5IFKA

Purine nucleoside phosphorylase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
302
structure length
295
Chain Sequence
DINEQRALIKSAHRYISEKLEDHFSSEFLPKALVICGSGLSGISTKIADEPKPLILSYSTIPGFKVGELIFGYMNGAPVVLMNGRLHSYEGHSLAETVHPIRALHLLGSINVLIVTNAAGGINASFKAGDLMCVYDHINFPGLCGFHPLRGANFDEFGPRFLATSDAYDLELRKLLFSKKKELNIERKIHEGTYSYVHGPTFESRAESRFLRLAGTDAVGMSTVPEVVTARHCGWRVLALSLITNECVVDPPASAHDENPVPIQEGKATHEEVLENSAKASKDVQELIFSVVAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Characterization of Purine Nucleoside Phosphorylase from Kluyveromyces lactis and Its Potential Applications in Reducing Purine Content in Food
pubmed doi rcsb
source organism Kluyveromyces lactis (strain atcc 8585 / cbs 2359 / dsm 70799 / nbrc 1267 / nrrl
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 92
structure length 295
sequence length 302
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ifkA00
1Z5OA 3MMSA 1RR6A 1PR5A 1PR2A 2HWUA 3DF9A 4QATA 4KN5A 4L5AA 1VHWA 1N3IA 1OTXA 4L5CA 4LZWA 1V4NA 2IQ5A 4D8VA 1Z36A 4NS1A 1T8RA 2A0XA 3KVYA 1NC3A 3BJEA 4BMYA 4D98A 3OF3A 3UAZA 4DAOA 1Z35A 5CYGA 1K9SA 2AI1A 3GB9A 2I8AA 5B7GA 1NW4A 5CYFA 3EEIA 3KU4A 4OEHA 1VHJA 4WKBA 3PNPA 5I3CA 2AI2A 4NY1A 1ZOSA 5C80A 1V2HE 2AC7A 1C3XA 1U1EA 3FB1A 3PNSA 3INYA 1PK7A 4PR3A 1TGVA 1Z34A 4TXLA 1QE5A 1RYZA 3U40A 3UAXA 1OTYA 4QASA 4DANA 2AI3A 4DABA 2QSUA 5F7JA 3MB8A 4TTJA 1ULBA 1Y1QA 4BN0A 1YR3A 1YQUA 3NBQA 5DK6A 3BL6A 3LA8A 1U1CA 2B94A 1YQQA 1A69A 3P0FA 1Z5NA 1Z39A 1RXUA 1U1GA 4QFBA 4LNHA 1VMKA 5EUBA 2Q7OE 1PR0A 2RJ3A 4G89A 3BSFA 1PWYE 1JP7A 3D1VA 4F3KA 4BMXA 1RCTE 4OGLA 1PF7E 4TXNA 1K27A 1A9QA 4TTAA 1A9TA 5JPCA 5F7XA 4M7WA 4WKCA 2A8YA 1SJ9A 1JDUA 1ULAA 2ISCA 4ECEA 3OOEA 1A9RA 3C74A 1RXCA 1RXSA 2OECA 5CCEA 1ODIA 3ONVA 3E9ZA 1T8WA 3OZEA 1Y1RA 1XE3A 5ETJA 4F2PA 3IOMA 3EUFA 1PR6A 4M3NA 1CG6A 4MCHA 4DARA 4P54A 3UAVA 1ZL2A 1Y1SA 1LVUA 1TGYA 4LDNA 4UC0A 1LX7A 3E0QA 1Q1GA 5B7PA 4I2VA 4JWTA 1A9PA 1ODJA 4TXHA 5CXQA 1PR1A 1TD1A 1G2OA 2OXFA 4FFSA 4QARA 3FUCA 3K8OE 4JOSA 1CB0A 3IEXA 1ECPA 4EARA 4WKOA 2QTTA 2OC9A 4TYMA 3OZCA 1U1FA 1FXUA 4D8YA 4WKPA 1JDTA 1RXYA 4L5YA 2P4SA 1RT9A 4PNPA 4G8JA 4F1WA 1PKEA 4DA0A 3F8WA 4OJTA 3OPVA 4WKNA 1V48A 4GKAA 4QEZA 1SQ6A 3FAZA 4BMZA 4NSNA 1PW7A 1Y1TA 3FWPA 3OZDA 4TS9A 4F3CA 3DP9A 3NM5A 5KB3A 1U1DA 5B7QA 1Z5PA 3KUKA 4D8XA 3LBAA 4U2KA 1OVGA 3UAYA 4GLFA 4R2WA 1PR4A 4DA7A 4K6OA 1OU4A 4R2XA 1TCVA 3GGSA 1T8YA 2H8GA 2HRDA 1Z38A 4L6IA 4GMHA 3NM4A 4GLJA 4H1TA 4DAEA 4M1EA 3P0EA 1RSZA 3FNQA 4X24A 1I80A 5F7ZA 3ENZA 3DDOA 2XRFA 1JYSA 4JP5A 3OZBA 3UAWA 5FAKA 3OOHA 3KVVA 4TXMA 3OCCA 2QDKA 5K1ZA 3KVRA 4LNAA 5F7OA 3LGSA 4G41A 4OGKA 1T0UA 1V45E 1V3QE 3BGSA 1PBNA 2A0YA 1RFGE 1Z37A 1OV6A 3SCZA 3DJFA 1WTAA 1YBFA 1Y6RA 4OY3A 1ODLA 1JE1A 4L0MA 5CCDA 4RJ2A 1SD2A 1TCUA 2GUWA 4R31A 4YNBA 1T8SA 1JDVA 4TS3A 2HN9A 4YJKA 3DPSA 1JDSA 1Y6QA 4EB8A 3FOWA 4LKRA 1VFNA 5F73A 4YO8A 1JE0A 3EMVA 5EPUA 1LV8A 5EFOA 3QPBA 5F78A 5B7NA 3O4VA 2ON6A 5F76A 1JDZA 1JPVA 3NM6B 2A0WA 5CXSA 4DA6A 1M73E 4OF4A 5IFKA 1B8NA 1YRYE 1V41E 3O6VA 1NC1A 1A9OA 4TXJA 4TTIA 3PHCA 3ODGA 3T94A 4IP0A 4F2WA 1B8OA 5IU6A 3PHBE 2PGAA 1PK9A 1SD1A 1A9SA 1K3FA 2HSWA 3E9RA 2I4TA 2QTGA 1ODKA 1OUMA 2BSXA 2QPLA 4E1VA 1Z33A 2OC4A 4YMLA 4MCIA 3KHSA 4D9HA 3EUEA 4QAQA 3TL6A 3UT6A 4MARA 3K8QA 5F77A 4DA8A
chains in the Genus database with same CATH superfamily
4FGUA 1Q5PA 1VB5A 5CW2A 1TAGA 2HV9A 3AT1A 4PZDA 2QG9A 2UU9B 3KKNA 3ZHSA 3MSXA 2FWIA 3KX2A 2JAPA 3ZHCA 2IU6A 5JO9A 3MFYA 3ND7A 3VVMA 4D9IA 7MDHA 5K5EA 4CMBA 5DFAA 2YOFA 3AFHA 2YRXA 2CKMA 2P9TA 1H8ED 4IEEA 4XJVA 1M6VA 3GZJA 4Z4CA 4EBBA 4JLAA 3T5AA 2ZRGA 5J2TB 1KEVA 1XVLA 5EZSA 1LJUA 2OORC 4RD1A 1LK5A 2V1UA 5HF6A 1MJFA 4MO2A 9LDBA 5JY1A 4W5QA 2OCBA 3U0VA 4CHGA 2OQ2A 1UBUS 3EIFA 1T8TA 1V5WA 2VZ8A 1ZCAA 4D2IA 3QU7A 4P0TA 3GVXA 2G67A 1KXJA 2HEGA 5CB4A 2G6BA 1Z5WA 4D98A 3CCFA 1X0VA 1ZIDA 3ILVA 4JQYA 3VTKA 5ENZA 2H6EA 2QXYA 3E23A 3LVBA 5H8WA 3UKJA 1XDGA 4INZA 4YUZA 4FYJA 2RHMA 1K6JA 2IDKA 5C8YB 4FLMA 1C9EA 5DWQA 1AUXA 2NO0A 3A1WA 1IN4A 1H1TA 4ZT2A 2YC4C 2I8AA 1MORA 1ADJA 1WEKA 4N49A 2DR0A 4QUDA 2Y9PB 3USZA 4NENB 3IIKA 4JKOA 4R0NA 3CRW1 4Q1CA 1M6WA 4LX8A 3HABA 4L16A 4MUYA 4URVR 4DPKA 3ITDA 2VPWA 5A5EA 5J3JA 3C87A 4ZOCA 1PV1A 1L4EA 3FNBA 3OLYA 1BFKA 4PLTA 2C07A 3L4EA 2DLCX 3PUYA 2QX8A 4J1TC 1US8B 3IL2A 2PS3A 1XMJA 3GUCA 4KNVA 4X6LA 3EZ2A 2QQ5A 3F9IA 3FNGA 5MDHA 3ZJ4A 5AVZA 1DBRA 1OFIA 1NPYA 2DLDA 3G9XA 3HGTA 1MIHA 3H97A 3ZWQA 1N5KA 1YNSA 2DB3A 2WKWA 1NT2A 3DE0X 5ALSA 4OD0A 2PQ6A 4A73A 3W5SA 4C5AA 2FE1A 2C4WA 5JC1A 2QAGA 3K73O 1POWA 2I29A 4K05A 3CSSA 4RACA 3R3JA 4C20A 2R8YA 5BW8A 5BWOA 2P5UA 1VKJA 2JD2A 2YNMC 3GU3A 4Q7KA 4KO8A 4S1OA 4LZOA 3UXYA 3K70C 1OB2A 2VTDA 1GZHB 1QTQA 3CH4B 4N7BA 3TVYA 4OCZA 4D02A 1VSBA 2D8AA 1UJNA 2XITA 1RPAA 3CW8X 4QC2A 2IOFK 5DGTA 4QGSA 2B99A 4QRHA 1R6BX 1WXFA 2RMKA 3DEAA 3KQUA 3N8DA 3AUSA 1L5RA 3P9CA 4UDYX 4ZQEA 1REQA 3LCRA 4E5VA 1BXRB 4TROA 2FJPA 1GUDA 1LV7A 4TYPA 4WASA 2X0IA 2Q50A 3FF4A 3IDAA 3IPYA 1LF5A 2JD1A 3P0FA 3DNFA 3VTZA 2O3UA 1Z39A 5KSPA 4Q93A 1F4VA 3U1BA 3C5EA 3DZ8A 4PQRA 1FTGA 4QFBA 5KVQA 2W6OA 1IJEA 2O0LA 2WV7A 3RC3A 4BC0A 5MF6A 4Z3OA 3COJA 1PV2A 3CPHA 1QZZA 4XFJA 5KZMB 2E18A 1R6TA 4OBXA 5FYQA 4UULA 2FP4A 3DEKA 4IZIA 4MLPA 4B87A 3AF5A 2A1UB 3EXEA 2IEIA 5SZJA 2WFLB 3D5QA 1EFAA 3WLJA 7ABPA 1JQKA 2FRVA 4IH4A 1EM6A 2F48A 4GC5A 4FT2A 4M9CA 4QXMA 2YMMA 1M54A 1TM3E 2DM6A 1GNRA 3PKIA 1ZJ4A 5H70A 4K9MA 1U3DA 3EVFA 1EK0A 3PGLA 3PFWO 4ZTBA 1F0PA 4PG4A 1ZCBA 3TE6A 2I7DA 3PCXA 1WL8A 2IEGA 1COZA 5SYAA 3RIYA 3ZQUA 4IXTA 4FFMA 4JC0A 4DLRA 4ECEA 3U44A 2K2QB 4JASB 5LXTB 3N05A 1C3JA 3ZIDA 3RYTC 1ODCA 4N5MA 1JDBC 1GYQA 1SXJB 1W47A 1ZUNB 1LDMA 1C81A 2OFPA 3QX7A 5AOCA 3BB3A 3DFUA 3L7YA 2J5KA 3I5MA 2GYVA 2WTNA 2ZB3A 1WB4A 2Q3MA 1S8OA 3H99A 1Q3HA 1VJ5A 1L7NA 2DCMA 4WCFC 3PV0A 3KQMA 4UM5A 1SU8A 3IESA 3HKCB 3W1EA 1QP8A 4MYCA 1PG5A 3FNEA 3L05A 2Z4RA 4Z7NB 1FDTA 1TA9A 4LXGA 4R54A 4PY2A 1GRRA 2ZRPA 2R6R1 2VBIA 3D6AA 2O8BB 1R7RA 1L4GA 1G98A 1UXKA 2O7NA 3EWNA 2FUG1 4LJAA 4RVDA 2OCAA 4PTYA 4DDHA 5HZKA 1ZP6A 3FYHA 2BSAA 1UUFA 1YFKA 2EC5A 3MJHA 4JJEA 4P54A 1KDYA 3BA6A 4MO9A 4WNAA 3GROA 4AJLA 2C3YA 1THZA 1UFKA 5KQLA 3CE6A 2EKQA 1JR2A 1Y5LA 1P9NA 3OLQA 4R1TA 4AWAA 4MVJD 3UJ8A 3OJEA 4R1LA 3W6OA 2JGMA 2MYPA 3STUA 3KB1A 4FOOA 4HQOA 5CFNA 4U0KA 2WU0A 2A4KA 4EJSA 2Q5CA 4C1NA 5IDWA 2YJ5A 1R8JA 1JFVA 4H15A 1XEAA 1DBQA 2XMZA 1CUGA 5KU7A 3W8RA 1SN7A 7AT1A 2PH7A 3CN9A 3UMSA 3TQQA 5KVSA 4AQ7A 2ZUEA 5KTNA 3OE1A 4IJMA 1MA3A 1OI4A 1TIKA 4I8XA 2AHOA 3NPAA 4DUZB 1USIA 4J2OA 1GXSB 4QOFA 5D7BA 5DLQC 2XMRA 1MJGA 1T3TA 1UANA 2FR8A 1GAXA 4J2HA 1KJNA 1WSBA 1X1BA 1ATIA 1G20A 1R6DA 1YGYA 1TQHA 4UD2A 4BJ1A 4AY5A 4X66B 1URPA 4JXKA 4PN7A 3LFTA 3RHFA 1CP2A 5C5EA 2H0RA 5HFJA 3H83A 4M22A 5CXUA 1E99A 1EGVB 2ONYA 3GRYA 1W7AA 3P9XA 3C70A 1FOEB 4DC0A 2YMPA 1MJ5A 1GGHA 1QIIA 3CZPA 4L2IA 4C0KA 1HEYA 4NCAA 1W85A 4TYMA 3LRTA 1EVQA 1LPOA 1CT9A 5G0UA 5FEMA 4A91A 1OAOA 4S1PA 1E8NA 1TKBA 2AT1A 2ZR9A 2X1HA 2UV8A 2OSBA 3KEOA 2WMDA 1A7KA 1DXQA 5FTMA 1J39A 1PFUA 5HIJA 3M4YA 1VJRA 2ZJ5A 2FSVC 4RF4A 4Z4QA 2E4XA 1QOQB 4H7EA 4AP6A 1DAFA 3HE3A 5HP4A 1MVNA 4P38A 3WHPA 3PR1A 5LZ7A 3FNIA 4I1VA 4NEHB 5JPDA 1XU9A 1GKYA 1XTSA 4Z2YA 3ANLA 2F1JA 1NLUA 3PS9A 4HX2A 2OTCA 2QGZA 2WJJA 3AM3A 5LC1A 2XWQA 4NDAA 4PHFA 4WUVA 1EDDA 1KI6B 2WJAA 4EW6A 5JNRA 3KYJB 2XE8A 3OJLA 3BULA 4W1RA 1FSSA 3BS4A 3RVBA 2CNKA 3T38A 2XGJA 2WU8A 1AXRA 1LS1A 3KD2A 1KOFA 1GCGA 3M34A 1O9BA 1G3MA 2Q3DA 1K7CA 2FH5B 3V8VA 3GLFA 2BI8A 3F71A 4M9SA 2W43A 5IYZF 1DPFA 4C4ZA 2HF2A 3ROEA 1TYBE 4M60A 2CXTA 1UJMA 5DHQA 2FWAA 1W5BA 3F6BX 5EXTA 3SJBA 3DL4A 5B7QA 1NR7A 3LZDA 2ISQA 1I4DD 1UXJA 2A9KA 2FPPB 2C97A 4TGLA 4X95A 1YJBA 2VNKA 4ITUA 3RC1A 2Y4NA 1GTG1 1Z45A 5LNK1 3S8MA 4I1IA 1QK3A 2VUSA 3KXKA 4LISA 2KM1A 3ONFA 1J70A 3C98A 4U2FA 4W1PA 5E9QA 1CX9B 1CTQA 2XVMA 5DX0A 4XSVA 3H1AA 3SXJA 1ZNZA 2CLEB 1DAKA 1DZ3A 2HDNB 1G19A 2XTZA 4K6CA 1KWGA 3RSSA 3I4LA 1Q2XA 3C1UA 4MUBA 1WMFA 2AMFA 1QGED 1C2YA 1IATA 4LOHA 4ICIA 4Q34A 4BWVA 2CFCA 3H4MA 2PTHA 4YPVA 2ZREA 4DNPA 1YTLA 4AJOA 2DHQA 1X6VA 3TLZA 4XWWA 4H7PA 2BP7B 2YNMA 1NLFA 1YZYA 2HNAA 2ZB4A 3WJ2A 5K4HA 4Q4AB 4BNNA 3ORQA 3T3IA 3L79A 2WIAA 2XTAA 2R11A 3TB4A 3I39X 3NHJA 1I0LA 4TQGA 5H81A 3O31A 3QE0A 1D9ZA 3LX4A 4TV8A 4DV4B 1ZD4A 1KORA 1PFKA 3T7DA 1PYOA 4AI6A 4I8DA 2B5WA 4HLCA 1S02A 3G59A 4ZQCB 1QGYA 2I80A 1X70A 3HKBA 4QTZA 1Z2PX 2BEUB 3K9NA 3X44A 2VDVE 1W35A 2I3ZA 2X7HA 3AG5A 3FCEA 3IIEA 4HEA6 1KAHA 3CQ9A 4KLRA 2O2CA 2PWPA 1EFDN 3QF7A 1Z0UA 3V80A 4DPMA 4B3BA 1SCQA 1V3QE 5F2KA 4N8DA 4R71A 4XVUA 1DELA 2WD9A 4R1NA 3DMPA 1R6UA 3IP3A 4OHUA 1GL6A 4PRYA 5IYZB 1H4SA 1R4AA 3K7EA 3FYUC 1X77A 2FUCA 5B1YA 1WP9A 4ZDKA 4OP1A 1U3UA 2DWOA 4FT4A 4AYXA 1P91A 4B09A 5FL7D 1Z37A 4TZKA 2JFOA 5LLSA 4CI0B 2X13A 2ZT8A 1WR8A 3F5FA 1MG0A 2A5YB 2VSOA 2W2VA 4KQKA 4V24A 3R7DA 1G8JA 3PI6A 4AS3A 1WXIA 3OE5A 2WRZA 3KZ1E 4TQ9A 3UICA 5MHTA 3BWVA 1Q1QA 2FSFA 2ZE5A 4FOTA 1EXVA 3H5TA 4H7DA 2XUIA 5DEOA 4Q16A 1FVOA 3TSWA 3L7JA 4M1YA 4BFXA 4LJ5A 3AETA 4FPXA 1SD2A 4RJ2A 4E14A 1SH7A 1B41A 3C6XA 4C3ZA 4GKKB 1XCOA 5ALKA 5EE9A 4OHFA 3JWEA 3UOAB 2VT6A 2BEJA 2RB4A 1OJ7A 3I09A 4BNKA 3VYTB 2OCDA 3D6VA 4UVGA 3OCJA 4OYRA 2I1VB 1CZHA 2VHXA 3FCAA 1BEEA 2EW2A 3D31A 4JDUA 4M55A 1Z22A 4ZVKA 1G1AA 4Q1EA 3THYB 2X86A 4AJNA 1XZGA 3AY6A 1ZIXA 5EN4A 4HNRA 5CT6A 2GO1A 4HD8A 4TRNA 4WH0A 4KOEC 3CJQA 5EPUA 3QX9A 3WGYA 3WAGA 3RPEA 1FX1A 4BO5A 4PLCA 2RHCA 4DQUA 4ZK6A 3O0DA 4YUYA 1SVKA 4JELA 2FQXA 4V03A 5ALOA 1XHEA 3AJAA 3D4NA 2AEJA 5L9AA 4G0XA 2J4DA 1N2XA 4Q3NA 4D0NA 4H1WA 3C3BA 4RO0A 1BKSB 3ZYZA 2AEFA 3DB1A 3DDSA 3AOEC 1M8FA 1P33A 2Q62A 2QD3A 4CQMA 4TZ6A 1QWSA 3OH8A 2H1WA 4B3TB 1AD2A 5INTA 4GOJA 1Q22A 1BRMA 1Z15A 4FCWA 4HN9A 2QBYB 1I33A 1X1SA 4KIWA 3O75A 2WVGA 3LPAA 2OHXA 2I87A 1ENYA 2LE0A 4X41A 4MI6A 2E87A 5BNZA 5EWLA 3AV3A 3UBMA 4BQFA 4DG8A 4HNGA 2DE0X 5DTIA 4EI9A 5L53A 3ZIAD 4N5HX 1H3NA 1KYXA 2P11A 1CUYA 4TTIA 1WTCA 2LWIA 5DO9A 3LC1O 3WGLA 4EB0A 3W4KA 5C3MA 4GX1A 4GDFA 4MWGA 4MZXA 4RPLA 5DMHA 3FUTA 4Z7QB 5FH9A 4M0EA 1NZFA 1H2YA 1JNYA 4HWOA 4QU0A 1KRWA 1Q3TA 1WY7A 4WLOA 1TMGE 3PL1A 3CONA 4HV4A 4PO9A 4DIKA 4D6YA 5H59A 1M33A 2ZAOA 5K3BA 5YASA 4OREX 5AFSA 2GPBA 2ONZA 4M36A 1Q0TA 3DO6A 3C8HA 5ULLA 4ASUA 2IUEA 2DBVO 5SICE 3OY7A 4FMBB 3FOCA 4LX0A 4MJXA 3JVDA 5BN5A 2QN2A 2Z30A 5L6MB 1PJ3A 4TUYB 2IRWA 1SD1A 4NDNE 1W29A 4UOQA 1GM5A 2VSNA 5FO0A 2CLMB 4DSOA 1RI3A 1MTOA 1T25A 3L4BC 2PUFA 3A37A 2JLBA 1K66A 1XIVA 2WHXA 1WB6A 2C4KA 1T36A 2HWWA 3BFKA 4HZIA 4DRXA 1QHHA 3UFXB 1XMQB 3IKVA 2PA0A 4KH1A 4E4YA 4OQLA 3ZWOA 3IV6A 3OCYA 3PZBA 1T9KA 4B85A 1EP1B 1KMQA 1Z2NX 4IGIA 4ZOQI 5ERGB 4L4XA 3TQHA 1OX4A 4ITVA 5ERXA 3GLHA 1DQZA 2VTEA 1Q1EA 3AYXB 5DSZA 3U9TA 1TAUA 2RGGA 3DE4X 3KWFA 1RKQA 5A71A 4HMPA 2N3ZA 4I0WB 2BF4A 3VI3B 4P36A 3K5WA 1B1CA 1AXEA 1DWOA 1NYRA 2W37A 3GA5A 3BWEA 3TTVA 4B3FX 3HWX1 4HYTA 1TIBA 4NMHA 3HMKA 4QUAA 1PR5A 3NG1A 4AF8A 4AS1A 1H0HA 1DEOA 4MKZA 3RU3A 1SUIA 3QQPA 4M9QA 1N57A 4FDAA 2P4UA 2PU5A 3GRUA 4RM3A 4UNIA 2YRFA 4B6EA 1J2JA 3D64A 4NAVA 4YAGA 3DTTA 2A5LA 3LE8A 3ONEA 1SBIA 1ZXBA 2C42A 4UTPA 4NESA 5F9MA 3AERB 5FNVA 1KA9H 3DZFA 5AM2A 4TKVB 1A8PA 1FUYB 2IKQA 1PUIA 4N6OA 1UBRS 1WVMA 1KC3A 4FX5A 4ZJZA 4K6GA 1Y1PA 5TT1A 1KK3A 4I3HA 1Z3IX 3OP1A 4KYTA 4GPIB 4CMGA 3FD8A 1QYCA 1K2WA 1USUA 3FKJA 1YR9A 3SC3A 4DY6A 4HADA 4U7JA 5HS6A 4BQEA 1PUXA 4EZEA 4Z1OA 1E5TA 1FFCA 3OE7D 5HEKA 2A14A 1MA0A 4H7JA 1V5IA 3AFOA 3IALA 2BMJA 5I7VA 1RAHA 4A0SA 4BDTA 3HJBA 4ZDWA 2C29D 1EHIA 1Z7YA 1J42A 3MBIA 4D6XA 3TI9A 5GOTA 3KT3A 2QQ0A 1KY5A 4XQCA 4FZVA 4K88A 3RBAA 2Q28A 2V6JA 3WIUA 1TMOA 2M1XA 4J16C 3V33A 2Q2WA 3B8EA 3ED5A 3ZGLA 2C2GA 2PBLA 1MC8A 1W0KD 2AC7A 2VHJA 3PNSA 4ZJUA 1V8OA 4PO3X 5KAPA 1YZGA 2QG6A 1BMDA 4BZPA 4HBZA 4DG9A 3ZD9A 1J8FA 3U26A 1JXQA 1MD9A 2XCRB 1ZL0A 1OLUB 3EUWA 3N5KA 3TEFA 1QYDA 2OCYC 1Q11A 3LI2A 2FZLA 2AI3A 5BNFA 4B1FA 1M34B 3K1AA 3Q1LA 3R6LA 1II9A 4LHEA 2H00A 3JQAB 2CHUA 2PGDA 4OXQA 3RUAA 2OQIA 3B13B 3SQLA 3AF0A 3ZKWA 3ZR4B 5BXYA 1Q0QA 5DI9A 3OJCA 4AX8A 1MFZA 3GEHA 2PRSA 3G5UA 1BVYF 2PBFA 1JLMA 1Y1QA 2C9YA 1DQPA 3E05A 4MWBA 1W88A 1RLMA 2F3TA 1II0A 5DB4A 3DW1X 5FL3A 4LCBA 3RODA 1VDMA 5EJAA 1AZTA 3ISTA 2H0AA 4LHVA 2C9MA 3E6AA 4IR7A 4PX9A 5CUQA 3WK8A 1QLJA 1LB1B 1MDFA 1V11A 1EUDB 2IZ6A 8LDHA 1FFEA 4RD4A 4RIGA 2ZBQA 2PUGA 3QGMA 2I6GA 3W5AA 1LDEA 3D3KA 1K0UA 3PDWA 4WK0B 3D8TA 3NGMA 4Y6SA 3FCCA 2FEOA 3BE5A 2V96A 2G1PA 2D62A 1D4AA 1GG8A 2VHWA 1W4CA 3QP9A 4R6WA 3UYLA 1CEXA 4O4IB 1ND6A 1VMKA 3F1LA 2CBZA 3NMUF 2P4HX 1EDOA 1CRPA 3QEMB 1Y4ZA 3JYPA 1SBQA 1KP2A 3WL5A 1WZUA 4UQPA 2V98A 5LWHA 2OV1A 4CMIA 1P0FA 4NU5A 1FUIA 1W6UA 3MUNA 4RZSA 1T43A 4FZRA 2SHKA 1T9BA 1MGOA 1YL7A 1DWQA 4WK4B 5SY4A 2HK9A 3QXJA 4BP9A 5I7HA 2HL6A 4P4LA 3REQB 4R8KA 1NXSA 3RV4A 4MW1A 5C1IA 3BSSA 4FE4A 1FYWA 3V2HA 2ZUTA 1DEHA 1IQUA 1R3DA 1E2MA 1N2EA 5CDFE 2IH4A 3WGZA 5JPCA 5KTOA 3HFRA 5CBPB 3TCXB 3LCUA 3M4ZA 4QOGA 4W8OA 2ATEA 4B6PA 4CEIB 1R8YA 2P2SA 1LBIA 1ISSA 5JCJD 3I01A 4H4DA 3O8CA 1C8KA 2GQ0A 3E9MA 3U13A 4L50A 2YZNA 2V9PA 2ANCA 3GDOA 3ZV5A 1XALA 4RK0A 5LP6A 3V8QA 2X9QA 4XYBA 5G1PA 1X0XA 2AYZA 1NW5A 1TF5A 4KPYA 4KAJA 2R1VB 5WRFA 4G5FA 1VA5A 1OOEA 2J0UA 4U2CA 4AECA 4TWJA 5E9JA 3LRXA 3DMGA 4TSFD 4FOPA 4DFDA 3T4UA 1Q92A 4XW2A 1C3OA 3MRVA 1BS9A 1BD4A 1YU9A 1NONA 2VDRB 2VF7A 5E6UA 3TO5A 4LGYA 3B7PA 5GOZA 2WNHA 2POCA 2C99A 4BVEA 2KSQA 4C7JA 1AH2A 2QT0A 2ZK7A 2D5IA 4IVNA 3TQRA 1T34A 4K0RA 4P4UA 1NJGA 1Z9BA 1WXEA 2D2IA 3UK1A 1VYHA 3HRHA 3G9TA 3NASA 2C5SA 3E7PA 3E5RA 3OEEA 3IVCA 2BFCB 1M2NA 1ECLA 4MITA 2QWXA 5B58T 1LX7A 4ZK2A 1T36B 4L8VA 1RPJA 3NTVA 4V2UA 4ZVUA 1HNWB 3CWCA 4AYTA 1XDSA 1UQRA 3DE7X 3JATA 2C5EA 4WZBE 2LKDA 5CJJA 5COQA 5KQSA 2ZP1A 4QODA 1B2RA 4NDZA 1F9AA 5FR1A 2AOTA 2DMRA 4EAQA 4JQOA 2F9LA 4TUYA 2QRMA 2G9NA 4Z1MA 2WF9A 3WYEA 3CLTD 1XLWA 1DJLA 3B6ZA 3L4BA 4BFSA 5JVDB 3BJMA 3EGCA 4EPXA 1U5AA 2GJSA 2FN9A 1ICIA 4Q7JB 3W8DA 5DTQA 1VIYA 3JALA 4Q9LA 1JU3A 2IBMA 3PTAA 1Z88A 1ZISA 2IOQA 2OOSA 3BXOA 4MRMB 4Q82A 1LBTA 3IAS1 3IEXA 4D46A 5HF9A 4CUZA 1LRLA 1PJLA 3ICQB 4WOJA 3TFQA 5EZQA 1IIRA 4KLAA 1GZ4A 3PRKE 2XLBA 4F4HA 5BYAA 1TEZA 4IMRA 1VI5A 2QSZA 1E3WA 5DCUA 3RC8A 4LYHA 2H7VA 3HVUA 3LW7A 4MP8A 1AIPA 4H0FA 1NQOA 1IN5A 1QRSA 2ZRLA 5A0FA 1QQTA 2DHEA 5KNCH 4NXNB 1H5NA 3GJTA 5BR7A 4IF6A 2MSCB 3U7FB 3DT9A 1ZRMA 5DIFA 4E51A 3K0EA 4I19A 4DA0A 4LYAA 5AJYA 5LBIA 4XTCS 3E53A 3NXKA 1PQ4A 3REFA 3T7IA 2YXEA 2ZWPA 3AUFA 5AO9A 5F4ZA 2HA6A 2OLEA 4I8IA 2VEDA 3M2TA 4CPDA 2IWRA 1AE1A 2WPDD 3WOVA 2W42A 1UMDB 7YASA 3GFSA 1EMDA 2QE7A 3EW7A 3N2KA 1M5RA 2BMAA 4NSNA 4Q9NA 4QKQA 4PAMA 3WI7A 2WEKA 4B2LA 4WLFA 3FYTA 1LJ8A 4F6LA 1H05A 2QRLA 2PDAA 3RAPR 3OE4A 4MVJG 3TQSA 4ARZB 1KSHA 3HCCA 2YY5A 4J0KA 3U0BA 5GVSA 3SQWA 5K3DA 3TIXB 1IHPA 2QUHA 1K88A 4F60A 1Z73A 4NICA 1QQ6A 5AUQA 1V96A 3IT2A 3RCBA 4E94A 1PSWA 4R2HA 4AJ9A 4JENA 3U3KA 2A1TS 1ZJ6A 5ESDA 5CLJA 5FDFA 3L6RA 3ZI7A 2GXAA 1FMFA 4Z51A 4GR4A 4OQMA 4G0MA 5C1OA 1LQTA 1YRWA 2OHHA 3ENVA 3RSZA 1FNSA 1P7PA 2R8RA 4ZV9A 5AKYA 4EELA 5F5LA 2NU9B 1SUWA 2VTKA 1QG4A 5C8XA 3EZLA 4EG7A 5FWXB 3GGSA 1RBYA 4MRRA 3U3DA 4EG5A 4TM8A 1WDKA 3QU4A 3JQ9A 5CEJA 3ER6A 3IUJA 5JH7F 4O4IF 1OE0A 2Q07A 3ENKA 5K0JA 1USVA 4TKZA 2AJBA 3SYRA 2VUIB 1NR1A 1ZN2A 3I53A 1NNSA 3MLEA 1Z0DA 4JV5B 2W00A 2OXEA 4OSPA 2H1SA 3C7AA 5IJXA 4D41A 5K4GA 2RG1A 3O2SB 1IJFA 1TMYA 4DQDA 3NGXA 5JC8A 2Z83A 4A5OA 5K8TA 5C0OE 3X2SA 4JNKA 3WDSA 4KTTE 1IFXA 1L7DA 1FU4A 1ZONA 3GUYA 2ECKA 3NM4A 4YMIA 1FE8A 2DPHA 2Z95A 3U49A 4ZMBA 1H9AA 2I99A 2X0RA 4N12A 3SQOA 3KQNA 3L6EA 3ESDA 3LMKA 4EA7A 1G42A 2ACEA 3OFKA 1HTBA 2WYUA 1JSZA 1SEPA 3FX2A 4HC4A 5K6AC 3KNZA 4RH3A 4LK2A 2ZCJA 5FBQB 3UAWA 3EARA 2ONCA 1IMJA 2JCYA 4LXYA 3R74A 2QPTA 2X3FA 4GOLD 1Z0ZA 1ENOA 4CKXA 3LGSA 4FSDA 4I5DA 2IYTA 1K7FB 2HO5A 1SQSA 3DLAA 3KZVA 4QDUA 4U4AA 4YI3A 3CR8A 3GRPA 4L15A 4ME6A 4LMAA 3JYQA 3KHUA 4HLUA 4I4LA 3HJAA 2ZRNA 3F0TA 4K1LA 4YP9A 3V4RA 1DTWB 2VK2A 4AURA 2UAGA 1HMPA 1K6IA 3TZLA 2J4CA 2UUPA 1B3BA 2P78A 1ZCZA 3D3WB 4FGKA 2AG1A 5KAMA 4BUCA 1M1ZA 3CKLA 5JNSA 1X7XA 4R9VA 1K7XB 3CUEF 3H2ZA 3ZHYA 2BELA 2ZWAA 4MWZA 3HZOA 2NW6A 3JQ8A 3UMYA 2AXQA 4M21A 1RQ7A 4DLTA 4RHFA 5KYUB 1QB7A 3H8WA 2YC2C 2NUTA 3U4GA 1QK5A 3HXLA 1R0RE 2RBKA 3EF3A 2W2MA 4FW9A 4NP6A 2XE4A 1P4HA 1JMYA 3D8SA 3HS3A 4CM1A 1F8FA 4IV0A 1OFUX 3ZHXA 4AQDA 1Z5UA 4TV9A 4B33A 1GWNA 2DPLA 1M74A 1Z2EA 1Q14A 1TEXA 2AW5A 2P9YA 3M6UA 4IWYA 4WXPA 5M3BA 4RU1A 2BRUA 4QG3A 3RSLA 4NHOA 4HDCA 2XEDA 5BYBA 1U3CA 1JVNA 4Z4GA 2BMWA 1ZEJA 4A36A 5TPZA 3OIDA 2DWPA 5K9ZA 3L4KA 1SHKA 3M9LA 4G9GA 4QA9A 1VG1A 1O77A 4FJ2A 2Q49A 4XDYA 4ZD6A 2B1QA 2VDJA 4KRXA 5BSRA 2D59A 1JHUA 3RSOA 1GYRA 4YXWA 1PWEA 1Y1LA 3R7NA 1N6IA 1XZCA 2D5CA 4E09A 3U7IA 5KC9A 3GLFB 1Y6JA 2VXYA 4GS5A 4HEA1 3KKOA 4L51A 3IVGA 4ZYTA 2AJDA 4PE5B 1GUZA 5AK5A 5IVPA 1VCHA 1CRWG 1CUAA 2NGRA 3S44A 1P0QA 3H1FA 3NDPA 4U6SA 5EJ9A 1EA5A 1KO8A 3TSZA 4EBFA 1NVVR 2A9JA 4PLPA 1JDZA 1XYYA 4OO3A 2WJIA 1LS6A 5C8YF 1EIWA 1P7ZA 2Z8YA 1AG9A 4BU1A 3HYSA 2BM9A 5EERA 1PNVA 3JQPA 4KDEA 5KKCA 3WB9A 3H6KA 4XB2A 5LB2A 1AK9A 3OZXA 2I8CA 2JAOA 1S01A 2IDMA 5C4MA 5IWCA 2X2FA 2XECA 3L9WA 1YDMA 5IFKA 1BA3A 1N33B 2WUFA 4ZVLA 3DFFA 2WT4A 1MFPA 2H29A 2ORWA 3I5AA 1YC5A 2INGX 2RHLA 4PO1A 5ELMA 1F38A 4P98A 4ZVRA 1U7WA 3VOBA 4KQMA 4A2PA 4BP1A 4WESA 4IUDS 4K6FA 4RSRA 5E38A 4YCMA 1VHQA 2MINB 1U8AA 3I6YA 3ZQKA 4BRZA 1CUVA 1YZTA 4TRJA 4U7TB 4Z0TA 1W85B 2EW1A 1Z06A 3JS5A 2B1JA 1EPUA 2Z6UA 1PW5A 4QYIA 5JW6A 4CQLA 1GO2A 2G0TA 2GILA 3ANNA 1BCRB 2MWMA 3WGKA 2H4WA 2J41A 1TTPB 3OPXA 4NYIR 4RW0A 3C24A 3HJGA 3ASVA 4MIOA 5JNVA 3LDUA 1P17A 2Z5FA 4OHOA 3M5PA 3GV0A 2E4ZA 2OAQ1 3IUBA 1DAIA 4BO7A 4Z54A 1PTKA 1H4TA 2XYQA 1GXSA 3SMQA 4K6HA 3MT9A 1DLIA 2EKZA 1T3HA 4OHZA 3K9LA 4LV8B 1GUFA 2ZJAA 3TDMA 2QMQA 4MV8A 1RIFA 4PLYA 2GOYA 1VL8A 3IMGA 4X44A 5FOWA 1X9GA 5SY9A 2V0CA 3KQHA 4XYEA 1O2DA 1CNEA 2P35A 2QYOA 3PDIA 3Q3GE 3G1WA 3FOZA 1DAHA 3CPEA 1Q7BA 4HFMA 2ZULA 4GX2A 3K9BA 4MRPA 3Q88A 2W8BB 1E1MA 2G7MC 1QHXA 1SKBA 2P7HA 2R5WA 1GCIA 3H16A 2C94A 1XN1A 1EFPB 1W2GA 2BBWA 2GFHA 2NYRA 2QU8A 3I0ZA 3O73A 2AG5A 3QELA 3AHFA 1NFQA 2G9ZA 3R40A 4S35A 1N2JA 4X1IA 4BGDA 3SVTA 2J9ZB 5EIFA 1T5LA 1CDDA 4BKRA 2ZSKA 3DE6X 4HGNA 5FUVA 1OKKA 3M6LA 3UCXA 2EAUA 1EX6A 2CNLA 4PHHA 1BRTA 3G0DA 2ZVJA 4UDXX 1NASA 1D3AA 1L7RA 1TJ5A 1GRVA 3JWHA 3NNNA 4OXXA 4IKOA 5KVAA 3RVMA 4F9EA 4LOIA 4UHCA 3SU8A 4EO7A 2ZETA 5BYJA 5IKPA 1V71A 2O2IA 3E3AA 3TNJA 2RH8A 3EWSA 1Y7PA 3CIOA 1U6IA 4WIAA 3W79A 1UOPA 1SU7A 5KYYB 2YVLA 2PQ0A 2QENA 2XF8A 3AEUA 2LCIA 2Z43A 3DTYA 1ZH6A 4O1IA 2JVJA 2ZRKA 1B74A 1S89A 4HH0A 3ZG6A 2X3UA 3CNBA 3PC8C 4XVHA 2PV0A 5FTKA 3UBTA 1OXVA 1LLDA 5IHPA 3GLGE 1PHRA 1KY2A 3K4HA 4R8MA 4N3AA 4BNFA 2BFEB 2LIVA 2QZ4A 5D7NA 1R0LA 2B20A 1WZEA 3X43A 5LKRA 4R3UC 4YRIA 1GG2A 1WZ2A 1OGIA 3ABSB 7MHTA 1U5BB 2AXPA 2ZUVA 3LT2A 1W0CA 3QSGA 3QVOA 3VTAA 5CM2Z 2C3OA 3ZDZB 1PLLA 2PGJA 1FJ2A 3BQNB 2DLNA 4HI0E 4GLBA 3ZWXA 2WVAA 2XVZA 3GJ7A 3HA3A 4MLZA 3GB9A 1QANA 1NN1A 5HM8A 4DBZA 2WVHA 2AFVA 3FCOA 1K86A 5B7GA 2HHAA 5JZ9A 2CFIA 5CYFA 1DNPA 4A03A 4P81A 1VHJA 2IHTA 5AVXA 3W2TA 2FMTA 5CEEA 1KYTA 2OE2A 3H2HA 3P2OA 5BWBA 5I45A 2HW8A 2Z3WA 1T6NA 1LDBA 3L5OA 4M1MA 1NSYA 1GG5A 121PA 2A3NA 4DCPA 2PJRA 4FFBB 4TYYA 1C3XA 4W5RA 4B5LA 4X7BA 3N1UA 4G4GA 4ERNA 4F38A 1I94B 1AURA 3NBZC 2XKKA 3E2IA 4UEQA 4BNZA 1MZPA 3G2OA 1C8LA 1XYVA 1HLFA 3W06A 4KIUA 4XARA 2HCRA 3ZD8A 1NF9A 2W2KA 4EWLA 4J7CA 2GZ2A 3ZVKA 1SCUB 3ET5A 4DYDA 4QTTB 1KJJA 1YQWA 3ACBA 4NV1A 2QTLA 3GFOA 4LAFA 5JISA 2GAAA 4XRGA 5DT9A 1N3LA 3N39C 2X6RA 1P1KA 3MB8A 4L0DA 1L7MA 2CJXA 1OXKB 3HY6A 4UUPA 5AM5A 2R2AA 4IZHA 1DMSA 3RFVA 3R23A 4KZPA 2G9QA 1FL9A 4LHWA 2G4VA 3P9YA 1KZHA 2IH5A 5DF1A 3KDAA 3PUJA 1E9DA 3TSAA 2P9CA 1CY2A 5HGJA 2ZUWA 3FIJA 3LA8A 4RJIA 2PWBA 5I9TA 5G4KA 4PM4A 3V6MA 5JMWA 2GMWA 2DU8A 2XGOA 3PQEA 4M9RA 3BWCA 5BSHA 3ZDEA 1ZGGA 3KQYA 2PLWA 4UJ3A 3ADDA 1RXUA 1YGPA 2XODA 1QIEA 3UW3A 1Y6FA 5DSXA 1SVIA 3L1UA 2LIPA 3QWIA 1D0SA 1H2EA 2ZI4A 2BGGA 1DAOA 3BORA 3H65A 1ADBA 2UUAB 4EJSC 1X1AA 2F1RA 1VLHA 2J3KA 3CRMA 1PR0A 4C21A 4EMTA 1UPUA 5L6LB 3BSFA 5MFZA 1EZ1A 2I78A 1NZJA 3PQ2A 1KEZA 1JP7A 2VNAA 2VPIA 3IYLW 2E1RA 3MAAC 3VFDA 4LGMA 4DIUA 5G4LA 4CNQA 4BFUA 1IN6A 4ZT4A 2O8DA 3VYRB 2WYOA 1OFTA 4IDNA 4OGLA 1VRCA 1FDSA 3OFJA 4FB4A 4S24A 2YV1A 3NWPA 1RIIA 2GZHA 3WBBA 1M1NA 2Q3JA 4JR1A 2IYQA 2JCXA 1A8QA 2ATXA 3H5OA 4JQZA 4EX6A 2AJ8A 2ISCA 3K70D 3U31A 3TQIA 5EMLA 4UNPA 1RMYA 1E0AA 3OOEA 1A9RA 1ORHA 2ID9A 2GNAA 4MPJA 4O1MA 1EHCA 3FVQA 4PR0A 5IAGA 4UOEA 3AVUA 3WNBA 2VPTA 1XVIA 2FSSA 1DZIA 3QTBA 4Z8YA 1J0BA 3LDGA 1ODIA 3Q3VA 2CXHA 1PUJA 2RH9B 3DAHA 3E9ZA 4TSKA 3Q0IA 5TPZD 4N0DA 4P7JA 1C7FA 4BB5A 2FKNA 3H5LA 4B3XA 2GJAA 4CQNA 4ZAXA 3KZMA 3OJXA 2XXAA 1ZN9A 1Z2CA 3DHWC 3LTEA 2D3WA 1Q21A 1ILWA 3IR5A 4I3FA 1CHNA 2CDRA 4JSYA 4F4CA 2NAFA 1KS9A 2EZTA 1PJBA 3RUIA 3FUWA 1WBDA 4GZ3A 4MQMA 1T9ZA 1MO3A 5TMEA 5IAAA 3L1KA 1Z0IA 4RQUA 4TV8F 1X19A 4NU0A 4ALKA 2GXUA 5TF0A 3PK0A 4Y6PA 3GFTA 1YJCA 1Y9AA 3GR6A 3E3OA 1R37A 4L7QA 2W5UA 4FYXA 4LDNA 4Y2SA 1GRQA 3MRTA 4ENPA 3IGFA 3G2PA 4EA8A 4Q9IA 3AQ4A 4YMHA 2H2IA 2FR8C 4EJ6A 4Q66C 2F55A 2EYUA 4GZLA 4OK6A 4EVIA 1DMRA 4N6NA 2IFTA 4P35A 2DUMA 3TRIA 2J8ZA 4DV0B 1M2EA 1JWAB 4M1OA 2HF8A 2KBEA 3SXUA 3IDQA 3VSAA 3WGHA 4ARUA 3G2NA 4M99A 3GG2A 4Q02A 3TTYA 5DBFA 4M1QA 3D81A 1LNZA 3HN7A 1JJ7A 1SKYE 1STOA 1D1TA 2RIRA 3FMFA 3I76A 3UH1A 4YDRA 3X3HA 1ZM2A 4PLGA 1HE1C 1RWQA 3EJWA 5C1BA 1NXPA 1EXMA 2E3JA 2G5PA 2C4VA 3OWHA 4IX1A 4AXXA 2E5LB 4W5OA 1V8FA 4D9CA 4EUNA 4XB1A 1SBYA 4TT8A 1H0RA 2BMDA 3JQBC 5ALVA 3AVXA 2CEAA 3GBVA 2AXEA 3E3NA 2QRNA 1BQ3A 1HFKA 4GZ5A 4HAUA 4RLFA 4WQMA 1DINA 4FIDA 1HG1A 3OPQA 3ID6C 2DVMA 3HUEA 3VAZA 1AY0A 1YS7A 1CS0B 1PGOA 1UXIA 3OM1A 3OT1B 4QYMA 1UAGA 1HRKA 2NV0A 8ADHA 2Q1UA 2XXAB 1TNDA 3RIEA 1ZKMA 3JYHA 4K9NA 2VYFA 1GZ5A 3PKJA 3TIGA 2B82A 3AIIA 4WBNB 3MTGA 3SQDA 1VL1A 1DKQA 1GYPA 2NSDA 3OLZA 3OBBA 3Q87B 1C41A 2O07A 4M6WB 1GRCA 1WB5A 4OPMA 5F77A 3ER9A 4MVJP 1XKXA 3OCUA 5CLLA 4F45A 3EG5A 4E11A 1UFOA 1PJRA 5AXBA 4EMUA 1PKEA 4D42A 1VB3A 4GSKA 3I2YX 4LNUB 2NVBA 4FHEA 4D4LA 2ZT7A 5AKEA 3AOGA 4FWTA 2RHDA 2RD2A 3JD2A 2UYYA 1GZVA 2BH9A 2FZKA 3LUBA 3TW8A 1G3RA 3VMFA 4BNVA 4D4GA 5KYKA 1WXDA 1DEAA 4L73A 2CCJA 2JHFA 3DBLB 4WMLA 2EOAA 2P3OA 3CMCO 5ADVA 2BSQA 1KSJA 3UJ7A 1FVHA 1QSGA 3GEDA 4RXMA 1J22A 4Y9RA 4B8YA 2V5AA 4RA9A 1JWLA 1UBHS 1OC2A 1CQPA 1YRBA 2VNJA 2JCGA 4XXHA 4TLDA 2M6RA 4KE9A 1SXGA 2Q3CA 1LCIA 1V8BA 2AWNA 4WXHA 1RBZA 3CVJA 2WWWA 4RHYA 4DLZA 2JLWA 4KXMA 1LPPA 4L07A 2ZYVX 4N8SA 5DTRA 3VJLA 1OH5A 1FMTA 1E89A 1TJPB 3MIZA 3LRPA 2GKOA 2I9PA 4HLDA 1I1NA 3LBAA 3WNZA 4OJQA 4PX5A 3A2KA 1AQJA 4MEJA 3WBKA 1EVJA 4YRZA 4X7MA 1ULUA 2X6QA 4AKHA 1NVWQ 2PZAA 3HG7A 1LBSA 2W9XA 3O2NA 3SP1A 4CT0A 4AN0A 5DX1A 4PBSA 4CKBB 1WB9A 1TYAE 3HA5A 3DBRA 1CERA 3AF2A 1NRJB 4LQ4A 1RACA 4YONB 4CU5A 4FFLA 3B48A 3M1IA 5D6OA 4FDTA 4ZV4A 5JRZA 4QNMA 2O2EA 1NNEA 1T2FA 5THXA 5AOBA 4CKCB 3A1NA 4UE3S 1ZUD1 2WY2D 4YRMA 2P5TB 3QXSA 4DC1A 1HLDA 5FUMA 3FNFA 4WT7A 4IQ0A 1QPBA 3AJDA 3ELDA 4G97A 2P0YA 3M3HA 2D1SA 3SYTA 4O4HB 1J56A 5DNDA 1T1EA 3UOWA 2CMFA 3EA0A 4I3GA 3LP5A 3WO1A 3TSYA 1QB8A 3UJDA 4GMDA 3L49A 4V38A 2W2KB 1R3UA 4KTVE 4R9RA 5LPNA 4JXJA 4X8MA 1JIVA 4U9UA 5CJ2A 3X1WA 3O9VA 4YLGA 5JJIA 3TECE 2QTMA 4LQDA 1M2OB 2G04A 1QBKC 5EP4A 1ZOLA 4IPTA 4DM7A 5D5QA 1JYSA 4DM4A 2P2CA 5DNEA 1KDOA 4C4TA 5B55A 3KB2A 3FYUA 3Q7QA 3PXEA 4QGGA 4TVBA 5CT9A 3OCCA 1U8TA 3VOTA 1EWKA 5AVJA 4YV7A 4F86A 4RF3A 1YB5A 4Y2GA 3ZDXB 3AOEA 3TQCA 4X20B 5EIBD 3G85A 5JH7A 4D9EA 5DHRA 2A78A 4D9BA 4KX5A 1L4FA 4HYQA 1PWXA 5BWNA 1QCDA 3V4VB 4OHMA 3FR7A 4P7BA 2IHNA 3SY8A 3RSCA 2QR3A 4CN8A 1M76A 1XJWA 4QUJA 5CG2A 5IP5A 1F20A 4OGWA 3O3NB 2JFBA 2Q45A 4I9FA 1G59A 3WRXC 2VUUA 5AW1A 2XMPA 1UODA 3PU6A 1I7NA 3DC2A 3DJFA 2OCIA 2OZPA 3GJYA 4G1UC 4HZUA 1KH3A 3K0CA 4C87A 1CUHA 2PVPA 1Z75A 3VPDA 3W77A 4GMGA 1XRQA 3D8BA 3HNOA 1X42A 3L7BA 3NONA 3DMTA 3CRNA 5AW5A 2KB0A 4E3ZA 4E6PA 1MIOA 4LJSA 2JLQA 3TX2A 4EG8A 4DSTA 1A98A 4UARA 3EFBA 1X7YB 4O5AA 4YNBA 3LBYA 5TB5A 3AV0B 2GJ9A 2ZSEA 3FDXA 2HN9A 3FOAA 3EGWA 1DCFA 4HFJA 1KQNA 2NVUB 1KDVA 3CG0A 3T35A 2QT1A 3BWYA 1QTRA 1DIGA 1JKJB 4BAUA 2UYOA 3HDQA 2X6TA 3MJFA 5FWYB 3B6EA 5KYTA 4M83A 1KOLA 1H6BA 4LOKA 5AW4A 3HFSA 4I1YA 1KETA 3VBCA 4X3CA 1LBEA 1P62B 1Z8NA 1C1HA 3OLWA 4O5OA 4AZTA 1NI4A 2J5BA 4S12A 4JI6B 2I62A 4ZC8A 5B6IA 1F2UB 4Z7OB 1N1EA 1EFPA 2ECPA 4RMJA 4D80A 4DIEA 1KTIA 2EGHA 3AC0A 3DPUA 1SKAA 3BTSA 3QPBA 4A8JA 1YB1A 5JPIA 4UE2A 3MJTA 4ZAZA 4HAOA 5KPJA 3C6ZA 3E8SA 4R2MA 1YRQA 4NCJA 4XLTA 3LC0A 2B7BA 3UC5A 2I7XA 2QQEA 4KFRA 4WL0A 5E4TA 1QCYA 2GFIA 1C3VA 2RHHA 2WJHA 3G8AA 3OCVA 1OLOA 3B6JA 3JPWA 4RS3A 3OPMA 1WUTA 1OIXA 3U7RA 4FI3F 4KQJA 2OK7A 4Y6LA 4EENA 4Y9UA 3CVOA 2QVLA 5EMMA 2FMUA 1XOIA 1E8MA 4BN4A 3BMCA 1T2EA 3N0XA 1NLZA 2Q0QA 1OXUA 4UUMA 1YCFA 5EHXA 4H3KB 1H6DA 1XSEA 1OXSC 1EINA 1EX9A 2D5LA 3PHCA 3U3XA 1PFWA 3UJ6A 1DTSA 1BCRA 1YHNA 1V7CA 3MC1A 4PHTA 1DSSG 1UXGA 3NIDB 4R81A 4WFKA 5DOZA 3X1ZA 5KINB 2UVPB 1ZIOA 4NEQA 3HXPA 4YDSA 2OZVA 4Q4DA 1F06A 2BV3A 3U1TA 4JT2A 5EZYA 2V6FA 3DE5X 1MAUA 4TMYA 2FOXA 4EQ6A 4CGZA 4C06A 1CZUA 5G02A 4GQAA 3PENA 3WX0A 3KOYA 4DLWA 3RAEC 5A4DA 3DOIA 3G82C 3HN6A 1X1DA 4IVRA 2FE4A 3ZUGA 2BBSA 3ILHA 3AILA 2VDUE 2FZCA 2BR5A 2XZTA 4PGAA 5HQTA 3R5KA 4XCQA 1DPGA 5E4YA 1WUYA 3RUFA 4CW7A 3T52A 1WXQA 2OZKA 4GI2A 1OSNA 1PQYA 1G8YA 2P9BA 4BV2A 1FNNA 4ND8B 3PGXA 3KK0A 3NHKA 1X7GA 2HSWA 4G0ZA 3RC7A 1P61B 1G8SA 2BZ1A 3MS2A 5AKIA 4TYWA 1SOVA 1V7QA 4RGVA 1WF6A 1J90A 3PFIA 2FSIA 2HJHA 1E1RD 1I36A 4QJ4A 3LLSA 1W5FA 3GPIA 3KDPA 2WPNA 4LN1A 5JDCA 5JO0A 4BKQA 4HXEB 3PHGA 4KDCA 3GZ4A 1IEVA 4RYLA 2H1LA 5BN3A 2VT7A 2X1VA 2GD6A 2ZJ2A 1N2CB 3HB7A 4BV9A 4QAQA 5CAEA 2JASA 2I6TA 1JHDA 2OVFA 2IE0A 2WC1A 2E6UX 3KLMX 4X3OA 4C3VA 5IVHA 1KMIY 2JIBA 2HJVA 2WSSA 3OM0A 3ROZA 3JQ6A 3CXUA 4HDNB 3QVKA 2C1ZA 2V7PA 3MS7A 4PTLA 1T1GA 1B15A 1YR6A 4G4IA 3JYOA 4K5QA 1X7ZB 2X23A 4LWPA 4QPNA 4RAOA 3TRDA 3WK9A 2WP8J 3ZV6A 1GJRA 3VR3A 1H3EA 3PT9A 3U3JA 1B6GA 4PZ0A 4DDWA 3TLGB 1I3MA 3HBAA 2FG7C 3T3EA 1S1MA 2ZYTX 4WZ6A 1PR2A 2HWUA 4PO8A 2CJFA 3PDCA 5JASA 4G1MB 1N2SA 4CTNA 4X63A 3E0XA 4LY0A 2QLTA 3MUFA 4KWIA 3S2ZA 2OQRA 3QY9A 4B6SA 4TKUA 2ZM6B 1ORIA 4BLQA 2FZGA 3SNKA 1O97D 2EJBA 4NS1A 4OXKA 1WM1A 1HKHA 2WT9A 3BBPA 2NVOA 4W4TA 1UM9A 4P3XA 3SDSA 2EDAA 4B3GA 2E7ZA 1QNLA 4RDCA 2JFFA 1WMAA 421PA 1AVTA 3D6HA 1Y81A 1PZNA 3UATA 5KYUA 4CNBA 4M8KA 2Y77A 4PRLA 3JZDA 4HNTA 5CT4A 2FZWA 4J16A 2QEQA 4QECA 1WAMA 2QD4A 1ODSA 1XEWY 4AG5A 4TX1A 1EUZA 4LI3X 2QUZA 3AG6A 4CM6A 4D3SA 3VBEA 1I7QB 2V54A 3UMMA 3CZ9A 1YQXA 2I4NA 3C6YA 3Q2OA 1QV6A 4JAVC 1LA2A 4J0JA 4PLWA 3VH1A 1M1XB 1PAUA 1VCOA 2IF0A 3WHKA 1J06A 3WHIA 1WZIA 3RFCA 5DM70 4H1HA 4N76A 3LSTA 2QHXA 3ASZA 3RSQA 4PXSA 5LOVB 2R4TA 3R9KA 1GFSA 1W19A 3BMXA 3AEXA 4KW7A 3K92A 5I9IA 1ZOSA 1G8MA 3NEJA 5CK4A 5AP9A 4DJFC 4ZCRA 5K0ZA 4QXAA 2X1MA 3ZLTA 3WIDA 4LTDA 5CB0A 3FB1A 4B73A 3INYA 3HJTA 3OFSA 3W3AH 2GJ8A 4REOA 1O9GA 1RXIA 4NCHA 4XOIA 3PPYA 1YNOA 3EZFA 4URWR 1XC7A 2Q6IA 3O3OB 4GOKA 1D0VA 1EGHA 1M2VA 1OD6A 3AUJB 3O3MB 1OB5A 3DLCA 3U80A 1YJQA 3BGIA 1EUYA 2QSUA 4LDRA 5NULA 3U39A 4FN4A 4LSZA 4EQ6B 5F2NA 2RGRA 1UDAA 3EGXA 3ES9A 3U7QB 3WJ1A 3A4YA 4LE1A 3AR6A 4X64B 1NI5A 5BVGA 2KE5A 4WLUA 1P8AA 1PLKA 3E27A 3IKMB 5DGCA 2GVNA 3CKYA 3HUDA 4FHZA 4UCXA 5KC8A 2QRVA 4IUYA 5A5VA 1A4IA 3WK6A 1U0RA 2RGWA 1MV5A 3WWPA 5CA1F 3ZHQA 3NWEA 2QX4A 2ZIXA 2C54A 1DC3A 2EDCA 5BT8A 4TSRA 4R4JA 3TR6A 2QI9F 4DKXA 3UMCA 5KCZA 1EEXB 3MGKA 2RFLA 2C5FA 1KNXA 2B8EA 1UWKA 2C8JA 3L93A 3P9NA 1UEJA 4JFAA 4LCJA 4CTJA 1O94D 1UDWA 1J20A 2D4HA 4XUCA 1I7SB 2IXTA 2BCGY 2H54A 2ZTVA 2X8JA 4AZ0A 4NS4A 1YVEI 3R7WB 3AVQA 1UCFA 1Z62A 2RJ3A 4FDVA 2BWJA 3CEAA 1VE6A 1P74A 2JBHA 4F97A 2OT3B 5I01A 1CW2B 3FXAA 4L9RA 3CE9A 4I2NA 2QVZX 4BOYA 4DWJA 1G20E 1L8LA 5ALZA 2P4QA 3ICEA 1TTQB 1L9XA 3QLTA 3D6FA 2H48A 2R97A 2Z9DA 5LP6C 1TCCA 1PF7E 2R7LA 3BH7A 4P08A 4CF6A 4TTAA 4XIJA 3KKEA 3O95A 3QOFA 2IIVA 3ESQA 4PZZA 1TI7A 1U2ZA 3A3KA 5AVSA 4LGVA 3K9CA 3KWLA 1MVOA 3NV7A 5EE5B 4ZU3A 1VDZA 5IBRA 4LHYA 4REMA 3M49A 3SJAA 4LWZA 1JT2A 1ZUIA 1X14A 3BRQA 4JT4A 5FNVF 3BGWA 2ILVA 3SSMA 1LSJA 4QIHA 1RXSA 2WE7A 1ORVA 4BVFA 4ZYLA 5I9LA 3QVXA 1AKYA 3CB4A 1RC1A 1L5WA 2D2VA 4H1VA 4XDZA 2BE7A 1DFIA 2L19A 1OV4A 4KFSA 4WN3A 3ZOKA 1FQOA 5EP3A 2EQAA 3SFVA 1VCIA 4N54A 4I6EA 1SHUX 4CU2A 3B3JA 1UADA 3QKIA 3ANMA 4HGPA 1TO2E 2ONKA 3RTEA 1YVUA 1JRLA 1P2UA 4YV2A 2JGIA 3COWA 4CUJA 4E2ZA 3R8FA 3L41A 1L5VA 3OBIA 3HU3A 3QMVA 4BYMA 4RD3A 4BGUA 2JAXA 3IKJA 2IBTA 2I6SA 3GPBA 1PFGA 5L8VA 1I6MA 4MRNA 2NYAA 2ZTUA 2ZUDA 3L7IA 2EJTA 2AG6A 2OHJA 1XRRA 4CMEA 5B1IA 3RGWS 1YMUA 2BEVA 2QUBA 5JS1A 2JLVA 1NP3A 4UM8B 4M0MA 1HM5A 4JJFA 3MK31 5FTNA 2QZJA 3CNEA 1UBTS 4JQSA 3K0BA 5FHRA 3OTHA 2F1IA 1JFLA 3D4OA 1E1LA 4KXLA 2D7JA 2HH9A 5LDHA 2VVTA 1L5ZA 1VLMA 1G64A 3GT4A 3E9DA 3TLJA 2AMJA 4HAYA 2UXCB 2WJVA 2R1TB 3OMLA 4FW8A 1KFKB 2G09A 2IXGA 3IO5A 1V5GA 3Q15C 1FVXA 2FRDA 1BW9B 3AJ9A 1NDQA 4WI1A 4TXHA 2OR3A 4EUKA 5CITA 5JHGB 1V4VA 1PJ4A 2WW8A 2ZVQX 3L0IB 2GXSA 3N28A 3KIPA 1H2ZA 4TTVA 3VZRA 4BLTA 4A92A 2OK8A 4WW0A 4FE3A 3F4BA 5IABA 2AEMA 3FSRA 4AJ2A 1O54A 4WBNF 1Z2DA 1ZJJA 4WFJA 4BQIA 2BEWB 2VS1A 1KK2A 6NULA 5EMJA 1Q7EA 2BJWA 1K8RA 3FZQA 4PFSA 1YB4A 2C4HA 4KQXA 2HBRA 5CCBA 2GBCA 3WNCA 5FT9A 1TB4A 3WV4A 1I5RA 3FH0A 2FFQA 3I32A 1FS4A 3WLMA 4KITB 4D4HA 5LFAA 5ILOA 5KJ6A 1VMIA 4NK5A 5JBNA 1T1IA 2F6RA 2I03A 3NS7A 2JFGA 3U62A 2GASA 2QYTA 3L84A 3CHYA 1L5MA 5E3HA 1X7WA 2PLFA 4N7JA 1BDBA 2BUCA 1BMTA 1BHO1 1N3BA 1ZM4A 3LCVB 3A9VA 4BLOA 2W7TA 2CFTA 4IF4A 4CKCA 4S1TA 3DLTA 3ETGA 2HO4A 3S7TA 1UDRA 2J0UB 3LKZA 1YKFA 3CBGA 5TSDA 1VCMA 4FOLA 1NURA 1K8QA 3AL2A 3FKQA 2BM8A 4DNXA 2JS7A 1AO3A 4BJ5A 2DFVA 3NUGA 1EVKA 4F1WA 2E1PA 2EZ9A 1RWMA 3K72B 3JR7A 1E9BA 1ZVKA 2H1CA 4FYMA 1XI2A 2VA9A 3H4IA 1KHTA 2PK3A 3HBFA 4AZ3B 1DJPA 1FRFS 1LI5A 2CFRA 2PYIA 2P75A 3L0OA 5DM4A 4EPTA 3CC8A 5BSMA 2FQQA 4B5KA 4EVSA 1MVLA 1R5NA 3F47A 1TYDE 3HFGA 3DWFA 1TAHA 3GAAA 1OBOA 2ORYA 4NHEA 5EC8A 4ALIA 3ELUA 4OQNA 2BTEA 1BAPA 2ECOA 3NANA 1F8GA 4DLKA 2Z1DA 4LYGA 4JXZA 1YO6A 1MABB 1IBRA 2H08A 1KDRA 3HGQA 4IHAA 2IX3A 2Z04A 1PVDA 4IQGA 5AVOA 2WYIA 1Y80A 5K0BA 1MOZA 2JFYA 4F3CA 1SUCA 3REQA 3KUUA 3R0QA 1YASA 3TPFA 5CA0F 4LGCA 4AYWA 5KOJB 4WACA 1D5WA 1TM5E 4B2PA 3KUKA 3OFND 4M9UA 3BE8A 4CMIB 1OHHA 3JRXA 4IIVA 1WNTA 5FFMA 4DR3B 4A6PA 2HNKA 4BB6A 1E3LA 4R2WA 1RU3A 3AVPA 2WSBA 1WDLA 2D1TA 4DSAA 4K6OA 4M7PA 4R2XA 2PUTA 2GAOA 3MQ4A 4RSHA 1DBWA 4JBLA 1QVWA 1W5SA 2BUAA 2EATA 3GAZA 5DCYA 4RPHA 4AO6A 4BMPB 1SWVA 2XNSA 4B46A 2PKWA 5KS2A 1QE3A 1P4GA 1T8YA 5GZ6A 3JQ9C 2IH2A 1BU5A 1BHSA 3EQ9A 1GAJA 5DV9A 4GX5A 4D8UA 3JWPA 1EUDA 5MGNA 1EK1A 4JR2A 5DIZA 4U00A 3C4JA 1FTSA 2J5RA 4OAQA 1NYLA 1R00A 4LC9A 1A4UA 2V59A 3CPSA 2COUA 5LCXA 3WA6A 3D3EA 2O4CA 3LU1A 3G79A 3G6WA 1YBAA 4B3CA 1TZCA 5TLSA 1ZW1A 3M5CA 1VE9A 2G4LA 2NVWA 2ERYA 3NDJA 1XWIA 3HYCA 5E7JA 4AFNA 5C5IA 2I2DA 5MN6A 2C4NA 2A86A 3PX3A 2RJOA 1EWQA 4OH7A 4WOCA 2VF4X 1B14A 1TYZA 1DJOA 1W6RA 1WCV1 1PU2A 3WSVA 4U3JB 4TL7A 1X9HA 2D06A 2HF7A 2FMIA 2I91A 4JP5A 2O20A 1XZNA 4LC0A 3OIFA 5FX2A 1GPH1 2OV8A 2WABA 3R5TA 4I1OA 4N5DA 1L5KA 1SC3A 3AR7A 3TNDA 2JI4A 2HZBA 1CZKA 3P97A 2FW1A 4WJLA 5E0OA 4F7DA 4QLBA 5HOQA 3FBTA 1F4PA 1QYXA 3MAGA 2RGDA 5THKA 1XCPA 4U7FA 2G5GX 1KVQA 2ZITA 3OQ1A 1Q17A 1QHIA 1T6XA 4EHAA 3HO1A 3U48A 1TCBA 1XMXA 3A4MA 1UKYA 4MKXA 5KOJA 3ZY2A 2B2CA 3UUWA 5D8DA 3UK0A 5JS8A 4ZEWA 2XSZD 3DQZA 3KOOA 3R41A 3RS7A 4N39A 2KBFA 1RFGE 2DZDA 2OG1A 2RCYA 3LVQE 4PWZA 4R2LA 3S68A 1K5PA 5AVQA 5LD2C 1H6AA 4X61A 1CXZA 2GPNA 2WTEA 4RY8A 1N0WA 2PMFA 3DZIA 3HPQA 4RHUA 2W2NA 1UJBA 4TRMA 4UHEA 4KE7A 3F74A 4CL0A 2GBIA 1VG9B 3I05A 3NAGA 4MYUA 3L07A 3ZXXA 3V2UA 1FW6A 4RMHA 5A06A 2YDXA 1YQ9A 3GDFA 4K9DA 3TJMA 1N2CE 1B8UA 1R12A 2XE7A 1T9GR 4PHCA 5D6NA 3VMMA 5LQRA 3OZ7A 4NXMB 1DT3A 3F5DA 3PHLA 4LJ8A 5EINA 1GGKA 3VI4B 3ZEIA 2XEXA 2ZRBA 3I6QA 3DXXA 3OIYA 4ZCPA 2J32A 3KC2A 4XGNA 2YWJA 3ZJVA 2Y92A 4EYEA 5DYIA 1P45A 3PIDA 1EWTA 4NONA 4M1WA 3Q8LA 3GGDA 3SQMA 4H0CA 4RTJA 3R8CA 4X90A 4WZAA 1EDEA 4FINA 5I6DA 5DOVA 3D6UA 5JSYA 4INAA 1GGJA 3FYSA 3KR9A 4ZALA 2Q5EA 2GBLA 1WHTB 3ZGNA 3MQFA 1SG9A 1QRRA 1NVXQ 5LZ2A 1DIRA 1GVHA 2BEWA 4XSGA 1QHHB 3C7TA 1JPUA 1PWHA 3UFXA 1XZPA 5KNCA 2C4MA 3N0WA 3CEMA 4MR8A 5K2MA 4RJKA 1E4VA 2VK1A 2WHQA 3DR3A 4URUR 2W2OA 2YCBA 1NQVA 5BOSB 1SY7A 4TRRA 1L8QA 1QGOA 1QUEA 4LVNA 3NIFB 1BW9A 3I5YA 1RKVA 3CPJB 1E58A 1Z08A 3Q6IA 4D3XA 1M73E 1ZNYA 5IJZA 4JI0B 2YQ4A 3B52X 2R1TA 1DGQA 2ZI5A 1K7EB 2NXCA 2B5VA 1IMOA 3OTWA 4X8OA 2RH5A 5IUNC 2VNIA 4ZRMA 2GPJA 2XVYA 2BN4A 3NAZA 4I9NA 2IODA 5K6RA 5CNJA 2NTJA 3DTVA 5TQJA 2O19A 4JP8A 2L2QA 3NKFA 1PT5A 1OGYA 1XLVA 1YK0A 3BIJA 3GQBB 4P84A 5EKTA 5JSHA 3AY3A 3K5IA 4P7GA 3MS4A 4GRAA 1CJMA 1EVLA 3EF0A 2QX7A 3PBKA 4TMTA 5F1PA 1YB2A 5BQPA 4O2AF 5BV2P 3GCXA 3ETLA 1JEOA 4TQUS 1OZ0A 2VJMA 2WF7A 4RIHA 4WA8A 1NBWB 4WZBA 3URKA 3SHFA 4YCLA 5C81A 1KY4A 5IAKA 4E1BA 4OM7A 1UBJS 2W11A 4HS4A 5HK8A 4ZC1A 4A0QA 2G1UA 5EWLB 3VC2A 2IPAB 3IMKA 1N9ZA 3ZBPA 4DVGA 1T8PA 1EXWA 5LJIA 5D5PA 1ZKDA 3RK1A 1PCXA 1ONOA 1MB9A 3F4KA 4WEQA 1KZYC 2I4MA 3FFBA 4JVOA 3DGFC 3G9UA 4P1ZA 3DO5A 2VHQA 1Z6ZA 2KLHA 3E8MA 1YHYA 2JK1A 5B36A 2IEDA 1KFEB 3HBNA 3K0FA 3PQ8A 4GL2A 1MJHA 2B4YA 4ARAA 3C6BA 1TM2A 4DPLA 4BP8A 4UOZA 5C7YA 1WDTA 1ZU4A 4BCDA 2ET6A 5TV2A 3Q8XB 1AKQA 1MC5A 3CW2A 4WA7A 3PPXA 2W2TA 4RQTA 5T8KA 4DOMA 1DKMA 1ZRNA 2ZDHA 3NO4A 4CLOB 1B76A 1AQLA 3EUEA 1CUFA 1UINA 3ML1A 5EHQA 3PFHA 2QM7A 4EH1A 5L95A 4YHHB 3NTQA 4X91A 4TL9A 4DL9A 1QIFA 2EW8A 3JASA 3BB1A 3G88A 1KU6A 1KE1A 1PEAA 4LZZA 1ZMXA 1LLCA 2EJUA 2FEWB 1VXRA 3RS8A 1E4EA 4BMOB 1T4MA 1UDBA 2A33A 3N8KA 1QH1B 4KBYA 4KI7A 5E9AA 3ZX5A 1G3UA 4OFWA 5KO2A 2RBGA 2B4QA 3SDZA 1E2PA 3OX2A 2AGVA 5KHAA 2CGEA 1UC4B 5L7YA 4DIBA 1UMKA 2X8JB 4WJKB 2ERXA 3HH8A 2VOEA 5D3QA 3UJAA 1IWPB 4DDUA 4L5AA 4ZREA 1N3IA 1JA1A 4OYHA 4BLPA 3EEQA 1CD5A 2QLFA 2Y0DA 3OQVA 1UKZA 1CNFA 1ZINA 2GA8A 2Q2VA 4ZT3A 1WV1A 5LA6A 4MVCA 4KG7A 3UK6A 4J8PA 1Q1BA 3SLRA 4DILA 2QN9A 1QDEA 4BMYA 2CEKA 2NNLD 2PE5A 5F3WB 4HFNA 4NATA 3U4MA 1NRIA 4IGKA 2QYSA 3ACDA 2IS4A 3PKZA 2JIOA 3KSAC 1EWRA 3EIHA 4IDBA 4HB2A 1DG1G 1ODTC 3B1FA 3RFUA 1XAHA 1Y63A 1Q7RA 3II6X 3NHBA 4II3A 3WVNA 1D4ZA 1HXHA 1Z35A 2ODQA 3ABQB 5KTKA 2WU1A 3OESA 1BZYA 2VCEA 3O9ZA 1ZGBA 4FEAA 2XUPA 3RABA 3CO0S 1L7OA 1JEQB 4B3DA 4AX4A 5E4JA 4UAVA 2O3JA 2ZBVA 1U94A 2CXOA 1FFSA 1GITA 4WKBA 1IPEA 3PNPA 4QX6A 3ZJUA 2JLYA 5L3SB 4Q7QA 4KSBA 2I4IA 3H87A 1PZMA 3P9PA 5CYOA 2BEUA 2GB4A 4GP6A 4JBHA 2Q6VA 2H57A 3PDIB 9LDTA 2JK0A 1K5HA 5DKFA 1XRSB 2ABWA 4MWCA 3W9SA 3JVUA 4URXR 1DG3A 3MT0A 4L78A 2FWBA 3THWA 4LQCA 5FLYA 3DBVO 5BO5A 3S28A 1BA2A 3V8BA 1HK7A 3VPGA 3V42A 2QUJA 2X76A 3OLCX 1HORA 3JQRA 5ITWA 1YA6A 3M1LA 1ESCA 2A0UA 1H0SA 3G1TA 4II2A 4C9BA 5AW0A 3TYXA 3RUEA 1PGQA 1FDWA 3CKKA 1BCSA 1G7SA 1H93A 1ZK4A 2H3HA 3IQFA 4D97A 4IWNA 4DCMA 1AKTA 1VKNA 1IVYA 4MQUA 4P86A 3KS9A 3RTAA 4CKEA 3BF8A 3AZOA 1G5PA 1E5QA 4TTSA 3RLIA 3IDSA 2CN1A 1I4LD 1SKYB 4F06A 2DGDA 4ZN6A 3PQFA 5ALUA 1U3WA 4XTRA 5BSUA 4YAKA 3E81A 1Z83A 3TUZC 4CMJA 4FTWA 2K4MA 3CLTC 3NBQA 3TUJC 5DK6A 3NQ41 4A0HA 4BIMA 2WFMA 2NZUG 2VJCA 1S1CA 3DPIA 1YCDA 3EXHB 3LG2A 2L0XA 3JZMA 3RH0A 3D0KA 2WZCA 4CYMA 2GUGA 6YASA 1A3CA 4JLPA 3PF9A 3SS8A 3GEPA 1A69A 1UZLA 2I4OA 4TKMA 1NR5A 1YKGA 2VJPA 1L4BA 2W6CX 1ZFNA 3A1FA 1WOYA 4QHTA 2O2HA 3NHAA 2AW3A 3NV9A 3O1IC 5G53C 4MVJM 1YCHA 1G3IA 2N47A 1T4GA 1ZD1A 3VNBA 3OTIA 2WTMA 5ES4B 1C0LA 1ST2A 3OA0A 1BMFA 5DYYA 4B3RB 2FPUA 5KU1A 4MWSA 3EFOB 2MYTA 1RHUA 3OF2A 2GF0A 3T7JA 3SIXA 4UATA 4HGYA 3OZWA 5BUSA 2Q4DA 2F3UA 4E21A 2NACA 4M98A 2WSSD 4HAWA 2DWQA 3PHHA 1XDUA 1ZK0A 4CR7A 5EVJA 4AC9A 1AF7A 2C61A 2QW1A 1N2CA 1FQKA 2FOLA 1E3JA 2II6A 5CAEB 3C7DB 4LXQA 5DBGA 1XPRA 4WY2A 1IG0A 4UBOA 2O8CB 4C4AA 1IBCA 4DREA 2ZRQA 4OHBA 1T3ZA 4MROA 1IQ0A 2NO7A 3IOBA 1KI6A 1KFJB 3RADC 3HCNA 5I4IA 3ROXA 2G8NA 2JNWA 4OHCA 4M89A 5D1HA 3W5UA 1LVHA 1ZJZA 4ND8A 3SI7A 4E5NA 5EMHA 5EFZA 3OZAA 1P9RA 3OIWA 4TSFA 5K99A 1LPBB 3JRNA 3TXAA 4TUYF 1CC1S 4HRYA 4OOEA 4RCVA 4Y2TA 1WMDA 3BKWA 1XNGA 2AJCA 2VAPA 5CCXA 1Z8DA 4BB9A 4AKIA 4M1TA 5DPMA 1R9NA 2B98A 1Z26A 3AVOA 3GGGA 4G65A 4J1NA 4RFLA 5EY5B 3LYUA 1E2UA 2F1KA 3IBTA 4LRTB 1JW9B 4Y98A 1V6AA 3V3KA 4ZHQB 3I61A 1E2HA 2I2XB 4LY3A 3T1TA 1QRUA 1DC6A 5ANRB 4L2IB 1G5FA 1YU6A 4N41A 4XCVA 2C7VA 4G24A 1D2EA 1XRPA 3R3XA 3UAVA 1JIQA 3HWWA 3PIRA 3PD0A 4NBTA 4TLLB 5HKLA 1UIMA 1HMYA 3AGQA 8GPBA 1E2GA 3BIWA 2PH5A 1U04A 3UV6A 1P7WA 3U37A 3FRJA 4QO7A 4C01A 1XA3A 1P6QA 1E9AA 1F4LA 4UM7A 4URZR 4TS1A 3H5NA 1G291 4IJKA 1R64A 2BAGA 1FEZA 3HYNA 4NPAA 3X2EA 3ZWAA 2J7PA 3K8YA 1EJBA 3ZCQA 4JI1B 4NFLA 3C3KA 4O02B 3PDUA 3TNLA 4COOA 4MUHA 2L42A 3OWXA 4ND3A 3VU0A 3SMVA 3TQTA 4MINA 4M87A 4HNVA 4O33A 4PFJA 3C3EA 2CUKA 4LDJA 3TH5A 2P9QA 4P8RA 3ZYCA 4DDMA 4FFSA 1GQRA 4AS2A 1XCGB 2Q6OA 2OBBA 4G84A 5IJAA 3WLPA 2VHZA 3UJBA 3HLYA 1GNPA 2C2KA 1F2UA 2P2YA 3DE2X 2KI5A 5ALDA 1EYZA 1ULSA 1XVUA 3GYBA 4ARBA 1OBHA 2UUBB 1HZJA 3LT4A 1ECPA 3O4HA 4IMPA 1D4OA 1K8ZB 1U0JA 1Z4PX 3NIGB 2QTTA 3SIPA 3PFFA 1UWLA 5JSZB 2FFHA 1O95D 2X0JA 2AMVA 4J3JA 4HCJA 4MK4A 4PZLA 3U4CA 2VC2B 4AP9A 3U09A 4MS3A 1R2QA 3SR3A 6REQA 1C7EA 1X3SA 1NUQA 2NVUA 1NJ5A 1QH0A 4JITA 1ZM3A 4L5YA 5IDYA 1V16B 5CTAA 4AW9A 3A3NA 3DOCA 1P75A 3H9BA 1E4OA 3N58A 4FK8A 4QUIA 4G8JA 3QV1A 1J9GA 2B35A 4NX2A 3BX1A 2FPMA 1HE8B 1ZUNA 4KQHA 2CLDX 5FWXA 3THSA 1NN3A 3HCPA 2CWDA 5ALEA 4QVGA 1O94C 5JADA 4QNRA 2Q46A 2Y4OA 3IPRA 1ZSNA 5AM1A 4Y2UA 4UHHA 4V02A 3T0IA 3RTBA 1DFGA 5J63A 3W5DA 1HV8A 2X40A 1MNQA 3BMQA 4HZUB 2MSDB 2G3YA 3UGQA 4Q4CA 1C7ZA 2ZAYA 4LDQA 3MTBA 4XM1A 1QS0B 1SOUA 1UPCA 2HXGA 3FKSD 4HTAA 2E4VA 3QOXA 5L45A 3GLGB 3VR5H 1GTVA 3PXBA 5I8WA 3IAM6 4MW0A 4CLOA 2I71A 2FP4B 3IRUA 4CIVA 2VSFA 1QHYA 1UMDA 4AN1A 2VDOB 5BVHB 2I6UA 2GN2A 1HX7A 3MNFA 2J6IA 3HP4A 4HYEA 3UMJA 4EOGA 3AR3A 3FWHA 1SOWA 1OU4A 2AN5A 2V5VA 3QXXA 2WQZA 4GIBA 4KN8A 4LE2A 1XXLA 3FYUB 2G1AA 1WZCA 2EVWX 1PTJA 2J4FA 1S2LA 3NHYA 4R41A 4W9RA 4EG0A 1EFLA 3DL0A 1TRHA 1CUEA 1T4DA 2P2DA 2H8GA 4N18A 4NU8X 4UEJA 2KQUA 3CNQS 3ZCRA 3NFYA 2COKA 1Z38A 2GHRA 5J9FA 3T9FA 1BXRA 5E8JA 5HNKA 2KPOA 1REQB 5KTPA 1SIOA 2ZBFA 4MTLA 3URMA 1LI7A 3IIIA 1VG8A 5JCXA 3LW8A 1XLUA 2QJWA 2JFWA 5ICEA 4BNYA 5AUOB 3ZVMA 5H9VA 1E3WB 1RJ9A 4A26A 1KJZA 2ZJ3A 2GZMA 1MO2A 3QLUC 4ENRA 3GUUA 5FO1A 3AKZA 1U0TA 3KKZA 1NQXA 3K6JA 5AUPB 4H3VA 4P2GA 3QZUA 3B5IA 5FBZA 5JEDA 4NC9A 1T3GA 3FRIA 2HA5A 1NAHA 1GTJ1 1IZYA 3W5VA 2JANA 1IXSB 3IODA 1D1SA 5TE9A 3DOEA 5I7WA 4OJYA 1RM3A 3GPCA 3IJRA 2G82A 1U98A 1KVSA 3LCCA 1K97A 4KFTA 4OKNA 4K26A 1G7CA 2TECE 4R1UA 1C29B 3RSHA 3PUWA 4BLVA 4E1AA 3GVHA 1E77A 3SBXA 1G5RA 1CSEE 3KYIB 5F7ZA 3ENZA 2ZYAA 2XRFA 3DA8A 3OCXA 4MKIA 1CQIA 4MUNA 1ODFA 3OOHA 3QPDA 1PT8A 5A4JA 4WVLA 1FPQA 3M8KA 4G5SA 3GFPA 1GTZA 1NXVA 1M7GA 3BMOA 4H0NA 5CGZA 1XPOA 1LKZA 4XSHA 2VHVA 4X1OA 1ICEA 3F7TA 4K2AA 1ZQ9A 8MHTA 3F1KA 1ZZEA 5ELXA 3K9WA 4Q4JA 5ILQA 1N1DA 3DLBA 3QPWA 4I66A 4JUIA 1R1DA 2FX3A 3PQ3A 4QREA 4B3SB 1OLSA 4KYVA 2XB9A 2NM0A 2WIDA 4QJBA 1L8XA 1S2IA 2YVUA 3D2BA 4IKEA 3HZHA 3RVKA 1A8SA 1IB0A 3LWDA 3MELA 4IV8A 5SZKB 2W6IA 4YRPA 4OV6B 3TKAA 4HUQA 3Q0TA 5LYJB 2P1ZA 3ZU6A 1I7DA 1RRPA 1W76A 1Y5RA 4ZCMA 5JVDF 3KZNA 4AZWA 2WUWE 5TQVA 5I51A 3KT8A 2VAMA 1VOTA 1BNCA 2JI7A 4B4DA 3I9NA 4ON9A 1FLVA 2IW3A 1IRXA 1WVIA 3LS2A 1P3Y1 1XWWA 4KRGA 2QGNA 1G8HA 2H4FA 1Q3KA 2N1BA 1FRQA 3EXG2 8ABPA 5KNCD 1NULA 2D5AA 4LYYA 4M6WA 4ECAA 4GYKA 1BDIA 3EGDA 3SC4A 1TK9A 2ZJBA 3H75A 3BXXA 5LP6B 4WBNA 1Y8QB 1GEGA 5CIQA 2PJUA 3I64A 3QFTA 1NBME 1H8HA 1UPXA 4JJZA 3E1SA 5EHGA 5FOUA 5T4HA 3BOSA 5TGZA 2IBSA 1GDTA 1TVEA 4HS9A 3V9AA 2AWOA 2PUAA 4QYSA 4NBRA 3ZE0B 1MT3A 5BWLA 3PJRA 4OXNA 5CDYA 4ZJYA 4HDOB 4LKRA 5EQFA 3H7IA 5J43A 1A9ZA 1TQ8A 1II8B 1LV8A 4PF1A 5F2OA 3IVAA 4IGAA 1ZXLA 4QPDA 4C7VA 5JCJA 4E5MA 1KJIA 4I5FA 3LPLA 3PEVA 3FSGD 4RK5A 3RKSA 3TR0A 5BSKA 3QE2A 4NYMR 2C20A 3K0AA 1YJ5A 1Z16A 3DYBA 5K7SA 1OILA 1XQWA 1NXTA 4ED9A 4WXRA 2A0WA 1D6MA 5EXPA 5B2EA 4JJ4A 4Y2VA 4O4IA 4MW6A 3RIMA 4BMNA 2YW2A 3RHSA 3E58A 4RY0A 3CNNA 1Z4LA 4GVLA 2X4LA 1EFVB 5A5GA 1W9MA 4KNYA 2PSFA 3M5DA 1C7JA 4PAWA 5ALMA 2VXBA 4F3NA 1G9XA 3CW9A 4U3JA 3I9MA 2HQBA 4MA4A 1OWPA 5A04A 2OHOA 3WFZA 4I4TF 1OZGA 3AHCA 5JRJA 1EVIA 4GBJA 4MIEA 3N8HA 1CB7A 1AGPA 2RHRA 4X7RA 3M4XA 2C2ZA 4J29A 2YWHA 3RE1A 4Z99A 2H2AA 3NEAA 3TMAA 2ZG6A 4KWEA 3WZMA 4MUJA 3SEQA 5BT9A 2WHEA 1EG2A 4FFNA 1RZRD 1LY1A 1LPNA 2ZRMA 3UV3A 2AOWA 1S6YA 2Z09A 4N7RA 4HP8A 2RDMA 1OAOC 2B9VA 4WN9B 5GVRA 4L8LA 3A4VA 4S3MA 4F2WA 1FFYA 5EG5A 1XF9A 1M34A 1MX1A 2PYZA 3ELWA 3K1AB 3F98A 3W8FA 3KT6A 3OFNA 1U31A 1XRLA 2N0SA 3QVGA 4X6YA 2I5PO 5AKHA 5FA5A 5LBUA 4ER3A 2CB9A 2Z2JA 3LUDA 2C8KA 4B84A 4IXWA 2PGAA 1T3LA 3G5LA 4YT8A 1E6UA 4I1UA 4OFZA 5T4EA 5FA8A 4Z1MD 2IUTA 3KBOA 4PPYA 1WBJB 4B7UA 2MSLA 3HCWA 3HXOA 3Q3EA 3P1JA 4RDHA 4PYRA 3EPHA 3IPLA 1EK2A 2JFZA 1NVKA 4QUEA 1A97A 3TLYA 5IBQA 3A9TA 3HHEA 2JHPA 1UBEA 1Y6ZA 2NT4A 2LNDA 2PVSA 3PXCX 4UUQA 1Z33A 1OXBB 4KO3S 1GGMA 5IM5A 4CFZA 1O57A 1SCAA 1GZ3A 5ICSA 1OKKD 4TN5A 4H3SA 4DB2A 2IOHA 2Y0BA 3B38A 3PFNA 3A4NA 3AY0A 1U0EA 3PGKA 4F7WA 4U6NA 2BGMA 4W8GA 2P8JA 4F4IA 3CX7A 1U2TA 4C03A 3KR2A 3O8OB 1XRJA 4ETMA 1DX9A 3MMNA 4HNHA 5GGXA 1QF7A 2EEPA 3D2LA 5HQJA 2XGMA 3I52A 2O5RA 3EX7C 5C8ZA 1SPXA 2ZWOA 3CEPB 1WKVA 2RHBA 3EDRA 1V6SA 2GBGA