2R25B

Complex of ypd1 and sln1-r1 with bound mg2+ and bef3-
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
TSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/transferase
molecule keywords Phosphorelay intermediate protein YPD1
publication title Crystal structure of a complex between the phosphorelay protein YPD1 and the response regulator domain of SLN1 bound to a phosphoryl analog
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 40
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r25B00
1FFWA 1YMUA 2MSLA 4W5TA 1VPWA 3SM9A 4QYWA 3L6UA 4KVFA 1QKKA 3K4HA 4OLAA 2R48A 5B3JA 1GUDA 2JB9A 1Z12A 3DLHA 3KJXA 1E6KA 3HXMA 2BGGA 4YR7A 2F8TA 3RVNA 4YO7A 4GPAA 4KV7A 1DRJA 1LBHA 2MYTA 3UUGA 4KPYA 1VKRA 3GRCA 2QW1A 2Q5CA 6CHYA 3TO5A 4D6XA 4UHJA 4D74A 4S05A 4PYRA 1JYFA 2FMKA 4RU1A 3JS5A 3OO1A 3CU5A 2PUFA 2ZWMA 2QV0A 1DRKA 2E4UA 3QX8A 5T3YA 1L5ZA 2PL1A 3ROTA 1DCFA 1EHCA 5DCLA 4Z9BA 4YLEA 2E4XA 2H3HA 3NNNA 3A10A 1A0OA 1XWWA 4ETIA 2OQRA 4GNRA 5PNTA 3RVQA 1ZVVA 1JDPA 3ILYA 3KLOA 1ZAYA 3TD9A 3GYBA 4HNRA 4N41A 3JPWA 3IP5A 3MMNA 5TE9A 1JYEA 3JVDA 1C4WA 1GLGA 3FGZA 5TQ2B 3KSMA 4RZSA 3RVMA 1E6LA 4MRMA 1KMIY 1CHNA 3FFTA 4HYEA 4KREA 1F51E 2HSGA 3DGFC 4XFKA 1Z18A 4QPJC 1I3CA 2PUGA 2JK1A 3H5IA 3IDOA 4G0QA 3O2QB 2KYRA 1OXKB 1QMPA 2IPMA 4Z0NA 3CHYA 4M88A 4MQEB 4RDCA 1NTRA 4RY8A 4O1IA 3W9SA 5KI6A 3EQ2A 4EYKA 1EWKA 3KG2A 2QVGA 3BBLA 1Z13A 2IDMA 2LIVA 3SG0A 2E4VA 1CEYA 4MQFB 2VUIB 4Z9AA 3SY8A 4WXMA 1P8AA 3TMYA 2HQBA 2FQWA 8ABPA 5JNVA 3F6PA 4F12A 1Z2DA 2IYNA 3EDCA 3MIZA 4B09A 2PKXA 2RJNA 3IPAA 5F64A 3C3MA 5IUKC 2TMYA 3CS3A 4W5QA 3L49A 3O1IC 4YV7A 4Z99A 4RWEA 2NT4A 4RS3A 3A0UA 3HV2A 1K68A 3K9CA 3O74A 3MQ4A 1NXSA 4L85A 4ETMA 3UKJA 1NXPA 3H5LA 3LTEA 2QVCA 7ABPA 2QXYA 4O1HA 3O21A 4XAQA 5IUJC 2JBAB 4F06A 3GV0A 4Z4GA 2NT3A 1K66A 4ML3A 4DQDA 2AYXA 3FMVA 4KK4A 4EUKA 4RY0A 3FDFA 5EWJB 4P1ZA 2PUEA 1ZGGA 3VNAA 3EJWA 5JNRA 2WWVD 3LUAA 4RXTA 5TQJA 4YP9A 1OXBB 1YS6A 3FFXA 4H3HB 4MS3A 3MF4A 2PUDA 1E2BA 3SNKA 1T34A 2GI4A 2IKSA 5I4CA 5KWSA 2MYUA 5DKFA 3KYIB 3BREA 4MYRA 2RDMA 3C6QA 4RK7A 3T95A 4ZPJA 3BILA 5JNTA 5D2CA 1BDHA 2WMYA 1M2EA 4MR9B 4PEVA 1KGSA 2WJWA 4MQEA 4G0ZA 1DBQA 1TMYA 5IEJA 3VNBA 1BDJA 4RK5A 3NNSA 1NATA 3O75A 1SD5A 3OLXA 4Y9TA 2PE5A 4KRFA 3M6MD 1DBPA 1U0SY 5EWLA 2LBPA 3G85A 3H1FA 3LKBA 5CHYA 2P4UA 2N9UA 5HQJA 5T7BA 1LBIA 4FB4A 1Z2EA 1YK0A 2AYZA 3RVKA 1NXVA 4IMJB 4KFCA 1MAVA 1TM2A 3EAFA 3HDVA 3DZDA 3GT7A 1ZY2A 4G97A 1SRRA 1RXEA 3LUJA 1YIOA 5EWMB 2FEWB 3G1WA 1KRXA 3QLVC 2FW0A 4LZLA 1P6QA 4TMYA 3T38A 2A9RA 1VRVA 4JB0A 3DBIA 4G0PA 3KYJB 4H60A 5TQ0B 2FVYA 2FMHA 2MSKA 3RVSA 1QP0A 1GCGA 3RQIA 4EVRA 1IIBA 3O2SB 4ZMSA 2NZUG 3MYYA 4NCAA 4RXUA 3URMA 2R4QA 3HSYA 2CD7A 1XHFA 2WJAA 4IRXA 3KHTA 4XASA 1NY5A 1QNLA 2CHEA 2PJUA 3O2JA 4YGXB 1PNTA 5KC8A 3EODA 5B3JC 2FEKA 2PUBA 1CYEA 3GBVA 5FWYB 1APBA 3JPYA 4MS1B 5C5EA 1AB6A 2L2QA 4MR8B 1PEYA 3QEMA 3HUUA 2FXIA 3A0RB 3LUFA 3GL9A 4Q6WA 4QYMA 1ZESA 3H5OA 3RVJA 1URPA 2QU7A 2JRLA 1ZN2A 4MAAA 4P98A 1F4VA 5TPZA 3BRQA 2VUHB 2R25B 1PHRA 4LX8A 4RXMA 5HKOA 3N0RA 1UDRA 4ZMRA 1Z25A 1DC8A 4JP1A 3GBPA 5BR1A 4N47A 3H5VA 5BRAA 1YS7A 1J56A 4Z4HA 2PMCA 5CNMA 3KCNA 1YMVA 1P6UA 4L4UA 1Z15A 3C3WA 4W5NA 4JA2A 2A9OA 5CNIA 4MR7B 4W5RA 3CFYA 3NHMA 3JTEA 3E3MA 1DCKA 5JS2A 1RXIA 1WETA 5HM6A 5JNSA 3NNDA 4MLDA 3LUHA 4OG2A 5IBQA 4YRZA 2L19A 1JBEA 2GX6A 1RPJA 3Q15C 2FQXA 4MS4B 3QK7A 3HJFA 2FLWA 4NQRA 5TPZD 2NZVG 4HNSA 1Z26A 1JFTA 4G86A 5TPWB 1USIA 2I6FA 4IILA 1JX6A 2FMFA 3LOPA 4LE2A 4KMRA 3Q7TA 5C5CA 4JOQA 5JS1A 2VYCA 1B00A 2PUAA 1DJMA 2H0AA 1NXWA 2WRZA 4DADA 5KQLA 2GBPA 1M5UA 4E7OA 3TX6A 5JNWA 3JVIA 4UHKA 4O5AA 2IOYA 4IGAA 3Q7RA 2QR3A 3CG0A 4E7PA 4KNYA 2A9PA 2DRIA 3EULA 3H5TA 1H9CA 4TN5A 3QEKA 1E6MA 1U2QA 1DG9A 2B1JA 3A3KA 1BDIA 1YTUA 1QP4A 2JVIA 1ZHHA 5FWXB 1DP4A 4EVQA 4RKQA 4WWHA 3S99A 1GUBA 5IX8A 1RZRA 1BVHA 4IF4A 1QO0A 5TQ2A 3CZ5A 2B4AA 4EYGA 4XLTA 1RNLA 3QLUA 4TLMB 4LE0A 3T8YA 3R0JA 1MVOA 2ID7A 4MS1A 4RKRA 4LE1A 4MR8A 4EYQA 1ZDMA 3N0XA 1TVMA 1DCMA 3N0WA 3LKVA 3SQNA 1PNRA 5JNUA 1KRWA 9ABPA 2O20A 3H5WA 4H3KB 4KQCA 1FSPA 2JCGA 1JL3A 3H6GA 3RVLA 3QELB 1SXHA 4MRMB 1TJYA 3HK2A 4RK1A 3OLZA 1QPZA 3LMKA 3O1JC 5KQMA 1P2FA 3LUDA 4F8JA 1RZRD 4Z4FA 1USGA 1QO0D 1JF8A 5E3JA 3HEBA 2FSPA 1SXGA 4MQFA 4JASB 1NXXA 4EYOA 1DZ3A 3M9WA 1NXTA 2WY2D 1MIHA 3OM1A 3Q41A 1JFSA 3OQMA 1QQBA 2FTKE 1ZH4A 5KQPA 4N03A 2P9HA 1VLZA 4MLCA 2FKAA 3F7NA 1ZGZA 3ILHA 1TLFA 4KK3A 1M5TA 1BA2A 4YCSA 2A9QA 3OQOA 2ZAYA 5GOTA 2CWDA 2CHFA 3QLTA 3IP6A 4XARA 3N53A 3IP7A 3HCWA 2QSJA 1XHEA 3OLWA 4Z4IA 1LK0A 3LUCA 1DBWA 3OM0A 3TB6A 2MYNA 2L17A 1YVUA 2E4WA 4Z4EA 4F3TA 1Y1LA 2JVJA 4N0PA 1MB3A 1D4ZA 4MPTA 1EAYA 2JBAA 4F11A 5CNJA 3SAJA 1W9HA 3IP9A 4WUTA 2HQOA 3M9XA 5FBKA 1SXIA 3OO0A 1ZITA 4FE7A 3LUGA 3RVOA 5DGCA 1NXOA 5EWJA 1Z17A 3H1EA 5FWXA 2PL9A 3UK0A 3KKEA 2NUBA 1ISSA 3OLVA 5BQ3A 4G0MA 1QP7A 3BRSA 4ZYLA 4RK6A 5FBHA 2FEPA 3GWGA 3RVPA 4S04A 1HEYA 3NHZA 2RJOA 3RVRA 4EVSA 2FQYA 1EFAA 4HNQA 5IEBA 3HO1A 2E4YA 1USKA 1PEAA 1U04A 1U8TA 2IPLA 5ABPA 4YWHA 1R8JA 2WB4A 4MS3B 4N76A 3QELA 4MR9A 4WXEA 1C0EA 2RGYA 2HPHA 4D6YA 3H75A 1M2FA 1LJLA 3DGEC 3E61A 5DLEA 2MSWA 4NCBA 3I5AA 4PICA 4CBVA 2F8SA 4ETNA 3F73A 2V0NA 3HDGA 3KLNA 5IC5A 1EWVA 3FFWA 3C3KA 1AB5A 1JWLA 4QICA 3H1GA 3P9YA 4Z4CA 3HVRA 1EWTA 1ABFA 5HSGA 3RH0A 3F6CA 2M1ZA 2XDYA 3Q7SA 4XXHA 3QX9A 2LPMA 4OLBA 3I42A 4WT7A 4G0YA 4KZKA 1S8NA 4LDAA 2VK2A 2E4ZA 3D8UA 3N6VA 3I45A 4EGSA 2FMIA 2J48A 1PUXA 4PZ0A 5EWLB 4PE5B 3I09A 3N75A 2PLNA 5EWMA 4IMIB 3KTOA 2JVKA 1ISRA 4Q7EA 4LRQA 2X7XA 3ROFA 4G0XA 4RSMA 5CNKA 2YHBA 3HM9A 1W25A 4RK0A 4OTZA 2LUOA 3CLKA 3OMXA 5IULC 5TQ0A 2YHAA 3OQNA 2GKGA 3D02A 1MB0A 3OMWA 3JY6A 5KC9A 3MM4A 4TLLB 3T6KA 1FFGA 4NICA 2LP4Y 5IUNC 4MGEA 4KQ9A 5KQGA 1QQAA 2MYPA 1D5WA 3CNBA 3DLBA 2R47A 4OBBA 3CG4A 3HZHA 4JAVC 3KS9A 4RY9A 4W5OA 1D1QA 1ABEA 2FLKA 1D2AA 5FWYA 3OLYA 1JDNA 3H6HA 1JFVA 3O1HB 4RK4A 1LJUA 2L18A 4YS6A 5GQSA 4RV5A 3LUKA 2M98A 2HQRA 2ID9A 4DN6A 4WZZA 3NBMA 1BAPA 2FN9A 1L5YA 2GWRA 2PAFA 1JLKA 1FQWA 4EY3A 3C97A 1Z16A 3N8IA 3QEMB 5ED4A 1A04A 1U2PA 1FFSA 3CRNA 3CZCA 2PUCA 3GA5A 3HUTA 4N0QA 1A2OA 1ZH2A 2QZJA 2HJ9A 3MA0A 3Q9SA 4JB2A 2FN8A 3CKMA 5DTEA 3QLVA 2W42A 2IPNA 4MR7A 2OENG 4NV3A 1JH9A 4ZJPA 3B2NA 3EQZA 3HS3A 1GCAA 1JHZA 4G0OA 5BRJA 3CTPA 4OATA 4Q6BA 1D1PA 3LFTA 1YK1A 4FE4A 3QLUC 4MS4A 3IPCA 6ABPA 4LDZA 5TPWA 2IPAB 1DC7A 3EGCA
chains in the Genus database with same CATH superfamily
1FFWA 3G1UA 3WYDA 4BEJA 5IWCA 1U28A 4M1ZA 3SM9A 5JQGB 1NJSA 2R8BA 3O8DA 2QX6A 3EGWA 2JB9A 2WV7A 3QX7A 1S4QA 4Y2XA 3HXMA 2YWEA 2EYUA 2ZIXA 1IHDA 4QU0A 2PNJA 1L4KA 2ZS8A 3A3YA 2C2OA 1N9KA 3KVVA 4OQZA 5EUQB 5FBRB 1J8YF 2Q5CA 4CQLB 4JT9A 3ZBPA 4ZYZA 1DFIA 1VIDA 3TCNA 3A4IA 5AK0A 1X2EA 2FZWA 1KI8A 1WD7A 2GXSA 3FX2A 4QU8A 4HLNA 3B9BA 1HSZA 2FK8A 2V6IA 3ONNA 1E3SA 3S68A 4C4TA 4YP0A 2AC2A 3NKVA 1NW6A 2GSDA 2RHRA 3TAHA 5FAKA 1LBQA 3L1KA 3DE4X 3KJFA 5EJAA 5C53B 1W48A 4TS4A 1M6HA 2PL5A 2R8YA 1YGYA 3FFBA 4TMTA 2C88A 1ETHA 3ES9A 1XFDA 3STXA 2WV9A 4GH5A 5FWNA 4QEZA 1XCMA 3PEYA 1D4OA 3D7NA 4MMZB 3DHVA 1U9IC 2HMVA 4PLYA 4GOND 1AUQA 3OMLA 4EABA 5CVTA 5IXYA 1BXKA 3UV3A 3FGZA 1TDJA 2VWPA 3PICA 3RE1A 2Q29A 4PPFA 1E6LA 5P8WA 5IVHA 1JSZA 3TJMA 2NXWA 5TS3A 4RZQA 2VNAA 2AX4A 1JB9A 2C2YA 3AF3A 4NYJR 4KHZA 1JIKA 4OQXA 4XIYA 1YZLA 3PLNA 4PHGA 4ASUA 2SCUA 3TVDA 2H31A 2HBRA 2OGUA 1P7PA 3V4OA 1V4NA 4E14A 1Y9ZA 1KZYC 3KYDB 3A8TA 1QMPA 3CRMA 5IKXA 3TLKA 2YJNA 3PR2B 4YMUA 3TR0A 2J3LA 3IHWA 3HA5A 1TO2E 2VHYA 3PXGA 4IGFA 5AMXA 3IR6A 2NW6A 4HRYA 1W47A 1XZPA 2IP2A 4ZDJA 1ENOA 1N8SA 2IS2A 3HFSA 3KNZA 4D44A 4FGKA 1Z6YA 1F3LA 5LOVF 3FYUC 3OF2A 5J2UB 3F6PA 3C6KA 2ZWVA 4QM7A 2FW8A 4H0NA 3IKJA 2QPTA 1V3UA 4MJ3A 3X1JA 3IUNA 1ZM2A 2EGHA 2FW7A 2Z0MA 3LO5A 4RVNA 3BXFA 4NE7A 2QMYA 5LUBA 1VL6A 5BXYA 3RC8A 4B3JA 1JB1A 2IGTA 3MCVA 2B37A 3LD9A 4WXYB 1KR2A 3KTAB 2IUFA 4OQLA 4ZKEA 1ZL0A 4IGEA 4GQBA 3T7EA 2Z4SA 2H9YA 2ACVA 4K88A 4LY6A 1NDUA 4NMWA 5DK6A 4BJ5A 4K9NA 1FDVA 1ZK3A 3PUZA 4Y1FA 2QVCA 4G1VA 3NORA 3A2KA 1KRHA 2PMDA 2TECE 3O21A 1SZPA 1ZVQA 3KOUA 4TXHA 4XAQA 4CLXA 1A9PA 3V8EA 1WQ4A 3LECA 1ZMXA 4MAFA 2H29A 5E6UA 3UZUA 2H5LA 3G59A 5GAJA 3FDFA 2GEVA 3RS9A 1CRPA 3A6GA 5DIFA 1ESMA 2OHOA 1E1MA 3D5EA 5IZ4A 5KVCA 2A8YA 1WP9A 3W7BA 2UXDB 5JRZA 1A7AA 3VR4D 3R75A 3ESZA 3CPHA 3SNKA 1WRBA 1T5DX 3DAYA 4FEAA 3AXTA 3WFZA 1IMJA 3VPBA 4EP1A 2WU1A 3I28A 5JDIC 4LYAA 3M70A 4RVUA 2CLMB 2Z57A 5GINE 5DTIA 2HNBA 2YMLA 3K20A 4OHBA 5L7YA 5T4BA 1UZLA 7MDHA 4MYRA 1S2DA 3SHTA 3GT4A 1K98A 3QW2A 4LTDA 2IHZA 1IOZA 2CE7A 5FR2A 2QL7A 4QHYA 3A6HA 3QMPA 4K2AA 4UDYX 2FFRA 2IYLD 5DBHX 4ZTBA 3ZZ0A 3AKCA 2FZ4A 2AWNA 2QXTA 3NFYA 3WYAA 3TPCA 3QU2A 4HC4A 3VYVA 4JJ7A 3QQ5A 4RK5A 2VHCA 2WHEA 4CV2A 1POWA 5IT0A 3S7ZA 3BA1A 1JHVA 1TUEA 3DYVA 3L93A 2H4JA 2X3FA 2XMZA 2ONCA 5CLLA 3G9XA 3DFFA 2J3DA 2LBPA 4IDPA 3BG5A 3O82A 3OESA 5FOWA 1RXCA 3SSMA 3WTCA 2DWQA 1Q0HA 3E8XA 3RBZA 2ECPA 1XF9A 2AYZA 1F7VA 5IW8A 4K9RA 4Q3DA 4DMLA 3FMIA 1AMUA 3Q3GE 1RKVA 3BRWA 1KARA 4G07A 2FMXA 4JY7A 3SZMA 3L6DA 1KMHB 2FEWB 1NTOA 1NIJA 3BMNB 3G1WA 2BHLA 5HIIA 5U4XA 2R2GA 1L7QA 3TK1A 4DG8A 2GK3A 3F8SA 4O6VA 2GN2A 1SIWA 1WSBA 4QJ3A 3BSFA 3EMKA 3K9HA 3RUEA 1XD2B 2ISCA 2NO1A 2QRVB 3QBJA 2A9VA 4RDIA 4XE5A 4FJ1A 1W4BA 2V6JA 2JGLA 1A1VA 2D1TA 2G80A 2CD7A 4I8IA 4E0BA 5B58T 3GLVA 1NBOA 2YY5A 4LSGA 4HYQA 3G0BA 5LLSA 2NTJA 1NY5A 1I3OA 3O2JA 4UTRA 1J0EA 4NOMA 5IK2D 3E7WA 5IVKA 2OGWA 4ZQEA 5CFOA 2L2QA 3FPGA 4A8JB 4FM9A 1AQJA 3VGJA 1CE8A 1QBGA 1AOXA 1H4VB 4WBNB 3KQHA 1U8XX 2EFCB 4RMGA 5AUQA 1MOQA 4REQA 4XLLA 2IV7A 3UYLA 4BGVA 4ZHQB 4C6SA 2JRLA 2GARA 3ENQA 4C89A 2P11A 2Q49A 3ZDYB 2A0WA 2Y76A 3HSSA 4UFPA 1GKUB 1TM3E 5HKLA 5C8YB 4RVDA 1KE2A 1WMSA 4GVPA 2DPXA 5DBOA 2H4YA 4D3XA 4FWBA 4EMSA 3H2BA 4QQKA 4ZK6A 4N47A 2P5YA 1A8PA 5L51A 2KWIA 4Q37A 2X3YA 1R3UA 3JQ7A 2IY7A 2EFEB 4KFUA 5DCYA 4BZWA 1NQUA 1RYDA 4RHXA 3D8BA 1UDCA 3WFJA 1CJSA 5CNIA 3REGA 4BLQA 4Q4JA 5KB3A 5KNDH 4P4NA 1ZVKA 4ZRNA 4J2HA 2AR9A 3WL7A 1F2TA 3FAKA 3OIUA 4BWGA 3RGWS 3ZE8A 3SC2B 2GBLC 3PNBA 5GIPE 4DV6B 4X54A 4NCHA 1QHYA 2J5KA 2J6HA 3PJRA 1W2GA 2WYIA 1T6BY 3QK7A 4J8PA 4L16A 2UZ1A 3T7IA 2VR1A 4L2IB 3RSHA 1WU8A 3IDZA 1MC1A 1PIWA 2CXNA 3CEMA 3P2MA 4G5XA 4GPEA 3OICA 4FWIB 4IILA 4JVOA 1K6MA 4H08A 2W2TA 4L7QA 4LE2A 4KMRA 4UHCA 5H1YA 3PXCX 5JARA 1XTPA 1QTRA 3UENA 3PDJA 1U8UA 3PA6A 3MTBA 1RRFA 4HK4A 5E3IA 1M1ZA 2WIFA 3RUCA 3W5UA 4CVNA 1OC4A 4M76B 4OXXA 4RJJA 5E7MA 3BMNA 4J1TA 3VKFA 1E3LA 4FC7A 1UFVA 3OE7A 1EGVB 5CMLA 4EHJA 1RC8A 1CUSA 3VR5D 4EQZA 3NAZA 1XL0A 4BJHB 5LKRA 5JRJA 1S96A 2XEDA 4IGAA 4P2GA 1JJ7A 5DF1A 3CG0A 3TRIA 1GDHA 1PX2A 1AHNA 1KI3A 1XD2A 1H9BA 1MA0A 2GM9A 2IYAA 4E6PA 1V7PC 2YZMA 1X1DA 1XZFA 3GJYA 3IE2A 3IQGX 5FWXB 1VJ1A 3KJNA 4RKQA 2DUUA 5K03A 2O14A 5CFLA 5BYAA 4UUMA 1DG1G 2IKQA 5G2OA 1KK1A 4YNBA 3FDZB 2J3HA 4QXPA 1UDWA 4Q9NA 3T8YA 3R0JA 4WFIA 2YXLA 1R9JA 1U2RA 5K05A 1ID8A 4G01B 4DLRA 1Z47A 4PR3A 1QANA 5JXHA 4WBNA 3LKVA 4RPKA 1US8B 3RTEA 1DHRA 1XD8A 4GM1A 4KQCA 5DT9A 2O07A 3GFPA 3K9NA 3QELB 3VYRB 4MRMB 1CY4A 3IOEA 4B80A 1TXGA 2ZJBA 2WU8A 4FGWA 2VYND 3TOCA 3KM0A 1NUQA 1OROA 1Q14A 5K3FB 3Q85A 2EATA 1E1CB 3HU1A 1M73E 3LMKA 1ZZGA 3NDPA 3CLTC 5F77A 1YWGO 4G25A 2V3CC 4A26A 4C6HA 3OZBA 1N5OX 2IIBA 2BUCA 3MUFA 1RYEA 1KDZA 4EB3A 3N8NA 5DNYB 1SXGA 4DM3A 2HHJA 3ZJTA 3SOPA 3H19A 5BY2A 3BTOA 4AY4A 1C4XA 1QOQB 3M9WA 3QM1A 4WASA 3ANSA 3RRNA 3ABZA 3UCXA 2FTKE 2HTEA 5A9SA 3GFFA 4MEJA 4O1MA 5B2FA 2ZTMA 1VFNA 2II6A 2IU4A 1PFYA 1REQB 2FKAA 3AJ9A 3ZLTA 2A86A 2CXUA 5G3ZA 3Q5GA 4KJZA 1WA5A 121PA 3OHPA 3CVWA 1G41A 1XVAA 3QGMA 4WK4B 5FLEX 3WKCA 2RKBA 4Y2QA 1NYRA 2W48A 3U7QA 2B5OA 4JLPA 1HQKA 2QSJA 3RG8A 1W93A 1YFLA 2GFHA 4EECA 1MEOA 3W0LB 2XUGA 2JL1A 1UPXA 3BXZA 3DL2A 3U1BA 4O4LF 4RPIA 2REQB 2DPHA 3TW8B 2R66A 1OIWA 1IM2A 3BJRA 3M5PA 2XOEA 3O4FA 1KH1A 4DW8A 1D4ZA 3BWXA 4M37A 4JVMA 5J59A 1KP9A 1R1DA 1R4ZA 2PWAA 3EA5A 4Z7JA 2IIVA 1J8FA 5AD1A 3ZLVA 4KQ6A 1G2PA 1T3LA 2O1WA 4NZNA 4YCDA 4M9RA 4F4CA 5FWXA 4OQFA 1E7SA 3PU6A 1FF9A 2BMEA 2X15A 3D81A 4LSZA 5BQ3A 3FVWA 1P1IA 1R88A 2Y3IA 4Y9DA 2RH5A 5J47A 3N0VA 2CJXA 2Y93A 4IWNA 3EVZA 1ZK0A 2QDKA 3L77A 3C48A 4QLAA 5I7UA 3SSOA 3E1GA 5FPYA 4FKBA 4C7MA 4DDKA 4K2HA 1MJGM 1R6AA 3IPXA 1US8A 2JKYA 4MVJE 5ALHA 4DMUB 4CMKA 4C04A 4EWLA 2ZB2A 3GA0A 2R751 3PHJA 2XTNA 3DPUA 3QELA 1ZI8A 4MR9A 5LBUA 3GAMA 1YZTA 3RI3A 1BH6A 3O84A 4HVTA 3SZGA 2ZBQA 2H9IA 1M2FA 3H75A 3DMYA 3HADA 3HYCA 4BU1A 4DOMA 3E61A 1HNZB 1EUDB 3I9V1 4FMDB 2PT6A 4NENB 2OCKA 2CB9A 2NTYC 3ZNNA 3SEFA 4N5DA 4L0CA 2OP0A 1YS2X 3SVZA 3ZS8A 1HDRA 1FU4A 1ZO8A 3GEHA 3NIWA 4D6PA 4UKDA 3WRXC 5IM4F 2GEFA 5JXWA 1W5BA 4Q4DA 13PKA 5EPUA 3RH0A 4IJWA 1WY5A 3WJAA 3DONA 3ZK7A 4DGSA 2QBYB 2C4NA 3U1VA 1ZFNA 1FE8A 2CV0A 1S3FA 4NV3A 3HKEB 3GR6A 2HXYA 1J5EB 4DEYA 4KR0A 2UZ3A 1T2FA 5CG2A 3ADBA 3KTOA 3HJTA 2JVKA 1T0IA 2HLHA 4BZZA 4CHGA 4JI7B 1XZIA 3HWSA 1G5QA 2XUIA 2J8ZA 2RHWA 4RD4A 16PKA 4RK0A 1BIFA 3SM3A 3CLKA 1E5DA 2O8FA 2X86A 2GNOA 4UM5A 3EBPA 2AC4A 1C50A 1NSFA 3ET5A 3K6SB 4LX0A 1IG0A 5A5EA 3L7YA 1JDZA 3OZVA 3EQ8A 1R18A 3KQUA 4KQ9A 5ALJA 4A6XA 4KUEA 2CLEB 1D5WA 1NW8A 4GVXA 4HMQA 3MGKA 4Q3AA 5CFZA 1WV1A 5KU7A 3AJDA 2GYWA 2OBBA 4M8SA 1E2NA 2HDHA 2E21A 2HTFA 1H6BA 2JKZA 3NTOA 4QQNA 4MGHA 2JIZD 4BTEA 1D2AA 5B1IA 3DDUA 2JGDB 4HSGA 1E69A 3SBDA 3IR5A 2R65A 3H6HA 4PFKA 3UNXA 1Q0UA 1NR7A 5EJEA 1OXUA 1CC1S 1DB3A 4GBMA 4X8HA 5HR5A 3LT4A 3LUKA 2H6EA 1SHJA 2VLBA 3NX4A 3OJFA 4YV2A 4WZZA 3PFGA 2X0RA 3ZOKA 1V96A 4HB3A 4YQEA 3ROGA 1Y9AA 4D9MA 4XRGA 2W11A 4CQMD 2D13A 3W4JA 4ZHSA 4BGUA 5KQRA 1JBQA 3BMOA 2Z04A 1P7ZA 1AGRA 4Z4QA 5ETJA 3H17A 5JVDA 1WMEA 4UM8B 1O8CA 3V8MA 4C2BA 1QXSA 4MVJI 4LGVA 2PK3A 3LHDA 1A4UA 5DEIA 1MX3A 4NFSA 2AN1A 3BIWA 1EFKA 4WTOA 2OORC 3EIHA 3V1MA 3AYXB 3L8ZA 5CDFE 1KXJA 1V5FA 1VI5A 1RFGE 2XIJA 3QXSA 4O3FA 1Z6GA 4P84A 1Y8RB 4CU2A 1M54A 2QD3A 1BFKA 4UUNA 2WD7B 4OATA 3LT1A 4Z51A 2PQ2A 2PKYX 3S3TA 4KMOA 3VPGA 1YK1A 3ZWPA 3GCXA 5JADA 5BV0A 3L46A 3IPCA 2ZKLA 3KZ1E 3U44B 1NQOA 2QBYA 1VYUA 1XTKA 5B4VA 1SG6A 2UYQA 2WOJA 4E22A 3WLEA 1KI1A 4X8MA 1P62B 2W83A 3I1FA 3UJPA 2IEIA 4BP9A 3U7GA 1GL6A 4J0EA 3VMFA 5JPIA 3AB3A 4ZAGA 1J2YA 1O89A 3FF4A 1LPSA 3QYAA 1AXRA 4HEQA 1ZM9A 4CCYA 4YR7A 1TC2A 3A9UA 4YHHB 5A0VA 4ID9A 5AI5A 1TFUA 4AVYA 1N4AA 4HDRA 1S8OA 1KS9A 1ISIA 2QJFA 2B8WA 2IELA 4OGLA 1MD9A 1OLXA 5DRTA 3CWQA 4YRJA 3WK5A 3PI6A 4RETA 1UBKS 1Z0JA 3ZHUA 4S05A 4RU1A 3DMNA 3P9IA 1N6RA 3NJ4A 2RHBA 3ER8A 3CU5A 1K3FA 4KB5A 4YJGB 4B73A 1TMOA 5AVRA 5D3MB 2VQEB 2YUTA 1NFQA 3OQJA 2W2LD 1U8EA 4Y18A 4P93A 2VNIA 1HE8B 1XWWA 3C3JA 4Q7MB 1BWPA 3L6RA 4YXWD 4ZICA 2EGUA 3LQFA 4NMLA 1NG9A 1M1UA 2JBWA 5ARDA 3K0CA 2O8BA 3II6X 4ARIA 2IDJA 3B1FA 4FSDA 5DN6A 4FFLA 5AJXA 5LZ2A 2ZI9A 1TL7C 2PJDA 1C4WA 1UBGA 5EIOA 5KYNA 2QUZA 2VCYA 5J9FA 3ROZA 5JJIA 3A04A 1GZSA 1ZH6A 1OPXA 2YINC 4JDUA 3DFZA 3ADOA 4L50A 4MZDA 4QDXA 4RC9A 3PJEA 2F4VB 5AOAA 3MXTA 3F47A 3AOGA 4O2AF 5ALIA 4KREA 3HKDB 2CD9A 1QBKC 3DJFA 2UUPA 1FVHA 1XK6A 2CXRA 2C9DA 3A4YA 3IKMB 4N8DA 1JV2B 3CMCO 4RENA 4B6RA 3N6RA 1J20A 2GEDA 2DWUA 2WFAA 3M2TA 1I5RA 2DPLA 3AY0A 3H2SA 3KK0A 4RA6B 2BPOA 5CBKA 1WXQA 4LSMA 1Y8RA 1YBHA 4RPCA 4XWTA 4I9GA 2X1HA 3OE4A 2WD7A 3DC2A 2OLEA 3SKVA 2BGKA 3IV6A 5IHXA 2ANCA 1LBEA 4M9QA 2P4SA 1E2FA 5JEEA 3C87A 3FDXA 4PLPA 4JEUA 2ZTSA 4BNZA 1CEYA 4D0NA 4PIMA 3FTDA 5AJWA 3AVQA 2VHJA 2DQ4A 4HVLA 8ABPA 1QVWA 3K0AB 1H8HD 4FYHA 1Z63A 1V16A 4TMFA 4MA5A 3SLRA 2J1LA 1EG7A 4PBTA 4YP6A 1X1AA 2AMJA 4PZZA 1RJWA 4AO7A 2J4CA 3N6XA 2GGSA 1Q7CA 1PZXA 1W4LA 2Y4NA 3KTDA 2XLCA 4HDQB 3R7DA 3UWKA 1ODSA 4RL4A 1ZD4A 2QE6A 2PRIA 5IAOA 3TGPA 2NT4A 4WXHA 4GLJA 4JP5A 4M6WA 3CX8A 4WEQA 2JAPA 3OX4A 4L85A 1P2UA 4DJAA 1OB2A 1SA0A 2GPTA 1D07A 1XTVA 4N01A 4R7GA 2PL3A 2ZSUA 2BI4A 3ZU3A 3TCXB 3EH1A 5LVAA 2QUKA 5G4KB 4Y2JA 4AY5A 4ZVLA 3ZWDA 1KI9A 1SUWA 2Q4DA 2W6PA 2P4QA 3TLXA 4Z4GA 3I61A 3MJ4A 4KEAA 5AHXA 3FLBA 2AZDA 3G5LA 4IIHA 1U80A 3ONWA 1U0LA 4R01A 3HCAA 3WYEA 4DEVA 3S55A 4INJA 1JEYB 5E1OA 4J2TA 2C2XA 2CCKA 4YP9A 2F62A 2AUMA 4UTNA 4BNWA 1D6JA 1R3DA 4FYYA 3T5BA 2PUDA 1XDWA 1XO1A 2ZT5A 5AM1A 1T34A 3PYLA 3PRJA 1AN0A 1M67A 4ZVTA 5M34A 1UXIA 1PDOA 3ND6A 4YRDA 1U0BB 1ZHFA 3FYUB 3DL4A 3LU1A 3ONVA 3KYIB 2BF7A 3PRYA 1EP1B 5T8KC 1W29A 1Y9EA 2JLXA 4N48A 1IQ0A 1VKOA 3CLTD 1X86B 4JUAA 5J23A 4HQNA 1OC2A 4BTLA 4M0DA 1YA4A 5JBNA 4YAIA 2BFEA 1NP3A 4P4UA 4RD1A 5EHQA 4C30A 4BQRA 7YASA 4IGKA 3RTAA 3T1HB 3IPYA 2F17A 1PT6A 1TMYA 1Z0UA 2PM8A 3IJRA 4D9FA 2Z6AA 4RKEA 1IOVA 1T2DA 3GPLA 1FLVA 2XBLA 1UODA 4HKTA 3NEJA 1K88A 3EXIA 4G65A 3HNOA 1Z36A 4I1VA 3IVCA 5I7FA 2G0NA 5B3LA 1H6AA 4P7JA 2AS0A 1PKXA 1XZHA 1KO4A 3CNEA 4HMOA 1RQNA 3S28A 3KHUA 5F21A 4IIVA 4EPRA 4EM6A 2GF9A 2VTDA 2IWHA 3FPLA 1QE5A 3JZDA 4L7VA 3Q8KA 3B7WA 3NHPA 4U1RA 1OASA 3W3AA 4YHBA 2JLWA 3UV6A 4JS0A 2X4GA 1EDZA 2ET6A 1WLYA 4XUEA 1RE0A 1KRXA 3V7NA 3Q7QA 2AOTA 4CIDA 2ZSIA 3OIGA 1P6QA 1Q50A 3D6FA 1WCWA 1YBMA 5L3ZA 4BNTA 1QZUA 1XYVA 2ZTUA 1NUAA 3GZNB 4JB0A 3C74A 3GD7A 2BKXA 4WPGA 2QLFA 4D8UA 3SIXA 1E1NA 1BN6A 1D09A 3WLSA 4QO8A 4CQMB 5H82A 2ATEA 3B5EA 4DUYB 2YY7A 4E2YA 1GQYA 1Y5NA 3RWOA 4AG3A 2CL0X 2D54A 1TQ6A 2G9UA 4FSHA 2P41A 1SXPA 1K9VF 1RU3A 4D3ZA 4US2R 4M2LA 4ZQCB 1D7AA 1IB6A 4P80A 1Y34E 3C98A 4Q19A 4C0KA 1CYEA 4Q1VA 3M6XA 5JSYA 1M34E 4IHJF 1JEYA 3CUUA 4LHVA 3I9V6 5FTKA 2IIPA 2MSNA 3NPMA 3TSAA 2B98A 5GPBA 5H83A 2W7TA 1SWWA 3U5TA 3C8MA 1PGPA 3B1XA 5EXSA 3EDMA 2D5LA 3G8AA 1GYPA 4XVRA 1QK3A 2G5GX 3O91A 4MV9A 4OIMA 1EUYA 4X3OA 1LS6A 5ISMA 1HC7A 1P0IA 1ZYUA 4G0UA 4IUDS 1KMCA 2DJ5A 1DQZA 2IQ5A 4JP2A 4YJHB 4G8JA 3WIVA 4AW9A 3CWZA 1JIXA 1RHRA 2GZHA 1NW7A 3MRVA 4JC4A 4C88A 2JIPA 3ZHYA 3SIRA 2FPOA 5H9WA 4EKEA 1AQNA 4TV8F 3SQDA 1E8MA 4F7WA 1RPAA 4P7KA 3U61B 2JD2A 4FZRA 1H2HA 3BZUA 3K35A 2PSJA 5D85A 3E3MA 5HKBA 4U5QA 1RXIA 2XGOA 4BFCA 1Q83A 6ADHA 1GJRA 2EKBA 4MPPA 2IH5A 2PANA 5KDOA 3T3EA 2VJLA 4HDSA 1ADCA 1TU4A 3G88A 4HNGA 1H23A 4EB8A 1RPJA 3F8TA 4L8GA 5DBIA 3V3TA 1JG3A 2Y1LA 3HB4X 3WL3A 1IZYA 1JX6A 4BMZA 1AV6A 4BEVA 5EJMA 4ESVA 1J2RA 1KJJA 3OVMA 1QV9A 3E8SA 1K5GA 1KYVA 4AI6A 3MYRA 3GJ5A 5FFFA 3U3ZA 4DIDA 2H07A 5C1PA 1U2TA 1RWVA 1MABA 5ALGA 3ELDA 3EFBA 3IRVA 5LUAA 3SDZA 4HGRA 4O5AA 4XM1A 3OFKA 3PA8A 4J0FA 1FJGB 3EXEA 3H8VA 3N28A 4RORA 5SY9A 1E2PA 1FU7A 1SVSA 3T3PB 4NABA 1VKNA 1NC1A 4L4ZA 5K6AA 2FXVA 4K05A 4JX8A 2HDOA 2ZYIA 3L5KA 1E79D 3D6TB 4FLEA 2DZDA 4N8EA 1RZRA 3AR9A 3O0TA 1BE1A 3ESAA 3VTAA 3WGMA 1W88B 1J42A 1Z83A 3IFSA 4XVHA 4C5AA 2J6BA 3KU4A 4OSEA 2OPHA 1Z0IA 1KIAA 4MCJA 3RUDA 5DM70 3CRVA 2ID7A 3BXHA 3ETEA 3V55A 1XNJA 3JAKA 2G6BA 2OILA 3NR2A 4CMJA 1FYEA 4YCBA 3ZE6A 2IW1A 1IZ0A 2BGMA 5FFMA 1CUIA 3Q3IA 5JASA 4EJFA 1YIDA 1P77A 4K6GA 5IJWA 3X1DA 1UUFA 4IG9A 4KMMA 5CVUA 4RPGA 2WHXA 3C43A 1TF5A 3EK2A 3MUNA 1GCIA 1DAIA 1OAKA 1ZH8A 4HFMA 4MIYA 5TXGA 2BGJA 2BM8A 5EKDA 4F56A 2DG2A 4A27A 1P61B 1BJRE 2RGDA 3SCZA 4DNOA 5JZSA 3VRHA 2LIPA 1VG0B 1DU4A 3Q0IA 3HLKA 4BLTA 1R27A 2CXPA 5K01A 4M0FA 3BGDA 1CV2A 1HE3A 1Z4IA 2P68A 3GJQA 3I1JA 3PQ5A 1JG6A 4PTYA 4AD8A 2PO7A 2OOSA 2XQVA 2QN1A 4DM4A 4DXDA 1AKRA 4QNRA 3OEED 3QFTA 4QTZA 4KXUA 5A4KA 1LW6E 2FA9A 1N2CE 2P0YA 3AC0A 1JFSA 3OM1A 4F8EA 2OO5C 4N3GA 5E1BA 5LB2A 3ETDA 1SCKA 2RGNC 5CEFA 2XYRA 3R3UA 1DJPA 1VBNA 4POAA 2J3IA 3E6AA 5DM2A 4L6AA 2OG2A 2XBMA 2ZAYA 3I1IA 4U63A 1V45E 2GK7A 3RLIA 4K9DA 4KBGA 1PFVA 3Q3VA 4UM7A 1RI4A 5ILOA 4JXKA 1AHHA 4BIMA 5DO9A 3STWA 3OU6A 1LLCA 2VK4A 2PCLA 1ZISA 5DP2A 2ZRMA 4OJKA 5HWSA 5JBIA 1TZBA 3ZI4A 4UEJA 3VVMA 4UVHA 1FXUA 4YMIA 4TMWA 2E5FA 3HJHA 3U5ZB 4BB5A 4PVCA 5MHTA 1P19A 3AWIA 4QBKA 3PT5A 2HQOA 1MZPA 1W9MA 1T9HA 3CPSA 1UF9A 3UYKA 1XLTA 4YB8A 1K0UA 1Z2NX 5CGQB 3L0BA 2PL9A 3UK0A 2NUBA 1ISSA 3AEQA 3B2EA 3IT1A 2C4UA 2GJSA 1R8XA 5IKOA 4F9GA 4ZYLA 4GOKA 4HUTA 3ZHXA 1B74A 3GMIA 1I1HA 1MB2A 5HZGA 2AQIA 4GPZA 2XT9A 3GXBA 3UBTA 2X9VA 4RV4A 1ZUWA 5AI0A 3T3MB 5HDBB 2QL9A 5BSUA 1ZVJA 1SHZA 4GO1A 1WCIB 3UMVA 2BE9A 2A67A 4JC8A 3F6YA 4GXNA 1DPGA 1NYTA 3TFWA 2H48A 4RHUA 4PO8A 3NEPX 2GBLA 4TTRA 1C3LA 4IX1A 3MCTA 4JL6A 4ZAYA 2RGYA 4JI3B 5FA6A 3GFSA 2VDOB 2QOEA 2BFOA 2X42A 3ITDA 1R12A 3ZLUA 2B1QA 4NCBA 1II8A 4RVOA 2R7LA 5I48A 2G25A 3PFWO 5INTA 3D5TA 2D2XA 3L1JA 3F7MA 1FP4A 1O6CA 4YPFA 3HBLA 2BJWA 2FP4B 4DMFA 4J4HA 4Q3OA 5DBEX 4LVOA 4Z3KA 2VDWB 4Z4CA 4PY2A 1EFUA 5JHHB 1NRXA 4MW6A 2DWCA 1IVNA 1G5RA 2XMDA 3HDHA 3MWEB 3Q7SA 4MVXA 3W5SA 3NRJA 4DLTA 4IH1A 3I42A 1OPRA 3MS4A 4QD3A 2B25A 1X77A 2L0XA 2YFQA 4FXPA 2ZRKA 2PS9A 3D8UA 4RF3A 3RWMB 3I45A 3L0IB 4TTVA 4DJTA 4YCMA 5EWLB 2IS1A 1A5BB 4K3UA 1Q17A 2AXPA 1M2VB 5ITWA 5KJ6A 8GPBA 3ZDFA 5CP8A 4RSHA 4WRRA 3VH4A 1DOAA 3O8QB 1QGAA 2BELA 1RHKA 4HX9A 4TKUB 5CDTA 3BFXA 5JAUA 5JYEA 4EF6A 4B4WA 2C83A 2JFYA 4EF4A 3ILVA 1M6NA 1QHNA 3B9RA 2YIJA 3AKEA 3EE6A 4DHEA 3JQPA 4BCDA 4FGZA 5FOSA 2JFFA 2LXNA 2OD9A 1IHYA 3ZVLA 4ZYVA 3JYHA 1PTJC 1T13A 2QN7A 2B83A 3DD5A 5KQGA 3NUQA 2HK9A 5ICCA 1VHJA 2HA6A 5GV8A 1YMQA 3R3HA 1XRMA 5AQEA 2PX2A 4W8GA 4JI6B 3DVAA 3UJCA 4A03A 5ICMA 2WFLA 3FPFA 1CLEA 2BZSA 4EA6A 2FOIA 1JFVA 1YCDA 3CMMA 1PRYA 4DPMA 1G0OA 2A4MA 4GXQA 4YS6A 1IDN1 1P31A 4BC0A 2WILA 1HLGA 2WUGA 3RJZA 3DTVA 3IVGA 3DOIA 2WKPA 3V1NA 1K75A 3JQ9C 3JYNA 3QOYA 3ECCA 4FC6A 2CB0A 3F2VA 4ZT2A 3ZHBA 1FFSA 3ZKWB 1NAIA 5FHRA 4CTNA 1GL9B 1BXZA 4IG4A 3SHOA 4FGJA 4F2PA 4OU5A 3VKHA 1SKAA 2JLBA 3PXDA 1T8RA 4I1IA 3TRFA 4ZAXA 1XR3A 3OLQA 3USZA 1CD5A 2HSEA 4HZUA 5LPNA 3C7DB 1W85B 3OTQA 1EXMA 1LPAB 4JLMA 4FBLA 4OU4A 4S0ZA 2ONKA 1J90A 4YO8A 5CDGA 1D1PA 5JH7A 3H1BA 2QN3A 2O05A 4QYIA 5BNFA 3WJ7A 2AR0A 2DSTA 2V58A 2VO1A 3WLOA 4B3IA 3I52A 1W0KD 1JNYA 1EFPA 5IPFA 2J32A 2OZLB 4DTIA 2OE2A 2PGOA 3G17A 5DDIP 3WIDA 4I46A 2WWFA 1ZJ5A 4AWAA 5GJBA 4QYWA 3ZIAA 4FS8A 4PXAA 4ZEOA 1XZLA 4UVIA 3E15A 1ONOA 4XJXA 1Y7TA 4B81A 3AM1A 2XKAA 4Q4HA 3FPAA 4BO4A 3M1IA 3V33A 1YHNA 1I4OA 5EE5B 5FO1A 3VR2D 5CH8A 2QNIA 2PZBA 4OP3A 5JZBA 3M3HA 5JI2E 3KKNA 2EZTA 3RUPA 2WT8A 3AVWA 2CF6A 4MGZR 2O2CA 3LI2A 3BL6A 5I4KA 5CM9C 4F91B 1BQ3A 5JIBA 2VTEA 3FHTA 3U17A 1M75A 3NBQA 5BVGA 4N12A 5HMMA 5ALZA 2I4NA 5T3YA 4X9XA 3MW8A 4MUMA 1N0HA 2G9VA 3QSYA 1Q3TA 3AQ4A 1QVRA 4W1RA 4K9LA 3LL7A 4U3JB 4YLEA 3K5IA 5DX8A 3WJ2A 4I4TB 3QKUA 1PQUA 3RVQA 1E1LA 2ZJ1A 1TCBA 5D01A 5FOXA 3ZUGA 1OWNA 2ZITA 3TD9A 1R66A 3A3PA 2V7TA 3DQPA 3JPWA 3LC1O 3NG1A 3TX2A 1EK0A 4WEOA 1MN6A 1JG4A 1ADFA 1HORA 1L5KA 2R5WA 3E2MA 1U7DA 1RKBA 3R7BA 2OYCA 2VP5A 4YYZA 1Z4OA 1T8WA 5C8VA 3FFTA 3FWHA 1PZEA 2H1SA 1SCDA 4FR5A 4N5HX 3VFDA 2ZIEA 2P40A 3EIFA 1W35A 3I04M 2HK8A 2VDQB 1HY3A 2PRSA 4DIFA 3DMRA 4F2GA 4NVRA 4BNVA 2Z58A 1HDCA 2XD9A 1W85A 2B4KA 4QQ8A 4C08A 3LRXA 4LCEA 1XDDA 2OBNA 3EGIA 4CUJA 1ISHA 4RY8A 5BW5A 3UUFA 5AJZA 1GGFA 5DRYA 3WGZA 3MJCA 3UK2A 2XITA 1AHIA 4N7BA 2VF2A 2QUJA 3UUWA 3W9BA 2OK7A 1YA8A 1E2HA 4YONB 3WGGA 1M6EX 3OX2A 1H8ED 3NALA 1G20E 2B6HA 2OZLA 4XGIA 5LXTB 5GVSA 3QUBA 2RK6A 5H68A 621PA 1T4BA 1S2OA 3C3AA 4F12A 3MIZA 4PAWA 3UMCA 3VOTA 4GX1A 4F96A 4G2NA 3O38A 1T5BA 1ZAKA 2VZ8A 1X39A 3DE1X 3L6OO 3O5AA 3PFHA 4M1SA 3WYFA 2ZDHA 4JLNA 3FPCA 1KBZA 2XMGA 2QRUA 3GW8A 3PJGA 3ZGVA 2H17A 4FYJA 2OYSA 5EQDA 3UAYA 3FTEA 2ZTVA 5LDGA 3Q7PA 2C2HA 4GZ5A 4QASA 3JAMA 3ZJVA 4UE2A 3PHIA 2JANA 1I6LA 2ZE5A 2XVAA 4BQQA 4Y1RA 3PHBE 3GNTA 3EW7A 4GDMA 1JHOA 1QQ7A 4LTNA 4D3DA 1PAUA 1LY1A 1WPXA 3CSUA 4NYJQ 3LHSA 2YZNA 4FHZA 3VQTA 2NSHA 4M0PA 4U3JA 1WR8A 3GDGA 3KQYA 4YT5A 2FE4A 2F00A 4U02A 2SICE 1JKIA 2P2GA 4RY0A 3EFOB 1IY0A 3UOGA 3ZY2A 5U9CA 2QW8A 3IVMA 4LNHA 5HMLA 3VO9A 3LUAA 4JBIA 4ER0A 1L9XA 4ARZB 1EZ1A 1EINA 1P9OA 3KQQA 2UUOA 3ZV7A 4XFDA 3GARA 4MS3A 1DBRA 3WZLA 3BOSA 3MF4A 3MJVA 1PN3A 1V48A 3PC7A 4KLCA 1D9ZA 3N39C 2ORED 3NYWA 1WVMA 1QK4A 1VHQA 1DI0A 2FFHA 2M6RA 4R1MA 4JYZA 4BLOA 1PLLA 2ZW9A 2V7BA 3IUSA 4NIMA 1HRDA 1L7AA 2VFAA 3Q11A 1ZK4A 4O2BF 3G0OA 5M04A 3JRWA 4DYDA 4CL3A 4FP9A 5JPCA 1NVXQ 2WMYA 1FS5A 1K8RA 1MIOB 1EDBA 3HA3A 4M98A 4DJ5X 4E2ZA 5DI3A 4AP6A 4Q9KA 2GK6A 1F48A 1G5PA 4XX0B 1PR9A 3O1LA 3DOUA 2R8RA 2ZRFA 1QO7A 1R10A 1ZJYA 2Z8XA 2EFHB 5BT9A 1ZMOA 3RB8A 3S2EA 4B2YA 4UM9D 1PJTA 3DEJA 4MARA 4Y6PA 2RBGA 3BL8A 2W9XA 5FUBA 4A16A 3MMSA 2VDJA 1RAEA 3NWBA 1C30B 2WABA 4RYLA 4X71A 4F6RA 4XGNA 1HPLA 5A03A 4MYDA 2IXFA 5J40A 5A71A 4IXTA 2VTVA 5T7BA 4MVJD 1SC4A 3PC2A 4M0KA 3FRHA 4DCCA 3WNVA 4LGMA 1VE5A 4S1PA 3T99A 1ZD1A 2WSSA 1RKQA 3SP1A 1M33A 2JIBA 2ZB4A 2DHEA 4ZP1A 2O5VA 4HP8A 5A1JA 1VE6A 3NFRA 3RUHA 4C0AC 3P45A 1JLMA 1PT5A 2FW0A 4LWPA 4QWWA 4XJVA 4M54A 5ALRA 5BSMA 3SIWA 3ZOZA 4E4YA 2DTDA 2EQBA 4WHMA 2ZRBA 3CVOA 4MKRA 2PWZA 4UBMA 4TS1A 5DGIA 3USCS 4F1WA 1J2JA 3I5YA 1U0TA 4ZWNA 3KYJB 3PVZA 2WT4A 2IEBA 4DJJA 2FWMX 3K8ZA 2VDVE 3H2GA 3PXEA 3REOA 1LNQA 1LFAA 1G19A 1A88A 1ONNA 2B0CA 3MWGA 3OF3A 3MYYA 2V9ZA 3UJAA 4BPBA 4RXUA 3KAPA 2D8AA 1LF5A 4BAUA 4ONEA 1D2HA 3T7DA 4Q4AA 3Q6MA 2DBRA 1TYBE 2OY0A 3G68A 3HFGA 4WA7A 4D81A 3CISA 4Q5IA 1QJ4A 1RAAA 4FHDA 3TKLA 5B3JC 2PUBA 1XJCA 2X8WA 4MS1B 2F8LA 3O9VA 5DB4A 1YRBA 2PXXA 4GX2A 4YRGA 3T0FA 4OJMX 4PIPA 2P30A 5EPEA 3DLPX 1QS0A 4G1FA 4D1YA 1QCDA 3FD8A 4ZA2A 1Y9JA 1N2GA 1WKCA 3HRHA 3Q7IA 4IUBS 4NEQA 3H5OA 1LI5A 2CNKA 4ERNA 5K5EA 4UHFA 4IDFA 2FZ5A 4PNZA 4DCPA 1H6DA 3GLFE 1CUCA 2AOVA 4WNAA 1AQLA 3WMGA 1JMKC 4AKSA 1ZGAA 5ENDA 5HKOA 5HZMA 1CS4C 3H1TA 4RWZA 3HYLA 4OI2A 3OZCA 5AW1A 1MIOA 2PMEA 3RNLA 3F4BA 2NO9A 1NC3A 2OUIA 3FI0A 5I7SA 2IUUA 4IKOA 2DBYA 2IVFA 3AZOA 3DV0A 5J4YA 2XKJE 3HXOA 3IQDB 3ONFA 3FXAA 3CUYA 4YJFA 5AM3A 5IDQA 3C4VA 3RIMA 5DJ5A 2DUWA 1Z26A 2I65A 4PG6A 3DNFA 4RKFA 1I7LA 2A1TR 3M4XA 2A0KA 4RZUA 1H2XA 3U4IA 4BB9A 4OMFG 3CVXA 1NUSA 1HI9A 3E53A 1YB5A 3KEGA 3VJKA 1R9NA 4EK9A 5DMHA 4EKNB 5KSOA 1B00A 1XZJA 1B15A 1KDOA 2X5KO 5IRCD 4Q48A 2XZOA 1KTIA 1FYXA 2YL2A 2VA9A 3OPYI 3IJPA 4ZOQI 2EP7A 2OBLA 3TL2A 5A0FA 1OLSA 1Q1BA 3VV2A 2VJCA 2QD4A 3OFJA 1WSAA 3S2GA 2QR2A 2ZZKA 4P4SB 3NBXX 4LJYA 3HL0A 4W9RA 3N2GA 2R6JA 4K87A 3G23A 5DU2A 3CA8A 3A3KA 5AVOA 3BORA 3ANLA 4RL6A 4XSGA 5DLPA 2XVYA 1Z29A 4DMHA 3R9XA 4R71A 1ODTC 2WM2A 1SCNE 1TUBB 3A4LA 3HBAA 2PGDA 3NC0C 1H42A 2G28A 2B1RA 2ICAA 4HQ6A 5CGZA 5EVJA 4YIHA 3I2IA 4MS1A 2JIDA 4F3YA 4UE3S 2BMJA 2AX3A 5TMPA 1GTRA 1FDIA 2NVWA 1DCMA 3RR2A 2ZUCA 1VI6A 1UKAA 1CRWG 1JSLA 2ZE8A 3DMPA 2GD2A 4C9BA 4KKVA 4TV9A 4FBMA 4H7EA 2OHHA 1T5HX 4KFTA 1UWCA 4TYQA 4UAGA 4CF3A 4AKTA 1SOAA 3P4YA 4EITA 4CIWA 1GNLA 5L4SA 1W1IA 2JI8A 1P3JA 2JI7A 2BTEA 5E6RB 2PRKA 1QPZA 1MTOA 4D46A 1Q92A 5HOQA 1SOMA 4PWZA 2B2NA 3CIFA 3QVGB 4R51A 4UNQA 1ULZA 3USES 3U60B 2XQFA 3GHHA 3MCUA 4G1BA 3I2JA 4GNKA 3ZX5A 4N7MA 3MLEA 3KKLA 4LOJA 1WB9A 1FP1D 4MQFA 4P0PB 1M8GA 3C2QA 3ZXYA 2JARA 3VDRA 2HAEA 3FPSA 4BVJA 4L0QA 4OCZA 4E03A 5DNWA 1UC9A 1XVUA 2IV2X 5KQPA 1VE7A 4E12A 1L5HA 4FCVA 3ZQKA 4N03A 1B8NA 1RM0A 1SY7A 2P6NA 3AF0A 3IIIA 3QVWA 5DYIA 1Y1KE 4D9JA 5BSHA 2X5JO 4J76A 3X1WA 3S29A 5A9RA 2D1SA 1BSVA 2DM6A 1N0WA 2Q1TA 5D3ZA 1MGPA 2QTZA 1D2NA 1KBQA 2VKQA 4B85A 2BI7A 3FSGA 3GDFA 1X7GA 1R0BA 2ZIFA 4WNYA 3ACBA 1XROA 3N53A 2GS9A 1USWA 4G5HA 4RGYA 5LWHA 3OAAD 3QWIA 4HFJA 2P7IA 1OMOA 3WG9A 3WSWA 1A2KC 3H5AA 4WZ6A 2CLKB 2FWBA 3EXFB 3E9CA 2IHBA 1Z4KA 2X76A 1BVUA 1XJ0A 2A58A 4KAAA 5E9AA 5C34B 5FF9A 3THSA 3PGVA 2I7CA 3UGTA 4N0PA 1XTUA 1Y42X 1Y4UA 4MHOA 1BEEA 1W9HA 2NPOA 1IK4A 1KDTA 1H5UA 1TVEA 3VNRA 1I30A 1ZIDA 3W7AA 1RM5A 3W2HA 2I5PO 1CERA 3K32A 2C96A 5L3SA 1FTGA 2RONA 4OOFA 3V1YA 5FBWB 3MOSA 1G8FA 3TG8A 4BASA 2I4RA 3ZDAA 3ROPA 2XR1A 4ZRMA 2O2JA 4BJ6A 1T2EA 4Z3OA 1SZDA 3WA7A 2MR5A 1C9DB 5CA1B 5JOQA 1IVYA 1EFLA 4S1OA 3VPAA 1USUA 2DPGA 3DH0A 3U6KA 1OH8A 2IXEA 1OV6A 1K63A 3CH7A 1QCYA 5BMVB 3FZYA 1BA3A 4UM9B 1XD9A 1BC5A 1JIJA 1RDFA 1YZVA 5IVPA 1Z7EA 4EZBA 2ZM6B 3AF5A 2CK3A 1DO2A 3LSTA 3RTDA 3TQOA 3L9WA 2HH9A 1I6KA 1QLWA 5LZ4A 2I91A 1PG2A 1UBHS 5E2IA 5E6RA 4ARAA 4M8LA 4NDZA 1FSGA 4HWOA 4R1NA 5SYAA 1G8HA 3MUEA 3G9ZA 4YGYA 5K3DA 4KR6A 3F73A 1L8QA 3OOYA 4GSKA 4IH9A 3A6DA 3NHFA 1V43A 3I0NA 4KX3A 1BO6A 4YTEA 4NZZA 6GPBA 4GWLA 5JJKA 4TWZA 3IAS1 3IUJA 3GEGA 4MGYR 4HH3C 3SZOA 3QXGA 3ER9A 2GBCA 5IKPA 1LRKA 3GQBB 3LY9A 3RAPR 2R8PA 4BP3A 2YXBA 4OFZA 3NOOA 4XI9A 4MP3A 4DF3A 4E1AA 1PWXA 1VC2A 2W22A 1C9JA 2BKUA 2J9GA 1ZRHA 3OZXA 1GTL1 1XALA 3PWKA 2IH2A 2ILVA 2G3YA 2FMIA 3AEUA 1TTHA 2VPQA 3D3WA 2O1SA 3EGDA 3MFYA 4IRMA 1NMEA 4C78A 1ZKDA 1I6WA 1SULA 3CW2A 2YV3A 4X00A 5KYTA 4Q7EA 1MFZA 4MWOA 3DV2A 3IEIA 3CYFA 4U0KA 3AW9A 4IJUA 5D6NA 5KDLA 3L0YA 5M29A 3AVXA 2IUEA 5SICE 4RJKA 5IJ0A 1G3RA 2LRHA 2QY6A 1ONPA 2RH9B 1MPTA 1XLUA 3EXFA 3QA9A 4WVLA 3VZBA 4ES6A 5CFRA 1JE1A 1ZA2A 2HQSA 5J63A 1J4AA 3G3EA 2ONZA 5DYYA 2VZEA 1CQIB 3HCBA 3QBVA 5DSZA 2I22A 1GN9A 4MPRA 5FOVA 2VBFA 3DM5A 5CB0A 5CH3A 3GJ0A 1R00A 1V9SA 2G04A 2PUTA 3CLSC 2C7RA 1Z38A 3LGXA 1ABEA 2X0NA 3V4PB 5IABA 4ZC1A 2VJQA 5FWYA 2INGX 5D84A 4F72A 2R6ZA 1QH1B 5BN5B 3ZHVA 3EIXA 4KR2A 1L4GA 1ZRNA 3L8FA 3DBLB 2ZRQA 5GJVC 4WBNF 3BB3A 3PCRB 2DQZA 3PR3A 3X0DA 2ACKA 2X8JA 2C7OA 1GZ7A 1KU0A 4XQEA 5DYWA 2OD2A 3A06A 1GQQA 3I53A 4RIFA 2QV7A 2JDIA 4CM1A 4ND7A 1D8TA 2NSJA 5IT5A 1KVQA 3CN9A 3ELYA 2C5SA 3RU9A 1AHPA 1VMEA 1E9FA 3TQIA 1DJNA 1ZQ9A 3BGSA 3ADDA 2PKWA 3QVTA 4X90A 1NKSA 1IHPA 4V0LA 5EMHA 4YMVA 1XCPA 3UH0A 1B7GO 1T4DA 5KTYA 5HUHA 5DGTA 4DIUA 3OCUA 1CQJA 4QOIA 4X84A 2PGJA 1JEOA 2R0QC 3HTXA 4P4GA 1HFWA 3Q9SA 4X6LA 4JI8B 3EISA 2VCHA 4P5PA 4DQUA 3ENNA 5JY6A 3AVTA 3TG2A 3DBRB 3WDKA 3TFQA 4RGQA 1BX3A 3KLBA 2GRAA 3HVIA 4CCAA 5CLJA 1RXSA 2UVPA 3E0XA 4JKIA 1GL3A 5ES3A 2EZ4A 3T9CA 4V1CA 1YUBA 4KQKA 1Z82A 1KHHA 4KQMA 3FBTA 2Q3HA 2FWJA 3IX7A 1Z28A 2ALJA 2UVQA 2YWBA 2C59A 3GLHA 3L05A 2X8AA 4PPQA 4TL6A 3TZHA 4AMBA 5DNEA 5TJ9A 4LDZA 3GLRA 1IN8A 3RYTC 3SXJA 1FX0B 3DMFA 4AAYA 1DC7A 1DXYA 2K6GA 3EGCA 1EFRA 3GVIA 2J87A 1UK7A 2AH5A 3MZ0A 1W1UA 1B23P 2BBOA 4R1SA 4HYYA 1UC4B 4RE5A 1YS1X 2FPSA 1NFRA 1W49A 2N46A 2R8ZA 1LDBA 2AEJA 3IQFA 1OKKD 4I3FA 4KQHA 2Q1SA 4P54A 3EQ9A 3HSKA 4C0LA 3VZQA 5SV2A 4A2QA 2DGDA 5JZMA 1LBHA 3LAWA 2VP2A 4KPYA 2OHFA 4MP8A 4B44A 4D6XA 4MDYA 3AIKA 3OZTA 3KSBC 3OO1A 5I5EA 4CM9D 3NRBA 2QTNA 2XSZD 2WG1A 3AQIA 2UZAA 2J3EA 3ASZA 1HO3A 2HCTA 4HQOA 5HQ3A 3FIUA 4R9VA 2V0GA 5GY7A 4IOLA 2Z95A 4PLVA 2XCOA 1EHCA 3PCTA 3KALA 4YWJA 4DRXB 2B2CA 2ZUBA 1N8TA 1M5RA 1N2BA 4BLRA 1IZ9A 4HWRA 5T6BA 3H4TA 4NCKA 1PK7A 4R69A 1E2UA 5CX1B 5FWDA 1KDVA 1VKHA 3RAGA 2JCVA 5A04A 2XUJA 1E5TA 1EP2B 3MMXA 2TMGA 5BYKA 5TE9A 1LSJA 3ABIA 3WGNA 3M83A 3KSMA 1N6LA 4RZSA 3D7MA 3I4FA 3L1UA 3PEUA 4HH1A 4HWPA 3RF7A 4ZOLA 1U9YA 1U2ZA 1OZ0A 1BMQA 4HRVA 2Q41A 3EPLA 1WU7A 4M3NA 3QUTA 1A95A 2W8ZA 3ELUA 3BRCA 3EVGA 5AHWA 3PVSA 5EJFA 2C0CA 5T4HA 3E0QA 4L4SA 3ERCA 3H5IA 2W4MA 1NRJB 4ZREA 3JQRA 2IP4A 4R8SA 1MF7A 3SF8A 4EUEA 1R9MA 3GI1A 1OWOA 4Y30A 3EEYA 3EVTA 5ILQA 5I7RA 2EKZA 1THGA 4YK7A 2PLFA 1KYTA 4O1IA 1XK7A 1ZRSA 3DWFA 5DNDA 5KI6A 3P2OA 1VYTA 4EY6A 4URXR 2IBSA 3IV9A 4RHYA 3OFSA 1H22A 1W2HA 4ZJZA 2R00C 3R5FA 1J70A 3GFOA 1OD6A 3R76A 2XUPA 2QQGA 1FX0A 1FTNA 4NFLA 5LU9A 4QOHA 1BH2A 2FQWA 1YR1A 1BN7A 2IUYA 2I6GA 1TNDA 2XVMA 3WWYA 3EIWA 1SU4A 1KAGA 2M32A 2IHJA 3EDCA 4RNDB 4ZU3A 4UCFA 1HBJA 1GZ6A 4HNUA 2UUCB 3LE8A 1K2VN 1RI2A 3IERA 4LXYA 3VBEA 4FLMA 1XZQA 3JYQA 3H84A 3IGFA 3ZH9B 4BKOA 1C81A 5KREA 3UGKA 3DUFB 3WQRA 1B93A 1J0CA 4ALKA 1KVUA 2N0SA 4LFBB 4BNDA 1T15A 3SMQA 4C4RA 3VO1A 3LZ6A 3PPIA 3X1ZA 1G21A 2QRLA 3M5WA 5BNIA 2GZ3A 4ZARA 1NXPA 1GU0A 4JGGA 4BNMA 2Q7XA 3O9ZA 2FUEA 4W6ZA 3EGVA 4F21A 4BQPA 3AHCA 1OX4B 2A92A 3W5AA 2IXGA 4MVJM 2VQ3A 4QUEA 3IJEB 3W3AH 3AF6A 1J2TA 3ZEIA 1BZYA 4DRXA 3E3OA 2Q3MA 1W4ZA 4AULA 4HOYA 3AHJA 3GNLA 2BJHA 5CFPA 2JHPA 4PN3A 2ZZMA 5GWXA 5LIRA 3EIQA 3LDGA 1C9YA 4QX6A 1TQ4A 2GWHA 1NNEA 3ZCTA 1OXBB 4PQYA 1G8YA 5JVDF 4DC0A 5JTUA 1FDSA 2WF9A 4B75A 2XWJI 1JSXA 1YIAA 3H97A 4E70A 3OFNA 1YKSA 2Y2VA 2GI4A 3VUEA 4W5HA 5B36A 1ZIOA 1KZ9A 4FMDF 5E3HA 1R0LA 2P5SA 1YZ3A 3UWDA 4GICA 1GUAA 4Q1CA 2BGIA 4WK2B 3VH1A 3OQHA 4CQJA 1P39A 3ZJYA 4HAYA 3TLBA 5JNTA 1F7UA 4MEBA 2GCOB 4PLHA 3M89A 2CLDX 2EEZA 1DFHA 1U31A 3LZDA 2B92A 4ZI2A 4UFNA 2BN4A 3RYHB 4G0ZA 1CF4A 2OWDA 3LX5A 4WVFA 2HLDA 4OHOA 2QB5A 4JI4B 4IHAA 3U0BA 4EHAA 3GUVA 1N0UA 1JFLA 4DR2B 5EIFA 1T4MA 4OO3A 1E9AA 4TRNA 1QGDA 1SHKA 3FCAA 5IZCA 1GFWA 1QG6A 2ZTLA 4ZI7A 1XU9A 4U7GA 3DLCA 3S2IA 3B5IA 5EE0A 1PR5A 2IP1A 2IYEA 1VHDA 1WOMA 2HWXA 1D3AA 5IP5A 1HURA 3ZIUA 3G0HA 2N9UA 3LRPA 1Q22A 4YJ3B 1VCOA 2PRYA 2WJZB 1Z2EA 5HJ5A 5AI8A 3OJEA 4DBZA 5C1DA 3T7RA 1VCNA 5AHKA 4OFWA 1UAYA 1SUBA 1XMPA 5LMCA 4P83A 4ARCA 2IDZA 3P97A 4FMPA 1EVIA 4YRFA 1QFZA 2P2YA 3GEPA 4KU4A 2A9RA 4L8FA 5FD8A 5JO0A 4BIIA 1KQFA 1KI6B 4RANA 1JKFA 1ZD5A 2HA0A 3KJIA 1TJ3A 4QGGA 3RUFA 3ZKAA 2A1TS 2P67A 2YIMA 3Q9LA 4JJ6A 2FQ1A 3RVSA 1J8MF 2ADFA 3RQIA 4EVRA 5AVQA 1QP0A 2AG0A 1V35A 4KC0A 4UU7A 1W2WB 3C45A 4FI3F 4IICA 1K8ZB 4Q4CA 1P7CA 3KZMA 1Z5UA 3GUCA 4IZIA 4DAEA 2O19A 5KJ1A 1QNLA 1OFUX 4ESEA 3GPDG 3K0KA 4XQGA 5FJIA 1B4DA 3AUXA 2LCQA 3GBVA 4MCIA 4LXIA 3ENKA 1MC5A 1LTQA 2FPGB 3QNMA 4QSMA 4U2FA 4IBOA 1HDXA 5JWRA 1RQLA 2QQ5A 1OA0A 3O7MA 3GGGA 3U56A 3PHLA 1RKUA 2RCNA 1EVKA 1K6XA 3LXXA 3DVLA 3DG9A 3TLGB 2DETA 1SVNA 3CNLA 3IAS6 4RD2A 4DSZA 1M34B 1W30A 2FG7C 3ND9A 1AKWA 3B7PA 4RXMA 4WBSA 4QYSA 1D1TA 1WB5A 2ZIAA 1QSGA 2ZRHA 5H7XA 4LF4B 2H4XA 2Q6OA 1TGVA 2QF7A 4Q3CA 4BFVA 5JMTA 2G8LA 3H5VA 4H7IA 3LJKA 3TTYA 1WB4A 2GCOA 2Y27A 5FO0A 1PFGA 3FJOA 4ZZIA 1M6WA 4JWTA 3GUZA 1DO8A 1SQ5A 3OJOA 1YR8A 2X5OA 1P8JA 4A7PA 3KETA 2DBZA 4L9AA 4HGYA 4PNEA 3MT8A 3FN4A 2Y1FA 2R6R1 4E08A 4NZ9A 1OJLA 1JBEA 3NIBA 2R5NA 3TINA 4M49A 4BLWA 3FOEC 4MS4B 1ORHA 1M2GA 4HNSA 5CJPA 721PA 2BP7B 1PZNA 3R5XA 5C51B 3KOZA 3ABSB 2I7VA 1E0KA 1ZW1A 4MICA 3RIXA 3EGXA 5DMXA 3O9MA 3ZCPA 2DXIA 1O94A 4R54A 3LC2O 1YL5A 2LVBA 2FPKA 1INLA 1F6WA 2W6MA 2I8LA 3E9EA 3H8SA 3IA2A 4XUCA 1XWIA 3WZ2A 4B4UA 2PUHA 3ANMA 4CDNA 4ZV7A 5ALOA 4GLOA 2O23A 3LW8A 4Z9YA 3UJ6A 1KOGA 5F2NA 2NUPA 5AW3A 1TYAE 5JW6A 1KI6A 1PLKA 4PCAA 2WM8A 4CIBA 5F2KA 3LT5A 2O2DA 2OAEA 3NIFB 3CLSD 1BRTA 2P79A 3ORYA 1TCAA 1EVYA 2DC1A 2IYOA 3HJAA 3B20A 3QEKA 1U2QA 4YCAA 4BN5A 1ULHA 3A2LA 2YOHA 3P32A 4FX5A 4MAMA 4NMHA 3VR6D 1VL2A 5EP3A 2MIIA 3ASYA 1GUBA 4V0SA 3W5HA 3REQA 2HA3A 1K06A 2CNWD 3E3AA 3U3KA 1RR6A 3IEMA 1GNTA 2O2GA 1OLOA 2A1UA 4N0DA 2B7BA 1KKLA 1M2JA 3VSDA 4Q9IA 3TLGA 3SZ3A 3R0ZA 1CVIA 2O20A 3D2CA 4CR7A 3RT1A 3UWPA 4Y98A 2DKOA 2UAGA 1GGMA 3R7SA 4Z54A 5C5IA 1HKHA 3HHEA 3EVAA 2NUAA 1D0VA 4HLDA 4KGXA 3RYIA 3DXXA 4PHFA 2FPIA 1N33B 2HRCA 2VP4A 2YHIA 3IXQA 5DXFA 1ZUIA 3WIEA 3EBLA 2QN8A 3CZPA 1NVVR 3F98A 1CRQA 2PY6A 4QDZA 3GT0A 4CTJA 1QFSA 3A6JA 4HEA1 1N5MA 1FXSA 2EFGA 3PWZA 2VHQA 4U7DA 5F2OA 3S8EA 4KDRA 3WADA 4MKIA 1DZ3A 3I9LA 2WY2D 4RPJA 1ZH4A 2NIPA 4A2WA 1QR2A 5EINA 4MVWA 5A2GA 4JC0A 2P5TB 4ZO7A 1BWSA 2BCEA 3ZD8A 4LXQA 3WDSA 4LRTB 2A9QA 1YE3A 2BEVB 3BWBA 1DS6A 3NLLA 5F12A 3SHVA 5ESWA 4A6EA 3ICEA 1SXJC 3QIVA 4MWEA 2NZWA 1DQRA 5ICEA 4JQCA 1UOQA 2DCMA 2VLIA 3KEQA 3OIVA 1Y3IA 2ZEJA 5F5XA 3RU2A 2PX5A 4ZYUA 4FZJA 3NTXA 5CT9A 3SZRA 4IWYA 1J24A 3VSBA 4Y6QA 3WL6A 5C37A 1JJAA 4HGNA 3DYIA 3HYRA 1PJBA 3IDSA 4DB2A 4MWZA 1U8CB 2XWBF 4KXMA 3ORQA 4WSOA 1KYYA 3EG9A 4G5FA 4QPDA 4WUTA 1DEHA 3LUGA 1NPYA 4DLKA 4GM4A 2RFLA 1FSZA 1YL6A 3PUYA 1EVZA 4LBVA 2VBIA 3WWDA 5AKEA 2VT7A 4CM4A 4UOZA 4Z7QB 3EUFA 1C0LA 3I6IA 4IQ8A 1DTWB 1KXZA 4TZKA 1VL1A 4M38A 4QU5A 1ZD2P 3R7WB 1Y5IA 4ND4A 3SQWA 2V7XA 3D5QA 4R2LA 1H2RS 2FQYA 3BE8A 3I9OA 3UWMA 4Q7QA 4KQIA 1OAAA 4FCTA 4NG5A 5FB3A 1PFUA 2DH5A 3VU8A 4F4DA 2BVNA 1X7ZB 4TYMA 3WBBA 1E2LA 1VE9A 1F1JA 4WXPA 1F8XA 1ZM3A 3BVPA 4HX5A 5JTTA 2NV2B 2Q6IA 3ZLJA 1AKNA 4GGMX 4DCMA 1NU6A 3TLZA 2OZVA 2P1RA 4IIJA 4IIGA 5F7JA 4G6ZA 2B36A 2P2CA 3JD1A 4PZLA 5F9MA 4PICA 3TXYA 4BX0A 4H1UA 5IMSA 2OAGA 4XCXA 2D1QA 3KLNA 3MGBA 4JLUA 3RBAA 1LFDB 3COYA 4RLHA 3DB1A 3JZAA 4ZAZA 4ZDWA 5BV7A 2D8MA 4QICA 1XPJA 2EKLA 2ZI3A 4UNRA 4Y2PA 5CLFA 4II7A 1O8BA 2W00A 3G2IA 1WKBA 4GLLA 5DSXA 1LRLA 2D0PB 1TCUA 3RF6A 4P81A 5AUNB 4UVEA 4ZCPA 3FWYA 1DKMA 1E62A 1OR8A 1W94A 1RYBA 2CVQA 2FB9A 3N70A 1W75A 4IGIA 4EGSA 3A1CA 2IEZA 5HG0A 3O7WA 1EHIA 4BNKA 1N2CA 1PKEA 1KJIA 2DFLA 3COSA 2HJRA 3E5NA 1SK8A 1UPAA 1Z39A 3ICVA 3DXFA 3KKOA 1QYRA 1TF7A 4YRPA 2YRFA 5TT1A 2WTEA 1N32B 3P7MA 2GKGA 3R6GA 1TC1A 4N5IX 4CW7A 3PC6A 4CV1A 2X5XA 5CIQA 3AG6A 5KC9A 1LLFA 2J9YB 2O2IA 1ZCBA 2Q50A 3F5FA 2A2ZA 1T1RA 2ZUSA 4RO0A 1NSYA 3ICCA 1AGXA 4DVGA 1S8AA 3CCCA 5EZYB 1OB5A 2YNMC 5AT1A 3I73A 2R47A 3EZXA 3QV1A 3UJDA 3PGA1 1JIQA 3KQOA 3FZQA 4WY2A 1TGYA 5K20A 4I4LA 3GLGE 1PV4A 1WUHS 5CBPB 1FTQA 1FMCA 2BFBA 1Y3CE 5EUBA 1Z0DA 2CC2A 3KUUA 3WLRA 1VP3A 4P53A 2VT2A 4MKFA 1RLIA 1PQWA 3GY0A 4KE9A 4KRGA 5GQSA 2P9JA 5ALVA 5EHIA 4KZPA 1ADJA 1M6YA 1XTBA 3HGTA 5GADl 1Q19A 4D56A 1JPVA 1E9EA 2FN9A 3MWDB 4UVDA 1NNUA 1B73A 1CJUC 3E23A 5FBLB 4D8XA 2VCEA 3C6BA 3GVHA 1SRQA 4EHKA 4XB6B 1KK3A 1Z16A 3AKDA 2VAWA 4ARUA 4ZK2A 3ZDDA 4DWOA 5CW2A 2O2ZA 4Y6SA 4XFJA 4EO7A 1E0AA 3ZWBA 3ZV3A 4JYCA 4P2BA 1KL7A 3QWHA 1G42A 1AUPA 3BS4A 3BEDA 1TM4E 2Q3BA 2IODA 3C7AA 2AMLA 5A4JA 5EUCA 2ZWPA 3QLVA 1RRCA 4HUQB 3PKJA 4MR7A 3V48A 2Z8YA 1NF8A 3KQTA 4PYIA 1HG1A 4MEAA 2Q28A 4ESHA 4Z7OB 3AV3A 3CF6R 3CTPA 3HI4A 4U7HA 1N5JA 1PGNA 3TCKA 1G2OA 4FE4A 4NK5A 4AKGA 1C9NA 2IYTA 2OV3A 2JLRA 2KSQA 3LDHA 2IBTA 3MWKA 4JJ8A 5EHZA 2DERA 1B6RA 1H85A 3AJAA 2IPAB 2CDNA 4FEYA 1ZP6A 3EOBI 4MWSA 1BKYA 4XEUA 2PQ0A 3DDWA 2H57A 1Y6RA 2RGCA 4H1TA 5TMDA 2Q45A 2Q6TA 3IKLA 1CUZA 4O4HA 3MWLA 3K4HA 1W73A 1OSNA 4I9HA 1GTZA 1JJBA 4K28A 4AKHA 1FLNA 1YCHA 2CFIA 4YI3A 5DE3A 1P7VA 1RWKA 1EIWA 1FRNA 1VFPA 2PA0A 4KV7A 1NY6A 4QULA 1EQUA 2XYHA 5F5LA 4AFNA 1C4OA 2VTBB 3UOWA 4O5OA 3DVQX 3GRUA 5EXXA 3PUKA 4M0LA 4IFTA 1BX0A 4LZPA 1GP2A 3HU3A 3OJCA 5DM1A 1WVGA 5IDXA 1SD1A 2X0JA 4G26A 2BIFA 1PEDA 3RU3A 5CVDA 4LHXA 4QXRA 3ZWYA 2VUUA 2E89A 3GZJA 4GI1A 5TS2A 3WLPA 2XXJA 4LRXA 2Q07A 3SKYA 1QUEA 5EZYA 1PT8A 2ORIA 3DFUA 3EDQA 2CLFB 5JMPA 3THOA 4RFVA 4F7DA 3AOEA 1DIRA 1E2GA 5B6IA 1G7CA 1OFTA 1X1CA 4UMFA 1I8TA 1A0OA 1A7JA 2PWPA 3OOEA 5FTMA 3QNWA 2Q7OE 4JI5B 5PNTA 2CUZA 3NHAA 4M21A 1Z4PX 1GFIA 5FL3A 1JHRA 1NE7A 1JT2A 2A57A 1AKYA 3C1TA 3MMNA 4NE9A 1MPXA 2Z09A 3LKZA 4AN4A 1E3JA 5TQ2B 4ITVA 3DBOB 5AXDA 5CG1A 4ZMBA 3ZBTA 2NO0A 2ECFA 4DEXA 4BQEA 1V11A 1NYLA 3RS5A 2F3RA 4TKVB 2O48X 2QM7A 3M6LA 2IYVA 4I7EA 1KDYA 3RC1A 1CEXA 5JECA 2MHCA 4B83A 2DFDA 4Q3EA 2QJTA 1RXVA 1YNSA 1SEVA 3O2QB 1XMOB 2WJVA 4L07A 3OWHA 3UXHA 1N6NA 1TZJA 4TPKA 1B2RA 1KFBB 4ITUA 3WGKA 4U7FA 4N9WA 4X0EA 4WIAA 4BVHA 3AESB 3V8RA 2QN2A 1GRCA 2V3WA 2Y9PB 3FRJA 1MQ9A 4QUBA 3DUWA 1XTZA 4FDTA 4B5KA 1SELA 2I0FA 3A9SA 3U9LA 4XVUA 1CX9B 1FVOA 1CUFA 3SQLA 3SG0A 4DUPA 1I13A 2GNAA 3AI7A 1W96A 2A0UA 1Q77A 4IWXA 4L28A 4A3SA 1WHTA 4KE6A 1BCRA 1V39A 2APJA 1YBAA 1C7FA 2CZGA 2VT3A 3E2PA 3GFRA 1VGVA 4RH3A 1Z2DA 2XE6A 4E2FA 4WW0A 4LYHA 4X62B 1RCUA 1QU3A 2O3TA 3CS3A 5H02A 3KL2A 5BSGA 5EIXA 1G20B 2XE7A 3L8CA 2R1VB 5SYMA 2VTBA 3B36A 2C5GA 1N1DA 5CK5A 1UK8A 2FVXA 3KOWA 4HAIA 4UW9A 1KMQA 1BVRA 4RS3A 1QC5B 3BSYA 2ZUDA 3EQ6A 3G8CA 2PR7A 4FFVA 4JCCA 5KKAA 1CFJA 2IU3A 1W4CA 4LJSA 4K6CA 1HL7A 1TAHA 2VNJA 1HZZA 2FSUA 1GDDA 1QVZA 1TPYA 3UC5A 1R5JA 1RRMA 1SBZA 3LTEA 1G0NA 1RJ9A 1NLUA 2PZLA 4HWTA 4XQCA 1NNLA 4Z9XA 3H99A 4F3KA 5C3UA 2JBAB 3BE6A 4JJKA 3M4NA 3IQEA 4CNQA 1SGWA 1XJQA 4FX2A 5I47A 3W77A 6Q21A 1NP7A 4IF6A 3UAGA 2Z1MA 1GNPA 5EWJB 3WYCA 3UGQA 2FWPA 1WWKA 3W2TA 4EA7A 3O03A 1YS6A 1HDGO 2B4RO 4KQ1A 4P9NA 5LBTA 2DYKA 4CMHA 1N3IA 1G6Q1 1QHIA 3HEAA 2XVZA 1EFHA 3FAZA 4J9VA 1K5DA 1NLYA 4CETA 1MO2A 3A3OA 2Z43A 2YW2A 3FBWA 5MFZA 5KWSA 4JBXA 4XWGA 2W8BA 3SX4A 1PTKA 4JUIA 5KSPA 2W70A 3FKSA 5H8WA 5BPFA 1ANKA 3F0TA 3C6QA 4RK7A 5C0OE 4MYTA 4COKA 1OILA 2FSVC 2GF0A 3DEFA 1KZHA 1COWD 2AGVA 3NATA 2PQMA 3HR7A 1CB7A 3F5DA 3ENZA 4WQMA 4Y9UA 2Q9CA 5KS2A 3WTBA 3NV9A 3V4FA 3GGSA 1ZIPA 1BDJA 2ZANA 4RBNA 3QBTA 3OLXA 2P3LA 2KX7A 4GSLA 3BUSA 1Y3DE 3TEJA 1KJ8A 2A14A 1Y8CA 3JQFC 3L18A 3P0FA 4P38A 2VOEA 4KVGA 1OLUB 5EMNA 1WCV1 3PQEA 5EMKA 3DFKA 2P77A 3ZPXA 1PK8A 1SQ6A 1D4FA 4XD7A 1G3UA 3QUAA 4X8OA 1NW9B 3PD7A 1YOVA 2XXAA 4FKMA 4FT2A 4CIVA 4ZXFA 1T5OA 2C61A 3RVKA 5B2ZA 1QH9A 4GQAA 1B0UA 2P9YA 3PJFA 1FRQA 1G20A 1IC6A 4COOA 1OXVA 1GG9A 1M2OA 1PG0A 2OKGA 4G2TA 4BRUA 6REQB 5LOVB 3OC0A 4GRDA 1KEPA 5A62A 3M2PA 1PFQA 1AK9A 1KU6A 3OPYB 5CAEB 3UN1A 4BNFA 4H60A 1QH8A 2FFAA 3W4IA 2QMHA 4NZYA 2FVYA 2FMHA 2F1RA 5TGZA 1CJTC 4ZMSA 5HK8A 1GPH1 1DBIA 2VRCD 3EEFA 3CF0A 1A82A 1IZ8A 1T5LA 4ZVSA 4AXBA 5BSWA 5FUMA 2EGGA 4JLDA 3URMA 5KTTA 4RULA 1I32A 1KS2A 2XMSA 3OSUA 4BX2A 3SYNA 3C3XA 5GIOE 3I92A 3DKRA 1KH2A 3ZZ1A 3KHTA 4OREX 4EI8A 2ZP1A 3MT9A 1ZS9A 5KC8A 4U6QA 5E0OA 3VSAA 3EVNA 2X14A 3TVYA 3N8DA 1L7NA 2YZ7A 1UQTA 4HBGA 1TX4B 3AUJB 2M6KA 1OCEA 5JEDA 2ZCJA 3DLAA 3RK1A 3D0KA 4J16A 4OUDB 4DG9A 4LK3A 1OZAA 3B3JA 3WY9A 2W58A 1A50B 1ARZA 1Z8HA 3OCZA 5U1PA 2QU7A 4X64B 3JYOA 4BMDA 2FJPA 3ZS9A 3EIUA 2QW0X 1VJ0A 5ED0A 4M4SA 3PFBA 3ZQ6A 1V25A 4F6CA 3KBOA 5LSAA 1YZHA 1XKTA 2XD4A 3F6SA 3QI7A 3N0RA 5TQVA 4CLHA 1CWUA 5LZ7A 1DC8A 5A3SA 4HNAA 4WNCA 2D5AA 3N07A 2HOQA 2JCXA 2PGLA 3EZYA 3IMEA 2XB8A 1P1KA 3ZXUB 4QNMA 3ZWOA 2B1GA 3U0VA 4Z4HA 1YDMA 1Z7YA 3O95A 1KQGA 5KYUB 3FI9A 4P5EA 1WNFA 4EKYA 2WYWA 5LQMA 3K6KA 1FLDA 2B20A 4NS1A 4BO1A 4E2XA 1UKBA 3MUOA 4LJ4A 1ZGHA 3A1EA 1Q7GA 1WETA 4YRZA 4URYR 2HA5A 4Q21A 2JIMA 1PQ4A 5D3QA 4WV3A 2OAQ1 5FOUA 3KLPX 3ETLA 5CEEA 4US1R 3PGMA 2E82A