWA 2I54A 1IB0A 1GR0A 3LH5A 4RVHA 3UHFA 1XU7A 3AQIA 3IQGX 5JR3A 1AUPA 3N70A 4KPUB 3ETEA 3LUGA 3OZBA 1ZEJA 4ZI7F 1CJSA 1KGSA 2V74B 3G0BA 4A5SA 4ALMA 3BMNA 5A4JA 5HW0A 2B5WA 2GKSA 2XRFA 1W4CA 5HZHA 3KWLA 2Q4EA 4I50F 1AQYA 1AC5A 1JDBC 3SHTA 2N47A 3M6MD 4W9NA 1EE9A 1JR4A 1DJOA 4TVKA 3PLAE 3OT5A 1EA7A 1U98A 3KUCA 4LBVA 3QGMA 4AJEA 3HM9A 5BUZA 1N5JA 2ARKA 3AP2A 3BZUA 5IF3A 2D5BA 2P5YA 3MWEA 3RKUA 3BM5A 3SBXA 4RMJA 2PLFA 1NXVA 2YV2A 1ORWA 3CWCA 3ODGA 4EA6A 3S68A 5B7QA 1PDOA 2B78A 3OY7A 4CM4B 1IHDA 4RU1A 2C07A 4AG5A 1L4FA 1QGED 4XM0A 1NX9A 2ZU6A 1IN8A 3PL5A 3IEXA 2ZDHA 2VDJA 4JVSB 3GLTA 4MW5A 4NNPA 2PL1A 1LWOA 2C97A 2QUKA 4RLQA 3MBOA 4EHFA 4JXXA 5DBEX 4D0RA 1TM7E 1N2EA 4MGKR 1G8GA 4IDHA 3OE1A 4KQIA 4PZDA 3L0ZA 5FFMA 4RTPA 4CMCA 3E8XA 5ITZB 3NXSA 1QIMA 1SBHA 3E84A 3K70B 1QUFA 1XTVA 5I4CA 1R5OA 1P7YA 1QXSA 3IUSA 1FDVA 1E5XA 3DE5X 2O5EA 2Z2XA 3WKAA 4YMWA 4GVPA 5IC4A 4EITA 3MCTA 4INJA 4P54A 3W6ZA 3NWOA 1YB2A 4K0RA 1Q7BA 3VTKA 1WY5A 1WW2A 1B7GO 1XMQB 5KB3A 2IBMA 4Q1DA 2EBHX 2HMSA 3OJ0A 3WIVA 2IA5A 1QOQB 1JQDA 3S70A 1Y8AA 1OI4A 3R7AA 4D5EA 4JHLA 3AESB 3NV9A 3VGPA 1ACLA 3LRTA 5B3JC 4QPCA 1NQXA 4C05A 3JQBA 5JZMA 5LD2B 2XMRA 3W2TA 4EGCB 4DNPA 1KEVA 4H3SA 1MABB 1ZOPA 3F5SA 4ND1A 4FDVA 2QF7A 2QOEA 3DKIA 5CVTA 1AQIA 2FPLA 2HHCA 4J3JA 5EOVA 2Z3VA 3EH1A 4OJKA 5JBIA 4UASA 4A8PA 1YJCA 1OPXA 1C3XA 1KC3A 2FG7C 3P7MA 4KQKA 3A4MA 3E7PA 5EL0A 1H1LB 1X15A 3OZEA 4DQLA 3QFTA 2DRIA 5IJZA 2PGLA 5KTYA 4BDTA 4BMNA 2GCOB 4PSVA 4P7KA 4N76A 5EJ8A 4B6EA 1JDZA 3PEFA 2FMIA 3DD1A 4TXJA 4KPYA 3E70C 3VR3D 4LZWA 4MAMA 3FVQA 2L69A 1T36A 3G49A 1E9FA 3QELA 4KFTA 4M53A 4R7ZA 4R8KA 3VC1A 4HNUA 1OILA 4OH1A 5B1IA 2J5XA 1HF3A 3I9MA 3WMXA 3OCVA 4MKFA 4WE3A 5HJ7A 4F2WA 2CK3D 3BK7A 5JPIA 4HAXA 1VIVA 2BD0A 3PL1A 2D0PB 2ZITA 3D4LA 3EVTA 4LSWA 1RWQA 1GRQA 4OH7A 3R9IA 2D4HA 3BQNB 3WK7A 4YRBA 2B4TO 3W1VA 1NFFA 4PZYA 3O03A 4RDCA 1C2TA 1EFPA 1ORHA 3TXAA 1Z74A 5LMZA 1K5GA 1G2PA 1CJVC 3QKWA 1U0TA 1Q7RA 4O33A 2QQ0A 4O4HA 1ZM4A 5T8KC 1DX9A 1JHZA 1ZJJA 4QXQA 2DULA 1AY0A 4B6PA 1CUSA 1ZLXA 1M8PA 2Z8YM 1Y1TA 4MWCA 3H2HA 4ZEMA 2AG6A 4JD5A 3TL3A 1HMYA 3KSZO 2QTTA 2RHCA 1XNGA 2JC3A 5ILQA 2VT2A 1DTWA 5D01A 2GZDA 3UMCA 4K9MA 1D4OA 2W2KB 1Q74A 2J85A 4IDQA 2A9FA 1PJCA 2C00A 3KV1A 5L7WA 4DB4A 4MJ3A 3ED5A 3L1JA 1UZAA 3EMKA 2B4AA 1YJXA 3N2ZB 3SVLA 4WCDA 1ESDA 4KQGA 3U3KA 1NURA 2XVMA 2O8DB 1IY0A 2LKDA 4QC2A 4TS3A 3IDSA 4TM8A 1GA6A 1P9NA 2QGNA 3BXXA 1B6SA 3R5KA 1NSFA 3A14A 4KUGA 3CW9A 3D54D 1N6LA 1CY1A 4PZLA 3T3DA 3OURA 5G1PA 2ZYIA 1FW6A 1P5RA 2WK1A 2WJPA 3CLKA 3H4TA 3NAGA 1VTKA 7REQB 4QDXA 4ZOLB 1LJUA 3OCWA 3OQ1A 5HPYB 1D7OA 1DINA 2B3DA 2O2HA 4KWHA 1JMYA 4BPBA 1FU7A 4C0WA 2WYWA 4KE8A 4PRYA 1N2IA 1XZLA 1XLTC 1F5SA 3K32A 2QG4A 4ZO8A 4C4SA 1TKAA 3ZDRA 1QFYA 2YBEA 2GKGA 2JAUA 2M9MA 3R6WA 1ZFNA 2N3ZA 3OC6A 1UBUS 4LJ4A 2OO5A 2I0FA 4FPXA 3ZH9B 2XB4A 3HB4X 3MUNA 2DHQA 2P30A 3ZR4B 4CKBA 3K4HA 4XTRA 3OFKA 2SECE 2BFCB 1ECPA 5JAZA 1JUDA 2Z1NA 1XD2B 4XJVA 5K0NA 3EY4A 4EY3A 1JAHA 4EHAA 2OZEA 4QXPA 1Z7EA 2B1JA 2YRXA 3FCEA 4CMIA 2UXBB 2XVYA 1SBIA 3P1JA 4ZTZB 2PUDA 2PMKA 1L3BA 1UQRA 1O8BA 5I7HA 4NEQA 2CL6X 1U7WA 4J1QA 2KE5A 4S04A 1H22A 2FP4A 3GZNA 4I6GA 2QMEA 3WK4A 4R3UC 1OZHA 4DLNA 3HVUA 3MHPA 1J0XO 4C7KA 2WJZB 3QZUA 1CJBA 3SXPA 4CUZA 1WETA 3ABZA 4QVGA 1FE8A 1CUFA 4IY1A 1Q21A 2H06A 3FGNA 3RSHA 3HY6A 2OG1A 4HPJB 2BV3A 4C2BA 2BZ1A 4KG7A 4FGZA 3TJZA 2AZTA 3C5EA 4HAVA 3WDLA 1BDMA 3NIWA 3RTGA 3M6LA 4EECA 2YKGA 1YXMA 4UPEA 1J56A 4NK5A 1GTG1 2H7VA 1NE7A 3LDGA 4KUEA 1VIAA 4B6RA 1DDOA 1I6MA 3CN7A 1C9MA 4F93B 1TJ3A 4JROA 5FBQB 3WGMA 4B32A 3FCOA 1XD8A 4XPZA 1VG8A 2X13A 4C88A 1ZN8A 1HUQA 3PQCA 5IULC 4NL4H 2HQ1A 3IAHA 1G18A 4BBJA 4CNQA 1Z83A 4KQ1A 5JJ5A 3D43A 3ASVA 3DDUA 4KBYA 4KXMA 4LWZA 1U3VA 2OEPA 3I9V6 3FRHA 1H3FA 1Z39A 1DKLA 2BDEA 3DMNA 2IU0A 3WGZA 3W5BA 1L7OA 4Y9DA 1IN6A 3AF5A 4R8MA 4CGYA 4EPVA 5EVCA 4ZOLF 1SA0A 2WTUA 1XROA 5IG2A 4BB5A 1DC5A 2BHLA 5C5CA 2Y6VA 4HLUA 2RGXA 4JBLA 2X9QA 5KTTA 1TECE 1YFZA 4F4DA 1XTJA 1J8FA 3FPEA 3O8QA 1MF7A 5GINE 3EVAA 2BUAA 5C8YB 1OUMA 1NMQA 1SUSA 4J0QA 3R5JA 1ECFA 4OAPA 3IQFA 3TZ6A 1GTJ1 4PONA 4INAA 2QLLA 1VJGA 4CLOB 4D4IA 1M1YE 4J0EA 4QTZA 1FFYA 3QE3A 2DBYA 4IFIA 4WUVA 4B82A 5K0SA 4JX8A 4MVWA 4RACA 1OWNA 3MUOA 2CXOA 4QUJA 4YJ3A 5EIXA 2JFHA 3OOHA 2DPLA 1FK8A 4E88A 4BGUA 2CV1A 1DIOB 3V4ZA 2YN4A 4UXHA 2DETA 1E1RD 3DMPA 4B7UA 1WZIA 2E2WA 1E9CA 1P4SA 2FWPA 3E9MA 3NNDA 3I5MA 3BFJA 1CWUA 3LA6A 4I7EA 4U7HA 3AFNA 1VLZA 1YCHA 1X38A 1IEXA 3FDJA 1ZWKA 4NYMR 5BQXA 2IVZA 3L5OA 3P19A 2J45A 2PX0A 3WZMA 1U8YA 4WOPA 4A1OA 1IZ0A 2P6MA 3NU1A 4UE6A 1RR6A 1KDPA 2QX9A 1AMNA 1AHIA 4RKQA 2EW1A 1KAMA 1FS6A 1MZVA 4ECEA 3ZHSA 5H9VA 2I03A 4F7DA 4WVFA 1ZVKA 4EYQA 3ODPA 2O8FA 4ZZ0A 4CVNA 1V3UA 1XTKA 1Y1PA 1MEEA 1M6YA 2VAVA 3ECSA 2B6HA 3H17A 3JTMA 3QLVC 3HYCA 1HL3A 1L5HB 4UTZA 3H9EO 4LJ5A 4A0SA 2G36A 3BB1A 1USKA 1Z5ZA 4JN6B 2CHQA 4E7PA 4WCFA 2POQX 5FNVA 4LQ4A 2BR3A 4FLFA 4D82A 1VXRA 1KWKA 2J5KA 3L7IA 4QYTA 1PLLA 1V95A 2CCGA 4D6YA 5BMVA 4YAJA 3L7LA 5A1JA 3Q3GE 4MZDA 3PR2B 5GM2A 5H3HA 4NARA 1ZK0A 2AWOA 2CVZA 3AVPA 2NYRA 4YMVA 1VFPA 1Y63A 3CG4A 1CJMA 2CUZA 2HNKA 1RFGE 2WKSA 3PXCX 4OP1A 4ZEXA 2PLRA 1NI4B 3KYBA 3FDZB 4K6MA 3T9EA 1E2QA 1Y7PA 2QV0A 2Q0SA 3FDXA 1GKIA 3U4GA 1K3FA 5D1NA 2QSJA 4JQZA 1F5NA 2IZOA 5EWLB 3O47A 3V8VA 1L3IA 2PLWA 1DRUA 2A0WA 1N5LA 4I9FA 4KVGA 4MJXA 3UHPA 3SYTA 3UV6A 4F71A 5TT1A 3I3OA 1LNZA 1P17A 3ELUA 1ZGGA 4M22A 1IJFA 2WZCA 2XB8A 3ZGYA 2QZJA 1I2DA 1XDDA 1EG7A 3DE4X 3VYTB 1PX2A 2BLNA 3FPCA 3ZX4A 1HFWA 1Y6QA 4YAFA 5BSFA 3VR1A 3U4MA 3QFCA 4XD7A 3C3XA 4PWZA 3VR4D 2QAJA 4J1TA 1PK7A 3OZTA 4YQYA 4D6XA 1TA4A 1KH1A 2I78A 3IXQA 4NULA 1U0EA 2WLSA 5HQJA 3BWCA 4CIBA 2UZ3A 1Y6RA 2DWQA 1W0KD 3WHPA 3TMKA 3OTOB 4OHYA 2QRJA 3TZQA 4YGYA 3QLUC 3RS2A 2V6FA 3GH1A 1YU9A 4CKWB 2IXTA 3PXXA 1VMAA 3I1YA 4G9EA 4HYYA 2IUYA 4TTTS 5DX1A 4F85A 1U31A 1W5EA 1QF6A 4YJFA 4P5DA 5DBHX 5CW1A 2R6CA 2VZEA 3D2AA 3F2VA 4FJ0A 4YCBA 3VYRB 4OD0A 1G8SA 3GGGA 2P3SA 1FBTA 2Z2KA 4N39A 4C6SA 4MCJA 4O4LF 3EA0A 4JA2A 5JXIA 3SS8A 2RGCA 3NANA 5A4FS 1BGVA 4FFVA 3G9TA 5EEHA 2GTIA 4GKKB 4N6GA 5K8LA 3LIPA 2QS9A 3N2IA 3HL4A 1ZD5A 4NU8X 3SP1A 4LI0A 1T9BA 1XCOA 4MULA 2OXEA 1U2DA 4GP9A 4PZAA 4HI0E 4RZ3A 4RXMA 4DC0A 4E03A 1RPZA 1H3EA 2Q5FA 4FJ2A 2H8GA 4H0NA 1M83A 2EJVA 4JT8A 3LC1O 4G1FA 4L8FA 4LGMA 2XE6A 3ZWBA 4CMEA 2H31A 1T34A 1P4GA 2LE0A 2VEDA 4M38A 2REQA 1J25A 1W4AA 1KYZA 2JI4A 3ETCA 2R85A 4KQMA 3JQ7A 1E62A 4B8WA 1G8KA 3I4FA 4XVCA 1MRNA 3GFOA 4IIDA 3BXHA 3G5LA 4OX9B 4JI4B 4H18A 4E2ZA 2YICA 1Q91A 2W9XA 2RB5A 4B33A 1UFVA 5FO0A 1Z4NA 1E7RA 1K7FB 2V6BA 5B3KA 5KX5B 4CEIA 4V2UA 3TLMA 1RP7A 1SQ5A 2KBFA 2RK6A 4QHTA 3GNLA 1WX1A 1GZHB 4BAZA 3V7WA 2GARA 1D9XA 3WADA 5KQPA 1VIYA 4BNDA 2B92A 1GT91 4N8SA 2XUZA 4CEJB 2KSQA 4K9NA 1NVKA 4PLVA 3EQ7A 4OB6A 4REQA 4U1RA 1PWZA 3KAJA 1K6JA 1U2EA 4S35A 4FIZA 2FJPA 1PVVA 2ZIXB 4OO3A 3WLAA 4KQEA 1W44A 821PA 2W6JA 2JJ1A 3HS3A 2XXBA 4WCVA 4YEDA 3U81A 5CFQA 4DVGA 1BGWA 4XQEA 2PZFA 3DTVA 4Z54A 4ZQCB 3LLCA 2ZZKA 4KAFA 1IQUA 2WIDA 4RPHA 3DL2A 4TKUB 3K9HA 4XVUA 1X7ZB 1PEAA 5LQMA 2MT9A 2W90A 3QF4A 3K72B 4IXNA 1EEXB 3DEYX 5F98A 3W5SA 4WADA 1BXKA 2I3BA 1D2RA 3I1FA 4R8SA 3V4OA 3QPCA 3H13A 2AW3A 3BGWA 3R7SA 3ZPXA 4A2PA 4ZU6X 1NHWA 1SWWA 1YL5A 4KK4A 4R5MA 4OJTA 5FTJA 5BSHA 2IBSA 3WV4A 4FYHA 1E6MA 3L02A 3N7AA 1I14A 2DEUA 5AVOA 1DBPA 3T0GA 4PZ9A 1R5JA 1NASA 1VE6A 3GMDA 3JAWA 4KXXA 2IUEA 3IP1A 3RS3A 2JJQA 2N1BA 1E6UA 1NDHA 5F77A 4MS1A 1ATZA 1KI6B 1UUFA 4X0EA 1N1DA 3T3IA 3ZXXA 2YJ6A 4EWLA 2OHFA 3K5IA 2P0AA 1GYQA 4LA4A 4A8JA 3QPUA 4U7PB 1AKTA 2PX4A 3L6BA 3QJGA 5B4TA 2X14A 3BXEA 4HUQB 1TZ2A 1XRQA 2X58A 3W9YA 1KIAA 4MR7B 2J3IA 4BHTA 3NKVA 1OBCA 4G09A 4C22A 2ZRCA 3AOEA 5FWXA 1QCZA 3QUQA 1EX1A 4NSNA 3VVMA 5BQPA 5EY5B 1NVVQ 1TYDE 5DJ5A 2HB6A 5IEBA 1J2JA 4GSLA 5G3YA 3UWDA 5IFKA 3E03A 4H3VA 1KZHA 2C2YA 2Q1XA 3OAAD 4IJ5A 1P6XA 4H6PA 5KX5F 3K92A 1IBKB 5K0CA 2ZW9A 4LJ7A 1JSCA 4JYBA 2BBTA 3JZFA 2WJWA 2CF5A 4ACBA 4EJMA 3BEOA 2V7UA 4MMXB 2NNWB 1IHUA 2RHRA 4MR9B 1X3LA 1CNFA 5CYFA 1JHPA 2XOKD 4NCNA 4PHTA 4EIWA 3ST7A 4HT3B 4UPVA 3D5QA 4QUHA 1QO9A 4ZD6A 1J39A 1BNCA 3OTGA 3SDBA 3VR6D 3X1WA 5C32A 1NN5A 1H42A 5E3IA 1Z8HA 2PKQP 2KLBA 1U94A 4EO4A 1KI4A 4YAEA 1YBAA 4RE5A 4O59O 3K05A 4GZ6A 4LYAA 4R9RA 2ID9A 3TAXA 1E9AA 3KX2A 4U8GA 1YJ5A 3EDOA 1O4VA 4FHFA 4BC1A 1QIDA 1G8PA 3T7AA 3VHRA 1NW7A 5EMKA 1GTL1 5K45A 3TQQA 1IEVA 1M7GA 2YDYA 4JEUA 4ZP1A 5PNTA 3I04A 1J90A 1SRQA 2VSQA 2SBTA 2ZT5A 3JQ8B 1I2ZA 3UICA 5H8WA 5KMGB 3IVAA 1JL3A 4B87A 4QHSA 1K9VF 3TB6A 4N5NA 4P4GA 1CIVA 4K9OA 4NH0A 4AKGA 4U2KA 1G291 2G6BA 3ENQA 1Z5PA 2QA5A 2VTVA 3HXKA 2HHHB 1MH1A 1ST2A 4JHXA 1QANA 1JU9A 1WZEA 3NKFA 2VRWA 1I3NA 1NUSA 5C4MA 3Q9SA 5FH9A 1YE5A 2XUJA 1HDCA 1URPA 3WDMA 4BECA 2GERA 3UVEA 3U6KA 4HXYA 3PNKA 1O95D 3NX4A 4Q4AA 1QGAA 5FJJA 1GD1O 5F12A 4EB0A 1Z0AA 2B1IA 2MR5A 2PKWA 2WG0A 1VGQA 3ROQA 4YYEA 3KR9A 3P2KA 4C43A 2UUCB 4KFCA 4AKEA 5FWNA 4HXFB 3WGUA 3RBZA 3UGTA 5JJIA 5I9NA 2Q99A 1HZJA 1P1HA 5CTJA 3ZYCA 5KEIA 2PQ2A 2WB4A 1BVRA 1SUIA 2J46A 1K63A 5FLEX 2HCFA 2C4VA 3QVXA 3RAJA 3KJGA 2JLAA 1FP6A 1SPBS 4K9KA 4C7BA 4G0YA 2XRMA 4UU1A 1P9WA 1TYZA 2B30A 3VDNB 3E18A 2VDWB 2R5NA 3E53A 2IYUA 2GK3A 3NBYC 1JIUA 5DF1A 2EKQA 2B83A 3DNMA 3NB0A 5DSXA 1IHOA 4NJEA 2XZPA 1P33A 1QK5A 3MCAA 4V0ME 1FSSA 5A2GA 1CLUA 4W5TA 3GXOA 5FBZA 3NGMA 1KBOA 4AO6A 4EG0A 5LOVB 1TW2A 2DM6A 2PBZA 1ULSA 3A4NA 4WN9A 5L3ZA 4C2AA 3K6KA 5I9TA 4AD8A 1VLMA 2QTCA 4OPMA 5KNDH 3QEMB 2YWHA 1QH1A 4LV5B 4XWKA 1NGSA 1Y8RB 4TYWA 4ZVRA 4NF2A 3NYWA 3W2HA 3EWNA 4RL6A 2ZETA 1PL0A 2OO3A 4ENVA 3PFKA 3SEAA 1P2FA 3F67A 3IPXA 3L0YA 4DLYA 4Q1EA 3ANLA 1C80A 4XGRA 4AZ0A 3AWDA 4L85A 3C74A 1TDJA 2H0QA 5CNKA 1VJ5A 4UBIA 2CHGA 4Z4HA 2CV0A 2A0XA 1BD4A 2H1SA 3BQ9A 3B9BA 2CNNA 3D31A 4AG6A 2IYPA 3D7LA 4EW6A 4BNFA 5CB6A 3H8WA 3L6UA 3BHJA 3ZJTA 4QOIA 3AUKA 2AX4A 3OF5A 5K6AC 2PRSA 5F9MA 4UFPA 3K96A 4DE5A 1FQJA 4M98A 1O3YA 3VQTA 1LS6A 3COYA 3AH8A 1XAGA 1GNLA 4MRAA 1JT2A 3GFBA 2QNRA 2AFRA 3AHDA 3IELA 4FQ8A 4IF6A 1D2HA 1RJEA 4KH1A 3UANA 3DBLA 2IYAA 4L75A 3VVCA 2Q8PA 4V03A 2R2GA 4BLTA 3GUYA 4R9NA 4Y2SA 1W96A 1GQ2A 4M3NA 1DJQA 2J6CA 3ASZA 1K6XA 3HVIA 3H5AA 1KK2A 4OMCA 4KV9A 5AWFC 3WBFA 4CN9A 3TD9A 1H1TA 4TGLA 2H51A 7MDHA 1CZNA 4ZJYA 3HV2A 4H1HA 1FFSA 2OBBA 4OHRA 1F4LA 1L5WA 1P80A 2BIFA 1KFKB 2CL7X 3RANA 1NG9A 1RC1A 2A3NA 1P0MA 4LZOA 3F1LA 4FSXA 1IQPA 5TPZA 1RYEA 1Q1QA 1GG5A 2ZGVA 4FEYA 4PO9A 4P5PA 2VQDA 4AROA 4CT5A 1Z2PX 4IDAA 4U2EA 5A0FA 4LF4B 4TX1A 4I8DA 4PQEA 3JATA 1K08A 3MUEA 1T2UA 1LV7A 2M6KA 4KL8S 5TARA 1RVV1 3BE4A 1TJ4A 3JR7A 4MWBA 5U9CA 5LOVF 2Q6OA 3PQEA 4UHHA 521PA 3LYLA 3UMFA 1YGPA 1KVRA 1U7TA 1HM5A 1BXRA 3CH7A 4LOHA 1NUPA 3WMEA 2WUEA 3IT2A 5KNBH 5KINB 4NHOA 1KK1A 3UJ8A 1C7QA 1E8MA 4AJNA 4EF6A 3VO9A 1ILWA 2XWJI 3KTDA 3L3BA 5KTOA 2DFPA 2CT8A 4IJWA 8ATCA 2HJ9A 3CX6A 1V8FA 1I4EB 5IYZA 1WF6A 1BDHA 3SLKA 4LDRA 4QJ5A 3DDNA 1ZUHA 2JK0A 2VKTA 4BEWA 1G6Q1 1BHSA 2BFOA 2QQ5A 2QQFA 2RAUA 1B8PA 1O94D 2WTXA 3ANMA 2YV1A 3AX6A 5E2IA 1KJYA 4PN3A 2PM8A 3HFJA 1SC6A 2R5WA 1G7SA 1WUHS 1DKQA 4DV0B 4BFCA 4O4JB 4RPLA 5HVNA 2OP0A 2HPAA 1RPNA 3G3EA 1QU3A 5F2OA 4DQVA 1MB3A 4ZT4A 4ZFNA 2O54A 1U8EA 2VWHA 4G4SP 2GXSA 4NCHA 1KKLA 4KRFA 1HZZA 1CEEA 1INLA 1EHYA 2WHEA 3JYHA 5T4EA 4IRXA 1A5BB 4Q01A 2XSZD 3IDQA 4N48A 3FSRA 4TZ6A 1E59A 1SCDA 2NUPA 2FF7A 1OYWA 3LPMA 3AB7A 4Q1CA 4BCDA 13PKA 1QX3A 1C30B 2VJPA 2GBLC 4S1PA 2A88A 3KHSA 1YASA 1PFGA 3ZE7A 4BNXA 4TWIA 1KI8A 3KFLA 1ZD3A 2IGTA 3N28A 2BKXA 3OCUA 3L8FA 2AMYA 3NDBB 1EK0A 1I7PA 3ICOA 1ZONA 2JL1A 3CUEF 3ZLBA 1RWMA 1D4AA 3BE6A 1E1YA 1BFDA 3P2EA 3Q7RA 5D86A 3RVNA 1TF2A 1CUIA 1HFEL 2JIQA 2H1RA 3CUWA 3HCOA 2ZE8A 4H1UA 4L5BA 2I6XA 4POAA 1KQFA 1S2NA 1VCNA 4B7AA 4W1QA 1QJCA 5DGCA 3OTIA 5HDBB 3WLPA 2C5BA 1AZWA 4BO7A 4P93A 3UTCA 3TPZA 4KAJA 5FR1A 4C0HA 2B4KA 3FHCB 3B2QA 4PC2A 3U19A 5HRAA 1TAHA 4DANA 3ZXUB 1AO0A 4KN8A 3LKZA 3A9SA 1ZIXA 4JBWA 3QE0A 4JLJA 2MIIA 3ZCSA 3W9BA 1LLCA 1UDRA 3NVKI 1P1FA 3TUZC 3OM9A 2PD4A 3TM4A 5BSWA 2YVQA 4IEFB 1WVIA 1UKBA 3PKZA 4TV8A 4HDNB 3HJRA 4I55B 2P40A 2VVTA 3H5OA 4E5MA 3LS2A 1YQDA 2HSJA 1HDGO 2FGKA 1G0NA 2BC9A 1Q50A 3LX5A 4AUKA 4OQXA 5CLJA 3KVRA 2C99A 4R5HA 2ZATA 1KSGA 3NOVA 2BTOA 1BWSA 2PVSA 2YRWA 5ARDA 4ZZ2A 2O8CA 3KXLA 1OXMA 1D6JA 5ALZA 4MP3A 2AD5A 2OV3A 4JJIA 2D1SA 2GOYA 3N86A 4EB6B 4AJOA 2H7YA 3CUYA 3AY3A 2FY8A 3I9KA 4LGVA 1ZGZA 5TE9A 1RIFA 1F2UB 1MKYA 3FI0A 3MS7A 2ZZMA 3C3JA 1MC4A 2CVPA 3MTBA 1VL0A 2P7IA 3GT4A 3FHLA 3O74A 1UKZA 3FZQA 4JUIA 1L5RA 1UBNA 1E9EA 2M32A 2JEYA 3T0IA 5THQA 4UU0A 3I4CA 3S1SA 4QGHA 3I3SR 5T4FA 2QAIA 3RR2A 1XAHA 3ITKA 5BOSB 2BHSA 5HHTA 2B20A 3DTTA 3R6GA 4ROTA 3U5TA 1FRZA 1YQQA 5FORA 1G4HA 3I1IA 1Y9EA 2HRCA 2GRJA 2O7RA 4FSDA 4D9EA 5I7OA 2PUCA 2AN1A 1XC7A 1I2MA 2O0LA 2P4QA 3DMTA 3LKDA 4PLZA 3PX2A 4EPXA 5BWOA 1BMFD 3EEBA 3TXXA 3WV5A 4ALIA 4EVQA 3DQPA 3LBAA 2JLWA 5DM1A 2I7TA 1UMDA 1PTJC 3N39C 5GP1A 5E7QA 4EL5A 5BN3A 3WVNA 5JMOA 4U6QA 3THYB 1F2TA 3Q7IA 4RHYA 3H19A 2IH5A 1H4TA 4AJIA 3LHFA 2V4UA 3FNQA 5B7NA 4KQ2A 3ZV5A 4KIWA 1G98A 4FJ1A 4NV1A 5HFAA 5DCLA 1O9HA 3G6WA 4TT3D 5IZCA 2Y68A 1JMKC 2GM9A 5A7GA 3VU9A 4BMZA 2PSHA 3C85A 5CPFA 1EFCA 4II3A 4ZTBA 4MWSA 1BVUA 4F4UA 5FPTA 4MV1A 3RFTA 3B9RA 3H0KA 1R5NA 4EHKA 1F6BA 3TM5A 3WYFA 5CCEA 3F4LA 3VH4A 1WNTA 1LDBA 1MR3F 4G9GA 1MQSA 3EIFA 5DHQA 3VNAA 3MFQA 2Z4RA 4YDHB 5LP6A 5DKFA 3JQPA 2KB0A 2QYSA 4W99A 1Z8FA 4DMMA 2QV7A 3RADC 4WY8A 3D3NA 3KB1A 1XNHA 3DLTA 4I55F 4RJJA 4KITB 1IJBA 4H7JA 4MEAA 4BWGA 2XTAA 4G5SA 1AK1A 4TUYA 3A1SA 2XT6A 1JQJC 4V3CA 4Y6OA 3BX1A 5HS6A 3U7HB 3ETJA 5KCMA 3QOFA 5BN4B 3TD2A 1XZHA 1YFKA 3P5BA 1POXA 3QBVA 5CGQB 1H9AA 1YVPA 1LK0A 1W6RA 1J09A 2BMWA 2H57A 4B46A 3OPQA 3QKSB 2ZUTA 1GGHA 4RGVA 3CVOA 5CW2A 2F7SA 1UBMS 2B34A 1DARA 1PW5A 1R12A 1V8BA 1WS6A 2OD7A 3GVHA 3RWMB 2XOXA 1ECCA 3IAUA 4NBNA 4PYKA 4U0KA 2E82A 3I0MA 4FMCB 5G2OA 4ZEOA 1XI2A 4AWBA 4F2HA 3F5FA 4X00A 2JFPA 4EUSA 5LXTB 3SXUB 1MT3A 3SYKA 3ZDZB 3JSAA 3WIEA 2GYYA 1A7AA 2WZBA 4C89A 2RKBA 3NKLA 3P26A 4C4AA 4EF4A 4Z49A 2VQEB 4EARA 1G21B 1XTRA 1UXGA 2CLFB 3BMQA 1L7VC 1CUBA 5I9SA 2JFQA 4FXOA 4DV6B 5E8RA 2IC5A 3TKAA 1Z6PA 1W49A 2VPIA 2J9FA 3EWIA 4HDRA 3GLFB 3NAQA 1M6WA 2I4NA 2GLTA 4UNIA 4J0GA 3RFVA 4DYHA 5CLLA 3CLTC 5JRDS 2Z09A 5JZBA 1ZUNB 4DDMA 1FRFS 1TU4A 2WWFA 2ZJ7A 4NECA 1GTSA 1E2JA 2DPMA 3W9SA 1RPAA 3J80A 5JUWA 1RZ3A 4X24A 4FGSA 3DONA 3KT3A 1JW9B 4NJMA 4LBZA 4MUAA 1EX7A 2Z08A 2DFVA 2XB9A 4CF6A 4QARA 2XKKA 3K4QA 3KJNA 3LHSA 3RVKA 2QU8A 1TD1A 1JLLA 2CE2X 3GHHA 5B1YA 5DIFA 1IH8A 1EM8B 2A1IA 1KPHA 3OQVA 4LF8B 2EZUA 2NU9B 3G85A 4JNKA 4NMHA 3SAJA 2Z30A 2GO7A 3SNHA 3WNCA 2QJWA 2X0RA 1FU8A 2NUTB 5BW5A 1J1IA 3R3HA 2O8VA 2C4HA 1R0CA 1YI8A 3QVJA 2XMGA 1SG9A 2UKDA 4YA6A 4KKVA 5ICMA 2X6TA 4X6XA 5TGTA 2PXXA 2ZRAA 2FPWA 2QQEA 4OKNA 3H2ZA 1KWGA 3WE7A 1X1BA 1BCSB 3HNPA 1PFKA 3W7VA 1T5OA 1X80A 4X1IB 1VJ1A 4LX0A 3OPNA 5JYBA 4CM9D 1DVRA 3D6FA 4YRQA 3C6ZA 4KPFC 1AZTA 4CHGA 3WGGA 5FA8A 4L0MA 2X3YA 2IYSA 2I2XB 5JATA 2I2DA 3NBMA 2VHUA 3LKVA 2R25B 4MEJA 2FKNA 4Y2HA 3QKRA 4DY4A 1Q7EA 1B23P 1K8RA 1LBTA 4N3AA 4MKGA 1XPOA 1RZVA 4IV0A 4OXIA 5ICGA 4WKPA 4IO1A 4KI0A 1XKXA 2GPAA 2DHEA 2XECA 4DQUA 4DJ5X 5HSGA 1MGOA 2HRQA 1THZA 2WHRA 3BL8A 1O6FA 1FXWA 2VYNA 2ZVQX 1KR5A 1VSUA 2R1VB 3FVRA 4OA8A 3PUWA 2AR0A 2R2AA 3FVTA 3GZTB 1CERA 1XZCA 4L57A 4OK3A 3MMNA 5JNRA 2AFIB 2EQ5A 3U7RA 4U5QA 3W8DA 3ZZMA 5KNLA 2AJDA 1W85B 1E89A 1N6NA 1SZJG 1XF1A 2JDID 3A6FA 5H83A 2FUNB 4J4HA 3K5HA 4UU7A 1WUYA 4GLLA 3B13B 1B6RA 2X6QA 2Q9UA 4R7GA 3L8EA 4HV4A 3TJRA 5J5CA 3WYAA 1I32A 5KYVA 4DDTA 3KQLA 5MFZA 1QLJA 2ENUA 4WNCA 2WP0A 3HBNA 3WQBA 1OYVA 4CKCA 4D9GA 4AZTA 2IX9A 1I1NA 2R6R1 3W5CA 5G0UA 5JXJA 1ISRA 3UAGA 4EK9A 2QTRA 1R6UA 3EZ7A 3LCMA 3WYDA 2AKYA 3IVRA 3CC8A 3IIIA 2PLAA 2X9LA 2QGFA 3RQSA 1A95A 3RC3A 2O0HA 4GR9A 1N2BA 1K2VN 2JAQA 2BI7A 2WIGA 2XADA 2YJ5A 4KC0A 2AQKA 2XWPA 1EAMA 1MXFA 3EK2A 3NETA 3LDFA 4AJPA 2BKVA 1TVKB 5AW8A 4BNLA 3PUJA 1NOIA 2VN8A 4X5OA 4BBPA 1KS9A 2G8NA 1ENOA 2E18A 3B1YA 5ICEA 2BJWA 1R2QA 2A5DA 2HWXA 3FX2A 3M8KA 4QGFA 4N5IX 4XJXA 2O6LA 1F8UA 1PNOA 1YK0A 3L8ZA 4M4SA 4Y2XA 2RJ3A 3QSGA 1PI3A 4ID9A 4YFVA 1VHQA 1JDBB 1M1UA 2PVCA 4KH0A 1LTQA 2AMVA 4UVIA 3LPNA 2JLYA 1XVAA 3OEED 4A1FA 1AQLA 1GAJA 4Q7MB 3DAGA 4LK2A 2PMWB 3ASUA 4UD2A