4MJ7A

Crystal structure of the pin domain of saccharomyces cerevisiae utp23
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
b'QKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA-processing protein UTP23
publication title Structural and functional analysis of Utp23, a yeast ribosome synthesis factor with degenerate PIN domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 51
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04900 Fcf1 Fcf1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4mj7A00
1UT8A 3ZD8A 3ZDDA 2BSQA 3QEAZ 1W8IA 1TAQA 5ECWA 2QIPA 5L6MB 4MJ7A 5HMLA 3ZVKA 5HMMA 1A77A 2DOKA 3ORYA 3Q8KA 3ZDBA 2MDTA 4XGQA 3ZDAA 3ZDCA 3TNDA 1XO1A 4CHGA 5HP4A 2HWYA 4XGRA 1A76A 1V8PA 1TFRA 3IX7A 5K8JB 3H8SA 1B43A 2H1OA 3H8WA 1BGXT 3Q8MA 1V96A 5ECYA 1V8OA 2IZOA 1TAUA 5FV7A 1O4WA 3H7IA 2H1CA 2HWWA 1Y82A 5ED0A 3ZD9A 1UL1X 2HWXA 3ZDEA 5L6LB 3H87A 2FE1A 3QEBZ 1RXVA 3H8JA 3I8OA 2WP8J 1MC8A 3QE9Y 5H4HA 5H4GA 3Q8LA 2IHNA 1UT5A 1YE5A 5HNKA 5SV2A 1EXNA 3DBOB 2LCQA 4WA8A 1RXWA 5ECDA
chains in the Genus database with same CATH superfamily
1Y6ZA 3IV6A 2QT1A 4RNDB 2GFHA 4RY9A 5LA6B 3KVVA 2QRZA 4ALMA 5FUWA 4QJIA 5TNXA 1UJ6A 1EAYA 1Z7YA 2DGDA 3AR8A 3GUVA 3PI6A 3WI7A 2WHYA 1XEWY 2AC7A 4JJ4A 4M1OA 3D7SA 5IWCA 4IGEA 4R69A 2VYCA 4CBVA 1JDNA 3OD1A 3VBCA 1USUA 2BI8A 2DT8A 3RODA 5A6SB 2BMWA 2GAIA 2YICA 1YR9A 4RXTA 1E2KA 5EIHA 5I7EA 1FP4B 3OHSX 2IP1A 4I5IA 2B0CA 5KWIA 3RYCB 4JEMA 4PYOA 1RAGA 5AD1A 4U0KA 1WS6A 1YJ8A 1BMTA 1GZVA 4QM6A 3ZS9A 4BGEA 3UBMA 2BF4A 1CQJA 4RDXA 1MMFB 4EECA 1J0DA 3P9CA 2B94A 5BUCA 721PA 4XRRA 5DV9A 3QV1A 1G4HA 1TLFA 2WJGA 4UHJA 3WWZA 1TD1A 2IJGX 1AGXA 2HMVA 2ZUSA 3JZFA 3OTGA 2QUBA 2IWHA 5JDCC 1DG9A 1NQOA 1W5AA 3G2JA 3IRVA 3MCAA 4TYMA 3H3JA 1V3TA 3UCEA 2NU7B 3TS1A 4M9QA 1ORTA 3PE6A 3D6HA 2CMDA 3QY9A 2WVGA 3V7WA 3K20A 4ZARA 1J09A 2ID7A 3RYIB 3U1TA 4ETNA 4FLFA 1XAGA 3IIJA 1OV6A 1O6BA 1V5FA 1XT6A 1YKSA 1ZRSA 1Q84A 2CDRA 1SRQA 2FFAA 2ZWIA 3HEBA 1V16A 3ICVA 3IKTA 3I9LA 1RI1A 4PXSA 5HKKA 5U1PA 1GR1A 1OA1A 4Q9NA 1NNEA 1KJWA 4GMGA 3R5XA 3RYFB 3BL8A 1UWKA 5IDYA 4HNUA 2RHLA 2ZWMA 4YGXB 4TLBA 2QTNA 4IHKA 2CLOB 1AUPA 2VBGA 4CMCA 5REQB 2FPOA 3TOXA 3NEPX 1EUCA 2PCLA 4MVYA 3ZGZA 4GXNA 5C5CA 2GVDC 2V7PA 2PKWA 4FEGA 2WIFA 3SZMA 3AF3A 4M89A 4R1OA 1JJFA 3GLFE 4UEOA 3NIDB 1Q2UA 1Z0UA 3LA8A 1J8DA 4C30A 3BCHA 2FPRA 3IR7A 3DUFB 4ZVOA 1L7XA 2ZQ5A 5C81A 1B15A 2IXDA 5AFSA 5EKTA 4JI5B 2COKA 1Z6QA 5LSAA 2CCGA 4GYJA 4MA5A 4C0HA 3FOFC 2Y1DA 3LPMA 4LQCA 2Q7OE 3COSA 1BA3A 4RJ2A 1R5BA 1RMQA 2GYYA 3RUCA 3L1UA 2XWJI 4JXJA 3ZWWA 1YQGA 1NVAA 3B5JA 4MO2A 1SAYA 4RZXA 5E7QA 3IPLA 3MYRA 2GJ4A 4EKGA 1Y5MA 5GIOE 3OCJA 3ELUA 2BKXA 3R7BA 2NM0A 2SHKA 3MRVA 3FYTA 5FF9A 4B87A 5JTTA 1J49A 4R0MA 4ZVRA 2ZCJA 2QNIA 1KBOA 4K9DA 1FFYA 2EG5A 4G1VA 2D1QA 1BCSA 3TQTA 1I2MA 5D8DA 3LCVB 1BDIA 1VB5A 2VT7A 1ZCAA 3ICPA 5JS6A 3PB3A 4CCYA 4F8YA 3QVGA 5JSKA 4EMTA 3ASVA 3VR4H 3WX0A 1B16A 3FJ1A 2CCJA 2AEMA 2PZEA 3F1KA 3K6RA 1U63A 1S0UA 3HY3A 2XTAA 4QO7A 5TEVA 1M34E 3DFMA 4PZLA 3QNMA 2IPMA 1C2YA 4CEIB 3FOWA 1U9YA 3AY3A 1A4RA 5B2ZA 4KJZA 1UFQA 2D6FA 2WNHA 1EFRD 1ONNA 3C1UA 2GZRA 3CXRA 4N7MA 1NUSA 3HABA 1G21A 1NG1A 1NVDA 4QVGA 4D6YA 5AVQA 1U0SY 3NTOA 3SJBA 3FYUB 1HDXA 4TTRA 3V4ZA 3QWFA 4GVLA 2ZIFA 3DDZX 4FYWA 5T4BA 1VL0A 3HHEA 5A71A 3KQHA 4IILA 2ODBA 1H93A 2PQ2A 1IPEA 4GI7A 5LXTA 4LJ4A 4RLHA 5EOVA 1XMVA 3QPBA 2Y1EA 1RJWA 3TRFA 4A03A 5IZCA 5KC8A 5HE8A 2ADFA 2ZAOA 3PGXA 4NIMA 1E1CB 5G1NA 1DWOA 3U3JA 3EULA 2FEKA 4DM3A 1DBVO 4BO7A 2ZULA 3JQ9A 2B92A 3O1IC 4GQBA 4JZYA 3RTBA 4RWEA 3VAZA 4EAAA 3ZNPA 1X3LA 1MAWA 2V5AA 3AK4A 3HO8A 4GMXA 4LJ5A 4XQ0A 1ENOA 2PMKA 3DV0B 3LY7A 4JLPA 4NYIR 3ESBA 3TIVA 3UWKA 2PGNA 3LSYA 2GLTA 3AJAA 1N7JA 4EMBA 2OHXA 3PA8A 2CE7A 2H4WA 2W83A 2BTEA 5EPUA 5IXYA 1QNLA 2WG2A 5KQMA 1NUTA 4IWNA 1NBAA 5C80A 1JDBB 2EZ8A 4RK0A 3TNDA 2J0VA 2D5CA 3CPSA 3TJZA 4JSYA 1JSXA 3RLIA 1KVTA 3CKLA 4IEIA 2GHRA 1MEJA 1W2GA 3FSJX 4P3NA 3UWMA 1SA0B 4UNRA 1C9MA 2G36A 2GWRA 1LVUA 3A58B 3WLAA 4BP9A 1Z06A 2OWEA 2J45A 3G5UA 3U4HA 1HY3A 3ENVA 3KV3O 4ZP1A 2AYYA 1PLLA 3HNPA 2WV9A 3DSRA 3H8SA 3P19A 2X5OA 4CLRA 3QSGA 1S3IA 3OTQA 1E6CA 2ZJZA 5M7EA 4MVCA 3BCUA 1ZBDA 1YDFA 5IPFA 4MRVA 1CUWA 1XDBA 5ARBA 1I2AA 1XVVA 2IYVA 3I2IA 3G7NA 4WKGA 2WAXA 1ZM3A 2OZKA 3DKIA 4A8HA 2VH1A 4HAXA 5AKKA 3CB4A 1Z5ZA 3PBKA 4EARA 2RH9B 1AQYA 3NHJA 4C0JA 1Z39A 2XYPA 3N1UA 1OJLA 2VDMB 3ZK8A 4CU5A 4ZYVA 5IVPA 2XA9A 1HURA 3O1JC 1GKLA 4YLEA 1W4ZA 3H2IA 1MTZA 1SY7A 2FRXA 4DADA 2DWCA 2WB4A 2F3UA 2ZSKA 4FTWA 2I91A 2CXRA 1IQPA 3OZIA 5EJEA 4ND6A 1NQAO 2R7NA 2WSSA 2ZTUA 3OIFA 3PPVA 1LQTA 3FFTA 2VEOA 3EZ7A 4Y6PA 4QIHA 4TSFD 4V24A 4B43A 3WKEA 2XE7A 4PU0A 5DEIA 5I7VA 3KHTA 3T0GA 3D8NA 4DIBA 3ZW8A 1EK0A 2PTGA 4MLCA 4QEZA 2AJBA 4FFRA 4ZC8A 1CQWA 2EV9A 2VSNA 3SF0A 3ZCXA 5LJIA 5HJ2A 1YJQA 4GMKA 1WY5A 4LSMA 4FCTA 2Q9BA 5CNMA 4ZT7A 1W29A 5I6DA 4K81B 2V8BA 1CY7A 3G1TA 3IBTA 4KV7A 1VLHA 2G5TA 3FPHA 4BLQA 2QVBA 4EYOA 2PUEA 2R4QA 4BNDB 1QWSA 2BTOA 3UMSA 1P0FA 4UNSA 4TVSA 5HS4A 1NM5A 2IPOA 1KAHA 2JIBA 3RJ9A 3S2FA 4MEAA 4AK9A 3SF8B 1NKVA 2WTXA 2JLYA 1CF9A 2V6MA 3NJRA 4QXPA 4QDKA 1YI8A 4LZJA 1XRLA 3Q2OA 3QEAZ 3V2HA 2OCPA 3IT1A 2LBPA 4YUYA 4JXKA 1IOZA 4D98A 4LF5B 3F1LA 5F64A 4MUYA 5KDLA 3W04A 3WMFA 3CH5A 4ID9A 1YWGO 3TMYA 2VLIA 5JRZA 3QSYA 1C7QA 4AG3A 3F7MA 3ORFA 1C3OB 2PM8A 5CDGA 1ZMRA 4M1YA 3UMJA 5KYKA 1O95C 4JD5A 3IB6A 3M4NA 5SZJA 2V03A 2JLQA 1IATA 1U7TA 5LYYA 3P9KA 3PNSA 5HS6A 3AV0B 3OFSA 2X1VA 1FNMA 3HN7A 2OILA 4QHTA 5G4KB 3PGA1 4XWWA 3M3DA 4MDHA 1W5FA 4MYDA 5I9TA 3GJ5A 1Q7EA 2AYZA 1PQYA 4FSHA 1Z4MA 1E1MA 3BFXA 3X1XA 2XXAA 1NXWA 2OHFA 5HGXA 1T3HA 5JWRA 2GHQA 4D25A 1N4DA 5FULA 1PFWA 2W2VA 1VKOA 3AHCA 5TDHA 4LXIA 3UANA 1VC2A 2GARA 5CCBA 4KPYA 3KOMA 4B74A 2FG5A 3GW8A 2ILVA 2PZ8A 1O2DA 2XX3A 3KQOA 1YL7A 5EWLB 3JD4A 5F78A 4FKBA 1WSDA 3BJMA 4N3GA 4QOGA 4TKVA 5BR1A 3AINA 3DHVA 4G07A 2XRZA 1PK8A 2LXNA 2X0FA 3CZRA 1NONA 1V8BA 4U6NA 2MJLA 4OK6A 3TXXA 3UAXA 4RK7A 1Q57A 2OOKA 1HE5A 4OFWA 2FXIA 1G6Q1 5LP6C 5A0TA 1VL5A 1GL7A 3X2SA 1SPXA 2VHVA 3V8BA 4CQMD 2HBZA 3IVRA 1T0JB 1EWRA 2EARA 2QM7A 1WZ2A 3YASA 1YTUA 3WGHA 1KI4A 4PIPA 2PUAA 4MPRA 4U8HA 1ZI9A 3MJDA 3IEPA 3OCWA 4ZRMA 1DTEA 2V97A 4LG1A 1VL1A 3UG7A 1MW8X 1M1NA 2VK1A 3C6MA 1T8WA 3ISJA 1TIBA 3Q12A 4UAGA 5K2OA 2F3SA 3HPQA 5F2EA 2VDPB 4IBOA 3R3VA 1DKRA 2JARA 3KPJA 1RZVA 3ODGA 4NBLA 2VPPA 3E84A 3IUQA 3QX7A 4XA8A 5BYBA 5B30A 1RWPA 1PL7A 2QRUA 4K3UA 1PV2A 3WE7A 1XA3A 5JCOA 3FDZA 2CFCA 3TOSA 3K8YA 4S24A 4YT5A 2KWIA 1E7SA 2PCJA 2OE2A 5JANA 3EGWA 3ZDEA 4YRGA 6ADHA 3H87A 3ACCA 2P75A 4EB3A 1GAQA 3A9VA 4CKCB 5IJ9A 1Z0IA 4DUGD 4UCWA 1MC8A 5JNLA 1EHIA 3G9TA 4LY0A 1KMMA 2Z08A 4YAFA 1AA9A 3R9XB 1OLXA 2VUUA 2BE9A 1GA6A 2IFTA 1QDEA 3UPDA 2HV8A 1Y6QA 1V7ZA 4I4CA 1FFXA 4EDFA 4Y2RA 2CNWA 1RXWA 3TR0A 4BO5A 1RYHA 1T5OA 1DDGA 5AOAA 4YRBA 2O2CA 3CQ9A 1XOIA 4MHOA 3SS7X 3WWCA 4PAOA 4U7PB 2QTVA 3P9YA 3T1NA 5A0VA 4KNVA 4W5JA 3AVPA 3MFQA 4LVOA 2IY9A 3HCDA 2BFAA 4IV8A 2F00A 1PT5A 2BHSA 2MSDB 4BKOA 1CY8A 4BFZA 2QNRA 2GCIA 3QVWA 5FPYA 3TUZC 1PUJA 3OURA 3ST7A 4C7JA 2XUDA 3FUVA 1AUOA 2IYPA 5KTRA 2BR3A 1JAZA 2ZUCA 2Z5LA 3C5VA 3IXQA 1Y8AA 4AVYA 2B4AA 2I55A 2IP2A 4YACA 3UEOA 4BO9A 1SXHA 2GN4A 1NJSA 3HYCA 1TX4B 4LJ6A 1A5BB 1IG0A 1XD9A 2JJ2D 4K87A 1XRSB 3JVIA 3NOVA 4LY3A 4OO3A 2PSFA 4PZ0A 5HMLA 1SBIA 4E2ZA 1FDWA 3G2LA 4LDZA 5AOVA 3THXB 5EWJB 3I42A 1KBQA 4DG5A 3VH2A 3T5CA 1V4VA 4BMXA 2ANCA 2D5LA 4FEEA 2DX7A 3K9FC 5JYDA 4IPTA 1SG6A 4QQRA 1ZH4A 3OIGA 3SAJA 2ZIEA 2DJIA 2E3JA 3CUKA 4QG7A 4JAVC 1A2OA 4HZUB 2CFOA 3WRYC 2ODTX 1ZJZA 1TJ5A 2HLDD 4J1NA 4EQZA 3D6NB 1DXHA 4EHHA 1GILA 3ODPA 1US8A 1WR8A 2FG6C 2FA9A 4LC1A 3ZW7A 4LW8A 2W6ZA 1UDRA 1H4QA 2ZYHA 1OB2A 4UM9D 3ABOB 3BGOS 4B44A 3HU2A 1ZM4A 3HADA 1XUOA 5ALEA 1LX7A 2OLJA 4RK4A 2YIVX 4L28A 2HQ1A 1KO8A 3TIIA 3DOEA 4RTRA 3GLIE 1C5KA 1LTKA 4WHMA 4US0R 4WZBB 3WLEA 3T7DA 2AF3C 3AR4A 4LV8B 2HDWA 5SYNA 5ABPA 2C9MA 2HBYA 2NQ8A 5EPOA 3ANSA 3OEHA 1QP4A 1OGYA 2IYTA 5TR9A 1EXMA 2YHIA 3A2LA 2JKVA 2BCJQ 3FFAA 4P7JA 1FX1A 3KSDO 1K88A 2PMEA 3FUWA 5JQGF 1ULSA 1D1QA 3MWFA 2P4UA 3AKCA 1CJMA 1O94C 3DC7A 3N7TA 2ODAA 3OOHA 2OMEA 4LY9A 4YP1A 4MINA 1XCLA 1IOWA 5JSYA 4IUDS 2IXTA 4EO4A 4PTZA 4V3BA 4US1R 1RHRA 3MVEA 4QPJC 1Z4IA 5AKJA 1Z75A 4J3JA 3CUVA 2PH1A 3UMRA 3T3EA 1LNQA 1ZOOA 4B8YA 2FN7A 2CL6X 2D06A 4ZMSA 5JQGB 3IHWA 3EVDA 4MITA 2B1JA 2PH5A 3UHFA 2GBGA 2GPTA 4NICA 4CIBA 1DWUA 3ICOA 4OAOA 5ES3A 1WVMA 4C2BA 4HAUA 3CLSD 4UPVA 4FUQA 2D1SA 2C0PA 3TLCA 3C3DA 1JHOA 4MUGA 2GXSA 3PNVA 4QUKA 3TE7A 2H5EA 1HLGA 1LRLA 1ZGBA 1R6AA 1NP7A 3FLEA 4FB5A 4AULA 4ILKA 2GKSA 3KT3A 4MI1A 1MIHA 1UK6A 3O47A 3KEOA 2I2CA 2MT9A 3KKMA 2EEZA 3FVWA 1A9ZA 2RHGB 2EZ4A 3PRJA 4FBMA 4IL5A 4WBSA 3MOIA 1DX6A 1GLGA 5HBGA 3X2FA 4YASA 1JALA 3EEBA 3PQ2A 1ZGGA 1RVV1 2DR3A 2ISCA 2YV1A 4X45A 5IJAA 5BQ5A 3ZQ4A 1AUXA 4IKOA 2K2WA 5A3QA 1Z07A 1FJGB 1U99A 1RMTA 1N9KA 2WJAA 3IKJA 3Q3VA 1FFGA 4HDRB 4EKDA 1QHSA 1JXAA 3FVQA 3DO8A 4NCNA 4XM0A 1I32A 3U3XA 1NRXA 2ZJOA 2YDYA 4M54A 4UU0A 3OESA 4B73A 3ZU5A 1JQBA 4ZT2A 3SZLA 3HJGA 2XHEA 3VZPA 3EZXA 5E7JA 1E9DA 3C7DB 3H2BA 4WACA 3FHTA 2H54A 5JAZA 3WKCA 4HPXB 4U00A 4ZQBA 3EIEA 1MJFA 2AW5A 2IF0A 4B6RA 1Q0HA 4A0GA 1QO9A 3NXSA 4E6EA 3ZJ4A 2AEFA 2V7WA 3ETEA 4JR1A 4MRNA 1YQTA 1WQ4A 4PQRA 5AHWA 2GUWA 1FMFA 3MINB 1ZNWA 2EHDA 1AB6A 3ZE9A 1HOXA 4QEKA 2NACA 3SQOA 1XZNA 1YRQA 1W59A 2H5IA 4QYMA 3T7CA 1W48A 4ITUA 3ONFA 5LLTA 1ENYA 4C76A 2CJWB 4MB2A 1MC1A 4C2AA 3HUUA 3A2NA 3TMAA 5K0JA 1GUAA 4GEGA 4QDOA 3T7EA 3IAM6 4CLOA 1BCRA 1QHHB 5D7BA 5U9CA 1Q1EA 4OQNA 2JLSA 1RAEA 2C8KA 2XPCA 4H7EA 4J2TA 3HJFA 2ZCUA 1FS5A 3HVRA 1LLUA 2IYUA 2MYPA 2HUPA 3E23A 4NWIA 1I7DA 1VA5A 5ALVA 2UZ3A 2PJDA 3O4GA 3OCYA 4G1CA 4XVHA 4ZZ2A 3TTXA 3LUJA 4R83A 1XRNA 2EFDB 1XEXB 3UJCA 2YCLA 1FIUA 2PVPA 3FPKA 1YS2X 2RHWA 1G5FA 1MX9A 4MPPA 4QARA 4AKSA 1WCIB 1N5JA 3LQYA 4BWGA 3VUEA 3PHJA 3LDFA 3PNQA 1N33B 2R8OA 4YUVA 3U80A 4LE1A 3QFHA 3G5MA 2Q28A 2FWNA 3SYTA 5BOSA 5BQFA 1FX0B 1BC5A 2C2OA 3SJCA 1FNDA 4YA6A 2IS2A 1C1DB 3H1FA 3F3YA 4JB3A 2BUCA 3DEFA 4K5QA 1XZIA 1CUEA 3PE3A 2NXCA 1T0HB 1TAUA 3N2ZB 4FFSA 4LXXA 4TVOA 2YHUA 2K7FA 1K2VN 2Z5VA 3KXKA 1Y9DA 4EB0A 4G1FA 3X3HA 3W5JA 1EDDA 4X6LA 1XBTA 3QEBZ 4BKRA 4U6QA 1W25A 4EY8A 4F5ZA 4A10A 3WMRA 4HT3B 1H1LB 3GCWA 1HUQA 1AK9A 1GZ7A 4AJ9A 2QU7A 2YWXA 1BX0A 3H3XA 1ADFA 4RHFA 4YCJA 3HEAA 1KWKA 3CRNA 2P6PA 3CFYA 3KQYA 2GVZC 5BMVA 1L3IA 2FNAA 1CZLA 1DSSG 2B4RO 4TRNA 3KETA 1WHSB 5GJWC 4KSYA 2ORVA 2ZT7A 4Y0VA 4R51A 3TLZA 4ZI7A 1VJTA 2F3RA 4EW2A 4DNOA 4B2PA 3P4YA 2YWGA 2AV6A 1I94B 4HNGA 3U7HB 2OBLA 1QG6A 3RU9A 2YJ4A 2I4NA 3RUPA 4FKMA 1WMDA 3UV6A 1ZUD1 2X23A 1G5TA 4BMOB 1QFZA 2WJPA 2H7CA 2OP0A 1ND6A 1P2SA 1FDVA 3PHIA 5L3VA 4PYRA 1WRBA 1XB2A 4CEJB 1DJOA 2TYSB 5BT8A 4WCFC 1XQVA 2AJCA 5KCMA 4C0KA 2B3DA 4XAQA 1QIFA 3KQMA 2FE4A 4Q4CA 1OFTA 2HU7A 2MSKA 4YJ3B 1RQGA 3IAAA 4K2HA 5AXDA 3HV2A 1KK0A 1OAKA 3R0IA 3KWMA 3G7SA 4Y1EA 5M3BA 5LZ2A 1Z22A 4FYVA 3DMNA 2Y2VA 2O1WA 3FR7A 4EUFA 3VPCA 2CJFA 5IXJA 3A4YA 2H1SA 3IBYA 1QLJA 4FMPA 4C6HA 3IJ5A 5JY6A 3HWWA 2E1RA 2ZSIA 4YAUA 3PEFA 1F4PA 5AIBA 2JJ1D 2J5KA 1N6RA 1A8UA 5CCEA 4DSAA 2XA1A 2CHGA 1Z5PA 4YBRA 1P4JA 3FZQA 5ARCA 2X5KO 5DZSA 5JT1A 1E1YA 2HHCA 1QQTA 4KDRA 1X19A 4YV1A 4YIHA 5AVTA 2CJPA 1XA0A 3LDGA 4HB3A 2YNMC 1L4BA 3T9BA 4Q7LA 4QFBA 3T0IA 4AS3A 5IU6A 1XD2B 4HB4A 5ARDA 4BTEA 1UFRA 1JR4A 3AR6A 4KQIA 5DLPA 1JKFA 1EI9A 4M3NA 1Z2PX 2J3JA 2XYRA 3GRFA 2YH2A 1E8NA 2C5BA 2Z0MA 3QKRB 1F2VA 2GD1O 2MOKA 2ZLBA 3MIZA 3NZEA 2FPIB 3O92A 3TL2A 5C18A 1IBKB 2CWDA 3PQCA 2ZANA 4U7TB 3OJ0A 1T24A 5IZ4A 1TUGA 3ZZTA 4TMFA 3DE0X 2UVQA 2WSMA 1EVEA 3JASA 3JQGB 1H9AA 3TFWA 3WR5A 4JJGA 4A26A 3PLAE 1RLUA 1U6IA 2PZLA 2EYQA 4QRDA 2E9SA 4KKXB 5FWAA 5JNUA 3GMSA 2QYSA 4KREA 3VR3A 1LSUA 1F2DA 3K9WA 1OI4A 2IGTA 4GF5A 4TZTA 1KA9H 4G97A 4PPYA 5JC1A 4V0RA 1TYBE 5JCZA 3VYVA 5B6IA 1KPGA 1YH3A 3DW1X 2P4HX 1EX6A 3EDMA 4LF9B 1SHZA 5AJZA 2EL7A 4DR7B 2FSVC 2DM6A 1Y4DE 3O4IA 2VEDA 3TRIA 3D6MA 5BVHB 5C7LO 4XB2A 4UPEA 3WZLA 4H08A 3L92A 1G19A 2B7CA 2IPLA 4HAIA 3V4OA 4JL6A 4NFSA 5EPEA 1Z16A 3W8RA 3R6GA 5KNCH 1GZDA 1JS1X 3NANA 1NLZA 1F06A 3SZOA 2JBWA 3IL2A 5FBHA 3SIWA 2J9YB 2JFPA 1PDWA 2IHTA 3G68A 1Z33A 2O0HA 4I08A 1LZLA 4HAZA 4W1PA 1CTQA 1W34A 2MTBA 4J9UE 1DU4A 4XSHA 1L7VC 4O0MA 5G41A 3UTCA 4B47A 5HIAA 1X1RA 1KKLA 2O6HA 5I9LA 3KO8A 5LR6A 3ACBA 3BZWA 1ULTA 2CNLA 2YWJA 5LA6A 1U8FO 3REGA 4HDKB 1MA3A 1CUDA 2E2WA 4RDIA 2EL9A 3KTAB 3QPAA 3X1MA 4KHZA 2P35A 5JNWA 3PKZA 4UZSA 2Q5JA 1MR3F 4UNQA 3M6IA 4NZYA 5AJWA 5DHUA 2UUAB 3F3MA 2X8BA 1CXZA 4Z9YA 3CVWA 5A6SA 1SIBE 4LZWA 3H11B 5GV8A 3RUIA 4E51A 4M46A 5LC1A 3L7BA 3DE5X 5KQGA 1GGHA 2ENUA 1FP4A 4IQ4A 2QRHA 4M49A 1DAGA 3RYCA 4MJXA 3SD7A 4QXOA 4HJRA 3MS4A 1PJQA 3AVVA 2V6FA 3P2EA 5C51B 3W5BA 1SKQA 3D3WA 4G9BA 3E5NA 4BC1A 2PNFA 4H16A 1JPVA 1G98A 5CM8B 2QRKA 3KSMA 2H2DA 2WVJA 4GLOA 1C1XB 4L9SA 5KZMB 1OWOA 2XW6A 3S1LA 2E4XA 3AEQB 4B46A 4F2PA 1ZIYA 3NCHA 1REQA 1GAWA 3CLUC 3GLVA 5CG2A 2PKQP 1U0TA 3LL4A 4UZEA 2NU7A 2W6OA 5DM60 2DQZA 3HVUA 4F2GA 2YWEA 3OZTA 5G40A 5ITWA 2J3KA 3NPMA 1MX3A 1UKZA 4KSCA 4TT3D 1QGED 5EMNA 3RYIA 4A5OA 2CZGA 1Q15A 5DCWA 3MLEA 3PDWA 5FNVA 1G0OA 3BXZA 3CA8A 1KO7A 2HN9A 4QREA 4L8VA 2AB0A 3EXAA 2P6OA 4F7DA 4BJHB 1R6UA 2J3EA 1DQSA 4CKZA 1SUBA 4TV9F 1CUFA 3GNTA 4AO7A 3C1TA 4FFLA 1JSRA 5C35A 4W8GA 2IEAA 5A7FA 3MMZA 4YHHB 2VHWA 1NRJB 3RIYA 4PRYA 5G2OA 1H3NA 4CCWA 3QVTA 1RS0A 1LC3A 5K7SA 5GJVC 2NZXA 5DTEA 4TV9B 2R1TA 2OAP1 3RS8A 4DUYB 1ZLYA 1UBUS 4XD2A 3WSVA 4LC9A 2VZLA 4N5DA 2X0KA 3CJRA 3DT8A 2EATA 1T4CA 3PCTA 1QIHA 4OI2A 1B43A 4ENSA 3N28A 5ALKA 2VRCA 3ILSA 5CB8A 3DUFA 2XVYA 4UHBA 4EPWA 2V6JA 4UTOA 2UXDB 1HT2E 3MBKA 2DQYA 1GRQA 4Z0HO 2QM8A 1IMOA 2FZVA 3BE5A 2ZM5A 3B2NA 3PNYA 3OI7A 2BKEA 5C1DA 3VKGA 5E7MA 3QTLA 3CT6A 1WL8A 4DDUA 3ULKA 5KHOC 1M8JA 1U5AA 4YRCA 1JPNA 3EDCA 1SC6A 3CY6A 5IN4A 2ZG6A 3B89A 1YB7A 4JLUA 4JJKA 5AW5A 3CE6A 2P2ZA 3O3OB 4L74A 5BWNA 5DHQA 4KN9S 1L1QA 2YV3A 4L3VA 1KTVA 1YFKA 2QEQA 2FQ1A 4QOIA 2ZJBA 3OJLA 4EABA 3Q3HA 1LBQA 3FNFA 3OCXA 4CMEA 4CIYA 3A3OA 2YY5A 4IGKA 4OXNA 4XPIA 4CRWB 3P96A 3A6GA 4YRJA 3OFND 1EZ1A 1NE2A 4MUMA 4IDOA 3UQYS 2FE1A 3PD0A 2JBAA 3G89A 3VZDA 4EI9A 4PPGA 3SBDA 1ZN8A 4Y7DA 4J91A 3QXSA 2PQ6A 3QI7A 1DFHA 2QZJA 4W5RA 3TN7A 1ISGA 1FTNA 2XGJA 2A9FA 3NVAA 3Q10A 1WTCA 4HF7A 4YT4A 2VWHA 1L4GA 3G79A 4ZYYA 2Q1UA 7AT1A 4TL8A 2WIBA 4OYRA 4C5CA 1ZNXA 2NV6A 3L0CA 3MTIA 4CEIA 1CHNA 2D0DA 2YWDA 1UBKS 2ZRJA 1XNRB 3L8FA 2HB6A 1V7CA 3MILA 4GKAA 4X3CA 4HD8A 5A2QA 1PLJA 5KYYB 3DE2X 2R1VB 5MFZA 4CFZA 1QYRA 2AJTA 1A5TA 1I4OA 1BSVA 2R96A 3H5VA 4MLZA 5IAAA 1PDOA 1UBTS 2P0YA 3I39X 3L6DA 3F96A 1YA4A 1LWOA 4BRUA 1XXHB 4DSOA 5L4NA 4D81A 2D62A 4G0QA 2V9CA 4RK6A 3SM3A 4E94A 4JYAB 5ESDA 3GFRA 4MP6A 4L2IA 4MV0A 1KY3A 5KYYA 1L3CA 4EA7A 3Q7QA 3B8EA 5HFJA 3K2EA 4X6YA 2G25A 1QVZA 2Q1SA 3CNOA 3HB0A 4F3NA 2MHCA 1E1CA 3EYAA 4D9FA 1FU7A 1K06A 1ZQ1A 3EMVA 3ZE7A 1N7HA 3AUUA 4RVSA 4M6WB 5LYJF 1D4AA 2NUTA 3ESAA 4X1IA 2G40A 2R8RA 4NCIA 5TT1A 3T5DA 4JSRA 5FLKA 3DV0A 5DT2A 5LYJB 1Y3AA 4MPJA 4CL3A 1RD4A 4F5EA 1G41A 1RXEA 2WD7A 3QE0A 2WTBA 1XCBA 1L5LA 4BX2A 2Q3JA 3MOGA 4YRRA 1XN4A 3RSQA 4PSCA 1JZSA 1XQWA 5A7HA 3QPCA 4E88A 3RT7A 2OV6A 4MV5A 4ONEA 4CW7A 1MEOA 1FSZA 4XTRA 3JVEA 4ESVA 5KUTA 3UPUA 1FRVA 1L2TA 3Q87B 2CSXA 1MX5A 2WHPB 3UJPA 1SA0A 1FYWA 4IZOA 2NG1A 3L4KA 3MT8A 2Z3VA 1O97D 3UHPA 4IYRA 4BKQA 4DYHA 3F5SA 2DXIA 2TRSB 2I7VA 2ZSEA 3SHWA 4OFZA 2J6BA 5DI9A 4XVUA 1L8AA 4RIGA 5E1DA 2R8EA 2LNDA 3CM0A 4Q3BA 5HKOA 3RNLA 5JMWA 3BVPA 2QRQA 4MAFA 3TLKA 2PXAA 3U26A 1W49A 2EJVA 2E1PA 2H2IA 4O2AA 4PCLA 3W3AD 3J80A 3B6KA 3N0TA 1QTQA 1F6BA 2FWBA 5HPYB 3NBMA 1N32B 3EYWA 3CISA 3KWFA 4HLUA 3UB4A 3BWBA 5JAIA 1OBFO 1RKVA 3E3MA 3IKVA 4MWSA 1KSGA 5D3KA 1V2HE 2JD0A 3PVSA 5A3VA 1N2CE 2GWHA 1DKPA 3O91A 3N5KA 4IFTA 4NESA 5E9AA 4EUSA 1JGTA 1IHOA 1WQ1R 5WRFA 1V8OA 4FW8A 4E09A 4JC5A 3KB2A 5BUZA 2PIDA 4DEYA 2H3HA 5EE9A 1NNLA 1QVWA 4OSOA 1RJ9B 3ZZUA 5JBIA 2WLTA 1NN1A 2Q3LA 4CUJA 1OKKD 1WMBA 3DCJA 1SCQA 1XDGA 3EVGA 4TKUB 3VYSB 3WYAA 2Y3IA 5CX4A 2MR5A 3D59A 4FX2A 2Y1CA 2OHJA 1JT9A 3C6ZA 3EW7A 4GW3A 2CV1A 3UB3A 2EGGA 1UOPA 2R97A 1HDCA 1S8NA 1ZSYA 3AUYA 3C6KA 4R98A 4U2FA 4UBJA 2RGRA 4D99A 4M0MA 1SN7A 1U7UA 4NQRA 1JVSA 1RKBA 3UK2A 1NVMB 4TL6A 1ISMA 5CA1F 3RF6A 4LRSB 5BV0A 4DB4A 2F8SA 4E22A 4KDFA 1QDLB 3CWCA 3PFCA 2HDOA 5ILOA 1RLJA 2NPOA 5KREA 1UC4B 2BFBB 4UXIA 3N74A 3R77A 1PRYA 3OJCA 2BMJA 5CA1B 2E6UX 2GYUA 3M6FA 5C8DA 3OIVA 4BNDA 1G8SA 3J7TA 4AB1A 5EIEA 3BXXA 1KOFA 1NQTA 2R6GA 1R0RE 1MH9A 3M5WA 2G07A 3B1JA 2IYOA 5EMLA 4ENPA 4LF4B 5EQFA 4UDXX 3T9CA 3EPJA 1CF4A 4C4PA 4D3FA 1T29A 3SF8A 1OXKB 3ID6C 3SBEA 4UXHA 3TI9A 3V8EA 5KPDA 4V0ME 2HA3A 1ZK2A 4TROA 4BFWA 4FINA 5AESA 4GSLA 4X65B 3P2MA 1JA1A 3B36A 4YI3A 3M6XA 4JFRA 4C0LA 2J1LA 3ZY3A 1IM5A 1IFXA 2YQ4A 1OWMA 4LMBA 3DD1A 1WKBA 2QTGA 5A0FA 3G8BA 1P4SA 3VYTB 1C3OA 1TF2A 5D2CA 3OC6A 1ESMA 4IW3B 3OA2A 1MTOA 2IOHA 2ZB4A 1F3OA 4H7DA 4MS3B 4U5QA 1IXZA 3V4SA 4EATA 3MPOA 5JXJA 1UZLA 3L7OA 4JC8A 1H2AS 1AQJA 3PEWA 1TO2E 4AZSA 5G4KA 5J59A 5ES4B 1XQXA 4WJZA 5K3BA 1W19A 5EFOA 4Y6OA 4IJWA 2H57A 1ZLXA 1MDBA 1JW9B 1Q3KA 2P78A 1E3JA 1T4MA 1ORRA 2GILA 4Q4AA 1WBBA 1GGKA 3HC7A 2GSDA 4KPUB 1TMGE 1GAXA 2V3WA 1AE1A 2RHTA 5TPZA 5K3CA 1DTWA 3CCBA 5I45A 3R40A 1KI6B 5IAEA 1E0JA 3ZHVA 3B5EA 5EWLA 4KWCA 1B41A 1LB1B 2ZS7A 1DAOA 3ITNA 2WPDD 3HBMA 3P26A 4Q9JA 1Z5VA 1IHDA 1ZZEA 1MB0A 1QAOA 1RM3A 2HPZA 2QD4A 3BZBA 3GFSA 3OZBA 2OCDA 3C7AA 3K96A 3PA6A 2VUIB 4K6KA 5CXSA 1XTIA 3VPDA 3C3MA 1E5QA 2JVJA 4G41A 1BO6A 1P2VA 4NMWA 1GD1O 2OORA 4C88A 1EDEA 2DFPA 2EW1A 5BYJA 5TV2A 1A7AA 5DPMA 3WGOA 3JQFC 1TGYA 3O0DA 2FPGB 2IITA 4J75A 4O4LB 4IVRA 2JFYA 4X0EA 2O7SA 4RQAA 2X6TA 2WLSA 2XUIA 4XJTA 1V26A 3E9NA 3F6EX 4N5LA 3ROTA 3KU4A 5C1IA 2P3OA 1U2TA 1QHNA 1MC4A 1N1GA 1LFDB 1E60A 1RCUA 2P1DA 1MQSA 2YC4C 4EGQA 1QK5A 1X6VA 2J4DA 1JLLB 2B8TA 4L0QA 5KMGB 5IUKC 2RCNA 1AN9A 3GYBA 4HWGA 4QWWA 1VLLA 3S2GA 3B52X 2IZ6A 1ZMOA 1TJNA 1C0LA 4GLFA 1MQ8B 2BEWA 3L6RA 3TZ6A 1WCXA 3PFBA 4IIJF 5K20A 1E5LA 1KJNA 1SEVA 4P82A 2I4IA 4WFIA 1FYDA 1G0NA 1U90A 4WNAA 2GN6A 2V7GA 3AG6A 3KUCA 3SC3A 3V6LA 3ZDZB 3ZLBA 4CTOA 1KZ4A 4J1TA 3WA6A 3W4JA 2G9VA 3WBBA 4X8LA 4FONA 5AOBA 3TSWA 4IIJB 4KN6A 3ZY5A 4DUPA 1QTRA 3GJSA 4PHHA 5AUNB 3H8JA 4DV1B 1CSEE 5KKNB 2HA4A 3F8TA 1ZKDA 2DH5A 3OWXA 3R9XA 3ZCVA 4M8LA 3M1LA 1UBCA 4ENQA 3VVMA 3EASA 3SJ7A 1FP2A 3L6OO 5CR9A 4LOIA 1VZ3A 1KQNA 3WGQA 4LPSA 1QX4A 3ZWAA 1C9DB 4LDRA 4WLOA 4IOKA 2B2NA 4JB8A 1CUJA 2CLCX 3IBSA 3WFIA 3BC1A 4FS3A 4LHWA 4O1IA 5AJHA 1NV8A 3MJHA 2JD1A 3PUHA 4OEHA 1DB3A 5E38A 1XTPA 2VJMB 3INYA 4MH0R 1BDJA 3A4LA 3DULA 4PNPA 4Y6QA 4M1WA 1TXGA 3LK6A 1ZMXA 4DWWA 5H8WA 3QVVA 5FFNA 3QENA 2OG1A 4HN4B 2VQEB 4JT9A 2HF9A 1CJSA 5CYGA 3LLVA 1XNGA 2E18A 2ORWA 3B2QA 1CB0A 1XJ0A 3MEQA 3PHBE 3RRXA 1XZ8A 1PZNA 3T1QA 3D4NA 4DQKA 4TLEA 5LD2B 1XVUA 2AW3A 2FF5A 1Q1GA 1C14A 4TQ9A 5C31A 1UBNA 3W4IA 3G2OA 4B4UA 4TYYA 2JZNA 4YCBA 1P4AA 1U7HA 3KQUA 3AFMA 3THXA 3ESXA 4G0PA 4R2WA 1BJTA 3GDHA 3QF4A 5DHAA 2R6HA 1PSDA 2ZIGA 1FNBA 4I4TB 1IJBA 3NM6B 1H0HA 4G63A 3I37X 1NVTA 5AJXA 2BCGY 4M87A 1V6SA 2BEUA 3NHMA 1Y4ZA 3GHHA 4LHSA 1IWOA 1PEDA 3TGWA 1OU4A 3L0BA 2QBYB 4HZUA 5JMTA 3BAZA 1E2MA 4I9UA 1EA7A 1Y9EA 4NZZA 2F59A 3K32A 2JANA 3LT0A 1BXRB 3O9VA 1P1JA 4P7BA 4AYTA 1TTTA 1GNTA 3U6KA 4AL4A 3W5HA 3A6FA 3O8DA 2FMKA 2W43A 2HYDA 1R37A 2BE7A 2Z56A 3RC3A 5AQEA 1XLWA 4ZCTA 2IS4A 2PS0A 2OAEA 3LZCA 4DCJA 1II8B 3OKAA 4GPTA 2QMZA 2BD0A 3H5IA 1BOOA 3PCXA 1D2AA 2PHZA 3FRIA 4NMLA 1N3IA 5KKAA 3VVBA 5FUQA 2W2NA 4B80A 4R16A 1FFAA 1G21E 3FUXA 2ZIUB 3KEFA 1XHFA 5AT1A 1B0UA 3DMGA 2EQBA 2KLBA 4LMPA 3FA2A 3EC2A 4TKZA 1CFJA 3U4IA 1CUZA 1HPLA 4CGYA 3JWEA 3E3OA 1PV4A 1NNI1 2X8WA 5DOVA 2ZRGA 3F2VA 3QP9A 4GLLA 1CEXA 1E9SA 2IKSA 2WKRA 3L84A 5H70A 5EHZA 5B58C 4DW8A 1I7SB 1OC4A 4FSDA 1ND5A 2VYVA 3LBYA 4QPPA 3BK1A 4MPTA 5BWMA 3PQ6A 2BYTA 2HR1A 2HREA 2G6BA 3EEYA 5F7OA 5IFKA 3E7XA 2RGGA 5KWEA 3HR8A 2ZROA 5JQGA 1N0UA 2V7QA 1C3JA 1COWD 3WOHA 1I5OA 2JFVA 2Y0BA 3CH4B 4BCBA 4C6SA 5L3ZA 1U80A 2GHTA 5BSVA 3K9GA 3K0CC 3ILYA 1OWPA 1Y9ZA 1WF6A 4N0EA 3V1MA 5BNWA 2HCBA 4PYQA 4QBFA 4DC1A 4GX5A 3EVZA 4R1NA 2IV2X 2O8NA 4BDSA 4PHTA 2EOAA 3EXHB 1BA2A 1RRCA 2PZKA 4JP5A 4HVCA 2I1LA 4K0RA 3OQIB 1CY6A 1PTJA 2R6AA 1HM5A 3WLFA 3L7IA 4RZ3A 3D0QA 4IG4A 1FQKA 4FN4A 1I7QB 2C9YA 3A37A 3JYOA 2C9BA 5KNDA 1PV1A 3P2JA 1VFPA 2YZNA 3ONWA 4JLDA 3WC4A 1D8TA 1D5CA 2ONYA 4AUKA 2C2HA 2QZZA 1A27A 9MHTA 5FPSA 3GEEA 2EP5A 3A4NA 1GWNA 2KSQA 4HDRA 4RSGA 2PKRA 4C6TB 5KNBH 4XWKA 4RVUA 1LVGA 4FX5A 1EP9A 1L0BA 1VL8A 3HDTA 3GN1A 4M9UA 3WK8A 2JRLA 1Z2EA 5LIRA 2NW6A 2PL5A 1ZD5A 3IVAA 1ZMTA 1AKMA 1VKNA 3K5IA 1M1YB 3FCAA 2E0IA 7ADHA 2GERA 2P6UA 3ADDA 4M55A 3V4PB 5I48A 4GM4A 1XNHA 4ISBA 1ZIXA 1WZIA 3K5WA 4FDTA 4CM9D 2JLAA 3I5YA 4G4SO 3LW7A 4I1IA 4W1QA 3UZUA 4IIHA 4PXYA 4BL5A 5CDUA 3MINA 2X8JB 5F77A 4K6FA 2YQZA 2JGMA 2FMHA 2W11A 1HF3A 1QOZA 3NEYA 4UCXA 1Q7TA 1T2AA 2ZGVA 2J5BA 3G2QA 2CJWA 2C8JA 2HTFA 1ZRHA 4P2GA 1ZD4A 2QD1A 1IOVA 4HTFB 4MUXA 3TTTA 3HKDA 4Z4QA 5BWOA 1QHHA 3OIDA 4GWGA 3R09A 2IPNA 5MN4A 4AXBA 2R44A 4JL5A 1SOVA 5G3YA 2C2BA 2GYVA 1SWWA 2GD6A 3QY0A 3Q3JB 4M0CA 3JALA 4G37A 4EO7A 2ZI6A 5LMNB 1RQ2A 3Q8WA 2JI6A 2QY6A 3ZCQA 2AZTA 1HFKA 1XEXA 4MYCA 1HORA 5AI8A 2F8MA 4BUJA 3GOHA 2C29D 1ILEA 3KCQA 3ZIAA 1VHLA 2RG7A 2YXDA 1WCIA 1KERA 3HNRA 3NKLA 5ELLA 2XSZD 4A6PA 1CJBA 2FR8C 2WFAA 4DVJA 1DRJA 1OCEA 1V8DA 3DVRX 3GEGA 4N49A 1J23A 1CR2A 1KJQA 5CIQA 5I01A 3WKBA 1FX0A 1ECLA 4RY8A 4IS2A 1DG1G 2Z2YA 3JX9A 4N6GA 5EQTA 3SGLA 1PHPA 2IUUA 1XCGB 1KZHA 3TMKA 3QJYA 1A97A 4MV9A 3E9DA 2FMXA 5TF4A 3FM9A 1OVMA 2XXBA 1N75A 1FQOA 4YO8A 1TUBA 1KZ6A 4RHCA 2C5LA 3GY0A 3U3MA 3GH1A 5IK2A 4ALJA 3TCNA 1FY2A 4HHEA 3JRNA 3NB0A 5NLLA 4WOPA 2YRWA 4YJHA 4JITA 5BV7A 1CNEA 2IIPA 4LJ8A 3VO9A 1OGIA 3VRHA 5L6LB 5AK6A 1ZVKA 2QAGA 1H1LA 4G5GA 4Y2JA 5HK9A 3GRYA 1NVBA 2O2ZA 5K9ZA 1RRKA 4N8EA 4KE8A 3ESDA 4IIXA 2Q5QA 4HBGA 1UOEA 3UICA 5LB4A 1E4VA 1W9MA 4ZO7A 2GPJA 2I33A 2OD2A 1WHSA 3TL3A 4V1CA 3ENNA 2FH5B 4TSRA 4UREA 1WHTB 1XZAA 1DS6A 1JR3A 3GJQA 5SV2A 4BVEA 4KITB 1X7ZB 1T6BY 2HQSA 3E3LA 2R00C 2C1ZA 2ID4A 1CS4C 4O2BF 2IU6A 4OFBA 1IUPA 2GASA 4GLBA 2IOQA 4PANA 4DLNA 2R1ZA 2C94A 3ANTA 2B98A 4Z9XA 4BAZA 1ILWA 1L5ZA 4LOLA 4R81A 1YS7A 3I30X 2VHQA 4EW6A 4O2BB 3AKEA 1SXPA 5DM70 2UYCA 2B30A 3KR9A 3QKSB 4UEWA 2HMSA 2QY9A 3B3GA 4TRMA 4YJ3A 3RFVA 1X7YA 5KSOA 1LBHA 2EHJA 2N47A 4X1YA 2ZREA 3DNFA 3WLSA 2R62A 5LQMA 5HCUA 1OILA 5BN5B 3K0EA 4U2KA 3AOEA 1EB9A 5COQA 1RZUA 3NGXA 3AM1A 1JHYA 2EKLA 2ZPTX 1E4EA 1S2IA 4CQMB 4XUGB 1JHZA 3S6JA 1P5JA 4INZA 2J9ZB 5HF8A 3MTDA 3U3RA 1ZJ6A 1L7DA 2A92A 3ZDQA 1DAPA 3U31A 2PPLA 1EX7A 1YS1X 1EVZA 4JMPA 1K6IA 1G1MA 1YGPA 4O2LA 3PPIA 3H5AA 4Q7JB 2ONJA 4EX7A 1CE8B 4UHKA 1QB8A 2QT9A 4Q3AA 1XJ5A 4YMLA 3MG9A 2JLVA 3WTCA 1F8FA 1U0EA 3GDWA 3JRWA 3AKYA 3O9ZA 5JWHA 4AG6A 3UTDA 3TZHA 4EA9A 1DOHA 1XD2A 4C5BA 2PN1A 2Z3ZA 3H9JA 3P7MA 3VGJA 5JAQA 4FSXA 3RVBA 1AZWA 1GKKA 1PJCA 4OUDB 1DIGA 1I13A 2IL1A 2Z5GA 2Z30A 4KQHA 1XTVA 2ZT5A 1XRMA 3VXKA 3NIGB 1RPJA 1ADBA 2ZYGA 4TYQA 3QKRA 5CURA 1O03A 1SKYB 1C4KA 2ZT8A 2OFFA 2FPIA 4YGYA 2BJWA 1CJUC 1SO8A 4OQDA 1TW3A 1U2RA 1OWNA 1JDSA 2GBIA 4MCAA 2J46A 4B5LA 2QUJA 1QG2A 2ZBDA 2I4MA 4OIFA 2BKAA 4RL4A 4ZVVA 3ONNA 2G9ZA 3JQGA 4HQLA 4M22A 3RS2A 4DMGA 2HTEA 4IR7A 3K8QA 1I2DA 1VHTA 1YOVB 2E87A 5C8YF 4LFBB 2BELA 2GQ0A 1V25A 4PFQA 5BSGA 4NONA 3I61A 3B6JA 1CK4A 1MQ9A 4FFNA 4M21A 1AGPA 3UOWA 3PUZA 2WF6A 3GRRA 1QONA 2G7MC 2R66A 3JQBC 2ZRDA 4H1TA 4J0CA 5GZ6A 1VLQA 5ESWA 3RKRA 2X0EA 3EPKA 4KE9A 3GCDA 4MHTA 4MGYR 1Z74A 3UKDA 1AO3A 4QUDA 4BP8A 3VNAA 3ZWMA 2H51A 4TS9A 1PJ3A 3QIAA 5GZ3A 1OXMA 2C2ZA 1ENPA 2VBIA 1UANA 1WG8A 1B8PA 1N2IA 1Z6TA 3OAAA 1Q0LA 3RSFA 1OFUA 4BCDA 4E2YA 2EWWA 1N2GA 4W9NC 1OXSC 3ROKA 3O5AA 5BR7A 3W06A 1HRDA 4PFKA 5ILQA 3D1JA 2PGOA 1I4DD 4RE6A 3DZFA 3EIHA 2CDAA 4BE9A 4JB0A 4L16A 1GNVA 2M2IA 2V6BA 3IQFA 3CF6R 4BNMA 1I51A 1RLOA 2ZSJA 8ABPA 4GO1A 1P1IA 4LDPA 3W5CA 2AL7A 4JIMA 2XQKA 1NX6A 3BGVA 3LGSA 2JI4A 1LPOA 3VM6A 1OX4B 4HDKA 4Q12A 3FMFA 3SEFA 4CM4B 3RUHA 2ID8A 3QLJA 1IQRA 1KK2A 1TJPB 1E2JA 4GG1A 4LWZA 5DSXA 2QYOA 3G59A 1M2KA 4FGJA 4X3PA 1FDOA 3AL0C 1IN1A 2NSYA 4RVOA 2C92A 1HLDA 4HWRA 4FP9A 1EA5A 2G7ZA 1STOA 3H11A 4OLAA 2WYWA 5AJYA 2XI4A 4D0GA 5L45A 4IWXA 4LJSA 2BGKA 3C24A 4PTYA 3ZNOA 1SVKA 5F2OA 2A1IA 3ORRA 3JSAA 1IMJA 3ZY4A 4Z1MA 2OFOA 2PUBA 1VYHA 2VK8A 3MLAA 1Q74A 2FUCA 3GQVA 3RVNA 1HXHA 1QANA 4UM9B 3PL5A 4D41A 3BBLA 1BTOA 3OY7A 2YR0A 4OXXA 1E58A 4JUCA 4YP9A 3RSSA 1SKUA 4ZK6A 5JOQA 4GL2A 1ZL2A 3BWYA 3AEQA 1NBIA 2GCOB 5TF0A 5A3SA 3ZUPA 2Q3BA 4IMIB 4WGFA 4F60A 5EERA 3WHPA 2C3MA 2RIPA 3PDIB 1SELA 3IAUA 1Z8HA 5L7TA 3PRKE 2ATVA 3UVEA 1SXQA 3NIFB 4KLNA 3TFQA 1CQXA 4QUIA 5HKBA 1A5ZA 1CJCA 2VBFA 3WWDA 4AP5A 3SSAA 2O8FB 2WKQA 2OVFA 3ZCUA 1JKJB 4J03A 2PEYA 3TINA 1WPGA 3JWIA 3PC6A 4AMYA 4KR2A 2WHEA 2AI2A 4MEBA 4ZREA 2FQXA 4NBNA 2H29A 1A4UA 4FILA 5FFMA 2GTPA 2HNBA 1TCBA 3GJTA 2I4RA 521PA 3WO1A 4RADA 2Y0PA 2GK6A 1DJMA 2WFMA 2VJYA 3SSOA 2VJOA 4HFNA 1O0CA 2OBMA 3QPUA 4ZCIA 3T99A 1V1RA 4DVGA 5A5FA 1PW5A 4X6XA 4CU2A 3VC7A 5JATA 5GMOA 4BFVA 4IXDA 5BNTA 3EF0A 3BXPA 5AI6A 3WL5A 3DGFC 2VA9A 1A7UA 4IDAA 4TMXA 2GK4A 4MKXA 1F9AA 2H4XA 1KP9A 3VR0A 1NR5A 4OA8A 1G3RA 4DC9A 3AUXA 3B1KA 5HKKD 1XVAA 4EX6A 4YCMA 2Z04A 4QU8A 3IEVA 3I9JA 2F48A 4M9XA 2DBRA 1J33A 4QPDA 5K4GA 1R4AA 3D8RA 1PK9A 4ZYUA 4P9NA 4I8IA 2J4FA 4TTJA 1IDOA 1USKA 2OO7A 4BO1A 2HZBA 4CXMA 3WXBA 1J25A 1OIVA 3KHSA 4Q1VA 4TLAA 1KSJA 4U7GA 1HA3A 2Y71A 3AUFA 221PA 1GPUA 2AXPA 4ND1A 3V1NA 2R5FA 4IDFA 4YRIA 1SC9A 1Z6XA 4QPCA 1N2OA 5BN1A 4HYYA 1OFIA 2ZBUA 4QRHA 1JP7A 4RGVA 1L5WA 2IVZA 2ODWA 2MSWA 2FRDA 2QD3A 3CTPA 4KIFA 4XI9A 5B5SA 2JGRA 4RE5A 3M5CA 2WT8A 4EEXA 1GQ2A 4OP3A 2DULA 2Z58A 4WCDA 1G8GA 3AP3A 3D6TB 4N7RA 2ZRQA 4DR2B 3FDIA 2YDXA 5CJ2A 4EPRA 2HKIA 3FPAA 3BIFA 4AP9A 3GLFB 2BP7A 5AI5A 1UP7A 5HDBB 1VJCA 3BA1A 1G3UA 1GG5A 2XBUA 3F8SA 4MOWA 2IQIA 2IQ5A 4OB7A 2R1VA 2I4OA 4H7HA 4QGFA 1A72A 2OCAA 1OXBB 3WNQA 5A1TA 2HIAA 1WW8A 4YEDA 3NRJA 4BNZA 1Y3BE 3BXEA 3M82A 1XXHA 5ALXA 4OU4A 1RC0A 3OF2A 3M1IA 3QUTA 3HBJA 1W35A 3AR7A 5EUMA 2NQ2C 5CG1A 5J47A 4BUCA 3A0RB 3R3UA 2NV0A 4WI1A 3ZN2A 3S4YA 4BTVA 4GPAA 1I8TA 2G83A 2WDZA 4R8SA 3ZVRA 1P9OA 1PFYA 3R9IA 4NPCA 4UCFA 2Q4DA 5ICCA 1GADO 3Q0EA 3N2YA 4M6WA 4B7AA 4HMPA 3GLHE 4JZKA 3QW2A 2RB5A 1U2QA 4PC6A 1EM8B 3MWEA 1H22A 1DXOA 1JWBB 4EHKA 4I19A 3PGVA 5LYJA 2H6EA 1CDOA 2ZBVA 5DX0A 5E9WA 2WZQA 3RR2A 4FK8A 1S8FA 3T7TA 3R7WA 1CUYA 1NQWA 2O7QA 1UXGA 2B4YA 4AT1A 3HZRA 3KKKA 4LJAA 5AOCA 3I28A 4KXFB 1QRSA 2QPAA 3I9KA 5JPIA 1PVOA 1M34B 1O5TA 3JS5A 3RV3A 1FS4A 3CN9A 1D2HA 2B1QA 2UZIR 4YRKA 1GCAA 2X0NA 2IBMA 2I2DA 2B6HA 3ZE8A 4HY3A 5JHGB 3LUBA 1Q5PA 1QFSA 3QPVA 3EODA 1FFDA 4UCQA 1IJKA 4CG2A 2WIGA 4FVTA 4V39A 4G86A 4PG7A 3WIEA 3AEUB 4OHOA 1LF5A 3ER8A 1F8UA 4PLZA 1SXJC 3W3ZB 1T6ZA 1ZU5A 4XR4A 2NPIA 3BTVA 2PSJA 4X7MA 3OFVA 2YXEA 4BMPB 1WXQA 1P0QA 1DP4A 2FW1A 1LWNA 2BR5A 3C5CA 3PKIA 3ABSB 4H7JA 2Z9BA 4WK0B 3BDVA 3AC0A 3CX7A 4H3KB 3L7YA 5EXEA 1C50A 3AYZB 3R20A 1ITZA 4FNAA 4LGVA 4RA6A 5KU1A 3B51X 2DETA 4TX1A 3WIOA 1RJ9A 5KVVA 1XNQB 2X5XA 3KRTA 4A73A 4UOZA 4TKUA 4ZT5A 4QU5A 4HTAA 2C04A 5H9VA 3A4MA 4BJ5A 3K1TA 1OBOA 2IH5A 4A6DA 2WV7A 3UW3A 3X1YA 1RI4A 2FCRA 4DIMA 4NBRA 3RQSA 3C7KA 1Z5NA 3UJ9A 2ADMA 5TIIA 3U61B 3PUVA 1PZXA 1XEWX 2ZATA 2IXFA 3OLWA 5DGHA 2Q4RA 1EQ2A 2A9JA 3TD6A 4BO8A 2CFTA 4KFCA 4R40A 1MRNA 1E2LA 3D81A 1A8QA 1I10A 1BG6A 1GYQA 1YS9A 2BFBA 3RVQA 4AN1A 1XP8A 1CS0B 2VIIA 3X43A 4CLHA 1E59A 5IASA 2YIMA 2Z6AA 1H9BA 2QP4A 2PU7A 1NDHA 1GPDG 3FWKA 3HG7A 4FQ7A 4HGOA 4JNCA 3T5MA 5E8RA 2GX6A 1U81A 1XIVA 1F3LA 4OJKA 3VR6H 4HNVA 5LZ8A 3TVYA 1RPZA 2BM9A 4UUPA 3ROFA 3IOMA 3HXLA 2CJXA 1ZOPA 1U94A 2H16A 4IKEA 2JLBA 1UXOA 2WSSD 3T9FA 3CUWA 4GR5A 1DC8A 3M49A 3W05A 1VP3A 1H42A 3WY9A 2XKKA 2P6RA 4PX3A 5G0VA 3LYHA 4UHDA 3HLTA 3ZQ6A 4CCSA 3G9UA 2OV1A 5KTOA 2CXOA 1AXEA 1C3VA 2C2KA 1NVXQ 3DPIA 3NP7A 1ZN9A 2QLTA 4NCHA 4OBXA 5H02A 3MCTA 5C7YA 1ZW1A 1A5SB 1KDTA 2X14A 2NVUB 2D7CA 2ACVA 1MVNA 4FC6A 4MS3A 4RV9A 4QAQA 3GA7A 4I46A 5EA2A 1DE0A 3ETDA 2P9EA 4Q1CA 3RFCA 2ZVJA 3U4AA 4DNFA 1NFRA 2AFIA 4JI0B 1THMA 1WUKS 5IVDA 1RWVA 4Z9FA 1G5QA 1GG9A 3IA7A 4F8JA 1TF5A 1WUHS 1QHYA 4DJEC 5G3ZA 4KPUA 4N5NA 2QS9A 1Q11A 2QUAA 3A3PA 2OCBA 3TDKA 1P3JA 3I34X 5HKAA 4MJ7A 1G8FA 3H4IA 3LYLA 3RRMA 1SXJA 2X42A 4DLKA 1KI6A 4KTTE 4AY2A 4MTCA 2Z4SA 4F45A 1E3TA 3LKBA 3P71T 4JI4B 3ICEA 1HDOA 5I4BA 2J6IA 1FXWF 1G2QA 1H6DA 3P5SA 2RHOA 4XCQA 3N2KA 4OKSA 3ED5A 4PBRA 3LPLA 4J4BA 1MABB 1E9FA 2JZOA 2XVAA 3JD0A 2JD2A 2KBFA 2CLLB 2IGBA 2OD9A 4L4XA 5IHPA 4YT2A 2NU6B 2CEKA 4BUZA 1X8LA 4O4LA 4NNJA 3NTVA 1MU0A 1N2ZA 5JYBA 4QFMA 1VHJA 2C7GA 3B6IA 4UQLA 2G88A 4ESHA 1F48A 1FMLA 2H7XA 3D0OA 4BQEA 2XOKA 2AQIA 3CLTD 3ZWKA 3OZCA 3WGVA 3BGIA 2XTJA 3CVUA 3UJBA 5KMGA 1SU6A 4B6PA 3LOUA 1ESCA 4V38A 1R9MA 1E6KA 2WWTA 5K0LA 3FETA 3T3IA 1F38A 4AUEA 3WYBA 1J21A 1N8KA 3WB9A 4UBLA 3MJVA 4RUKA 3FHCB 3QLUA 1HG0A 5IF3A 1E3SA 2VDLB 2Z1NA 1RTTA 4X8MA 1WZUA 2MSCB 4GPIB 1FE8A 3E9CA 2WTAA 5F1YA 4AQ7A 1KS2A 1N3YA 4GWLA 4P2BA 5EMKA 4Q9DA 1E0AA 2GYWA 2JF0A 3ONVA 5BQXA 3DXYA 4HH1A 5LKAA 1BZYA 2DBQA 4FE3A 4ALLA 1T9ZA 3UMCA 4ZEVA 2ZU0C 3VX4A 1H2HA 3JCZA 1YBFA 1X8KA 1L5QA 1CUCA 4L1KA 2GCPA 4AIIA 3ZHYA 2O20A 1EZ4A 1GGJA 2HWXA 3NT4A 4RM3A 5DRYA 3HPRA 4XOUA 3I92A 2QX8A 3LUFA 3EIWA 2PS3A 1RXVA 3TGPA 3ROGA 3BOSA 3AJ8A 1U7PA 1KARA 1K8QA 1C4XA 2FJPA 4ZJUA 2PUTA 4DUZB 2P40A 3G0CA 1AH2A 4B9AA 1ODLA 1AQ6A 4D4JA 5LP6A 1ISIA 4XGKA 2WSBA 4LE0A 4UKDA 2VJMA 1JG1A 3IC5A 4YRTA 5FOUA 1FFEA 1HOTA 4R1SA 4WZ6A 1MGOA 3M5DA 4LWOA 1C4OA 2PD6A 3T95A 3S3TA 1Y37A 2ECFA 2NTNA 4MQ6A 3WV5A 1O0BA 1Y42X 1EK2A 3VPHA 1D4OA 1A9OA 2Q1XA 3AM4A 4Z2YA 3TH5A 3BRQA 3GLKA 3PTAA 2I3AA 4HEA6 4OV6B 2Q8QA 1C9NA 3NVMB 4OQFA 2EZUA 4E5SA 1PQ4A 3NALA 1SUPA 4O4IF 4XLTA 2RC6A 5PGMA 3RTGA 4DWVA 4ZAXA 1GTG1 2P77A 4C4SA 4XH9B 4DDHA 5AVRA 1AV7A 5AMXA 2J30A 4BB5A 1WSAA 3WG9A 4EJSC 4WCVA 1EBBA 1VSQA 4WDQA 4O4IB 3L8GA 2P91A 4CL2A 4I4TA 3HWSA 1C7IA 5JUWA 3IFSA 1JZTA 3TTSA 5T57A 1SZPA 1LBEA 2IX3A 2JAXA 4EHIA 4GPBA 2Q3FA 1JB1A 1YD7A 1EE9A 1GSAA 3UHJA 4LSGA 3GIDA 2QLBA 3Q88A 5FLEX 3UJDA 1EJ6A 1FUIA 2PR2A 1BXRA 3L41A 1B73A 2K7ZA 2A9VA 3JR3A 4NH0A 5IM5A 2P1ZA 4H6XA 3S27A 4Q93A 2FEAA 4EUKA 2RG1A 3STUA 2RAPA 4MO9A 4XPZA 3JWJA 1AKVA 4LXTA 5AVYA 2XYGA 4ARBA 5KCZA 2ZSBA 2GAFA 3F9IA 4I5FA 4C0XA 4KVZA 3O73A 5AHXA 3JYQA 4GAEA 1II8A 4QLOA 5ICEA 4C7OB 1YNSA 1RBZA 2ZBRA 1P2GA 3PKJA 5DWVA 1OW3B 1MUUA 1YONA 4KB5A 4CQLA 1CY0A 1DINA 3OTHA 4KV9A 2CEAA 13PKA 1K0FA 3H5WA 3A9SA 3JVUA 3OQ6A 3TO5A 4DM7A 2W42A 1GLNA 4ND7A 2PZAA 4OHVA 2H2WA 4UM8B 4D96A 2QQGA 1RJFA 4HNSA 4HEHA 3UUEA 4K3VA 4DARA 2YJZA 1GVHA 5LQCA 3PJRA 3IVXA 2P8SA 1P2FA 3A1VA 4KLZA 3QFSA 4MUJA 5BR8B 4U7FA 4DJAA 5HIIA 5MDHA 1DBWA 1NV9A 1YB2A 3G9XA 4DTIA 1GIAA 2B20A 5DBHX 3VMFA 2ZK7A 3B5IA 3HJNA 1M5TA 1NBOA 4D43A 1EK1A 3HWRA 4GRAA 2A67A 4DZZA 2BBOA 2NYVA 4JKYA 2CHVA 2I5PO 2DPYA 2JAQA 1M83A 4DRYA 1VGQA 4G2TA 3ILVA 4G0OA 3B3QA 4KW7A 4JI3B 1CUGA 1UC5B 2PXXA 3TBKA 1C0KA 2D1TA 1QYWA 4HZGA 4BJ6A 1L6RA 2FX5A 3VH4A 2JHFA 2PX2A 3GFQA 3ZOZA 1TM5E 3OEHD 3IUEA 3K2IA 3EXHA 4IIFA 1EIZA 3D1LA 2MR6A 1JECA 2E85A 4G1UC 1K5HA 3I5XA 3OQIA 4AZ3B 3TUJC 2FQQA 4AMBA 5EKDA 2I7DA 3KJIA 2XD4A 2UYYA 1Z34A 3GLIB 3DBRB 2NXJA 2VPTA 1P39A 4LJ9A 1QE0A 1DAFA 3LD9A 4YN3A 3UA3A 3X0DA 4JLJA 4WZZA 3IUJA 3S2UA 2IPXA 2P2YA 2VZ8A 4HMOA 3HP4A 2JGKA 1VCIA 3AHFA 1WLSA 2PMWB 1TYCA 1OFGA 1MD9A 3AHHA 2RGAA 1HZZA 2X5NA 4BOYA 2WKWA 1ZOIA 3HCEA 1SQSA 4JASB 1ZC4A 3RBZA 2C20A 2QJWA 5EZ6B 2Q6KA 4YRPA 3UK0A 1OLSB 1K9VF 2RH4A 1JAYA 1K7YA 3NWEA 4KODA 4K1XA 4E5NA 1RI3A 1XKTA 3H5OA 1CY4A 4NZPA 2JAHA 1M1YA 1VJ0A 3LECA 2JCYA 1CR1A 3Q2IA 1E5XA 1QIIA 3OLXA 2AZMA 1SVNA 4EELA 2QJTA 4KNYA 3DZ8A 1W8IA 1M2EA 6Q21A 1YQEA 1X70A 3KQQA 4D44A 1W1UA 5ITVA 4LY6A 4NS4A 4G0YA 2XNDD 5B58T 5K3AA 1RVDA 1M1ZA 4MGIR 4HPWA 1YBAA 1BNCA 2X8JA 3P1JA 4LJ7A 4M8KA 3ZX5A 4BEBA 4DF3A 1Z5OA 1TJ4A 1MOZA 1H4VB 5E6SB 3RSLA 3ZJTA 2H18A 2ZB3A 4A2PA 3LLCA 1SULA 5DTRA 4D5EA 5CXQA 4N65A 4DA0A 5AW1A 4I3HA 1T6NA 5AK5A 1A7JA 3AF2A 2B8EA 3V80A 1NBHA 5FWNA 2J08A 3V55A 3BE6A 2VJCA 4CTKA 1WB9A 4R2IA 3LUPA 1Y34E 3AR3A 3UAVA 2FR1A 2PV0A 2JLWA 3KQTA 4U2GA 4UW9A 3ITDA 3P45A 3N2LA 1SM4A 5CEEA 2QVYX 2A7QA 2ASVA 4AD8A 4YDSA 5P8WA 1I1NA 2IIQA 4CIVA 4K9MA 4G01B 3VBEA 4CEHB 4BLWA 1IY1A 1UK9A 1ZRMA 2VJBA 2Z1DA 1Y9AA 2RHDA 1NUUA 3M9WA 4AZWA 2WZCA 3U6BA 1LD3A 4II2A 1OE0A 5JAPA 2D3TA 2BAGA 3GU3A 5IC4A 5ICMA 4D0RA 3OLCX 4GOOD 1GZ4A 1G7RA 3T3OA 4ZALA 1VIYA 2QW0X 3L7CA 3O26A 2W8BB 1HDIA 4DQXA 4WINA 4XDZA 3QRWA 4UUBA 2H59A 4ID3A 4KLCA 4WK4B 3VZSA 2GBLC 4WUTA 5H80A 1NKTA 2QZPA 2XDAA 4X1KB 5DLEA 5FEMA 3CZ4A 2JFZA 4FWIB 4Z86A 3I5MA 4LRUA 4W6QA 3PC8A 1BQ4A 2CJYA 4JEUA 4O4JA 1IIRA 1O94D 1C7FA 2X7JA 3Q3EA 3MWYW 3QHQA 7MHTA 4E3ZA 1PGQA 4TWIA 4B4KA 2LWIA 3S2EA 1R00A 1L5YA 1YAHA 5J4VA 5EJ5A 2ZBFA 2IW1A 3HR7A 4L27A 4A5SA 2R1UA 4BV9A 4C3UA 4QT4A 1OTHA 5HZKA 4N41A 2AEEA 7GPBA 4P98A 1OOEA 2PJZA 4JVLA 1DUSA 2WKSA 3KPVA 4JC0A 2RGUA 3TVTA 1GQFA 1LV7A 2D8AA 3HXTA 4ASUD 1QK4A 5AJVB 1NASA 3IEMA 1JIQA 1U0FA 1IIBA 1WHTA 3HB5X 4FDLA 1SHTX 3VFDA 1FU4A 1Z5GA 3D4PA 2O8DA 1SU8A 3PFNA 5D7NA 1Q91A 2MMGA 2O07A 2ZAIA 3KLNA 3KXPA 1KYTA 2HY7A 4HQKA 4KCGA 4YBZA 5DTJA 2RCYA 1GXSB 2YOGA 1RSZA 2B61A 2BF7A 2W93A 2YV5A 1QYVA 4HH0A 5F7JA 1JFVA 2C03A 2VF8A 2X8LA 1XK6A 1S2NA 2NPFA 1HKHA 4KE7A 4B6OA 5L53A 4O2BA 5EMHA 2ZI9A 2XRFA 3QKSA 4J43A 4BMYA 3LTNC 4HZIA 1Y4AE 3KPYA 3KZVA 3UKOA 1NXXA 2FZ5A 2GSWA 3CW9A 3PHLA 4FW9A 2QU8A 1UMBB 4JL8A 4Z51A 5BN5A 1JMVA 3OEEA 4MMZB 1ODTC 3OJOA 5H68A 2GN2A 2PT9A 3UT5B 5EUCA 3UXHA 2MSLA 2P68A 3BKWA 3JQAA 3WZ2A 4B71A 4CQMA 3FIJA 4CODB 4QJBA 1KNXA 5DW3A 2QL7A 1NW8A 1WMEA 2WF9A 4DA7A 2FG7C 1IAVA 1EG7A 1YRYE 4BQQA 1Z83A 2RGNC 1L7AA 2CBXA 3L4BA 4R2XA 1DDIA 3F9CA 1SZCA 2PFSA 2YY7A 4KACA 4HN2A 4KYVA 3AF4A 1G16A 2W0SA 2AUMA 5H83A 1ZVMA 421PA 4CM6A 2CLKB 3N3AC 3WK6A 1EVYA 1CE8A 1XZHA 4H27A 2PRJA 1G20A 1LF0A 3LT5A 1FA9A 2I6UA 1M5RA 5ALPA 2QTZA 3FB4A 1NWHA 2BM1A 4IY1A 2QSJA 4QOEA 3U49A 2F67A 1E79D 1MAHA 2AN9A 4ZRNA 1KEKA 1U8AA 1N1EA 5B55A 4M2LA 1F5NA 4HFJA 4WWHA 4AF8A 5EUQB 2R6DA 1JG7A 1DXYA 4OUDA 2Q5OA 2ZSAA 3R3XA 3JQEA 4MLPA 4DIKA 1WMFA 2YXBA 4D82A 3HO6A 4LHZA 1SQ0A 3VDQA 3PQ8A 1XMIA 3C3EA 2UDPA 3NV7A 2LZ0A 3G7UA 1S9HA 3LDAA 3VSDA 4BNYA 1BD4A 1I7PA 4NSNA 2C1EA 1D1TA 1F17A 1FMTA 2NVWA 1L1RA 2JZCA 2EAUA 3LFUA 1DX9A 3MGAA 3PK0A 1B00A 1E1NA 4CLEA 1QU2A 1YOVA 1SVOA 2Z09A 2ZI5A 3SR0A 4YAKA 4WN3A 2VTBB 1WMSA 2Q3DA 1F4VA 1OR8A 3B7WA 4G24A 4JELA 1SCUB 4GVXA 4RGBA 4V2UA 3WGZA 1KYYA 4R6WA 4Q3OA 1RJDA 2ZRPA 3IILA 4EJ0A 2R4UA 4HWOA 4JLMA 3NBZC 3T3MB 1UOOA 4QLBA 4J0HA 2DRIA 4X5OA 2DFNA 1C9KA 2Z2KA 4PSAA 5EIBC 4CMJA 4U5XA 2BKVA 3ITEA 3A1UA 1YIAA 4N3NA 3TRJA 1TE2A 2EVWX 3FTDA 4G5QA 2XMZA 2ISSD 2FAXA 5DMXA 3S8EA 1IXRC 4BKPA 1EUYA 3UJ7A 4L0CA 3WAJA 2OFWA 2YXPX 1PJ4A 2O8CB 3E03A 4MCJA 5DH9A 2BBTA 4NKRA 2Q7DA 3E15A 4IFBA 3LT2A 4I99A 4OXYA 3T61A 3UB2A 3ZU2A 1B7GO 1NG9A 2X2EA 5JS8A 3MIIA 2IBSA 1RYFA 3OG9A 5CX1A 5F9MA 3VR3D 1WB5A 4L0MA 1IWBB 2P3QA 4AWAA 2XB2A 4EFMA 1BRTA 5JS7A 3EXFB 2X9VA 4KK3A 1X39A 1KWGA 2P9JA 2JJ2A 2XADA 1A5AB 3KJHA 3M6LA 5D3MA 1N7GA 1GHTA 2XMBA 4OKNA 3L9XA 4P4GA 1OX4A 1P9RA 2FHPA 4RC9A 4DCPA 1JWAB 3S5JA 3R7DA 2GCEA 2V0NA 3HBFA 3NHPA 4WZAB 4A0HA 2VI5A 4JGBA 3SYMA 1QPGA 1SD2A 3INTA 2C7OA 1KYWA 4QSMA 1C7RA 4UVEA 4WA7A 3K9LA 4HWTA 4UBMA 4XEHA 3TW6A 4NBSA 1D5WA 2HLDA 4J4HA 2W5UA 4ZOAA 5AVZA 1NLUA 2FSSA 4LMRA 3EIOA 3R6DA 4ER3A 4FMDF 2XB8A 3D3EA 2JGDB 2RGYA 1Z5UA 1A0OA 2BHNA 1LI7A 5IM4F 3N70A 3WLNA 4O8CA 1KQGA 4DAEA 5F2KA 1U3VA 2ZBEA 2RJ3A 5KSYA 2R751 3DFKA 1CKEA 3K73O 4FMDB 4G56A 4PO8A 1OLUB 4TUYF 5UKDA 3WLQA 4QFDA 1L7OA 2GCOA 3C97A 3ER6A 2XYHA 4NCJA 3WK5A 5AUPB 2HT6A 1M66A 1X7WB 4F46A 3PDIA 4K26A 3BWDD 3OOEA 3UXMA 1XTKA 1IDN1 1KMHA 2HEGA 3DYBA 1R3DA 2C7VA 3K94A 1QZUA 3EXG2 4RAQA 4Y2VA 2DBVO 3T7AA 5MGBA 1KI2A 2GPWA 4BFYA 4I6EA 4HXFB 3AZQA 1FFBA 2BFOA 4L75A 1JKJA 2FLKA 5LZ9A 2QTMA 5CTJA 5B4UA 4K05A 2O2EA 2Z6QA 4QXQA 3EVNA 5K03A 3QXCA 2YNMD 2Z8XA 3AJ9A 4YRQA 4RABA 3R7SA 2QUHA 4C7VA 4DIEA 3MCVA 3G6KA 4LVNA 5B2FA 1TT7A 1LBIA 3ICCA 4IDEA 2VXYA 2CVFA 2ZJ4A 1PNOA 1SIWA 1K3FA 4BNHA 4GOKA 4HYTA 3SC2A 3PXUA 4BNGA 3M33A 3OPYB 2R60A 1LLDA 2ZM6B 2I4LA 1JTEA 4K9SA 4AS2A 2LIVA 4H3SA 4W4TA 4YCAA 2PX4A 2VWGA 1O0SA 1E66A 3TQIA 1ZONA 3ZD6A 4CN8A 4Z2AA 2F55A 1VLZA 4HB2A 2I99A 3BRWA 4BV8A 4ZOQI 2DQSA 1UUFA 2D00A 2C3PA 1UKCA 4A0SA 4E33A 5C1OA 3I45A 1HYHA 5J5CA 1U5BA 2Y27A 4BC0A 5I8PA 3A10A 3LOPA 1WO8A 4DREA 3F6RA 4MPDA 5JECA 2YS7A 3A9WA 3H9UA 1JAIA 5ECYA 4QYSA 4RLFA 1E2HA 1NVWQ 4BJ1A 4DNXA 1JIXA 4DLAA 1UXIA 2NUPB 3HRKA 2VRCD 2QGFA 4D8UA 3WB1A 1JEDA 1ZESA 1D2GA 4KVGA 4GMHA 3S55A 3FCYA 2JFBA 3SKYA 3VDMA 3F97A 1YAJA 1Y7LA 1ZNQO 2ACWA 2BRUA 4EPXA 4YT8A 3RANA 2AG8A 4JQYA 2QVGA 2CF5A 1T6YA 4H59A 4JLVA 3CZPA 3ZD9A 4I1YA 5JZVA 1QF9A 4DWOA 4MGKR 4QYWA 1TEXA 5EVCA 2ZPAA 1D07A 3Q85A 3GP5A 4DCMA 4RFVA 5GINE 1ZXLA 4R9RA 4DIDA 5B1DA 1EFPB 3MERA 2P69A 4C1BA 1GG2A 1ZCBA 3QLTA 4QXMA 3CZMA 1P9LA 1LTQA 1ZH8A 4A36A 2EKBA 1MOQA 5G02A 3PQEA 4RO0A 1N5KA 5AKHA 5J9FA 3IE1A 2KQUA 2A84A 1TO1E 1WUYA 2GF9A 3PC3A 3OX1A 4M1MA 1FCJA 3SR4A 1AQLA 1RYBA 1P81A 3P94A 1YMUA 3KZCA 1P73A 3QVMA 2FPMA 2FW6A 2P3SA 1I1OA 4OAQA 3TTWA 2ZRCA 3H5LA 4KFRA 4D9NA 1NZJA 4ILEA 3RK1A 3PR3A 3TXYA 5EEHA 2WUDA 2TMKA 2WMYA 3KJZA 1M73E 4JI6B 2GPNA 3V32A 1CEQA 2ABWA 5DYTA 1FYFA 2V7BA 1XRPA 2FUG6 5DBOA 4EPVA 4A15A 1SPBS 5EJAA 1EFLA 2DH6A 1GCOA 1E6LA 1G8YA 1WCWA 2AZDA 2G9QA 2IODA 1EM8A 4RQTA 4TS4A 5ALNA 3ITKA 1NW5A 4J0EA 3A7DA 4BO2A 4B3HA 2BWJA 1ZD9A 4OXIA 5EHGA 5THKA 4ZJYA 3PNLA 2IRWA 4WQMA 4XIJA 4ABYA 2J59A 4W5OA 3DEJA 1RIFA 3HUFA 4ATNA 4BHTA 2JJQA 1P75A 1IN8A 3GVXA 2JFFA 1NF3A 3ZK9A 4YQYA 5BY2A 4E5MA 4EIWA 4TSKA 4OHYA 1E9VA 4LYHA 1M34A 1R8JA 2I29A 3UYLA 1G5HA 2G4VA 3ASUA 3MUEA 4H4DA 4S3MA 4D1YA 1CQPA 4M7RA 2E4YA 2BJVA 4H1WA 3A27A 3K9BA 1X94A 4CIAA 2ZTSA 3EZ6A 3RRYA 3L8DA 3GPLA 1J7KA 4KWEA 3PIRA 1E2QA 1FNSA 3N2GB 3KSUA 4RKQA 4BVJA 1S2DA 5J63A 3LJKA 4D3XA 2X7HA 4ZANA 4MVJM 3C98A 5LDDC 3AEUA 3C16C 3RKSA 1MT0A 1NF2A 2JCVA 1VPDA 4JCCA 4J16C 1I9GA 4RPIA 1XTBA 1X8JA 5DXJA 2EDCA 4ZCSA 2FEXA 1JR3E 4YMHA 5CBPA 3E9QA 2O1SA 1JSCA 1OV4A 3SQXA 4NFHA 1W4AA 2WG0A 4I2NA 2E21A 2G5PA 4MROA 3VU3A 4H1UA 3FNHA 5KX5F 4C78A 1F2UA 3CO0S 2DHRA 2VHYA 3FGNA 3EK2A 4TMTA 3UC9A 3RG2A 5HTKA 4W9MC 5HIJA 4LGMA 4AKEA 3T5PA 2PY6A 2QX4A 1P1RA 5KX5B 5LQDA 1K6EA 2MCFA 3ABIA 2XZLA 5LOVF 3JW8A 4FT2A 4P81A 4EUHA 5JFOA 3ASYA 3VH1A 3E5MA 1LS1A 3H1BA 3MF4A 3W4KA 5KTPA 1I6MA 2Q1YA 1T9KA 1R0CA 2BH9A 2IF2A 3DTYA 4PQEA 1H5UA 4JJ6A 5HR5A 4JT4A 3PXGA 5LOVB 1EK6A 3CTMA 1U9IA 5A1JA 1TAGA 1U2PA 2PWPA 3DM5A 1O8CA 3ESRA 5EIWA 3DHYA 5FUYA 5KB3A 4BS9A 2CC2A 3OMWA 4EJFA 4Q9AA 1VIAA 4ZQHA 3IELA 3L3BA 1SVUA 5B57C 3FPCA 5K6AC 1GTSA 4MEJA 1M2WA 4E13A 1PW7A 1CS0A 3DLTA 2Q1WA 1MA0A 5FA5A 1NXOA 2OENG 1IZZA 4LQDA 2IHZA 4P4UA 4PX9A 2QVLA 1B1AA 5HUJA 4JA0A 4CF7A 4P3YA 1A98A 1J9GA 1KEPA 2RHHA 4QGAA 1PWYE 5DI3B 2C59A 2B0JA 3IGFA 3TLGB 4OLBA 1Q1QA 3TBHA 2JJ1A 3QZUA 3IHKA 3C8HA 3NKVA 2RE8A 4HQRA 1DO0A 3B7GA 1Q7CA 5JADA 4KE6A 1N2CB 1NUPA 2P9GA 3F7NA 2A6PA 3CRMA 1J2JA 1TLTA 3HYSA 3NBFA 3GFGA 4OLJA 3ZI0A 1EVLA 1JTFA 2ERYA 2P2SA 5BUSA 2QWXA 2IU3A 3GV0A 3KUKA 1BWQA 1U8CB 4UTNA 1QHFA 2FW9A 3BMNB 3DFZA 1HTWA 4YJFB 3DEIA 5HK8A 1XV5A 4MUAA 2NVUA 3NM5A 1YR8A 3WIBA 5KWJA 2MIIA 3WMXA 5J2TA 2C4MA 4RMHA 5ENZA 1X7XB 2X9QA 1U7ZA 1UBFA 3E9EA 3FDFA 4G2NA 3FPJA 4ZEMA 1XZBA 4KBGA 3R5SA 4P8RA 1W87A 2QN7A 4L50A 5AVWA 2XZDA 3ZOKA 2R0QC 2LPMA 1HEYA 1DAHA 3BAFA 3QLVC 3TTVA 4DSNA 2J3IA 3H9QA 3GLRA 3R5FA 1QRDA 3IP1A 5H9WA 4YO7A 3FBTA 2HF8A 5FQNA 3W9YA 1XU9A 3GZNA 3HDGA 2V5VA 1E4OA 5L3SB 1XYGA 1WZEA 1KYIA 5K01A 4M53A 3G0IA 1GTRA 4L07A 5E6UB 1N3BA 1AK1A 3WGIA 3ORYA 3EFOB 1HNWB 5IVKA 3DXZA 1KDOA 1S4MA 1NATA 2V96A 1GV0A 3IBFA 1Y3CE 3GEHA 1MABA 1EQUA 2FYTA 3GN2A 4NS1A 1R8SA 2JAWA 3F47A 4CM1A 4FR2A 3U09A 4B3SB 5KSWB 3VZCA 4YDHB 5JCJA 4F92B 2NU6A 1PFQA 4WXMA 1NZFA 3DZIA 3TQSA 2CT8A 1P19A 5IKXA 3DCYA 1ONBA 3GF4A 3JPWA 5TMDA 5TPZD 3FZNA 2YWFA 4HDNB 4E6PA 2X2PA 5C32A 3B6ZA 3U7JA 4FCVA 2V58A 2IOFA 2W37A 1T2VA 1YU9A 1TFRA 3JZAA 4D02A 3JVDA 3WP0A 3WDMA 1ONPA 4L8WB 4ODIA 2B8WA 2Q0QA 2NXEA 4PXAA 4A2CA 1X9GA 4CMAA 2SCUA 3H6KA 3W5IA 4I1OA 1QM5A 1FVHA 4PPFA 5GAJA 1NYLA 4N6NA 3SIRA 3UMFA 2GJ8A 1PJ2A 3AWDA 1IM2A 3DAHA 2CHEA 1PJ8A 4K86A 1FZTA 1X0VA 3RC1A 2BGGA 4MJ3A 5CAEB 1G6HA 2CB0A 4DWJA 4OVKA 3UAWA 5KQLA 1PO7A 5BSFA 1DXQA 4HPJB 3BIJA 2OO5C 3EIUA 4Q03A 3EIXA 4FFWA 1J6UA 1KAOA 1ONOA 1SHLA 2IUEA 4MI9A 4PINA 3KVNA 4LX0A 4B34A 2M6RA 1S89A 2FK8A 2IZ5A 3F5DA 3QYFA 1XTQA 3FWPA 3RRFA 4NQZA 2F8LA 4NR0A 5BVGB 2PRKA 1E62A 4MWBA 5H82A 1WD5A 1YJXA 4G26A 2P11A 2QD2A 1VB3A 3T38A 2YZ7A 4HMQA 2EWMA 5BPFA 3WBKA 2H1IA 3DQPA 2JCSA 1B8UA 4GS5A 4PLTA 3VR4D 4R0NA 8ATCA 1B0PA 1IEWA 2XNHA 3JTMA 3RRNA 2C2XA 5KDOA 2EKQA 4BZWA 4XVCA 3BJRA 3RWOA 3JSXA 2IYLD 2XLCA 4JVNA 2TECE 1ULZA 2DTDA