4MJ7A

Crystal structure of the pin domain of saccharomyces cerevisiae utp23
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
QKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA-processing protein UTP23
publication title Structural and functional analysis of Utp23, a yeast ribosome synthesis factor with degenerate PIN domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 51
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04900 Fcf1 Fcf1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4mj7A00
5ECYA 4XGRA 3Q8MA 3ORYA 1W8IA 5L6LB 2FE1A 5HMLA 5L6MB 1B43A 3IX7A 5ECDA 4XGQA 5H4GA 3ZD8A 3DBOB 2BSQA 3ZDCA 3ZVKA 4MJ7A 2MDTA 3H87A 1UT8A 5H4HA 3Q8KA 1BGXT 2WP8J 3ZDBA 2HWYA 2IHNA 1MC8A 1UL1X 1TAUA 3QEBZ 2QIPA 5HP4A 3QE9Y 3ZDDA 1XO1A 1Y82A 3Q8LA 5K8JB 5ECWA 1RXVA 1EXNA 5ED0A 1O4WA 2HWWA 1UT5A 3H7IA 2HWXA 2LCQA 1V8PA 1V8OA 2H1OA 1V96A 1RXWA 1TAQA 4CHGA 3H8JA 1A77A 3I8OA 5FV7A 3QEAZ 2DOKA 3H8WA 1A76A 1YE5A 3TNDA 3ZD9A 5HNKA 3ZDAA 1TFRA 5SV2A 5HMMA 3ZDEA 2IZOA 2H1CA 3H8SA 4WA8A
chains in the Genus database with same CATH superfamily
4IIVA 4H16A 4QU9A 4QFCA 6REQA 1AK9A 1FRFS 1B76A 3KTOA 3VM6A 4W5OA 1ZJ5A 1E7RA 2ZI9A 5FUVA 4AJ1A 2VTEA 1YS1X 1W0KD 4UJ5A 1JVNA 3KL2A 5FUWA 4R1QA 2GCIA 1Y8RB 3SU8A 2RHTA 1U0BB 4HDSB 1XYGA 3NH6A 4MUEA 3KZKA 5DHFA 3RAJA 3JQGA 3RHSA 1SXJD 4KJXA 4AO6A 1GQQA 1R8SA 1UBHS 3DYIA 5DNAA 5K5EA 5KQMA 2F8SA 2BSQA 2R8ZA 4N76A 4V0KA 3TNLA 4D9IA 1TXGA 1CR0A 1VL0A 4BB0A 3GNQA 1PTJA 1DWUA 2GEFA 2IZ6A 3GCXA 3PD0A 4G5YA 4KQ2A 4O2AA 4BMSA 5JYCA 2R86A 1PEDA 4MRMA 1Z29A 1XD2B 5CA0F 4KACA 2B1IA 1CULC 1PZEA 2H4JA 2W2VA 1JQDA 3HBAA 1VBNA 4FI3C 4GF5A 2JD1A 1NE2A 1SH7A 4QREA 3TW0A 5DX1A 2O3SA 1V7ZA 3ULKA 4WXHA 3AUSA 4TYPA 1QZTA 5K0ZA 3U81A 3OUZA 3R5XA 3RTGA 2WPDA 1SWVA 3FA2A 4J03A 1P9RA 3D8UA 5B7PA 1TZMA 3ZTWA 4F7WA 5DMXA 1YFJA 1I4EB 2VK4A 1JDUA 4I4TB 4M8LA 4U7TB 2Q6KA 4PLHA 3NWBA 4PSAA 5AJXA 3E53A 3K09C 3G8DA 4U7WA 4HNAA 3V4SA 2J4FA 4C30A 3VSCA 5I9TA 4BNJA 3OIDA 5HZHA 3G2NA 2XBLA 1UODA 1IZ9A 1DI0A 2ZI7A 4DIUA 3CG4A 4HADA 4BNIA 4EW2A 3QKSB 2R6DA 2M32A 3UJNA 1JDPA 4HYTA 5DNCA 3EIXA 3VX3A 5DXJA 3GHHA 4K1XA 1V16A 1JHOA 3ICOA 4Z3DA 4IGKA 3U7EB 5LVAA 3PXDA 1DBPA 1DJOA 2CKMA 3BSFA 3HCAA 4HGPA 4OOFA 5EHQA 5TJ9A 2I9KA 1AOXA 2R65A 2VP4A 4PM4A 4UD6A 1XAHA 1V3QE 1GRCA 1NF8A 2BD0A 1RBYA 4PG5A 1IEQA 3L05A 4UHDA 1XZMA 4MIEA 1AS0A 3HXQA 2O1WA 3EBLA 2WFAA 3PWKA 1E63A 1WW3A 4BNYA 2FFBA 1X7WA 3H2BA 1XNJA 3CUSA 3CPEA 4KRYA 4QVIA 3GI1A 4PYMA 4LJ6A 5JCOC 3AFGA 3QG1A 1DEAA 3PHHA 4Z7OB 1NMSA 3ESXA 1DWPA 1ESZA 3MTAA 2RHHA 2VT7A 3KVNA 4UBJA 4MVWA 4BV9A 2LW7A 1W88A 1GV0A 2JDIA 1GKUB 3E7XA 4TWZA 3IHKA 1RWBA 4KW7A 1VDZA 1YRBA 2WFLA 4NMMA 4IJ6A 3AUJB 4R2WA 4RH0A 5CXSA 3FCAA 3A9SA 1EK0A 4JUIA 4UATA 4LYEA 1EEXB 2OV8A 3V3KA 3WRXC 3H5VA 4ZCQA 1X94A 2JAUA 3GJ3A 3R3VA 1XGKA 3PICA 2OCGA 3AR9A 1N0WA 3G8YA 4FNMA 4JNKA 1SXPA 5SV2A 1IOLA 4FZ5A 2HF2A 2ZYRA 4IIEA 2W93A 5E6RA 4WRRA 4OJNA 4OHXA 4XD2A 1DC7A 2GSWA 2ETXA 3IBFA 4KN9S 1SVSA 5KPJA 1U3UA 5DYWA 2GBLC 5IFLA 3OE7A 2Q4RA 3OIGA 1AKTA 3U31A 3QFTA 1Q3HA 2O1SA 5A7HA 1EE1A 4RDXA 5I9LA 1TZKA 4Q1FA 5B6JA 3VV2A 1B00A 2QJTA 3NDPA 4NX2A 1ITZA 4PYQA 4KPGA 5EMLA 1TM7E 1J22A 1V5GA 1TM4E 2C5EA 4PCLA 2J0EA 2HQBA 2PFSA 3TGPA 1P45A 3OTWA 1RM0A 3C15C 3MXTA 3BXFA 1EJBA 3HL0A 2GILA 4XEHA 3G9TA 1RE0A 1OE0A 5B7NA 4W5QA 4B6RA 4D98A 1SU6A 4WBNA 1JJBA 1RIIA 1VMDA 4IVPA 5KREA 3ZWWA 5FEMA 5FB3A 3UAYA 1ZD9A 2ZBDA 3C3CA 3I4CA 3KTAB 3OLXA 1R8JA 4MQ4A 2ORYA 2ZWIA 2YZKA 4FQ7A 1XZGA 3HB1A 1IZYA 3FJOA 4K6GA 5KWVA 4BPRA 2FPPA 2P9YA 4NJOA 2J7PD 1ZD1A 1U98A 2Y8EA 3B20A 2IVZA 1UPBA 3WYEA 4ZGWA 2E5LB 2JCVA 4KGDA 1ZNXA 5AVYA 3SC2A 1FRQA 3O2SB 3ZTYA 4U7FA 2OK7A 3UENA 5CM2Z 1ENZA 3ZUGA 4CF6A 3V8RA 4ZJUA 1Y1KE 1EJ6A 1QGUA 1P9NA 4G5HA 1V5IA 4XH9B 3PF8A 4BEJA 4BNHA 2QLNA 1YRQA 1OILA 2OOKA 4G5OA 2BE7A 3UJCA 3CFYA 3WFJA 1MJHA 2I8AA 3OEYA 3SZLA 3T7RA 2QD2A 5TQ0B 1YKSA 2ASEA 3BMQB 3A6EA 3TLXA 2XUHA 1N78A 2AQIA 3RJ9A 2Q49A 1PL0A 2QRMA 4XJSA 3D4IA 1E61A 3OQOA 3QEKA 4BUCA 2EQ5A 4Q4AB 3IDFA 2RI1A 4XVCA 2OLKA 1PR2A 1YA8A 1MDFA 3CMMA 2QW8A 3MMSA 4Q7KA 4BVLA 5KTTA 2H4XA 1GKIA 2OC4A 1BCRB 4I5FA 5IDYA 3UAGA 2IE8A 2P2LA 2BI8A 5AHKA 2AZ4A 3WIDA 3B78A 3P8ZA 3O4HA 1T9BA 3Q3JB 2QL9A 1W75A 3A1CA 4KQ6A 5EJ4A 1FDSA 4KPUB 1U5BA 2CLEB 2IUYA 2VTDA 2OLEA 3PQ3A 2FWRA 1HOTA 3WLOA 1PV1A 2ODTX 3C6QA 1TD1A 1U0HC 4OAOA 4ZT2A 3W2EA 5BXYA 3H8JA 5IHXA 1HX7A 4DA6A 1N2CE 3QHPA 4KN6A 3T9CA 5FTLA 1IZ8A 3W78A 1YZTA 1WW8A 2ORVA 3V6MA 3GPLA 1I3NA 2HPAA 3I5MA 4H7HA 1QG2A 1GTL1 4J7UA 2AG8A 1QH0A 2W2QA 1RP1A 4PV7A 3EXAA 3H8WA 3O83A 4NOKA 4EI7A 2QTRA 3QELA 4H35A 3RLIA 2G6TA 1LLDA 5BR4A 3K0EA 1F3OA 2PEYA 3PC7A 3O4VA 5A9SB 2YIMA 1A71A 1Y89A 2ZI6A 3EXIA 4CETA 2ZKIA 3IOMA 4IOMA 2DWCA 3KVYA 2W0SA 9ATCA 1WXGA 5FRDA 4ND5A 1A9PA 3GY0A 3KB2A 3NAZA 4ID3A 1P1BA 2XLCA 2FMIA 4IQ0A 4YV7A 5M34A 1E8MA 2IEGA 4DIEA 1GNTA 1CJBA 1TX4B 5KSOA 3HO1A 1NF9A 3IJ5A 3KUDA 4GLBA 4F06A 4XWGA 2DWPA 4NFSA 4QT4A 1T4MA 3S2GA 3H9BA 2FX5A 1Z6PA 4RF2A 3RYIB 2DPYA 3CVWA 1P5HA 2GM5A 1P33A 5CFMA 2JGAA 4Q9KA 1ZIOA 3LVRE 4YT5A 1ECFA 1YQEA 4FMCB 3A1EA 1ILWA 2GB4A 2WWYA 1GVHA 4C08A 4YCDA 3EF0A 5AR1A 1VMKA 3I6ZA 1G8YA 2HADA 3HP4A 4NDAA 4K6OA 4KQXA 5BSGA 3FKSA 2DAPA 3QLJA 2V8BA 3GT3A 3IT1A 4I08A 4Q3DA 5I5EA 1D09A 1HT3A 1U1DA 1DWQA 3EGOA 3N2ZB 1CDDA 2ZAGA 4PX9A 1EFDN 4R9RA 2Y76A 4Z1MD 2NLOA 4HL6A 5CH5A 3UAZA 2BEVA 1DIGA 1GCIA 4W1PA 4BQQA 1IY2A 5HVNA 1CKEA 1Z7WA 2ZAMA 3MEQA 2Q46A 5E95A 2ZUTA 2R7MA 2AF4C 5IXJA 2ZAIA 2H85A 3DYVA 1PQWA 2FFHA 3CPHA 4JUAA 3VR2A 4AX4A 4P86A 4FSHA 1M83A 4HTAA 4R41A 4RBNA 1BO6A 4YMUA 5JROA 3ZZTA 3HP1A 1K9SA 4FJ0A 3Q8WA 4BWVA 1SXQA 2CB9A 3G8AA 1BVHA 1JT2A 4Q6WA 1WXIA 4F6RB 4REMA 4DSUA 1KY5A 3QUAA 4QGFA 4MB2A 2OT3B 1NQAO 5E4YA 2B0CA 3PYLA 1RM3A 5D1HA 3STUA 4MUJA 1JHUA 1XHEA 4GQIA 2IHTA 4UVIA 1V37A 4E6EA 5A5EA 5JD5A 4KAFA 4XEUA 4OSPA 4EPTA 1JJ7A 4B8YA 4V0QA 5EE0A 2Q29A 3RIYA 2B7LA 3RYCA 2J3EA 1NZDA 5KYXA 5F9FA 1ETUA 2P5TB 1G60A 3WGJA 1A1VA 1XYYA 2VQSA 4WZ6A 1VKRA 3NWJA 1XRNA 4QWMA 2BDTA 5JR3A 5KYUA 5MGBA 2WMNB 3PFFA 3VJLA 3IALA 2E49A 4NIMA 2GFIA 3BICA 4KLAA 2SICE 4AJIA 1Y1TA 3OTOB 1BIFA 2Q9UA 1MO5A 2C00A 3DL0A 1VLLA 4IDDA 1YR7A 2W2MA 4YDRA 5GMOA 5FUXA 3VDXA 2LE0A 3AL0C 4MYHA 1C0IA 1MX1A 1RFLA 3GZNB 3HB9A 2E5WA 4Y2PA 5DGDA 3KX2A 3RB8A 1YAHA 1ST2A 3QMPA 1FJXA 2J4DA 1DQYA 3I4LA 3EWIA 2VF2A 3MQ4A 3K0CA 3I0MA 2YY5A 1I4OA 3A1VA 4AXBA 4EG4A 5A4AA 3D3NA 2P4QA 4FGJA 5LBUA 3QTBA 3DOFA 3UPTA 2R2GA 1J7KA 3C6BA 4OUDA 1O0CA 4AWAA 2YJ3A 4FHGA 3LC7O 1W85A 3WLIA 1A2KC 1DAKA 1E1NA 4TTQA 4YP1A 2BHTA 4KQIA 1N33B 4Q0MA 1QLWA 3IUBA 1DTWA 3F6EX 1W5TA 3QSGA 4M0MA 5DLPA 5MDHA 1GPH1 2O50A 1HUQA 3AKCA 1QHSA 2PSHA 1MAHA 1T4CB 2AR7A 3N3AC 4MB6A 5TQ2B 5LNK6 3EDYA 3RVKA 3PZRA 4DLLA 5AD1A 4PQRA 2D2EA 1ADCA 2Q6VA 3B36A 3O47A 4TYYA 2IY9A 5BQXA 3F97A 2R96A 2FV8A 4QBGB 1YL6A 4L76A 1TFUA 2XWQA 1II8B 1Z5NA 3OFND 2NAPA 4FYWA 3K70B 1CF2O 1SAYA 2AKYA 2VBCA 2X76A 4M0EA 3KP1A 1MNQA 3SJCA 3ZGLA 1C1YA 3IGFA 5J2TB 1FBTA 3A9CA 3KQQA 3KB6A 1Z16A 3QVLA 3EULA 4HEA1 4OGGA 4Q82A 1YHYA 5EZYF 5L3QA 3DTVD 1J39A 3N0VA 2DPXA 3OJLA 4LK2A 5JD3A 1LF5A 2ZRQA 4EHIA 3S1AA 1GPYA 1XVLA 4POAA 1W48A 1VTKA 4RZIA 3TM5A 4JC4A 3TE7A 4EMTA 4J0HA 2FOLA 1KMNA 3HWRA 4QPJC 2XB9A 4CCWA 1Z6TA 3MT7A 3HB0A 1RXYA 2PJDA 4BXOB 1D1SA 3AHEA 4C0JA 2PMFA 2E21A 1HRKA 2HTFA 3FX2A 5JATA 3JZFA 3WWDA 4LJKA 2HIAA 2UYYA 4PGAA 3N6XA 4HNHA 1DSSG 2BFWA 2JIRA 3D1LA 3EISA 3HJBA 3KLOA 4LY3A 3NH9A 4XOIA 2WIDA 3CGGA 2Z4TA 1Y4SA 2X5OA 3OSUA 4JUBA 2W48A 3EGDA 3DDZX 2R6GA 3G0IA 2WNSA 4R7TA 5AK3A 5K0LA 3RR2A 2FP4B 2C92A 1ISGA 1NM5A 1WS6A 4CL0A 1NXQA 3C98A 3FUCA 1EI9A 5JQGB 3GLIB 1EFUA 1IDOA 1RRKA 1T35A 2VUTA 4RWZA 4EMBA 2RI0A 3Q1LA 3SI7A 1P31A 3UMMA 3ETEA 5H1YA 3LU1A 3P9NA 2XH8A 4O4HA 4EHBA 1E7SA 1HWYA 1P1FA 3PPVA 3ROQA 2R84A 5LP6C 5JS2A 4A8JB 1O5OA 4HGQA 4I1IA 5IZCC 3PNVA 5FV4A 3PPWA 2XZOA 4IQ4A 2YXNA 1HDXA 1C9NA 1G0OA 3X1WA 5MHTA 1ZBQA 5AP9A 1KAQA 3X44A 1ZIYA 3DLPX 4P7FA 3F9CA 3FYHA 4W4TA 4GI7A 2GN0A 2EFDB 3ODPA 4J0IA 4N9QA 1RWXA 1K6IA 1A96A 1GFWA 2PH1A 3OG9A 2VAPA 5IVHA 1L5SA 2BJVA 3G8BA 1WZ2A 3FNHA 2DCUA 5A5FA 1NUQA 3VJRA 5A0TA 2H48A 1NVGA 2AJTA 3H9UA 3UOAB 1T25A 1WB4A 3PX2A 2WABA 4LGVA 5I8PA 3DHVA 2C97A 3ZLVA 1JDSA 4IIYA 3E7DA 1INLA 1RCFA 3QUCA 2YHUA 3RSOA 5AW9A 1LVHA 3OPNA 3KPVA 4Y2UA 2XGGA 5FBHA 3VPAA 3V9AA 2EIHA 1MIOA 3PIDA 2BF7A 1SD1A 1WPGA 2J45A 3BWXA 3U9SA 2R68A 2VK2A 3ONWA 1W0JD 3QMMA 4HNGA 1JIUA 5CVEA 2CK3D 5BUCA 3D0OA 4G65A 4BFZA 3TL3A 1J09A 1SU4A 1WG8A 1YT5A 2P8SA 1Y3DE 2VP3A 2XKBA 3ICCA 4RLHA 5EIFA 3N2YA 1G5HA 2W6ID 3X3HA 3PLNA 2C0QA 5TLSA 4AJ4A 4LYFA 3EEOA 4CHTA 2WHYA 4AKHA 2PU7A 4YRNA 1R16A 2ZPAA 5MN6A 1OLUB 3E8XA 1T3LA 2B35A 2I03A 1CUVA 3LBHA 3PNQA 3QPUA 4LSZA 1Z8NA 4TMVA 2BT4A 3LC0A 4BNWA 5CTAA 3PA8A 3N75A 4F1KA 2Y93A 2AR9A 4LOHA 1TU0A 4UUAA 4QVKA 5E0KB 3MHPA 2Z6VA 3ZWOA 5EJMA 5JVDB 4YUAA 2VUUA 5JW6A 2BJHA 4F21A 4JYAB 4AI6A 2MR5A 1ACJA 3WK4A 4NZMA 4A6PA 4DMMA 2P1RA 4RHXA 5IC4A 1K06A 2IHZA 4QOEA 3FDZA 3BG5A 3SKXA 2YNMC 5DHQA 4RTKA 3BE6A 4K9OA 4LJLA 3TSYA 4BBZA 5BWOA 1G7RA 2A5DA 2H11A 4W8OA 4PYNA 2HNKA 3D2AA 3ECAA 1MB0A 3BHIA 2O2JA 1OWLA 2E18A 4G37A 4OFZA 5CLIA 2EKZA 4R31A 1UFKA 2CVHA 2ZWVA 2WJ6A 5A0FA 1KZ1A 3U4HA 5CDTA 1O94D 1TD9A 1E1CB 1NYTA 2GXSA 3B1FA 4DOMA 4EAQA 5LPNA 4HDQB 3IAAA 1FFEA 2QT9A 4JA0A 1TADA 1J4AA 2RAPA 1HY3A 2BEKA 3H0KA 3JVDA 3N8DA 3PXEA 3GBPA 4UC0A 5GVSA 3SOZA 4E5VA 4KUGA 1WIWA 3ROEA 4PHGA 1E6EA 1KQGA 1SK9A 1E1KA 2OBFA 3ICQB 4RMJA 1YZLA 2AA3A 3AI2A 5IAJA 3TIXB 4ENPA 3P94A 1XZHA 5TB5A 3VYTB 4DG9A 1RXSA 1XRQA 2B1QA 4V3BA 1OOEA 2K6GA 2HLDD 3BULA 5IXYA 2DWOA 4RZQA 1DOZA 3QIVA 2GYYA 3COPA 3T9EA 1TTPB 3QKWA 2V4ZA 4FC7A 1SQFA 5EMMA 1Y4ZA 1J8MF 1E8NA 1SG0A 1UFVA 4KBGA 5BR7A 1OASA 4OH1A 5KWSA 1H0RA 4XI9A 2JFQA 1IN7A 1XPJA 3HVKA 3NXKA 4U5QA 1QIEA 8LDHA 1ZC3A 4U39A 1P2SA 3E6AA 2ISQA 4W5NA 1F06A 1K63A 5FWAA 3Q3GE 3D2LA 1ZLYA 3FB4A 4JASB 4URZR 2VQDA 4ZODA 3I9JA 3FYCA 1N7IA 1R6XA 3H4VA 1QRRA 3VC3A 3PLRA 2A78A 4DMCA 2VCEA 3I39X 4RDCA 1P2VA 1U2DC 2EFEB 2RHMA 2Z98A 1E3LA 5L9AA 2ZZMA 1ZSYA 5CK4A 3HQ4O 4OBXA 1YQQA 1Y9JA 4HNUA 1JEQB 3OA2A 3SC3A 2YV4A 4QT0A 3CE9A 3IKVA 4UDXX 2V9PA 4I4TF 5EYPA 2CDCA 1BOOA 1F9EA 3CCCA 1FMCA 4NESA 1Q7RA 3TJZA 3WBBA 4CWAA 2HA4A 1KVSA 1M2EA 2BFCB 2LKCA 1ZGJA 3CZCA 3FPGA 3GG9A 2FQYA 2IIVA 2PT7A 2Q41A 3MUNA 3UWMA 1IVNA 1A5AB 2XRFA 4BASA 4HDOB 2ZITA 4OQLA 5B2EA 1J0BA 1OV4A 3CCBA 4GXTA 4P81A 1FU7A 1S0UA 2X4GA 4NMLA 4RPKA 1UWCA 1VL8A 4P3NA 4HZIA 4G8JA 4UHHA 4X9XA 4IFIA 5FV7A 2PVCA 1BS9A 3RC2A 2VKTA 3T3HA 1ZI6A 1SVIA 2C4TA 1J1ZA 3OFVA 1YZKA 1YS6A 2GJ8A 5B57C 2ZI4A 3GLFB 3WK6A 3W3AA 2E7ZA 5IYZF 1E0SA 1S7GA 4L2IA 3SS9X 3U3RA 1OBOA 4X1YB 2EGGA 3TTUA 4CIXA 4P5DA 2JGKA 3B1ZA 3AI7A 3EOBI 3LDUA 4RV4A 5EIAA 5LFAA 3R3UA 3EEBA 4JL6A 2O2EA 1RZRD 1ZMXA 3WKCA 2QHXA 1QK4A 5I7HA 4K9PA 1VSUA 2GXUA 2NVUA 2EFGA 2XUOA 1RS0A 3N2LA 3NDJA 2JFPA 4KRFA 2YHSA 4ZXPA 3ZZNA 5THKA 5F9MA 4G4JA 3RUAA 3U7RA 3OO0A 3UHAA 3H5AA 1U2QA 4KSCA 3DTNA 2V55B 3L6OO 2CHVA 3VV3A 1HQCA 3SMQA 2ZIFA 2C4HA 3AG6A 3D7SA 4EJSB 3DUFA 3HKBB 1EVKA 1RLIA 4ROSA 4A27A 4TMFA 5EXTA 5DIFA 3X1ZA 4ISCA 4PRZA 4TZ6A 1PR3A 3ER9A 1FP1D 1LI7A 3L8EA 4NFLA 4Z4CA 4M99A 4LVNA 1G5FA 1IYZA 1ENPA 1WMAA 1OFTA 2EW8A 3LF2A 4IVRA 4D9CA 2EKBA 3TG8A 2A3NA 4HMPA 2F17A 1JQKA 3SP1A 3UT0A 4DWOA 1YU6A 1CZRA 4YRGA 1N25A 3IHLA 3RJ5A 1X92A 5CVDA 5IPFA 4ABYA 1CC1S 2HREA 5F51A 2AS0A 1JG1A 2QQFA 1EZ4A 3KE9A 1C30B 1OFUA 3IHWA 2H0AA 2Z2IA 4WVLA 2NUAA 4RKFA 5JY1A 1BDBA 1NHWA 4UDYX 5EJ2A 4C7OA 4Q4DA 4DCPA 3PL5A 2WOOA 5CM9C 1APBA 3JSAA 1VPLA 3QJGA 1G41A 1U8TA 4N8SA 4QEZA 5BW5A 1SGWA 4M88A 4FQ8A 4KPFC 3V8EA 5CNMA 5BMVB 5LZ7A 4CQMB 2R11A 4E1VA 4YY3B 3ONNA 4YCAA 3BT7A 3C1OA 1AURA 5BRJA 5FBVB 3ZZ0A 2QGNA 5FCDA 2O3UA 1B1CA 2VOEA 2XW6A 3HCWA 1LSJA 5FYQA 3CG0A 4QO8A 1K1EA 2FPOA 5HF6A 1EGAA 1JN0A 1PFKA 1RQRA 2DFNA 3GVCA 4FOLA 3ENKA 1UDCA 4IV8A 4PZAA 5JSHA 3Q85A 2O20A 1XFAA 1M72A 3IH5A 4RVNA 3GA0A 1SELA 5CLHA 5E6SB 3GMSA 2Q1WA 2GPWA 3HV2A 5BQOA 3X43A 1U2GA 3KOWA 4AKSA 2BMJA 4JLWA 4HXYA 4D92A 2CJYA 1BMFD 2DPGA 2QBYB 3IDQA 5BVGA 4LQDA 4B3GA 1EP2B 4OX9Y 1YOVA 4XQ0A 2I66A 3IPCA 4EFLA 1EM6A 3DFUA 3FN4A 3VSDA 4UKDA 3N2NA 1PE0A 4FU0A 4PZCA 5ALPA 3IP1A 4FS8A 4JMLA 2C5AA 4XASA 2JIPA 3O75A 5K2MA 4IIXA 1YR1A 5BRAA 1UKAA 2UV8A 4FFSA 5IJXA 2AJ8A 5SY4A 4PLVA 4YCCA 1VHTA 4KREA 1CZLA 4L8LA 3RS9A 4DJ5X 4PTZA 1V4NA 3SXPA 5HZKA 2H1IA 4L27A 4D0LB 3UV3A 3MFYA 4MQ5A 2EX1A 3F3SA 4GMHA 4QDZA 5EMJA 5CA0A 4L7VA 3RIMA 3S55A 3I42A 2HQSA 3SF8A 4FN4A 4CLOA 5KMGB 4CEJB 8MHTA 2FHSA 5SYAA 3L1VA 1RJGA 3I6MA 2R5WA 1X7YB 1YMVA 1AY0A 3BX1A 1QCZA 2H2IA 1MVNA 4YASA 1QGAA 1QZXA 5KTSA 2ZQ5A 2WF9A 1VM6A 3I23A 3RU7A 4JXKA 4BJHB 1W8IA 3KBBA 4CM5A 2AN1A 2FI1A 1J06A 2GN4A 2QX7A 4CF4A 1JR2A 2H1RA 4V0ME 1I33A 2ON6A 3UUFA 4DAEA 2CMHA 1Q19A 4NBTA 2BELA 3TSCA 2PE5A 1GA1A 4EFNA 3FG9A 4LHEA 1Y7HA 4O1IA 1JMYA 4FZJA 4KMRA 4DLPA 3C85A 3VR4D 3CKKA 3O26A 4I6GA 4DPKA 2WW8A 4MI3A 1PUJA 2AFRA 3MD0A 2CXOA 4OREX 2A5FA 3RVPA 1QSGA 3E9YA 3TTXA 2P9QA 3LHIA 5IFKA 5GV8A 1MO4A 4ENQA 1T29A 1BDIA 3JQ6A 1BQEA 3KJZA 4XOUA 5DGCA 2O54A 1P7WA 4NFYA 3JR3A 3SNHA 1LK5A 2I55A 3M1YA 2ZSHA 4IKPA 3ZWYA 1G21B 5CVJA 3TL2A 2HHLA 2J6IA 2WZQA 3W8NA 1OA0A 4BB6A 3P5SA 2OC9A 4LF5B 1JFVA 2GAJA 5IAAA 1X15A 2A9JA 3DV0A 3URMA 4DW8A 3K70D 2MSWA 1L6RA 1RRVA 4FMCF 2XRYA 3QBVA 4G41A 4ICIA 5IWCA 3G1WA 5JALA 2PKQP 1H42A 4CKBB 2VQEB 1J49A 3AH8A 3LCJA 4HNQA 3WLPA 3SK0A 4EZIA 1F5NA 4U0KA 1A9XB 1ULUA 4YWHA 2PJUA 2QAGC 2GO7A 2OMKA 4E2FA 4NCKA 3Q7TA 3CC8A 3CVUA 2JIOA 3T52A 1E3IA 2JJ8A 3IUPA 3OAAA 1UOEA 1JEOA 2B92A 3LKBA 2NPFA 5KNDA 2HJWA 2QTNA 1XQYA 4IYRA 3A4NA 3K53A 5J47A 2OCLA 4GNKA 2NYAA 4BO7A 4MW5A 1KMHB 1N5LA 4Z0TA 1L5QA 5PNTA 5KNBH 4RULA 1N57A 3EVCA 2Q4TA 4FFLA 2QG6A 4M36A 4AJ9A 4C0AC 3T5PA 4FYMA 5G3ZA 2C61A 4DRZA 4DDKA 3D8HA 5U4QA 3CBGA 1ZH8A 1T8SA 3VU9B 4BX3A 2WRZA 4BFWA 1P4JA 3KSMA 5EN4A 4BNXA 4L16A 3RC7A 3Q6IA 4JEIA 4LXGA 2H1WA 2NO9A 4CR7A 3KQTA 5MFPA 3ET4A 1TJ4A 1W0KA 4Z4GA 2GPAA 4L8VA 3UJDA 1V43A 3HA7A 3K8OE 5JMWA 5M2QA 1X7ZB 1RI2A 3AXSA 4XJVA 3RYFB 4YJ3B 1AT1A 1D5WA 1ONPA 2BSXA 4RK1A 1B7GO 4DBLC 4XR9A 5BOSB 1ZWKA 2DJIA 1P9LA 1Y9EA 5BPHA 3AESA 1SXJA 1T1RA 2AH5A 3O1IC 4XWAA 1W8DA 2JLUA 2AQ8A 2AFHA 2CL6X 3SHVA 1VHLA 4GOMD 3I2YX 4GR4A 5M5BA 4BEVA 3ABOB 4R2KA 2YMLA 2NXWA 4AP9A 4E5DA 4EVIA 3RHZA 1GFSA 4MH0R 2X0DA 4UZFA 3OD5A 4IIGA 2OTCA 4EJ2A 1YFLA 2Y05A 4AS2A 4DCGA 4B3SB 4KXQA 2F9FA 2QIOA 4ZI5A 6LDHA 1ZN7A 4ND4A 3PC8C 5K0TA 1EFVB 1XEXA 1CZNA 2JHPA 4W9RA 1J2RA 1YFZA 1D4AA 2PRYA 1YL7A 3GJZA 4GSLA 2BP7A 5U9CA 2VHJA 1GVNB 3ZDEA 3Q2KA 4HF7A 3K05A 5DBOA 3IIIA 3WR5A 1Q7CA 4ML3A 4JAVC 3EZ7A 2QLLA 3MWEA 3PT9A 3V2GA 1TKCA 2PA0A 3LCCA 3A04A 4GL4A 5IXSA 1KVQA 2WU0A 3EAFA 4E3ZA 4F3TA 5JZSA 2H2AA 4GX2A 2RDMA 3VU1A 3R7AA 4PGFA 1TCBA 4YCSA 1V95A 1MGPA 5FOTA 4DXAA 2QJRA 2PYIA 1SBNE 3O8OB 1DRUA 2VH5R 3C3MA 2W6ZA 3EHDA 3NHFA 4NEGA 5AKGA 4FFPA 4P0TA 2J3JA 3QWIA 2W70A 3RUDA 3SSAA 4FB4A 1AKQA 1FYVA 4B3IA 1NTOA 1M54A 2VBGA 3TZ6A 3KQOA 4PFQA 2OORC 3K3PA 4RV5A 4MW6A 5LQRA 1V39A 3DEZA 4NULA 3W8FA 1H6AA 2VDKB 1VL6A 3L8FA 1Q92A 4E13A 4LE1A 1M67A 1UUFA 4JDPA 5AVRA 3ANYB 3G0DA 2MDTA 2Q5IA 1WPXA 2JNWA 4OXIA 3R0VA 1E3WA 1GG9A 3BE5A 4DHWA 2FTKE 3CNEA 5TGTA 2OA0A 3ZWBA 4L8WB 5HFNA 4YRMA 2JJ2D 4MVCA 1K3TA 3OU2A 4B48A 3AF2A 1BXRA 4KEAA 1P62B 3TBFA 4DV6B 2FPUA 3I53A 3IAS6 4FCWA 5CT5A 4DCOA 1KO7A 1UJMA 4ZI2A 5J2TF 1M5RA 1UL1X 2GK4A 4FOTA 4OHKA 3SMVA 1LX6A 3PNPA 4MRAA 3II6X 3SJUA 3ZU4A 3OZAA 3HVUA 3H13A 4MLZA 1M9NA 5A9TA 3PEEA 3S3TA 1JMKC 1HE8B 2DE0X 4GPEA 5E1DA 2XUQA 5GJVC 2AFIA 1LZKA 3T9FA 2WNHA 4P7JA 1SHJA 1ZVVA 3U4MA 4KXUA 3K09A 4GBED 1G3UA 2A88A 2X3FA 2ZUBA 2PT5A 1V5WA 3TQTA 3I32A 1VE5A 3WK5A 1GWNA 1KJ9A 3DMTC 3ED1A 2PZKA 3EY9A 1DUSA 4ZAXA 1QQ6A 4L50A 1E2JA 4ND1A 2ZWAA 1U2RA 2IPLA 3SYTA 3ZLTA 2QVGA 4YP6A 4RTMA 2IYYA 1OXSC 1WKBA 3ACDA 1KEPA 3THSA 1T43A 3QE3A 4DBVO 4LHZA 2I3ZA 5CRIA 3UQYS 1KI7A 2EWVA 4QLBA 1Y8QB 2JAHA 2LWIA 4X54A 5CR9A 4H1WA 3WLMA 1VKJA 4M9XA 4PXYA 2ZVJA 1V8PA 4F0JA 1ZDMA 4MR9A 1SUEA 3A4TA 1BZYA 4IHAA 4FDTA 3BIJA 2DUWA 3Q72A 2WF5A 2YV2A 1D8AA 4KNYA 2GWRA 3G17A 2NU9B 5JQGF 3ZCXA 2BZ0A 3STTA 1J8YF 5MN4A 3HUTA 2G63A 3TJMA 4OK6A 3S2FA 1QIJA 1XWIA 1FUYB 4OVKA 1U8FO 2CGEA 2CE7A 3H4IA 3PE3A 5EEGA 2FG6C 4E51A 3UMBA 1DLIA 5AKIA 4D9BA 2CSUA 4DCVA 4WZAA 3T41A 3O3CA 2PJZA 3WL3A 2EJTA 2WA2A 4L5YA 2ZBQA 4P33A 3RV4A 3V1NA 4WDRA 4IJUA 4MGKR 1I30A 4B8ZA 5GADl 4HPXB 4N7MA 3Q1KA 2XTJA 3JVEA 5FBRB 4UUBA 4CT0A 2WWXA 4GIBA 5B3JA 3M89A 2WNIA 3GJSA 4BP9A 3WRXA 3CX3A 3G0GA 2J7PA 3TEFA 2ZSJA 4HJXA 1SPBS 5EJIA 2EFJA 1KSHA 2JIZD 2H1FA 1QIDA 3ZY5A 3BB1A 2I87A 3DSRA 4EJSC 2WIFA 4UCQA 1U9ZA 3IEUA 3U0VA 1PBNA 3FSJX 4DN6A 1U8CB 2CFCA 2UVPA 4WESA 4I1RA 4M0FA 3FLAA 1SCQA 1GQFA 4LKOA 4ZRMA 5C31A 4LRWA 4DJAA 3CUEF 1H3FA 5L6LB 4FIZA 5BNFA 3MJSA 5HIIA 1CV2A 2BISA 3L9WA 1CUZA 4H2DA 4DJEC 1WABA 3NM5A 4Y9TA 4OMUA 3FWZA 1ZKDA 1KO1A 1X70A 4RMHA 5I48A 1RYMA 4Z99A 1XKQA 2A94A 2JVKA 2X58A 3N07A 4HS9A 4RJLA 4US2R 1FFBA 1OCEA 5FWXB 1F8UA 3PFIA 1QU3A 4S2UA 1DX9A 2JFZA 5GM1A 1NJSA 3R7NA 4LYGA 3UB3A 4C1BA 3ELUA 3RTCA 2ZUWA 4ZQEA 4Q21A 1LTKA 3AP3A 4HDNB 5JADA 4M49A 5TDHA 5AW0A 1JDTA 5DWDA 2Z1DA 2GARA 2YJ5A 3KG2A 3R5FA 2WTXA 3P2MA 3L5KA 3I3OA 4KU4A 4HMQA 5IJWA 3IIEA 3INYA 1XV5A 4GM0A 4NL4H 2W2KB 3A6HA 2LTAA 1E1QD 4DR1B 3ESRA 4FLFA 3WHKA 3JQFA 1U0RA 2OD9A 3IDSA 5CB8A 4P98A 3CX8A 3U09A 5EHXA 1OLSA 4FHFA 4JB0A 4PX2A 3TSWA 3ZHTA 4H27A 2W00A 3LPAA 3K6KA 4BL5A 1LKZA 2EG5A 3JZAA 1W5EA 3EEFA 4YJFA 5FUBA 4J75A 3P2KA 5HRUA 4G89A 3HLYA 4A6EA 1FVOA 2PTHA 2OMEA 3HCPA 2B8TA 1JR4A 2HK8A 5FPHA 4RQBA 3G2OA 2JFUA 1JEEA 1PJLA 2HJ9A 3ESBA 1XXLA 4EGJA 4HSEA 1YJQA 4HUQA 3WTCA 4B2IA 3RTEA 3H2IA 3QNMA 2C42A 3HYNA 3BGSA 2GOYA 3H3JA 3ZX4A 3GJ6A 3EVAA 1G8SA 1TA9A 1ULSA 1R50A 2IYWA 3AETB 3UYKA 2FVXA 3FMGA 5F5LA 2E4YA 2IHUA 2NQTA 3PIRA 2LIVA 1CE8A 1S6YA 5AVJA 5DM70 3VHLB 2C3UA 3T9DA 4QM6A 1TQ6A 5REQA 2HXSA 4PN3A 2ODNA 3I1IA 4RGQA 2Z58A 1N9GB 3OE5A 2WSLA 2X5KO 4D6PA 4NENA 5LIPA 3RAPR 3WY9A 5LQCA 4CXMA 4CQMD 5AOVA 3BPSA 3NYIA 2JGIA 3M7IA 1MHPA 2FEOA 1Y7PA 2PWYA 1XP8A 4ZYYA 3RBXA 3MLBA 5ALRA 1L7BA 3HB4X 3T5DA 1WA5A 2FFJA 5BSTA 2AD5A 4RSGA 1FDVA 4JMPA 4UCWA 5F12A 5LM3A 1PUIA 2HV9A 3B3GA 2JLSA 2G08A 1CVLA 2OSBA 2ZRIA 2IHBA 2V7PA 1THZA 3EAQA 4PWZA 4RK0A 4D42A 4YIKA 3DDWA 4DTIA 3QNUA 2XHEA 4LS3A 4Z1MA 2PLWA 5EE3A 4ALLA 2C98A 3VZDA 1AXRA 2FPGB 3HJUA 1J9ZA 3IJEB 1KP9A 3L7OA 5EERA 5I7OA 5AKJA 2CJFA 4F3RA 2DH5A 3MWFA 5JYBA 4F5WA 2ZTLA 1YS9A 2GYVA 3LLSA 4B3JA 1U8AA 1U6IA 4W8HA 3F6CA 4TKVA 5HIJA 4P7KA 1SC6A 9ABPA 4LCJA 3ROXA 1HURA 3A32A 4GEGA 2X9VA 3WLLA 2RHJA 1EBUA 4FDMA 3UY4A 3UN1A 4F8YA 2WYHA 2DUMA 3P0IA 4CF3A 5KC8A 2P2DA 1E3MA 5GIOE 2NU6B 1SB8A 4HCJA 4CT4B 3UMRA 3IPRA 3OP4A 4KN5A 5FUYA 3RC3A 6NULA 2AJDA 5KOHA 4UM8B 3KV1A 1O1YA 4EM6A 2QGFA 3EVTA 3O4JA 3RTAA 1VE9A 4JUCA 4ARAA 1M6VA 2YMPA 5P21A 4BQSA 4DILA 4YRIA 3WGIA 3THXA 1E2BA 5AW7A 2OGSA 4E7PA 1QFJA 4HGZA 3C3JA 1SEVA 1G20E 2OYCA 3TTTA 2NOAA 2YVUA 4FFOA 4DC0A 3U4QA 2IDJA 1YDHA 5C8YB 3V8QA 1LBIA 1I14A 3DBOB 3G0OA 5KDDA 1ZINA 2P69A 3B9BA 2Q6OA 2XNJA 4FFNA 4S1OA 3TLCA 2ILVA 3EARA 5JZVA 2IYZA 3DULA 1QONA 1E79D 4JHXA 2AX3A 3P0EA 4C2BA 3NONA 3PE6A 3GGJA 5TXGA 2MYTA 16PKA 3CMCO 4P4LA 4ER0A 1E59A 2DFVA 5HJ5A 4AN4A 2WKSA 1G9SA 5JC8A 1AXGA 1H2WA 1P61B 2OXCA 4JXZA 4OQEA 4YRDA 5TPWA 5FX2A 3KE8A 3JATA 1M6NA 2HH9A 1TIPA 1P19A 4B33A 3RS8A 3WMWA 3F8TA 2ZSIA 2PMEA 4M1TA 1Z0IA 1SKBA 2YW9A 1EFCA 2GAIA 2ZRJA 3PNBA 5EA2A 4H4CA 2Y1FA 1TT5B 1M5TA 3CRQA 3KO8A 1IWBB 2I62A 1V25A 1L4HA 3KZVA 4NPAA 1LBTA 3W1VA 4X62B 5KAPA 2C1ZA 1G5QA 3M5DA 2HU8A 4P83A 4DMFA 2DETA 3GAFA 2A2ZA 4CM6A 4L0QA 1BTOA 2C8KA 3WKAA 4B79A 4BP3A 5J3JA 2NSHA 2CN1A 1RLJA 3SZGA 2ACKA 1ZMRA 1FYFA 4LOAA 1W9MA 1RXEA 2FPKA 1NP3A 3RS7A 2R0QC 2IA5A 4HDRB 1YC2A 1II9A 3OBBA 3ZE6A 4DNQA 4W6QA 3TSZA 4LZZA 2KPOA 4YRSA 1IXZA 2I99A 2YV3A 3OFNA 1YE3A 4LXXA 5B53A 4LOJA 3EEQA 4GC9A 4BTVA 2FFQA 3CR8A 5GINE 4M4SA 1Q11A 1YH3A 1AO0A 3K9WA 4RCVA 5P8WA 1QHNA 2ONKA 1KH3A 3NU1A 1NF3A 3JWEA 3MS4A 1K5PA 5KIAA 1O77A 1ESNA 4YDSA 4YN3A 5JJLA 1B0ZA 1FX1A 3VH3A 4PFSA 1SVNA 1GUFA 1NXXA 3DTVA 2BCEA 1K92A 2H9AA 1Z6YA 3E18A 3PT5A 3ZCVA 1SHUX 5A4DA 1QAMA 4ZN6A 4LC1A 3IXQA 2ZJ6A 4GRIA 4WH0A 5FADA 4EATA 1NHGA 3L07A 1BWSA 1VBKA 1GARA 3FH0A 2QN7A 4CLHA 1QQAA 5ERYA 1BMDA 2UZIR 1U7PA 2WJHA 3DLCA 4TT8A 5ITWA 5J59A 3EIOA 1OUMA 3G6WA 3GLUA 1M8KA 1IDN1 2OBYA 2F8LA 3FTNA 4OXKA 4UREA 5FOSA 1KFBB 4ZAYA 5HCUA 2V3WA 3ZDZB 4A7PA 3PP8A 4LY9A 4V38A 1Q2XA 1DIAA 1BE6A 2BKLA 3CTPA 4N3NA 4A73A 3SXJA 1JE1A 1L8OA 1L8QA 2PLFA 2YFQA 4OQNA 2IZOA 5KHAA 2ZEJA 3BAFA 1BE0A 3LTEA 5DTEA 2RHWA 3IVRA 4QPPA 1VIDA 1MRZA 1RQXA 1E5VA 1IL0A 1F12A 1IOVA 3LYLA 3HCRA 4O2RA 2HBYA 4ZOAA 2KB0A 3KOMA 4HDSA 5HRAA 4DQLA 4JKYA 2GPNA 4P54A 4Q3CA 4OFWA 4N6NA 4BGUA 2ZT7A 1NLUA 2G1JA 2E5FA 4LJ8A 3LQKA 4OOEA 5FNVB 4DMRA 4IRMA 4RY9A 4UNRA 1FBNA 1JG7A 3AF6A 2C7BA 2VVTA 3OMXA 4XGQA 1FYEA 2PUAA 1D6JA 4RF5A 3SEZA 1XD2A 4U8GA 4NBSA 3GRKA 1T2VA 3N0RA 4CUKA 1USIA 3K8ZA 1DKOA 1S8AA 2Y77A 3NHZA 3PHGA 4G85A 4Q9JA 3U39A 2YWFA 3VDNB 3WLHA 4GPBA 2D1RA 2B0JA 3FNRA 4LG1A 2PFGA 2W9XA 4DV7B 1TUBA 2C94A 2E37A 2J0UB 3K16A 4I5IA 4X5OA 3VAAA 2DWUA 3BGVA 5DNVA 5EKSA 4RCZA 4DB4A 1T8YA 4WJZA 2IYEA 4C3UA 3C5WP 3IQFA 4DQXA 5HXAA 3T9BA 4KGZA 1PWYE 5FLYA 3DO6A 2QG9A 4J8PA 3P0FA 1Q12A 4S1VA 1OX5A 2CDRA 4A1FA 4DV3B 5TARA 4RHYA 2QMOA 5AJYA 2WU1A 4X1IA 3FPKA 4QSMA 4NMXB 2PWBA 4MV5A 4JJ4A 2ZJBA 4M9SA 5KTMA 1XI2A 1LTHR 3NTVA 3QKSA 4L51A 2BKAA 5CDFA 3RYHB 3WSVA 2HDOA 3PGJA 4YCBA 1NBOA 4G0QA 4E6PA 3ST7A 4H7KA 2AUNA 3CLUD 3QJYA 2FDRA 3UCFA 3F7MA 2XUZA 5JZ9A 3K6SB 1CRPA 1W0JA 1SA0A 2BFEB 2QRGA 2R2AA 3KKQA 2CK3A 1DFHA 3LLVA 2XB2A 3OPYI 4W99A 2LZ0A 3S4YA 1GCAA 1IU9A 4OQMA 2FWPA 4RA9B 1HZJA 4B6JA 8OHMA 4KAAA 4PFKA 4REOA 2E4WA 5D6OA 1T5BA 3INTA 4B35A 2W6IA 1G64A 1DC8A 1V1JA 3TTSA 1CF9A 1A2OA 2VPQA 3AHGA 1FEZA 3L01A 1EB9A 4HVCA 4FIDA 3WISA 2DU8A 1I10A 3DOOA 5LP6A 2JCGA 3I92A 4JYBA 5IZCA 1GTVA 2F55A 4N3BA 1OIWA 2Z3WA 4PIVA 3KKNA 4MQMA 2KHZA 3W0LB 3UAWA 2UU9B 2TMGA 4BO8A 1K7XB 2HWXA 2LCQA 4J7XA 4YO7A 3WYBA 3A27A 2C2XA 1EINA 3VDMA 4B4DA 1YQ9A 4KFSA 2Y0BA 2FMHA 2QZZA 1LPMA 2ADOA 2BHRA 2W98A 2PZGA 4TKUB 4BVFA 3X1JA 2JG3A 1K9VF 4QXMA 4XB2A 3G02A 3M33A 4KXNA 4KBYA 3CM0A 3WGZA 4AULA 4LZOA 3TTWA 3MC1A 2YZGA 2WWRA 1MDBA 1XZCA 3LI2A 3O9VA 4EG7A 3B7GA 3LT4A 3OEHD 3IE2A 4IDHA 4EEKA 2P6MA 1E8DA 1QF7A 3WHLA 2LR0A 2FWBA 3AO0B 3E2IA 3KB1A 1V3TA 4KHPB 1YE5A 3D31A 4BVJA 1MB9A 3CR3C 1O94A 1MFPA 3AW8A 3BWVA 4NK4A 4QAQA 4E2XA 4K9SA 1WP9A 1F0KA 1K89A 4FHCA 4YP9A 1RKVA 2OFWA 1V9LA 1W73A 2EF1A 2QN8A 3EDRA 1AKNA 2QN6A 4TN1A 2BN4A 2XAUA 3D3JA 2XMPA 5DNUA 4J49A 5F5XA 2QRZA 3ETCA 1ZISA 3GLGB 5IVPA 3PFWO 1KAMA 3PD7A 1SURA 1K7FB 1GAWA 4YJ3F 2HLDA 2PD3A 4MVJI 4TT3D 1DUVG 4UMFA 3AHDA 4C7BA 3UJ9A 3L4JA 1R15A 1DQNA 2I7VA 3KJEA 3N7TA 4D4GA 3K70C 5K2OA 3ICVA 2OZEA 4DM7A 1H8HD 2MSNA 4TYNA 1EHIA 2H3HA 4L9RA 4NTZA 5B1YA 2E4UA 5B4TA 5IYZB 1Y1LA 1N0IA 1USGA 2C8VA 2R00C 3R7LA 1H5UA 3F46A 4WCFB 4TQGA 2WF6A 4W5HA 4QE3A 3KTAA 4E21A 3L7DA 1CSEE 5DN9A 3GFBA 3LRPA 4R9NA 4EB3A 3K2EA 4X92A 3LWNA 1AQJA 2R60A 2V6BA 3S2EA 2BEWA 1ZESA 1QB7A 4LYDA 2EERA 2PDAA 1GGHA 2J3DA 1T6ZA 1V9SA 3AYXB 4TWJA 2O2ZA 2QDXA 2ZATA 3DT6A 3AU9A 3HYLA 3AIOA 3NXSA 1Y8CA 2F1HA 5BPFA 1SVOA 2RI6A 4M3NA 3GDHA 2OHFA 1XLWA 3HSSA 2G9RA 4PBTA 5FLKA 3FWYA 5IBRA 1ZIPA 4RORA 3QU2A 3L0IB 3PHCA 5GOZA 4KYTA 1L1FA 1GZHB 1QV7A 3UXHA 4PAQA 3PXUA 4BMOB 1L9XA 3WGHA 1OZHA 1V9CA 4KXYA 5IC5A 5TQ0A 2IYAA 4D74A 3CRZA 2G82A 5LWQA 4MVJM 3UBMA 1CW2B 3IB6A 1LPBB 1C1XB 2QRPA 3CWCA 3QMVA 4P3OA 4RENA 4W82A 5EQFA 2ABWA 1FXWF 1KA9H 2XNDD 2WJIA 3FUUA 1AHHA 3OU7A 4QA9A 4Q4AA 4Y6LA 2G1PA 4N54A 4OYLA 1ZR2A 4YBRA 2PLNA 3DLAA 3EXG2 1BCRA 2NO5A 3G79A 4LDAA 4M0CA 4RHFA 4AZ0A 1V6SA 2GNAA 4EK9A 5AM3A 4HNVA 2PNFA 3I01M 3ZPXA 2ZUDA 1NXSA 3F5QA 3HEBA 1DIBA 3B6ZA 4KPUA 4N40A 3RKRA 4ARBA 4C20A 2VAMA 5LYJB 4FOPA 2H06A 1BJKA 5F3RA 1GTMA 3KPWA 5CFZA 4WV3A 4JOCA 1Q14A 1YOBA 2EU8A 2O7SA 2CL0X 2OOSA 3EZNA 3H7IA 3PDHA 4QRHA 4Q9LA 3BYZA 5E38A 4Z6KA 3PA6A 1A4XA 2KWIA 1VHWA 1ZD2P 2G5TA 1ZR4A 1U2DA 4G1VA 1BA2A 4PZ0A 1UBLS 5JCJD 3WYFA 2IV3A 2BDUA 4UBNA 1PBTA 1KYWA 3QV1A 2ERXA 5L3SA 3NGXA 1VJRA 4LVOA 2DFLA 1A8PA 2F3UA 4FXOA 3UWDA 3ZCPA 3IDAA 5TEVA 4GFDA 2RCYA 2RK3A 4NU6A 4CMCA 4O0MA 3DWFA 3GARA 4WUTA 4YTEA 5AYVA 1LBQA 5A9SA 1VRWA 1Z88A 3WIBA 4KITB 2CFRA 3IUNA 1EVQA 4RKYA 4G8CA 2MMGA 3MJRA 1USVA 1BGWA 1G6KA 3ANSA 1GGNA 2H65A 2H9IA 3BCUA 3M9WA 5CHYA 3EZ9A 3JWPA 1X1TA 4X94A 1BFUA 2DQSA 4GWKA 2VDVE 3HKEB 4LVCA 3UW3A 1I0IA 2PXHA 2OEPA 2EFCB 4I4LA 3WHPA 4A0GA 5KVSA 2N1BA 4BO0A 1DKQA 3A2KA 2BGUA 1UEIA 4OQPA 3K20A 2ODQA 3RYIA 1M73E 2DKFA 2YJ4A 2ZVDA 4FLEA 4YP7A 5EWMB 1VIYA 4GMGA 5LBIA 5TQVA 2WZDA 4XQCA 5JARA 2Z3VA 3B48A 3G9XA 4N8EA 3G13A 5L3ZA 3ZK8A 4A92A 4I0WB 1Y1SA 3HKDB 3E35A 3BWDD 2DX7A 4OLJA 4UQOA 3D2BA 1DAHA 1U7DA 2Z2ZA 3HCOA 2H5IA 4QG7A 4NCAA 5H0IA 2GXQA 2ZYTX 3QX7A 4N5HX 4OHVA 1LCIA 2JFWA 2ZRAA 4O4IB 3I9NA 5F78A 1MF7A 3ACCA 4RVUA 1NC1A 2B3DA 2ATXA 4HN4B 3MNFA 5B6IA 2JLCA 3GCDA 4LK3A 1DEHA 5DLQC 2Q5QA 1LI4A 3L04A 1R6TA 4LPSA 1MENA 1BMFA 4MUMA 5D5HA 4UTPA 1MP0A 3EVDA 4YYZA 4FYYA 1QP0A 2P1DA 2W2NA 1W25A 4IEIA 3AVQA 4F6RA 1VI5A 4EDFA 1AF4A 1Q1NA 5FTJA 2IHNA 1WDKA 4DUPA 3UO8B 1HH4A 2QYOA 1PGNA 1UC9A 4HSGA 1PU2A 4TWBA 1SBQA 4AT1A 2WSSD 4AQ7A 2GO1A 1Q91A 2OGTA 2WC1A 2NV2B 4CFYA 1YJXA 4Z49A 2IS6A 2ZBEA 3QFFA 2QSYA 2HJGA 4TRMA 2XJ9A 4I99A 4P4GA 4Q9NA 2FRDC 3HC7A 5JSFA 4IQ8A 1PLJA 3COWA 3I05A 3WLJA 3Q8LA 3RWOA 2P9ZA 3BZUA 2CXQA 3GEDA 2R48A 4GLLA 2QMEA 2VRCD 3QKIA 1QORA 1PWXA 2FUG1 4JVMA 4PR3A 4EB6B 1FDOA 1GL6A 4KQWA 2E0IA 3BTUA 5CVCA 3RYCB 3FPJA 4L22A 3I30X 3K72B 4XWKA 1NY5A 4D6XA 4G23A 1FW6A 3GAMA 5DYYA 3GZNA 1JJVA 5ITZB 1P2BA 1QR6A 1QQBA 3OHMA 4X85A 1H2ZA 1F2UB 4FKMA 1Q2UA 5B1HA 4ZREA 3DWGA 1PN3A 4PLFA 1U7OA 1XHFA 3NHWA 1GG5A 4H7IA 2VDRB 4FFVA 1RZVA 1NMXA 3ZWQA 3G5MA 4OFXA 4KO1S 2J9FB 2HU5A 1AS3A 2JVIA 3OKFA 3PCRB 2HY7A 3AXTA 4HB4A 4I9UA 5JRDS 3VR4A 4AY4A 5D87A 2XGJA 1YFKA 4G5RA 5ALXA 2VDLB 1IJEA 3CKMA 3OM0A 4R5MA 2GJAA 1G3MA 3N5CA 3UWKA 5IVDA 3A1DA 3OKPA 5TQ2A 5KTRA 1OBFO 5AVSA 5JAOA 3R7FA 3A10A 4ZZ0A 3L6CA 1Z35A 2FHPA 4AY5A 2YJ6A 3IUEA 3SLGA 5ARBA 3ZWPA 5JH7F 1BC5A 1WRBA 2W6CX 4NABA 3PL1A 4QOIA 4R8LA 2FJ0A 2PKYX 1L7VC 2Q2NA 5ILGA 5CITA 2UVQA 4MQUA 3NMUF 2VYND 1BNCA 3B38A 5BNIA 3UJBA 2R8YA 4AN0A 3N3BC 2V0GA 3ROMA 1G19A 1VLVA 1L5OA 2B3TA 2IL1A 4HFRA 1FFCA 3DM9B 3E22B 3EC7A 3LD9A 4ER3A 2I54A 3LVFO 4ZEMA 2LXNA 3WGMA 4OHMA 2IYXA 3NEPX 5FL7D 1E5QA 4BNTA 1IBRA 1UXJA 3PHLA 1KEWA 2BZ1A 4XB6B 1FS5A 1CNFA 2CVZA 2PWPA 2VP2A 4Y30A 4EHFA 4ERNA 5I9NA 1PSDA 2Z9BA 2FW8A 1ZD3A 3WGTA 5LZ2A 4YIHA 3Q10A 4K6CA 1G98A 3LP6A 4ARSA 2PRJA 2GI4A 1M34B 4BXOA 3IC5A 2G8LA 1HFEL 1ZUWA 3O2QB 4GBMA 2X8WA 5AM0A 5F1PA 2DFTA 1UCFA 2YXPX 4GWGA 2NT3A 1N3LA 2DUJA 4MWOA 3W6UA 4PO3X 2JA1A 2V74B 4UU0A 3D4PA 1BWQA 1RNLA 2DHEA 2HA7A 1E5XA 1P6XA 2NO7A 3CIFA 2X5XA 3H42B 5D86A 1PNRA 4GKAA 4XZ3A 2Q0QA 3LNTA 3RU9A 2V03A 2VDWB 1OZFA 1LI5A 4BKQA 5H8WA 1FK8A 2VBFA 3AF0A 1RQLA 2VHXA 1V8DA 3AEQA 4BUZA 5C2JB 2FP4A 2NYRA 3B9RA 2GPSA 3KWFA 3VBEA 2R8BA 3PD1A 3GLIA 4TPKA 5TVKA 3ND7A 3UK2A 2CYBA 2GJKA 1U81A 4ZJZA 1IUNA 2VHVA 1B8NA 2FK8A 2I6QA 2WYVA 1LPSA 3BTOA 3E9EA 2VJNA 3HN7A 3PNKA 4KO3S 2IV2X 4QM7A 1G66A 1FF9A 4EW1A 1OIVA 4IIHA 1MV8A 4A8JA 2D5BA 4PNHA 3VKHA 4GL2A 4IIJB 3VKUA 4DCNA 4LGYA 3QE9Y 2QZ9A 5C8YF 1KIMA 5MGNA 2G04A 2I22A 3K5HA 1AQLA 2XSZD 1ZCAA 4KODA 1KSGA 4KK3A 4R01A 3V2HA 3WYDA 2GEDA 5K8JB 4ABTA 4HPWA 3GELA 3OY7A 1CQZA 1JZSA 3E03A 1WMDA 1R0XA 3B2NA 1NNUA 4K3VA 3MWGA 4KE8A 3I6QA 4EX7A 1O4WA 3O94A 4ZQCB 2CUNA 3CKLA 1RAGA 3C43A 1R6DA 4MV9A 5GPBA 4WN9B 3L02A 3IQHX 4R68A 3NKFA 1VP3A 3EDMA 3WGNA 4MUAA 1VZ2A 1Z25A 2XT0A 3KQSA 2XE7A 4NV3A 5FTNA 2VK1A 5JIBA 3KUCA 3VPFA 5CFPA 1OZ0A 2FZLA 5D84A 3DEIA 3PEYA 1R10A 2OV3A 3NHMA 4RD4A 3T1OA 1LLFA 1R9MA 1XP5A 2DQYA 3O8QB 3PGVA 4R71A 1L5YA 1RPZA 1MLDA 1JTVA 4FYKA 1THGA 2NTNA 2BKXA 4AZ3B 1DRKA 4EGSA 1LNZA 2JIQA 2NZXA 4J3FA 2GF0A 4PRYA 3WYGA 5EKTA 4NXNB 4D99A 4GXRA 3VVLA 1MJ5A 1NBIA 1OTHA 2PXCA 3ASUA 3T4PA 1KNQA 2BIFA 3JAKB 4L0MA 4XYEA 1JG2A 2JJ1D 4BX0A 5HTOA 4PNEA 1C2TA 1Y34E 2Y92A 4RL4A 4RZ2A 1SZPA 1NN5A 3DC2A 2GQ0A 4OJKA 4AM8A 4CI9A 5CYOA 1SKUA 1USKA 3WLEA 2YN2A 3WLAA 1IM2A 4O8ZA 3D64A 2HT6A 2W11A 4II7A 4B7CA 4WFIA 1MJFA 5FFNA 4DV1B 2V5AA 3F1LA 2EJWA 3P26A 1LEHA 1Z34A 4TMTA 4HLCA 5G1PA 2OZKA 4MYTA 1U7ZA 1YS2X 1SBYA 2ZBVA 3AT1A 4LHXA 3GJYA 2AX4A 4NZNA 3OCUA 1SEPA 3QFRA 4F5EA 5JVDA 2PKQO 1KJZA 3DW1X 3X2SA 5ALNA 3MJVA 3FGOA 1XRMA 1JSCA 1EFKA 3WGOA 1N3BA 4M98A 4NFHA 4X44A 2GHTA 3L8HA 1X1AA 2IS4A 5EHZA 4MTLA 4DG5A 1AKEA 1PGPA 4KVAA 3D1JA 4IH4A 1VE7A 2E4VA 3BJRA 3IBSA 2OZPA 3L1IA 5JO0A 1GPLA 2W8BB 2OWEA 2P35A 4YAWA 3RUFA 1E1CA 5C4GB 4M1YA 2BUBA 5L3VA 1NJ5A 1LA2A 1QH9A 1R4AA 1LSSA 2G3YA 2QT1A 3FMPB 5AXBA 2EZ4A 3ZQ4A 2YDXA 1ZHOA 2KS6A 4DLUA 3T5CA 4XQGA 5FTMA 2HLHA 5HCIA 4Q9IA 1GN8A 1THMA 2JIDA 4AJLA 3RJTA 5J4KA 5LQAA 1GAJA 1OTYA 1RM4A 3MILA 1G2IA 4WGFA 4UTRA 3DBLB 2MSCB 5H4HA 2B9EA 2J30A 2QXUA 3MSXA 1US8B 5DGXA 1A5ZA 4BB9A 4QBHA 3WOHA 3J81A 4U7DA 5GGXA 4A6DA 3DL2A 1Q0RA 1QQ7A 2Y71A 4X3PA 3NT2A 4ZCMA 5HQ3A 3LXUX 4RZSA 2HXGA 1ZOIA 5DRYA 2NM0A 2PO7A 3K1AB 1RC0A 2OPBA 2DY0A 2QX6A 1W4CA 4J91A 4XM0A 5FNVF 1LNQA 2FWJA 1Y8ZA 1R74A 4IM7A 3VX4A 2X23A 3NR2A 2VDQB 3NYQA 3K2BA 4K6KA 5BN3B 5JI3E 5DISB 3I1YA 1PS8A 5C7IO 3DZ8A 2B5WA 4KO2S 1NQVA 1W4ZA 4LYJA 1TJ5A 4WAUA 2HHJA 1S4MA 2JHCA 3JQAB 3PTZA 4TL9A 4JJZA 4ZAWA 5FI5A 3TX6A 3VNAA 3ZY3A 1DV1A 3CY6A 4D9EA 2QPTA 3WMRA 5FO1A 2B7CA 2JIZA 3INGA 4H6XA 1KOFA 1ORVA 3DMTA 4ERXA 4NE7A 3FFBA 4ZVMA 3ZDXB 3D7NA 1OX6A 3P20A 3SY8A 1J33A 3PCXA 1UPXA 2BFCA 3ZWAA 2ZETA 2YH2A 6REQB 1Y5IA 3CNBA 5CT4A 5JBNA 1A88A 3DAHA 1UFRA 2QU8A 2OZLA 4D8YA 1N8KA 3AERA 5FAKA 1JP7A 4PZUA 5ALSA 4ALNA 4PPQA 3QM1A 2QVYX 2J87A 4LBZA 4N0PA 3ZY4A 4HWRA 1RTTA 1U9CA 5JXIA 3PUXA 5CB0A 2JEZA 4EW3A 5HG0A 5A4JA 2ATVA 3GLFA 4AX8A 5L3RA 1IBCA 2W2OA 3GMTA 3GNLA 3IQIX 3IJPA 3IULA 4M9UA 2XMRA 4UE3S 2IX3A 3W9YA 1SRQA 4MGYR 1HYHA 4RO0A 5EJEA 5HF5A 3I5YA 1ZL2A 2OESA 3M4ZA 5ARCA 1NMEA 4IGEA 4HAUA 1U1CA 3G2PA 3V80A 2BTOA 5KI6A 3CEHA 4JSTA 1S01A 1TMOA 2G4VA 3JAWB 1E7YA 5DWVA 5FHRA 4MPDA 1E9RA 1XK7A 4YAOA 1KKUA 1XTQA 4F8JA 4K8OA 4E30A 2XR1A 3EUWA 3AKDA 2H2FA 2BMWA 4UE6A 1Z0FA 4QXQA 3A7EA 4J2TA 2JW5A 3IUSA 4WL0A 2GVNA 4QGGA 3WJAA 5CPFA 2PGIA 3BRSA 3AVVA 2V65A 3O1JC 3BERA 5AI9A 1GQYA 2O8FB 3DE6X 4GPAA 4UEWA 3FM9A 1E1QA 2H1CA 1NIPA 1SOMA 2B9VA 5FR1A 3O90A 5B7QA 1Z3IX 3R24A 3WLNA 2IH4A 1N0UA 3GN1A 2FW6A 4HGYA 2OENG 4EJSA 1Q57A 1WUYA 4C4TA 4Z9AA 2V4MA 4LAFA 2AQKA 4X95A 2YN4A 4UNSA 4YRTA 1J2EA 1MVLA 3HKCB 5FI0B 3VO9A 3K31A 2OPHA 3UMSA 2UAGA 3MTGA 3O3MB 2AI3A 4CM3A 4E11A 5H59A 1XCBA 3JW8A 4RV9A 2H07A 5BW4A 4RIHA 2HRCA 2QLBA 3JASA 2QLFA 4BP1A 4CBVA 4A0QA 4L74A 5CFLA 3DTYA 5DMHA 1G6HA 2B8WA 3WRYC 4E88A 1DRJA 2RH4A 3SZ3A 5EFOA 5L7YA 2QAIA 2XWSA 3SX4A 2VJLA 4D9MA 9LDTA 3BSSA 4MPRA 4LMBA 5JNTA 1QWSA 2YVKA 5AVZA 3T94A 2PIDA 1U7UA 4KQFA 4QGHA 4O5OA 4ZV9A 1KK2A 2QUZA 2YUTA 1WPQA 2J3IA 4XDGA 1J2JA 1WY5A 2AHOA 2Q0XA 2YJZA 4JJEA 4LHSA 1VYHA 1I9CA 4JWKA 1HZZC 2J33A 4LWPA 2F6RA 4J7CA 4NECA 1WSBA 4CQMA 3GP5A 2BFNA 3JARB 4RFVA 2XUPA 3L7CA 2Q5EA 4JBGA 5A62A 5G40A 4MJXA 4OXYA 3U6BA 4NCIA 2G7ZA 4ZV7A 3H2YA 2WDPA 5DCWA 4G0VA 1VL1A 2X4DA 1A7KA 4BN4A 4KIWA 1R5JA 5E6SA 1GZ7A 1O96B 3AIIA 3JD1A 4Q48A 5JXJA 2Y67A 1PG5A 3JQ8B 4KDFA 4UUQA 3D5TA 4J1TC 1DQSA 3KHUA 4H3SA 4ZOLB 1EXNA 2QBYA 3M3HA 4MWSA 2H7YA 1ES9A 3A05A 3QGMA 3ZWNA 4EG6A 1H2BA 3U1TA 2HPZA 2IPAB 4LHVA 3W5AA 2FUNB 1F14A 2PZJA 4AD8A 4X3CA 3FTQA 2FWMX 3H2SA 3PFNA 3QW4B 1G1AA 1ZAKA 3EOAI 1ESEA 1EFTA 3Q9LA 4JU8A 4ASUD 2GFQA 1G8FA 1CEXA 1BKDR 4B5LA 5HJEA 2CMDA 2PBZA 1WQ3A 1J5EB 3Q0TA 1JHMA 2CLIB 4GUAA 1HDGO 1TLLA 3IHTA 1HFJA 1ATIA 2H4YA 3HSYA 4DMHA 3RIXA 2YZ2A 3MM4A 4YLEA 5JCXA 3SQNA 4TTVA 4EKNB 2YHAA 9MHTA 3PGXA 1OI3A 3ICPA 1DAIA 4MEBA 2PS0A 2V59A 4MCHA 4DLZA 2AG0A 3QX9A 1BE8A 5E4JA 3WNVA 4CEJA 4RVDA 3UJ8A 5KMGA 3C8HA 3GZTB 3T7AA 1PV4A 3LUPA 1SVUA 2GMWA 3H1BA 4M6WB 4CMBA 5J4HA 1I4TD 3D59A 1ODJA 4BO4A 5C5IA 4LF6B 3FNBA 5LYJF 4DWWA 4KL8S 1E79A 1WVMA 1X7YA 1YGYA 5AVTA 1S9DA 5SY9A 3N9IA 4PRKA 1EA7A 2B99A 4OI1A 3ZHCA 1GR1A 2CUZA 3CCFA 1PD1A 3FDIA 1PG0A 4TXMA 5KCMA 5AW4A 2WE8A 5JUWA 2ZI5A 2HDNB 3L9XA 3T5TA 1MOPA 3AUUA 5IJAA 5KNBD 1Z4QA 1P18A 1X1CA 3W5VA 1Y4UA 4FS3A 1SUCA 4A23A 3OA0A 4D96A 4P3KA 2HWUA 3QUBA 4DTCA 2FUCA 1UJCA 2A35A 3EZFA 3ILHA 2FE1A 3GHYA 4I50B 2IPXA 4KVGA 3ZHUA 3AF5A 4MARA 3V1TC 2Z9CA 3TW6A 2X0NA 2PMDA 3L8MA 4RH1A 1B0PA 3ZBQA 1QNLA 5AW6A 3M9LA 1B8PA 4TL7A 1JT9A 4WECA 2X3YA 1N7JA 2GAFA 3C5HA 1N2IA 1VCNA 1NURA 3CRW1 1G21A 4FFMA 4LY6A 4PSKA 4RLSA 3T7DA 1PL7A 5GQSA 2DXIA 1NMZA 1N1MA 1WP4A 3ONDA 5EZ6B 1UINA 3M49A 2A9QA 2MCFA 3W1EA 1RRMA 1WQ1R 2PYDA 4XPIB 4TTTS 1UKZA 2AFHE 3DL7A 4N0QA 2GA9A 1QUFA 2YOGA 1V6CA 3GLHE 3PEFA 1MJGM 2X13A 2XCLA 4O33A 4ZU3A 4RY0A 1PZFA 4CT5A 2CNOA 5K0BA 3DV9A 2X5JO 3UEOA 1O95D 2IW1A 3F6BX 1Q22A 4UBLA 3FCXA 2HIGA 4KXFB 1NVVQ 1BVRA 5DSXA 3SQMA 3ZCTA 4PYRA 4LSMA 5IG2A 2B4QA 4I9HA 2IYTA 3QPWA 4O4IF 4B74A 4QOGA 1KMHA 5F5NA 2G72A 2PV0A 2C9CA 3TZCA 4DWJA 1AVTA 1XJCA 3KK0A 1E4YA 5GM2A 4LBYA 2OXRA 3Q0EA 2OKCA 4BC0A 2R1ZA 3AVOA 3FHOA 3R41A 3VU9A 1BG6A 1KXZA 4MINA 1VL2A 1SBTA 3TPFA 1FP2A 2C0CA 3WQHA 2IXEA 4KQHA 1YR3A 3AZPA 1WEKA 1Y5NA 2NZVG 3OMWA 3RIGA 4PG6A 2JPDA 5TMEA 3U4DA 3TQIA 4K7JA 2HBRA 1C7FA 5F33A 3UHOA 1RE1A 3N2IA 3ZY6A 2PUEA 1X7ZA 1Y1QA 3D6MA 3OCXA 3ZEAA 4P0PB 4YJ3A 3TUZC 1N6KA 3IP6A 2TMDA 3GT7A 4FGWA 3TRFA 5BOSA 1JAYA 1T1EA 3ZHOA 1DFIA 5K8TA 5FPSA 5ALZA 3AUKA 5ALKA 1U0FA 3SFTA 2H2HA 1DS6A 2KLBA 1G55A 1QRSA 2CFOA 5JWHA 3CEAA 3HK2A 2JZNA 1CEQA 3CUYA 3EXHB 3FMOB 3RJZA 4F4JA 1V1RA 3TLYA 2OB1A 3I73A 5DM2A 3CWQA 2EOAA 4BC1A 2XCTB 1NAIA 2P77A 4QUBA 1IMOA 4QASA 2ZS8A 1EFVA 2IRWA 2O6LA 1VKNA 4NH4A 3VKFA 1XK6A 5LDHA 1MXHA 1GXSB 1FFXB 2RAFA 4H7PA 4O6VA 1XDDA 3REGA 1UDWA 3G0BA 3RQSA 2F1IA 4QUHA 3IXMA 2QW1A 4N5NA 3IQDB 1QB8A 4IOJA 3IEIA 1FZQA 4PQEA 3WK7A 4CE6A 4YMLA 2HSWA 4G8DA 3T99A 3MGKA 5I7RA 1MX3A 3KQHA 1CY2A 1TAGA 2FG7C 2YFYA 3EG5A 4XX0A 3OPMA 4WNIA 5ICFA 1BDHA 4EFDA 3Q3VA 3T12A 3P9IA 3ZXUB 4G63A 4HDAA 1DO0A 4NBVA 3RAGA 4OU5A 3VH2A 2HNAA 2V7BA 2DULA 4KG7A 3JQRA 2H5JA 5D2CA 1MU0A 4XGRA 1PYDA 5GJBA 3BK1A 1T91A 1GU1A 1QG0A 4HTFB 4MO2A 2X1MA 4IBOA 4Q12A 1YDEA 2PGDA 2ZB4A 3GDOA 3HXMA 4YP0A 3BM5A 3WO1A 3EGIA 2P2ZA 3P9SA 1P1CA 4O3MA 1J0AA 1FXWA 1W9HA 3RVMA 4G6ZA 1WPRA 5CFQA 3EUFA 2O3RA 2XA1A 3E0XA 4RDIA 4AJKA 5PGMA 1E7MA 2AQHA 4DR6B 4MOWA 2PGNA 3MJ4A 2Q5CA 3FUVA 4DL9A 5HTKA 5BURA 3SQXA 2ZYHA 5B2ZA 3E9NA 3W5IA 3AOEC 1KRXA 3HDTA 2D5IA 3EUAA 2EP7A 2RH5A 3FVVA 4QEKA 5EE5B 3AQ4A 1CUEA 3A1SA 1BCSA 3DJYA 4GT1A 3F6PA 4NS1A 3VDRA 1QHFA 5HFAA 4KXWA 3GF4A 7ABPA 1W47A 1H1TA 5LB2A 3W7BA 5IAGA 1JAZA 4TZKA 2GESA 1UMDB 4P1ZA 2ODAA 1IIBA 2GKGA 3LQYA 3PQFA 3BOSA 4JOSA 4JBNA 4OYYA 3T6KA 2YV1A 2WUWE 4YAKA 4K9NA 1JIJA 2J3LA 4JQZA 4KUHA 3TJRA 5KYNA 2OBXA 3ZHVA 3QK7A 2AZMA 5KINB 3FWPA 1VL5A 1W4LA 2OKGA 2WM9B 3HYSA 4P5EA 5LP1A 3VMMA 3OEHA 1WXWA 3CXUA 1L4LA 3D3EA 2J5XA 3QHAA 1P3DA 3IVAA 1D9ZA 1FMLA 2GR9A 3W9UA 1TTQB 1WETA 1OHHD 1HLPA 4NP6A 2Y66A 5AKZA 3A25A 3CF2A 3PR3A 3NIBA 3AJDA 3C7CB 2R6JA 3FMIA 3PJDA 3R6WA 1DCFA 1QXSA 3ANMA 1WZEA 3CS3A 4UUPA 1RD4A 3AEUB 3GZ4A 4LRUA 1UQRA 2CY0A 4LGCA 3BMOB 4A16A 4CM4B 4MWCA 2NU9A 2BGLA 1UT5A 4UDNA 1HT1E 3LX4A 3ZKWB 3E5RA 4TT3A 1WCWA 5DTMA 3ROGA 1SU8A 2ZSFA 3A6LA 3MB8A 1PK7A 3OLYA 1YMUA 2A7QA 2Q5LA 4RK5A 5HFJA 4BMVA 5BUSA 4JDUA 1H8HA 2J08A 4NKRA 4YAGA 5C1OA 3UMYA 2G70A 3VZRA 4L4ZA 5EXXA 1XQVA 2RONA 4IIJF 5JAZA 3RAEC 4ENRA 1K5HA 3SXUA 3QIAA 4XPZA 2Z2XA 2P2SA 3OZIA 5T3YA 2WHPB 1FP6A 1H93A 4CQJA 2Y0CA 3IUMA 4C03A 1FSFA 3JQAD 1HFKA 4BNVA 1G2PA 1DHTA 2ZS9A 4B3XA 4C78A 1W34A 5IJ0B 4QBTA 5LA6A 2COUA 5KO2A 3TB4A 1M0SA 1RXUA 4JFAA 4L78A 4C3VA 1UJ6A 1PWHA 4PO1A 1LSOA 2ONYA 2WIKA 3TQSA 3AG5A 4JFRA 4LDRA 4LQLA 3B51X 1EH5A 2I1VB 4G9BA 3TQRA 2PX5A 2B20A 3FFAA 1X19A 1RVV1 2ZIXB 2PPLA 3JQBA 2XLBA 2AB0A 4QNNA 3ZW8A 1FFWA 5DCLA 3MQ2A 4UD2A 3LLMA 3SPXA 5L4NA 4GR9A 3GUUA 2C5LA 5CFNA 5LXTB 4ARZB 1PQPA 3F96A 2HUNA 2XODA 3IR5A 4ND6A 4V02A 5DF1A 2Y27A 2QQEA 3WL7A 4F56A 1RPNA 4CRWB 4EUKA 3HR4A 5HQTA 4H17A 1VIMA 2Z1NA 3PNLA 2VIIA 1KTIA 3MN1A 4TZ0A 3FKQA 5K6AA 1XMVA 3PGA1 2XNDA 3HZHA 4HEJA 4RZ3A 5GONA 3KEGA 3NTRA 3U0BA 5IBPA 4WZZA 2WJZB 5FWXA 4ZGBA 4FYXA 2JFNA 3EIUA 4ZVSA 3C6YA 1NJFA 2DCMA 4KNWA 2R00A 2XCRB 1EB8A 4QNRA 1A27A 1SKAA 2GN9A 3A4IA 3ZV6A 3O9ZA 4JWTA 3M6VA 4RZXA 2XOKD 4C0HA 2I6FA 5IF9A 2EP8A 2W2KA 2NU8A 3UNXA 4B5KA 4BRZA 1C4XA 2ZIEA 4KXVA 4C4AA 3MW8A 4ND8A 1UPCA 3JX9A 3N2GA 2P2CA 5DULA 2HI0A 1YCGA 4PW0A 3NM6B 1RYYA 1GGKA 2JBWA 3B8EA 3QLUC 2PGAA 4QQFA 2QB5A 1Q0SA 2JGNA 3RVOA 3VR5A 1GQSA 1PWEA 1PT8A 3ZLBA 4R9SA 1FTNA 1E6KA 5EWLB 3H19A 3CH5A 3FTCA 2ZSBA 3PKIA 4OXRA 3UUEA 1DQRA 3KXKA 3I0NA 1NBME 2LD4A 3NI2A 4TV9B 1ZJ6A 5I7AA 4B71A 4CGYA 2OGWA 3UXMA 3V1LA 1ZXXA 2EZ8A 4ZIRB 4ZYXA 1PLLA 3LC2O 3FGPA 3N53A 1C7ZA 1C1DB 1NWHA 1PZGA 3PUWA 3UK1A 4FDVA 5B30A 3LKDA 4KVFA 3WYCA 3U17A 2I71A 2VN8A 3LW7A 3D6VA 3AETA 4RZHA 4MYUA 4UUMA 1AX9A 1NW7A 1OBVA 4MUHA 5JU6A 2JAPA 4RK6A 1Y1PA 2VJQA 3ORFA 3BBPA 3OH8A 3DKIA 4KPYA 2IXFA 4F3KA 1XN4A 1IK4A 4HGOA 3RK0A 3G68A 1G4HA 1Z6ZA 4JBHA 1QP8A 3UWOA 1N9GA 4BO1A 1Z63A 3L7MA 4YJKA 1H65A 4W7HA 1E6LA 4BLOA 1R6UA 1HT0A 4IO0A 1KVUA 4QQRA 1VECA 1PHRA 3MUEA 1PR1A 4XUEA 2BDEA 3WTBA 1T1JA 1EQAA 4PAWA 4URWR 3S2YA 1T1SA 2WHRA 1OWMA 3BGWA 3KR2A 4E3WA 4KDCA 1CR6A 2Y1GA 2ZB3A 3OOEA 2V96A 3VI4B 3DF7A 3ML1A 4PGHA 1JEJA 3DR5A 1L5ZA 2QM3A 1NQWA 2I4MA 4R84A 3TMKA 3GP8A 5J2UB 1B0AA 5H7XA 1XJ5A 3N6RA 2FPGA 4PSCA 4U7PB 3RVDA 5LMZA 1J2TA 1AMUA 3B6EA 2X9QA 5KYYA 1ZK0A 4BBPA 2AC4A 1IHUA 5HSGA 2AC7A 3BK2A 4KOEC 3W34A 4FYJA 3BH6A 4R6XA 4OG2A 1S4QA 1Z15A 5DGHA 1KGDA 1C3VA 1CVRA 5HQJA 1DXQA 3ZNOA 2MSKA 2OGUA 1ORDA 4NEQA 2IITA 2YRFA 3ETLA 2PSSA 5BNZA 5ADWA 5J4VA 4DDWA 2Q5FA 1A7AA 1WEHA 5SZIA 4E12A 4LV8B 1DKLA 1DT3A 1VJ0A 3NETA 1DU4A 4RIGA 4WOJA 4H0NA 4XYBA 5JMTA 1EUYA 5AQEA 3CF4A 1JIIA 1Q6YA 1C5KA 1S3GA 4KI0A 2WSSA 2BY4A 1Z39A 2Q4EA 2VF5X 4M1OA 2AMJA 5EFZA 5K0SA 5LD2B 1OW3B 1D5CA 2ZYAA 4ND7A 1AUXA 2GCGA 3TR0A 2QY9A 2Z5VA 5C8YA 1FUEA 2HSGA 4JH0A 1TO1E 5K51A 5CCDA 1QYDA 1E3JA 2CEAA 2ID8A 1JLRA 4HDMB 4A8TA 3U7FB 4Z2AA 3NYWA 1SK8A 1E9FA 3U7GA 2VRCA 4G0WA 2OG2A 1NVXQ 2WIGA 5CIQA 3LUGA 1FQKA 3CRMA 1E0KA 2FPIB 3N0TA 1RLTA 3GFQA 2H0QA 3VNQA 4B43A 2ENUA 1TEHA 2WVGA 3R23A 5DYIA 3V4LA 5I8WA 2V6JA 3ISJA 5FI1B 2Q1UA 1L5WA 1AGRA 4EQ6B 5B58T 5KTKA 5AVVA 3GR6A 4BKOA 1GLNA 3I04M 3WSTA 4FWTA 1XJQA 1P4AA 2ONZA 4OPMA 4IXMA 2PA3A 1XKXA 1WDLA 2EFYA 2P11A 2O2SA 3LUJA 3N8HA 4UTXA 1HL3A 3QXSA 2Q0SA 2RG7A 4CQNA 1M76A 1YU9A 1IC6A 4GXQA 3UFXA 4C87A 1K8RA 3ZJUA 1TT5A 4L9WA 4B6QA 1PK9A 3ZU3A 2W0MA 2FN4A 2Z04A 3OZBA 1XRRA 4NCBA 1TAUA 4CGZA 3L6RA 2K87A 2OFOA 1E3TA 1ODLA 5BQFA 2FLVA 3B1XA 2BH2A 1KMQA 4BMXA 2XYGA 4D3SA 2X7HA 1WSDA 5H83A 5CJPA 3QP9A 3RWBA 4J6FA 2YZMA 1ID1A 2ACWA 1EDDA 3MT9A 4HAIA 4XIGS 4DM4A 1IUPA 3VXKA 2B4RO 1E32A 1FA9A 3OM1A 4IX9A 5TSDA 1D4ZA 1HV8A 1W46A 3NHRA 2VPYA 4H6PA 2JKZA 1N6PA 4HDRA 2A7XA 5BSMA 3IEKA 4KR9A 1P29A 3RS3A 4C3ZA 1OYYA 5ISMA 3KSBC 2FZKA 1AUPA 3K0HA 4L28A 2HC9A 1P5ZB 1YVUA 1QS0B 3LX5A 4YAFA 4Y2XA 3RUCA 4JX8A 1V47A 2VYNA 1HA3A 4LXQA 1SWWA 1MPXA 2X9NA 5CG2A 1PQUA 4J0EA 3S2IA 4A36A 5CCEA 2I6TA 1C8KA 2PL5A 4B6EA 1XZKA 3AV3A 1E9CA 1EXWA 1N2CB 1T6XA 1WTAA 5IJZA 5FL7A 1YVDA 1TMYA 2QTHA 1XKLA 2CNKA 3MCAA 4EF4A 3AUFA 4W5JA 1SIOA 3AP2A 2A4KA 821PA 3LAWA 4FKZA 2YVAA 4OIMA 4X00A 5FTKA 1XE3A 1JJIA 4GPIB 2FUEA 1CS0B 1GPDG 4MI1A 4C29A 4FE7A 3LLCA 2Y0EA 5EKDA 4R2JA 4YH1A 4Y9RA 5HIKA 3DZDA 4ZOLF 4GKKB 1PLKA 5WRFA 3S8YA 3LCRA 1QH8B 4EHLA 2ES4A 4FEEA 2QP3A 1E7QA 4FYIA 3KJGA 4XTRA 1LDNA 3U44B 1N2EA 1CNEA 2OHXA 3H7AA 4KE9A 5A1JA 3T7TA 4BBJA 2DF8A 2IYPA 3HUFA 3P2OA 5CDFE 3KT6A 1H2FA 1VRCA 4FZVA 1KY3A 2JVJA 1NY6A 1X42A 1JEAA 3GJRA 4PYLA 4YQZA 3EIQA 3HA3A 5SZKB 2FUKA 1V5EA 4QGAA 3WK9A 1ZKMA 3SX0A 4BCBA 5C8DA 1E96A 4V0LA 4X6LA 3ORSA 4HR7A 5EC8A 1JLMA 4XUCA 4U4AA 4JCCA 2PFKA 4B32A 3J7AC 1PRYA 5INTA 2H4WA 1E1RD 3P9XA 4FONA 4ENUA 1JVSA 3RQIA 4RLQA 4RFSB 5FNVA 1ZU4A 5DW0A 4C89A 4MDEA 1V1MA 1FDUA 3OE1A 1WD7A 3BA6A 4LTNA 2GEJA 1J1IA 3LFUA 4RELA 1C7RA 4JC5A 2XSZA 3JYOA 3P4XA 2FP3A 2Y1LA 3EXFB 1IJKA 2F9LA 1U3TA 3BFVA 5C35A 2DERA 4YJGA 5J58A 4XWYA 3RHTA 5KX5B 1D7AA 2J0UA 3N28A 4B84A 3GRCA 4RTPA 1LTQA 4KQJA 4BVHA 4P82A 3SR0A 4UM9D 5KOJB 5CNKA 1W35A 2E87A 3ZIDA 4JOQA 4K8RB 2XMQA 2X15A 1BXKA 2HA2A 1JEDA 4Y8VA 2PD4A 1Y3CE 1XDSA 4HNRA 4PAOA 1REQB 2DBQA 5IH7A 4F9EA 2EGUA 4ZP1A 4IDGA 1LK0A 1TPYA 1PX2A 1Z7EA 2IEDA 2WP8J 3CSSA 4NK5A 4ONEA 1XZJA 2V7XA 1NT4A 4ZQBA 3TAHA 4B3DA 3WGVA 3I9MA 4ZO4A 1VKHA 1SCJA 4GYWA 5EP4A 3K6SA 4E31A 4I50F 4ALMA 2BFEA 4MV8A 4FM9A 1QFZA 4X93A 1B74A 1I6MA 3NEAA 2EX4A 3U2QA 1QF6A 2CZGA 4C2AA 1T4GA 3A2LA 5CDHA 3PX7A 2PQ2A 1GZ3A 3QI7A 2JJ1A 4R05A 2CXUA 2UZ1B 4ZOCA 2Y4NA