5E9WA

Crystal structure of mrna cap guanine-n7 methyltransferase obtained by limited proteolysis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
310
structure length
273
Chain Sequence
SRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Molecular basis of RNA guanine-7 methyltransferase (RNMT) activation by RAM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 273
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5e9wA00
2LD4A 3BWYA 2PV0A 1TW2A 5CVDA 2ZIEA 4HGZA 1N7IA 4C06A 5HIJA 1MHTA 4RVHA 5EIFA 3M6WA 5GOZA 3FRIA 1FJXA 4C4AA 4Y2HA 4EVIA 3JWGA 1XDZA 2PWPA 5HZMA 3MGGA 3I9FA 5DTMA 5GWXA 4FGZA 3G2OA 4RTRA 1L3BA 2OB2A 1NW5A 2XYQA 3C0KA 3G2PA 4M36A 4R8RA 3KQWA 4E31A 1G55A 4FR0A 3M4XA 3EVCA 3B3GA 5E8RA 4OBXA 3CCFA 4AZWA 5CIYA 5E1MA 4LG1A 2OXTA 1KR5A 1NE2A 4M37A 4MQ4A 1I1NA 3OZSA 4F85A 1P1CA 5EMKA 3EVFA 5CM2Z 4BLVA 7MHTA 5EC8A 2O0LA 2PGXA 2ZIGA 3EVAA 3P9NA 2PT6A 2AOWA 8MHTA 3DR5A 1WXXA 3ME5A 3EPPA 1NBIA 5FULA 1R74A 3R24A 2ZIFA 3C3YA 3G2QA 3RODA 5T6BA 5DM4A 2O06A 4F84A 3TPZA 4QDJA 5E9JA 1XDUA 2GLUA 3KHKA 4PIMA 4FP9A 4U7TB 3VC2A 5K0JA 2JG3A 3GRUA 3TLJA 5KS2A 1JG3A 1R18A 5ERGB 3P71T 3TKAA 2WA2A 4UOEA 1NT2A 3KKZA 4RTSA 1NBHA 1ORHA 1VLMA 2AOUA 2V74B 5CVUA 3ER9A 2P7IA 2ZCJA 3LSTA 1QYRA 2I9KA 3UJBA 3IV6A 4ATNA 1D2CA 4RTLA 3DTNA 1SUSA 2YX1A 3FYDA 2KW5A 2AVDA 2FYTA 4QQNA 1INLA 1SKMA 5C1IA 4FSDA 1OR8A 5D1HA 4PCAA 2IH4A 4CKBA 2GAFA 3B7PA 5ICCA 1AF7A 1R8XA 2AN5A 2WA1A 3E8SA 3C6MA 3G7UA 1ZHFA 3Q7EA 4OQDA 5DXJA 5F2KA 4GC9A 1F38A 2EFJA 2AOUB 1QAMA 5T67A 3P2KA 5FA5A 4RVDA 1WZNA 2QY6A 2XVAA 2PWYA 3MCTA 1M0EA 3PX2A 4DCMA 3LKZA 4E32A 2HNKA 3V97A 4RSRA 3OZTA 4BLWA 5K0CA 4P7GA 2IH2A 2ZBPA 1KYWA 1N7JA 2OKCA 3UBTA 3KR2A 3T0IA 3U81A 4KVZA 3LL7A 3MCZA 2AZTA 2G71A 4C04A 5EGSA 4EQZA 3QOXA 1IY9A 3C6KA 2G70A 2NNWB 3OFKA 3EMDA 1Y8CA 4QVGA 5DX0A 5LQUA 1I4WA 1KPHA 1O9HA 5CCXA 2YXLA 3GRRA 2NYUA 4HTFB 4AZVA 5JUWA 1L9KA 1WG8A 2QRVB 4EMSA 5HOQA 4PYKA 5E1BA 5P8WA 3UFBA 3LKDA 3UJAA 3TMAA 1YZHA 2XYVA 3HVJA 5DX8A 2NP7A 3FUTA 3GDHA 4AZSA 4XUDA 5H02A 4R8SA 2PXCA 5HILA 5ICGA 3DMFA 3ELDA 4QQKA 5ICFA 3K6RA 3M6XA 2B2CA 4AUKA 1Q0TA 5LSAA 3KQVA 3BKXA 5D1NA 5FTWA 3BKWA 3DP7A 1JTEA 3FPFA 2CKDA 4X63A 4CXMA 4RX1A 1SUIA 2ONZA 2PX5A 3BGIA 1VIDA 3KPYA 2Y1XA 1HNNA 1L1EA 1R6AA 3B5IA 3GRZA 1WXWA 3UJ8A 2BH2A 5DLYA 2AVNA 2P8JA 2PX8A 3BXOA 1WY7A 5K0FA 3BWMA 2ZBRA 2I6GA 3LBFA 1P91A 4YV1A 4ISCA 3KPJA 1XCJA 3NDIA 3TR6A 2UYOA 4X1OA 4E2ZA 2OO3A 3CJRA 4MHTA 4POOA 5E1OA 3I58A 5DM2A 2ORED 4DQ0A 4EK9A 3TM5A 1D2GA 1WS6A 3HM2A 4EKGA 2UZ4A 3GXOA 3FPHA 1G6Q1 2JH8A 5EG5A 3ERCA 5K05A 3SMQA 2IPXA 3SGLA 3SSOA 2PSSA 3WSTA 2Z6UA 4XUEA 2V7EA 4P7JA 2Z6AA 3BUSA 3KQSA 3PTAA 5KYGA 2P3LA 3FPJA 5DM0A 1JTFA 4E2XA 1XJ5A 1KPGA 4PYNA 5B1SA 3EVBA 5EPEA 3UWPA 2NXJA 2P3QA 3HP7A 4C05A 2IP2A 3EVZA 3TKYA 2C7QA 3UJ9A 5IH3A 3G88A 5F2OA 4PYJA 3FUUA 4LWOA 2AR0A 3JWIA 2ZZMA 3HA3A 1JSZA 1R00A 3FRHA 4PYLA 1BC5A 4MTLA 4YUVA 4C07A 3ORHA 4DMGA 4M7RA 4RWZA 4KIGA 3SX0A 4QDKA 4HC4A 1RJDA 3VC1A 2JHAA 2HR1A 4DKJA 3GJYA 3DXYA 4CKEA 3IYLW 4C08A 3P2IA 5U4XA 4NECA 4AX8A 3DMHA 3M33A 3NW9A 3GRYA 3PFGA 4PYOA 3GO4A 1Q0SA 2WK1A 3LHDA 4E2YA 5BW5A 2P1DA 3O31A 2C7OA 4AZTA 5DRYA 1YUBA 1U2ZA 2IDKA 4QTUB 4XCXA 4E70A 2YXEA 3NTVA 4X61A 5DWQA 3EVGA 3NWBA 4PYMA 1V39A 2B78A 2PX4A 3HCBA 3OPNA 5FCDA 4DZRA 5HIKA 2HV9A 2JJQA 3DULA 5EEHA 5EMLA 1JR4A 3SVZA 3R3HA 2EJUA 2ZFUA 1FPQA 3LGAA 1PJZA 2VDVE 3O4FA 4ER6A 3AWIA 1KHHA 2FCAA 4PYIA 1G38A 2QYOA 4RV9A 2P40A 1ZKDA 2JH9A 3P9IA 4HGYA 1N2XA 3SM3A 1DL5A 4OX9Y 3DLCA 3ELUA 1MJFA 3NDJA 2ZWVA 5K0GA 3KQPA 5EZSA 1VP3A 5DPMA 5K8VA 4YV0A 5FHQA 2PBFA 3BZBA 1YFLA 2P35A 3AXSA 1RI3A 2PXXA 3THSA 2O07A 3A7EA 1ZQ9A 4LECA 4G56A 5FADA 3D2LA 3LDGA 4PGGA 2ZZNA 1ZG3A 1IXKA 2YVLA 3P9CA 1VP9A 1EQAA 2XYRA 5EKXA 2IGTA 5LQJA 2B3TA 3EGIA 2Z6QA 3LX6A 3KQYA 1VPTA 3P8ZA 4GOLD 2OYRA 3A7DA 2IFTA 2AN4A 2XVMA 3LECA 3EVDA 4OQEA 5FQNA 1KPIA 3HA5A 1H1DA 1ORIA 3ID6C 3KU1A 10MHA 3FYCA 3HVKA 2BM9A 3JWHA 3NVMB 1RI5A 5K01A 3MQ2A 5LQNA 4HTFA 2Q41A 3SXJA 4QPPA 2B9EA 5GM1A 2QRVA 3G5TA 3HCDA 3SSMA 2R3SA 3SSNA 3UJCA 3VSEA 1QANA 3H2BA 1L3IA 1L3CA 4GOMD 2PKWA 4QTTB 2OY0A 1G8AA 2VP3A 3GU3A 3HCCA 3KQQA 3BWBA 2BZGA 4HG2A 2ZSUA 2GPYA 4JXJA 5CVVA 5DSXA 1DCTA 3EVEA 4H0NA 1F3LA 4YUXA 1NV9A 3GCZA 5FUBA 2ZBQA 4PGHA 2DULA 2G8NA 1X1DA 2IIPA 5KQSA 2ZULA 5JR3A 4RTMA 2H1RA 3FUWA 3HCFA 2FPOA 3O7WA 5LQCA 5M5BA 1EAMA 2ZZKA 3R6TA 4ER0A 1KXZA 2OB1A 1AV6A 1QAOA 3LDUA 5EEGA 3EEOA 3BGDA 3CJTA 3KR9A 4HH4A 4P7KA 3IEIA 4IKPA 4P7FA 2EX4A 3KQOA 5K0BA 3FTFA 3HA7A 1O9GA 4A6EA 4RTNA 3FPEA 2ZVJA 2IBSA 3S68A 3TOSA 3MHTA 4OBWA 4RVGA 3A27A 3CGGA 3MB5A 2GB4A 3OE5A 4QPNA 2B25A 1VE3A 3A4TA 2GA9A 3NJRA 1O54A 2OZVA 4KRGA 5FA8A 2Y1WA 4YUZA 5E9WA 3T7SA 4CTJA 2I7CA 2O57A 2NXEA 5EZQA 4BP3A 1XXLA 1SG9A 3MTEA 1X1CA 5HFJA 3KPUA 1G60A 2HTEA 3ER8A 5CVJA 4KWCA 3MTIA 3P2EA 3BT7A 4E2WA 4ER7A 2QE6A 3HEMA 3PT9A 2GH1A 3LBYA 2UYQA 4MIKA 3AJDA 3KR1A 4GOOD 1XCLA 3CJQA 2N47A 2FK7A 3ELYA 3FUXA 3K0BA 3F4KA 1X1BA 4Z2YA 1NW6A 4KW7A 4ER3A 3REOA 1RI4A 3G89A 1B42A 1XDSA 4GQBA 4DF3A 2YQZA 3LPMA 5T64A 2EJTA 2P41A 3PX3A 4FS8A 4K6MA 1NKVA 3PFHA 4KDCA 4BLUA 4PIPA 2BR3A 1EJ0A 2BR4A 2PLWA 5G02A 4WXHA 1R8YA 5EQJB 5K0EA 3E05A 1NW8A 4L7VA 3FZGA 1I9GA 4A6DA 5MHTA 2PT9A 5E2BA 4IV8A 9MHTA 3EEYA 2I62A 4BP1A 4YUWA 1EJ6A 1JG4A 3KPVA 4M38A 4P58A 1AQIA 1P39A 5GIOE 1JQDA 4FZVA 5DRTA 3X0DA 5ICEA 1KP9A 3SR4A 1P1BA 3CVOA 4YUYA 4RTOA 1JQ3A 1M6EX 3GWZA 4IV0A 4KIFA 5EHIA 5LQAA 3UJDA 4B17A 4OA8A 2UYCA 2CMHA 3OCJA 5FQOA 3NVKI 5K0LA 2NXNA 3DH0A 3OU6A 4RVFA 2YUIA 2IH5A 5DM1A 4FT2A 1QAQA 3UJ7A 2EG5A 1XVAA 5CUQA 2IBTA 1VBFA 3G8AA 5HIMA 2R6ZA 1T43A 1NW3A 2ZW9A 2UYHA 2HWKA 5EKUA 3EMBA 1YB2A 4MWZA 3C3PA 5FWDA 2JHPA 5E1DA 4YMHA 5GINE 2E5WA 1KIAA 2BM8A 3OU7A 4V0QA 3M6UA 2YTZA 3P9KA 2P3OA 4QVKA 4YV2A 3I5UA 2NXCA 3IHTA 3Q87B 2G72A 1M6YA 2FRXA 1Z3CA 4R6XA 4FSXA 3PLAE 2ERCA 2NP6A 1BHJA 3GGDA 3R0QA 5DSTA 3UA3A 1JG1A 3UJ6A 3AXTA 5CVEA 1X19A 4DCGA 2ONYA 4RYLA 3HNRA 5BW4A 2PJDA 1EIZA 4PWYA 3DUWA 3I64A 5K0NA 3UA4A 3L8DA 2ZWAA 2ADMA 3UZUA 5IKMA 5FWAA 5K03A 3B89A 2AS0A 5EVJA 2OPBA 1IM8A 3HVIA 5E8JA 3G2MA 2FHPA 2HMYB 3PB3A 3QOWA 1NW7A 3LCUA 4KDRA 1VQ1A 3TRKA 3OE4A 3B3JA 1RJFA 5BP7A 3FUVA 3G8BA 3JWJA 3OU2A 5LQKA 3T7RA 5GIPE 1AQJA 5DT2A 4LWPA 4RTJA 5KQRA 1VL5A 4DA4A 3KQMA 5C9ZA 2C7PA 3DOUA 1UIRA 2A14A 4F86A 2BR5A 3NMUF 3TM4A 3EGEA 4PONA 1X1AA 1RI1A 4PNEA 4GF5A 5FHRA 3DLIA 1KYZA 1TW3A 5HEKA 4X41A 4GBED 4ZTBA 3RW9A 3HCAA 1BKYA 4O29A 3R9XB 5BXYA 2IDJA 2AOTA 3DMGA 4IWNA 1YZ3A 5LR6A 1FP2A 5EIWA 3E7PA 1BOOA 3RIEA 2QM3A 2PVCA 3NWEA 3OFJA 3BGVA 3M6VA 2P7HA 4R05A 4C03A 2CL5A 4GOND 2FK8A 5EMMA 2G1PA 4DM3A 1RJEA 1EG2A 2O05A 3DXXA 3FPGA 4CWAA 3A26A 1RI2A 1ZGAA 1G8SA 2AOTB 2CWWA 2YXDA 3TQSA 1XTPA 3AY0A 3M70A 4RTKA 5GP1A 1SQFA 4FT4A 3QV2A 3ELWA 3A25A 5GM2A 3T7TA 3E23A 2PXAA 2PX2A 5CD1A 5DXAA 5DX1A 4XUCA 5CCBA 3KR0A 3GIWA 2XBMA 2AOVA 4PYQA 3OZRA 3CKKA 3PS9A 4U7PB 1JQEA 3GNLA 1JSXA 4Y30A 2PY6A 3FTCA 3LDFA 5EOVA 5C0OE 2H00A 3ANXA 5DTRA 4E33A 1TPYA 2YR0A 1FBNA 4RTPA 4PINA 5LQRA 2VDUE 4HSGA 5E9QA 1SQGA 3THRA 1ZGJA 2JHCA 1UFKA 3B3FA 3G5LA 2H11A 3LCVB 3MERA 2GS9A 5DTQA 2CMGA 2K4MA 2AOXA 4GC5A 2DPMA 3KPWA 2ESRA 3CC8A 3TFWA 3EGVA 4E30A 1RJGA 5E2AA 1D2HA 4RTQA 2C7RA 2ZLBA 4BY9E 4X60A 3FTEA 3CBGA 1QZZA 3I53A 4OA5A 5KVAA 1SVUA 2VS1A 3DXZA 2ZTHA 4PCLA 4HRAA 1FP1D 3KQTA 3VYWA 5F2NA 3P97A 4EKIA 5HIIA 4GUAA 1YF3A 5EHGA 4CKCA 3LCCA 3BWCA 3MAGA 4YMGA 3HCEA 2F8LA 3GRVA 4ER5A 1NV8A 4GEKA 4V0RA 2OBFA 1HMYA 4WVLA 5EMJA 3HTXA 2AN3A 1DUSA 3FTDA 2VZ9A 4R6WA 3V8VA 5K09A 1PRYA 1YFJA 1UWVA 2VDWA 3HVHA 1JG2A 3PVCA 4CTKA
chains in the Genus database with same CATH superfamily
2X2FA 1M5UA 2AG1A 1PR9A 2DM6A 1VRVA 1V8ZA 1RR6A 1IN7A 4MTCA 2OEPA 4PZEA 2C7VA 4NEGA 1FK8A 1SWWA 1EZZA 3V6LA 4OQPA 4LA4A 3N8HA 1JFSA 5GWXA 2QVCA 3OHPA 1Z7YA 3K9LA 4RZ2A 1QDLB 2A94A 2QUZA 1H8ED 4LMBA 4DB2A 2D13A 1WUIS 3IDQA 5E8RA 2DPXA 4HWPA 3K70C 1G291 4KE7A 1FTYA 1JLLA 3C3AA 3M5WA 4UMFA 1EBBA 1H2HA 2M2IA 3WLJA 4EO7A 2P0AA 3OZSA 1WDKA 3G9QA 3EY9A 4XR9A 4B6QA 2B8EA 1KK2A 3ZK7A 4JH0A 1IG0A 2PUWA 4ZKDA 1I3NA 2PLNA 4PHFA 2PS3A 1JR3E 5KNCD 3V8PA 2PT6A 4JXKA 4PC3A 3R4VA 1A50B 3W4JA 3KEQA 3WL5A 5AR1A 3U4QB 3R9WA 1GNRA 1KH3A 2I29A 1PD1A 4DLSA 1BXGA 1A2BA 1YS2X 4ZEMA 3AIMA 5FFNA 2ZIFA 4A26A 3L4EA 2XT6A 1WXIA 1SJ9A 2CFIA 2IOHA 2W11A 3N07A 3V32A 4A8HA 4BQEA 1IWBB 4F9TA 5JH7B 4E5VA 2DHQA 4CMEA 2GEJA 2GUGA 3TOCA 5JBNA 3VNSA 4DSOA 2DERA 3RJMA 3JAMA 1NQVA 3M8KA 2UVPA 1L4YA 2O7SA 1RFLA 1WMAA 2OKGA 2PKXA 1LLFA 3DMTA 2J0UB 2OECA 3KKZA 4Z9XA 1YJQA 4OGWA 3UCEA 4D92A 2AEEA 4KWIA 4EFNA 5ILGA 1M6HA 2ZCJA 1TM5E 2O7NA 1MAAA 4OYLA 1TU3A 3LSTA 3IV6A 3D8UA 3EWSA 4FYWA 5IDQA 4EI9A 2KW5A 5LWHA 1NVKA 3WZLA 3HWWA 1UPBA 1SK9A 1V9SA 3E9MA 1T0BA 4MUYA 4CLOA 4HATA 2ZYDA 2F1IA 2H2AA 3GW8A 1OU4A 3EDYA 4MITA 5ALWA 3BRWD 5KDDA 2EZTA 3HKDB 4NSNA 2UYHA 2E85A 4OQDA 4F93B 1QQTA 1R5BA 2PK3A 1YQXA 4WNCA 2ZVQX 2YDYA 2FPXA 1T3GA 1GGHA 1OXVA 2D1YA 3WRWA 2QGFA 2BFNA 4FVTA 4KMMA 4PHCA 1A9ZA 3RRFA 3Q0IA 1EXVA 3JQRA 4H9GA 3FGOA 1Y5LA 1MB3A 3KYCB 4QBHA 2F55A 2H1CA 3GI1A 4BRZA 5CYFA 3CX3A 4D0NA 5BUZA 5IUJC 5KDOA 1V1JA 5ALYA 1L7OA 3IJ5A 5TQJA 1FX1A 4WK0B 4EH1A 3PYMA 3UY4A 1T0UA 1G4AE 3TLYA 1T8WA 1KDPA 1SOWA 5HOQA 4F4FA 5FOWA 3FYHA 1XRPA 5JDIC 2FPGB 2CVZA 2YW2A 4R2HA 5JEDA 2GN4A 2OCLA 4C21A 1K9VF 1K7XB 1YZHA 2R7MA 4FFDA 5MF6A 1K8ZB 2BFDB 1JH9A 2EFGA 3ITEA 1HWYA 4MHOA 4V3BA 3LKVA 1QE5A 1MC1A 3M6XA 4PO3X 4GNRA 4MV7A 4P3XA 4G36A 1M75A 4ZYXA 3U44A 3KQVA 1YR9A 4G0OA 1P1RA 1KHTA 2A4KA 3WR5A 3M3HA 3MFQA 4UM5A 4MGYR 5M2QA 2BGKA 4F6CA 1BH2A 1RWBA 3I12A 2IE8A 3AB7A 2HJRA 5FI3A 5D6NA 1QR2A 3SXPA 1O6GA 2QE7A 1W73A 1HNNA 2HCJB 1UM9B 1EK2A 2ZOSA 5TQ0B 4PF1A 3ZHQA 5AIAA 1E3TA 5C4GB 4NDNE 5KWJA 3OQIB 4LDRA 1OV4A 3ZIUA 1A9XB 2X14A 4BNWA 4QM6A 3OZAA 2XODA 1W4AA 3BIFA 4L75A 5DEOA 1T13A 2NUTA 3ZDXB 5E1OA 1UMDB 1F8YA 4B7XA 4CVNA 4GR4A 4HBGA 5AW5A 1WEHA 3UOWA 3D8HA 1P7WA 3BIOA 4QDXA 4EG6A 3T7AA 1JHXA 3AV3A 4WAUA 2JH8A 3AZOA 1T0IA 1RE0A 2ZDQA 5K05A 1TCBA 1FMLA 3K0CC 2IHUA 3STWA 2F90A 3FB4A 3JZMA 2VSNA 2PNJA 1H4TA 2AC4A 2QG9A 2RGRA 2FJUA 5FTJA 1RM5A 2YZKA 3EXHA 3JS5A 3LK6A 3HFRA 2YOHA 3MBIA 4RF2A 5DGDA 4OAQA 3U56A 3EIOA 3ESDA 2VVTA 2H5LA 3G23A 3RV3A 3U1TA 4ZT2A 5ALEA 1MIOB 4Q7QA 1SU4A 3KJNA 1QDEA 1ORRA 2BGRA 2QAIA 3AP2A 3W7AA 3OWHA 2P8SA 3WLQA 2ODPA 3O3NB 4WNAA 2O8NA 1A9OA 2W0MA 3T9EA 1A2QA 5EIXA 2GLTA 3RK0A 1ODIA 3A6ZA 5FJJA 2OQ2A 3O2JA 3ZWNA 5A9SB 1FLVA 1GRCA 4YRCA 4AX8A 5JAUA 1LX7A 1T8RA 3MBKA 3N8GA 3QELA 3AJ9A 4ENUA 3WHIA 4OL9A 3HJAA 4NEQA 1PJLA 1NVWQ 4DR5B 3KP1A 4WNIA 3I05A 1IUNA 3CWCA 3O3OB 4YMLA 5GGYA 3H4IA 4E70A 1JQKA 5FUMA 1L8OA 3L8YA 4R7GA 3WK6A 4LF4B 1U7PA 3VVMA 4DZRA 1W5SA 2JFHA 2JJQA 3N75A 5LNK6 1OYOA 2ZAGA 4HXGA 2NNLD 4FEAA 3WGYA 2YWCA 1VB3A 3RSFA 4QNNA 3NALA 4JD5A 3IQHX 3WKBA 3CS3A 1C9DB 1HZJA 1G5QA 1TLTA 2WHYA 2YL2A 3Q3HA 4OHPA 1FVOA 4ENVA 2ZWPA 4F6RB 4D8YA 3M3DA 3EJWA 4GLBA 3T6KA 3AL2A 3L7JA 3NDJA 4GE0A 2D5IA 1E2IA 3K9HA 4G41A 4WK2B 4AJ4A 3ZZUA 3BH6A 4KBYA 4C0AC 2YKGA 1EIWA 3P9SA 4GXTA 1NQAO 2NVUA 1Y9DA 2BBTA 3QQPA 1UPAA 2DFTA 2I2WA 4EECA 5DHAA 4JMPA 1YOBA 2ZZNA 3BCSA 1ACJA 1IXKA 3P9CA 1VP9A 4RH3A 2K2WA 1QONA 2YV3A 5EIBD 4PPNA 3BMOA 1N7HA 3VISA 1QGUB 4NFYA 4PLZA 3KQYA 3LU1A 1EU1A 2DHCA 4W7HA 2I2BA 1FL9A 3QQ5A 1YQDA 4INAA 1K0UA 1ORIA 2EZUA 4J4BA 3E2MA 5AW2A 3UEOA 2GEUA 4KAXA 3HJTA 4PSUA 3HVKA 1MH1A 1KDVA 1FFYA 3U4IA 4K46A 5IANA 4CKYA 2ZJ1A 1XRNA 4D02A 2GCNA 3MUEA 4NOMA 1QIJA 1UBEA 2XTMA 1U81A 2GFIA 3UJCA 1T4CA 3D0OA 4TSKA 3LXXA 3WL8A 3WRVA 5I9IA 2WQ7A 1GR0A 2AFIB 4BRWA 3GMDA 3HCCA 4TKVB 5A5DA 1V8FA 4O4JA 4H59A 4XGQA 4Z2AA 4WOCA 3CEMA 1J5XA 1RAGA 1NNLA 2AX4A 2H4WA 2IXAA 2AMLA 2B7BA 3VVLA 4L5JA 3T7EA 1NATA 4O4JF 3LCRA 2PMCA 3AHHA 3HUFA 1C1XA 1PZHA 2WJ3A 2XXBA 3ORRA 1BS9A 1TZCA 1YNSA 5EXDA 1V1MA 4BZQA 4BMPB 2DMRA 1KSGA 3WGZA 4I4NA 4WERA 4QARA 1EB8A 3KR9A 1E69A 1PWZA 4JV5B 2BTOA 4JLVA 2DGDA 2EX4A 1QVWA 1JJIA 2DVMA 3A6KA 4ZEVA 2C4MA 1HE4A 3OESA 3OBBA 3WRXC 1OPXA 4Y2JA 4B3TB 4RTNA 3HDYA 2IBSA 5IYZA 4OBWA 2O0KA 5EE9A 3IIEA 4NBLA 2HBRA 1VLZA 1XVIA 4QPNA 4FFOA 1E3DA 1OAAA 1Y5MA 5FLYA 3KOZA 3DKRA 2FKNA 2I3BA 3DTVD 3CKLA 1W7AA 1E6CA 3Q72A 3NASA 1P6XA 3ZCUA 4F4HA 4RJKA 1L6RA 3KT3A 3G2HA 3MTEA 5EE0A 5EWLA 5IW8A 3P4UA 2ZDHA 1M2OA 1QS0B 5T8KC 3CWZA 2OWEA 3IBYA 1M8PA 1S1CA 2CNWD 3R3WA 2QVLA 2VHCA 5COQA 2VRWA 3RFXA 2PKYX 4MARA 5ELLA 1P5RA 4YPOA 3K2QA 2VNIA 4HNAA 4MIKA 3GH1A 2JAXA 4V0OA 2WKSA 2LTAA 2VXOA 2VOEA 1PJSA 3CU5A 4DSAA 3HR4A 1W0KD 1X1RA 2PGLA 3H6HA 1VI6A 1I80A 3C8MA 1F2UA 2G0AA 3LXRA 2W2NA 1RWVA 4LF8B 2HJWA 2FG7C 4FFBA 1R0XA 5TLSA 1JMVA 3D7MA 3KNZA 3CH6A 1KERA 4H27A 4MJ3A 5CXXA 2SKEA 3SKXA 4FR5A 2J3LA 1IN5A 2J9FA 4IIJA 5A3RA 1XN1A 4N0PA 4X3CA 2Q4TA 2QT1A 6REQB 2QX9A 2GX6A 3FTPA 1RE1A 1KVQA 1RAFA 3ROFA 4BO4A 1GGNA 1OAOC 1AXRA 3NUZA 3IR6A 2WFLB 2TYSB 3PGKA 2GZAA 4MVJG 4F3CA 1JHUA 2AKYA 4YCLA 2YRFA 4M38A 3WAKA 2VSXA 1L4NA 1X7WA 1Y3CE 4I5EA 1Z45A 5AHWA 3RS2A 4R9UC 3ZYCA 1TT7A 1W94A 1ZEJA 2V03A 5F76A 3S1AA 4FKBA 4QQ8A 3M89A 1NVMB 1U2GC 3KL2A 2GZ2A 5H9WA 4B17A 2ZQYA 2B8NA 3K35A 3KLMX 4L4YA 2CMHA 3K71B 3RAEC 3ABOB 4HVTA 2ZYUX 5J4VA 4QO7A 2B4QA 3DH0A 4QBKA 1U2TA 2VTEA 2ZTUA 2Z8YA 3SC4A 2H4ZA 4ZXPA 2VHZA 3TIGA 3TZEA 3WJ1A 1TI7A 4W5WA 4AIIA 1U3FA 2W6JA 4DDTA 4MNTA 3ZQUA 4N3GA 3QXJA 3IAUA 4P4SB 4BEJA 2BGNA 2OVBA 3CB2A 2HOQA 1GUBA 2P2NA 4FIZA 4KN9S 2DCUA 1UJMA 4AXXA 4L9RA 1OJLA 3TQTA 2YOFA 5B6IA 2XCIA 1A2OA 3OO1A 5CLIA 1MO3A 3V33A 3GWGA 4HR7A 1Z3CA 2WJWA 3FSGA 3L07A 2PMKA 4FSXA 5E4TA 4TQAA 2NP6A 2PFSA 3F9RA 4PC1A 4KV9A 2R8XA 4U6SA 1IONA 1JBKA 5BW4A 1RP7A 4FYMA 5HHTA 3CCBA 3TRJA 3ZJ4A 1I4OA 1J23A 1LBTA 1V3VA 5JXJA 4PWYA 1RQGA 4TQ9A 1NL3A 3NOOA 2AWNA 3L93A 4HPXB 4PZUA 2GXQA 3O95A 4X1IA 4DDWA 5TPZA 5E8JA 4HLUA 3AVUA 2WUEA 4JNCA 4KDRA 4AZ0A 3RFCA 3KDPA 5JANA 3B60A 3G8BA 3I6IA 2BKXA 1QYVA 1NLUA 2C8JA 2R4QA 3W6UA 5K5EA 2Y71A 5DDIP 1CY8A 2JGRA 1AQJA 3DSRA 4ZCLA 4IQ8A 1OZHA 3NGXA 3R75A 3QUAA 5AQEA 5EI5A 3QI2A 1XYVA 2BUCA 2QRKA 3DBHB 3I23A 4GF5A 5G40A 2O2HA 4G0YA 3EGOA 1T9HA 1ID8A 2ZAOA 3SBDA 4HN9A 1A9SA 1ENPA 2IK8A 4HH1A 4IO0A 2PVPA 2F2TA 2YVAA 2FLWA 1JYSA 1T5OA 2ZUSA 4G1MB 1JU3A 1CNFA 1D2AA 3N8IA 1T3SA 4I46A 3EFEA 4D98A 3A9CA 5KNBA 4MVJM 3AVPA 2VSQA 3C6ZA 4BLRA 1LPPA 1KO8A 4Z0TA 2YZNA 3F4BA 3DLHA 1I2ZA 2VDNB 2LIPA 4CJXA 5EP4A 1YS6A 4EHAA 1JHOA 4JFRA 4BO3A 3I39X 2PUTA 3FPGA 1MZPA 3O4GA 4RJJA 2WEKA 3IUBA 3QYJA 4TV9F 4YJFA 4YAJA 2Q5JA 4CTNA 4RE6A 1OF1A 4RK0A 4N82A 3AY0A 1ZWLA 4W5OA 2O6HA 3RNOA 3PQ3A 5CLFA 1K88A 4C88A 2Y99A 2QR3A 3CIOA 1MF7A 3UO8B 1XLVA 1YB4A 2J30A 4WBSA 5CCBA 1PIWA 3Q3IA 2R60A 5AVKA 4GRDA 1ZD8A 2LPMA 4Y30A 2W93A 4NPAA 3URKA 4DBVO 3N70A 4OJKA 4A0RA 4BV3A 2YR0A 4H6VA 4TMZA 3TEFA 1T6ZA 2GASA 3LPLA 1UMBB 2RH8A 4HX5A 3EFHA 1VOTA 1PR2A 4KLAA 3RVNA 1ZGJA 1STOA 2YN2A 2FWJA 3BWEA 3PP8A 2AD5A 3B3FA 1N2CE 3LCVB 1MO2A 4REMA 4AROA 1RYBA 1TC1A 4KQWA 3NOXA 1GPJA 5F3DA 3ZOZA 2ESRA 1P3JA 4RTQA 1KP2A 1IULA 1SOUA 3D31A 1G18A 4E12A 3QNUA 4PVDA 3WLTA 1SVUA 1FFEA 2WSMA 4OSPA 5I6DA 3K8QA 4OXRA 3SD7A 6YASA 2YVUA 2ZTHA 1BJKA 3BMCA 5I9TA 1Q0LA 3G0IA 4XVHA 1R6XA 1HFKA 1I5RA 2ZJ5A 3R5KA 5I7FA 1G64A 4RETA 2XCTB 4N65A 4KYUA 2CL6X 3SJAA 3SJUA 5G0SA 5A9RA 3EMVA 2ZBDA 5LL6P 1EB9A 1UDAA 1MT3A 1X1EA 1E32A 3DHVA 4NR0A 2ZKIA 1D8TA 2YWBA 4O5AA 4DILA 3KBOA 2OUIA 3QVXA 2WM9B 3I76A 4ZI7B 2HN9A 1QC5A 1EESA 1TGVA 1IDOA 1KI7A 4MW9A 1IOLA 4Y18A 4BAGA 4BKOA 1MHTA 1JI3A 4HNTA 2CXOA 3DDNA 4G24A 1JEOA 4RK1A 5ULLA 1Z4PX 3F96A 5ALSA 5CD9A 1ODTC 3SQWA 4OLJA 1A7AA 2PX6A 1SD5A 5HIJA 3STTA 4C06A 5CT4A 1PLKA 1U0SY 1UQUA 2KSQA 2R8PA 4KAAA 3FRIA 1FJXA 4C4AA 1C81A 5DNAA 3ADBA 1MTOA 4EVIA 2YY6A 1XDZA 3W3AA 4US0R 3S0JA 3WZ2A 1PG5A 4CQLB 1GPYA 3LRPA 3UMSA 3BJIC 1EVKA 1G4HA 2NSHA 4H1WA 2AQIA 5IG2A 1AY0A 2XF2A 2P2YA 1DAPA 2BRUC 4GGMX 4Q4JB 3GFSA 4F2DA 3W0LB 4C4RA 3BK2A 1QQ5A 5CJPA 4NULA 5EJ6A 1Z4NA 4I8XA 1D0IA 4PM4A 2C04A 3C8ZA 3L06A 3COJA 2I66A 3COVA 3GFVA 4WN3A 2XQJA 2GILA 2MMCA 2OL4A 1KO5A 1M6WA 2E55A 3SEAA 3TZKA 4DN6A 4JKOA 4ARZA 3DR5A 1WXXA 1ZXLA 2VKTA 2VQ6A 3QM1A 4NCHA 4PBTA 4WKCA 3A6JA 3FHTA 2XMDA 3WP1B 3FWNA 2HC9A 3GFBA 3UICA 1V11A 3G2QA 3DVAB 4HNQA 4BLQA 3TLKA 2J0SA 1BU8A 3IOCA 5B53A 4PIMA 3HP4A 4DYVA 1LB1B 1X7DA 5L7WA 4OLAA 3VOTA 1G7RA 2O19A 3FNHA 1WD5A 3ZGNA 3IEUA 1NM5A 1JDBB 4ZCQA 2Q1UA 4AVYA 1W19A 3S2YA 4UOEA 3CPEA 4BNIA 1V3TA 1K8YB 1MB9A 1MD9A 3KKOA 4KN5A 1EBFA 1DX4A 1G21E 1K4KA 1OYWA 1O97D 1ZESA 1TL7C 4L8LA 1NSTA 4FEEA 4GIBA 4Q4AA 3OEHD 4BOYA 1J0XO 1X94A 2A0KA 2R44A 1O94D 1JGTA 2PWBA 1CEXA 1QYWA 3LY7A 3EOAI 3HY3A 4PCAA 4XM0A 1CJBA 3Q2IA 2RKOA 4BJ1A 2AN5A 2WA1A 3CUKA 1IHDA 2V8BA 3E8SA 4JVLA 5JQGA 4OK3A 2MR5A 4NBUA 5HF6A 1OXBB 1EP3B 1PUIA 2J7PA 1THMA 2HU8A 3LKBA 3RK1A 1ZOSA 2CFSA 4EKNB 3Q3VA 4RADA 4L4SA 2Y0CA 2H2GA 5BSEA 2PQ0A 5KWIA 2MIIA 3LI2A 3U3XA 1KYWA 1Y1LA 3BF7A 4XCQA 3EN0A 2RH9B 3PHBE 1TKBA 4ZHQB 4PEVA 4MYTA 2VIIA 4KVZA 2AZTA 4M9CA 4NZNA 3ONVA 3W5SA 3WQHA 4JSYA 3NEJA 3UH1A 3OFKA 5H82A 3IULA 4DJFC 4M49A 3UHJA 4HWKA 2PZ8A 4UQOA 1RMYA 2QRPA 4QODA 4RKEA 2BFPA 1M10A 2PS9A 3EAFA 5LMNB 2X22A 1P7CA 3TZ6A 5KO2A 1JHYA 1LPMA 2NWQA 3L6DA 4CIAA 1XZEA 5BQ3A 2NUAB 4D4IA 3C24A 4KGXA 4EJMA 4GSYA 1COWD 1VFPA 3P0IA 3QEOA 2XVYA 3B6JA 4A2WA 4CHGA 2E21A 3KCNA 4REQB 1VFNA 1EAYA 2H2FA 3H04A 3SQNA 4HDKB 3U3RA 1L5FA 4YLYA 4J90A 5G41A 3N0RA 2WYOA 3GA7A 4TTSA 3Q3GE 1G8HA 3PVSA 3B38A 4WDQA 2HIGA 1B8NA 4C1BA 1JR3A 3CPSA 1ZM7A 6PFKA 1IPHA 4BNYA 5A02A 1QHXA 4U5QA 4HFNA 4Q93A 5DH9A 1T2VA 1JV2B 1YZFA 2YWRA 1U9IA 1R4NB 1F6DA 1C1DB 2L69A 1DV2A 1UP6A 1XXHB 4JJIA 3HXKA 4JOSA 4L07A 5E3IA 2B5OA 5L3QB 1EFPB 3D2BA 3IR7A 1FNSA 4LPKA 2ORED 3F0TA 3L1HA 4H0FA 1XZDA 2XUZA 4KNWA 4X8MA 4XZ3A 2J3DA 4I55B 3UATA 1WKVA 2UZ4A 1V45E 2RJ3A 1ATIA 1WRBA 1NRJB 2O2SA 1DAMA 3ECCA 3LWBA 3I30X 1P9NA 4XM2A 4JVNA 2Z57A 3KQNA 1R0BA 4IJ6A 2Q3DA 1UFRA 4D81A 1DFGA 2DOKA 3JQGB 5CDYA 5E38A 4KUHA 1I7NA 2WIKA 2CFCA 3CZ9A 4HWGA 3WOHA 3EG9B 4TMTA 4CEIA 5B6JA 5J47A 1AXEA 4MPPA 4RD4A 4QDUA 4QJ5A 1DJPA 4BL5A 1KI2A 1UBSB 1R00A 4GGOA 1SCQA 5CBPB 1SUFA 3FOAA 1G9SA 3DDHA 1D2RA 4JP1A 3AV0B 2FFJA 3CUSA 4J0FA 3T1OA 4KO8A 1TIBA 3MSXA 4FW9A 2C2WA 2VF8A 2X0JA 3CT6A 1C0PA 1GCUA 2XZDA 3RJTA 1UBMS 1KY5A 5TPWA 4RELA 3IP9A 5ARCA 1N1EA 1DC4A 4CNQA 4Q03A 5ITSA 2X8WA 2A1TS 1GOTA 721PA 2RCYA 3A2KA 4Z4FA 5KB3A 1Z2CA 3PXXA 4KNVA 5KQMA 2BI4A 2XUOA 1Z6AA 4RJ2A 1QTNA 2GLXA 2QN1A 2ZRJA 3Q3JB 4PZYA 3FNFA 4X5OA 1YO6A 3BMXA 5HTOA 3EYWA 4II2A 1V39A 2PLFA 4DLNA 5D5HA 1RXCA 2IUUA 1UJ2A 4U7WA 1KBOA 3QBEA 4NNJA 4BGIA 3SVZA 1Z4QA 3NBZC 4UCWA 2WJHA 5ESXA 1WUHS 4JI0B 4F3KA 3NCHA 2OESA 1YR6A 4YLGA 1SXHA 1KO4A 3GEIA 4MJXA 4ZO7A 2Q2OA 2IHVA 1NVUQ 3HFSA 2BKUA 3IAEA 1XFAA 4PLHA 2PRKA 3B2QA 3B7WA 2J08A 1X3SA 1AT1A 3GZNA 4J3FA 4RA9A 3RU9A 5K0GA 3DFMA 2CSXA 2ID4A 1S3SA 3GARA 1PO7A 4N76A 4D25A 5IBRA 1PZMA 3TW4A 1TA0A 2PZFA 3I9JA 1XAGA 3OE7D 3A7EA 1D4ZA 2GFQA 2PZMA 3IC5A 3WMWA 4AW9A 4XIJA 1T9GR 4CRWB 1NMQA 1ZG3A 1MXHA 3ZWCA 1KVTA 3UHAA 1JHQA 3FYTA 4ZT4A 2VC2B 4YCAA 1KL7A 4RAQA 2VK2A 2R4TA 1VCOA 1UEXC 2INGX 1B3BA 3B1ZA 3PD7A 4OQEA 4QUDA 5B3JA 1LJLA 3FKSD 2GJ4A 2F1HA 3HZOA 4L5YA 1JZSA 3ZV6A 1IHPA 3Q9SA 4V0LA 3ZY3A 2ZBGA 1EDEA 2WZBA 2CZGA 4WZBE 4Z3DA 2WTNA 3Q9LA 2HCFA 3RVMA 2OCYC 1VJDA 4Q7KA 2PGNA 1YC2A 4ZVNA 2C88A 4LRSB 4YCCA 4HB2A 4WKBA 4EG3A 1EXWA 2GHTA 3WSWA 4BNGA 2O8FA 4F8YA 1NVXQ 4B5LA 1B23P 1JFFA 2VP3A 1O97C 1DQNA 5I7VA 1G2PA 2O2IA 1KJIA 1Y5RA 4HQOA 5CNMA 1F7UA 3JQ8B 3A2LA 2JAQA 3CH7A 3JU3A 5AM3A 5B64A 5J4HA 5CLGA 4IFIA 1F8UA 1NV9A 3GCZA 1APBA 4II7A 1QHIA 4UNQA 3S4YA 2XVXA 2ZRNA 3LPAA 1Z8HA 1Q0ZA 4KO4S 4FQ8A 2NVWA 3WICA 4AXBA 4I3FA 1FQWA 2PUHA 2FQWA 4IUCS 1CVLA 3GT3A 4WKNA 4BVLA 2AKEA 1CQIB 3MRTA 2DUUA 1IHXA 4GOXA 2C82A 5HR5A 4ZZ3A 5A6VA 2FF5A 3RR2A 1S1MA 2QZPA 1D2NA 3UMGA 4JLSA 2VSOA 3TS1A 4A6EA 4TZ6A 1TO6A 2WSLA 3RVDA 1SD2A 3TLAA 3KKKA 3DUFB 4I9FA 2FW9A 5GPBA 3ODGA 5THXA 2ENUA 2ZRQA 3CNEA 4XFDA 2WB2A 2GYYA 1O54A 2HK8A 1SHUX 2XXJA 2EGHA 4LZJA 3ZGYA 1MOSA 2O3RA 5JVDA 4WBXC 5D5QA 1KK0A 2O57A 5K0ZA 2RGDA 1WKBA 4BP3A 3GLHE 1SG9A 3TTXA 1HZZC 4HNGA 2V0GA 4X8LA 4B3XA 1WXHA 3W6OA 3FIJA 3KPUA 4XLTA 2WVAA 3WB1A 4EI2A 5JVDF 3M5DA 5DIZA 2HA7A 3UK2A 1JWLA 5CCDA 4YAUA 3FNRA 1XZGA 2QRJA 2KI5A 3EGXA 4GOOD 1X7YA 3MG9A 4WA8A 1AIPA 3GRKA 3U7FB 3ZJTA 1E2EA 2XSZD 1FRNA 3F4KA 1T9KA 2BVNA 4KTVE 2ZYHA 1OZAA 1J22A 5J4LA 3FWYA 1TQ2A 2XMCA 3FETA 3KOUA 4JI5B 2EHDA 2O20A 3H5OA 4H31A 5LM3A 1Z5UA 2CYAA 2WPDA 4KPFC 4IHJF 4Q1VA 5G02A 3L8MA 2ISCA 3LOUA 3RKUA 1E5QA 1TJNA 3GUCA 2NQ2C 1L4EA 1V5EA 1NDQA 1L5ZA 4HVAA 4XWAA 3O1IC 4ENSA 2VXCA 1EFVA 1DIGA 1XD2B 5DISB 4IOLA 3HCOA 3KJZA 3EPJA 4B8YA 3FCEA 3GJXC 5F7OA 2CDBA 2NU6A 2CDCA 5FNZA 3LHIA 4EPXA 4KCGA 1GSOA 1TFRA 3D8SA 3MRXA 3TECE 1W4BA 3M0EA 4RFLA 4D8XA 4KIFA 3GWZA 4C0LA 1VG9B 4G4GA 2AGVA 3K1AB 2K6GA 4A8JB 4D44A 4OA8A 3QTTA 1I2BA 1SVWA 3BQMB 4PICA 3DEKA 4CV0A 5JIBA 4TYNA 2UU9B 2WSBA 3KB6A 2IYXA 4FT2A 3UJ7A 2WICA 2VPYA 5ALRA 4UUNA 2Y2UA 4NMXB 4ZOLB 3QPWA 5F9FA 5C1PA 1NI3A 1VC2A 2FQQA 5C52B 1MFZA 3PZBA 1NF2A 1ONSA 3T5CA 2QP3A 2V7WA 2WPNA 2HBYA 2LBPA 5JYEA 4MVJI 1NYLA 1K89A 4XASA 1KY4A 2CXPA 4AURA 2OQRA 5K45A 4AM8A 1TEVA 3K8YA 1GGMA 1U3CA 3H4TA 3PHLA 2FPSA 1QH0A 2CLDX 4U3JA 5A03A 1AHIA 2HRRA 2BEWA 2W7TA 3NHPA 3PGVA 1X19A 4FQ5A 3UA3A 2YZ2A 3I0NA 4RYLA 5A4KA 3NZEA 1ZA2A 2ATXA 3AINA 2VKQA 1BWSA 3SQDA 3DJYA 1UK6A 4OMFG 1PAUA 4FYPA 3M2PA 1W36B 2JD1A 2P6MA 3LBNA 2DWCA 3SLGA 3OP4A 4ZRMA 4UPVA 4KHPB 5DW3A 1E89A 3CSUA 2AQHA 2FHPA 2FPKA 4D0GA 3OEEA 2PR7A 4PG8A 1VQ1A 5IFLA 3ZE7A 1Y1PA 4KX3A 4L15A 3BYZA 1VIVA 1N5OX 2WHPB 1B8OA 2OSBA 2FW6A 4FZJA 4YEDA 3TUIC 4BXOB 2HA2A 2PCJA 3EWNA 4RY0A 3ZBTA 4JA2A 2XMSA 1P1KA 2VOJA 1O5OA 1LQUA 3KQMA 4YO8A 3MIZA 3USES 4RVNA 1THGA 1RI1A 5JI3E 5A3VA 4X45A 4DSNA 2Q6LA 5HXAA 4E5SA 1LRLA 2Z4SA 2VYCA 2CL0X 3MGBA 2RI0A 3H84A 1CUGA 4MW5A 3ROTA 2OM6A 3P94A 1SXPA 4JI2B 4LXGA 1Y7IA 2QYTA 3CH4B 3T4UA 1YCFA 1TF2A 3PXGA 5EN4A 2JGEA 1BQ3A 2VBCA 2VFAA 2VHTA 4MP6A 4XW2A 1D03A 2FLVA 4P3OA 5SZJA 1X74A 2DXIA 3O8DA 4FN5A 3CNQS 4G85A 3QUCA 4Y67A 3VR5H 5LPNA 3L9XA 2FFBA 3IPAA 3LBIA 4H3KB 2O2EA 4WXPA 1J8FA 4ZPXA 1HDOA 4IJKA 3H5NA 1PQUA 4EB6B 1P4RA 5HJ2A 1KMQA 3RC9A 5E6SA 1A4XA 1QF9A 5DYIA 4WD3A 1J20A 1HKHA 2XNSA 1POWA 3JD2A 2PN1A 2W5UA 2PX2A 3GUYA 4OHVA 2VJMB 1VGQA 3F6RA 3HUUA 3UFXA 4AJ9A 1YKFA 4CQMB 2J1LA 2XBMA 2Z1DA 3G7SA 1W52X 4E6EA 2GK6A 1Y7LA 5L3RA 4KXNA 1OZ0A 5FR1A 3QXSA 1C3OB 1JQEA 2JFVA 3LD9A 4O1IA 1E9AA 4Q3NA 4D2IA 5L3SA 2BCEA 2JLRA 2C2KA 4HFJA 5FPYA 2QLJA 1VYHA 4XYLA 1GPKA 5LQRA 2BTEA 5J43A 1F7VA 2HM7A 3F5FA 2JFQA 1VL8A 2BEVA 1HYEA 3ELBA 1WCV1 3VVCA 2WYWA 1A8PA 2IVZA 1ODKA 3NGLA 3MERA 3OX1A 4RHUA 5AICA 1I13A 2AK3A 1GUZA 2Q8NA 2OR3A 3SJ7A 4OIFA 2IS2A 3TOVA 2QOEA 2XZOA 3VR6A 1K5HA 1GWNA 3U7HB 1BJTA 3E8XA 2R8ZA 3EARA 1T0JB 5U4QA 1V26A 1GFIA 4I1OA 4G4SO 3NTXA 3W4IA 4BVHA 1SKAA 1YJ5A 3L1UA 2EW2A 4YP0A 2E7ZA 1WPQA 5CB4A 1WABA 2CLFB 3HCEA 4U8GA 5AJTA 4ITRC 5KYYB 3IBSA 4MQ5A 8OHMA 3Q7IA 1HMYA 5HA5A 3QXCA 1LSUA 4LV6A 3NFYA 4M0UA 2CEAA 3EFOB 5EUQB 2BP7B 3ZE2B 2QTGA 2F62A 1TW2A 2PV0A 1SC3A 3SR3A 1RRPA 1M2JA 2BBSA 2VDRB 4B2LA 4JLJA 2NZJA 4KFUA 5GOZA 4EYKA 3BBPA 4MDHA 1EUCA 4LJKA 2ZUBA 2W6PA 2GBGA 1P80A 2IUSA 2PWPA 3MGGA 4F3TA 1M1YE 2QB5A 3D3QA 1SOMA 2YHIB 5ESDA 3NIWA 3PC2A 2JIPA 5LLTA 1GKYA 1OIWA 4ZCMA 4BBAA 3CCFA 4AZWA 4L08A 3V00A 5K6RA 3SOZA 3CRVA 1MPTA 3I6QA 1N3IA 4M37A 1C14A 5DGIA 4F85A 4TKMA 4ZJYA 1YR8A 1ZINA 3DFIA 3EVFA 5CM2Z 5IT0A 4ODIA 4HDRA 1AXGA 4A2PA 1T6BY 3VTAA 4BEBA 3ABSB 1DRJA 3K0SA 1HR0B 3LUHA 1OD6A 1UJ6A 1WVMA 2IYNA 1MVOA 3HYNA 4AJJA 2VH5R 4P36A 1CDOA 2J3EA 4GX2A 4H1HA 3CNNA 4ZEOA 1TKRA 1KFBB 1WCIB 4RIEA 3NBAA 4Y2PA 3KETA 1JLLB 4PGAA 4F84A 3GRFA 3KHKA 4H1UA 3LQRA 3L82B 4KP7A 4OLHA 4OAPA 4QYSA 4TWRA 1JPNA 3ZS8A 3EAQA 3ZTTA 4OY3A 3FPSA 5I4KA 2AE1A 2I3AA 3I83A 2ZJ6A 4B3BA 4MI6A 1PNOA 3I28A 3IP1A 2WA2A 3IQZA 1DFIA 2YWXA 1VLMA 2AOUA 1KDRA 2JW5A 5CVUA 3TDNA 2P7IA 3ZD8A 4QLOA 4D9IA 1ELOA 4N0QA 3NIBA 2HJGA 3RTGA 2QJOA 2UYYA 1G0NA 1E79A 3OLVA 5FPTA 3DTNA 1DAOA 1FU7A 1R6TA 2G9UA 3OOEA 1N2CA 1LS6A 3IXQA 3P5SA 2ARKA 5ALVA 2Q0XA 1VHDA 1BMFA 1QRDA 5A06A 5K8IA 4G5XA 1PG2A 2EBUA 2P62A 1WZUA 4MUXA 5AW1A 1MQAA 2XUGA 1HFEL 1F48A 2GAFA 2UVPB 4JJEA 3Q7EA 3R6LA 2XE8A 3ZE1B 1FTQA 1NC3A 3AYZB 5T67A 3JARA 1ZDMA 4K81B 4LXQA 1YOVB 1D4OA 2ON6A 2RD2A 5AK5A 1OI7A 2JVJA 4KQXA 1NBAA 1UOEA 2QY6A 3VZQA 1J25A 1M0EA 3LKZA 4INJA 1HE1C 2VF5X 4MPTA 4BLWA 2CB9A 2AZMA 3UK0A 3ZUPA 5AESA 4G26A 3NX4A 1T2FA 1X8XA 2NADA 1PR1A 2XWJI 3IT0A 1R3DA 1MJHA 1H85A 1BCRA 2XVZA 4ZRNA 2PMEA 3PU6A 5D7NA 1UUFA 3WGLA 1SBQA 1U8XX 3ED5A 1LBIA 3EZNA 4QOFA 3UQZA 4RANA 1G8FA 1P72A 2NNWB 1GQRA 1YR2A 3CEJA 5DNDA 4F9GA 2JFPA 3KVNA 4Y9UA 4FE7A 4G9EA 4LTDA 2H18A 3SS7X 4PC6A 3SN6A 2HSGA 3TBKA 5A5EA 2C78A 3QHQA 1W93A 1Y8QA 2G5CA 4K2HA 2W9XA 5DCWA 1QHYA 1XEFA 3ILSA 4RXUA 3TMAA 5FUWA 2DTXA 1FFDA 1JDPA 4R41A 3LZDA 2G4CA 4F2PA 3RYHA 4FFPA 1CP3A 1KH1A 3E4DA 5KTTA 4XUDA 4BTVA 4FTWA 4GGPA 4B32A 4FFNA 2HD4A 2B2CA 3B1FA 1Y8RB 3GUVA 2WLSA 3PGLA 4KYTA 3BQNB 5CT9A 4MI1A 1WF3A 2CF5A 4NDAA 5IJWA 4DCCA 5CDHA 2Z43A 3AVYA 2CMFA 2I2AA 1R6AA 4Q3OA 1RADA 1A2KC 4NCBA 4RZSA 2FWPA 2P8JA 4YRZA 3GAFA 2OHXA 5B7GA 2EFHB 3TLZA 3KT6A 4Y0NA 4P82A 3KYDA 4FYVA 5AM5A 4Q3KA 5ITWA 4M1WA 2HTFA 3U44B 2ZE8A 4L0DA 2PA3A 4IH9A 5DYWA 1D2GA 1SA0B 2IIBA 2RGYA 2WT4A 3GFTA 3V2UA 3F1KA 1HDXA 2JZOA 3NTLA 1JKIA 1SZDA 4M1MA 1R66A 4RKYA 2X9LA 3K16A 3Q8XB 1UC4B 2W2LA 4NENA 3NYIA 5H4GA 3I0ZA 1FX0B 1VLVA 1G21A 1XPUA 3PHHA 1JAZA 1MVNA 1WXEA 1XEAA 4OHCA 2ZB4A 5JWRA 1XZNA 4DA8A 2FRDC 2GAIA 3K32A 4UM9B 4BRSA 3D5EA 5D6OA 3RUHA 2EERA 2XNDA 3QUTA 4KHZA 4UTPA 4M1OA 3V4VB 3FLMA 4JHXA 1Z0KA 2XUIA 3GJRA 4UU1A 1M76A 2QQGA 3W2HA 1JSZA 4EZBA 4ETMA 1RT9A 1A04A 4YUVA 3ORHA 3THOA 2Z30A 4KIGA 2HX1A 1DBSA 1ZH2A 2OFXA 5FIUA 2A9RA 3W5VA 5LZ2A 2GXUA 3P0JA 4HXFB 4MCIA 1SURA 3FUCA 4OXYA 5DO9A 4CMIB 4ERNA 5B36A 3DMHA 4JQCA 4RNCA 5F3RA 2I0FA 3T5DA 1AA9A 4V0SA 4BPBA 1ESZA 2VCEA 3LP5A 1SZPA 1YQTA 2O48X 1M1NB 4AFNA 2YJ4A 4X3OA 4QEZA 5EJMA 3LRXA 2BLNA 2H31A 1FTSA 1G5TA 3M4YA 1ZAKA 3G79A 3BD8A 1FYDA 2IDKA 3MHPA 1FUUA 1YB1A 5M5BA 1RTTA 4M6WB 1NUSA 3WWPA 2OZKA 3SLRA 4ZT7A 5J5CA 4EG4A 3K8ZA 3I32A 1C0IA 3PPXA 4D5EA 3U09A 1NFFA 3SZOA 5CFQA 4YRQA 5IM4A 1G38A 3ZGXA 4B6PA 1J0AA 4OI2A 1UK7A 1KMCA 3P9IA 2EX0A 3USCS 4G0UA 3DBLA 2AYXA 2KB0A 5H4HA 3TIVA 2IP4A 5IM4F 4UMEA 4ID9A 4RSMA 1CRZA 2B4RO 5FFFA 1BN7A 3DC7A 4TSFD 2JAHA 1RRFA 3ZDEA 5KC9A 1XLUA 2WF6A 5DCYA 4ESHA 4M0KA 1IZYA 2JLCA 4LECA 4G56A 1M72A 2VYVD 3ITKA 3PC7A 3GT4A 4KXWA 4X97A 2P69A 2YV2A 3DVRX 4IX9A 5J1TB 2B3TA 5JDIA 4JJ8A 1USVA 4BE7B 5DM70 2XOXA 2YYYA 2WUDA 4PSVA 5DNEA 4BB0A 4ZP1A 4M60A 3D6AA 5F73A 2OLJA 1MG0A 4BUZA 1H2WA 4JLAA 5CA0F 5LD2B 2OQIA 4B3DA 2KHZA 2VJQA 4ND7A 3LF1A 3GJZA 4HEA1 5DSZA 2B9EA 2VJBA 1ZD1A 4A92A 1VZ3A 2R3SA 2CBXA 4LXYA 5IX8A 1G2OA 4DEXA 3H2BA 1L3IA 1C9KA 3BMOB 4HPWA 5TMBA 3VDXA 4DAOA 2P9BA 4IVRA 1C3VA 5DT9A 821PA 3CTMA 4TLMB 4YI5A 3AT1A 3A05A 2J33A 2Q1SA 4J0KA 1ZUNA 1OTYA 4EJ2A 5EKSA 3EQ8A 4JIMA 1JDUA 2C1XA 2RGEA 2H1RA 4GNKA 4RL6A 1N5RA 4RLFA 3ROKA 2Q2QA 3ZV4A 3CPJB 5E3JA 1T4CB 2DY1A 3FFAA 4FDAA 4QDOA 4TTJA 2P91A 5K3FA 3K0CA 4KFCA 4P4LA 1O8BA 2QR5A 2Z09A 3MMXA 3ZKWA 4O4JB 5K1ZA 3KHUA 4F7WA 1SCDA 2XDAA 1H2AS 2X19A 2YDXA 2VYNA 3EZGA 3T15A 1IN4A 4GKAA 4EYGA 1XMOB 4OQNA 2D2VA 1TAUA 3SSAA 1ZYUA 3TSZA 2WE7A 4V1CI 5M04A 4MVJE 2V98A 1T34A 4S35A 4LXHA 1QIKA 1KC3A 2YNMD 2JLUA 1CJKC 2G1KA 4B6OA 4DXHA 5D3ZA 1AKEA 3DMNA 3N2YA 2ZRPA 3VZCA 2I7CA 4MMXB 3T5AA 4ESVA 4Q01A 3T7KA 3RQSA 1WSDA 1KAMA 2GZDA 2QVBA 2PFKA 4INOA 5AKYA 3R74A 1EKXA 2CNOA 1RXEA 2WG2A 4GFDA 4Z1OA 3UBMA 2O1SA 4IY1A 4KSBA 4LYDA 2Z1NA 3O4HA 1Z13A 4QGHA 1JPUA 3OQHA 4D45A 3AJDA 1LWNA 2G04A 2I2FA 3AIKA 1A1SA 4D9NA 2I78A 2DAPA 1CZOA 1W2HA 1XAJA 1EWTA 3GP3A 4PS0A 4FDTA 2QW1A 1XDSA 2G77B 2CBZA 3CNOA 4CQNA 5A5GA 3HWRA 1BJRE 4Q1EA 2QUIA 1Q1NA 1WU8A 1Z7EA 4K6MA 4PFKA 5TARA 2JNWA 4X24A 1KO1A 2ONKA 1QWSA 1P4SA 1CIJA 1PSDA 3F9IA 5EY5B 1KQFA 3SKYA 1L5NA 3EF1A 1E1DA 1XTSA 4HNAB 1GCIA 4ZAZA 1G7CA 2FMKA 4A6DA 3E9NA 4JGIA 2B1JA 1QVRA 1L5KA 4ZWNA 4F12A 1KIFA 1F2UB 2EBHX 2O2YA 2RHCA 3HY6A 1H8EA 2ORVA 1YRBA 3K2EA 1OBVA 4GW3A 4G5FA 1AK1A 1JG4A 3Q10A 5JYDA 5GV8A 4P3NA 4WZBA 1JQDA 1Z35A 4ZOCA 3KTAA 3WHKA 4JU9A 4BNTA 2J9FB 2WTXA 3V7FA 3V46A 1OYVA 2I3GA 3K5HA 4M8KA 3EQ6A 4IV0A 2BHLA 3R6WA 4FYHA 3NKVA 3S40A 3OFND 2P9GA 3ZXXA 5KNCA 5GOTA 4JQSA 1D6NA 4ZIRB 1XTRA 2QQ0A 3L7LA 5L4NA 2I9PA 4B3RB 3DWIA 4O1HA 5F2EA 4KXMA 1OKKD 2C2XA 2X4DA 3B1WA 3DTYA 4FFSA 4C0SA 1K1EA 3NOVA 3GLVA 1L5HB 2R6ZA 2WP8J 3K0HA 3LWNA 2IIVA 4TMVA 5D3QA 2BI7A 1FDUA 2RSLA 2RGXA 5EE1A 3S1AB 3ZWYA 4EX6A 4W6QA 3NH6A 2QI9F 3EMBA 3UK6A 3VHQA 2AH5A 1QVZA 3JR3A 4BQSA 2VT6A 4TL7A 3GYGA 4HQNA 1GPUA 2JIBA 4TKUA 4H1VA 3FNGA 2CN1A 2A5LA 5EZYF 3VPHA 2XTAA 5K8JB 3VSAA 1YZLA 4ZVTA 3AKZA 2GKOA 2PRJA 3I5UA 3IHTA 3PX7A 5DNCA 1MPXA 3PLAE 1WY5A 2FUG1 2WJZB 4EY7A 5IJ0A 2WTUA 1D5CA 3R0QA 4MROA 1E0DA 1O89A 1UBRS 1B0ZA 2XGGA 3IP8A 1AUQA 3KKPA 3U1VA 4EB8A 4FE3A 1U8CB 5HGXA 3DUWA 3HP1A 3G17A 1FLAA 5D84A 1YMQA 1JT9A 1KI6A 5AKZA 3QYPA 2IZ7A 2JJ1D 3ZU2A 3IP5A 2Z8XA 4ND8B 2J45A 2AE2A 3ZDZB 2UDPA 3R9XA 3VNAA 3WRXA 5LQKA 1EXMA 1V48A 5DT2A 1XO1A 1YZKA 3B9QA 3GT0A 1BGWA 1PJ2A 5KQRA 4UOZA 1IBSA 1KU6A 5CXQA 3JASA 1HDEA 5DN9A 4TL8A 3OA0A 1X7HA 2OD9A 3GD5A 1TQDA 2A30A 3UAZA 4B3CA 4PONA 5KX5A 1S5PA 4C3UA 4GVPA 1CS0A 4I8IA 3BQ9A 1J8VA 1J56A 5KNDH 3U16A 4XVRA 1CUXA 3RG8A 3SXUA 5T8KA 2EL9A 5HOEA 4E51A 2X42A 5CW2A 3ML1A 1BX3A 1FP2A 1G7SA 2YHUA 3ADDA 2H7XA 3GFGA 1LKZA 3I2HA 3RIEA 4CM6A 5JWOA 2OZLA 1MABA 5TT0A 4JI8B 2W2KA 2YZ7A 3LW8A 3ZN2A 1DAKA 3PTZA 2P67A 4GYJA 5IU6A 3I1IA 1D9XA 4RVCA 1PHPA 2AUTA 2YMPA 2C0CA 5BV2P 5LDHA 4B6FA 5I48A 1CDDA 2H1VA 2Q4OA 2GPWA 1YJAA 4XWKA 2B2NA 2J6BA 3N2EA 2F9LA 4MRAA 4X8OA 1S4QA 4DA9A 4JEMA 4M9QA 2IXGA 3P9PA 5FWXB 1RWKA 3K05A 4IO1A 4MO2A 1IL0A 3IQWA 1AMOA 2X76A 2GAOA 1OAOA 2CVOA 2FR1A 2DT5A 2VP2A 3K0KA 3N6RA 4XUCA 2RJOA 3EW7A 4PC7A 4TV9B 4RZUA 4UUQA 4B4KA 4I19A 5EIAA 3TO5A 3FZYA 1P0MA 3NUGA 1OLXA 2NG1A 1JIKA 1QH8B 3TQCA 2H0QA 1K66A 1Z7BA 3AFGA 1WF6A 3O0TA 4DYDA 4C5AA 4JBGA 4CE6A 5L4LA 2FEAA 4RTPA 1RD4A 4C9BA 4KVFA 4J6EA 1FFBA 1U2GA 4MV9A 4U1RA 4CU2A 1MAWA 4LRUA 1UFKA 3DMPA 3FN4A 3STVA 1A9YA 3SE7A 4CL0A 3KQUA 2CMGA 4EHHA 1O4WA 3L02A 5BNIA 1K63A 4Z9FA 4LQLA 4JI6B 1RJGA 4UE6A 3VAZA 1FYEA 3RVQA 3U3ZA 3THWA 3P0HA 4F72A 5C5DA 2YNMC 2V55B 2C0PA 3VTZA 1JAYA 2C4TA 1X7XA 3VYWA 3B8EA 3ND7A 5LXTF 3CE6A 3ESQA 2OC4A 3BC1A 4X92A 3D7RA 2GTPA 3EXFB 1F20A 4GUAA 1YF3A 3RAGA 4NJEA 5ALQA 2M6LA 2Z5VA 1S3FA 2ZAYA 2FGJA 3IJRA 3MAGA 2O4CA 3NAQA 5D51S 4B33A 4CM4A 4Y2QA 1L2TA 1U2RA 4U2DA 3ZQJA 1I6LA 4KMRA 3PXCX 1JXOA 4M87A 3WLMA 2DQZA 2FX3A 3I9LA 1L5WA 2VDWA 2EQBA 2JIDA 4A73A 1QJ4A 1DRUA 3IMCA 3L4BC 2C42A 4MQEB 4OUDA 3T5GA 4DLYA 5DWVA 4OUKX 1EX9A 2Y1KA 3Q2KA 4FHEA 1D2MA 2IQ5A 4HGZA 1DKPA 4K7JA 1VYUA 3UG7A 4BFWA 5EIFA 5P21A 1EG7A 3IV9A 4LNHA 1XRRA 3TZCA 2WDPA 4G0MA 2ETVA 4W1RA 4YECA 1UMKA 1DC8A 4KXVA 2FI1A 1QC5B 4M36A 4MVWA 3FTQA 4E7OA 2LXNA 3O4VA 5CX1A 4ED9A 3MMZA 4CU5A 3EIEA 2GUWA 1QV6A 2WD9A 4IXDA 3WKCA 4OBXA 1ADJA 1ZBQA 5JATA 5JCJA 1KR5A 1XEWX 3R7NA 6NULA 3WL6A 4ZYTA 2XGJA 1MQSA 1SU8A 5EMKA 4S1WA 2RHGB 4D9JA 2FDRA 1R9MA 4YBRA 1XQWA 4AX4A 5TEWA 1WW2A 1Y4AE 1ISGA 1WR8A 2OTCA 4OKNA 4KGDA 5JS7A 5JZOA 3E3NA 1XEXA 1UP4A 4FN4A 4UBIA 3RUPA 3PDUA 5IF3A 3WSVA 2VI5A 3NNNA 4O08A 2GYUA 2B1RA 2PRIA 2Z5GA 3OUTA 3ETCA 2RB4A 3IAXA 3SNHA 2GLUA 3WG9A 3FOEC 1DT3A 1MKYA 3NBQA 5J63A 5KS2A 2XIJA 3OY7A 1CERA 2B92A 2JK0A 3MCUA 4ID3A 1O0BA 3B3QA 2LV8A 3COZA 2G5TA 2ZTMA 1NJ5A 1W5TA 2B4TO 1VCIA 3O8CA 4B4DA 1W46A 3DM5A 3IQGX 2NO6A 1BU5A 1MJ5A 2M98A 1ADFA 3WI7A 4NV1A 4NZPA 2B1IA 1D04A 2Y27A 4UU0A 4DXAA 1CUBA 2HA0A 3CX6A 3CY6A 4QG7A 5ESWA 3Q3CA 2IH4A 1U0LA 2GBIA 4D4JA 2PUGA 4UPDA 2QTWB 2A5JA 1XTUA 2ZYAA 3C3MA 3IHLA 5BT8A 2EFJA 5THQA 3P2KA 5A4MS 3PHCA 4C1NA 4J6FA 5YASA 1UZMA 3ADKA 3NHWA 5D7BA 4Q4AB 4P93A 5DBFA 2ODBA 3OUZA 1WUYA 1KFEB 2CJFA 4BNMA 2FU5C 1UOQA 4Q82A 5EJGA 1ZHOA 2XYGA 1QG6A 2JEOA 1QHHB 1TDJA 2IDZA 3I0MA 3I9KA 4JI3B 4X65B 5K8UA 3I2JA 4IIBA 1YZUA 4N6OA 4PX5A 4FHZA 1FFWA 1XZBA 1MN6A 2GBLC 3F8TA 4AT1A 3QOXA 3TNDA 4ABYA 3SE0A 3BN3A 4R1TA 1UJBA 3QY9A 1FW6A 3EMDA 4HX2A 1GL6A 1UXKA 2XE4A 3CEAA 2H4FA 4LJ9A 1I4WA 4MUHA 1V5WA 3GB9A 4HTFB 4AZVA 5DLPA 1WG8A 2W70A 3TLBA 2FZKA 1NUPA 1NSFA 1KBQA 2YC2C 2I2CA 3FNBA 3B9PA 2XTZA 1M1YA 2CNWA 3F49S 1EFRA 2CLLB 3UJAA 3DDSA 3MJDA 2XYVA 3LRTA 1LQ2A 1RLMA 1XYGA 3CF0A 3FUTA 3JQ7B 4MLCA 4MQFB 5LYJA 2I6SA 5H02A 3SQOA 5CFMA 3ZH9B 1MDFA 1KZYC 2I4OA 3CKMA 1FMJA 1WULS 2ZANA 3K0EA 3PNOA 4DMRA 4KO3S 4UREA 4WMLA 1JTEA 2WVHA 3P4XA 5AI8A 5ALDA 5EXSA 1FFGA 3VAAA 1TYEB 1K4MA 4U9IS 3LM8A 3HU2A 4DR1B 1NU8A 2Q0HA 1VGRA 4P35A 3WQRA 1CP2A 4IIGA 1RQXA 2REQA 2V9CA 3VO2A 3PE6A 4M9ZA 3KPJA 2R25B 4QC2A 3OFSA 2V3WA 1CJVC 2BRUA 3Q98A 1AC5A 3CW9A 1SZJG 4C89A 1AHPA 4XE5A 1KOJA 2VTBA 3HM2A 1Z4LA 1FVXA 2DB3A 2F8SA 1G6Q1 3S7TA 1D09A 5BSWA 4R1NA 3WSTA 5JC8A 2Z6UA 1KI8A 1U5AA 2D5LA 4M8LA 4KPUB 3RSLA 2P3LA 2GJ9A 3AETA 2WU0A 2QRZA 4CDRA 1KPGA 1N2SA 3JALB 4XD7A 4YFVA 4RJTA 3OOWA 4DLKA 2IL1A 1J5EB 1ZIXA 3JV7A 1Y0BA 1YE3A 2GWHA 2C2GA 2BFFB 4HN2A 4MRVA 3BXEA 3DDZX 1QE0A 3UK1A 4AYWA 4YMUA 1S8FA 2Y2VA 3L18A 2QU7A 1LDNA 1QGYA 4WJLA 4C6HA 1V41E 4QYXA 2ZZMA 1RU3A 5H3CA 1DUVG 1ZJJA 5EIEA 5IDVA 4B7ZA 3OIVA 1HLFA 3FNEA 3QEBZ 1NMSA 1JVBA 2FMFA 4LISA 3HKCB 3VC1A 3KU4A 4DWJA 3CMMA 5JS6A 3BK1A 4QAQA 4ZI5A 4Z7QB 4NDZA 2PYZA 3H0KA 5FO0A 4CEIB 1VHTA 1DWQA 3TR0A 4M88A 5JNWA 1T9GS 5JXHA 3E35A 4I4CA 3IURA 3MT9A 4I81A 5UKDA 5HJ7A 4EO9A 1SCKA 1VSBA 2FN4A 4QOIA 1B4DA 5D8DA 4WEOA 5KVQA 3EBPA 4YXWD 3D6FA 4HQ6A 4X20A 3WFIA 3BXZA 3H4MA 3S2GA 4UAUA 7MDHA 3HGTA 1GRNA 1H4VB 2VEOA 2X4IA 3MTJA 3TD6A 5HIKA 3E84A 1M6VB 4NMHA 3BE4A 3HUDA 3LQ2A 3WJ2A 5FV7A 4DNPA 1YDFA 5F1PA 4AJ2A 5BN3B 4QGFA 2J9RA 4DDVA 2R66A 4NYIR 1TJYA 3ROZA 3U4GA 1FDWA 2J0QA 1TC2A 4P81A 4MUJA 3NHJA 4Y9DA 1CE8B 3SM3A 3D7NA 3ELUA 2DC1A 2GBCA 4Q3DA 1SUEA 2CXNA 2MYNA 4C6RA 4DJTA 1AKTA 3ZDAA 1WDWB 5EZSA 2QSUA 1RM0A 1ZGZA 1M0TA 1KIMA 2AXQA 4JBYA 4MVYA 4NLLA 5AK3A 4EW3A 1YFLA 3TSCA 1G3RA 5HSGA 4DR3B 3O8BA 4M54A 2J3HA 4DARA 5C46F 5LU8A 3LDAA 2I2DA 4PGGA 1R4MB 2R68A 3RYTC 4OQFA 3CZAA 1HURA 4EA8A 3PICA 2JLYA 2GERA 1VE1A 2Z6QA 5CBPA 1O5TA 4B6SA 3VKGA 2Q3MA 2QXTA 4HBZA 4UM7A 4EIWA 5F33A 4RA9B 3UF0A 2QWXA 3OFVA 3EVDA 2ZWMA 2JLSA 4D3SA 3OC6A 5IN5A 3PWZA 5JTUA 3PV0A 2YC4C 1RC1A 1Z73A 3C5CA 3CYFA 2EJCA 3HU5A 3MQ2A 4R01A 4N8SA 4MRMB 3PDWA 2RARA 5FL3A 1T35A 4HO1X 3D6NB 5H5JA 1OT5A 3MTQA 1ZGCA 4JJFA 4QU9A 4JASB 3KOOA 4K1LA 1P81A 1JIUA 2P75A 2VTVA 3BHIA 3JQDA 3ZS9A 1AJEA 4DC0A 1VA5A 2QORA 1BXZA 4MCHA 1R16A 2C58A 1GFZA 1U1CA 3LLVA 1NZDA 2JD0A 3IAFA 3KEOA 4JXJA 5I7OA 1W49A 3AERA 5JSQA 3FVVA 4B3HA 2C8LA 2WWYA 4MLDA 2Y0PA 4PGHA 3PQCA 2P0EA 4PSDA 2B6HA 4GMDA 1NBEA 3DC2A 2ZULA 3OMLA 2I7TA 2FPOA 3M81A 1BXKA 2F1OA 4LNAA 2ZZKA 4XDZA 4NK5A 4BVGA 2GFHA 2O8FB 2UAGA 2R65A 3PJDA 4F5WA 1J4AA 4Y6SA 2PLRA 2DETA 4Q1AA 1HDIA 1E4EA 3AH8A 4KKXB 2QTBA 4AKEA 3MWGA 2JH3A 2VZ8A 1XVVA 2BWJA 2O5VA 3GIDA 3O8LA 5ETJA 3HRHA 1PBNA 3FPEA 3MS2A 3OKAA 4NF2A 4DKXA 2HSWA 3DGFC 3NM6B 2P5YA 3IVMA 2CF6A 4MB2A 2GB4A 3KWLA 1OA0A 1XOIA 2F7SA 2YRWA 3JQAA 4AKIA 5BWMA 5I8PA 2OZVA 1N6PA 3V4RA 2HREA 3K1TA 3T7SA 1TRHA 2FF7A 2A59A 3GGGA 4I4TF 4ZMRA 4NBWA 3AM1A 1G4UR 1XEWY 4PQFA 2NO0A 2PGAA 4JQOA 1NLZA 4XI9A 1RZ3A 5HFJA 2WIAA 3PHIA 5JCOC 4OOEA 1K3UB 1IH8A 1QYDA 4QXRA 3DYBA 4YJ3A 4MWOA 1KMNA 4JOCA 1KZHA 3ZY2A 1Y5IA 4MUGA 1DEKA 1JXMA 4V3CA 4LGMA 1P0PA 5K2OA 2GH1A 1NZFA 3ESCA 4YJ3F 4JYMA 5AJUA 4EPVA 5C7YA 1LI4A 4EPYA 4Q37A 1E2MA 4CCWA 2PIDA 5JVDB 3KZVA 1YZQA 4B84A 3AR2A 4ZC8A 1G20E 4M2LA 1X80A 2MSNA 2HPHA 3CUUA 1M1ZA 2P6PA 3HHEA 1CUIA 3LPNA 1USUA 3I5MA 4X94A 3MWEB 4AKTA 2UVQA 1OWNA 1BHO1 5EKTA 1NKVA 3K9NA 3ICPA 1DMSA 1AVTA 3IVXA 2FPIA 3EEBA 3S8EA 4CNBA 1I0ZA 1PTJC 3C6YA 4P4UA 4QECA 3SG0A 4D6YA 1J5PA 4ESEA 1I9GA 3IIJA 1T8TA 2FPMA 3AKCA 3OAAA 4GZLA 1X7YB 4C14A 4UTRA 2MR6A 1XU9A 3IX7A 1CCWA 5ARBA 4IDOA 5BSHA 5KQGA 3KXDA 4DMFA 1NFRA 2FFRA 1OHHA 4KNYA 3PPYA 3F4LA 3LCMA 1HE5A 2UZ3A 2EKPA 2ALJA 1JW9B 1ZONA 1NYTA 1US8A 3LFTA 2GD6A 3B5JA 4NMLA 1YVRA 2Q3EA 3GXBA 3IAS1 4NU5A 3GP8A 4ARUA 2IYTA 5GIOE 1NQUA 4XKJA 3N0TA 4MMZB 2HCTA 3OTHA 4H7HA 4TTVA 3UB2A 3NNDA 3I3SR 3OKCA 2Q21A 1E0JA 1UJ5A 1OROA 1JG6A 1JQ3A 1ZJ4A 3K92A 1KDTA 3DCYA 3WLLA 4Z99A 4NBVA 1NMEA 2VF4X 4LCJA 4QL3A 3EG5A 4J0CA 4UUAA 1C4XA 2EG5A 1GHTA 2HB6A 5HNKA 1HGXA 3IEVA 2NU6B 2OMKA 2WUVA 3DEAA 2B1GA 3IMEA 4ADSG 2MHCA 2AJDA 4CMHA 2HWKA 4EHDA 4UVEA 2ZS7A 4LJAA 1MRSA 3I04M 1O95A 3TB6A 1SZCA 3EUWA 3DZGA 3PXAA 4YMHA 2E5WA 1KIAA 2WMNB 3HKEA 1IATA 3VI4B 3P9KA 2DG2A 3ZHVA 1T5TA 3TD9A 1R27A 1PF7E 4BWVA 2O1WA 3II6X 2ERCA 3GGDA 1XROA 1JX6A 3PR1A 3AXTA 4MVJA 1GDTA 3JVEA 1XRJA 3UAWA 1DTWB 1PGQA 1EVIA 2JVKA 1OY1A 5E2IA 1BWQA 1N8TA 1BH6A 1E2QA 2Y0EA 3CUWA 3RIXA 3LFUA 3KSRA 2R47A 5IKMA 3BE5A 3DHEA 5E95A 5JD4A 1B76A 1B43A 3HO6A 4RKFA 1NQOA 1FYFA 1Y3IA 3H2YA 4Y2SA 3RABA 5AVVA 4NG4A 2TS1A 4MGKR 1U80A 1K5GA 1XHLA 3KEMA 4M1QA 3T7RA 4RXTA 4AWAA 4MV1A 4BB6A 3BMNA 3CUTA 1EHIA 4QOSA 1S9HA 2QTRA 4RGQA 4CTMA 1URPA 4B3FX 1K97A 1K6JA 3NJ8A 3BRSA 4XYEA 1RBMA 3H3JA 3DVSX 4P6VF 3OZFA 4CR7A 1BCSB 1IVNA 2QDKA 2ZRKA 1IUOA 3CZCA 3A9UA 4M83A 3GLIA 3S2ZA 3H19A 4S1OA 1HZZA 4PNZA 1JE0A 1SPXA 5JC1A 1QV7A 2DBYA 4GUDA 2BFBB 4Q4LA 2NM0A 4FX5A 1HRDA 1ZH4A 1BA2A 5EIWA 1U65A 4ENQA 1NOJA 2Y68A 4RW0A 2PVCA 3TLEA 4HB4A 2GN9A 5FPPA 4QVIA 4DQKA 1NJGA 4LSZA 2CLMB 4E1AA 5I7SA 3ICWA 4EEZA 1COWA 3NVDA 4Y2UA 5JRZA 2J3QA 4F5DA 2WWFA 4LC0A 2NYAA 4DIOA 1U3GA 1E59A 1OX4A 1RYMA 1RWQA 2W6MA 3EIFA 4CWAA 3CF2A 4AN4A 3B1YA 1YQEA 5BYAA 3ZIDA 1JYEA 4IFEA 4WLVA 1RZRD 2YMMA 4OMCA 1XJQA 3E82A 2E6KA 4IGIA 1KI3A 4ZYUA 4Y8VA 2QMUA 3H9UA 2I34A 3D1VA 1SBNE 2ZXEA 3K4QA 4TS9A 3F90A 3UT0A 4QGGA 5A6SB 3RGWS 1ZEMA 4P54A 1CQPA 1B41A 1W2GA 2OCKA 3EXAA 3VKWA 1XJCA 3E0QA 4ME6A 3LHFA 4F1JA 3U40A 5C0OE 4UTNA 1V5IA 4AQ7A 2X8JB 1HUQA 2Q50A 4MCJA 4RACA 1FDVA 4P2BA 5E6SB 2AYZA 3H1EA 5FORA 1RHJA 4FJ2A 2JHCA 3D8TA 3V7NA 5JARA 1V7QA 2PSJA 3DBRB 4RY9A 2NPOA 1RMQA 2FWMX 1D07A 3UFXB 3L43A 3C3BA 2JS7A 5C7LO 3KPWA 1PT6A 3RV4A 4BECA 5MFZA 5TRTA 1KZ1A 2V0CA 4RF5A 3PFWO 2WTAA 3O94A 4L74A 4KJXA 3ST7A 1QZZA 1NKTA 4CETA 4KIWA 4U7DA 1UBNA 3EZFA 4YREA 2ATVA 1DE0A 2VS1A 2X7XA 2HPAA 2R11A 1WP4A 4H4DA 4EFKA 4F2GA 3FDXA 1WDTA 2YZMA 3IQIX 3ZD9A 1N2ZA 1XBTA 1TUIA 1UBFA 2BEVB 2WLTA 2H06A 1TT5A 2JDID 4JMLA 4MW2A 4BMDA 4MAMA 1DQZA 3CG4A 2ASVA 4RDIA 5A4JA 5SYAA 4IL5A 3BWCA 3C48A 3L40A 3BF8A 4HK4A 1J2RA 1I3KA 4CF7A 2P5SA 1L8QA 1RVDA 1NV8A 4KXYA 4B1FA 1MB2A 2R62A 1I4DD 2Z98A 3GCWA 1I9CA 1PRYA 3G2IA 4HUQA 3BCUA 3T9CA 3USZA 1XKTA 1Q0QA 2J9YB 3ENWA 2V3CC 3HJFA 3PQ8A 3L8EA 4TRJA 2XWQA 2WBLC 3A1UA 3G0OA 4RF3A 1T9CA 2I80A 3PWSA 3H83A 3WBBA 1E2PA 3IEKA 1YNOA 2YWGA 1ESMA 3WNZA 3P5BA 4EO4A 3L41A 2IDMA 4ZVLA 3LV8A 1L5MA 1YJCA 4RTRA 3KG2A 2VP0A 4CLEA 1YB7A 3EYAA 4LZOA 2AXNA 1BEEA 3V4LA 4XWOA 4WXRA 3VUEA 2JLXA 3EVCA 3K2BA 4NONA 4G2TA 1TU4A 3SX4A 4L3OA 1SC1A 1G41A 1UIMA 1XSEA 1J7KA 3C85A 2M6RA 3QLTA 4ZVOA 2XITA 4YAKA 1PV4A 1J7JA 1DXYA 4RKQA 3RS5A 4D8TA 1NBWB 1EUCB 1LFAA 4TMFA 4D9EA 5BYKA 3N2GA 1QBGA 4KK3A 3ME5A 4WESB 2W4QA 4CN9A 3EF0A 3PNMA 3OE7A 3PRYA 4Q47A 1XQ1A 3ETJA 3FI9A 3GYBA 3K7EA 3R5FA 3RTEA 2XY4A 4V02A 4ZV4A 1DZIA 3LW7A 3OCCA 4GE3A 4TLBA 4R83A 2FZLA 2G9NA 1Z5PA 2FX2A 2J9GA 2UUOA 4JX9A 3TI7A 1WOYA 3MWDA 3GCDA 1QKKA 4U7TB 1H65A 3FKSA 3GRUA 3EODA 2YFQA 2H0AA 3RUCA 3WV5A 4B5KA 1ZSYA 1ACLA 1FVFA 1LSJA 2AF4C 2JFXA 1N4AA 3ADOA 5IAEA 3VR1A 4JROA 2V74B 3S2SA 2BGWA 3WGUA 1PT7A 2JB9A 5B1HA 5JBIA 2W6NA 2VK8A 5JFOA 3WQSB 3RVJA 5MN5A 2FZWA 2PZLA 1UWCA 2EFCB 5FI0B 1KWKA 1U94A 5C1IA 4KR2A 4R8LA 2QJRA 1OR8A 4F3RA 3W1VA 1OJ7A 3TW8A 3FLEA 2J0EA 4ZJPA 4KPGA 3F67A 1B2LA 1P77A 4G37A 4K9QA 4O2BA 5E7QA 5JSKA 4CMJA 2R1UA 5I47A 1R0WA 2VJKA 3KDSE 3OCYA 2AOUB 1RCFA 2IV2X 1NFQA 4I1YA 2Q2NA 1T10A 2IEYA 5JZMA 3ISVA 1FS6A 1GTVA 2I7VA 4I1UA 1FS5A 1TM2A 3ZNPA 4ZAFA 4AS3A 5C31A 1M2EA 1ZHHA 2I1VB 3F5MA 3RJ5A 4DJEC 2GZHA 1PSZA 2CMDA 1IBMB 4UU8A 4NYMQ 1Z8FA 3W3ZB 3GBPA 1Z29A 2P6UA 4IBOA 2P2GA 3QF4A 2R1TA 1NYRA 3LL7A 2C95A 4D41A 4YLEA 1OXTA 3GUZA 4EQZA 3JARB 4HB0A 4UUMA 2ZRDA 5TS3A 3JZFA 5TNXA 2NU9A 3F8SA 2QIPA 2XV1A 1Q1BA 2RK3A 2WSSA 1QBKC 4QVGA 5ED0A 1DBWA 4BGEA 1XDDA 4B3MB 3GLKA 2XNHA 4OGGA 2NYUA 1X9IA 3AUJB 1ZH0A 2VHVA 3RTDA 3HYRA 2A0UA 3KFVA 2FZGA 3LQ1A 3PQEA 1HTTA 4IF6A 5E1BA 3I2YX 3LKDA 2PJRA 4M21A 1FLNA 1X1TA 4DOMA 2JI9A 5TX7A 3SQXA 4DRXA 2AA3A 2GCOB 2HI0A 3DT9A 3H3XA 2GKGA 3U4DA 5IHPA 4LY6A 4RD3A 1M74A 3QE4A 5AHKA 1OGYA 3T7IA 2C5BA 2JAPA 1H0KA 2B20A 3GJ3A 1R37A 4YUAA 2ID7A 4RS4A 1SBCA 3AM4A 3ANLA 3MWLA 1LPOA 1TZMA 1SUIA 5EJ7A 2C2ZA 2QQFA 1QK4A 1VIDA 2YRXA 4WX2B 4YRFA 1GYPA 5EE3A 4JB3A 2ZJYA 1EFLA 3BFPA 1DARA 3RYHB 4Y1GA 1L5LA 1X77A 5LLSA 1XCGB 2TMDA 4FUQA 3DV2A 4ISCA 1XCJA 2WHEA 4MRPA 4W99A 4U2BA 4KE6A 5E9AA 3W5HA 3ZZ0A 1LLUA 4E2ZA 1CY6A