5E9WA

Crystal structure of mrna cap guanine-n7 methyltransferase obtained by limited proteolysis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
310
structure length
273
Chain Sequence
SRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA guanine-7 methyltransferase (RNMT) activation by RAM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords mRNA cap guanine-N7 methyltransferase
total genus 99
structure length 273
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5e9wA00
3HM2A 3KQTA 1FJXA 5CVEA 4NECA 3B3FA 4AUKA 3R24A 4KDCA 1WXXA 4Y2HA 3WSTA 3S68A 2VDWA 3KR2A 3BXOA 4FS8A 3LKZA 3DMFA 3PT9A 2R3SA 3A26A 3IYLW 4R6XA 1P39A 3HVKA 2ZWVA 1R74A 2B9EA 1BKYA 3MTIA 4LECA 5EC8A 4Z2YA 2IH5A 3ERCA 3OE5A 2NXNA 5EMKA 4RX1A 4X41A 4E33A 4PCLA 4BLVA 4HH4A 2XVMA 2YQZA 3Q87B 5GP1A 2OYRA 3A7EA 4DF3A 3HA5A 2PSSA 3OZTA 5EMJA 5D1NA 3CVOA 1AQJA 1G8AA 2DULA 1G60A 2CMGA 2YXEA 5GWXA 1IM8A 2UYCA 1JG1A 3EGVA 2I7CA 4QPPA 3ER8A 2G1PA 5MHTA 4DZRA 1JR4A 4PIPA 3PFGA 3I5UA 5K0NA 3SSOA 3T7RA 2YX1A 3UJAA 3FUTA 2O57A 2G72A 2BR4A 3GCZA 5HIMA 3G2QA 4PONA 5EHIA 2AVNA 5HILA 5KYGA 4GOLD 3KPYA 2YVLA 3B3JA 1M6EX 3FUWA 3O31A 2PKWA 4FSXA 3PLAE 1VLMA 3C3YA 4C4AA 3P8ZA 4E2YA 4ER0A 3KQQA 5DX8A 3P9IA 4GC9A 2V74B 5ERGB 1NW3A 3SSMA 3PX3A 3KHKA 4F85A 3HCBA 3LHDA 1NKVA 1SG9A 4DCGA 2PWPA 3PVCA 3NDIA 2FK8A 4PYQA 1R00A 2PJDA 2NYUA 3GRUA 4FT2A 2PGXA 1XDSA 3GWZA 1VL5A 3IV6A 4GUAA 1JTFA 2O0LA 4RWZA 3TM5A 3R9XB 3RODA 2HR1A 1JG4A 1UIRA 2OB2A 1MHTA 1JSZA 3DXZA 3EEOA 1XCJA 1WS6A 3TR6A 3EVCA 4P7FA 4C05A 3UA3A 1TW3A 3BZBA 2OKCA 4DM3A 3NVMB 3NMUF 5CVJA 4PIMA 4QPNA 3OFJA 5DRTA 3G2MA 3GRRA 3QV2A 3VC1A 5FADA 2EX4A 2LD4A 5EIFA 4X1OA 2AN5A 4KRGA 4RTLA 3AXTA 2WA1A 3ER9A 3M6VA 5DWQA 2P1DA 1FPQA 1I4WA 3FYCA 3HCDA 1ZQ9A 3DMHA 3OZRA 4H0NA 3HTXA 3P2EA 1M6YA 3GU3A 3VC2A 2OB1A 3OCJA 3QOWA 4LWOA 4AX8A 4BP3A 5K0EA 5LQJA 1XTPA 4PGHA 3PS9A 4QQNA 5C9ZA 2GLUA 1IXKA 4RVFA 2B3TA 4EKIA 5ICEA 2XBMA 2NP6A 2XYRA 1INLA 1KPHA 2AOXA 2CL5A 3DOUA 3KR9A 4GOOD 3UJ6A 5P8WA 4MTLA 5G02A 1D2HA 3DTNA 5FA5A 1ORHA 1O9GA 2VDVE 4EK9A 2AOUB 4OA8A 3BKWA 3H2BA 1KPIA 2NNWB 4YMGA 4E31A 4M36A 1FP2A 2BZGA 3FPEA 1WZNA 3KKZA 5FA8A 4CKCA 4PYOA 2WK1A 3LCVB 1L3BA 10MHA 3CCFA 5EGSA 3SR4A 3DMGA 4IKPA 2ZWAA 1NW7A 1N7IA 1NBHA 3BWYA 3CBGA 2YXDA 3EVGA 3MERA 4FR0A 3LPMA 4IWNA 2AVDA 2B25A 1Z3CA 3HEMA 2V7EA 2FRXA 4RVGA 4RTSA 2BR5A 5C1IA 1KHHA 3LX6A 3BGIA 1YF3A 4DMGA 4KVZA 1JG2A 3VSEA 4F86A 2GS9A 3EEYA 4GQBA 3JWJA 5GINE 4M7RA 2ONZA 3FPGA 2PX8A 1R8YA 5EEHA 2ZBQA 5EOVA 5K01A 2ZZNA 3EMDA 4U7TB 4GF5A 3CGGA 1SUSA 1IY9A 1B42A 5HIKA 1BHJA 4A6EA 4FSDA 2P40A 3UWPA 1ZG3A 2B2CA 2QRVA 1BC5A 1KYWA 5LQRA 3LDFA 3M70A 3TPZA 1JSXA 3CJRA 5EG5A 2ZVJA 2CWWA 3AY0A 4PYLA 3G89A 5DT2A 5KS2A 2BH2A 1WY7A 3KQVA 4HTFA 4ER5A 3U81A 1NW6A 2QYOA 3MTEA 2IH4A 3ANXA 3NDJA 3KQSA 3JWGA 2H1RA 3PB3A 5K8VA 1NT2A 3KPUA 4PYJA 2YR0A 1VP9A 3GRZA 1QZZA 5BW4A 1RJGA 1WXWA 2NXJA 3UJ8A 4E2WA 3SMQA 5EMMA 3THSA 4ATNA 3M33A 2Q41A 5C0OE 3M4XA 4QVKA 3OU6A 3LCUA 3UJCA 4P58A 2A14A 4R05A 1L3IA 5E9QA 2XYQA 1KR5A 2H00A 3K0BA 4RSRA 2OXTA 5U4XA 3EVAA 3IHTA 2IIPA 1NW8A 4DKJA 4AZWA 5EHGA 2IDJA 2FCAA 3NJRA 4YUXA 5HOQA 4KWCA 3DR5A 5EKXA 3FTFA 3SGLA 3FRHA 4CWAA 3EPPA 5BXYA 5DSXA 1ORIA 1P1BA 4FZVA 4GOMD 4HGZA 5E2BA 2ZBPA 5EVJA 5ICFA 5LQNA 2AOWA 2QM3A 5CUQA 5EMLA 1EAMA 5CD1A 3IEIA 3GDHA 4KW7A 5FHQA 2G8NA 5GM2A 4XCXA 1RI5A 3V8VA 3K6RA 3DULA 2H11A 4YUWA 1YFJA 1KP9A 2P7HA 3BGDA 3EVFA 2G71A 4WXHA 3FTCA 3AWIA 1RI4A 2B78A 4QDKA 1BOOA 4BLUA 2GAFA 2C7OA 3LBYA 5K09A 4EVIA 2ADMA 4R8SA 2EFJA 4HGYA 1KPGA 3C6MA 4GC5A 4E70A 3NTVA 3SM3A 3PX2A 2I9KA 3UJDA 3QOXA 3LCCA 4E2XA 3E8SA 5EZSA 1NV8A 5M5BA 3HA7A 2IFTA 2IBTA 5H02A 4MIKA 4BLWA 2AOTB 4OBWA 3CKKA 4R8RA 2JHPA 1RJDA 1X1DA 2JHCA 2XVAA 3B89A 3OZSA 1SKMA 3R0QA 4RTNA 1V39A 1NE2A 3P71T 1NW5A 1Q0SA 4KIFA 3TQSA 3A25A 4AZSA 1AV6A 3GNLA 3G8AA 1TW2A 4R6WA 3P97A 4OBXA 4C08A 4CKEA 2F8LA 4IV8A 3NWBA 5CVUA 5FHRA 4RTPA 5KQRA 2VP3A 2AOUA 2PY6A 8MHTA 4ZTBA 1N7JA 1TPYA 1SVUA 1I1NA 2ZBRA 3FYDA 5IKMA 5FQNA 1VPTA 3MQ2A 4E2ZA 5GIOE 2PVCA 1VQ1A 3G5LA 3MCTA 4EKGA 5HZMA 4RTRA 3T0IA 3OPNA 5HEKA 3TM4A 1L3CA 5K0BA 5DM0A 1DL5A 2P41A 2IBSA 2PXCA 1L9KA 1NBIA 3MB5A 3UJ7A 5GM1A 2BM8A 2YTZA 3I64A 2EJUA 4YV1A 4RTOA 2BM9A 2OY0A 3P2KA 3R6TA 1AQIA 1ZGAA 2NXEA 3HCEA 2P35A 5E1BA 4QTUB 5D1HA 4CTJA 1AF7A 2P8JA 1Y8CA 3KQYA 2JH9A 1F3LA 3TLJA 4X60A 2PXAA 1RI2A 4YV2A 4GOND 5CM2Z 3I53A 1PRYA 1JQ3A 3TFWA 3AXSA 4BY9E 4LWPA 2NP7A 5EZQA 1N2XA 5GOZA 3REOA 5E1MA 3R3HA 5K0CA 2G70A 2IGTA 3KR0A 3OU2A 4EQZA 5CVDA 3DXYA 1D2GA 4DQ0A 3RIEA 3LGAA 3HVIA 1RJEA 2CKDA 4HTFB 5CIYA 3P9NA 4MHTA 3VYWA 5K0LA 4K6MA 5K05A 3HNRA 2P7IA 1X1CA 5F2OA 1WG8A 2PWYA 5LQAA 2C7QA 2QY6A 2VS1A 4QVGA 2HNKA 1XDZA 2FHPA 5CVVA 3HVHA 4OA5A 5GIPE 2DPMA 5DM1A 2OBFA 3MCZA 5DM2A 5DTRA 1T43A 1VP3A 5ICCA 1UFKA 4OQDA 1KXZA 4U7PB 5E9WA 3B3GA 5CCXA 2ORED 3HP7A 3PTAA 1XVAA 2HWKA 3ELYA 3EVDA 3B7PA 3EGEA 7MHTA 5FWAA 3C6KA 3PFHA 2FPOA 3V97A 4KIGA 2KW5A 2I62A 2ZLBA 5EEGA 4YUZA 4GEKA 2UZ4A 2P3OA 3FPFA 5LQCA 2Y1XA 3X0DA 4OX9Y 1QAQA 3HVJA 1R8XA 2AOTA 5DRYA 4RTKA 5FWDA 2ZIEA 4P7GA 5BP7A 3JWHA 1QANA 3OFKA 2I6GA 1X1BA 5T67A 1G38A 1QAOA 1QYRA 3KQMA 4GBED 4O29A 3TKAA 2AN3A 3OU7A 1U2ZA 3MGGA 4QQKA 3M6WA 2YUIA 3B5IA 3GXOA 3AJDA 5DPMA 4DCMA 3ELDA 2ZIGA 2AZTA 3ID6C 1DCTA 3NW9A 1EQAA 4RYLA 4YV0A 2HMYB 3G2OA 3NVKI 1YZHA 5CCBA 5E9JA 2GH1A 4PYMA 2OZVA 4EMSA 1RI1A 5EQJB 5DXJA 5FQOA 1G6Q1 3CJQA 3FZGA 4G56A 4PYKA 3KQOA 1JQEA 5DTMA 2O06A 2O07A 3C3PA 3KQPA 2E5WA 2GA9A 2FK7A 2PXXA 3KPWA 1XXLA 2IPXA 4M37A 5JUWA 3HCFA 4XUEA 4F84A 2Z6QA 3OE4A 3GIWA 5E1OA 5E2AA 5FTWA 1P91A 4HRAA 4ISCA 2PX5A 3T7TA 4RTJA 4YUVA 3BWCA 2Z6UA 2JH8A 1SQFA 2IDKA 2ESRA 4PCAA 3BWBA 3G88A 3ORHA 5F2NA 3DH0A 1O9HA 3DLCA 4PYIA 3KQWA 1M0EA 4QTTB 4P7KA 4RTMA 3UBTA 1Q0TA 4DA4A 2IP2A 2QRVB 2R6ZA 3LBFA 4RVHA 3BGVA 3GO4A 3RW9A 1PJZA 1NV9A 1VE3A 4Y30A 3UFBA 3EGIA 1SUIA 1XJ5A 3G7UA 3GRYA 5DLYA 5EPEA 5KQSA 2JG3A 1ZGJA 1R18A 1FP1D 2ZCJA 5DXAA 4C04A 5HIJA 5B1SA 4E30A 5FULA 3CC8A 3ME5A 3P9KA 4ER6A 3ELUA 1D2CA 3E05A 2JJQA 2FYTA 3I9FA 4X61A 5FCDA 4RTQA 5K03A 5KVAA 1OR8A 4KDRA 2N47A 3DP7A 2JHAA 3G5TA 3TOSA 1ZHFA 2ZULA 3E23A 3HA3A 3EVBA 4LG1A 5EIWA 2QE6A 2PT9A 3TRKA 4RVDA 3UJBA 1JQDA 1KYZA 3EVEA 5DM4A 5E8RA 2AS0A 3LL7A 5LQUA 3O7WA 2ZZMA 3UJ9A 4UOEA 2ZFUA 4OQEA 3LECA 2PT6A 3NWEA 4P7JA 5DSTA 3E7PA 4AZTA 4AZVA 1HMYA 2ONYA 3FPHA 4POOA 1RI3A 3UZUA 4C07A 1H1DA 4A6DA 2OPBA 1EJ6A 3A4TA 5HFJA 4FP9A 2GPYA 1EJ0A 4RV9A 5E8JA 4YUYA 3FUXA 3O4FA 3GGDA 2PLWA 3LDGA 3L8DA 3SX0A 2XYVA 1O54A 1YUBA 3CJTA 4HG2A 3MHTA 1XDUA 4CKBA 2UYHA 2AN4A 4X63A 4ER7A 5FUBA 3DLIA 3GJYA 1I9GA 1MJFA 1RJFA 3EVZA 3LSTA 5DX1A 5DX0A 3FTEA 3A7DA 1DUSA 1KIAA 4JXJA 4FGZA 1X19A 3DUWA 3BUSA 4HSGA 4MWZA 4V0QA 5JR3A 5K0JA 1G8SA 1L1EA 5LQKA 2PBFA 3I58A 3SSNA 1YB2A 4M38A 2WA2A 1YZ3A 3GRVA 2YXLA 2OO3A 4C06A 3Q7EA 3T7SA 2Z6AA 4C03A 2ZW9A 3LKDA 3M6UA 3SVZA 3SXJA 1VIDA 2EJTA 3LDUA 3DXXA 3EMBA 4PINA 3D2LA 4XUCA 2PV0A 4MQ4A 3THRA 2BR3A 2NXCA 5F2KA 2C7PA 3TKYA 1HNNA 2AR0A 2P3LA 1X1AA 2ZSUA 1SQGA 3HCCA 3P2IA 3HCAA 4L7VA 4BP1A 5T64A 3BKXA 9MHTA 3TMAA 2UYOA 2HV9A 1YFLA 3ELWA 4PYNA 1UWVA 3FTDA 5BW5A 4PWYA 2ZZKA 1QAMA 2IH2A 2O05A 5K0FA 2CMHA 2K4MA 4B17A 3MAGA 5E1DA 1EIZA 5K0GA 2PX4A 2ZTHA 4PGGA 2PX2A 1VBFA 1JTEA 2AOVA 4QDJA 3KPVA 5DTQA 3KPJA 3KR1A 4IV0A 1EG2A 4HC4A 5T6BA 4YMHA 3JWIA 3BT7A 3G8BA 1G55A 2Y1WA 1FBNA 2EG5A 4PNEA 4E32A 2GB4A 1R6AA 2UYQA 3A27A 3C0KA 3KU1A 5LSAA 1XCLA 1JG3A 5LR6A 5IH3A 3P9CA 2VDUE 3FUVA 3M6XA 1ZKDA 2HTEA 3FPJA 4XUDA 1P1CA 5EKUA 2ERCA 2ZIFA 3FRIA 5HIIA 5ICGA 3UA4A 2P3QA 3G2PA 4FT4A 4V0RA 1F38A 3F4KA 4ER3A 3BWMA 2C7RA 2VZ9A 4CXMA 4WVLA 4CTKA 3FUUA
chains in the Genus database with same CATH superfamily
5CW1A 3HM2A 3ZGXA 5IHXA 5IM5A 2QUIA 4BMNA 4NIMA 1PAUA 1QF7A 5B6IA 1CY4A 1UBLS 1XF1A 2HMSA 3L01A 2E3JA 2FSSA 3GCGA 2IZ5A 3N59A 3T9DA 4TSFD 1M67A 3BL6A 3O1IC 1YU6A 5F77A 4BKRA 3IT0A 3BXOA 1KKMA 4FW8A 4D25A 3U19A 3VM6A 5EC8A 4N0MA 4W99A 1OV6A 3IAXA 3HYRA 1Z35A 5GONA 1N33B 1U90A 4ZYYA 3EUWA 2A30A 1FX0B 1SRRA 2PMCA 3KFXA 1NYLA 1GSOA 4KMRA 2PSSA 3GWGA 4XSVA 2YRWA 3B36A 5DNDA 4HR7A 4L07A 3USCS 3L7IA 3CVOA 3H86A 2CMFA 4RW0A 5JROA 3N8KA 2IE0A 1KHTA 4O4LA 4R1QA 3RFVA 3V7WA 3DL2A 4BWVA 4IHAA 2BGJA 5B5SA 2TYSB 2VHEA 3N8IA 4N7RA 5K4GA 2JFHA 3I1JA 3INTA 1UBOS 4AIIA 2E4VA 1C8KA 4CBVA 1R64A 1SXJD 4AJHA 4I1PA 4GGMX 2AJLI 3DKKA 3HZOA 1RM4A 1SXJC 3FUTA 3N74A 2YWEA 1T3ZA 2IXGA 4WCFA 5EHIA 4EG4A 2XRMA 4QUBA 2H51A 1DXYA 1MEOA 1GT6A 1JQKA 3LLSA 5FPHA 4MWSA 3ZJ5A 3MW8A 4JGGA 3ACBA 3JQEA 2WKRA 2WFZA 2BGNA 2QRQA 1A4RA 2G5PA 4A2CA 4GLOA 2HHAA 5H68A 4CQNA 1S89A 1OI2A 1BCSA 1RAEA 1A7UA 1I3LA 1N3BA 2IU6A 2VPYA 4KSCA 3ZTYA 2V6FA 1KP3A 4BCCA 3PVCA 3HJAA 1B6TA 2EIHA 3GLIE 3G59A 4D4MA 5AP9A 4I9UA 3PHHA 1O4WA 1XZNA 1FQJA 3CBQA 4GECA 1WP9A 4IJ6A 4NJEB 1CJUC 4QGHA 1YCGA 2UKDA 4FFPA 4BV9A 4TTJA 1JSZA 4I1VA 2X19A 4G8JA 4GZ6A 4L15A 3MINB 4DA9A 3UA3A 1LVGA 4QQRA 1U1GA 3OQIB 3FNHA 5CDFE 4ZQCB 4CDGA 5LZ7A 2Y0CA 4A5SA 4RTLA 2DUWA 9GPBA 5JJCA 3D4PA 3DG9A 2W9XA 2X6TA 3E81A 4PIVA 3ENVA 5LU8A 4WTOA 5KPDA 1VG1A 2H92A 2JFZA 3V8MA 1DRWA 3UK7A 2J9ZB 2WU8A 1SHTX 5K3AA 3T41A 4YMVA 2Q5FA 4BP3A 5LQJA 4YONB 4O4JF 2BELA 1JQAA 1TZMA 3MIZA 4BO5A 4CKBB 5C9ZA 3KSMA 1L7VC 4L5IA 2GF0A 5FTMA 1INLA 1XRMA 2OR3A 1Y7PA 4KXWA 3DYVA 5KTPA 3G9QA 1Y81A 2ID7A 2IXEA 3UIEA 3W06A 4LYJA 3VNSA 4CKYA 3BQ9A 4EK9A 1LBSA 3OJCA 1TX4B 1XPOA 2GFIA 3BKWA 4O1IA 2EG9A 3R7LA 1CUIA 5BRNA 3SKYA 1J2RA 2QJRA 1FP2A 4IQ4A 2WINI 2ZJ6A 3CZPA 2R1UA 2GN8A 3T54A 10MHA 1SOWA 4B3MB 3MERA 1NBHA 3HZZA 2H5EA 3OA2A 8ABPA 2B4RO 1CRWG 4UJ5A 1P19A 4D5GA 1JLLA 5I7FA 3ZOKA 2JZNA 2YFYA 1JI0A 3VZCA 3FPAA 4QGFA 4UUOA 3IT1A 2XRFA 2QM8A 5AJTA 1NJGA 3PC7A 2ONZA 3WLRA 1R8YA 1BA3A 1MBZA 1X94A 1DG1G 1YL6A 3JQ9C 3QY9A 1QWOA 2BISA 2BJWA 1JHUA 2CSXA 1F2UB 1XYVA 1B42A 3JAKB 1TUGA 3EJWA 4X7PA 5AVTA 5A4AA 1GP2A 1WF6A 1CR2A 3G6KA 3NS7A 4RJJA 2CVZA 3UWDA 4G0YA 5IYZF 4P5PA 3U6KA 1QORA 2Z3ZA 4DR6B 1IOLA 2BH2A 4ZAGA 5KS2A 4MDYA 5DT2A 3GAFA 2BSXA 4H2DA 4RJIA 4Y2RA 2VNJA 3SD7A 1U9IC 3Q1KA 1NUUA 1CHNA 3VR5H 2B83A 2IYPA 2ZS8A 2W2OA 1PE0A 1J9EA 2F1RA 3PT5A 4M8KA 3RUFA 3TCNA 3K1TA 2W0SA 4NV3A 2PGAA 2IC5A 4BC0A 4F92B 5G2OA 3MWEB 5JMOA 3UJ8A 4E2WA 1EP2B 3ZX4A 1EGHA 1N92A 1QS0A 1YGPA 2JAHA 3M6AA 3JQQA 4MV4A 2IWRA 1U3VA 3A9CA 3GJ8A 3PP8A 1Y8RB 1V5FA 3D3WB 3ZUPA 2R62A 2RI0A 1XI2A 3TB6A 1RXWA 1JW9B 2C5GA 3VR1A 2XYQA 5JLJA 4QAJA 1UZAA 2HU5A 1BH6A 3DD5A 1BD3A 5BRAA 4QBFA 3C97A 2XT0A 1PD0A 4QPCA 5LOVA 1K6XA 4N5NA 3QGMA 4L4YA 4QDUA 4X6UA 3JTMA 1QCCA 1L5RA 4H17A 5I01A 1RCFA 4UBKA 1K7SN 3PQFA 4DCNA 3NEYA 4HWKA 3PDCA 2WG0A 2BHNA 2XQJA 3TWOA 1IHYA 2I76A 5E2BA 3WTBA 3SYMA 1BEEA 3I76A 3IAAA 1L4HA 3WMXA 1A5AB 1ECJA 1I9CA 4ENRA 2JCVA 3FFTA 1JJFA 2VRCD 1DRVA 3V1YA 2WF6A 4BQEA 4XKJA 1B8NA 1T9AA 3FTCA 1IVNA 3OKPA 1PWHA 1J6UA 1MVOA 4IZOA 4GPD1 2NNLD 3HCPA 4FXOA 4YP5A 2NUPA 4IEEA 3WIVA 3QE3A 2EFJA 5TIIA 1KFBB 1ZN2A 5KQMA 3N6VA 4KEAA 1PDVA 5JS8A 3B9QA 1OVGA 2FV8A 2ENWA 4G4SP 2QJWA 3TSWA 2ZYGA 2PQMA 2WVJA 2NAPA 2V7PA 2ZE6A 3EG9A 4EB0A 3T0FA 4BWYA 3DUFB 2XNHA 4ZZ2A 5DE3A 2B8JA 4V0ME 4IQFA 3VDRA 2E4WA 3TF5A 1FP7A 1WVGA 2NVWA 3JR3A 5TARA 4E5UA 1DC8A 3C4VA 4LHEA 5F98A 1YQTA 4MR8B 3PNLA 4BX3A 5B57C 1BVHA 2KLBA 4IIUA 1BHSA 5LZ4A 2GZ1A 3OQMA 2AOUA 8MHTA 3OM9A 3I04M 1LNZA 2VH1A 2B35A 3D2CA 3MIIA 2BF7A 4ZJPA 2Z08A 4HVTA 1N2BA 2Y67A 4MPPA 2PA3A 3WSWA 2YWRA 1VPWA 5FAKA 3WJ2A 4JZYA 1QQ5A 4WVFA 5HR5A 1EX9A 5IC4A 2XUHA 4E12A 1PT8A 2ZB3A 3EIXA 4CFZA 4X7MA 5DCYA 2JH3A 2ODPA 3QU4A 1QG2A 4MGIR 4Y1EA 1OIVA 3TDMA 3Q12A 2BM8A 4YBZA 2GHRA 2WYWA 4RC9A 4ZOCA 4CMIA 3JQ8B 2BM9A 2Q0XA 1ZGBA 5FL3A 1RHMA 4YRMA 3BJRA 3PDHA 1PX0A 2A5LA 2VJLA 3QW2A 1B6RA 2B3DA 4IDGA 1MW9X 2JANA 4YQFA 1GNLA 4II2A 1AF7A 3MHPA 4Q37A 3VU9A 1XMXA 5CXUA 4YN3A 4FNMA 2F4VB 1M76A 1NASA 4M49A 1EFAA 1WSDA 5KVQA 1FTGA 4YV2A 1KNQA 2EKDA 2HK7A 4RJLA 4Y2UA 4UE6A 2P6UA 4QQFA 3PFWO 5CM2Z 2VSNA 3LKVA 3R6DA 3AVWA 1N2XA 1OBOA 1OTXA 4HATA 2WJZB 2FW0A 2OZKA 3CVUA 2WPDD 1X8XA 4G81A 2OD9A 2YBEA 4IOKA 5IDYA 1TVEA 2FJUA 1GPKA 5DSZA 2IEDA 3FTQA 3KYCA 4DIKA 4PLHA 4BNGA 3FNIA 1COWD 3CPEA 4HFJA 1QX3A 3FAKA 5HJ7A 1NSFA 2UAGA 4KZPA 5IVKA 1WPRA 3MK31 4DDMA 4RPKA 4D96A 1NWCA 2E1RA 6CHYA 5LJIA 4GXRA 1CDZA 3ENQA 4FE7A 2PH7A 4QUGA 4NG4A 4HVLA 1R4AA 4Q5IA 2QY6A 3VYUB 3SWWA 5A4FS 2NSLA 1GUBA 5TQVA 5CVVA 1IEQA 1TA9A 2V3VA 4B6RA 5CM9C 2H8KA 4C7XA 1HM5A 3NTOA 3QF4A 3D6HA 5AXAA 3WHKA 3NC1C 4ZI7A 4IRUB 1B73A 4EO7A 3U60B 1N3YA 5KMGB 3T5AA 1CJMA 4DLLA 1GL9B 2Q62A 2JI6A 5FUQA 3FOBA 4DBLE 3UKJA 5DO9A 2XJ9A 3FPFA 3UMFA 1NBAA 1S2IA 2PUTA 4G24A 3N2YA 3NETA 2WYOA 4J8PA 4O63O 5AO9A 1X3LA 3FCAA 3RVNA 3VOBA 1NVVQ 1K92A 4PLYA 2Q9AA 2GPWA 2QMUA 3DZHA 2ZJ5A 2X5OA 3PDUA 4GI3A 4IO0A 4S2EA 4DJTA 2G5GX 2V3CC 1JEYA 3OFKA 4NLLA 2CD7A 3AERA 4D0NA 3MM4A 4LJ5A 2WZCA 2Z3VA 3B38A 3VU1A 1QYCA 3W5HA 3ESQA 4EX7A 3OMLA 1T5BA 4XD7A 3I23A 1IC6A 3A1VA 4UMEA 2PSJA 3KP1A 3Q0EA 1GPH1 1O3YA 3CRQA 1DRKA 3F4LA 1GNPA 3WGHA 4AJKA 1IZYA 3DOOA 2HRQA 1Z7WA 2AC2A 5DXJA 1JEQA 3IP3A 2EZTA 2O8VA 1MUUA 4R3UC 5DTMA 2O06A 1TM3E 2JG3A 3KM0A 4ZCIA 1GAEO 3K0KA 3LJKA 1JN0A 3GT4A 3RYCA 4AJ2A 1R4MA 2OP0A 4Q39A 2O2ZA 3EAGA 4Y0AA 4V0KA 1E98A 1LZKA 1ZM2A 3URMA 3PEYA 2JFQA 1C1DA 3CV3A 5K8UA 2ESRA 3LP8A 1RJWA 5JCOA 4GKJB 1Z7EA 3FX2A 3PHIA 2PKXA 2V65A 3GLTA 4OF4A 1KDVA 1J7JA 1I30A 4KVAA 2R11A 1Z7GA 1LVHA 4D44A 5IC6A 1NV9A 3L6EA 4RPLA 1KJ8A 3BOSA 1SUIA 4J29A 1ZGJA 3JQ8A 4ML3A 5CBPA 4JKIA 2WF7A 4BVFA 3NBMA 3P9KA 4TSRA 2YJZA 2Q3FA 3TH5A 5FRDA 2AIRA 5FBHA 3PC8A 3IS3A 3EN0A 1ZHFA 1OWOA 4ILEA 4TVSA 1IWOA 1IY8A 1EQUA 1YJQA 3BGWA 4G0VA 1RFLA 5JY6A 2DG2A 3N2LA 1IJFA 2X7JA 1ZJ6A 3S70A 2QPAA 3CKYA 5AM3A 1YZYA 2FFQA 2Q9UA 1KFKB 2ETXA 2I6XA 3EUAA 3RVSA 4J7AA 2FMFA 1RHQA 1M5RA 3RIMA 3OFSA 1MPXA 5TMEA 5MF6A 9ABPA 1LDGA 2GM5A 3DP9A 3HDHA 3CN7A 1CIJA 1EBUA 3ZWKA 2YJ6A 1WSBA 1LJUA 5EZ5A 1UQUA 1ODJA 5FFFA 4AZTA 1VL0A 4C07A 5BR7A 1FVOA 1T36A 3BWXA 3DGEC 1PJRA 1Z9BA 1Q0LA 2VXYA 2RHGB 2HHHB 1N5IA 4B3GA 1RM3A 1O87A 2GM9A 1Q7GA 4GOJA 5HE9A 1Y4ZA 4Y2TA 4WOCA 4DE5A 1VKOA 1XVIA 2IW3A 3GPCA 2JGKA 2VJDA 4FFLA 1LNSA 4FEEA 4N18A 4NE7A 4XFDA 3SFVA 1JJ7A 5A04A 4PZLA 1XZMA 4D4JA 4DLUA 3KYDA 1IVYA 1HF3A 1XTQA 2HKIA 2R00C 3T5GA 3BTUA 3SLGA 1KIAA 1JHYA 2CCKA 3ANYB 3NAGA 4EYKA 2OK7A 3LRPA 1G8SA 2WILA 2XUKA 4QDZA 2LW7A 5AKLA 1MO5A 4ZZ0A 4MHSA 2OO3A 4MWTA 4QU0A 4TLAA 1XL1A 1A5TA 2EBFX 3TZBA 2EHDA 2NGRA 3T1OA 2E2WA 4MQ6A 5AHKA 2QDXA 3KJHA 1DBIA 5ALUA 2I99A 1W75A 3DXXA 3WWYA 2GARA 2XOKD 3JWEA 4QLOA 2BEUA 4D57A 4QODA 4CMHA 5LOVB 4Q4HA 4X65B 1B3RA 1H0SA 1ADYA 1YJAA 3U1VA 4DMLA 3J7TA 4RZQA 4JI5B 5CDTA 3J81A 2FQXA 4PPQA 4UVIA 3HJFA 1BWSA 4L2IA 2OBNA 3P7MA 2VHCA 4OAQA 4HDOB 5T64A 3ZGZA 2FSIA 3ZLUA 3GLKA 2FN7A 3T3EA 4EG1A 4N6OA 1C3EA 2VCEA 2VIIA 3ELWA 4G1CA 1E7MA 1LWOA 4BFZA 3FJ1A 4IVPA 2LP4Y 2VQEB 1GFSA 1SIOA 3ZW7A 3M83A 4MHOA 2IIVA 4B46A 5L95A 1KS2A 3BB1A 4PGGA 4LXHA 4DV5B 2E6UX 3BK1A 3IKTA 2ZBFA 2IYYA 4FWIB 3LC1O 2X9GA 1PEKE 2IHBA 3JWIA 1KKUA 2Q0QA 4UEKA 4P4NA 5IM4F 3LHIA 4AUNA 4DV1B 3RC8A 1AVTA 4KQ6A 3A27A 3WMWA 1SAYA 2HAEA 2FSFA 1XK6A 3IVMA 3NOXA 3DPSA 5E7MA 9MHTA 1AUXA 2Q4DA 2ZBVA 4NJOA 4EGAA 5DJ5A 1PEYA 4CM8A 4B4KA 3G2JA 4QDOA 2PDAA 4UOQA 2V5AA 3ZD8A 1OYYA 1KOLA 3ASUA 3L77A 1BO6A 3BE6A 3ONDA 5IZCA 4HFNA 5K0TA 1L5SA 5LU9A 4PHCA 2R87A 2BJHA 2JEOA 5AXDA 4Y2HA 4YFVA 4MB0A 3OKAA 1ZVVA 4IKEA 2FOLA 1R0RE 3DOJA 4LHVA 2HCRA 4WADA 1K4MA 4N01A 4W6ZA 5GQSA 3RROA 3THOA 3LZ6A 3J7AC 3OZXA 4WAUA 3SVLA 1II0A 1Q1AA 2W8BA 3O8NA 3DNPA 4UULA 1K2WA 1QYDA 2OBYA 2YWGA 3SZMA 3U5TA 3V5NA 1JXMA 1KQPA 3TTXA 4EJ0A 1TU4A 3R4VA 4KKVA 3FOFC 4JXKA 3AI7A 3PHLA 5ADHA 4RHTA 3H0KA 1YB4A 2A9PA 3RD5A 4FN5A 4KJXA 3KEOA 1ECGA 2YC2C 1ZL2A 5J2TF 3ZZNA 5JFOA 1B0AA 3WX0A 2HH9A 4EJSC 3QBEA 4BFXA 2V55B 3PWZA 1W85B 4B31A 2I4RA 2DR2A 4IXTA 3OVMA 3QG1A 4HYQA 4IIVA 1V4BA 4PSVA 3S3TA 1UAAA 4A03A 4CM8B 4Z7QB 1LPOA 2BFBB 3HUUA 5C37A 2AVNA 1M7HA 3JX9A 3OTIA 4TUYF 4EW1A 2OYSA 3AT1A 3FSGA 4MJLA 1T9DA 5ALZA 3D0QA 4CMEA 1FSFA 2X77A 2V74B 2V7QA 3BEOA 2AHRA 2X1MA 3BD9A 1L4EA 1P5FA 4LY6A 4WHMA 3U62A 1ADJA 3STWA 4PZCA 1ZK2A 2RONA 2BGRA 3EDCA 3FWPA 5I7WA 4IIXA 5CA0F 4FHFA 2X0IA 3MSXA 1MC8A 1SRQA 4JQSA 5HMMA 5KYYB 3U7EB 2NUTB 2XNKA 1ZKMA 2FWNA 1QQAA 5U4QA 2ZYHA 3L1IA 3O93A 3AHHA 3RUHA 1XDSA 5C4MA 4RSMA 2O0LA 5I7HA 1VKRA 3FGNA 3V3KA 4HY3A 1B23P 1C9YA 2HR1A 2BEUB 2ZRNA 4MI1A 4X97A 3U2QA 4AFNA 3A3YA 5AK6A 1NIJA 4JU9A 3TR6A 2W2KA 2AR9A 4NFYA 2HLHA 1JBQA 2PQ6A 2A4KA 3E48A 3W8DA 5IT0A 1JIQA 4HNRA 4JAVC 4LYDA 5K8IA 2J5RA 1VMAA 5I9BA 4ZQEA 2Y4NA 1R0SA 4K6FA 5DWQA 2WIBA 3AY7A 3FF4A 1RRFA 4RD3A 3TINA 1G2IA 3VRHA 5IJ9A 1X8KA 4MB2A 1ZESA 1ULSA 1MO4A 4XI9A 4URFA 5EIAA 3ETDA 4KFRA 3UHPA 3ZJVA 4K9NA 3RTDA 1LLCA 2A5FA 3DVQX 4RIIA 1G21E 2QD4A 3RS7A 1AXGA 3RV4A 1WTAA 2XYRA 4E5VA 3NDPA 5HDBB 1KDPA 4TT3D 1I36A 1MTZA 4GI1A 1RPTA 1XA4A 1EUZA 1ABFA 1ZCBA 4HN2A 3W1VA 3EIQA 4KO4S 4KPUA 5EHQA 2R6AA 3FDZA 4FM9A 2E87A 2ODBA 1EK2A 1VBKA 2FDXA 2W2MA 3JZAA 3K35A 4IIYA 3KKZA 5K3DA 1DB3A 1KTIA 3DTVD 1FNDA 5GONB 4AL4A 1DQPA 3B20A 3EIOA 1AKUA 3CZAA 3DMGA 3OSZA 1HPLA 1QOZA 5HKAA 3ZHXA 5A5GA 2E49A 4Z6KA 2FRXA 1HTTA 2JJ2A 3HKBB 2VYNA 3S6JA 4L5YA 4C7OA 1OBCA 4R8VA 5JZSA 4QGAA 1KAGA 2CXNA 3FPLA 3WLEA 3BICA 4AN4A 4KR9A 1KFCB 2OCBA 2ZIUB 1EK1A 3PJFA 4XWWA 4KXNA 3WBKA 1VSQA 2JFNA 1ARZA 3W3ZB 1AGPA 4TX1A 4BWGA 4D3SA 5JRDS 5DNEA 5JBQA 2C3MA 1SUSA 3ROTA 1L2TA 3B3AA 5JI2E 5GV7A 4AY4A 2B8TA 2P40A 4IZHA 4A15A 2B34A 2FEXA 4R1TA 1SD1A 2W6MA 2DHDA 2C5FA 5LQRA 4HGNA 3TPZA 4BNLA 3KKOA 4TRNA 2BE9A 3TCXB 1YQXA 2BYTA 2WICA 4JGBA 4H77A 1U28A 4M87A 5AW9A 4AULA 3R7NA 1WL8A 4JI1B 3MWDB 4J1TC 2Q5LA 2VA9A 2X4LA 3ANXA 4ZT4A 2H1RA 4TQGA 5K8VA 4OLBA 4L1KA 2OLEA 3KXKA 4EJSA 1N2CB 2PZKA 1YZFA 2KMLA 4M9UA 3VAAA 4BE9A 3S8MA 1W8IA 4X00A 4G3XA 5B4UA 3PIDA 1W9MA 2P5YA 5BNZA 4MIYA 4ZGGA 3SZRA 1FNMA 3DHNA 2H54A 1Q7CA 2I7DA 2XADA 3HH8A 1E2FA 4LRSB 1ORRA 5KYKA 2NYVA 4FOSA 1W73A 3IELA 4P4GA 1HURA 5LP6C 5T57A 3ZV4A 1EXNA 4CLRB 3BEDA 4AKSA 1Q11A 2UZ0A 2Y99A 1H93A 1MOPA 4RSRA 5KQSA 5E6UB 2WWXA 4D4HA 1WXHA 2IDJA 2O1WA 5HOQA 1M6NA 1U3GA 2BM0A 2C5LA 2DX7A 3K0AA 4WESA 5GJVC 1ZXLA 4ASUA 1IQRA 1VG0B 3FRHA 2I34A 3OX4A 5JJKA 2Z5LA 3FHOA 3QI2A 4W9MC 4HNAB 2OHIA 5AKYA 1QVAA 2PLNA 4XYMA 4CL8A 3EXHA 1AHNA 3GDHA 1P0PA 1QIGA 4QUDA 2YN4A 2PAFA 3IKMB 4JP5A 3G8YA 3SP1A 4DTIA 2CZQA 1FDUA 1K5DA 2OE2A 3D6FA 3K05A 4FMCB 4IIJA 4RGYA 1RI4A 1R6BX 1KMQA 1U2DA 3F78A 3KWMA 4O4HA 1YRAA 4CEJA 4OP3A 1IN8A 1I7PA 2F1JA 3PBKA 2VJPA 4GC5A 1ZGZA 2OXCA 5HBGA 4LGYA 4L4ZA 4H18A 1KSHA 3QQ5A 1Z2PX 5EZSA 5M5BA 3RK0A 3GNQA 4MV3A 4ZV7A 1K7CA 4EG3A 1HEYA 3DOHA 5BN3B 1XZQA 5EIXA 2JHCA 1LI7A 4R68A 1HUQA 2GI4A 4Q00A 3AF4A 2L17A 1N7GA 1SKBA 3A9TA 3TQSA 4D9MA 2FPUA 3G8AA 2Y6UA 1K5PA 1SURA 3W5CA 5KAMA 3RKSA 2VRCA 1P2BA 5DNYB 4DV3B 1VPLA 2J07A 3E9NA 1NUAA 1TAUA 3TLCA 1RRPA 4TSFA 3DWGA 4O3FA 1ENYA 4KAJA 4DSOA 4H4DA 3JZFA 2Y1CA 3HCNA 1CC1S 1BSVA 2HTFA 3QIAA 4WNAB 4DLPA 4EGSA 3CVWA 5F9FA 3UK0A 3QITA 3AHDA 1E2HA 2QRMA 4R98A 3IH5A 4LYFA 3TM4A 2DY0A 4A82A 3K96A 1JDJA 3S1SA 2CT8A 1GQOA 1DQNA 1ZPDA 1QR6A 2DM6A 5L3QA 4I81A 2JJ1A 3ILVA 3E9RA 4H7IA 4NBSA 4DDTA 2EJUA 2HJSA 1OHHD 1MVLA 1SVNA 3E7WA 4I1SA 3FLEA 4MGHA 3WLAA 1KQNA 1ZH8A 4B2IA 4H31A 4YXWD 4ZDKA 5BQFA 4U6SA 3A14A 4INOA 2XCLA 2ZJBA 1EE2A 2BMDA 3G9UA 3QVLA 2YC4C 3B85A 5B1EA 3AJEA 2QBYB 5C7IO 3E5MA 1JKFA 1NX6A 1SCKA 4UXIA 1X7YB 4X60A 4NMMA 4OHUA 2EFGA 4MKZA 4P35A 1H9CA 7AT1A 5LZ5A 3VR6A 1LCIA 1SELA 1TM5E 2H2WA 4YYZA 4LDRA 3UAZA 3QUTA 3R7AA 3A0UA 3ASZA 3NAMA 3VI4B 4D3XA 5KOYA 1SG0A 1P29A 4UCQA 2I6QA 3EY9A 1HDEA 4MMYB 1VSBA 1XLWA 3ASYA 5THXA 4EKEA 4MUIA 5JD5A 3DXYA 1U65A 4ERNA 2BSAA 1OIXA 3WA7A 1MENA 3BIFA 1R10A 3MN1A 1TRKA 1T5LA 4HJRA 5K0SA 3IVAA 4CG3A 4B8WA 1MO6A 2DQKA 2A94A 2MMCA 3KJQA 3KJZA 1ICIA 2R4TA 4FFVA 4ZT3A 2FPGB 3OOHA 3SY8A 4JI7B 3QPCA 5LP6B 3G2NA 4FFMA 1N6IA 1NN1A 1IY1A 2C3PA 3RVLA 4MYRA 4DG9A 4I46A 4ERXA 2H2DA 2HB6A 3U7QA 5ADUS 3RF6A 1VJCA 3NBYC 4CCWA 4RBNA 1CIVA 2RDMA 4OM8A 4F5DA 5CCXA 1OZHA 2HD4A 4UEWA 1LKZA 4TWAA 5JLAA 1RYYA 2ONCA 3K0HA 3NORA 3ZZUA 2QI9C 2REQA 1MORA 2IS6A 1PHRA 1QTRA 4OJYA 2Q3DA 1XOIA 3CPHA 3WWCA 1F5SA 3MA0A 1TAHA 2VT6A 3MT0A 3NT4A 1FU4A 3RIYA 1T4CB 4B6EA 3PKJA 4JBNA 2P5UA 2PD3A 3OP4A 1T4BA 2DSTA 3JWHA 3ZV5A 5LQMA 4A6XA 2R8EA 1WY5A 2Y27A 1BN7A 1FNNA 2AN3A 2XW6A 4TL6A 4ND8B 4PHGA 4JSYA 1PL7A 1TCBA 2PLFA 2QTVA 3ROZA 1ZUWA 5KJ1A 4CW7A 3PLRA 1GLGA 3HWWA 1L0BA 1XLTC 2QVXX 1D2MA 3M4YA 4I9NA 3KJFA 2I6FA 5U1PA 3WLSA 5DNUA 4P4TA 4Q1EA 2BKUA 1O97D 2OV2A 1JF8A 3O0TA 1YZHA 3WQQA 1SHKA 1XRNA 3PGA1 2GH1A 4WCVA 4Q03A 5E9JA 3GP5A 4CEHA 3KKNA 1ZH0A 3FZGA 4M1KA 5FQOA 4K6HA 1QDLB 2F59A 2QSYA 1N7HA 5FTNA 5BMVA 3JQ7A 4KH1A 2I3DA 5IZCC 3EZ7A 5JUWA 3RWOA 3HKEB 3UXMA 1NOJA 5DBEX 3UAGA 5E2AA 4KLNA 3E22B 1TGYA 3HVUA 3TGPA 1N0UA 1LFAA 5CLJA 2PZMA 2WRZA 121PA 3OEHA 3MYYA 3R3UA 4JHLA 3VSDA 1J70A 1X2EA 1MXHA 1RFGE 3OOEA 1WWKA 4KHPB 2AH5A 5SYMA 3HJNA 3LBFA 1U8YA 1XCBA 2GLXA 3ABSB 4DQDA 3GZNA 5IARA 3W5SA 4BNXA 1FP1D 2OPHA 1JL3A 3O8QB 1G20A 1BQEA 8LDHA 4MA5A 1DQYA 1HDYA 4G5OA 2OSVA 1XK7A 4DHWA 4ER6A 4CEIB 1WCYA 2OAGA 2WD7A 4TWBA 1BEUB 1G3RA 4MJXA 2I4NA 4MYUA 4CT5A 2I22A 2ZUFA 3GV0A 2HU7A 4M54A 1CJVC 1MB0A 2ZI9A 2IWHA 2A58A 1WV0A 1I1HA 2GWHA 4ZFNA 5K3BA 3ZJUA 1V4VA 3K9QO 3GBVA 5ALLA 1FRZA 2FP4A 4ZMSA 5IW8A 2RSLA 3EARA 3O7WA 2VWQA 2Z2YA 1E8NA 2PANA 3CRZA 3D5QA 3EWAA 5IJXA 2DECA 2ONYA 4F71A 1O89A 2CLHB 2PS1A 2WOJA 3PGLA 4EVSA 4FQ7A 1E89A 4B35A 1QIHA 3AOGA 4MZDA 5FIUA 4PS1A 2OCKA 4KRFA 3D43A 1QHHA 3H65A 4C87A 1S2LA 2F9LA 5ECGC 5FBRB 3DVSX 3O4FA 1P0IA 2NO4A 3PC2A 2GCNA 2AFIB 4V1CB 1V6SA 2AMYA 4HDNB 3TUZC 4TVBA 3NRCA 3AV0B 3PCRB 5FDFA 4XOIA 1WBDA 3RT9A 2TMGA 3U48A 1WPXA 4D42A 4ER7A 4MVJP 1QQBA 3NHMA 2FZWA 5LMNB 3NAZA 3A7DA 4L85A 4YBRA 5E6UA 1O5IA 1PT7A 2B6NA 3MTAA 4FYPA 3TJMA 1A9QA 2H1CA 2VF5X 4JDUA 1XZGA 3ROKA 4C88A 3NVKI 2P2SA 2W48A 4IWYA 1X9HA 3RSOA 4XGNA 3RC3A 3AEQB 3GRVA 4FTWA 3TG2A 2D00A 1MX3A 2AT1A 3L0BA 3MUNA 3T9AA 6REQA 4NRDA 2QE7D 4LVCA 2X0FA 3EEIA 3LC2O 4C4OA 1JU9A 2OLJA 2QAIA 4WACA 2JC3A 4MYTA 1L7RA 1Z8DA 2PZ8A 2O1XA 3F2VA 3KHTA 4H7EA 3D2LA 3HSYA 4OGWA 3UPTA 2ZDGA 4NCBA 1U94A 3NQ41 4DIEA 4Q05A 2XYGA 3L4KA 1JS1X 1VCNA 5B55A 3VOAA 2FE4A 5JASA 3FD8A 1N3IA 1V45E 1HH4A 3I2HA 4F12A 4BP1A 3KJGA 2QP4A 1IONA 4K05A 1H2BA 3DWIA 3AVPA 3EA0A 4RMIA 5KSZA 5KYTA 2FUKA 5H1YA 4WZ6A 3R0ZA 2Y05A 5HA5A 4Y3UA 2QX9A 3GAZA 4LJRA 2PMDA 3LGXA 1PWEA 4K86A 2D8AA 2MSKA 2QUAA 2FZLA 3EMKA 3KR1A 4UKDA 3DVAA 3FYTA 3RVRA 1J90A 2ZIZA 3N8NA 1W581 1T2NA 2X5NA 4KLAA 1YO6A 2YY5A 1TF2A 2IEBA 1L5LA 2IEYA 1JG7A 5HUJA 5CXQA 1C4OA 5LR6A 2DJ5A 2GO1A 1TJPB 2HSWA 4TMYA 4BFTA 4DYDA 5JCOC 3FVTA 3PRJA 3IQIX 1OLOA 1EGQA 1Y6RA 4H6XA 4M4SA 4NPCA 4WXEA 3JQAB 4OMFG 4AF6A 4ZT6A 3W3AD 4RWEA 3N0XA 3DOCA 2HLPA 2C7RA 2VZ9A 3PUXA 3T1QA 2OXRA 3KSRA 1GPMA 9LDTA 5K45A 2JGFA 2OHXA 4BE7B 1J49A 1TIPA 1Y9ZA 2GF2A 3ICPA 1OXSC 2DQYA 3JALB 1UDWA 4Q3BA 2Z95A 5IAJA 1P4SA 5K3FA 1MJNA 2ZRPA 4L5CA 4O4LB 4DUPA 4M0EA 5MN4A 1VOTA 3V1UA 1TEVA 1YE5A 1RYMA 1WXXA 3WWZA 1R88A 5AJWA 3LQKA 1KK3A 4IM7A 1AMNA 1DWOA 1OPXA 3FNQA 2O5CA 2G17A 5CCBA 3A26A 1T91A 3IYLW 4C3ZA 3BTSA 3WNDA 5E2IA 3ELBA 2ODAA 5EMKA 4KQEA 3M4NA 1II8A 1JAIA 4NDZA 4PCLA 2DLNA 1ZRNA 3GG2A 4L8LA 4J7XA 1DU4A 4BLVA 4WJLA 2Y8EA 1FA9A 4ZU1X 1CUUA 5B1IA 5IXYA 2PKEA 1M2OB 2W98A 2NT3A 3LO5A 4G6ZA 1ID1A 2DULA 4DIOA 4EVRA 2YXEA 4HMOA 4YRIA 2CSUA 2QZ9A 3HXLA 4ZOLF 2I7CA 3R76A 4F4FA 3TIXB 1R2QA 1JUDA 3EWNA 5H59A 3CE9A 2VRNA 1JAZA 3SXPA 3PJRA 4PIPA 1ZY2A 2ZYVX 1M8PA 4HKTA 3OE7A 1TUEA 2F43A 3KZXA 3V80A 5HIMA 2Q1SA 2QZ4A 1QWSA 2XDAA 3FWKA 3PPYA 4PONA 4EPYA 3HYTA 2H07A 1RMQA 2ZIAA 2UV8A 4LKRA 1TZBA 4RH1A 1OFTA 4EELA 1M6EX 2A7XA 3NPAA 4FSXA 1SU8A 1Y1KE 2NU6B 4EZEA 3G1TA 4A0RA 2EZ4A 4IVQA 1HE2A 4A8HA 4LFAB 5EWMB 3QEAZ 5CLHA 2QT0A 1V9SA 1EXMA 3C48A 2BPOA 2P3SA 2C00A 1L5YA 1R27A 1PQUA 1ZCJA 2C4TA 1RPAA 3INNA 4HUQB 2X6QA 1GQYA 1MFPA 1NKVA 1ZIYA 2NO5A 3L6CA 1L9XA 5DMHA 1W4BA 4YQEA 4YMWA 4FQ8A 2FK8A 1K7FB 3CF0A 4AB1A 3ILSA 3N3AC 1YDHA 1NT4A 2COEA 4OB7A 3WHLA 4AIRA 3GBPA 3KSAC 2Y2VA 4EQ6A 4UPEA 2EF0A 2ETVA 1JTFA 1B76A 4CPDA 3ED1A 3FNEA 1A2QA 3DMRA 2DKFA 2XNSA 1EM6A 2SCUA 1H23A 3JQAD 3P2YA 4RD2A 3TNYA 3WDSA 4P7FA 3X1JA 4EW2A 2OBBA 3TW0A 4DSTA 3K6JA 4J4HA 1WMBA 1UDAA 1G42A 1YBAA 3FYUB 1A95A 3PF8A 1T3SA 5G53C 5FADA 3P0HA 3W9BA 3WMGA 4OU4A 1WA5A 2B4KA 3M1AA 2FWMX 6PFKA 4NESA 1A4IA 4BBZA 2A57A 4ZOBA 2OORA 3PGVA 1GHTA 3UAYA 2AN9A 2YVAA 4I36A 4PRYA 5A3VA 1SXQA 4OHFA 3RM3A 2SKCA 2BEVB 4ZA2A 5JAZA 4OJTA 1GZ4A 1XTPA 3R5TA 3FMIA 4JBWA 1A2BA 2AFIE 3V48A 1FS4A 2B3TA 1VRWA 2IPLA 2APJA 2RH9B 1YQQA 3KFLA 4XQGA 4XWGA 4Z4IA 1P1FA 4JI0B 1R9JA 5CB4F 3BERA 4YRRA 2QUKA 5FBVB 1NBME 2GAOA 3WL8A 2VVTA 521PA 1N8KA 4KXMA 1S3IA 2Q5OA 1Y9DA 4M36A 5ITWA 3PCTA 2D1TA 2UYYA 4NICA 4M1ZA 3BHIA 5AQEA 3CCFA 3V33A 5ALWA 2VAPA 2CGEA 1KKLA 1YAJA 2CNOA 2DPYA 2E1PA 4WY8A 1GADO 1QUFA 4MO2A 5DCLA 2G7MC 1EU1A 4CI9A 2HDNB 5HKBA 1Q1NA 5HKKA 3TFQA 4I3FA 3FYUA 3I9NA 4KK3A 5HPYB 3I9JA 4IIDA 4RJKA 2BKXA 2GHIA 4UW9A 3KX2A 4B5KA 5JALA 2HJWA 3A6EA 3DEJA 5G1NA 3VMMA 1ENPA 4YECA 1MH1A 4ZIRB 2JVJA 1YGYA 1R0XA 4GF5A 4R2LA 2CLFB 4RCZA 1A88A 1P45A 5GADl 2I80A 2AFIA 4FSDA 4BQPA 2Q5JA 2C4UA 2XMPA 3IAUA 4LC9A 5AJZA 5DASA 4A2WA 3SJBA 2XBUA 1QMPA 4DRXB 4B44A 1GCOA 3FYHA 4GSYA 3ZS8A 4AX4A 4A10A 4NOLA 1FS6A 1UUFA 1C30A 5EJIA 4FZRA 1C4KA 1XZAA 3ZU4A 2ST1A 4B74A 4ER5A 2WYVA 4N6NA 1OJLA 4AJ9A 5EHNA 4OYHA 3JD3A 5C3MA 3BK7A 2VBGA 1TM7E 3E9ZA 1JXQA 2Q8NA 1USWA 3NM4A 4NBLA 4RHCA 5GPBA 3TSZA 1VLJA 3WMFA 3AVXA 4LHWA 5TF0A 1MB4A 4W8HA 3QU2A 2X1VA 1TLFA 3PCXA 2C5HA 3OU6A 3RFFA 3JD0A 3RFCA 4IUYA 3ICVA 4NAHA 3EPKA 2EL7A 2VK2A 4LE1A 3CZ9A 4F11A 2H9IA 4LJ6A 3PR3A 3K0BA 4B40A 2ZITA 3UWKA 4UCWA 1FQOA 3B13B 3W6ZA 4ENVA 4KG7A 4EUHA 4JYMA 1J42A 2DLCX 1GPLA 3BTVA 1ISPA 1KVRA 3RBAA 3D6AA 3SGLA 1DZIA 1UINA 2JBAA 5DYNA 1XSEA 4G65A 3V2UA 5BXYA 4Z9XA 4HGZA 2LCIA 2DBZA 2O2GA 3VPHA 3VZQA 4BKOA 2JFFA 3GD7A 5BUQA 4PRLA 1GG8A 5I8ZA 1S8OA 3OC0A 4NK4A 1XZJA 4IQGA 3K0SA 3ROGA 1L4UA 3I3OA 4C0HA 1VLVA 1TK9A 2YHIB 2NSDA 3K4QA 5DIFA 2J3KA 4KB5A 4GT1A 2JFYA 2GWRA 1XJCA 4PTLA 5KBYA 1RQGA 3SJCA 5TY0A 2J08A 4JLJA 4H08A 3PX2A 4YJ3B 1XEXB 4HEQA 1YQUA 2P4QA 2WUGA 1K66A 1VHQA 3LCCA 4HWPA 3WDMA 1QBGA 2IS1A 4EY3A 4W5NA 1YH3A 1Z26A 4RFSA 5AVUA 1MJ5A 4KO1S 4IIEA 4G4IA 3FJOA 3R0QA 1FQKA 4EUSA 4Z4QA 4L0CA 3ISTA 1V39A 1NE2A 2AYZA 5BUCA 3GGPA 1AKTA 1A7AA 3KOYA 4MCAA 2V5UA 1M2HA 1C8LA 4PG7A 1BDIA 2A5GA 2JIRA 2Q4BA 4MI6A 3UWOA 3ZDQA 1DJMA 1UKZA 2I3GA 1VXRA 3KOXA 1MIHA 3WP0A 5EMHA 4R1OA 2YHUA 1MDFA 2GZSA 2WSIA 4MB6A 4KWEA 2FMTA 2UUPA 3QPVA 1MCZA 3KOUA 1QHHB 2QZSA 1SBNE 1ULZA 3BH6A 5JAHA 3M1LA 3V8RA 4JNCA 1HKUA 3DAFA 5G0VA 4EY6A 3MTJA 4YJHA 1RQLA 2XCIA 4RTRA 2VYCA 4FX5A 4PWZA 3T0IA 3PF9A 3RPEA 3LBNA 5DM0A 4U7DA 3HDVA 3MJCA 3U7HB 3UJ7A 4PHHA 3H5IA 1RHUA 4KBGA 3S40A 2B0JA 3WY9A 2X0DA 3RH0A 4EPTA 3M82A 4ZYLA 1EINA 4UOZA 1EX6A 3AG5A 1F6DA 2O3SA 5HK8A 1SA0B 1E4OA 3OFVA 4NU5A 5EKTA 3KQYA 4DARA 4M0LA 4YRDA 1CDDA 2VPTA 3M2PA 1XLTA 4I99A 1WP4A 1JH8A 3VO8A 2DEUA 5ALYA 1WMAA 2HF9A 1TTHA 4WCFC 4IJKA 1Z4QA 2CD9A 1JSRA 4AF8A 4CM4A 4Q3KA 3AGPA 5EJ8A 3A6DA 3CUYA 3KR0A 5K3CA 4Z49A 4MCJA 1U2TA 4Q19A 2R7KA 3DZKA 2W2QA 2Y1KA 5TPZD 4RORA 4TTTS 3IXMA 3SF8A 4B75A 1TU0A 3OTOB 2DERA 4ZXPA 3AM1A 2UXDB 4Q3CA 1OIWA 4KPFC 3HNRA 3NONA 3U4IA 5F2OA 4BUZA 1N8TA 1C5KA 2PWYA 2QK4A 3KZNA 5LQAA 1BD4A 4M99A 4YALA 3D7LA 1RJ9A 3VU3A 3ICOA 2P30A 1XCPA 3G6WA 1SD2A 4Q7LA 4OGGA 5H3HA 4B6OA 4M1OA 4OA5A 3G17A 1C3OB 2R1VB 4JUFA 4MRVA 5EWLA 2QTWB 3SSAA 1V0JA 3LS2A 1MKYA 3HP7A 1QMGA 4M8IA 5C8XA 1H6AA 2HWKA 3LX5A 4UEOA 4PSUA 3VV2A 4F2PA 3T7IA 2Z5VA 1FRFS 1CE8A 3PFHA 1HTBA 4KQ2A 1GRVA 4KIGA 3L8CA 4GEKA 3ESCA 4WXYB 2Y1XA 1XRSB 2KJQA 2MINB 2NU6A 1LC0A 1L5QA 4WFQA 3L49A 4TQAA 2GSWA 4W9RA 4LXTA 3VQTA 2JLVA 1RADA 1QH1B 1JKJA 3MMZA 4C0LA 3ZCUA 3I04A 1H5UA 3G0BA 1X1BA 3GOQA 3RNLA 1VLHA 2O3TA 1NNUA 1QYRA 1VIAA 1BWRA 2LUOA 2NO7A 2GASA 2ZB8A 3I8OA 3ITKA 4PLWA 3TD6A 3LVFO 5H9VA 1MQAA 1SBHA 3M6WA 3THXB 2BUAA 2QGNA 3CF2A 5BRJA 3NYRA 3K8ZA 4FE4A 2F8SA 2B5VA 1WZIA 4U02A 2WDPA 1I2DA 2R1ZA 3UHOA 1H4TA 2JLUA 4RLHA 1IPHA 1Q74A 3G82C 1D2AA 3B9RA 1OLXB 2FB9A 1OD6A 3CEHA 1FNBA 4MQFA 2Q4OA 5DN9A 3I62A 1N25A 1KRXA 1F60A 1JQ5A 2VRBA 3GK3A 3MS4A 4Q9JA 5GJCA 3RKRA 1BDHA 2PXXA 2QXYA 2IPXA 1NBWB 1JFTA 1IIBA 3KTAA 3H18A 3DZIA 1UODA 5BR8B 1GNVA 2D0DA 3KDAA 1DINA 4TMKA 2DCMA 3C3DA 3LUCA 4I4TB 5AKIA 3DO5A 5CYPA 1YZKA 1U11A 4LJKA 2QQGA 2XHEA 3P9ZA 5HF9A 5B37A 1EM8B 2BEVA 4UU0A 4PANA 1PS8A 1Q1BA 3QQPA 1R7RA 4HAXA 2O20A 2A9QA 2H7YA 2WUFA 4IILA 3O84A 3UATA 1QU3A 4U7JA 3FR8A 3BGVA 1CJBA 3GUYA 5TLSA 1GRNA 4AKEA 1KSJA 2ZR0A 1ES9A 2KPOA 1SBYA 2Q2NA 4IDCA 3Q7PA 1Z36A 2CNDA 4XRGA 1ULHA 4B85A 2PIDA 1E1RD 5B1SA 4E30A 2D59A 4KJZA 4EF6A 5IFLA 3E05A 4MP8A 2Q0HA 3I9FA 4OQZA 4PZPA 5SY6A 4YGXB 3QYAA 4JDPA 3WXBA 3OESA 3U56A 4MV8A 4U1RA 4QUKA 1W7AA 1RQXA 3RRMA 2DBYA 3HU1A 3I37X 2OVFA 4PR3A 1HC7A 4YPVA 3F7NA 2O50A 4M7WA 1JQDA 2Q28A 1GXSA 1UK7A 4KP7A 1T25A 4EFMA 1JAXA 3DZFA 3PVZA 4RIHA 4G86A 4B09A 3BXPA 3KAPA 4YJKA 2ZFUA 3DCYA 2MT9A 5BR4A 2ZUUA 5EXSA 2ZKIA 1OGIA 4RE6A 2Q5EA 5H0IA 3L6BA 1AMOA 4JC5A 1Q1QA 3LUKA 2LKCA 3BE5A 3LY5A 3R7WA 5EJ4A 4P4SB 2RHJA 4KE9A 4ZEMA 3GH1A 5KWSA 5JPIA 1R0CA 2QXUA 3L84A 3VVLA 3CF6R 3WGYA 4RD4A 4FDLA 3UK1A 4ZARA 1E59A 2Y1EA 4LVUA 1WRBA 2RK3A 3RVQA 2AN4A 4QL3A 1T8YA 5EWLB 4M3NA 3GLRA 3CUWA 1EFDN 5BSUA 3MTQA 3ROEA 3DPUA 4KQWA 2DF8A 5EWJB 4PQYA 1DAMA 3U44B 1WE2A 1FIUA 2PUCA 1GG2A 5BV2P 4XYLA 4F8EA 1GTRA 1XQWA 1VE1A 1BW9A 2YZKA 5A3QA 1KI9A 3R8XA 1G98A 2WW8A 1XMPA 2R8ZA 1X13A 1Z8FA 2ZR7A 3L1KA 3QELA 3QPWA 2GFHA 4QBIA 2H31A 4BQQA 1IN6A 1NKSA 3IBSA 1YZNA 2HLDA 3LDUA 1RLOA 1XZ8A 3EJ6A 2NM0A 1XU7A 4CCSA 1ULUA 4TTIA 4F97A 4PINA 2PYZA 1QGYA 5HJ5A 2BE7A 3ZI7A 3UQYS 3DC2A 3PNPA 5K4HA 4Q1FA 1P1JA 1Y8QB 4K1LA 2BFWA 3VTAA 3ZE1B 1E2IA 1SQGA 2OECA 3P2IA 2RHLA 3HCAA 3RSLA 1Y3DE 5DYIA 5FOSA 1CF4A 3GZTB 3PYLA 2J3EA 3MBOA 4TLEA 3A1DA 1ABEA 1AY0A 4IFEA 3TQFA 3RUAA 5IT9A 4ITRC 3VR6H 2OQIA 2V03A 5FUVA 1NUSA 1GL7A 5K0FA 1MX9A 3SQXA 4AMVA 5I47A 3H6HA 4YI3A 1B43A 1HE4A 5CIYA 1DAFA 2ORVA 3LZCA 5DFAA 1K8YB 4DMHA 3L1UA 2D0OB 1TCUA 2AOVA 2OCDA 2JGLA 4NU0A 3T3HA 2W22A 2BD0A 2GESA 3ZDZB 1BCRB 2GPNA 3CB4A 1EG2A 4HC4A 4HEA6 4TT3A 4UTPA 1KEPA 1BDMA 2GN9A 2R6HA 3O8CA 3PK0A 1DKQA 1UH5A 1GKIA 4NCNA 5L4SA 5IRCD 2BONA 4CEIA 5LA6F 3NUGA 3ORQA 5LSAA 2O8BA 4FEAA 1J00A 4CF5A 2YYAA 1N1GA 3N39C 4JLVA 3UB2A 2GILA 3T06B 4WLFA 3ETNA 3AVOA 1LTHR 4XUDA 4G41A 4IDBA 1P1CA 3O4HA 3X1WA 5ICGA 1ID8A 1DEOA 2ZYWX 1MX5A 2ZVQX 4LJ9A 2VTDA 3SK0A 3N76A 5DK4A 5CNMA 4BKQA 1NN5A 3PQ6A 1S96A 2A88A 4RK5A 2IOFK 3AM3A 1T1JA 3FMFA 4MQFB 1ZNZA 1PBNA 3AR3A 4RKEA 3VTFA 3TVDA 2OYCA 4QA9A 1EVIA 2QUHA 2G67A 4JT8A 2TMDA 1JEJA 3DZDA 2WT8A 3ZXYA 4YRPA 1SH7A 1OASA 1CY1A 4J1SA 2QYTA 4HLUC 4DMMA 5CA0B 3TDKA 1HNXB 5HCNA 3G8DA 3FIUA 3ZH9B 1EWRA 3OIGA 3LKZA 3DMFA 4HQLA 4FOLA 2Y6VA 2FEAA 4MWCA 4R5HA 4LECA 2BFBA 3NEAA 5ULLA 2WF5A 3D1VA 2P6RA 3K70C 3UUFA 1K9VF 1ZLXA 4DLKA 4HDSB 4JZKA 4HYEA 2F90A 2OENG 3L04A 1F2DA 4HNQA 3G2LA 1WV1A 3GUHA 2XE6A 5BNTA 2F6RA 3B2NA 4AQDA 2WTXA 3EXHC 4R1NA 3KNZA 4RULA 1A9SA 3CQ9A 4ALKA 5GZ6A 1U1DA 3ER8A 3BGSA 2XD9A 4ZK2A 4HLDA 5MN5A 4YQYA 4DL9A 4H7KA 1CFJA 3FTPA 5A6SB 3QOYA 2IIBA 4MRSA 1JLKA 2D62A 2OP1A 3K3PA 1ZGCA 1PHPA 1WXQA 1AM4D 2PKWA 1H5QA 1ILWA 3LNTA 2DFVA 3O8OA 5HZGA 3DE5X 4V02A 3MJTA 2A9KA 4O2AA 3HO1A 1VKNA 1FTSA 3CF4G 1XVUA 1CTQA 2NSHA 4BKUA 5KNDA 4OHYA 1FYFA 2Q49A 2NUAB 1JB1A 3QY0A 4JLOA 1Q1ZA 3SJUA 3MJHA 3KS9A 1ETHA 3DDSA 3QUBA 1SN7A 4UTZA 5ER6A 3AX6A 1O8BA 1VMEA 3PRKE 4QC2A 1K7EB 2XF2A 3FETA 4ZCQA 3W9UA 1MJGA 1E79A 4TWIA 5TJ9A 4LNUA 2GEJA 3KTOA 4HDMA 4C6SA 5FEUA 3AUFA 4R1UA 3QKRB 4BNHA 3RODA 2AZDA 4DVJA 1F8XA 4QG3A 3DXZA 2O8DA 1C2TA 4Q7QA 4C05A 2HQBA 1ACLA 1U5CA 3BHJA 1T15A 3BWDD 3SOZA 2E0IA 4XPIB 3MWKA 3HXKA 3L8YA 2AN5A 1K7YA 4F46A 5IHPA 2PZEA 1G291 2GZAA 1RAIA 2GD6A 2LR0A 3FYCA 4PLFA 4D0SA 2Q3LA 1N3LA 3PR1A 3G85A 1APBA 1ZAKA 2OB1A 3IURA 1P0MA 1Z82A 5F3DA 4LBZA 3NU1A 4N5HX 1NGSA 1KVTA 4XLLA 3ZCVA 5L3ZA 3KDPA 3U4GA 5AW0A 4MEAA 2IHNA 3N2NA 3E15A 4LRWA 3OZAA 1JHZA 2BAGA 2I03A 1F8FA 3DDHA 3E7XA 4OB8A 3RS3A 3UF0A 2P4EA 2OG1A 3STHA 4TM8A 1T9BA 3PA6A 4G0ZA 4LNHA 5AM4A 5HM6A 5G3ZA 4YMGA 4XQEA 1E3TA 5FYQA 4YVFA 3I5YA 3AVVA 4BN4A 2GPTA 3KB8A 2ZJ0A 4H15A 3ZNQA 4WGFA 4Q1DA 4Y9TA 1S01A 4MWEA 3DFMA 4PN7A 4RDIA 3JD2A 4PSAA 2ZWAA 4JEHA 5F9MA 4ZCTA 4Z5XA 5KQPA 4WKGA 3TGWA 4ZTUB 3AL3A 1VM6A 2X0KA 4KYVA 5DBOA 1N5RA 4M1YA 1CR1A 2V7EA 1XRQA 4RVGA 2IS4A 4WD3A 1GFZA 2EDCA 5EJ5A 3U16A 1M34A 3LPCA 3LX6A 3QVVA 4JVLA 4NSNA 5IDVA 2GR9A 1YZVA 2O2SA 3REFA 5KNDD 4Y2VA 4F3NA 1QTNA 3DWEX 2C9BA 1NVTA 2GO7A 2LWIA 3I2JA 4JT4A 5EOVA 3ZE8A 3FWZA 1TKRA 4ZO8A 2XQIA 4BO7A 4E5NA 1EGAA 1ZX1A 1DKUA 2OO7A 3ROPA 5C80A 2P11A 2GCOA 3UH0A 1VL6A 3ZWXA 2CXUA 2RHOA 2QRVA 3JALA 3NHFA 3WNCA 1G16A 4MQUA 4QREA 1VYVA 4ZC1A 4KI7A 3AFIA 4F7WA 5D5PA 5IYZB 4PYLA 1G5IA 2IHUA 2JGJA 2Z98A 4DNPA 1HFEL 3O4VA 2V7XA 2X9LA 4QGSA 2IOHA 5T4EA 2CFSA 3MTEA 1HDGO 1ZXXA 2R47A 4XEUA 1BX1A 4YJ2B 5CT5A 1NT2A 1J0EA 4UVGA 3TBHA 1NBMD 2V0NA 4LOIA 2K7ZA 1TQ4A 4FGWA 5HRCA 1Y98A 1Z0ZA 3KUDA 1JAHA 2B92A 1C9JA 3GJQA 3SQDA 5FBKA 4R0NA 4V0MA 1RLTA 1D3AA 1QIMA 3DBHA 4QVKA 3U9SA 4F4IA 1M34E 3IIIA 1UDBA 3L7JA 4ZICA 1WM1A 4IDEA 1WB4A 1GLVA 3BD8A 5C5IA 9LDBA 4A0HA 1E9EA 2R60A 3N5CA 2B7LA 3OPMA 4HB4A 5CX1B 5CNJA 3CLHA 1NW8A 3IEKA 5T8KA 4RPJA 3C8HA 1A76A 1RE1A 1E4YA 3PYXA 4LJ8A 4W9NC 4M0DA 1TK2A 1Z56C 2MTBA 1NMQA 4YRQA 1YKFA 4Q7MB 4X6LA 2FCRA 3CLTC 3PXBA 4UHHA 2X1HA 3OQ6A 4AJIA 5C5DA 2ZBPA 1BW9B 4QTYA 5NLLA 3GCXA 1Q5PA 4ARZA 4HX9A 3GVPA 2QLJA 4A16A 4YT2A 5L3SB 2EU8A 1T8RA 3K6RA 4TSKA 4QHYA 2ZXUA 1I5OA 1N1DA 1Z29A 3WL7A 1PFUA 2REXB 3RRBA 1TM2A 3T1HB 3PFCA 4MPRA 2NQTA 2P79A 1DX4A 3M9LA 3ZBUA 2FZCA 3DE0X 3KRTA 3OQPA 4A23A 4OG2A 1JHOA 3HSKA 1V16B 5G0WA 4UHDA 2Z9BA 3QOXA 2ZREA 3EGDB 4RESA 2ECQA 5DMXA 1MOSA 1ZBQA 4JCCA 2OZLB 5IWAB 4EMBA 1FRVA 4M21A 1NMSA 2CXSA 3AR6A 2HZ7A 3PRYA 4ZEOA 5KJCA 5IKXA 4KFCA 3FI9A 5G0SA 1P5HA 1E7SA 2CLDX 4IOJA 2V0GA 4BV2A 1Z39A 1KIMA 2ZJ3A 1PDOA 3QLEA 1K1EA 1Q92A 3GLSA 1DCKA 4LRTB 4BU1A 4EDHA 2FOXA 2F1IA 2F8LA 3OQBA 1CUEA 1YB6A 1JKIA 3H2YA 3ORFA 2GN1A 5KQRA 2VSFA 1JDUA 1OZGA 1DBVO 1QYIA 5AJYA 3PC4A 5JECA 1ZEJA 5BXQC 2YW9A 1T35A 1WUKS 2ERYA 3GOHA 3I09A 1F3OA 2DOKA 4H1HA 4K6OA 1G20E 1OROA 3V8PA 2NZXA 4BMPB 2YV2A 1XQ6A 4ZODA 1FOEB 4YUAA 2PVCA 4JP8A 4JI8B 3T4EA 3Q9UA 5HEKA 1N2EA 1DL5A 1KAEA 3C14C 3ZCQA 3TL3A 2FX3A 3MB5A 1XDGA 3I4CA 4BNJA 4MDFA 1CY8A 4FI3F 1ZUIA 4GKKB 5IM4A 4U9IS 4DLBA 3DTVB 3DV0A 3JAWB 1RRMA 5F5NA 2C4VA 3SNHA 2F9FA 3UICA 2Q4EA 4DGQA 1IHDA 1Y8ZA 1GAXA 2JD2A 4CU5A 1N2IA 2Y77A 2JBHA 5JAQA 1SUEA 4AT1A 3RBXA 3RF7A 1A1VA 3LDAA 1DEKA 3BMCB 4DSUA 3VTZA 3AU8A 4GDFA 1OT3A 2J31A 1H2AS 2BFOA 3HB1A 4RZSA 4BNTA 2XH8A 1ZMTA 3AU9A 4LOAA 1GGJA 4CG0A 4LOHA 1JQ3A 2YY7A 5HRUA 2ZXEA 1DX6A 2FDRA 1AGYA 4P08A 4EX6A 5CBPB 2NSYA 2PJUA 3BRQA 2CDRA 1JRLA 1UBHS 3PE6A 2V58A 1ZHOA 1D2GA 2HMTA 5KYVA 1ZJYA 3HVIA 3FCCA 5AKHA 1MMFB 4LXQA 4BRWA 3QBJA 4GX1A 3SBXA 4AG6A 3ZLTA 1YJ5A 3GLUA 4NQZA 4QM7A 4I1RA 2IK8A 3E7DA 1X1CA 1YS4A 1AU9A 5I7AA 2EBUA 2ZS9A 2XMSA 2FPRA 4GR9A 4R8MA 3JATB 4CRWB 4CDRA 4IICA 2XWBF 5CLLA 3ZS9A 2X23A 5IU6A 3VR3D 5GOTA 5M2QA 3AEUB 1ZIDA 4D8VA 1C1XB 3BQNB 1NONA 4PO9A 3CCCA 4DS3A 2Y92A 3L0OA 3VPCA 4WY2A 4UTXA 3EX7C 4CL0A 5SYAA 1DNPA 4QWWA 4RZ2A 3ASVA 5EZYB 3OJFA 3IB6A 3TQIA 4BO3A 2IOFA 2KW5A 2JLBA 4R69A 4BB6A 5C1OA 6ADHA 4W1SA 2J67A 3QPAA 4MKXA 2WU0A 2FGKA 1CUVA 3U3XA 3RWMB 3OJEA 1AD2A 1AKRA 1JZSA 1TAQA 4XJVA 3TE7A 2G7ZA 3VH1A 4N3GA 3Q6NA 2R48A 4JKOA 1JEOA 4O4JA 3BMNA 2I6GA 3DYIA 4EHFA 1IH8A 4YRAA 3JYQA 1WD5A 4GLBA 5DK6A 4QQKA 2AMVA 4X92A 4CM3A 1EB9A 4HT3B 5K3OA 3QKTA 4DJEC 4DNXA 3R9WA 5DHRA 3CTPA 1ONOA 3QXGA 4AO7A 5CT8A 2CVQA 2ZIGA 5KB3A 4RS3A 4IVRA 3ON5A 2II6A 3UKOA 4RQTA 1NUTA 1ZUHA 4G84A 3N2KB 1AZTA 1K3TA 3OF5A 2WM2A 3A9VA 4OPMA 4OXIA 4YAUA 5D2CA 4O02B 2DHEA 2OZVA 2POCA 3LUAA 1K8ZB 2FEOA 4JB8A 2IV3A 3V1KA 3IE1A 1YVPA 1JLMA 1VCHA 1ACJA 3F96A 4G07A 4LKOA 4B6GA 4E1AA 5IEJA 3O8QA 2PMFA 3T12A 1KMNA 3U09A 2XWSA 4M86A 4M37A 1KBZA 3GFPA 2P0EA 5LDDC 4FJ1A 3QX8A 4YAGA 2GTHA 5JHGB 1C1YA 1M0TA 3LZDA 2XCUA 1QZTA 3PIIA 3OZIA 2MSNA 3PI6A 4LBWA 5AW8A 1YSCA 5JNRA 1NC1A 3AH8A 1J8MF 4HP8A 3VYSB 2XA2A 4JLAA 4WJKB 1A8UA 3X1XA 4CUZA 3DT8A 4OAPA 1DFIA 5REQA 3SFZA 4C1BA 2FJ0A 4QTTB 4B82A 4UU1A 4V3BA 3FHJA 1YJCA 2QRVB 3IOCA 4PXYA 1TO1E 3RW9A 2FSHA 1VE3A 1Z6QA 1VG9B 3EGIA 4QXRA 1J1IA 1CRLA 1DBRA 1XJ5A 2QVZX 1VGVA 4P2GA 3EBOA 2I7TA 1B1AA 3AFHA 4B3SB 2XSZD 2VDLB 1H9AA 4V3CA 3ELUA 4FGUA 5EZ6B 3DDWA 3PFBA 2NYRA 4TT8A 3SZOA 1EG7A 3OAAD 4Z0PA 2FFBA 3M89A 1OH5A 1LDNA 3D7KA 4M0UA 4LNAA 1CV2A 1Z83A 4L27A 3LV8A 2QR2A 5AKEA 4F72A 1MABA 4EO4A 1XVTA 2D7CA 1E9SA 2QMQA 4KQCA 5EFZA 1Q7RA 2QU8A 1W44A 2XEDA 3ETJA 2EEPA 4I5FA 1PL8A 2JFGA 4HX5A 4KMMA 1PFWA 3PDJA 4MYDA 4QOIA 2BFDA 1OAOC 1VYHA 3LT1A 2NVOA 4RS4A 1MNAA 4KIWA 4N82A 2HA7A 1QHEA 2JFBA 1MG5A 3LQ1A 2VEOA 2FPWA 3NTRA 1W0JD 3B1YA 2PSDA 3DOEA 3M49A 2C29D 1E77A 2LKDA 1K06A 2VJYA 3C2QA 5DLPA 3UMSA 2D2FA 4I7EA 1WMEA 4B2LA 3O47A 3F3YA 4P3NA 3UAXA 3GGDA 4WKNA 4Y2SA 4UVDA 2IV7A 3GAAA 1R6TA 1H69A 4WIAA 3WICA 2W83A 2ZWPA 1T3HA 4MAAA 1UXIA 3FNRA 1JKJB 3CJTA 4MA0A 4M7OA 1ESDA 3AEUA 4XDYA 5BSGA 1I7SB 2GUGA 4D46A 1RYEA 2VTEA 2F3PA 1P74A 2NZ2A 2QX6A 5BURA 1Q1EA 1C0PA 1H3NA 1C7FA 1X19A 4HGOA 4PYJA 5DISB 1RNLA 1RRVA 1MDBA 2IDMA 1L1EA 2YIJA 2NIPA 2WJAA 3CURA 2HHJA 1M6WA 4R9SA 4XE5A 3U4DA 3EPJA 2WA2A 1GNSA 1SKYE 5FWYB 6NULA 1NXOA 5CYGA 1P9OA 3T7SA 4OHRA 4UPVA 1YDWA 1YDMA 2HA2A 3FOCA 4KXYA 1RTKA 3QA3E 3P2OA 1KQGA 4YMUA 1TVKA 1CUSA 3Q9SA 1YQGA 3TVYA 3FSRA 2W37A 3GLIB 4UUAA 4RD6A 4I3HA 4J0GA 4GVPA 1W1IA 2NSJA 4AXBA 1BXGA 4KO2S 4NWIA 5I7RA 1UMKA 1HQYE 4RY2A 3LPAA 3TRFA 1X86B 1ZMXA 1QSGA 1RVDA 2W7TA 1WW2A 2UYOA 1ZONA 4UXHA 3ZDDA 1EM8A 2GEFA 1U5BA 2FFRA 5G40A 2V6GA 4DR4B 1NXSA 4JLBA 3EXG1 2RGRA 2ZSAA 3UXYA 1H3FA 3Q6IA 1ENZA 1NYQA 5E1DA 4BNUA 3BDIA 2B4TO 2M2IA 2I2DA 3FSEA 1NX9A 3U7RA 1AO3A 1JKMA 4MWOA 2LIVA 3WRYA 3JU3A 1R5OA 4F5ZA 4V1CI 3VA7A 1AKQA 4YRFA 2MYTA 3EIHA 3KUUA 1R6VA 3CT6A 4PZ9A 3CS3A 1X1RA 1BQ4A 1F4VA 1JQBA 2CN1A 5D87A 2GB4A 4AP5A 2A5DA 3CTMA 1V5EA 3QHAA 4E07A 3RKUA 3WV5A 4DBVO 3VDMA 2X6RA 1Z5OA 4B4UA 5DYYA 2NUTA 3FUVA 1PI3A 4UNPA 3EG9B 1POXA 1E2LA 4OBEA 3UMMA 4UBJA 1NY5A 1LRKA 5E6RB 1RXIA 4BVJA 1UKAA 2DH5A 4KGVA 3ZR4B 1R9MA 1HDIA 3ET4A 4US2R 4M0MA 1UFVA 1BXKA 3MFYA 4MQBA 2ZRCA 1Y9AA 4BFVA 1RZRD 2JJ2D 4UUQA 5IXSA 4OXNA 4E2FA 4Q16A 4A0FA 5IJ0B 2PBZA 2G6BA 1T9KA 1I7DA 1D03A 1E20A 4MVJE 3IMFA 5EJ7A 3KJEA 1O58A 1N2HA 1F2UA 2QD2A 3NV7A 2V8BA 3WLFA 3IP6A 4YP9A 1GPWB 3L92A 1U0SY 3T3IA 2WIDA 1EUQA 2QTTA 1SUWA 4NZNA 4C3UA 3F47A 4YCLA 4HDNA 5E3IA 1PV2A 1NXQA 3M5WA 3HWRA 4TYNA 5ALEA 2AGVA 3OA0A 1LH0A 4BYMA 2QT9A 1IU9A 4NBVA 1DAOA 3S2YA 4R01A 1J99A 1G8AA 5KCZA 1Q6ZA 4G1BA 4J0IA 5TX7A 1CZKA 4IF4A 4R84A 2QF7A 2M1ZA 1SUAA 2V9CA 3LMKA 5JSYA 1L5NA 3R7WB 2ZIVB 1N6KA 4AWAA 5EJEA 2FUEA 3PFGA 3AR4A 4GR4A 4DWWA 4PSDA 2JAUA 3SSOA 5INTA 4IGEA 3D8SA 3GCZA 2XXAB 1HZZA 4ZVVA 1QV6A 3IMCA 3RAGA 1G21A 3IDZA 4F04A 1JHPA 4YH1A 3AFOA 1RP7A 2CKMA 1GGKA 5H16A 1A9XA 4RJ2A 5ILOA 1X7XB 3F7MA 1GDHA 3KB2A 1YZTA 3GJ4A 4X8MA 1OBHA 2VF4X 1PX2A 3OM1A 5EI5A 3D2AA 3V2IA 1UAYA 1TYEB 1OLUB 3LHKA 1EEHA 3DFKA 5BSHA 3C98A 5KINB 2WTEA 5B53A 1ECFA 5AOVA 2VAXA 4EB8A 1YZUA 2VF7A 1C1HA 1PUJA 2A1UA 2XUFA 3AP1A 2XUGA 3OIUA 4B0OA 5A1TA 3M3HA 1RRCA 3TD2A 1V1JA 2WSYB 4ZO9A 1G0OA 1N2SA 3KYJB 4R5MA 2AMLA 4ZPJA 3O1HB 1W76A 1JG4A 2OB2A 4Z4GA 3E53A 4WZAB 3EEOA 1KIFA 2GXUA 2EC5A 3FOWA 3H1FA 1FFCA 3ESZA 4O08A 2HUPA 4P31A 4Q7KA 1TW3A 3H2GA 1WVIA 4G0NA 4JWKA 4R2HA 5KKCA 3IEPA 4PIMA 4LUCA 4PTYA 4WZBE 4TZ0A 1U0LA 2AG5A 5EIFA 3RVMA 3OLQA 3ZE7A 3SAJA 3SE7A 3HCDA 2QYHA 2ZBDA 1SBCA 2WZQA 1WXGA 5DWVA 1QHIA 3DAHA 3TLGB 3UCFA 4F2DA 3GU3A 1V6CA 4ZZ3A 4Q12A 5PNTA 4RAOA 4BIIA 4D79A 1XJWA 1GFWA 4LQCA 4GSKA 3SLRA 2GLUA 1LI4A 2C58A 1JEQB 2BFAA 5TPZA 2PYIA 1Y82A 4ZGWA 3GN1A 2A1IA 4E3ZA 1EZ1A 4DXAA 4ZMBA 4Q3NA 3HKBA 4OYLA 4IW3B 1EFRD 4MYCA 2DP4E 2HCBA 3F6RA 2BFFB 5BN5A 2PRIA 4DSNA 5EXDA 4KR2A 1NYTA 3FPEA 4MNTA 2WB2A 2IHJA 3DTTA 3QXCA 2Q6IA 3O73A 4PYOA 2GEVA 1M83A 1W4CA 1PJ4A 5E4YA 1V7QA 1BMTA 4G8CA 3FVRA 2CNLA 1WXFA 1YASA 3CNBA 1OWNA 4W6QA 2HPVA 1W93A 4GM1A 4RTSA 1EUCB 1KI3A 1K6EA 4HB3A 2A67A 3VHLB 1DLIA 3A9UA 1DUIA 3VSEA 4GLFA 2IZ0A 4F86A 5KSYA 1GG5A 3JWJA 5FT9A 3ADCA 3C3MA 1AIPA 2R1TB 3EMDA 1WKBA 1BXRB 2HL6A 3PHJA 3T0GA 3IP9A 3UCXA 2JFUA 1JLHA 2WU1A 2CFOA 2QX8A 3NHUA 2X8JB 4MEBA 1HL3A 2I3BA 1Y37A 3VR3A 1OGYA 4FLMA 1Z4IA 3VKWA 1P6UA 1X1QA 3K31A 3LDFA 4IDDA 2HDWA 3BM5A 4O4IB 4C7KA 2VZEA 3CJRA 2JA2A 4TS1A 4XAQA 1TC2A 4OCZA 3UQZA 4D0RA 4DC9A 4N5MA 3UGJA 2G5TA 4N48A 1Z8HA 4LC0A 1KFJB 3NTLA 2VDKB 4Y2GA 5HJEA 2OGWA 1GUZA 5KQLA 1QB7A 4KGZA 1VP9A 4JQYA 4PR0A 4WESB 2QJOA 1DHTA 3TRHA 3TZLA 2FSPA 1Y4AE 2JCBA 1HYGA 2NZ8A 4KZKA 3LCUA 3RRFA 1O8CA 3E5RA 4KOAA 3RYHA 4J0CA 2MSEB 3OJLA<