5E9WA

Crystal structure of mrna cap guanine-n7 methyltransferase obtained by limited proteolysis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
310
structure length
273
Chain Sequence
SRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Molecular basis of RNA guanine-7 methyltransferase (RNMT) activation by RAM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 273
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5e9wA00
3DLIA 5GIOE 1F38A 4E30A 4AX8A 2ORED 3CJRA 5K0BA 5DM0A 1XVAA 1R6AA 2P3QA 2PY6A 3MAGA 1QAOA 4KW7A 1IM8A 3VSEA 3P71T 1M0EA 4DM3A 5HEKA 3CVOA 3DP7A 5K01A 5EVJA 5IH3A 3MCZA 1VE3A 1L3BA 1P1BA 3B5IA 3Q87B 5E2BA 2ZZKA 3HCFA 3BWCA 2O06A 3NVMB 2CL5A 3E23A 2C7RA 5K0LA 3ELYA 4HH4A 4EVIA 5CM2Z 4FP9A 1NW8A 3KHKA 4PYNA 4WXHA 9MHTA 4AUKA 4M38A 2FCAA 3OZTA 3HVIA 3DMGA 2P3LA 2QM3A 5FADA 1Z3CA 5DM4A 3PLAE 4YUZA 3NTVA 3LCVB 3DXYA 3B3GA 8MHTA 3HCBA 4XUDA 4ER6A 4M36A 5ICEA 2ZIEA 5F2KA 2WA1A 1P39A 4DCMA 2ZWAA 3OZRA 2IFTA 3E05A 3MQ2A 2CMHA 5E1OA 1L9KA 5EC8A 1YFJA 2V7EA 1RJFA 1WY7A 4QTTB 3FYCA 3C3YA 3AJDA 3SSNA 1X1BA 3PVCA 2Z6AA 2R3SA 1KR5A 2AN5A 3GRYA 3M6WA 2XYRA 3DUWA 3KPJA 2Q41A 2ZWVA 5DX1A 5E9QA 4ER7A 2OB2A 4PGHA 4X1OA 2ZBPA 3QV2A 5FHRA 4LWPA 4EKGA 2IH4A 5MHTA 1RI4A 4R6XA 2OB1A 5EQJB 3EVBA 2IH5A 3BZBA 5EHGA 4ER5A 5G02A 4GQBA 1NW6A 4BLUA 1WG8A 3FRIA 2HWKA 5JUWA 3HA7A 1M6EX 1YUBA 3OE5A 2ONYA 5EHIA 1YF3A 4KIGA 2QRVB 1R74A 1JQ3A 3VC1A 5EPEA 4YUXA 2AOTA 1EQAA 5K0NA 4ATNA 4YV1A 3EGVA 2Z6QA 3RIEA 1KIAA 3OU7A 4RSRA 3T7RA 4E2WA 1KHHA 3IHTA 2FK7A 2ZIFA 3O7WA 3OFJA 1KPGA 3S68A 5LQNA 3TFWA 1MJFA 2VP3A 3MHTA 1KPIA 1PJZA 1VP9A 4IV8A 5FA8A 4X41A 1I9GA 4DCGA 4EK9A 4KRGA 3A7DA 4PWYA 2YXLA 4FSDA 5LQAA 1T43A 3TQSA 1INLA 4RWZA 1KYZA 1JQEA 1XCLA 3PFGA 4AZTA 4PIMA 3FUXA 1SQFA 4POOA 2QRVA 2NXEA 4RVGA 5E1BA 3FTFA 3AXTA 4MTLA 2IP2A 3KQMA 2JH9A 1AQJA 4MWZA 5DM2A 2PBFA 5DSXA 1N7IA 5F2OA 5HZMA 2YTZA 1R00A 4QTUB 4RVDA 1ZKDA 5CUQA 2XBMA 3F4KA 3HM2A 2R6ZA 4QVGA 4PIPA 5H02A 2PXXA 2IDKA 3UJCA 3KQSA 4RYLA 1EG2A 5GIPE 3GRRA 4KWCA 4L7VA 5U4XA 2K4MA 3EVGA 2AOXA 3CBGA 4QQNA 5HIMA 4HGZA 4FT2A 5ERGB 1TW2A 4CKBA 2OY0A 4BLVA 3PB3A 4LECA 4RTLA 3EVEA 3I64A 3UJ7A 4PGGA 4PONA 4HRAA 1FBNA 1FP1D 3V8VA 2BR3A 2IH2A 1VBFA 3EPPA 1QAMA 4XUEA 5CCBA 2I7CA 4FGZA 2OXTA 4C05A 2PX2A 5K0CA 4CKEA 2HV9A 1QZZA 1XJ5A 3OPNA 4OQEA 2AZTA 3LCCA 2UYCA 2OBFA 5E2AA 1G8AA 3ORHA 2YUIA 5F2NA 2ZZMA 2H11A 5EOVA 4XUCA 1ZGJA 5DXJA 5ICCA 1I4WA 4BLWA 4FSXA 1XCJA 1VLMA 2PLWA 1YFLA 3P9IA 3UJBA 2I62A 3G5LA 5K8VA 5FHQA 4CKCA 4YMHA 2P35A 1XXLA 4HTFB 1H1DA 2LD4A 5IKMA 5EG5A 3TKAA 2JG3A 3M4XA 2PJDA 3RODA 1U2ZA 5FULA 2A14A 2GH1A 3G2OA 3OCJA 4PYLA 4K6MA 5DTRA 5FQOA 3X0DA 4UOEA 3KPUA 5GINE 5D1NA 3DXXA 5ICFA 4EKIA 2P7HA 3A27A 4QDJA 1Y8CA 3KQTA 2F8LA 2PWYA 3JWHA 1YB2A 3M70A 3UJAA 3LBFA 3HVJA 3M33A 5FTWA 4A6DA 5CVVA 4C4AA 2G71A 3DMFA 1JSXA 2UYHA 5DT2A 3AY0A 3FUUA 3UBTA 4HTFA 1DCTA 3KPVA 3C0KA 3TM4A 3THSA 2EFJA 2FYTA 2GB4A 4PYKA 4GOOD 1Q0TA 1TPYA 4RTOA 4RTKA 3C3PA 4ZTBA 3FTEA 1RJDA 2PV0A 4DZRA 4B17A 5K0EA 3REOA 4E32A 1DUSA 3ERCA 3A4TA 3TR6A 4CTJA 5FA5A 3E7PA 5EEHA 2ERCA 3E8SA 5P8WA 3IEIA 5LSAA 2PT6A 5DLYA 3ELDA 2E5WA 3FYDA 5CD1A 5CVUA 4PINA 2I9KA 1XDSA 4YV0A 4HGYA 3A7EA 2WK1A 5ICGA 3FTCA 4RX1A 3KQVA 2QYOA 1NT2A 3HVHA 3KR1A 3P2IA 2CKDA 2B25A 1ZGAA 1ZG3A 4PCLA 4FS8A 3GGDA 1KP9A 2IGTA 2O07A 2G8NA 3PX2A 4PYMA 3WSTA 4GOLD 2AN4A 3MB5A 2GA9A 1R8XA 5KQRA 3T7TA 5E8RA 3ELUA 4X60A 3MERA 3LPMA 2AOTB 4KDCA 3GRZA 4FT4A 4QPPA 3MCTA 2AVNA 3PT9A 5GWXA 4OX9Y 4BP1A 3FPEA 4R6WA 4G56A 4KVZA 3PFHA 3LDUA 5DX8A 3DULA 2IDJA 2FK8A 3TOSA 3SSMA 2VDWA 3SXJA 2VS1A 3G2MA 5E8JA 3ELWA 4F84A 4RTMA 3KQQA 3CJQA 2YVLA 4GOND 5FQNA 3PX3A 3DOUA 3UJ6A 3AXSA 2EG5A 3BUSA 4GC5A 4RTSA 1JG3A 1JSZA 4GBED 5EIFA 3U81A 1F3LA 1WZNA 2BZGA 3UA4A 2PX8A 3R0QA 5DX0A 3MGGA 4LG1A 3GCZA 3GNLA 3VYWA 2DPMA 1SG9A 4QPNA 2PKWA 3D2LA 4PYQA 3I53A 3SSOA 3AWIA 5K03A 4GC9A 4CWAA 5KS2A 3JWGA 2PGXA 3BXOA 2AOWA 2HTEA 3LECA 2BH2A 3BWMA 1X1AA 3LGAA 4IWNA 4O29A 2KW5A 1V39A 1BHJA 1KPHA 2YQZA 4NECA 2P40A 1G60A 3BWBA 3GRUA 2H00A 5T64A 2ZSUA 1FPQA 3UA3A 4RTNA 3I58A 3VC2A 3K0BA 4OQDA 2ZBRA 3H2BA 1NBHA 3O4FA 4A6EA 1JTEA 3FUVA 4CTKA 1EIZA 2EX4A 5GM1A 4FZVA 3PTAA 5DXAA 3I5UA 3LKDA 2FPOA 3FPHA 4X61A 1UIRA 2PSSA 5LQKA 1SQGA 4DA4A 5C0OE 5KYGA 3TRKA 4Z2YA 3KU1A 3HNRA 4X63A 3G89A 4ER3A 2BM8A 5E1MA 1RI1A 2YR0A 1P91A 2ADMA 3MTIA 2AS0A 4EMSA 1IXKA 2PT9A 1NV9A 3ANXA 3PS9A 1FJXA 5LQJA 3BGDA 5FWAA 1TW3A 5EGSA 5LQUA 4WVLA 1FP2A 3NDJA 2V74B 4E2ZA 3HP7A 2GAFA 5HIIA 1M6YA 4OA5A 5LR6A 1JG2A 2I6GA 3LX6A 2NXCA 1X19A 3G2QA 2PVCA 3NDIA 2OKCA 4DMGA 1QYRA 1L3IA 1NBIA 3EVZA 1NKVA 3DLCA 2G1PA 4XCXA 5FUBA 1WXXA 1JG4A 2VDUE 3KQYA 3B3FA 3SGLA 4YV2A 1X1CA 2AR0A 3KR9A 1WS6A 2AOUA 3NJRA 5HIKA 3TM5A 4FR0A 4MIKA 2JHAA 1EAMA 3V97A 4RTPA 2H1RA 3HEMA 2EJTA 1O9GA 1ZHFA 3CJTA 5DTMA 2P8JA 5BXYA 2N47A 4YUVA 4F85A 1SKMA 1G8SA 4M7RA 1PRYA 4C07A 3EGEA 2B3TA 4P7KA 3DR5A 3C6KA 3P9KA 1YZ3A 2ZLBA 4C04A 2P3OA 5EMJA 3EVFA 7MHTA 1UFKA 3UZUA 5EZQA 3EEOA 2AN3A 1XDUA 3G88A 3G8BA 3FTDA 1JG1A 3EMDA 3G2PA 1JR4A 3NWBA 1MHTA 2NP6A 3SX0A 2ZFUA 3CCFA 4M37A 3IYLW 1XTPA 3KQOA 4GF5A 3EGIA 4HSGA 1B42A 1Q0SA 4KIFA 5EKUA 2YXDA 4GUAA 1O54A 3OFKA 2P7IA 1D2CA 3CGGA 4QQKA 4AZVA 1RI3A 5CVJA 2B2CA 3LL7A 3SMQA 5DRTA 3BWYA 2NNWB 2OPBA 3TMAA 4C06A 4PYJA 2UYQA 3GU3A 3BKXA 5DM1A 2PX5A 4AZSA 1QANA 2B78A 3HCEA 1NV8A 3JWJA 4OBXA 3K6RA 1NW5A 3EVAA 4HG2A 2ZBQA 5KVAA 3R6TA 3FRHA 3P9CA 5JR3A 2OYRA 2P41A 3UJDA 1N7JA 3M6XA 4E70A 1RJEA 1EJ0A 5GOZA 3HVKA 4RTQA 2PXCA 3THRA 5EKXA 3ME5A 4RTRA 1I1NA 2BM9A 5C1IA 1KXZA 4ISCA 3KKZA 2C7PA 4IKPA 2FRXA 3EMBA 2UZ4A 2AVDA 3B89A 3BKWA 2HMYB 3BT7A 4YUWA 2XVAA 3IV6A 3T7SA 5EMKA 2FHPA 3LDFA 3M6VA 3DTNA 4P58A 5DPMA 5HILA 2NP7A 2C7QA 2CMGA 2XYVA 5K0GA 5B1SA 2ZVJA 3JWIA 5EEGA 1UWVA 5D1HA 4C08A 3UWPA 2QY6A 4E31A 3HA5A 2G72A 3KPYA 1ZQ9A 1SVUA 1D2HA 3KQWA 4GEKA 5DRYA 2ZZNA 3FZGA 1D2GA 5CIYA 4RTJA 3TLJA 3NMUF 1SUSA 2ZW9A 2OZVA 3HTXA 4V0QA 3UJ8A 4PCAA 4Y30A 4R05A 1ORHA 3G5TA 4GOMD 4AZWA 2O57A 3HCDA 3R9XB 2UYOA 3GDHA 2OO3A 4PYOA 4E2YA 2JH8A 1NW7A 3QOWA 5K05A 2BR5A 2Z6UA 2JHPA 3EVDA 3G8AA 2B9EA 2HNKA 1BC5A 4R8SA 5T6BA 3TKYA 1JTFA 4RV9A 3KR2A 4JXJA 5HIJA 5C9ZA 2IBTA 3QOXA 1SUIA 5E1DA 5K0FA 5K0JA 4Y2HA 4ER0A 3FPGA 3HCCA 3LHDA 1RI2A 3DMHA 3HA3A 2XVMA 4V0RA 5DWQA 1X1DA 2C7OA 2ZTHA 3M6UA 5CVEA 2PX4A 2IBSA 3BGIA 5K09A 4IV0A 3L8DA 4P7FA 4P7JA 3FPJA 2ONZA 3SM3A 4DF3A 5LQCA 2YXEA 4RVHA 1NW3A 1AV6A 3P9NA 2AOVA 1HMYA 3LDGA 1RJGA 1P1CA 3FUWA 3GO4A 3TPZA 1JQDA 2ZIGA 1R18A 1EJ6A 2WA2A 3R24A 3G7UA 2GPYA 3P2KA 5DTQA 5HOQA 2P1DA 3CKKA 2CWWA 2QE6A 5EIWA 4U7TB 4EQZA 1IY9A 2YX1A 3NW9A 3OU6A 2XYQA 3GXOA 2AOUB 10MHA 3R3HA 5EMMA 1VIDA 4QVKA 5E9WA 1XDZA 5GM2A 5HFJA 5GP1A 1VP3A 3LKZA 2O0LA 5E9JA 5EMLA 5M5BA 5CVDA 2GLUA 4MHTA 3GJYA 3BGVA 2GS9A 3O31A 3OE4A 3UJ9A 4C03A 5LQRA 1R8YA 3Q7EA 4MQ4A 4R8RA 4DQ0A 3ER9A 1VQ1A 2VDVE 3EVCA 3A26A 3I9FA 3KQPA 4KDRA 2Y1XA 4E2XA 2G70A 2PXAA 5CCXA 3C6MA 3B3JA 1G6Q1 2NXJA 4YUYA 3RW9A 3GWZA 5BW5A 4BY9E 3OZSA 2HR1A 3SVZA 1RI5A 2PWPA 3EEYA 3OU2A 5FCDA 4HC4A 1BKYA 1NE2A 1N2XA 3KR0A 4H0NA 2NYUA 2ZCJA 3FUTA 1AQIA 2JHCA 2NXNA 2Y1WA 1YZHA 3LCUA 4E33A 1KYWA 5FWDA 1G38A 4QDKA 1HNNA 4P7GA 5EZSA 3P8ZA 4YMGA 3P2EA 3NVKI 2JJQA 3T0IA 3A25A 3NWEA 3KPWA 3HCAA 3LBYA 1OR8A 3B7PA 3GRVA 4CXMA 4PYIA 4LWOA 3P97A 4PNEA 4OBWA 2IIPA 2EJUA 5T67A 3CC8A 2DULA 5DSTA 2ESRA 3LSTA 1L1EA 1BOOA 1VL5A 5KQSA 1QAQA 5BP7A 2ZULA 3DH0A 5BW4A 3SR4A 3UFBA 4F86A 3ER8A 1DL5A 4BP3A 1O9HA 2O05A 1VPTA 3FPFA 4DKJA 4OA8A 1WXWA 2VZ9A 3DXZA 4U7PB 3MTEA 1G55A 1AF7A 1L3CA 1ORIA 3GIWA 2BR4A 4RVFA 2IPXA 3ID6C
chains in the Genus database with same CATH superfamily
3DLIA 1IPFA 4LPSA 1Z0ZA 1H2FA 1N2OA 3IQEA 1O4VA 2X5NA 3WL4A 3KK0A 2KB0A 4RM2A 2PY6A 3OPVA 3UFXA 4O3MA 1PFVA 3AFNA 4NYJQ 1E79D 1X1RA 1YQ9A 4RS4A 1U5AA 3DSRA 1YR2A 4V0OA 3AEQA 1CRLA 1LI4A 4A6XA 3ES9A 5AD1A 3F6YA 2IIQA 3R44A 1KK3A 4KEAA 1KJ9A 1NQTA 2QORA 2ZZKA 1PT5A 1I0ZA 4XIGS 3E9MA 1IHUA 4J0GA 4RQAA 4L0DA 4HB4A 1CT9A 1SUWA 2CCGA 4X1KA 1ACLA 1YMVA 1JT9A 1YTLA 3GBVA 4FP9A 2JFZA 4TWBA 4QFCA 5LZ8A 1RHMA 3Q9LA 3GCWA 5K3OA 2EX1A 1GDHA 1Y5NA 4PE5B 5BQXA 1L5HA 4A2QA 2O8CA 4F3CA 1T4MA 5H70A 4KRYA 4RETA 1ADJA 3KETA 1M2OA 1HV8A 4JS0A 4LXTA 4BQFA 3TNFA 1J70A 4W7SA 3WBFA 4M6WB 1JU9A 3FR7A 3MF4A 3B70A 3OQBA 1VYUA 2XGGA 4HDOB 1BS1A 4PLVA 4KXLA 1OX6A 2NQ8A 1GL6A 3F3MA 4IG4A 3L6UA 1Z06A 4M55A 1WY7A 4U7JA 1RLJA 2D2EA 3FYCA 4Y2VA 1C9YA 3SSNA 1X1BA 4EL0A 3IQFA 4OHVA 2XYRA 2WVAA 1WVGA 5K7SA 1UDBA 3L4BC 4G85A 4AJ9A 1JEDA 4M9SA 1DWQA 1FF9A 1XRQA 3B1WA 3EZFA 3KWLA 4FCVA 3NS7A 2QD3A 1Z0FA 2ZJAA 4IH4A 1Y1KE 1WG8A 4K3UA 3CMCO 1H23A 3TNJA 1VPLA 5B53A 1YUBA 2FY8A 4P82A 5EHIA 4EBFA 2H16A 2BFBB 4EUEA 1EFCA 2QSYA 2J9RA 4GX1A 1K98A 4QFBA 1P7WA 1GTJ1 1I7LA 1MV8A 1WNTA 4UE2A 3LUDA 2YJZA 3M34A 5JS1A 1ZEJA 2OGWA 3MT0A 2A9RA 4JH0A 4KXVA 1P62B 1TEVA 5LQNA 3FYHA 5D5PA 3FN4A 3K31A 1KPIA 7GPBA 4B4WA 3HB9A 1FS6A 1ZM7A 3OIYA 2VDJA 1T6XA 3AJ9A 1Q5PA 4BECA 1F3OA 4GD3Q 4BJ1A 4Y1GA 1IEQA 1QIMA 3PQDA 1NXQA 2R11A 1KVQA 1JIVA 2V4UA 2NXEA 2QW0X 3QPUA 1GA1A 4HAXA 3CCBA 3ILYA 2JCBA 3PC4A 4G5XA 3C4VA 4AYWA 2JH9A 1NMXA 3DBRA 3VSCA 3WDSA 1KU6A 2CB0A 2IXDA 1FFGA 4LRYA 4RH3A 3H9GA 3DLPX 3HM2A 3DFKA 1JJBA 2BGMA 2IUEA 1XZIA 3CRZA 1Z7WA 1PI3A 4YT2A 5U4QA 4IIJF 4R2HA 3A58B 5IZCA 2F8SA 5C3MA 4UQOA 3IBGA 2R7AA 1U6IA 3BIWA 2CVFA 3H11A 1ISMA 3CEMA 5FNVF 1ULSA 4NZNA 5H68A 1MW9X 2OHIA 3EPPA 4IMJB 2R7MA 3CUYA 4GPZA 1F0YA 3JQBC 1X42A 2DPGA 2Q3EA 1MBZA 2Z9BA 2W2XA 1MJHA 4OM8A 5IN5A 3T9BA 3TIGA 4FMCB 3GLIB 1VKZA 5E2AA 1P19A 3KYCA 5C8ZA 1MO6A 1TQ2A 1R4NA 3ONEA 2A1UA 4JX9A 5HFAA 1I4WA 3SVLA 1H65A 5J47A 4GMDA 4AMBA 1W2HA 4YMVA 4XQ0A 4FEEA 3ZBPA 1P2UA 1WZCA 1OA0A 2GLTA 1XXLA 2Q8QA 2Q6TA 3T4XA 4YRAA 1H1DA 3E27A 3EZ6A 5EG5A 1KARA 3TKAA 2JFFA 2VK2A 4MTCA 2EGHA 3AEQB 3X0DA 1Q11A 1XDWA 1NVMB 3U3KA 2GK4A 3DXXA 1E2EA 3KOYA 1LPSA 3I72A 2WTMA 2ZJ2A 2KS6A 3R3WA 3GLUA 3KUUA 5HF8A 3BC1A 3IP7A 1HGXA 1V5FA 3ESQA 5E3HA 1OPRA 4XEUA 4X1KB 5CVVA 1MNAA 2PUEA 4WUTA 4FOSA 1UP6A 4C4OA 3AEZA 4DMKA 3BRSA 4L74A 3HUUA 2UYHA 2V03A 4J2OA 1RR6A 4X94A 1ZC4A 4UE6A 4C21A 2GFIA 1L5HB 2O8CB 3DFMA 2EFJA 2IZOA 1RM4A 3B8EA 3MJSA 5DB4A 3TLAA 1FSFA 4MGHA 5AKYA 1X1SA 1M2OB 2VCYA 4RTKA 1APBA 4BO9A 1U8ZA 1DPFA 1XNGA 1XOIA 1ZC3A 2XNJA 3TR6A 1JU4A 2PS9A 3PL5A 4FQ5A 1V8DA 5EEHA 2IPNA 3GRKA 3U3DA 5CURA 2FWPA 2AG5A 4F2PA 4FNAA 1NUSA 1G1AA 4IBOA 4MR7A 2PJUA 2Q07A 4HDNB 5F73A 2VC2B 1R10A 1Z73A 3QXHA 1WMSA 4UQLA 3AESA 4DM7A 1K7FB 3GGDA 3NIBA 3PNVA 3HR8A 1UC4B 2CVPA 3FZQA 4UDXX 1JJVA 3PX2A 1JQLB 1FVXA 1B41A 4EHDA 4G8BA 3SX4A 2HH9A 2J6HA 4RFVA 1Q6YA 4QYIA 1LC0A 8ADHA 1IBMB 4JBIA 5KQRA 1QRAA 1WXHA 2V7VA 3UCXA 3I6IA 1LPOA 2AVNA 4UEWA 4QFMA 3AG5A 3DD5A 3PTLA 4KQJA 3G59A 3OEWA 4S2EA 4GGMX 4WLUA 5HBRA 4BQPA 5TPWA 1IZZA 2P9ZA 2PQ6A 3ELWA 2FRDC 5IJ9A 4YLGA 4D3YA 1JR3D 2FZEA 3VXKA 4EA9A 2HC9A 4F21A 5I51A 3I62A 4WOBA 1TD9A 1P2VA 3T7KA 1XPUA 4HEA1 5BOSA 4OI1A 3VV2A 1PAUA 1PX2A 5J59A 3K6SA 1EHIA 1JDZA 2RG1A 4GKKB 4FUQA 1RBZA 1DCMA 3BL8A 2QLBA 2R4UA 2YCLA 4L4XA 1KQNA 2XRFA 1BZYA 4HTAA 1ZN7A 2DPMA 2ZT6A 1RWQA 1Y4AE 3DBRB 2ZSAA 4QDOA 6LDHA 3OZVA 3ZNOA 3OHPA 2CT8A 5EZYB 4X7PA 3QUQA 4WSOA 3WV4A 3G3EA 4G1UC 1HZZA 2B8JA 1AS0A 2HADA 3SEZA 3CT6A 1C3OA 2D3WA 2Q6LA 1RSZA 2FPWA 4OKSA 1FTYA 2X6RA 3OZFA 1VJGA 1G60A 2A33A 3Q5GA 1U4OA 3ANLA 3H11B 4WGGA 4XCVA 3GPBA 4ZVVA 3SQOA 3T15A 4DMUB 4E7PA 4O4LA 4LSZA 1QUFA 3A1TA 2IQ5A 3WKAA 4X0EA 1CTQA 2VHXA 4QHYA 4PZEA 4RW0A 1GYQA 4UHHA 4BVKA 5A5VA 1FYWA 4GHWA 3OLZA 2PPLA 1UP4A 5KDDA 2BFDA 2J0EA 3CH6A 3KYCB 4UXJA 3TS1A 2JFVA 2VTKA 2IXEA 5A0VA 3VNVA 5KYGA 4C7VA 3SQLA 1YCDA 3EXEA 2AB0A 3CLHA 3UJNA 2ZK7A 3G89A 1B14A 1XZBA 2IKQA 3HS3A 2C84A 1SULA 2I4IA 1EWQA 2XT9A 1BXGA 4Q39A 3LRPA 3OA0A 2FUKA 2H1LA 4IYJA 3I09A 3KXKA 4I5FA 1XMVA 3IKLA 2VNHA 2ODNA 4BUCA 3B12A 4JCOA 2A4KA 2EATA 1RQNA 2R6FA 1CJCA 1RQ7A 3WMWA 1D0SA 1A5AB 1X9GA 3NGXA 1X86B 1MX5A 2DFNA 2NT3A 3QNMA 3GA7A 3L5KA 4IOMA 3EVZA 1Z7GA 2YYSA 2G36A 2HRDA 4LF9B 1E0KA 2VUHB 1RHJA 3NOQA 3ZZUA 5A62A 1U0JA 3SGLA 2I7XA 5IBPA 3BMNA 5EINA 2OCLA 1KEZA 3DNFA 2X9NA 3V9AA 4CR7A 1RZRD 4H7KA 1CDEA 1EAMA 1VJ5A 2W6ID 3LT4A 4K05A 2UZ1A 1IQ0A 1RP1A 4C20A 2GBGA 2XDYA 4LY3A 2QL5A 1JI0A 3HGTA 4BFTA 4A73A 4M9RA 1D9XA 1YU9A 2P6OA 3DD1A 1COZA 1I51A 2Q2VA 3CNQS 3K0HA 3NP9A 3G9UA 2ENUA 1WW3A 2WWRA 3PF8A 1RS0A 4ZAWA 4MR7B 5KYNA 2NSYA 2P3OA 5E4YA 5BQOA 3EIEA 1A97A 4IR7A 1VL8A 3AESB 2AN3A 4GAEA 1GPNA 1G6KA 2V6FA 1QZTA 3FKSD 2V7QA 1JHAA 2I2DA 5A4DA 1JR4A 2DT5A 2X0IA 5TC4A 2ZFUA 3UKDA 2UVDA 3A4NA 1SHTX 1CDOA 4J76A 5DNDA 3W90A 4PYRA 1Q0SA 4U2FA 3ZDDA 4JC8A 2WKWA 2WB2A 2OD2A 2WYVA 4FCTA 1JMKC 3OCXA 4Q3AA 5HQ3A 1A7AA 1YJ8A 1GUFA 3SMQA 2HX1A 2QW8A 5FA6A 3S2FA 2WT9A 4R9VA 2OPBA 3ROGA 4D9NA 4DA0A 5DGTA 3G2JA 5TPWB 1KVSA 3G2HA 3AY6A 3OE1A 3AH8A 4Z0HO 1Z63A 1ZNYA 1CUGA 1Z7YA 4EMUA 4LF8B 3JWJA 5IJ9B 2TYSB 2WZCA 4YTEA 2W22A 4EQ6A 2IU6A 1HE3A 1VJ0A 2ID4A 1HBJA 5BOSB 1H0SA 1G6OA 2CNLA 1IZ0A 1V6SA 3CNHA 3D2BA 4YRCA 3HPRA 4ZRNA 1DXYA 3DXFA 5K1ZA 4Q3KA 2XXJA 4CL0A 5L3VA 1H8EA 4G81A 3VU3A 4RTQA 1COWA 1OCEA 3SZMA 1K97A 5G0WA 5KNBD 1P74A 4EJ6A 1DWOA 1JXMA 3EBOA 4FIDA 2CMFA 4MB6A 4EFDA 3GFOA 2G1KA 3DV0A 2DKOA 1NI4A 5C1IA 2PFSA 2C7PA 1EVYA 4AF8A 1BRTA 1UR5A 3MWJA 1U9YA 4U3JA 5CFPA 1CR1A 4KO3S 1C3OB 4UVEA 3RFVA 1TVKA 4XOIA 1AX9A 2VP6A 4MPRA 4PLCA 2HA0A 4Q7JB 5B7PA 2CV1A 1JPVA 4D1YA 4D57A 1W44A 1G19A 3EISA 1UXOA 2X6TA 4O4LB 1SA0B 2XECA 4S1TA 2ET6A 4NFSA 1EFHA 4TSKA 3QKSA 1FYFA 4GEKA 1JIUA 4OGKA 2OGZA 3FETA 4RPHA 4ZOLA 3ZV7A 4B3HA 3OKAA 4IQ0A 3FOFC 1P3JA 3NMUF 3KVVA 1QX3A 4MMXB 5D3MA 2BFDB 2CNWA 2WOOA 4X7RA 2RI0A 5EIOA 2L0XA 3G5TA 4LK2A 4WADA 1Q1BA 2XB9A 4DR6B 3D0OA 1CJVC 2V7UA 3EXEB 4CCWA 1R9GA 2GNOA 1T8SA 2YUTA 3PNOA 1D2EA 1EX9A 3K1JA 3M81A 1SCUB 1EFUA 1DTWA 4OYLA 1BXGB 1OW3B 2QEQA 3A1FA 1DG1G 1IHOA 2JI6A 2WTXA 1WB5A 4HNTA 2ATEA 4TZ6A 3D4OA 2B8EA 3K8YA 4Q6BA 1XTJA 3T3EA 1OFHA 3GDOA 3GF4A 4KXYA 4AB1A 3FDZB 4E1AA 1J22A 1CZRA 1PS8A 2NSLA 3H9UA 4LGMA 5T3UA 3SE0A 1E1RD 3T5BA 4CF6A 4BB0A 3AF6A 1ZI6A 1HMYA 3N2KA 4H1UA 1RJGA 2P5UA 4LRSB 4ZJPA 1UH5A 4GEGA 1EJ6A 4IGFA 4KLCA 1Y8ZA 4E6PA 3RJZA 4NXNB 4HLCA 1CUCA 4MKGA 3U9TA 4ARUA 2LIVA 3L6CA 2GF2A 3NALA 1UJ6A 3BMNB 3S1LA 1YZGA 2FG6C 4JDPA 5FBZA 2C92A 1VSUA 2JF0A 2XCTB 3BFPA 1RWOA 4LGYA 3LCMA 4GZ3A 2UZ1B 1NF3A 5EJ5A 4BV9A 4ZXFA 5JJBA 3HBJA 1LW7A 2FJUA 1SB8A 1XVUA 1YR1A 1WCYA 4RMNA 3QQPA 3HBLA 1Y0BA 1P7ZA 5CCXA 1KZHA 4YO8A 4JUIA 1E2LA 3WMGA 3U44B 2D7DA 1DOHA 4G25A 2FAXA 3GWZA 4FXPA 2ALJA 2R7KA 4J6FA 4PTYA 3B1YA 4CGZA 3QX9A 5FCDA 3RF6A 2JCXA 5H16A 3IRVA 2V5VA 1HFKA 3HFSA 3QLJA 5KNBH 3OQPA 1DINA 1YKSA 1F51E 1DU4A 5I45A 3LLSA 1V4NA 1KZGB 1FTGA 1NL3A 2BCGY 2O7VA 2P9CA 4TMFA 5KAMA 2RE8A 2XZLA 1TT7A 5HQ3B 4MEAA 4WY2A 1V26A 1A71A 1K5GA 1XV5A 4GPBA 3DF9A 1YK1A 1YMQA 2AQKA 2E48A 2GJKA 3P97A 5GONA 3JD4A 5JNRA 1RWVA 4BMVA 3IPCA 2FETA 2XTAA 4PX5A 1QFZA 5FF9A 1CIVA 4F11A 1L1EA 3IAUA 3EA4A 3OCZA 4K2HA 4KKXB 2FDRA 3LO8A 3PF9A 2HQSA 4LXQA 5CHEA 2WUEA 2GD1O 1IVYA 1E3QA 2PMBA 1TL7C 3F5SA 3MSCA 3EA0A 3ZWWA 4F86A 3KOMA 1YGPA 4TKUA 2BCJQ 4BO1A 4CQMD 2H4JA 2VZ9A 5IU6A 2GCGA 4MVYA 1O95C 2ZSKA 4NQZA 5DF1A 3R3SA 3H19A 4MAAA 1VJTA 4OD0A 1JHUA 3UUGA 5KTTA 1L0BA 1SD5A 1TLTA 3CF4G 3OM8A 1F9AA 4OXQA 3AGQA 2VP4A 2HSWA 1PTJC 1NI4B 2ORED 4HYEA 1DAMA 4O33A 2C2XA 4F5DA 1WETA 2P3QA 2W93A 3FMIA 5KCMA 5GZ3A 2OOKA 4U3JB 1R3DA 1UXKA 4NZOA 4O4HA 2HEIA 1L5NA 3TMYA 4CTOA 4DDWA 1HR0B 1TVKB 2R7LA 4MR9B 5AM1A 3MGAA 4R8VA 2C58A 2NZ2A 2O2JA 3H1AA 3OCCA 3OIWA 4G23A 3QKSB 4ZOLB 5IBQA 1NWCA 2CXNA 3WWDA 4F7WA 2PKRA 5IXSA 2BN4A 5JYEA 3QEBZ 4J90A 4GX5A 4FKZA 2JAUA 5FAXA 1C0IA 3G5MA 2XWQA 1Q3TA 1O6GA 1P6XA 1LBEA 3EW9A 3JV7A 5D3MB 3FNBA 3HVIA 4Z0TA 4ZXPA 4PR3A 4KH0A 4Z3OA 1KJZA 3I6ZA 4IDGA 3GN1A 4O5OA 4PC6A 4QECA 2XUJA 4GGOA 4F4JA 3UPDA 2XYGA 3CF4A 4QBTA 4B6QA 4PC3A 4LOIA 4TS9A 3HBNA 1F12A 4RY8A 2MSNA 4KPFC 5HKOA 1DTWB 1NQOA 2HTFA 2CNKA 2H59A 3COVA 3U13A 4M46A 3O8CA 4R7GA 5KYXA 4ZZ3A 3OLWA 1ZA2A 1M2GA 4GDFA 5IJAA 3GDWA 3L7LA 1OIVA 4KWIA 1J6UA 4E88A 1E79A 2REOA 2I66A 3SHVA 2Q41A 1DDGA 2Q27A 4EKGA 3NQ41 5FHRA 2DBRA 2IH4A 3N2KB 3ZJUA 2O3JA 4G1VA 1PVDA 3K32A 3VNAA 3U7HB 1BA3A 5JS2A 4UPDA 1ZO8A 1WQ1R 1G16A 4I1UA 4MP8A 3LQQA 3I42A 2IE8A 3LA6A 4KR2A 2JGMA 3GJRA 1T35A 4B48A 2CNDA 2ILTA 3MQFA 4KQKA 1YR6A 1AMNA 2DX7A 5LBIA 4ATNA 4B33A 4KBFA 3RBAA 1DKQA 4GI5A 3PHIA 3LC1O 1UMCA 1P7CA 2BF4A 2GILA 1CEEA 3I4CA 4X00A 2W6JD 1M5TA 1RMYA 1GRVA 1KZYC 1R0RE 2VYCA 4K2AA 2IXBA 4KRXA 3P20A 4CM5A 3BMOA 3DFFA 4WCFB 4LYJA 1XIVA 3NM6B 3A37A 4GOXA 4UHFA 1OWNA 1FLAA 2B4AA 3A10A 3HN2A 4MI9A 4DPLA 4Z4FA 1AHHA 3AI1A 1SC3A 2L42A 1D2AA 5EI5A 1OT3A 1TM4E 1ODSA 5CT8A 1SB9A 2GPWA 4PPGA 4UBNA 4RF3A 5ALIA 3JYHA 3ONNA 4PZUA 3C5WP 4NV1A 4PIMA 4RMHA 3FZNA 3D7LA 3VVBA 4BWFB 5BSWA 5LOVA 1GA6A 4Q16A 2I2XB 4H6WA 4BQOA 3VVMA 5JRDS 1LFAA 1WBJB 1Z12A 4GWLA 3VI3B 2PBFA 1Y4SA 4XWTA 5IBCA 2DFLA 1YI0A 4JZYA 4IVNA 3VHXA 5H02A 2IDKA 1OBCA 1UDXA 4YH1A 1K5HA 3DJFA 1PCXA 1QQAA 2M6SA 4GWGA 3ZWDA 3ZCSA 4JMPA 4WFIA 1NJ2A 1QYXA 4BNWA 1IIBA 4NBNA 3SQDA 5AVKA 3UMMA 4LEIA 3MELA 4TTRA 3QX3A 4EH1A 5A9SA 3L1IA 4D9KA 4RTLA 1KFEB 1UBOS 5DOVA 2JGJA 5GONB 4BMCA 3O9MA 1VKHA 1SUPA 4M60A 3TE7A 1EFVA 5F5LA 5CNJA 1RFLA 1G8YA 1OGJA 2G7MC 3HU1A 3I6MA 4ECEA 2BUAA 5IVDA 1M2HA 1C8VB 4JI6B 1TIPA 4YMUA 2FZ5A 2XBUA 3K30A 4NIMA 4RF2A 5ALLA 3ZY6A 3KFVA 1OH6A 2H11A 1O97D 2X2EA 4EF6A 4O2AF 2QTMA 1ZGJA 5J4KA 3OOYA 4BLWA 4WACA 3OOJA 4GZMA 4F8YA 4D79A 1DSSG 5EJ8A 1JMVA 1GRNA 1P7PA 4AQYB 2FLWA 5CTJA 5DBEX 5EJGA 1FS4A 1V48A 3B3QA 3L7JA 2QX9A 5GGYA 4F06A 3CH4B 1L8OA 1P1IA 3QIVA 2FQWA 4O4HB 2OHHA 4JQOA 4I66A 4AJKA 1SBHA 5FULA 2GBPA 4LYFA 2XB8A 3U7GA 2FSUA 3H17A 4HGOA 4K6MA 4Y6RA 5CXXA 4Q7MB 1P9WA 2NAPA 3NR2A 2B1IA 2FZKA 2L18A 3HXOA 3HXKA 2F8LA 3CX3A 3X3HA 4HYQA 4OHUA 5B37A 3SLRA 7ABPA 1E5LA 1M34E 2FXVA 4II3A 5LP6A 5J23A 3DEHA 5CPBA 3DMFA 1SKYE 3O93A 2BTQA 4BB9A 4PPQA 5KTNA 1GZ5A 3DZBA 2P9FA 1K86A 3CX6A 2C0QA 5FTNA 4N0QA 2PX6A 4QAQA 1DUSA 3W6UA 1MG0A 4OV6B 4UUPA 1XYGA 1ZZGA 2WT8A 4CTJA 5T4FA 3ZHYA 2X13A 2NSJA 3BK7A 3E8SA 3DW3X 5KYXB 4W4TA 3V8QA 3X2EA 2LE0A 3ELDA 3GVIA 3PJDA 2A78A 4B35A 4XUGB 3EEIA 4C0LA 5J63A 4A8JB 1AGPA 1CR0A 3LHIA 3PEWA 3P2IA 3B6IA 3VSBA 4X90A 3JVIA 3MT8A 1RQ2A 1YJ5A 2B4KA 2FPPA 2VP0A 2ZRHA 1HTBA 5J40A 2IX9A 1RZVA 1XN4A 5GJCA 1E1LA 4FXOA 3S70A 2YH2A 2ZBVA 4LI3X 4QICA 5JC8A 1BXRA 3MAJA 4URWR 1ESDA 1AK2A 1RAHA 4BQEA 5E8RA 2R86A 3CUEF 2PNFA 4JXZA 2QXUA 4JBXA 4LF4B 1A4XA 1ISPA 3AVXA 4AS1A 1IDN1 3M83A 2XIQA 4ZKDA 1A72A 2HDHA 3DULA 2CJXA 3RM3A 3LUGA 5CYOA 1A50B 1WUHS 3BMOB 3B9QA 3G2MA 3ZCQA 1IEVA 5ESRA 4LY9A 5KJ6A 4OFZA 3U09A 3KAPA 3PX3A 4BLRA 1R12A 3QV1A 1NGSA 2AMVA 3ZS8A 4AIRA 2B8WA 5CFMA 2NZWA 4FCWA 5JD5A 1JSZA 3MYYA 5LOVB 2KMLA 3F6RA 4UZEA 5D00A 4TSFA 5KNDD 1KDOA 7ADHA 3GCZA 3A32A 5JCJA 4EI7A 4RY2A 1VJ1A 2AJDA 3AHJA 5SY9A 4D9GA 3CZ5A 3IJRA 5T4HA 4DBLE 4HPJB 2OZEA 2RIRA 3VHXB 3CKMA 4CWAA 1I1QB 1QCYA 5T41A 1ZWLA 5K3FA 3FTPA 4B6RA 3KJGA 1JXAA 4Q24A 2ZJ1A 2BH2A 4FMBB 1F20A 2G9QA 2NADA 3BWMA 3DKVA 1T0HB 4MWOA 2M6RA 3U17A 1EFPA 1KPHA 1OB5A 2BMDA 1A9OA 2VXYA 4AJ4A 5DEIA 3PQ5A 2FLKA 4MQLA 4LW8A 3IPRA 1PN3A 3A6KA 1QRSA 1FPQA 1ZPDA 2HXSA 1R8QA 3BXPA 2LWIA 1EFVB 3AR6A 3GGJA 5AK5A 5C8YB 3SC2B 1CU1A 3H4TA 1JDTA 5JCZA 5MN5A 1E6MA 5AOVA 3N2LA 4A6EA 1JA0A 1B73A 3CKLA 3FTQA 2CXQA 3FUVA 2G67A 3NTUA 4FZVA 5C37A 5DXAA 3TSYA 4AO8A 5HM6A 1JR3A 2FPOA 4M1SA 4TMKA 3U37A 4RD0A 1QVVA 2C7VA 3JALA 3DLHA 1MX1A 3ZWYA 4AN4A 4CN8A 5CJ2A 2PUJA 3ZI4A 1BCSB 1IYZA 1TX4B 3LY9A 4GYKA 6YASA 2C94A 1KFJB 3AOEA 5IAKA 5C4MA 1QQTA 1U31A 3CB2A 2SICE 1NXPA 2WTBA 4CLOB 4I19A 4MCAA 3ZGZA 1GOTA 3H13A 3S2SA 1ZD1A 3VPAA 1DEAA 4W5TA 3QPBA 3N6VA 2B1QA 2M98A 4WPGA 4ENSA 2VQ6A 4K1XA 3ZU4A 1B2RA 5LQJA 1ZWKA 4LN1A 1I2DA 1SH7A 1P5FA 4IO1A 2V74B 4PZAA 4L9SA 3BJZA 1LK0A 3KZNA 4OA5A 1WDWB 5D84A 4KE8A 4BQNA 2PVCA 3LKBA 3T9FA 3CM0A 4BB5A 4ZQBA 3R9KA 5ED0A 2JRCA 5JXWA 2BTQB 3Q8XB 1JG4A 4M1QA 4OQNA 4MPJA 1P33A 4Y6SA 1GSHA 3KR9A 5FWXA 3E15A 3RK0A 2OCBA 4MUJA 3Q9UA 2C5FA 3RUAA 4LCJA 2H52A 2O2SA 2NGRA 3L7NA 4PGMA 3E3LA 3PDCA 2ZTUA 3VZCA 1ZHFA 3CLRC 2BFOA 3OBIA 3U1VA 1IUKA 1G7SA 2WRZA 3LDHA 2WM8A 1JEOA 4F97A 3CZRA 3QTTA 1P7YA 4WZAA 2IPLA 4C07A 4HAUA 4KHPB 4DDVA 3NX4A 3BVPA 2QP3A 2HREA 5LXTA 1N3LA 5CFOA 2PH1A 1VLZA 4DSTA 1RIFA 4RPLA 5AVYA 2ZJ6A 5KNDH 1I6KA 3JVUA 1OZAA 1HA3A 1FZTA 1WM1A 1PE0A 2FPPB 1UK7A 3L6DA 4IH9A 5BORA 1V0JA 5AI9A 4J7AA 3L46A 4BZWA 3U4GA 4WFJA 4EHHA 2NTEA 3WICA 1BXRB 4JC4A 3ZEIA 4YJGA 1Z2OX 1Z35A 3X44A 3GZ4A 3IQZA 3RBZA 2BFCA 3NCTA 1BDHA 4AZVA 4F91B 3D3NA 2B2CA 1OZFA 4H31A 1M2JA 4PZ9A 4YRTA 3C45A 4WBNB 1ZI8A 4OHOA 4PQRA 3KQKA 3FWHA 1JLHA 3D4PA 3FPBA 4ZHSA 2BGLA 2ES4A 2O8EA 4OBXA 2R9VA 2ZS8A 3GK3A 1BGVA 2DMRA 2VRBA 1E9FA 5JD4A 5F5XA 4WD3A 4JYMA 3H8VA 2P8SA 3HCOA 3H0EA 4TSRA 5KVAA 3VPCA 5CG2A 5A2GA 2AJLI 1G2OA 4N4AA 4EB8A 1GPLA 3BILA 1ZK3A 1V5IA 4WWHA 4P3OA 2W90A 1W5BA 1XJ0A 1I1NA 2BM9A 2EKPA 4X93A 2VSFA 2AT1A 4IKPA 2X5OA 2BHTA 3KAKA 1RVV1 1CUFA 2P5SA 5K3FB 1Z29A 2G0AA 2PWBA 3K9BA 4UKDA 3T7SA 4WHMA 3RVMA 1EFPB 1HQCA 1LC3A 4P58A 3ISTA 5HILA 4ASUD 3I9KA 4EY6A 2NO0A 3ANYB 1RHUA 1OIXA 1ZH2A 3TUJC 4LV8B 3DM5A 2ZM6B 4BO0A 4G89A 4XYMA 1HT3A 2QY6A 2ZQYA 1N5RA 2NSDA 2QBYA 3PUVA 2UUPA 2F9FA 4DARA 1F06A 1JKIA 3EMVA 3PUXA 5HCIA 3TB6A 4JWKA 4A5SA 2Q1YA 1MKYA 3JALB 4GOMD 1SEPA 2JCSA 3LLUA 1C2YA 2Z6UA 2RONA 1HDRA 1HMPA 3ZGYA 1YBHA 4JKYA 4PV7A 2GN2A 1Z74A 4HZGA 4K6HA 3ZE7A 4MUKA 1A7KA 1CLEA 1BMFD 1SUIA 2BGKA 4CN9A 1VE9A 1Z68A 5KNBA 3CLTC 5G3YA 3FROA 1ATIA 3GJ7A 1XQYA 4J29A 1G5FA 4REMA 8GPBA 3TSWA 3GV0A 1KS2A 2WNIA 5FD8A 4XGKA 5AVRA 1OF1A 1JA9A 1FK8A 1JDSA 1NRXA 2ONZA 1NI3A 5FI3A 2IC5A 1JHDA 3P9NA 1N5MA 4PQGA 1C80A 1GGEA 4NK5A 4UFNA 2P6UA 5EJ6A 1E2FA 1IB0A 4GYYA 2HU2A 2ZIGA 5HOQA 2KWIA 4F5EA 2C1EA 2JI9A 2ZIVB 4UFPA 1LSJA 2FPLA 1IY9A 4HH0A 2PMEA 1IN4A 1S3GA 5FWXB 4S1WA 4KAAA 2BC9A 2JATA 1E64A 3MD9A 3MZ0A 4QVKA 5EUMA 5F12A 5J43A 2NZVG 1FUKA 1EDZA 4C03A 2O14A 1V6CA 3R41A 3KTAA 1FQKA 1GPYA 4WZAB 2Y0EA 3DV9A 4Z8YA 4OSPA 4KDRA 4F04A 1C7FA 2PXAA 1ENYA 5IC6A 5T6MA 2JLBA 2ZB3A 3AKYA 3LPDA 1S9HA 1X2EA 2BH9A 3CY6A 1KJ8A 4J94A 3UMFA 1XMJA 2GEDA 1I0IA 1OUMA 3C3MA 5CA1F 4WY5A 3VJKA 3A05A 2YWCA 3W4KA 1RI5A 2VUUA 3G5UA 1NQWA 3VH4A 4D9BA 4I55F 3ZJVA 4OYRA 4BLQA 4D26A 1JQKA 1TAQA 1P6QA 1E1RA 5CB6A 3DEAA 3ZVLA 4YR9A 1G41A 1SVWA 1JQBA 1UZUA 3AUXA 5TJHA 3NFRA 3UT0A 4B2YA 4JL6A 1XWFA 2AHOA 2SHKA 1OX4A 2FSHA 3G9TA 3QKTA 3SIRA 4E33A 1RYFA 1N6PA 2BFCB 1P2DA 5BPFA 4BZXA 5LDHA 2D4HA 3O82A 4M21A 1DB3A 4DV0B 4BUJA 2PGLA 2HLPA 4RGVA 1TKBA 3VAYA 1X6VA 1QIHA 4O02B 2K7FA 2BKXA 2XNSA 1H2BA 1NJSA 1QKJA 3AUJB 1UXJA 4GPAA 2E21A 3OLVA 3CC8A 2R7NA 3ZU2A 5DSTA 4NCHA 4XM0A 2O8EB 2CXTA 1E3JA 2ZEJA 1Z38A 4HX5A 4U0KA 5FRDA 4AP9A 3TKLA 4KXQA 3V80A 2EKDA 2AJCA 5COQA 3ABQB 3NIGB 1MZPA 2O8BA 1NN0A 3BULA 3C3XA 2RHOA 3H5WA 4GSYA 4D8VA 3PU6A 3BN3A 4HRYA 1YDEA 5D7NA 4TROA 4D4GA 5TARA 5F3WB 3HWX1 3FPLA 5EERA 1NXTA 5JZOA 4BWGA 1BVHA 5K0BA 4MEBA 1IJEA 2ZB4A 2ZRGA 1GJRA 3LY5A 5K8CA 4BO8A 2P2CA 3CA8A 2XA9A 4WEQA 4NU6A 1GPWB 2DFDA 4UTOA 3ZH2A 1YAJA 4BN5A 2IA5A 5M7EA 4MRAA 2F55A 1SY7A 1N8NA 4TV9A 3KB1A 4EFMA 3GEDA 1ECCA 4BV2A 4CDRA 1PV2A 3ZOKA 3UATA 4IGIA 4C2UA 1AG9A 3CVUA 1UKEA 4AMGA 1Y82A 4FYXA 3JPYA 1NQUA 3I45A 2BM1A 4BFYA 3BCUA 4TL8A 5DK6A 1D07A 3F3KA 2BDEA 2C98A 4I3FA 5CM2Z 1TO6A 4KPGA 4BOYA 2VHVA 1QWOA 4AUKA 4BE4A 3OFNA 2AI3A 5JZ9A 4CU5A 3W6ZA 3L7BA 4UHBA 4ZQIA 4BN4A 4MHSA 2DG2A 3K9QO 2X1VA 4ESHA 4R9NA 3ROKA 3B3GA 1OX5A 1I33A 2EJCA 2WJZB 3CIFA 4QFDA 1NG9A 1ZP6A 4B7CA 4EG5A 5K6TA 2W11A 3REQA 4J2HA 4WI1A 1DRVA 4GP9A 1W0JD 3EVTA 2HZBA 3TAUA 3Q3GE 4JB0A 3KIPA 3OX1A 3PGA1 2Z6AA 3AFOA 3CPEA 4IS2A 3GJ6A 4Z2AA 4QNMA 1JR2A 3DVSX 3K0FA 3F71A 3DFZA 3A4VA 3DUWA 3M6WA 2RGRA 2F3PA 3UOGA 1CV2A 2XB6A 3ZWOA 4BMNA 2V4ZA 3E1KA 3H2SA 1W8DA 4ARVA 2J7PA 4DLWA 4ZI7A 2X58A 4U8HA 2IOYA 1UBJS 1BJRE 2QG4A 4TKVA 5JUWA 2HJSA 3B36A 4GI3A 1L1RA 3RV3A 1PEDA 2Q7DA 3ZS9A 5A6SA 2FW9A 2PL9A 2QTRA 3G0BA 3IMCA 3I9OA 3MTBA 4EYSA 2JJ2D 4EG1A 3CSUA 1K6XA 1YS7A 2Q3FA 2CFTA 3CUKA 3PC8A 4IVPA 4MUXA 3RIEA 3WGIA 1KHHA 4R7ZA 1FJHA 4KMOA 5F9HA 3BD6A 4FVTA 5JXGA 1NNEA 3KTAB 1PJQA 4JJFA 4L8FA 5BWBA 4OREX 5CT6A 3KT8A 2F1HA 2O3UA 4OVKA 4I14A 5DNCA 1KEKA 3K0SA 4R8LA 3A6DA 3QITA 4NC9A 4XFDA 2QTZA 4ZARA 3BD9A 4JYAB 3DO6A 1T4BA 2F59A 2CL7X 1B0ZA 2I1VB 4D8YA 3X1DA 1G291 1Z0IA 4O6VA 4EABA 1GPUA 2FN4A 3FTFA 1K0FA 2EHJA 1XRLA 2IYQA 1GP2A 1X8XA 1QHIA 2CCJA 3NU1A 1M0SA 2WBLC 3RARA 1OX4B 3ZX5A 4LHVA 4F5ZA 3RUHA 5AKXA 3KQSA 4MSUA 4S24A 1PT7A 3EB9A 5E6SB 2CHVA 3OOHA 3PEEA 4E5UA 5JJLA 1RWPA 1E0SA 3QIAA 3MRXA 5F2EA 4AL4A 3FB1A 3FBWA 1ZS9A 3PWTA 4X20A 1SZJG 4BEWA 4PONA 2QX8A 1EP3B 4HRAA 3ZUGA 4P80A 3BHJA 4DLVA 4B3XA 1NMYA 2W6JA 4BX8A 2IH2A 2O48X 3RE1A 3VOBA 1J21A 1DPGA 4ND5A 2DHRA 3Q88A 1TF5A 2O8BB 2IV3A 5IFKA 2I4RA 3V1MA 1DT3A 4NPHA 4BVJA 3BGOS 1IPHA 3ORHA 3W7VA 2P6RA 4Y7CA 4HUJA 2GBFA 2ONJA 4AULA 3G2KA 1GDTA 2JFGA 4KSBA 3V4FA 3TOXA 1AS3A 1NLFA 1KEVA 3ABZA 2M2IA 3CXUA 3D8SA 3PNBA 3H5VA 3KL2A 5ALHA 3QPAA 2O2YA 2G80A 5KKCA 3TECE 4TYPA 2HHJA 4XA8A 2QTNA 4TV9B 1O0SA 5BSMA 1JKFA 3SPXA 2LR0A 5FPYA 4D0LB 3LWDA 4KXXA 1CUIA 2P11A 2ZE6A 1YZTA 4JJAA 4DXAA 1C3XA 2JBHA 2FN8A 3UBTA 2YRWA 4IHKA 3LBFA 3UJAA 2BGJA 4AZ3A 1F60A 3I30X 4HMOA 5KPJA 1DOAA 4JI1B 2YZ2A 3FUUA 1MO5A 3K9CA 1U9JA 4URZR 4NLLA 5AK4A 4P6VF 3QXGA 3TM4A 3NT2A 4PHHA 4YIHA 1TPYA 3MK31 4LBWA 4QNNA 4QRDA 2JNWA 3S7TA 2RDMA 4N5LA 2GERA 4DQUA 4RABA 3HO1A 4R9RA 3REOA 2W83A 2XI4A 4QXMA 5EP4A 5KQPA 4V0ME 3ZI7A 3RC9A 3TVYA 4DQVA 1GTSA 3M9WA 4LDJA 2PT6A 1EA7A 3HSSA 3Q6MA 3PXEA 4FHCA 1GCUA 2RI6A 3RADC 3QUSA 5CB4B 3K0FB 1NPYA 3UVEA 5EMHA 4NY1A 3ZNQA 3JW8A 3BRCA 1KP9A 1NE7A 2BM0A 4ZI7B 4BKPA 5FUMA 4ZYZA 4TKVB 1XX6A 3MJCA 1P4GA 5EIXA 1O8BA 1QYWA 2RAFA 2QMUA 1OGIA 2FN3A 4HQOA 4G5OA 5A6SB 1ISIA 2UU9B 2FZLA 4YJHA 3W3ZB 2GZMA 5MFPA 3VKFA 1JLRA 3QPWA 4GOKA 1L5WA 2O20A 1JSCA 2N75A 4DDMA 1KDPA 2H8GA 3ER6A 4LJAA 5DGCA 3KV3O 3L6EA 1UJMA 2O5VA 3K09C 5IYZF 4FM9A 5A02A 4KLRA 1TKCA 2ISCA 2GXSA 2XUOA 3CJQA 4KMSA 4M0DA 4NBTA 3HU2A 4MINA 4N7MA 2GM3A 4GC5A 3BUSA 2IUUA 1RXWA 2HPVA 5ALMA 3NNDA 4RY0A 3L8HA 1FQOA 3ZWXA 3U81A 1N36B 2BZGA 2RGYA 2H4XA 1NUQA 4NU8X 1OI4A 4KGZA 4P86A 1TDJA 2VPQA 1LPPA 4UULA 5DX0A 5I47A 1ZM9A 3SIXA 1JP7A 2L2QA 1MQ9A 3PZRA 1VGVA 1QMGA 3AV0B 4MAMA 5I48A 2ECPA 4Q3CA 3TGPA 3BE4A 4YMLA 3PHJA 3RQSA 4CMKA 2MTBA 3C8DA 4ZN6A 2ACKA 2VDKB 3K94A 2F9MA 1VLLA 1V1MA 3EIQA 4M0UA 1YO6A 4EARA 3VZRA 1N1EA 1BHJA 3FNFA 3LX4A 4UEQA 5DKFA 4Q1AA 1JFVA 2CMKA 5HJ2A 1L5KA 3LLCA 4X20B 1WNFA 3RSFA 5SZKB 3RTDA 1GZDA 3IUMA 1N0UA 4N12A 3SNHA 4D9MA 2ECOA 5ADVA 3ZLVA 4YJDA 3VNQA 3HB7A 4CEIA 3IE1A 1G8KA 3KJQA 3LYHA 4D9JA 3NZEA 1BE8A 4PN7A 4QBFA 3RC2A 2DECA 3GGPA 1N77A 2R60A 1KKMA 3KEGA 3KJXA 1NI5A 4PZYA 4BQRA 2Y4OA 3B2NA 2BTOA 4F71A 5I9LA 1Q7EA 1G9SA 1QR6A 1FUUA 2GEUA 2QMHA 3FYSA 1D4AA 2DOKA 4DZZA 5E1MA 5KNDA 2XT6A 3GLIE 2QNRA 4KI7A 2WPNA 2ADMA 4RD2A 2L17A 2G06A 3VVLA 3EF3A 3VHLB 1GQYA 1DV1A 2C4UA 3CURA 1QYDA 1DC5A 5I4KA 1ZGCA 4HYTA 5LQUA 2PJZA 1KL7A 1I6MA 2D1QA 3W4IA 1OFTA 2WF8A 3CEPB 4ZCTA 5FPKA 2XOKA 2GMWA 4G8CA 4D4LA 3VDQA 5LR6A 6ADHA 4PSDA 4TGLA 2P0YA 4Z4IA 4AZ3B 1DELA 4DV1B 2ZIXB 3BWVA 5K9ZA 3O1LA 4DTCA 1ZRHA 4F3RA 5H1YA 4QZVA 2FUNB 4Z4GA 1M3SA 5FUBA 1WXXA 3BRWD 4HFMA 1ZJ5A 3M3DA 5AJZA 2O8DA 1JHXA 3EHEA 1JHZA 1YIDA 2X2FA 2AOUA 4ZQEA 4ALLA 2WMYA 4YAEA 5HE8A 1EUDA 3CE6A 3EQZA 4L57A 3WIBA 5EIBD 3EQ9A 4RA9A 3KSMA 3NTOA 1IONA 2PGOA 3G8YA 1KZ9A 1J00A 4RADA 4MDYA 4RLFA 2AC2A 5B7NA 5BXYA 5A05A 4F85A 1QBKC 4FPXA 2A59A 2HHAA 3W2IA 1RPZA 3JQFA 1OV6A 1YZ3A 2ZLBA 3EUFA 4MGYR 4C4RA 5IAAA 4B0PA 2UYGA 1E3IA 3EVFA 2GHQA 4J6EA 4ZVRA 3WQQA 1NW4A 4DR4B 3JPWA 1S2MA 3AIMA 5CGQB 1E1NA 4CFYA 1FY2A 1XDUA 3IAM1 1AK1A 3TFQA 4ESVA 2V96A 2WAYA 2XTMA 5HKAA 1XRPA 4MUFA 2MJLA 3HRHA 2Z2JA 1RYZA 2XF8A 3H5OA 4GF5A 2Z83A 1IEWA 1BH6A 4YJHB 3X1YA 5HNKA 3REGA 1QK3A 2OM6A 4GUAA 1K88A 1HTTA 1E8DA 2OFFA 1W0CA 3WRWA 1AKWA 3LFHA 5FOUA 4DSAA 2FUG1 2JGLA 1SFRA 1ITZA 1SD2A 2I7DA 3LBIA 3AIIA 3ZQKA 4MXDA 3S2ZA 1A9TA 4KPEC 5IDXA 1SKBA 2O7QA 3OEHD 4AZSA 2QSJA 4Z4CA 1QGAA 2B78A 3NT4A 4BMXA 2QYTA 4JNKA 1CFJA 4L2IA 4YREA 3QLVA 4UM8B 1GO2A 2ZBQA 2WTNA 3PRYA 4INZA 4EY7A 2GPJA 1RQXA 1QUEA 5ALXA 3I2GA 1W52X 2X4DA 4K28A 5BSFA 4I50F 2HRQA 5K2OA 3HK2A 2WICA 3VJRA 1WUKS 4ZVNA 4L85A 3CZCA 3VU9A 5L8VA 4RTRA 2XUKA 3OCVA 1U99A 1IJBA 2WNSA 3MC1A 3IIEA 4LCEA 3MGKA 4N82A 4RKWA 2A6PA 4YRRA 4YASA 2WU1A 2ZDQA 1YE8A 4DCPA 1UADA 1V1MB 1P2SA 1JFLA 3AGPA 1Y3FE 1G5TA 1Y42X 1I4DD 1Y5LA 3KZCA 3DTNA 4OYHA 3WSVA 4CVNA 3DGFC 2QJRA 2D5BA 1KO1A 3OM9A 1VL1A 4B84A 1SBYA 4KWEA 3ICVA 3OEED 4EW1A 2R6R1 1K1EA 3QYJA 2Q2WA 1L7MA 1ULZA 2O4UX 1DX4A 1XAIA 2WJIA 1D7AA 2NYAA 3PXBA 3Q3VA 4ZV9A 3UGQA 1H1TA 3W1VA 4GM4A 3ZQ6A 5B4TA 4DBZA 4P84A 4M1ZA 4OH1A 2PVSA 1B23P 2YXPX 3C6YA 3HCDA 4TMVA 1U8YA 5BMVA 4DSOA 1W76A 1ADGA 1LCIA 2IS6A 1WY5A 5KAPA 2EF1A 2VAVA 5AK0A 1UPFA 4WK4B 5AOBA 3RI3A 5AIBA 5K6RA 1WBDA 2IBTA 1Z6GA 1A8HA 4JY7A 3SHOA 5IS2A 1MU0A 1VHTA 3FAKA 4IDOA 4R0VA 2G08A 2C9ZA 4TMTA 1U7PA 3NC0C 5ANRB 1NVFA 2R84A 1XFDA 1SOVA 5T8KC 3TDKA 2FUCA 2BJHA 4EA6A 5A3JA 2BELA 1BJTA 2QLLA 1GR1A 2QENA 2Z2ZA 3TB4A 3ZJ5A 1EE1A 2FRVA 1M83A 1V71A 2KSQA 2ZITA 3PXCX 1Q1QA 4FDAA 4ASUA 1H5QA 4M3NA 2JGFA 3RVSA 1MOSA 2GAIA 2A0XA 3QM1A 2GO1A 3GJXC 3G9XA 1L7DA 3PQCA 4H60A 4X24A 1U7OA 1Y37A 2R1ZA 4XIYA 3FNQA 2H07A 2D7JA 1MQAA 4DIKA 2O8DB 1H4TA 3H42B 3HHEA 1KR2A 1C7JA 1CR4A 1RZUA 1SBIA 2C4NA 2PSJA 2AOUB 2R8YA 3LG2A 3R3HA 4G5YA 4LQDA 2Y9PB 1EUDB 2WHYA 1LY1A 4LJLA 5C8DA 1E9BA 5D01A 1HX7A 3WLHA 4U5QA 3EDOA 4WOPA 4RA9B 2ZRAA 1SZDA 1GHTA 4EBBA 4YJ3F 1JT2A 4YB8A 1M6HA 4GPD1 1D4OA 3W7BA 4UJ5A 2PR2A 2ZAIA 3QEOA 5BN5B 3BXEA 1FFWA 1WCXA 2HU5A 3CF6R 1TC2A 3EPRA 3Q2KA 4J16C 3RK4A 3U9SA 3UK7A 3ZZ0A 3PFNA 4LDPA 4OKNA 3SHQA 4U63A 2D5LA 1YBAA 2FNAA 4EEKA 2RJ3A 4HAOA 1U2PA 3AUKA 4OXKA 2PZJA 2QV0A 4CPDA 5BV1A 4Z4EA 4MI6A 4W5NA 2XCIA 4GRDA 4YDHB 2ZSHA 3RK1A 4L07A 3RVLA 4GO1A 5I01A 3NUZA 3DB1A 4B47A 3C3KA 3B7GA 1LRKA 2Y1WA 4Y9TA 1T6YA 1N5OX 2ZYVX 5LD2B 2O0JA 1JS1X 1GNSA 4Q7EA 3FGNA 4P7GA 3P8ZA 3FHCB 1E2IA 2JJQA 1QIKA 1NFFA 1WDKA 2DCMA 3A25A 3LT1A 3PUKA 3AHCA 1Z4MA 2VWGA 1MIOA 3MOSA 2VT6A 5EWJB 2YRFA 4DC1A 3DOFA 1PHPA 3D1VA 1KEEA 4CKZA 3AF3A 5BSUA 3IHWA 1R5NA 4RK6A 4L2IB 2R48A 2WABA 2YHUA 2H06A 3C24A 1Y7IA 1QGUA 3BS4A 4MMZB 4W9RA 5EXPA 3O83A 3FVTA 4CF7A 3NRBA 3A1DA 4B1FA 4DDTA 4AJIA 4NAHA 1LB1B 1P80A 1U3UA 1YC5A 2GK7A 1XU9A 2PLNA 3MRSA 2GAJA 4QU0A 1IFXA 1Z4KA 2VNIA 5DDIP 5IDYA 4F46A 4F9FA 5KOHA 5LA6F 2WM9B 4RVFA 5TB5A 1WO8A 2Q4DA 4IIXA 1EHCA 2EJVA 3ZWMA 4C78A 1C4XA 2D74A 4JYZA 1DBVO 1V7QA 3I01M 1R6AA 5FTMA 4LHZA 4YPVA 1MXHA 1A8PA 3P9SA 4CMGA 5GTDA 3U4DA 2NT4A 1PJ4A 3TR5A 4KLZA 4PZDA 3MN1A 3RJTA 4K9NA 2FWIA 3IQWA 2Z3WA 3A11A 1K89A 2H5JA 3AHDA 4I1VA 4A3SA 2UUBB 5A4KA 3LBNA 1B93A 1KE2A 3VDRA 2LXNA 1N2CA 2NSHA 3KHSA 3HCFA 4MVJH 4QEZA 5KKAA 4UCWA 4D42A 4TMXA 1A5SB 4ALKA 4RD3A 1M0WA 1HLFA 2VHTA 3TXXA 5EJEA 3ZN2A 1UP7A 2FMKA 2WVJA 4YHBA 2PS1A 3G9QA 4PX3A 4RBNA 3HJCA 9LDTA 2FE1A 3B9RA 1I10A 5BMVB 1ZONA 1AU9A 1MIHA 3L4JA 2QE7D 1RE0A 2Y0BA 3R7SA 2ZE8A 4EUNA 3PJFA 1PJ3A 3DCYA 2B0CA 2GVNA 4M36A 4J0FA 5JPCA 1HI9A 4HUTA 4QSHA 1SC1A 1DKUA 1N8KA 1W25A 1HDOA 2HLNA 2JC3A 1YZYA 3C7KA 3CTMA 3DYVA 3L3BA 4GG1A 4XE5A 4ZU3A 5BR7A 2ETXA 3PVCA 2CLSA 4UASA 2YWGA 1Y4UA 3KPJA 2C2OA 4HY3A 2ZBPA 1BDJA 1D8TA 1P77A 2XZPA 4HUQB 2HDWA 3ZDEA 4BPBA 3WLJA 1AHIA 1PYGA 5IK2A 3L49A 3V1KA 4IXMA 3E5HA 3AHIA 2V7WA 3N0TA 4IQ8A 1RAAA 1F8XA 2OYCA 1M72A 4MWBA 2FVYA 1ICIA 1CK4A 1U2GC 1RRCA 2Q45A 3STWA 1N0HA 4LMRA 3FOZA 1XNQB 1ZFNA 5B1DA 1R74A 1DAKA 1VCIA 1YRAA 2AOTA 4B3FX 4W5QA 3T7RA 5IFLA 4JWTA 2QXTA 5KTYA 5E6UA 2X7JA 1CDDA 3IVCA 2KI5A 4R8MA 3I2IA 1T0PA 4EENA 4P0QB 5BSEA 3BSYA 3NBKA 4IV8A 2CF5A 4TRMA 4PVDA 1B26A 3OWHA 3WKDA 3A7DA 5JYBA 4X1IA 3VC7A 2VYQA 5LQAA 3Q9NA 5LYYA 1BEEA 4W8HA 1ML4A 1DCFA 3ORYA 4S35A 3DLTA 5E1BA 3RRXA 1I3NA 1KZ6A 2QX7A 1XZEA 4EW2A 3D4IA 1ZBQA 4FLEA 4WBSA 3PVSA 1IN1A 1VI6A 1EWYA 1QU3A 1JKMA 1PVVA 4QTUB 4TS4A 3W8FA 3ZDYB 2XDQA 1KU0A 2R6ZA 3AW9A 3F4KA 4E2FA 5DHAA 5B7GA 3GROA 3VR4D 4HD8A 4RJTA 5K99A 3CISA 3RUDA 3GRRA 4Y6QA 2NU6A 1UKVY 2AQIA 2K4MA 2QT0A 3EVGA 2H1VA 1MIOB 1X8JA 2RGEA 3F49S 5CA0A 5JZSA 3V32A 5HP4A 1KEEB 1I14A 5J2TA 3BMCA 1DQPA 2PZGA 2ZIUB 1E9CA 1UCFA 2AG1A 2G5CA 3G02A 1E7RA 3GT7A 4KO1S 2B9VA 4M8SA 2WD8A 2QTHA 1QGUB 4CMEC 1A9ZA 4CKEA 1QZZA 5E0OA 1TTHA 1NSYA 2B5WA 2QRJA 4K9LA 3R76A 3S8MA 3VOAA 4FBLA 5HW0A 1CUBA 3I39X 2C4KA 4C87A 4D0RA 5KOHB 2KM1A 1PEYA 4TTTS 1MGPA 4ZTUB 4A8PA 1RHRA 3H16A 4FKBA 4RLQA 5EIHA 3GGOA 4OLFA 2EGGA 3WKBA 4LJSA 3TRDA 1B1CA 4P32A 3AVQA 3S5UA 5I7SA 1LWNA 3KQLA 1IULA 3G2OA 5DTRA 3ZZNA 4UOEA 4WGFA 1WMBA 5A2QA 3PCTA 2AJBA 1RPJA 3EIFA 5ICFA 4CFSA 2WY2D 1OTHA 1G9TA 4EKIA 2W2TA 3M70A 1AM4D 1YB2A 2E18A 3L40A 4FNGA 1E99A 3AR3A 5KTRA 1TAGA 3M33A 1E62A 4XX0A 1D3AA 3DVQX 4LA4A 2GM5A 4IDCA 3WYAA 3F78A 1GQFA 3ZUPA 1Z39A 2B7BA 4JLUA 5KU1A 2DC1A 4KQGA 4MB0A 3KPVA 1YZQA 3V33A 4LJ5A 4P54A 3L7OA 4Z1OA 4UBOA 1LEHA 3HZHA 4IUCS 4N9WA 4DLSA 3ST7A 1YB1A 2HSJA 1WWKA 2IUSA 1RAIA 3R4VA 4XVRA 1QH0A 2K7ZA 4WEOA 2ZOSA 3PDHA 3WMFA 5IT4A 1FU4A 1ZGHA 4WX2B 1FDOA 3UKOA 4CKXA 1DFHA 3IEIA 1TZ2A 2Y71A 4ND2A 3TCNA 2JKYA 5HUHA 4J07A 3EZGA 5CB0A 4BKQA 1FUYB 1NP7A 1ONNA 5IP5A 4EG8A 2Q62A 3WRXA 2H29A 4HNSA 3NHPA 4LZOA 3RGGA 2J3LA 5DBFA 1O0CA 4GYWA 1UBCA 3DDWA 1DC3A 1WW2A 3KFLA 3M9LA 2V7TA 1KFBB 1J49A 1XHLA 3Q12A 4HBZA 4IIFA 3INRA 4ACAA 4C4SA 4BP8A 1A9PA 4PG5A 4MJ7A 2CLIB 2ZRMA 3H1FA 4K6FA 3VR4H 4JNCA 3ELUA 4FN4A 5E95A 4F1WA 1J5XA 2HO5A 4US2R 3LPMA 2AOTB 3BIOA 5I8WA 5LNK6 5CX1A 1EX1A 1EFTA 1KF0A 1RFGE 5E6UB 2QHXA 1NZJA 1AE1A 1QH1A 3O8DA 4FFMA 3BD8A 4HATA 2IOFA 1MGOA 4RIEA 3KQQA 1PUXA 1VE6A 2WP0A 2V6GA 4YMTA 1I32A 3KKKA 4JBWA 3DS8A 3BJRA 721PA 4GVPA 1TYCA 4BEVA 2H2AA 3P32A 3MTGA 1G63A 1V8OA 3LYLA 3UICA 1K08A 2NG1A 5FPHA 4HZUA 1ULHA 2BZSA 2LBPA 4TTPA 1VL0A 1XYYA 2C3MA 4QPNA 2WYHA 4V0KA 3VKUA 3AKZA 1XZQA 3Q6IA 2GO7A 1CULC 4HDCA 1WXFA 1Z5NA 2EOAA 3GD5A 3WQBA 1C7RA 1WF6A 1AT1A 4P34A 4CEHA 3C16C 1OC2A 1Y1TA 2VVTA 2AFHA 4IMPA 4RPGA 2AOWA 2JIQA 4UNPA 4N3GA 2PZ8A 5F3RA 5DFAA 3LGAA 3FVRA 3FDIA 5CA0B 4QUEA 2P40A 5J2TB 2AI1A 3BMCB 1TEXA 4YRDA 3BSSA 2CLOB 4CI0B 4HWGA 2XX3A 3V3TA 1PIWA 2IE0A 1EFLA 5F76A 1L5RA 2IW1A 4OSEA 4I4TF 4KOEC 5B2EA 3O4FA 4GR4A 5JSKA 4NMXB 2FSIA 3PTAA 3SKVA 1HK7A 5KWJA 1RBYA 2Q5LA 4JHXA 4UVGA 3ROXA 4C0AC 4B5KA 1U0RA 4BN0A 2VAWA 1WSWA 2XYPA 5C0OE 1QV6A 1ZIXA 2J07A 3GEGA 3E03A 4Q3DA 1KO7A 4ZAVA 4Z2YA 4AT1A 1BWSA 2PBLA 3EK2A 1WB9A 1UT5A 1KERA 4JI8B 1C9MA 1JIXA 4ZO9A 3DHEA 1U2QA 4N8SA 5ED4A 1EDEA 3R75A 1UJNA 5J2UA 3U56A 2FWMX 5BV0A 3RS4A 4D0SA 1M6YA 3IBYA 3ENNA 3I1IA 3KOOA 3H9JA 4EJFA 2WF5A 4LQLA 1RQRA 3G2QA 1NMZA 3KDAA 1VJDA 3ENVA 5EVCA 3HKCA 2HSEA 1HKUA 3TQFA 3KQYA 4MZDA 4PN3A 2DR2A 1XMXA 3MT7A 1TD1A 5DCYA 3VU1A 2IUYA 5BSKA 5E7JA 3H97A 4R7TA 2VRWA 3EMKA 3QYPA 1ODKA 4LJ4A 3CH5A 4XQEA 4ZU6X 3VTFA 2XMBA 3ZLBA 3E7XA 2XLCA 3KEQA 4LFAB 1E2JA 1XN1A 2GCEA 3E5NA 4C0HA 1VPEA 4PICA 4H0CA 5G41A 3T1YB 2R0QC 3PUWA 2VHQA 3GGCA 2RB4A 2F2TA 2G1AA 2P9TA 5DHFA 3X1WA 4EB6B 2MYPA 3GGGA 3E9YA 1THTA 1Q91A 1GDDA 4QATA 2YWEA 5A5FA 2PE5A 4ILKA 3GQBA 3M4JA 4XDZA 3P45A 2BHRA 2Q5OA 1VG9B 5DN6D 2HA2A 3HV2A 2ORWA 3IO5A 2WMOB 1H4QA 1LLFA 2GPSA 5YASA 2NLOA 4P53A 3WRYA 1MHTA 1J8MF 3SSAA 4OMCA 3PNQA 2NNLD 4AKEA 2P4SA 3O8QB 4JASB 1CCWA 1SOMA 3VA7A 4GR9A 4K6CA 5MDHA 1O54A 5JD6A 4EI8A 2C4HA 3J7TA 2FV8A 3WL3A 4M9UA 3UGJA 5CX1B 3F9IA 5ALWA 3BRWA 3JY6A 3QVSA 2HK9A 5AHXA 1QH1B 1X7YA 1Y4ZA 2AZDA 3AB7A 4B6FA 3GU3A 4BB6A 3P27A 3D3WA 3IB3A 2NX2A 3HCEA 4DADA 4GPEA 2EW2A 5EKTA 4ETIA 1NW5A 4FNOA 4TVSA 3IMGA 3SEQA 1SCBA 3ICEA 1I5OA 2WIBA 4OX9B 4LDQA 1XTTA 1ECFA 2QD5A 4HZUB 1TTPB 2QVLA 4JJ4A 2NU7B 3M6XA 3KCNA 3O3CA 4LRXA 4RD1A 5FXMA 5G0UA 3ENKA 1PO7A 1OLOA 3AI2A 2Y1DA 1MB3A 2Z6VA 4EFKA 2WHEA 1JJAA 4RHTA 5IZCC 2IYRA 4EF4A 1F6DA 3U2QA 1W49A 2EZ4A 3I28A 4H3SA 5CYFA 4NV3A 2FMIA 1RYNA 3MILA 3LWBA 4M9CA 4OSOA 4PLPA 3B89A 1QPGA 3OTOB 5F7JA 4C4ZA 2CBGA 4ZMBA 5LU8A 3KNZA 4J0DA 3IV6A 1USUA 4PSVA 1KBZA 1VCNA 5A0TA 2J4CA 1YULA 1OWMA 2CKMA 1AGNA 4EJ2A 2CUNA 3TI9A 1E0JA 4KAFA 2H0QA 2QL9A 2WILA 1AD2A 2G72A 5AK6A 3TZCA 4C22A 1D2HA 1ZL0A 4ZYXA 3OEHA 1C1YA 2FEPA 1NWHA 4JHLA 5JTUA 5CIYA 4XD7A 1F6WA 4OKIA 2FOIA 3HTXA 3P9RA 3Q7PA 5HG0A 3FW1A 1ORHA 4HAYA 3L5OA 4NV0A 4JI5B 2UYOA 4RKQA 2JH8A 2Q1TA 5GQSA 3KZVA 4QLOA 5CT5A 2FFQA 1KSJA 2D1YA 4FFNA 3H99A 5M04A 2BF7A 3N7AA 4ER0A 4TZ0A 4GU5A 1OH5A 1R5JA 2BOVA 3NASA 2VAXA 3C14C 2XV1A 2XVMA 3QWBA 2QRZA 1NASA 2GEBA 2VJMA 1WCIA 4WMLA 3TTYA 3H3XA 2H1SA 3DAYA 2O2CA 3I3SR 4MQMA 3UFBA 3OJ0A 1J4AA 1RVDA 1W93A 2JFHA 2O7SA 3HLYA 2YJGA 1YS2X 5ALUA 4MI3A 3PL1A 3GJ3A 4QGGA 1SUEA 1W2GA 1P1CA 2VJAA 3AG6A 2P79A 3HEBA 3T4EA 3HKCB 1XTVA 2P1DA 3OEEA 4Q1CA 2DTEA 4PZCA 4QXRA 2FMXA 4MVJG 2YX1A 2XYQA 3CLUC 2J0UA 3OQJA 4UAJA 5EMMA 4YHHB 5HFJA 2XOXA 3MUEA 5GP1A 4L8GA 3PHLA 3T94A 5F7ZA 3VJLA 2DXIA 3AVYA 1PSZA 4DY6A 5FTLA 4IGEA 1N9ZA 4KR0A 4YRSA 1ZH8A 1SAYA 3Q7EA 4DQ0A 2H63A 4X66B 4YPFA 1UZAA 2GWRA 1FFXA 4F4HA 3IQDB 2ZYGA 3L7DA 2G70A 4Z53A 3N5CA 4ARZB 4HDKB 2YWFA 2BONA 3HYRA 3GQBB 5AJYA 1DAEA 4CT4B 3TF5A 3DYBA 1XWIA 3OQOA 3RBVA 1MEOA 1RLOA 1DP4A 1CR6A 4NE9A 3ND5A 421PA 1OQAA 2Z2XA 4K9RA 2IP1A 4E0BA 1P5ZB 4CFZA 3E70C 2F9LA 3ZWNA 1UXGA 3ZDQA 1TU3A 3FUTA 3A1SA 2JHCA 4MPPA 1JFTA 3ZWBA 4MVJA 3WNQA 3ZJTA 1JB9A 4JEHA 2J3EA 3GEEA 1ZOIA 4FOTA 5EZSA 5G1OA 4E7OA 4CLRB 1TJPB 1MJ5A 1NVGA 1YA8A 3ISVA 4ZV7A 4CJXA 1DTSA 1X7YB 1FRZA 4CZ2A 2HWUA 3EG5A 2TS1A 3ESAA 4TYMA 4OBWA 3AEKA 1OLUA 3VR1A 5HA5A 4BJ5A 4ZP1A 4LFCB 1GNLA 1R6DA 2ODPA 4HLNA 1I7PA 3NV9A 4EKYA 5LPNA 5JSUA 5DVZA 4O0MA 3VR3D 5BWNA 3BL6A 4IL5A 1L7XA 3EZLA 2YWJA 3VH2A 3W0LB 5HWSA 1W19A 1Z62A 3DZDA 1I7SB 2DHDA 1PK8A 4BEJA 4ER3A 4D46A 3L8YA 1RT9A 2RIPA 5FBLB 1HZZC 4BFXA 3CONA 4L27A 3QFFA 4IRMA 4P1ZA 3T12A 4LBYA 3MTQA 1WMEA 5BRNA 2VDLB 5TT1A 3ET5A 4V24A 4W5WA 1QHHA 3W5DA 1A69A 5CT4A 4ZHQF 4ARBA 1YDMA 4RPCA 2AEMA 2Q1XA 2ORIA 2VSQA 2G9VA 2DEUA 3KSUA 4GL2A 4TMYA 5JPDA 1EZZA 1PFYA 3HYSA 2D2VA 1UZLA 4P4UA 2XAUA 3GJ0A 2IS1A 1A1SA 1BX1A 3HDJA 1YQDA 1OI2A 4B3DA 1P1BA 1T36A 2PO5A 3BFKA 1UQRA 4HAVA 1DNPA 3T7CA 2F1IA 3LCRA 4MCIA 3ZH9B 3D7MA 3ELYA 4DR1B 2WYWA 2B34A 4BYGA 3OHMA 3ECSA 4PYNA 3O94A 3VNUA 4C7JA 1FW8A 1TMYA 2FCAA 4M38A 2PLAA 4RJIA 3CF0A 3KKMA 2JGDA 2B1GA 3CE9A 3UHOA 2F90A 2NZXA 4LMAA 1ZIOA 4HEQA 1PJAA 3HJUA 3EIXA 3L84A 1E20A 3N5KA 5AW3A 1BNCA 3NTVA 2OG2A 1V5WA 1E98A 1JR3E 3MQ2A 4XPIA 1Z0AA 1N2IA 4P4GA 4PG7A 1XA3A 4TMZA 3IV7A 1FTWA 3EODA 3GVXA 4DJFC 3R23A 4RKRA 5JNSA 1AB6A 5TR9A 2ZRIA 1Y3DE 3AUYA 4CLHA 1KWGA 3ZWAA 1XA4A 1GQ2A 1HL3A 1H05A 4PLYA 4Q9JA 1N7HA 2PRIA 2B99A 3ZBTA 1E2DA 2VYFA 4P4LA 4JROA 5EN4A 4A0FA 1DKPA 2HWKA 4QJ3A 1C9KA 1C30A 3G82C 3HA7A 1PWZA 2A8YA 2I2WA 2J32A 3CO0S 3PQ2A 3QENA 4H77A 4LSWA 1HYGA 4PO1A 3ENQA 3W34A 4CKYA 2F8TA 2J0UB 4ODIA 4TWRA 3MBIA 3QMWA 1QHYA 3LP8A 5K0NA 4TLCA 2BEWA 3OU7A 1AGRA 4FSHA 2AQ8A 4KBYA 4ND8A 3H2HA 4GM1A 3RVRA 1R8SA 2JLXA 1OJLA 4YEDA 3TFWA 2QE7A 1MJFA 1KDYA 1E92A 4KODA 1VP9A 1ZR2A 1FFXB 1NVWQ 3C2QA 2O2GA 2JFBA 4WXPA 4WDRA 2M9MA 2NO1A 4INPA 4JLBA 4BXOA 2KHZA 4PWYA 2AA3A 1C2TA 4BCBA 3CEHA 3DAFA 2O2DA 4P2GA 2LRHA 1HDIA 1KYZA 3QJYA 1W7AA 4KX5A 2FEWB 3HYCA 2QRVA 1PGPA 2NN3C 2IUTA 3WHIA 4WZAE 3T3OA 3GUVA 5A4AA 2VHWA 4CMAA 1UOPA 2XEDA 4RGYA 1JVNA 4KUEA 4YCBA 2WHPA 3I1FA 4ZVMA 3DOOA 2B2XA 1NJ6A 4NBSA 3IULA 2FW7A 4OAPA 1CS4C 3W8EA 3ZHSA 1II9A 4ZGGA 1JU3A 5JQGA 2I76A 5G0TA 4AJPA 4IFIA 1AKNA 5DIFA 5HIMA 3TINA 4W6QA 1JQJC 1JIJA 1K6IA 3ZKWA 4CNQA 4K9PA 3K5WA 4ZOCA 4LECA 1NA5A 1Z33A 3EGCA 3AEKB 1OLUB 1OH7A 1YUNA 2GD6A 1FP1D 3N9IA 1GGMA 2G1JA 1ZOOA 4REQB 4Y2YA 2GN6A 4LJ8A 5JAIA 1EA5A 1UODA 3OURA 3HYNA 2IY7A 3QVGA 4QO8A 4UCFA 1ZLYA 1XJ5A 3D6VA 5JHGB 3JAWA 1RQLA 3BXXA 3R7WA 2NO9A 4CRWB 3PJRA 4ID9A 5C5CA 4WL0A 3WP0A 1T5IA 3UWSA 3K5HA 4Q4HB 4RLSA 3J81A 1Z07A 3P9IA 3ADCA 3DZFA 3ZZ1A 1T15A 1QJCA 3KUKA 2ZWOA 3BE5A 4QOEA 5AI8A 4R2IA 3SQMA 2E85A 2JKVA 5B57C 3WLMA 1J0DA 1U3GA 5IKMA 1J9GA 2FG5A 5AKKA 4MK4A 2UXCB 3RHFA 3VPGA 4K1LA 4I55A 1VGRA 3AT1A 1Y1PA 2OC9A 2Q2QA 3WO0A 5I4BA 3VR4A 4FMCF 3S7ZA 3WAGA 1OXUA 2GF9A 4MDHA 2BT4A 4B79A 2A9PA 1T36B 1WPQA 3KVNA 4LX8A 2WU0A 2I87A 4YFYA 4KQ9A 1QZUA 2OD9A 1GFWA 2C8JA 2A1TS 3OF2A 1QGOA 4HAIA 2I3ZA 4NNJA 2EC5A 2J87A 2YOFA 3FNRA 3RIHA 3W5JA 3OQMA 1JEAA 2VI5A 3V7FA 2YC4C 5H4HA 2ZTVA 2XUQA 3ZYCA 1RC8A 2JH3A 1BQ4A 4II2A 1CJBA 3TZEA 3UNXA 2PU7A 3M5DA 4I8IA 3RRZA 2A0WA 3E8MA 4S1PA 1IN5A 2VXBA 2LV8A 3V8RA 2PV0A 1W34A 2ANBA 4B17A 1U0HC 1YRLA 4YRJA 3W2TA 3DR3A 2RK4A 3HDYA 3KZ1E 3P5BA 3PUYA 3JWEA 2Y0CA 4XGIA 4FYMA 4XPIB 1XEXA 2HF8A 2QJFA 4PLTA 3RSSA 3WAKA 3T9AA 3D54D 1IWBB 3L8GA 3WO1A 3H84A 2I9KA 3VUEA 2W8BA 3ANNA 1A98A 2XJ4A 4KP7A 4L95C 3FTCA 2OBBA 3AM5A 3GARA 1I1OA 2FFAA 5CLIA 3ROTA 2J09A 3T3DA 4NAVA 1M67A 4NJEA 2P27A 4ACBA 4PCLA 2O07A 1FLDA 2II6A 4EJSA 4U7WA