4MJ7A

Crystal structure of the pin domain of saccharomyces cerevisiae utp23
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
QKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of Utp23, a yeast ribosome synthesis factor with degenerate PIN domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords rRNA-processing protein UTP23
total genus 51
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04900 Fcf1 Fcf1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4mj7A00
1BGXT 1V8PA 5L6LB 5ECDA 3H8JA 2WP8J 1TAQA 1UT5A 2HWWA 5H4HA 5HMLA 1RXWA 3TNDA 1EXNA 2LCQA 3QE9Y 3H87A 3ZDBA 1TFRA 3H8WA 5ECYA 1V96A 5SV2A 1TAUA 2BSQA 4XGQA 3QEAZ 3H7IA 5K8JB 3ZDCA 3ZDAA 5HP4A 1UL1X 5ECWA 3I8OA 2H1CA 2IHNA 2HWXA 3DBOB 4CHGA 3ZVKA 3Q8MA 2IZOA 2H1OA 1UT8A 3Q8LA 1MC8A 2HWYA 5HMMA 3ZD8A 3Q8KA 1Y82A 3ZD9A 1W8IA 5ED0A 1V8OA 1RXVA 1A77A 2QIPA 3H8SA 3QEBZ 2DOKA 3ORYA 3ZDEA 3IX7A 4WA8A 2MDTA 5HNKA 1XO1A 5FV7A 1B43A 4XGRA 1O4WA 5L6MB 3ZDDA 5H4GA 1YE5A 2FE1A 1A76A 4MJ7A
chains in the Genus database with same CATH superfamily
4QAJA 3EOZA 3OCWA 1G98A 1SVSA 1H9BA 3BJIC 4WNAA 4AJNA 1ECLA 4A2PA 3I9NA 1AKUA 1CHNA 3P20A 3FLBA 1O5OA 3O4VA 4PGFA 2XDAA 4EPWA 2H4ZA 2WF5A 5H1YA 4MP8A 5EMJA 4ATNA 3KWMA 1JHMA 4M36A 1JILA 2IUUA 2IV2X 2QPOA 2DEUA 3SAJA 3SZMA 4BQSA 1Q1ZA 3HV2A 4FU0A 5D85A 5BSRA 3SX4A 3UENA 2C07A 1SH7A 2JIQA 3LUAA 4LN1A 4ZTBA 3RQIA 3LDHA 421PA 4BMDA 5LN1A 2AK3A 1HSZA 2EJUA 4Q6WA 5EJ8A 3JYOA 1J39A 1U0EA 3F2IA 3IVRA 4WLUA 3W9BA 3THXB 3F4LA 1Q50A 4IILA 1QGUB 4US1R 1PDWA 4L5IA 5AM3A 2C78A 2VPYA 1QRDA 2QUZA 4FYJA 4HP8A 3TNJA 1CU1A 1AN0A 2SCUB 2YVKA 3EISA 3JQ8A 4Y2TA 3WHLA 1SUIA 1N2GA 2GARA 3HPQA 3VYRB 4ZO6A 2DHRA 5AKIA 4BN4A 3ORHA 1VRVA 3LOQA 1P5RA 2KLBA 2AQHA 1RQXA 3K20A 1F8YA 1VKJA 5I9MA 2X77A 3WGMA 1H2EA 1XELA 3BXXA 4M76B 5T5QA 2ZI7A 2Q0SA 2X5OA 2EEZA 1N2XA 4X6LA 3Q8WA 4X91A 4B48A 1SCBA 1CUHA 4BN0A 4E6EA 3C1TA 5KVSA 3ZQ4A 1VE9A 4YJDA 1IN4A 2BI4A 2IA5A 2QD2A 4MGHA 2XT9A 3RVDA 3VZQA 5KUTA 3CRZA 1TKAA 1I8TA 4CMIA 1EFDN 4LQLA 1D4AA 1LPNA 1QHSA 5CNJA 3MT9A 2NUPB 2RK4A 1XEAA 3TAUA 2Q3JA 1EGMB 2QTNA 2AI1A 3MAAC 1V2GA 2GD1O 4ME6A 1G21E 1N92A 3LX6A 3HDGA 5CM8B 1E2PA 1Z0IA 1JHXA 2QX7A 3IVXA 3NBUA 3O92A 3VBEA 4B85A 4OG2A 2IYQA 1BKYA 3CMMA 4EJSA 3FVQA 4AY2A 2G08A 4YK7A 4E1BA 1N57A 4JWTA 4N9WA 5CCDA 5IKEA 2WHQA 2G5TA 4KWHA 2ZIZA 4S0ZA 3LBNA 3E9MA 1ZI6A 2HDNB 4L16A 4EDHA 3GMSA 2OL4A 4DBLE 2AI2A 1IONA 3TSCA 5KQSA 3ST7A 1A9OA 2I66A 4U63A 5I4BA 1P4JA 3NAGA 3OT4A 5IEBA 3SZGA 1BS9A 3VTFA 4HB3A 4PG5A 1XOIA 4ITVA 1OC2A 3B3AA 4UBOA 3RBXA 3IVGA 1L7DA 3WHKA 1CZHA 3ZHXA 3AJRA 2A8YA 3MW8A 4FC7A 1HRKA 4OFZA 5J58A 3WX0A 4RYDA 3PP8A 1A4UA 3U0BA 4IV0A 3AUAA 2GD6A 2J5RA 2YZ7A 4R68A 5JZOA 1P6UA 4Q4AA 4IQ0A 1TVMA 4BLOA 2PMBA 5HCNA 3P9XA 4PAWA 2QW0X 1IQ0A 2JF0A 2QRMA 2GNPA 3NIBA 4YAJA 2HSEA 2JJMA 2C5GA 2XNKA 2DULA 1P2DA 3VO1A 1E20A 4FFLA 1WZNA 4JK3A 1FUIA 2PWAA 3U4HA 4CKBA 1ABFA 1WXWA 2BW0A 1Y4ZA 5LA6F 4WA8A 1BE1A 4HWRA 4ZQBA 2CLHB 3GMIA 1XFDA 3AUFA 2P2GA 3R0ZA 2FSVA 4EG8A 3HKEB 4W7IA 5DSTA 4ZOQI 2IF0A 4R1MA 1Q0PA 2QZPA 3AKYA 4LE1A 4G5HA 1VLJA 4QG7A 1G60A 1WNTA 3ZXUB 4Q93A 2HH9A 3HC7A 1GPDG 2BGTA 3LA8A 1IOLA 1NXXA 2FR8C 1WB9A 2V65A 3G0HA 5EG5A 4TQUS 3EEIA 1O8BA 3RFTA 1ISSA 4HNQA 4IUBS 4CM9D 5CB4F 4G0UA 3LWNA 3ABQB 3ENVA 1P18A 2CLCX 2GN2A 2HYIC 1EFCA 2ZVJA 1KP3A 3QLEA 1PD1A 1YMQA 4FR5A 3DLIA 9LDTA 1ZEMA 5ALLA 1GSIA 2QL7A 4FHGA 2W2OA 1LB1B 3G0DA 3ZQKA 5B2FA 1MC5A 3PZRA 4UMFA 3T3PB 3TQIA 4ESHA 1NW4A 3NUZA 1AKMA 3RUFA 1WABA 4GM1A 2ZE7A 1KFJB 2IXDA 1I0IA 2ZUFA 1E2JA 2X6TA 1IULA 2IGBA 5B55A 3H99A 4XLLA 4EKNB 4JP8A 1FDRA 1Y80A 1JSCA 3VR5D 4DIBA 1NPDA 1XZJA 2E4ZA 2YC2C 1P91A 2YBEA 2W48A 4RX1A 4WMLA 4OUDA 3EJWA 4HGQA 3ET4A 1CJUC 2FZKA 1GU0A 2REQB 3MN1A 1RQRA 4HDNA 4KLZA 4ON9A 1JJBA 5EERA 4D0NA 3SBXA 5JAMA 4Y2GA 2X7JA 4XWOA 2Q41A 4MO9A 3FA2A 3A6LA 1WCV1 4NBLA 1A9XB 4I1VA 5A1JA 2FJ0A 2W90A 3P9CA 4DTCA 1UBTS 1N5LA 1MO2A 2EG9A 3HYNA 3OZDA 4IS3A 2FEMA 4N0PA 4QLOA 2RD2A 3E1GA 5T6BA 1D4ZA 1KVUA 4U5XA 2WICA 4DB4A 2O5EA 4K9MA 4EY5A 3JQCA 3A06A 1K08A 4IIJA 4Z5XA 3TFOA 3SP1A 3K6SB 2WKWA 3IUMA 4XDGA 3ABZA 1QZ3A 3EXG2 3OUZA 1XTSA 5C31A 1A69A 4KQIA 5FBKA 3CF4A 2TMGA 3UAXA 4OAPA 1I01A 1UMKA 2JA2A 3JQRA 1NJFA 3K0BA 4BMSA 2RSLA 3A6GA 4X1YB 5EKXA 4B2IA 3TIVA 3LCRA 1YAJA 1E1MA 3QKUA 1X8XA 3WLFA 1KOGA 2CXQA 3F0TA 1F6WA 1HX7A 3IKMB 4AC9A 1XXHA 1MT0A 3AXSA 4PIPA 1AB5A 4TROA 3TIGA 2XZOA 2AG1A 5FHQA 1PT8A 3VHQA 1FYDA 3ZV6A 1S0UA 2EWVA 2JVIA 3HVKA 2G7MC 4OFXA 5E0OA 2XVXA 3QTLA 2I34A 1MG5A 1ZIOA 3AWDA 3QYJA 3CZQA 3OQ1A 1M73E 2HCFA 3Q7SA 2B2XA 3S2UA 4AJJA 1N7JA 2OOSA 4GSLA 4OPMA 8OHMA 1CC1S 2QLMA 3IVCA 3NJRA 1RVV1 1W2GA 3K6RA 4WV3A 5CTAA 4HVCA 3VUEA 1HURA 2X76A 3DO8A 4KRXA 4NCJA 2A1UA 2NXCA 1FUKA 2H4YA 5I4CA 2BHSA 4BPBA 3E4CA 4GP7A 2HJHA 3W5JA 3QLVC 1A7JA 3RC9A 3QV1A 2H2HA 1K4MA 3TZ6A 3U7QA 2ZP1A 1JFSA 4CI9A 4UUMA 1F2TA 2V3CC 2FSSA 1AGPA 4PPQA 4YVFA 2JLZA 3EZNA 1H23A 1NQXA 2PTHA 4KVGA 1M2JA 1HV8A 2Q99A 3MA0A 3IXMA 4W9NC 5COQA 1GLNA 5DXJA 4ZRNA 3TE6A 3RBZA 3W7BA 2R1ZA 4KQXA 2BHTA 4YACA 2XYPA 3A28A 1W35A 2PKRA 1M6HA 4B4VA 1XAGA 3FOFC 1QG2A 2PU5A 2QDKA 4UUBA 4W99A 4DEYA 1QK4A 2DPHA 1QK5A 4ZT7A 5K7SA 2PUGA 4KIWA 2RHTA 5E3JA 3SHFA 4OSEA 4FXPA 3BE6A 4JIGA 3RS8A 1EM8A 4QHTA 2VDOB 5EHNA 1II8A 4KDFA 2ZYHA 4MRPA 1DI0A 4J9UE 5KU1A 1CNEA 4RS3A 2Z6UA 4LRUA 4D0GA 3H2JA 5DKFA 4QGFA 1KYWA 2VXOA 3Q0EA 4YJ3B 4XCVA 1VE5A 1JLLB 4BO9A 5HRAA 2WFAA 1WNFA 3QQPA 3QKSA 1QH1B 2P4HX 4OQEA 1CJBA 2CMGA 1DRJA 1DWQA 2B1RA 2E2WA 2JFVA 4N01A 4XFJA 5CVJA 5DSXA 5KJFA 3GR6A 1R8YA 4LDRA 2GVZC 1OWNA 4MXDA 4P84A 4Q1BA 4BAUA 3OZWA 4TYMA 4IR7A 3ZGLA 1U2QA 4C0HA 5LZ4A 3AI1A 2NQTA 5ECWA 5AKJA 4GYWA 5FJJA 4F2HA 3ZZTA 2GFHA 2ZKIA 3EAFA 3HCOA 3U80A 4A0HA 4M46A 1EUCB 2W2PA 3N87A 4RTLA 4C5CA 1V9CA 2MSEB 5FRDA 2O2GA 3EZ7A 2YHAA 1FRFS 2ERXA 4EFKA 1NQAO 1W9HA 2WHEA 1XQ9A 2NVBA 4LTNA 4R1TA 5J2TF 3OQIB 3SFTA 4MUIA 5IDXA 3NKFA 2JNWA 4LMAA 4Q39A 1DBWA 2GS9A 3AW9A 1PR2A 3K2EA 1H3EA 5EJ2A 1KJIA 2A9QA 1E5LA 4A8JA 4FM9A 3C8MA 2V6JA 3NH6A 1WB4A 2NZYA 2BDTA 5EHIA 4MUYA 5E6UB 3ZZNA 2OVBA 5B1EA 3W8RA 4IWNA 1MTZA 4HCJA 5AKYA 3MBKA 5I7VA 1TO6A 4KIJA 3GRRA 1HE2A 2Z2ZA 3AFHA 1K9VF 4R1NA 4F72A 1SUPA 1L7BA 4YMHA 1N2CA 3GGJA 5LMCA 3QMVA 2QDXA 1RTTA 3OECA 1XG5A 4IEEA 1L1QA 1U4NA 1RXSA 4PYQA 3AJ8A 1HEUA 3HMKA 5EUBA 4KJZA 1Y3BE 1F7UA 1PWHA 1Z38A 1T3LA 2GN8A 2YVQA 3OAAD 3AKCA 2ZSDA 5DW0A 3N2KA 3HLYA 4ZIRA 4RDXA 1VBKA 3PPVA 1Q2UA 4F5YA 3ZHZA 1HDOA 3TXYA 2A2ZA 1Q1AA 4L0MA 1VCOA 4WOBA 3JSAA 3MB8A 4L72A 1M76A 1TVKA 2D00A 3NHPA 4PZEA 2FPGB 3WI7A 1RZRA 3EXFA 3LXRA 5EJAA 3RS0A 3HTXA 1ICIA 2P9QA 2JLUA 4N6OA 4QDOA 2IYLD 2NO4A 1JX6A 4KOAA 4QM7A 2IITA 1G59A 1E3EA 2ZM5A 2PT6A 4MA0A 5CT9A 1W85A 5ERYA 4QD3A 3GROA 3QUQA 3RW9A 4RIIA 3UAOA 5C8ZA 5T8KA 1U1DA 2VJAA 4I3FA 4F11A 1AH2A 1OV6A 3U4IA 5HVNA 2ZIGA 4OXQA 3FPFA 1K7YA 2D1YA 2IP1A 3KUDA 4HB4A 1NW8A 1E2UA 4HAZA 1YI8A 3NM5A 3MMXA 4FFWA 3BRWD 2JFXA 1ZM3A 3QMPA 4WOJA 1ZNXA 4Q4HB 4ZEWA 2YIJA 1BDIA 1DX6A 3I2FA 3T35A 1B16A 3EAQA 3EC2A 4UXIA 3D8BA 4BFCA 1JS1X 1M75A 2WOOA 1R4MB 3WHIA 5JQWA 4IVRA 1ZD9A 1TGVA 1GUFA 1VZ3A 3A6EA 3HBAA 5CX4A 3V80A 3S55A 4ZRMA 1Q57A 3WAGA 2J0SA 1DIAA 5D5QA 3EGEA 5CVVA 2GHQA 4E5DA 3N6XA 2D2FA 4OBBA 3DDNA 3GEBA 3E22A 3S2ZA 1Q7BA 3ENWA 4ROTA 3N2IA 2NZ8A 4PQGA 1R9NA 2IYVA 1GQQA 1CY4A 1E9EA 1H6BA 4J90A 4UHJA 2POQX 2GCOB 1SD1A 3LKDA 1YBVA 2HMWA 1SVWA 4OK5A 1CDZA 3T7IA 2OXFA 3VR2A 2FUCA 4YV2A 4FOTA 2EEPA 2HM7A 3PSHA 4KQWA 1FNNA 1TYBE 1OR8A 1NIJA 1Q6ZA 1DSSG 4EYSA 2OGSA 3P9RA 1V3QE 2H7YA 4PZPA 2LZ0A 2ZFUA 5LXTF 1M1XB 1XKQA 3A14A 1LSJA 4RE6A 5H4GA 5JE8A 3KQKA 3HEAA 2HRRA 2WIFA 2GRJA 3EAGA 4V1CB 1HPLA 4R2WA 1CZKA 1L4LA 1JIJA 4P53A 1DKUA 1EWTA 2O2CA 3H87A 2FMFA 2DWPA 2QU7A 2B9EA 2FF7A 1QRRA 3CO5A 4H2DA 3KUKA 3MXTA 4KRYA 3N3BC 4GZ6A 1USWA 1PSZA 1H2RS 1HEYA 2WV9A 3FDZA 3OPVA 4IIJF 5JTTA 3GJ8A 2XNDD 1GGHA 3DDOA 3DD1A 4IOJA 3ZWDA 5G0UA 1M2OB 5K05A 3KJEA 3R3UA 1JDJA 1L5VA 4I4IA 4N7BA 3T3MB 1YBAA 3ZW7A 3FPGA 1II9A 3DFUA 3HCAA 3I72A 5KAMA 1FS6A 1H6AA 3U1VA 4L8YA 1WBBA 1XMVA 1H4SA 2ZBEA 3K92A 1UMBA 1YE5A 2NNLD 4FEYA 3HY6A 1VE1A 2R25B 2Q5CA 4MUAA 4DANA 4DV2B 2GBCA 5A5EA 2OXTA 5D87A 1A2BA 3MG9A 1S1MA 3LT0A 4DR4B 2ZQYA 4BVLA 4G97A 1OA0A 2NSHA 4Y6QA 3L4EA 2PE5A 2FHPA 1PYDA 2ZPUA 1IOZA 1UXGA 3C3PA 1RHKA 1TGYA 2B1GA 3EHEA 3HVUA 5EMMA 1AO0A 3O8RA 2DLCX 3TR6A 4IUYA 1U80A 3D6MA 4KQCA 5KYTA 1CHDA 2QRNA 1JQAA 3GZTB 4Q3OA 4D81A 4ENTA 5KVQA 2JDID 1IWPB 2ICAA 2MYNA 5H02A 1LQ2A 2N46A 3DMPA 1WBDA 4N1AA 4CQMD 1V25A 2UZ0A 4YMVA 1VPWA 1XZHA 3NVDA 2OCPA 4I50A 5CB6A 1O9HA 2P8JA 2VPTA 3I4CA 3OE5A 2OHIA 3I5MA 3X1XA 5MN4A 4FS8A 5CDYA 4KJXA 1P4HA 2PRSA 3RYHB 4IDCA 5B2EA 3ZEIA 4QDTA 4HAWA 2OGUA 1HTWA 4C3OB 4UXHA 1W8DA 5CW1A 3DMHA 1U90A 3CXRA 4YREA 5I7RA 4G0YA 4JSTA 2UXBB 2P3LA 3CNOA 2H7VA 4C2BA 1DOAA 1ISPA 2QLNA 4N3GA 4HLUA 1X0XA 1Q1NA 3LVFO 3PFGA 3DR3A 3PRJA 2WUDA 3BAZA 3O7WA 4QPPA 3LQKA 1U0BB 1KL7A 1ZG3A 4YDHB 2D7DA 4LJYA 4D3ZA 4RVGA 2FB9A 1R4AA 2ZQZA 2PYZA 4HDMA 1W44A 1QGAA 4I8DA 4M0CA 1S2DA 1Z25A 2C4WA 2DPYA 4H27A 3RARA 4TXHA 5GV7A 2IY9A 3IH5A 4BHTA 4F9GA 3CZRA 4BFXA 2CZCA 4RAOA 3DL0A 4DXAA 1C81A 3H5VA 4XVUA 1GTRA 1FNDA 1RPAA 4C21A 4CMCA 5AJZA 4LIPD 1DO2A 1XZ8A 5A7FA 1SQGA 4QBTA 4FBMA 1F9AA 4TL8A 1L7VC 1Y7IA 3ISTA 1X7XA 4LXIA 1W9MA 2N0SA 3OU6A 5TARA 2E7ZA 3SNKA 5KYYA 2CDBA 1NV8A 4HT3B 1DAHA 4EO9A 1MXHA 1ZBDA 2DWCA 2PH7A 1BC5A 4UASA 3NJ8A 3ZDQA 4AJ4A 1HKHA 1P33A 1Z5OA 3L3BA 1DV2A 2IUSA 1YRLA 1JE1A 1ZJZA 1N1EA 4FE4A 4NENA 3BT7A 3CY6A 3BICA 2IYYA 5IBPA 4JKIA 3G7SA 5E4JA 4M9RA 1R6AA 4RKFA 5JDIC 4OXNA 1SG6A 2BL4A 3ZXIA 4TT8A 4QVGA 1UM8A 3DHYA 1DMRA 3NASA 4CN8A 4Z2AA 3JQQA 1T2VA 1Y63A 4WPGA 3WNZA 1ODIA 4N39A 4DNPA 2EC5A 3AL0C 2IWHA 1YHNA 3C1UA 1NT4A 3EG5A 3LH5A 3PEUA 1C7ZA 3DO5A 3LP5A 4G0PA 3FHCB 4P5DA 4IV5A 5DI9A 3D59A 1K1EA 3LPMA 2BEVB 1GZ7A 4JL5A 4GR4A 1ZHFA 4RPLA 1E8NA 1RM5A 1V1RB 2J9FB 2V97A 2WU8A 3OOYA 1TA0A 5H3HA 5TQVA 4JJKA 2WJ6A 3C6BA 5PNTA 3SDSA 2QIPA 3B5IA 3WWDA 1QIKA 3ABSB 1RE0A 3AVXA 2WVJA 4QYIB 2XWJI 3CEAA 3K0AB 4QTYA 3MJVA 3UEOA 1MZVA 2Q1YA 1BSVA 4LCJA 3KELA 3T5TA 4MKHA 2PKWA 1IXSB 4YX9A 3TEJA 1UBGA 4YRSA 3KLPX 2WJGA 5ICFA 1G17A 4DUYB 3VXKA 2OCXA 3IUEA 4A2CA 5EP1A 3IDOA 1S6YA 4CR7A 1NHWA 1M2EA 4BIIA 4MQFB 4PQRA 2NZWA 2MWMA 3LDFA 5K5EA 2H65A 5JNVA 4Q4JA 1WW2A 1BDHA 1Y33E 2Q3MA 2RB4A 4TUYF 3FKQA 4TS4A 3F7OA 1RRPA 2WAAA 1FTSA 5EXPA 1RYYA 4IEFB 5C51B 2Z9CA 2IT1A 2WABA 4JUFA 1BEEA 3AHJA 3L8MA 4HEQA 4GVXA 2AZTA 4FOPA 4ZU3A 3VZRA 5KHLB 1GADO 1VIVA 4TKVA 3UMMA 2ZB7A 3RT1A 4KQMA 1JEEA 1T4MA 1VCIA 1YCFA 3EULA 1OBFO 4OHPA 2IYNA 4QREA 1LLDA 1BX0A 5JCJA 4AROA 3E4DA 3GQBB 3RIYA 1C41A 1L5QA 1H22A 3A9TA 3D9QX 3UAVA 3PHGA 2KMLA 3B3JA 4HGYA 1KQPA 3W79A 1RYMA 4BVBA 5CA1A 2G09A 5CB0A 2QZZA 1GZUA 2QP3A 3M49A 5BRNA 1AN9A 2XB4A 5A0FA 4EK9A 1P8JA 3LUKA 4GOKA 2HRBA 2QMHA 3FCUB 4LK3A 3QVXA 1EWVA 1KFBB 2HA0A 2VS1A 4QOFA 4FQ5A 3WK7A 3I6ZA 1W36B 3UJ9A 5G0SA 2D2IA 2OV2A 4UCXA 2AYZA 2FUKA 4O2AF 4WKCA 5LVAA 3B13B 2COKA 4JUDX 4FWIB 1PEDA 1ZEJA 3V34A 4PO3X 4ZKDA 3FETA 3UMCA 4HYQA 4DY6A 4EB6B 3VZBA 1PQWA 5IN4A 2FLWA 1OIVA 4HQRA 4N48A 1AKWA 4G8JA 1K6MA 4AUKA 4AKIA 4P33A 1P19A 3K35A 1SXPA 1PFQA 4BYMA 1KYVA 2E6UX 3O93A 5EZYB 3FYHA 1NE2A 3A3OA 1J8FA 2CVFA 3SMQA 3SLGA 4D8TA 4EB8A 2AG6A 4L9RA 2A3NA 3I4FA 4OEHA 3L40A 2JI4A 4R05A 4CMKA 2HQSA 2FX2A 1SZJG 1LKZA 2KM1A 2VHJA 4RC9A 1F60A 1QC5B 3SR4A 2W42A 4WKPA 2JG3A 3LZ6A 1OZ0A 4WNCA 3WSVA 4OXYA 4R7ZA 5A7HA 3KB1A 5IT5A 2YXDA 1QP4A 3JARB 4ZVMA 3OO1A 5EKDA 1NQ5A 1P7PA 1ZLXA 3T4PA 3EGIA 1TCVA 2I76A 3CTMA 1H1LB 2HRQA 4F6RA 3V2HA 1ZCZA 2XMRA 3PFKA 5EMKA 2V96A 4WW0A 2ATXA 4O3FA 3RUPA 4A6PA 2PKQO 4WCFB 1UMBB 1R74A 1V1JA 2XA1A 4BQIA 4DSUA 4MR7A 4B1FA 3U1TA 3R9XA 1IEQA 2IZ0A 1OZGA 3T5CA 3HJFA 4N6GA 1SC6A 2LXNA 4PC2A 4JBLA 2KS6A 1Z6XA 1YT5A 3Q5EA 2EFDB 5K2OA 2F3TA 3QELA 4L73A 2JFBA 4BKRA 2JH3A 1CK4A 2YMLA 4WCFC 3BGDA 3SC6A 1XGKA 2VLIA 2Z2IA 2VNSA 1TD1A 2ZIEA 1GL9B 2DBZA 3TPCA 4B6OA 4RVNA 1T36A 4BQFA 2ZQ5A 4OCZA 1DQNA 1WXIA 2XTAA 4IGKA 2AOVA 1UP7A 1BVRA 1ICEA 4QU9A 5FJIA 3ZWWA 2JEYA 3OOWA 2ZUEA 4D02A 5TVGA 3K1TA 1ZINA 2WWFA 1ZM4A 1EAYA 2VJKA 5KNBA 1JQLB 3G2KA 4N5DA 2G0TA 1ARZA 2NN3C 1ITZA 1JIKA 5DU2A 2E85A 3IOYA 2GPTA 3W2HA 3WYBA 1NNLA 2I80A 4ZQFA 1U1IA 1YK1A 3F74A 2RFLA 1AQJA 4JYAB 3LXMA 3LG2A 1TF2A 1XNJA 4OBXA 5TLSA 4QUKA 3G2HA 5EKUA 3ND6A 2YWJA 3Q87B 5ALTA 4EI7A 5HPYB 5HOEA 1Z3IX 4TYNA 2YW9A 1UOPA 1EK1A 1E94E 1XDSA 2IV3A 4D41A 1L7EA 4Q03A 5EINA 5GTDA 2C4HA 4FW9A 1OU4A 2XEDA 2OD2A 2XODA 3B12A 2ZRMA 2JHPA 2PFKA 3GGGA 4MKFA 2OV3A 4C6RA 5K6TA 2VCHA 4WUTA 1R1DA 4E5YA 1U5BA 3EUWA 3TSZA 3W06A 4EA8A 3FCXA 3V8EA 4M49A 5TPZA 3B9BA 4Z54A 4HRAA 4IIEA 4UEWA 4WERA 5JLAA 5HSGA 5GIOE 2HW8A 2W8ZA 1F5SA 4J49A 3FZNA 2XMCA 4JR1A 1VP9A 2GNAA 3BULA 2G1AA 3M4XA 3VYTB 3ML1A 1R9MA 5C4GB 4DLZA 4XIJA 5CK4A 1RKXA 1Y7LA 3MVEA 4HNUA 1LBIA 5HUJA 3CA8A 1GV1A 4H9GA 1RXVA 1XZDA 4U8GA 1RWNA 4J0EA 4PLFA 3WLKX 4X64B 3ZJVA 2BGIA 3MTIA 2XCSB 5TMBA 4ZCIA 4R5HA 3AUYA 2HLDD 3BYZA 1G7RA 3GLHE 3OZAA 4PYMA 2WWIA 3PJFA 2BZSA 3R8XA 5C8VA 4PYKA 1YK0A 1IHXA 1T1IA 3JARA 4NTZA 2Q2NA 2P1ZA 2Z9BA 3CH4B 4S2EA 4WN9A 3J7TA 3ZH2A 4E08A 3TX6A 5HQ3B 4II7A 3FHOA 5COAA 1X3LA 4DEVA 4IINA 4QGAA 4CF7A 1J9GA 3W5VA 1L8AA 2J6BA 3IL2A 4HWSA 1HM5A 4AG5A 2YJ3A 4LPKA 5AVKA 3SD7A 1ZJ6A 4N5IX 3PU6A 1FU4A 4XSHA 5HQTA 2V3VA 3GLIE 4Y1FA 3C6YA 4M1ZA 4D4GA 1YFZA 3NNNA 3DMTC 1KXZA 2H63A 3SR3A 1QKIA 3B20A 4PHTA 1MJNA 4MI3A 5E6UA 2BKVA 4U9IS 4QTTB 4WBNA 1DKMA 4DREA 1ORWA 5E95A 2E0IA 4NMXB 5TY0A 3X1MA 1MB0A 3CG4A 5JPIA 2QX4A 1Q1QA 2NU6A 4PFKA 1X1TA 4R2IA 5DGTA 3HP1A 1KI8A 4JA2A 3MQ2A 4RKWA 2HLHA 4PWZA 3AC0A 5FLYA 1FFAA 3E58A 4AO8A 1F2UA 3DVLA 4JQCA 3M4JA 1N33B 1XQVA 5I9NA 2PEZA 4PYNA 4F2WA 3GLGE 1AZLA 3ND7A 2J7PD 1L9KA 4MYHA 5GIPE 2BRUA 2XF2A 4JU9A 5D5PA 2J9XB 1GDTA 4F4IA 2ZCVA 2F64A 2OY0A 4HRVA 1PVVA 1XRSB 4AJ2A 4F84A 4XX0A 3UGTA 3D7NA 1LSSA 1W5TA 1ZW1A 3LQ1A 1JR3A 4XUDA 5SZJA 1PJ4A 5KHAA 3Q2OA 5BNTA 1NF2A 1RNLA 4NF2A 4G1MB 2QLLA 2XT0A 1OA1A 4HDSB 1R6UA 5TVKA 3VYSB 3Q0TA 1Z6YA 3FFXA 2O4CA 2OHFA 1JHRA 1JLLA 4UD6A 1PNRA 4CEJA 2DFNA 4CKEB 4TTAA 3TB6A 5EMLA 1YS6A 3CX6A 2NP6A 3CGGA 3KOOA 2MSKA 5CA0A 4ZJPA 3VKHA 4OVKA 4CV1A 1LBHA 3N2EA 2C59A 4HAOA 1CZLA 2FFHA 4RY0A 3FNIA 1W4CA 4BNFA 5GONB 1F2DA 3L1UA 3NC1C 4NJOA 4AWAA 2BKAA 2JLCA 4JH0A 3CB2A 5L3SB 2JFWA 1P62B 4S0XA 2OZPA 3LHIA 2SKDA 3NETA 3GZNA 4HNAA 5IH3A 2WTAA 4YCBA 1PJQA 4G81A 1R6XA 3VAYA 1U1CA 1YHYA 3MIIA 2XNJA 3FGOA 3OZXA 3TGWA 1W7AA 3FUVA 4XKJA 1JFFB 4DA7A 1PR3A 4IQ4A 1SCAA 4GMHA 3OPMA 5HQJA 2ETXA 3QBVA 4YJHA 3K71B 1AY0A 1AGNA 1TCAA 2OG2A 2XY4A 3JD0A 1LVUA 4PS1A 3TNFA 3X1ZA 3EQ6A 3FDXA 3SX0A 2WB2A 2J9FA 4HD8A 4K5QA 1O58A 1ZIDA 5FFNA 1GFZA 3MK31 4J8PA 1AF7A 4B82A 1KGSA 2B34A 3D8HA 4QUJA 3HKBB 4E15A 5B6IA 4DXHA 4C6SA 2YHSA 2B0CA 5F51A 1TYDE 2R6JA 2I2BA 1X13A 3EPPA 5CFNA 2QAGB 4NOMA 4KHZA 4OHXA 4DUGA 1R0XA 1OD6A 4K3VA 4PLTA 3WK5A 4YQFA 5B7GA 2V7EA 4Q1CA 3NGLA 4L9SA 4RHCA 4B3BA 5KREA 1WD7A 2G17A 3Q88A 1R8JA 4E6PA 3LGXA 1SVKA 1C1DA 4NCIA 4UTOA 3NBYC 2P2SA 1PO7A 4PRKA 2YDXA 3VUFA 4MTLA 1HYEA 4XGNA 5JXIA 3GLIB 2IS4A 3HKDB 1TYCA 1QB7A 4WZZA 4E07A 2VOEA 1LBSA 4UM7A 1O6FA 1T34A 5COBA 4EHDA 4RTPA 3AKZA 1UJ2A 2G1JA 5KSWB 1U8AA 3ZYZA 4HPJB 1YJ8A 1PSWA 1WW3A 3G2MA 5AI6A 1L4YA 4KRGA 4ND6A 4KGVA 4RZ2A 5J59A 3TD9A 3BEDA 1HMPA 5DK4A 1FNBA 2HL6A 2WSLA 4Z9AA 2BCJQ 1FJ2A 2YFYA 5ALFA 2DUNA 2OBFA 3E81A 1N2ZA 2GYUA 5FI0B 1QOQB 3ZV7A 3M34A 2VJLA 1XDUA 1NR1A 1U8EA 2J3QA 1Y6RA 1U7PA 3D6TB 4G0XA 4Z1MA 1YIAA 2P6UA 3TMYA 4TWRA 2P9YA 2WI8A 3RF7A 1FZQA 1T5BA 2O7VA 1AMUA 1MOSA 2P2NA 2GM3A 3AI7A 4NCNA 4RJLA 1LUAA 4DDMA 3R77A 1MB3A 2CJFA 1XMJA 2EW2A 2G9UA 4KDEA 4C0AC 2IVZA 1MW9X 1HL3A 2H51A 4TXJA 5SY4A 1TU3A 5C53B 4CDGA 4B4UA 2I6UA 4DOMA 4FN4A 2RAFA 2N75A 4LXTA 4L51A 5DHSA 3QHPA 2BYTA 2JLWA 2QQGA 2ZRBA 1Z2NX 3CISA 1KVRA 1FFYA 1BH6A 4BJ5A 2GH1A 2G3YA 4UJ5A 5DASA 4HJRA 1P44A 1WLSA 2KW5A 1C9NA 4B44A 4CM7A 4MUJA 1QQBA 1FU7A 3DMFA 1BCSA 2BGWA 4GYYA 1DQPA 1VSUA 4XIYA 3GLHA 1IZ0A 5I7EA 3H13A 3C87A 1CUGA 2WU0A 3G9UA 4OH1A 2FWIA 1UJNA 1G8FA 4CM8B 1DHTA 2F9MA 2C88A 1NVUQ 1N2EA 2ADOA 2VDPB 5DPMA 4CYMA 1SIBE 3RAGA 1UDAA 4HOYA 4GI7A 4ZVOA 1MZPA 1F0YA 5JXGA 3KYCB 4FP9A 2IUFA 3ESAA 4IVNA 3L1HA 1H3FA 4OU5A 3LHSA 4PSAA 2BR5A 1I1OA 2I2XB 4M8KA 3G2LA 4TT3A 4AJEA 3D3WA 2O59A 1YL6A 3BMQA 4M7PA 2UU9B 1JH8A 1P1CA 2PZJA 2VH2A 4UAGA 2PGDA 3EXHC 4NFHA 9ABPA 2Z6AA 1W0JD 1DARA 1ADFA 2VJBA 2FQ1A 1EGAA 3WGZA 2JC3A 1EZ1A 2XRMA 4DJFC 1L8QA 3OAAA 3PQ4A 1H2BA 2W5UA 4C3ZA 4C07A 3TQRA 2O2JA 4BLUA 4KPYA 1R4ZA 2PAFA 2HSWA 3P4YA 3PEVA 3HP4A 1RVDA 1XXLA 2QP4A 1A1SA 4JITA 3DEHA 3EXHB 4KYTA 4OK6A 4G4IA 5E3HA 5JD4A 4H0NA 5JASA 1DAOA 3BSSA 3L4JA 4H60A 1O0BA 4RFSB 2QLBA 3U3DA 4JP2A 2VDUE 4KX3A 2H1LA 4PAMA 1B7GO 1FE8A 3RO7A 1QQ5A 1I0LA 5FNZA 5C81A 2AZ4A 5LB4A 3D8UA 1OFUX 2W71A 1MX9A 3KKEA 1U7WA 1D2RA 2D5IA 5JCOA 4LOKA 2XIQA 2VWQA 4CT5A 4Q7QA 1VL2A 1DRUA 1NMSA 1UOOA 2CXPA 5AOAA 1IDN1 1W6UA 2QV7A 3QWIA 1FFXB 2R7AA 3KTAA 1W93A 1SCKA 4CKWA 5FBWB 2GM5A 3RK0A 4DG8A 3AI2A 4POOA 4WKGA 4HQKA 2JFZA 3WRYC 2NT3A 1COWA 2P65A 3WO0A 1KEKA 4TOIA 1UJMA 4BTEA 4MW0A 1UBHS 1HDIA 1Z33A 2R6HA 3NDRA 1WA5A 3H75A 4LOAA 2XB9A 2BPOA 2BCGY 1UBLS 3PR3A 3JALA 1XD2A 4MS3A 1W36C 3AM1A 1EA7A 5EZQA 4C89A 1WIWA 2EZ8A 4EW1A 1ZH8A 2H2IA 4UBJA 4R1QA 4X6YA 1EP3B 1GEEA 4MRNA 4PVCA 4BKMA 4ZCRA 4MJ7A 1QJ4A 1WB6A 4YDRA 3DZJA 1DX9A 1T9DA 4ZTUB 5HKLA 3RRFA 1EX1A 5CMLA 1ND5A 4DIOA 2V03A 1KS2A 1ZKMA 4A0SA 1KI7A 4ZGGA 5JH7A 4CF6A 1LDBA 1G8KA 3AB3A 5CCEA 1XQXA 5CGZA 3I2YX 4L4UA 4OUKX 3FMOB 2C5AA 4MR8A 1VJ0A 3KRTA 1X77A 3QVVA 3SF0A 1OFIA 3EY9A 3O83A 4RJIA 4S24A 3RFXA 3W6OA 3WYNA 1EE1A 3QBDA 1P9LA 2P69A 4F1JA 2HPVA 5I7SA 4Y6OA 4DLXA 1E0SA 2B21A 4ODIA 4AW9A 2NO1A 3RGWS 4Q4CA 4NLLA 3RS2A 1VG9B 2VYQA 4MIEA 4EM6A 1Y5IA 2JFPA 2VP9A 2ZRLA 1OSNA 3ETNA 4XM0A 3ZNQA 3E9YA 4BP3A 1U2PA 5C8DA 3C5HA 4QU8A 3LP8A 3JQ8B 2DMRA 4UZFA 1P31A 3LKBA 5A5DA 2JIMA 4NCBA 4DIFA 4UMVA 1G42A 2UAGA 1MQSA 2M98A 2DH6A 3VU8A 4NDNE 2LTAA 1RLIA 4Q66C 2JRLA 3EXAA 4WZBB 2VXCA 5DIZA 3AX6A 1BA3A 5FIUA 3T1VA 2V7GA 2VATA 3BOSA 3N2YA 4FMDB 4TWAA 3H9QA 1QFZA 3QBTA 2PNJA 1TK3A 5DW3A 3RABA 1YL5A 1MEOA 2QN8A 3B6JA 3ZKAA 2ZS9A 3AOGA 3IUBA 4OI4A 1V43A 2ZI3A 1UPFA 2IHTA 4X63A 3FPAA 3CUSA 1U2DC 3C3DA 3KQPA 2EBFX 4HNGA 3FOBA 4ZCSA 1E0KA 3ZE8A 5KQMA 3I9FA 3IODA 1E9DA 4HGNA 4ZCPA 1U2EA 2P77A 3IP1A 4F1WA 1GVHA 4PC6A 4XH9B 4LY3A 1JAXA 2Z43A 4Q15A 3O1IC 5HYVA 2OBXA 3QF7A 3OTOB 4JP3A 3N07A 5AW5A 5TMEA 1KYXA 1WDLA 2PANA 3STHA 3EIUA 2Q3DA 2R6FA 3Q3EA 2PSSA 4ARUA 1BO6A 1CBUA 2QR5A 3C41J 4LDAA 4DDVA 1X1AA 4NYJQ 4FHFA 4K6OA 5H9WA 2CJWB 1IN8A 1CY6A 4FDVA 1QORA 3L8YA 4DV1B 2BMJA 4Q1DA 2K2WA 3B1WA 4AUEA 4BS9A 1NUHA 5DBFA 2D2VA 2ZJ2A 4R2HA 5K0SA 4X00A 5DNVA 5JARA 2BZGA 1WF6A 2FW8A 4G4GA 4X24A 2YWRA 4OB6A 1YCHA 4BRSA 4BY9E 2XZLA 2GCEA 3U3XA 1HC7A 7REQA 3WL5A 4K28A 1EPUA 2QXYA 4O2BA 3G9XA 1K0UA 1GUYA 1QPZA 5J43A 3PWKA 1UADA 3IBYA 2EZTA 3EHDA 1VPDA 4L6AA 4RKEA 4DMMA 1MO6A 4G0WA 5M2QA 2R00C 3N7TA 3QVGB 2BN4A 4RHYA 1U8CB 1AQ6A 4DARA 1EQAA 1UPBA 1XN4A 4O08A 1N77A 4DLKA 4EABA 1I3LA 4C6TA 3H7IA 4AJLA 2ZZNA 3DJYA 1O96A 1JF8A 4LBZA 4NU8X 1VMAA 3RVOA 5EIFA 3LCUA 3PGJA 3HJAA 3DMDA 3VHXA 2EATA 2CJWA 2PZ8A 2H8GA 1DAKA 1F1BA 4R8SA 1FF9A 5I7WA 2VHYA 1GXSA 2EW1A 4OYYA 2UUOA 3GOQA 1UXKA 1ZWLA 1Y42X 2ZYAA 3ONFA 3ZIDA 4I19A 4BNIA 1ML4A 1KJNA 4MDYA 1YS7A 4GF5A 1FDIA 4BO2A 1UJ5A 4TQ9A 5H82A 2I2AA 1EK6A 1R0BA 2FQQA 4HPXB 4L4ZA 4HWKA 1P80A 3LHKA 3ADBA 1YR8A 1M34A 5K8VA 1DEHA 1GO2A 1Q1EA 2DLDA 2Q6IA 2QN3A 3D4BA 3D6HA 3P2IA 3E2PA 3PLRA 1S9HA 4WSOA 4WY8A 4YRFA 2AB0A 4BNLA 1K6JA 1JKIA 3I39X 3K2QA 5EZ6B 5E9WA 1QOZA 2CDAA 2O9JA 4QFBA 4B46A 3OIFA 4F5EA 2CWDA 2P1RA 1ZMXA 3PJEA 1B0UA 4WZBA 5HZMA 2WM8A 1DRWA 1L0BA 2JZNA 2ZW9A 4JLAA 1PGJA 3DPSA 3NV7A 3PRHA 5DYNA 2JFGA 2VK4A 1A7UA 1O9GA 1TFRA 1NU8A 2HA5A 1EFVB 2R7MA 4C14A 3GYBA 7ADHA 3CPJB 5DCYA 2F9LA 1WXFA 4CCSA 2GBIA 1RRKA 2WIDA 4FOOA 4CMGA 2PQMA 5I01A 5FR1A 1NUAA 2H0QA 2OPBA 1HFEL 5AICA 3DLCA 3DFFA 1N6KA 1JG1A 1MQ8B 2VWGA 3TLCA 2GM9A 3U0VA 1QR6A 1U3DA 1OAOA 3BWBA 4YWHA 2Q3CA 4AP5A 5JISA 3WC4A 2F48A 3MWYW 4JI8B 3QBEA 3TQSA 4B6RA 2GN6A 2Y68A 4EP1A 3S1AB 1KY2A 3HWSA 2MOKA 4LJ7A 3RRYA 1HFWA 1Q22A 3KKQA 3K0SA 4WACA 3DD5A 2P35A 1I7DA 2B8WA 1TTPB 4D2IA 3QE9Y 3O0DA 2QUHA 3TUIC 4LW8A 3AETB 1YZKA 1BN7A 4GT1A 4LCBA 3ADOA 4OMCA 3L7KA 5DYIA 1P81A 5SZIA 1OASA 4E5KA 1N7GA 4X0EA 5HZGA 1QIFA 1NXSA 3N5CA 4X66B 3B36A 3EMBA 3KZMA 1O6ZA 4U2BA 1P2GA 3OEED 1H8HD 2PY6A 3MS2A 1XEWY 4DNOA 5H81A 4EB3A 2XUFA 4FBLA 3I5YA 1SHKA 1XBTA 1SMKA 2YHIA 3QEAZ 3D8TA 4GWGA 3SK0A 4DV6B 1INLA 1OZAA 2AL7A 3CONA 1O95C 4AIRA 2GILA 5KVAA 1N36B 3B7WA 4FOLA 3GCGA 3AB8A 3VO9A 1AZTA 1KRWA 3OZGA 2GXUA 1WF3A 5JAQA 4HATA 2JGJA 4J2HA 2N1MA 2O3SA 4HSGA 4NX2A 5DOVA 4MHTA 5FOWA 5FH9A 4FZ5A 4R71A 1EP2B 3LW8A 4OLJA 5WRFA 2L19A 1X7YB 1DOHA 5JBQA 1SBYA 4PN3A 1U04A 2XAUA 3SEQA 4DCGA 2HXYA 2ZS8A 4MYUA 1DUSA 5HE9A 3GPBA 2CUKA 1QX4A 4TSFD 1UWCA 2OAQ1 1ZP6A 3NAZA 3C74A 2QSJA 4HLCA 2PNFA 4MVJG 1P7CA 3GWZA 4YYZA 1EHIA 4O4LB 3TPZA 1GQYA 1I7PA 3SVLA 1GGNA 2HO5A 4ZMSA 1NXQA 4D57A 1FPMA 4LDPA 4DG9A 1XZMA 4DQKA 4DSOA 2G5GX 1FLNA 2GD2A 3WYAA 4CGZA 1JI0A 1GZ3A 1XTRA 5DULA 4CLXA 1O4VA 4AF6A 1OREA 4N5LA 5CFZA 2VT6A 4YRQA 4E32A 3ZIAD 3VR2D 1SQFA 5JAIA 3W8FA 2G1PA 4IDQA 2PQ0A 1GR1A 4RIEA 5GZ3A 1B6TA 1FMCA 2CFRA 3IP7A 1R0LA 3LF1A 1R0YA 2H4XA 5CLQA 3TLXA 4ER3A 2C7QA 3WWEA 4MRAA 2BHLA 2VHUA 3EGOA 2O3JA 1WEHA 4ENUA 1IMOA 2PBLA 4ASUD 4NJMB 1KI6A 3ETCA 1J99A 3ROKA 1VA4A 1LRLA 4B47A 5L3RA 2VHEA 3FUXA 3KP1A 4MUHA 4EUHA 1YZYA 5DLYA 3E7FA 5L6MB 2O14A 1V4VA 4LSWA 4V2UA 2ACEA 2NXJA 3IELA 2A58A 4HAXA 4QHYA 5CLHA 4A92A 4F38A 1Z18A 1E18A 1QH8A 2QZJA 3EUEA 2DY0A 3JZFA 4Q3BA 4EF5A 1Z68A 4JQZA 4EY3A 1HDZA 1U0FA 2GKGA 3G8CA 4V38A 2O8BA 1TL7C 5ILOA 4HTFA 4V03A 5K6AA 1RMQA 2E6KA 1N9GA 2R1TA 2XVYA 3IULA 1RM3A 1SOMA 2OXRA 3ETDA 3KQWA 2JHFA 2YHBA 5CYPA 3RT7A 2XTNA 3HCPA 4MINA 4D5EA 2EL7A 2AFIE 1LNZA 3K1AA 3BRSA 4R6XA 5U1PA 3LY8A 5D2CA 5IBCA 5JS8A 2NG1A 4ENRA 4DUZB 3ZD9A 1W5AA 2DXIA 1Z83A 3IAUA 1LRJA 4KMSA 4A16A 5LMZA 1C50A 1LF5A 1T4GA 5F78A 1ESZA 5J2TA 4K0KB 2DBQA 4JOSA 5C9ZA 3SM9A 5CYOA 2ZPAA 3ZW8A 4Y9SA 2EFCB 3IOCA 4MV3A 3HBNA 4Q00A 3ET5A 1Y3DE 1XRPA 1MQAA 2GHRA 4D99A 5A04A 4OJMX 3DXFA 4IICA 1JLRA 2WSSD 2C2KA 2QN9A 2A94A 2GYYA 2ONYA 3ER6A 1L8XA 1DS6A 3IJRA 4HWGA 4NZPA 3VJKA 2AWNA 3SIRA 4CJXA 3QFFA 1ZU5A 1MORA 3VM6A 4YR9A 5E2AA 3EYAA 4L08A 2PZGA 2BELA 2H57A 5AVRA 1P1RA 3SYTA 2J9YB 3HU3A 1UPCA 5HHTA 4D25A 1U9CA 2W37A 1SCQA 3JASB 4IXTA 4LJ6A 3T7RA 2PVPA 2YZ2A 3NP9A 2IS2A 4JC0A 3VVLA 3P32A 5IJ9B 1DC4A 2ORIA 2DX7A 3F7NA 4K6MA 1BH2A 3JVVA 3R6TA 4C05A 5LXTB 5LZ9A 2ZUUA 5AVSA 1JECA 1W4ZA 3TTSA 1H2FA 3L7IA 5EIEA 1FDTA 2FKAA 5A6SA 4M1EA 1RBQA 3IMFA 1KY5A 4FFBB 1ZFNA 4D82A 2HA2A 2PRIA 1A98A 4J6EA 3GLSA 2X0KA 5KTPA 5A9SB 3SQWA 2MMGA 3VSBA 4LF4B 4PO9A 4WJKB 2RGNC 1FOEB 3A36A 1ORIA 3Q7EA 4L0DA 3FDJA 1RAAA 2QT9A 2J5XA 3KYJB 3KKOA 1V16B 4BVKA 2Y1EA 3HFSA 3QX8A 1RQLA 2W98A 2VDLB 1Y8AA 2GA9A 4O2AB 1KU0A 3RVQA 3V7UA 2IU6A 1P4GA 2WK1A 3DUWA 5HG0A 5GPBA 3ZU4A 3FUTA 4YJHB 3GFFA 3F5SA 1G5QA 3AFOA 2WWWA 3ZHUA 1X1BA 1RRMA 3RH0A 2BMVA 5B58C 4Z9BA 2BFBA 4PRZA 2FOIA 3WDLA 3N0VA 3RTCA 5LQAA 3PTAA 1C0EA 4DCPA 2XCQA 4O4HB 3QKRA 1QHHA 2LD4A 2XZDA 1UANA 1F51E 5JXWA 2ON6A 3F4BA 1YFLA 3CSDA 3SJ7A 2D5AA 1QG4A 3GL9A 3AH8A 3H17A 2CLKB 3QVLA 3ZE7A 4BBZA 2AVNA 4ZGWA 4IQ8A 4N5MA 5BYAA 1GVNB 4H7HA 3ZS9A 1LEHA 1JG2A 4KYVA 4V39A 3LE8A 2OQ2A 3VHXB 1VM6A 3V3KA 3IAXA 3C39A 4PQEA 3T52A 1FQOA 3UOAB 2JFFA 3GHHA 1Z7GA 2J87A 3PRYA 2EDAA 4I6EA 3K70B 2OVFA 1XTPA 4K9DA 1RHRA 3KVNA 1OX5A 4TLAA 1FDVA 1C3OA 1WUTA 3NG1A 4TV8A 3TIIA 4UM8B 4KXNA 3AIMA 4DIUA 2BFCA 3AZOA 4U7WA 1JA0A 1AD2A 1NRIA 4KPGA 3RPEA 3RS4A 3SI7A 2DHEA 4G1FA 2GMWA 1XTQA 2F3UA 4EARA 5D3ZA 3PUXA 4BFVA 3PQEA 4Q4DA 5A3JA 1H1TA 3L8GA 4MKZA 4KQEA 3ACBA 3R76A 1U2DA 4DL9A 1YQ9A 2OV8A 4QOSA 4R8RA 5B53A 3A6JA 1IBCA 1OFGA 3D5QA 3MOGA 5AMXA 3ZWNA 1UKYA 4FUTA 4KVZA 1Z0UA 2HA3A 5K3FA 2BT4A 3WYDA 1QIHA 2ATCA 3P9SA 1GKUB 1J8YF 1AOXA 1U1EA 3AR7A 3R6WA 1RDFA 3E8SA 2ZE6A 1MV8A 3CUKA 4WBNF 2JAXA 4QXRA 5IKMA 2WPNA 4CF3A 4EYKA 4JMPA 5FA8A 2NXWA 3OLXA 4AZWA 3GP3A 2L0XA 2RG7A 3B2QA 4I0WB 1NDHA 3U7IA 5D01A 4F8JA 1KTIA 2R751 5KTSA 3WWPA 3DBOB 3G0CA 5J47A 1YO6A 3ILVA 4YLGA 4FYKA 2QGFA 4F9FA 3DAFA 4M1KA 4RMGA 3R5XA 1W4LA 4OU4A 5KTMA 2C4TA 3BH7A 5E3IA 1NW9B 3WRVA 3CEHA 4XTRA 4I3GA 3EQ8A 3W3AD 4M8NE 1AS2A 3N28A 3RRBA 1T5OA 1CY2A 1ECPA 1TIPA 4Q7KA 1M5UA 1NXOA 1XL1A 1SIUA 2EYQA 3CNQS 1E1YA 2QW8A 4ZI5A 5JI3E 2R1VA 3NPAA 3KJNA 4LQCA 2I3GA 2FMXA 2J7PA 4JLPA 2O1SA 3W1EA 1JL3A 2ZR0A 4DMLA 1PP4A 1ZUNA 4WESB 3T12A 1E7YA 1PKEA 5AVJA 4U7HA 3TQFA 3QSYA 4A6XA 3IE1A 3DKPA 4RXUA 5EC8A 3KU1A 3LQYA 2ETVA 4CFSA 3UJNA 2ATEA 3OZCA 2WSIA 1S2MA 4IFEA 3FYSA 3NEPX 4AS2A 1IM2A 4RCYA 5AW1A 1JQ5A 1L5NA 1P60A 1AF4A 1XHLA 1YI1A 3V55A 5ER9A 1Z8NA 4V0KA 3HDTA 4ZVUA 4YQEA 5SYNA 1HG0A 3NWPA 4CIAA 2CB0A 4CR6A 3KPYA 1MRZA 2C3OA 1JDPA 5ARDA 4DJ5X 2XDQA 2OCBA 1I14A 2TMKA 1C30B 4LEIA 3VJMA 2OHHA 4KXVA 3TKLA 5LYJA 3JR3A 3MEQA 2WQ7A 2GF0A 1U9ZA 5KKNB 3KD2A 1F3LA 2ZJFA 3G1UA 3KXIA 2C2BA 1E8DA 4ZVVA 3D4LA 1MAAA 2VNJA 2FYTA 1YNOA 2IXBA 3NHJA 3ZY4A 2CJPA 2Y4NA 3DPUA 1GT91 2R8OA 1YUMA 4DMGA 4BRUA 3EMVA 1KTVA 3QX3A 2DUUA 3K8OE 3P0JA 3A9UA 1OKKA 1JWAB 1SOAA 2GUWA 2PUJA 3QLTA 1MV5A 3OKAA 5HIIA 1BGXT 2C9BA 4GHWA 4OP3A 4Y67A 3H0KA 4EVIA 1I13A 3GELA 4MP3A 1LXCA 3S2EA 4F2GA 3RAEC 1RI1A 4GNKA 2ZBQA 4IH4A 6NULA 1D0SA 3EIWA 1E9RA 1YS4A 1H2WA 1LZLA 5KOJA 2Z8YA 3WWCA 2ZATA 4RTNA 2XQGA 3U3RA 5EI5A 1VFNA 3SE7A 1MX3A 4QWWA 4EUSA 2F4NA 3HDQA 4H7KA 5CIYA 5FLKA 3GLKA 5JSHA 3R7WB 4W6ZA 2ZSBA 3K16A 521PA 2OZKA 2J41A 2FN3A 3AR6A 1YH3A 1W30A 2IU4A 4PBTA 4X5OA 2NV2B 5KKAA 3REQB 2IRWA 2W6NA 2XQJA 1OX4A 2UUPA 4QNNA 3ZCXA 5F98A 3HU5A 4RSRA 4HNHA 3GK3A 1SCDA 4JNKA 3CNLA 1T1RA 4MRMB 3EODA 1KBQA 1IHDA 2AYYA 1QGDA 3IVMA 3AK4A 1PJ2A 3D0RA 2I6GA 5DP2A 4RORA 5CFLA 3BMQB 2DWOA 1LK7A 1P39A 2IIPA 2O3UA 2PFSA 4JVSB 5G0WA 4DB2A 1OKKD 1RXUA 1EVQA 1H9AA 3IQEA 2RBEA 3KYCA 5H3LA 4EWLA 3JAWB 1N6IA 4M1QA 2JFQA 2PEYA 4Q24A 2XKAA 3GPLA 4WAUA 4R8VA 3TW8B 2J3MA 1R6BX 2P2CA 4DDKA 4DKJA 4E21A 1SEVA 2ARKA 2AN5A 3IQZA 3DGEC 4I1YA 2DKOA 3OMLA 1H5NA 3DTYA 1ZR2A 3RVLA 4DZTA 3O5AA 4LBVA 3EXHA 4X6UA 5IHXA 2G5CA 5J2UF 2V74B 4RANA 1OGIA 3N2LA 1TC1A 2B61A 2V9CA 4UNIA 4DQVA 2NADA 4C3VA 3S40A 5BY2A 1BCSB 3PSAA 1X9IA 2RHMA 4RNCA 2QQEA 4EA6A 2IYOA 4PO1A 5KJ6A 3K6KA 3OU2A 1J2YA 3N2NA 4ZHQF 4GDMA 1I2ZA 2JRCA 4HMPA 5FAKA 3P0EA 4GOJA 5FO1A 4FIDA 1GIAA 3UICA 5KU7A 3KVYA 2AKEA 1KK3A 2QVLA 1SU4A 2D5BA 1LA2A 3KC2A 1ZLYA 2VL7A 1GZVA 1FSGA 2XDYA 2Z6VA 2GPAA 4EPVA 2WZBA 3GNSA 4C7MA 4Q9HA 1K2VN 1NUSA 3CUYA 4CCYB 4E7PA 4ZQHA 3E5RA 1E4EB 4MA4A 4GYKA 2M32A 3WGLA 1G5HA 1I2DA 5ITZB 1NTRA 1QF9A 1P9NA 3IEXA 3GLHB 4X61A 3UZUA 2PL5A 2QMOA 1IRIA 2MCFA 1JG7A 4EHKA 2OSBA 1P1FA 3AM4A 1K2WA 3DQPA 3ABOB 1P4SA 4AVYA 3MHTA 4KFTA 3PNPA 2YHIB 1KPHA 1IJFA 3NXKA 1QYCA 4YMTA 1JHOA 4D42A 1SNYA 3QHQA 5GWXA 4HX9A 3HKDA 2EZUA 2VHCA 5H7XA 4YXFA 3LUFA 2PHZA 1DADA 5F2EA 2IEIA 1FDWA 4QTXA 1Q92A 4E30A 3S28A 4ECEA 2ZWPA 3D3EA 2QI9C 3DT6A 1MABB 4KNVA 3OZBA 1Y4DE 1KDOA 3K9LA 4H7DA 2JH8A 5IUNC 3M70A 3VI4B 2RH8A 5JS2A 2NZXA 2W6QA 1BHQ1 3OJCA 5IBQA 1OFHA 5AVUA 3I32A 2VZ9A 2QG4A 3NBZC 2CFOA 4AQYB 3LBHA 1F6DA 2LWIA 1ECCA 4UBLA 2ZT8A 2RIRA 1KIMA 3KJXA 1KDRA 3EIOA 3NHRA 4I1UA 4BEWA 5HOQA 3GLQA 2G36A 1JEDA 2PMCA 3HCCA 4HL6A 4QOGA 4QX6A 1W4BA 2D06A 3UKJA 4HUQA 4B31A 5BMVA 2YCLA 4Z4HA 1XD9A 1PEAA 2V5VA 2ZUWA 3GLIA 1Z37A 3GT3A 5IJAA 3GJZA 2XUOA 1O97C 5DH9A 2VC2B 1YA6A 5FBRB 1DQRA 2ES4A 2YZGA 2ZXUA 1G7TA 4NBRA 2UZAA 5A4FS 1ZUIA 2GF2A 5DGXA 3ZVRA 3RJZA 2H1HA 1FLVA 4PPGA 4WNYA 4E2XA 1Z8FA 1KSGA 2WF9A 1NQOA 1ONBA 3OZTA 1JZTA 2VP0A 2QAGA 4G2NA 4QOIA 5BQXA 1IU9A 1FL9A 2WAOA 1HOTA 5AHOA 4FLMA 2Z5VA 4DLLA 3PHIA 4GR9A 3HKBA 4BO5A 1MX5A 4MYDA 2XE6A 5CLIA 3TI7A 3D8SA 5KZMB 4DZRA 5FNVF 3ZZUA 4S1VA 5KJ1A 2HHJA 4AMUA 2NTNA 4HFRA 4XB6B 5HJ2A 4J0FA 4GICA 5BW6B 2F62A 1SY7A 2FZVA 4JLWA 4LJKA 5EIBC 1FSFA 2QV0A 2OYCA 5ALJA 1XTTA 1U7HA 5ALZA 3W5UA 4HYYA 3PJRA 1QIIA 2ODBA 3IDAA 1EFRD 3W77A 1WHTA 2CXXA 2VHVA 1PZFA 3QQ5A 1MVOA 1Z75A 4GKAA 4XI9A 1X7WB 2YY6A 3IV7A 4FBGA 2DECA 1TTTA 1IK4A 1Y5MA 3L4BA 2GI4A 3FD8A 4KDCA 4LVOA 4FX5A 2C2ZA 2IYFA 3VSCA 4OJYA 3X43A 4YR7A 1YIOA 2HFJA 4F2PA 2Z8YM 1A3CA 2B78A 2C9OA 4BMZA 1KQFA 1DTEA 5E7MA 4OGWA 2GEKA 1NBMA 1KMHA 2FRXA 3M1IA 1H3NA 1WWKA 3C3KA 3D2CA 4IH1A 4U6NA 4H59A 4TL7A 3DP7A 3RG8A 3NJ4A 3WLMA 5BWMA 4D6XA 4LHVA 4JBHA 4E11A 3PF8A 3PHLA 2AOTB 1MB2A 1GA6A 1KZ1A 1PRYA 1RQPA 1YKGA 1Z4LA 1KAMA 2HBYA 4Q02A 3RF6A 4JXZA 3FOZA 5B3LA 3SF8B 2JGRA 5FT9A 2JHGA 3LX4A 3O2JA 1RBYA 2NGRA 2VP3A 3L1VA 2CFCA 5LB2A 3AQIA 3GRVA 4AJIA 4KVAA 4YO7A 1OWOA 4JT9A 2VQSA 3BK1A 5FULA 4F4DA 4GWLA 1I6MA 3R3YA 4RHXA 2ZAMA 4TTRA 4BJ1A 3TUZC 3GJ3A 1NRXA 3D1VA 2VNHA 3AY7A 4L3WA 1TZ2A 1RMTA 4RENA 4CT4B 2SHKA 3FZGA 3MWDA 5F4BA 3TSYA 3KWFA 3BBLA 3HGTA 4D9NA 4DT1A 4XB1A 1JEOA 1DOZA 4YN3A 3V33A 3I92A 1JJFA 1VI6A 1GYQA 4BAZA 1CQPA 4MW5A 5HZHA 3WLSA 3PI6A 4Z4QA 4U2KA 1XZKA 3U3ZA 1Z2EA 4GI3A 3V4PB 3DOCA 1L4EA 1N6HA 3QOXA 4ZVTA 3V8QA 2B8NA 4K3UA 5IEJA 1VIDA 2NU6B 3FM9A 1D2CA 1NNUA 1VIYA 2DCUA 4CIXA 2YV4A 1N8TA 3CSSA 4QASA 3PUJA 1Z7YA 3KL2A 5AVWA 3A6ZA 5K3AA 4JXKA 2GA8A 1OVGA 121PA 1KAOA 1LSOA 2FMUA 1WUYA 3NVKI 1JDVA 1FU8A 1RXEA 3JV7A 3W8DA 5A4KA 5T3UA 4H4DA 3DDWA 2XUHA 3QNWA 5G0VA 3ZXSA 1S2LA 1E9AA 1QU2A 4ILEA 4I4TA 2DE0X 1ECJA 1GRRA 1VHQA 3NAQA 4RLSA 5DT9A 1A82A 4D8YA 5A06A 3OOEA 5B6PA 4AN4A 3ZWXA 3ESBA 1REQA 3HV0A 5DNUA 1V71A 1DQYA 2AKYA 3FOEC 3S99A 1R5BA 1Z4NA 2EG5A 4PZLA 4QELA 1W75A 5DI3A 3IT0A 3TLYA 3GJ7A 4RQUA 3DAGA 2G9RA 1DPFA 3KJQA 4HQLA 1PFVA 4UOQA 4XOIA 1TM1E 2FX3A 4BX0A 3U44B 1CYDA 1EJ6A 1N3YA 2FK8A 5TC4A 1H65A 3EQZA 3FSEA 4AQDA 4QVKA 3A11A 1XYGA 1EXVA 2FV8A 4F7DA 1ORRA 2QTLA 1KKLA 4MVCA 4RYLA 1M9NA 1IZYA 1GCAA 3U4MA 3EIHA 2P9EA 4WTOA 2WWXA 1QO0D 2PXCA 2V45A 2AYXA 2JLVA 3TGPA 3KEQA 3FYUC 1Z6GA 3ORFA 4WQMA 1ZL2A 5FV7A 4WJZA 1SC4A 2YN2A 3RHFA 3JR7A 4PPNA 3RB8A 5EL0A 5IC5A 5CCXA 4WFQA 4XD7D 1U5BB 1FVHA 4AM8A 2ZSUA 3TQCA 1D1TA 1ZD4A 2D5CA 3GRYA 1A88A 1WU8A 4EZIA 4RGYA 4B33A 2ZXFA 4CR8A 2Q3HA 3ZDCA 4UDYX 3EW9A 4XIFA 1EI9A 2R6AA 1B74A 3EFHA 5J40A 5IP5A 3S7ZA 4JEIA 3EFEA 4ZQEA 3U48A 4Q7JB 2Z2KA 1Y37A 4JP1A 3ITDA 3M83A 4OXIA 4QYXA 1BHO1 2VH1A 3VR4A 4IM7A 2VHZA 3HSKA 1FX1A 1JIVA 4XX1A 3DZHA 3E84A 4BMNA 2J0VA 1BRTA 2GCIA 1JUDA 2FRVA 2GK3A 1DBVO 2DUWA 4PIVA 2ZU6A 2E48A 5JFTA 3QLJA 3PK0A 4URFA 1VMDA 3D7SA 1SULA 4A0RA 3KYIB 5DI3B 4DHEA 2ST1A 2XAAA 2MR6A 1E66A 2GWRA 3D1LA 4BLQA 5A3QA 4OQLA 1B8NA 4E5NA 1DC6A 1Q20A 2PS3A 5HCIA 3H11A 1O08A 1G9XA 3QKTA 4AZ3B 3OE7A 3F67A 1NFRA 1UP4A 3DAHA 3VSEA 1T4CB 3HYSA 1EQUA 4HBZA 1OFTA 4DSTA 2VDWB 4RIHA 1VYUA 4M1MA 3THWB 4ZOAA 4G37A 2C00A 2OFPA 3GP5A 4MR7B 3R9XB 2Y9MB 4BDTA 3KSBC 4G1EB 4QJ5A 5FTKA 1JI3A 2OXEA 1XHFA 1YZHA 1ZU4A 1KBOA 3AR8A 3GEGA 2RH5A 3P96A 4RVCA 5D84A 5HM6A 3PC2A 3CRNA 4XCXA 4EB6A 4QKQA 1Y0BA 4OM8A 4MVJP 1J90A 4JI2B 1H2YA 2AWOA 2JGIA 4W7HA 4FQ8A 2XEXA 5E1DA 4YRLA 3HNRA 3TM4A 4OO3A 4F92B 3NV9A 3VHRA 3WIBA 4QUHA 1SUEA 4DIEA 1BFKA 3DUFB 4RGBA 4UDNA 5HGXA 5I7FA 4RTSA 2PAAA 1QC5A 2PL9A 3NPMA 4LSMA 1MRNA 5A0VA 2ZOSA 3IV9A 4JB3A 3VBCA 1ILEA 5EQFA 1MOQA 4KQ1A 1LK5A 3T3OA 2H0RA 4XCQA 3LVQE 2EERA 1U7UA 1V39A 2JFOA 4RF3A 5AVQA 3PPIA 4OAQA 1GGFA 4JBXA 3D02A 1TT5A 4JYBA 1EDDA 3BM5A 1CFZA 1T4BA 4MQEB 4TSFA 5G4KA 5C2JB 2VT2A 1EQ2A 4OBEA 1F12A 2CZQA 5B58T 3RSSA 2PO5A 4GPIB 4XPIA 5FL7D 2NSLA 3T3HA 3WP0A 3KQNA 3NUGA 5DIFA 1FTWA 5KX5A 3QOYA 4KXLA 3SHWA 2I6SA 4KBGA 5ELXA 4UCFA 3CZ4A 1U6IA 3ZE6A 1MP0A 1GCOA 4N4AA 3E35A 3I5AA 4MULA 3GAAA 5B1IA 1BCRA 1A5AB 5I6DA 1W4RA 1NN1A 3NHSA 2NU8A 3IB6A 4LJ4A 3NVMB 1DAMA 2AF4C 5KSYA 4K7JA 2PUDA 2FPXA 4B3DA 1NF8A 1E6KA 2LW7A 3UHAA 5G1PA 3D81A 2YN4A 1SAYA 4C76A 4YRZA 1YR6A 2J3KA 2Q8QA 1K5GA 1J22A 3T9BA 3WYFA 1D09A 2AOUB 2MSLA 1U9JA 1TECE 1BE8A 1TK2A 1S7GA 3L8HA 3T7TA 2BD0A 3NP7A 3WGTA 1F4VA 3M6LA 2O1WA 3I9OA 1LLQA 3DBLB 1QO0A 4G0MA 3IUJA 3HCFA 3Q41A 4RKRA 1WQ4A 3OIYA 1PJAA 3DQQA 3QG1A 1F20A 1JXOA 5BURA 5ED4A 1V1RA 1KZ6A 4GZMA 2Z0MA 5EXXA 1AHIA 2X0FA 3OA0A 1QDEA 1T2CA 2C20A 4RD2A 3CGWA 3Q3IA 1KKUA 4GL4A 2ONKA 3I42A 3OPQA 3I3SR 4CTOA 1KO4A 2ZVDA 3VU9A 4C7OB 2B20A 4REMA 5FUQA 3GFRA 1Y3IA 1RT9A 1PZXA 2Y0EA 1A9QA 3GJ4A 2C0QA 1NMEA 3M2TA 2G77B 4YASA 1YULA 4MGIR 4JJGA 2OILA 1CVLA 2B0JA 1GZSA 1KYIA 3OF5A 3FJYA 3GUCA 3FE2A 1UOEA 1V5FA 1O2DA 3I1FA 4GBMA 3L7JA 4JKYA 5ALIA 2CXTA 2IYSA 3FW1A 4AZ0B 4MAMA 1ISHA 2JJ1D 3CRVA 3RS7A 2IXFA 4BGIA 4ZEMA 2DFPA 4XSVA 4ZYLA 4DNQA 1XYYA 4QYIA 1CUFA 2HXSA 3OT5A 1V4BA 5DNWA 2YJZA 3ODGA 2OD9A 3X1KA 3HU1A 4DC1A 3COJA 3ICEA 5CDGA 3OMWA 1CQWA 1J56A 2C61A 2HPAA 4Q12A 3CVOA 4OGFA 2BBSA 3LYAA 3UQYS 1KNQA 3HACA 1T15A 2A67A 2W70A 2OZLA 2BEVA 2ACVA 3RNOA 4EI8A 1Z2OX 5BYKA 1E9SA 3H05A 1Z15A 1FEZA 3PLNA 1Q7GA 2UYQA 4YROA 5EEGA 1E96A 2WY2D 1K7FB 1HDEA 3DBLA 4KTVE 4CQLB 3LX8A 4REQB 3W9SA 1Y7PA 2JD2A 5KC8A 1MCZA 3IKVA 4QJ4A 4UMEA 1DDOA 5H83A 3C7CB 1Q3HA 2FSHA 3CLUD 1CF2O 4QFMA 3LUDA 3MCTA 3OZIA 4HNAB 3VX4A 1N4AA 3OZUA 4C22A 3OQPA 2MSCB 1ISRA 1FXSA 1H94A 2C92A 2W22A 5KI6A 4XWKA 1UIMA 2HHLA 3MINA 5ALOA 5JYCA 1A9XA 4WZAB 3S1LA 4ZI2A 3H8VA 3GLUA 2P0AA 3GJ0A 3GBVA 3KT0A 2RKBA 4PG6A 1ONSA 1KAHA 3A9CA 4IOKA 1Q14A 3WADA 3DWIA 4UFNA 5AK4A 4POAA 1R27A 3OM0A 2CMFA 3AVOA 5FR2A 4K26A 1DAPA 3I2KA 5AWFC 2VYND 2XXAA 4CEJB 3OOSA 4YMUA 1DJLA 2C84A 2QE7A 2BKLA 2XD4A 3IPXA 5H70A 2O0KA 3RYHA 1RC1A 5IVPA 5KYUB 5EP3A 1BGWA 2ZYDA 4MQEA 2YQ5A 2CHVA 4KU4A 2NU9A 5FWNA 2LR0A 2WF6A 3HSSA 1I2MA 4CMJA 1C9EA 2VQ6A 3GFTA 3FCAA 2UVQA 3ID6C 1DBQA 2GVDC 3QTTA 4LOIA 4X3CA 3TZBA 1KK0A 2D8AA 1D2AA 1W5BA 4UM9D 5AW0A 2AXPA 4H4CA 2O6HA 1GGEA 2PMEA 5F77A 3IBCA 4EOGA 1B23P 4FFDA 1M67A 1YQXA 3ETLA 1KOFA 1EJ0A 2R5WA 1YRWA 2Q1UA 2NU8B 3SSOA 1WXGA 4FMBB 4EAQA 4G8BA 1U11A 4ZEXA 3C8ZA 4YRAA 3GEMA 2D7JA 4OV6B 3RASA 3D6AA 5NLLA 2AXNA 2H1RA 4BV8A 4D9BA 2EL9A 1JB9A 2DPMA 2GN1A 2QLTA 3O1JC 3ND8A 3TNYA 4X94A 4HAVA 1NNEA 3E9CA 1J6UA 1H8HA 4GFDA 1OI7A 3BF8A 3LIIA 2H18A 2QNIA 3CN7A 3NO4A 3QU7A 3TSOA 1JLKA 3F8SA 3UJ7A 2F59A 2IZ1A 1DC5A 1JT2A 3X1YA 5F7XA 4C03A 2HSDA 4LZOA 2HK9A 3WGHA 1FQWA 1RYFA 4B83A 4I99A 2X8JB 1BJRE 3A05A 1H85A 5FEUA 1ADGA 4W8OA 4MQBA 3DDHA 3LAWA 4UTZA 5EJFA 1EUZA 4G4SO 4YYEA 3PQ6A 3T1YB 2KYRA 1Q0RA 3QA3E 3VDNB 2PR2A 1QLWA 4WZAE 2PUEA 7YASA 2JI6A 1RYZA 1NVMB 3FDZB 2ABWA 3GDOA 3TRHA 3ZWQA 5BQFA 3BH0A 1E5TA 5FTNA 3NBQA 1UF9A 4W63A 1Z2DA 1P7WA 2K87A 2ZPTX 1YC2A 1T0HB 4NY1A 4G5RA 1TMGE 1NW6A 1QH0A 1PEYA 4NCXA 3GD7A 3GCXA 4QDUA 5IUKC 3WS7A 1DO0A 1T35A 3ORSA 4B3JA 2Y6UA 3ZCSA 1DG9A 5BW8A 3UATA 1DKPA 1MVLA 2YXBA 1HOXA 1Q0SA 1RHMA 3U9LA 5JZMA 3QENA 4MS4B 1J5PA 4NZZA 4XLZA 4X3OA 2VJPA 2GCOA 4IGFA 5DLDA 3TZQA 5LQJA 4ZWNA 4MVJI 1JVNA 2LVBA 3UMYA 1P0MA 3EBPA 3AZPA 3F1LA 2G28A 5BWLA 4V0ME 5JWRA 5KQLA 4QRHA 2XLCA 2VQ3A 2R65A 1CDEA 3O8OB 3HDHA 3DS8A 3WGYA 4K6CA 4S1OA 2VPZA 1DTWB 1CR1A 3EVBA 2POCA 1SVIA 3JQ9C 2GJ4A 4FYMA 1YQGA 5DYWA 3PXGA 1XMSA 4RTMA 3EPHA 3TF5A 1R4MA 4C0QC 2HA6A 1BA2A 3D6UA 2OFOA 1BS1A 3C8UA 1WZ2A 4RSMA 2WD9A 4YMIA 4ZZ2A 3WMXA 3L79A 2IGTA 5JCOC 1T25A 1W0CA 4Q6BA 2BUBA 1QHEA 2B1QA 1GPWB 2HBZA 2A5YB 3QVOA 3UY4A 1YFKA 4MUNA 3FGPA 4IW3B 1P2FA 3VA7A 1J2TA 1PHPA 3NRCA 2I71A 2PXHA 1CUIA 1U98A 3ZVMA 1QO7A 4BB0A 2BGKA 3V7YA 3HJHA 1IHOA 1JP7A 4ZA2A 3GDGA 1Z7WA 1Z26A 3GZJA 4OLAA 5EKSA 5CVUA 3BA1A 2OCKA 3UC5A 2B82A 1MC4A 2AS0A 2Y71A 3I6YA 1PE0A 1A5BB 4W8HA 4KAJA 3O9VA 5FOSA 2L18A 3BTVA 3A9VA 3PNSA 3N39C 5TS2A 3UB3A 5BP7A 2V4MA 2YZKA 3Q15C 3WFZA 1HMYA 3EIEA 4MQLA 3AKDA 2WJ3A 4EI2A 1GNRA 1UZMA 4QZVA 1IK6A 1ZRSA 2QRZA 4WKBA 2A9PA 2PN1A 3H6KA 3QELB 5IXJA 3IKTA 3MLBA 3O4FA 1G5TA 1Z63A 4PYIA 7GPBA 1KR5A 4PFQA 5LU9A 1MJ5A 1N5MA 4PN7A 1ZUNB 1ZL0A 3QK7A 4M6WA 4NFYA 2DQSA 4L4SA 9LDBA 3FNGA 3PJGA 4GSKA 4PGAA 4K2AA 3TO5A 5L45A 2B36A 3I01A 1I4WA 4ARAA 3O4RA 4GUAA 2CXSA 2F1OA 3GA0A 3I9LA 1QAQA 3LA6A 3V1MA 3LC7O 1Q5PA 4TMZA 5E4YA 3WA6A 3COPA 4FB5A 1T0UA 1WXQA 2ZJ0A 3QU5A 3WTBA 1TZKA 1PG5A 2WT9A 4Z0PA 4ALIA 4TL9A 1RM0A 2B8EA 2EARA 4BE4A 4C1BA 2C7OA 5CDHA 4BTVA 1W29A 3PYLA 5TX7A 1XDDA 4BU0A 2ZSIA 1NMYA 4V0QA 3KOZA 4I6GA 4A4DA 3ED1A 3PGXA 4KGZA 4AQ7A 1EWRA 1N2CB 1ONOA 1R8QA 3CJTA 5IDYA 4TVSA 1FMTA 3ICOA 1G0NA 4AMGA 1GDDA 3AIIA 4UHEA 3WVNA 4ZV4A 2HFKA 2NAFA 5EE1A 1M8KA 2QL6A 4DC9A 5IAEA 3O8NA 5IAAA 1E92A 1J21A 3O4IA 5HIJA 3T15A 1BJTA 3P4XA 3R0JA 4H1TA 1NLMA 3M6WA 3OF2A 1ZGCA 1AK1A 5AOCA 3X0DA 3TFQA 3Q40A 4O8CA 1HSOA 3Q2IA 2YJTD 1IB0A 3N7AA 2IHNA 3ANSA 2VK8A 3UF0A 4BWYA 5KPJA 3FTFA 5DHTA 4BU1A 1CY7A 2WYUA 5DXAA 2C2OA 2DT8A 2HV8A 3OZFA 4FEAA 3T5BA 1MPTA 3WL3A 4BRZA 2Y9PB 1YONA 2B69A 2F8MA 1PFYA 3TRJA 2B6HA 1SB9A 4GIBA 3RROA 3U31A 1U8ZA 4D8WA 4MNTA 1CY8A 5DN9A 3NALA 3R4CA 3MSXA 3G82C 4HDKA 5MFPA 2OORA 1A27A 2XVZA 2NU9B 1UQUA 1WHTB 3ZC3A 4D46A 2OO5A 1DAEA 5H9VA 3HI6A 1IUNA 1Y8RA 2BP7B 3S6JA 2WU1A 4HF7A 5FQNA 4D96A 1TNDA 4B3RB 5AHRA 4YCNA 1E9FA 5J1TB 4QDZA 3V42A 4CUJA 4F0JA 4Z1MD 4W5QA 1ZIPA 1HNWB 4UU7A 4WLEA 3RYCA 1ZVVA 3PA8A 2NO9A 4J4HA 3D8NA 3CX8A 4FWBA 3NBFA 3G79A 1BAPA 5D5HA 3LYHA 1N6OA 1I7NA 4N3BA 3I3OA 2ORED 1II8B 4G84A 4H7EA 1W0JA 1ULAA 1HTBA 3LXUX 5D7BA 3ZR4B 1F0KA 3BIJA 5JQGA 1EFAA 4NXNB 3W34A 4CE6A 1K8YB 1R12A 1SOWA 4FX2A 4MQFA 1CQJB 4PSUA 1ZO8A 3UGKA 4E14A 3J81k 1V6AA 2X23A 3AEKB 1JHAA 3O9ZA 3GG2A 1X7WA 3PI7A 3QKRB 4TLDA 3P27A 3PGMA 4PXAA 1H05A 1UBMS 2Z2JA 3OC0A 4CGYA 1NZJA 2LCQA 4LKOA 5KKCA 5CX1A 3MTEA 4K9RA 5F9HA 3GFPA 1NI4B 3SHTA 1JR2A 3ZDAA 4N76A 4N03A 4PFSA 4UATA 4X85A 2WW8A 4GL2A 1XRQA 1TEHA 1JKJB 3R0IA 2X9GA 3N7UA 3TJMA 4B34A 2ZTVA 1B26A 4F93B 2QTCA 4Q82A 3HCNA 1TZJA 1B14A 1YVUA 1KPGA 3BWMA 4TLCA 3M89A 4EF6A 3R7SA 1E2BA 1FMFA 1CZRA 2FFRA 3KALA 4ZQCB 1YUBA 3JYPA 1E5QA 2JK1A 3BGOS 3PV0A 2VJOA 5K0GA 1E77A 1GYRA 1ZUD1 2OECA 1N6NA 1PS9A 2I2DA 3KHSA 4GG1A 4KNWA 4UUQA 2V98A 3UWOA 3NYWA 1Y6JA 5IXYA 1J23A 3SN6A 5CLJA 4BLTA 2FH5B 2ONCA 3TSAA 1Y7HA 1KYTA 3F7MA 3U6KA 2Q6LA 3STUA 1M1NB 3PHJA 4TWBA 2DM6A 4JJ6A 4UHDA 2C4MA 4QUGA 1NJ2A 3CNHA 3S3TA 3SR0A 4MKXA 2VNIA 5IJ9A 1KMMA 2IZOA 3QIVA 4YRTA 1PX2A 4FE7A 4DA4A 2RAPA 1XXHB 5ADVA 4CM9A 4GKJB 4N0MA 1FVOA 3I76A 5CHYA 3T0IA 2GX6A 3F9IA 1BRMA 3KZCA 4ND2A 3WZMA 5B7PA 1FW6A 2W6ID 5BYJA 1RPTA 1LGYA 4MI6A 2OLKA 1BVUA 4RQAA 2ODEA 4C0WA 3GZ4A 2OQIA 3AEQB 1GJRA 4C1NA 2EF0A 4NIMA 2QTWB 2Q9BA 2Z1MA 3GA5A 1ZHHA 3V8NA 1JDSA 5IJWA 1D9XA 4LCEA 4OI0A 1KQNA 2CNLA 3UUEA 2AOUA 2GM4A 4IDBA 1Z4IA 4H3VA 3BXOA 3TNLA 1OTYA 3PD0A 1W88A 1CUCA 3I9V1 1FFDA 1RKBA 2B7LA 2YWFA 4Y6PA 3I62A 3K31A 4L95C 5CYGA 5D6OA 4A91A 2O0LA 4GLBA 1GTJ1 2H48A 4DLNA 4X8HA 1DKQA 2FP3A 1GG2A 3PXBA 1KSFX 3R3WA 4RMJA 2ENUA 3HDVA 4EKEA 4RPIA 1EZ4A 2OORC 2ZYWX 5FI1B 4WN3A 3AERB 3ZWKA 3BZBA 4QQRA 3WSWA 4E5MA 5IH7A 1HLDA 1MXFA 3L06A 1PLKA 2ZTMA 1Z35A 3AHGA 4X71A 3DE5X 4KW7A 3P71T 4PPYA 1ETUA 5AM5A 4L02A 3REGA 3AHFA 4NQZA 3ZDBA 4A36A 4HLUC 4JZKA 1TAUA 1KY4A 4UM9B 4BC1A 2C1XA 5KNCH 4I50B 1D2MA 1TUIA 1Y3AA 2NACA 2KI5A 4FT2A 4Z99A 1EFRA 2REXB 3THRA 5AYVA 3PA6A 1KEZA 4EKDA 2XH8A 2WVHA 4E46A 4I1OA 1S9DA 4ER6A 4GDFA 3AT1A 3IIKA 3FWZA 1W2HA 2IH4A 3F6BX 4ZAXA 1SN7A 1W59A 1WL8A 2JBAA 2XNHA 1NMZA 1U9IC 2IC5A 4E4YA 1G5RA 2FSUA 3IO5A 2D5LA 1YJQA 2P40A 3FRIA 2P79A 4KE9A 1OFVA 1AK9A 3C4VA 3NTRA 3KHTA 3NM6B 2X4IA 4P92A 5LNK1 4DV4B 4FW8A 1P4RA 3DP9A 4O1MA 3RIHA 2V7QD 2AV6A 5EUCA 4OFBA 4LDJA 1ESEA 2XCTB 1DXYA 2C98A 3PENA 4GOXA 4GPAA 4GE3A 3BE8A 3AEZA 4QARA 2ODPA 4R9UC 3H5TA 4KN8A 4CKBB 2QTGA 3Q8XB 3ROXA 3SJUA 3Q7TA 1U2TA 2YJ4A 4D3DA 4QLAA 4P0TA 1GNTA 5IWCA 5MN6A 2B4TO 1N9ZA 2BBTA 1H1DA 1O3YA 1XDBA 2GR9A 3P9ZA 3SHQA 3BAFA 2AMVA 2CHQA 3EF0A 4KV9A 4R3UC 4EEZA 2DPLA 2ZIFA 2AZDA 3BXGA 3WL8A 3BA6A 2AN4A 1NY6A 3AL3A 4LXXA 3OJXA 1HRDA 1HE1C 1K6XA 1WV0A 3ONWA 3TVDA 4ZJUA 4JJAA 5EVCA 2GZ3A 1JKFA 2X5XA 4R41A 1R6VA 4CKCB 1U3GA 5M3BA 2C7RA 1ZN8A 3IAEA 1PJZA 1RXYA 2Y1LA 4Q48A 4UPDA 2WWVD 5JZSA 1NKTA 1WSAA 1X1RA 1NZDA 2K6GA 2PX6A 3TEFA 4BECA 3IPLA 2MT9A 3TBFA 2XHZA 1D0IA 1RMYA 2ZIAA 3EIFA 4HLDA 1WZIA 1USGA 1NBEA 3LJKA 3WP1B 3BK7A 4GPTA 4BNTA 1PR6A 2HSGA 5DP1A 4TN5A 5CPFA 1JBKA 1RI2A 1TCBA 1GKLA 2ZBFA 2I4MA 1RWXA 4TRNA 2Q7DA 4C7VA 4HVLA 3ZD7A 3A2KA 3HU2A 4RF2A 3S44A 2XYVA 2V0NA 3KKNA 1S2OA 1OI3A 1B43A 1R4NB 3NHYA 3V1NA 1DV1A 4PC1A 3FTEA 1KI4A 3FOAA 1TKRA 4QGBA 1C8KA 1NYQA 2ZREA 4Z4FA 1HQYE 5I48A 3V9AA 2ZBPA 5JAUA 1SCUA 1VFPA 2IOFA 1KNXA 3HVJA 1O03A 2YVAA 3L82B 4D26A 4QL3A 1RWWA 4JAVC 5GM1A 4CMIB 5ENVA 4LXQA 5EIXA 2GEFA 1HDRA 1WMSA 2G8NA 3LF2A 4ENQA 2DVMA 5ALGA 1CIVA 1Z36A 2F1KA 1ZGZA 2ENWA 2NX2A 2QRPA 2WJHA 1GPBA 3D6VA 4L5BA 4CIWA 1JB1A 2EGUA 4MB6A 3GGDA 1Y82A 3DEJA 2QMUA 3O3CA 4YRIA 3ZHOA 4YJFA 3DBIA 2OA0A 4MGKR 4J9VA 2BH9A 5KWSA 1K4KA 3LOPA 3T9CA 3H97A 4HMQA 3EXEB 3VNRA 2IXGA 2QD3A 4YI3A 2BF7A 2BFFB 1CQIA 1MFZA 4JLUA 3R41A 4Y1RA 3V8PA 2XDQB 1XTZA 4GR5A 2SCUA 4K9PA 4O02B 4F3CA 5KNCD 5L7WA 5CH5A 3CZMA 1EK0A 3H9BA 4J07A 1AU9A 2IUEA 3E5NA 4EIWA 1AQYA