5IFKA

Purine nucleoside phosphorylase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
302
structure length
295
Chain Sequence
DINEQRALIKSAHRYISEKLEDHFSSEFLPKALVICGSGLSGISTKIADEPKPLILSYSTIPGFKVGELIFGYMNGAPVVLMNGRLHSYEGHSLAETVHPIRALHLLGSINVLIVTNAAGGINASFKAGDLMCVYDHINFPGLCGFHPLRGANFDEFGPRFLATSDAYDLELRKLLFSKKKELNIERKIHEGTYSYVHGPTFESRAESRFLRLAGTDAVGMSTVPEVVTARHCGWRVLALSLITNECVVDPPASAHDENPVPIQEGKATHEEVLENSAKASKDVQELIFSVVAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Functional and Structural Characterization of Purine Nucleoside Phosphorylase from Kluyveromyces lactis and Its Potential Applications in Reducing Purine Content in Food
pubmed doi rcsb
source organism Kluyveromyces lactis (strain atcc 8585 / cbs 2359 / dsm 70799 / nbrc 1267 / nrrl
molecule tags Transferase
total genus 92
structure length 295
sequence length 302
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ifkA00
2H8GA 1Y1RA 3GB9A 3NM5A 1Y1TA 4OJTA 1VHWA 4G41A 3NM6B 1JDVA 4M3NA 2RJ3A 1T0UA 1U1EA 2HSWA 2ISCA 1U1DA 4L5YA 2ON6A 4F2WA 4NS1A 4LZWA 4H1TA 1TCVA 4PNPA 5F7ZA 4QATA 1PW7A 1OTXA 1TD1A 2P4SA 4P54A 3INYA 4G8JA 4MCHA 4L6IA 1RT9A 1Y6RA 3KVRA 1TGYA 3OZDA 5EUBA 3K8OE 5CXQA 4OGKA 3ENZA 2QSUA 1Z38A 4K6OA 3FB1A 4R2XA 4BMYA 2BSXA 1U1CA 4TXMA 1VFNA 5F77A 1FXUA 5EFOA 2XRFA 4JOSA 1Q1GA 1A9QA 2OC9A 4NY1A 3F8WA 1PKEA 3NBQA 4OEHA 1Y1SA 3OF3A 4OY3A 5ETJA 3KHSA 1PR2A 3FUCA 3OCCA 1Y1QA 1JYSA 1RSZA 4DANA 1Z5PA 4L0MA 4MCIA 5JPCA 2I4TA 1U1FA 5I3CA 2PGAA 4L5CA 5K1ZA 3IOMA 1JE0A 3FNQA 1TGVA 3FWPA 1A9SA 1U1GA 5F7XA 4F3KA 4YNBA 5FAKA 2GUWA 4EB8A 4LNAA 3BJEA 1Z35A 1LVUA 4TXJA 3D1VA 1ULBA 3KVYA 3K8QA 4NSNA 5CCDA 4ECEA 4D9HA 1T8YA 1SD1A 4DAOA 1TCUA 4QASA 2A0XA 3IEXA 4FFSA 2I8AA 4DA7A 4EARA 4L5AA 1NC3A 5B7GA 2QPLA 2QDKA 4TXNA 4GKAA 1WTAA 3OZBA 1LV8A 4QFBA 1PBNA 4G89A 1B8OA 1T8WA 2HN9A 1C3XA 3UAZA 1PK7A 1PWYE 5CXSA 4YMLA 5CYFA 4M7WA 3UT6A 4DA8A 1Z5OA 1RXSA 1PR0A 4GLJA 5B7PA 1JP7A 1LX7A 4WKOA 4U2KA 1A9OA 3QPBA 1K27A 1A9TA 4X24A 5CYGA 1SJ9A 4WKPA 4R2WA 1RR6A 3DDOA 3OZEA 4TTAA 3P0FA 4YJKA 1PR6A 3OPVA 1JDSA 1N3IA 4OF4A 1V41E 5IU6A 1A9RA 3LBAA 5C80A 1YQUA 5F7OA 3EUFA 4KN5A 2A8YA 2AI2A 4F1WA 4DA0A 4LKRA 1Z39A 1YBFA 2B94A 1ZOSA 1T8RA 3C74A 2IQ5A 4TXLA 3MB8A 4I2VA 1RYZA 1NC1A 1CB0A 5F7JA 3T94A 3FOWA 2QTTA 2OECA 3DP9A 4WKBA 1ULAA 4BN0A 3GGSA 4M1EA 1YRYE 2AC7A 4TS3A 4TXHA 3LGSA 1Z37A 5F73A 1ZL2A 1I80A 4DAEA 3E9RA 5CCEA 4LNHA 4PR3A 4D8XA 3PNPA 3OZCA 4OGLA 4QEZA 4D98A 4D8VA 1V2HE 3KU4A 3U40A 3PHCA 3DPSA 1Y6QA 3BGSA 3O4VA 3KVVA 3DJFA 3PNSA 3EUEA 5KB3A 4R31A 2OC4A 1OU4A 1ODKA 4BMZA 3KUKA 1Z33A 3UAXA 1Z5NA 4DA6A 3OOHA 1OVGA 4TTIA 1SQ6A 2A0WA 1RCTE 4LDNA 1OTYA 3TL6A 4F2PA 1XE3A 5IFKA 2A0YA 1JDTA 4DABA 1A9PA 1RXUA 1M73E 3O6VA 4UC0A 3UAYA 3UAVA 4DARA 2HRDA 3E0QA 1A69A 5B7QA 1ODJA 1V3QE 1T8SA 1JE1A 1YR3A 3BL6A 1RXYA 3FAZA 4BMXA 3MMSA 4E1VA 4WKCA 3EEIA 3BSFA 1VMKA 3ODGA 1VHJA 1Z36A 1ECPA 2AI1A 2Q7OE 1OV6A 4TYMA 1K9SA 3EMVA 2AI3A 1V45E 1Z34A 1ODLA 4MARA 4TTJA 3PHBE 1PF7E 3P0EA 1QE5A 1B8NA 3DF9A 5EPUA 3NM4A 1JPVA 1G2OA 3LA8A 4WKNA 3E9ZA 1JDUA 4RJ2A 4YO8A 1PK9A 1PR1A 4D8YA 5B7NA 1ODIA 1RFGE 3SCZA 2HWUA 2OXFA 4IP0A 3ONVA 4QAQA 4JP5A 3UAWA 4GMHA 1SD2A 1CG6A 4JWTA 4F3CA 1PR4A 4QARA 1NW4A 1JDZA 3OOEA 4TS9A 5DK6A 2QTGA 1OUMA 1PR5A 1V48A 1K3FA 1YQQA 5F78A 4GLFA 5F76A 1V4NA 1RXCA
chains in the Genus database with same CATH superfamily
2O2GA 1LNQA 3TBFA 2WUEA 4RW0A 4XEUA 1BZYA 3MJ4A 1KK1A 4GXTA 2FPPA 3AIMA 3KYJB 2QP9X 3FRHA 4LTMA 2I7XA 4UEJA 4EQ6B 2V5VA 1B0ZA 3CURA 3JR3A 1Z4KA 3G2QA 2A0KA 4UUQA 4ZYWA 3WGHA 4LF7B 1KRXA 2QD4A 3RC2A 3SU8A 2EFYA 3RVRA 3V8VA 1TEHA 5IWCA 1G7RA 2VHXA 4XZ3A 5IJAA 3HY4A 5CHEA 4ZEXA 5LB2A 2GLTA 4UMEA 4NMXB 1VJ0A 4KDRA 4YX9A 2RCNA 2OHXA 2XUHA 1CR2A 2HH9A 4Z8YA 3L6RA 2HSEA 5AESA 2J30A 2KX7A 2WIFA 1WNTA 1E1RD 4DXHA 4BCCA 2IKSA 1JEJA 1D2NA 4G1VA 4DG5A 1ZH2A 4IVQA 3IODA 4MPRA 2VKTA 2WAAA 1HPLA 3PHLA 1OT3A 5JZOA 4XCQA 5DRYA 3T38A 3KQLA 3MM4A 3ZX5A 1BVHA 4F9GA 2JLRA 3G9XA 1EVEA 3CZCA 2PMCA 4II2A 1H0RA 5FA6A 3V1KA 2VTVA 4Y6RA 3Q3CA 1LPAB 4TTQA 3RUFA 4C5AA 3V2IA 1C1DA 2AN1A 3IDAA 5L3SA 2B3TA 4JLJA 1PR3A 3S40A 3JSAA 2QRUA 1K08A 4EMSA 2GDJA 1Y6RA 3KAKA 1CQIA 4YP7A 4AS3A 3EWSA 4L76A 4NCBA 1HL3A 1G66A 1KBOA 1RLOA 4IZHA 4QNNA 2XKAA 1A98A 4Z2AA 3S8YA 1Z38A 3HVRA 4AUNA 3UXEA 1FBTA 3CTMA 2EDCA 3LPMA 5DNYB 2QMYA 4OK5A 3D5EA 1WVIA 2BUBA 4M9RA 3SF0A 1XVLA 2V45A 3GPIA 3ND6A 4G5YA 5KYWA 4RL4A 1C1HA 1KQ3A 5DMHA 1NFRA 2PGDA 3UMYA 4IO1A 5FI1B 4FZVA 3GJZA 3UOAB 1ETHA 1XJQA 3SZRA 1QYCA 3O4FA 1G9XA 4X5OA 3ONNA 4BNTA 4D4JA 5GZ6A 4HNTA 2PS9A 1GPAA 4IUBS 4KAAA 3Q6MA 4MPJA 1R37A 3VPHA 4EZBA 3U9LA 1I3NA 2B8TA 4W6QA 5ENVA 1ISPA 2R7KA 1W6UA 4JMLA 4LPSA 5FORA 1YJ5A 2AG8A 4PF1A 3LO8A 5TGTA 3KTDA 1KSFX 1QPGA 1TVCA 2PWYA 2Z4TA 2ZTLA 3JPYA 4FHCA 5A0FA 3K35A 4AB1A 5EHXA 2JLUA 3NMUF 1DEKA 1W5FA 2QVLA 1T9DA 4UHJA 5JO9A 5FULA 1MQAA 3GDGA 5TXGA 1IY0A 2EFCB 3R5FA 1G2QA 2IDMA 2EF1A 4DG8A 3IUYA 4N3NA 2CVOA 4ID3A 5A4AA 4L8VA 5D85A 2OHOA 1U0JA 4ICIA 4JA0A 4YJ3F 5LP6C 4GYWA 5CT5A 1B93A 1FMFA 1SC9A 4JR2A 1W4AA 1NLFA 4FT4A 3LWDA 1TF5A 4PZDA 4RA9A 3OTIA 5I7AA 4CF3A 5JNTA 6REQB 2IITA 5BUQA 3GJ0A 1PS8A 1RWNA 1UT5A 1A1SA 3H97A 3GP3A 4P84A 2OM6A 1S8OA 4Y9RA 1C0LA 3TJMA 3ICVA 2XMQA 3QVVA 3IAM1 1IN5A 3HB7A 1XZ8A 1ZGCA 2PKQP 3GYGA 2PUAA 4QBIA 4KWEA 3DB1A 4A7PA 3VO1A 4ZVOA 4NZZA 3STYA 5A06A 4YUAA 1R3DA 4ZGBA 4JOBA 3PD0A 3ZWBA 4PLGA 4XYEA 3DOOA 5F21A 5HRUA 4P4SB 1GU0A 2VP4A 1YZHA 4WFKA 2P6NA 3BWVA 1ENPA 3GFOA 4IWXA 3S2EA 5I51A 1MIOB 4OI4A 5I3CA 1UJ2A 3PDIA 4RGYA 4ZZ2A 3IOMA 4Y98A 2IZ6A 4P31A 5DBEX 5ECGC 2VBGA 3DMFA 5I7SA 1B00A 2YWRA 2IYLD 3MCWA 1KI6A 3GK3A 3QTBA 3MMPA 1KVRA 3MOGA 4XEHA 3TQHA 3T1HB 3KTOA 2ZB4A 1BOOA 2BKVA 3AEUA 3QYFA 4ID9A 5H16A 4EL0A 4F6RB 2DUUA 1G5IA 2BMWA 2FW9A 2G06A 4J7UA 5KOYA 1QAQA 2C2GA 3BFJA 1VSQA 1OGJA 1R6XA 3ZY2A 2ZAYA 3PI6A 4K6KA 4P5DA 4YAKA 2HSZA 3QNUA 2YJNA 2XGMA 1T9CA 1KAMA 2YYAA 3VU9A 5CEJA 3MQ2A 2JZCA 1H2WA 1EFVB 4MB6A 1XPUA 1MF7A 2P4UA 1C30B 2QYOA 2D06A 5AJZA 1MVOA 2FXIA 1H1LA 3FYUC 1CEQA 4ZAVA 1TRHA 2PD4A 3KVYA 5FAXA 2B0JA 5KNBD 2JGFA 4DSAA 1QS0A 1VZ3A 1X1QA 2FLVA 3PX2A 3W4JA 3KZNA 4MQEA 1Z0ZA 2P27A 2VXYA 3A1EA 4JUIA 4YAEA 3IE1A 4LYDA 4N6NA 4G56A 4YUZA 1QP7A 2G5PA 3PQDA 4YCDA 4DR7B 2G88A 4YY3B 1TVMA 3WZMA 5J58A 2V6JA 4G1BA 1OGIA 3E53A 1LLFA 4ARCA 5KYYB 2HIHA 2JVIA 1NKSA 1EGVB 1ZGGA 4C4OA 1QG0A 1AK2A 5M2QA 4KXWA 4US1R 4LVCA 4HDQB 3IOYA 4EARA 3L0ZA 2TMYA 3WISA 1NC3A 1RKQA 3FNHA 1Z0JA 4K9LA 2RHOA 2ZTSA 3JVDA 1V6SA 3KSDO 4G0OA 3SZGA 3ZWAA 4BKMA 4YV7A 1YOVB 2KLBA 4GKAA 4WERA 4D3YA 4I3GA 5KYKA 2D5IA 2FSPA 4XCVA 3SFTA 3T1NA 4PSUA 1PBNA 3DAOA 3WGNA 1N5OX 1P4HA 2J3EA 5P8WA 4RM2A 1DKRA 3AERB 3FHOA 1ZKMA 1LDBA 3PXXA 5IVDA 2OPBA 4NIMA 1BWPA 1OFUA 5EERA 4LCJA 1IVSA 2JCSA 2NZ8A 3IHWA 4QYIA 1HDIA 4ETIA 5I3ZA 1A9XA 3LT4A 1NP3A 3VTKA 1L2TA 5IYZB 2JJ1A 4NG4A 3VYRB 3ASZA 1X80A 3HRKA 4J3JA 1BGWA 4N8SA 4TYWA 2WNHA 4GOKA 3K0KA 4R1QA 4XRRA 3TXXA 1RYFA 1XEXB 2RGNA 3H7IA 4CW7A 2PCLA 3OX4A 2IPMA 4NG5A 2J4DA 2XT0A 5CIWA 5AW2A 4PZLA 4BNNA 5FH9A 4PZPA 2CZQA 1UOEA 1JR2A 2W2KB 3H2JA 1WPGA 4P7FA 4R3WA 2VJDA 1E0KA 1Q91A 1S4MA 2W8BB 1MRNA 4CMHA 2EVWX 4E6EA 1WA5A 3ADOA 1U6KA 3E1SA 4YAJA 3TXAA 2Y0DA 1P4GA 3FWYA 2H0RA 4YJKA 3CZAA 5EUMA 4DGQA 3UJNA 1NHWA 1TX4B 4LBVA 1NX6A 1RHUA 2AR7A 3KDAA 3KVNA 1R9JA 2IXGA 3MZ0A 4ESEA 5C81A 1ISFA 4X54A 5AKYA 2G0AA 3SZOA 4JJKA 3ZW8A 1MB2A 4NMHA 2E48A 3RO7A 1GN8A 4OX9Y 1EI9A 2M6LA 4ER5A 1QX4A 4RIEA 5EINA 5GVRA 3MUOA 3VDXA 2WJJA 5BVGB 1EQUA 4ALKA 3A8TA 2I2DA 4UUPA 1PWXA 4PZUA 3UMRA 4PRLA 3I5AA 3VPBA 2WJ3A 1XDZA 3FPBA 3IQFA 3KLBA 3MJVA 4CG3A 3PB3A 3IOCA 5LXTA 1GTSA 3EQ2A 2ZYTX 2BN4A 4DV2B 3EZFA 3CRNA 1ULHA 2MYUA 2J33A 4C0XA 3UQZA 4QECA 1Z4MA 4RY9A 3RU9A 2C2OA 1U5AA 4P38A 3M2PA 4PYKA 3NHRA 4RFVA 3TIVA 4LOLA 2X4IA 3PIIA 4XJXA 3V7YA 3EPHA 1EAYA 2ECQA 4CFYA 4L4UA 3KZ1E 2WSYB 4MAMA 2ZIZA 4UNSA 4MHSA 1A82A 3TX2A 4EAQA 3THWA 5F9FA 5ERYA 4KVGA 1KL7A 3SXUA 4IVNA 4U7DA 1E1LA 1PFKA 3HVJA 3QW4B 4RBNA 2Q5CA 4FFBB 4X1KB 4NABA 1T29A 4WHMA 4YVFA 2QUZA 3RGWS 3SYNA 4EMBA 3T1OA 1OI2A 2IDJA 1Y9DA 4E5NA 2GXAA 1SY7A 3GA0A 2H2FA 2RK6A 1T1JA 5JEDA 3DMTA 1SG6A 4YMTA 5EPEA 3NASA 3TB4A 4BO6A 3VR0A 2CY0A 2P41A 4JX9A 2A9VA 3RFTA 1HNZB 4Q4LA 4YO7A 1NXXA 1WOYA 2V7PA 3RWMB 5MN5A 1N1GA 3SC3A 1SPXA 3WYNA 5KYVA 1F0PA 5FFNA 2MSEB 1WW2A 3VR6A 3D4BA 1TVKA 4LJ4A 2XE4A 4HI0E 4RMHA 4Y6SA 2G9NA 1GG8A 3TE6A 4BQQA 4YFYA 5K6AA 4HWKA 2Q5EA 5LZ9A 1P1IA 1Y4SA 1OVMA 2DF8A 1I2CA 4OXRA 5AI5A 5EMNA 5F2KA 3ZXUB 1Y6QA 4F2GA 4DSTA 3BGSA 3BDVA 4G5GA 1Q92A 2LPMA 2MYTA 1N5RA 1SHJA 5ALFA 5THXA 3WMEA 4TV8F 2VDMB 4XLTA 2H92A 4YCMA 4O1HA 5H4GA 1BDIA 3GLHE 3L9XA 1DARA 3UCEA 5LZ2A 4H18A 3AUSA 4GEKA 4QLOA 1BW9B 3HCCA 1E6UA 5HOEA 4E88A 4Q9AA 2AFIA 1ABBA 3SMVA 3HJNA 2AOVA 3I4LA 1O9BA 1O94D 4ZAWA 1O58A 2ICAA 2IYVA 1ELOA 5D1HA 3WYDA 2O23A 4A8HA 5EZYA 4DZTA 3BG5A 3DAYA 2XOEA 4Q03A 1S2MA 4DR1B 3U7RA 2ZJ5A 3CUSA 4NQRA 1ZGZA 4E2FA 2GZRA 3TDNA 3J81A 4ZI5A 4UM7A 1BVYF 3AF4A 3TFOA 1FFHA 4K0RA 1C14A 4WCVA 4ZAYA 1QTNA 1WOMA 3AGPA 1E58A 2ZU0C 4NFYA 2P79A 3AV3A 3KQSA 4JP3A 2YOHA 4MV9A 5B6JA 4DM4A 2C03A 1G60A 4HNSA 1X1TA 3KHUA 2X86A 2YMLA 1EE9A 1WUTA 4MQ6A 4DRZA 4XRGA 4XSVA 3L1VA 4LZAA 3ROQA 3TPZA 2OORA 3PD7A 3W5VA 3R3YA 3EGEA 3FGZA 3MTAA 5FD8A 3CCCA 5CB4B 3B36A 4Z4QA 1PS9A 4JNCA 1S2NA 3DC7A 2A78A 1WRBA 1C4XA 3IALA 1F8XA 1T5OA 3DVRX 5ICFA 1J7JA 4G4SP 3TW6A 2MYPA 2QJRA 2CVQA 1C5KA 2XB9A 4RCYA 1DU4A 5AJXA 2I6UA 5CFNA 3K6RA 1XMXA 3SKYA 1TW2A 5KZMB 3FAZA 5B2FA 5JTTA 3PWSA 2AJLI 3CWZA 4YRJA 3LT1A 4OQLA 1KO4A 1DJNA 1NW7A 3AZPA 4YRTA 4M53A 3SM3A 1JIKA 4IHJB 2HHAA 3W9UA 3DCYA 1E1CB 5TMBA 4OKNA 1EDOA 1EHCA 1VSVA 3LOUA 3VJMA 3W4IA 2AEMA 2ZBFA 2H7CA 4F3YA 4YT4A 1UFRA 1O0CA 4GNRA 3JQBC 4P93A 2NV2B 4UQPA 1T13A 4EY7A 1P62B 4HOYA 2JGDA 2G1UA 2Q07A 2BMVA 2VQ3A 3K5PA 2FW6A 2I4MA 4C6TB 5TJ9A 1U8YA 2XXJA 2R86A 2C3YA 4OHCA 1ST3A 4FLFA 4BO8A 4BB0A 2XVYA 1XJ0A 1RWMA 2PZKA 4R41A 3UG7A 3EDMA 1CNMA 1VHQA 4RQAA 4DYHA 3AMVA 4WVFA 1P73A 2WI8A 1GQQA 3DT9A 1WB9A 2C2ZA 3FY4A 3NRJA 4MKRA 1XCLA 3CVUA 1Y5LA 4ND8A 1R4NA 4M0FA 4YGXB 4YHBA 3X2FA 4C21A 4MDEA 3ZE9A 4YJGA 1R8XA 1X7ZA 1JR6A 5AW1A 3DBRB 1G2OA 4KIJA 3EOAI 4NJOA 3TGLA 2BM8A 2VTKA 1UBCA 4MQLA 4TVKA 1KU0A 2IXAA 2X0IA 3M0EA 3KR9A 2QUHA 5AW3A 4YO8A 1HEYA 1RWOA 5AW6A 2GNPA 2Q7DA 4BGEA 5HXAA 4K9DA 1E5XA 1SCQA 1IJFA 1GNLA 1JBEA 1QYDA 4IYRA 4OMFG 5DFAA 5DU2A 3T3MB 5GTDA 1QFMA 5JHGB 1FSPA 1JECA 1MGOA 4HXEB 4R0NA 3KOOA 5KDLA 3TDMA 1Z73A 1TAHA 5KCZA 2HWUA 2DBRA 1YRBA 3FAKA 2J0UB 2H59A 3LT5A 1UXKA 2BEUB 3OFND 2RBEA 4HQLA 4IP0A 3DBLA 3Q7TA 4Q3EA 4EG7A 2IPOA 1GL3A 4EUKA 4GMDA 4JP5A 2GSWA 2RC6A 1HQKA 5A0VA 3QVLA 3NKFA 4W9NA 5A4IS 2CWWA 3FMIA 1SK8A 3GF4A 5CT4A 3X1MA 4W1QA 4BX3A 1IBLB 3KR1A 4PG6A 5GGXA 2DPLA 4F3CA 3K3PA 1JKJA 2GPAA 4YQZA 1WD7A 1F0KA 4LHYA 3Q12A 3Q3HA 4WNAB 4YUYA 1KH1A 3EA4A 1MZPA 1IWOA 4BAGA 2QQFA 1KKMA 3QVMA 4PEVA 2MINA 1Z4JA 4MA0A 4F5WA 1CEYA 5LP1A 2JI7A 4JELA 1QF6A 2WHPA 3H8JA 2XUIA 3Q8WA 3QTTA 3JQPA 2YZ7A 3EXAA 3GZTB 4EG5A 5HJ5A 3LXXA 1GCIA 2F1JA 4TLAA 4NBRA 3DP7A 4FPXA 3I12A 5IJWA 1G8JA 3STXA 1GQOA 5HKBA 1HNWB 1ND6A 4LOHA 3WKAA 1FE8A 4BO7A 1Y82A 1P4JA 2DJIA 2V54A 3AXSA 5BSUA 5GMOA 3HM2A 3G5UA 1FX0A 3Q98A 2QLJA 4Y2UA 1GA4A 1NJ6A 1SVIA 2VN8A 4QA9A 3IMGA 3N2GB 3NNDA 1AHNA 1Y3HA 2JFZA 2BZ1A 1TEXA 5JH7F 2HZBA 2RKWA 1CUJA 1FTQA 3C1UA 4QUKA 2CN1A 3SPXA 5DWDA 1EX1A 4P22A 2QMZA 2ON6A 1SVNA 4UQLA 1TEZA 3F6BX 2BKLA 4D8UA 1O8CA 2RAFA 2Y27A 5DP2A 1UBGA 3RBZA 2XDQA 2G0NA 3ZHTA 1DPGA 5IK2D 3B51X 3OFJA 1CE8B 3RVBA 4DV0B 2EFEB 2VOEA 2ZUVA 1KIAA 2FSVC 3ACBA 3OCUA 2CXSA 2VP9A 5MGNA 4Y6PA 5DHFA 5LPNA 1PW7A 3ZD6A 4TMVA 3IOEA 1FSGA 3QVGB 2R751 3IGFA 3ABRB 2NU8A 4BQOA 1JDBC 1FXWF 2IGBA 2IHVA 3I6MA 4OFZA 4DG9A 1YWGO 2P0EA 1PLKA 2PZGA 3KEFA 3PYLA 2VYNA 3LY7A 1FFCA 2J07A 4LXUA 1GKLA 4D46A 3K96A 1GL6A 1LS6A 1JA1A 2CW5A 4HLUA 4XFJA 1UDCA 1O96A 3KVRA 1X9IA 1JMKC 3U17A 2I71A 1CVRA 4MR9A 3W8RA 2BR3A 1R6UA 1VHLA 1PT5A 2OWDA 5CB4F 4JBIA 4OBWA 1D5WA 2BEVB 3FB1A 4YONB 2R87A 1QANA 1VLLA 3D7NA 2GAAA 1GEEA 1OY1A 4BMYA 1DBVO 1YHNA 3R7LA 2YN2A 4Z9AA 3E9DA 1I3MA 3K1JA 5HILA 5TDHA 4V24A 2AW5A 5IAAA 1NQ5A 2WABA 2FWIA 4RPIA 3S2SA 1WEHA 3L04A 3DG9A 4OH7A 1QH9A 1TJPB 3MWYW 5ENZA 3SBOA 5LIRA 2PX4A 1IOWA 1N5KA 4HHEA 3LO5A 5CR9A 5EQDA 2HDNB 1YQDA 3P9PA 1DEHA 4GS5A 4JXJA 1S3SA 4WOBA 3THOA 1PL0A 2JKVA 4IHJF 5EFOA 1AHPA 2AMFA 4FBMA 5HYVA 4IS2A 4LQCA 4FVTA 4OBEA 3QMVA 1T9GS 3MJRA 1UXHA 4ZOBA 3ZHVA 5BVHA 3NO4A 5DEOA 4GPD1 1J0BA 4M7PA 2PFGA 2ORYA 1TJNA 3D3NA 1KJWA 1EFCA 2YVUA 1E5TA 3HA7A 3HDVA 5SV2A 5F2NA 2JK1A 3FDIA 4TTSA 4OEHA 3UT0A 1M8JA 5I9TA 3RC3A 3E03A 2RARA 3WLLA 4EI7A 2VDUE 1RAFA 3LDFA 3QX9A 3H9EO 4C4SA 4PRZA 1F7UA 2NP7A 3K72B 4BFUA 3KUCA 4EW1A 2D59A 4ZHQB 3LX4A 1IAVA 1HM5A 3FOAA 5J4LA 4MV6A 1I2BA 3VYUB 1XZEA 2PZJA 3R2JA 2VSOA 2ZWOA 2PAAA 1EU1A 3IO5A 1BE0A 3VVMA 1E3EA 2VO1A 2ZJ8A 3C1AA 4H2DA 3QFCA 5JU6A 3KB6A 1G6Q1 3CR3C 4D26A 2BJHA 2ZWIA 1P7VA 3AETB 3L07A 1WUIS 3PENA 4IDEA 4NPCA 4PO1A 4UTZA 4B3FX 4EUHA 5KIAA 1CY2A 2ZUDA 4C7JA 1RHKA 2R5NA 4PYNA 4QLAA 5JANA 3Q9LA 2VJKA 4XWYA 4GBGA 1WNFA 4D25A 3IYLW 3PDIB 1HTBA 3NHAA 1RJWA 2A5YB 2PGAA 4U63A 2VBFA 1KOGA 1OPXA 1GZUA 2PKXA 1T36B 2QU8A 1E4EA 3RYFA 1KSHA 2BW0A 2QVCA 3O8OA 3OU7A 1XCGB 1KI6B 1U6JA 3MVEA 4KWIA 1G21E 4PLPA 4UOQA 1D6NA 4N0MA 5K51A 3V4VB 4P4GA 4U8GA 1XTSA 3C7KA 1VE1A 3LWNA 4MWDA 4L8GA 1J0EA 4XI9A 1HLFA 5JJIA 1WO8A 4RKFA 3GD7A 2CWDA 1DQNA 3QKRB 1P1CA 5COBA 1C80A 1EUDA 2XKJE 1UM9A 3CUKA 4R71A 3SEQA 3D6AA 2RFLA 3GX1A 2HK7A 2PN1A 4TTTS 2IV3A 4DV1B 3QOYA 4ASUA 3CNNA 3AEQB 1H2AS 4YRQA 3MJTA 3NEPX 1R4MB 3KB1A 5J59A 3TTTA 5J4YA 4BFVA 4EATA 4JI7B 4DS3A 1M1NA 4EYQA 3CR8A 3UANA 5ILGA 2YQ4A 4B83A 1QQ5A 2ZLBA 1CTQA 2X9VA 4DMLA 1Y4AE 3E05A 4WXRA 4DCJA 5L4LA 3BFPA 4ILKA 4G0YA 4QJ5A 1EFUA 3CNHA 3TRHA 4IG4A 1KI8A 2VOJA 2WC1A 4YJ2F 2OZKA 3J80A 4L4ZA 1PJLA 3TLEA 2CL5A 1IXKA 2WIKA 1JNXX 3KHKA 1S2LA 2QR3A 3F8TA 1RJGA 1B3RA 3FRJA 1G1MA 3UA3A 1XZBA 2P91A 3O8CA 5EI5A 1II9A 2QPLA 1IBSA 3L8EA 4P53A 1R88A 4YRCA 5FOVA 5SZIA 3K6JA 5K6AC 4YP6A 3CF2A 1R18A 4CJXA 3IV6A 1JILA 1KZ1A 1RS0A 3K31A 4W5OA 2XB2A 2PG3A 1DS6A 3GDHA 3I6QA 2ZKIA 2ZYIA 4FN4A 2QT1A 5EMLA 2SNIE 5HKKA 1NP6A 4BP9A 2YN0A 1X2BA 2Q45A 2XR1A 1XD2A 3OE7D 2WB2A 2A4KA 1OI4A 1PK7A 1UJ6A 2HBRA 2NVUA 3CRW1 3LECA 1IB0A 1SFRA 3MGCA 3NVAA 2Z8YM 3RD5A 1OASA 2SCUA 5ERGB 4WGFA 4BTLA 2VQDA 4F92B 5TVKA 3VGJA 2HMWA 4QNRA 1UPBA 1XLTA 2NO5A 2Q2QA 3FTDA 3G68A 1GZ4A 3PFNA 5IT5A 4R1MA 2O2XA 3GJ4A 1VL1A 1DBRA 3L1JA 3P7MA 4MTLA 2W2VA 2WT9A 2DFKB 3CVOA 1JP7A 4RZ2A 5FRDA 3ULKA 4M1KA 1YDEA 2FUEA 2HWYA 3BMNB 521PA 5CG1A 3DHWC 4E70A 1XLUA 1OLSA 2JPDA 4FONA 2CLOB 3CRMA 4HB3A 3U37A 2PGJA 2WQ7A 3PNBA 3QE9Y 2LKDA 4YALA 3DZFA 4BC1A 2QZZA 1ADCA 1KP3A 4XQGA 5T5QA 3U80A 4OHXA 4Q24A 1CUYA 3BBPA 3E48A 3P0IA 4ZT3A 1WMSA 3KOXA 1XTPA 2AQKA 1VCIA 5K01A 3WG9A 1KH2A 1OAOC 1Z56C 4ZV4A 3ZJYA 2JHPA 4U7JA 5E3HA 3I3OA 1IZ8A 1TDJA 4WECA 1D1QA 1E2UA 1S8AA 1AY0A 3HKBA 5FO0A 1R0ZA 1L7MA 4JKYA 2W8ZA 3DZIA 3TBHA 5AI0A 5G0TA 4BVBA 3VYSB 4G0UA 3OIVA 4BV2A 3E9MA 1BMTA 2QE6A 5IF3A 1DHTA 1UODA 4B0PA 2CHGA 3R41A 1JLSA 3TTUA 4ZIRB 3GZNB 4QG3A 1J56A 3QMMA 4KVZA 1Y9JA 1NLZA 3NRBA 1YQUA 3QSGA 4KN5A 5CVVA 1L7QA 2Z6UA 1PQWA 1E5QA 4IKOA 1G6OA 3OBIA 1IJEA 2HF8A 4BYGA 1GPKA 5K3DA 4RPLA 3WBBA 1NUQA 3NHSA 3MTIA 4YASA 4R9VA 5E9QA 5BUZA 2Z1DA 3RV4A 3A9VA 1M6NA 1NJ8A 1USWA 2WHEA 4CM8A 4J29A 1E2KA 2XVMA 1J1ZA 1THMA 1DRJA 4F97A 4JU8A 3N07A 2DPGA 4Q1FA 4ZP1A 3P2OA 2J46A 4TXLA 4LC9A 2F3TA 3W5JA 2JVKA 1E32A 3PNQA 3UTDA 4MUNA 1VKJA 1XCOA 1F2UA 2XVAA 4HDRB 5LZ7A 3RI3A 1MT0A 3WTCA 1UKYA 2JCGA 3OEEA 3OMWA 2VWPA 4I4CA 2A9RA 5FBVB 3DH0A 1NVFA 2FRDA 3MJEA 5AKJA 4HSGA 1EFLA 1LBHA 1OC2A 1BJRE 1VA5A 2JGIA 2P2ZA 2YJGA 4X44A 1RI4A 4FZ3A 2RH4A 3AUJB 4WESA 3VR4D 1LWNA 2ZG6A 5JMTA 1LI4A 5JYEA 4TXHA 3FYHA 2RGWA 2WWGA 3QITA 1JEQA 5BWNA 4H17A 4KGDA 1FLAA 3AW9A 1GXSB 3G2MA 4PZYA 2AJBA 3FCYA 4GRIA 1AIPA 2R7AA 4CMAA 4IIJA 4BMDA 4CDNA 1P6QA 4XYBA 3T5AA 1UC5B 1QVRA 3A25A 3LUPA 4F96A 3LRTA 4GRDA 1P39A 1Z2AA 1WXIA 2D2IA 3U40A 2A4MA 3ST7A 5I5GA 2FMUA 4GC9A 4NDNE 1NYLA 3V2UA 1KO1A 3BMCA 5FJIA 4U6SA 2ZR7A 4EZEA 1XMPA 3GQVA 3QG1A 4WGGA 3K0FA 4NE2A 1IONA 5E7MA 1XPRA 4TLDA 2BGLA 3JYHA 5DGCA 3WGLA 2XBLA 4MHTA 3MS4A 2CXHA 3MPUA 3HEBA 1U8XX 2AQ8A 2OB1A 5FTNA 1JFRA 4ZPJA 2L2QA 3M6AA 1GCUA 4F4JA 1KKLA 3W0LB 1OU4A 1QF9A 2GKSA 3V4OA 1NSFA 1SZJG 1ZGHA 4CQMD 3MGGA 4GOJA 2NPFA 1ZA1A 1HDGO 1U7DA 4ML3A 1II0A 1AM4D 5AJYA 5EZYB 7YASA 1R6VA 4HTAA 3J7AC 2MWMA 4NBTA 1M2FA 2CXTA 3PC4A 2VHVA 1MJGM 4IIXA 3OPYA 4OBXA 2AK3A 2QLTA 5GZ1A 3IQWA 1GKUB 4RM3A 5K3CA 1KFEB 1DJMA 3D59A 3PJEA 1EEHA 1H6BA 1A0OA 4ZYXA 4RWEA 4WCFB 1WVGA 3FSGD 2YVQA 3DD5A 2FG6C 1IXRC 1KSJA 3JATA 4FOSA 3U3XA 1UOOA 1XKQA 3I58A 3FXAA 3C43A 5IUKC 2QBYB 2QTAA 5AM1A 1TECE 2GCPA 2HMYB 5CGQB 2O7SA 3AR9A 3DMGA 4NTZA 1CR4A 2UZ0A 3P9KA 2B4KA 5A04A 2WWVD 2RGCA 4MQ5A 3U60B 2YJ5A 5L7YA 5FEMA 3E58A 1A2QA 2QLMA 1UPUA 3IVMA 2IYZA 1CNFA 4BNYA 1RAHA 2XGOA 1X6VA 2HRDA 4Q1VA 5BV7A 5JSUA 1Z8FA 3A58B 4DFDA 3HZRA 3BAFA 2JFYA 1RWVA 4NH0A 5BN3B 2BTQA 1WZ2A 1JAIA 1MH1A 2AJCA 1IHUA 1KTIA 4A5SA 3RRYA 1D2MA 5BUCA 2IF0A 2P6OA 2W11A 4TOIA 4CEJB 5LBIA 4JS0A 2CHVA 1RI1A 2H29A 1YD7A 4D9KA 3B7GA 4ZD6A 5D00A 2R8BA 5KTNA 2E37A 3DPUA 1Y33E 1FMJA 2R7LA 4ZZ3A 5KU7A 1HKHA 2IX3A 1THGA 1LPOA 1J20A 1PDOA 1RVV1 3NH6A 3OWHA 4HQ0A 3SVZA 1HNXB 3EVFA 5EJFA 5T64A 1NQVA 4O08A 3L18A 1NJSA 1TQ4A 1X1CA 2A3RA 2I4LA 2HEIA 2ZU6A 3CA8A 1RYDA 3OBBA 4UEOA 2PWZA 1DAEA 3ACCA 4NMLA 2Q7OE 2VTEA 3BMXA 3RU2A 4Y6GB 2IYAA 2RHTA 4ENRA 4J1TA 1T5DX 2B5VA 3FCAA 1OV6A 1CY0A 3NPAA 1O6GA 4G01B 4KPUA 4CQLA 1B6GA 5EJ5A 5THQA 1X0VA 2BGMA 2Q3JA 2ZTVA 2WE7A 4UTVA 3G6KA 1E6MA 2OLKA 4QBHA 4MZDA 4N5LA 3ZQ6A 2NACA 1E4VA 4IDAA 4FGZA 1VZ2A 5JJKA 1MO6A 3EOBI 5EPUA 3IP3A 5MFPA 3CVWA 5LCXA 1NQXA 4BATA 1X7ZB 5FCDA 4KITB 5KQSA 1Z2NX 1GL7A 1PS0A 4TQGA 4RANA 2FPXA 3K15A 3SLKA 1CQXA 1BDHA 4PX2A 3D3JA 2NGRA 3SJCA 4C20A 1MW9X 4O5OA 3QVKA 4GI1A 5ALZA 5LR6A 3HCPA 4YV2A 2BKUA 3QX7A 1PIWA 3QPDA 3K0SA 4M1QA 2F43A 4LI0A 4QDUA 3GFPA 3IIKA 3DM9B 3G0IA 1RFGE 1QIFA 2GEBA 2FEMA 4JBHA 3WLQA 1F9EA 2HHJA 3DTVD 4ZTBA 2QQEA 3NOOA 2Q5OA 4Q6BA 6YASA 1JIIA 1D7AA 2G08A 4B43A 4CQMB 5BPHA 5KBYA 2PSJA 2WNIA 5DDIP 1E94E 2F1OA 3DBLB 4M38A 3KUUA 3CGWA 5E9JA 3M83A 1H05A 3G9TA 4GT1A 2AXQA 2BGUA 3B1ZA 2GYWA 2ONKA 5KC8A 3H3XA 1J5PA 3PUWA 5CIQA 1OXVA 3OJWA 4F5YA 5BSKA 1X7WA 1X3SA 4YMGA 5IT0A 4BFSA 1CF2O 1I13A 1WDWB 2WIDA 3DMHA 4H15A 2DU8A 3W06A 4IXDA 2C1ZA 3O4JA 2R11A 1T1GA 5BN5A 2GUGA 2XF8A 3KE9A 2B1QA 2PGOA 4HS9A 4R2JA 4DJ5X 1NAIA 2XXAB 4NJMA 4PG8A 2C7BA 2VDOB 3G2LA 4JBYA 1SB9A 1T1SA 5HBRA 2CNLA 4S1TA 3GRPA 5E7QA 4C4XA 1X1SA 2EKBA 4EK9A 4OUDB 2F3PA 4H3SA 1SQ5A 3NETA 4KQGA 4E14A 3ANTA 5JTUA 5LD2B 1JWAB 2BFFB 4LDZA 2DOKA 4LJ9A 5CDTA 1LVGA 3LBYA 4NNPA 2IVZA 1IZYA 2M9MA 4K81B 2WHRA 4RD2A 1ZC4A 1GGHA 4LJLA 5K8TA 3D6MA 1VHWA 3X43A 4FU0A 2IPAB 4INJA 3HA3A 4X6XA 2WU0A 1ORDA 2YC2C 3QE2A 4KO4S 4L08A 1U94A 4NS4A 4WKGA 1WB4A 1UDBA 3DT8A 3RK0A 1RKVA 2JFFA 5BR4A 1PZMA 4F06A 2ZS8A 4Z7OB 2I1LA 5ARBA 3M1IA 4P86A 5LQSA 2IEYA 3GLHB 5TMDA 2ZAOA 2D5LA 3JAKB 3N53A 3H9GA 3S99A 3C8MA 5LN1A 1JHPA 2XUFA 2ZVDA 5EZYF 3R7NA 5L9AA 4PRYA 4RV4A 1I01A 1MXFA 3C3DA 1ZH0A 3RVNA 1IOVA 3Q7IA 1ZGJA 4GFDA 3ZDZB 3ZGLA 4EHKA 2WEKA 1KZ4A 1VLQA 3EPPA 2RB5A 5H7XA 2CFTA 1Y81A 1Q0RA 2C9MA 3AM3A 4ALMA 3RVPA 3TRJA 3F6PA 3VJLA 1KVQA 3KSUA 1KAEA 4DRXB 5H02A 3BH6A 4JLDA 2CYBA 2O2IA 4YRPA 2OFOA 2ORIA 2OCIA 4TRRA 1U4OA 4MUAA 1KZGB 3BK1A 2E4VA 1HTWA 2F8LA 3TI7A 4ZDIA 3T61A 3AQ4A 1X7GA 3FDZB 3KD3A 3V5NA 3ZWYA 4NBVA 3THXA 1R6DA 3KKMA 3D7MA 3SX2A 2BOVA 5JNVA 2EKDA 4OQXA 3X1DA 2Y67A 3KZKA 3NI2A 1E7RA 3EHEA 2JBWA 3U9TA 4PTLA 3FTQA 3TW8A 2WM9B 3VGPA 2XLBA 3GBPA 1FYXA 4BQRA 2B7CA 1OOEA 4LE1A 1VFNA 4WZAA 1FP4A 1M72A 4L28A 4V38A 5BMOA 3IB6A 1S01A 2B2CA 2NO1A 5EA2A 3AP1A 1A8HA 3QF4A 4B6JA 3KKNA 3G8DA 4H6WA 4P3OA 1DC7A 1PDVA 2Z8XA 4IRXA 4ISBA 1Z6TA 5EAIA 2WYWA 5F2OA 1PGPA 4R6XA 2DG2A 1PJAA 5HJ2A 3HDYA 3PBKA 2QTZA 3LBIA 3ORFA 3KQYA 3RTDA 4LJ5A 4MQUA 4NZOA 1PLLA 1QQ6A 4NPHA 5CIYA 3S7TA 2BMDA 2O7QA 2LE0A 2YX1A 4WFJA 1ZZGA 2XZDA 3DBIA 4W5WA 5K0FA 2HCJB 4HP8A 1U0GA 3P2JA 4ETMA 5KNBA 4KAJA 1XK6A 5CVCA 5B4UA 5HG0A 1LBTA 4DB4A 3VYVA 5JJLA 2J6HA 1U8FO 3LC0A 5HGJA 3C14C 4WN9B 1HKUA 4X45A 1G7SA 3K1AB 4I46A 3M4YA 4OYHA 1OROA 1SUBA 3N2YA 4HC4A 3ZGYA 5I9IA 3BE6A 5KMGA 5BWOA 3Q0IA 2ZXFA 1XF1A 4OXKA 2FZ4A 2OVFA 3HGMA 1CS0B 3AHEA 5B2EA 2BCEA 2ROQA 2PMKA 3DDHA 4ALLA 2B82A 4A15A 4DUGD 4CLOA 2C92A 4V0OA 3ISJA 1DQPA 1L0BA 1MA0A 1P80A 4C4ZA 4ZFNA 2IYSA 1QZTA 1XTJA 2MSKA 4XWKA 4R7GA 5K4GA 4PLWA 5FR1A 3EGCA 2JJYA 2E4UA 1WU8A 2VSXA 1G5HA 3GUHA 4CCSA 1CUHA 1T24A 1MB9A 3V34A 5EKSA 2D0OB 2GKOA 3L2OB 1K88A 1D7OA 3QNWA 2BM0A 1P1KA 4Q4AB 1H2FA 4XIJA 1EBUA 3ZBTA 1V96A 3V1TC 3ZU3A 1TGVA 1DQSA 2I2AA 2HO4A 5ARCA 1OZFA 4JEMA 2QA5A 3DE4X 1A5BB 6NULA 3RC8A 1UT8A 3L9WA 2IOFA 3MT9A 2ZIGA 1WPXA 5BSMA 1XQVA 1PFQA 1OXUA 3B85A 4NH4A 2IU0A 2A5JA 1TM2A 5SZKB 1GZ3A 1L8LA 1N6KA 4YIHA 2I99A 3L7IA 1II8B 2HK8A 3KEQA 3U56A 1EXWA 4KO8A 5B3AA 3NHBA 3S1LA 4TL9A 4H27A 1SELA 4LYHA 2CKDA 3IIMA 1KEWA 3P20A 3SBXA 4BNVA 4Q3AA 1OQAA 2H2DA 2XMDA 4C5BA 3DLHA 3OLXA 4ILEA 4JLNA 4FLEA 2R2GA 4BV3A 1IH8A 3HI4A 2QRMA 4M8LA 1ULBA 3DHVA 3OMLA 3N2NA 3PDJA 3QWHA 4Q6WA 4DWWA 2W7TA 4CU5A 3I9KA 4HAUA 1WXDA 1I7PA 2CLMB 2WTNA 3QQ5A 1G18A 1MUUA 1UPCA 2CB0A 2P1DA 5I8ZA 3WBKA 4ECEA 4EG0A 4CMJA 4CDRA 1JH9A 2FJPA 2O19A 4WA7A 1IBRA 4CMEA 5D51S 3USCS 1W4LA 2RHGB 5JYCA 3KPWA 3DXXA 1L7RA 1J8YF 4KP7A 2FMFA 3QELB 4RHCA 3VKUA 2I2CA 2JAOA 4X0EA 4AIIA 5H9VA 3MTGA 1A7UA 1GTL1 121PA 5AIBA 3I42A 3DFUA 2WAMA 2LTAA 3BIWA 1U0FA 2WKRA 4ON9A 2H5EA 5KKAA 4A0SA 4DTIA 3G9ZA 4P32A 2XHZA 3LF2A 4RTPA 1RWQA 2OK7A 4G89A 2X1LA 4KK4A 3THYB 1VJRA 1XQYA 4F3TA 3NATA 2IPXA 4K2HA 4JAVC 1JALA 1TJYA 1GU1A 2WVHA 1XXHA 4CL2A 1EWRA 2PRIA 2F2TA 1DKMA 1SXJE 2XODA 4OD0A 3UEOA 4FIZA 2ZYRA 2HSDA 3VOBA 2J6CA 3QMWA 3U0VA 1YI0A 3ROMA 2PZBA 4URXR 1RM4A 1DINA 2CDBA 1FW8A 3HV2A 3HKEB 4Y2PA 2W6CX 3RV3A 4MJ3A 4CIAA 4B4UA 2PMFA 3ZV4A 1LCIA 1BO6A 2GWRA 2R97A 3WL4A 4QQFA 4DEXA 1L7NA 2IYEA 5CXUA 1IN8A 4XGNA 5B7PA 2KPOA 2WFAA 2BI8A 3D54D 8ADHA 1CUSA 1EWQA 4DDWA 2OMKA 2W9XA 3D1JA 3O1IC 1MEJA 3IT1A 5CTAA 3UJ8A 3DWFA 2QXUA 1ESDA 3EXEA 4LJ7A 3UJCA 4DJAA 1NQAO 4GM1A 1RM5A 4WW0A 3I6BA 4BQEA 1CETA 5KAPA 3HEMA 3ZY3A 1M6VB 2OTCA 4K26A 2ZZNA 3DR3A 4QXPA 1FUYB 3QK7A 2JBAA 1XA3A 1UXGA 2YZMA 1TVEA 2W2TA 3DHEA 1C29B 4L95C 2RGNC 3PUKA 3CG4A 4JJAA 2ZBRA 4Z3KA 2XITA 3PT9A 3E0XA 1E1MA 1IU9A 2QAGA 3DO5A 3L7DA 1LSOA 1Z5UA 2GHQA 4FHZA 1N33B 1TM4E 1FQKA 2H1RA 4R9NA 2UYYA 3L1UA 3DZ8A 3GLGA 2PL3A 1IMJA 3L7YA 4UFPA 1A9RA 2O2ZA 3ECSA 3OQJA 4MV7A 3KFLA 4OI0A 3FGNA 3ETHA 5IMBA 1E7MA 2GH1A 5EZSA 3TXYA 5AW8A 4ZVKA 3GMIA 5A5FA 3LRPA 4L3OA 1NSYA 3ZHOA 1T1IA 2J9FA 1I14A 1LQ2A 2D0PB 3MWFA 3BCRA 2QRLA 2WJIA 1JZSA 3GRCA 8ATCA 1N6PA 5INTA 2QX9A 3PFKA 1L4LA 3H1EA 1MJ5A 1KAQA 4HEA1 5C7IO 2BVNA 3R24A 4YLYA 2RGRA 4KQWA 3WXMA 1I9GA 1VL2A 3NW9A 4XB2A 1K6JA 2IHBA 5CNMA 2JHAA 3GCZA 1W30A 2F59A 2WVJA 1AJEA 4P98A 1WDLA 3UVEA 1J39A 1QONA 2C1EA 1TKBA 2DMRA 3SX4A 5IDYA 2H1FA 1NF9A 4LBYA 1G5TA 1CJMA 5DEIA 3W9YA 2NV0A 3QPVA 1WE2A 1YNSA 5AOCA 2W93A 4DDTA 4ZCRA 4Q3NA 3TSZA 3IHTA 2IUTA 2KHZA 1WKCA 3RBXA 3S27A 4EFMA 1G6HA 5AKZA 5KO2A 3U44B 3I0MA 3K7EA 4MRAA 5DB4A 4BN0A 1I4OA 4FNMA 1PX2A 4R98A 2ZRCA 1RQ2A 4WTOA 3STUA 4OVKA 3U31A 5KVCA 1P9NA 1ZIOA 2AC7A 2QJOA 1ZMTA 3K92A 5AVJA 3VKHA 2PGXA 3HPQA 1PSZA 1ZX1A 3QKIA 4BFWA 1I4WA 3T0GA 4C7KA 3A6HA 1ZIXA 1J8QA 3JYLA 4J43A 1YAHA 5DGHA 1Q17A 4D9CA 1LF0A 4YRSA 1N2CA 1RMQA 2BP7B 4QWMA 5LNK6 4QUBA 4GGMX 5A9RA 3E9RA 1VE7A 2QL6A 4AY3A 4ZV7A 1V39A 2J3IA 2FFBA 4FEGA 4HB0A 4RLQA 1PTKA 2OCDA 3WKCA 1P2SA 2QP3A 3NKLA 3OZCA 5CITA 4F9FA 2QLLA 1Y7HA 4QNMA 1ECCA 1P75A 3SEFA 1LA2A 4G2TA 1EUYA 1ND5A 2P77A 2XSZD 1GAEO 1YJCA 3WWDA 5JJ5A 3DMTC 4B71A 3LVBA 5F1PA 1TAGA 2JGNA 1JKXA 2AHOA 3I2HA 3ZPXA 2QPAA 5BP7A 4OP1A 5CA0B 1HG1A 1QAOA 3AEKA 3P4XA 3O4VA 5REQA 5K8VA 2IA5A 5ECDA 5L8VA 4FMCF 5LOVA 4R2MA 3U7JA 2OD7A 4CMGA 5MF6A 4D1YA 4QGHA 3NHMA 3C4JA 3QE0A 4KXLA 5JZVA 1TU3A 4G86A 4R31A 1EM8A 4GE0A 3ZDXB 5JXIA 4AJJA 1H2EA 4X71A 3DLAA 3SOZA 5BNIA 3K70B 1ACJA 3MJHA 1FJ2A 1DAHA 2O3SA 2ZREA 1YC2A 3UAGA 2FW1A 3A6FA 2BGNA 3LW8A 5JNLA 2Y9PB 2JAWA 3EXHA 4EKYA 1B6SA 1NIJA 5ICSA 1YZTA 4N3BA 1WXQA 3L7CA 4YREA 3SJUA 2R8ZA 3UJBA 4F9TA 3N0WA 4Z4FA 1I0LA 1T2VA 3HL4A 2BM1A 4ZYTA 3EQ7A 5FQOA 4ZYZA 3S7ZA 2XNSA 3LYAA 4JJGA 4MAAA 4B1FA 4JB3A 3JQDA 1U8ZA 2FFAA 2WJAA 3PFGA 3M7IA 3MSCA 2H2AA 3PHHA 4IJ6A 1PW5A 2PUHA 3F7OA 2XTAA 3PKJA 4PAWA 3W2GA 2BWJA 4S1OA 4KH1A 1YXMA 3K2BA 3LE8A 3LK7A 4DQVA 4XAQA 4RMGA 1SH7A 1CBUA 3PPXA 4KO2S 2R65A 3EBOA 1UC8A 4TMXA 5EZ6B 1Y5MA 1GKYA 2C84A 4MR8B 2KLHA 1QHHA 1C50A 4Q3KA 1CR6A 1UQRA 3O6VA 2B4RO 4WCFC 5FI5A 4S3MA 1GRRA 4CCYB 5K09A 1GPDG 4JT2A 5KX5A 3MAGA 1JPNA 4WNIA 3PL5A 3THSA 2DCUA 3FOEC 2JCXA 1YK1A 1YVPA 1PJQA 1RXYA 1SKBA 4BMXA 3EZGA 3U4QA 2OORC 2XQGA 4IJMA 5DX1A 3CRZA 3N0RA 4C6SA 3B89A 3DF7A 1IRIA 4RMJA 1Q0HA 5E2IA 4R0MA 1YCHA 3PUHA 4QICA 1CDEA 1QCDA 1A9YA 2JANA 2QW1A 2WHQA 3VR5A 3LPAA 1VHJA 3G0DA 1Z36A 4DLKA 5CLJA 5ES4B 3JAMA 4D9BA 1ADYA 1XXLA 5BMVB 3QU5A 4UCWA 1T9BA 1CCWA 1DADA 2Q2WA 4QUDA 4F4IA 2C31A 4MGZR 1O9HA 1JLKA 3MCTA 1CIPA 4JLUA 4KYVA 1ORRA 4PLYA 5B3JC 4I4IA 3FE2A 2ZR9A 1W0KA 2X7XA 5DLDA 4EX6A 1FEZA 3GGJA 3MT7A 3LY9A 4MQ4A 3SX0A 2E21A 4ZO6A 5BWMA 2RAVA 3D2CA 5IKPA 5ESWA 4RVSA 4DKJA 4KMRA 5G3ZA 2AA3A 3PWZA 5L53A 3ZGZA 3GRZA 1XPJA 3JQGB 4RVOA 3GUVA 5L7TA 3IL2A 1LJ8A 4QUHA 2LIPA 1LI5A 1QGOA 2YFQA 3R09A 4GSLA 1T2EA 4IM7A 5KYUA 4MKZA 5JAMA 1RCUA 3SC2A 1K5GA 3ZCUA 5AVSA 1EFPB 3PDCA 4S24A 4UCFA 5GOTA 5KNBH 2BI4A 2Y77A 1C8LA 5EIFA 4TV9B 1J8DA 4BB6A 1AXEA 2BGRA 5LA6A 4B0OA 2FOLA 3ELBA 5ECYA 3BIFA 1EXNA 1Z82A 1SKYB 2GWHA 1LPPA 4N1AA 2V8OA 1VOTA 2R1VB 3AX6A 4WFIA 2LCIA 2XOKA 4ZEVA 5JYDA 4B3MB 2XCIA 2AFRA 3D43A 3FI0A 4KAFA 4WK6A 3IEUA 2OZVA 3B52X 4LQ4A 4IJ5A 3ESRA 4LAFA 1JSZA 2IH4A 1R12A 4EUFA 3QVTA 4DYVA 2R8OA 2D7JA 2AUMA 1LFDB 2ZJ0A 5M7EA 2ACKA 3RF7A 3JQCA 1SZCA 1Z26A 1D6MA 3ESDA 2EHDA 2YIVX 5AK0A 1PR4A 1Y8RB 2XGSA 1B14A 3NHWA 1Q7GA 1E2QA 4ZQFA 1ZK3A 2FMTA 1J90A 3CIFA 2ZSFA 1OFUX 3NBXX 2GBLA 4Q1EA 3DT6A 3LCVB 3VYWA 3EZ2A 5E6SA 1V48A 2X9QA 3K5HA 1OWPA 4IIJF 4MVJM 5I9NA 4HBGA 4B3IA 1XZCA 2UAGA 3EMBA 4TT3D 5F78A 3B1XA 2ZI7A 4F5DA 1ZC3A 2FPIB 5LZ8A 4OLBA 4BBAA 1Q2XA 2ZJZA 2BR5A 1FU4A 3MMZA 1XHFA 5F35A 2B5OA 4D4GA 3LA6A 4R8MA 3K71B 2CJYA 2H8GA 3K0AB 3U7GA 2CMFA 2GJAA 3I04M 4W1PA 1Y1TA 2REXB 3EXIB 2OYCA 4I55B 3OTHA 4CTMA 1RPZA 3H2ZA 1GQYA 1I3LA 3UWOA 4TMTA 3KXKA 5IPFA 3MRTA 1WMDA 2GBPA 4F5ZA 2IOHA 2OFXA 2FW7A 3R6LA 5DNAA 5K05A 1P9LA 2WIBA 4RHTA 2JLXA 1KI1A 2HK6A 1V9CA 2OAEA 1E7SA 1G7CA 2GGSA 3ORQA 3HSKA 1PSWA 3TTYA 5IG2A 2IELA 3EVNA 5D87A 4CETA 1YVRA 1ZMBA 3KTFA 3R6TA 3GNLA 2IRWA 4XGQA 2HKIA 4PNPA 2Q8NA 5DIFA 3TQQA 1CUBA 1CZNA 4H35A 1K7XB 1T4GA 4R1LA 2Q29A 1N2HA 1EVYA 3DKRA 3P5BA 4B7XA 3EDRA 2X19A 1EDEA 1OBFO 2KM1A 4H7HA 4HFRA 4FHGA 3PQ3A 4WDQA 2XRYA 3WJ7A 1C0KA 1Q7RA 1VRWA 2B4TO 2ODAA 3LL7A 3PP8A 4P54A 2CCKA 2BF7A 1CYDA 4QTZA 1R8QA 4HAXA 10MHA 1DCMA 4XM2A 4ZCMA 2VWQA 4UUOA 1DX9A 3PQ7A 5EUBA 2A88A 1EJ0A 2QIOA 3AF0A 3GP5A 2A5GA 2PT5A 4I5GA 4OGKA 4QQ8A 4ZYLA 4YP5A 1A2BA 1GWNA 1K68A 1PN3A 2IZ1A 4A8JB 2FLKA 1YO6A 1V6CA 2IW1A 3F98A 2Y1CA 1HFWA 4MTCA 1HY3A 2VUUA 4M8NE 2IYYA 4HNGA 3VC1A 2QRKA 1NUHA 3QA9A 1M2KA 3H18A 3IKVA 3KLMX 1JKMA 3REQB 4ZOLB 4BV8A 2B2NA 4BX0A 5E9WA 1VSUA 5TIIA 1DKOA 3ZNQA 1DJPA 4NOJA 4HLUC 2B5WA 1SIOA 2GXUA 3ZE1B 2NUBA 2G76A 4IF6A 1U0TA 3A05A 4KCGA 5LU8A 1NRWA 3F6RA 1WCV1 3G0BA 3A4IA 3F2VA 1XK7A 4LY3A 3EGIA 1PJ2A 3L79A 3GGDA 1BWRA 5IC6A 1H5UA 1TU4A 3A32A 5CBKA 5CDSA 3GA7A 3TLZA 3RUEA 1UQTA 4MMXB 1NJ1A 2PBRA 3KQTA 5DM2A 3FTEA 3ZHQA 2X7HA 3KJFA 2NZUG 1LB1B 1YZVA 5DX8A 4AG3A 5BMVF 2XWSA 2FR8A 4GX1A 3JWHA 5D01A 3O31A 3OJFA 1KYQA 1M2GA 2V03A 4BKOA 4AL4A 4XPZA 2J5QA 1R0RE 3OF3A 4O4IB 3FETA 3H6GA 3JARA 3UZUA 3FCEA 3EAGA 8OHMA 5HIAA 3MGBA 3O2NA 3L92A 4LX0A 4YRRA 4CM7A 2VQFB 1IWPB 4L5IA 3N6VA 2WWIA 5CX1A 1TCCA 4DHWA 4RV5A 5J23A 1XNRB 3S44A 2J7KA 1AXGA 5E6UB 5EQFA 5G4KA 1Y1QA 4J90A 2GSDA 4KPYA 1JYSA 3HCRA 3QU4A 5MN6A 3CLTD 3H2IA 3NRCA 4P0PB 3F71A 3PG5A 5IX8A 2P6UA 1WSAA 2PR2A 4DLPA 2VNJA 3C4QA 3PCTA 3RAJA 1PT6A 3LBHA 2XKKA 2Y71A 3GRAA 1EFAA 2C3MA 3U3MA 4ZO4A 4FK8A 1Q7TA 1WMBA 3CBGA 1TLLA 4QWWA 2WD8A 1ONBA 5ELLA 2G70A 4P4NA 3OSZA 1STOA 2QMHA 4JMPA 1KGDA 1T4CB 2FMXA 3C3PA 3IPAA 3MBKA 2IY8A 2EF0A 3PF9A 2XW6A 2QMQA 1SXGA 2NZYA 4JOQA 2JCVA 2WYIA 2HK9A 4Q4CA 4L5CA 1SBNE 1KMMA 2O57A 1N8NA 1YNOA 2GJ8A 3OE7A 2P4HX 4JB0A 1VJDA 1RQRA 3ECAA 5K3BA 3HO1A 2QNBA 1UWCA 2P5UA 3BICA 3GRYA 4LZJA 2WDPA 4BLVA 1U1GA 1G38A 1E9SA 1DRUA 3HZZA 5DSXA 1FXSA 1SVOA 2ZI3A 4MO9A 1L5HA 5LYJB 4S0ZA 1N6LA 3IILA 5CCXA 2YIJA 2GZSA 4JLMA 5LXTB 5JSYA 4YCJA 3W9SA 5AUPB 1SGWA 5PNTA 2PX3A 2R2AA 3HN2A 1JHRA 3L5KA 1RKUA 2JLVA 2A30A 2HMUA 2QRHA 2X3FA 1F5NA 2QQGA 4CHGA 2VPIA 1W7AA 1B8UA 3PRHA 4LF9B 3AVUA 3U0BA 4RADA 4RL6A 3TQOA 2G63A 4DIMA 2XNDD 3QVJA 4QDZA 4S0XA 2PJDA 4DCTA 2D13A 4F45A 3BSSA 3NANA 4G5OA 1LTHR 1XZIA 4BXOA 3FYTA 1SHUX 1PNVA 1YMVA 3ABOB 3F8SA 3SS9X 3HUUA 4DCOA 4RUKA 3DA8A 3TTXA 3DAFA 2YYYA 3OC6A 2I3GA 1DIHA 4P5EA 4MRRA 1QK4A 1ZWKA 5DM70 1FNNA 3N58A 5A1TA 4AQ7A 4ZO7A 1KFCB 4MKGA 3R74A 3QWAA 3BL8A 4JK3A 3DOJA 3W9BA 4W1RA 5JAZA 4W5RA 4IOLA 4RLHA 4MGHA 1GNSA 3EDYA 1XRJA 4KQ2A 1Z8DA 2OXTA 2B21A 3BWDD 4EEKA 4EIWA 2WQ6A 5LQAA 1D9XA 4B3CA 4DA7A 5CB6A 1TQHA 4BCDA 2HF7A 3N7TA 4TN1A 3IP7A 4DR3B 4QUJA 3RS3A 4I55F 4QYXA 1OMOA 3ZCXA 1NR1A 2EC5A 2IZ7A 3VZQA 3NX4A 3TFWA 5A4JA 1ODTC 4PPGA 5BQOA 3L0BA 1TLTA 3H9UA 2E49A 5LDHA 1JHZA 2JIQA 3G2PA 4OQNA 5BW8A 1G291 3HXPA 1RI5A 1YA8A 1WB5A 2R7MA 3A4NA 2FVXA 4J9UE 5LYYA 3B3GA 4U9HS 4LOAA 2HQ1A 3EJ6A 4Q9LA 2JJMA 2EWMA 2FN4A 1RP7A 3SR4A 2O6HA 4DA8A 3UHFA 3WR5A 4RTLA 4OQ4A 1SUSA 1UBTS 2WSMA 1OT5A 2VLBA 1E9VA 1R6AA 3O2JA 1NI5A 5J9FA 1J0CA 5LWHA 4O25A 1N1DA 5A0TA 1SK9A 2I6FA 4GLJA 3UW3A 2XTJA 3FOBA 2BGKA 3DAHA 3BC1A 1Q11A 2X5OA 2H00A 4K7JA 4OB6A 3PRYA 2JDIA 5B57C 5KVSA 2ZVJA 4JFRA 2QX6A 2QX4A 2XPCA 1A5TA 1FFXA 2EW8A 1A4IA 4KQKA 2QN2A 4U8HA 3TSAA 3EX7C 4B4DA 1QU3A 1TFUA 2AOUB 4GRAA 4CIXA 2QG6A 4MKHA 2FH5B 3H4TA 3HDTA 4GKVA 4B4WA 1CQZA 1T6XA 3ROZA 1OI7A 4AVYA 5BWBA 5IT4A 4PAOA 1RYHA 1XLTC 2Y6UA 2FQQA 1AQNA 1VXOA 4E08A 3MILA 4Z54A 1VIDA 4S05A 1KMIY 3KHTA 3ZDAA 4DY6A 2YC4C 1DO2A 3WBFA 4F4HA 4CKBA 4J2TA 3RQSA 1YHYA 3QWBA 5J47A 2WRZA 1SB8A 4ZOLF 1UEXC 3U3DA 2OXIA 1KETA 2D1YA 4PN7A 2POCA 2ID4A 3COSA 3EBPA 1H6CA 1XCJA 1NU8A 2WTAA 2WMDA 1IZZA 3IAXA 4FNOA 3OHSX 2JARA 1C3EA 4IIHA 3VR5H 4PICA 2PDAA 1Y5NA 1JAXA 1YUBA 3LBAA 3Q1LA 4XH9B 3PV0A 3EUFA 1QIMA 3E8MA 4FCVA 4JGGA 5DULA 3ZZUA 1M5RA 2AC4A 3WL8A 4EFNA 4MVJP 1U2PA 4R69A 1M5UA 1ZVMA 2YWXA 4U5QA 1N2SA 1YJQA 2W98A 3JYOA 4WZBB 5EXTA 2I03A 4ZVSA 4LKRA 1ZGAA 4QFDA 3TZ6A 1MAHA 5TNXA 5HK8A 2R1TB 1XYGA 2E7ZA 3HO6A 1HT1E 4Z0NA 4EGSA 4I50B 2ZYSA 1SXJD 2XZPA 2IQ5A 4ZAZA 3QKWA 3TQFA 1U7XA 2BFBA 2VUSA 4Q7MB 5C46F 1X0XA 3CIOA 1CB0A 2XB4A 1P7ZA 5HIMA 2IZ5A 4UBNA 5EXSA 1RJDA 2ECPA 1CFJA 1OR8A 3IT2A 4GLOA 5ALOA 1H9CA 4I1IA 3CNLA 3SVLA 3NBKA 1SU7A 4HQ6A 1A4UA 4RK0A 4ZU1X 4C07A 1YR6A 4B6OA 3X1XA 4IX9A 4TM8A 2QUAA 821PA 3LIPA 3EC7A 5LU9A 4MLZA 4R1TA 1JTEA 1SA0B 5CAEB 4WBXC 3E5NA 3FSGA 2RGAA 3GGSA 4UTOA 1Z08A 4KR9A 2QYTA 2XBUA 2Y99A 2AGVA 1VPEA 2G8LA 2X8JA 3AHFA 4L15A 1XTQA 1NBOA 4TS3A 1CUXA 5ALIA 4KC0A 1HE3A 2WU4A 1SQGA 3ABZA 1UAYA 1BXRB 1ZL2A 2PHZA 2PVPA 4WN3A 1E8DA 3LDAA 3WL3A 1IBMB 1AZWA 2PVCA 5A7FA 2XEDA 3RSGA 3D81A 4CGYA 4DAEA 1J33A 1MPTA 1MV8A 2FRDC 4YTEA 2ZM6B 5K8LA 4ZRMA 1DL5A 1XP8A 3K94A 4ARVA 2HDHA 1ZR2A 2XZTA 1M66A 4QEZA 2HFJA 2VNIA 1SIBE 2BGIA 2W2MA 3GNTA 5ECWA 2I7DA 3VI4B 2I9PA 5LXTF 3GUUA 5AJHA 2C4NA 1L5YA 3BSYA 2P3SA 3FLAA 1NMSA 3CN7A 4BGDA 3WLMA 4Y6QA 4BWYA 1HE5A 1MJNA 1GTVA 3UHJA 1L7VC 1ZD1A 4LRTB 2GEUA 4XDYA 5B58T 3NWPA 3THRA 3ZNNA 4PANA 5FUBA 4E5DA 4XQCA 2IH2A 4KZPA 3IBSA 1PV1A 1K9VF 2LP4Y 4Y67A 3KSBC 2IODA 1K2VN 1WUKS 4GG1A 5ALLA 5CFRA 1ECBA 1WPQA 2X40A 4RZQA 5T41A 2JFGA 4CF6A 2WHYA 2OGSA 3D8TA 3NAZA 3UHPA 1P5FA 4DLRA 3P8ZA 2QF7A 2ODBA 4G85A 2Y1LA 2ZI5A 1YS6A 3IUPA 1M8FA 4OQDA 2J67A 4KSCA 1ZVKA 1LDNA 3MFYA 3GLFB 2OB2A 1F8GA 2LBPA 1GTG1 5TGZA 4FX5A 3N39C 2IV2X 2HY7A 1JVBA 4XVHA 2PQMA 1KE1A 3QOFA 3H8SA 3JCZA 3U3JA 5KVAA 4DCMA 1OVGA 2DFVA 2X0RA 3PWKA 5KC9A 1Q3HA 3AJ9A 1QK3A 3Q40A 2HPHA 1S02A 1E2NA 2WD7B 3PFCA 3K70C 5EXEA 3NHLA 1GV1A 2O07A 3C16C 3WTBA 1I7SB 1O6CA 1QPBA 4GEGA 1P6XA 1V5GA 3AYXB 4Y2JA 3L1IA 5F12A 1V1JA 1GPMA 1XZGA 6AT1A 2XZOA 3RAEC 4QGFA 1PZHA 5ESXA 5CFZA 4IW3B 1WKBA 1JHDA 3P26A 1JDTA 2CUNA 3I72A 2IZZA 2PSFA 4EYGA 1Z7EA 2G7MC 2AYXA 5CFPA 1H3FA 1XJCA 2CNKA 4ND1A 1S89A 3A1DA 4U7WA 3MS2A 4DM3A 4DARA 2RMKA 3DTVA 3O2SB 2G9RA 3JU3A 4PZCA 3S5JA 5KJ6A 1HQDA 4TTPA 2WWYA 1Q15A 4N4AA 3DXYA 1VLZA 4KFRA 1ORWA 1PAUA 3DV0B 4HTFB 1OFVA 3PNVA 1NYTA 1E6WA 1V5WA 3G9UA 3HNOA 4Q18A 3MRSA 2DZDA 4DV3B 5EJMA 3H04A 3NP7A 4FCWA 5CVUA 4RFSB 5IAKA 1H69A 3O03A 2C2MA 4EHLA 2C4TA 4WOPA 2C8LA 3TIGA 2JG3A 2JEOA 1QB7A 1CVLA 3PA8A 1YDHA 1V11A 1B26A 3Q7SA 2OUIA 3PFFA 5M5BA 4BJ6A 2QGFA 1YE5A 3BSWA 3ZV6A 4YRZA 4XGKA 3VKVA 3Q7QA 2PMWB 2C5EA 2YR0A 3FUVA 5AI8A 1ZD8A 3FYSA 1BHO1 4PO8A 5HUHA 2RHJA 1RWBA 1FIUA 1ZISA 1O6ZA 2FSIA 4FDMA 4V0MA 1NPDA 1XZJA 2C99A 1A71A 3EZ9A 4JJFA 3U9SA 4DNFA 4U02A 1ODLA 1B7GO 1T2CA 4ME6A 3B3AA 3FGPA 4D02A 4D57A 4CKCB 3F4KA 3H11B 4LV8B 5AHOA 4DIDA 1DFIA 1V1RA 2IU3A 3DVAB 4MW6A 1BHQ1 3AF5A 3OZUA 1C7FA 4HNAA 3ENVA 3ADPA 3PXBA 4EI2A 3HXLA 2X9NA 2A84A 4FYYA 5GM2A 1L5ZA 4QOEA 2UYCA 1F60A 1ZVJA 3T15A 2ZUBA 5JZMA 5J2UB 1IXSB 3C3BA 4NYJR 2O2CA 5BN4B 4OXIA 1UOPA 4IX1A 5U1PA 1XNJA 4B6GA 2HQRA 4J1TC 3AP3A 5CG2A 1DOZA 1XRQA 3C1OA 4OUKX 4RJ2A 4QRHA 2FU5C 3ITKA 3PE3A 5FUVA 5HTKA 2NO9A 4G0MA 2RB4A 2MSCB 1Q83A 4I9FA 3WP0A 3O83A 1DLJA 1FFBA 4N9WA 4RSGA 2BHLA 2CDNA 4ZCTA 4Q4HA 1D8TA 2B83A 4KXNA 4NOKA 1ZNZA 4S1NA 2ORWA 2P9TA 2RGDA 2G4VA 4OAPA 4UBKA 1UWVA 5CJ2A 4KMMA 4ZMRA 2AF4C 3H1TA 2OXFA 3FCCA 2BEWB 3OPMA 2EYQA 3ZWWA 2YHIA 3HUEA 1KJQA 5C8YA 2IEDA 3H1GA 3ONVA 3DSRA 1RYMA 4X6YA 4DUPA 4K8OA 1RXVA 3V3KA 1DWPA 4WAUA 4GMHA 3FPFA 2UU9B 3D3WA 1JQEA 2V3VA 4YXFA 1CY6A 3JAWB 4DNOA 4AURA 2H6EA 2OA0A 2C96A 3BOSA 3KALA 1KYXA 4IIDA 4CKEA 4YMUA 2UUBB 3HYSA 4A36A 1VIMA 2XNJA 1NY5A 3BTOA 3M34A 2YS6A 2BMFA 1JDZA 2EZ4A 4HVAA 3B9QA 5DHUA 4F7WA 1IY1A 2AQIA 1T5SA 2ORED 3EXFB 3V4ZA 3ZVNA 1Z63A 1DQYA 3TZLA 3BX1A 3TNFA 1G9SA 1Z45A 3WNZA 2FEOA 3TLYA 1NI4A 1QIDA 3IBTA 2OLJA 4LA4A 4QD3A 1Z62A 4DMKA 1E62A 2HD4A 5JBNA 1IK6A 1Y9AA 1DEOA 2XMBA 1M6YA 3LPDA 1LDEA 1JFLA 3BRWD 3C8UA 1V4NA 3AUKA 3G89A 3ANXA 3GO4A 1N9KA 2IYPA 4AO6A 5FOWA 4KLAA 5HF6A 3IKTA 2OBBA 2CV0A 5G0VA 2XCUA 4B3HA 4YRKA 1ZAYA 2HLNA 1HSZA 1IUOA 1T0BA 4OJTA 4E51A 3ETNA 1VE6A 5LOVF 4ER7A 4EVQA 3CH6A 1YHZA 2OZLA 4IXWA 4MUMA 5EG5A 4AKEA 3I34X 1UANA 1PTJA 2PTGA 2G3YA 4B8WA 4D4HA 4E2XA 4NE7A 3WA7A 2FPGB 1LY1A 1TADA 4LMPA 4PC3A 3TR6A 2WB4A 2QZSA 4HAIA 2PU7A 4DBLC 2ARKA 3T0FA 2K87A 3OI7A 4K05A 4MEAA 4RVCA 4CIYA 1W5EA 3CW2A 1KU6A 2XRMA 3ZDYB 1W2WB 4P81A 1KOFA 4DDMA 3NIBA 2A33A 4AZTA 4JYAB 5CT8A 2OO5A 1WEKA 3VU0A 1M1UA 1VFPA 2W6IA 4UAGA 1F6BA 2GD1O 5ISMA 5K0SA 2QD3A 1CLEA 1E3TA 4I8IA 4OMUA 3RSLA 4E46A 2CJFA 4G8JA 4QL3A 1VG9B 1D1SA 5CVJA 621PA 3KUXA 1JRLA 2E9SA 2MT9A 2OQIA 3A26A 4L6IA 4J0IA 4TUYB 3ZE0B 4CEHA 1DWQA 3CRRA 3DBHA 5AD1A 3K8OE 3OURA 5D1NA 3DOUA 4WVLA 5J2TB 3GJRA 1JAHA 1X70A 4KNVA 4NMWA 5G40A 3KV3O 4QVIA 2YNMD 1N6OA 2ZZMA 1KNXA 2PWPA 2VNHA 4D4LA 1W35A 1I1QB 4RU1A 4BVJA 2H2WA 1TJ4A 1QFSA 2ADFA 3KQOA 5KX5F 2RG7A 3AUYA 4KE7A 3VNVA 3TX6A 4DLWA 3EFEA 1UJ4A 3R5HA 4D82A 3ZVKA 3KX2A 4BO1A 1RZ3A 3V8NA 1W0JD 2Y4OA 3GQBB 4G36A 3Q72A 1LK5A 4OL0A 1C7QA 1E5VA 5G0SA 5CK4A 4BIMA 3VR4H 4C3OB 2GMWA 1FBNA 1TQ2A 5A62A 4WNCA 5JAHA 5JSFA 1DCTA 2B92A 2HCTA 1J9ZA 2G71A 5ADHA 2OC9A 2OD2A 4NY1A 2J9YB 2G9VA 4O2LA 3TL3A 4NZNA 1P0IA 4IH9A 3GA5A 2O5VA 1SHKA 3NBQA 4HRVA 3LAWA 3HP7A 3W77A 4OQYA 3GW8A 3AYZB 1J2EA 3G49A 3KP1A 3QKSB 4YJFB 2G9UA 5ED0A 5ENDA 4AUKA 4KDFA 2I76A 4QPZA 4J3NA 1TAQA 2OFWA 3CLSC 3BMQA 3H4IA 4Z53A 5BSVA 1C9KA 1O7JA 2R68A 1KYVA 3UAWA 5JAQA 3BJRA 3DHNA 1G3RA 3H83A 3QA3E 4C4AA 4S35A 1DBPA 2QNRA 4FW9A 3M4ZA 4X3PA 2FP3A 4ROSA 3UCFA 2YASA 4JQZA 3WMRA 1WF6A 3ADBA 4AS2A 1VGRA 2H48A 4U6NA 4PYQA 1T2NA 4BO0A 2CXUA 4RCZA 1SU8A 4U7GA 1W581 1VCOA 4B8ZA 4GU5A 2NIPA 4R54A 3GMTA 3L4SO 4CKWA 4HYYA 3A28A 3A1UA 1FQJA 1UEIA 3O3OB 2CB9A 5AUNB 4BZXA 4JBLA 4DNPA 1R27A 5JSQA 5LA6F 5K45A 3W5BA 4N6OA 1L6RA 2FPLA 3INGA 3X1ZA 5H70A 2Q8QA 2AJDA 5EWLB 1NKTA 4BTVA 1EFRD 4BNHA 4MUGA 2HRZA 4OU4A 3ML1A 2A9OA 5EKTA 1HF3A 4EKIA 2VEDA 1CF9A 4MWZA 1N6IA 3LQRA 2EBHX 1Q3TA 5JOQA 3FUWA 2PYIA 3N1UA 4E7PA 4IGEA 5EMJA 1Y48E 2IH5A 1K8XB 4CTOA 1G21A 3LHSA 4HUJA 4DDKA 1O6FA 4BOYA 2WTEA 3A3PA 4CIBA 5AVVA 2Q28A 2PZFA 2VT6A 5CH3A 3SNKA 2PEYA 4DIFA 3SFVA 1U0HC 4IWYA 3AU8A 1NONA 1CIVA 2R4UA 4ESOA 3EVEA 1ISRA 3ESBA 4JI3B 1UDWA 4RHXA 4II7A 5K0TA 2JL1A 2NLOA 4FI3F 3G59A 3BXHA 2LZ0A 1GVHA 3UFXB 5KSZA 3BJMA 3MWEA 5TR9A 2DYKA 3FCXA 4BJ3A 3OX2A 2ZPTX 4LNUB 5K8UA 3JD2A 3CUWA 3KYDB 4Y2QA 3DDSA 5LQRA 2VHJA 4RHYA 1F3LA 1G7TA 1XV5A 3LXUX 2P90A 4IY1A 4J16A 4A73A 1ZG3A 3ASVA 3A7DA 3LX8A 2R5FA 4ND2A 3WVNA 5K6RA 5BO5A 2P7HA 3AVTA 4AF6A 4J91A 4W8HA 3C5VA 1BMFD 4Q37A 3IP9A 3ESXA 3FLEA 1R64A 2G17A 1RPJA 3HLYA 4YP1A 4P0QB 4XPIA 4MVJD 5IKXA 2IEIA 3IVCA 4KFTA 2D1SA 2Q0XA 3HXOA 3M33A 4B3GA 5G4LA 1P6UA 4NZYA 5AXAA 2ZJFA 4D41A 1A8QA 1UMDB 3NGXA 3TR0A 3TCKA 3L06A 3H17A 2ZXUA 1T5TA 3L49A 2XUOA 3UHOA 4QGBA 5K0JA 2JK0A 2OP1A 4UEQA 1U9ZA 4C01A 4FYHA 1AURA 4FXPA 4RORA 3NC1C 2HADA 1RXEA 1SBHA 3JWJA 4EAAA 1MG5A 1DOAA 1KJIA 5D86A 1LK0A 1QC5B 4C4PA 4DCVA 4I8DA 1XEWX 2GVNA 3MT0A 4HGNA 4LGYA 3RREA 5HNKA 3D7SA 3BQMB 4XIFA 3PICA 3DOEA 4KN6A 4MVXA 1TYAE 4KO1S 1I3KA 2DVMA 2C88A 3TAUA 3VPXA 4YP9A 3G0HA 5BQFA 2Q41A 4FYKA 1Z74A 2CLLB 2YMMA 4HDMB 1AKYA 2YBDA 4XFKA 1G20B 3PFHA 2QM8A 3HCBA 1ES9A 1U9CA 4ARBA 4JI2B 4PXSA 1LTKA 1RTTA 3UKDA 4FKZA 5DF1A 2CNBA 5BRAA 3PLRA 2V96A 2Y8EA 3JASB 5D3QA 4Q3DA 3T7AA 4IAOA 4DIBA 2BFWA 5K0CA 4RPHA 2PSDA 2JC3A 1ULSA 4NEGA 4IGAA 4K9OA 5CEFA 3AP2A 5FLYA 1YV9A 4LRXA 4WBNA 1E3JA 4LX8A 2BDEA 4L0DA 3IR6A 4WX2B 2PUGA 3W8EA 2VC2B 3QJ5A 1X7XA 3JD1A 4KVAA 4DCSA 3EIEA 4AMGA 3LYUA 4DJEC 2ZB3A 3LM8A 4UNIA 5LNK1 4F60A 5AHWA 5BSGA 1W1IA 2EZ8A 5JC1A 1E3WB 2B25A 2EZUA 4D0NA 5HZGA 3QEMB 4M0EA 2YN4A 5KTPA 1WHTA 2HQSA 4AD8A 3S3TA 3SGLA 2QAGC 3MOSA 3BEOA 3QXXA 5IC4A 3B9PA 3Q6NA 1R1DA 3R7WB 3UATA 4ACAA 3LFHA 1Y37A 4AU1A 1JXMA 1BRTA 1Z0DA 1WSDA 1E79D 2JATA 4WLOA 5SZJA 3KAPA 4E2WA 1J97A 1JHMA 2OOSA 3PUVA 3D8NA 1LDYA 4TN5A 2BTEA 1RYZA 5FI3A 3ME5A 2ZRPA 1AKWA 3CH4B 3H99A 1FP7A 2WMNB 4OFXA 1H8ED 2HA4A 3INTA 3VMMA 4UXJA 4ALIA 4Q5IA 1HYBA 4RD0A 2AMYA 4B7AA 1M83A 3D4LA 3DS8A 1ACMA 5AMXA 3U4MA 4TWRA 7ABPA 3QIVA 4LFBB 4LMAA 4PN3A 2D2XA 3CO0S 1KERA 4EFLA 1Z7GA 1UDAA 1NGSA 4LIPD 3KJXA 1V2GA 3K8YA 4C0WA 1ZS9A 5AK3A 2RBGA 1SC4A 4LDJA 2P62A 3PPIA 4W6ZA 2J9GA 3TW0A 1E20A 3B6IA 3D02A 5GM1A 1Y9EA 1CDZA 1S6YA 1L1RA 1D9ZA 5EZ5A 2E1RA 3HE3A 4WLVA 4DIEA 1NZJA 4D8XA 2ERCA 2OENG 3NPMA 1WXFA 3KSZO 4XTCS 1PWHA 2R48A 4M6WA 3VOAA 5BORA 1KMHB 2FXVA 3L0DA 5J1TB 1QWOA 2FKAA 3BZBA 1ZHFA 5JT1A 4QRIA 3M82A 4C2BA 3ACDA 2V58A 1POXA 4L4RA 2ZRFA 2QM7A 3M9WA 2UKDA 4XX0A 4RVGA 1QCZA 1Y6JA 3VTZA 2FWBA 1QRSA 4ARIA 1J42A 2A59A 3C39A 1P29A 1VL0A 3A2MA 2VRCD 3OJOA 4FDVA 2NUAB 1GGNA 1J8MF 3GI1A 2E55A 2WJ4A 1DAKA 2Z8YA 5F2EA 3HKDB 5HIIA 4H08A 3BYZA 5TGDA 2XDAA 2GHIA 4X91A 4MI9A 2GS9A 1CUAA 4ZT5A 4IV8A 2R25B 3INNA 4FS8A 5DK4A 4M60A 3RLIA 1XGKA 4NU0A 1OYOA 5JWRA 3NEJA 3R0JA 2Q6LA 3B2QA 4OOEA 5CB8A 3F3KA 2QG4A 4NAUA 4UTPA 2C54A 3CLVA 4I4TB 4CWAA 3ZHRA 4TZ6A 4NQZA 1XDUA 1S5PA 2IOQA 1YUMA 2H7YA 3CNEA 4H0FA 4BLUA 1VMAA 1CY7A 2CXOA 4QVKA 1MAUA 1BMDA 4R8SA 5GINE 2GTHA 3H87A 2BRUA 2G0TA 3R9KA 4YHHB 1HETA 1R8JA 4IJVA 5EWJA 4ALJA 4F2PA 3OIYA 1Y8QB 2W22A 1Q7CA 2Y9MB 4CL8A 3URKA 5JQGA 3QU9A 1PL8A 2ZRGA 3NHZA 4BC0A 2ZJ7A 4E22A 3PWTA 2M1ZA 5BW4A 2G7ZA 3CNOA 2FHSA 2AZMA 1EXMA 2R4TA 3IQIX 1JX6A 3PEEA 4F2DA 4HRAA 3LS2A 3R0QA 3GMSA 1RQGA 4OMDA 1T8SA 3D8BA 1NBME 1YMQA 2B36A 1YK0A 4H4EA 3SDSA 4D42A 2OYSA 1HYGA 3LUDA 3OQ6A 3VZBA 3ZWPA 1R10A 1NOIA 4BKUA 4AMVA 2QVXX 4WDRA 1JTVA 4MVYA 4D5EA 1QIKA 2HT6A 3TD9A 4ETWA 2XMRA 4LJKA 1DAMA 3FCUB 5COQA 4M1ZA 4FKBA 4GZ5A 2IE0A 5TLSA 1H0HA 3HFGA 3QF7A 1ECPA 3T41A 4TGLA 4MV1A 2CJXA 2VWGA 1M2VA 2GILA 2NU9A 4J9VA 1OA0A 3DUFB 5F52A 3NVKI 1RYYA 1PEKE 2A1TS 1RLMA 1PGQA 1L3IA 2GEJA 2IBSA 4AYTA 4CMIB 1N9GB 3HU3A 1UUFA 3QXGA 4EF4A 4DADA 1GLVA 3QFTA 4DR5B 2QLFA 3ONWA 4KQCA 1ZW1A 3RKRA 2P5YA 4GI3A 3P71T 4HNAB 4JEUA 4I1PA 1AGPA 4RTKA 3UN1A 3AV0B 3WIVA 4ONEA 2JAXA 4YIKA 2GASA 5DYIA 4TZKA 5E3JA 5I4KA 1YB7A 2AJTA 4J6FA 3T3OA 4OJNA 4U4AA 1EIZA 1P0QA 2FFRA 2GPSA 1ZEMA 5EVCA 1CD5A 5K03A 4JYBA 3D0QA 1EMDA 1POWA 5H3HA 5TV2A 3GBVA 1DBIA 1RJFA 2PUVA 3SC4A 4K88A 1U8UA 4FDLA 1OSNA 4QOIA 1U7TA 2JBHA 3CLRC 3ET5A 3W4KA 4PSAA 4A6EA 3DFKA 1N0IA 1R16A 4HS4A 1BC5A 3V55A 1SVUA 4IGIA 4PYRA 2LRHA 5EMHA 5C8YB 1FFAA 5K8IA 3JQ7A 3RR2A 5JMPA 1JEYA 2JAPA 2MDTA 1EXDA 3T54A 5KTTA 3UJAA 3ZLUA 3D3WB 2CL0X 4I3FA 2WJYA 1KO7A 1DIOB 1MD9A 3A6JA 4I5EA 4TMWA 1J21A 5BW6B 3WO0A 1KH3A 5CD9A 5AVWA 3I5YA 1B73A 1B23P 1RJ9A 1IOLA 1IZ9A 1GZVA 4OM7A 2R6CA 4EKGA 4YAFA 3QEBZ 4EFDA 3RROA 2ZWVA 2FEAA