2R25B

Complex of ypd1 and sln1-r1 with bound mg2+ and bef3-
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
TSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphorelay intermediate protein YPD1
publication title Crystal structure of a complex between the phosphorelay protein YPD1 and the response regulator domain of SLN1 bound to a phosphoryl analog
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein/transferase
total genus 40
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r25B00
3RVOA 2QZJA 4YR7A 3NNDA 1P6QA 5FWXA 4F06A 1ZDMA 3EQZA 4P98A 4G86A 3GV0A 4MQFA 1KRWA 3CLKA 4N0PA 3N0WA 4MS3B 4FE4A 1A04A 3I09A 1NXTA 1YMVA 4MPTA 4RWEA 4Y9TA 3CG4A 3H1EA 4RZSA 2IOYA 3HUUA 1RXEA 4G0ZA 4KK3A 4Z0NA 3T38A 5JNUA 4Q7EA 3T6KA 5TQJA 4RXUA 4RK0A 1YK0A 3MA0A 4HNSA 1YMUA 3VNBA 3E61A 4N47A 1WETA 4IGAA 2QR3A 2LUOA 3EGCA 1RPJA 4IMJB 2HQOA 3A0UA 3JPYA 1MVOA 8ABPA 2IPMA 1APBA 3C3WA 3ILYA 3KCNA 1U0SY 1DBQA 2MSLA 2FQWA 4RKRA 1BDHA 3LUAA 2JB9A 1JH9A 3OM1A 5HKOA 3NBMA 1PEAA 3HVRA 5JS2A 3I5AA 3JTEA 4KREA 2MYNA 3I45A 3JVDA 4MR7A 4EVQA 1NXOA 3D8UA 2R47A 3LUFA 4RXTA 3HCWA 3RQIA 1U2PA 3CS3A 4QPJC 1Z25A 1U2QA 1USIA 1YK1A 3OLYA 1Z15A 4IRXA 5DTEA 3K4HA 4ZJPA 1JFVA 2QXYA 3JY6A 1Z26A 4H3HB 4LRQA 2PAFA 4EUKA 1ZY2A 1TM2A 4JAVC 4TLMB 2FQYA 2MYPA 2E4VA 4YLEA 4MRMA 1QO0D 5TQ2A 2F8SA 3RVSA 4Z4CA 4OLAA 3KS9A 1XWWA 5HM6A 4Z4EA 2A9OA 2FN9A 4EGSA 1ISSA 2GI4A 4HYEA 4MQEA 5IC5A 3UUGA 2W42A 2RJOA 4O5AA 4IILA 3RVNA 1LK0A 2IPAB 2QU7A 3M9XA 1ISRA 4F12A 2TMYA 1QQBA 1GUDA 1Z18A 4G0OA 1L5ZA 1F4VA 3A3KA 4LE1A 5EWMA 3CFYA 3EULA 3ROFA 5IULC 5BR1A 2P9HA 1DZ3A 2QVGA 1BDJA 4NV3A 2LBPA 4KNYA 4G0XA 5DKFA 5FWYB 5BRJA 4KRFA 3OMWA 3OLVA 1DBPA 3OO1A 3QX8A 2E4WA 5T7BA 1Z12A 1NXSA 1EWKA 1E2BA 4OG2A 1E6MA 4MR8A 1ZAYA 1JFSA 2QW1A 3KG2A 4W5QA 2RDMA 5KWSA 1E6LA 2JVIA 3KYJB 4YV7A 3H5TA 2HSGA 1E6KA 1JYEA 1Z2EA 2PUEA 2PMCA 3MYYA 2PUCA 3Q9SA 4RK4A 3SM9A 3NNNA 3BRQA 4JP1A 4RY0A 4EY3A 5IUNC 5IEBA 4TN5A 4UHJA 1RXIA 3BREA 2Q5CA 4QYMA 4RK6A 1T34A 4F8JA 3F6PA 2B1JA 4N03A 3FGZA 1USKA 1F51E 3M9WA 3QK7A 1MB0A 4KQ9A 2FTKE 1LJUA 5JNTA 4XASA 3SY8A 2PL9A 3SG0A 1KRXA 5GQSA 1K66A 1CYEA 2FEPA 2PJUA 1YTUA 2FSPA 2KYRA 1ZGGA 3Q7RA 1FSPA 3KKEA 4MS4A 4D6YA 3VNAA 5TQ0A 4ZYLA 1QQAA 1JF8A 2ZAYA 5F64A 3HUTA 2FEKA 3O2JA 1B00A 2M98A 2GX6A 1AB6A 5KC8A 3LUDA 1J56A 2JRLA 3NHMA 1SXHA 4G0MA 4TLLB 4CBVA 5IUKC 5JNVA 1NXXA 5CNMA 2I6FA 3O2QB 1NXPA 1JL3A 3QEKA 4YS6A 3TD9A 1ZH2A 4FE7A 2B4AA 4LDAA 3OQNA 3HXMA 1DCFA 1PNRA 2FMFA 1BDIA 2R25B 1Z17A 3OMXA 1USGA 1VRVA 3M6MD 4MR9A 3P9YA 4ZPJA 3SQNA 3HEBA 1JFTA 3HDVA 5PNTA 1S8NA 4XXHA 3T95A 3H5OA 1DP4A 2GKGA 3GBVA 5GOTA 3G85A 2IYNA 2WJWA 4Z4HA 5JNWA 3FMVA 5FBHA 1JHZA 5JNRA 1Y1LA 5BRAA 2WJAA 2NZVG 4MS1B 2MYTA 2H0AA 3N6VA 4MS3A 2L18A 4L4UA 5IBQA 4MAAA 3H1FA 2PUAA 1KGSA 4KFCA 5KQPA 3GWGA 4MLDA 1ZN2A 2QVCA 1OXBB 4Z99A 5IEJA 4QICA 5I4CA 2DRIA 4OATA 4HNQA 2M1ZA 2F8TA 1PHRA 3K9CA 3T8YA 4IF4A 2A9PA 3KSMA 4EYQA 1EAYA 4HNRA 2HQRA 2RGYA 3IP5A 1JX6A 4JOQA 4LDZA 2PUGA 2ID9A 3GRCA 3EODA 4YRZA 2JK1A 3CRNA 1H9CA 3F7NA 3C3MA 3MQ4A 4G0YA 4WZZA 3RVLA 4D74A 3DBIA 3IP7A 2LIVA 1MIHA 4KZKA 3MM4A 1ABFA 1FFWA 3N0RA 2BGGA 3CZ5A 4PEVA 3EJWA 3CG0A 1ZITA 3HM9A 3OLZA 5KQMA 4Z9AA 3JVIA 1CHNA 3O74A 3DGEC 1BA2A 4UHKA 3TMYA 3KTOA 4KVFA 2GBPA 2CD7A 3MMNA 5KQLA 6ABPA 3FFXA 5CNKA 3CHYA 4WWHA 3RVKA 1CEYA 3C6QA 5TPZA 2PL1A 4YP9A 5TPWA 3O1IC 3KLOA 1ZGZA 5EWLB 1FFGA 4B09A 3URMA 1LJLA 4RU1A 1MAVA 5KQGA 1VPWA 3HDGA 5B3JA 2NT3A 1YVUA 4YCSA 3H75A 4S05A 1EHCA 1VLZA 3HS3A 4MYRA 3UK0A 5FWYA 1XHFA 2JBAB 2PKXA 2O20A 1JWLA 1FFSA 4GPAA 1GCGA 2FLWA 1QNLA 1BAPA 3QEMB 4W5RA 2AYXA 3G1WA 3TB6A 3LUHA 4IMIB 1LBHA 1Z16A 1SD5A 3CU5A 3KYIB 1JDPA 3RVPA 2L17A 3BBLA 1DRJA 1W9HA 1M2EA 4G0PA 1FQWA 1NY5A 4WT7A 5EWJB 1D2AA 3Q7TA 5ABPA 3KLNA 3FFWA 3GL9A 3OLXA 3DZDA 3IP9A 2WB4A 4JB0A 4WXMA 2FKAA 2HPHA 4EVRA 2FQXA 5HSGA 4W5OA 2IKSA 3OQMA 1QMPA 3HV2A 4JASB 2V0NA 1QP7A 3I42A 1RZRA 4ETNA 2FMHA 1QKKA 3O1JC 2MSKA 3DLBA 4NCAA 1DRKA 2NT4A 4FB4A 4MS4B 2PE5A 2L2QA 5CNJA 2FMKA 1D1PA 3O1HB 2PUDA 2FXIA 4ETIA 4PZ0A 4QYWA 1PNTA 1SXIA 1YIOA 3N53A 3QELB 2N9UA 5KC9A 4OLBA 1JDNA 3LKBA 3GT7A 4H3KB 3LUCA 5DLEA 4EYOA 1HEYA 4Z4GA 4E7PA 2FVYA 2QV0A 2H3HA 4F3TA 2JCGA 3L49A 3S99A 1ZVVA 1NXWA 3IPAA 3QX9A 5T3YA 5FWXB 3H1GA 1M5UA 3EQ2A 3KHTA 4Q6BA 4YWHA 1LBIA 3RVRA 4NQRA 3JPWA 4LE2A 4MQFB 5CNIA 3HO1A 2P4UA 1ZH4A 4JB2A 3N75A 4F11A 1NATA 5B3JC 3A0RB 5C5EA 2IDMA 2PUBA 1GLGA 1NTRA 4KQCA 1QPZA 2NZUG 3FDFA 3OO0A 4M88A 2LPMA 1D4ZA 4RS3A 4O1IA 2LP4Y 4LZLA 1U8TA 1EWVA 1ABEA 1JLKA 2RJNA 3C97A 1Z2DA 4PICA 4WUTA 3H5IA 2E4YA 2FLKA 4GNRA 9ABPA 1C4WA 1URPA 3QLUA 2PUFA 4G97A 3LTEA 3QLVA 4RK5A 3EAFA 1M2FA 4MS1A 5TE9A 3CKMA 4G0QA 1DC7A 4MR7B 4YO7A 4DQDA 1QP4A 1DCKA 4P1ZA 5KI6A 2AYZA 3RVQA 2NUBA 1EFAA 1TLFA 3O2SB 1DCMA 1YS7A 2E4ZA 4N41A 4ETMA 4W5NA 1Z13A 3N0XA 3TO5A 2WY2D 5FBKA 1TMYA 3Q41A 4NCBA 3GBPA 4ML3A 3TX6A 4RY8A 3MF4A 5TQ2B 4MRMB 1JYFA 3CZCA 5IUJC 2GWRA 4LE0A 2CWDA 7ABPA 1GCAA 2JVKA 2ZWMA 4MQEB 4RK1A 1EWTA 4RKQA 1NXVA 2YHBA 3GA5A 3F6CA 3H5LA 3KJXA 1W25A 2HJ9A 4RXMA 3BRSA 1KMIY 4RY9A 1P2FA 3DLHA 1I3CA 2FMIA 3C3KA 5TPZD 2HQBA 5EWMB 3BILA 1C0EA 2OQRA 3LUJA 3R0JA 3O75A 4KK4A 4Z9BA 4XAQA 1A0OA 1QO0A 1R8JA 4KV7A 5BQ3A 2J48A 3N8IA 3QLTA 1TJYA 3IP6A 2WWVD 1BVHA 4H60A 5TPWB 3D02A 4DADA 2VK2A 4DN6A 1QP0A 4KMRA 1GUBA 3HZHA 5DGCA 3Q15C 2FW0A 4MR8B 1RNLA 3MIZA 2R4QA 4LX8A 4YGXB 1L5YA 4XARA 1DC8A 5EWLA 4E7OA 2ID7A 4N0QA 3OQOA 1YS6A 3LKVA 3A10A 3LUGA 1SRRA 3LFTA 6CHYA 3EDCA 3FFTA 2IPNA 3L6UA 4O1HA 5E3JA 3OM0A 3QLUC 2X7XA 3W9SA 4ZMRA 3HJFA 4OTZA 1UDRA 3QLVC 1TVMA 4RK7A 3LMKA 4JA2A 3H5WA 4S04A 2JBAA 4RV5A 4Z4IA 1OXKB 2PLNA 2VUHB 1D1QA 3IDOA 5ED4A 4W5TA 1RZRD 1P8AA 3QEMA 4RSMA 4Z4FA 4WXEA 4XFKA 3E3MA 1XHEA 4MLCA 3NNSA 2JVJA 3ILHA 5C5CA 1MB3A 4L85A 3NHZA 5DCLA 3CTPA 3F73A 2E4XA 2XDYA 2FN8A 2IPLA 1ZHHA 2A9RA 3JS5A 5TQ0B 5EWJA 4EYKA 1JBEA 3CNBA 1M5TA 3LUKA 4XLTA 3HSYA 2CHFA 2R48A 4ZMSA 4Q6WA 3B2NA 4N76A 1PUXA 2QSJA 1P6UA 1SXGA 1DBWA 4TMYA 2VUIB 3UKJA 2MSWA 1AB5A 2VYCA 3Q7SA 1IIBA 1A2OA 4NICA 2L19A 2FEWB 3DGFC 3H6HA 4PYRA 3ROTA 1ZESA 2YHAA 3RH0A 2MYUA 3H6GA 3LOPA 3SNKA 3IPCA 4PE5B 4EVSA 1PEYA 5CHYA 3SAJA 5HQJA 3QELA 4OBBA 4KPYA 3HK2A 3RVMA 1U04A 1K68A 4MR9B 4RDCA 2OENG 5IX8A 4D6XA 5D2CA 4MGEA 3RVJA 4EYGA 3OLWA 1VKRA 3GYBA 1D5WA 3O21A 1DJMA 2CHEA 1DG9A 2E4UA 5JNSA 3H5VA 2A9QA 2WRZA 2WMYA 5JS1A
chains in the Genus database with same CATH superfamily
3P2MA 2VAWA 1GZUA 3IILA 3I39X 4TTRA 1Z0DA 2XA9A 2PZKA 1G8MA 4TKUA 2XTNA 2XSZD 2A3NA 4P80A 4N0PA 2HPVA 4FJ2A 1DIHA 4HEJA 1K63A 2JGMA 4J3NA 4ZTUB 3DD5A 1WPQA 5D3ZA 4QGHA 2UUBB 2H1VA 1IJKA 3GLSA 1R6TA 4KQ1A 4D81A 4ZCRA 3AO0B 6Q21A 1H2ZA 2PS1A 3AEUA 3QKTA 1KVSA 1N2OA 1SQ6A 5K3EA 1IOZA 1FP4B 5JZ9A 4BO6A 3PNKA 4DCSA 3ND9A 3A70A 3N7UA 3AR4A 1RPNA 4EYSA 5DXAA 2PDAA 5DOVA 4DJDC 1I6KA 1I0LA 3HG7A 4DBZA 1XCBA 3R0ZA 1SG9A 1ORHA 4LYFA 4RA6B 4BQNA 3HXOA 3OIGA 5KKAA 2VF7A 3C5WP 2MSLA 4DEXA 3NT2A 3A1EA 1W36D 1KI2A 3GLIE 4P4SB 2QTGA 4B4VA 3F78A 1RRMA 3WMGA 2FNAA 3DZIA 3E8SA 1NULA 1SC9A 3T9AA 1O95D 2O07A 5SYAA 1P6XA 5LYJB 2WMNB 2JH3A 3C41J 2Q6IA 3B38A 4TMXA 4AY6A 4C6SA 1PV2A 2A5YB 3C45A 2RE8A 1QX3A 2CL6X 2RHMA 5AUNB 1P8JA 2ZTSA 2B3DA 3ANTA 3H42B 4DJJA 3R0IA 1N6RA 3JY6A 2ZCUA 4ATNA 3R23A 3NORA 4JAVC 1EK5A 3BD7A 4E08A 5LQRA 4HLNA 2B2NA 4XJTA 5GONA 1BXGA 1OWNA 4KAAA 2FDXA 3ND5A 1L7OA 1DUIA 1THGA 2PZ8A 5LMZA 1ZU5A 3WIVA 3ZU5A 4DL9A 2QM3A 3NBKA 1GGJA 2C4MA 4M21A 5A6VA 5CCBA 3EPLA 1QQBA 3GLTA 3RBZA 3IT3A 4UU0A 3MMPA 3DPIA 4WASA 1G7TA 1V16B 4CEIB 1FTNA 4Z9XA 1HFJA 2CBGA 4WD3A 5A0TA 2XVXA 5DCYA 3DAPA 5DGHA 3WP1B 4TL9A 4NE2A 1US8A 2P1RA 4BKRA 2WNIA 2HHCA 1DXQA 1MFPA 2PWPA 3DS8A 2LBPA 2OGZA 2NV2B 3ND6A 4LCEA 4A2CA 5FWYB 1KI6B 2B5WA 5F1PA 2H06A 4EHIA 1HZZA 1I2ZA 1SPBS 4IDCA 2P5UA 4DEYA 4F4FA 5BNIA 1M2VA 4DHEA 1W0JA 2YJ5A 3SDBA 2P69A 4PNPA 2VDVE 4PWZA 4ZODA 1XTKA 2QZ9A 1YKSA 2CXQA 2WJYA 1OV4A 3E7DA 4Y9UA 3UATA 2X4LA 4GM1A 4XA8A 4NBWA 5SZJA 2AUMA 2GN6A 3M2TA 4DR4B 3PQ6A 5JZMA 4GZLA 4GICA 3UW1A 4NHOA 3GP8A 1Q0LA 1D4AA 2PMCA 1EDOA 4QU5A 5DNYB 4M1SA 3TTSA 3LRPA 1T2FA 4HFMA 4LK3A 1V45E 4RK4A 1L4BA 1YR2A 4JP1A 1XQ6A 3AMVA 3ZDEA 3UHAA 1SIOA 1KSFX 2H7YA 1QTRA 4QTTB 2XQJA 4F8JA 1HNZB 4YB8A 3S7TA 1THTA 2R7NA 3QE2A 1R64A 1RZUA 5AKKA 1GL7A 3FBGA 2ENUA 2XRZA 1JTFA 4NMXB 2HLPA 1G5IA 1ULBA 3ZWXA 4F4IA 1FRVA 1G9SA 4HADA 1ZCZA 1CFJA 1W52X 2C1XA 2YL2A 4MUAA 2XCSB 4I4LA 2F1HA 3HYRA 2QPAA 3AUAA 3ICVA 3KVYA 3HLYA 4OP3A 5C4GB 5AVQA 3UMYA 2HMWA 3W2EA 4L3VA 4YCNA 2G8NA 5FCDA 3BMCA 4UVIA 3GLIB 2G5TA 1EWQA 3M70A 1VLVA 4JLAA 3TNJA 1OWMA 1N2GA 3A1CA 2GZRA 3KSZO 5DBFA 2XKKA 1G21A 4M0PA 4ZTBA 2BW0A 5A4DA 1SVSA 1WB9A 2YZ7A 3ELDA 2H63A 3P71T 2O2HA 4QDJA 3TW8A 4BMYA 3JRNA 4MI1A 1X92A 5MFZA 4CBVA 4EDHA 2EAUA 3DO5A 4D9MA 4HMPA 5LQUA 3ZLBA 4P58A 1PVVA 4I9NA 4YAUA 4RL6A 5ARDA 1ODCA 4REMA 4MWEA 3K6JA 1QC5A 1CY4A 1A8IA 1MEOA 2V7XA 3KOMA 3IUYA 2P90A 3TZBA 4A6DA 2W2MA 3HYCA 4MA5A 1DV2A 1EG7A 3M6MD 5EJ2A 2G88A 4ZEVA 2OP1A 4OFXA 1VGRA 1JB1A 5JCZA 1IY8A 3K30A 3MG9A 2Y4OA 3HEBA 1SUIA 1JLSA 4YCBA 1RC8A 2R6ZA 2DULA 4YJGA 1OKKA 3AY7A 2ZITA 3O84A 4P8RA 1CZOA 2VDMB 3WV4A 4D5EA 1BJKA 2DFVA 4O2AF 4QYIB 1YDHA 4KRXA 1LF5A 2GBFA 2FPPB 2WJWA 4XOIA 4KXMA 1F6WA 4NABA 4RWZA 1G19A 2HBZA 4NDZA 4GOND 3OTOB 2EX4A 4QECA 2E3JA 4ZVUA 4XEUA 5TR9A 4M53A 1CUCA 1N5KA 3HNPA 4DZRA 1N5DA 2QWXA 3GO4A 1RHRA 3GFFA 1OLSB 1UM8A 5M3BA 4EDFA 4P0PB 3OOEA 3OQBA 2HMUA 5JD3A 2VDRB 3OIDA 1XYYA 5AFSA 1D2GA 3ZY6A 5LQJA 2BSXA 1LD3A 4PLCA 4S1PA 5FL3A 1M6VB 3D8BA 5AOVA 1OT5A 3V4OA 4BYMA 1M1XB 1ZXBA 5C31A 3ZH9B 5K1ZA 4R68A 1VC2A 2OLJA 1AXGA 1Y3DE 2CJFA 1YUMA 2E48A 4WLFA 1QH8B 2GSDA 2PBLA 3HB5X 3G9ZA 1FPMA 5ALXA 4IICA 1QQ6A 4DGSA 1COWA 4M7OA 5ALUA 1E63A 3NT5A 4AS3A 3E7FA 4D79A 2OZPA 2ZBFA 4JC8A 1Q7BA 4M9RA 4ZDJA 2ID9A 2XB4A 5FUYA 4AT1A 2PXHA 4UNIA 3IEVA 4F45A 3SS8A 1XQXA 4JJZA 4C0BA 3OUUA 3GRAA 1E6UA 2G83A 1T5SA 1SBHA 3V2UA 5DNUA 4NBLA 3FOZA 2EBWA 1UWCA 2GJAA 1R5NA 4HN9A 5T8KC 4EHBA 3NM5A 3CG0A 3UQZA 2ZWPA 3PDIB 1X1TA 1XVVA 3EH2A 5E4FA 1ZA2A 2A84A 2IP1A 2Z5GA 4IFIA 1BE1A 5K6RA 3BS4A 2Q45A 5IC4A 1UJNA 1P19A 1E1DA 3ETDA 4JL6A 4P3NA 1AQLA 4ZCIA 3V7UA 5A5FA 2O1SA 4MCHA 1M34E 1SBTA 5EEHA 4PAOA 4AJ4A 2BRUC 3DUFB 2ZYTX 2HPZA 4X60A 3CLSC 2JFOA 4HTFB 4Z7QB 1OYWA 1B2LA 3RS8A 1JTVA 2TSYB 3BORA 4ZYXA 4B3BA 4EG7A 5KQGA 5CT8A 5DWDA 2BV3A 4EF4A 3UZUA 5IJ9A 5I7SA 4PO9A 2H4JA 3OBBA 4I55A 2P1DA 4QOGA 1VE9A 1J8YF 1WCYA 5AQ1A 1EHCA 2GN2A 3OTIA 4Z2AA 2BR5A 1Q0RA 1Z38A 2KW5A 3AKYA 3WLPA 5JV5A 3T5MA 2QMUA 2GT1A 1FSSA 3MXTA 1ND6A 1VJ5A 1BAPA 3I76A 3UMRA 3ZGOA 5LZ7A 4D9HA 4EJ2A 3RFXA 2OKCA 3G1WA 4B48A 1YMQA 4IMIB 4LRWA 4MGKR 3VYRB 4D99A 4PINA 5IHXA 2PZAA 4IGIA 3EXHB 3NC0C 1Z2CA 2FZLA 5AKXA 4FS8A 2Y0DA 3DMNA 3K73O 3KQNA 3U5ZB 4RESA 1P0PA 5JWRA 3IODA 3KLNA 2WU8A 1XWIA 3IP9A 4ZQFA 3LV8A 2F48A 4J90A 4F6RA 4JLOA 2OILA 3LX8A 4IDAA 1QMPA 3GLRA 3NI2A 1L4MA 2DQZA 4DJ5X 1QKKA 3I6YA 1QM5A 4N8DA 3N2EA 4BO5A 1JQBA 4RBNA 2B25A 5P21A 7MDHA 3H86A 5MF6A 2FHSA 1EFVA 4C3VA 3QEBZ 2WHYA 3OJXA 3AH8A 4M36A 2HSJA 4LFAB 4CF5A 5KYTA 1E1CA 1JT9A 4QRHA 3K9QO 3IKTA 2J3HA 1XNQB 2BFCB 1B73A 4AMBA 1JDBC 2Q3JA 1IOVA 3BB1A 4GQAA 1U2EA 4TTQA 1NUPA 4N0DA 4PX9A 2WA2A 1TGYA 4PZ9A 4OJMX 2OBLA 6PFKA 1C8KA 2PUHA 2UYYA 4J7AA 3QBJA 2C4NA 4ZD6A 3DE6X 5BW6B 5JQGA 3DYIA 3PC8C 4KKVA 5JI2E 1RKBA 3LCMA 4AYXA 1X7WA 2J85A 3OU2A 3QFRA 2FMTA 1IK6A 3KJEA 3Q0TA 3U80A 4L8VA 1FY2A 4UBNA 3L1HA 3EAQA 4UXHA 2FE1A 2C9BA 3JQPA 4Q6BA 3LGAA 4EL5A 4EG0A 1H8HA 1I32A 2ONYA 4JGBA 1QE3A 3L7DA 3QXCA 4X64B 4MYTA 3GLGE 1G59A 2RGGA 3K0SA 1E1YA 4BNUA 1YI8A 1MAWA 2EHDA 1TD9A 5HCIA 5LU8A 2VTDA 3EGXB 4LJKA 5B4VA 2ZI3A 1IONA 3FLMA 2Q1TA 3LECA 3OO0A 2YIVX 1M34B 4BNYA 4TV9A 3P4UA 1ZVMA 5JVDB 2Q6VA 4FMDF 1P7VA 3B2EA 1GN8A 1T2NA 2CSXA 2XVMA 1DTEA 1VXOA 4JH0A 4PZPA 1PN3A 2Y0BA 1Z2OX 3AEYA 4MCIA 4OQXA 2OB1A 4RFLA 3TQIA 3WFIA 2V7QD 3FZYA 4RK5A 3RC1A 2NXNA 1D8AA 1EPUA 2XT9A 3Q6IA 3BAFA 3Q3IA 3S2ZA 4PANA 4DCTA 2IYTA 2BKAA 1XFDA 3UMMA 4RTMA 3ZV5A 1AU9A 1DKLA 5EI5A 1QP4A 1CB0A 3TM5A 3R5FA 5KI6A 1Q1QA 4F91B 3PQ4A 4R2WA 2OOSA 4YECA 4EARA 2O54A 2R6AA 1J2RA 1WVIA 6YASA 3S2EA 3TO5A 4CM8B 1BEUB 3KZMA 4OHCA 1CUWA 3Q41A 4M54A 2GNPA 3RJTA 1NFFA 5EFOA 2XTZA 5C3UA 2J3IA 4B4WA 1M2NA 2NN3C 4IO1A 4AJPA 3MF4A 2QM0A 1AHNA 1BDBA 3CZCA 1I36A 4ND7A 3SYMA 4C6TB 2ZWMA 1THZA 1KQ3A 3RSFA 4RK1A 3R5TA 5DN6D 2K7FA 1MHTA 1QGDA 3QKRA 1NVVR 4X1KA 3T1VA 4D98A 4JHLA 3FOWA 3O73A 3FPBA 5BSEA 4DMCA 3EIQA 2GXAA 1I3CA 3UMGA 1M7BA 2GGSA 4ZO7A 5K0SA 5EWMB 3A9VA 1B14A 1DQZA 3E2PA 2CW5A 3UGKA 2WYVA 3ENWA 4XAQA 3UUWA 3TSAA 4OFWA 1EE9A 5LU9A 4FCWA 4J6EA 2DCUA 5LP6F 1DGQA 4NMLA 3WZ2A 5AVUA 2BDEA 5EIHA 1DOHA 1BX0A 1EB8A 3W2HA 2YR0A 4OQFA 1IG3A 1P4SA 2VJQA 1F2UB 4DQUA 3HZHA 4FZJA 1PS9A 3Q15C 4TUYB 1VCMA 4NI5A 1C7ZA 2PGXA 4TM7A 4DIUA 1PQWA 2AYYA 2EW1A 3ESCA 1U02A 1K8QA 3G5UA 4F2WA 3E2IA 2QV7A 2PU7A 3MCUA 4GKJB 3KU4A 1QX4A 4QQKA 2HCRA 2XLCA 3CX8A 3PK0A 4RJIA 1Z2AA 1P44A 1JA1A 3UN1A 1FIUA 5LNK6 3GLGB 3KT6A 1H4QA 1T26A 1X8LA 1ZH0A 2R5FA 4OTZA 1NURA 2XMRA 1E1MA 2PWZA 4RDIA 4S04A 1YVRA 4X6UA 3IDOA 4UBKA 2ZUVA 1JE0A 2CCGA 4HNGA 4MHOA 3ZU2A 1E2EA 4DYDA 3ER8A 3LZ6A 2C58A 4LYJA 3HKCB 4CKXA 4WESA 5FYQA 4ECAA 2EDCA 2CDCA 3WLTA 2B5OA 1EM8B 1NR5A 1EK0A 1PL7A 3H0KA 5KYVA 3ADOA 1DC4A 3CMCO 1UBHS 2NW6A 2Z6AA 3KR0A 5G4KB 5IDQA 2GASA 3JVVA 3TUIC 3AERB 1JKXA 1HMPA 2CLFB 4IJ5A 2VDQB 2CLKB 5FPPA 2WYOA 4Q3KA 1Z6XA 1KJJA 2JFPA 4IIJF 3HSYA 5AVKA 1S01A 4UZFA 2FCRA 1CQJB 3LXXA 3MWLA 4IZ6A 3TINA 4DPLA 1YZVA 4G5SA 2EKBA 1LUAA 3A2LA 1HT1E 3BMNA 1FUEA 4X71A 3BJRA 3DOCA 3O0TA 4B74A 2QN1A 2MSWA 2BFEA 4PGHA 1TJNA 3EVCA 3L0BA 5U9CA 1UUFA 4EA6A 2WUWE 4R1UA 3KQKA 2YHAA 2ZUFA 5GOZA 2J3JA 4HGQA 4MO2A 2RBEA 1FEZA 3JQ7A 4J0GA 2HRDA 1PT9A 4WFQA 4RHYA 5ESXA 3GZJA 1GVHA 1AZTA 3I9NA 2XADA 4PQEA 4LV5B 1U9IC 4AYWA 4YXFA 1N5OX 1GKIA 1BXRB 4CJXA 2FG7C 2A67A 3UQYS 1GA6A 4L8LA 3T0FA 3CIFA 2IHNA 1ZKDA 2DWOA 1NJ1A 1VPLA 2H4HA 2P6NA 4ARZB 2CNKA 3ZHTA 5FP0A 4KG7A 3K6SA 5G41A 4MDFA 1NHGA 2HZ7A 4RVHA 4NMMA 4B47A 1TVEA 1KFCB 3HVJA 1Q7RA 3C8DA 4GMGA 1W93A 5KNBH 4F06A 3DBVO 2IS2A 2GS9A 5DX8A 3AOEA 3RWOA 3PUYA 5AKGA 3EQZA 3HKEB 4F9GA 5DBIA 2GZ3A 2LKDA 1M33A 2YWGA 1DXYA 3OFKA 5F7ZA 4DGQA 4EQZA 1JHPA 4MS3B 2R84A 1ZONA 2ZBPA 3EZFA 1SHZA 4IDEA 1H4VB 1TJ5A 4L7VA 3EWNA 1BSVA 4LIPD 4RWEA 4UUBA 5C7IO 5ITZB 4G1EB 1KEUA 4W9MC 3GFPA 3QP9A 3UAOA 1C41A 4PX5A 2X13A 4YWJA 4DMUB 5HP4A 4RETA 1YDEA 2QNIA 1XN4A 3NVDA 4FGKA 1UBKS 2MINA 5BN5A 3R7FA 1EKXA 1H94A 3KJHA 2CHUA 4IMJB 3PJDA 4XKJA 5JSYA 2J3DA 4LHYA 4EJSA 2TS1A 4M38A 5EP1A 1IN1A 3WLHA 2A9FA 5G2OA 3K70D 4YREA 2JB9A 4U8HA 3BCRA 1L7QA 4ENWA 1SVLA 4UUNA 4WADA 3D8UA 4RZQA 1RC1A 3ELWA 3P9SA 4IXDA 4HNAB 3AGPA 4PSCA 2HUPA 2RH4A 4QPJC 5JS6A 3TLKA 1G7SA 4B85A 2ZRMA 1K08A 1QIJA 4MKGA 1SB8A 1FTYA 1L3CA 1MC8A 8OHMA 1WCIB 2FP4A 1VL6A 4JUIA 4EUSA 4H3HB 3GLQA 1HYQA 2CB9A 3P27A 4LZJA 3V5NA 4F3KA 5EESA 3PQFA 3WGNA 2J0EA 3UAVA 2WWXA 3H0EA 5B2EA 3PNQA 5HHTA 1D2RA 5FD8A 4OLAA 3LNTA 3W1EA 1WPRA 3CSSA 1T36B 2JHFA 5K20A 1DJPA 3BFXA 4X61A 3SMVA 4GGOA 5I7VA 5H8WA 3AY3A 4BWFB 2QU7A 3OHSX 3LF2A 2QLFA 1B1AA 1H66A 3LIIA 4RD4A 1PTJC 2PL3A 2OYSA 5ALKA 3RSOA 3BAZA 3LCVB 4HO1X 1IAQA 2VDUE 2IXFA 1GOTA 4TPKA 2AEJA 2QUIA 3FNHA 1YZQA 1T8PA 4M0CA 3TSCA 4RLFA 1VOTA 3WMFA 1G5TA 1U2ZA 2YWDA 1OXUA 3N59A 1AM4D 3DV0B 2GJ8A 1GGFA 5BRJA 1E2LA 3NYIA 4AZSA 4HK4A 2ODAA 2CXUA 5T7BA 1XEXB 1JA9A 1JIQA 4DLTA 4LZAA 621PA 3O6VA 2ZBQA 2H8KA 5F4ZA 5BSTA 3UB3A 3X2SA 4BQRA 4D8VA 4FYXA 5FI1B 2QW1A 4RTJA 2ZYUX 3KG2A 4OHRA 4MV5A 2OQVA 1CX9B 1Z0JA 3BVPA 4D8XA 3EWSA 5JMOA 3A1WA 3X2FA 1EX1A 3VJMA 1EE2A 5HEKA 4DA9A 5A9SA 1JECA 2ZTHA 1KQFA 4WBNB 4YX9A 1O3YA 3BSSA 4HJRA 2Q5CA 3LWNA 3GRYA 3RSLA 2NSLA 1U11A 2JIZD 2E82A 3F5SA 1C30B 2G0NA 3LYLA 1F51E 5DTRA 4U4AA 1CD5A 3V4PB 1J0DA 1J4AA 4M8SA 3UWMA 2M2IA 4AUMA 2PEYA 1N2CE 2CKMA 4KQGA 5FTJA 5I9BA 4XPIB 4BO3A 4BXOA 1NHWA 3ZQKA 5J2UA 1KY4A 1XJ0A 2JAUA 1HKHA 4I7EA 4Z1MA 4AMGA 2PUTA 2XCRB 5JJ5A 1L7XA 1VMDA 2CVPA 4NAHA 3WLOA 1E66A 4FJ1A 3F8SA 1ZVQA 1RHMA 2Q27A 5CURA 5CA0A 5TRTA 1A5ZA 2GX6A 1LU9A 1CRQA 4B7UA 4BRWA 3EPJA 3E48A 3ICWA 3ZUPA 2O8FA 4O0MA 1RCTE 5CCDA 3PHHA 3PUKA 3O83A 3ZU4A 1ORWA 1NV9A 1KR2A 4K9LA 3VV2A 2XBMA 3QEKA 1LSSA 3NOOA 5CAEB 2VZ8A 4JB8A 2IEYA 2VP3A 2SKCA 4LSWA 3HBJA 4AUKA 2YV3A 1ZS9A 5AKLA 3LC7O 1CQPA 1GLVA 1L4EA 2J45A 2C42A 4ZV7A 1RVV1 5HKKA 4CG1A 3UMVA 5LR6A 1G8HA 1FXUA 2G07A 2X9GA 2YFQA 4HH0A 4AMZA 4WBSA 5GONF 3QLEA 1KKMA 3ZHOA 1W8IA 2I3AA 2W43A 3M4YA 3AR8A 3GBVA 4OEHA 3RF6A 2IP4A 4GRAA 4RLSA 1DT3A 1U7UA 3C3BA 2PNJA 2ZYAA 4OJYA 1ZLYA 1Y82A 3IQGX 1XMPA 2H08A 3WK4A 4B2IA 3ANMA 1DQYA 2Y0EA 5KEIA 5M2QA 2C7PA 4HLUA 3V7YA 5H82A 2ZAIA 2EWMA 2DBVO 3GFBA 5F1KA 3T3HA 1VBKA 1WPXA 4JLWA 1PJSA 2DSNA 5I48A 2VLBA 2L18A 4YJ2F 1T25A 2O52A 3SLGA 3B7PA 3MGAA 1L3IA 3LDAA 1W75A 4GUDA 2JKYA 3UMBA 1KGSA 2X86A 4NAVA 2WJPA 4PONA 4H3SA 2J0VA 4FEYA 5EQTA 2H5IA 3D0KA 3AF4A 3RJ5A 3MJFA 3BXEA 3JYLA 4E5DA 4EEXA 5BSHA 4BRZA 1U80A 1H05A 2C78A 4GS5A 4R1NA 2QTWB 2RARA 4XX1A 1JEYA 3K70B 4OJKA 5I9NA 2PLAA 3DFIA 4LDRA 1RAGA 2R86A 4I9HA 2ZKIA 2UUPA 2BFMA 1XTBA 4XM2A 4GKBA 3AEKB 5BWCA 4MPJA 4DG9A 3MRVA 1IUPA 5DM1A 2O3JA 3KR9A 3KE9A 2XUKA 3I53A 1RPTA 3EODA 2JDID 2AMYA 5A05A 2OMEA 5SV2A 1PR0A 1KMNA 2JGNA 1G60A 2WIFA 3U13A 5CXUA 2OZLB 1IWOA 1N2CB 1FFWA 1U99A 2ACKA 3ETNA 3U9TA 1FFDA 2GETA 3B12A 4M49A 4P9NA 5HRCA 2Q7XA 1H8EA 3FPEA 4Z2YA 1WP9A 1GZ3A 4O2AB 2J3LA 4ZU3A 1XELA 4S12A 2DYKA 2HHLA 1SXQA 3DXFA 3EOZA 4JVLA 5EIWA 6REQB 5F7XA 3T1HB 1XMJA 2OT3B 1OZGA 4WWHA 4TWBA 1CEYA 4PCUA 5BR7A 5F51A 5KTNA 8MHTA 2MSNA 4B76A 4FC7A 4GP6A 4QXPA 1I14A 5I7FA 4EO9A 5HKBA 2AJCA 3G82C 4Q4JB 1H0HA 1C0LA 2CLSA 3VZQA 1SBZA 4CKWA 1EGMB 3PYLA 3HR4A 5B3AA 1M6HA 2HF9A 1NLUA 1YVUA 4BP9A 4KSYA 5DNEA 1E3WB 1TGVA 2WE7A 4V2IA 4OLHA 1YTUA 3I3OA 3RHZA 3CE6A 1YC5A 1VGQA 2J5XA 2C96A 3COYA 2AYXA 2PVPA 4K0KB 2HWXA 3ND7A 3H2BA 4L5IA 4UM9D 1LBHA 2WZDA 3JATB 1Q22A 1OFUX 4WFJA 1GDTA 4UARA 5AWFC 2WAMA 4K1LA 2WINI 3RVPA 3RROA 3MRXA 4D8WA 1SK8A 2YX1A 3HFSA 1GKUB 3W3AA 3K9BA 1QVAA 2Z0MA 3SEQA 1NUQA 1OYOA 4GWGA 4BKMA 3TLZA 4YAKA 4GT1A 2GYUA 1YGYA 3FFWA 3BWVA 1G8GA 2PS0A 2NU6A 1N9ZA 1X1DA 3EF1A 4W5JA 4Z86A 3WMXA 3K1JA 3REOA 1K2VN 5AVVA 1IZZA 5CT5A 3E7WA 3PNBA 4RF3A 2AGVA 3O1JC 2J9YB 3C1OA 1G2PA 2NVUA 2R8BA 3N9IA 3TQTA 1AQJA 1WUKS 4MUFA 1GRVA 4MI9A 2DXIA 4XD7D 5FYDA 1TQ8A 3FTPA 2EZ8A 3T7CA 4MEBA 1REQA 1WZEA 4HQNA 4KBYA 2Q1XA 4I2VA 1A8UA 2G1UA 5E6UA 4ZT4A 4URZR 3RM3A 2CHVA 1VL2A 2PGNA 1COZA 5C5DA 5K0EA 2XUPA 4PO8A 1ENYA 1CYDA 4JLUA 4DV1B 1YI1A 1C2TA 3FJOA 2VT3A 1GGMA 4YMIA 4KO2S 4MAMA 1NV8A 3R76A 4B6GA 1LSOA 1ZIYA 3EFOA 1SH7A 1A9QA 1Y6RA 2VBCA 2B1RA 1SXJC 3K0HA 3QW2A 2YHUA 2FUNB 4HQRA 3ZJVA 2OYCA 2D1RA 2PZGA 2AZTA 1E3DA 4LC0A 3ZW7A 1EAMA 1G8FA 3S1SA 1PWZA 3RK1A 1DRVA 3WKAA 3H99A 4I8DA 4OXYA 4QBIA 4TV8A 2FPXA 2ZT8A 3Q3JB 5BR4A 2GZ2A 1XZJA 1LBIA 1RM3A 2FZEA 2YWJA 3B51X 3NUGA 3P9NA 3RS2A 5IF9A 2CXRA 1GGKA 2VXCA 1GCOA 1PR6A 1RM5A 4GXRA 1L7MA 2ET6A 2O0JA 3OJFA 5TMEA 4EO7A 4CPDA 4ZHQA 3TK1A 4QDTA 2QX6A 5BUQA 1LC0A 1NTRA 1P7YA 4J7CA 3BSYA 4KRYA 4EGJA 4KPEC 3U56A 1ZN7A 2LPMA 1T5BA 1FUIA 1AQUA 2HO4A 2WSBA 3U1BA 4ZT3A 3I1IA 1H2FA 2CMFA 5L3VA 3B13B 4IR7A 1V3QE 3TAXA 2NZ2A 3HCPA 4MIKA 1MQSA 3HUDA 1RMQA 2HLNA 1G8YA 4BC0A 5I45A 1B41A 3T1OA 1BXKA 4OQNA 1R9MA 2A2ZA 4KW7A 3RUPA 3TDNA 1GTG1 3CXUA 2ZPUA 3QGMA 3RC2A 3RIHA 2FN3A 3TOZA 4OMFG 3TG8A 4KQJA 1OA0A 4LDJA 4YRRA 2AJ8A 1KS2A 3AI3A 4NS1A 3HBMA 2WWFA 4LV6A 1UDWA 5LB4A 3WOHA 2QMQA 2I76A 4U0KA 1EXDA 4DV2B 4Y0AA 2A0KA 2PS3A 2WUDA 4JT9A 5K0CA 1DTWA 4N54A 2DQYA 1NVBA 1A9RA 2W6CX 4WRRA 4A1FA 3CC8A 4BO2A 3DLPX 4WL0A 2GXQA 3PRYA 4DT1A 3RTGA 5KNDA 3H05A 3QM1A 1NG1A 3ZE7A 2X2PA 3ZNNA 4D2IA 1PS8A 4D3SA 4BFYA 4NJEB 4ZCMA 1GRNA 5AM1A 3K2QA 4RJLA 4ZGBA 1E2UA 4MA0A 4ZVRA 3ZWQA 4H1WA 1C9EA 1DC3A 4KQXA 3I6MA 1L5OA 1U90A 2B9EA 2DG2A 2R6GA 2PKQO 3QV2A 1SA0A 3C16C 3KEOA 4Q1BA 4RD0A 3WHLA 4CCAA 4NS4A 4YT4A 4GWLA 5CXQA 3D1VA 4FW9A 2ENWA 3R0JA 4CLRB 2KX7A 3NOQA 3CB2A 2HCBA 5DV9A 3F3KA 1TCUA 1H6DA 4DNQA 3I8OA 3GVPA 1T8WA 4ZOAA 4E88A 4IOKA 3Q8MA 2O3TA 1OC4A 3IQFA 3R8CA 2HV9A 5JAPA 1K3FA 3CW2A 4W7SA 2WTUA 5TPWB 3UBTA 5FB3A 4BCDA 3HB0A 3DF7A 5EZQA 1Z29A 3RYCA 1T0JB 2GARA 4LC9A 5K6AA 3MAJA 5EY5B 2BFPA 4NK4A 5DGCA 2XYVA 1Y1QA 3E4CA 2Q9UA 5ECDA 5F78A 4DTIA 2H0QA 2BOVA 5KHOC 5JQGF 2QBYB 5FOUA 5AXCA 2R4QA 2GYVA 1D9XA 2WHPB 3KQQA 3NTXA 4IH4A 5IMSA 4HFRA 2W00A 1QAMA 3ZJTA 1Z3IX 4WKNA 3GMTA 1Z4JA 3ENNA 4J4HA 4ZEXA 4HR7A 2IWHA 3NRBA 3LKVA 1W85B 3TIXB 5CLJA 2Z57A 5LN1A 1TZCA 1AKUA 1NJ2A 2RK3A 2H8GA 2IRWA 1FP6A 3QLUC 5ALRA 1RD4A 3B3GA 4RCYA 4ZQGA 4EENA 4PWYA 4OA8A 2WKRA 4UM9B 1DTSA 1Z47A 3K20A 2VDPB 3CJRA 4L7QA 3WHKA 1E79D 3SR3A 4A8HA 2EJVA 4R2MA 3AVPA 2D1QA 1XMOB 3PDWA 5CLLA 5K5EA 1P2UA 2NAFA 2OGWA 4L85A 4O3FA 4TV9F 4QSHA 5FBWB 3U3KA 2XCTB 3H2YA 3PD7A 2E4XA 2WJZB 1IY2A 1WF6A 1YBMA 3HU3A 4QTUB 3WYBA 2HK8A 1TTHA 3OZXA 4MVYA 2WHEA 3T7AA 1S2GA 3WK7A 1PJ4A 2R48A 2Y4NA 5HCUA 4Q4CA 4YFYA 5JNLA 4CDGA 5IASA 2YN0A 4JIMA 5ENVA 5HJ7A 5LP6B 3CUSA 1FMCA 5LA6A 4CG3A 3I5MA 3JWGA 4GM4A 5EIOA 3A7DA 3OHPA 5DW3A 4BX0A 1ESMA 1CUEA 1W88A 4GQIA 3RH0A 2R44A 2AC4A 3LLMA 4UUQA 1N3BA 3RCBA 3KVOA 4KXUA 3GPIA 3HP7A 2QRHA 1NUUA 4FSHA 4DB2A 4EVSA 3AKDA 1H5QA 4OBBA 4BMVA 1R3DA 3FYDA 3ZXSA 1AKWA 1CLUA 1EBBA 3HKBA 1Q83A 2OENG 4K88A 4E0BA 4EFLA 5BWBA 4OOFA 4U0JA 4JWKA 4PN3A 3THWB 2O8EB 3P2KA 3FCUB 2PKEA 3OLWA 3O21A 4J0EA 4BVKA 2CVFA 1TYDE 1OQAA 4QNNA 3ITEA 3D3EA 2DGDA 3EN0A 1UOPA 4NZZA 1U4SA 1OBOA 4YCDA 1G3QA 1XJWA 5F2OA 1PFUA 5A6SB 3VAZA 4AZWA 2HSEA 4KN6A 1NC3A 5D3QA 2AEFA 1W35A 1XA3A 5T67A 4BWYA 1KRWA 5EWLA 4YRNA 3TVTA 2F2TA 3LDFA 2Z08A 1YS2X 2XZTA 3IT1A 1OROA 1KR5A 1YMVA 2YMPA 1KAGA 1GYQA 4LHEA 4GF5A 4CMJA 1FVOA 3NHSA 3OPYA 4CGYA 1YRLA 2G1PA 2OHOA 2O8BB 2DLCX 4OY3A 3L40A 4ISCA 4OIMA 3RABA 4IIJB 1PK9A 1KKUA 3C39A 3JQEA 1WETA 3VAYA 3A6PC 3BEDA 5JJIA 1E7WA 1S2LA 1HK7A 1Q1ZA 2V7PA 3C6XA 3MGCA 4LRTB 5EUMA 3BSWA 1IHXA 1P80A 1MVOA 1P0IA 1PI3A 1O6CA 2IZ6A 4JYPA 1R66A 3ZDAA 3ILVA 3C3WA 2C83A 3SVTA 2I3DA 2I6GA 5ICEA 1M2KA 3HTXA 3PNOA 1EEHA 2P0AA 1KMQA 4LPKA 2CYAA 2W6PA 3I01M 3EARA 3I45A 3CT6A 4IDQA 3HWWA 4MR7A 1BX3A 5DCWA 3BHJA 3HCWA 4FFOA 1JPJA 1J06A 3DDHA 3B1ZA 1RWMA 3M5CA 3OJLA 2RHCA 3ILSA 3WE7A 5KYYA 3OLYA 2XDQB 3JQFC 1SCDA 2LWIA 4ZCQA 1L5HA 4B44A 1VG8A 2OESA 1ZKMA 3BK2A 3HN6A 2AZDA 4HQFA 2UDPA 2DUJA 4YIKA 3IVGA 3IX7A 5EE3A 1WEHA 2VCEA 4ND2A 5AW2A 2B8WA 2N46A 5DI9A 1WMBA 3PDCA 4D5GA 1EWYA 4BMPB 1LI5A 1UDBA 4XQ9A 3MUOA 5KOJA 2IHZA 1C9MA 3KTDA 4IILA 1L7DA 1AKEA 4V2UA 4CUZA 2OD2A 4IDDA 4FNMA 2OPHA 2PLRA 4JJAA 3UAWA 4JKIA 2C77A 3K1AA 4YROA 1XD2B 3RT7A 1G18A 4URUR 4WZ6A 5BVGB 1GADO 1XZMA 3F7OA 4H9GA 4PY2A 5E7QA 1CUUA 1U0LA 1G7CA 1GZDA 4PAWA 1T3HA 1EX9A 3I1JA 2V6MA 1WXEA 2GXSA 3SC4A 2JAXA 1Z63A 1DBPA 1V8BA 3NWEA 3QBTA 4PGGA 4QXQA 4BVJA 5HFNA 3DWFA 1UMDB 4YAOA 2CNBA 1HDOA 1I3NA 1KMMA 1YVEI 2G8LA 4K28A 3RRBA 1YONA 3EMBA 5EN4A 1PAUA 4PLTA 5CCEA 5JAIA 4W5QA 4TMVA 3EWAA 4FYWA 2JVIA 2ZRHA 3IQHX 4YV7A 1OFVA 5C46F 1MXHA 1QTNA 4XCVA 2RGRA 1P4RA 3UYKA 1IN4A 1AO3A 1SUFA 4ZWNA 1FMFA 3BHIA 1TM7E 1JEOA 2EOAA 4KH0A 5F98A 2HRQA 3N76A 2G17A 4FR0A 2D4HA 3FGNA 3JRXA 1MGOA 4W7HA 4NCJA 1ZOOA 2I80A 5AUQA 1IXSB 1Q57A 1T5LA 1Y8RA 2GM4A 1N1DA 1K4KA 1HT2E 1JG1A 1F9EA 5C7OO 1QPGA 3B9PA 1BE6A 2IJGX 4TL8A 1JTEA 2ZK7A 4ZAWA 5SY6A 3SG0A 3SY8A 4AP6A 3S7ZA 4DIBA 2H2HA 2IYYA 1CYEA 4DQVA 3W9UA 3TXXA 3UHFA 2WTAA 5IVPA 4ROSA 1QHIA 2OWEA 2AG1A 3WWDA 2XIQA 3VYSB 3UV3A 4ZYLA 3LK7A 4DXAA 1FYXA 2ZYHA 4WNAA 2WOJA 5F64A 3ZKAA 3HUTA 4FINA 4X1IA 5B12A 4BAUA 1XRPA 5FBLB 1BCSB 1E6WA 1XTUA 4ZYWA 10MHA 2GAIA 5MHTA 2MU1A 2FSGA 3A3YA 3SI7A 3NV9A 2PG3A 2AN3A 4JKOA 4KIGA 4MVJI 4ENVA 4O4LA 3QIAA 4KJZA 1UZAA 4RQAA 4C08A 5EZ5A 4Y1RB 1A77A 4WZBA 2QVYX 4BAZA 2P77A 3VR5A 5KOHA 1S8AA 2Q4RA 4IMRA 1RE1A 4YPVA 2AIRA 4IFEA 1JHXA 1OE0A 3H1BA 4JA0A 5FO1A 3V2IA 4BX8A 2IS1A 4TWRA 2VQ6A 1CY2A 3UC9A 1PIWA 1HL3A 1TO6A 2ZUSA 5DNWA 3NHRA 3ON5A 4IIUA 3AKCA 3BDIA 2CK3A 1NIPA 1USGA 3S68A 2VHJA 2HIHA 2VDJA 1UBRS 3DAYA 3EB9A 3AFMA 2KB0A 1XCPA 3AR5A 3OZRA 4OP1A 4ZTZB 4BUJA 2QRVA 3DHEA 2G7ZA 5KVVA 5DIZA 1H42A 2P62A 3P9PA 1UKZA 2NTEA 2CNLA 2YFHA 3B9RA 4UDNA 3X1DA 4D80A 3GFRA 5F9MA 1OZFA 2QHXA 1Z74A 1UINA 3KTAB 2ZXUA 3WZLA 3T4UA 2E6UX 4CCYA 1QYRA 4K05A 3K1TA 2NZVG 3O8CA 3B85A 1P4AA 3FCYA 1KI9A 4PG4A 2QVXX 1Y9ZA 3AF0A 3K9NA 2SCUB 1YCFA 5JU6A 4H7JA 1AV7A 3RS5A 3THYB 5EPOA 3AXSA 5THXA 3WL5A 5KQPA 4AJ1A 3BGOS 4DWOA 2BSQA 3I04M 3D8NA 4MUXA 5CLQA 2QA5A 4LXUA 3U6BA 1DQSA 1VE6A 2DJ5A 1L1EA 2DRIA 5JPCA 1QH1A 1L0BA 2Y76A 2I1QA 2NU9A 2P6OA 1MOZA 2Z3WA 5LQSA 2NM0A 3EIEA 3PEVA 2AZMA 1FSGA 3IUPA 3HH8A 5EHNA 3KZOA 1EDZA 4QE3A 4COKA 5IAAA 4KXXA 2P65A 4KDCA 5DTMA 1O94A 3VM6A 3F7MA 5BQXA 1S8FA 4EYQA 3EIOA 2P9GA 1MEEA 1V7PC 2FWIA 4RLHA 4ID3A 4DMMA 4FI3C 4N1AA 2R4UA 2WHRA 1Y1PA 1X7YB 1XTTA 2ZJFA 4MUNA 1JZSA 3CX3A 3E35A 1ZGJA 1E2IA 3R0QA 1CK4A 4PHGA 4FFMA 3TUJC 3BMXA 3BJZA 1TPZA 1QIKA 1NE2A 1HQKA 1BXGB 1WMFA 3MM4A 1UZMA 4IZHA 2I7XA 4RSRA 5KCMA 1QGAA 1E61A 4U7GA 1ZITA 4O4HA 4OLJA 1T1EA 4NCKA 3ANSA 3PEUA 4EPRA 2XPCA 4Z9AA 1GM5A 2LCQA 5IVHA 2JG3A 3U9LA 5BWOA 3BJMA 4LA4A 1JU4A 3C3CA 4IDGA 5J2UF 5JR3A 4PS1A 1OFUA 3DPSA 4PYMA 2WWHA 4YASA 2FPMA 1J23A 5F4BA 3ELUA 5KNDH 4BE9A 4YFVA 2L0XA 2BBTA 1W87A 2VXOA 1ZSYA 1UL1X 3L7IA 4G1UC 4YJ2B 2PL1A 3O1IC 2BTEA 4JHXA 3JQBC 4OAPA 3K8QA 1LNQA 2EGHA 1V8FA 2QEQA 4I4CA 5EINA 1A4UA 3T7EA 1R8QA 1S2NA 3W5HA 2QRMA 1TK9A 3ZY5A 4PO3X 4LJ6A 3RG8A 1M2VB 4RYLA 2GRAA 2M6LA 4GVXA 1VHTA 4WLOA 2AHRA 3H75A 4JBGA 3GAFA 1W5SA 1VLZA 3FROA 3HY6A 3FI9A 4GI5A 4TSFA 3A1FA 5DHAA 2DZDA 3UK0A 4HWSA 3QJ5A 5KYKA 1FFSA 4N9WA 4XYMA 3BE5A 2REXB 4V0SA 1GCGA 4WZAA 1Y5RA 1XP8A 4Y2PA 4CKCB 4GZ6A 1V1RA 1C2YA 1EP1B 1V1MB 5HRAA 4TZ0A 3AI7A 5E6RA 1FDIA 1I2BA 1W4BA 3G88A 1WAMA 1AC5A 3HB4X 3O8OA 4NBTA 5G4LA 2QAJA 3TOVA 1EFRD 1I1HA 3PFKA 2FQ1A 5AI9A 5FQOA 3EWIA 5H70A 1K7YA 5CXSA 3C7KA 3EDYA 3CLTC 4FGSA 4CU5A 2FPIA 5K45A 3GEMA 1ZOSA 4BNLA 2HF2A 3JQDA 2PAAA 4LZPA 4AM8A 2P78A 3C1TA 4EVRA 5HQ3B 1E1NA 5DGIA 4D7AA 2Y99A 4YDHB 4MNTA 3RRJA 4ETNA 4JMLA 3O7MA 4EL0A 4J2TA 4QOSA 4QUJA 5HK9A 1A1VA 2B3TA 2YNMC 4Q21A 1TKAA 1I30A 1M5RA 1VKJA 3WLNA 1ZW6A 4QRDA 4Y67A 3WWOA 1C9YA 4X66B 1BMFD 4DV3B 2CYBA 2O7VA 4ETIA 2HQ1A 3PICA 4QZVA 3JAWB 1JLLA 1DMRA 1WSWA 1YIDA 1HT0A 3I4LA 1WCV1 3RYHA 3ASUA 1TA4A 3CNLA 5CDYA 3FWHA 1Q6YA 3RT9A 4YUYA 4OK6A 3MLEA 2A94A 4MIYA 1GQQA 3IJRA 3RTAA 3UW3A 1WUJS 4LZOA 4PZEA 3ZDQA 2QM8A 2WF5A 4IJQA 4TRNA 3COZA 4ZJZA 1P1RA 3HWX1 1K98A 3KQSA 2CL7X 3IPAA 2GJ9A 1CG6A 3JYOA 2Q9BA 4QGFA 1K8XB 4A73A 3FLAA 3VH2A 2RAVA 1SU6A 3OZGA 2VSFA 5JZBA 2DSTA 3U7RA 1TC2A 1FYEA 1KI3A 3PVCA 1R12A 2IEDA 4J0IA 1VI5A 2LIPA 2QPTA 4GOLD 4G5RA 4PRKA 4PSVA 5JYBA 1FF9A 5L3RA 3OSZA 4REOA 2NNWB 5DEIA 4UHFA 1AX9A 4QU8A 4XUGB 3W5IA 4F3CA 2HRBA 2OBNA 2WTBA 3ZGVA 2WBLC 1A3CA 2P4HX 4X6XA 3VNVA 1GLGA 2OEPA 3HVHA 3I5UA 3K72B 2O5RA 2QDKA 4LXTA 1YD7A 3U4HA 3VSAA 1SB9A 1YOVA 4B2YA 2H9AA 3HABA 4RULA 1UIMA 2Q50A 3OEHA 5HUQA 1DI0A 2BR4A 3HJNA 5J2TB 4X84A 2K2WA 4H1HA 4W9RA 1NJ5A 2O6LA 5K6TA 4ZZIA 1M2GA 2VHWA 3EAFA 3I1FA 4PZZA 1MT3A 1LRJA 4HMQA 1M2FA 1X19A 3GT3A 1XYVA 2W5UA 3ZJ4A 1AHPA 4G0QA 1VLJA 4GX1A 2NQ2C 3EGIA 5CLGA 1LPPA 4UTVA 5JH7A 1M2WA 3DVSX 3EDRA 1NKVA 3O5AA 2E4ZA 4O4IA 1HH4A 3H13A 2VRNA 4C0HA 5BPFA 8AT1A 5K7SA 3AKZA 5C4IA 4L51A 3DBOB 4G24A 3GJ5A 3ZXUB 2YHIA 3R3JA 3G5LA 1D1SA 3IELA 4RY8A 4I14A 2XAAA 3A6HA 4WOCA 3WWZA 5HWSA 4I3FA 2YXBA 2QE7D 3CF6R 3TTYA 4MX8A 4I4NA 3H16A 1JDTA 3P7MA 3GA5A 5WRFA 3FYUA 3RBXA 4JJEA 1PZEA 5HJ5A 2P7IA 1CP2A 1VKHA 2HREA 3G17A 4WW0A 3PKZA 4BKQA 5L4NA 3FPKA 5FAKA 3Q9LA 4N3AA 1QDLB 3ZZTA 3WSVA 3DLHA 3MS4A 2B7LA 2Q4BA 4I1SA 2IVZA 2O0HA 4V38A 4X5OA 2ONZA 4P4LA 1GNPA 2BE7A 1U7ZA 2HWYA 3RFUA 1VJ1A 1NN3A 4H16A 1T8RA 4Z9BA 1JHYA 1QO0A 5F52A 1H3FA 2DWQA 3OWXA 4MVJH 3R8XA 3FFAA 1N36B 1ADJA 2XHZA 3F4BA 2GTHA 2QN8A 4E4YA 4OBWA 3OZBA 4PLZA 5DTQA 4GZ5A 2VBIA 1YTLA 2BDUA 2FSUA 4PCVA 2OP0A 4AXXA 4IXNA 2CFSA 2JJ1A 3U3DA 5IJ9B 3GCDA 1MX9A 4I4TA 1RWNA 3FPSA 4B3MB 1U4NA 4YGXB 3NP7A 4G63A 4TGLA 4K6MA 1CFZA 4Z3KA 2ZSKA 2VJMA 1GAJA 3OWHA 1GQSA 1FFXA 3DE7X 4Q48A 3H1AA 1UWKA 5FOWA 1I8TA 1TA9A 2C4KA 3LFTA 5HG0A 1UJ4A 4E31A 1PS0A 1ARZA 2X7XA 3LX5A 4B4OA 2HC9A 5AVOA 1Y5MA 1OI4A 4D57A 3EQ8A 2PSJA 3KHSA 1TMKA 4TX1A 3P9ZA 3B8EA 3IPRA 2BZ1A 3CLVA 1VCIA 3OE5A 3W7AA 1AHHA 3IKJA 3Q3HA 4E2ZA 4ZHQF 3SN6A 4YY3B 3JR7A 3T34A 2CLHB 4RPLA 1BEZA 3IEUA 5EJMA 4LMAA 1SO8A 3LOQA 1JFFB 1SVWA 2PO5A 3IR5A 2YIMA 1E9BA 4Q82A 1CP3A 1NBMA 1F6BA 3G02A 3QEOA 4I5IA 2ZETA 5JBNA 3GGPA 3NYRA 3LX6A 2JAPA 4YJFB 3KWJA 4H08A 4UM7A 5CVJA 2X1LA 3O47A 2DFLA 4H3VA 1AMOA 3DP7A 3WIOA 1E1CB 2W2KB 1EDBA 4BLVA 2OLKA 1YF3A 4J0DA 1J97A 4C4OA 1W6UA 4JR0A 3H6HA 4KQ2A 1UBNA 4HGRA 1SCUB 3ZU3A 4CF7A 3BERA 3V8VA 1PK8A 2G4VA 2YN4A 3A4VA 4JLKA 3DVAB 4XYBA 2ONJA 2IDJA 1BE0A 1JJBA 2RGWA 2BTOA 3WB1A 4EJ6A 3IPCA 3O1LA 1A69A 1PEYA 1GEEA 1X7WB 2FZVA 3B9BA 2RHDA 4GZ3A 3CIOA 3T41A 3G9TA 4IWNA 4RDCA 4URYR 2CDNA 3E15A 1ZI9A 2JLZA 2Q2WA 3R4CA 4MGEA 1VZ3A 4NFLA 4X54A 1T4MA 2JAWA 2WU0A 5GP1A 3WY9A 2NVBA 4PXSA 1AQ6A 5ER9A 3S2FA 1Z56C 1JG2A 1DJMA 3SDZA 2HWUA 4RVOA 4CQMA 4D1YA 2IYQA 3K3PA 4HAIA 5HOQA 1K7CA 2FRVA 2DP4E 2KPOA 3UC5A 3EXG2 4TQUS 1F3LA 1OSNA 1R7RA 1E5QA 4GNKA 5BV7A 4WEOA 4Y8VA 3KZNA 2J08A 1C14A 1JBKA 2YV2A 3WRYC 1QK5A 1TLTA 1F8UA 3GNQA 3F4KA 1D3AA 3M8KA 4KMMA 1V47A 4ZVVA 2MMCA 3F8TA 4UUMA 3SKYA 3DMTA 1Q0UA 1JPVA 5H9VA 2PJRA 1QIDA 3M2PA 3AVTA 3H1EA 5DOZA 4B9AA 2ES4A 4COOA 2WT8A 4G0ZA 5DBEX 4NJMB 5H16A 5FQNA 1UKEA 2HTEA 3DE0X 2P3LA 2HDNB 3JYQA 3T6KA 1U1CA 1ZD4A 1YUNA 1XZNA 1CRWG 3N74A 4E15A 1RTKA 5FNVA 1OILA 3U1VA 2V6IA 2X0RA 2LUOA 1VL8A 4FCTA 1FX0B 3IMCA 4X92A 4F5DA 5AJTA 2GCNA 4IS3A 4DYVA 3CLUD 4NV0A 4PG6A 5EXXA 5LJLA 1GVNB 5L6MB 4ABTA 1GTL1 3B6ZA 3DEZA 2VTKA 5TF0A 1LTKA 2J0UB 2R1VB 2VG8A 1JJIA 1KFBB 2ZQZA 5JYDA 2X4IA 1N5RA 2MDTA 3JZMA 3LXRA 3QVMA 1NWCA 3JVDA 3QMMA 3TPZA 1CE8B 1JAIA 3QVWA 1DXHA 2R47A 1W76A 1EFCA 3CS3A 1T9BA 2DU8A 3UHJA 1VB3A 3CTMA 3NAGA 2H31A 2WUGA 2XY4A 1H1LA 1CT9A 3OOWA 4M7PA 4R6WA 5HCNA 1N34B 3K4HA 4FOLA 4G4JA 1Z5UA 1CY0A 3IUSA 1QIGA 3L0CA 4DCVA 4CM9D 3GVHA 2PXCA 4DIEA 5LQCA 1X80A 4AECA 1Z26A 2YZNA 4OGLA 4JZYA 4S1TA 4L0CA 1XEWY 1EDDA 3NBAA 1K1EA 1W36C 2H1WA 3CZMA 2FX3A 2ZEJA 1HDYA 2NSHA 2F8SA 1WXDA 2W2LA 2FN9A 4LQ4A 4EGSA 3O4VA 3H18A 3HCFA 1P9OA 3IOBA 4LOHA 4O5AA 1SHJA 3KQOA 4ZRNA 1E8MA 4YP5A 3QQPA 3MWJA 3RIEA 2RAFA 1VPTA 3M83A 5JSZA 2AJTA 3Q2KA 4PYLA 1R5JA 2XDWA 4GP7A 1YL7A 2ZR0A 3JAKB 2C31A 5LA6F 1U5CA 1ZIXA 3CFYA 1RQXA 3BZWA 3BULA 4MEAA 3V3TA 1AGYA 2BP7B 4LF4B 2HX1A 2HADA 3BIXA 3Q7PA 3TECE 2XVAA 4REQB 4GR9A 1SMKA 3RS7A 2OCDA 2XT6A 3ZK9A 2VTBB 2ZJYA 3OLVA 2VF2A 1ZU4A 3CZ9A 5JRJA 2P27A 3L8FA 3ACBA 2GEKA 4RZ2A 3W5AA 1XZAA 4MHTA 1CSEE 4QFDA 4DC0A 4RF4A 2RIPA 4RQTA 1YRAA 4IDHA 3AU9A 1RHKA 2DT8A 1Y5IA 2AG0A 3NIFB 2JGIA 1D6MA 1VE1A 4Y98A 2O6HA 2C92A 3IAAA 3MK31 4FJ0A 4TT3D 3T3DA 2O8DA 1E8NA 1JYEA 1JS1X 2HEGA 3Q7QA 3HFRA 4PLYA 4RA6A 5FLEX 1N75A 2B8EA 3W5UA 4D9NA 4KE6A 3VDQA 1AKYA 3IMFA 1B8OA 3OF3A 3FUUA 1T8SA 5D7BA 1OH6A 4NZYA 3D3KA 3QWFA 3F47A 4LN1A 4XB6B 3FD8A 1KU0A 5EQFA 2Q5JA 4N03A 5CHEA 4OQEA 5SY4A 1OC2A 2WMDA 3E5NA 3KVVA 1UJBA 2IUEA 2JD1A 5TXGA 3EY4A 4TLBA 1GPNA 4D26A 3DMFA 2Q4EA 4O33A 4BO9A 5IT4A 1DRUA 1B0UA 3TOXA 2LKCA 1KHTA 2IY8A 2R3SA 4ND6A 4C7KA 2FDCA 1U94A 4LNUA 3A6DA 4D0RA 4IHQA 4YRBA 2H57A 5AKIA 4Q1EA 2IE0A 2MOKA 1JF8A 3EZ9A 1NQVA 2BFBA 2XW6A 2PIDA 3TEMA 3OPMA 4YRGA 2P2YA 3V4SA 5J4VA 5ICGA 1H3EA 1QFJA 1ABBA 1Q0ZA 4QWWA 3UG7A 1QRTA 3AVVA 1L5WA 1MJFA 4MTCA 3T9FA 5A5EA 1V5IA 2BIFA 2JI4A 4WUVA 5GVSA 1E1RA 3SC2B 3UAXA 3L02A 1GSIA 1UK9A 2G82A 4L28A 4C4RA 4DM3A 2V6GA 1GD1O 5J2TA 2H2WA 1MT0A 3H2ZA 3OSUA 3TLAA 3OECA 3NIWA 5IG2A 3HXMA 1IIRA 1DWOA 1ZH2A 3X3HA 4TMKA 2FMFA 3LK6A 1CQXA 1BDIA 5JANA 2R25B 1HYEA 2PTHA 3K6SB 1KVQA 3ZVRA 1EUYA 2C4HA 4FHCA 3I2KA 2G40A 3T5GA 5A7GA 3WNVA 3BRWA 4M22A 1PJAA 1DC6A 1X3LA 3WL4A 3H5OA 5DNCA 2NV6A 4CXMA 2GKGA 4K6HA 1VIYA 1BJRE 2CNWA 2XUGA 5A3QA 1UDCA 3WVNA 4IZIA 3LW7A 1RT9A 2CLCX 2AQKA 4Q9NA 4C6RA 3M81A 3JZIA 1G17A 4MP6A 5AHOA 5JNRA 3CUTA 4QFCA 1LA2A 2WJAA 5E6SB 3M49A 5H4HA 4CM3A 2O5VA 4HPXB 3O94A 4FS3A 4NH0A 2HFJA 5JEEA 2P67A 1V35A 2EYQA 4FP9A 1II8A 1OVMA 2QG9A 3NATA 3NIBA 4HUQB 1BWQA 3IH5A 3W3ZB 1N9GA 1Y9EA 1EFLA 3IO5A 3SC3A 3E3NA 1P5RA 4JP3A 1KH2A 3LVQE 4OVKA 4EH1A 3PLNA 2VNJA 2XH8A 3K71B 3LQFA 3WTCA 3VMMA 4ER5A 3HSSA 4MVXA 4CNQA 4EKEA 2UZ0A 2Z3ZA 1WQ1R 4EHLA 3BMOA 3LP8A 1RXVA 1K2WA 1CXZA 4MUIA 4URVR 3ZWAA 3ZGZA 2ODWA 3NBYC 4TXMA 4C7OB 2H52A 5BR8B 3D7KA 2WT4A 1D2EA 1EUDA 3UWSA 1I1OA 4Z0TA 4ZK6A 1U5BA 2G72A 1USVA 2JEOA 1XCLA 3NIDB 3T7IA 3LD9A 3BMQB 1VPDA 2FP4B 1PX0A 1D0IA 4H7FA 5KWIA 5B1EA 3EFHA 1M8JA 4X20B 1ENZA 4B8YA 4YT8A 4G0YA 5ADHA 2PUJA 2K2QB 2LIVA 2ORYA 5PGMA 2C2HA 3W1WA 1ZHFA 1YULA 2ZRQA 4ZT6A 1N92A 1QFXA 2Q21A 1EJBA 3CZ5A 5FR2A 3AM1A 2DKFA 3GJRA 4MKRA 3SQXA 4JNKA 3UT5A 1AY0A 4GPZA 5BN4A 5C35A 1QVZA 4QRIA 3M33A 1Q7CA 1FXWF 1Q3TA 2XMSA 4DIKA 3Q5DA 4YQZA 2QSYA 3B89A 5AVWA 4DMKA 5J4YA 1U2GC 1ZM2A 4HXFB 2YZ2A 1O5IA 2A86A 2FF5A 3WJAA 4G1MB 1M7GA 1TM3E 2QMEA 1QQTA 1I7PA 3O82A 2QRNA 3AM4A 5DWVA 1KC1A 4LGCA 2EBHX 3C6QA 3PCRB 2EGUA 1KZ7B 3DW1X 2B1IA 3TTXA 4B31A 2CJWA 2GBLC 4XGRA 5EWLB 4P6VF 1PRYA 3OOHA 4EKDA 1JKJB 2IYRA 3KZ1E 1VG9B 1XZHA 5DXFA 1UCFA 5DO9A 4E2YA 1SUEA 2Y1CA 4BBJA 1JN0A 3QOFA 2IEIA 5EKTA 4ED9A 5AKHA 2LRHA 2QX4A 2VDLB 3IQEA 5BSWA 4M83A 2O20A 3FDZB 5JUWA 2YIJA 3VX3A 2VPIA 1U0TA 1CNMA 4IQ4A 1AF4A 1QV9A 2HH9A 4CDMA 3QFSA 4DSUA 1L4HA 3ZCTA 1JLRA 4LF6B 3W3AD 3ZDDA 4LC1A 2D0DA 5A9SB 2FOIA 1TUIA 2FSSA 2QTLA 2VP6A 3DL2A 5EKXA 3OPXA 2XXAB 4MA4A 3OZSA 2CD9A 4BV3A 2BMWA 3NAZA 2ZIFA 4JC4A 1HMYA 4CMHA 1E2MA 3AR6A 1CRZA 4I46A 4JB0A 2P75A 1Z35A 2DPGA 3M6IA 4RW0A 5FTNA 3LCCA 2YJTD 4DLWA 4YMGA 1ZA1A 2JAOA 5JAOA 3U16A 3UYLA 4FB4A 5FOXA 2GCOB 5J2UB 5AVRA 4AQ7A 1QHEA 2GN4A 1KDZA 4WVLA 4HH1A 2GTIA 3VU0A 1HNNA 2VWQA 2QVLA 3HJAA 2IQ5A 4Q7MB 5CUQA 4F8YA 2AJBA 4R1OA 1HGXA 1NVDA 2OSVA 4YRJA 3MWYW 3QIVA 1RWXA 3LKBA 3P32A 3UWDA 3VTAA 1EXVA 2CVHA 3GT7A 3EYWA 3PGLA 4U00A 4U2EA 1VP3A 1MFZA 4XD2A 4A8JA 4X7PA 1M75A 4ZREA 3D5EA 1Y3BE 1TECE 5K0JA 1WV0A 3I52A 3F2IA 3H9EO 3O9MA 4RKWA 1EGAA 4PG7A 4QODA 5BXQC 2F7SA 1LRKA 5D7NA 4L4SA 1N4DA 1OB5A 2II6A 1Y3AA 3RUEA 2LV8A 1N7HA 1W4ZA 1WQ4A 1ZYUA 4FT4A 4LZNA 3CH5A 4MGHA 3IXLA 3ZY4A 1KEVA 3T7KA 3EVAA 3KOYA 4XWWA 1LC3A 3BXGA 4UHEA 4B87A 1SVNA 3OCCA 4O4HF 2XUHA 2C2WA 1OZHA 4C1NA 1RXWA 3RU9A 2KS6A 2VP0A 4YJ3A 2CKDA 2AOUB 3QPDA 1AK9A 4KQFA 3LCRA 1LX7A 1Z0ZA 2ISSD 4MQ4A 5LOVF 1MH9A 4GLJA 4Z7JA 1XU7A 3LBHA 4B6QA 3IHWA 5AKEA 3RUAA 4QUHA 2RGNA 1JXOA 2CBXA 5G0VA 4ZXFA 1ABEA 1NWHA 3P2YA 1XZQA 1VSVA 3GNTA 1T3GA 1PQUA 1Y33E 2GKSA 1MLDA 3L0PA 4FR5A 4X7BA 4BKUA 5HYVA 1XAHA 4CEHA 2FMXA 3E58A 2OE2A 1TAQA 4D3YA 4K6FA 5EJ8A 1JWBB 4OKIA 2WAAA 4Q01A 1BNCA 5CEEA 3IL2A 3BIOA 1NVXQ 4OHVA 2Y1LA 1OXVA 2FUKA 3DSRA 5EEGA 1KMCA 3P9RA 3QF7A 4ILKA 4CKBA 1CERA 2P2CA 4N3NA 3S3TA 4ENQA 5K8JB 2ZVDA 5F7JA 1TQ6A 2C0QA 4NCBA 1O96A 1Q1NA 2B8JA 3TWOA 3OOSA 4BNDB 5JJBA 3AWDA 4WIAA 3JW8A 1SKBA 3ICEA 2Y93A 3D5TA 3UO8B 3HACA 5CEFA 4WMLA 1I7DA 2OV1A 2QP9X 2OVBA 3NP9A 5JT1A 2FGKA 3OEWA 3IKVA 1DKPA 1TRHA 2NTNA 2Y1FA 3OFSA 5DSZA 1CY7A 1XTRA 3GJSA 2PGOA 1Z0UA 5KDLA 1Y9AA 4LBWA 5LKRA 3AR2A 1TCBA 2WOOA 3BRSA 1H1TA 1K3UB 2WTEA 1KETA 1O8BA 2NZ8A 4GMFA 1FVFA 4C05A 4IGKA 1HDXA 4QGBA 2OXIA 2JIRA 3VC1A 5JARA 2O1XA 2HQBA 1TZBA 5KTYA 3PFBA 5EPUA 2PGDA 1DELA 1FBTA 1U8YA 1XRRA 4MUJA 3KETA 3R5SA 3LH5A 4ESEA 1KVRA 4XWYA 3HL0A 4U5QA 2V3VA 4B0PA 4BQPA 3GGCA 1YS4A 1CZHA 1AA9A 4ZZ3A 4BFTA 5FIUA 1HOTA 1LFAA 1UOEA 1Z08A 1DAKA 4POAA 5ALWA 3R75A 1PJTA 1XV5A 4QARA 3Q11A 4FZVA 3PQ2A 1TYCA 5H4GA 5KNCA 1XMXA 2H3EA 3CF4A 2GILA 4HDNA 4TKVB 5FA6A 2OAP1 3CV3A 4JN6B 4Q9KA 2AA3A 1EB9A 6CHYA 1KIAA 3DMRA 4KYUA 2OHFA 3U3MA 4G8JA 4RD2A 5JSHA 2J7PD 2DWPA 3PU6A 4BASA 3M6VA 3W04A 2B8NA 3MWEB 3OZTA 4MYCA 3ER9A 3IE0A 5D5PA 4PC3A 4WACA 3LY5A 4N5IX 4AZVA 5HW0A 5K99A 1P1HA 4JT2A 1I1NA 1ECJA 4Z54A 1GNLA 1ZN8A 4XFKA 3KT3A 3OE4A 4Q7QA 3D8RA 4BGUA 1E9FA 1KO7A 2RCNA 2QRGA 1G0OA 2YY7A 3F9RA 3ILHA 3KKQA 3FUWA 5JEDA 1L5KA 2XJ4A 1LBSA 2X2EA 1Y48E 3EOAI 3WGYA 1MA0A 2XYGA 2X0IA 1ILEA 2A9RA 5BYJA 5CG1A 3K6KA 5DBGA 2NU7A 5EWJA 5HF9A 3ROXA 5CB4A 4X8OA 2IXDA 1TM1E 3MCAA 2QQEA 4WCFA 1P45A 1YA4A 4KXYA 1QLWA 1PWYE 1I80A 2H9IA 4QQNA 5E6UB 3U4QA 4JV5B 2ZS7A 3KD2A 5JDIC 4ISBA 3MOGA 4QUKA 1X39A 2BLNA 2FN4A 2IHKA 1IJBA 3AV3A 4B6RA 1A2OA 1G5HA 4NICA 2ACVA 2GFIA 3WQBA 2PKYX 4JQOA 3HJBA 2C2GA 4O4IF 4JVSB 1UBJS 3RS0A 1OBHA 1SHLA 2ZBEA 1Z4IA 1CRPA 3UCEA 1QHHB 2ODBA 3KDPA 3RVMA 4B4UA 4EW2A 1RJ9A 3OG9A 1CDDA 2C98A 3LQ4A 3L7JA 3P19A 2A7XA 2FR1A 1D5CA 4MGYR 5C2JB 1JEQA 2QTZA 3FPGA 1EFKA 4LSZA 2GPYA 1VKRA 2R8OA 3I64A 3KKMA 1NM5A 1ZJYA 2CHEA 2JFWA 4KZPA 4F9TA 5C32A 2AXPA 2R2AA 3N2GA 4J29A 2EG5A 5G0WA 5GV7A 1EP3B 4CN8A 1NRIA 2HJGA 5JS1A 1OH5A 1V5WA 1JJFA 1TCAA 3CW8X 4LWPA 4TN1A 3RAJA 2FFQA 4CG0A 4ZHQB 4WXPA 1ZUIA 4G86A 3U44B 1Y7LA 2VHXA 3M3DA 5GZ3A 1YR6A 2AD1A 1HQDA 1YJCA 4U2CA 3HYTA 4PR3A 3C43A 4H0FA 1Z83A 3QUBA 4U7WA 4U7FA 4YRAA 1GEGA 3WL6A 1FNDA 3JVEA 4O2BA 3RYFB 3S8EA 2I3BA 4CQJA 4N6NA 5CVDA 1CQIA 5DK6A 3FYSA 5IK2D 1G8AA 1YT5A 4RJTA 3S55A 1S6YA 3LO5A 1SVOA 4B6FA 4I4TF 5I01A 2IPMA 3WADA 1SZDA 2DF8A 3A2NA 3SQMA 4TZKA 1OH7A 2OL4A 1J0XO 3OM1A 2JFFA 4R0NA 4AX8A 4Q03A 3WWCA 3UJAA 4B6JA 1T91A 1R6UA 2JATA 3L04A 4G89A 1WEKA 2ZYIA 3SBXA 4XRGA 3KQLA 3WJ7A 3GRRA 3V1KA 3Q3VA 1Z82A 2CN1A 3GF4A 3KB2A 3L7CA 1QH9A 1GTMA 3D81A 3GNLA 5C53B 3TJRA 2YZMA 1YCDA 1W44A 3ZHYA 2PZBA 2FG6C 1M10A 2QXYA 3G8AA 2JL1A 4WN9A 2WG1A 4OCZA 3ZZMA 4EK9A 2YOFA 1N6HA 2FQYA 4YLEA 1GPLA 5K8IA 1ZJ4A 1QQ7A 5GJBA 4F72A 2YWBA 2QTNA 1U9IA 4FT2A 4NNJA 1CUFA 5D8DA 1O0CA 4Y6QA 1UBUS 1CIPA 4P31A 1FRFS 3RIYA 1L8XA 1LK0A 2OHVA 4R2IA 2TMYA 2P2ZA 1NGSA 2HXSA 5JFOA 1XNJA 2CVZA 5HDBB 3ZUGA 3DT8A 4J16A 1QG6A 1E98A 2GEBA 2IUYA 2WYUA 4I1IA 2OBXA 4AKSA 3DR5A 3O8BA 2HA0A 1QCYA 3FKSA 3PV0A 5KOIA 1NX9A 2OB2A 1ETUA 3WMEA 4RTOA 1OREA 4K9RA 3H19A 3PWSA 1W1WA 1FRQA 2WV9A 2TECE 1QQ5A 2ZLBA 4R69A 3F90A 2OFOA 3DHNA 1GKLA 3LHSA 1X6VA 1G41A 4ITUA 1XPRA 3D0OA 1ZM7A 3KLBA 1BH6A 1NXSA 3KUXA 3MELA 2I34A 4LYAA 4ZVTA 4ZCLA 4C3ZA 2P8SA 1CUGA 3B5JA 2I4LA 3A05A 1W5BA 4KIUA 5A4KA 3SVLA 5CDSA 1TAHA 2FX5A 2I2CA 4PM4A 4S2UA 4ZDWA 4O25A 1RAHA 2PQ2A 3TEFA 1LTQA 1QO7A 2BEWB 2F64A 1IBRA 3CRRA 3CPEA 4AS1A 4WSOA 3P2JA 3RNLA 2HXGA 1U7WA 3G79A 3OIUA 3ROZA 3KYDA 3MYYA 3L4JA 1JR4A 2PUCA 5JAHA 1D2MA 3G2JA 4EB8A 5KKCA 3IQDB 4ZQHA 1JI0A 3BRQA 4PQRA 1Z88A 4IVPA 3WGIA 4PYOA 2H18A 1YH3A 5JS8A 5IBRA 3VR1A 4DCMA 2ESRA 4U7TB 4CL0A 2J0SA 1ZD3A 1P0CA 3F6PA 2QUAA 3FPLA 3M9WA 4ARUA 2WSSD 3A1TA 3MWDB 3RHSA 1I2CA 5FXMA 4DZZA 1P5FA 4DV6B 1Z3CA 1RSZA 1NY6A 3DKIA 3ADCA 1FFCA 2ZRPA 1K88A 2FSPA 1EFHA 4PYNA 4LF5B 4Y2RA 1S1MA 5FNVF 4K81B 4Q4LA 4RTNA 1U81A 1MG0A 4QATA 1KQPA 4W6ZA 3VSBA 4AY4A 4DBLC 4X62B 1CU1A 3UOGA 4KUEA 1SOAA 1W88B 4K0RA 2V4MA 1PCXA 4O0LA 2M98A 1VG0B 5YASA 2AHOA 3CCFA 5TJ9A 4POOA 4K8OA 1J56A 1YQ9A 1EVZA 4LBVA 4OB8A 1O9GA 3ZDFA 1HE4A 2IX3A 4HAWA 4IH9A 1CZKA 4UREA 1QR2A 2G25A 5JNVA 3HP1A 2QIOA 1OASA 3OQVA 4C0SA 1W6RA 2A0XA 1SAYA 3TD9A 3FJ1A 5I8PA 1UJMA 2WD7A 1EQ2A 3TKYA 5KJ6A 3OQNA 4QPNA 1KWGA 3RG2A 5EJ4A 5GWXA 4JBHA 5B1HA 2GESA 1GR1A 3SKXA 2YV4A 4MR9A 1Q1EA 2RBKA 1Z68A 2E49A 1TADA 1T8TA 2DTDA 3LQ1A 4UU1A 3HDVA 4B35A 3AXTA 2VSOA 5AM2A 2W6ZA 4G2NA 2ZQYA 4FOOA 2VPPA 3RS4A 4NJOA 3U39A 4E51A 5KKNB 3PIDA 1NBOA 2P2SA 4LCBA 3CB4A 5I7OA 2ZBGA 4D0LB 3FOAA 4IGFA 3A4NA 4C2BA 3W7BA 3LKZA 2JI7A 3VO9A 1F6DA 1QK3A 4AMUA 5TS3A 3AF2A 2VAVA 4HGPA 5B58C 1T3TA 1WOMA 3K5IA 4S2EA 4DDHA 2ERXA 3H1FA 4YRTA 2FWMX 4EECA 1ODTC 1XZIA 5J59A 4KFCA 1Z4LA 1NR1A 3VZPA 1V6SA 2ZCVA 3U7GA 1JU9A 2GO7A 3NVKI 3BWEA 2DBRA 3RU7A 2EQ5A 4J49A 2D59A 4N3CA 3VU3A 1FP4A 3AP2A 3VJKA 3AVOA 3DB1A 5ALQA 1PDWA 2D0PB 3IOYA 4NBVA 1VYVA 4Q93A 2QLLA 1TW2A 2IYUA 3AYZB 3D6HA 1FUUA 2XBUA 1T2CA 1PJ3A 3H9QA 4M6WB 1FUKA 4OXXA 2H07A 2YWCA 3KSMA 3ORSA 4ME6A 2GA9A 5FHQA 3U60B 3CBGA 1RCUA 2WKQA 1L5HB 3B3QA 2RGYA 2P9BA 3GXOA 3LRXA 3OY2A 4P4SA 5CYFA 5LZ8A 2VDNB 5EHZA 4IAOA 5JCJD 1QYIA 4L16A 4ZN6A 1W2GA 1J24A 5LYJA 3MQ4A 2VJNA 2CFTA 1XGKA 5DLYA 5F9HA 2C95A 4B7AA 2P2LA 3PJRA 2W4MA 2C20A 3WRXC 2BM0A 2GAFA 2E87A 4BUZA 2PBRA 4DRXA 3DDCA 4MUEA 4RIEA 3TL3A 1O97C 1RJWA 4RCVA 3URKA 3J81k 2ZZMA 3X1ZA 2OM6A 1BVRA 1ZW1A 3A3OA 3L7LA 4YV2A 4JX9A 1GTVA 3FFXA 3EIUA 2X4DA 4L5AA 1XKLA 3LBNA 4BNJA 1PZMA 2JGFA 3EGWA 4F8EA 3PI7A 1QFZA 3PL1A 4ZQEA 4YP9A 2WW8A 3FZGA 3JQ9A 1NBEA 2PGJA 2RHRA 3IIKA 3SBEA 4JOCA 2DHDA 4PG8A 1FUYB 4G0NA 3ZCSA 1QHGA 1V16A 3UXMA 1YB6A 1ZX1A 4YMHA 5B1IA 4CEIA 1AS2A 2JFZA 3VPDA 4A36A 4RMHA 2YASA 2NZWA 3ZBQA 1FBNA 4YDRA 3CZPA 1UAYA 4ZO8A 1IZ0A 2F1RA 1MO5A 1YE8A 4MW7A 2OBYA 2WP8J 3ABOB 3HPRA 1BA3A 4FOPA 2JFHA 5FWYA 1KI6A 1N33B 1LDYA 1IM5A 2J9ZB 3V97A 1LQTA 7AT1A 4GPAA 3QEMB 3I2GA 3ZTTA 1XKTA 3I5YA 2Q4DA 4HLQB 3UA4A 2YYSA 4HZIA 1OUMA 1OXSC 1XU4A 1AZLA 3MGKA 3SLKA 5CDTA 1IBKB 1IN6A 2GDZA 3NLLA 4HRAA 4TS3A 3GJZA 1QS0B 1CNEA 4W99A 2RIRA 3PXCX 4DNOA 5KYNA