2R25B

Complex of ypd1 and sln1-r1 with bound mg2+ and bef3-
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
TSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a complex between the phosphorelay protein YPD1 and the response regulator domain of SLN1 bound to a phosphoryl analog
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein/transferase
molecule keywords Phosphorelay intermediate protein YPD1
total genus 40
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r25B00
4WZZA 1YTUA 2NZUG 1VLZA 3BRSA 3P9YA 3D8UA 5T7BA 3EQ2A 2E4XA 4MS3B 5HM6A 5I4CA 5CNJA 3RVNA 3TO5A 5C5CA 2QU7A 2VYCA 3QEMB 4YO7A 5KQPA 2GKGA 2R25B 3TD9A 2ID9A 1QPZA 1L5ZA 1E6LA 4MR8B 3UUGA 2Q5CA 3Q7SA 4LX8A 3LMKA 4ML3A 1JH9A 4N0PA 3DLHA 2FEPA 2LUOA 5EWLA 4MR7B 2V0NA 1XHEA 3HCWA 3HUUA 2ID7A 4MLDA 3OO1A 1VRVA 3H5OA 3EQZA 3LTEA 3GWGA 1ZGZA 3HK2A 4DQDA 3KS9A 4OBBA 4PICA 3FFWA 4EYKA 1KGSA 1NXWA 4G0MA 5GOTA 1JL3A 1U04A 2IYNA 4E7PA 1WETA 1NATA 1ZAYA 1NXOA 1W9HA 3UK0A 1U0SY 3LFTA 2FQXA 2QV0A 3GBVA 3MM4A 1JHZA 5TQ0B 1D1PA 2QW1A 5PNTA 1JYEA 1F51E 2WJAA 1AB5A 3KG2A 1FQWA 4ZPJA 4HNRA 3DGEC 2IPAB 1QKKA 3M9WA 4Z99A 4QYMA 1BAPA 1ABEA 2QZJA 3FDFA 3H5WA 4G0YA 3QEMA 1ZITA 2RGYA 3OQOA 4D6XA 3NNDA 4GNRA 3GA5A 3T95A 5KC9A 4MR8A 2A9RA 3LUKA 4EYQA 1LBHA 2HQRA 1TMYA 1YVUA 4HNSA 4EVSA 3A3KA 3SG0A 2FVYA 4RDCA 1EWVA 4MS1B 2JRLA 2HQBA 3LUHA 3M9XA 4PE5B 4F11A 2GX6A 1RZRA 2IPMA 4RY8A 1DC8A 1NXTA 4ETIA 1A0OA 3MIZA 4RK1A 1GLGA 4OG2A 2LIVA 3H5VA 3NNNA 1SRRA 4ZYLA 3IPAA 3LUFA 3CS3A 3GYBA 1K68A 3Q41A 4H60A 3IDOA 3M6MD 5TPWB 4WXEA 3MYYA 3H1GA 3CU5A 3IP7A 3LUAA 4IILA 2B4AA 4KK3A 5JNTA 4KFCA 2M1ZA 2FMFA 3BREA 3O2QB 2QVGA 4MS1A 4RY0A 4MQEB 3GT7A 1DBWA 3RVKA 3O1HB 3JVIA 8ABPA 3IP9A 1E6MA 3ROFA 1YIOA 3KCNA 4RKQA 5FBKA 1M2EA 5JNRA 1U8TA 5CHYA 2BGGA 3EGCA 1MVOA 1YMVA 4FB4A 3OLZA 4RS3A 3DBIA 3O2SB 2LP4Y 1USIA 2FMIA 5HSGA 5KQGA 1UDRA 3MQ4A 3LUDA 1YMUA 2OQRA 4Z4FA 3SY8A 5BQ3A 1EAYA 3HJFA 2QXYA 3I5AA 3CLKA 4RK4A 3N8IA 3OQMA 3QLTA 2CWDA 4KVFA 4O5AA 2F8SA 4MS3A 3KLOA 4OLBA 2GWRA 3OLXA 1YK1A 2P4UA 1FFWA 4O1IA 4RU1A 5FWYA 3HXMA 3I45A 1J56A 2F8TA 2JVIA 4G97A 2GBPA 3KTOA 3E3MA 3RVJA 3MMNA 4EY3A 3H1FA 2TMYA 2A9QA 4KZKA 3RQIA 3F6CA 2PL1A 3NBMA 5BRAA 1JLKA 4Z4GA 2AYXA 2JB9A 1D2AA 2A9PA 2IDMA 3IP6A 5DKFA 4IMIB 4L85A 4H3KB 3QX9A 3N6VA 1AB6A 2HJ9A 4ETMA 1K66A 1DBQA 1ZY2A 3Q9SA 4KK4A 2R4QA 4LZLA 2IPNA 1RXEA 1D5WA 2R47A 3Q7RA 2FMKA 1NXPA 2FEWB 4IRXA 3RVRA 2PUEA 1HEYA 5JS2A 4Z0NA 3SM9A 5C5EA 2VK2A 3KJXA 2QVCA 2VUHB 3DLBA 4KQ9A 1JDPA 4MQEA 4G0QA 5BRJA 9ABPA 2KYRA 3G85A 5DGCA 4W5RA 3CKMA 4F06A 5FWXB 1C0EA 3C3KA 5DTEA 1Z17A 2J48A 3EODA 3LKVA 4Q6BA 4RXTA 2PUAA 4YCSA 1MAVA 4YR7A 3FGZA 1EWKA 3BRQA 3NHZA 1EFAA 3RVSA 1ISSA 1JFVA 4MLCA 4Q6WA 2QR3A 3B2NA 1BDIA 4FE7A 3OMXA 2MSKA 2GI4A 4UHKA 4WUTA 2PUBA 4OLAA 4E7OA 1KRWA 3QELA 1QP4A 3O1JC 4XASA 1R8JA 1DC7A 2JBAA 3OMWA 1ZDMA 3G1WA 1QQBA 1KMIY 3LUJA 1SXIA 1LK0A 1USKA 2ZAYA 3GV0A 4N0QA 5GQSA 3JTEA 5ABPA 2FKAA 2NZVG 4UHJA 4D6YA 2PLNA 5TQJA 1U2QA 2FMHA 1QQAA 4Z4HA 1PNRA 4ZJPA 1YS6A 1P8AA 3ROTA 4F12A 3F7NA 3SNKA 1Z2EA 4PZ0A 4XXHA 4EVQA 2FN9A 2RJNA 1QP7A 1Z15A 1YS7A 2WMYA 3HDGA 1VPWA 1XWWA 4EVRA 4S05A 1IIBA 4HNQA 4W5OA 3O21A 3KSMA 1PHRA 4YLEA 2FW0A 2X7XA 3HSYA 4TLLB 3EULA 5JNVA 1BVHA 3DZDA 4XLTA 2FSPA 3SAJA 3E61A 5DCLA 2DRIA 1XHFA 1U2PA 5KWSA 3NHMA 3L6UA 2IKSA 1Z26A 2JK1A 1DRJA 4MRMB 4RXMA 4JOQA 3N0RA 4MPTA 1JFTA 4NCAA 1PNTA 4KREA 3ILYA 1ISRA 2L18A 6ABPA 1DCFA 2PUFA 1P6UA 3N0XA 3LUGA 2OENG 4B09A 4ZMRA 3A0RB 2HQOA 3H1EA 3C3MA 3IPCA 2PE5A 3LKBA 1B00A 1ZHHA 2XDYA 4JB0A 4IF4A 6CHYA 1QP0A 5TPWA 5EWJB 4OATA 3OLVA 3O75A 3SQNA 1P6QA 2FQYA 4M88A 4MQFB 2PKXA 1DJMA 1DBPA 2FEKA 1DZ3A 4RWEA 4D74A 4RK7A 1Z2DA 1BDHA 2FLKA 4PYRA 4L4UA 3NNSA 5JNWA 3TX6A 4EYGA 4F8JA 4NCBA 4WWHA 4DADA 4W5NA 3UKJA 2IPLA 3CRNA 1QO0D 4N76A 1GCAA 2E4UA 2MYNA 3EJWA 1Z13A 4RK0A 1A04A 4YRZA 3DGFC 1PUXA 2B1JA 2HSGA 3CG4A 3FFXA 4EGSA 4LRQA 1MB3A 3BBLA 3CG0A 2WY2D 1SD5A 3H5TA 4XARA 5IUJC 1H9CA 4YWHA 4XFKA 5TQ2A 1ABFA 3T6KA 3HM9A 2P9HA 3GRCA 3N75A 4YV7A 4OTZA 1RPJA 2FN8A 4MR9A 4IGAA 1EWTA 3Q7TA 5FWYB 1JYFA 4Y9TA 3JPYA 1FSPA 4KMRA 4NICA 5IBQA 5FWXA 3RVMA 5TPZA 1JBEA 5TQ0A 4MQFA 1M5UA 2YHAA 4JB2A 4Z9AA 1OXBB 2RDMA 4HYEA 3I42A 4G86A 3QLUC 1GCGA 3FFTA 3HZHA 5CNKA 5TE9A 2FXIA 3C3WA 3A0UA 3EDCA 3VNBA 4LE1A 4P98A 1MB0A 4TMYA 4EYOA 5TQ2B 5EWMA 1TLFA 2WRZA 1E2BA 1URPA 1APBA 3CTPA 2NT3A 1QO0A 5KQMA 4H3HB 4TN5A 4N41A 2HPHA 1NXXA 1CYEA 5B3JA 2L17A 3CHYA 4KPYA 4N03A 5CNMA 2PUDA 2JBAB 3D02A 3JVDA 1EHCA 1JWLA 1Y1LA 2LPMA 2R48A 3OM0A 3HV2A 2QSJA 2VUIB 1C4WA 1E6KA 1NXSA 2PUCA 5T3YA 1F4VA 4ETNA 5B3JC 1RZRD 1OXKB 3K9CA 1M5TA 2I6FA 2H3HA 3OLYA 1FFGA 1LJUA 2FTKE 3KHTA 4LDZA 4DN6A 4EUKA 1M2FA 2A9OA 3HDVA 3GBPA 4O1HA 1ZH4A 3RVOA 3JS5A 2FQWA 3KYJB 4CBVA 2N9UA 2PL9A 3JPWA 4MYRA 4NV3A 2PJUA 5JS1A 5KC8A 2E4YA 4IMJB 1TVMA 3CZCA 1S8NA 3IP5A 1JX6A 4W5TA 2FLWA 4GPAA 1NY5A 5CNIA 3CFYA 3O1IC 3I09A 1DCMA 4RV5A 2PUGA 1MIHA 4PEVA 4RK6A 3HO1A 4JP1A 2PMCA 2JVKA 3H6HA 5JNUA 1DCKA 1SXGA 1ZVVA 4MS4B 1RXIA 1GUBA 3HS3A 2E4WA 3K4HA 1GUDA 1LBIA 2AYZA 1TM2A 2MYPA 4RKRA 5IEJA 5IEBA 1DG9A 1FFSA 2L19A 2WB4A 4YP9A 1A2OA 2L2QA 3MA0A 4RY9A 5EWJA 4Z4IA 1D4ZA 2H0AA 1NXVA 4P1ZA 5D2CA 4KRFA 3QLUA 3QLVA 3EAFA 2CD7A 3OM1A 3ILHA 5ED4A 4W5QA 4MAAA 2JCGA 4YGXB 1KRXA 3H5LA 2YHBA 3LUCA 5FBHA 2NUBA 4JA2A 3RVLA 1Z18A 3HVRA 4XAQA 2RJOA 5JNSA 1LJLA 3KYIB 4WT7A 4YS6A 1ZESA 2M98A 3Q15C 3QX8A 4QPJC 3QK7A 5F64A 3GL9A 1Z16A 3O74A 3OLWA 1Z12A 1ZN2A 3RVPA 4KV7A 3QELB 1ZH2A 1P2FA 4MS4A 3RH0A 2WWVD 4Z4EA 4TLMB 5E3JA 1T34A 5IULC 1JDNA 2PAFA 4G0XA 3BILA 4Z4CA 1RNLA 2IOYA 2E4VA 3C97A 3F6PA 1CHNA 3R0JA 1DRKA 2ZWMA 4N47A 1VKRA 3C6QA 3FMVA 1W25A 3H6GA 3QLVC 4F3TA 4JAVC 1JF8A 4JASB 3URMA 5EWMB 1BDJA 4G0OA 7ABPA 4G0ZA 3VNAA 4RZSA 1D1QA 3CNBA 5HQJA 2WJWA 4LE0A 1QMPA 5IX8A 2MSWA 1USGA 4MR9B 4FE4A 3O2JA 4QYWA 1PEAA 3N0WA 4LE2A 4RXUA 4WXMA 4Z9BA 4KNYA 4RK5A 2MYTA 3TB6A 1L5YA 5DLEA 5IC5A 4KQCA 2W42A 1I3CA 3JY6A 4NQRA 2NT4A 4S04A 2LBPA 1ZGGA 5IUKC 3S99A 1QNLA 3H75A 3RVQA 4LDAA 4MGEA 5BR1A 1TJYA 1YK0A 3F73A 5EWLB 1JFSA 1NTRA 1DP4A 5HKOA 3MF4A 5TPZD 3CZ5A 3W9SA 3KLNA 3QEKA 1Z25A 1SXHA 3HUTA 2MYUA 3H5IA 4Q7EA 1CEYA 2MSLA 3KKEA 5IUNC 3TMYA 3OQNA 4ZMSA 2E4ZA 2CHEA 3LOPA 3L49A 4RSMA 2JVJA 2O20A 3N53A 3T8YA 3HEBA 4G0PA 4MR7A 4QICA 1BA2A 5KI6A 3T38A 3OO0A 2CHFA 4MRMA 5KQLA 1PEYA 3A10A
chains in the Genus database with same CATH superfamily
2FR8C 4WZZA 2C3UA 3ZCPA 4RIHA 3D8UA 4JDPA 5IAEA 4MPJA 1Q2UA 2ZR0A 5BYAA 2AXPA 1VPLA 4QGFA 1KYXA 1OREA 4UM7A 4IZ6A 4WNIA 4PR0A 2VYCA 4G37A 5FNVF 1QPZA 4IDDA 3K4PA 2OKCA 3SZGA 2F1OA 1U9JA 3ELYA 2I2DA 3V6LA 3PTZA 1WW8A 4ISBA 3VHLB 1EVKA 3D2LA 4Z0PA 1AHHA 2A1TR 3PXUA 1RJEA 1LWOA 3VH3A 2J87A 1P44A 3OJWA 2CV2A 4U8GA 2V0NA 3QQ5A 2CCJA 1BW9A 3H8VA 1N1EA 3AETA 3JWHA 3LY7A 5LDHA 2JFOA 3HCWA 4Q39A 3G2PA 4UCXA 4ZDIA 4FHFA 1D6MA 1K4YA 3PNVA 2F67A 3GWGA 2QX9A 1I4LD 4R1OA 1J4AA 2R6ZA 4X6UA 2WE7A 2V59A 3TL3A 4A0HA 2HA5A 4OMDA 5J5CA 4BFTA 4W4TA 3JAMA 2ZQYA 2GTPA 4GMKA 4NJMA 2RGBA 2EFGA 5AI8A 4UTVA 1PKEA 3D3WA 4WCDA 4JMLA 1G291 1Z56C 2PBLA 2YXEA 3L8EA 3LFTA 4PYKA 4B47A 4ENWA 2DULA 1R6DA 3ROEA 1OLUA 3JZAA 3GJSA 3EFBA 2WILA 3VZRA 1Z4QA 1OLXB 3A2MA 3HFSA 3N2KB 1FVFA 2O2GA 4HDKB 3BULA 4AO8A 4B3GA 1QKKA 1NUQA 1T8SA 5IT9A 3ZJUA 2IODA 4D3YA 5EUQB 3V3TA 2C9DA 4DB4A 1ICEA 2D0IA 2P6UA 2RGYA 3NC4A 4GNRA 1Q0UA 3EPHA 2VA9A 3QW2A 4MR8A 3G0BA 1ODLA 2X8JA 1KY5A 1WB9A 4IJKA 3CW9A 3U3OA 1YVUA 3AM4A 3OHPA 4FMDF 1NWCA 3WLMA 1N6RA 2IHUA 4V3BA 1K2VN 2F3QA 3SBXA 4V0SA 2GF2A 1IHPA 1QHHA 2XUFA 1D0SA 1I7PA 4G1VA 3STUA 5KINB 1PFGA 2JLYA 4CEHB 3DHWC 3GGDA 5LKAA 5J5AA 2ASVA 1UPFA 4W7HA 4R2XA 2W83A 2TMGA 1PWYE 1C81A 1XL1A 4ZWNA 3K32A 1L4BA 1W2WB 1GTMA 3OZDA 4PG8A 2XXAB 1R37A 2FRDC 3NNNA 1SRRA 3EXHB 3SIWA 1WMSA 4Y18A 1VE3A 2FWJA 2JCBA 3BX1A 1Y9JA 2UUBB 2DR3A 4MZXA 4ZDJA 3I2YX 4NDNE 1ES9A 4JYBA 3IP7A 2VHUA 3MTAA 1TJ5A 1XRRA 2J0UA 4TQ9A 1XF9A 4RZ2A 3WSTA 5A5DA 2B9VA 3QFFA 3ZCVA 3OP4A 5JNTA 3J80A 4AXXA 4EG1A 1UBLS 2QVGA 1FUIA 4MQEB 2FOXA 4LRXA 3TB4A 1NW5A 3JVIA 3NRBA 3K92A 2ABWA 4XQ0A 2ZIWB 3ZDYB 1E6MA 3DVLA 2IYVA 4K8OA 2QZ9A 3GEIA 1V43A 2GYVA 1WHSB 1X94A 4PPFA 3W2TA 1E2DA 2PZLA 2Y92A 2EX0A 1MVOA 3PICA 3ZW9A 1FS4A 1TW2A 2GJ4A 2FOIA 1USIA 3PQ8A 1JALA 4QUDA 1KVTA 4HR7A 1YMUA 5HX7A 1A9PA 2FJ0A 3CZRA 5K6TA 5FUYA 5B1DA 2G80A 1KU6A 5J2TB 3ZZTA 1A8UA 1HGXA 1OV4A 2GLXA 5BV2P 3ZVMA 1FBNA 2I0FA 5CH5A 1GWNA 4DA0A 3ZXIA 4OMFG 5JD4A 5CCEA 4RSGA 4YC7A 2GWRA 1U4SA 1YK1A 4FLEA 5DCWA 2QRJA 3WGNA 2D7CA 5AKLA 1PJ3A 5FAKA 4U7HA 3VNUA 4PQYA 5JANA 3R7SA 1JDBC 3V48A 4D99A 2FNAA 1V8DA 2JZNA 2TMYA 4L95C 3WRWA 1GN9A 1E1DA 3AERA 3FUXA 5BWOA 2R6CA 4TXMA 2N0SA 5DNWA 1HLPA 3GF4A 2JB9A 1TD9A 1ENYA 2O1WA 4YRQA 1NXQA 1G0OA 2F3TA 3BWCA 5A3VA 5A5VA 5EE9A 4KQ1A 3UPDA 2I4TA 1ADFA 4A36A 1DQSA 2QMHA 3NRCA 1SEPA 4DR6B 1L4LA 1OT3A 1VJ0A 3JVVA 3O90A 4GMDA 4O63O 3WBBA 1A88A 2VJBA 1NBME 2WWHA 3HCCA 1SU8A 2PUEA 3VV3A 2YYYA 5A05A 1JU4A 3IVCA 2IUSA 1Z68A 5J4VA 3OT1B 2Y0PA 4RQBA 5J2UB 4LTNA 3O4GA 2ECFA 2HRRA 1YL6A 3NP7A 3X1ZA 4MZDA 3T06B 5JY6A 1L1RA 2ISCA 4G0QA 4HZGA 4ZDWA 1EB9A 1WCYA 4FNAA 5P21A 3L8DA 2WYVA 5BYBA 2QL6A 4YMWA 5K0JA 6ADHA 1HNXB 1T25A 1Y8RB 2WUEA 3DMNA 4MWDA 3B9RA 4Q6BA 1WXHA 4LTMA 2BKEA 5D8DA 4PYOA 5CVEA 5KAMA 2DXIA 3DAOA 3BRQA 2PZJA 2V54A 2Y2UA 4F72A 2Z8ZA 3MUOA 3D1LA 4IDPA 4UUMA 2QJOA 3CGGA 3GAFA 3BC1A 4U39A 4Z1MD 2GZDA 2RHJA 3D6VA 2BEVB 2Q3DA 4MWTA 4CMEC 4EHAA 4YAGA 3BICA 4JQYA 3UATA 2JDID 2GFIA 3V7UA 3FHJA 3EIEA 4LFBB 4EP1A 1L3CA 5JROA 3SDZA 2C97A 2WABA 3QBEA 4NFSA 1E3TA 5KWVA 1UZMA 4PONA 5IJZA 3SR4A 5DP1A 3MGAA 3DHVA 5TQJA 1L8QA 1K8ZB 2OR3A 4J0EA 1INLA 1M2VB 4KFUA 4OHBA 3PKJA 3D8HA 3QPUA 3L9WA 4MJ7A 1RJFA 3SEQA 1FSSA 1JVNA 1T8UA 1AOXA 2QM0A 4QZVA 3IS3A 3UMMA 2ECOA 2SCUA 4EVQA 4D98A 3H7IA 3GLHE 5HKKD 2PCJA 2AJLI 4C2TA 1EFLA 1YQEA 1Y1RA 4GZ6A 2BW0A 1Q0LA 3O21A 2XCSB 4TLLB 4FYXA 5HEKA 1K63A 2JAHA 1WCWA 2BUBA 1WDKA 1WTAA 1TTQB 1FSGA 1G5HA 2ZIFA 1C0PA 4PSUA 4REQA 2GM5A 5ADVA 2IS6A 4DNOA 2IKSA 2A92A 3I2GA 2XVXA 3HUFA 3SZOA 4CM5A 1I7QB 1PNTA 1BTOA 2VAMA 1QG4A 3UK7A 3S2YA 4KI7A 3VZPA 1WDLA 1DCFA 1TCCA 4Q9DA 4TL9A 1BVYF 2C4KA 1P6UA 1LPSA 3KOUA 3H13A 1N5DA 1PT9A 1WW2A 2YASA 4C3OB 4BXOA 1JBKA 3H9GA 1J5XA 2HQOA 3A0RB 3H1EA 1FFHA 4UJ3A 4OL0A 1YACA 4YIKA 3FGOA 2CSXA 4ZV4A 3H87A 1LPAB 1PS8A 2NVUA 1IDOA 1QR2A 2VPQA 1GADO 2QK4A 1NBMA 2ZI7A 5G4KB 3VH2A 1Z37A 3QEJA 1U7UA 3G2NA 3AKYA 3D81A 3W5IA 1ZMOA 2FQYA 3WMFA 4JLKA 3RUIA 2C7RA 4ZHSA 1WMBA 1F2UA 3RDPA 1CUJA 1TC1A 5IAJA 2JAUA 1TU4A 1F9AA 1ZJZA 2HPZA 3UICA 4YV2A 9MHTA 1T91A 1FPQA 2V0CA 5HF8A 1TAGA 4TRMA 3VBCA 1Z2AA 3DTVA 2AR7A 4RM3A 4DADA 4HUQB 1JEEA 3THWA 3CRNA 4RFVA 3THYA 1RQPA 2JFGA 1KQOA 3CR3C 4DQUA 4JEMA 3AF3A 4TYYA 3O83A 2O52A 4HVTA 3DDZX 4OJQA 2QT1A 4C6SA 3JQPA 1X2EA 5AI0A 4ZOLB 2QYSA 3CF6R 2PNFA 3A4VA 3K0FB 1NHGA 1AXEA 3HWRA 5HF6A 3LO8A 1T36B 3TQSA 2IUEA 4B46A 2Q46A 1AIPA 4BVBA 3TSOA 3ZVNA 3B38A 2CVOA 3GMDA 3GRZA 1GT91 1QIJA 4GWGA 4CIYA 1RRPA 3H83A 5IKMA 3PRKE 4DEYA 1Q1GA 4L72A 3SC4A 1JYFA 1IH8A 5JZBA 3CRMA 4NFYA 4EM6A 4MW7A 2P4HX 2GD6A 1ISHA 5LMUB 5B4UA 3OJLA 4X5OA 1HDRA 3IEKA 3F6YA 3CO5A 2HMSA 2VTBA 4Q3CA 3AF1A 4B2YA 1SUEA 1PR3A 3MGBA 3QLUC 1UFRA 4LVNA 3HZHA 2F43B 2CLKB 3JZIA 1CZKA 2I1LA 3CN7A 5FPSA 4DEVA 2C99A 1A9SA 2QGNA 2J7PD 1AE1A 1ZNZA 1ZQ1A 4QSHA 3TLEA 4URVR 4YIHA 1RYEA 1VCIA 5D00A 2SHKA 4MCAA 5FA6A 4QG7A 1WCIA 1GKKA 2C20A 1KYIA 3NBFA 1EWYA 5LYJB 5TC4A 2GDZA 1FLAA 2H5EA 4BWYA 4IOKA 1K3TA 2DWQA 2ZTUA 3UV7A 3CTPA 3FMIA 2WD8A 3QX3A 4IVPA 3FTNA 2I71A 4LCJA 1TYZA 2WAXA 4KR9A 1Z4NA 1IPEA 1T1SA 3ZU4A 1K6EA 5ALRA 1ND6A 2GSDA 5EMHA 2QZ4A 3ITEA 3JZDA 1RBZA 2HO5A 2PIAA 4OF4A 2C3OA 1CETA 3HJAA 3PUWA 4XOUA 2OHFA 2AUTA 4PAQA 5ALXA 4KVAA 1NNI1 2V7QD 2VWPA 2AI3A 1E6KA 3GU3A 2FSIA 3HB1A 3M9LA 1ESDA 1DJLA 1YB1A 3LNCA 4I6EA 2AC4A 4QVKA 5D6NA 2ZIUB 1S8FA 1W8IA 3CH6A 2BGNA 4HBGA 4JX9A 3U39A 1QIEA 4MKGA 5KJ6A 4YRBA 4CLRB 2PWAA 2W6QA 2EYQA 3KHTA 3MWEB 4GT1A 3HADA 3S2GA 3V1LA 3M89A 3ET4A 3GBPA 1Y82A 4X8HA 4BLUA 2COEA 4YR9A 1A5AB 1PJAA 1GZDA 4F1JA 5HK9A 4BVEA 1WP4A 3ROKA 2BVNA 2A0YA 1EFKA 3OA2A 4TPKA 4TTSA 1XVTA 2B34A 3OCJA 1OW3B 4UM9D 3G79A 3H0KA 3IUJA 3HLYA 4V0OA 3RADC 5CB6A 3FSJX 4M9SA 3WDKA 5EJ6A 5CNIA 1NOJA 2B4KA 4Q1AA 5ICEA 4OQXA 4QX6A 3KJNA 1PK9A 4HH4A 1DCMA 2QHXA 4M2LA 1KKLA 3QLEA 4PEVA 3RS2A 3OKCA 4BUJA 1E6EA 5I4BA 1YOVB 4JP1A 2PFSA 3NR2A 3NLLA 3LZCA 3TAHA 5CD9A 5KSWB 1HE5A 4MS4B 2WZCA 1SCUB 1PR0A 2O14A 1G3QA 5IYZB 1BXKA 1SB8A 1ZP6A 1BJRE 3CUSA 4P2BA 5GJCA 3B70A 2C9BA 3N2LA 3LU1A 3O26A 1X70A 4KN8A 3HU1A 5JQWA 3UJHA 1ZJWA 4RW0A 3O9ZA 5JDCA 3Q3EA 5D2CA 3I9NA 3T15A 2FB9A 3NGXA 2IL1A 4KSYA 1JJ7A 3EXG1 3I12A 1Y37A 1QJCA 2HTEA 5J43A 3JX9A 4LN1A 1WQ1R 3DMTA 5A9SA 5JEEA 2GVZC 1PL0A 1ULUA 1ZJ5A 1A3CA 1O94C 4IUYA 1ZK0A 3K9WA 1SH7A 3H7AA 5BPFA 1YDHA 4RHYA 3VSCA 1MX1A 1PR5A 3OLCX 1IY9A 3MFYA 3WKDA 3BXOA 2LKCA 4BNVA 5KS2A 1NJFA 4S04A 3EPJA 2BM1A 4GYWA 3QK7A 1PD0A 1O58A 3ABOB 4BEBA 3RROA 2AJTA 3SJCA 1VG0B 3F4LA 4BFCA 1JZQA 5HVNA 3AYZB 1YB6A 5D7NA 1WTCA 1MEEA 1Y63A 2CEAA 4TKMA 2WWVD 4TLMB 5CDGA 3RBVA 1MB2A 1DT5A 4RLFA 4B4DA 3RWMB 1QHSA 4KH1A 3HG7A 3SHTA 4DW8A 3Q1KA 5HRUA 2YBEA 2GXAA 2E4VA 2NSDA 2R6GA 4KREA 5MFPA 4P7GA 3RSQA 5EQFA 1E7WA 1UM9B 3HNOA 2FMTA 4C2AA 1SVIA 1L7VC 3RUCA 3PUKA 4BLWA 1AS0A 1NF3A 4RZSA 3VR5H 1ABBA 5CPFA 4GMFA 2XVAA 2GZ2A 1VE5A 3G2HA 4RXUA 1Z74A 2PLFA 5CMLA 2W00A 4DRYA 1BQ3A 4NBSA 5DM0A 2RB4A 2H9IA 1P2BA 1G9SA 5IC5A 1TW3A 4KQCA 4BMZA 1RI3A 5TQVA 4QDKA 4KIWA 4H7IA 2BFEB 1XP5A 2OXEA 5KWIA 1EFPB 3TIXB 1GQRA 5SYNA 1XMVA 2H65A 2CXSA 2IHYA 3H99A 1B3RA 1UT5A 2V97A 5BSUA 1DP4A 3VSEA 2GYYA 3A25A 3AJ9A 4MAMA 3W9SA 2Q9AA 2EQAA 2R68A 4ZD6A 2VJOA 1U7WA 4YUWA 1GUZA 1T8TA 2NGRA 2MYUA 1DWQA 2VTVA 1EXVA 1KHTA 1DZIA 2FP4A 1WBDA 3SPXA 3SS9X 2FFQA 1SC6A 3NHRA 1IFXA 4BBAA 2FZKA 3U44A 2JGKA 3L8MA 1GLVA 3UJPA 1KZ6A 4MUXA 1IN5A 1CNEA 1ODCA 2ZKIA 2QGFA 2HHAA 3CMMA 2CHFA 2NTJA 3Q85A 5KQLA 1HETA 1GZ6A 1E3MA 3A10A 1VYVA 1JH8A 4DDMA 3BRSA 4AW9A 4HAYA 4BQIA 1SZDA 2YQ5A 5T7BA 1NX9A 4YCBA 5F5NA 2WLSA 5E3IA 1QFMA 1WBJB 1E8DA 1VKOA 1W76A 1XIVA 3RVNA 2C7GA 3ELBA 4K9OA 4WKNA 3W5SA 5B30A 4YRGA 3DBLB 5KSZA 4AKSA 2ID9A 3T7EA 3EZLA 3MWYW 4CF5A 1LSOA 5EJ9A 2UUCB 3D0OA 4IX1A 5AJXA 1H4SA 2BIFA 3SVTA 1EP1B 2QUZA 2EP7A 1G6Q1 4WZAA 4BO6A 1JH9A 4GPIB 2HW8A 3AK4A 2DP4E 7AT1A 3VI4B 3IEIA 4L5BA 5JCJD 2CFIA 1BXRA 3BK2A 2DFNA 5FCDA 2AUMA 4MLDA 1M8JA 1T3SA 2E48A 4FFWA 1CUDA 3TLGA 1FNNA 4CM1A 3FFWA 2QB5A 5FBQB 2B20A 4B6OA 1QBGA 4KPGA 4OJMX 4N4AA 3QX7A 1CERA 1SIWA 3KSDO 1WETA 3LP6A 4NMHA 1C2TA 1CUBA 5D3QA 1TLLA 3BGWA 3UOAB 4COOA 5IJ0A 3O2NA 5DGDA 1IEVA 4IAOA 5DASA 5EC8A 3TRIA 2X77A 4PSVA 1YV9A 5BN5A 4JK3A 5KTRA 3TGLA 2XKKA 5IDYA 3A6PC 2ZSHA 2Q8QA 4L9AA 1XTIA 1XGKA 4BJ5A 5I7EA 4P58A 1DE0A 2YVLA 4BEVA 4YV1A 1TTHA 1PEDA 5DTQA 5EFOA 3DL7A 1T5HX 1XEXB 1LB1B 2B7LA 2F64A 4QWWA 3CH7A 3A6EA 5DRYA 3H5WA 4X7BA 3TRDA 4C6TB 1S6YA 1ZHOA 4I55F 2YDXA 2PLAA 3GA5A 4UE6A 1R18A 1G8GA 4E4TA 3FPLA 1UJNA 3UUFA 2WTAA 1F4LA 1PEKE 2A0FA 1TT5B 3A3KA 5AKYA 2QPLA 1UP6A 3PDJA 1Y98A 4QOJA 3TLYA 1ONNA 3W2IA 1HDCA 2GBCA 4HQKA 3FVQA 3QNUA 4OB7A 1A9TA 1IBKB 3KOZA 3NBYC 2DLNA 4HB0A 3OZEA 3FDZA 4RTRA 3RU2A 1YGYA 2GQ0A 4JU8A 3VI3B 3QPVA 4F4JA 2PN1A 1A0OA 1ZINA 2ZSAA 5DGTA 4N5LA 5AW3A 5JR3A 2YJNA 2DFPA 3N28A 3SF8A 1UAYA 2WU3A 1XA0A 3L8YA 3Q8KA 1Y5LA 2W4MA 4MDYA 4UBMA 4ZALA 4B0PA 3H1GA 1HZJA 3UHFA 3LUAA 3IAM6 5IN4A 1A9XB 2EG5A 3LHDA 4X7RA 1RRGA 3RU9A 3IULA 2WF9A 1GVNB 2R5WA 3A11A 3IUBA 3KT6A 3M82A 2VHQA 2R751 3MOSA 4M0UA 4PLFA 3UQZA 3CINA 2FMFA 2AG0A 2ID8A 3L4BA 2R8RA 2AF4C 5FNVB 5CYOA 5DNAA 1QGOA 4FD3A 1Z2CA 1BO6A 3NHBA 3WDMA 1C14A 4GLLA 3ZLUA 1X1EA 1QMGA 3DBOB 2ZBUA 2BGGA 1P91A 5A6SB 4F5YA 5C51B 1T9GS 4QU9A 2BBSA 1AS3A 5KOIA 1GV0A 5LIPA 2XZLA 3TGWA 1T6NA 2KHZA 3S2IA 3HEAA 4YCAA 9LDBA 1SQSA 1QGUB 2EG9A 2IHKA 1C3VA 4YPOA 5SZJA 2VHJA 2DYKA 3DLPX 4X85A 3UXEA 5BQ3A 1II8A 2UYQA 2B2CA 2IT1A 1DTEA 3W4IA 2ZT8A 5BWBA 4D02A 8LDHA 1C7QA 1XTPA 1EWRA 2V6GA 3I72A 3V4LA 2ZUTA 1MENA 1Y1PA 3A7DA 3I45A 1DV1A 2G71A 3QYJA 1W0CA 1OF1A 1XZNA 3PUZA 5CX1B 1NYLA 3DJYA 2OYCA 3RR2A 5LZ4A 4MDEA 1SAYA 2A0UA 3KU4A 4EY3A 3AR2A 1JIQA 3AUYA 5AHKA 1RYBA 2MTBA 4JEHA 5IVHA 2WD7A 4DZRA 4TV9B 3U3RA 4X90A 2HUPA 3TQTA 1U8YA 3Q0EA 3M4JA 2A9PA 4X64B 1UKAA 3E23A 3TR0A 5DKFA 5BXYA 2YWHA 5MF6A 1R0LA 1E79D 1ZY2A 3UPUA 4P38A 2CVZA 1CQIA 2R4QA 2I7VA 3BYZA 1D5WA 1DKLA 1DUVG 4XIFA 3T7TA 3OJ0A 2PLWA 2FMKA 1PFKA 2B5OA 3HRIA 1ISMA 4FWBA 5K0ZA 3OI7A 4QDXA 1BDMA 5AM4A 4ARZA 5DPMA 3KJXA 3LVFO 1WB5A 4QO7A 2BM0A 1J97A 1H2YA 2W37A 3WB0A 1M2GA 1Y3DE 3VYSB 3OOWA 3DAPA 3ZK7A 5C3UA 4MIEA 4GBED 3KKMA 3VSDA 2Y0DA 1DAKA 1E3QA 3C6MA 3ORFA 2QTNA 4PHGA 3JD4A 1TIBA 3TM5A 4YCSA 4US1R 1LLFA 4D9EA 7YASA 5J2TF 3TSCA 1ADYA 2HEIA 1U2ZA 1YUBA 1E0KA 3C85A 4IX9A 1P60A 4KLRA 4Y9DA 4B5LA 1BDIA 1AV7A 3ICWA 2X1VA 1ENPA 1KJIA 5DHTA 3P2YA 5FLKA 2PUBA 1A9ZA 3M1IA 1R9NA 1JSLA 5ISMA 2XNDA 3FCEA 4PGMA 4BMVA 3RKRA 1HTWA 4YDSA 4L5AA 1GGMA 1Z62A 3GLHA 4H0NA 4N0QA 5IC6A 3D6JA 3ZIAA 5MN5A 2RHWA 1A96A 2POQX 2EZ9A 1NPTO 2RBGA 2FMHA 5JOQA 2NZJA 4EBBA 4DR7B 4ZJPA 5DNYB 3HJGA 4PLCA 2HGZA 3OX1A 3ZKAA 3DB1A 3DYIA 4I50B 4PS1A 4AUEA 4NMXB 3RGGA 3EC1A 4YJGB 1MCZA 1KY4A 2BEWB 1LU9A 1YJCA 4F4DA 1AMOA 2OQ2A 1V4VA 1ORVA 4IZOA 5KNBA 3FYSA 3FI0A 1GRNA 3G9UA 1Z8NA 5CXUA 5LWHA 3KSMA 4BFLA 1PSDA 4J7UA 1ZW6A 1GAXA 8AT1A 5CIYA 4FDTA 3EULA 5FXMA 2RCNA 3IR7A 4J7AA 2A0WA 4UHCA 4IEIA 1JHQA 5KHAA 3D59A 2EERA 2F9LA 3MAAC 2YUIA 2CVHA 2ZT7A 3GNTA 2WFZA 5IKOA 2OFWA 3QGMA 4I1UA 1F1BA 3WOVA 3L6UA 4ZO6A 3PGXA 4TWIA 3R1IA 1V1MB 4NZMA 4KQXA 2ZUFA 1ISRA 1CQJA 3NT4A 4WL0A 1C3XA 4KI0A 3DO5A 5HZGA 1YBVA 3SIPA 3MRSA 1GQOA 3U5ZB 2O3QA 1XVAA 2W22A 4G5XA 2IV7A 4AQYB 5IVIA 4DKXA 5IDWA 2P9TA 1OYYA 4G89A 1CC1S 4BKUA 4BO7A 4BP8A 4Q00A 4BUCA 2CBGA 5DNDA 4KXNA 4N8SA 5CDSA 2QQ0A 5EMMA 3M6FA 4M49A 2VK8A 1L5NA 1C0IA 5CLIA 3NHAA 1PGJA 1PFWA 1Q15A 1NVUQ 2R1VA 4FC6A 1SN7A 2P5UA 1DZ3A 3K0AB 3L92A 3MW8A 4ZCIA 1UFQA 1NW4A 5ITZB 4IQ8A 1TQ6A 1LKZA 3OE5A 3HM2A 4PXSA 1UC4B 3OCVA 2R8BA 4YJ3A 2QLNA 4C20A 5IZCA 5GJWC 2UAGA 1EEHA 1IBMB 3UKJA 2IPLA 2JJ2A 3ANSA 4FUQA 1QOPB 2Q5LA 1OFGA 3KT8A 4MCJA 5DGHA 4B31A 1UBOS 1H6DA 4QU0A 4XYEA 4YALA 4BJ1A 4CNBA 5C37A 1KRHA 5H4GA 3BH7A 1WD7A 3DZCA 3UFXA 1Z38A 2C9ZA 1FOEB 3OZUA 4G6ZA 4WJKB 4UAUA 1JAIA 1MB3A 1VXOA 2AKYA 4IKOA 4DR2B 4FN5A 4BQSA 1RRFA 3I1JA 3ANTA 4BNNA 1Q83A 2WA2A 3DZHA 4YV7A 4BX8A 3EDRA 1U2RA 4D8YA 1XKLA 2G88A 1QO9A 1NSTA 3JYQA 5DISB 3GG9A 4QSMA 3CZAA 4DBZA 5DLDA 5IBQA 4LHEA 1IY8A 3DEZA 4FHDA 3UGTA 4I5EA 4AJJA 2IYEA 3BMCA 2FVXA 4K46A 4KXQA 5CAEA 1MW9X 1ORDA 4RGQA 3OIUA 4F9FA 1Y8ZA 2JFHA 4BJHB 5MHTA 4H7HA 3HWX1 4K5QA 3UANA 1SXJE 3GAMA 5IK2D 3I42A 1H2ZA 1TD1A 3ESDA 3KQOA 3LE8A 3ESZA 4N9QA 3SSAA 3B20A 4MUEA 2QUIA 4GDMA 1W49A 2D1QA 2JJMA 1EFRD 1IHUA 2P6NA 3FF4A 2PKWA 4GQIA 1XC7A 4ZT3A 1GARA 5JSYA 1Z29A 2Z0MA 3RJMA 1OIWA 1VQ1A 2QTVA 3DDUA 4BN5A 4HDNB 4TMYA 4LPSA 3ICCA 4MWOA 4TKLA 3KWFA 4BGUA 4TV9F 2IX3A 2WRZA 1NUTA 2QJRA 4DLBA 2QZSA 3LYLA 5LD2B 5LBTA 5D1NA 1X1SA 3ZQJA 2CMFA 1I3KA 2RE8A 5K3CA 4WFJA 2Z2KA 1NXXA 1PQWA 2H4YA 1NVWQ 1FFAA 3NYIA 1DFGA 3NGLA 5KTMA 4KPYA 3IESA 3HB7A 3JQBC 4EG8A 4KO2S 4LC0A 3T35A 3GMSA 1B0AA 4RFSA 5A0TA 1UQTA 3FGNA 5EP1A 1F48A 3G0DA 2PRYA 4INJA 5ETJA 4LZAA 1ZWKA 3EIWA 4D41A 4KE8A 3W06A 3VOSA 4Z3KA 5K0GA 5F76A 3UMRA 4MKFA 5AVTA 4LHYA 2I65A 3OX4A 3ML1A 3S55A 3UWDA 3GJ4A 1CQZA 1XTJA 3DMRA 1KEWA 1R5JA 2WVGA 3KWMA 5HK8A 4E2FA 1FDRA 1ZJYA 2IEAA 3EUFA 2ODTX 1E6CA 1FYWA 1Y4UA 1NZJA 3G8BA 4PLWA 3VPSA 4BQEA 2FQQA 1V8ZA 3OPYI 2DH6A 2WWRA 2IOFA 3OICA 4QDTA 1Z08A 3AB8A 2JA1A 4P36A 4KN9S 3B1JA 4EF6A 5HCUA 1EP9A 5BY2A 2AWNA 1SOUA 5HRCA 4C22A 2FPXA 2O0KA 4G5YA 4XCQA 2RK3A 2TRSB 5F78A 2Q6TA 4ZCMA 5JJBA 3TECE 1ZVMA 3SJBA 3NTLA 2FLWA 2G28A 3OFNA 4POOA 5A0VA 1FUYB 1MRZA 5KPJA 1F2VA 4TS3A 2XQKA 3HJUA 4PHCA 1SOAA 3ASYA 1F12A 1PTKA 4RV5A 3TSAA 1DHRA 4BO4A 4BNLA 1CK4A 2HHCA 4R54A 3B5IA 4QC2A 4DNQA 3JATA 3AONB 4DCJA 3INRA 2OAP1 3LUPA 3PSAA 4B76A 4D9IA 3DXFA 1I10A 2FH5B 4XA8A 2GCNA 5EAIA 4GPZA 3LPMA 3V32A 4OGWA 1OAKA 1BS2A 3D3JA 2GO1A 5BSMA 1G8PA 1BKYA 1VJCA 2QG9A 5AUQA 4QDUA 5CG2A 1QE5A 2FKNA 4EA6A 5JMTA 1DU4A 2JGAA 3LTNC 4ZTBA 5KVCA 1J39A 1KYYA 3LS2A 3VPBA 4Q9HA 1DKQA 3IB6A 3P9KA 4B6SA 1SVOA 1LRLA 3AEKA 3NB0A 4W99A 5L4LA 1R6VA 4KQEA 4MVJG 4LSGA 1CZHA 1XU7A 3AHIA 3GYGA 2V7XA 3RARA 5JNSA 4YQEA 5LBUA 3ZU5A 3OPVA 4E5UA 2AHOA 4Y2SA 3RD5A 1JHXA 2R6AA 2B37A 3BGVA 4GHWA 4W7IA 1GZ3A 1E2KA 1M2OA 1JILA 3AESA 5BN4B 3TLXA 1AKQA 1N2CB 5KYWB 1JQ3A 1VMKA 4UDYX 3O74A 3E8SA 1KDPA 2AN1A 2JIDA 2WD9A 1IUPA 4OHKA 4K9RA 5CBPA 1Z5UA 4QGGA 1Q77A 2QVYX 2P41A 4K81B 3B8HA 2QP3A 4WD3A 3IXMA 1S3FA 4OREX 4XRGA 4UBOA 4JXKA 5GOZA 3FCSB 3CIOA 3H16A 5LSAA 1N0IA 4QBTA 3ZC3A 1EK2A 4ALMA 2VIIA 4NULA 2NIPA 3FMVA 3DTTA 2HL6A 2C4WA 3PIRA 4G1MB 5CDUA 3NXKA 1G8YA 1LDMA 4B45A 1TF7A 4DWWA 5KSOA 1E1LA 2J9XB 3A6ZA 1RS0A 2MIIA 3ZXUB 2XQJA 4BMDA 1D1QA 4LZOA 1USVA 4EHBA 4WESB 4OKIA 1AO3A 3WFZA 2YFYA 4FE4A 4W5OA 1AMUA 3FAZA 3R5HA 4FUTA 3K70D 4KNYA 3WO1A 2VZ8A 1G16A 4A2WA 1UKEA 4EUEA 5T4EA 2D8AA 3ZXSA 2A0KA 3FNHA 4I3HA 2OGSA 3A6DA 4N0EA 2I6QA 3QFCA 4DCVA 4KCGA 4EL0A 1ZC3A 4IKPA 4YRFA 1JDJA 2EHDA 1K7XB 3JQFC 4L15A 5DLYA 3T5CA 1X14A 4YXWD 3IJPA 3KVVA 2HD4A 5TPZD 1MAWA 1SWWA 3TM4A 4DQVA 1M34A 1UBGA 1NC3A 4MQBA 4P22A 4X66B 4ACAA 1IM2A 5F1KA 2C57A 3VHRA 1XRLA 3WSVA 3RNOA 1T43A 4FDAA 1WE2A 2JVJA 1TA4A 4H1HA 4S1VA 4HXEB 2PKRA 3H3FA 3I32A 1F2TA 1CJMA 3W2EA 2I4RA 3CV3A 1BA2A 1T8PA 3RI3A 3RT9A 3Q2OA 5JYBA 2QSZA 3KUKA 5KHLB 3CF4G 4J3FA 2ACWA 2VP9A 3H19A 1Q7TA 3BGOS 4ZVVA 2WG1A 4ZI5A 3AH8A 2NZUG 2RB5A 3A4LA 3T3GA 4WFKA 4G0UA 3LBAA 2H7VA 3GJQA 3ZE1B 2DERA 1MFPA 4BMOB 3NAGA 1YFZA 5L3SA 4MUAA 1U0JA 2V4ZA 3AHDA 3J81A 3ZE2B 1U7HA 4DIKA 2R7NA 1E6LA 3L9XA 2P9GA 1V3QE 1W5AA 4LX8A 1UADA 1ZIXA 3RUEA 1Q0ZA 3FPBA 2VQEB 5CB0A 1KC3A 3MFQA 4LPKA 4V2UA 4UTNA 2O8EB 5EWLA 1U1FA 4IIJB 4OL9A 3GN1A 4MUYA 3DKKA 2JAOA 3PL1A 3IAUA 3MILA 2NTEA 3HBNA 4EEXA 3UAWA 2AW5A 4OM8A 4PNEA 3AC0A 3RJ9A 4C78A 4BQRA 1SZCA 5G3YA 1NAIA 5F2EA 1NATA 1NXOA 3A3NA 4R1PA 3WLHA 2DUMA 5AHOA 1AHPA 1GZSA 5ESRA 3IC5A 5BMVB 1TC2A 2X19A 3KQKA 2HIMA 1U63A 1YJ8A 2Y8EA 2EFHB 4PX3A 4RX1A 3WYDA 1CFZA 2X9QA 4DV0B 2GLUA 4OP3A 3W9BA 2JASA 4PZEA 1S8AA 2GWHA 1N5IA 2DPXA 2ZJ5A 3EMBA 3VBEA 4BNJA 1X7ZA 2O7SA 4JOBA 4BLQA 1S01A 5LLSA 4EW6A 4Z4QA 2CXPA 1BAPA 3TUJC 2W6ZA 1G20A 4IJWA 4LXYA 1VM6A 5KDOA 3G0GA 4G0YA 1ZITA 4FJ0A 2G72A 3T95A 4YREA 3F98A 1WXIA 3K9GA 3PVSA 1HMPA 1KS9A 4B79A 3BFXA 4C3UA 2B83A 3AZPA 4U6SA 4HNSA 5TMDA 3TVDA 3ILSA 1ISFA 1U0LA 1UK6A 4K3VA 1IWPB 4OHVA 3H04A 1Y9AA 5G2OA 2C5LA 3HSKA 2GPYA 5IAGA 4G01B 3WMXA 4AJOA 1SVLA 1E2IA 2PSFA 2PD4A 4MLZA 4Z9XA 3TW8B 2WFLA 3G3EA 4II7A 3EG9B 3LCJA 5D84A 3WRYC 3BD6A 1T2AA 1Y6RA 2IPMA 3RYCB 5JVDF 3AWDA 1XQWA 1NXTA 4L9SA 2QPOA 4ETIA 4G67A 1Z8HA 2HIGA 3GZTB 4KAXA 1TZBA 2VDNB 4LWZA 3MMXA 3GRYA 4KVZA 4U9HS 5BYJA 1WZIA 4AWXA 2D1FA 1NBIA 5ESWA 5A3QA 3EZGA 1H1LA 1JLHA 1OR8A 2SCUB 3Q41A 3Q3GE 1FRQA 2ORWA 3PUJA 4CR6A 4HTAA 4YJDA 4F3YA 1MIOB 3L4KA 3U4QA 1G4HA 2W43A 3DVAA 5GAJA 1AGYA 3O8OA 4IILA 1PW5A 1AF4A 1LRKA 1ZVJA 2AN5A 2VWGA 3E82A 2C07A 4F4CA 3PNPA 1Z28A 2WKRA 3O2QB 1XJCA 2ZRGA 1HLDA 2AZMA 5A6VA 3IP9A 1ONPA 4UW9A 1C30A 4PSDA 4Q21A 4WAUA 5L95A 1BMTA 1AQLA 3C74A 1OWLA 4QREA 5EIAA 2FPIB 3DA8A 3OIWA 1P7VA 3DQQA 4C7XA 3ZX4A 1F38A 5E9JA 1PJRA 5AW7A 3TZLA 3EA4A 2Y4OA 2ZWPA 3U7FB 1JHMA 2CUKA 2NTYC 1NW8A 2ZROA 1XTUA 1GGHA 2ZUUA 3EEIA 1H4QA 4L57A 4LXXA 3UGKA 4YJ2A 2LV8A 2G7ZA 1SK9A 4KVFA 5M34A 2PRJA 3II6X 3QE3A 1KP2A 2Y0BA 3HXMA 4O1IA 2RG1A 4BVKA 5KUTA 4Z1MA 1W30A 3SC6A 4HFJA 3NWBA 3PZRA 3ZHVA 2OK7A 4BHTA 2JVIA 2QRKA 1CWUA 2UZ3A 3VR5D 3FWKA 1YE5A 3CVVA 4WN9A 2HI0A 2XQFA 1RQ7A 1DL5A 3DE3X 5AI5A 4DNPA 1E7RA 4C0LA 4ZU6X 1VLLA 4A8HA 1BKDR 2H5JA 2OEPA 1EIZA 3SD7A 3ZVRA 4W7SA 4O59O 5AI9A 1MC8A 3DEJA 1O5TA 3EUEA 3UWOA 3P9PA 5A9TA 5H16A 2P4QA 4R6XA 1I3LA 4DV1B 3L8CA 3WLOA 4HQRA 1JSRA 4ZVOA 3U62A 2ZTVA 1XYVA 4HSEA 4IRMA 4P35A 5AH0A 1KPIA 4F04A 3NHLA 1LF0A 3A32A 3I83A 1XF1A 5CG1A 4JP5A 2VLIA 2ZRAA 3QMMA 1DMRA 4JLBA 3E5NA 4YMHA 5JHGB 5JS2A 4Z0NA 3ERCA 2V03A 1Y9DA 4V39A 3ZTWA 4PQEA 4UTOA 4H6XA 1QCZA 3WFIA 1MAUA 3NDJA 3QFSA 4MVJH 4KQ6A 4BFVA 4DLNA 5K01A 3UWSA 3G85A 4E33A 3FOCA 2Z5FA 4L0DA 3ZGNA 1C0EA 4JYCA 2OO5A 5DTEA 4JFRA 3U3ZA 2PUAA 3MT7A 3QXJA 3HY4A 3RSLA 3M4YA 1MHPA 1L7RA 3ZWCA 2GYWA 2VTBB 3DZBA 5C5DA 4MLCA 2OORC 3QUCA 4J4BA 2IXEA 4P7BA 1IY2A 1NN1A 4LRUA 3D4PA 2IUFA 4QIHA 3ZCSA 3FHTA 4PLPA 1ESZA 5AW9A 3SXUA 3AJ8A 3HFJA 4ZT2A 2EF0A 4XD2A 1I1HA 3DC2A 4OEHA 1A5TA 1JXAA 2G09A 4IDEA 5DTIA 3TUIC 3UF0A 1QYRA 3CJQA 3H1BA 2BFWA 3ZCUA 1R1DA 5BVHA 3JTEA 4EQZA 1PBNA 1AN0A 2F9FA 2Q3JA 4C7BA 4Y1EA 3LXMA 3WHPA 2F1RA 5FYQA 1EM8A 3SHWA 5HKAA 5KYYB 1AJEA 1JKMA 2X1MA 4U2FA 2BRUA 4F12A 1OT5A 5FULA 2JHPA 3TZCA 3SNKA 3ZCXA 4ZJUA 2QRGA 4UTPA 1VE1A 1YVDA 1M33A 2A88A 1OGJA 1V37A 4AVYA 3WGZA 1K89A 3FUWA 5DH9A 3T3DA 4F4UA 1PJTA 3ECSA 1HE2A 1XVUA 3UG6A 3K6KA 3MTDA 2QPAA 1ZEJA 2PZKA 4E5SA 3A6HA 3H4VA 4HAUA 1MTZA 3R0ZA 4NXMB 3IBCA 1X86B 1UAGA 1XHFA 1U2PA 4JBXA 1HDZA 4YLYA 3DBHB 5CP8A 2WU4A 1NJ1A 3OIGA 4EFDA 1OTYA 4HUJA 3IBTA 3IBYA 4ESHA 3IH5A 1X7DA 3CUYA 4P31A 1R4NB 1K0UA 1SNYA 2WHQA 4O33A 2JS7A 6ABPA 1IXYA 4UTZA 3IV6A 3UJ7A 5I9MA 2WJZB 1P5FA 1S7GA 4B85A 3INNA 1RBYA 4IM7A 5E4JA 4RZXA 5JE8A 4DC0A 2SKDA 3BEOA 5AVXA 4P5PA 4CM8A 4MINA 1RE1A 3C3MA 4P84A 2O4UX 3O4JA 4Z86A 4XVCA 5JMOA 2JH8A 1WPGA 4FYMA 4U0JA 2WSBA 2VT6A 4KQ2A 4IF4A 1J0DA 4FDVA 1UMDA 2BGJA 3G5MA 4WY2A 1Z9BA 2CN1A 3KT3A 4GZLA 2YHSA 4IIFA 3LHFA 3LM8A 4RWEA 3SXUB 4EA7A 4DWJA 4ZN6A 1RVV1 3FIJA 4KLNA 4E5VA 4ER0A 1Q7CA 1QGUA 1V5IA 1K7YA 1JLLB 4WV3A 3P2EA 4OCZA 1E99A 1N0HA 3L43A 4GU5A 4QDJA 2IBTA 5JQGF 1BG6A 4HVAA 2CKMA 3HXPA 1SPXA 3DVQX 5FLYA 1L4KA 1R9GA 3EMDA 3NAQA 4H35A 3GCXA 5DYTA 3TAXA 3R3HA 3VM6A 3TOSA 1I7LA 4MKIA 4MVCA 4ZHQB 5ELXA 1JWAB 2I66A 4LOAA 3WLAA 1K2WA 1P1CA 5C8ZA 3FFXA 1EK5A 4WXHA 3RHFA 5EP2A 3I6MA 2I4NA 3IAS6 3DB2A 3NBQA 1G5FA 2FPPA 2FZVA 4RCZA 5JC8A 3BL8A 3NKFA 4HPXB 4ZGBA 3WGJA 4FKZA 1HT0A 2PT7A 1T0JB 2P9HA 3OZWA 2RAUA 2FYTA 1NBEA 3QVJA 3MINB 2G40A 2WFAA 2Q5OA 2WAOA 1L3IA 2A7XA 4HRXA 4C4TA 2BBWA 5DM4A 4ALJA 5A7FA 5DGIA 3S1SA 2VQDA 1CB0A 4X24A 4NC9A 5H5JA 2OQVA 3JR7A 1RCTE 5SYMA 2FSFA 2HDOA 5AOVA 2GPSA 2YMPA 2VH5R 2V8OA 1E1MA 2J5KA 2ARKA 3D3NA 1AA9A 4HSGA 3TFQA 5P8WA 2FXIA 3GELA 1SQ5A 1CFJA 3SSNA 4D44A 5ANRB 3U4GA 5BQOA 2X14A 5CTAA 2IEDA 3UBTA 3PJGA 3QVUA 4I1IA 4OXXA 4EITA 4Z2YA 1FTGA 2PBZA 5EA2A 2XKAA 1YB2A 2QQGA 3OWXA 1S0UA 2ZRJA 3UGQA 2OFOA 2N1BA 3SEFA 3SX0A 2XSZD 3VDNB 1ODIA 1V1JA 2NT3A 2VHTA 4H7KA 3RREA 2R00A 2AE1A 3R3ZA 4Z0HO 3ZE6A 1NQWA 1IRIA 4FI3C 5FH9A 3X2FA 2VAXA 1MP0A 3G17A 3GVPA 1BYIA 4EHIA 3LKDA 1DADA 1M2HA 1OFVA 5ITVA 3UJ3X 3HBFA 1EI9A 2D59A 3D02A 4OH7A 5A4IS 3DE0X 5KIAA 4GC9A 3I5YA 3H5AA 1UMCA 3AEUB 1AXGA 4E51A 3FYHA 4ZHQA 5CBKA 1MZVA 1WL8A 2O8VA 3A9CA 4QBFA 4R9VA 3FWYA 1QB8A 1RADA 1JJIA 2ADMA 2QD2A 4MUFA 3GO4A 4Z9YA 2XT9A 4KVGA 1KKMA 4HMOA 4JSYA 4O3FA 4CMKA 1SKAA 3U13A 3TLMA 5DM60 3M6XA 3IMGA 2FU5C 3UMGA 1PL7A 3K9CA 3HA7A 4I50A 1LJUA 1Y3BE 2PFGA 5HJ2A 2ZCVA 1RFGE 3KCQA 1WY7A 2VS1A 3SC2A 1HO3A 2RH4A 3I3OA 1FQKA 3JS5A 1WV0A 4G26A 2DLCX 5A7GA 2R9VA 4Q1EA 4AKGA 3QVOA 3IIKA 4K9QA 3DDHA 5NLLA 1Y1QA 1NW3A 2YIJA 5FWDA 3WGLA 3ZUGA 3KQPA 3KKPA 1B41A 4E3ZA 2R00C 5LQRA 3IRUA 1JQKA 1MX3A 2VH1A 2CXTA 3H2GA 1O9BA 4M55A 1XXHA 1M9NA 2Q5FA 4J0KA 5HDQA 5JNLA 2UZ4A 1TA0A 4CZ2A 4D97A 4ZI7A 1GSHA 1U9YA 2QN7A 3NTRA 4UM9B 3TLGB 2BMVA 2H4XA 5TX7A 1G5TA 3DE1X 2WWTA 4DUGA 1MQSA 1RXIA 4JVSB 5H70A 2ZPTX 3I5UA 2Q5IA 4WZAB 1G7TA 2OLKA 1DOAA 1N7GA 1EP3B 3B7PA 4QPDA 1BH6A 4NZZA 4H17A 4NIMA 1SVUA 2WDPA 2GJAA 3VGPA 1TIPA 5FEUA 1JJAA 4HXFB 3TDKA 4V24A 1RI1A 3F9CA 1I3OA 2CD7A 1KIFA 2BJVA 2JHFA 2ZSBA 5CFRA 4S35A 1SG6A 2HCTA 3EF3A 3DFUA 4F6RA 2VK4A 1JAHA 2YW9A 1T9DA 4UXIA 2C2KA 4OJYA 3UAVA 4C6TA 2W6ID 4CT5A 1G7SA 2JCVA 1AS2A 1VJDA 2CHGA 4R1TA 5JXIA 3CW2A 4XAQA 5ICFA 3ZZNA 4H77A 1RWWA 3I8OA 2JIPA 3WLEA 3VR5A 2M32A 1G64A 3LQFA 1RBMA 4H2DA 5DXJA 3SZLA 4DARA 4C01A 7REQA 2IU0A 3HCPA 1J49A 2OZPA 3U1BA 4MPDA 3NUQA 1GM5A 1TE2A 3WNDA 3OZVA 1ZN2A 4KL8S 1JR2A 2O54A 1GU7A 3VPGA 4I1PA 4M9UA 5G41A 4HWOA 1IQUA 1VOTA 3Q72A 1LPBB 4G25A 3I4FA 3WYEA 3FI9A 4HHEA 4JBNA 1GKIA 1MGPA 2QUJA 2C4HA 4PBTA 4XWOA 4BASA 5FI5A 4ARBA 5CDFA 4UVGA 1ZLYA 4WASA 3USZA 5AXBA 2AOVA 3JQQA 5D1HA 3WL4A 3H6GA 1SA0A 1TQHA 1I4OA 2XMGA 5EKXA 5LL6P 2F3SA 4WJLA 4F92B 4BBZA 5K3EA 5H83A 4CW7A 3O31A 2PV7A 4E6EA 3GA0A 4EI2A 1UBNA 4CQMA 2WYIA 1HFEL 4LE0A 3IMCA 2QI9C 5FTLA 5REQA 1QO7A 4Z9BA 1U7ZA 3AKEA 5IT0A 2MYTA 1EUYA 2HBYA 1L5YA 3HCOA 3DTYA 4GKBA 4ENTA 4UAGA 2DPMA 721PA 2I03A 4HDOB 2ONYA 1D8AA 4BRSA 2V1XA 4I6JA 1QS0B 4O4HF 1VYTA 4XUDA 4MUHA 4NPAA 3O3MB 3KDAA 3SIXA 1AC5A 1OKKA 1SXHA 2XIJA 1YZ3A 5AW5A 3ZGXA 1SKMA 1MRNA 3HVUA 1QFYA 1CEYA 1ECJA 5JU6A 4JNCA 3N2KA 1RZUA 2B78A 3UQYS 4ALIA 4E1AA 4WMLA 3LOPA 2X8AA 3P2MA 5K2MA 1XKQA 3QV2A 1HG1A 4U7FA 4TYNA 2Y1XA 1V41E 1E3DA 4HDMA 1EAMA 1Y48E 3GRUA 4C0BA 4N8EA 2H1OA 3DONA 1JKFA 4YAOA 1X7YA 2I80A 4GX2A 2A3RA 3KXIA 3ETGA 3DE4X 3L8GA 4B40A 4XFJA 2YJ3A 3QTBA 1Z22A 4FYVA 2DJIA 4V02A 4XCVA 3D0RA 3WK4A 3QHAA 3H5RA 2WJ6A 4I46A 4LECA 3INTA 2VT7A 3EIXA 4PTYA 3H8SA 5KQPA 4YO7A 4BLSA 2QY6A 4AY6A 3D3KA 4RKYA 2HOQA 3CX6A 1P39A 2J6BA 4HG2A 1NDQA 2QIPA 2R4TA 2CNBA 4MV3A 3E1SA 5AVOA 4LF8B 1WB6A 2HDNB 2A14A 1W2GA 2OZLA 2X6TA 1H2XA 1SBQA 2H2IA 4FT4A 2ID7A 2REQB 3MMSA 1BEUB 1Z4MA 3PVCA 2NW6A 3DZGA 4WKGA 4DC9A 5HHTA 3HK2A 1Y6QA 3JQ7B 1TB4A 4L3WA 4NDAA 4HX5A 4MQ5A 4HMPA 3MJVA 3ER9A 1UFKA 4JD5A 4AF8A 3SF0A 2WT9A 4RZUA 1C7ZA 1MDFA 2H0RA 4B35A 1KK2A 1H3FA 3UK0A 5J4KA 5KTPA 1ML3A 1PNQA 4L74A 2X0KA 3K8ZA 3QUSA 3KXPA 1NU6A 1RD4A 3UJDA 9LDTA 1E3WB 4MP8A 3HJTA 3KBOA 1JB9A 1EJ6A 3TBHA 3P71T 4UNQA 4O8ZA 1WUJS 2W6CX 1F51E 2Q6KA 1JE0A 5T5QA 1FQWA 4OYRA 1FYXA 3ZV5A 5LJIA 3LCUA 3ENKA 1LW6E 1E3EA 1NFQA 4JROA 1YASA 2D54A 2Y93A 3FDFA 2HU7A 5EPOA 4TZ6A 4OBXA 2ODWA 1J1UA 4D6XA 4P3PA 4PLZA 4JWTA 4OPMA 1UMBA 1J06A 2DVMA 3OTGA 4JITA 1FDOA 2VF2A 3PF9A 4TYMA 2CFSA 4I4NA 2HJHA 1L5HA 2D1YA 1LBHA 1AX9A 3CY6A 4IV0A 4DLPA 2FG5A 5CEEA 4OHWA 4P4SB 2B1IA 3AUJB 3P0EA 1RAFA 4HLNA 2RGRA 4P32A 2Y71A 3HDQA 3UKDA 1MO2A 4TM7A 4ZI3A 2QAJA 2RFLA 2GN9A 4LK2A 4Q3OA 4UQOA 4AURA 2WJ3A 2VA8A 1RWKA 4K0RA 2GVDC 1A9OA 1NMXA 2FWPA 2ZJYA 2ZUCA 3D6MA 4JU9A 2ILVA 5C8DA 1SU6A 1E9DA 3HU5A 2QX8A 1DAFA 2C7VA 2VJCA 4KKXB 3H5VA 4ASUA 4LZNA 2XMZA 5H3CA 4BP3A 3G6WA 1V1MA 4OQZA 5EJ2A 1TEZA 4F5EA 1THMA 4DIUA 3SQMA 1L1QA 3OECA 4QJ4A 5FD8A 1QK4A 1DOZA 5E1MA 4PN3A 2ZGVA 4TT8A 1U3UA 2HBQA 2VOJA 3ZE7A 1LD3A 4MMYB 1DEOA 1R4MB 3DF7A 1I5RA 5LB4A 1RE0A 4B4UA 3ZLJA 1DG1G 3ZI4A 4F8YA 1E8MA 1GUAA 2GAOA 2XE7A 4L8LA 3QYPA 3WIEA 4E4YA 2ZE7A 3RFTA 3T9FA 3UOGA 3ROFA 1SXJA 1X1TA 3NKLA 4DV2B 4KR7A 1NR5A 4RKQA 3VUFA 3QBDA 1U8TA 5CM2Z 1TRKA 2AK2A 1S1MA 5KCZA 1V4NA 4LF7B 3TGPA 2G6TA 3ESCA 4RS3A 1IZ8A 2Y9MB 3IO3A 3P27A 5FOSA 2BD0A 3REQB 5AVYA 3A2LA 2G63A 5KQGA 3QMPA 1RABA 3RRNA 1P9WA 5B7NA 3OCUA 1SXPA 5KDLA 3RE1A 1WOYA 3B36A 3HJFA 4FIDA 1ULSA 4BNMA 3WQSB 1CUGA 3CSUA 5AKHA 1VDMA 2H48A 3A9WA 4KWCA 2QF7A 4FGUA 1P1BA 3ILXA 5E6RB 4RIIA 1R00A 3OLXA 3V7YA 4F2GA 1G3IA 3C3EA 1KO7A 2QJTA 3FFAA 3NDIA 1FA9A 1QIIA 1UCFA 2ZYDA 3DM5A 4FR0A 2P0YA 4PWYA 1FRNA 2E55A 3NJRA 4IXTA 4BVJA 1ZX1A 1UPBA 5AD1A 3E3MA 3C48A 2G82A 1QC5A 1RCUA 1XT6A 1XU4A 3MMNA 3AOEC 3HY3A 4IO0A 3R76A 2VRCA 2H11A 1QHIA 2OBXA 3BHJA 3PQ7A 3H8JA 5DSTA 4Q5IA 1D7AA 1ZXBA 2YZNA 4B6GA 5I7WA 1C3EA 1IG3A 3M83A 2COKA 2IZ1A 2EJWA 1AB6A 3V1YA 2JI9A 1BVRA 1EDBA 1KBOA 2F8MA 2LDXA 2WU1A 1DFHA 3AW8A 3KWJA 3Q9SA 4D9BA 2FR1A 2N1MA 1P0FA 2QMYA 3Q4GA 4YAUA 4LF9B 4IRXA 1IY1A 4D25A 4QEDA 5I7FA 1Y8QB 3O92A 4ZA2A 2YYZA 1YU6A 3EGOA 4U7PB 4M8NE 4ZK2A 4P0TA 3VO8A 4BBJA 1U3TA 1RHKA 1KARA 2IIQA 2JCXA 2QVCA 2JI8A 1O6ZA 3LBNA 2NPIA 3IP3A 5U4XA 4EBFA 1IBLB 2V0GA 3C3KA 1K7CA 1TUGA 3ITKA 4RXTA 3WNVA 5C7OO 1YQ9A 3ORSA 1TEVA 2WC1A 4LRYA 4REQB 3SOZA 4A27A 1JG3A 1U11A 1ISSA 4W8HA 4WVFA 3NAMA 3UHJA 1RLJA 4OQNA 3NFRA 2JLRA 1RYYA 1KAMA 1E5DA 1FRZA 3A4IA 2EU8A 1U2GA 5FOQA 3GP5A 1SBCA 2WBLC 1GTZA 3N59A 4G1CA 4IQFA 4H0FA 2DT5A 4A16A 1G20B 4NJMB 5EI5A 2I2CA 1BU8A 3KZOA 3PR2B 4Y9UA 3IDZA 2H1IA 4DA9A 4C4SA 3WNQA 4J0FA 1BCRA 5JAMA 1U2QA 3KL4A 3O82A 3D43A 1VC2A 2A7QA 2DR0A 2I6SA 2HWXA 2ZE8A 1OLXA 5U1PA 3GPDG 2HHLA 1KQ3A 4DLYA 3NGMA 4XM0A 1DQYA 2RGNC 3H65A 2J5QA 2FN9A 2G4LA 2C0QA 4B6FA 3IT0A 1VPWA 4YHBA 1GZ7A 1P74A 3ON5A 1EWQA 3V6MA 1KZ9A 4YTEA 3VFDA 2X7XA 1OA1A 3QU5A 4PGFA 2FSPA 3IQZA 3NHKA 2P6RA 1Z0KA 5LMZA 2JAXA 1XJ0A 1OWPA 3GLGE 3GPIA 4BN4A 2AG1A 4CKEB 5BOVA 1GL7A 3O95A 3I34X 5EHGA 3WADA 3K7EA 1QUEA 3N0RA 4ZRMA 3N2NA 4HY3A 3ILYA 4ZXFA 4I8DA 3C5HA 4IIEA 3OBIA 5DK4A 3SS8A 4YRNA 2XJ4A 5ICMA 2PUFA 1HG0A 1SBHA 1K08A 2WYUA 3TVYA 2X4LA 1HQKA 3KFLA 4FPXA 2M6RA 4PYLA 1YI0A 5A3RA 1PVDA 1KJJA 1N8NA 1V95A 2XDYA 3TDMA 4CKYA 2O1SA 3PFFA 5EWJB 3ELUA 2FPWA 4YJFA 3RFCA 4EJSC 1BCSA 4AX4A 5JEDA 2JG3A 2NUTB 3A9RA 4NTZA 2ID4A 4P0QB 1Z2DA 3OEWA 1VL0A 5ARCA 2JIRA 3AEYA 2QJWA 3H3JA 1I7NA 3WTBA 4EOGA 3LCRA 4GLBA 4EYGA 1CY2A 2RKBA 2D1RA 3WLQA 3E5HA 4PNZA 1B8UA 1Z0UA 2I3DA 5TS3A 4AJEA 3R7WB 4AUMA 1XAHA 3QVXA 5FTMA 4ESEA 4YV0A 5BN4A 2NO6A 4YGYA 4DA6A 4W1SA 2O2DA 2IU6A 2CDCA 2XF8A 1HZZC 1B2RA 1A50B 5AM0A 1VI2A 5DP2A 4C6RA 2WV7A 3BJIC 1J2RA 2ANCA 1FJHA 1ULHA 2ATXA 2EP8A 3QKRA 3OC0A 4B09A 1GEEA 4ZC1A 1E4OA 1Z7WA 2P7IA 3D3QA 4Q9JA 1FVHA 3H5TA 4XFKA 4BVAA 4Z0TA 1VMIA 2CLFB 3N75A 1C9EA 1W19A 4HDRA 2GN6A 2Z2JA 1IBCA 1LA2A 4D4GA 1M2OB 2C2GA 1DEAA 5ICCA 4JJ8A 4C4ZA 1ZUNA 5EGSA 1JQAA 1XQVA 3T7RA 3ZDQA 2MU1A 4G5OA 3K9NA 5CBPB 2O19A 4MQFA 3SYRA 2WJJA 3CGWA 3IBGA 4Z3DA 2OSVA 2P7HA 3EOBI 3VHXB 3CRVA 4LJ6A 4NU8X 4P93A 3MG9A 4AFNA 4D26A 4W8OA 3IQXA 4HYEA 2QM7A 2IELA 3W3AH 2Z3WA 1U31A 1SUIA 2A0XA 2VHZA 3NW9A 3CXUA 4BNDB 4DSAA 3AP2A 3IEMA 1G38A 4CEJB 4TL6A 1U28A 5TJ9A 5AW4A 2XMRA 5D01A 2YWFA 2CV1A 3QWIA 5LB2A 3HBLA 1NVXQ 3EB9A 3NTVA 5JSKA 3RT1A 1RR6A 4B7CA 3AOGA 4QYIB 3LT2A 4Y6GB 3J7TA 4JBLA 3R0VA 3FNRA 1N2XA 4OO3A 3JYPA 4D5GA 4I99A 3KQQA 4TN5A 1L5OA 5BORA 1AUOA 4MICA 3GQVA 4UKDA 3HABA 2OUKA 2ROQA 4FCTA 4G1FA 4XYGA 4P53A 5FR1A 4DDWA 4IOLA 5AQ1A 4KODA 4TSKA 3PPWA 3BWMA 2AT1A 5D51S 1IHDA 1HFJA 3STTA 1J9EA 5BW8A 4D9HA 3X1WA 1GTL1 1JWLA 5LU8A 2ORIA 2XUHA 3MPUA 3OM0A 1V1RB 4F7DA 2WSLA 3AEQB 1MHTA 3P2JA 1Q50A 1G9TA 5EZ6B 4MEBA 3EUAA 3BF7A 1U94A 2Q1XA 2BBOA 2PUCA 3REFA 1D8TA 1F4VA 3LW7A 1FLNA 4L27A 5AK3A 3GOQA 3OCXA 3KR0A 1PVVA 2AMFA 2WSSD 2B2NA 3QPCA 4GF5A 4YJ2B 2YXNA 2A9OA 4EUKA 5KPDA 1K6XA 3EPRA 2OV2A 1OI3A 3FDJA 1FXWF 4X61A 1ECPA 3SE7A 2C4TA 3JPWA 1VPEA 3HTXA 4PV7A 3S5UA 2OD7A 4QDOA 3TZKA 2FJUA 4L8YA 4ENPA 4HDCA 4DAEA 3TQFA 2DTXA 2B98A 2BR3A 4G1EB 1LPNA 3MCTA 2PZBA 2QP4A 1GAWA 2XADA 3L0OA 1PWEA 4CI9A 1GKLA 1YCGA 1P18A 1JW9B 5TJHA 1X92A 3AQ4A 2ZG6A 3QJYA 3KE8A 3R5KA 4DJFC 3OCWA 3PP8A 4IDOA 3K4HA 5KOYA 4C7JA 1Z4JA 3C8ZA 4Z54A 2ERCA 4HL6A 3U31A 4IFTA 2CMHA 2G77B 2Z6QA 4OHPA 2F1HA 4N01A 5DN9A 2XCUA 4YAFA 2BFEA 3D8BA 3V80A 1XRSB 3P2OA 4C0XA 2IXBA 2HF8A 4ZYWA 1DBVO 4MVJD 1J8DA 2CLDX 2H57A 5FPQA 4BXOB 3OIDA 3ZWNA 5H0IA 1MJ5A 2B61A 4HAZA 1MNQA 2O2ZA 4KBGA 4N7BA 1ZAKA 5DF1A 3JRNA 2O2XA 5FBHA 4XLZA 5DV9A 2BC9A 3AYXB 5JCZA 4WLFA 4KB5A 2RH5A 3KDSE 3QXCA 3RT7A 1LJLA 5DBEX 5IRCD 3MJEA 5I4IA 3M70A 1RKUA 4PTLA 3HKEB 3KAQA 1OXMA 2ZJ3A 3PJEA 2E5FA 2P35A 3Q15C 5CM8B 3W5DA 4BCDA 4J03A 3BXPA 1EGHA 1QVVA 1EFDN 4FFRA 2P79A 4LVUA 3F9RA 5JMPA 2OB2A 5FKJA 3PKZA 3A3PA 2ERXA 5KVAA 4TLEA 4CUKA 4ZKDA 4Q7MB 3RVPA 1YL7A 3EYAA 1NN3A 2O7RA 5B7QA 3DEAA 4IBOA 3MCUA 4YP0A 2VUUA 1RM5A 3WOHA 4RLQA 3CLHA 5IULC 2W0SA 1J70A 5F1PA 1LCIA 5LUAA 3C1TA 1EGVB 3QKWA 4UUQA 3OQBA 5DO9A 3WLFA 2JFZA 5JECA 1XVLA 3BFPA 3FVWA 4JAVC 2DUUA 4LCEA 3RV3A 3CISA 4MYTA 5EWMB 2OESA 4H16A 4ON9A 5B36A 2IW1A 5HQJA 4I19A 4UU8A 3HCAA 2MSWA 4NH0A 4HN2A 4LMBA 1F60A 2VAVA 2HDHA 2V7GA 5H02A 4A15A 1BC5A 3NBXX 2F1IA 4UUNA 3BKWA 1BA3A 1HYHA 3K1JA 3QVLA 2CVPA 4G2NA 1C30B 4OQDA 4YCDA 2CW5A 3UAXA 3JY6A 1U2TA 2GN1A 4KFTA 1U5AA 1Z5WA 1T3GA 3PDCA 3B6KA 4Y6OA 1QIFA 2NZYA 5KNLA 4XVQA 2Z6VA 3PV0A 1EE2A 4K7JA 1FB5A 2D3TA 2G07A 2LXNA 3AT1A 3GH3A 3HBMA 3TIFA 3FNBA 4JQOA 5F21A 2IEYA 2FK7A 2MSLA 2O7VA 3K15A 1XJWA 3DXYA 3GUCA 4I5GA 1B1CA 5ALTA 4Z51A 4ZMSA 4URXR 4CF6A 1EXNA 2FFJA 2GPAA 4DJAA 3WP1B 1RKXA 1Q6YA 5F77A 5FT9A 5IM4F 3IOEA 1TJPB 2NV6A 3V7NA 4CETA 4RNDB 1YDMA 3GFFA 4M7OA 3SIRA 5KI6A 4BZZA 3VU3A 1JJFA 4KXVA 5HXAA 4RORA 5L7WA 1L5VA 2C5EA 4XD7D 1QPGA 3RRZA 1Z4OA 1XD8A 1B42A 1DC5A 3H4IA 2PS1A 1M6YA 1GKYA 5IAOA 2X40A 2BDTA 4QHTA 1D1SA 2SECE 4J9UE 1R15A 3TO5A 2HFJA 2Y76A 1C9KA 3VDQA 3N7AA 3U3XA 2GHRA 4P3OA 2HJSA 3UUGA 1T9BA 3KSRA 4OU5A 1E5QA 1Q1AA 3AVQA 2EEZA 2VC2B 1LS1A 1RI2A 4BBPA 1XZJA 3AL2A 1HTBA 3CE6A 3RM3A 5JXGA 1MO6A 2GXUA 1PS9A 3IUSA 2FEPA 3TINA 2ZBQA 4ZCLA 3GUVA 1LQ2A 4M54A 4EJ2A 3I1FA 1WMDA 2FI1A 4R98A 3PX2A 4IQGA 1GCIA 1I6KA 2RHGB 3O94A 1FXWA 4TZKA 1VE7A 2A9FA 1TADA 3I9V1 3KS9A 1KXJA 1GA6A 3LYHA 3NDRA 3H1PA 4EQ6B 1XZGA 1WXWA 3CX4A 1JEYA 1ZAYA 2B69A 3H9QA 3E9QA 1UBFA 3P9QA 5DWVA 4ARUA 4RO0A 3LPCA 1P9RA 2QZPA 4HDAA 2ZUSA 5EE3A 2QTLA 1E3LA 1KO5A 1NE7A 2VDQB 1LC0A 5K4AA 5BN1A 1EK6A 1P4JA 5IBCA 1LDGA 1V3VA 3GRVA 1VI5A 2Z08A 3FOEC 1KI2A 2EFEB 1AB5A 5HUJA 1W36D 1Y9ZA 3GVCA 1UWLA 2O8BA 1ABEA 2NYRA 2H06A 4FILA 1II8B 4D7AA 4H4DA 5B3KA 3OQOA 2B35A 2AG5A 1XNRB 3IUEA 1P3JA 2O0MA 3LIPA 4CTJA 5L8VA 2BH9A 4N12A 1RZVA 1Y6ZA 4NU5A 4PS0A 3SVZA 3V4SA 4PG6A 5GVRA 3WB1A 2AJCA 1ONSA 1X1QA 1HQYE 1EK0A 1XLUA 4D46A 4EW1A 2CLMB 4IVRA 5COBA 3EGEA 3EX7C 2ODBA 4MS1B 1Y7IA 1CDOA 5HJ5A 3H11A 1L7MA 1QBKC 3L6CA 2YJZA 1PSZA 1KORA 3CLSC 2OWDA 4G1BA 3G5UA 4M0DA 3ADBA 1QU3A 5JPCA 1TKRA 2PRKA 4UTRA 1M2NA 3LYAA 2GS9A 3P9RA 3JRXA 3CF4A 4GXRA 4TSRA 1JS1X 3AKDA 3ZNPA 4H7FA 4UE2A 4FEGA 2WNSA 4GFDA 4P54A 2OXRA 3OOJA 4J6EA 4TYQA 3CW8X 3GYBA 4IWNA 5AW2A 4OYYA 4RFLA 2UZ1B 2CHUA 1P2VA 4AKIA 4LOLA 2Q1WA 1SUCA 1WEHA 3DMYA 3ZW7A 3HN6A 3HQ4O 1OPXA 4RMIA 1B3BA 2C98A 3GGGA 1ZUIA 3LQ4A 1JN0A 3NDPA 4CM9A 2XBMA 3IVAA 5I6DA 3HU2A 4DSOA 3RVKA 4RLHA 3GT7A 4INOA 4YONB 2GAJA 4ND2A 1W36B 2KQUA 4NYJQ 1N57A 1UMDB 4KO1S 3ER8A 4CV3A 5JNRA 1GNPA 2WIGA 4ND8B 4EHLA 4Z7QB 2G08A 1RTKA 3PF8A 4FGWA 3JALA 2DECA 2OGTA 2Z57A 3PWTA 4YCCA 4XQEA 2CF6A 5J59A 4JV5B 4NE7A 4YBZA 3VU8A 3PUYA 1JHVA 4JUAA 5IABA 5J23A 1TEHA 2YRWA 3I5AA 2BKVA 4FYKA 1DJOA 4O4LA 4Q9LA 2BGMA 5AKIA 5KAPA 4M53A 4EMUA 4H31A 2Q6IA 3K4QA 1PK7A 2P0EA 1WU7A 1YRWA 1POXA 1UJCA 2CJWA 4BCCA 4I3GA 4XW2A 5ER9A 2V9CA 3U37A 5FWYA 1FJ2A 2VPWA 1HK7A 1XCMA 4JLSA 5K99A 2FX5A 3DMDA 5KYVA 3WXMA 3O73A 1J20A 2WJYA 3IVGA 1HSOA 3AVVA 4CV2A 3MOGA 1ULBA 4OHYA 3ENNA 5B1YA 5C3MA 5JADA 1V8OA 4DM3A 5GIPE 3GLRA 2BEVA 4MW0A 2WTMA 3PBKA 1NM5C 3IOCA 4BX0A 5JT1A 4B2LA 2AYXA 3BZBA 4LJYA 1UJ6A 2HB6A 5CLHA 1V25A 2V7BA 3S70A 4PINA 2NO4A 1MOSA 3TNDA 3L07A 1I01A 5DMHA 1DBQA 2NO5A 2WSSA 2VZLA 4KN6A 5CT8A 4EKGA 3GAAA 3T1QA 3N8KA 1HL7A 2BTOA 2ONCA 3DAFA 1OIVA 2AFIE 3Q87B 3OKAA 1IEXA 4FJ1A 4YECA 5K8TA 5K8JB 3HFGA 1CZUA 4R9NA 5JBQA 3CRZA 2CEKA 1DC6A 4YUAA 3FBTA 4L6CA 2QXTA 4WUVA 4HNGA 1TZMA 4YJGA 5L40A 1CQJB 3QNWA 3HEMA 3DLBA 2QQEA 1G55A 3I61A 2QG4A 4ZYVA 3SZUA 1VTKA 1VLJA 3RSFA 2G06A 1CV2A 2ZBRA 2QYOA 2XB9A 4A03A 3EODA 5A4FS 4L50A 4TZ0A 2WSIA 4DIMA 3OZGA 1II9A 3I23A 3UIEA 1TI7A 5EXEA 2GUWA 3ZDZB 2G0AA 2IIBA 2R6JA 1S2MA 1ZM3A 4G65A 1TF2A 5ALQA 3VNQA 4Q6WA 5HMMA 4LF4B 4MUMA 4DM4A 3ONDA 4L75A 3TOCA 3GJ6A 4FE7A 3ZU6A 2O5RA 1BD3A 4WUTA 1T1EA 2O6LA 4NF2A 2J4DA 2P9YA 1V9LA 1XAIA 3MT0A 4ZFNA 4BMCA 1P4RA 2XZDA 5FOWA 5L4NA 3Q88A 2P11A 4M1YA 1GAQA 4KNVA 1GNSA 2F8LA 3CLUC 4RCVA 5FFNA 3LIIA 3VPFA 1TUBB 1SXIA 4BIMA 1N8TA 3NCHA 4ZICA 2XZOA 3AEUA 1C41A 2I6UA 4OOEA 4URUR 3OIYA 4KWHA 5BSGA 1JZSA 5LVAA 2AJ8A 3EFOA 5JD5A 5LIRA 2WHPB 4LY0A 2YNMA 1WVMA 1F2DA 3O8BA 5JASA 1P6XA 1Y7LA 4PBSA 3IQEA 5JYDA 4XXHA 4Y2TA 1U2DC 2Z4SA 1N78A 1YCFA 3AJDA 1RFLA 3G2OA 3HKCB 3PC8C 4L0CA 4OJTA 5FPTA 5EHXA 1T2EA 1A4RA 3E3OA 3N3AC 1EA5A 4LQ4A 4E03A 5BMVF 1FDTA 4EI8A 3W3AA 2JZCA 3TE6A 3ZD8A 1Y1TA 4UZSA 4N6NA 3MZ0A 4WXRA 1X7XB 2BFDB 4GI3A 3E61A 5EL0A 4M8IA 1WP9A 1JHPA 1G4UR 4QRDA 5HRAA 1A8IA 1CD5A 1LNQA 3GCDA 5KWSA 3SQXA 3THRA 4MPTA 5A2QA 4KGZA 3DXZA 4YACA 1D07A 3FX2A 3AI1A 2PQ2A 4J3JA 3G89A 2H18A 2OV1A 2A84A 3DZIA 2DX7A 5JCJA 4C76A 3BSSA 4U3JB 3RWBA 1HH4A 1KO1A 1T36A 2CLHB 2QD5A 4HEHA 1XWFA 1XN1A 4TTPA 1NHWA 1DTWB 3EWSA 3VKWA 5MGNA 1N36B 3STXA 3L82B 2C5FA 4GI7A 5D3MA 1UK7A 3ZG6A 4X62B 3PC3A 2IVZA 2FUCA 3BEDA 1XZKA 3MPOA 4JB0A 4CCAA 4DMFA 5JQGA 5U9CA 4ZVNA 2XEDA 4IHKA 4CODB 1ESMA 3AR5A 1Z07A 5A02A 2CGEA 4LRWA 1JA0A 1U2DA 3LX4A 4N8DA 4RETA 5EXXA 2WM9B 3X1YA 4FM9A 2PMWB 3JYHA 1YQDA 4UCFA 1UFVA 1G42A 2HT6A 3AVWA 2VJNA 1YNSA 2CHQA 3WA6A 3AVPA 3F5SA 3IJRA 4YQFA 4M1SA 2XA1A 3K16A 4W5JA 5HBGA 1VG8A 3SHFA 1O0CA 3B48A 4DGQA 2ZRPA 2XLCA 3BDIA 3B3QA 1U5BA 3EGXB 3CQ9A 3IV9A 3K3PA 4QXPA 5E6RA 1HT2E 3ITNA 4DL9A 3GPLA 3C5CA 1UBHS 2GZAA 4AZWA 7REQB 1N25A 2YIMA 3PT5A 3GLFB 1IYZA 1QZZA 2AR9A 4O2RA 4JI5B 2ZWVA 3DGFC 3ONWA 2ZM5A 4FQ5A 3JQAD 4C0KA 4E0BA 2X42A 4DRXB 4F2HA