4MJ7A

Crystal structure of the pin domain of saccharomyces cerevisiae utp23
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
QKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA-processing protein UTP23
publication title Structural and functional analysis of Utp23, a yeast ribosome synthesis factor with degenerate PIN domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 51
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04900 Fcf1 Fcf1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4mj7A00
5ECWA 5HMLA 4MJ7A 1B43A 1UL1X 1UT5A 1V96A 1A76A 4CHGA 3H7IA 3I8OA 5H4HA 4XGQA 3ORYA 1TAUA 3ZDAA 2BSQA 4WA8A 5FV7A 2H1OA 3TNDA 1V8OA 2FE1A 2WP8J 3ZVKA 2QIPA 5L6MB 3DBOB 1MC8A 5SV2A 1YE5A 2DOKA 5ECDA 3ZDEA 1O4WA 5K8JB 3H8SA 4XGRA 5HP4A 3ZDCA 3IX7A 3H87A 5L6LB 2IHNA 1RXWA 2LCQA 1EXNA 5ED0A 3QEAZ 1V8PA 5ECYA 1BGXT 3ZD9A 3QEBZ 1Y82A 1RXVA 2IZOA 3Q8LA 2H1CA 2HWXA 5H4GA 3ZDBA 3Q8KA 2MDTA 1A77A 1W8IA 5HNKA 3ZDDA 1XO1A 3QE9Y 2HWYA 3ZD8A 1TFRA 1UT8A 3Q8MA 2HWWA 3H8WA 3H8JA 5HMMA 1TAQA
chains in the Genus database with same CATH superfamily
3IS3A 2B1IA 5IK2A 1O58A 3AI1A 1ORWA 4MLCA 2FLWA 4UNSA 4WKNA 4F21A 3FMOB 3RU7A 3BB4A 3DHEA 4Z2YA 2Y0PA 4L74A 2ONCA 3LCRA 2WAYA 2XWJI 2OXTA 4ZXPA 1P91A 5AW4A 2X22A 3EMBA 4YV2A 1EWYA 1Y48E 1G16A 4PZAA 3SK0A 4I3HA 5CXUA 4YGYA 2BEUB 2QS9A 1BX0A 2V7VA 2YUIA 5IAOA 1L7QA 2O4CA 1WW2A 5JIBA 1CQIA 2GWHA 2PV7A 2TMGA 2VNIA 3GFVA 5KX5B 1XD2B 3SFTA 2Q2VA 4KH0A 1M1ZA 2XD9A 3PTAA 1NMYA 2H5EA 3IILA 3TMKA 1DIBA 2AI2A 2FYTA 1UBSB 1I30A 1JPVA 3DNFA 2WMYA 1FUIA 1Y9JA 5AUQA 4IGEA 1IRXA 4ZI3A 1IWBB 2YMLA 4XW2A 4OFBA 4UHHA 2BFMA 1M0SA 2NTVA 2VDLB 1IN7A 4CUZA 1W5FA 4LVUA 1K7EB 2QVZX 1EEXB 3EZLA 4C3UA 5HKKA 2YW9A 5KCMA 4C0JA 4EATA 4LF4B 2R6HA 4XM0A 1GU1A 2AJDA 1KIFA 3U7QA 3DEAA 1NLMA 2O06A 4UNNA 1JJ7A 1HKHA 1H2FA 4MJLA 4X44A 4ETNA 4Q93A 4GKKB 2EX4A 2QDKA 4W1SA 1GZSA 4D4IA 3PQ7A 4YJGA 3VMFA 3R0QA 3RRYA 3P5SA 4NZZA 4PX5A 3SX4A 3U60B 1IN5A 1DV2A 3AVPA 3PD0A 2HF8A 4EZBA 1T2NA 2P1DA 3G0CA 4L7VA 3ST7A 1BCRB 2UU9B 3SR3A 1L8AA 3LLMA 1OX4A 1WIWA 2IOYA 3ZV6A 1X0VA 3ZX5A 4WWHA 1VDMA 2Z3WA 1TYEB 2DX7A 3BMNA 3WA7A 1R6TA 4D3YA 3L79A 1O94C 2HADA 3IOYA 4ZRNA 3Q6IA 1FA9A 1M6HA 3VOAA 4BB0A 5A5DA 4V1CA 4MWEA 5EI5A 4C1NA 1F0NA 2DHDA 1KU6A 1O97D 5CPFA 3TXXA 4WCFA 4MR7A 6YASA 3AVYA 2O54A 4FIZA 2ZIAA 3LKZA 2NQTA 5EGSA 2OECA 3FJ1A 4H7EA 2EEZA 1Z4NA 1QSGA 4GMGA 3RU9A 1MKYA 1DPGA 2J9XB 2QX7A 4LZWA 3ESCA 3ZHYA 5EE0A 3W2IA 4TLEA 3USZA 4DY6A 5EIAA 3ZJYA 1UIMA 2BEKA 4U3JB 3CO0S 4MQFA 3IBSA 2FFJA 5HJ2A 5KVAA 3RVQA 4AS3A 5AW2A 4QFDA 4BC0A 5CFPA 4O2AA 3ADKA 1TQ2A 2B78A 1Z6PA 4JD5A 3C8HA 1MQ9A 4AS2A 1ICEA 2OCLA 5I45A 4UM5A 2DWPA 3WFZA 2WHYA 3GT0A 5K0SA 1UJ6A 1A9PA 5EQFA 1C8BA 2PGOA 4YJFA 3F1KA 3WX0A 1SUBA 1ONNA 3W2FA 3G2JA 4FFLA 1NRIA 3I72A 3OFND 4KIJA 3DD1A 4COOA 3KBBA 3AVTA 2OFOA 1TF5A 4N8SA 4E6EA 4QU0A 2X3UA 5H8WA 3BZWA 1LPAB 1E8DA 2DTEA 3ANYB 4LJAA 1CRQA 2PKQP 4ZD6A 2WC1A 5GADl 4R2IA 4RVFA 3AW9A 1BGWA 2I5PO 3PXDA 4A03A 4UMFA 4D4LA 4D9CA 3DAHA 2W6JA 3EASA 4RNDB 4UHEA 3DKIA 4BKPA 2NYAA 2RBEA 5K0LA 2FRXA 3DWIA 1KEVA 2I3DA 4NABA 3BSYA 2VZ8A 4IZIA 1KMCA 2A0WA 5DM0A 3V33A 3JYQA 3U3DA 2X86A 1NP7A 3PJDA 1JXMA 2AVDA 1OAAA 2QG6A 2W98A 1BD3A 4JI3B 4TTPA 1ZMRA 1D0VA 4JJ6A 4X7RA 2PUWA 4C4AA 2J5BA 3K15A 3WIEA 2PKXA 3D6FA 4PX3A 4RY9A 1OASA 2QBYA 1XJCA 2ICAA 3FXAA 4ACBA 2FSVA 3TFQA 3IIIA 5IN4A 1FXWA 2IE0A 1MZVA 2WG1A 3HE3A 4NOLA 3LC7O 1WB5A 5LC1A 1DKOA 3RJ5A 4YUWA 3DBLA 4J90A 3KWJA 1CZUA 5JLAA 1JI0A 3AFHA 1J8MF 1JDJA 3AP1A 1VYTA 3BJRA 3GMDA 4FXOA 3B1WA 4X6UA 4XQEA 2M2IA 4EGCB 4LDQA 2FZCA 4EY3A 1N5LA 3NAZA 1FS6A 4CBVA 2HHHB 2BTEA 3JWGA 3I9FA 4MR8A 2PSHA 1Z45A 1L4EA 2GN9A 1CQJB 5LA6B 1ZVJA 3W1WA 3WGLA 3S1AA 5HW0A 2AC7A 1NC3A 3QGMA 1AZWA 1TLLA 1XU4A 3IIKA 1AKWA 1DIGA 2REOA 2NZ8A 4TUYA 3CZ5A 4YRCA 4LA4A 4FYPA 3RS0A 2VHZA 5GAJA 3I4LA 1TYBE 3PHLA 1B7GO 3PPWA 1Z56C 4PR0A 2VJQA 2XA9A 4D3SA 2QX8A 3DW1X 3FYSA 1Y5LA 1A1VA 1AKQA 2R68A 1BE0A 3CR7A 4DL9A 4H7JA 4NPCA 5DGHA 1EUDB 5CX1B 4KAAA 4D9NA 2VHWA 3ENNA 4FN5A 5F5XA 4EA8A 5EZQA 3IE1A 2CDRA 2GNOA 3NHWA 2V8OA 3IX7A 1GNQA 3CW9A 3VI4B 1JQBA 4DLPA 2YYYA 4L6IA 4XWYA 5EWJA 3CNNA 2C8VA 2XJ4A 1HYGA 1EJ6A 3PJFA 1NXSA 5AW1A 3KZ1E 4Z4EA 2VPWA 4HDRA 4W6ZA 2WEKA 1CLEA 1O0BA 3TOZA 1G66A 2RI6A 3MFYA 1GEGA 5E3HA 3FFXA 4KHZA 2WHQA 1R4MA 1Z4IA 5HQJA 2QLMA 2HQOA 3OCVA 3VUFA 4FUTA 1L5YA 4DLAA 1PDOA 4C2AA 1Q44A 1Z5OA 1RAGA 5JLJA 3VYUB 3R76A 2ZQZA 5FI3A 3BCSA 3TLCA 5AI8A 3TR0A 2JG3A 4DCUA 2WG2A 1J00A 3TN7A 2AWOA 3B53X 1YR7A 3LLVA 3EHDA 1E4OA 3DDOA 4UUPA 3WNBA 1PWEA 4C29A 5I4BA 4N0EA 1IONA 4Y67A 2UZ0A 1N4DA 5EWMB 5H59A 1QXSA 3ORRA 2VA9A 3H2IA 1NW6A 4XRGA 3UMMA 4B3GA 3RYCA 1C5KA 2J9FB 1YOBA 3F7TA 3W5UA 4ATNA 1WHTA 3OIVA 2RE8A 1YZYA 2NSJA 4RS3A 4HRXA 1B4DA 2EERA 1VOTA 4RCVA 3GDOA 1KAOA 4LFBB 1C0KA 1KPHA 1A04A 1NKVA 4H4EA 4M8IA 2ZE8A 3JVDA 2Z9DA 1VXOA 4KFTA 4P5EA 2BDTA 1PI3A 2YXEA 3DE4X 3HRIA 3OQIA 2XNDD 4KACA 1AHHA 5LQCA 1NMZA 1SVLA 2FLVA 3F7OA 4M46A 1UT8A 4J0GA 3I0MA 4RPHA 2VPZA 1EBFA 4HNSA 2F6RA 3RV3A 3I53A 2FQWA 3VDMA 4YFVA 1W5BA 1QCDA 3SS9X 1XLTA 2Q5CA 4DR4B 3PEVA 1C3VA 2FK8A 3OO1A 3L4KA 3GNTA 3W2EA 1YZKA 3M6VA 1AH2A 1RJFA 1UQTA 1QDLB 4LYHA 4ZU1X 4ENVA 3HDYA 2PBLA 2ZRAA 2PK3A 3WL8A 3FLAA 1CB0A 4MYSA 5F7XA 2OCYC 1GN9A 3ACDA 4OQZA 1AOXA 4LFCB 1UOEA 4P34A 2OGZA 3MIIA 1OXMA 5BY2A 5C4MA 1ST3A 3H9GA 5U4QA 3NGMA 2YDYA 5HJEA 1PS8A 1Q50A 3AJ8A 1W0CA 4OYRA 4N9QA 2IWRA 3DDWA 2XH8A 1IU9A 1JMKC 1V2HE 4GPD1 4TMZA 4YCDA 3U7JA 3KU4A 1RDFA 3TWOA 4DCSA 3FB1A 3LPMA 3H4TA 4RANA 3PFHA 1M1YE 4DG8A 4XVCA 4A8JB 2ZIXA 1P1IA 4Z9FA 5EQDA 1XMJA 2G04A 2WJYA 3X1JA 1ZNZA 3T5BA 4JLJA 3ZEIA 3WL4A 1O95C 3TLMA 5FUVA 1SCIA 3RJ9A 4R7GA 1JKXA 1V16A 1L5WA 3IUQA 3QMWA 4RV5A 4C3OB 2XE6A 4I8XA 4BTVA 1M6EX 3NHLA 4HJRA 1CJVC 2J0VA 4UZSA 3B78A 5AKJA 4RTOA 4PRZA 1L4UA 3FOAA 1U4SA 3FJOA 5M29A 4HFJA 5CFMA 3KG2A 4BNHA 2XNJA 1NSTA 1ONSA 1XQ9A 4JYAB 3S28A 2ZXEA 4BRUA 4W5OA 3DDUA 3L0YA 3WMXA 3HGTA 5HRAA 3GUYA 1MAVA 4DA0A 3WAJA 1S4QA 4J1NA 5BOSB 5BMVB 4WBNF 5BQXA 5KAPA 2Q9UA 3JPYA 2ZRNA 4KVAA 1XCJA 1AQ6A 3KQOA 4CKXA 3QEKA 3CFYA 4CM4A 4Q1EA 2PWYA 2ZB7A 2RKWA 1WDKA 2R8PA 2WJ3A 5K2MA 1OBFO 1DRWA 1R88A 1TVMA 1WKBA 1NLUA 2QJWA 2RI0A 2V7TA 3HKDA 5BQ3A 5K4GA 1RXEA 1V3VA 3ZH9B 5C1PA 4YPVA 2V8BA 3EIUA 5DMXA 3QE0A 4R71A 4ALIA 5AFSA 3BAFA 3KTAA 1N5RA 3CWQA 4N47A 1USVA 2C5AA 4LRTB 2P5TB 4EHJA 2V1UA 2ZZKA 1VYUA 4C2TA 1PR6A 1G6KA 1JU9A 2ZTHA 4KDRA 1ZH2A 2NSYA 1R9GA 2OVFA 2JCGA 3HLYA 3MJEA 2DLCX 1PEKE 1MQ8B 1KY3A 4HWRA 3QVJA 2DU8A 5AVWA 1U5CA 2X14A 3PPIA 1I3KA 2PH3A 2WIAA 3TPFA 1C9MA 1CUBA 2VDNB 5EEHA 4ZAVA 4A5SA 1BSVA 1IBKB 5ALSA 2C2GA 4G3XA 1T8TA 1PWYE 4FVTA 4MKHA 3LQQA 4AT1A 1CVRA 3COYA 1U63A 1P33A 1TJYA 1E3DA 3R7WA 3NP9A 2HTFA 4DV0B 2P5UA 3AFNA 1SKUA 1P0IA 2AE1A 4KE7A 4GLBA 1XD9A 2R0QC 1CTQA 4IIBA 2CHFA 4RJIA 8OHMA 3A9VA 1XO1A 3K6SB 1O94A 3KQNA 1MJGA 4E46A 3GJQA 2B21A 1ZIYA 2QRNA 3I04M 1E9EA 4NCBA 3RK4A 3OIGA 1WSWA 3QEJA 2O0LA 4JJEA 3JZAA 2Q7OE 2FHSA 3E61A 3ORHA 5I9MA 1Y4DE 1UWLA 2V59A 1W47A 3D4LA 4JN6B 4CMJA 3G82C 4ON9A 1DQNA 1MB9A 4G5FA 1A27A 821PA 3VNVA 4TTAA 3AEKA 1IHPA 1O03A 3ROPA 2N3ZA 1XXHA 3HI4A 1CUGA 4CIVA 4UTOA 1I2AA 1RRCA 3Q7IA 4N5IX 4R6WA 4M36A 2J09A 4FNMA 1XA4A 3VR3A 1E1CA 2PQMA 2VQDA 1K7FB 3F4KA 4MUIA 1Q6YA 4WEOA 2GGSA 3S4YA 3SR0A 2PIAA 5FOWA 2NUAB 1T0HB 1GQSA 2WLTA 2ZI5A 3EODA 4JA0A 4E4YA 3WKCA 2FJPA 1XRRA 4KR6A 3L4JA 3L41A 2FPUA 4PNZA 5FA8A 1A9ZA 3ZNQA 1UJ5A 2ZI3A 1W0JD 3B70A 3OFKA 1NI4B 4AQYB 1HNXB 3E27A 4XKJA 1EXVA 1FFEA 4PINA 5FJIA 1SKMA 2GD6A 4LQLA 3ETEA 5BQPA 5T4HA 4FHEA 3V4VB 2XBUA 2G72A 6ADHA 3VA7A 2Q6LA 3UWDA 4G9BA 3FLMA 1TNDA 2Z2IA 4XSHA 5C18A 1HNNA 1ISMA 1XFDA 1JDBC 2WTMA 4JT8A 1ZX1A 4QQKA 4WY8A 5FBHA 1RADA 5G0UA 1EM8A 4E07A 5CA1A 2OV4A 1GJRA 4FCWA 1OZGA 1T35A 2BGMA 4B6QA 5CT8A 4X5OA 3F2IA 4ZAXA 4F1KA 3T6KA 1NJ2A 3W8EA 4XWOA 1C0IA 1R0RE 4QXMA 2QENA 3IAAA 4W6QA 2RJNA 4MCAA 3I30X 4RD6A 2A57A 1E64A 2JI8A 3L8DA 3B36A 4UE6A 3ZJUA 2H85A 3URKA 2C7BA 2IUFA 3C14C 4MUJA 1Z0JA 4HQOA 1DJQA 1KY4A 2VDVE 5BURA 1RTTA 2ECQA 2P78A 3FPCA 3IAS1 4HFMA 2IP1A 2IODA 3LY9A 4L7QA 5EZ6B 4BGUA 5KNDH 1MIOA 3I9NA 4GMHA 3WOHA 4TZKA 3ONDA 4UJ3A 3V1MA 1A5BB 1K75A 4L02A 1Z9BA 1KJIA 3OF5A 3QXCA 3SEFA 2O7QA 1Y7HA 1VE5A 2WWFA 1FTYA 3FPKA 1QGZA 2C4MA 4DDKA 2YS7A 5DBHX 2XWQA 3FCSB 3SXUB 2V5AA 1NUSA 2JAOA 1JLRA 4CV3A 1M6VA 1YDWA 4GR9A 1RWVA 8LDHA 4JT9A 4UKDA 5DU2A 3UB4A 3WKDA 2DFPA 1X14A 2WTXA 4L27A 3RVBA 4QDXA 1XCOA 4P7JA 4BP1A 4BO6A 1DX4A 1RJ9B 5TNXA 1YOVA 4UEOA 3S7ZA 3DL7A 2CBGA 2WYVA 4RC9A 3W3AD 4ER7A 4GDFA 5LMUB 2E4YA 3AG5A 4K9LA 3VR6D 1MDFA 1NJGA 1ZRNA 2JFZA 4XFDA 5EHXA 2ARKA 3JWPA 3ETLA 1UKAA 2A1IA 4IDBA 5G0WA 1VE9A 4YDQA 1QP0A 4HJXA 4D81A 2O19A 1J21A 3AIKA 2PANA 4UHJA 1T34A 5LCXA 1KU0A 1LC0A 1PFKA 2A8YA 3K1JA 3PSAA 4NYIR 5EJ2A 3MMZA 1UBLS 3N5KA 3ZQUA 4K9QA 2YWGA 4AG6A 2NQ8A 4TLBA 4C6RA 1FX1A 1WMEA 1ZH0A 3PUZA 4B9EA 4DWWA 1Z3IX 1UP6A 4CF6A 1W93A 4H7IA 4QPZA 5IAEA 4KPYA 1PJTA 1VECA 1TTQB 1VIAA 1NNI1 2GX6A 3Q8WA 3WISA 3QE9Y 3LBHA 3H11A 4FR0A 5D5HA 4UOEA 7REQA 1W7AA 5DK6A 1BWRA 1FFBA 2HK7A 4XGKA 5IUJC 2VHXA 5TMPA 1VSBA 4L5YA 4OHFA 3GCXA 4JJAA 3P4XA 1VA5A 3OJOA 4TKZA 1B0UA 4BQNA 1O5IA 2X8WA 1RYYA 2GAIA 3CUSA 1IXKA 3LWDA 3O73A 3UC5A 4CW7A 1HWYA 3PVZA 4O4LB 2QVBA 1SD5A 3ZXSA 3JQEA 1FU8A 2OKGA 4D9EA 1DINA 3M6FA 3WWEA 5IP5A 1AGNA 1DJLA 4LCEA 4XFJA 2C83A 2FPMA 1J7JA 4UJ5A 3GYGA 3OEHD 3TECE 3KQWA 1HT1E 5FFMA 1G7RA 3RUPA 2R79A 1N78A 1F12A 1YQXA 2PX0A 3ENVA 5E9WA 2IUUA 1UBUS 3R09A 5IARA 4BHTA 4ETWA 2I8AA 3OP1A 1HLPA 1QRAA 4UXHA 3M1LA 4CETA 3KQVA 4CU5A 2WDPA 1D0SA 3FR7A 5C2JB 3KFLA 1UJ2A 1ZC4A 3NALA 2UZ1B 4LF5B 1QLHA 4AG5A 2HC9A 1ZIPA 3ENWA 5IDYA 4ZQHA 3BWXA 3GEIA 1IHDA 2C2WA 4X90A 3VSEA 4N4AA 3ZX4A 3D31A 1M5RA 1JFSA 5TS2A 1HO3A 2LW7A 4RK7A 1EQ2A 1V9CA 1GGJA 2HLNA 3F49S 2ZR0A 1UMBA 2RKOA 3FF4A 3QWIA 3NHFA 4FFWA 5JZVA 1HG1A 3IP5A 4B09A 3BCRA 2VZ9A 3QUTA 2VXBA 4RADA 4F1JA 3HQ4O 3VZSA 3N0VA 1JYEA 2BYTA 1J5XA 2MMGA 2J8ZA 1T6NA 2WSMA 2I2WA 2J1LA 3C3EA 3MPUA 2Q3MA 5JH7B 4BNGA 1ORIA 1NFQA 5T3YA 1T5BA 3RYFA 5F3DA 4Y1FA 3D7KA 3IJ5A 2FUKA 3X1KA 4BO9A 4GE3A 2CFRA 4E5DA 1KRHA 2XVXA 2L0XA 3K2BA 5DISB 5E6SA 3PFGA 4BAGA 2BKLA 1MPXA 2ETXA 2HRDA 2WVGA 2M1ZA 4ZO4A 3B12A 4OMCA 5ALKA 1JHXA 1O95A 1AZTA 1JZSA 3DVLA 1HEYA 3IEVA 3KOOA 2CCGA 2DB3A 4MITA 3ZD9A 4JLMA 1THGA 2P69A 1D7OA 2CCJA 3MJTA 1M67A 2XZPA 2Z5FA 3OY7A 4IAOA 2IV7A 1Z08A 3S2EA 4LGCA 2B20A 1DAIA 1N2BA 3F46A 7YASA 1ZW6A 5JS2A 2PJRA 3QP9A 1M2VB 3E2MA 4K9MA 2I1WA 2PU5A 5JADA 2AD1A 3H05A 2WWVD 3W5AA 3T9DA 4EG1A 1ZI9A 2GF2A 3NYRA 4JI8B 2H59A 3B3JA 3ZGLA 3CZ9A 7GPBA 2BW0A 4HXEB 4HWKA 5AVXA 2E4AA 3C8ZA 2XGMA 3AERA 3ZHRA 5JAHA 4EFNA 2LCFA 3LK6A 3AQIA 3ZIUA 2IZ1A 1D4OA 4CMCA 4CRWB 4F5YA 2ONYA 2WF9A 2C2XA 1K6XA 5CHYA 4BIIA 3R23A 2B30A 4NZ9A 1T9AA 1OFTA 3P2YA 3E5MA 4JVNA 2H7XA 1UAAA 2AXEA 4UM8B 1Q1EA 3FY4A 1FDTA 2PL3A 1X3LA 1UBMS 2FPXA 3PVCA 1YQWA 3A7EA 4MHSA 3GGJA 1RWNA 4FE4A 4KC0A 4U2DA 3MGCA 4WRRA 1FBTA 1JQDA 1E66A 3GIDA 1E3WA 3DZBA 3JTEA 4MS1B 3ZJ4A 2R85A 5KPJA 4L0MA 5FTWA 1DJOA 1E8MA 2HJ9A 3RBVA 3PG5A 3MF4A 4WXPA 2CYBA 4OHUA 3BQ9A 5CA0A 2AKEA 4JEUA 4OQXA 1SUAA 5C5CA 4IDCA 1WW8A 3FOBA 1UBOS 1L4NA 3BWCA 4EW6A 3KJXA 3BS4A 1DDIA 3O21A 2DYKA 5A4MS 1PGQA 2AQHA 1T4BA 1Q84A 3G88A 3KQMA 5ES4B 1MXHA 3AL0C 2E0IA 1XGKA 4L4SA 4BEJA 4R1TA 5FBKA 4DS3A 3L1HA 1XZGA 1ZUNA 4UE3S 3WIUA 6NULA 4E1BA 3BTVA 4KV9A 1ADGA 1JSLA 2P9CA 3T15A 5M2QA 1JHPA 1TT5B 3QOFA 2C2KA 1M1YA 4FB5A 4ECEA 4DSTA 4BRSA 2QD3A 1G2OA 3L6CA 4HX9A 4FJ1A 4RFLA 1QO0A 3HL4A 3I76A 3B3GA 3AHFA 4Q12A 2XZTA 4HNGA 4UTZA 1NQOA 3N74A 5K3AA 5BRAA 1ZK2A 3BD8A 2Q46A 1NQTA 5MN6A 3LUPA 3H9JA 2OGUA 3R6LA 1U2PA 2XF2A 1DBPA 5DN6A 1JLMA 2Y0CA 1V26A 2WFAA 3H9UA 2ONJA 4G0WA 3EHEA 3FDIA 4CM8A 2XMBA 2XPCA 3QTLA 1PLKA 1NLZA 1MVNA 3NBMA 2JGNA 4OJTA 5CLFA 2QAGB 1JVSA 2IHTA 2OQIA 1DBWA 4NZMA 4PYMA 1CUHA 5THKA 4ZT5A 3KQYA 1M7BA 2ECFA 1L7MA 2R96A 1L5NA 1RXCA 5C5IA 2IWHA 1OKKD 1NWCA 4KXYA 3TI7A 1CK4A 4KZKA 4FYVA 3OHSX 3LBYA 2R8XA 4JDUA 3PWSA 1A7KA 4O08A 4PGHA 4TS3A 1S6YA 4ZO7A 5IXSA 1U3DA 4FXPA 3C5WP 4Y2SA 1BYIA 1QDUA 2BY4A 3BWVA 1M7HA 1QHGA 2IIVA 3AR7A 3ZY5A 5CBPB 2H1IA 1DCFA 4FD3A 1F14A 2SKDA 2P4QA 3EFOA 4KN5A 4IJQA 3R3HA 1KIMA 2NACA 4LVCA 4TWAA 2P4HX 2J07A 2VKQA 4HH0A 1C7ZA 2GN4A 4EAAA 1DOAA 4X95A 3M2PA 4QPPA 2WIKA 3D7RA 1ZN2A 3TQSA 4EBBA 3HN6A 3U7GA 3HR8A 4V0ME 4JJFA 4IRXA 4LTDA 1H66A 3QA9A 4RDIA 3L77A 1X13A 1HYBA 4WLEA 1E6WA 3KTOA 3VC2A 3M4YA 4OB8A 5LOVA 1DRVA 3KCQA 4V1CI 3H1PA 3MTQA 4QQFA 2YFYA 5B1IA 4WJLA 1O77A 1V95A 1CY4A 2ZAYA 2ZRLA 4OXQA 5LZ9A 5ED4A 2VT2A 3KD3A 4DWOA 5JC8A 4TSRA 4C7KA 3KOWA 3C1TA 4N0QA 4A6XA 4YXWA 1E6EA 3E15A 3HO6A 4DJEC 2PRJA 4LRSB 4ZZ0A 4XB6B 4G1EB 1N5OX 4RVCA 4ZI5A 1LQ2A 5B1EA 3U2QA 4U9IS 5JXWA 4LJKA 2FSIA 2SBTA 4F5ZA 4GMFA 1SPXA 1Z0DA 2GAJA 1WZUA 2ZBUA 4HAOA 1HORA 2D5IA 5CTJA 5KMGA 2ZUBA 2G67A 2FFRA 3T5AA 3PHHA 4JQOA 3A05A 2IBMA 2JF0A 1YA4A 2ZRMA 3AEZA 3FA2A 4GX2A 4EB8A 1ECLA 4GKAA 3E1GA 4Z1OA 2ZIGA 3GLGE 5LPNA 3NDRA 2AWNA 4GZMA 4EVRA 2YHAA 3JY6A 3QVXA 4M2LA 4XM1A 4FHCA 1FSGA 4GVPA 3ZOKA 3SDSA 2ZSDA 1T8UA 5LLSA 3C4JA 2RGBA 1BJRE 4GLJA 1URPA 1OZHA 4WCDA 2PX5A 4IOJA 4QBGB 2Q99A 5JZOA 2W2OA 4EFLA 3HMKA 3N0XA 3EULA 1EUCB 2JGFA 1F1BA 3IDZA 3T7RA 2A33A 5ER9A 4ARUA 1ZN8A 3OCYA 1N8KA 1X92A 3IVGA 4G4SO 4R98A 4C7MA 3EX7C 1KKLA 2QWXA 1U4NA 4PZPA 1P2FA 2XR1A 5CM2Z 5HKBA 3KQUA 5K3FA 2EF0A 2XB2A 4LVNA 3LT0A 1G38A 3SLKA 3F9IA 5MHTA 4NU8X 2DWUA 5ARDA 1EB9A 4K6OA 4ZEVA 3RRNA 3D1JA 1SZDA 3GEHA 5EE9A 1F60A 2MYTA 4DMMA 3W5BA 4BP3A 2R1TB 4ED9A 1QGYA 2HPVA 2PGXA 1QHIA 2QVYX 4MV4A 2BI4A 4LF8B 4XSGA 1AA9A 1LBEA 1B8PA 1ZH6A 2BVNA 5FOVA 4B35A 5AYVA 5AM2A 2HRZA 5GONF 1JJFA 4HVTA 1RWMA 4E13A 2FDRA 1OPRA 1XZKA 1TK3A 2UZAA 3VPGA 2Q21A 4H60A 2Z8YA 1R8QA 4DJTA 3MMXA 3VM6A 2V3CC 3LLCA 5AVVA 3PUIA 1V8FA 2ATCA 2ZRIA 1F6DA 2HHAA 5CU7A 4EPVA 2FN7A 5KKCA 3DVQX 5JAUA 3BPSA 3JRWA 3EIQA 3T54A 4CLOA 3JQBC 1RRVA 1Y3BE 2P2CA 3QUQA 1VJ0A 4AXXA 5LYJA 5CM8B 5GMOA 1UBGA 4AZSA 3CVWA 5HFJA 3WV5A 1Q16A 1XEXA 5HM8A 1CY7A 3ZHTA 1Y1KE 4E88A 3IESA 4H2DA 2J9ZB 1E62A 3T3OA 5FORA 2QD4A 4F11A 5CDSA 2JI7A 3A6PC 4EJ2A 2RAVA 4FU0A 2YZMA 1OY1A 1V8PA 2IS4A 4FFDA 2B6HA 1YR3A 2NU8B 1SC6A 3NZEA 3QEOA 4HQ0A 4MA4A 4QT0A 3UJ3X 2VRCD 4DHWA 1EAMA 2P2LA 4M99A 4YJ3A 2VAMA 3H5AA 3PXGA 3FPSA 1FYDA 3P2MA 4FLFA 3ITNA 3IR5A 3HWRA 2A9QA 2B5OA 5KQRA 4UM7A 4LQDA 4BC1A 3UJCA 1TFUA 2W6MA 1Z13A 3CN9A 3PIDA 3JQ6A 5GQSA 3HHPA 3CEHA 2CD7A 5DB4A 4I5DA 1YVUA 3IIEA 3A1FA 1QO7A 2CWDA 3AHCA 1CE8A 1A8SA 3AEQB 3UAOA 4BVGA 4PYJA 1SELA 1GPLA 3HKBA 1GZ3A 4MRAA 1ESZA 4TOIA 3G02A 3F47A 1W19A 1GCGA 2JAUA 1SK9A 1WUJS 4OI1A 3IH5A 2VF5X 4QVGA 3CZAA 4O6VA 3SSAA 1Z6TA 5CFOA 4FZRA 2DQZA 3B52X 5MN5A 1LK5A 1SFRA 1N0VC 1UDRA 3UAZA 3G0GA 4INPA 1KAQA 2PUVA 3A0RB 2I76A 2Z04A 3FJYA 3FYCA 2FE4A 1UDCA 4RHYA 4O4IB 3EVBA 5BN3B 5B2ZA 4M54A 5AWFC 2IYLD 4FDVA 3HP7A 1VDZA 1GPH1 1G6Q1 3S2FA 2Q5EA 4YGXB 3IBGA 4GICA 1VPLA 4KQXA 1H2XA 4MVCA 5AK5A 5J2TF 4Q9IA 4BFZA 1DC7A 5AUPB 1V4NA 3ELWA 5I9IA 2Y0EA 5EPOA 3D3NA 5HQTA 4OG2A 3HYLA 4LPSA 1R9JA 2TRSB 5AJZA 4RGVA 3FYTA 4E4RA 1A72A 2HMAA 1PJ8A 2P75A 2Q27A 3HB0A 2ZWPA 3IIJA 2EGUA 3NTQA 4REQB 3ZCQA 1IUNA 1NVEA 2YNMC 3K4QA 4PSKA 2V98A 4NBWA 1ZBQA 3TDMA 2ZG6A 4W5RA 3EA0A 1G3RA 2CZCA 1EZZA 3I58A 5F51A 3GLUA 4XSVA 1OREA 3Q98A 4G23A 5E0OA 3W8FA 1QYWA 2JFGA 5LUBA 1DC5A 4DKXA 1VE6A 5GVSA 3HK2A 3AI7A 4ZICA 2F1KA 4G9EA 5B55A 2G8NA 5IJZA 4FMCB 4P4TA 2H4ZA 1F0KA 4R2LA 3WC4A 3V55A 3WP1B 4CJXA 5T4EA 1X1QA 3LVBA 1T6ZA 2HZBA 2W22A 2YN4A 3Q6MA 1TK9A 2JFYA 4J0KA 5CGZA 4BNIA 3IPCA 3CUKA 1ACJA 1DIAA 3EOAI 1D1TA 2VUUA 4YJ2B 3BXOA 3QU5A 4MKXA 3V4SA 3PP8A 1YFJA 3LCVB 1V1MB 3R3XA 4PYOA 4RWEA 1QVZA 4II2A 4RZHA 4XDGA 2D5CA 5JSKA 1L1RA 2O3SA 4PM4A 4HQ6A 2IGBA 3F6SA 4HN4B 5AVUA 3L40A 1E1RA 1JKJB 4LPKA 4ER6A 3T5MA 2OM6A 1RRMA 2ZK7A 1WBJB 2A0KA 4IVRA 3IP9A 1R3DA 1R3UA 1ZCAA 3KKMA 1G8FA 4F91B 4IRMA 3IEXA 3VOSA 5GJBA 2QYHA 3F6RA 1JQ5A 2QTWB 4NU6A 5ESXA 1J1IA 4KX3A 4QFBA 3KO8A 1BN7A 3L0OA 4HPJB 4AJNA 2F1RA 2GEDA 1J33A 3RC2A 5JECA 5IAGA 4KRGA 3ZJVA 3LWZA 1SVKA 1AN9A 2AI1A 2N0SA 2NXEA 3PFBA 4YJHA 3ZHSA 1YRLA 4NFLA 2SKCA 3WDLA 2PL5A 3MRSA 4ZJYA 1LPPA 4PPQA 2O3UA 3C74A 4Q00A 1E1KA 1LLDA 4AFNA 1WXQA 3TL3A 2CXXA 2CJWB 3I4FA 3KKEA 1CQXA 1A2QA 3E8MA 6CHYA 4MPDA 5EN4A 2NV6A 3DM9B 3PXAA 3FYUB 1H42A 3PGA1 2A1UA 3R0JA 3I64A 3S70A 1PCXA 1RRKA 4MQ5A 4B73A 4KIFA 4DF3A 1GLVA 3C2QA 4F4JA 4GPZA 5AVJA 3TMYA 1HQYE 1IRIA 2HLDD 4P35A 5M3BA 3KSUA 4CF4A 1L7XA 5TQVA 1VPWA 4EG3A 2Q5QA 3QHPA 3NM6B 1QTNA 2AEMA 4OBWA 4ENTA 3TFOA 1EB8A 1YS4A 1BQEA 5HCUA 1D5WA 1YS6A 2WWYA 3BKWA 1KK0A 1LSUA 5ALHA 1CXZA 4NCAA 1YHNA 1TFRA 2D1SA 4MS4B 3WQHA 4PYKA 3O6VA 1KE2A 1YDEA 2PSSA 1FOEB 5DULA 4Z4CA 1Z7WA 3L01A 3PNSA 5D86A 3W9YA 2GFIA 2XZLA 1Y1LA 3AKCA 4L3OA 5F52A 1WCIA 3AC0A 2X58A 1QNFA 1UPCA 2ZJ6A 4JI4B 2Q3EA 4MTLA 4N39A 2P6OA 4M0MA 1NONA 5GWXA 3S55A 1RLIA 2D8MA 4KITB 4Q3AA 1YQEA 4OUDB 5JJKA 4H1TA 3BE4A 1RYMA 4TM8A 1H85A 1XQ1A 2HF2A 1LSSA 1KA9H 3B60A 4FN4A 2W2VA 4IWXA 4WNCA 4WGGA 2VP3A 3OEED 4H15A 2PG3A 4M9SA 4GSKA 1QF6A 4ZZ2A 2P2ZA 1N7JA 2VTEA 1GTJ1 4BJ6A 2AN9A 3LHIA 3CUYA 4KWHA 4D9HA 2H1FA 2YIDA 4UCXA 5I9BA 2IEAA 3EIXA 2EKZA 3UA3A 3A6JA 1DT5A 3D2AA 2V0NA 3TL2A 3MB5A 3ZYZA 2XEXA 1XEAA 2XB9A 3WL7A 1WU7A 4AYXA 3B1YA 1LA2A 5TT0A 4DIOA 3SF8A 2I4MA 1IMOA 3C5EA 4L9SA 3L0DA 4BWGA 2JGJA 2POQX 3N2YA 4A8JC 4TZTA 2FMXA 1Q1BA 4WUVA 2H5LA 4IDDA 2QEQA 4NBNA 1VJTA 3TW4A 1JEAA 4BFTA 1ZITA 3VJLA 2AJ8A 2C95A 1V39A 3V34A 5JVDB 3ZBPA 1YNOA 2FWPA 2I54A 2FEXA 2GKSA 4Y2QA 4Y2UA 3P4YA 3RS3A 1K5DA 3VVLA 3HJFA 1UPAA 1NVVQ 1ZJZA 3V4FA 2E21A 3KZKA 4R8RA 2Z4RA 1H2ZA 3QXXA 1FUYB 2RGNC 3LKDA 4L4YA 2XOEA 4NEHB 4BVAA 2OAGA 5HVNA 2Q62A 4MW4A 4TMVA 1ZH4A 4V0QA 6REQB 3WBFA 3ZN2A 4LC9A 2GZAA 4X1YB 5J58A 4MYTA 3AZPA 3B1VA 4RD1A 1ZM4A 4Q7LA 4Q02A 4MP8A 4RIFA 1KI1A 4Y2VA 5BWNA 1X39A 1ZIXA 1XD2A 1KF0A 3NTUA 1Q5PA 1YFZA 3IQWA 3WYEA 4KKXB 1Q7RA 1FTWA 3C6ZA 2BHLA 2VP4A 4UU0A 4DV2B 3DFZA 5IT9A 3WNDA 5EJAA 2VYND 2OFFA 3IKVA 2X6TA 3K5WA 3SLRA 1NMQA 1D09A 3DBHA 2UUBB 4OATA 3TQTA 4M0EA 3NYQA 5EXDA 4EMBA 3DDZX 3D6AA 4I4TB 2OWDA 1A8HA 1B0AA 4NTZA 4EY4A 1IZYA 3OHPA 1LDBA 4GZ5A 2NM0A 3CHYA 5F1YA 2EGGA 4K46A 3UK7A 4MWSA 2BGIA 2DCMA 5BSRA 3RTCA 3HVHA 1DIRA 1M2WA 3CSUA 3WYAA 1JDTA 1L3CA 2X41A 4YP7A 1ML3A 2HMVA 2GVNA 1KY2A 3ANXA 3CPSA 3D54D 3K32A 4XTRA 1LUAA 2QY9A 1HT0A 1LBQA 3AF6A 5KQLA 4GIBA 5EUBA 2G9VA 2H3HA 2XB4A 4DM7A 3GUCA 2HF7A 2YV3A 3FMPB 1BCRA 2MDTA 2XMRA 1B16A 4OGFA 5IKXA 3QLEA 3OFSA 2BCEA 3JQBA 4MQLA 4M7PA 4RGBA 2CVZA 3KJZA 3VVCA 4AKGA 2EFEB 3E2PA 2R4TA 5H3CA 3T9CA 2CF6A 2QJFA 1N1EA 2AXQA 5HBGA 3IDSA 5T4FA 5AW3A 4FYMA 4J07A 4WASA 3DEFA 4AP6A 2O59A 3EDOA 4MDHA 4B6PA 3H8JA 1O1YA 3ISTA 3WGIA 5IYZB 2R6CA 1D0IA 1HTWA 2AT1A 3PIIA 4O1HA 4DT1B 5KNDD 1ZVVA 2ZETA 1LX6A 3JX9A 5JSYA 4EQZA 1T4DA 4U3JA 1AQUA 1OBOA 1KYTA 1E6UA 1VCNA 3BBLA 3WR5A 5BN1A 2WZQA 4A1OA 1KEPA 1QK4A 2P2GA 3KLMX 3LSYA 3OPYB 5AKXA 4AX8A 4E7OA 1F17A 4M6WB 3JAMA 3VO1A 5HZKA 4Q01A 4CUKA 2J08A 2TS1A 5EY5B 3X3HA 3R8FA 5AKIA 3IA2A 2OC9A 1QIJA 2Q41A 4GP9A 4QOGA 5EIBC 4R5MA 3T9EA 2C98A 3OTGA 4OJMX 2YDXA 1EVIA 2ZBRA 4DKJA 3B8EA 2IHYA 4IKOA 1IIRA 4RULA 1XPOA 4XX1A 1MVLA 1CUUA 2GXSA 2XGSA 2XB8A 4I9UA 4ZC8A 1W36B 1PR5A 1NQ5A 2JJ1A 3GUZA 3N2GB 1Z4QA 2IPLA 4RHCA 3RRMA 3RS8A 3OM1A 5FWYB 5F64A 1UM9A 3MCUA 5FYQA 3ZE9A 5FOTA 2PSDA 2ZLBA 1F4LA 5H82A 4Z8XA 2XTNA 3EAFA 3ZZNA 4BO2A 2XTAA 4XVHA 4AMGA 3E84A 4M7OA 4QECA 1OT5A 1RWQA 4U7FA 5DXAA 4FOSA 1IVNA 3DZIA 4OL9A 3T5PA 4CQNA 5IC4A 2VJLA 5A03A 5JD6A 4L72A 5EMNA 2W2LD 4B6OA 5ILGA 5IM5A 2N9UA 3FAZA 1NNEA 4LK2A 1TUIA 2ID4A 5K0BA 3AWDA 1I1HA 4M89A 2VK8A 3BFKA 2YNMA 4B4WA 3TLKA 2D8AA 3UGTA 3OHMA 2DH6A 3OE7A 4F5WA 1FSFA 1QRTA 4CMGA 3O4RA 5LP6B 2H2HA 3C6YA 2DHQA 3E9EA 4YQEA 3T3HA 1EIZA 4B5KA 5HIMA 2O57A 1NVAA 4P4LA 5IJ9B 2XB6A 3QYJA 3CR3C 1G55A 4Q7MB 1AK1A 4KWEA 4D8WA 3PJGA 5A6SB 1KJWA 1OOEA 1ZM2A 2IYUA 2I7TA 3BGVA 4Q4AB 3HJUA 2XECA 5E6UB 4O3MA 3HO8A 4RMGA 4KXFB 3O5AA 5K0ZA 5LA6A 3IAEA 3R3JA 2QZ9A 3DNPA 4HLUC 1V7CA 3EYAA 4NMLA 5EVJA 1X1EA 2PNJA 2WK1A 1B6TA 2C0QA 2J3KA 3BWYA 4FYHA 3V9PA 4C88A 2UDPA 3IAXA 3CCCA 3LGXA 3PEEA 1NUPA 4JC5A 4G0ZA 4N03A 1XELA 5EJIA 3WI7A 1EUQA 3V42A 1Z15A 4EW3A 4P3OA 2DSTA 4URUR 5ETJA 4DZRA 5BORA 3FWNA 4L5IA 1ORHA 3PYLA 3A70A 5DHTA 3WMGA 1EUDA 2E1RA 5KYTA 1N32B 1Z5GA 1C9JA 2PT6A 4JENA 4RNCA 3PFWO 4BN0A 2LTAA 4ZVRA 1ZNWA 2BE7A 2GZDA 2WUWE 3PEFA 4YRRA 4F45A 1JWLA 2BH2A 4DLZA 1CF2O 4ER0A 2HSJA 1GL3A 4BDTA 1UOOA 2JAXA 3PFCA 1F2TB 2F62A 4NMMA 1U5BA 3STWA 2NZYA 3EUEA 4A9AA 4LDRA 3VOBA 4PU0A 5HMMA 3E82A 3RIGA 1IQ0A 3CZQA 1O97C 4G65A 4M8LA 1FRVA 4PXAA 4RSGA 1W49A 4XE5A 5JASA 2FX2A 3SC2B 4YAKA 4KAXA 3WB9A 2OGSA 1MBZA 4WHMA 5FPSA 4MUXA 2WFZA 2CD9A 2XQVA 4ZFNA 2ACWA 3DM5A 5DHRA 2WHRA 3AM5A 2E5FA 1WO8A 1KHTA 1SBQA 2IYQA 5LB2A 3T0IA 1VG9B 5BUCA 1NVWQ 3T9AA 2VHEA 4HXGA 8GPBA 3MJHA 4ZCLA 1EX1A 5TSDA 3O9MA 1M1UA 2Y1EA 3JYPA 3OM0A 3ZHXA 4PPNA 2AH5A 4FX5A 5L7WA 2QE7A 2J9FA 3N2KB 2BR3A 1FNDA 3EEIA 1ZFNA 1LFDB 3R7SA 3RSHA 1JXAA 3CPHA 3A0UA 3DAPA 3V8NA 1ID8A 4K87A 2H4JA 1DC3A 2OP0A 1JXOA 2A4MA 3D3JA 1Q1AA 3OAAA 5E4FA 1J2UA 4ZTBA 2KLHA 3N0RA 3ZBUA 4JT2A 5I9LA 5EA2A 3GP8A 1ZGCA 3Q3CA 4K1XA 2KX7A 4G5RA 2QTTA 2XYGA 4IICA 2GJ4A 9ABPA 2D1YA 1X9HA 2YY5A 4NOMA 1AO0A 3MEQA 3KQLA 3KKZA 2W42A 1T25A 1KIAA 1OBHA 2IY9A 3BRQA 4BGEA 1NV8A 5L51A 3WB1A 4J7XA 1PU2A 2IUSA 2A9FA 2H1HA 3D8NA 2JH8A 1KJJA 2C96A 3H7AA 1RLUA 2FFBA 4KI0A 3C8DA 3DWGA 3MGAA 3MXTA 1QP7A 4J76A 3UAWA 1M2GA 1QCYA 2HWUA 3NIBA 4LF6B 4PZLA 3SYRA 3U39A 5GZ1A 3IMEA 1IY9A 1WSDA 3X1MA 3VMMA 2FQYA 1TCCA 16PKA 2PM8A 4ND1A 5HR5A 1NZFA 3F90A 2VAXA 5B1SA 4JSYA 3F3KA 3T4XA 1EWKA 3WKEA 1ZHFA 2X19A 3LYUA 1EMDA 4A8JA 2FFQA 421PA 3KE8A 1JDPA 2CLLB 1R0YA 1J2YA 1AGXA 3EIHA 2RCYA 2FGJA 4E51A 4NE7A 4F1WA 4M4SA 4QLOA 1D5CA 3KUUA 4TL6A 5CUQA 3MSXA 5D1HA 1G9XA 1M1XB 1OX6A 2D74A 1HE1C 2HAEA 3VR2D 2CV2A 2RGNA 3L7YA 3QF4B 3CVXA 2BF7A 3RKRA 2Q6IA 2POCA 1Q7EA 4MLDA 2X7JA 3ZXXA 5A7FA 1GARA 1WCXA 2EWWA 5DRYA 5BO5A 4ARCA 1CLUA 5K8LA 2ZT8A 4B3HA 1C9EA 4XQGA 3QBVA 3UW3A 2GN6A 1GGFA 2DR2A 3RUCA 2DKNA 4D41A 5A0FA 1JEEA 4AJPA 1IEWA 5BOSA 5EJ7A 1TZKA 4IXDA 3U4DA 5B58C 3CH4B 5BMVA 1JEQB 5EJ5A 1G5FA 5T6BA 2G9RA 3FMVA 1UZUA 1DAEA 3DFKA 3OE4A 2V9CA 1QF7A 2F8LA 1YUMA 3TGLA 2NIPA 5E3IA 4EX7A 1RABA 5AR1A 3W3ZB 4HVLA 4BO8A 2JD0A 1ORDA 3E1KA 3DE7X 2H2DA 1ZZEA 3C1OA 4QDUA 3TFWA 4U2GA 1K6IA 3E9QA 4QQ8A 4M38A 5CFNA 2X8AA 3EDRA 5C3MA 2A5LA 4JC4A 3A2KA 2OR3A 2IYSA 4Q05A 2G1KA 3NDBB 1UL1X 4HLQB 1GQOA 4RA9B 3QTBA 3JXEA 3JQ9C 2OCBA 4LXIA 4B33A 2A9VA 2XGGA 2B0CA 1KOFA 4RLHA 1U94A 1P6UA 1E3EA 1I24A 1T2FA 2X2PA 4DRYA 4ALMA 2F1HA 4MQBA 4OPMA 1JIQA 4EEKA 5LXTA 3CNEA 4ZALA 4DXHA 3K6RA 4L2IB 1EP2B 1NQAO 3G5UA 4BKUA 3MTBA 4I5GA 1RYNA 2F3PA 4X91A 3V8RA 5CURA 3BE6A 3ZWMA 5HTOA 2HR1A 3LM8A 3QIAA 4BVBA 1XTVA 3KT3A 1EJBA 1BU8A 3O26A 3SBEA 3KNZA 4EX6A 5AXDA 4LE1A 3K6SA 2O5RA 2K7FA 1RPTA 5KTRA 1AHNA 4L08A 5TMEA 1Z34A 3JYLA 4OO3A 4RJLA 1U8UA 2AQKA 2Z56A 3ES9A 1TYAE 4CR7A 1YULA 2A78A 3QVGB 5FNVF 1S02A 5HTKA 5EHQA 1ACMA 4JEMA 4NZNA 2ZTSA 3P9QA 3GNSA 1EA7A 5AKHA 1FSPA 4XJSA 2GHTA 5D85A 1OUMA 4B6EA 3RV4A 2O52A 3TPCA 1ULBA 4R1QA 4NXMB 4MLZA 1CUXA 1POXA 3NTVA 4XWTA 1E96A 4I3FA 4K9RA 5LU8A 4P8RA 4LDPA 1YDMA 2F67A 5KAMA 1O9HA 2J6BA 4CCYB 4ASUA 4Y7CA 2ZYSA 4U2BA 1H6BA 2ZROA 3DLAA 4U5QA 4URVR 3QK7A 2G80A 3LHKA 5THXA 2XMSA 3QJYA 3BQNB 4ZVQA 1ZD8A 4PAMA 1QHYA 4CCWA 2QP3A 2QAGC 2NUAA 2Q3LA 5KJFA 1M6WA 4C7BA 1WL8A 1EWVA 2B94A 4E3ZA 3ECCA 1I7DA 4P53A 5CMLA 3GD7A 4BL5A 1G64A 4C89A 3FB4A 5CW2A 1NI4A 3UBTA 3OZVA 2AEJA 1FDWA 3TRHA 2B7CA 2Y8EA 2P6RA 5FO1A 1BMFD 1CJBA 2IXGA 3FBTA 3EEBA 4WNAB 4OKNA 5ERGB 5TE9A 1ZNXA 1QO9A 3K05A 2FW1A 2FPIB 1XVUA 3IRVA 2PCLA 3SS7X 2BAGA 5ALTA 2OY0A 3PQ4A 3KAJA 2AFHB 2XZOA 1W4CA 4TN5A 2XE8A 4FW8A 3K70B 2BUBA 3JZFA 4QJIA 4O4HF 3P2JA 2Q1SA 5C1OA 4QJ4A 3H5TA 3C3JA 1V6CA 2RGXA 1IB6A 1NHWA 1TZ2A 1U7DA 2CJYA 3ZDBA 1MEJA 2VF7A 5PGMA 5LD2B 3UK1A 1JQ3A 1NOKA 1Q22A 2XMGA 3CWCA 3NOXA 4JJGA 4Q1CA 5DFAA 521PA 5HDBB 2JD2A 3KHSA 5KWEA 2DBQA 4URYR 3L84A 1XMPA 3CSDA 3TSCA 5CDTA 3GFTA 4CGYA 1AS0A 5BMOA 4NCJA 2AVNA 4YBRA 3I9JA 4ZV4A 2QJOA 3BHNA 1QR2A 1U3FA 2BWJA 5GJCA 4DSOA 3OTHA 2CJXA 4PYIA 5TEWA 1PKXA 3GOQA 3SXUA 3KU1A 1MPTA 2HRRA 4CKCA 2P40A 1JLSA 4HLUA 1SVOA 5EIHA 1KI2A 4JLWA 4R8SA 4O2AF 3OPNA 4DSNA 2Y6VA 4UUAA 1X7GA 2C5BA 3GP5A 4U63A 3PFFA 3NWEA 3KWFA 4DMGA 5C32A 4JX8A 1HOXA 1RJ9A 2IYVA 3H8VA 4RFVA 1PG0A 4TQAA 9GPBA 5CDFE 1G7CA 2AKYA 5J4LA 4EVIA 3HEMA 3UB2A 2X9VA 4LYAA 3I61A 1IHXA 5ALYA 3SP1A 1J56A 1PIWA 3R7LA 7ABPA 3ZHZA 2R62A 3TLEA 4YRPA 3E2IA 3B7WA 2JLSA 4CQJA 2PWBA 4F92B 2BSQA 3CCBA 3OZIA 2ZI6A 4W1PA 1Z8DA 2BKAA 1PFGA 3TQQA 5FIUA 3AM3A 1U0JA 1TQ4A 1V6SA 3BK1A 4E03A 2JB9A 5LQJA 1KARA 2H1OA 3EVNA 3ZTWA 3NBQA 2ODWA 1E2PA 4YBZA 1C8KA 3RQIA 4Z6KA 3GRVA 4BKMA 1QPBA 3BL6A 3C3PA 4EB0A 1WF6A 4B6SA 4EHBA 5TGTA 4YUYA 5JYBA 1E2JA 4Q21A 4R0MA 2GHRA 1UFOA 1YGPA 2IPXA 2R84A 1D1SA 1WOYA 1B6RA 2P2YA 4OHXA 3PPYA 1I0ZA 3AIIA 1L4HA 3WDSA 1WA5A 2Q1YA 2XD4A 4FI3C 5IM4F 2V6FA 5IC5A 4O4LA 2DTXA 3QKSB 4KQMA 3MAGA 1JZTA 3SZRA 3TLBA 3TLJA 1U90A 2WUFA 5EHNA 2JIDA 3GP3A 1QHNA 2CFOA 4I1UA 2A86A 4F9GA 4YPOA 1NVXQ 3I2JA 4MWBA 1J9GA 3SPXA 3DZFA 1GRCA 4EKYA 3I05A 1LLFA 3BXGA 3M6MD 4MWCA 3SBOA 1GPBA 2HCFA 3P0HA 1I2CA 1PSDA 2P3SA 1U98A 3PF9A 1OBCA 5CYGA 3JAWB 1QIDA 3IO3A 3QKRB 5EKUA 5EKSA 1L6RA 3PNPA 2PZBA 2BM8A 1LX7A 3MBIA 3FTDA 3OFNA 1KI6B 4X63A 3MWLA 3S1LA 4LECA 3ETNA 3UBMA 2QORA 2BV3A 2OPBA 1GU0A 3AFMA 4MVJE 4B5LA 5BSWA 1GSIA 2VUIB 1ACLA 1QIFA 3B6EA 3FR8A 4JY7A 4TUYF 4U00A 1P7CA 1DOZA 2RAFA 3TIVA 1R5JA 2H1RA 1U7WA 4JB2A 2J3JA 4PGGA 3RIMA 4D3FA 4R9SA 3GJYA 3LP8A 2PGNA 4UUNA 3LBAA 4FT2A 1T2UA 3C6QA 3LUFA 3P2EA 2P9JA 4OHCA 1QJCA 4J7UA 3VNSA 4YHBA 1RQNA 2FGKA 4U0JA 4L8YA 2R9VA 1T2VA 5A1JA 1XZCA 5KTYA 5KYXB 3M33A 1P31A 5DNYB 5HM6A 3VR1A 5KTMA 2RMKA 4Y6PA 3BL8A 4F56A 3PE6A 1CW2B 2Q5JA 3W6OA 2FZ4A 2XDWA 1ZOIA 2YXLA 1W5EA 3AXTA 4XASA 5JZ9A 1UOPA 2VWQA 3WV4A 1JDZA 2UUPA 5FUBA 3T95A 4D8TA 4DM3A 1JQKA 2RKBA 4FYKA 1TL7C 5K0JA 5LQDA 1UKBA 1V0JA 1QF9A 4EQ6B 1E2QA 4K3VA 5I7VA 3WTCA 1USIA 1IZ9A 4UTRA 1TZBA 1E3JA 1K1EA 1NPDA 4N41A 3T1OA 1WXIA 2F48A 3IEIA 2W83A 4LV6A 1M2OA 2GSDA 2M6RA 3A6HA 2QL5A 4OREX 4V02A 1JA9A 1L8OA 1YRWA 3Q7QA 4E22A 3RS5A 3ACBA 4JJ7A 3ICOA 1XZJA 1XT6A 2Q5HA 3NATA 4J6FA 2QMUA 4LKOA 1MO5A 5ELXA 1Z4JA 1EFVA 1QE5A 3DR3A 5F5LA 1JTFA 3H13A 4WK4B 4CKBB 2AN5A 1U1DA 5LM3A 5IH3A 2ZTVA 1V37A 1G3MA 1OZ0A 4A92A 1M2VA 1F4PA 2BBSA 1NN5A 3DLBA 1P1RA 5A3JA 3IQDB 3B9PA 1OJLA 1BIFA 1J9ZA 4Q9NA 4D0NA 4F46A 1ZMBA 1XZMA 1UBJS 3G5MA 3SI7A 2GUWA 4MJ3A 3SE0A 1CF4A 3ZIDA 2L42A 1P5JA 1U8EA 3FSRA 1QUEA 2OV8A 5IKPA 2BRUC 3BICA 1KRXA 4N3BA 1PG5A 1PT5A 3H97A 2F2TA 4QBIA 4TVBA 2O8DA 3KUKA 1UWCA 3ND8A 3UMFA 3ZWDA 3DBOB 4B4KA 3PNVA 4JLBA 4R5HA 1BWPA 4PZ9A 2B99A 2EP7A 5FWAA 3PKZA 1Q1NA 1HDEA 4W9RA 3G9QA 4IX9A 3QWHA 4MS1A 2B5WA 3LY7A 4MMZB 5U4XA 4KK4A 3GWZA 2PUJA 4BYMA 2ZAMA 4C14A 2B8EA 1PN3A 1J0EA 2CHEA 3O1JC 2ZRCA 4RZ2A 3VZDA 5ICEA 4MCHA 5DCUA 3DJYA 5LWQA 5M04A 4NAVA 4ZZ3A 4CODB 1GTL1 4MVXA 4RE6A 3U31A 1RMTA 4ZRMA 1RQLA 1I4LD 2JAQA 1OYYA 2C78A 1CP2A 4G24A 1F2UB 1A50B 4Z9BA 4GX5A 3NM4A 4HXFB 3RVSA 3AR2A 3NVAA 2OK7A 4HF7A 4WDQA 1SHTX 1W0KD 1WHSB 3RDPA 3RVJA 4KXXA 5JYCA 1OFIA 2O20A 3BJZA 2EP5A 3SR4A 1RIIA 1CJMA 1WPQA 2VQFB 3AGPA 3Q2KA 4MH0R 3QTTA 2E82A 5DNWA 4KQEA 5BVGA 5JMTA 4NYJR 4FOLA 4J9VA 5FPYA 5H80A 2WU0A 2XNDA 3DO8A 4CL3A 2IKSA 3A1NA 2ZANA 2F8MA 3RPEA 2EW2A 4P4UA 1QIMA 3DTVB 1RBMA 2OSVA 2YXDA 1BW9B 4TPKA 3SHTA 4MMXB 3ZTTA 2B8JA 2YVUA 3A9RA 1HDRA 4DZTA 1U4OA 2LP4Y 3JARB 2PPLA 3IE0A 4PC6A 4ZI2A 3ADPA 3VAYA 1L7EA 3FYUC 3R1IA 4BN4A 3I73A 2PD4A 1DE0A 4M86A 1OWLA 2JW5A 1Z29A 3FKQA 3FPJA 5EESA 3RTGA 2B9VA 1BU5A 3C3WA 1A77A 1F9AA 2AC4A 2E4XA 2QAGA 2YZ7A 4NPAA 4Y9RA 3A9WA 2GYYA 5DASA 1V4VA 2CLCX 2J3DA 1GDTA 1G8PA 3FOCA 2ATXA 2Q29A 2LIVA 1FZTA 2Y1GA 5TGZA 3RYTC 3DXYA 1YCFA 5CRIA 3ZWXA 1R50A 3KB6A 4WN9B 4DLLA 1O08A 1WJGA 1XLUA 1K2VN 2WJWA 4BYGA 3WZ2A 2QSJA 3AEYA 4EO7A 1DBVO 2DFDA 5CBPA 1PZFA 2BMWA 1SUSA 4DQKA 5FR2A 4F6LA 5HMLA 3ODPA 4WUTA 2YYSA 2QYSA 2HDHA 2PTGA 4JKYA 3GEEA 1GGNA 1GFSA 2J5XA 3KFXA 5HE8A 2FVXA 2WB2A 1YK1A 1O9BA 1UUFA 3LO5A 2WZBA 1HR0B 2XNHA 3NV9A 1THTA 3ZE1B 5J3JA 5B4TA 4Q19A 5AK4A 1VM6A 1YL5A 3EXG1 1PV1A 3MRTA 2I1QA 3IOEA 3P0RA 2RJ3A 3DYVA 2H4XA 2Y0DA 2IC5A 1X77A 1G3UA 1N1GA 1PJAA 4OQDA 1Q0ZA 2M32A 2E37A 3RWOA 2YMQA 3EZ6A 2PIDA 3F6CA 4YREA 3B48A 2QYOA 1UZLA 3OSUA 3K5PA 4NJOA 3SY8A 1MNAA 1KQFA 4FEGA 1OROA 1XA0A 1QE3A 1Y89A 2K5UA 4OMUA 4PR3A 4MUBA 4X54A 5FJJA 1GKKA 4YN3A 4TT8A 2QUZA 5I01A 5LU9A 3OD5A 3QPCA 1JAXA 4UC0A 4DIFA 1QDEA 4PQEA 3WGVA 5AH0A 1EFAA 3UJ9A 1STOA 1I2DA 2VDRB 1GR0A 4TXHA 1TQ6A 3BEOA 4PIVA 4BRZA 4CGZA 1V8DA 1XJWA 1WAMA 4DJ5X 1N5JA 1ODJA 1YBHA 1W2HA 3T1YB 2YJ6A 4ZQEA 3DAYA 4TLMB 2HO5A 2DOKA 2OCAA 1FDRA 4RQBA 4ZOEA 4LJYA 3R3YA 4JBIA 4F7DA 2Q5OA 4KXVA 2JVIA 4LHZA 2VATA 5JPIA 4X7PA 4KSYA 1T0BA 3PNMA 5C5DA 4DA9A 2AMVA 3DTNA 3Q1LA 4QHTA 1L1FA 3FF1A 4YT8A 2GXUA 4RMJA 5I7RA 3RJMA 2QA5A 4IGIA 2I71A 2NU7B 4ERNA 3HPQA 1EUCA 2HSWA 3DL0A 4JKOA 4P3NA 5DLPA 3AUSA 3TL6A 4QVIA 4RJKA 3SN6A 2ODNA 1T1EA 5CVUA 4EABA 3ESBA 3GVHA 3SQWA 1KH3A 3W9UA 3SJZA 2NVWA 3P9NA 5EERA 2HBYA 3TW0A 1Z6ZA 2Z3VA 4OFXA 1GDHA 3ZGOA 1TTPB 2ZIVB 4PAGA 3OJCA 3V7FA 3KSBC 2UYYA 4DIKA 5CA1F 2CCKA 2FWRA 2ZSKA 2OBLA 1XDZA 5I3ZA 4II7A 1UBRS 1VHTA 3PNOA 1K8ZB 4M9XA 4YAGA 1CUYA 4ZZ1A 4WOCA 3L1UA 4OK3A 3ZWVA 3MTJA 4FCCA 4JWKA 4DV1B 3D8BA 3OZTA 3SBXA 3ILHA 1Z06A 4J7AA 3W7VA 1Y9AA 3RFUA 4YRAA 1Q11A 4GC9A 2QSUA 2A9PA 4E5PA 2GJKA 3DLCA 3WYGA 2O7VA 4C1BA 2J0EA 3GLHB 4KBFA 1E7QA 3DMPA 2H57A 1G5HA 4L9RA 1FC0A 3GPIA 4G56A 4I08A 5CJPA 2H08A 4DY4A 3QHQA 4H08A 4ZANA 2FK7A 1C0PA 3CF0A 1LWNA 4NYIQ 5AW7A 2ZUVA 4DR5B 1U04A 1GUDA 4HDAA 2QN3A 4CTJA 1N2GA 2ZIZA 2Z8XA 3QPUA 4PV7A 3U44B 2DFKB 1W0JA 5GVRA 2DVMA 4LG1A 1FJ2A 3DE0X 3WAKA 3TM4A 5MN4A 2Z95A 2PXXA 1NDQA 4HKTA 5A0VA 4HDQB 4ZODA 5JYDA 2CLDX 1HRDA 3AXSA 3BBPA 2WM8A 4ZCIA 1KZ6A 4D4KA 2ZM6B 3FD8A 4FQ5A 2R48A 4OQ4A 1IUOA 1K6MA 1MU0A 4DNOA 3CRQA 3QFRA 4RD2A 1JI3A 4J2OA 4RTMA 4KSBA 2XV1A 2GA8A 2DJ5A 2YHUA 3CA8A 4O2RA 5BW4A 3AR6A 4MEAA 3V97A 4JGIA 5GTDA 5LLDA 4UTVA 1ILEA 1FUUA 2ZUWA 3U5ZB 1JWBB 2V9PA 3GXOA 3LDGA 1PFVA 2J30A 5DV9A 5LMZA 2VHCA 1FF9A 1TVEA 4H9GA 3OZCA 5TQJA 3UO8B 4FPXA 2FSGA 4MIEA 5NLLA 1Z17A 4OAQA 1DPFA 3ABSB 3RSGA 3AEQA 1Y4AE 2JCYA 5GPBA 3MWEB 2GBPA 3FCAA 3GLFE 1KDOA 4XZ3A 4N5MA 4JFAA 4B7ZA 1E59A 1QYDA 4BEBA 1IN6A 2OZLB 3LHDA 4GPBA 4ARBA 4UM9B 2KS6A 1KPGA 3ISJA 4MQ6A 5BRNA 3SU8A 5A9SB 5LMCA 4E94A 1PWXA 1C8VB 3LYLA 3F8SA 3EA5A 3G8DA 5AI4A 4U6QA 4ALLA 4HNHA 4A6PA 4NZYA 4O4IA 1RHRA 4URHA 1H2BA 2HIMA 1VL6A 3O3NB 3U4AA 3GK3A 1THMA 4CKZA 3EN0A 1R8XA 2JC3A 2VTBB 4S1NA 5JRZA 3H0CA 2O8NA 2Z1DA 4RVDA 1PR4A 3VU3A 2OFWA 4AKTA 4A82A 2ORIA 4RX1A 5HKLA 4RQTA 4GECA 5BP7A 1YDFA 2OBXA 2PRYA 1X9GA 5JAMA 5AOBA 4JXZA 4RETA 3W3AA 4ZOCA 5BW5A 3EZYA 5TRTA 1DIHA 2VVTA 4INZA 1DHTA 1ZK4A 1FX0B 3VR6A 4BS9A 5FQOA 2YFHA 1RP7A 2XMCA 3KZMA 2CB9A 4QUAA 4REQA 1QS0B 1N2CB 2X4LA 4CG1A 3GFRA 2BEJA 2ENWA 3QLVC 4CIDA 1IUPA 4DILA 4KMSA 2IVZA 2PGLA 1I6MA 1M3SA 4PEVA 1IXYA 4BFLA 2IW3A 2BRUA 3G9UA 1LBIA 5BUQA 2XUKA 1ESEA 1VJCA 3G1UA 1L8LA 1AD2A 2GEJA 3QBTA 1KDVA 2C8LA 5A62A 2ZGVA 4QEDA 2GZ1A 2Q3JA 2QR5A 4RXMA 2EFGA 1SXJD 1SKYB 3D64A 3FUXA 3P2KA 5G53C 2VHYA 3DHVA 1N4AA 3R77A 4D8YA 4ITRC 4MHTA 5DLYA 2XBLA 3V2GA 5BSFA 1VI6A 2XUOA 3NR2A 4LRXA 4PC2A 1NW7A 1T2EA 2BN4A 2K87A 5JEEA 5JAZA 2YJTD 3K0KA 1V1MA 3LDUA 3AUJB 3QVSA 4LRUA 1JKMA 4WXHA 3NPMA 3D6TB 1SUIA 2I1LA 1E3TA 3GI1A 4U7DA 1WRBA 1TUBB 4DCVA 3AINA 4BWVA 3CG4A 4BMSA 4EL5A 3ZV3A 4ND8B 5I4KA 2JASA 3USES 1BD4A 3OEHA 4WFJA 1S96A 2K4MA 3NC4A 1AGPA 5ALXA 4NJMB 2CSUA 2A5DA 2HOQA 3TM5A 3F5DA 4ENPA 4YY3B 2ST1A 2FMFA 1PX2A 3HVUA 1LK0A 3A25A 4J75A 2NT4A 5ALJA 2D54A 2W6JD 3CZPA 5KNCA 2CKMA 3O4HA 3B9RA 3GCGA 1FBNA 3MG9A 4Y1RB 3NS7A 3L04A 3G5TA 4C0KA 3R9XA 3C16C 3TXAA 4OLBA 1NT4A 1OLXB 1XDDA 3BRCA 1SVSA 1RMQA 2VFAA 4QLAA 4EYEA 1D2NA 1NAIA 2XUGA 3U4HA 4Z3OA 4J2TA 4DRXA 2WR8A 5BNWA 4F2WA 3RYHB 1VB5A 2CJWA 1E20A 3VTAA 5AESA 1LLCA 5EIOA 2AFRA 3GU3A 1S3GA 1U0TA 2A7XA 4PLCA 3FYUA 1XJ0A 3O9VA 1W4BA 3V2UA 5FFNA 4BBPA 3UYKA 3N3AC 5CIWA 4DZZA 1Z25A 1N6OA 1UC9A 1XN1A 2EQAA 3W5IA 5KS2A 3VHXA 2JFHA 1JG3A 1M5TA 5BVHB 4GPIB 1UBCA 2CVQA 1UKVY 2IOFA 3OQVA 1MW9X 3GJ8A 1CBUA 4JVMA 3UWKA 3OMLA 5C8VA 2P27A 1IQRA 2VN8A 4QNRA 4FS3A 5DT9A 3FNIA 4MZXA 1D9XA 1VBNA 1K8RA 3TZ6A 1QU3A 4YMGA 4J29A 4OAOA 3OQBA 1XNGA 3EGXB 3FCOA 3KZXA 4MS4A 1R4ZA 4XIFA 3SICE 5J5VA 4YP5A 1MF7A 4ZT4A 2L19A 2BSXA 4BVEA 3WWOA 1UADA 3V4PB 4DEVA 4XYEA 1YFKA 2QX6A 2PFKA 2Y27A 3GT4A 4OUDA 3LT5A 1BE6A 2GDZA 1NBOA 2FETA 2R1VB 5KWSA 4BUJA 2BELA 4CI0B 4R84A 4UCFA 5HCNA 5CD9A 2PZLA 3TVDA 4EUEA 1G6HA 4P7KA 3DG9A 5B57C 3COZA 4LX8A 3T3DA 5K6RA 3GLVA 5BUZA 2Y2UA 5AD1A 1TU0A 1TQ8A 2V6MA 2WJVA 3A32A 3DMRA 4RH3A 4IOLA 5SZIA 4BWFB 2CL6X 4BX9A 4CV1A 1VTKA 1HZJA 2QTVB 3N2NA 1C3JA 1QPGA 3CPEA 1OW3B 2ZYWX 4FZ3A 4WVLA 2BKXA 4YH1A 1NNLA 4IZHA 3WB0A 5BWOA 3NNDA 1B2LA 1B0PA 1GT91 3EF0A 4HG2A 1QG6A 4L8LA 3ASUA 4NCIA 4PSCA 1E9VA 4OX9Y 1DC6A 3DVRX 3HN2A 4J49A 4QGSA 1Y0BA 3DVAA 5EJEA 4X61A 2J87A 4IGAA 13PKA 4HYYA 3IELA 4ICIA 3A10A 1JIJA 2ZTMA 1HY3A 1Y8AA 1USUA 4FUQA 4LIPD 4MRMB 1ADJA 3SYLA 1ZC3A 1Y4ZA 4CZ2A 4DR3B 1GFWA 4H3HB 4W1RA 1OH6A 1H65A 2AXNA 4LY3A 3WLQA 4I6GA 2OQRA 3UF0A 5HK9A 1V47A 1LZKA 3S8YA 1WUIS 1K86A 3V6LA 3K0AB 4M49A 4NS1A 5BQFA 1JNXX 1PT6A 4P6VF 3MERA 1Z63A 1A9SA 1CUWA 4FD2A 1R0BA 4YJDA 3D43A 3JQ8B 2MSEB 3ZWOA 6REQA 5AW0A 3TG8A 4C78A 1EP1B 2O8VA 1VE3A 2DCUA 4PLYA 3N6XA 4X1YA 1J22A 1T8WA 2BT4A 2MWMA 2VBFA 2GPSA 2C5LA 2NUTB 1BOFA 1KJQA 2PX6A 3BMOA 5TPWB 2F55A 1C1DB 2FCAA 3A1VA 3KALA 3LRXA 1NURA 2YVLA 2E87A 4YEDA 3AOGA 4GF5A 5I5EA 4QIHA 4IDGA 3BFPA 3AKYA 2EKBA 4EGQA 4L0QA 3DS8A 4LCJA 4QXOA 3FAKA 1JYFA 2HCBA 3K72B 4ZQGA 3EC1A 1I2MA 3QFHA 1U0FA 5FCDA 2AFHE 2B2NA 4I4TA 1P60A 3SLGA 2B3TA 2GN2A 2J5RA 5DM4A 3SBDA 5KOYA 5C53B 1T5LA 5EZYB 2RBGA 5LFAA 5LOVF 2PGIA 1ENYA 2K2WA 1KDZA 2GCOA 4WL0A 3SOZA 2OAQ1 3D2BA 3SVTA 2RJOA 4PCAA 4ZVNA 4KXLA 3KOZA 1Y6ZA 2MSCB 2EWVA 2VI5A 3GROA 3MMSA 3OG9A 3BG5A 3HN7A 1VMAA 2FW7A 4RK0A 1E2EA 1GTZA 2GZ3A 4HQNA 1L5RA 4BQPA 1YI1A 1HT2E 5EJ6A 1DWQA 2PXCA 4A3SA 3GJZA 2XA2A 2UUAB 3K8QA 3MINB 4QGFA 1NLYA 5DTMA 3TGWA 3TRFA 4C76A 4DUZB 3EXIB 3I1YA 3LT1A 3MJDA 2AOUB 1A5AB 4XLLA 5JDIC 3VNQA 3TR5A 3B5JA 1GNSA 2Y92A 4ZTUB 5BSGA 4RZSA 1SHJA 4KPUB 4CTNA 1ZO8A 4L4UA 4MCJA 1N0HA 1VG1A 2RDMA 4GHWA 4MO9A 4ZT6A 5GV7A 3T7JA 3UJDA 4AMBA 3WQRA 1PT7A 2R7KA 2XYPA 1UP7A 1T1IA 1U3VA 2OLKA 5BSUA 4QM6A 4GVLA 4DLKA 2JIBA 3CRW1 3ELBA 3DMTC 4OHPA 3HA2A 5IYZA 3AUAA 4E14A 3IVRA 3TVYA 2ZJBA 3QNWA 4OP1A 3VC3A 3DKKA 3IPAA 1NR5A 1WZCA 1ZZGA 2ZIUB 4FC6A 1Z28A 1M2NA 1EAYA 1XLVA 5DGXA 5F12A 4CL2A 1SHLA 3OPYA 3GYBA 3EFBA 2AG8A 2Y93A 2O07A 3M1IA 2X42A 4M6WA 1G5IA 2CLSA 4EI8A 3URMA 5G3ZA 4XH9B 4J0FA 1Y9ZA 1CR4A 4B8YA 4D4JA 3UN1A 1L9XA 4D9JA 5AM3A 1O0CA 1QYRA 4GQAA 1XHLA 1Z4MA 1XL1A 3CNBA 3PXEA 4WDRA 3IOCA 3FTNA 1TJ4A 1PNOA 4M9CA 4OXRA 1V6AA 4EG8A 5B1YA 4NYMR 5K01A 1VL2A 5B64A 1TUEA 2ZSEA 2P62A 5I8WA 3COJA 2BPOA 2JFXA 1YS2X 2V6JA 3M89A 3QOXA 5FI1B 1Q7GA 3DYIA 3DC7A 3M83A 3G9ZA 3B1ZA 4HBZA 2GSWA 1QTIA 2DWOA 2E6UX 2X5JO 2HQBA 3ER6A 3GJ0A 3N2GA 3O3MB 3QVKA 4YR9A 5JJ5A 1QE0A 3NVKI 3T12A 1DZIA 4KO4S 5FWYA 1TO1E 1SB9A 2FWIA 2YCLA 2ZATA 4HAZA 1HE2A 1UODA 4FCTA 2I34A 3ZXIA 3HG7A 3BWMA 5IWCA 3GRUA 1U8XX 3ESRA 4GD3Q 4GGMX 2FF7A 3ZEAA 3K70C 3MJRA 3OCXA 5K0FA 3IXLA 4NS4A 3EC7A 2C04A 1I6KA 5F7ZA 3WAGA 4DIBA 2W2MA 1TZJA 3OIDA 2DFVA 1BMQA 4E31A 3BDVA 2QW0X 1P4AA 1SIUA 3Q5GA 4NBVA 3QENA 4YDRA 5JCJA 2DQKA 3S5UA 5LYJF 2QB5A 5AVTA 5LD2C 4OQPA 3M4NA 1O94D 3P7MA 3UXEA 2XQKA 5H1YA 4ARZB 3I37X 3QU7A 4I5FA 3HCFA 4ZVMA 3SJCA 2G1AA 3QLVA 1XR3A 5KWJA 1H2HA 4LHSA 1NFFA 2DFLA 3UY4A 2D59A 4HQFA 4WXEA 5GOZA 1DVRA 4WBNA 3WRWA 5IJ9A 3MLAA 1OZAA 4DMFA 5IM4A 1D4AA 1AKUA 2IZ0A 3L06A 2A35A 3G9TA 3ZK9A 3NHMA 5A6SA 3F97A 5E6UA 3ZHQA 3U6KA 1N25A 1T5IA 3ZU2A 4UMEA 4RH0A 1RFGE 3D3QA 3FPHA 3KL2A 4CIWA 4JFRA 5C51B 3ELUA 1CYEA 3G59A 4KMOA 3QFTA 3CGGA 4N54A 1XCPA 2HN9A 1SBNE 2FB9A 2I4OA 3O74A 4RCYA 5F4ZA 3TO5A 4N3GA 1FXSA 1Y1SA 4LHYA 3VR3D 4H27A 4UUOA 4YV1A 3MPOA 4ZMBA 2O8CB 2KLBA 4V0SA 3EQ6A 3D3EA 3ETCA 2EW8A 4OBBA 1R15A 1LU9A 4DIUA 1R8SA 2RGDA 2PHZA 4L9WA 1KETA 3KQQA 4XIGS 4Y6LA 4DYHA 3ZK8A 3JATB 2AXPA 4CIXA 1E99A 3FGOA 1UDWA 3DXFA 5G4KB 4G4SP 1H5UA 1TC2A 2CLMB 4EEZA 3UGJA 1SMKA 5KREA 1E0DA 3LZ6A 3E0QA 1Q14A 2ZJ2A 2ZTUA 3X1DA 4S3MA 4PRKA 5IX8A 3AR9A 2C2ZA 3MD0A 1US8A 1VKNA 2X1MA 4RF2A 1C0EA 5GIOE 3THWB 3TUJC 1F2TA 3PQFA 4X7BA 3UEOA 2Y05A 3LU1A 1W581 4L15A 2X1VA 4FDTA 2SKEA 2FFAA 3I5AA 4KBGA 4MEBA 4RSHA 1ARZA 3BWBA 1U8YA 5T4BA 2VJCA 4NF2A 1OIXA 3SC2A 4RA6A 2CHUA 3RNLA 1IZ0A 4R9NA 3I6QA 1OI3A 3UHOA 2HPAA 3ZKWB 2HA5A 3C97A 4ZA2A 3UJNA 2JIZD 1MXFA 3F5MA 1K68A 3OJEA 4KYUA 2VRCA 5DYTA 4E70A 1M8FA 3VX4A 4KR3A 3UHAA 5I6DA 2MJLA 1YA8A 4YMVA 2XW6A 3CKKA 3B7GA 4H0NA 2EKQA 1RHUA 4UDOA 3CONA 2HPHA 3BGSA 4D0RA 2AW5A 3G8BA 1K06A 1ZAKA 4XFKA 1SUEA 3R5HA 3TLZA 2XRYA 3L92A 4Q4JB 3B1KA 4F3RA 4EB3A 4H0CA 4RD0A 1TJNA 3IJRA 2BC9A 2UVPA 4MB6A 1XE3A 4J0JA 4ZN6A 2J4CA 2UAGA 2EFCB 2COEA 1KZ7B 3QOWA 2Q9BA 5CT9A 4BQOA 1UT6A 2W2KB 1EQAA 1Q1QA 1Z0SA 3AHGA 3O47A 4PG7A 4A1FA 3BF8A 3DZHA 4EYKA 3AFIA 2NU6B 3FHOA 3BL5A 4OV6B 2VK4A 1ZW1A 3QUCA 4HX2A 3ZGVA 2CUNA 1BX3A 1LTKA 1UK6A 1MX1A 3AF5A 3BSFA 5HUJA 3BTOA 1KEEA 3BYZA 4UHBA 3Q8LA 1CUCA 4GG1A 3D6MA 4HEJA 10MHA 2F4NA 5D3QA 5A9TA 1LS6A 1QZUA 4RF4A 2ZRFA 1RCUA 5AI5A 2Q3FA 1MB4A 3CZ4A 3HBNA 4G36A 3TRKA 4Y6OA 1E7RA 1VKJA 3BE5A 1YE8A 2P41A 3ID6C 4O4HB 4EF5A 5B2FA 1N9GB 3ZDRA 4WX2B 4L16A 1E3LA 5GOTA 4FBMA 3LNCA 1AVTA 3SHQA 2FR0A 1B2RA 3U9LA 1JDVA 1K3TA 4FOPA 2I6QA 5H68A 2OBFA 2WFMA 3CF4G 3HBAA 3L2OB 3HCNA 3KYIB 3IT3A 4IG9A 4KIUA 3EXG2 1BA3A 4Z3DA 3TDKA 4BX8A 3GLQA 1E9BA 4WACA 5CVVA 1TEVA 2I66A 1E5QA 2B0JA 3I1FA 4CXMA 3GCZA 3V8MA 4B71A 2BEVB 3KKOA 4GBGA 2BI8A 1K4KA 2Y6UA 3FPLA 4URFA 2I29A 4H7HA 3ECAA 2XMDA 4BY9E 1CY0A 3ORSA 2XLCA 5ALMA 1U8ZA 2V7UA 5EJGA 5SZHB 5KDOA 2ZFUA 4EO9A 1YKGA 1IY0A 2AGVA 2ZUUA 1QR6A 3MGGA 3MJCA 3WK6A 2B8NA 2DHRA 4CMIB 5K0EA 4PLHA 3W5HA 3JQ7B 1KJ9A 5ALOA 1RLTA 5K51A 3VHQA 5F2NA 3ZVMA 2C1XA 2QGNA 3QWAA 3RUHA 1RPZA 3QSGA 1U1IA 4E09A 3I2FA 4CHTA 1CIVA 3UOWA 2CNWD 1BDHA 3FFAA 2OHFA 4LSMA 2NYRA 5CM9C 1CFZA 3ZS9A 5LR6A 1OWMA 3EIEA 1XL0A 4KGXA 2Z6VA 2CEAA 1PNTA 1N5DA 1RJWA 3BTUA 1C80A 3L4EA 4PQYA 5SY9A 3WO0A 4TWRA 2IZZA 2H51A 3IVMA 3KB2A 3AHIA 2H7VA 1H6DA 3V32A 1JEQA 2ZBFA 5AMXA 4DE5A 1IFXA 3G1TA 1K63A 2PS0A 4QBFA 1EZ1A 1EVYA 1OH7A 1EHYA 1EVJA 3SF0A 3L43A 4ZDJA 5HRCA 5DCWA 2X15A 1TEHA 3V8BA 2HMSA 1LF5A 1NI5A 3KVRA 4OB7A 4B8WA 5CVTA 4BNXA 1JDNA 3O3OB 4G8DA 1ZYUA 3F73A 1L7OA 4F60A 5JAPA 3C1AA 3V4ZA 3DPUA 3SSNA 1BXRB 2W2TA 3L8YA 2W58A 1A82A 1WZEA 3DXZA 3HLKA 3NX4A 4LMPA 4WE3A 4RA9A 4EJ6A 4ZCTA 2E2WA 3QY9A 2FWJA 2H2FA 1Z2AA 3OFJA 1Z8HA 4DBLE 5CBKA 4D4GA 3RTDA 3TI9A 2ZM5A 1XZDA 5ALZA 2QMZA 4EHHA 4L2IA 5E2IA 2KQUA 2RH9B 5KQMA 1W75A 1Y80A 2WHEA 1R12A 4M87A 2HLDA 1PQUA 2QT0A 3COWA 1PE0A 2WKQA 4BRWA 4CLHA 3H1BA 1Y6RA 1NXVA 3P9YA 4D6PA 1PJ4A 5JDIA 4ZO6A 3AF0A 1ZEMA 4GOKA 3T7IA 3ENKA 3M5WA 4PPGA 3W34A 4ALJA 2C8JA 1NN1A 3Q5EA 1O95D 4YCMA 2GCNA 2H29A 1FMLA 1P8JA 3QVGA 1KZ4A 3ZWCA 4BMVA 1KGDA 4D9GA 4TSFA 3E7DA 5KI6A 1E1MA 5BYAA 2OCPA 3LIPA 4EHAA 4Y6SA 2MMCA 3DMTA 5F73A 3BH6A 3KUDA 1Z0FA 1YVEI 1QFJA 1RHKA 3EZ7A 3FPFA 1T9KA 1MOQA 1S8OA 2QRUA 2J33A 5EXTA 4B2YA 4DPKA 3OEWA 5EUQB 3GRYA 2QTAA 4PAOA 4BV2A 2QV0A 2QM3A 1QK5A 3FBGA 1WKCA 5HIKA 1HLGA 4ID3A 1UJ4A 5KX5F 2Y1OA 3QI2A 2Q9CA 2XCUA 5H83A 4HNVA 3RYIB 3LPCA 4KPFC 3UJAA 1H5QA 2IX3A 2ZJ7A 1MAWA 2KPOA 1K5HA 2X5XA 3A6FA 3GN2A 4KDCA 3UG7A 3HU2A 1LXCA 4GSLA 1PQPA 1V7ZA 4WNAA 1IIBA 5SY4A 3GAFA 1V1RB 1A9QA 5HFAA 1LDEA 4ESOA 3U9TA 4ISCA 1JVNA 2FPIA 2WTUA 1XCMA 4BQEA 3O1IC 3DZCA 5EXXA 3CVUA 1AX9A 1P2UA 2Q7DA 1WMFA 3P9XA 2YV2A 4ZHQB 3GDFA 1DDGA 4L8VA 2QR2A 4V0KA 5CDYA 5IBRA 3GJ6A 3X2SA 1GQFA 5HFNA 4XUGB 4Z49A 4JH0A 4H59A 3GLHE 1BVHA 4RK5A 1KZYC 4PPYA 2O6HA 2XVAA 3EF3A 3UOAB 3DDHA 5DBEX 5F9HA 2R11A 4GBJA 1FQWA 5ICMA 4LGVA 3GLIA 3B6ZA 2QQGA 4TQUS 5JJIA 4DA6A 1TW2A 5E4TA 4Q3CA 4DBLC 3DV9A 4Y9TA 1OGJA 4OXNA 4L85A 3SC4A 3HKEB 3Q85A 3THSA 5A06A 2BJVA 4E2FA 4EF6A 1II8A 3LA6A 1DFIA 1FZQA 1EZ4A 2XUJA 1PS0A 2VSYA 3C3XA 3N0WA 2VL7A 3K0FB 3LWNA 2MINA 2EQBA 5EZ5A 5CLJA 1AMOA 3DP9A 3BRSA 4DSZA 2VPTA 4FMPA 2ZITA 1W4RA 3QF7A 4BNVA 5IWAB 1U0EA 3RSZA 1SG9A 1XC7A 4U2CA 3EY4A 4CG3A 1PUIA 2P68A 4H35A 4KNVA 1QO0D 2VNKA 3UAVA 4LMBA 3WYFA 1MV8A 3NLLA 4AAYA 2VYNA 4DMLA 1T4CB 4BU1A 2WBLC 1NG9A 2D2EA 1P18A 1RNLA 4PPFA 4QPCA 3RM3A 4CEJB 4ONEA 4CDNA 2OHIA 4KXNA 4TVOA 5DN6D 1S7CA 4FMBB 2ZSJA 1RYZA 4BCCA 3HCBA 2DWQA 3KPWA 1L2TA 4LW8A 4F8YA 1G42A 2A0UA 4NJEB 5DIFA 2RK4A 1GAWA 3JZDA 4BLQA 2NVUB 5HP4A 1JA1A 2W0MA 3DHWC 1U7XA 4RIGA 1XZBA 4RIHA 9ATCA 5JPCA 1IN4A 2ZPTX 3FETA 5DBIA 5AM5A 2AEFA 2Q9AA