5E9WA

Crystal structure of mrna cap guanine-n7 methyltransferase obtained by limited proteolysis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
310
structure length
273
Chain Sequence
b'SRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Molecular basis of RNA guanine-7 methyltransferase (RNMT) activation by RAM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 273
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5e9wA00
4RSRA 1ZGJA 3FUXA 2CWWA 3KQWA 4YMHA 3JWJA 4YUXA 3HTXA 3PLAE 3KQQA 1JQEA 2P8JA 1B42A 5BP7A 3HCEA 1D2GA 3G2PA 1Q0TA 5DM4A 3B3FA 4QQNA 1KHHA 1G8AA 1TW2A 5LQAA 1X1CA 3CVOA 5DSXA 1KP9A 2Y1WA 2UYHA 4LWPA 2CMHA 1RI2A 2ZWVA 5DX1A 2YXLA 5EEHA 3KHKA 3HP7A 3RIEA 5CUQA 1KYZA 4JXJA 4YUYA 1DCTA 3U81A 5CVVA 1G60A 2PT6A 3FUWA 3KR9A 5ICFA 4OQEA 3VSEA 4DMGA 2ZZNA 4DCGA 5K0LA 2YX1A 3OZRA 3KQMA 2H00A 2IDJA 3KPYA 5EHGA 1FBNA 2AOUB 3OZSA 3TOSA 1P1CA 2P1DA 3CJRA 4GEKA 5FWAA 4C06A 1QAMA 2IIPA 3ANXA 3P8ZA 3OU2A 4RVGA 2GH1A 3A25A 5EOVA 3B3JA 2OBFA 1P91A 5E1MA 5GM2A 3PFHA 1WZNA 2AS0A 5DXJA 5GIOE 2YXDA 2XYRA 3P97A 4G56A 2E5WA 4RWZA 4C04A 4GOLD 4P7KA 5K0GA 2OPBA 2PSSA 2ZZKA 3LDUA 2NXNA 3C0KA 3DLCA 3C6KA 4QVGA 1NW5A 3B5IA 5GOZA 1SQFA 3FTFA 2CKDA 2G72A 4EQZA 3NWBA 1QAQA 1L3BA 1M0EA 2F8LA 5FHQA 4E70A 1P1BA 2YUIA 2QE6A 1O9GA 3CJQA 4PYLA 3EGIA 2ZLBA 4GBED 2HWKA 3A7EA 4MQ4A 3AWIA 1FP2A 5K01A 2UYCA 3NTVA 5H02A 2PKWA 3BXOA 1F3LA 1O54A 2IH5A 2ZBQA 1JSZA 2B25A 4QTTB 5E8RA 3UJ9A 4AUKA 3FUUA 3I64A 2ZFUA 3DOUA 3MCZA 3LECA 3PB3A 3VYWA 4O29A 2ZW9A 5ICEA 3UA3A 2Y1XA 3LPMA 3V97A 1BOOA 3LDGA 4ISCA 5FQOA 4A6EA 1KPIA 1N7JA 2P41A 4PYMA 1R6AA 5DX0A 3G5TA 5ERGB 1G38A 3K6RA 3GDHA 5DT2A 2VDWA 4Y2HA 4BLUA 5F2OA 2PWPA 4PYKA 5DM1A 5KYGA 4R8RA 2JH8A 3REOA 5KQSA 3VC1A 1EQAA 4FT2A 1BHJA 1KPGA 2AOWA 2BM9A 2OYRA 1YZHA 3QV2A 4AZVA 3CC8A 2ZBRA 3KKZA 5DPMA 2PLWA 1KPHA 4RTSA 1RI1A 1SUSA 3VC2A 4CKBA 3IV6A 5HIJA 3R0QA 1EJ6A 3DR5A 3H2BA 3KPVA 5DRYA 2WA2A 1R8XA 3RODA 4CKEA 2IBTA 4KDCA 4GC5A 4CTKA 8MHTA 1VQ1A 2DULA 5EMMA 2O05A 2FRXA 2G70A 3TM5A 3G2QA 4F86A 4YV1A 4RTOA 3OE5A 1D2CA 5E1OA 5EPEA 4GOOD 5LQCA 2AN5A 5GP1A 3BT7A 3OCJA 1G6Q1 1XDSA 3GO4A 3FPEA 3I58A 3KQOA 2YXEA 3P2KA 3L8DA 3G8AA 5HIIA 1RI3A 2XVMA 5EKUA 3IHTA 4QTUB 3T7SA 2AR0A 2JJQA 5EZSA 5T64A 4XUCA 5EZQA 1O9HA 2AVNA 3R6TA 1MJFA 3UJDA 5K03A 1FJXA 3DMFA 2FK8A 4OA5A 3G8BA 4FS8A 2PXXA 3Q87B 3MCTA 5K0FA 1AQJA 2WK1A 5FULA 4DZRA 2P7IA 4P7JA 3EEYA 5C1IA 1PRYA 3G7UA 5DX8A 3KR1A 3THSA 3FYDA 2ZZMA 2B9EA 2ESRA 1VP3A 3M6VA 5DRTA 1F38A 3SSMA 5LQUA 5DTRA 4DQ0A 5JUWA 3LCVB 1RI4A 3KQVA 4E31A 2PXAA 2IH2A 4CTJA 3BKWA 3O31A 3FZGA 4DA4A 3SSNA 5E8JA 3A4TA 2EJUA 3SXJA 2UYOA 1U2ZA 3BGIA 5CM2Z 5FHRA 3LX6A 3BKXA 3PFGA 1SKMA 2G1PA 4HH4A 3A27A 4X60A 2XBMA 1I9GA 2P7HA 4XUEA 4AZWA 1NT2A 5EKXA 4MTLA 1IM8A 1RJDA 3ELDA 1R74A 3FPGA 3FTEA 4M7RA 3EVFA 1ZQ9A 1HNNA 3HEMA 2QM3A 1ORIA 3FUVA 1X1AA 3NDIA 3Q7EA 5B1SA 5K0CA 4MHTA 3FPJA 3FTCA 2G71A 3JWHA 3X0DA 3UJ6A 4E2XA 5EC8A 1RI5A 2I6GA 3IEIA 3KPWA 4M37A 3KPJA 2BH2A 2QRVB 4U7PB 3SGLA 4QPNA 3TRKA 2Z6QA 5E1DA 5LSAA 5CCBA 2JG3A 3BWBA 5HZMA 4P58A 2IDKA 3G2MA 4OX9Y 3UJ8A 4OBWA 3MAGA 2GLUA 3EVGA 3M6XA 5K0EA 3MB5A 4LWOA 4PCLA 4F85A 2WA1A 4RYLA 2AOTB 1UIRA 2A14A 4ER3A 2NXCA 5CD1A 2R3SA 4LECA 2NP6A 3KQYA 3DMHA 4RVFA 1XCJA 3KR2A 3TQSA 2OKCA 3B7PA 2DPMA 3QOXA 5U4XA 1ZG3A 4E2ZA 3GXOA 5FTWA 5E9JA 4EKIA 1WXWA 2GS9A 1H1DA 5E9WA 5FCDA 4YUWA 3LGAA 4BP1A 4IV8A 3OFJA 3QOWA 3EMDA 4YV2A 2IFTA 3EMBA 2HTEA 3R24A 5D1NA 2ZULA 3TKYA 3B3GA 1X1BA 3CKKA 3NMUF 5K0BA 3ELYA 2ONZA 2O0LA 3CBGA 2V7EA 2PGXA 1L9KA 1SQGA 2NP7A 3PTAA 3SX0A 1WS6A 2O57A 2GAFA 2FPOA 2NXJA 1EAMA 5JR3A 1RJFA 4NECA 1NV8A 3HM2A 5EMLA 4E2YA 5HEKA 3BWCA 5K05A 2IPXA 4K6MA 5F2NA 3E8SA 1YFJA 4HG2A 2C7QA 1OR8A 1NBHA 1FP1D 3DMGA 4RVDA 3SR4A 2P3QA 1JQDA 1UFKA 3HVIA 3AXSA 5HILA 4AZSA 4C03A 2AN3A 4FZVA 1SVUA 4BLWA 2C7OA 1ZKDA 2NNWB 1VBFA 3LCCA 3DULA 5EIWA 3UA4A 4YUVA 4AX8A 1T43A 2Z6AA 3MERA 4OA8A 2OY0A 2YVLA 2HR1A 3A7DA 1YZ3A 4GF5A 4RVHA 1L3IA 4E32A 3GU3A 3O4FA 4HTFA 4P7FA 3SVZA 4UOEA 5GINE 2ZIFA 3JWIA 1D2HA 5DM2A 3C3PA 4DKJA 5FA5A 9MHTA 3E05A 1L3CA 2VDVE 3KQPA 5FQNA 4Z2YA 5HFJA 2KW5A 4DF3A 1N2XA 3A26A 5FADA 2ZBPA 4C05A 2G8NA 3GNLA 3HCCA 4EVIA 2R6ZA 4M36A 3UBTA 1YUBA 2LD4A 4F84A 4GC9A 5K0JA 5LQNA 1JSXA 1XDUA 1G8SA 4FT4A 3G5LA 2QY6A 3HNRA 2C7PA 2CMGA 3GRVA 5EEGA 2OB1A 3HVHA 5IKMA 5D1HA 3T7RA 2ERCA 3ER9A 5GM1A 4KVZA 2AVDA 1EIZA 2BR3A 2BZGA 1G55A 3BZBA 3EGVA 3GIWA 3G89A 5BXYA 3EEOA 4PYQA 1VL5A 3OPNA 2P3OA 5HIMA 5KS2A 1IY9A 3F4KA 4YMGA 3DXXA 5LQJA 1EG2A 1L1EA 5GWXA 3RW9A 4GOND 3BWYA 4RTKA 3ID6C 3PX3A 4BY9E 2B2CA 3P9CA 3TLJA 1V39A 1SG9A 4KIFA 2YR0A 4QVKA 2YTZA 3OE4A 1KXZA 2HNKA 3I5UA 3MTIA 3HCDA 2I9KA 4PIMA 5DLYA 4P7GA 1XCLA 3EVDA 2VP3A 2BM8A 5F2KA 4BLVA 5LQKA 2H1RA 1JQ3A 3ME5A 4R6WA 1DL5A 3TMAA 4C08A 4XUDA 3D2LA 1P39A 3ELUA 4PIPA 2V74B 3GRYA 4IWNA 5E1BA 1UWVA 4KDRA 4IV0A 3DTNA 2GPYA 1QZZA 3T7TA 4MWZA 2XVAA 2B78A 3NVMB 3UWPA 4MIKA 4U7TB 5K09A 1M6YA 2GA9A 2IBSA 4M38A 4PYNA 1FPQA 4ATNA 3HA3A 2AZTA 2JHAA 4WVLA 5BW4A 4RTRA 3KQSA 2NXEA 3UJ7A 2Z6UA 2YQZA 2EJTA 2PY6A 2VS1A 4X61A 2AOUA 3LCUA 5E2BA 5T67A 5FA8A 1JR4A 3AY0A 3P2EA 4V0RA 3NW9A 1XDZA 3THRA 2ZVJA 4Y30A 1YF3A 3C6MA 4DCMA 3EPPA 4POOA 2OO3A 2OZVA 5KVAA 2PX4A 2PBFA 3MTEA 2Q41A 3BGDA 1YFLA 3TR6A 3BGVA 5HOQA 4HRAA 3M6WA 1XXLA 4HC4A 4OBXA 4ER6A 2EX4A 4L7VA 1N7IA 1TW3A 4ER5A 3P9IA 3FPHA 1VIDA 3TKAA 5EQJB 5FWDA 3LKDA 1VPTA 1HMYA 3GWZA 2P35A 1SUIA 5CVDA 2UZ4A 2AN4A 1AQIA 4CXMA 3PS9A 5LQRA 2I62A 2I7CA 2P40A 3P2IA 1EJ0A 5E9QA 3OZTA 5KQRA 3NVKI 3LHDA 2PVCA 2FHPA 2XYQA 2EFJA 2ZIGA 2ZIEA 4LG1A 3C3YA 5GIPE 2JHPA 2PX8A 1PJZA 3IYLW 3DP7A 4X63A 1AF7A 3FRIA 5EVJA 1R18A 4RV9A 4HGYA 4A6DA 3MGGA 3HA5A 4EKGA 3FUTA 2O06A 3LBFA 1NW7A 3E23A 1QYRA 4YUZA 5CVUA 3KR0A 3BUSA 1Z3CA 4ZTBA 4CWAA 4FP9A 4ER7A 5HIKA 4FSXA 3FPFA 3EVAA 1MHTA 3CGGA 5CVJA 2PV0A 4C07A 7MHTA 1WG8A 5CVEA 5IH3A 3DUWA 4HSGA 4WXHA 1R00A 1VE3A 1KYWA 1RJEA 3WSTA 4AZTA 3FRHA 4C4AA 5ICCA 3AXTA 2O07A 2JH9A 3JWGA 4RTJA 1TPYA 2NYUA 4OQDA 3V8VA 4B17A 4RTQA 5DTMA 1DUSA 5EIFA 3GRZA 3HVJA 3KPUA 1JG4A 3EVEA 3ER8A 1X19A 2H11A 3OU6A 3UJAA 3UJBA 5K8VA 4X41A 2VZ9A 3CJTA 1AV6A 1INLA 2AOXA 2JHCA 4EMSA 3I53A 3SSOA 4RTPA 1XTPA 4DM3A 2EG5A 1YB2A 3I9FA 4RTMA 1KR5A 2IGTA 2PX2A 3HVKA 3DLIA 5FUBA 5ICGA 3MQ2A 2IH4A 1VP9A 3M6UA 5DM0A 2B3TA 4RX1A 3NDJA 4CKCA 4PGGA 4E33A 3PX2A 3CCFA 4R6XA 2OB2A 4R8SA 2FK7A 5EMJA 4QDJA 5E2AA 3EGEA 2FYTA 4ER0A 1NW6A 3KU1A 1BKYA 1NBIA 5EMKA 2OXTA 3SM3A 3UZUA 5M5BA 3MHTA 3ELWA 2UYQA 4V0QA 3TFWA 3UFBA 4PONA 2PJDA 3ERCA 4GQBA 10MHA 2XYVA 3GRRA 4QPPA 2VDUE 5BW5A 4PWYA 2QYOA 2ZCJA 3AJDA 1NV9A 4PYIA 4IKPA 4KRGA 5K0NA 3TM4A 3HA7A 3LDFA 3DXZA 3NWEA 4FGZA 4YV0A 2FCAA 4HGZA 3LSTA 1X1DA 2HMYB 3P9KA 1Q0SA 5EHIA 2ADMA 3UJCA 1ORHA 5CIYA 2N47A 3P71T 1NW8A 3TPZA 3K0BA 5MHTA 1KIAA 4QQKA 1WXXA 2GB4A 2PXCA 1XVAA 4KW7A 1JG1A 5DTQA 3DH0A 5G02A 5C9ZA 3OFKA 4HTFB 3M33A 3EVCA 2PX5A 1ZGAA 1I1NA 3KQTA 3HCBA 4H0NA 2C7RA 3NJRA 4PCAA 5EG5A 1R8YA 1VLMA 4GUAA 3GRUA 3FYCA 3PT9A 1JTFA 4FR0A 3E7PA 1QAOA 4QDKA 5EGSA 1JTEA 1WY7A 2CL5A 1NKVA 3B89A 4KWCA 1IXKA 1XJ5A 2P3LA 3LKZA 1JG3A 4X1OA 2ZSUA 4PYJA 1JG2A 2PT9A 4FSDA 3DXYA 1NE2A 2IP2A 5P8WA 1Y8CA 3M4XA 3HCFA 4BP3A 5LR6A 1ZHFA 2QRVA 3LBYA 2ORED 3S68A 1NW3A 3G2OA 4R05A 5DWQA 3BWMA 3O7WA 2PWYA 2HV9A 3EVBA 3P9NA 3GCZA 3GGDA 1I4WA 4EK9A 4GOMD 1QANA 1M6EX 2ONYA 2ZWAA 3R3HA 5DXAA 2K4MA 4XCXA 4PGHA 3LL7A 2AOVA 2AOTA 3FTDA 3PVCA 3GJYA 4KIGA 5T6BA 3G88A 3SMQA 3HCAA 3T0IA 4PYOA 5DSTA 5C0OE 4PINA 4E2WA 3EVZA 4PNEA 4RTNA 3M70A 3OU7A 4RTLA 3R9XB 2BR4A 3ORHA 2ZTHA 4E30A 5CCXA 2BR5A 1BC5A 1RJGA
chains in the Genus database with same CATH superfamily
1OIWA 3ZU2A 5AVVA 3BHNA 4ZGBA 4Q3DA 5E0OA 4DNOA 5L40A 1IBKB 4FMDF 4JR1A 3AEQA 2IQ5A 5CB4A 1VSUA 3CLHA 5KJ6A 3D6AA 4MYHA 4UZSA 2EBWA 4RVSA 1H2ZA 3H5AA 1JRLA 2BMDA 2UYHA 2ZEJA 1L5LA 3LDHA 1XXHA 1I5EA 4XDYA 3VSCA 4D3FA 2JW5A 1E6MA 1QB7A 3ACCA 3BD6A 3TTXA 3SVTA 3A37A 2BSXA 1A71A 3QKRA 3IDSA 4NBWA 4XGNA 4Q01A 5J63A 4DBZA 2WWTA 4HX2A 1YRYE 3CF2A 2FI1A 1H05A 2C0CA 2MDTA 3W8NA 3FFTA 1BRMA 1Q0ZA 1S0UA 2QZJA 2XLBA 3BXZA 3HS3A 5FLKA 3TK1A 1GCOA 3AEKB 1PR2A 1JR3A 4HVTA 4RFVA 5F5NA 1YONA 3HL4A 4CI0B 2X7JA 1AOXA 1JHDA 2GH1A 2QYSA 2W2VA 2BHSA 1B15A 3EXIA 1W52X 1WZNA 2AS0A 1N1EA 2CNOA 3P97A 1CFJA 2W8BB 1W6UA 1E3LA 4C04A 1RHUA 4YRBA 2R11A 4GLFA 5CLGA 1E96A 1LK5A 2OM6A 2PSSA 2QTCA 5G0SA 4F6RB 2NXNA 3IP5A 3WNQA 3FTFA 1HE4A 3AL0C 1X1TA 2AKYA 5A5GA 1VC2A 1GYQA 1Z4IA 2G5CA 2G67A 2FF7A 1L7EA 2IYWA 3HP1A 3UHAA 1IY1A 3NATA 3QBJA 4OK6A 3SC3A 1PEYA 2LCFA 4PVDA 3VHRA 5KTRA 1KY2A 2OMEA 3OJOA 4MQ4A 1KJ9A 1VLLA 2XUFA 3BQMB 5FL3A 3IP8A 4LPKA 2F9MA 2PKWA 2QSZA 1KFEB 3FLAA 4IL5A 4QTTB 4UE3S 4AUKA 5KBYA 4U2EA 3I64A 2ADOA 4RANA 1B1AA 4CG1A 5CITA 5BQOA 3ZY5A 4CLDA 4Z4FA 3OJEA 1Y9ZA 3NEJA 1ZA1A 2Y1XA 2IYAA 4L08A 4LGVA 2OUIA 5FQOA 4JI1B 2QVBA 3WGHA 1I80A 2GBCA 4N5HX 2J5KA 1B0AA 2L19A 3CX6A 3G5TA 3MRVA 3O3CA 1A7KA 4EGQA 4L0DA 2BC9A 2KQUA 3EARA 2E5LB 2JDID 2BWJA 3PNMA 4GM1A 2E5FA 4OFBA 5JYDA 5ED4A 2C3YA 3CNHA 3VUEA 5IVHA 4HH3C 3JSAA 3Q0IA 2X2OA 5KOIA 1TKBA 4J03A 3L7IA 2AJTA 1BXGA 2ZI5A 3DMDA 1IJKA 4MUAA 1GA6A 3KV3O 1Y9DA 4PSKA 3OCWA 1S02A 3IV6A 2ODNA 4M53A 4M9XA 4OGKA 4M3NA 4EKEA 1JTVA 1GV1A 1K8QA 1E2EA 2OZLB 2PZEA 3O38A 2JLWA 4G4SP 5JRZA 2YNMA 3OP1A 3O82A 4KTTE 1TZMA 4R8VA 3OCVA 3PCRB 3HYNA 5KNBA 3DS8A 3NALA 1S5PA 3RYFB 1OX4B 1P3Y1 4IJKA 3G8AA 3EWNA 5EKUA 4UMDA 2OCGA 3K6SA 1KJNA 3W2IA 3AVTA 4UZFA 4PHHA 5EZQA 4B87A 1CW2B 2AVNA 5AHOA 4ZVKA 2FH5B 1DLIA 1WNFA 2P6PA 3Q0TA 3TE7A 1A8IA 3QA9A 2X58A 1IUOA 1H94A 2ZIXB 5KSZA 2JI4A 3GMTA 2DJ5A 2QJTA 3OP4A 1PRYA 5C1IA 5KTOA 1P6QA 1CHDA 4ZQGA 4LQLA 2B9EA 5EQTA 3BZWA 4G65A 5IAJA 1FTSA 2CVHA 2FFAA 4D9FA 1KMCA 1MZVA 2EFHB 2XVZA 2P9HA 4EW2A 1VJ0A 4I1IA 2RIPA 3O8BA 2PXAA 5LXTA 4U02A 1XCGB 2JZCA 1SKUA 2FN4A 3NB0A 3EW7A 2O1XA 2X0JA 4UAUA 4KITB 4RHYA 5CEJA 2QM0A 3NKVA 2UYOA 4CIAA 1FY2A 1TK2A 4KVFA 4G1CA 2OAEA 4DCPA 1SELA 2WMNB 1UFRA 1WEHA 4F2DA 2HJVA 3SHFA 1R3UA 4PR3A 3FSEA 1T0BA 1PW5A 2HXGA 4NMXB 3WMEA 5AVOA 1C7RA 3F98A 1W49A 2BE7A 3ICVA 4GMGA 4TKMA 3WL6A 5TRTA 3RGGA 4EP1A 1ZD5A 4BWFB 3NDPA 4UAJA 2C1EA 3IT0A 1XELA 3UJ6A 2W6IA 3PGXA 2CXTA 3C3EA 1RI5A 3MN1A 3HJHA 3E7FA 4X8HA 1BD3A 3BJIC 1Y1LA 1D1TA 3DEIA 3CO5A 2R8RA 3I1JA 1DIBA 2E49A 2JG3A 1UM8A 4FYHA 4G5FA 2R751 4QREA 1YE5A 3P9QA 3TRJA 3RWOA 5MN6A 2YYSA 2J5BA 3I23A 4PRYA 3NTOA 2A5FA 3M3DA 5JCZA 3REQB 4GP7A 4A92A 2GLUA 4H4DA 3DZCA 4OPMA 4RPLA 2AOTB 3IR7A 3N87A 3ONFA 4FMCF 4YFVA 1FX1A 2R3SA 2J87A 2VPYA 1SUBA 4X3OA 1P7VA 3RVPA 4ID3A 5EJEA 1R6DA 2N75A 1LDEA 1EK2A 5EWMB 1UBUS 3GXOA 4EKIA 4JWKA 3C6YA 5LQDA 2QP4A 3DLAA 3JD4A 1AQNA 3SX2A 1OF1A 1W4AA 3D5QA 3H05A 1NVVR 1R27A 1NSYA 1OBFO 3FF4A 3HFJA 3O95A 4JMLA 3AKZA 1YJXA 4OHZA 2GKSA 4UHFA 2ZULA 5D1NA 4F8YA 1NNI1 4BB9A 1TVKB 5M34A 1PG2A 1K06A 2WIBA 3CZCA 3JR7A 3ROKA 3LY8A 3L1IA 3QVJA 3D6FA 3KB8A 3UT5A 2ODPA 2JVKA 1VKZA 1XZPA 2DECA 2HF2A 1J49A 2BFAA 1I2BA 2QF7A 1TYDE 1RXCA 3DOHA 1HF3A 2GAFA 1Q74A 3BK2A 1N7GA 5AVWA 3BIWA 2NXJA 5MF6A 3T3NA 1EAYA 2BD0A 2C99A 2J9ZB 4IWYA 4NECA 4Y6LA 5E2IA 5EP4A 1C7EA 1QH9A 1DCFA 3BERA 1QDLB 3QNUA 2HMTA 3FFWA 3PFIA 4HYEA 1K1EA 3GJXC 4CEHB 3GQBA 3HLTA 2YV5A 3JZIA 2NO1A 4TVOA 2F6RA 1GGFA 2JA2A 3H9BA 3QXXA 3URMA 3CW2A 1IU9A 3B70A 5HILA 3LOPA 4Y9DA 4NL4H 5AO9A 3LCCA 5ALPA 4AECA 2RARA 3D8TA 4UAVA 4DJFC 4YUVA 2QUZA 3RHSA 2WIFA 3HXOA 4DSZA 2OY0A 2YWFA 2R8BA 3A4VA 3AY3A 3GMDA 2HHLA 3ABZA 3NGXA 1J97A 2GFQA 1UDXA 1SQ6A 1WW3A 4GF5A 5DCUA 5IYZF 3VI3B 7GPBA 3PBKA 4HTFA 2C8JA 1JVSA 3Q1LA 2LP4Y 3UICA 2NG1A 2IQIA 4U6NA 4UM9D 1GADO 3PDWA 4Q9AA 1PFGA 13PKA 1CULC 3QKTA 2WDPA 1EM8B 5BW6B 1BHO1 5HR5A 2QBYB 5D7NA 1DVRA 3F6YA 4EVIA 4RZ2A 3SFTA 5DNYB 1YB6A 3UBTA 3CIFA 4AP6A 5IKPA 3SHOA 2OAQ1 3PUYA 1MIOB 1GP2A 1Y89A 2HH9A 2PTGA 4OXKA 3G5LA 2WAYA 4EJSA 1RJ9A 1J4AA 2V9CA 3BJEA 1X7YA 4DVGA 2AXPA 2O2CA 3UWSA 1NXXA 3IDZA 1AG9A 1W4RA 3QU2A 2DLCX 2FFRA 1BVRA 3RVNA 3DBRB 2WLTA 1GU0A 3Q98A 3RU7A 3WK7A 3ROXA 4M88A 1UPUA 1ZOPA 3MW8A 4NE2A 3T5TA 1YDFA 3UXEA 1R5OA 3EEOA 1HI9A 1KS9A 1I36A 2CGEA 3CKMA 1MOZA 2LW7A 2HSWA 2V58A 3OSZA 4UMEA 1IBRA 1K5DA 1KGSA 3BAFA 4MJLA 4Y2PA 4AO8A 4BQFA 4DQLA 1VHQA 1Q17A 3WS7A 2H7VA 3ZDDA 3P0EA 1CRLA 2H0QA 1L5SA 2ZRKA 3S4YA 4S04A 3HCDA 4GZ5A 4BZWA 1YR6A 3RFXA 5COQA 1KTVA 2WAOA 4IRXA 4BEWA 1XHLA 2W83A 5H1YA 4LRQA 4CKBB 5JV5A 1E6WA 1SKBA 3FCSB 2VP9A 4QGBA 6REQA 4NYIQ 3DOJA 5JS6A 3ME5A 4I1YA 5BYBA 4G5YA 3U4GA 1DL5A 2PA0A 2B5VA 5EAIA 5JCJA 3M7IA 1BXRA 4YRQA 4X1IA 3SEAA 2VXYA 1KEUA 3JASA 3LE8A 4DV7B 2EGHA 3IO3A 3KVNA 2RC5A 4E1BA 4O5AA 1N0HA 2HRCA 5HXAA 3WBFA 1S2MA 3VPDA 1GJRA 1JJVA 1ZOSA 5D6NA 4TV8F 1N32B 2XYPA 4B6RA 4YAEA 3B85A 2C2BA 4D42A 3Q8XB 4OJNA 2PA3A 1CRZA 5HQ3A 2WAAA 1NZFA 2GEBA 3VBCA 2XTMA 2WOOA 3QHQA 3PC6A 3PYLA 4JP8A 2PUDA 4J4TA 4ZCRA 1G66A 2D4HA 4ND8B 4Q3NA 4EY5A 4PHTA 1HLFA 4Q7LA 1UWLA 4ARZA 4KBGA 3TQCA 6ABPA 2RHOA 1JU4A 1YHYA 2NO5A 2FZEA 2R68A 2OHXA 4PZCA 3LDAA 2WHQA 1WUYA 4PSAA 3IJRA 3ADBA 5H8WA 1W76A 3IT3A 3OE1A 2H2GA 5EXEA 6CHYA 1J0CA 2G4CA 3PF8A 2CLDX 2P35A 1XTSA 4B3GA 4RPKA 4YRNA 1IN8A 3K1TA 3A31A 2P9YA 4P5EA 3ZVKA 3AV0B 5KQRA 1M7HA 3AR6A 1JHXA 1ISPA 3CLSD 4DR7B 3E5RA 3RS4A 1Q50A 4G5OA 4EYEA 5G0WA 2R8XA 3HB4X 2P1RA 1DWOA 3A4IA 4MUGA 5SYMA 4A6DA 3WKDA 4KLRA 3FUTA 1JKXA 4JX9A 4MHSA 4Q7KA 4C6TB 1I33A 3TFQA 5GONF 3NR2A 1X1QA 1ISMA 2YQ5A 4NCKA 4RMJA 4KPUA 4OG2A 4WXYB 7MHTA 3N8HA 4LYGA 3CYFA 2X0EA 1ZUWA 4GBMA 1TO2E 3R3YA 1ZRMA 3KHSA 3T4EA 4DG8A 1EGQA 1YQUA 4MUMA 4YXWA 4HD8A 3O4HA 2HDWA 2PGLA 1I4LD 1P62B 2FMUA 4Y9RA 3AT1A 1NVFA 5FXMA 5TPWB 1WDKA 1W5SA 4UUMA 3WIDA 1VJRA 2ZTLA 3A4NA 3A1VA 2GJ4A 4C7JA 4FEAA 1PR9A 4HYTA 4AZ3A 3V8RA 2I6XA 1AGXA 2R97A 3ZH9B 4JMPA 4BU1A 3RKUA 1KR5A 4KN5A 3ZQUA 2YWHA 2J9XB 2ZOSA 4HVAA 3BRWA 3M6IA 1HH4A 2YMPA 3OHSX 5FUBA 1WNTA 3Q3GE 1OLOA 3HH8A 2R65A 1Y4ZA 3PX2A 1JEQB 1THTA 3FMVA 3PKZA 3PWTA 4MLZA 1P2DA 2P9FA 5CLIA 4QC2A 4LOHA 5M5BA 3RHTA 3KSZO 4FFWA 3STVA 1SC6A 1EU1A 5L3QA 1JPNA 1ZI8A 3TLXA 4P4GA 4P84A 3ZTTA 3O0DA 4HVCA 3QP9A 2ZRQA 3AJDA 1NV9A 1PWXA 2O0MA 3TCKA 1Z29A 4D74A 1PS0A 3DXZA 3F7TA 4C20A 1N2SA 4XR9A 1ZK2A 1X1DA 1GQOA 5HFAA 3LXMA 2RH8A 2GZ1A 2JFOA 3DHVA 3P71T 4R84A 1K68A 1ZJ6A 1OAKA 2NYRA 3O2QB 2JRCA 4Q9HA 3ESDA 3HFRA 4KW7A 2WINI 4D9MA 2VN8A 3HXLA 5HIAA 4EJ2A 3PYXA 4J0KA 3LT1A 2CE7A 1J9ZA 1RWKA 3V1MA 1AY0A 2D06A 1N6OA 2Q29A 3FGPA 3NAMA 2H0RA 2R6R1 3A04A 1YVRA 2QSUA 3D4PA 2AG6A 3PT9A 3NHPA 2Y0CA 3IIJA 4A0GA 4B34A 1UCFA 1VECA 1EDDA 1JG3A 4K0RA 1GRRA 4AX4A 5KYYA 3NIFB 1SUEA 2E18A 3Q41A 3EEFA 1TQDA 1E3IA 1SC1A 3LY9A 1Y8CA 3EWIA 1ZHHA 1FS5A 4BFXA 1APBA 1OLUA 1E3MA 2Y1LA 2QUAA 2FWJA 3CR3C 4FN4A 3I2FA 4I1PA 1QCZA 4NOLA 4XCVA 3EVBA 4DSNA 3P9NA 3GGDA 1MB4A 1LQTA 4RY9A 1ADGA 3VO1A 2RGNC 2XJ9A 4BFSA 5DNCA 4PGHA 4RC9A 4PFSA 2J0VA 1STOA 3FTDA 3GFOA 4RHFA 5EQFA 3UJPA 4C3VA 3DLBA 3ZY4A 1J8YF 2QORA 2J6CA 1ZIPA 5TXGA 2QSYA 1G59A 2JATA 3EISA 2IHUA 2RC6A 3NHSA 3OOJA 1CT9A 4A8PA 2C2YA 2Y3IA 5AUNB 1T1IA 2JAQA 4MINA 1E4VA 5T6MA 4ZHQF 5DHQA 4X92A 1NASA 1MKYA 1RKXA 5A3QA 1T9KA 4P4SB 4PLZA 5A05A 2XNHA 4WSOA 1HRDA 2XCLA 1E9VA 3F4BA 4UBMA 2YJNA 2HDNB 5ULLA 2HK8A 3BWVA 1T0UA 5AM5A 2W00A 3DQZA 3EGDB 3P2OA 4XPIB 1WUHS 4E03A 4Z7QB 1KQGA 3SQWA 1DWUA 4TXNA 1MC1A 4RXUA 2CVQA 3ENKA 3RIEA 2RHRA 5FAXA 1KYZA 4WUTA 3BSYA 4EKYA 1OPRA 1G60A 2Q21A 1XZMA 3UENA 1HT2E 1B2RA 1HQKA 3ZWXA 1JH8A 3R5FA 4BNTA 3ANLA 5GOTA 4DCGA 4ENRA 2I7XA 3T5GA 5IM4F 4M76B 4UBOA 1DKNA 2VNKA 2OCAA 3IE0A 4H08A 4MVJE 2FR1A 3ROZA 1FBNA 1NONA 4KUGA 1IEWA 1P1CA 3EYAA 4NJMB 2IXEA 1ZVVA 3ANXA 4MWDA 2O2GA 5DI9A 5CPBA 5ER6A 3RIGA 4I81A 3HNPA 4ZO8A 1RZ3A 3IPLA 4NAHA 2WHXA 3LUJA 5DXJA 4QOHA 3DMTA 4GW3A 1ZIYA 1T3ZA 1J07A 3PRYA 4QKQA 3QENA 1MN6A 1NNUA 3W2EA 5D6OA 3WV5A 1G2OA 1HYEA 3EQ6A 4PHGA 3AW8A 1TM3E 4GG1A 5JFGA 2CKDA 3GLKA 4LVOA 4UNRA 2XQVA 2XOXA 3AFNA 1DQSA 5F1OA 3RU2A 2QE6A 3AFGA 2FGJA 3IAS6 5JMTA 2I22A 2HCJB 4BVKA 1GNLA 4KREA 3DZJA 1KI7A 2GAJA 1BEZA 3AWIA 4L51A 2UYCA 2F3RA 1P0QA 1SXJD 3GBPA 5SYNA 4KFRA 3AFIA 3BXOA 3MQFA 1YDEA 3LK7A 1BDIA 4IR7A 2QTZA 5A7GA 1J6UA 3L0ZA 1JDTA 4DEYA 4LA4A 1N6RA 2VVTA 2YY5A 4LDQA 5B6PA 3OWXA 2QTMA 5ELMA 1CR2A 1KA9H 4COKA 1EWTA 1P60A 5KKNB 4BNYA 2CNWD 1EE2A 5DXFA 1XZKA 1NQXA 2JAWA 1N7JA 2ZWMA 3DAOA 2K7ZA 3EUEA 4MWOA 4XSVA 5ERGB 1LPNA 4WN3A 3SNKA 1KMIY 5B12A 5JZBA 2I66A 2I1VB 1NMQA 3A3KA 1GU7A 2NUPA 4IS2A 4PYKA 3TTYA 3TH5A 4IRUB 2JH8A 1XCMA 1D2MA 5IZCA 1Z5WA 2EG9A 4EMTA 1FQWA 5EWJB 5B3JC 3QLVC 3QV2A 4JY7A 4CEJA 1Y6JA 3D5TA 4JKOA 4TRRA 2IU0A 3GJTA 1JDUA 4AUEA 4GKJB 1Y82A 4G0YA 3IUPA 2G80A 1TVCA 3C5CA 3RODA 3NQ41 3H86A 3I5AA 4B3RB 2DBRA 2G70A 2Z4RA 1T9GS 4BCBA 4OXRA 1COZA 3ZE1B 3FPCA 2EKPA 3ZWQA 4DQVA 1E94E 3SCZA 3TNJA 3IDOA 3GO4A 2Z1MA 3F97A 1UXHA 1X7ZB 4HI0E 1NVEA 1QIIA 1EVLA 3I9KA 3J80A 1RWOA 3SWWA 3ZWYA 3ILSA 3NBMA 3A6JA 3OPVA 2JJQA 3E15A 1ZO8A 3UMRA 2JHFA 4JKIA 1TA0A 4WFKA 1W5FA 2V5AA 5DZSA 2FK8A 4CEIA 4FFDA 4FS8A 2DPHA 3FDXA 2VDOB 2BP7B 1GNTA 1TB4A 4FWIB 5JJ5A 5H0IA 2VDNB 1A4RA 5JXJA 1LRLA 3KR1A 1E6KA 2V7UA 3LWNA 3S2IA 1MAAA 1XVTA 1JLMA 3U3ZA 4KK3A 2DUWA 2HFKA 3GMIA 4HNGA 1AGPA 3L9XA 3OIDA 4EJ0A 3ZU3A 3GQVA 1GEEA 2C0QA 3H4TA 3LCVB 4D3ZA 1E9CA 4QNNA 5H70A 3UEOA 3FNHA 4J0JA 3I8OA 3R5SA 1SCUB 4OFWA 4ERNA 2YJTD 3FZGA 4RFLA 1KGDA 2AFIB 3IR6A 3SI7A 4H1HA 5KREA 4KH1A 3SXJA 3DWIA 3ZUPA 1DQNA 1DO2A 3E61A 1L5NA 1YAHA 1CY6A 1GZ3A 3DL2A 4Q1EA 1J0BA 3KWMA 4Q9NA 2J07A 4MTLA 5PGMA 4EB6B 1EVQA 2H2DA 1JEDA 1QYCA 3O4JA 5JDCA 3TGPA 3HN2A 1ZQ9A 4WZBA 2OFFA 1SCQA 1NRIA 1RU3A 1W85A 3VDRA 2LIVA 3S2GA 1RQXA 1SKYB 3MMXA 4BMYA 4E1AA 3UK6A 3AB8A 1AIPA 4KQHA 1NBOA 4HQFA 3KPWA 3S7ZA 3KB1A 3OIUA 3AP1A 3KVVA 3DD1A 5EE1A 3TLGA 1M3SA 3GJQA 3TRKA 2R5FA 1REQA 3KC2A 5BNIA 3IUBA 1QP4A 2YXNA 4HGRA 2FSSA 2H2FA 3A9CA 1EFPA 1JFLA 2JNWA 2IDMA 3G2MA 4FI3F 4KV7A 3KYCB 3F8TA 5CCEA 3PWKA 2HT6A 2YOFA 3SZGA 5JNTA 1O94A 4JX8A 3OH8A 4RD6A 2WC1A 4RYLA 3UTCA 3AVUA 5GJWC 1X0XA 4LECA 1FFXA 3V1UA 5F7XA 4QT4A 1QV9A 3DAPA 4YHHB 1IDOA 4Q37A 4BZZA 2R8YA 1QKIA 3VHXB 2YNMD 3I76A 3CURA 1FFHA 3K0HA 1U0HC 4I55F 4JBYA 3A11A 2JJ8A 1GTZA 3QXJA 4YBZA 2BGIA 3LGAA 3VOBA 2C04A 1WMFA 2GN1A 4V1CA 4NBSA 4GZLA 1OWMA 1YQEA 1NNLA 3IUQA 2GJSA 3H7IA 3F6RA 5AM3A 1YJQA 1RLOA 3C8DA 4RK0A 2XZLA 1SXIA 2BBOA 4NOJA 1EHIA 3U6BA 5K0BA 1HLDA 2XIQA 3FJ1A 2DY0A 2Y05A 4RL6A 3N05A 3IVAA 2CN1A 4JL6A 3UFXA 5HVNA 3NNDA 1KEZA 2XMRA 5LP6C 4IIXA 2YV1A 4B6JA 1USWA 1BVUA 1OIXA 1WY5A 4FOOA 3IEUA 4XQGA 5B2EA 3HB7A 2IW3A 3IS3A 5EMLA 4H18A 1UBRS 3BWCA 4KLCA 1T8YA 3MJSA 4JODA 4L74A 1SCJA 3QKUA 5DE3A 2F1HA 4DNQA 5C52B 2FV8A 1OC2A 2LCIA 2FEWB 4LXGA 3DCNA 3QI7A 1WDMA 2CXHA 2J4DA 3FZQA 2WSBA 1QU2A 1KI1A 2JAPA 5CH3A 3BD8A 3IKVA 4YRDA 1DUIA 3B3AA 4HGOA 4RCZA 4ZO6A 1U7WA 4QU8A 5LA6A 2XHEA 1J25A 3A1DA 5BSVA 1QKJA 5J2UB 3ZLTA 1UM9A 3INYA 1P4RA 2C9MA 3E5MA 4HWPA 4KN9S 1OFVA 4I9FA 4XFDA 1E99A 1TUGA 3MCUA 1G6KA 3NHKA 4WN9A 1JAZA 1CEQA 4E32A 3GU3A 5J3JA 3FNBA 2PUCA 3SVZA 5A4MS 3DV9A 4UEOA 5DHUA 1L5RA 5AM4A 4ARSA 4H15A 5DM2A 5IH7A 3PD1A 4FKZA 1NXWA 3MNFA 1NVVQ 4MYRA 5YASA 2NTNA 3AFHA 2W6ID 2XA2A 4BLPA 1DAIA 3BMCA 2OORA 4EPVA 5JASA 1G4AE 2HDHA 1TUBA 4RW0A 4ZOLF 2HN9A 5K0JA 1NULA 3EIFA 4DCUA 4RKFA 2OBLA 3DQPA 2C5BA 4CCWA 4D9CA 4Z7OB 1XMPA 3DT8A 2W5UA 4N0DA 4XB2A 1ADYA 1SCKA 4H31A 1T5BA 1UPAA 2A0KA 3IX7A 2VK8A 1CV2A 2A5DA 2GJ8A 4DRZA 1Y7LA 3VZQA 3WQRA 2ZE8A 4MGHA 4YRMA 1VJGA 3X1ZA 1NMYA 3FLBA 3GF4A 4D9NA 2EL9A 4TQAA 1WDTA 5KJCA 4YHBA 3AI1A 1HQDA 1N8NA 1L1EA 1NBEA 1P0CA 4D8UA 5C35A 3GCWA 4V0NA 4JDUA 2VDWB 5EWLA 3BL6A 4EBBA 4YAGA 2JI6A 3KWFA 1DRVA 3LIPA 2BJHA 3DBVO 1U6IA 4JB0A 3J7AC 3R7WA 3R9XA 4KO1S 1WHTA 3H17A 4Q7JB 4WW0A 2ATIA 3O2JA 4M8SA 5GAJA 4EG3A 3NJ8A 1EA5A 2YICA 3CX7A 5AXBA 1BE6A 3AU8A 2I33A 1V35A 5JLAA 4ZIRB 5CB4F 2Z5FA 3VXKA 5DLYA 3BULA 3BMXA 4AIRA 1J24A 2XT9A 1B76A 2QUIA 1C1XB 2WFMA 1CJCA 1GKLA 1OI3A 2PWBA 2E82A 3B5EA 4R6WA 4KOEC 2H4ZA 1P39A 2WOJA 2R0QC 1ZN9A 3K9FC 2JFYA 4ZAGA 1OTHA 5D3QA 1RFLA 2FQXA 1IQUA 4N6OA 4NARA 4DMKA 4ZZ0A 1RYHA 1ZSVA 4EIWA 3KJGA 1G8PA 1QIHA 4IAOA 3UWPA 2EEPA 3C45A 4BNLA 3IP7A 4KFUA 4BTVA 3X1KA 1N0VC 3HJNA 2F1OA 2O1EA 2WD7B 4N5NA 4UNPA 2ZRFA 1KO5A 4F46A 5BWOA 1IN1A 4GSKA 2A86A 2ZI3A 1U6KA 1YBVA 2K7FA 3ZHVA 2FZ4A 4D43A 2RDMA 1XK7A 1TFUA 1AZLA 4J29A 1Q11A 4W9RA 1ODJA 1FU7A 4Z54A 2ZVJA 2PVSA 2QTLA 1WBDA 1UJ5A 2C61A 3BILA 5HUQA 2Q41A 1WKCA 3OIWA 1Z37A 2QLNA 2IPOA 4IXDA 3VR2A 3H87A 3K09C 2IVZA 4CLRB 4BWGA 1BA3A 2BN4A 4F93B 4HDAA 1KKLA 3PICA 4KXUA 1GKKA 1TW3A 3RBZA 2IXTA 2JLUA 5IJ9B 1KERA 5CDYA 2Q4OA 2HU5A 4C4RA 5HCIA 4EAQA 2O59A 3GWZA 1W4BA 2XLCA 3GJ4A 3V8NA 1KYVA 1RMTA 2JCYA 4Z9FA 4LXHA 1JFRA 2IXBA 4F4IA 3NVKI 1MG0A 3PEFA 3GRCA 3OEWA 2BBTA 1UBHS 2ZJBA 1Q1NA 2P78A 3OLVA 3PZRA 1O6ZA 2QTVA 4OIMA 4OP1A 1EDEA 2QRUA 1LH0A 2VJMB 3FRIA 5AKJA 5BSMA 3RC7A 2Z1DA 4HAUA 5LZ8A 3ROQA 1E20A 2DBVO 3BMQA 2P4SA 4M1SA 4IH4A 1QYRA 1DFGA 1KI6A 3EH1A 4CWAA 3GFVA 3N7UA 3RTCA 4ER7A 2QI9C 2O8NA 3FPFA 3DDZX 2GUWA 2RB5A 1QDEA 3CGGA 3U1VA 3QPUA 1W19A 4FHEA 3B6IA 3FPSA 3I2HA 1Z2NX 4RACA 1CDEA 1NJ1A 1U0SY 4HDCA 1ULUA 3EG9B 2I2FA 4AZTA 5JXWA 2F4VB 2WM9B 2FQQA 4O1IA 5TMEA 3C97A 1USVA 2IYRA 1Y3CE 2ZI4A 3ETGA 3M6LA 4WY2A 4RJ2A 5BQFA 2JFGA 1JLLA 3SSAA 4K88A 4RTQA 1YZTA 1Y42X 1PZFA 2QMQA 3ER8A 3VGPA 3UJBA 1QFJA 1AV6A 3AR8A 5JCJD 2Q5CA 4MKFA 2DETA 4Z9AA 1XTPA 3BGSA 1QIMA 4P34A 3VC7A 3ZV4A 3J81k 3E48A 3FVVA 4O2AB 1HKUA 5E7QA 1AKVA 1HTWA 3CNLA 3QOYA 3K1AB 1JZSA 3V7WA 3KBOA 4OP3A 1TQ2A 1Y3BE 2B3TA 2WKWA 4BO2A 1MMFB 1CZNA 4XFKA 2B4TO 4R8SA 5B53A 4BV3A 4L28A 4GBGA 5D51S 5KTPA 1Z6ZA 1XDGA 2HT1A 1BKYA 5G3ZA 3I4CA 2OCXA 3UZUA 3OEYA 1KYXA 4V02A 3GR6A 3TFWA 4O02B 5CDFA 1WPXA 4FVTA 3WL3A 1FVFA 4GWLA 3CU5A 10MHA 1KO7A 1SOVA 1DAKA 1V47A 4L4UA 1B6SA 4DDTA 2Q6IA 1F7VA 3TGLA 3L5KA 2ZSJA 3BCSA 1FSSA 5ABPA 2VHTA 4K6OA 5FWNA 4FGZA 1L8QA 5LXTF 3H1PA 1Y8QA 2IGBA 4FC6A 2HV8A 3M4YA 5EHQA 2RGYA 3P9KA 4B73A 1OW3B 3QW2A 2EGGA 3ESAA 3GYGA 3MJCA 4AMVA 1WXXA 3GCGA 4JJFA 4JSRA 3I4FA 4WLEA 4B3CA 5D87A 2VL7A 5A5DA 1VPLA 4YH1A 3G6KA 1F8YA 1GILA 1JJFA 2VT6A 5LCXA 1PGNA 1SXHA 4H0NA 5AVZA 4UUOA 4EHLA 2Q0SA 2Y4OA 5KYXB 4R1SA 1DC6A 3ZXXA 5LWQA 3NI2A 2CJWB 2C2ZA 3O1HB 1UBSB 1TT5B 2CFSA 2BEUB 2JGNA 2QRPA 4IGEA 2QPOA 4UPDA 4Z1OA 1DTSA 5P8WA 3M4XA 3A9UA 2BKXA 3R0VA 3TN7A 4BMXA 5K6AC 2ZGVA 2HSEA 4EFLA 4Q3EA 5C8ZA 1L7DA 2AB0A 4B6GA 3VYRB 3SIPA 2YYAA 3GNSA 1AM4D 2XMPA 1MVNA 4ZI7A 1QE3A 4QXMA 1L8XA 3ECCA 2I55A 4E88A 4NCJA 2K4MA 1PKEA 9ABPA 3D02A 3JQ9C 2YRXA 2PJZA 1ZD2P 3G2HA 3HCAA 4GOXA 4OQDA 4RPGA 5HNKA 4TYNA 3BE6A 3OLWA 4U3JB 3KCQA 2DTEA 4NZYA 1OTXA 4DBLE 4IUBS 3BRWD 4F9EA 2UXDB 3R3XA 3OQMA 1LQ2A 2ZAIA 1W1UA 4FQ7A 4MOWA 1Z4MA 3AW9A 5AHKA 1OBCA 4FXPA 2EYUA 2YZNA 3EASA 5ECGC 3ZCRA 1C3OB 1SVNA 3GZTB 2M6KA 4L8WB 4C2TA 2QYHA 2ZUCA 4I99A 1U80A 4DKXA 3THYB 4X6XA 3CNQS 3ZEAA 4M0LA 2F90A 4HEHA 1TYZA 1LLUA 1VG9B 2Y68A 1V43A 4NFLA 2ORVA 3ZNPA 3IGFA 4ENVA 3ZWVA 3EGOA 1JP7A 2ODQA 3RT1A 4CG3A 1IN7A 2OFXA 1ADFA 5ALTA 1GXSA 1A5SB 1U7PA 2ZSEA 1AVTA 5EHGA 1KBOA 2OBXA 4R71A 1GR1A 4GR9A 1ECFA 5AK6A 5FWAA 2PX3A 4FDLA 4FJ1A 3AF2A 3SC2A 4YYZA 3UGJA 1YOBA 1NJ5A 3PFHA 2A1TS 4ZVOA 5K3FA 5F33A 5GIOE 1Y1KE 2QX4A 3SICE 1LWNA 3PDUA 3QIAA 2IZ6A 5K0GA 2XCRB 2V0CA 2XNSA 4G1EB 2ZYSA 4O4IF 5LNK1 3HSKA 1A8HA 3NWBA 2FX5A 2XADA 2HJRA 1PFKA 3CNNA 4WKBA 5D3MA 1K66A 3H19A 2G7MC 4R2IA 1BMDA 4NNJA 2H4FA 1U04A 3IOYA 4LXTA 5AI8A 4E5MA 4X94A 4NX2A 3P52A 4TTJA 3BVPA 3NTVA 5EJMA 1KJ8A 4DLWA 2V98A 3JCZA 4AKEA 2V4MA 1JB9A 2P6NA 4RETA 4WBSA 3B6EA 3OTWA 1ZR4A 2VSNA 1WBBA 2B25A 1AT1A 3MT8A 3RNOA 1Y34E 2QL7A 3EDYA 2FPKA 1YR3A 4HFNA 4KGDA 3HM9A 4XCQA 4P3XA 2BH9A 2A78A 4HUQA 3FOEC 3LPMA 3V97A 3UJNA 4W99A 2RGCA 4K9QA 5B4VA 3AQ4A 4FD3A 3LZCA 2J30A 1H2BA 1U9YA 4NFHA 4Q00A 1ZU5A 1N2HA 1UP7A 2XYHA 4MGEA 4UULA 2UAGA 5JH7A 5TGDA 2PSDA 5K99A 2R1TA 4PBRA 4F3NA 4U9HS 2GM9A 4FT2A 3WX0A 3YASA 1BHJA 3JZMA 4RKEA 4JBLA 4C6SA 2GJ9A 3AVPA 3QX8A 3EQ9A 5K51A 4ALIA 4EB8A 1E3TA 3I04A 1J06A 3I6QA 4OHPA 3TOVA 3TZEA 1Q0LA 2FPIB 2F3QA 3W6OA 1NKSA 1ZM4A 2V0GA 2ETXA 4D0NA 1IRIA 1LC3A 3QZUA 5I3CA 1PGPA 4RTOA 2BCEA 4RA9A 3OIFA 5AI5A 2AN5A 2V3WA 3WG9A 1JDSA 4HN2A 3R6DA 4DV6B 2X86A 1UBFA 4MI6A 1Z2AA 3HLKA 4K6HA 3KQHA 1QIEA 3RS8A 2WEKA 3WYEA 1CUCA 1YJ8A 4EZEA 4O3FA 3IXQA 2B94A 1G0NA 2PU5A 3OQBA 2HA6A 1T2VA 4DGQA 5CT5A 3DHNA 3PKIA 3G8BA 3B1FA 1RHMA 1HQCA 3D0QA 2ZUVA 3JZFA 4WOBA 5I51A 3AC0A 2OO5C 3GG2A 3EUFA 2VTBB 2O2SA 2CXOA 3A28A 4NS4A 4DVJA 3M4NA 4BFYA 1HDCA 2EW8A 2C8VA 1ODCA 2AXNA 2LUOA 2AWNA 4ICIA 1F17A 3D1LA 3H42B 3DPUA 3R44A 1GT91 3EEQA 3EJWA 4OXIA 3RJ5A 2J8ZA 1AA6A 2P77A 3VNAA 1A88A 1XD9A 3N74A 4KXNA 2CXSA 3LYUA 3PQ3A 4F8JA 1C3XA 3WDMA 4UPEA 3G23A 4QICA 2I4MA 4CLEA 4CIVA 3NAZA 4XUEA 2QTWB 2BUCA 1NW9B 3IQFA 3KTOA 5G1OA 3TBHA 3ZXSA 1XAGA 3HZZA 4N3NA 4ZMBA 3FTEA 4M83A 4DR4B 4Y0AA 5A0VA 4KN6A 2HX1A 4JQZA 3OA2A 5HKOA 1B14A 4UW9A 2EWMA 4FYYA 4EVQA 1II0A 3I32A 5JCPA 1KIMA 4YAFA 3K72B 2AK3A 4JZKA 2XWPA 4K5QA 1BN6A 1D2AA 4MEJA 2LCQA 3NHFA 2FN8A 3D3WB 5IBQA 5BUQA 5DLPA 3GJSA 4JBIA 5DKFA 2XF2A 4MRVA 3X1DA 4BJ3A 2C4NA 4ZDKA 1X74A 4Y2GA 2WHPB 2XB8A 4PLTA 3TS1A 3D8NA 3GOHA 4WTOA 4B7XA 3UHJA 1CUXA 1NN3A 4J91A 1H8EA 1NVAA 2BFDB 2I4LA 1F7UA 1PJCA 3ZWAA 2I80A 4WD3A 2HYIC 4KYUA 2XZDA 3DR3A 1CPYA 4V0KA 2AE1A 3C6ZA 3A32A 1M8JA 1XRPA 3IMFA 2GAAA 1YR2A 2QLLA 2Z9BA 1EDZA 4HWRA 1RADA 1TM7E 2WWXA 3FJOA 1WXWA 3WMXA 2FXIA 3CLRD 5DK6A 3QOWA 3IODA 1TTQB 2PKEA 5HYVA 1X8XA 2WTNA 5CYOA 3I6IA 3HB9A 3ZW9A 3UG6A 1E8DA 2ZUEA 3G5AA 2J7PA 4WXEA 1DC8A 4DA0A 4ZARA 5ADUS 3TAHA 2QJRA 4INZA 1WU7A 2O0LA 2QZZA 2SKCA 4H6WA 2GVDC 3IDQA 4D4KA 1AUXA 4IIYA 4UHHA 4D2IA 1XZIA 2GLTA 2AR7A 2DR2A 1ATZA 3MILA 4DLYA 1MC5A 1R0WA 3R76A 1JPUA 4BRWA 5FDFA 1M2OB 2DUUA 4DRXB 1IDN1 4F21A 4YJ2F 1Z68A 2FX3A 3AETB 3DBHB 4C43A 1CNEA 1RE0A 4RF3A 3H2YA 4KQKA 4OL0A 1ZD4A 2WW8A 4IOJA 5AKKA 4WDQA 2Y93A 2AFHE 5CCDA 2HGZA 1AXGA 1ZKDA 1GFSA 1VFNA 2ZR7A 2W8ZA 3PRJA 3L8GA 1XVIA 3WGZA 1UXJA 1ISGA 2EF0A 3V7NA 4REQA 4E4TA 1KP2A 2YOGA 1RRFA 3ETHA 3BXPA 5JSFA 1SH7A 1WLSA 1FDOA 5ENDA 5AVYA 1N2GA 1FDTA 3RFVA 5EJIA 3W3AH 5GINE 5JI3E 3GFGA 3C8UA 1N9ZA 2HLHA 1DE0A 3TKLA 1Q3TA 5HX7A 4EUFA 4DCNA 3OTGA 1T5LA 3QLEA 3PC8C 4J2HA 4HWKA 1PNVA 4HDRB 2C4VA 3QGMA 2CJXA 5DGCA 3KLPX 4XQ9A 2GEVA 3JQBC 1UPXA 4YASA 5FADA 2R6ZA 2Q4TA 3NDRA 3WKCA 4G0PA 1GRNA 3MIIA 4EHHA 1F6BA 2VJCA 3KT0A 4GPAA 3IL2A 1X7XA 3L8FA 1W48A 4CMIB 4CL2A 1FLAA 5TF4A 4DCSA 1VL6A 3C8ZA 1PLJA 3GJ3A 1IPFA 1UJ4A 1YDMA 3WL7A 1GQYA 1WXDA 1WMBA 3QUQA 1MH1A 1OXBB 2VP6A 2YW9A 4G37A 4TQGA 4CQMA 1WO8A 4JUFA 3UAGA 5KX5A 4ZK6A 2VDPB 1N2IA 1O94D 2WY2D 2NV0A 1P9NA 3FCYA 3HJTA 2ZB8A 2RBGA 3WBJA 3JQ7A 1WF3A 2VYCA 1MO4A 2EZ9A 2A4KA 2WMDA 1YKFA 4FC7A 3QLUC 3L7DA 1QO0A 4ND2A 1EG2A 2HUPA 2RJ3A 2XGGA 3GHHA 4RD3A 4CKYA 1YGYA 3KTAA 3MRXA 3IALA 1HWYA 2YZ7A 1OXMA 4R9UC 3P2MA 3DOOA 4EY4A 4N0EA 5CA0B 1JKJB 1KYIA 3H2HA 1QH0A 5AD1A 2Q49A 4N7BA 1GZDA 4X91A 4PO8A 1MFZA 3DUFA 4UXHA 5HZKA 2ZSIA 3C6XA 3GPCA 3JQAB 3PGLA 1PWYE 1BZYA 4CKEB 4COOA 4Y2UA 1G8MA 2R96A 3HWRA 5AHWA 5I7VA 2FRDC 2Z58A 4JJEA 5IS2A 2VPPA 5HJEA 5ALRA 1G8KA 4KRXA 4DL9A 3F6CA 4M9QA 5FOUA 3TX6A 2VDRB 4BMZA 1TQHA 3A06A 2PR7A 4MWZA 4AJ9A 2QRMA 1NBAA 2D62A 5K09A 1Q6ZA 4GECA 1W34A 5ERYA 1X1EA 4M38A 3KQUA 3SC4A 3O73A 5FA6A 4OO3A 2IYUA 3PXGA 3QMWA 1GUZA 2H7CA 2YQZA 2EJTA 2QKYA 3INNA 3MMPA 1XBTA 3BTOA 1W4LA 2YS7A 2QVXX 3IBGA 5FBWB 3ITDA 2HYDA 2IYZA 4DSTA 5HRUA 4J0HA 3M9LA 1LA2A 3PGVA 3N2GB 1CP2A 4OU5A 4JBXA 3IPAA 6Q21A 4MWCA 5J4VA 3F6SA 1ZY2A 2BAGA 2R6AA 3FWYA 3MF4A 2BTEA 5TGZA 5IASA 1M8KA 1G21A 1ZK0A 1YZFA 1EMDA 1D6NA 4BMSA 2YKGA 4AO6A 1N6LA 1E1DA 3EXEB 3L7AA 2CF6A 2PL1A 3ADPA 3ZGOA 1MEJA 2X0NA 3U60B 4A0SA 4V3CA 1SRQA 1BO6A 2NYAA 3M5DA 2VT3A 2BFPA 4WLFA 1Y33E 2GEDA 5HKLA 3SR0A 5J5AA 1MW8X 1BIFA 2I7CA 5E9QA 4UU7A 5LOVB 3OZTA 3T9CA 3CVWA 4WX2B 2AMLA 2IZ7A 3WO1A 1E61A 1L4MA 5JD5A 1RM5A 1EP2B 1RM4A 1RWMA 3D2AA 2CHQA 3UK1A 3MGGA 1K6IA 5K0TA 1LNZA 1AMNA 1GG2A 2O3SA 4CDMA 4PZUA 2Q3LA 4EG4A 1EIWA 3L82B 1BCSB 4FYMA 4M87A 1ZK3A 2Z5VA 2WU0A 5DP1A 1GCGA 1XNHA 3DLTA 3EY4A 4RH3A 1LPAB 5IH3A 1S7GA 1VE3A 2NO7A 2LPMA 2OOKA 3F6BX 4QYIA 4DE5A 3CLVA 2I0FA 2NYUA 4GZMA 2EV9A 1D6MA 1C14A 2GZAA 2C59A 3CPSA 3PEVA 1S01A 3RS5A 1FC0A 1PL6A 1ZICA 1JR2A 3TL2A 1GGKA 2VRCA 5HCUA 3TR0A 1SBTA 3KDPA 1KOLA 3SU8A 1SC3A 2GSDA 2CDNA 4RZIA 3B36A 1U5CA 4QYWA 2DQZA 3VTZA 1DTWB 3TJZA 3PXCX 5LP6A 1PG5A 1XQXA 3B2NA 4KSYA 1UK7A 3JYOA 4MPJA 3RTDA 1HBJA 4G24A 3E22A 3B1JA 3NDJA 4HO1X 3KKOA 4ZC8A 1M8FA 1GGNA 4KR9A 3M0EA 1LKZA 4INOA 2J5XA 3X2FA 4PX3A 3SJBA 1I30A 2FPGA 2ZRCA 3EGEA 4B4WA 1RP7A 5ITWA 1A9ZA 2B83A 4TUYB 2ZUSA 1DKRA 5A0TA 4DDMA 4HYYA 3B6MA 5TB5A 2B30A 2P9TA 2I8AA 4GR4A 1Z35A 4BVHA 2AH5A 2QOEA 2O5CA 2GBPA 1JDJA 5B57C 3NX4A 1C8KA 4XEUA 4PWYA 1VLVA 4M1MA 1Y1TA 2PS0A 3HCNA 4KRGA 5SICE 3VR2D 2W6PA 4XQEA 3L02A 3WSVA 1FP7A 4G84A 3ZV5A 1PX0A 4YV0A 2QB5A 1VGQA 2WSMA 1D4FA 3TRFA 3NPAA 1E8NA 2AG1A 3CF0A 3UGTA 3K0BA 3Q7QA 4NK5A 5CLJA 1U8XX 4A73A 1OPXA 1U0JA 4AM8A 1XMXA 2OFOA 3DW3X 1JIIA 2EJBA 1K5GA 1U2GA 3BZUA 3OJWA 1PYDA 4I4TB 5C9ZA 2Q4RA 3TCXB 2EP5A 2IY8A 4MS3A 4CMEC 3BM5A 1G20E 1FMCA 3DVAB 5BR4A 4M4SA 1U4OA 3GRUA 4FR0A 3HYRA 4HL6A 3GX1A 3HV0A 1UEXC 1WY7A 5FBQB 4DLZA 3MXOA 3OZ7A 1TUEA 2B4AA 1O03A 3JVEA 4Z7NB 1NJ8A 2GQ0A 3ITNA 4KACA 1AK2A 2A3NA 1WETA 4NCBA 4DR6B 3JTMA 2FF5A 2J6IA 2HGSA 2HPHA 1FYFA 2NUTB 2X8JA 1G9SA 1O96B 3EXFA 4EW1A 4JD5A 1GZ6A 3OHMA 4LYJA 4ZT7A 1TJNA 1KAHA 3SIRA 2DHDA 5MFZA 3COWA 2FW8A 4YP9A 1ZQ1A 3OBIA 5IJZA 3U4IA 1XTVA 5GJVC 4MKRA 4LY9A 4ROSA 1KK2A 1MV8A 3GH1A 3LL7A 2AOVA 3LHFA 3L04A 3TDNA 2G9QA 4KIGA 5DI3A 1US8B 3DHWC 2WV7A 3DVQX 3WAGA 3OPYB 2Z83A 5DSTA 4CODB 3KXPA 3MS2A 1XEAA 1NQAO 4QT0A 4F97A 5I47A 4G1VA 3IQGX 2ZRPA 2H06A 1JPJA 3HBNA 1U2RA 1SB9A 4LOKA 2V3CC 3PI6A 3BE8A 4ZVMA 1QGYA 3HDQA 1VCIA 3RHZA 3HADA 2R7MA 1DWPA 1D0IA 1O4VA 4OAOA 1D2GA 1HE2A 2CL0X 4AJOA 2AEJA 1POXA 1BS9A 1PZHA 3FSJX 4FFSA 3O94A 4HLDA 1RLJA 4URWR 4UU0A 2B1JA 1XNQB 4YP1A 4D02A 1YGPA 4RNDB 4ZU6X 2ZWVA 4CKXA 3PEYA 2I8LA 2MU1A 2ZJ0A 3WLNA 2FEKA 1UINA 3HP7A 2C57A 1P5FA 1WZEA 2QR3A 4C0HA 1QZTA 5CUQA 1E2FA 5C37A 1Z82A 1WXQA 5SZIA 1JECA 3U81A 4WAUA 1H6AA 4L4XA 1ELOA 2WJ3A 3W3AA 1JUDA 2EBFX 2GO7A 3L1JA 1VI2A 5LA6F 1WPRA 4MB6A 5I5GA 3B51X 3OZSA 2UV8A 3M8KA 4YONB 3SZRA 1LI4A 4TTVA 4RQTA 3R6WA 3H2ZA 3N59A 4J4BA 4EX6A 5H3HA 3I8SA 1PT5A 3RIXA 4ENPA 1P91A 4UJ3A 4KK4A 1M2VB 1TMGE 3H6KA 4RE6A 3RLIA 1QNLA 2Q45A 2ANCA 1MA0A 1TF5A 1HO3A 3H8JA 4RJLA 4IEIA 4Y0VA 1AB6A 3C0KA 2PD4A 5EWJA 5GOZA 3K73O 4EKNB 3A1EA 1UDRA 3AM5A 5JY6A 3V1NA 1I2MA 3T1QA 5FHQA 1P1BA 3K32A 1ZN2A 4B3SB 5JO9A 2ZJ1A 1NDHA 2WWVD 5HK9A 4M54A 1KKMA 2D5LA 1KSFX 5A4KA 4MROA 3W79A 1NTRA 2PSFA 1W0JA 1MX1A 3IH5A 1BTOA 4TKUA 4YRCA 5IAOA 2NW6A 4M0UA 3QTBA 4MRPA 5E7IA 4MCAA 1NKTA 4AD8A 1P5ZB 2VQDA 4HFMA 4KGZA 4MPRA 1MUUA 4PWZA 1T0PA 2Y66A 1PS8A 3L0PA 1BJRE 5EXTA 4FU0A 1PX2A 5JT1A 2L2QA 2G1AA 5G0TA 4C7KA 2FX2A 3KOUA 1LDGA 1GL3A 5FD8A 5BRAA 5JQGB 3ZZMA 5BWBA 3UCEA 3WLHA 5DT2A 1NZJA 3OPYI 2QUJA 4A5OA 2F3UA 2HPAA 1R4MB 3R3VA 3S55A 1AV7A 3VC1A 4FFVA 2WT8A 3ZDAA 4GU5A 4E2FA 1KPGA 1YZHA 3FDZA 3JALB 5KYKA 1VSBA 2I67A 2QN2A 5LDHA 2G25A 2VHEA 3H04A 1QVWA 1GPLA 1SUSA 1Z62A 3AVWA 3IUJA 1HZZC 4DG5A 4KPYA 3G1TA 4ND6A 3RS2A 3PG5A 2OLJA 4Z3OA 4I5EA 1ESNA 3KG2A 5TMPA 3TM5A 3R75A 1I2AA 2W6OA 3IUMA 1I3OA 4AURA 3UUEA 2D8MA 1IAVA 4CF3A 2GX6A 2ADFA 4MULA 4UEQA 3U40A 4GEGA 1G3RA 1H0RA 1WCYA 3L4KA 3PFKA 5IDQA 2Q2OA 1I6KA 3D0KA 2DQSA 4GXTA 3SP1A 3LM8A 2WYUA 4EB0A 4RDXA 1G5HA 3BBPA 4QXAA 1MJFA 3WGQA 1OGIA 3GLSA 1Q0PA 3U7RA 3V2GA 5KU7A 3C1OA 2V7PA 3DEKA 1ICIA 2D5AA 3ZE2B 4GMKA 2C31A 4PQGA 1X80A 4XTRA 3EAQA 1D2RA 3D4BA 4FFOA 1F2VA 4MV8A 3ZKWB 5AW7A 2OL4A 1IQRA 1R15A 1MAHA 1VP3A 3SSMA 4MI9A 3EZ6A 1XPUA 1V5GA 4RIFA 3TAUA 1K6EA 2JCXA 4FJ0A 5GTDA 5JUWA 1T6YA 1PSWA 3QXCA 2OGSA 3TW6A 3UNXA 1LX7A 2HI0A 5CFMA 3A6GA 4HMPA 2NVUB 3GVCA 2G83A 3QU7A 4DA4A 3P9YA 3OZAA 5JC8A 5IJAA 4CCAA 2BMFA 1MO6A 5FI1B 2FZGA 1K6XA 1QH1A 3PFGA 1F0KA 3EXHA 4BASA 1L5VA 4H3HB 2REBA 4QOSA 4EJ6A 4ZFNA 4KPGA 4GO1A 1GSAA 4CL3A 3OOYA 4OXXA 4WCFB 3DZDA 2HW8A 1YQWA 1V1RB 2DWOA 4L3WA 4TLMB 5K6AA 3GZNA 4C5AA 1R9MA 3JD3A 1HNNA 5ESRA 4K3VA 4NS1A 1VSTA 4FD2A 3RTAA 3JWHA 1JXAA 2HK6A 5KZMB 1ILWA 2NZ2A 3JQ9A 2EHJA 3HNOA 3G9QA 5LMCA 1D7AA 3GGOA 1JA0A 3FMPB 4LDZA 5K4GA 1RHKA 3H3XA 4QTXA 4BNGA 5HZMA 1FTWA 3THXB 4A0RA 1NWHA 1UEIA 2PSJA 5T4BA 3PSAA 1OXKB 2BFOA 1A76A 3MAGA 3LUCA 5K0EA 1DMSA 3ZLJA 3JAKB 5H3LA 2QRJA 5GJCA 2H54A 3MK31 1NRWA 2FEMA 3PJFA 4LHVA 4AMZA 4B8WA 3KR2A 2C03A 2QTRA 2OKCA 3B7PA 4O0LA 4J2OA 5KNDH 2QD3A 3IOBA 3ZG6A 3U5TA 1HT1E 2C9ZA 4IFEA 4RQBA 5IJXA 3R5KA 1L4YA 3OBBA 4ZYVA 1Q95A 4M6WB 3VHXA 3EDQA 3HI6A 2IFTA 1U2DC 5FNVA 1BEEA 4NYJR 3ASUA 4F6CA 1ZOOA 1L8AA 1R88A 2AJCA 2FN7A 3T5CA 2QPAA 2W0SA 3VFDA 2ISQA 3OTHA 4D41A 2ZE5A 4LQDA 1P1JA 3CCCA 4MUEA 2QQ5A 3QYFA 3D6MA 4URVR 2KS6A 2WIAA 5LYJA 3SOPA 4MUNA 2IUEA 1M1YE 4JJ6A 5JR3A 1MJGA 4UD2A 2CNLA 4OKIA 3FM9A 4JC4A 2FWMX 1T4CA 1U7XA 5HEKA 3SBXA 3QX3A 2Q4EA 3N2IA 4AS1A 4D9EA 3TYXA 4C0SA 2R5WA 2UZ1A 4PQFA 2RH5A 1CUYA 5B1YA 5KINB 4AN4A 2CXQA 1O6GA 2WB4A 3EHEA 3PDIA 1Y6RA 2X3YA 2AN3A 4R9SA 2RKOA 3LUPA 2AF4C 4BMCA 2ECPA 4IKEA 3W5UA 2QN3A 1KF0A 3AUAA 1YJAA 5DOVA 5ALZA 3LF1A 2VT7A 4HQOA 1AO3A 1VJ1A 1KZ6A 3CY6A 3ZHZA 3K4HA 5J2TB 3K1JA 4ZZ2A 3QXHA 1WTAA 1SEVA 3W4JA 4L0CA 4CF5A 4BEVA 1TO6A 1L4LA 2E89A 5EHNA 2IOYA 3GLIA 1KMHA 3EX7C 3OQOA 2QPTA 3OKAA 5B4UA 4ESHA 4HMQA 3CWQA 1SVKA 4ZDIA 3U44B 1I2ZA 2AJ8A 5CPFA 3I5YA 1DG3A 1TKRA 3E9DA 1OYYA 2OAGA 3PNBA 1V9SA 4G1FA 3TFOA 3DHEA 3DDWA 3JZAA 4H7JA 1DZIA 1NURA 2JLBA 2M9MA 3PLNA 4R1MA 1RW4A 5CAEA 2WZDA 3CRNA 1WSWA 1PUXA 3N8GA 2DQ4A 1BE8A 3KNZA 1EX9A 1T1SA 2CXXA 2C8LA 3NTRA 3OLYA 5EZYB 5G2OA 4ZI7F 3ZHXA 2FZLA 221PA 3I6BA 4WCDA 1KYQA 4P5DA 5F9MA 3JYHA 3UH0A 2QL9A 3FROA 2D1QA 4MR7A 4O8ZA 2SECE 3ZCXA 2NQTA 2EIXA 3K8ZA 5BXYA 1V16B 5KS2A 4DIBA 3AVOA 3U4CA 1UJBA 5IP5A 3VI4B 5JBQA 4FNMA 1ULHA 4WA8A 4F7DA 3NOQA 3M3PA 3ZS9A 1RXYA 3TBFA 3AEUB 2CSXA 3E9EA 2CC2A 3OE4A 1N2BA 1DG9A 3L2OB 2GCIA 2IE8A 3AY7A 1I7DA 2XJ4A 2QYTA 4FX2A 4GLLA 2J7PD 1NJ2A 1O95A 2WYHA 4G67A 1XCLA 4YO7A 4D9KA 1FNMA 2O7SA 5LQKA 3MUEA 1EQUA 4BLSA 3LIIA 3TI9A 5CDGA 1SZJG 2P9EA 1U7HA 1CKEA 1JSCA 2FUEA 3ZJTA 2GEUA 2IZ5A 5ITSA 2FW9A 4TZKA 1RYBA 4JGBA 2GPWA 2O3JA 5JD3A 1ZK4A 1I4EB 2UVQA 4L95C 4TWRA 4C2AA 3KQNA 1W581 3ROFA 3NVMB 5IF3A 2IBSA 4B3HA 3W04A 3PD7A 4NPAA 3D6JA 3Q72A 4LS3A 2Z5LA 3M2TA 1D8TA 2QMHA 1VJCA 3ZOZA 1XEXA 2P2YA 2PZBA 1KO1A 3UJ7A 3ES9A 5GZ1A 5BWMA 5JMWA 5BOVA 5J5VA 2APJA 2PY6A 2QUKA 3I9NA 3UJ3X 1FNSA 1CRPA 2ZE6A 3EZLA 3HWX1 4BEBA 4IZHA 4TMZA 1S1CA 3FYUA 2YHBA 4Y30A 5HF5A 1T2NA 5AW6A 5ISMA 3EPPA 5JTTA 3C8MA 3Q3JB 1C7ZA 2VTVA 2J0UA 2PYZA 4JGGA 4MQBA 3ENVA 1IH8A 2ZDGA 3F5QA 1WOMA 1ZJWA 2ODWA 3P0RA 1RPNA 4MLDA 2M6LA 3U6KA 4OBXA 2O8DB 1KP3A 3HC7A 1GUFA 3WGLA 3AINA 4QOGA 1OXTA 2RBKA 2D8AA 3KJZA 2VDJA 4YCCA 1Z0JA 3F7NA 4O1HA 1VLHA 4U7HA 4UDXX 5BUSA 4FNOA 3ZY3A 4MR8A 1QYXA 2O2EA 5FPKA 1GZVA 1N2CE 2E4WA 2YV4A 1MT3A 3KOYA 2O2IA 3GDOA 2B8TA 1BMFA 2BV3A 3JQQA 5IEBA 2FHPA 4HMOA 4AJIA 4CQMD 2OTCA 5ARCA 3WWDA 2JHPA 3HE3A 3Q15C 1TU4A 3ZC3A 3KJNA 4YRRA 4Y2YA 2J3MA 4PXSA 5EUCA 4JLKA 2ONJA 3HB0A 1A04A 4LWZA 3QF4B 1X92A 2QMOA 4HAVA 3V2IA 3EZ7A 1NW7A 2H1WA 4RQUA 1HZJA 4YUZA 1QO0D 4YGXB 1C1DB 2RHMA 3FDFA 1VRWA 1YDGA 1Z3CA 5JH7F 4IHQA 4U7JA 5KDOA 1R8JA 2JCBA 3G02A 1KQPA 2BGUA 2I76A 4GVPA 4IIJA 1FNCA 3U17A 5CVEA 1KQFA 2VC2B 1Y7PA 2GCOA 3DDCA 5DGHA 1K86A 3PPYA 2K2QB 4JT4A 4C4AA 1RNLA 3JWGA 4LC9A 1T3LA 1OFIA 5KAMA 2QVLA 1BYUA 4E1VA 2DG2A 1WB5A 2YHSA 4L73A 5L53A 1M6VA 4O25A 4YVFA 4QU5A 2O7QA 2P2ZA 3DSRA 5AI4A 2XKKA 3ML1A 2AZXA 1IOVA 5JEDA 1W9MA 3FY4A 1ZH4A 1PGOA 1YRWA 2V6MA 3QG1A 3KLMX 3M82A 5KTTA 3SLKA 4TLAA 5CIWA 1GTSA 4BO4A 2EVWX 3NC0C 2J3EA 4KPEC 3I83A 3RR2A 1NG1A 1Q7TA 4EVSA 4KYIB 1FF9A 2VAMA 1GV0A 1XDBA 1Q0HA 3HACA 5KKAA 4B4DA 4EG5A 1SVSA 2QN7A 1OT3A 3WK4A 3HP4A 1D0SA 3WGNA 3TZKA 1VKHA 4K9KA 3UTDA 2GPAA 3H2IA 1ZJZA 3KRTA 4K8OA 2ERXA 2REXB 5ADVA 1Z0DA 4J1QA 1DQYA 4WCFC 5D3KA 1JHRA 3HJUA 5BW5A 1SEPA 1XD2A 4U63A 2V45A 4ETWA 4TSFD 4CKZA 3I2YX 3KYBA 1JX6A 2ACKA 5EERA 5BRJA 1IMJA 1NP3A 3MAJA 3MJ4A 5G4KB 1BVHA 5AOAA 4KL8S 4B35A 5ALOA 3G13A 9MHTA 3EA0A 1S9HA 1S3SA 1ZWKA 2I3BA 3PA6A 5DSZA 3WVNA 5E3HA 4K9NA 4J0FA 3BORA 3JQRA 5TF0A 4M22A 3DZFA 1Q1ZA 1W1WA 3JQBA 1ZRHA 2CFCA 4QLOA 5F12A 2IYPA 5L51A 2JBAA 1D3AA 3D3EA 3U13A 1Y5IA 4N8SA 4KLZA 4KLAA 1N9GB 1TU0A 3LGXA 3MBIA 4UU8A 1IVYA 3WK5A 5EG5A 3IHLA 3OX4A 1SVOA 4DDWA 5KIAA 1O77A 2K2WA 3E7PA 4QBIA 1CIJA 3MFQA 5IDYA 5K1ZA 3UHPA 3ZVNA 2CL5A 4CMGA 1IXKA 2P3LA 5P21A 2I2XB 1MC8A 5DB4A 5KU1A 1Z0SA 3IP3A 1G17A 2I87A 4FBLA 1PK8A 3B5JA 1KBQA 2YWDA 3RB8A 2ETVA 3HKCA 3L18A 3ICWA 4IJWA 3S68A 5FFNA 1GSIA 3AESA 4MARA 3UGKA 5ER9A 5KNDA 2SNIE 1RPZA 3GEGA 1LBSA 1Z15A 4RSGA 3WB1A 4YV2A 2ZSFA 3GCZA 2G9RA 4PQEA 4CV1A 1C8LA 4GI5A 1U5AA 4K2HA 4L5IA 3W2TA 2HADA 3M83A 1JE1A 4JUIA 4PSDA 2NU8A 2VRCD 3MT9A 4I9UA 3EIEA 1HFKA 3GL9A 4ITRC 1F0NA 3LX5A 3C4JA 3VPXA 1N6KA 3B2EA 3LOQA 1YL5A 4E2WA 2YHIB 3BDAA 1B3BA 2H2IA 3ODGA 2ZIAA 2ZT7A 3BPSA 4XSGA 3FB1A 4P0PB 4IHJA 1LBIA 3P32A 1H5NA 2OHOA 2ZTHA 3N8DA 3U7GA 4XB1A 3GI1A 2D0PB 2QR5A 5CBPB 3LBHA 4FKBA 4EG7A 2WKSA 4YDSA 1K5HA 1O5OA 1UMCB 3GVXA 4P35A 5KHAA 1Q0TA 1VDZA 5IRCD 4AC9A 3CVOA 3F3KA 3SYNA 1TZKA 3PXUA 2J9RA 4JUCA 4BUZA 3FKQA 1RI2A 4C0KA 3CH7A 3PA8A 4XM2A 2IDZA 2Z1NA 1JDVA 4GWKA 1CEXA 3GPBA 4RDHA 4D4HA 1A8QA 1QF7A 1NFRA 2LV8A 2ZQZA 5CNMA 3ETJA 4UREA 4GPD1 5EPOA 4ZAWA 4BVBA 1DT3A 3DTTA 5BVGA 4K2AA 3CZQA 1EGVB 3EBLA 4URHA 4DLAA 2O0KA 4YJ3A 3ZQ6A 5ESWA 1L4FA 1OFHA 2A9PA 3U9LA 1VKNA 5AJTA 4UAGA 3V7UA 3I34X 5KYVA 1NXOA 1TYBE 1SN7A 2BBSA 1C9EA 1K92A 1UUFA 2X3FA 3CJRA 3HJRA 4GEKA 4I4LA 1QO9A 2IIPA 3JATB 3AK4A 4IXMA 4ZD6A 4B8YA 2FAXA 2RFLA 1NQTA 2E1RA 4MWEA 3B3JA 2DOKA 4WBNA 1OWNA 4W1PA 2YIVX 1Z7EA 3DKIA 4RWZA 4Y2SA 4N6GA 3WP0A 1ANKA 2A30A 4D1YA 3ZCPA 4WK6A 4UTPA 1ML3A 1QB8A 2P68A 2WJ6A 3UCXA 2OHHA 4N1AA 2W7TA 1U8CB 2OMKA 2C82A 1A8SA 1U7UA 1M0EA 1J2YA 1Y5MA 5A4AA 2NZJA 2CZGA 5TVKA 5I7AA 4MA0A 4M8NE 4PYLA 3R6LA 1GZHB 1I6MA 1G7TA 1YT5A 2A7XA 2ZJ2A 1GTRA 1FSGA 1VHDA 5ALNA 1RRKA 2P9BA 1ZUD1 5KX5F 3RYCB 3R5JA 5BT9A 3G2KA 1AS2A 4HPJB 4J43A 1TKCA 3ZW7A 3ZJ5A 5REQA 4F1WA 1N6HA 5H83A 5EUQB 5CLHA 3W8DA 4DMRA 3LCRA 4O29A 4XFJA 4A6EA 5LKAA 1SFRA 2I99A 3LYHA 5A2GA 2RG7A 2BSAA 2O48X 3T1OA 3MMSA 4QIHA 1I32A 3T7KA 5JADA 2I91A 2IITA 5KYTA 4DB2A 2VKTA 3AHEA 3LPDA 2YH2A 3EZYA 4K6GA 5DJ5A 4CLXA 4RMNA 1DI0A 4DG9A 4CG0A 2BM9A 4O4LA 4HDSA 4UEKA 4RK5A 3N0WA 2DF8A 4UDNA 4OBBA 1L7MA 2ZBRA 2X1HA 3AWDA 4HEQA 1Z63A 4MUKA 4DWVA 2VUTA 2HWXA 3R0IA 3DL0A 1YTUA 1U02A 4R1NA 3Q8MA 2WFLB 3BK1A 3KHTA 4V24A 1VQ1A 4WXRA 1AQ6A 4YV1A 1ISJA 1A9XB 4RPCA 3T3HA 2NVBA 4GOOD 4KQFA 3LKBA 2A9OA 3NIWA 1H3EA 3AI3A 2H4WA 2XXJA 5HIIA 2YXEA 4F4JA 3L8DA 2DFTA 3W3AD 4ZCMA 1YBMA 4UEJA 3WE7A 1CG6A 4D0RA 1FJXA 2BI8A 5A06A 3CE9A 2PS1A 3UXMA 1V95A 1BKSB 3T9EA 1K5PA 4A2WA 4C30A 4P2GA 1BQEA 5CFZA 1K0UA 3THSA 2B8NA 1Q20A 2J9FA 3PVZA 4MVJH 4IVPA 1ZI6A 4Q21A 4JLAA 3Q2OA 3GLFE 3JY6A 1F38A 4M99A 2AYXA 2FLVA 5DTRA 1IB0A 1LNQA 3QVKA 2D1TA 3ZV7A 4AJPA 5IDVA 4GSYA 3NBYC 1ZC3A 1HMPA 1SOAA 2QZ4A 1OH7A 5SY9A 3GPIA 2R7NA 1W0JD 3ABSB 1AD2A 3K2BA 3M6MD 1R5BA 4XA8A 4TVBA 5C8YB 4X00A 2A1IA 2NUAA 2DH5A 4KQMA 1G9XA 1I5OA 1JQKA 2WWGA 1SBIA 1G3QA 1H2EA 1NQUA 3IKLA 3EBOA 4MJXA 4EO9A 2QM8A 2WU1A 3GROA 3MS7A 1RRGA 2B4RO 4G5RA 1RAAA 1I10A 1R4NA 1J90A 1V8PA 2QN8A 3TEFA 3UK7A 3TXAA 2G71A 3V4SA 1LVUA 2YVKA 5FPQA 4ZAVA 2D5CA 1Q57A 5KC9A 3OWHA 1W73A 4FZRA 1Z5VA 5EC8A 1FIUA 2EATA 1PN3A 2B2XA 4ZK2A 5JAPA 2X4LA 1KZ9A 1JIUA 4DSOA 1DUVG 3DL4A 4D0GA 1R3DA 4P3OA 2XRFA 1ITZA 4QPNA 4ZZ3A 3QE9Y 1K9VF 4RD2A 4NMLA 5AM1A 3O4RA 2HO5A 5CB8A 2FSPA 5JOQA 1THGA 1QH8B 3ANNA 2P4HX 2XI4A 1B8NA 4LYAA 4NH4A 2NPFA 4NICA 1T3SA 1U3TA 2ZJZA 1Z33A 3QEMA 4XUGB 2RHCA 3TVYA 4DS3A 3EPLA 2RHDA 2PQ0A 1JHOA 4J16C 2ZB3A 3GBVA 3OE7A 2PPVA 3NBUA 4KE8A 2PBLA 4TTPA 3ZLVA 3RF7A 3CLTC 5U4XA 4LSMA 2A0YA 2ERYA 5LP6F 2GZHA 3A4YA 1XZEA 1MX9A 3CT4A 4P9NA 5E9WA 2YCLA 2PKQO 2CLOB 4O2BB 1RCUA 3O4GA 5T4EA 3NKFA 1QFSA 5BUZA 1B8UA 3D4OA 1BDHA 4NBKA 4PLPA 1QRSA 3OIYA 3TKYA 1E59A 2QRQA 3T7DA 5FTLA 1QHFA 3GMSA 1LTKA 3ELYA 3ODPA 1Y48E 2LDBA 4MZXA 3R7DA 2V7EA 1YR7A 1L9KA 4EA8A 2Q7DA 3JQEA 3WIUA 1H1LB 4AB1A 4UZEA 3HMKA 3PKJA 2ECKA 1BH2A 1CTQA 1SAYA 4N82A 2PNJA 4LF5B 1Q92A 2C5SA 3UV3A 2IIBA 3N2KB 1E3EA 5L3SB 2SCUB 1SZDA 1S2OA 1DOHA 1T36B 1UMDB 1H5UA 1LPBB 3OTOB 2GMWA 3NG1A 1RQ7A 1S3IA 4LPSA 3OCXA 4P38A 2H1OA 4KRYA 3F1KA 6LDHA 3EGXB 2QAJA 1EA7A 1A2KC 3AXSA 4QFMA 5K8CA 4DR5B 5EJ8A 4IZOA 4MGIR 5TQ0B 4DR2B 1VBFA 2XE7A 4PZPA 2C83A 2GN0A 1R0KA 3QE3A 4RY8A 2ZVDA 4CL8A 5LNK6 3KXLA 1OH5A 2FWNA 2B9VA 4QHSA 3RVJA 1TDJA 4JLPA 4I50A 3VC3A 2HIAA 4AXBA 4C2BA 5JATA 4RGQA 1XE3A 4F45A 1YC5A 5CYFA 1FXWA 4JP1A 4DIDA 1CD5A 1QIGA 4MV7A 4OEHA 4DKJA 5CHYA 1Y6FA 1EWQA 3RADC 2WTEA 3AHFA 2UZ0A 1IL0A 3RAEC 3AUFA 3HU5A 3JWEA 2R9VA 1IXSB 1CVRA 3DWFA 1K63A 3HCCA 4NYJQ 5KDLA 3K5IA