4MJ7A

Crystal structure of the pin domain of saccharomyces cerevisiae utp23
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
QKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords rRNA-processing protein UTP23
publication title Structural and functional analysis of Utp23, a yeast ribosome synthesis factor with degenerate PIN domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04900 Fcf1 Fcf1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4mj7A00
2MDTA 5HMLA 1TAUA 5HMMA 1EXNA 3Q8KA 5ED0A 2QIPA 3H8SA 4XGRA 1YE5A 3ZD8A 1UL1X 3ZDDA 2BSQA 1UT8A 3H87A 3H8JA 1V96A 2H1CA 3Q8MA 1MC8A 4MJ7A 1A77A 2FE1A 1A76A 5L6MB 5ECDA 2DOKA 2IHNA 3ZDAA 1V8OA 5ECWA 5H4GA 1UT5A 1RXWA 3QE9Y 2HWYA 3IX7A 5HNKA 1RXVA 5HP4A 5L6LB 2WP8J 5ECYA 3Q8LA 5K8JB 5H4HA 3ZD9A 1B43A 3ZDEA 2IZOA 2HWWA 1TAQA 3H7IA 5FV7A 1O4WA 1BGXT 1Y82A 3ZDCA 3I8OA 5SV2A 2LCQA 3ZVKA 3ORYA 1V8PA 4CHGA 1W8IA 4WA8A 3TNDA 1XO1A 3ZDBA 2HWXA 3QEBZ 2H1OA 3DBOB 4XGQA 3QEAZ 3H8WA 1TFRA
chains in the Genus database with same CATH superfamily
1NUTA 3LCJA 2ZBGA 1TIKA 4LHYA 4YROA 4WBSA 1SQGA 5JFGA 4IUYA 3AFGA 5FPYA 4L76A 2I2WA 1GTVA 4L3VA 1HG0A 1NL3A 1GU0A 4YRKA 3HU2A 2W5UA 1IB6A 1VLJA 1JBQA 1ODIA 1Z7YA 3FNQA 3GBPA 3NONA 2ORIA 1P72A 3QKIA 4KMMA 4QNRA 6Q21A 3OVMA 2OHGA 5AVRA 2EKBA 1NVXQ 2XMPA 3SXJA 4CV0A 4DDVA 1RKUA 1OOEA 1E2MA 4QDXA 1Q12A 1UM9B 4JYMA 3M81A 5EIBC 1V1MA 4UXHA 3QFCA 2BP7B 2HMVA 3VNUA 4AMVA 1Z34A 2OYSA 3WK6A 4HXEB 1KWKA 4RVNA 1Z15A 3JWPA 2PS9A 3H8JA 3LUHA 5I5EA 5MF6A 4LXQA 2H7XA 3WA6A 3TCKA 3UB3A 4CIYA 3BHIA 3J81k 3GH1A 5GM2A 3C3XA 2PR2A 1P17A 1B6GA 4P82A 3D6HA 2WTAA 1IY0A 1JDUA 5BYBA 1KE2A 4LY6A 2I34A 4DABA 1YR9A 4REOA 5A3QA 4JT4A 3LW7A 1QOPB 4EO4A 3R5TA 4QVIA 2XJ4A 5ESWA 1HZJA 2XQIA 3HR4A 3VU9B 4WK6A 4YFVA 1C50A 1R4NA 2I65A 2OVBA 2Y0CA 3RT9A 5IKPA 1RZRD 4MVJF 1VJCA 4O0MA 4NJOA 4XLZA 1S3SA 5AJXA 1Y8QB 1S2MA 4XPZA 1EZZA 3OPNA 1W5TA 3LNTA 3LUCA 3R3VA 4BS9A 1G0OA 3PNMA 4WUTA 4TS1A 1OHHA 1PSWA 1T3TA 1M2JA 3PZRA 1YK0A 3A1UA 1RYBA 1T2DA 1CQIB 5JBQA 1AV6A 4HYQA 5ER6A 1BCRB 1YJ5A 4A36A 2BVNA 4DV2B 3R6WA 4QQFA 5IH3A 2C3UA 3E48A 5JADA 2XYGA 3ZZ1A 5BXYA 1LJ8A 2QD2A 1ECBA 1HNNA 2EGUA 2R8XA 5JG7A 3E15A 1YZVA 2ZJYA 3BRWA 3WHPA 1N5JA 1R4MA 1PLJA 4TV8F 1AY0A 3NG1A 4TWZA 5TGZA 1PJCA 1T1SA 3SJUA 1UZAA 5CFOA 4M7OA 1QAQA 4IIVA 3MLBA 4J3NA 4BWVA 4XLTA 3T12A 1W36C 1DS6A 4A8JA 2SCUB 2BE9A 3IUBA 5AW7A 4AKIA 2P8SA 3QVOA 3DBIA 1P0CA 3DF7A 1XAGA 5E4JA 1RKQA 3VU0A 3IVMA 1AUXA 3DMTC 3ZHYA 5J5CA 4PX3A 5DM70 2P75A 2Q3EA 2B9VA 3PFHA 4L6AA 2FDCA 1CB7A 4Q82A 2QLMA 1YI8A 2P11A 4DLRA 1T36A 1U7HA 4URFA 5FYQA 2H7YA 4EGJA 3DULA 3T1QA 3EA4A 2RGUA 2JRLA 2ODTX 2UVDA 4XKJA 3WDMA 5ALLA 4RIFA 4L02A 1Q21A 1EZ1A 1IHYA 1KDOA 1I4TD 2JRCA 2QM3A 4JX8A 4RIGA 4RANA 3SYRA 2QQEA 4R2LA 2AMFA 4FXPA 3Q5GA 4Z53A 3NATA 3U60B 2HQBA 2CB9A 3SMVA 3DQPA 4UHDA 3OQOA 3AVPA 3LY5A 1LTHR 2X8BA 2VK8A 1U0FA 4FFBB 1A88A 1HSOA 1FFHA 2ILTA 1T9BA 1GWNA 1UBKS 3ENZA 3ZIUA 4DBLE 4N5NA 1NFQA 1EP3B 1KU0A 5D5HA 3FDZA 1YVRA 3CO5A 3AXTA 3NM6B 3FA2A 4HBZA 4I14A 3L6EA 4P31A 4BMZA 3KKLA 1CC1S 2IUYA 3N2KB 5K51A 2OHFA 1XMVA 5U9CA 3KL2A 2RGDA 3BIXA 1XZIA 2IF2A 1WG8A 1TA0A 3PITA 1YDFA 4BFTA 1PS0A 3FBGA 4IYJA 2ZWAA 2EX4A 2H0RA 3O7WA 3D8HA 1ACJA 3A1CA 1MPTA 5B2FA 5JJLA 3LPAA 1ODCA 4XWAA 3CUSA 3KEGA 5TPZD 4DRZA 5DBEX 2F67A 3A6HA 3MMSA 3QFTA 1BDBA 2EFJA 4RHEA 3K6KA 2IOFK 1QORA 2VP0A 1XXHA 2FETA 3CG4A 3HVIA 3S6JA 2XDQB 3E3NA 4GKJB 4MLCA 1U8XX 1N6IA 4I50B 4MR7B 3R6LA 1BROA 1L7XA 2EHDA 3G0HA 2QTNA 5K01A 3CVOA 2H4HA 4FMBB 3DT9A 5H16A 3S44A 3QSYA 3T3EA 3M0EA 1O6FA 3DMPA 3JSXA 4OKNA 4MQFA 2LVBA 4E5MA 1PW7A 5FOWA 3GZNA 4MS4B 2HYIC 2OMKA 3PQ3A 3ZUPA 4CMAA 5G3ZA 2VHUA 3NS7A 4Z1MA 4FNOA 4NS1A 1GCIA 2CFTA 2XBUA 4H35A 1TZ2A 4UEWA 1WOMA 2QVXX 4KZKA 4MWGA 3OFSA 1K3FA 1CRZA 1YRBA 4ZKDA 3HLKA 3WYNA 3E35A 3DB1A 4L7QA 2HDWA 3C6XA 3QX8A 3TRIA 2IYFA 2V03A 1GPH1 3NFRA 1ZD5A 1NNLA 2FPPA 1S3GA 3H2YA 3I6MA 2Z6UA 1OZAA 4NMXB 3MA0A 3H5AA 5FHRA 1PFWA 2QMUA 3AL2A 4HEHA 5JW6A 1KVUA 5AK5A 4RLFA 1SCKA 2XI4A 1Q0ZA 3IR7A 2QRQA 5DJ5A 1Z38A 1R6VA 4TM8A 4B9AA 2GHRA 1FSZA 5DXJA 5NLLA 4BQPA 2B7BA 1NW5A 3D6UA 4FDUA 4TSRA 3JYNA 4XJTA 3A4VA 3AILA 4XR4A 2XUJA 1G7CA 4W9MC 2X7HA 4US0R 2QN2A 5BQOA 3RUFA 1GG2A 2Q27A 3DUFA 4QDTA 5DGXA 1A9XA 5EUBA 2QUAA 1AZSC 4NCHA 3UWDA 4J8PA 5ULLA 3VVBA 5KMGA 3GFRA 1J9EA 2O5RA 1RRFA 3E61A 4FYXA 3WFJA 2JH3A 3AFNA 3A9RA 2C9YA 2I3AA 3DEFA 3JWIA 4B8YA 1XQXA 2CUZA 4E4YA 2WSMA 2WNHA 5M34A 3ZWDA 1QZXA 1KL7A 1QQ6A 2ZRNA 2NU8B 2WB4A 1RMQA 3K0CA 4GFDA 2HMYB 3W9UA 4HGYA 4K8OA 3I2YX 1B8NA 2B5OA 4WRRA 2XVYA 1BJTA 4XVCA 4ZVVA 4IXWA 2X86A 2JHAA 4W63A 4KN8A 4L4XA 1DBIA 4RQUA 3TSAA 3L6CA 4JUFA 2C59A 1XLVA 2G6BA 3TQCA 5FNVA 1CJMA 2M9MA 2R8RA 4W7IA 4X91A 4QU5A 4CLOB 1Z39A 2IY8A 5CFRA 3TGLA 4M6WA 1RLMA 2YYZA 3K0CC 1X3LA 3UW3A 1J07A 2Y4OA 5T8KA 1MOQA 1WSDA 4P3NA 5JT1A 1KFCB 3OC6A 1GP2A 2N3ZA 1Y3IA 3B9RA 3QZUA 2FJUA 3BWDD 5FOTA 4BJ5A 3SZMA 2H2GA 3CPJB 4XOIA 3V4SA 1JEQB 2XLCA 2RK3A 3IKTA 2JIOA 5FUQA 2CLOB 3DDNA 3PKZA 3Q7EA 2XUAA 3TIFA 1U1IA 3LI2A 5HIKA 3MQ4A 3O8DA 5TT0A 1MTZA 3NJ4A 4AMBA 4L0DA 3Q88A 1NXQA 2IY7A 2UZ3A 1USWA 5BR8B 3A4NA 2L0XA 3HO1A 4DRXB 1OFVA 1X1AA 1IQUA 4MICA 4B31A 1K86A 4KX3A 5EHQA 2CBZA 1TGYA 5ELXA 4U0JA 5KNCA 3FHCB 4PN3A 3A8TA 3KCNA 4JBNA 4ZARA 1OJLA 4F5EA 4W9RA 5EJ6A 3U6BA 1EJ6A 3CBQA 2ZTHA 3IOCA 3IPRA 4QQKA 1G6KA 5FPQA 3RREA 3K1ZA 1EUCA 5AR1A 1FVFA 2OL4A 2OORA 4YNBA 3T1NA 3WB0A 2MINA 2V55B 2JI7A 2PX3A 4K6FA 4DLAA 4JN6B 2JFGA 1M2OA 3AEKA 4AUEA 3B6IA 5LZ8A 1PEKE 4U2KA 5JXJA 1V41E 1SBZA 5C5IA 3VPFA 4TPKA 2X5KO 4YRQA 3ELBA 4FIZA 3SJZA 5FOXA 3HXPA 3QWIA 4WD3A 3W8DA 1XMJA 4BFXA 1JFTA 5I6DA 4B8WA 4LC0A 4JDPA 2OHIA 3SHVA 4XUEA 2XD4A 3DOHA 1YH3A 5FF9A 4HX9A 1G98A 3MBKA 1IVNA 1KYQA 1QG4A 3RIYA 4CQLB 3HB4X 1U98A 3AVXA 3IIMA 2Y92A 4JLDA 2BI4A 2JIPA 5JLAA 1I7LA 2J67A 3DAFA 4PAOA 2P90A 3K15A 3RS7A 4JI7B 5DW3A 2P9EA 1C7IA 4PGAA 4RFSB 1VZ3A 2I7VA 1XELA 1O03A 1N3BA 4N40A 1OT5A 2QSJA 2ZSBA 3QLUC 4ND4A 4PLZA 3HCEA 2YWDA 1YMVA 2R84A 1AU9A 1QYWA 2VJMB 3EEIA 2ZYVX 3OM1A 1QKKA 2VJDA 5A9SB 1IZ7A 2DHDA 2NZ8A 1HKHA 4C3UA 3LHDA 1VI5A 4WNCA 1C2TA 3PHBE 4RX1A 1QF6A 4B32A 4OREX 5CPBA 1R0XA 5CW1A 2CF5A 3V4LA 5LQCA 2PGJA 4E21A 4WZBA 1ZM2A 3PNSA 4N0DA 1GZ5A 1MQSA 3CPHA 1RHJA 1MXHA 1RMYA 5H81A 2XTAA 2INGX 3A0UA 4BX3A 5LNK1 1E1MA 3QITA 5CEJA 1I6WA 4PYLA 2XKKA 2BMAA 3BKXA 3T6KA 3TX2A 3L4BC 3GY0A 2YBEA 2QN9A 3BEOA 3VYVA 3ZDQA 4NXNB 4IFEA 4OHXA 2C5SA 1V5IA 1NGSA 2Z3WA 3CRW1 3KOXA 4QEDA 3ONEA 3PVCA 4I1RA 5KSWB 2Y0EA 4UOZA 3QM1A 4I66A 2VQDA 1TKRA 4EPWA 3OIVA 5JCJD 3O75A 4Q66C 2PT5A 5H1YA 3AIIA 1GZVA 4ZOCA 3S29A 3UT5A 2OAEA 5KVQA 1F9EA 3TNFA 1FSFA 3FVTA 2VDJA 4B7AA 1M8FA 4RTRA 4RS4A 4G0VA 2P69A 1W29A 2VQFB 2AYXA 4ND6A 3SF0A 3Q41A 5DM60 1T8YA 2QIPA 4NPCA 4CW7A 3IA7A 3R6GA 1QHEA 5FCDA 3D3NA 4BBJA 1DKMA 1UMBA 3A04A 2IODA 1U0TA 3E8SA 2GTIA 2OFOA 4M2LA 4IF6A 4Q1FA 2NXCA 3I9JA 5DWVA 4YIHA 1Z3IX 2EC5A 4RORA 3THXB 2P30A 3BH6A 4HOYA 3A05A 3DXFA 3H1TA 5DB4A 4A82A 4EZIA 4UFPA 2IYZA 4YRNA 5F3RA 1QJCA 5JNVA 3EPRA 4FCWA 4I4TB 5K0FA 1D7OA 2I2XB 4ZCPA 3LWNA 4E13A 4B6FA 3H42B 1S7CA 1MIOB 4UEJA 1Z82A 3F6PA 3P4XA 2XUZA 1KEVA 3GVHA 4IMRA 1PQWA 2G3YA 4WCDA 1IZYA 4KFRA 4OHYA 1E4VA 1KK1A 4DCCA 1L3BA 4XIYA 4LRYA 2R6AA 6NULA 3KKKA 1VMIA 5BV8A 1E77A 2NWQA 4F4IA 2PQMA 2NZ2A 4QFCA 4PRZA 1X42A 3JZDA 5ELMA 2QRMA 4KWIA 3MWEB 2HA4A 4CODB 2D59A 3CX4A 1GPMA 4X6UA 3G8AA 3W2IA 3MMPA 1IN5A 1P1RA 3CF0A 1PIWA 1CRQA 4DNXA 6AT1A 2VTBB 3Q5EA 1LS1A 1GVHA 3RIHA 2C0PA 1H2EA 3DZHA 4TL6A 4U9IS 1OSNA 3DW3X 1C0PA 1XDZA 1TYEB 3PRYA 4KAAA 4IHJB 1WZCA 4C0JA 5TRTA 2AOTB 1IONA 4PRLA 3BE5A 3DBRB 4WEQA 3HL0A 3WIOA 4ZJPA 5DBIA 1A50B 2QMEA 2R85A 3WYGA 3ZE6A 5DP2A 5CFLA 1J5EB 4MULA 4I5IA 3C14C 3OA0A 3UK1A 1XQVA 1VL0A 2HADA 3H6HA 4DSZA 5BNTA 1FU8A 2J5BA 4AMYA 5EXPA 1TAHA 1SU7A 3AF0A 2MSEB 5L4SA 3HMQA 3M1IA 4MINA 5K8CA 5BT9A 4IGEA 1SHTX 1DLIA 2ZIVB 4YP0A 4AROA 4ENTA 2RAVA 4JNKA 3HRIA 4H0NA 5KTNA 2WG2A 2ZTMA 3HFSA 3GYGA 3I0ZA 2EIHA 1L9KA 4US1R 4W5HA 5LZ7A 4DLKA 3VNVA 3K6JA 2FPGA 5AUOB 2H7VA 2JGNA 2B25A 3L1HA 4G5YA 4E0BA 2I4NA 2W6OA 5E3IA 4RHCA 2X0RA 1THMA 1IOVA 2R62A 3PWZA 1E9AA 1H5UA 5B3KA 3I3OA 2GDJA 2QJWA 4IHKA 4LFCB 2HX1A 1XZKA 3EGXA 4OJKA 4PTYA 1ISRA 3RTCA 3SLGA 4OXIA 1GGMA 2VTEA 3DAYA 1G64A 3U44B 4F85A 2FPIB 1X86B 2RI6A 5IXSA 5IMSA 3F3KA 4FJ0A 2QLBA 2Z83A 1JDBB 3WWEA 4LMRA 1SXGA 2VDVE 5K2MA 2I3GA 3OO0A 2ZUCA 4OHCA 5DLQC 5AJWA 4J03A 3UK2A 1IEVA 4B79A 1DDGA 1FXUA 1OROA 5LVAA 3B9PA 5CMLA 5FUVA 3TUZC 5CCBA 4URUR 3N2ZB 3Q1KA 1UXOA 1DBWA 2UZ1A 1NKSA 1WSAA 4X7RA 2O0JA 2ZWIA 3FPGA 2NYAA 3FOAA 3NZEA 4LQ4A 3VJKA 3VQTA 1Q3TA 2IEAA 3PQFA 3GJYA 4F91B 2WSSD 4OEHA 1LWOA 2NT4A 1K3TA 3DKRA 1LBHA 3M3PA 3OD1A 4PHGA 4PW0A 1DB3A 2J9GA 2P2LA 3DDUA 4QDOA 3ZU5A 4F6RB 4KFUA 3CURA 1SGWA 3SNKA 1S89A 2D2FA 3HWSA 4MX8A 1IWOA 3PR2B 3LT0A 1SWVA 5I9BA 1PJSA 3IALA 4BN4A 1XTPA 2IYUA 4ZTUB 1UJ6A 1JP7A 1X19A 2ZU6A 2EEZA 2HBRA 3JQBA 2PBLA 4PZEA 3AF6A 2VUSA 3FFWA 3SY8A 3ZQKA 4F11A 2BSQA 4RWZA 3GLUA 5A02A 2NM0A 5REQB 5DH9A 2BV3A 2H5IA 4G0MA 1G2PA 2O2YA 2RH4A 3I9KA 3P32A 4LE2A 5IYZB 3NDBB 2F9LA 3D6FA 3T94A 2Y27A 5JDIC 3L49A 2E4AA 2DFLA 3G0BA 4GMXA 4Q4HB 4U7HA 5A5GA 4MGKR 2UYCA 1F8XA 4WAUA 2QLNA 3DOFA 3EZFA 3NV7A 5AKLA 1QQAA 3I23A 4BUJA 4QYWA 1V7PC 2HJRA 2ZT8A 2JH9A 4L73A 3ZLVA 4LX8A 5T4FA 4F45A 1EUDA 2OCYC 3E9MA 2NO5A 1HNXB 3DE2X 2GJ9A 5TS2A 2PQ6A 2R7NA 3DDWA 3QMVA 1WR8A 3NHUA 1S9HA 3LDFA 2ATVA 4NEQA 5CK4A 2AFIE 2QTVA 4GP6A 2POCA 4YJHB 3F78A 1TECE 4GHWA 2IBSA 1W6RA 4NBTA 1UIRA 1GGHA 4RJKA 1SHKA 3P0IA 1RHKA 1NNSA 2QJTA 1PWEA 2COKA 1N8TA 1Z5UA 4H1UA 3K96A 3F5MA 3WRWA 1G6HA 3X3HA 1YOVB 4MUYA 5JAHA 1I4DD 1I5RA 1MR3F 1OY1A 2D5CA 4ZWNA 3OZDA 4XDZA 3SQNA 1AA9A 5IK2A 1H2AS 3DVQX 1J1UA 5FUYA 4EYKA 1NASA 5JASA 3EAFA 2QGZA 4HFRA 4D4MA 5CIYA 1R66A 3V5NA 1XPOA 1B73A 3LUJA 5GM1A 3TGWA 3N59A 3COJA 1AT1A 1VRVA 1PU2A 1Z6GA 3LC2O 4L3WA 4Q39A 3Q5DA 1HQKA 2DR2A 2OEPA 3EDCA 1Y3DE 2F8SA 4NKRA 2OFFA 3VO1A 2RBKA 2YYAA 3GWZA 1OWOA 3BKWA 1FFSA 2BEWB 2LBPA 2R44A 3IDFA 4M1ZA 4Z3OA 2O7VA 3QFRA 2MHCA 2ZE8A 2EF1A 2I6SA 2BH9A 4DY6A 3I01A 1V3QE 3ZHXA 1GKKA 1M33A 1P9LA 3DV0A 5FL7D 3IUJA 1RQLA 2X23A 4L8FA 3ZV7A 2V54A 4J9VA 1AUVA 4Y2PA 2V7QD 2Z9CA 3T06B 4TYWA 2GNAA 1ICEA 3B6MA 4X00A 1S8FA 1BYIA 1NBME 1OLXA 2PFGA 2HIMA 2V45A 3BA1A 4YAWA 5T4HA 3SE7A 3FYTA 2MSWA 5LUBA 2WA1A 2PJDA 1P7ZA 4HO1X 2DLDA 2QX8A 1SKMA 1AB6A 2Z8YM 4KRFA 4FBGA 2BGNA 3FSRA 4PZDA 3E1SA 5EEHA 1W85A 2Y1EA 3FPSA 3OBIA 1W8DA 1ADJA 1GA6A 5BOSA 2DB3A 2WVGA 1TKBA 1XHEA 2CDAA 3HCPA 2OCBA 4NJEB 1R8JA 1Y6RA 1T2UA 1DCMA 5HBRA 1T2CA 1SK9A 5DLPA 1CR1A 3AFMA 1E6UA 5L53A 2D5AA 4BZQA 5IBCA 5KYXA 1T3SA 1DEHA 3LCMA 1MH9A 3IAUA 4A8HA 4NNJA 3L07A 2QSUA 2X15A 4KPEC 2EW8A 2WU4A 5F2OA 4DF3A 2C8JA 1NV9A 5CVTA 1PKXA 1P4RA 1OTXA 1T8SA 3BWYA 4ZYLA 3FMVA 2FWMX 3KQSA 2PQ2A 3EPPA 2PRZA 3L8FA 1AC5A 1D2AA 2WKPA 4BAGA 2VK1A 4BGEA 3HBAA 1Z0KA 4E30A 2B0JA 3T7EA 3PHIA 4JIMA 1DQRA 1OLUB 2EZ9A 4BFUA 4PNEA 4D45A 2C07A 3DVAB 1GPWB 4JOQA 4ZFNA 1D2NA 3I04M 4YX9A 1R8QA 1KMHB 3I53A 1WD5A 4F3YA 1DAFA 1Q11A 2ZAYA 3LT4A 1DO8A 1Q0RA 1TVCA 1YACA 2GARA 2M32A 2V5UA 3IR5A 3PWSA 2R7KA 3QHAA 4N8EA 4HS9A 4C2BA 5BN1A 1IBLB 2OENG 3LL4A 2GCNA 1A8QA 3FNGA 2HJVA 3HYNA 5BSWA 1A8UA 1QE0A 4HAWA 4I4NA 3AJRA 2E1RA 2Q9AA 4P8RA 3KYIB 1TUGA 1J8QA 3BS4A 3C4VA 3DNFA 4L5BA 2DPYA 2GN2A 1LGYA 3SBEA 4ZPJA 5C53B 1KJIA 1WDWB 2HQRA 3E27A 4PM4A 3UOGA 1WBJB 2WIBA 3WL6A 4EUNA 2PMKA 3V9AA 5LP1A 3AY6A 4RD0A 5FJJA 1IDOA 2BY4A 2YZNA 3PVZA 221PA 1BHQ1 1PR5A 1FFYA 1NHWA 2A78A 1IN8A 1ZN9A 4P6VF 1Q2XA 3U9TA 4L85A 3LQKA 4EMBA 1EBBA 4EX7A 2C2MA 3OJWA 3QKWA 3JQRA 5KNDD 2EG5A 3K73O 3MPUA 2GZ3A 3V33A 2MMGA 1UM9A 4OQ4A 2FJ0A 4ROTA 3KPJA 3KJNA 1FFWA 1OZHA 2QG9A 1JLKA 2I76A 3WSVA 1BW9A 1C4XA 3RAPR 3HNPA 3BSSA 1USUA 2HGZA 5I45A 4FZ3A 1UPTA 1WAMA 1GKLA 1XZJA 4FGUA 3RLFA 4MDHA 2C1ZA 3M8KA 1V8BA 4MI6A 3EQ9A 5LIPA 1PWXA 3LLMA 2H08A 3PXDA 2HWKA 1AN9A 1QHGA 1XRLA 2RJOA 1NDQA 2WP0A 2ZQYA 4MTLA 3WXMA 5FAKA 4KQXA 3DP7A 1I7QB 2GH1A 3H5WA 1GOTA 1GAXA 1QK5A 4G84A 1U9JA 1ESCA 3HWWA 3DUWA 4OQDA 1N6OA 5TPWB 3KXLA 1DQZA 1QVAA 3SYKA 3VU9A 3FOBA 5I7RA 2W6JA 4F4JA 3TZQA 1CQXA 3ESQA 2JLAA 4QWWA 4Q4AB 1ORRA 3WICA 1C0EA 1Y8QA 3KYCB 2GCEA 3WNQA 4PIVA 4FIDA 2R6FA 5E8RA 1GPNA 4MWBA 1KP9A 1ULHA 4RKRA 5IDWA 5J4YA 2ZZMA 4KXFB 5LQDA 4EJ2A 2VIIA 5L7YA 2BOVA 3AFIA 3I52A 4MWSA 2A86A 3KLNA 4YQYA 3TW4A 1BCRA 5AUPB 4PCVA 1CFJA 3OQBA 3LC0A 1IEWA 4MVJG 5JLJA 3OESA 3VH3A 4JOBA 2VP6A 1J2JA 1VE6A 1PVDA 3C7CB 1S96A 3IC5A 3LXRA 3ROFA 4KO3S 2NAPA 3F90A 2OBFA 1ML4A 4LN1A 4BAZA 1W4ZA 1ZAYA 4XTCS 5AM0A 4OHPA 4JC4A 5L40A 1ZH8A 1YRYE 2IQIA 1ABBA 2VWGA 3L43A 3RTAA 3SJBA 2QUZA 2I4RA 5HHTA 2GS9A 1A5ZA 3I6QA 5DWQA 3P9SA 2ODNA 4HJXA 2FRXA 4MW1A 4OB8A 3BIOA 2PWYA 3ZZMA 4WINA 3D3EA 3W8NA 4RO0A 5DOZA 2HO5A 2D7CA 2X2EA 2OZLB 3S55A 2RGCA 4OXNA 4Z51A 3KSUA 3N6VA 2VC2B 1TEVA 5DO9A 3ENVA 1D1TA 3O8OB 4Y8VA 2AE1A 2DUNA 1PZFA 2XMRA 3S2UA 3ZDZB 4I9FA 4L8WB 4C4TA 2Y99A 3NM5A 1UOEA 2WJIA 4C78A 3MWFA 1Q7GA 2G08A 4X54A 4EL5A 4BMDA 1I6LA 1GPDG 3MUEA 3OLCX 4N1AA 1ZOOA 2HZ7A 1NJGA 5IZ4A 1JVNA 4GL2A 4FFBA 2DXIA 1BMQA 3K20A 3Q7RA 4F9GA 4YP9A 1SIOA 2V9CA 3QKSA 5A03A 3O4HA 4GS5A 5CH5A 5AVQA 3LOPA 3MJRA 3H5RA 1FTQA 16PKA 2IYAA 2G9RA 4LJ6A 1AE1A 2I2FA 2WAXA 1LVGA 4J6FA 5ES3A 2MTBA 2TMKA 3OIGA 4RJJA 4S1WA 5E6SA 3ZS9A 3N2KA 5IVPA 5TS3A 2MSDB 2ERYA 2VZLA 2X77A 3STWA 5HUQA 1BXZA 3GNQA 3L8CA 4I6EA 1G6OA 5TMBA 4ZALA 3CR8A 4EG3A 1HFJA 2JGEA 3QEJA 1TM5E 5DULA 4KR3A 1P7PA 5AH0A 1YFLA 5MGNA 1AMOA 3IDQA 2ZRIA 2JGDB 3MLAA 5ELLA 2BHNA 3ZNQA 1Z6QA 3CLRD 1JW9B 1C0LA 1HF3A 3BMNB 4JSYA 5H68A 1FUYB 4CGYA 5DTEA 5HDQA 1V47A 2PEZA 1M73E 5IEJA 1N0WA 4X61A 2VP9A 2XDQA 3IO5A 3MLEA 4JITA 4CL8A 4ZV9A 4AMGA 1D6SA 2KW5A 3NDIA 4UNQA 4MR7A 2GXSA 2WSBA 1W0CA 4W5TA 3U5ZB 1I1HA 2W98A 2DULA 3D8RA 4PLYA 4V0NA 1KZ6A 4NESA 5CYPA 5H82A 3RFFA 2YQZA 1NLZA 1W581 2AR0A 3KKOA 3BDIA 4O8CA 5B4VA 4FONA 2Z2YA 3ZNNA 3PYLA 2GFQA 3H9CA 4MS4A 1U7OA 4QXRA 3EOZA 3THOA 3U4DA 3ZCXA 1GFWA 1WXFA 2CXRA 1N6LA 3ZDEA 3C1OA 3NUZA 4B4VA 2V7GA 4DQUA 4H6PA 1XJWA 5B1IA 1P6QA 5DFAA 4ACBA 2C4VA 1I4LD 4YI3A 2XR1A 4IQ0A 4ER6A 4XVHA 1U90A 1US8B 2REQB 5K3SA 3EPLA 1U4OA 4E51A 1QM5A 2PV0A 5HILA 1T6NA 3S68A 2HRBA 3VTFA 4FYWA 3LUPA 3SVLA 4OHZA 3F47A 3EDMA 2CHUA 3N07A 3SIPA 2Q3MA 3GA0A 1NR7A 1V25A 1UXJA 1A5BB 3C98A 3JZAA 4FYMA 1MO2A 4Q3LA 4J0QA 4B4UA 3L9XA 2YWJA 1N2OA 2P6UA 3L7DA 4BNUA 4G6ZA 1Y1QA 2R6CA 2Y05A 3CSDA 1G38A 2YS7A 3PXBA 3NDRA 1QX4A 3O9ZA 4R0VA 4EI2A 3EOBI 1XKTA 3ZCTA 2GN8A 1AX9A 2YHIB 2QZSA 3HVJA 5ABPA 1U3VA 3CLVA 3N86A 4JUAA 2FSPA 2VF7A 4CE6A 4UARA 5FRDA 3ACDA 3SFVA 2ONJA 3A1SA 3AFOA 3QMWA 3GPBA 3V7UA 5IG2A 2ZWOA 1UJNA 3FVWA 4RL6A 1KI4A 2EKDA 2G1UA 5E9QA 4K87A 3OPVA 4CF7A 3BX1A 3NIDB 3EIFA 3RODA 2AFIB 4M0UA 3WV4A 3O2JA 1WHSB 1HT1E 5FLXA 2FV8A 2HCTA 2OHOA 1KMQA 1X0VA 4PZCA 4XWKA 1T6XA 3PUWA 4ICIA 4ZOLA 3IVAA 1HT2E 1FFDA 1FUEA 1ND5A 3FSGD 3LPNA 5TXGA 2JKZA 3IMGA 4L16A 3VOTA 2PUDA 2ZJ6A 5AMXA 1L1FA 1DXYA 2HMSA 2V7TA 4MWDA 2C03A 3WGQA 1XEAA 5C3MA 2CMKA 4JP2A 1SIBE 3J7AC 3RSSA 1ORVA 1DKRA 5IFLA 3CKMA 5IVHA 3OOSA 5FXMA 4KUHA 2CCJA 4CMBA 4CLOA 4MLPA 3ZGZA 2QV7A 4KW7A 2HU2A 3PC2A 3PJGA 4LPSA 4LRXA 4ECAA 2CKDA 1K97A 1GN9A 1N8KA 5L6MB 4MP8A 3JATB 3ZLBA 5AK0A 4IH9A 2EJBA 3AKDA 1Z5WA 2ZWMA 4LOIA 3TMKA 4TRMA 5ECWA 4D3ZA 3OFKA 1U8FO 3OJEA 4GYYA 2WMYA 3R76A 4DC9A 1WX1A 4ZVNA 2WZCA 1G9XA 3ZK7A 4C3VA 5JAMA 3WL4A 2X41A 3I9MA 4X71A 3L4EA 3BSWA 3QFHA 3AI3A 1EWTA 4LSZA 4A91A 1DI0A 1Y37A 4NZOA 4DRXA 1WSBA 4ATNA 2BFPA 3D7SA 4PG7A 3W8EA 3SBDA 2GFHA 4I8IA 2X1VA 4DGSA 1LY1A 3SZ3A 4ISCA 1C2YA 5HFJA 4TZTA 3X1ZA 1LH0A 4PZ0A 2GBGA 5EE0A 2VBFA 3Q8LA 3FIJA 2O06A 4MRRA 1RT9A 3ZJ5A 3CNHA 3ESCA 5KNBA 1WZ2A 2JHPA 3KKNA 1AHPA 5BUZA 3PNYA 1IULA 2YRXA 4RY2A 2BKXA 4GOMD 1E3DA 3WK4A 5KJCA 2Q6LA 4NBRA 4NE9A 2FZ4A 3GGPA 1QNFA 1HM5A 4AO7A 2C3YA 4ZJUA 4ALJA 3FLMA 4BYMA 1VHQA 4H3HB 2B8JA 2H4ZA 1VGQA 1GPKA 5K3EA 3KIPA 3TCXB 5KYWB 4JVOA 4ALIA 2VWQA 4CUJA 2BJVA 4CCWA 3DDOA 4OKSA 2P35A 1G41A 2IP2A 3BB1A 2VT6A 3G5MA 1STOA 3CQ9A 4H27A 4ADSG 1HXHA 3BQ9A 2XE6A 1XV5A 3BMOA 3OE1A 1G8PA 1OZ0A 4RFSA 1EWYA 3PYMA 1Z68A 3PT9A 5CLQA 3UKOA 3GLGE 4XZ3A 3ZX4A 1TUBB 5DASA 2C7OA 2HB6A 1L5SA 5BT8A 2JI4A 5I9IA 3RVLA 3V1KA 4P3OA 3OETA 3KHSA 5J58A 4S1OA 4QASA 2JARA 2RIPA 3A9WA 4Y2SA 3FD8A 4JI2B 4IVNA 3K16A 3A11A 3BXHA 4RZHA 2NO7A 2ISSD 2IYQA 3U3KA 4LV8B 4N3CA 5ES4B 1SVNA 3H19A 2QJFA 1O57A 4QGSA 2I4IA 1T0HB 4D0NA 3SWWA 3QJYA 2Q2VA 2RAFA 3DFKA 4PS1A 3LFUA 3GGJA 1CUHA 2UV8A 4YBRA 4N48A 1IXYA 1YF3A 1W49A 4MDEA 1PG2A 1IATA 3KJIA 2JLUA 1U0EA 4RXUA 1XIVA 4I1YA 4ETWA 3V8RA 1X9HA 8AT1A 1K9VF 1UP6A 3RTEA 3RRMA 4CF5A 1FFEA 3RBVA 3U3JA 4DG5A 4YUAA 4MPJA 4HK4A 3AF5A 1JH9A 4N0QA 4EW2A 3F2IA 4BNDA 3MB8A 4N4AA 2I0FA 3EC1A 5DCLA 3SF8B 2AG1A 4RD4A 5D01A 4LFAB 5IT4A 2C95A 4K6HA 3SPXA 3RYIB 3RFXA 2HAEA 4XTRA 1TK2A 3ND8A 2QJOA 1CY0A 2AZDA 4HDMB 4AF7A 4ZCMA 3IEVA 3QVWA 2QE6A 4MW9A 5JWRA 3QVGB 3RD5A 2D7DA 1TU0A 4X45A 3TSWA 3UMRA 4JEUA 1M8PA 1NBOA 5F4BA 4DFDA 3BULA 1P18A 3A6GA 3SYLA 1I5EA 4N5HX 3IEUA 1CJVC 4KR2A 1VIYA 2O8BB 2IL1A 5EJIA 1MAHA 1OIXA 3EOAI 3ZH9B 4YCAA 3OQJA 5KNCH 1ZLXA 5J4HA 3KKPA 2XRYA 5FI1B 1MC4A 2O54A 2C4WA 1E8DA 2XODA 3THXA 3DWEX 3MCAA 1XF1A 2HU8A 5CH3A 3VU3A 3UANA 3UKDA 2K7FA 3V2HA 5D3KA 3KALA 4YRLA 1PDVA 2H4WA 3M4NA 2V7BA 2VZ0A 2A59A 1SR8A 1PFVA 3E5RA 2OGWA 3UENA 1WTCA 3F4KA 4TS3A 1AM4D 3TL3A 3TRDA 4D6PA 4X65B 3C41J 1Y3BE 1ID8A 1QG6A 3GJTA 3W7VA 4E5UA 1XD8A 5BQXA 5IARA 4DA8A 3K94A 4ZVPA 1LPPA 3BT7A 2Q4TA 4ZGWA 1YB5A 1MG5A 3MWEA 4KYTA 4TTIA 3RVPA 5B6PA 2RHDA 3KJHA 4AQ7A 3VGPA 2E5WA 3FWYA 4PHFA 4ZQBA 5EIWA 4ZYYA 4OXRA 4O4HF 1Z7EA 2FVYA 1P73A 1RMTA 5J1TB 3V8EA 3DCIA 4Q02A 1Q0UA 4LHZA 3FPBA 4IZ6A 5BRJA 4MVJM 3SZUA 2VTBA 4GL4A 4MS3B 4R2HA 5AIBA 5D1HA 1TCAA 1IDN1 2Z43A 2FEAA 3OQVA 4IHJA 2SECE 4ECEA 2UUPA 3ZY5A 3OPXA 2AC4A 4OM7A 5FQOA 4L6CA 1PG0A 2AFVA 4QDJA 4K2HA 4N82A 3TQOA 3L8DA 2Z58A 4OP1A 2HW8A 3FCCA 1W5AA 4NP6A 1JQKA 1XDSA 3B2EA 4GEKA 4HAYA 5BSMA 3LOQA 4ENUA 2E3JA 1YC2A 3L2OB 4FOPA 1T29A 1F17A 4XQ9A 1TCCA 1WXGA 3RAFC 3SJAA 1GN8A 1QZ3A 2ZRFA 3ID6C 4JJKA 2BM1A 4PO8A 4Q03A 4AIIA 2WWWA 4HNSA 5DTRA 5JNRA 4S04A 2HV9A 2I9KA 5CNMA 1CPYA 1T4GA 1D03A 4LNUB 5TE9A 3WE7A 4DUZB 1F2VA 1J20A 3C3CA 4HCJA 2J3JA 5KQLA 2X5OA 2AZ4A 2F90A 4B6RA 4QT0A 4JWKA 4QBHA 2A2ZA 3VHQA 4BO8A 3ZHZA 2VQ3A 3HPRA 1JFFB 2C0QA 2J9FB 4AP9A 2HUPA 2X6TA 5I9SA 2C2GA 2CMFA 2FLWA 1E3SA 3A10A 1SUAA 1DO0A 3U5TA 3GFTA 4B45A 1ZJJA 2GN9A 5IASA 1KWGA 4C9BA 2FPIA 4URZR 2GD1O 4ZV7A 5FORA 5T41A 2G9NA 4EY5A 3DAGA 3U7RA 5JZ9A 3BBPA 5MN4A 1P7VA 4KLCA 2XUDA 3AHFA 1TU4A 4NCJA 5ILGA 5JSUA 3F8TA 1RAEA 2IFTA 2QW1A 4QU8A 3O8QA 3TFWA 5G0TA 2IPLA 4WZ6A 1CZRA 2JASA 1Q17A 1LDEA 2QWXA 3FJYA 1T5TA 2BMVA 3UG7A 3IDSA 3HTXA 3U4IA 1KYIA 5ILOA 2BUCA 3PIDA 4FQ8A 4ZVOA 5CUQA 2YXLA 1CT9A 5AKJA 3ITEA 4E33A 2IHNA 3OZCA 5EZ6B 5LYJF 5EUQB 2QE7A 4EW6A 2EYUA 4KPYA 3BJRA 2ADOA 3T9AA 5DSZA 1G3QA 2ZP1A 2KS6A 2RH5A 4J91A 1H6BA 1Z47A 2DBZA 2XXBA 3E2PA 3I9NA 2C8VA 4MGZR 5KVVA 2UVPA 3W4IA 2X6QA 2CV0A 3H65A 2A88A 3HJAA 3M6MD 5AO9A 4YP1A 1CULC 1QV7A 4OK6A 4YWHA 4IKPA 4CHTA 3HSKA 5EIXA 2J4DA 3G3EA 2P9JA 1EXVA 3QE9Y 3F6CA 3WMXA 2I5PO 1AQNA 5AT1A 2FI1A 1NURA 5LP6C 1JKFA 3X1XA 5IBRA 4RGBA 4BQIA 5REQA 5AUQA 5IYZA 4EYQA 5GIOE 4NH4A 4B76A 5A2QA 3VUFA 3T1OA 1E9DA 1JSLA 2J9XB 3EHDA 4HN4B 2X8AA 3BMQB 5AVTA 4P2BA 1UFKA 2G4VA 3KQMA 5EERA 4LWZA 3VPCA 2O0LA 4RGYA 3WV5A 1Q1BA 1GDHA 1C3OB 3L4JA 3WLKX 1D2MA 4D3YA 1Z74A 5BSFA 1HH4A 1R6DA 2I2DA 5AVZA 4L4SA 1DEXA 2Y2UA 3B1JA 1WXQA 3BF8A 3LTNC 2AZXA 4RIHA 1HEIA 1HOXA 3KV3O 4C05A 5BV1A 1SCAA 2BISA 2W90A 3P45A 4LECA 4HJRA 1GQYA 4UFNA 3U48A 5E9JA 1DDOA 4GGMX 3IVXA 4A23A 4EYSA 5EUMA 5I9NA 3NBUA 4KXWA 5FI3A 5T7BA 1I7NA 3L84A 3MMNA 4AURA 3R5JA 2FWJA 4TXNA 1H9AA 4G8BA 4IDAA 4CMEA 3UB2A 1QB8A 2P65A 4W5QA 1HDYA 1ZGBA 3QLJA 4L15A 1VLLA 2NTEA 5CXSA 3WC4A 2AQKA 3PHJA 2AW3A 2A9FA 2KI5A 2W2PA 4WKCA 4L22A 1LK5A 3W90A 1BD3A 2P7HA 2E37A 4DCNA 4QGGA 3FYCA 4GR9A 2VDLB 1O5TA 4F4HA 3DE1X 2O2CA 4A2QA 3WGZA 3H2ZA 4BGUA 4QOSA 1VTKA 4XDYA 5CJPA 4U8GA 3TAXA 2CUKA 4Z9BA 3UK0A 4B4KA 1YHYA 4WACA 3WADA 1QG2A 5KWVA 1M0SA 2ZBVA 3KXPA 5BWLA 5B5SA 3E6AA 2H3HA 1QK3A 1N2BA 4K9SA 4OD0A 1FYWA 5JXHA 3DV2A 4ARSA 2H2IA 4G97A 3AH8A 4YIKA 1HYHA 3PCTA 1ZC3A 3WL8A 2JS7A 4HYEA 2BKEA 1P0IA 4MYDA 5AKYA 1SCNE 3ZIAD 4WLOA 3KT3A 4XJXA 1TQHA 5KJEA 1K6IA 2UVQA 3GRRA 3NIFB 4N7MA 4I50F 3TLEA 4LXHA 1U4NA 4BX9A 1EFUA 4ZDKA 4B84A 2H1RA 1UL1X 2AUNA 3VU1A 4A6EA 2DP4E 3D4LA 1RW4A 1WW2A 4NE7A 1G2IA 4V3BA 2VKQA 3ACCA 1T10A 3DO8A 2DHEA 1DJOA 2GMWA 1BA2A 2EU8A 2QA5A 5BWNA 5A4MS 4FM9A 2PIAA 4H0FA 2VRWA 3Q8MA 4NJEA 5FWDA 3TDMA 2X6RA 2F43B 4TXMA 3MMXA 3IAM6 4IQ8A 1A77A 4J7AA 4HQFA 2PJRA 3BRQA 3IP3A 5HQJA 5HW0A 1U8ZA 1PSZA 4YCJA 3BH0A 2BW0A 3REQB 4B2LA 4EEKA 4BGVA 3LZ6A 2YOFA 1V9SA 2FR8C 4X0EA 3PPIA 3RVNA 3W4KA 4KWTA 4FZRA 3T0GA 2JDIA 4PHHA 1WPQA 5AVOA 3AM3A 3CISA 5JO9A 4BTVA 3HZRA 1RXIA 5DHRA 2P79A 4MYTA 5F33A 5A1JA 3PNKA 4R31A 2QD5A 4P4LA 1OLUA 4KU4A 5L3SA 4PLCA 1BA3A 1D9XA 3DVAA 1KY4A 3GUZA 4PR0A 3UAXA 4P5PA 4PLGA 1RFGE 5MHTA 2A5DA 2AJTA 3GLSA 1RXEA 4RMHA 1XR3A 2AJCA 2GLXA 1JU4A 4ZYZA 1J0EA 2AF4C 4N3NA 5CX4A 1H9CA 2WK1A 1YDWA 4P93A 4D4HA 3SFTA 1TM7E 3EXAA 3IX7A 4KNVA 1K27A 4W9NC 1M8JA 5AW1A 2VQEB 3U4QB 2JCYA 3JD2A 4WK2B 3FAKA 1HKUA 3GLGB 3E84A 2B4QA 3RS9A 3UZUA 4AZ3B 1ZM3A 4B2PA 5AOCA 2Q5QA 3V8VA 5C4MA 2JIZA 3AKYA 4R2IA 1E4OA 3LTEA 1QYRA 4QRDA 3R77A 1RPJA 4MCHA 1UBRS 5D85A 3DZFA 5KTRA 4IICA 4FW8A 2BDEA 3EGVA 1VSVA 3CKYA 4YXWA 4LXUA 3WDKA 1OHHD 3BTOA 5CDFE 3WGIA 3FYDA 1VJ0A 4F2WA 3OFJA 2IYLD 5J59A 4WASA 1EDEA 3BM5A 3GI1A 3ZCPA 4EFKA 5BYKA 3D4NA 4L2IB 2ECOA 4RHYA 1J2EA 2NQTA 4E2YA 5KKCA 2WM8A 3TVDA 3AF3A 3V4VB 4CXMA 2DUUA 2VJYA 5FYDA 1MW8X 4BNJA 3U26A 2DTXA 2YRWA 3JQ8B 4Y2GA 1L5QA 4W1QA 2HXGA 5AJHA 3PRKE 3WRYA 1ZJ4A 1A04A 2O4UX 4L51A 2H1OA 5KS2A 3VZDA 1T5IA 1PNOA 1L1RA 1PR2A 1V8FA 5SZHB 1EGAA 1XZLA 4RNCA 4CL2A 2R8BA 1DOHA 3AQIA 2VUIB 5C3UA 2CNBA 5TPWA 1NPDA 4A15A 3RE1A 1Z6AA 3H0KA 3W5HA 5DE3A 3UHPA 4FQ5A 1EXNA 3CX7A 2AXPA 3WRYC 3WWPA 1CY6A 4Q4AA 2I22A 2VYCA 4R69A 4EEXA 4RD1A 4PPGA 4LNAA 2VF4X 3B3FA 5GONB 2O8NA 1GUZA 5BN5B 1NDUA 2XVZA 4U5QA 3RG8A 4OQPA 1IY1A 2SKEA 1R9NA 1T9GR 2WYOA 1LPAB 2A94A 2FPKA 1IAQA 1WMBA 3LY9A 5E1OA 5H8WA 3WGLA 1DZ3A 1P29A 3DSRA 4D96A 3I2KA 3BFXA 4ZK6A 4CYMA 3SS8A 3KM0A 4D44A 1XK6A 2ATCA 1XCPA 3OG9A 4LHSA 3E22A 4JFRA 4LK3A 4TYMA 4MHTA 4D41A 3A2LA 2AJDA 3DQQA 5JDCC 1FXWA 1R50A 8MHTA 4XAQA 1ZC4A 2PT7A 4PAGA 4WI1A 2AS0A 2DBRA 2TS1A 3I61A 1F8YA 4ZEOA 1E9VA 4TMKA 3CLSD 3OX4A 1UAGA 2R5NA 5L3ZA 2IX9A 1BE1A 2H00A 4RULA 4AF6A 3DD5A 4II3A 3BF7A 3N05A 2N47A 3PC7A 3DTVB 2VBCA 4XGIA 4E5DA 2IZZA 4D97A 1P0PA 2ZYIA 4EUFA 4HN9A 1R6BX 2WTNA 4GE0A 3ZU4A 3NALA 2YV5A 4BEBA 5KDOA 2ZLBA 4H7DA 2OZLA 3LS2A 4QQ8A 5BW4A 1JDNA 3PQ2A 4DMLA 4UBOA 3ZQ4A 3O8OA 2X58A 3ZW8A 1UDBA 3LCUA 2WSLA 1VSQA 4ZRMA 4ZT4A 4RFLA 1P4AA 4BN5A 2BUAA 2Q3JA 2EFDB 2BGWA 2KLBA 4HQOA 4RE5A 3LBFA 3R5FA 3AG5A 4MI3A 2HK6A 2NO1A 3QW2A 3WOHA 3KR9A 3VJRA 1QV9A 1SBTA 3A3PA 1UEXC 4TRJA 1WOYA 2D4HA 3GAMA 3PGVA 1COZA 2X9QA 5FWAA 2PVPA 5F76A 3V9PA 2OV2A 1U1FA 2W6ZA 3NJRA 3K5WA 5AQEA 5JEEA 4JOCA 4J3FA 3IB6A 4OBBA 1JH8A 3DONA 2Z6AA 2BLLA 4PGGA 3HA2A 2Q1SA 4F97A 4TT8A 3PFNA 3T7RA 4DUYB 1FMTA 1OXVA 3H4MA 1E89A 1Y7IA 1T9HA 1W48A 1DTEA 2JIMA 4ZRDA 4KIWA 1ZONA 3EEBA 4DJFC 3KKZA 2CWWA 4JXJA 1KORA 2QVBA 4NBKA 1NX9A 2G4CA 2JGDA 2QYOA 3DLCA 2J8ZA 4GI2A 5AHXA 4PAWA 2CYAA 1LB1B 3FI0A 5A5DA 2HJHA 3SU8A 3BMNA 1KKLA 2AI3A 5J5AA 2CF6A 1JEDA 4R8VA 5BW8A 3R5SA 1EX6A 1FP4B 1Z4KA 5LBUA 3H3FA 5AESA 1L6RA 4HGOA 4FFNA 1E9CA 4EHJA 3M6FA 4QFBA 3VTAA 3R7BA 5AKIA 1XL1A 4R1QA 1FW6A 4GLLA 3V48A 2NP6A 1XZCA 2O8VA 2VPZA 2ZM5A 1FMFA 4PLTA 3QF4B 3MPOA 4PPYA 1TAUA 2AX4A 3KTAB 3I9LA 4UBJA 3LHSA 1ECPA 5HKKA 1M7BA 2WKSA 2YDXA 1KZYC 1KDVA 4I4TF 4C1BA 1XNGA 1JIQA 2KQUA 4DMFA 1UK9A 3KHUA 4ID3A 1YNOA 1FU7A 3WWZA 3JVEA 3VDXA 1AKVA 2QD4A 5E3JA 3FWPA 4EVQA 1FYFA 5EY5B 5LB2A 2B94A 4GC9A 4CM8B 1XTUA 3WIVA 1NOIA 2WHPA 4O8ZA 2BTEA 3C4QA 4R2XA 3U7QA 2X2PA 2VR1A 3THWA 1MAAA 3Q9LA 4HVTA 3HB0A 4EGAA 4KRYA 1JXMA 1U65A 1E58A 2GEJA 3BDVA 4BNZA 1YDEA 1KZ4A 2G7ZA 4O4JF 4WMLA 3G9ZA 1JDJA 4NFHA 2QM8A 4JKOA 4V1CI 3ICQB 2QT0A 4MJ7A 3B5EA 2Y1FA 3LIPA 1KAQA 4BZXA 2I71A 4RV9A 1NIPA 2XRMA 5BXQC 5F7XA 3HZZA 1WUJS 1Q16A 1DGQA 2WJVA 4HRAA 2WF7A 1P7WA 1RM5A 2OBLA 3FCUB 3IP1A 4IHJF 4NDNE 2ID7A 4EJSB 5IDXA 5LN1A 2CK3A 4BVAA 1TVKB 2AFIA 4H7FA 3K7EA 1KO4A 1WHSA 2Y1DA 5KZMB 3TLXA 5ITSA 2UYQA 1KDRA 1J00A 2FFAA 2BFMA 4MGYR 1NUAA 5JPCA 4QL3A 5B37A 1AXEA 4QUIA 4UEOA 2DFKB 4HTFB 5I4CA 1DBPA 2QTLA 5J23A 1DCKA 1KQGA 5CDGA 1F2TA 5J4LA 3PUYA 1ABFA 1G66A 1B3RA 2Q4DA 3D81A 1XN1A 4HSEA 4XH9B 5BSKA 4JU9A 3GEPA 2YIDA 3RK0A 5M7EA 1KYWA 2GFIA 4ZCTA 3UUWA 1XNJA 3S5UA 5DYGA 1KI1A 1QHSA 3TW8B 1JA1A 1RAFA 4DJTA 2O1WA 4BO6A 1XP5A 3JARB 3H1PA 4EJ6A 2PKQP 4RIIA 4ZCQA 2O3UA 2ZZKA 2EX1A 5FPPA 4JLVA 3JATA 4B3JA 4Z4FA 4KDFA 4YYEA 2AQIA 3F9CA 3OEWA 4FWTA 3MINB 3R0IA 4Y1GA 4YV2A 1MFZA 1D8TA 3JD0A 3OOEA 4DJ5X 1EWQA 1YJBA 4COOA 4C0BA 4JBHA 4KJXA 2WTMA 2IIPA 3R7DA 1PV1A 3VPGA 3TPCA 3PI7A 2D1QA 5CLIA 1K7CA 1NBMA 4QOIA 3MS4A 4YMHA 3DEKA 2G25A 2VP2A 3LPDA 2YJ4A 2VUUA 1SUDA 3WGYA 1FZTA 5LA6F 3WDLA 5F1OA 3ER6A 5T6MA 1DEAA 2A33A 2X1LA 2XF8A 2ZPTX 4XFDA 4CHGA 1GNPA 5E9WA 2NUBA 1MENA 4PSUA 2GERA 5K9ZA 4Y9UA 1NW6A 2R6GA 3VZCA 4BCCA 4CFZA 1KQ3A 2IW3A 3MAJA 3Q3GE 2ZIZA 2F00A 1RHQA 2PTHA 2PZAA 3NIWA 5J2UB 3P27A 4UZSA 3GRZA 2HXSA 1RP1A 1F60A 1BZYA 1K1EA 3OX1A 3HBMA 1XTTA 1WXWA 4D25A 3SQOA 1C3EA 1TC1A 3JVDA 3KLPX 3NGXA 3G2KA 2PU7A 4HQKA 4II2A 1SXJA 3UGQA 3E1GA 4TTVA 1CDEA 3EC2A 4RVUA 1N5OX 3TIIA 2FE4A 1NY6A 5KYWA 4UDYX 1E7QA 3UOWA 1Y7HA 4XXHA 3OCUA 4EKDA 4TWJA 2Q0HA 3WWDA 4OHFA 621PA 3TVYA 2LGJA 1E98A 3ANYB 5DTMA 4NARA 1MC1A 3UAWA 3SVZA 4AN0A 3NHMA 4OYLA 2GAJA 3QKTA 3VBCA 1SXJC 4R83A 2RMKA 1HNWB 1E7WA 4DVJA 1TUBA 4KAXA 2WQZA 3WS7A 5IM5A 3AY0A 2GJKA 2J3LA 1ESEA 2VZEA 1MRZA 4R2WA 3U3DA 4DMUB 2ST1A 2XVXA 2YHAA 2JGKA 3RFTA 2W2XA 2H54A 1I3NA 3FH0A 4R2JA 4DV6B 1I3OA 5AHWA 5EQJB 3PF9A 4KITB 1AHNA 5EWLB 4FS3A 2WWTA 1JHYA 2HU7A 1SVUA 3LUFA 1JXAA 4RJLA 4TT3D 1XD2B 4FYYA 2BF7A 3B12A 3OMWA 1IPFA 3P52A 2OXEA 4UUQA 5DGCA 3TRJA 3VSBA 4HWOA 4EKNB 4N9QA 1SOWA 4N5MA 4NG5A 3RVBA 2EFGA 2EQ5A 2R86A 1LI4A 1XZEA 2V4ZA 3IB3A 4IFBA 4ZCSA 1KOLA 4EG6A 1HETA 4NHOA 1J5PA 3VR3A 2QBYB 5FEMA 3VR5A 4W99A 4WKPA 2IJGX 3IA2A 1N2SA 4GSLA 2XTZA 1GGVA 4FKBA 4U7GA 3SF8A 3T3GA 1L4KA 4XSHA 2QM0A 3I28A 2ZRMA 4PBTA 5FO0A 2WP8J 4JB0A 3U1VA 4A7PA 5IRCD 5AOVA 4OJYA 1RI4A 2NMVA 3PUKA 2GWRA 3RYIA 3FYHA 1J8MF 3RQSA 2B6NA 2FCRA 2X9VA 3D3JA 2DBQA 4HDMA 3QUSA 1UBJS 2C57A 4FMCB 5F1YA 4F21A 3QVGA 4WVLA 5FBHA 5CDHA 3R9WA 3QHPA 2AKEA 4MKXA 1SU8A 3M3DA 1DJLA 1C9KA 2ZSHA 3JWGA 1DEOA 1R0KA 2B1IA 2FQXA 4C30A 4BJ1A 1S0UA 2MSLA 3IT3A 4TKVB 2V6IA 4YLEA 2G0TA 3VKUA 4AY2A 5HKBA 2ZRLA 1P9RA 4ZAZA 3E7WA 3OHPA 3SKXA 2OE2A 1LLUA 4YRRA 5IF9A 1JI0A 4JUBA 2P9ZA 2HPVA 4LUCA 3WI7A 1XNQB 3VSCA 1JDSA 3MTDA 1TK3A 2R4TA 4Q01A 4DQLA 5JI3E 3HDQA 1NBIA 2EDCA 4HNAB 3BHJA 1QOQB 1TT7A 3OQ1A 4GX1A 2Q99A 4PWZA 1EG2A 5C7IO 4UDNA 1ULZA 3UAYA 5ICMA 1G5HA 3R7AA 5KNBH 5KTTA 1R5JA 2NNLD 4I6GA 2AN3A 1U7XA 2OG1A 2DTDA 2I1LA 3E18A 4PAMA 4L95C 1ZUWA 2XYPA 1TA4A 5JOQA 1CF2O 2O07A 3FF4A 4BC1A 2ZUVA 3EF1A 3UKJA 5CM2Z 3A4IA 1YI1A 3T5PA 1TQ6A 2J87A 4ID9A 2C7VA 3OTIA 3G13A 2YNMC 3MIZA 2MIIA 4IZIA 4LDQA 5CH8A 4EECA 3TM4A 1EJBA 3COPA 1X77A 1XGKA 2FMUA 2Z5GA 4UDOA 3DZKA 2HF7A 3I34X 1D6NA 1VHLA 3O26A 3N0RA 4ZVQA 2FR1A 1QP8A 1VLMA 4P3PA 3D7LA 1Z29A 2G7MC 2H63A 3HYSA 4MS3A 1PE0A 3OIDA 4K9QA 3NHSA 1R0RE 3P9NA 5KSZA 1CUFA 1RYYA 1SCUB 5GJCA 2RGRA 2PTGA 2G28A 3M89A 2WYVA 4GMFA 4IJWA 4LVUA 5LMZA 3S81A 3JQ7B 5IKXA 4LZZA 3NPMA 2M2IA 1J0CA 3PPXA 1TZBA 1L5YA 1MQ8B 1Z2EA 1CR6A 4P58A 4MI1A 4Z0PA 1ADYA 1VI2A 5CB6A 5GVSA 1NW9B 2X5XA 2C3MA 4TQ9A 4DYDA 1KF0A 3WL3A 1Z07A 2E18A 2FMXA 3C48A 2AK2A 3FTCA 1YVPA 2X0FA 3PR3A 4PYIA 5EZYB 2H7CA 4LNUA 1RJWA 1AV7A 2YJNA 2AV6A 1Y9DA 1UP4A 1YL6A 3TK1A 5A06A 1V1RB 1BEUB 3BCUA 3VC2A 3EGOA 1QTIA 2Q2OA 4ZVSA 3RVRA 2PDAA 4LJ4A 3ZYZA 3CMCO 3ADBA 4D8TA 3E8XA 2O3JA 1PHPA 3L7LA 2GM5A 3CZCA 3MCZA 2XNJA 1BD4A 1NIJA 1JFFA 2HBZA 3E9CA 4JCCA 3RVSA 1M5UA 2XT9A 1YTUA 1Y1SA 1CDOA 4KV9A 4IGFA 4RMNA 5E2BA 4CIWA 4E22A 2B2XA 3V1TC 4TLEA 5BVHB 4J7UA 1W1UA 3DJFA 1D1PA 3SC4A 1JU3A 4ZJYA 1ZBDA 4ARZB 4W5NA 2A35A 2OGUA 3OU6A 1ZG3A 4N18A 1J0BA 2H16A 4P7GA 1Y9EA 4BX0A 5KTSA 1I9GA 4AVYA 1Z5VA 5JZBA 5ALFA 3C43A 3ISTA 1DJQA 2D2VA 5ICCA 2OY0A 4KO8A 4R05A 4K3UA 5L51A 4FDMA 3BILA 2FOXA 1P4SA 1SU6A 5BN4B 1P6XA 1JA9A 3NRJA 4QXPA 3ENQA 3G1UA 1JZSA 2YWRA 5AM3A 3A6DA 3INRA 4EARA 3NT4A 2ZK7A 3NWPA 3PXUA 1C30B 3QLEA 1VHTA 3AP1A 3UN1A 3ZHVA 5HZKA 5JMOA 5JXGA 1I4EB 1GLGA 1ETUA 3A06A 3T3NA 4QTUB 1TZKA 3AB7A 3PK0A 4JYCA 3EDOA 4YJGB 4HNUA 4P4SB 3C1TA 1H9BA 2DJIA 2PSJA 3FROA 5BQFA 2GEKA 1KRWA 8OHMA 2WILA 1ZGAA 3T54A 2W2KB 3PUZA 1BMFA 2WT4A 2B1RA 2FDRA 4QOHA 5KWSA 5IK2D 1B7GO 1MT0A 4J29A 3TVTA 2WDZA 3WLSA 3NRBA 1T2EA 2Y71A 1XLUA 4MWTA 4U63A 3ORYA 3M82A 5BSEA 3S1SA 4R84A 3UV7A 3CF4G 3QKRB 4TUYB 3CZRA 4TXJA 3M5DA 5HGJA 4DM4A 1L5OA 2HM7A 2Z95A 1I94B 5DGTA 3BMQA 3C15C 5F52A 4ENRA 3DBOB 3CZMA 1GPJA 4DHWA 1FC0A 3NX4A 5FOQA 1DWQA 4REQB 3TTXA 5C51B 1J09A 1C3OA 2HDHA 3LXMA 1AKNA 3N5CA 2R7AA 1EU1A 1IHPA 1J7KA 2WFZA 1KJYA 2XH8A 1YRLA 4DRYA 1NT4A 2CFCA 1IZZA 2J0VA 1RRVA 2YJ3A 1FVXA 1QVVA 3E1KA 1O89A 1UBOS 1TM4E 1H2FA 2WJ6A 2DQSA 3TDNA 1C4KA 3U4CA 5C35A 3EH1A 4ZMSA 1AZTA 3HG7A 1M1NB 3KWFA 4OL9A 5A0FA 1W0JA 3RAEC 2W2NA 3EIXA 1C3JA 1QHHB 1KI3A 3GHHA 5DX0A 4J2TA 1I7PA 1WDTA 2NPFA 4BIIA 2GRAA 1JSXA 3AEQB 2OQIA 1H1LB 3BXFA 2PN1A 3GEEA 4COKA 4YXFA 2OWEA 2B1GA 2OO5C 4AY5A 3TPZA 5AM1A 1C0KA 2DM6A 1N0IA 2RGEA 1MV8A 3GEHA 4R1OA 4YCMA 4MI9A 1V6AA 3JRXA 6REQB 5L3VA 4M1OA 1H05A 3V1LA 3VDMA 3IUQA 5JMWA 1VG8A 1YL5A 4LGYA 3WYEA 3G1TA 5KPDA 1SIUA 5IU6A 2X13A 3H5IA 1XZQA 2ACKA 1L4YA 3MSCA 1CP3A 3NXKA 2RI1A 4EG5A 2E85A 3K2EA 3IBYA 4PBSA 3L7KA 2OCIA 4KLNA 1J1ZA 2XMQA 3S7TA 3W3ZB 1PT9A 5M5BA 3EZ7A 4OLJA 3OLWA 5FWYA 1TTPB 3DA8A 3OHSX 4MYHA 5CCDA 4DLVA 4I55F 1E6LA 3CLKA 5JH7F 5C5DA 2Q6KA 1HDZA 4MZDA 4ME6A 4LF7B 4P2GA 1K5DA 3UPDA 4B3SB 3HCWA 4N0MA 4X3PA 3VPBA 5K4HA 5KQPA 1MP0A 1CEXA 3JR3A 3GRPA 3IIJA 4M60A 1C0IA 4FT4A 3QLTA 4R9RA 3SP1A 3GL9A 3TTWA 1QFXA 2IDKA 4KQFA 1LFDB 3IAHA 1UMKA 2A5FA 3F4LA 3WIUA 2C31A 1THGA 3KQQA 5DI3B 1GZUA 1ZHFA 3TOZA 2JI9A 1SVIA 1U6KA 1Z25A 2FZVA 1DQNA 3RSOA 3H86A 1YBVA 5KVSA 1L4GA 2AKAB 1E60A 3N6RA 3QQPA 4OI2A 2FU5C 2QR3A 2IDZA 3R09A 4MVJE 5TF4A 4BZPA 1Y5NA 5TMEA 3U7FB 4Q1DA 4AJIA 4B75A 4BKOA 2F43A 4M36A 4HI0E 4TMXA 2BFCA 2C9OA 2RFLA 4V2UA 5DN9A 5EXTA 1G20E 1XRNA 3FRHA 3IQEA 3PUXA 3REQA 2QORA 3PPWA 1A9YA 1J8YF 3PDJA 2GGSA 4EOGA 1R5OA 2X5NA 3BUSA 1BU5A 2NUTB 1ZOSA 3IHTA 4HATA 1OYOA 3JY6A 5FTKA 1CVRA 3QOXA 3MIIA 4MR8B 1JEOA 5HSGA 5GOZA 3S4YA 3TZCA 1E0AA 3IEXA 1WW8A 2BHLA 3DWGA 3DYVA 4YQFA 3VU8A 4DR3B 4XDGA 3EPHA 4YMSA 1EH5A 4GMGA 4WZAE 4C08A 1VG9B 1KDTA 5CFNA 1OH8A 4LVCA 2W2QA 2WVAA 5JCZA 1Q44A 1A9ZA 4MPPA 2MYNA 2PL9A 1QGAA 2FA9A 3TRKA 5I47A 2G8NA 4S2EA 4JB8A 2HWXA 2CWDA 2TMGA 1C7FA 2ZQ5A 3HUDA 1AKYA 3EVTA 3HY6A 3OECA 1PYDA 2E7ZA 5HJ2A 4FB4A 3P2OA 3X1MA 4DDTA 3GLGA 4A2WA 4R8RA 2I66A 4A03A 2ZUFA 2I03A 4TZKA 2W6JD 1M83A 1YQWA 2F1HA 1GCUA 2ADMA 1N3IA 5IJAA 2C88A 3ECSA 1KZHA 3VMMA 4CG0A 3ZDRA 1F0PA 3NKLA 1O94A 1T5DX 3V1MA 5G4KB 5CNKA 4FFSA 4G5HA 3GIWA 2NW6A 4IIJF 4EG8A 1SZJG 5HRCA 3H1GA 1CCWA 2AI2A 1TUEA 3OUUA 4IDFA 2CXTA 3FWNA 4L2IA 1ZD2P 1L6IA 3OF3A 5J4KA 4AC9A 1KYVA 3ADDA 1UXIA 1YZQA 4Y9DA 1Q74A 1O94C 1DTWA 4XE5A 3VNSA 3JQ8A 2AXQA 2OGZA 3GEGA 4V0ME 1OKKA 4WOPA 3V4RA 3P2KA 1ZNXA 3JU3A 2XCSB 1XQ9A 2D2IA 4TV9F 2K6GA 3MUOA 4XW2A 4PCAA 1Z37A 3KB6A 4PLFA 4ZDJA 2ZIWB 4MYRA 9LDBA 1RKVA 3G79A 1NW4A 3Q0EA 1O6GA 3HCDA 3LOUA 1IQ0A 2Z1NA 2P0YA 5AW5A 2A30A 4JLNA 4WLEA 2Q1YA 3VX3A 2Q49A 3W5IA 1RYEA 2GZRA 4WBXC 5MGBA 4DLZA 2H2AA 2V6GA 3DR5A 2PKEA 2V7PA 3OJ0A 5DIZA 1E7MA 1GU1A 4RQBA 5GONA 5IT5A 2ZVDA 5GZ3A 1QE5A 4W1SA 2WUEA 5HG0A 4YMUA 4LJKA 3NGLA 2WHRA 4U39A 1RLIA 3HC7A 3GDHA 4JYAB 2C2YA 2EJCA 3GLQA 2YYSA 2PXHA 1L4LA 3OWXA 3HVKA 1N9GB 3HM2A 2QQFA 4FZJA 1KI6B 4OOFA 3QVSA 1I10A 5ESRA 3HLYA 3D5QA 1FTWA 3NTLA 2AMYA 3V34A 2R6DA 2XDAA 3FR7A 3I6BA 4YACA 2J9YB 5JRDS 3CZ5A 2GK6A 4RY0A 4LBWA 4NDAA 5IMBA 1GPAA 3UMVA 5B3JC 1Z8NA 4GF5A 2XWBF 3PX2A 3ZU6A 4PYNA 2L18A 3I01M 1JU9A 2PU5A 5H0IA 2GYVA 1IHOA 2EFCB 2VA8A 1M2NA 2PFSA 1SBCA 1BDMA 1JTEA 2XXJA 1JPVA 4IDQA 1K8ZB 5GGYA 2E5FA 1ZD1A 3GJ6A 1EKXA 1TAQA 1U2ZA 3I5MA 1AKEA 3P0EA 1ISHA 1DBQA 3I9V6 4FMDF 3T5DA 4OYYA 2B1QA 2FW1A 2ENUA 2OQRA 2WKWA 3I76A 4HDAA 1R2QA 1T25A 1ZD4A 3R23A 3B7GA 2PGOA 4U7TB 4U2GA 1L7VC 4LHEA 3VO2A 5F3DA 2RCNA 2OUKA 2EVWX 2VATA 4PZPA 4X60A 3QMMA 4X1YB 1C8KA 5K3FB 3ZVKA 2F62A 1W44A 4RBNA 4E07A 4K0KB 2M6LA 3ANTA 1YB4A 3BWEA 4UNRA 3SGLA 1MA3A 1VG1A 1PGPA 4OOEA 4HT3B 2E4XA 1D2HA 1YB7A 1BTOA 1X8JA 3CW8X 2I3BA 4RZXA 3D6VA 4JV5B 2VJCA 2FY8A 1E32A 4JI4B 2C5GA 2YC2C 3BE8A 3P9ZA 3SSNA 2XCUA 3VH1A 2BEVB 2CY0A 2Y9PB 3WBFA 3B1YA 1K63A 4CM9A 4LFBB 1BMTA 3GYBA 4B6GA 4JLJA 4QTXA 2XNKA 1PTJC 4ZPXA 4C3ZA 1QRTA 2RH8A 1XZBA 3DPIA 5F9FA 3F71A 3TSYA 5JO0A 4TMWA 3FR8A 4C5CA 1QSGA 5HQ3A 3K1AB 1QVWA 1KH1A 2FP3A 3KR2A 5IDYA 4X62B 3BIFA 1D0VA 4Q37A 2YJTD 5CFPA 4KUGA 2Q5IA 4XCQA 4D0SA 4BE4A 2DHQA 2GSDA 5HK9A 4EI9A 1KQFA 3A4TA 3GLIE 4XUDA 1LWNA 1SUBA 1PGOA 1Z75A 4QYSA 4A4DA 2XB4A 3FUCA 1SY7A 1DQPA 4LWOA 4EL0A 3DAOA 4BC0A 3I39X 5A7FA 2QDKA 1A2KC 1FP4A 3CXUA 3M7IA 1RADA 3KS9A 4FDVA 3IIEA 4KZPA 2XZLA 4BNFA 4AS1A 2W6QA 4EJFA 1DAHA 4GBMA 4LWPA 4YS6A 5TQ0B 1CF4A 4H60A 2GILA 2IXEA 4I4CA 1SQ6A 4GIBA 4RF4A 4FYJA 3AF1A 3QF4A 4ZEXA 1TZJA 4ESOA 3R3ZA 3JYOA 1RC1A 1YJXA 2C5LA 3C1AA 4FSXA 2PGIA 4JDUA 5K3BA 3WY9A 4BFZA 1FMLA 3FCAA 3KTAA 2BFDB 3FGOA 3OT1B 1E99A 1AQUA 2XF2A 3BD6A 2GM3A 3W7BA 2WBLC 1MX1A 4K1LA 2ZJ8A 1YDHA 4OBXA 3BXOA 2P9BA 3L1UA 2ECPA 1PQUA 3FVRA 3O3NB 2OC9A 1MJGM 3Q2KA 4KKXB 4OHRA 2OUIA 1RWWA 3ANNA 1KXJA 3U7EB 3OP1A 4RABA 3ETHA 4BVBA 4F72A 1A7JA 4KXQA 1E5VA 3BXPA 1G55A 1BFKA 1DRWA 3CX8A 4OMCA 4CM8A 4FEGA 3U81A 3ZWPA 4E08A 4KH0A 4ZANA 2QZ4A 1JQAA 3CN7A 4OA8A 2VO1A 1DAKA 4PG5A 4XJSA 2HA2A 4EGQA 1LPMA 3CX6A 4XD2A 1MFPA 1QB7A 4M1TA 4ZOEA 5JC1A 4GRAA 4FYHA 1K06A 2GZMA 4V2IA 1NN1A 1Z0AA 4A1OA 3BTSA 4M0FA 1RXVA 5CXUA 2PO7A 4TL8A 4GDFA 2PZMA 2V8BA 2G5PA 1M1YB 4EWLA 2HSGA 1PV4A 4O2LA 2R5FA 4XPIB 4HX5A 2IPXA 3G6KA 3SJCA 4CCSA 4ESHA 2QYTA 5AW8A 1XAHA 2QV0A 3LFHA 2NSLA 4EJSA 2O7NA 3NIGB 4KGDA 2C9CA 4PX5A 3HADA 3R2JA 1UC8A 1HT3A 1DG3A 4QDZA 4Z9YA 1UF9A 3WKBA 1IHUA 1TVKA 1OVGA 1F51E 3C8MA 2C2XA 5FUXA 2HH9A 5F2EA 3UWPA 3KB2A 5LDGA 1NA5A 5DHTA 4F9FA 2J09A 3W2GA 4EY6A 4D9NA 3N2GB 2CXOA 3H1FA 1QR6A 3BJZA 3LGSA 1HEYA 1JT9A 2XGOA 3AUYA 4PLWA 2MCFA 4FN4A 4QREA 3U40A 4DA0A 5KINB 4RPCA 3ZDCA 2ADFA 3PNVA 2BELA 2O2EA 3NEYA 5HK8A 5U1PA 3UK7A 2CBXA 2IIBA 2JFPA 3JALB 1EWVA 1GILA 2F6RA 5HS4A 4FE4A 3ONFA 3ACBA 2YHUA 5GQSA 1SQ5A 3IERA 4MJ3A 5GZ1A 2VUHB 5KNBD 3GP8A 3W34A 1DJNA 3N8HA 5AFSA 4B33A 3B52X 3TW8A 4S2UA 1Y1PA 1JPUA 5LKRA 4WHMA 3JARA 4HPWA 2EW2A 2WJWA 4RETA 3E53A 1G19A 5ERXA 5J2TA 3LM8A 2GBLC 3IKLA 4RH0A 2H4FA 4GP7A 4YAKA 3WHLA 1U31A 2B36A 2HV8A 3FCOA 3T4EA 1AQYA 3ZZNA 2JKVA 3RKSA 4XM1A 1RABA 4GBGA 4XDHA 4IFIA 3CYFA 1YC5A 4URWR 4JHLA 4OHMA 1J97A 1JJBA 1GJRA 3R3WA 4KQIA 1SO8A 3OOYA 3BEDA 3Q4GA 2ALJA 4J7XA 5DTQA 3BK2A 1HWYA 1B0PA 3VH2A 4BZWA 4J0DA 1CQWA 3AYXB 3EBLA 4KAJA 4K05A 2VLBA 3KQPA 5COAA 3M9WA 4LF9B 5C8YB 4BTLA 3O83A 1ZVJA 4KTTE 1GTZA 4OGLA 3W6OA 1P2SA 5A04A 2ZRPA 2JFWA 4OQLA 4UUMA 3U62A 1ZKDA 2GCIA 4G26A 4JL8A 1U2TA 3A6FA 3KJXA 2E4ZA 4OV6B 3B3AA 4S0XA 2JGLA 5EMLA 3TNLA 2ZPUA 4HAZA 4JEMA 1RRPA 4HB2A 3GLFE 2YZGA 2HTFA 2AEEA 2NTVA 2P9YA 3NUGA 1CKEA 4M0KA 2XADA 2NZJA 3OFVA 1LC0A 4MXDA 5J2UA 2DUWA 4M22A 1RM4A 1G20B 5B7NA 2IS2A 2X1MA 1Y6JA 4C4RA 2NYUA 3G9TA 4FEAA 4JLSA 4NV1A 3GNSA 5JZSA 2XRFA 4EELA 1U0HC 2IU6A 4GOXA 5ESXA 4OH7A 3K92A 4P86A 4KR6A 3PKIA 3ANMA 2XMZA 1ZVMA 2PH1A 1YIDA 1UKAA 1IWBB 1PNQA 1P2VA 2WE8A 3LW8A 3P5SA 2DWUA 4ITUA 2AG6A 2Q7XA 4M86A 4QU9A 3SEAA 2CCKA 5IBPA 1OFUA 2QVCA 1FW8A 1JHVA 4AY3A 4GGOA 1ST3A 1AHIA 2R7MA 1J8FA 2RHGB 1O9HA 4WZAB 5ERYA 3JQCA 4W1RA 1O0BA 4C6SA 2XIJA 4JX9A 1M6YA 4DE5A 3BRSA 4PO1A 2X7XA 1BCSB 3KE8A 1T1RA 2CXHA 2H1IA 4YRIA 4RM2A 1JDTA 3SHOA 1UZMA 2JD0A 4FOOA 4L8VA 4S1PA 2AYZA 1ORWA 2FN8A 2RHHA 2ZR0A 2ZTLA 3NR2A 1JXQA 1D6JA 2LXNA 2FJPA 4OF4A 1TKCA 4RCYA 1FFXB 3NNSA 1ZOPA 4HRXA 4J0CA 4B5LA 3OUZA 5A6SB 1KVQA 5F21A 4Y30A 1HQDA 5IVIA 2OB2A 1B8VA 2OCKA 3LLUA 3NKVA 3P9RA 5AJVB 2I33A 3EWIA 5ETJA 1E7RA 3UUGA 3DXXA 3MBIA 1B43A 5EWLA 1J90A 2OMEA 3LAWA 3DNPA 3EEYA 3PC8A 5AJYA 1I7SB 1X7WB 3SC2B 1XD2A 4X1IB 3ZWAA 4ZHQA 1CNFA 4K9NA 1AGRA 3T9DA 3WBJA 4MB6A 2C5AA 3ESXA 4BOYA 1JR4A 5KAMA 1I2CA 1O97D 5G40A 1SVMA 3F7MA 1GGJA 3D1JA 2XGMA 3NPAA 2VDKB 3IBCA 1I33A 3I8OA 4KR9A 2QBYA 2ZVJA 4DIEA 4GW3A 3RC8A 4K26A 4L0MA 2A1UB 2I6FA 1TTQB 1UPCA 2IEDA 2OHHA 1CZNA 4QSMA 4UUPA 1B00A 3PQDA 4J0EA 3SNHA 5JWHA 4E11A 1UKYA 3RRFA 3TOSA 1ULSA 4A0SA 4C4OA 2VSXA 3O73A 3SHTA 2G82A 3UUFA 3P20A 5EMJA 3WMEA 2X0EA 5B55A 4RCZA 3WGOA 2UYYA 4Q3NA 3CTMA 5BQ3A 3EYAA 3NH9A 3KZNA 4RPLA 4HNVA 4H08A 9ABPA 4N49A 1L5WA 3MSXA 3ES9A 3L6UA 4B4WA 4DARA 3WK5A 4KGXA 4TKVA 4LF4B 1NRJB 1RLOA 1BXRB 1AD2A 1Z2PX 3NHFA 1ZINA 4J0HA 1DIGA 3GFSA 1ZESA 2YCLA 3LBIA 4WKOA 1PDOA 5D3ZA 5L7TA 3V55A 3CVVA 2YVQA 2Q1XA 1SELA 4G4JA 5D8DA 3MGBA 4MOWA 4HNAA 1E9RA 3PIIA 5E2AA 2PUEA 3ZDDA 3O8CA 1ECGA 1EDBA 4O4LB 2GN1A 2JIRA 2NVBA 4B0PA 4S1TA 1WB4A 2B35A 5EXSA 1ADFA 5T64A 4E15A 5K09A 4ETNA 3HPQA 2PAAA 1E3IA 1O9GA 1OLSA 3C85A 3KWJA 3LT2A 1RQPA 3ND7A 1Q5PA 1Q57A 2Y67A 2VZ9A 4MW2A 4UMFA 4MUFA 5DX8A 2JFOA 1MRSA 2OR3A 1D2EA 3C6BA 3AHIA 2XA2A 1OYWA 3FN4A 4WESB 4DJAA 2WA2A 3LDAA 1QGED 4R1MA 1Z73A 1HE5A 1T6BY 4EFLA 4D82A 3INTA 2D1FA 4RA6A 2PKQO 4RE6A 4BMPB 4DY4A 4F38A 1G8FA 2ECFA 4X8LA 2IUSA 4HYYA 1ZK4A 3BQMB 1XVIA 1UWLA 5HYVA 1KFEB 5C52B 4KGZA 1IYZA 3FTFA 4MA4A 4ZOAA 3L3BA 1K0FA 3W1EA 5IP5A 1GO2A 1U7ZA 2ET6A 4EHBA 1NBAA 2VRBA 1VB5A 2XOXA 4MWCA 5JCJA 4DCMA 3LUDA 1QYDA 1XMIA 1YR7A 2KB0A 2X19A 1OBCA 3KYJB 3DDCA 3L7NA 5ADVA 2YZ2A 1KOJA 1U8TA 2IOFA 2QB5A 4LRWA 3V1UA 4KR0A 5PGMA 3BGDA 3GXOA 1C4OA 4CGZA 4AO6A 4AT1A 4QAJA 4EHFA 4DLWA 1X0XA 1PZGA 1DJMA 4JLOA 3S2GA 1CUBA 1L7BA 1WSWA 2AUTA 4G9EA 4H4EA 5AXDA 2B7LA 1EVZA 4C6RA 3NWBA 4LHXA 2A0UA 1M67A 3R5XA 1HYEA 3RS2A 3UH0A 1X7ZB 2NV0A 4GWKA 1ECLA 1Q84A 4HZIA 3AINA 3GQVA 1K0UA 1KIMA 1AQ6A 3T52A 4OHVA 1X3SA 2HREA 2QE7D 4Z5XA 1OIWA 1LSJA 3RI3A 4JBXA 5F7JA 1Z6TA 5EZYA 1SHLA 4F84A 4BGIA 1V1RA 2KLHA 4FCVA 4DIKA 1JL3A 5LBIA 5DOVA 4FEEA 1NYQA 3NGMA 2K87A 2QKYA 1EFVB 3AUKA 3MQFA 1IG3A 1IIBA 2QENA 1C9YA 2IY9A 3ICPA 3M5CA 2PGXA 3NBMA 5HF8A 3VR5H 4NBUA 3WYCA 3I45A 4KP7A 5IAJA 3QVLA 2QR2A 3GLIB 2IW1A 3GFBA 5BVHA 1PL7A 1XAIA 2J3IA 3W1VA 4N6GA 2ZAOA 2O8DB 3H9UA 1K6XA 4ARZA 4X95A 4HEJA 1GSHA 1KK3A 2A9RA 2CL0X 1RWMA 2NZXA 1XEXB 4YB8A 2GJ4A 4GXQA 5DZSA 1P7YA 4B3HA 4ML3A 4IXMA 1MQ9A 4UU1A 3KU1A 1NUSA 2KX7A 2W2LA 3DHWC 3E9DA 4NX2A 3FOWA 1W2GA 1KH2A 3I04A 3S1AB 4D8VA 1EAMA 3BGSA 2HC9A 4RHXA 1ZI8A 1VE9A 1ZM4A 1C30A 2H8KA 3KSZO 4IX9A 2Z56A 3WSWA 1XVUA 3ZLTA 4RZUA 4ZJZA 2XUPA 2ZJ1A 3R20A 1XALA 4WFJA 5KWEA 2VHEA 2QP4A 4UZEA 2EGGA 2GO1A 3I6IA 4YJGA 3U3ZA 2QZ9A 5LQRA 2K4MA 3RKUA 2D0DA 2DQ4A 4F2GA 3NYWA 5EAIA 2NVUB 1MLDA 4BO0A 1ILWA 1PT7A 2NQ8A 2W2KA 3LYUA 3WLQA 3W06A 2Y1OA 5FDFA 3UJBA 1YQEA 4F12A 2QLLA 2AF3C 2G63A 4PPNA 1SKAA 3UC9A 2Q8PA 1OGYA 4RAOA 1V95A 3NM4A 1GNVA 4WGGA 5G1PA 3OX3A 4EW3A 4DILA 2OA0A 3C7DB 3N2EA 1NC3A 1OA1A 4QJBA 4GEGA 1DV2A 1M6HA 3R1IA 4KMOA 3NBQA 4PVDA 1K7XB 5EIHA 4AQYB 1TT5B 2B0CA 4YMGA 1GRRA 2AN4A 3QKRA 2VDQB 5DM0A 4EHDA 4BV8A 1F3LA 5JD3A 1HTTA 4Y1FA 1PHRA 2I7TA 2IBMA 3EXHA 3H9BA 3KSRA 4REQA 5EC8A 5I9TA 1PO7A 4X94A 1JNXX 1PFUA 3Q0IA 1CUVA 4PLPA 2A14A 1QG0A 3PTZA 4QRHA 1E9BA 3NHRA 1NXWA 1DBVO 3QLVA 2J0EA 2ZJAA 1SCIA 1UOQA 4FBLA 4KFSA 4OSEA 3JCZA 1Q1ZA 2A1IA 5A7HA 3R7WB 2VK4A 1M1NA 3DQZA 2Q0SA 4ZN6A 3KSAC 3GD5A 1NNUA 5IS2A 4R3NA 5F98A 1T0BA 4A0RA 4H1HA 1F1BA 2GAAA 4JELA 3HS3A 3AEQA 1H1LA 1CUWA 5J5VA 4FLMA 4F5ZA 4ZOQI 5I51A 3V80A 5JVDB 5U4XA 3H1AA 1KPIA 4A1FA 5E38A 4FFVA 4KSYA 4Q1AA 4JROA 4BBZA 4HDKB 1Z3CA 1G3UA 1UKZA 4KXUA 4IJQA 3S70A 3VNQA 5AUNB 6REQA 2VCEA 3L05A 5CT6A 4X92A 4PSDA 2J7PA 4G8CA 5T57A 5C81A 1ICIA 5B6IA 2F3QA 2O3QA 2OFXA 1I2MA 1U0GA 2XMBA 1N1EA 4MO9A 4GSYA 3NHKA 5CD9A 1K68A 2IELA 3HUUA 2JDID 4ONEA 1AMUA 4DXDA 4QOFA 1CZLA 4FZVA 1J2RA 2L19A 4INPA 2IEIA 1OREA 3GJZA 3I2JA 3WMGA 1L2TA 3AJ9A 3IXQA 3O03A 3JPWA 3CVJA 1F4LA 5I4IA 2YYYA 3G2PA 4MRNA 1L7DA 3VSAA 4EJMA 2QYHA 1D2RA 1OR8A 1A3CA 1U9CA 3MTBA 5C8ZA 1Y5MA 2KBFA 2B30A 2H51A 3A9CA 2QTHA 3QXSA 1D04A 3PSHA 4OQZA 5DI3A 5AQ1A 2VPYA 4EJ0A 2UUBB 2PL1A 4DCTA 5KYUB 4Y6RA 2AXEA 3MC1A 2HLPA 3KOWA 4YDSA 4M0DA 4K03A 3T7SA 3QW4B 2R2AA 1TMGE 1GQ2A 5CB0A 3DGEC 5TEVA 4G0OA 3TZEA 1KQOA 2JIZD 2WEKA 5LQNA 5LU8A