5IFKA

Purine nucleoside phosphorylase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
302
structure length
295
Chain Sequence
DINEQRALIKSAHRYISEKLEDHFSSEFLPKALVICGSGLSGISTKIADEPKPLILSYSTIPGFKVGELIFGYMNGAPVVLMNGRLHSYEGHSLAETVHPIRALHLLGSINVLIVTNAAGGINASFKAGDLMCVYDHINFPGLCGFHPLRGANFDEFGPRFLATSDAYDLELRKLLFSKKKELNIERKIHEGTYSYVHGPTFESRAESRFLRLAGTDAVGMSTVPEVVTARHCGWRVLALSLITNECVVDPPASAHDENPVPIQEGKATHEEVLENSAKASKDVQELIFSVVAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Functional and Structural Characterization of Purine Nucleoside Phosphorylase from Kluyveromyces lactis and Its Potential Applications in Reducing Purine Content in Food
pubmed doi rcsb
source organism Kluyveromyces lactis (strain atcc 8585 / cbs 2359 / dsm 70799 / nbrc 1267 / nrrl
total genus 92
structure length 295
sequence length 302
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ifkA00
2OC9A 4MCIA 3EUFA 1A9QA 4YO8A 1Z5NA 4G89A 1JE0A 4YJKA 3P0FA 4DA0A 3DJFA 1RXYA 4MARA 1A69A 1ZL2A 2HSWA 4DA6A 1TGVA 3EEIA 1NC3A 1PR2A 2QSUA 1YBFA 4P54A 4L5YA 1LV8A 2AI3A 1RSZA 2AI1A 4D8XA 3INYA 4U2KA 1OU4A 3BJEA 5F7XA 4TXLA 4BMZA 4M7WA 1U1GA 1PR4A 4M1EA 5C80A 4BMYA 3PNPA 3IEXA 3KVRA 2A8YA 1RXCA 4TXNA 1C3XA 1PK9A 2HRDA 3U40A 4PR3A 1T8SA 4LNHA 4WKOA 3KUKA 4G41A 1SD1A 1VHWA 1RYZA 5FAKA 5CCEA 5ETJA 3NBQA 2Q7OE 1V4NA 1RT9A 2I8AA 4UC0A 1Z36A 3OZCA 3E9RA 4TTJA 3UAYA 1PWYE 1Z5PA 5IFKA 1RCTE 4IP0A 2QTTA 4DAEA 4QEZA 1VMKA 3E0QA 3OOEA 3UAXA 3DP9A 4TXHA 1VFNA 4FFSA 3PNSA 1CG6A 4DANA 4TXJA 5K1ZA 4L5AA 5CXSA 1V2HE 5I3CA 4D8VA 4YNBA 2H8GA 2QDKA 4BN0A 3FUCA 4D98A 1YQUA 3BSFA 3OZBA 1Z5OA 4WKCA 1Z37A 1Y1SA 1PKEA 3KVVA 2ON6A 3UT6A 1RR6A 2A0XA 3LA8A 1A9OA 1A9SA 4QASA 4EARA 1FXUA 1OUMA 1V45E 2AI2A 3OZEA 5F78A 1NW4A 3F8WA 4TTIA 4DA7A 3O6VA 1YQQA 5B7GA 1OVGA 1M73E 1ECPA 2BSXA 3P0EA 3MB8A 1A9RA 3OF3A 2ISCA 3UAWA 5KB3A 5IU6A 3GGSA 4F3CA 1XE3A 5F7OA 1JDZA 1U1EA 5F7JA 1PF7E 1RXSA 3PHCA 3FWPA 1T8YA 1LVUA 3OCCA 3GB9A 1U1CA 1NC1A 4WKPA 1QE5A 3K8OE 4TS3A 3DF9A 1PK7A 1JDSA 4GMHA 4OJTA 4OEHA 3NM6B 4PNPA 4QATA 2OXFA 4DA8A 5F73A 2IQ5A 4JOSA 4WKBA 1JDUA 3O4VA 1PR1A 2OECA 1JDVA 3ODGA 1I80A 1N3IA 5B7NA 1ULAA 3IOMA 1PR0A 4LKRA 1B8OA 3ENZA 4NS1A 3MMSA 1ODJA 3DDOA 3FNQA 3UAVA 1Z33A 4K6OA 1V41E 5CXQA 1PW7A 2PGAA 3OOHA 1SD2A 1JDTA 3PHBE 5CYFA 4YMLA 1RXUA 3NM5A 3KVYA 4F3KA 3T94A 4ECEA 4QAQA 4I2VA 3LBAA 1OTXA 1K9SA 1T0UA 3ONVA 3EUEA 5JPCA 1JYSA 4GLFA 1U1DA 1Y1QA 1K3FA 2RJ3A 4G8JA 3KHSA 4LDNA 1PBNA 1LX7A 4GKAA 1TD1A 3UAZA 1RFGE 3FAZA 3FB1A 4LZWA 4DARA 4TYMA 4DABA 4KN5A 1PR5A 2P4SA 1Q1GA 3NM4A 4OGLA 1SQ6A 1Z34A 3BL6A 1V3QE 5CCDA 1ULBA 4MCHA 4RJ2A 4E1VA 4DAOA 1CB0A 4D9HA 1Z39A 4R2WA 5EPUA 1Z35A 4TS9A 2HWUA 3BGSA 4WKNA 1T8RA 1A9PA 4LNAA 3K8QA 3E9ZA 4QFBA 1YRYE 4OGKA 4F2PA 4H1TA 3C74A 4D8YA 1K27A 3OPVA 4F2WA 1Z38A 1PR6A 1OV6A 4M3NA 2I4TA 3LGSA 4L0MA 2QPLA 3QPBA 3D1VA 3KU4A 4L6IA 1ODKA 1ZOSA 4X24A 1Y1RA 4BMXA 3DPSA 4L5CA 4TTAA 4TXMA 1B8NA 1V48A 1SJ9A 4GLJA 5B7QA 2QTGA 1TCVA 3SCZA 4EB8A 4R2XA 5EFOA 2A0YA 2XRFA 4JWTA 5B7PA 1JE1A 1T8WA 4OY3A 4OF4A 4NSNA 1TCUA 1ODLA 5EUBA 1JPVA 5DK6A 1G2OA 2GUWA 1Y1TA 1OTYA 2A0WA 1JP7A 2OC4A 4NY1A 2HN9A 3FOWA 4F1WA 1VHJA 1TGYA 4R31A 1YR3A 5CYGA 1U1FA 5F77A 1A9TA 3TL6A 3OZDA 2AC7A 5F76A 2B94A 4JP5A 1WTAA 1ODIA 3EMVA 1Y6QA 1Y6RA 4QARA 5F7ZA
chains in the Genus database with same CATH superfamily
3NTXA 4FHEA 4PYOA 4YO7A 5IDXA 3KV1A 3E23A 2H7XA 1SA0A 3DMTC 2AD1A 2PMWB 1YVDA 3EWIA 5KVAA 2BEWB 4RVSA 4W8OA 4M36A 1A9QA 1U7UA 2IPNA 2AD5A 1TKBA 3CE9A 1OI4A 3CN9A 4KQMA 4UVHA 2OYCA 4BOYA 2C4KA 4UFNA 2R6DA 5ALSA 4BFUA 3EMBA 2RDMA 2JATA 1VYUA 4H7FA 4L0DA 3JYLA 4RVOA 5I48A 1U9YA 5KJ1A 2WJ3A 3KDSE 1TIBA 4BVHA 1Z5VA 2QTZA 1PD1A 5AVTA 1G1AA 2IEZA 5T67A 2XWPA 2A9RA 2Z2JA 4FDLA 1GGEA 1D2RA 3DKPA 4AMZA 3U4QA 1L9XA 3KR1A 4MITA 2BIFA 4LF7B 2Q6LA 2C7GA 3CZMA 3QLUC 2HNKA 3AESA 1VI2A 3N7UA 2FDXA 2X5JO 3AILA 1RP7A 2JIQA 2TRSB 4WEOA 5ECGC 1XPUA 5CFLA 1FP2A 1G55A 2NU7B 2HIAA 4FFWA 2YRWA 1SXJE 1Y9DA 3CW9A 4WOCA 5I6DA 2J5XA 3RYIA 1GUZA 3JAWB 1O9BA 1L5LA 3WISA 1G6OA 4RHFA 5AVZA 2VF5X 3WKBA 3WAGA 3MD0A 1JEEA 1Q11A 3F7NA 2YZNA 4AUNA 2BE7A 4GX1A 4YRCA 4XZ3A 3VR4D 3LOPA 1E9SA 1LVHA 3ED5A 1H1LA 3GVHA 1ABBA 2XVYA 1QLWA 2DKOA 3G9ZA 5DTQA 1MO4A 3AIOA 4RLHA 4MINA 3A6EA 4E3WA 4ZMRA 5HZKA 1GU7A 5TQ2B 5C5IA 3JD4A 4MWEA 4LWOA 1N3BA 1M2HA 1JLRA 3OZIA 2OMKA 3EXG2 4PZLA 2C4HA 3AM5A 4YCBA 5AJUA 2OBMA 1VIDA 2OCDA 1KOLA 1LB1B 4FGKA 3RUDA 4EMUA 1VE9A 2XYQA 4AWXA 1KPHA 4PHFA 6ADHA 2LE0A 3MC1A 2HOQA 1KZYC 3FBGA 2IHTA 5EGNA 1TRHA 5ERGB 4XX0B 2O7QA 3ORYA 4YAGA 3IALA 5I9TA 1QP4A 4XWGA 5BN4B 2RKOA 2WAXA 2WHRA 1P6XA 1XX6A 4B87A 1QYVA 3ACBA 13PKA 3CSUA 3LWDA 4B74A 2FPLA 3IKJA 4ZYVA 1LI7A 4W1SA 3RVKA 2XNSA 4HWGA 3V7WA 1KVRA 2EJVA 3IAEA 3OQIB 2O0HA 1KYYA 2XMBA 1GZSA 3Q3HA 5B58T 1J4AA 3OPMA 3LBIA 4Q9HA 3Q98A 4BXOA 4N12A 2H3HA 3T5DA 1MAUA 4ZI2A 2YASA 3OCXA 5JDCC 521PA 5I7FA 1MN6A 1YGPA 2AMYA 4J16C 5GM2A 5HK8A 3LUBA 2JGKA 2HB6A 3EGXA 2R97A 4I08A 1LLFA 1O5OA 1HG0A 4DLRA 4UU8A 1RU3A 2VPYA 2XRZA 4DJJA 1WHTA 3CRVA 1R64A 4AK9A 4O1IA 4E7PA 4EFMA 3OD5A 2F3UA 4NBTA 4TXJA 2PZBA 2C5GA 2BTQB 2FK8A 3QM1A 4MWOA 5GWXA 3W5UA 3X0DA 2W6CX 2RGWA 3KYDA 3AF5A 3WNBA 1UKEA 1QIDA 3FOAA 2RI6A 1FFCA 3QU7A 1SXJA 3V1MA 1FY2A 1X77A 1H9BA 3QXGA 4HG2A 2XWSA 3WBBA 1C8VB 1SRRA 2CBZA 3PC3A 4AW9A 2EU8A 4GBMA 1A1VA 2ZUFA 2ILTA 3T9EA 4JMLA 4O59O 3HDGA 1UBCA 3CLTC 3RIMA 1XTSA 4YALA 3T3GA 1EJ6A 5EGSA 5IG2A 1QHFA 3WHIA 4REQB 1YQUA 5JU6A 1EXWA 2FJPA 3KKZA 3QHAA 1U2DA 2D1FA 2HGSA 4GBGA 4D3YA 5T57A 5HOQA 3TQIA 3B52X 3Q3IA 4JBHA 1AKRA 1N2CB 3PT9A 1E61A 1S4MA 1W44A 1ZVKA 2IEYA 2YV5A 1QIMA 2BMDA 3D4PA 1PZHA 4B4VA 5BORA 2FSVC 2QE7D 4S1TA 3JZAA 1DPFA 5FHQA 3OLQA 1KMHB 2QUAA 1YULA 3FHLA 5LCXA 3ZV4A 1A9SA 2YHAA 3D4LA 5AXBA 4OBBA 3WNZA 1E7SA 1WD5A 3EOAI 3T5BA 1TYDE 4BQRA 4F4UA 4PC2A 5FYQA 5C18A 1I6KA 1CRLA 3B53X 4QSMA 4BFYA 2WG1A 2P2YA 1EESA 3OJCA 3F67A 4AMUA 1PTJA 3JU3A 5B7GA 3LGXA 3JW8A 3FVTA 5K0LA 2Y1CA 1I2CA 4K9PA 4UPVA 1RJWA 4KIFA 2Z4TA 1DAIA 2FKAA 4U7HA 3KLNA 2BTEA 2OO7A 2VP0A 1FTQA 4L5BA 1P4RA 1ZM7A 2Q3DA 4KXVA 3HBJA 1HSZA 2BUCA 2P4QA 5ESRA 5JS2A 3HKBB 5H4GA 1DC6A 2WUWE 2AVNA 4YRZA 3D64A 4JVLA 5C1OA 1COWA 1C1XB 5JADA 3M6WA 4AJJA 3R5JA 4L9RA 5K2OA 3OCZA 1C0IA 1I9CA 1TOAA 4I4TF 4RMIA 4P98A 1FRVA 3HEAA 3RBVA 5FEUA 1N77A 2PS1A 2YS7A 4D92A 4DMRA 2FTKE 5J2UB 2HF9A 2NSLA 3IBFA 3PTLA 3AX6A 2VHUA 3C8MA 4IIGA 4ZQHA 2VRBA 1BD3A 5CIWA 3PT5A 4LHXA 2OQVA 4CN9A 1XWWA 1E3IA 1SBYA 2TSYB 2GF9A 4RHYA 5E0OA 4GMXA 3RS2A 3UHAA 1OKKD 3AERB 3I1FA 2FWNA 3TPZA 4E15A 1ISSA 4O4HF 2BFNA 2V6MA 3RC8A 3SJZA 4G26A 1CUXA 1AGPA 1DTSA 3LYLA 5F64A 1ENYA 4XJSA 1X74A 5CA0A 2V6GA 2Y2VA 4GWGA 4QPCA 1JQAA 1BA3A 1Q7BA 4M1TA 1PI3A 4MJXA 5EUQB 3W0LB 4KHPB 2F1KA 1Q3TA 2NGRA 1GOTA 1K89A 1HFEL 1I3OA 2FPRA 1JPUA 4GMHA 1W29A 4V2UA 3LPMA 1A8HA 3L0ZA 5G1OA 3MCAA 3ZX4A 1EP2B 1EIZA 5KVCA 4DOMA 2V6JA 1R37A 4MJ3A 3HXLA 4OHUA 4E14A 5KREA 2UZ3A 4BPBA 3E9DA 3IKLA 5E1MA 5TC4A 3Q3JB 5K3SA 2C2WA 4KN8A 4BU0A 4DLYA 4F2GA 1KJ9A 1N5RA 1LBTA 3GO4A 4RY0A 3HXMA 2JLZA 1Z08A 1T10A 2XQVA 2PD4A 4EF4A 4ZMBA 4K05A 1TADA 4LJ8A 4B81A 1P17A 3UUWA 1N3IA 2K5UA 4QE3A 4YYEA 4Q4JB 2IYAA 1HDCA 1F2UA 5TQJA 3GRUA 4B6SA 4R2IA 2O2HA 4R1TA 3BTOA 3G02A 3DNMA 1JQJC 1XZKA 4B3HA 2JAUA 5AVYA 1WB9A 4V0SA 4C05A 2BEUB 3W8RA 4BQFA 4G0UA 2JFNA 4YECA 2GDZA 2BBTA 3GXOA 3HSYA 4R1PA 4YWJA 4MVJF 5GJWC 5EPEA 4TTSA 2ZTMA 2R5NA 2I7DA 2ZSJA 3LIIA 5LB2A 3H9BA 1EFPB 1JHZA 2PO7A 3KHTA 4H4EA 4EG7A 3FFXA 1DB3A 3UXYA 1SBZA 2OLJA 4KXFB 1GVHA 3LBHA 4ZIRA 2PGAA 1NQUA 2YY7A 5KIAA 4UDNA 2SCUB 2WM3A 3UKJA 3PHBE 1L7PA 3QZUA 3VC3A 1UKCA 3OQVA 4MLPA 4Q47A 4RVUA 4KQFA 5DTIA 4ABTA 2XOKD 3THWA 4H60A 1TZBA 4Z53A 4KFCA 1MC8A 2RI0A 4M9RA 3OX1A 4YAJA 3L84A 4M38A 1FFYA 3C6BA 4F4IA 5G0UA 2ODQA 4LJSA 3QEBZ 3FPBA 3L6CA 4L8VA 3GP5A 1BU8A 2VSNA 3EMDA 1O87A 1Y7PA 1QXSA 3HO8A 1GGVA 2EP5A 4LDJA 4LK3A 2B30A 4C2BA 2PLAA 4CTNA 1XEXB 3AHGA 3WRXA 4ETNA 5JSHA 1FQJA 3ANLA 3PE4A 4E51A 3BQNB 4YJ2A 3RNOA 2LZ0A 3RVPA 3HNOA 4C2UA 2P65A 4JJKA 3F6SA 1TK9A 2FETA 3KV3O 1QGYA 2XMDA 4LMPA 4PZYA 4Q15A 2YXEA 1KZ9A 1GUFA 1XLWA 3VR6H 2EBHX 2K4MA 1T2VA 5JMWA 1Q74A 4EQ6A 4KV7A 3C8HA 4E5YA 2P30A 1A7AA 3AV3A 3LBFA 3NHUA 4JOQA 4KXNA 4IS2A 3R6LA 1HYGA 4JQCA 2ZAYA 1XYGA 1STOA 3O92A 2PX3A 3WX0A 1CQXA 1IZ8A 4YP5A 2V0CA 2VYVD 1ZP6A 2CSXA 1D8AA 2ZIZA 4UUBA 4CFSA 5MF6A 3M9XA 1Z25A 3PYMA 4CLHA 4AF7A 5EJMA 2Z6UA 1TTQB 1IBRA 3RUIA 5A4IS 3FSJX 3EQ7A 5ALUA 3MF4A 1BMFD 1R0YA 3AI1A 2FCAA 2LWIA 5JMPA 4HN2A 4DMGA 3AEUA 4WDQA 3E8MA 4ETWA 5A1JA 4C0XA 2I6UA 4NEHB 4C4RA 1LDYA 3WAJA 1AQ6A 2JFZA 3U31A 4C0WA 5ALFA 1G20B 3INRA 2B99A 3A1VA 4OK5A 1YT5A 5MFPA 2W2TA 2YJ3A 1TA9A 3MJRA 4C0AC 3BIJA 4YS6A 4D8WA 4R1SA 5C3UA 5CVDA 2OHFA 3UW3A 3BMOB 5G41A 4IDNA 4Y7DA 3KOWA 5AQ1A 1Z34A 5KWEA 4G24A 3RS3A 2HADA 3SZMA 4QGBA 2IBMA 3UT5B 4QGSA 2FUCA 2WQ7A 3UHPA 2IY7A 1E79A 3A4IA 1XVLA 2QUJA 2X42A 3IXQA 4N40A 1BJKA 1EGQA 4F7WA 5HXAA 4CEHB 2PBRA 1ORDA 2ZQ5A 3PZBA 5JE8A 2GA9A 4O2LA 2YC4C 4XUCA 1Y8QB 4R0NA 1PFVA 4IV8A 4CG0A 2HMVA 4XIFA 2WFMA 3LRPA 5LQAA 1ADYA 5C7OO 4I9GA 1CULC 2NU8B 1KFKB 2V74B 2ZDHA 4QUIA 4GSLA 3RT7A 4BUJA 5CEEA 1QZTA 5HUQA 1NBWB 4N0QA 4TTPA 2W6JA 2Y1LA 3A3YA 4MZDA 5KYYB 3SXJA 1ZR2A 2FQQA 2FPIB 1NAIA 2VZLA 3HB0A 1LJLA 3I9V1 3IAXA 3O73A 2GAFA 4FC6A 4OP1A 4X3PA 3OT1A 3T5TA 1KSFX 1YRYE 2JZCA 5DTJA 3NC1C 1NONA 3M7IA 1L3IA 2OBBA 2ZI7A 1JQDA 1UKZA 5FWNA 3M5CA 5D01A 1KE2A 4YROA 5C81A 3TW8A 5BPFA 1T15A 1OI7A 3PFCA 4GW3A 2PMEA 2SKEA 1JEQB 2ZIXB 3EYAA 3OD1A 3RREA 2R44A 4WZAB 1SGWA 4RA6B 2HZ7A 4G5GA 4F46A 1E6CA 3HR8A 4GOMD 4QUAA 2G3YA 1X7XA 4MQFA 4EG0A 2C8KA 4XCVA 3G7SA 1W85B 5BO5A 1QTRA 4PO1A 1ZVMA 1W8DA 4MRNA 4X1KA 3OC6A 1EFVA 5KVVA 3WE7A 5BR1A 4GDFA 5IXJA 1JG3A 4XYEA 3WLEA 2J9FA 4NZPA 4DWJA 1I1QB 4ZOQI 5LFAA 1DG1G 3RIEA 2C2XA 5KC9A 4GLJA 1RMYA 4RJLA 2EQBA 5EUMA 3WLQA 5KQSA 5FI1B 4ZAYA 3SDZA 5B12A 4A92A 2ODWA 5K5EA 1T5TA 2B34A 4Y18A 2XCLA 5E1OA 2D2VA 4QBHA 4B09A 1EQAA 1GL6A 2A0YA 3H5NA 1Z0AA 4X95A 3FXAA 4XTRA 5AT1A 4DCSA 1OYWA 1Y7HA 1FJHA 1T8WA 2QX4A 2C4TA 4OYHA 4TV8B 2D4AA 3TBFA 1IEVA 4Q1CA 4X84A 2VXYA 2HFJA 2UKDA 3PD0A 3EBLA 1SU7A 1RWBA 4KSBA 1OOEA 2G7ZA 1MO5A 1SVOA 2XYVA 5KKAA 1XKLA 2GUWA 4KUHA 2PLWA 1PT5A 2Q49A 3UBTA 1JHQA 4DXDA 1OAOC 3TLCA 5HOEA 1VPDA 1P18A 3KEFA 3TXYA 3IL2A 4U2FA 2I4IA 3OZAA 4I81A 1OE0A 4D45A 2O6HA 3QE2A 1W2HA 1WW2A 1EZ1A 1QVRA 1UM9B 4FR5A 4F5YA 1JFSA 3DOJA 1E2IA 3L7YA 2I80A 2JHCA 1RD4A 3W3AD 3K05A 1B73A 1UJCA 3OBIA 3QA9A 5AWFC 4DY6A 5LMUB 5TB5A 4EUHA 3DBOB 1QIEA 1SUIA 2O1SA 4HNVA 1A9TA 3OHMA 3ADKA 2GEKA 2XDAA 1X2BA 4L28A 5EEGA 4AJPA 4DCGA 1QZUA 3PKJA 1FDVA 3H5RA 4HX9A 4WN9A 2WQZA 4PRKA 5CAEA 4OQMA 2JG3A 4NV0A 1D3AA 3HLYA 3UENA 1Q17A 1VSUA 3DZ8A 3IYLW 2XIQA 2WMYA 3OOJA 1T35A 4IVQA 5GJBA 4HGOA 3LM8A 2O1WA 1JS1X 3TZ6A 4CTKA 3HI6A 5EFZA 1BXRB 1DE0A 1ECLA 1PFKA 4G0OA 4MW9A 4B8ZA 1EGHA 1QWOA 3UGJA 2IY8A 3A1NA 1G3UA 3PD7A 2BEWA 5C51B 3LHSA 3G17A 1ULHA 1Z4NA 3TJZA 5F2NA 3UC9A 5KKCA 3KJNA 4EHAA 1MC5A 5K8IA 2I33A 3ZX5A 5C8YF 3NETA 4UPEA 2ZSAA 3GFVA 5DP2A 8OHMA 4XVQA 5L95A 4N54A 2ET6A 3DEKA 1RW4A 3QQPA 3SIWA 3QIVA 5K0EA 3NHPA 4PICA 3PUJA 2GN4A 2UYQA 4IF6A 1ECCA 1Y5RA 1QB7A 3ROMA 2PYZA 3WQBA 2L42A 2ZJ4A 3LE8A 1RTTA 1RXYA 2EZUA 3GC6A 5T5QA 4C6HA 1D2NA 1JSRA 1MPXA 1VGRA 4G5FA 1JA1A 4GT1A 4NI5A 4TMWA 5GOZA 4DA6A 3NHFA 5CA1B 2NU7A 1DEHA 1KHHA 2VZ0A 4OYLA 4EGFA 2QBYB 3V4SA 2OVBA 3JAWA 4WK6A 3CNLA 5JEDA 2FW9A 3FSRA 1P5RA 5KNBA 2FI1A 3ROPA 1YA4A 1V7QA 2O0KA 2VNHA 1IVNA 1E1KA 1E2JA 3GL9A 5I8WA 4F9EA 3NBUA 1XNQB 1AU9A 4EGCB 1NVDA 3FDIA 4HF7A 4U5XA 2AN5A 1NBIA 1FSSA 2M6LA 1IPEA 1O58A 2DAPA 2WE7A 1P19A 3IJ5A 1MABB 2Q8QA 2KBFA 1XF1A 3DL2A 4FKMA 3M1YA 1N2CE 4HPWA 5TQ2A 4CCSA 1IEQA 2C5BA 3OLCX 5K3CA 4GL4A 5A7GA 3D2AA 3W2GA 4U02A 3QXHA 4EK9A 5FV4A 3BWYA 4RS4A 4W9NA 3VPGA 1LRLA 3DDUA 3QHQA 1PR9A 2WMDA 1G41A 4OQQA 4Q1FA 1R6VA 2YV1A 4WMLA 1CVLA 4BMYA 1L5FA 3KLBA 1EX9A 5G0TA 3RIGA 4XLTA 5TMEA 3O38A 2VYND 2NYUA 3D8RA 3M1AA 3U3DA 3UB3A 2FPUA 2ZSBA 1L5HB 4MUMA 4NPCA 4RVHA 2PSHA 5BN4A 2OSBA 3GJ4A 1QQTA 2WDPA 2Q99A 5HE8A 5TVKA 4CIVA 1JDBC 4G4IA 1LQUA 4MRPA 1YMVA 5FA8A 4F60A 1F8XA 1LJUA 2D0DA 3AEKB 2ZSFA 4J43A 3U4AA 5I7OA 2Q4OA 1GZDA 3IDZA 2WPDD 4DCMA 4DPKA 3MWDB 1KWKA 3OQIA 1AO0A 2JBAB 1TM4E 4EUEA 5FIUA 3N58A 2EXXA 4OHRA 3UMBA 4QDTA 1L4NA 2XE6A 1OLUB 4GWLA 2CVZA 4NZOA 4B6OA 4NZ9A 3ABSB 2WUEA 1UXGA 4OLBA 1ISRA 2HLHA 1W2WB 2JFBA 3CUSA 5I9IA 3BXFA 5ECYA 1KP9A 4QG3A 4JI1B 3AB8A 4NCHA 4F5WA 3T99A 2G5GX 2WEKA 3BMQB 2FW6A 5LQKA 1QPZA 2AJTA 3F5SA 5ELMA 3E9CA 4BDTA 3OZCA 3GZNB 1PWZA 3UHOA 3JWJA 1XD9A 2FMXA 1T5OA 5IFKA 2MMCA 1ZCBA 1ZN7A 1JFLA 1N6OA 3DD1A 3EY4A 3PQ3A 5CFPA 1RYEA 5JAHA 4QEZA 2FOXA 2NG1A 1VMKA 4FFOA 1W1UA 3G23A 2BTQA 4OJMX 5ERYA 4UE6A 3ZJYA 4GNKA 1OCEA 3QLTA 4E3ZA 1ZLXA 4HGQA 5TS2A 5AW8A 4XYLA 4NBLA 1A96A 2AOXA 1KH3A 3GX1A 2DX7A 3IHTA 4BMPB 3LX5A 4Y9SA 1WF3A 1YL7A 5JS6A 4D0LB 1IOLA 2C20A 3GUVA 2PZMA 1OH6A 1EVIA 4LE2A 4IDEA 4IM7A 3LSTA 4U7FA 1S02A 4DYHA 3QU4A 4ZYTA 4REQA 3THYB 1V2HE 4BVJA 2GPBA 2WSSA 3SBDA 3KJZA 5LP1A 1N2HA 4FDTA 1AN0A 3JVUA 3FIJA 1KDVA 1FF9A 1Y4DE 2R68A 1SXPA 4JYAB 1N2CA 1QWSA 1WB5A 2X1MA 3HUDA 3A25A 3FY4A 3T5CA 1G8AA 3D6TB 4WKCA 2D5CA 1QBGA 3SHFA 4PLYA 5KVSA 1V9CA 2P4EA 2CMHA 2X1HA 1KMHA 1NQOA 2XUQA 5CMLA 3THRA 5HZGA 1UPTA 4B5LA 3FYDA 1PKEA 5WRFA 4UBIA 1XCGB 3V6LA 4HDQB 1HOTA 1KEEB 4R8MA 4LYJA 4NDAA 2X6RA 3KQTA 4ZQFA 3MFQA 2HI0A 1YE3A 2PGJA 2DRIA 2VDJA 3NJRA 1JLMA 1Q19A 4HDRB 2WYHA 4BL5A 4DLLA 1GV1A 1UXOA 2NADA 3P5SA 5BW5A 1XAHA 2SNIE 1YV9A 3IKVA 1TMGE 1Z68A 3T6KA 2YUTA 3RR2A 1H1DA 2X5XA 3OWHA 2D7CA 2AG8A 3D8BA 2FRVA 3AVOA 1GZUA 1ZM3A 5LL6P 1NBEA 1A9XB 3QUAA 3EXEB 2PZFA 4GQAA 1E7WA 4BU1A 1DJNA 2RCYA 4DA7A 4CEIA 2YFHA 4CV2A 2SKDA 1YQQA 3WFJA 4ZTBA 1D1PA 3OFVA 2IGBA 5TGTA 2O5VA 1WZUA 4N39A 1D6NA 4PFKA 1NYTA 3GZ4A 4KMSA 2CFRA 2BSXA 3MB8A 1MT3A 1C1XA 3KPUA 3UTDA 1UC8A 1FS4A 5E4TA 3TSYA 1JAIA 4I8XA 3WLTA 3A8TA 1BROA 1RQGA 5CT5A 5EWJA 5BN5B 1DO0A 2WR8A 3DMRA 3V9PA 4Q00A 4BVAA 1IN4A 1KRXA 2OP1A 3TIIA 2AK3A 1Z2PX 5AKHA 3AJRA 1MX1A 1ZVVA 2N1BA 5JSZA 4B3SB 1QUFA 2RGGA 3OFSA 5FR2A 1HE3A 4HWOA 5E2BA 1EJBA 4UEWA 1WETA 3AERA 1LS1A 3BXXA 3L4SO 4J0JA 3E2IA 3KPJA 3U49A 3ABIA 2W71A 3BWMA 4N7JA 1E1CB 2IIBA 4HLUC 1NYRA 3VYUB 4RK5A 2F3SA 1IXSB 1X80B 2E6KA 2IPLA 2W8BB 4RA9B 3UMMA 1YH3A 1CFZA 2ZTSA 2AXQA 4R16A 5U4XA 5IBPA 5A9TA 4ZTZB 3D3WB 3CF4G 2I1QA 2XDYA 2P2DA 4BVFA 1Y9EA 2JKVA 1M10A 3FOZA 4KLCA 2V7VA 2FSSA 1XQVA 2FQWA 1KVUA 3GB9A 2QVLA 1SB9A 5JATA 1GTSA 1OHHD 3E05A 2CSUA 4KR2A 1SY7A 1JDSA 1GNQA 1TJ3A 2JKZA 2CUTA 1QAQA 1T29A 2PV7A 3HM2A 4DQUA 2HHLA 2JFPA 3MRTA 1IM8A 2REXB 2X9NA 2A57A 3H2KA 3N05A 4GKVA 4O4JF 1KEPA 3MBIA 2IYOA 1W88B 3SBXA 3WLRA 2WU1A 5JSQA 1P4JA 2ZJ2A 1WMFA 2H2IA 2X86A 4Y1EA 5F73A 4B83A 3ZHRA 3H83A 2UYYA 1S3SA 3U1BA 5J5VA 4EGSA 1MJHA 2EHJA 3GPLA 2FEXA 4UBNA 4EYOA 2QEQA 4Q4JA 2OECA 2ZSUA 3L7BA 1MNQA 3B8EA 3PSAA 4HFRA 4RFLA 1EFTA 2NVWA 4M53A 3ROKA 1G20E 2Q6VA 4BNWA 4R1OA 1CETA 1E3TA 2JD1A 2BEUA 1JKJB 4WAUA 4AY5A 3PB3A 2RIRA 3NRJA 4RMJA 3KFXA 4IKOA 3AF2A 2XNDA 5IH7A 1B74A 3FTDA 1L4EA 3TBHA 4B3JA 1BHO1 2JD2A 3AF4A 2EL7A 3CVXA 2GGSA 1EFPA 3HVHA 4LS3A 3FTFA 1YKSA 2QTRA 4FT4A 5ABPA 3ZNQA 1JQ5A 5DNVA 2ZG6A 3I2FA 3KSAC 1CERA 2SCUA 2FSHA 3E3LA 4IJ6A 2WHYA 5SY9A 5KTPA 4CI9A 1XQ9A 4LRUA 5HX7A 2QM7A 4UTNA 2RHHA 2JLXA 3O9MA 4N5DA 3FMVA 3RSHA 4O4IF 5JS1A 4Y6QA 2OE2A 3KQQA 1HX7A 4F4FA 2H1FA 2BUAA 1APBA 3DR5A 1M66A 2D5BA 2FN4A 1EVQA 2IYZA 4WY5A 1F60A 5KC8A 1WZIA 3ZW8A 2BKVA 2GRAA 4JGGA 2C4WA 3TLYA 1IWPB 1MXHA 1VKRA 2P0AA 5TPZD 2BR5A 2GJ9A 4JLMA 5CB0A 1GA4A 1XEXA 3E3NA 4JEIA 4H3VA 1C8LA 1DJQA 2C2MA 2GD0A 4BGVA 3AXSA 1OT3A 3QBEA 1PLJA 4BNFA 2C4VA 1TM2A 1F0YA 5HGXA 3SDSA 3HL0A 1P5JA 4GOOD 4EL5A 3I30X 3C43A 4MVYA 3OPYI 5JXJA 3L0SA 4E22A 4CNQA 1OTXA 4JCOA 1AUXA 5DCLA 1ZXXA 1F0KA 2BMWA 3B2NA 3C3YA 3N74A 4MV9A 5FPTA 4PN7A 4WZAE 2B98A 3ANYB 5HEKA 1E6UA 2GSDA 3HYNA 4Q3NA 4QBKA 1MAAA 4C03A 5LQUA 1EFHA 1ZH8A 3AY3A 4WLUA 2R6CA 5G02A 4JWKA 1VCHA 1WV0A 1EBBA 2PUWA 2V3CC 1P4AA 2XB4A 1ZK2A 4FFBB 4I8IA 3AHCA 4IGEA 1WXHA 2OAGA 1BQ3A 2DZDA 5E6SB 4Z0TA 4B7ZA 3QVTA 3KHSA 4LDNA 3JQ6A 4W82A 3ST7A 4EYSA 1MDBA 1M6WA 4B7UA 2JLQA 4WPGA 3ZI4A 3AONB 2VK2A 5K8UA 1ZINA 3MQ4A 1S2LA 5HCNA 5HIKA 5BWBA 1JFVA 2R8ZA 1ZH4A 1EA5A 4QQ8A 4U6QA 1L4HA 3AETB 3HO6A 1RRVA 2Z4SA 4F9TA 4KRFA 3VHRA 1W49A 2I6QA 3NIGB 1G20A 1V4VA 3DYVA 4GP6A 4WK2B 1SHLA 4ZT2A 1T25A 4ZFNA 5L3QA 1SG0A 1AZWA 2O2IA 2QZSA 3UJ6A 2H2HA 3MINB 1VMEA 4QPPA 4WCFB 1UPAA 3BMOA 5HIIA 1NKVA 3NORA 1E9DA 2KB0A 3OJ0A 4TYMA 1WDTA 4WNYA 4IO1A 3G0IA 2ZBVA 3HJNA 3N7TA 3QRWA 3UT5A 4CCAA 2C98A 2RC5A 2ZKIA 2YN4A 3PNKA 3M89A 5HIJA 1Y3HA 4Z0PA 4UMVA 1XHEA 2HU8A 3GF4A 5AM1A 5IM4A 1RYMA 3GBSA 4FT2A 1N75A 1Y8QA 2HQBA 2O1XA 5DM70 2ZAOA 4C7KA 1EE9A 3ESBA 1E6EA 2NU8A 4X1IB 4NYMQ 4E70A 4NG5A 3ZW9A 2H85A 2ZUWA 1EXVA 1P0PA 1SCDA 3MOGA 3NHRA 3FFAA 1AXGA 5KYYA 1WVGA 4MVJI 5BVHA 3JYQA 4R2WA 2M6KA 1NG9A 3L0IB 3E4CA 2HBYA 2ZYDA 3HC7A 3BH7A 3HUUA 4IVRA 4RD1A 3UCFA 4GGMX 4KAAA 5M5BA 2Q4EA 1DG3A 3TEFA 5KNLA 5DWVA 3EWNA 5J23A 3G59A 3VOSA 5BXYA 2F3RA 3CX6A 3NOVA 3ZCVA 4HRYA 5DTRA 2I91A 4RMNA 4ALNA 4EZEA 2ATVA 3EHEA 1GZ3A 1HMYA 2XOEA 2ZS7A 3ELBA 4IOJA 4F2PA 3B1XA 1LTQA 4MIKA 1JEQA 2V9ZA 1KZ7B 3OTQA 1F2TB 3FSEA 4WZAA 1Z5UA 1YDMA 4RA6A 3TFWA 4L2IB 2GVDC 1RXEA 1AS0A 3SS9X 1YTUA 4FBMA 1CNFA 2ZIVB 3F3MA 5CJPA 4CIWA 1JMYA 1MAHA 2HJWA 2LR0A 2B8NA 2QNBA 3LLMA 4YHHB 1WCYA 2QQ5A 1ISJA 1QDUA 2H17A 4G84A 4M98A 4NU6A 2DUJA 3TMYA 1GPWB 1JR3E 1FDRA 2JLWA 1P5HA 5IDWA 4DM3A 1ZI8A 1CFJA 3NHBA 3ZBPA 2QTVB 3PC7A 3VPFA 4P38A 3ZKWB 1B8NA 4G8BA 2V8BA 421PA 4J6FA 2XTAA 4ND8A 4BEWA 1V48A 5CB6A 2BR3A 1DG9A 1UINA 2OAQ1 4Q19A 4GM0A 1J00A 4Y2SA 3TLZA 2BM0A 4JU8A 3JR7A 4TV8A 4BASA 4RTRA 4BE7B 1IN7A 1S9DA 1YVEI 4MWGA 2JHAA 3JQCA 2GPYA 3GDHA 5DX0A 4HDAA 2J4FA 2IW3A 3ZGXA 1FPQA 2H1SA 3K5HA 1H2XA 2AA3A 4KDRA 4Y3UA 3ZIAA 1BCSB 1IUPA 3H8VA 2HJHA 2JCBA 1ZJ4A 1N0IA 1WSAA 3NOOA 4B7XA 6PFKA 3WNQA 1H6DA 1ZIDA 1BXGB 1RWVA 2ODEA 3QGMA 1A82A 4LC9A 5KAPA 4L16A 2SKCA 1UP4A 2HHCA 4GFDA 4IHKA 3RSQA 3Q72A 1NVFA 1UM9A 2VTEA 3Q7RA 3LX4A 3Q2IA 4G1VA 1X87A 1DIGA 1EJ2A 1YR6A 2CXNA 1GFWA 2R85A 2DWUA 1P2TA 3NASA 3EJ6A 5JW6A 3MUEA 3J81A 3L0YA 3KX2A 2TS1A 4RPIA 2A2ZA 5TJHA 1U8TA 3ZPXA 5IPFA 2WVJA 1PQYA 3LHIA 4BB0A 1I9GA 1A9YA 4LWZA 1QCDA 3WXBA 3AVTA 2I4MA 3Q3CA 4BNMA 3T7EA 1U8ZA 4EAAA 1KZ4A 5CDYA 3I01A 3OA0A 1YA6A 1N8TA 5EJ5A 3DBRB 4U1RA 5EJIA 2AUMA 1OQAA 1YR3A 2PJDA 3FNBA 4E32A 3LW7A 5EIWA 3H5WA 2JIBA 4RVNA 2HT6A 4XJTA 1ZGJA 5J4VA 3CS3A 3OZDA 3QUTA 2D2IA 2EW2A 4D26A 3UO8B 1BXRA 3EDYA 1XYVA 2WIGA 4DNXA 4RHCA 3W6PA 1XBTA 3OEWA 3W1EA 3TS1A 1A72A 3R3VA 1U0LA 2EF0A 5THQA 2W2LA 4HDCA 4GE3A 2ZT8A 4TTQA 5KTTA 4J2OA 4NENB 4KQ2A 2HRBA 5FP0A 1Y6QA 1XNJA 4BVKA 3A2KA 2Z09A 4I1IA 1NI3A 3V3TA 3RADC 1P8AA 4FTWA 1MU0A 2IOFA 1PBTA 2ST1A 4HEJA 4UMFA 5M2QA 1S5PA 4H31A 1BEUB 2M98A 4R2MA 3W4JA 4J49A 2AR7A 4G0QA 4LY0A 2EW1A 2RHLA 3KKQA 4II3A 1NYQA 1D7AA 3IUJA 4BC1A 1L4GA 2Y71A 4NJOA 1NN5A 1PDVA 4Y2TA 2WA2A 3INTA 1I3NA 1IE3A 2G88A 1Z63A 1QGAA 2ZBEA 3VPBA 1V26A 1CP3A 1VJGA 2BDEA 4KK4A 1PGQA 3IAM1 3WLHA 5CA1A 1ETHA 4HXYA 2QBYA 2DLNA 4HN9A 4N0MA 2O52A 1NP3A 1A2OA 1ETUA 1Y3CE 2VDUE 2OV8A 5ADVA 3ZJTA 2ZZMA 2XMPA 4QWMA 3ZYZA 1QU2A 4J2HA 2Z8YA 3LYUA 2H1CA 2G5PA 4RCVA 3I52A 1XLTC 3E61A 3R0ZA 5BRJA 5K0CA 5DLPA 1V8OA 3CU5A 4LVCA 3EYWA 4CIYA 3IJRA 3ZLUA 1C2TA 2CUNA 5FBZA 5JI2E 2ZI4A 4P54A 3FLEA 2JH8A 1KR2A 4KNVA 4TYNA 1RI5A 1U3GA 1MABA 3CWCA 3IT2A 1W96A 3TL3A 5HSGA 1L6RA 4NDNE 4YQFA 2H2AA 1T4CB 2C84A 2QRGA 4JBXA 5EIBD 1YCGA 1SU8A 1U0TA 1Z74A 4MA5A 3CKMA 3QE0A 1XRSB 3CSDA 4LJLA 3NGMA 3O4GA 2YWFA 4QHTA 3UJ7A 1SG6A 1HTWA 4YRDA 3ESAA 2ZSIA 1C9KA 3VO8A 4LC0A 1D1QA 2C3OA 4CHGA 1YFKA 5E38A 1Z47A 4L50A 3WGMA 4BQQA 3ZJVA 3VVBA 2VPXA 1L5HA 2PMDA 4G65A 3B9RA 4QJIA 5KKNB 1GPJA 1TM1E 1VPTA 3KXIA 1AGRA 3PNPA 3IXLA 4IV5A 4JK3A 4UARA 4XLZA 5PNTA 1SOMA 1I4OA 1PJZA 2HPAA 3WBKA 4K5QA 1UZNA 2W4QA 3D8NA 4CT0A 2J8ZA 2OORC 3LQ1A 2YWHA 1YZHA 1N33B 2HRDA 5MFZA 4OFXA 2IYWA 4YWHA 2VC2B 4PR3A 1NW5A 1B6TA 1O54A 1YZGA 4QEKA 3VISA 2V7BA 1II9A 2Q3FA 1XZQA 1OLUA 3OQPA 4OXQA 1AF4A 1P7ZA 1YHNA 1FUUA 3VC1A 5A5DA 1Q16A 2B69A 4NV3A 1Z9BA 3S2ZA 4GC5A 3VH3A 1KYQA 5JROA 5L6MB 4Q7QA 2P9QA 3ZWCA 4XRRA 2ZB4A 3ZU4A 4ZT5A 1ZH2A 3KZXA 3GZNA 2WK1A 3KXPA 4OSOA 3K70C 3HEMA 4GL2A 4JR0A 3ESCA 1YDEA 3GT4A 4V1CA 4YRRA 2RK3A 1UIRA 4GPIB 1FC0A 4M8IA 1YJBA 1NMZA 5ALVA 4QBGB 5C8XA 2I1WA 2QKYA 4IUDS 4RU1A 5DNEA 1M5RA 4RF4A 3VVCA 4JUIA 3GZTB 2QTTA 2IUSA 1UEXC 3TB6A 2UUBB 2O8DB 2G72A 2QIPA 3TTTA 1N9ZA 2PCJA 4OA5A 4P93A 5EE0A 5CDGA 1SULA 5T4HA 1JMVA 4QVKA 2O3QA 4HAOA 1JXOA 4L5IA 4S1PA 5DBFA 3B1KA 3UK1A 5KX5A 1JHMA 4LHZA 1R8YA 3OESA 3THYA 1J9GA 3PJFA 4KKVA 2EFHB 2QRPA 3V4FA 5F23A 3LPCA 4QQRA 4R69A 2NIPA 5JNUA 1NFQA 1ZIPA 2ZJFA 3CSSA 3N8NA 1U0JA 1GPLA 2AZ4A 2W43A 4RGBA 3V1NA 3WK4A 3ADDA 2M1XA 2D59A 3MWJA 3EXFA 2ASEA 1DBPA 2ZZNA 1K7CA 3RS4A 4S35A 3VR6A 4O1HA 2P27A 3PL1A 1UFVA 4C5CA 4F9GA 4HDOB 1EKXA 3LZCA 4D2IA 5K0JA 3DO6A 5HQTA 1JQLB 2H11A 3ZWPA 1OGJA 1W0KA 2KX7A 3ED1A 3MERA 4IFEA 3VR4A 3ZS9A 1KEEA 4HDRA 3ECAA 4WBSA 2G67A 1UC5B 4FVTA 2CDNA 2BGGA 4BPRA 4Q7EA 4MYSA 3RVDA 4JVNA 2IYFA 2BGUA 1TM3E 3I6MA 1UZUA 3TLBA 2UVPA 4Y9UA 2WKQA 2VZEA 5JAPA 4RV4A 1W76A 2AMVA 2MSEB 3CJTA 4MROA 4QXOA 4OGWA 4D4GA 4I14A 1MFPA 2IHZA 2OFXA 2UV8A 1D9ZA 3EXEA 3NV9A 5AXAA 4B6QA 4OXYA 3I39X 1OV4A 1OAKA 4IXNA 5K0NA 4EARA 2PD3A 3FMIA 2VHWA 2ATXA 1KS2A 1QFJA 3BE5A 2J0SA 5DM0A 4HAYA 3ZN2A 1USIA 2Y92A 1Z6ZA 4LTDA 5BQPA 1FFWA 4GOND 4RTKA 5AI8A 3COYA 5A62A 3O6VA 1GQSA 4UNQA 1QANA 1PFYA 1TZJA 3K5PA 5BN5A 3CLHA 4JLOA 4RD3A 1ECPA 3ZCQA 4P4TA 5EJ8A 1P0CA 5CT6A 3SI7A 3ZVKA 4OI2A 3HWWA 4N3GA 1XCBA 5JISA 4YCMA 5M7EA 4B35A 4CV1A 3ZDQA 2E55A 4IZIA 1ZU5A 1O08A 2VPQA 3VU0A 4NBKA 1JQBA 5J5CA 1E1CA 2E87A 3OPNA 4HVAA 4UHHA 1KH1A 2AR9A 1HH4A 1TUIA 1X80A 2VHYA 3KALA 3M8KA 4RA9A 3OKAA 2AV6A 2UZ1B 4DJTA 2OILA 1U0GA 2Q3LA 3A58B 3AEYA 3MXTA 3D3WA 4JFAA 5FFFA 1EDZA 2I6TA 4I1SA 4TWBA 3ZE8A 4LYYA 1RXSA 4ZAXA 2PRJA 1FLAA 4G36A 1U1IA 3G0BA 2X5KO 1FUKA 3RVQA 1PSDA 1YZ3A 3UG6A 1L5RA 1N8KA 1ONOA 2R96A 3E58A 1C9JA 1YE8A 1FQWA 4JLKA 4CL3A 2H51A 5FRDA 4Q9KA 1YJ8A 2NT3A 4TKZA 2QVBA 4HEQA 5IK2A 4EP1A 1PRYA 5BMVB 1E1DA 3ZQUA 2HEGA 5DPMA 3TB4A 3UGQA 3M4JA 5INTA 2QS9A 1E18A 3KQSA 4NOJA 3ZH2A 1W88A 4UBKA 4ASUD 3B5JA 4GLLA 4N41A 4QM7A 1YAJA 3R5FA 2F8MA 2GYVA 2IEIA 3G8DA 4L4SA 1BWQA 1PVVA 4HX2A 2C8VA 1G19A 2BHNA 4OEHA 4UDYX 3ADBA 2FEAA 1FJGB 1FQKA 1Q1QA 3EVNA 2ZIGA 4WNIA 2UYGA 5LLTA 1BXKA 2C58A 3A4NA 1EDEA 4N9WA 2ZRQA 3VYRB 1RKXA 1JKJA 1TC2A 5AHXA 2PS9A 4WBNB 3S7TA 1DI0A 3B2EA 3OUTA 2QF7A 4NYIQ 3WIEA 5L7TA 3CEJA 1G18A 2BRUC 3CNBA 1XEFA 3MLAA 1QBKC 1SVMA 1X0VA 2FY8A 2RKWA 3U48A 4BO2A 3A06A 1B14A 4NH0A 4EIWA 1P3DA 4XD2A 3I3SR 3V33A 3JPWA 4ZU3A 3ZXXA 4KE8A 3IOMA 2YZ7A 1PR0A 1PK8A 3OP4A 4DIFA 821PA 1ODSA 4C2TA 3CX3A 1H6BA 5A4DA 1VJRA 2HA2A 1OXKB 1ATZA 3KBOA 3QFSA 4BHTA 3C8UA 2RI1A 2N47A 2ETXA 4OVKA 4A10A 2QX9A 4U3JA 3ZUPA 2Q5EA 5EE3A 4ZEWA 4DIOA 1QRTA 4ARIA 4F7DA 2C00A 3VR5H 3CZ5A 4M83A 1PW7A 2Q27A 3NP7A 3UANA 5EZYA 2CDCA 5KINB 2ZYGA 3EEYA 3JASB 2XA2A 2FEPA 4MB6A 5DV9A 3VSEA 2O0MA 2P35A 5CYFA 5J4YA 4XWYA 3HH8A 1MH9A 1YUMA 4ZV7A 1CLEA 4RK6A 1G9TA 5IUKC 1W5AA 2X8WA 3D4IA 3KQOA 4O29A 3UBMA 2BMJA 1BYIA 3O47A 4PS0A 1KC3A 3IMGA 4HH1A 3EA5A 3MHPA 5ALKA 3OWOA 1SHTX 3Q9UA 4I6GA 4ZAZA 3EPJA 4I2VA 2XSZD 4XIYA 2MSDB 5FJIA 3G2PA 4WA8A 4RX1A 1GLNA 1UJ2A 1MD9A 4RH1A 3T4PA 1TUBB 3G1TA 2AE1A 5DNDA 2CLHB 1VXOA 3A3PA 3TZHA 1BYUA 2G70A 1L7EA 4ZOEA 4INAA 2ZE8A 2MOKA 5E6SA 2V8OA 1KS9A 1K2VN 3V7UA 1Z83A 2EBWA 3BWXA 2BBOA 5B4VA 4MUNA 4YLGA 3URMA 2C95A 3LY7A 3PE3A 1NRIA 2RJ3A 3R9XA 1P31A 2FUKA 3KT8A 1O3YA 4DR1B 3E7XA 3ELDA 1U7XA 1GP2A 1LBEA 2CYAA 3FTNA 2ATCA 1HE4A 3F73A 1VYHA 3MM4A 3NONA 3GLSA 1L5WA 1E1MA 1H66A 3CR7A 3EGOA 5KU7A 3ZE6A 3IUMA 3K9BA 1HZZC 1J1ZA 3O94A 4BFVA 3OJLA 1CZRA 1WXGA 3IUYA 3SSMA 1P80A 2JAOA 1EP1B 2MHCA 1UPXA 1VBNA 1NU8A 2DHRA 2WNHA 1H93A 3AVQA 4YBZA 3TQFA 4BX2A 4D4HA 5IABA 3GJSA 4TZ0A 5C35A 4FFDA 4NCIA 1RYNA 2YHSA 4BY9E 3I01M 3UAOA 2RD2A 5REQB 3D5EA 1YZLA 1U7OA 4BNTA 1JKIA 2UXCB 5TV2A 221PA 1FZTA 5CFNA 3NO4A 2R00A 4CBVA 4R9VA 1Y3IA 2CXRA 3AB3A 4OQXA 5IZCA 1IHDA 3ABQB 1M54A 2L0XA 4X1IA 1OILA 1SD5A 4TQUS 5DRYA 1OXUA 3K6KA 3KHKA 3N8DA 3W79A 5DX8A 4EHNA 2V7QD 2DVMA 4MRMA 4BN4A 4YMGA 4DAOA 1JR4A 1XJ0A 2JARA 3P2MA 4B76A 4B3IA 1NKSA 1G3QA 4AMGA 5AJWA 4CQMB 5HKOA 3LY9A 3KQLA 1JA9A 1XU4A 2M6RA 2DQYA 1QK3A 1X7GA 4WJLA 3LDHA 5A06A 5B5SA 1GM5A 4RVDA 4TS9A 1SXJC 5CUQA 1HG1A 2DUUA 1DKLA 3TRIA 2EVWX 1NMXA 2VATA 4TKUA 1M1YB 3NB0A 1KI8A 2Z4RA 1YZNA 3S2IA 4MLZA 4EUKA 4IGAA 1F2TA 1FP1D 2PVCA 4C30A 1P1HA 4ALJA 2HRRA 2VNIA 4L2IA 1E2QA 1FCJA 4TMZA 4ED9A 1F7VA 2XWJI 3LXRA 5GJCA 1QIFA 3ZQ4A 5BSWA 4QUDA 1URPA 4UE2A 4WASA 1KE1A 2Z58A 3UJNA 2D2XA 1MB4A 3W2HA 3DAPA 4CDNA 4EI9A 2OV3A 2Z8YM 3ZY2A 4L8FA 2WKSA 4L75A 3T3HA 3TPFA 1NJ2A 2I65A 3RSZA 2INGX 2QTVA 3KU4A 3FA2A 4X90A 3ZKWA 1LK0A 2R2GA 2PMFA 1DX4A 1QONA 1ZOSA 2VRCA 1GNVA 4JJZA 1K8QA 2CLEB 4CPDA 4MJLA 5DLQC 4YPVA 1CK4A 3QBDA 1TJPB 3TLXA 5KX5B 3HA2A 5KJCA 2PRKA 1O57A 3JRNA 1I13A 4F6CA 3FYUC 1Z8DA 2F3PA 4XASA 3IMKA 1J23A 1SC4A 2OV4A 1PL0A 3H75A 2PL1A 4OL0A 3N59A 3R0QA 2PMKA 4EEKA 2DHEA 2H0AA 3AR3A 2V0GA 1EVKA 5DDIP 1ZD4A 3K4QA 4R8LA 3O91A 1CUCA 5KVQA 1PTJC 1FE8A 3M5WA 1BMFA 3SCZA 4IDAA 4OFWA 1LWNA 4BUZA 2PGIA 4DC0A 4R2XA 4EHDA 4BVLA 1KFBB 4X44A 1YJCA 4AUMA 3G8AA 4Q1VA 2P91A 5JXHA 1BXGA 5IYZF 3W1VA 4OLHA 3VU3A 1DLIA 1UH5A 2VP6A 3OFND 1ZGAA 1I2AA 4DCPA 1JPVA 2HBZA 4F38A 3EULA 4YXWD 4J3FA 3IMFA 2CLKB 3S4YA 2XGMA 5FEMA 2RHDA 3K2QA 2HNBA 5F1KA 1XJ5A 4DSZA 3PFFA 3HCBA 1SK8A 2Q2QA 4OH1A 4B7AA 1BE0A 2ZB3A 1EWYA 4EQZA 2P79A 4ENPA 1HQKA 2F48A 2WKPA 3CRZA 5L3ZA 4OX9B 2NQ2C 3LA6A 1LF5A 3V8QA 4G5RA 4DTCA 1BDHA 1CRQA 1JP7A 3ZU3A 4B44A 4D57A 2ZIEA 5CGQB 3VYSB 8ABPA 4PPFA 2O4CA 1PNQA 3M70A 3WA6A 4BJ5A 3VKUA 3W05A 4FDVA 4M88A 2HGZA 2GM9A 1B6SA 1N8NA 3CEPB 4UTRA 2A35A 3PGKA 1CR2A 2J6IA 4EY3A 4DG9A 1UC9A 3CPSA 5FXMA 3UXHA 3ZHZA 5CYGA 2OUIA 4IIYA 3WDMA 1KOFA 2QUHA 2C7BA 3NH6A 4KVGA 3GZJA 1JAXA 1M8FA 3Q5DA 4HCJA 4NENA 3FVWA 4JXZA 1W5SA 1VG9B 2IU6A 4RCYA 3R1IA 4JJ4A 1TW3A 4HAUA 4GIBA 4B46A 2IOHA 4KDCA 3KT0A 4UKDA 1PWXA 3LI2A 1UADA 1XZBA 3DCJA 4MKIA 4BNVA 3KZKA 3RGWS 4EVIA 3UMCA 1K7FB 1QIIA 2H5IA 3CXRA 2ZS8A 2AQIA 5A0FA 1HQYE 3WR5A 3H3JA 2J30A 1T4DA 4XSHA 1KI3A 4CLRB 2VQDA 2O2CA 5BT9A 1NZFA 4B33A 1J9EA 2FHSA 1ULZA 4F86A 2ZTLA 4QXQA 2W2XA 3ONWA 2AOTA 2WHPB 5J5AA 1ZHFA 3AUSA 5JVDA 1X6VA 1DHTA 2PGLA 4QDKA 1KEWA 3DHWC 2VLBA 3M6VA 1SXQA 4COKA 2PPVA 4RNDB 3I5XA 3EMKA 2OP0A 3IOBA 4OB7A 4ZGWA 5DI9A 2WINI 4KIGA 2FUEA 1Q3KA 1ZHOA 3FCSB 1ACJA 2DY0A 4JA2A 3H9UA 1F51E 1AMNA 5F98A 5JZMA 2WF7A 3WKDA 1DKQA 2QZZA 5EHZA 3C5HA 3FCXA 4JUBA 3DTTA 1RHQA 4MTCA 3AY0A 3T3IA 3F5MA 3L0BA 2A1UA 4I1VA 3EPHA 1T4CA 1PR2A 1XTQA 2R6JA 2OCAA 4AY2A 1XXLA 2EWWA 4FMCF 1YJAA 1E2MA 4UM7A 3HE3A 1Y6FA 4O4LB 1LDBA 4RZQA 5IF9A 1Z4MA 4JIMA 4NVRA 5JANA 1H4QA 1VSVA 4UJ5A 3TLJA 1O6CA 4JLBA 3V1YA 1BEEA 3TVYA 2R6R1 1K0FA 4LWQA 3VPDA 2Z95A 1ZUD1 2GZAA 2OGUA 3INYA 2PWPA 1DAPA 1IIRA 1T5LA 3MGAA 3F2VA 4JJIA 5K3EA 4D41A 2QTCA 2WBLC 5DWQA 4PGGA 3F9RA 3VHQA 4XM0A 4DIBA 4PINA 3ICQB 3CB4A 3GAAA 1GAJA 3GEDA 2SBTA 2C8JA 2NTNA 5JS7A 4LIPD 2IYSA 2QN6A 4P81A 4N0DA 3P9PA 3QA3E 5JZOA 4UXJA 1MP0A 1P2UA 3OLZA 1FRQA 3PVZA 4Q4LA 4QX6A 3ELWA 4IDPA 4E5DA 2X41A 4O63O 3PUXA 3W7BA 2PHZA 4A0QA 4QIHA 2HUNA 3QKRA 3U40A 3HUTA 2XKKA 4LYGA 5DN9A 1OB5A 2C3MA 5ITZB 4YRTA 1N2EA 3U80A 4OQYA 4U2GA 5DXAA 4B73A 1XELA 1Y6GA 3IT1A 2JLCA 1TU4A 5JPDA 2OOSA 3A9SA 3RHTA 1CRWG 2C99A 4UQLA 3CRQA 3ND9A 2HTEA 2VQFB 4RIIA 2TMDA 3HZZA 1C80A 2FFJA 3CNEA 1BQ4A 1U6KA 1XVUA 4KYUA 4AMVA 1II8A 3A3NA 2J6CA 3T7KA 1Z0KA 3CZPA 1DXQA 4O4IB 3ZS8A 2WI8A 3BJIC 4OB6A 3SEQA 3KL2A 4G4GA 4GRIA 4DCCA 2ZR0A 2WVHA 4Q7MB 4PSDA 2O8DA 3JX9A 2DECA 1Q2UA 4J2TA 1AE1A 3E9RA 3Q41A 3BMXA 4PPQA 4NK5A 3TKAA 3I5YA 5FUWA 1NDHA 1LW7A 2PTHA 1C9EA 1P9NA 2A1TR 3MAJA 3FPSA 5IKEA 2CMDA 3KG2A 3CC8A 4ID9A 4JITA 5KQMA 4WCVA 1ZGBA 1KGSA 3OOEA 3WB0A 1W5EA 3W34A 3SBOA 1XF9A 3DP9A 4TXHA 3OY2A 4FFSA 5EQTA 1OXVA 3RW9A 2HPVA 1DAFA 2WM2A 4HEA6 4ESOA 1R0ZA 2XMRA 4FN5A 3GEMA 3I5UA 1VL0A 4OQDA 1GDTA 1O0CA 5HWSA 3S2GA 2NUAB 3BWBA 2H7YA 4NMHA 4LA4A 4DYVA 4Y98A 4S0XA 3OFJA 1ECBA 3L8FA 2B8JA 2QUKA 5DIFA 4UPDA 1VHDA 1NSTA 4QUJA 3MCTA 5DHSA 4XR4A 5HF5A 1KORA 2O1EA 2WT8A 5DW0A 1J70A 4B9AA 4V02A 3T1YB 5K20A 1J0DA 3BD7A 1KK3A 1YI1A 3EQ2A 5KHOC 3HYCA 2GNPA 2VPTA 1R12A 2X0FA 3CMMA 3AFHA 2P7HA 2VAVA 1ZK0A 1Y1SA 4FYJA 2PBZA 3D3JA 1PX0A 2BDUA 4B4KA 3VU1A 5AW1A 4KCGA 1GSOA 1DBIA 3HBMA 3AVVA 3OTIA 3O26A 1ESEA 1Q0UA 4UU7A 1SKYE 5H3LA 1M33A 2RGUA 1IBKB 3WC4A 2IPMA 3A1UA 3HJRA 1TQ6A 4QASA 4MYHA 4TSFD 3RRBA 5DCWA 2ZB2A 4UOEA 3R09A 3E2PA 1MPTA 5KZMB 1Y5MA 1RACA 3TTYA 3QEJA 4X0EA 2FN9A 3BRSA 1IOZA 3C8ZA 2W8ZA 3HKEB 1JW9B 3KPYA 4L07A 4R54A 1HDXA 1MEJA 3RIXA 2GX6A 2G76A 4YRLA 5HUJA 4FXOA 4C4PA 1EUQA 4AICA 2NZYA 4MKFA 2Q1YA 3H4IA 3LUJA 3QMMA 2LBPA 3HDHA 2AMLA 2AC2A 5FF9A 5G3YA 2WIAA 3ODPA 3C70A 2BZGA 1P2SA 1Y33E 3DFMA 4O8CA 2VBFA 3ETLA 1R0KA 2DPXA 1CJCA 1ZI6A 1UWLA 4HGYA 1JIQA 2PAFA 3ETEA 1O95D 1VGVA 3OP1A 4G4JA 4XFJA 5BOVA 5HE9A 3IVCA 4D81A 3C7CB 1WB4A 3PS9A 2VWHA 1ZX1A 3UJDA 4Q4CA 1LRJA 3BH0A 2RG1A 4XM1A 1RLMA 4JZYA 4FMPA 1X7ZB 2YMMA 5HCIA 2XF8A 5LC1A 2VTKA 1E2LA 3N2YA 1XE3A 4IIEA 1NJGA 2BGRA 4C0BA 3QW4B 2FRDA 5LM3A 5HM8A 3GV0A 4G5XA 3KKPA 3A7DA 1PGNA 4JROA 5C5CA 2KMLA 4YQEA 5BMVA 1T36B 1CD5A 2G17A 1MJFA 5CLJA 4E0BA 4YAIA 2YRXA 1T8YA 3NUQA 4I3GA 1TE2A 1UC4B 2FG7C 4PAQA 3A32A 1H9CA 4F1KA 2VJDA 2C2ZA 4YMUA 1R1DA 4XIIA 3RJTA 1TT5B 2VTVA 2WF9A 2C5AA 1W52X 2R5FA 2AYZA 3D3EA 3LV8A 4BUCA 3SKVA 4LY6A 4TV9F 4GPAA 2NUTB 4Z4FA 2DTEA 2LV8A 3DTNA 2W6IA 1V2GA 3NT4A 1WUJS 1E58A 4OJTA 4BKMA 1AVTA 1T4BA 2JLSA 1J90A 1FVHA 3FNIA 1ZC4A 2A59A 3WS7A 4RK7A 2HMUA 2ZQZA 3UNXA 4WBNA 4YUYA 2ECOA 1OREA 3BWVA 4JOSA 1VMDA 3KR2A 4JGIA 1W48A 5A0VA 4FIZA 1MQ9A 1R5BA 3WGYA 4ND5A 1FS6A 4OHOA 2XVXA 4FGSA 5JWRA 2RAPA 4MW6A 3ZHVA 2RHOA 1CYDA 3DMYA 4V3CA 4MNTA 3K2BA 5BVGB 4PS1A 1TEVA 1HRKA 5MN6A 4D6PA 1NJ1A 1NP6A 2G06A 1C4KA 2I7XA 3I45A 1RQXA 1WY5A 4HS4A 1G5TA 3QVUA 1QNLA 4OIMA 1WXEA 3QTLA 4D44A 2WYWA 3KP1A 3RVSA 2B82A 2PR7A 4R6XA 1I4TD 4WZ6A 4AJIA 3PYXA 1A5SB 4D1YA 3DFUA 5FCDA 4D4IA 1KZHA 1ODJA 7YASA 2DFLA 1NBOA 2NLOA 1V41E 1QORA 3JASA 2C3PA 2HSEA 4FINA 2VQ3A 4YMSA 2HJ9A 4RDIA 3GH1A 1MA0A 3SYLA 3SFZA 3UC5A 4QC2A 4HQFA 3QWHA 3P20A 4X6UA 3ZWQA 4FYKA 1AHNA 3BSYA 1P2DA 4PNEA 3VYTB 5ELXA 3E1GA 2X8AA 1IG3A 1RAHA 2P41A 3WHKA 3C1UA 3THXB 3RWBA 4NU5A 4WUTA 3NWBA 4HJRA 1Z8HA 4BQPA 1HNXB 3DE0X 2MT9A 4YV1A 2J32A 1USGA 4OHCA 4TVSA 1GA1A 4QDUA 4KR6A 2WVGA 1NZJA 1Y6ZA 1FEZA 2GBGA 1EZ4A 3NNSA 1TUBA 3FR8A 4JUDX 4W6QA 3RHSA 4HDNB 3BQMB 4I4LA 2OZVA 2V65A 3QMPA 3BMNB 4MVJD 1F0PA 2GBPA 3Q8XB 2AR0A 1RHRA 2LW7A 2V58A 3EIOA 3D7SA 4E4RA 2IHYA 3ZE9A 4UOZA 3NPMA 4D43A 3LHDA 5IT4A 1IY0A 1DXOA 3NQ41 1TI7A 2QENA 4URHA 4P3YA 1GQFA 2OKCA 3SHVA 2WTNA 4URVR 1X3SA 1W94A 1KFCB 4PY2A 3OSZA 5JAMA 3D7MA 2WDZA 3GEGA 3ND7A 3CWZA 4RJIA 1B41A 1H8HD 3GRPA 5LZ7A 2Z43A 4CLDA 5IJ0B 4LI3X 1S3GA 5IBQA 2EX1A 2VNSA 3COZA 1NXTA 1UWCA 2H2DA 4MULA 4X1YA 4DG8A 1HRDA 2ZRLA 5A5VA 1J5PA 5B4UA 2QM3A 3ELUA 4QPJC 2P62A 5BNTA 4GI5A 2IUFA 2AFVA 3RRYA 1DX6A 2GS9A 4L1KA 5FPKA 2P9EA 1CUUA 2G83A 5REQA 4RWZA 2C0PA 3WNCA 2A4KA 3E5NA 4ZVMA 2Q5QA 2XYHA 3FCCA 3W5AA 1G8GA 3X1XA 2JLVA 2Q3MA 4C0HA 2FH5B 2VDLB 3UAZA 3ZK7A 3Q10A 4CUZA 3DFIA 3PXBA 4WJKB 4K3VA 1NF3A 4GPD1 4H6VA 4HWSA 4K3UA 4LWPA 5FD8A 2AZDA 3HU3A 3M4NA 3R8CA 1A97A 2H48A 4B4DA 3DOIA 1IFXA 1BAPA 5GIOE 1QP8A 3KOMA 4L95C 3TCNA 1A27A 5A7HA 4KU4A 1P7YA 3NTQA 2WT4A 4KG7A 2PSDA 4DZZA 3NKVA 4EF5A 5LXTB 3HKDB 3BX1A 4F06A 3RSCA 4KQGA 1GZ6A 2EDAA 4U4AA 4W7SA 2WSMA 4CQMA 3O82A 2K6GA 5EHXA 4ZN6A 3JQDA 2P3LA 3T34A 2VBIA 4G8CA 5E1BA 3IPCA 3LK6A 1E8DA 2ZRCA 2NTJA 1TYBE 4PZEA 2R8OA 1N78A 1CB0A 1JIIA 4UATA 5HQJA 1MV8A 2VHQA 4A2QA 5C7LO 4IZ6A 4L3VA 4ZYUA 4UBLA 1E1NA 4N7MA 5IT5A 2QVGA 2OG2A 4L7QA 4HPJB 4OP2A 4TM7A 4CODB 2C2YA 4IFTA 1V9SA 4HXGA 2LIPA 4J7AA 5TPZA 3WB2A 2J9ZB 1MH1A 2V45A 2GEJA 3O7WA 1VG1A 2A88A 3C0KA 2XJ9A 1DRKA 3G2NA 3KXDA 4LUCA 4R9NA 3WNDA 4EFKA 4TL9A 4INPA 5F9MA 3LYHA 1OWLA 3UXMA 3W2TA 3PU6A 1XDDA 4G1BA 5KOYA 2AG5A 4COOA 3QSYA 1YL5A 4M0UA 4JP1A 2ZJZA 2A4MA 4D56A 4CT5A 1NVTA 1P4GA 4RK1A 2XLBA 1UBLS 2BL4A 3BWEA 3GQBB 3JSXA 3NTLA 4ZK6A 5A7FA 1BJTA 1ONPA 4ER3A 1TJ4A 1P4HA 5FBWB 1OLXB 4G0VA 1NQXA 5B6IA 3GGCA 5IVIA 3G2HA 2X2PA 3GVPA 4G09A 3ER9A 2Y68A 1G6HA 1ESMA 5I7WA 3I4CA 3CR8A 2PH5A 5FADA 4MCAA 4TXMA 1IXRC 2CXPA 1OWMA 3BXGA 5L3VA 1EVZA 3HKCB 3MFYA 4HMOA 4K6HA 5KYVA 4JI3B 3ROGA 4IVNA 3TE6A 3VGJA 5EJFA 1ADCA 2Z3VA 3SNKA 1WBJB 1X1SA 2PKCA 4B7CA 1KARA 2H1HA 4GZLA 2O5RA 1NQTA 1C9NA 2B2XA 3UMVA 3DZCA 1V1JA 4I9UA 3W06A 2XADA 2TMYA 1I2DA 3KEOA 5HF9A 5ALLA 1BVYF 1OT5A 4KXQA 5A71A 4Q9JA 1BRTA 1C30B 3IP1A 4FCWA 1RPAA 1Y3AA 2Q46A 2X58A 2H1VA 3D81A 3H5VA 1LW6E 1JSXA 3VNSA 1BMQA 2JIMA 1TCUA 2ECPA 2YCLA 5KHAA 2ZCJA 1W9MA 1RQPA 4P86A 1MOPA 4RPCA 3O95A 4LMRA 3ZQJA 4C0KA 1F3OA 1UWVA 2QLMA 1X15A 3UPDA 1SOVA 3UJ9A 1D2GA 2PZAA 3QKIA 4P2GA 4BWYA 4DBZA 4DCVA 8MHTA 3LOQA 4EKDA 1U3VA 3TMKA 3TEMA 1WA5A 1TO6A 5A1TA 5HA5A 2R47A 4LKOA 1C3OB 4UM8B 4MV7A 1RJGA 3RFTA 4RUKA 3VTFA 1E94E 4K9RA 4CTJA 4R8RA 4PRYA 2VJKA 4QOJA 3C24A 4JC5A 3NNDA 4PLTA 5DYTA 2W11A 3LO5A 3K6RA 4HSEA 4OXKA 2AMFA 4F5EA 2AFIE 4LSZA 4YMIA 4BTVA 5BSKA 1L5SA 3N2EA 3DHEA 4K1LA 4UFPA 1PV1A 2AC7A 2JANA 1T0IA 4CDGA 1GO2A 3P9ZA 3SXUB 4R7ZA 2PUDA 3ZNNA 4DLSA 2VF8A 5DN6D 3OOWA 3O3OB 4WK4B 5MHTA 4UAJA 4X64B 2WJ4A 3WL5A 3ADCA 5AM3A 3UM9A 2HREA 4BQNA 3KJIA 2PUBA 3PTZA 2R25B 1OX4A 4LRSB 1Q20A 2IYYA 3MOSA 2WHPA 2Y67A 1EDBA 1YDWA 4ZVQA 3TEJA 4YXFA 3U7FB 1O97D 4FW8A 1LBHA 3LBNA 4LK2A 5HKBA 3QJ5A 1CEEA 5BSUA 2RMKA 2HBQA 3TIGA 1OD6A 4RTSA 1LD3A 4D99A 4EHHA 1ZOLA 3EISA 4ZODA 3TL2A 3EE6A 1Z26A 3PXEA 3TTVA 3VX4A 3WZMA 3G49A 4YMVA 3AKZA 3DDNA 5C52B 4Z1MD 2B20A 1VIMA 1ZMTA 5DO9A 1G16A 3L04A 1PYDA 5DF1A 2QSYA 4F8YA 3ESDA 3LSYA 1J0EA 1UFRA 4UHBA 3Q1KA 4HAZA 2QUZA 1CTQA 1UP7A 3NU1A 1CUWA 4QXRA 3UMGA 1LNZA 1NVUQ 2GZ2A 3EVAA 3GUZA 4LTMA 4BLOA 4GMKA 2P2CA 4Z7OB 3AGQA 1H3EA 4O4LA 4TMTA 3S2FA 5CLHA 4TMYA 1RKQA 5AI6A 4HADA 2D2EA 3R7DA 4JASB 5JXWA 5B1IA 4F4CA 2ODNA 2AQHA 1BRMA 4LBWA 4JBNA 3DMGA 4KQHA 5DSXA 3TM5A 5JNRA 2OPBA 2Q8PA 3PXDA 5M04A 2F43B 1S89A 1FP6A 3DLHA 3WICA 1S2OA 1RHJA 4S1NA 2QRVB 3WOHA 4CMEC 3S2EA 1G6KA 4D8XA 4N48A 2I2BA 5EKDA 3G1WA 1NM5A 4MO2A 3EVCA 2HT1A 4ENSA 4YUZA 3BE8A 3B36A 1F2DA 2WD8A 3FPAA 4PGFA 1OU4A 4UCQA 4AX8A 5A9SB 1BO6A 4ACBA 1XYYA 3F7OA 4R5HA 2YYSA 4TRMA 4WN3A 5EVCA 2F2TA 4BLSA 4XDZA 2WJPA 5FBHA 2NQ8A 3G7NA 3QVWA 2EL9A 3C85A 2I6SA 5I51A 1OFUX 3ROQA 2LD4A 3OQOA 5AKKA 1J24A 1E0KA 3GBPA 3KAPA 2HM7A 3FM9A 4QT0A 5ITZA 1SZPA 1JT2A 3GG2A 3GDGA 4DA9A 1HL7A 4QYMA 4XB6B 1IPHA 4QFMA 4NCAA 1KJYA 4N3CA 5DFAA 1M2GA 2WM8A 3EDRA 2CBGA 1RI1A 4Y9RA 3QFCA 1PG5A 3NYIA 1BS2A 4J7XA 3TDKA 3ZDRA 4LNHA 5B36A 3DOHA 3OE7D 3PQCA 1KDRA 2FX3A 3AHIA 3ICPA 4LRYA 3IULA 4AM8A 1Y9JA 4UTXA 1LBSA 3TR5A 5I9SA 3UB4A 2LCFA 4RXUA 4BDSA 5BY2A 2WZBA 4V24A 4PLPA 3PWZA 3ROEA 4DF3A 4O4IA 4RHUA 4LOLA 2G09A 1JXQA 4MDHA 4JJ8A 3WWPA 2NSYA 1YBVA 1O9HA 4IRMA 2Y66A 2J0UB 3DXYA 2FFAA 1NUAA 4DLUA 4FNOA 2YQZA 1RWKA 5BNFA 5CBKA 4PO3X 3K71B 4YJ3B 4OPMA 5DHPA 3VR5A 1F0NA 4R1LA 4X6YA 4Y7CA 5NLLA 4R41A 5LUBA 1RP1A 1W4ZA 1S8NA 3GPIA 4CMAA 4QICA 1Z4KA 1UDWA 1KZ6A 3H2ZA 1D1TA 3PPIA 4Y8VA 2FSPA 3I5AA 4Q7KA 1ZJ6A 2GVZC 3PKIA 3Q6NA 1UKYA 3FYSA 4ID3A 1IUOA 4UHEA 5CYPA 1XPOA 1MC4A 2EBUA 4I4IA 3QKSB 5JUWA 2CYCA 4DR6B 3BQ9A 1YSCA 2PA0A 2HDHA 1HC7A 5TRTA 4YV2A 5DX1A 3PNSA 2NUAA 3U4DA 3FHOA 5B6JA 5LPNA 2YVKA 3KSDO 2X77A 3QLUA 1XVTA 1Z4PX 3VAYA 4E4YA 5LYYA 5K0ZA 3EVZA 1O03A 1Q1AA 3R2JA 3IP3A 1ACMA 4DUGA 4N8EA 5G40A 3UCEA 3ZI7A 1PJBA 3HFGA 1YGYA 1Z0UA 1FDIA 4MJ7A 2J31A 4G56A 1DMRA 3MELA 4FN4A 5JFOA 2POCA 3H5IA 3KSBC 2Q28A 4RQBA 3RFCA 4Y2XA 3G7UA 2MR6A 3CE6A 4FYWA 4WOJA 4YPOA 2Z2XA 5HPYB 3U4IA 1YC2A 2UZ0A 3KZCA 4HQRA 4W99A 1AK2A 1XZFA 1PNRA 1RJEA 3EFOB 4KQXA 4QAJA 5HQ3B 1JFTA 2C94A 1DJOA 2ZULA 4K9NA 3WTBA 3FOCA 3KVVA 2JFUA 3Q8MA 4RD4A 4LBVA 3GD7A 2VXOA 3OM9A 3RRXA 2X5OA 1C50A 1RR6A 2OM2A 4WLVA 4DV7B 1B0ZA 3ZU5A 4D4JA 2H65A 1DJPA 4RAQA 3GUYA 5C37A 3VR3D 1GGNA 5ALRA 3W7AA 1KQGA 4KL8S 1YZVA 2ILVA 1K08A 2EEPA 2Z3WA 3T1QA 2QLBA 1ONNA 4G1UC 1UZMA 5HTKA 3ZNPA 1FDSA 1I24A 4FE4A 3MQ2A 3NKLA 4EOGA 1K4MA 4NNOA 1T9CA 4KPGA 5AM0A 1JDBB 1ZKMA 3F8WA 4ZZ1A 3R3WA 4HRXA 3K3PA 3SEAA 1J8MF 2YWRA 5IBCA 1X8XA 1ZJJA 3FMFA 1E5TA 1GZ4A 4LCEA 3RLIA 3LQFA 4ON9A 3EOZA 1DT3A 3KK0A 1VE1A 4NAUA 4CR7A 1XEAA 3R75A 5EKUA 1H8ED 3FVQA 4CEIB 1K6JA 1X7ZA 1S7GA 3HY3A 2FYTA 2ISCA 5TMPA 1XJWA 1XRLA 2CJYA 2QRZA 3EUWA 4KR9A 4ENUA 1OBFO 4EKYA 1NPDA 3N3BC 4M7OA 4PQEA 3V2GA 3KKLA 1IRXA 1RM5A 3UICA 3EFHA 4FR2A 2VG8A 1LNSA 2JC3A 3BRQA 4G23A 2CGEA 5AQEA 3RANA 2C59A 1KDTA 3WGIA 2R60A 3FZGA 3MNFA 4QL3A 4ZEXA 2PR2A 4R05A 1UBFA 4MPDA 5JD3A 3WDLA 4PYNA 4XD7A 2IV2X 2ORIA 2BFFB 1IEWA 3BK7A 1TT5A 4JXXA 4P7BA 2KJQA 2QXUA 4PE5B 3HU1A 3RUEA 5ICMA 4AROA 5GPBA 5A4FS 4BVGA 5FWAA 1F7UA 2NUTA 4PZ0A 2AMJA 4KLZA 1NT2A 3AU9A 2GVNA 1KTVA 4FFNA 5DHAA 2JIPA 2PH3A 2QAIA 1NC1A 4RGYA 1RRGA 4XR9A 4HNHA 2VJPA 2F64A 1ONBA 1QE5A 4WKPA 3A6KA 3KHUA 4X91A 3CRW1 1NJSA 2E4WA 5BQOA 5ITWA 4P83A 3HCPA 4EKEA 1PK7A 2G4LA 4I9HA 3OETA 4O2RA 5DHFA 3IOCA 4OG2A 1U6JA 4UQPA 1WDKA 4G4SP 2CF6A 5BSMA 4YR9A 3NHLA 1YACA 3LP6A 3UMRA 1SQFA 1VL6A 3GFTA 5BVGA 3DM5A 2A0FA 1DAKA 2EFGA 3NTVA 4FFLA 4I6EA 3K9GA 3I53A 4O1MA 2FSVA 2HCTA 2X0DA 3QP9A 1SBTA 3ZDCA 1H4SA 1E32A 4E88A 2C5SA 3FLAA 1CF2O 1G7RA 4B84A 5JO9A 1DIBA 4XYBA 3BL8A 4WXRA 5BWNA 2XIJA 5CA0F 3MG9A 5CM2Z 2V3WA 2B4RO 2D0PB 4JOBA 1UBJS 3ZQ6A 2Y76A 1BDIA 5KDDA 4WE3A 1RC0A 2R8EA 4Y2YA 3KJFA 3AOGA 3BFXA 4AURA 3VKHA 1ZC3A 1R88A 1D1SA 4ZYYA 2H1OA 1I8TA 4R3NA 2Z5LA 3EOBI 1A5TA 5K09A 2PUHA 1ISHA 1N9GB 3BE4A 2ASVA 4GR9A 5AW9A 3THXA 2HYDA 1JJIA 4D3SA 3FCUB 4ER0A 5ALXA 1GLGA 2C8LA 1FA9A 1V71A 1DRWA 2IITA 3U19A 1FX1A 4XI9A 4L3WA 3FSGD 3TW4A 1UDXA 3SQXA 2IP2A 3IBSA 3NM5A 2QX6A 3D7KA 1XTUA 3PCTA 4HDNA 1OBCA 2I3BA 3OLYA 5DNCA 3JALA 2FFQA 3BMNA 4RY2A 1HNZB 4XIJA 3JQBC 5FTMA 5FL3A 5TEVA 1DC4A 1TLFA 3IH5A 2ZXUA 1I0LA 1SIWA 2JFGA 2JJ1A 2WB4A 4A16A 4IDDA 4MYUA 2I76A 1LDMA 4KW7A 2DFTA 4IJQA 4PGHA 1NWHA 2GCOA 2HBRA 4R71A 1ZFNA 1BW9B 2FN3A 1GAXA 1KQPA 3IQDB 4E33A 5KYNA 3NHJA 4TZ6A 2XUHA 3VU8A 3VKWA 5CX1B 2C0CA 3ZY3A 1E2BA 1ABFA 1ZGGA 2D8AA 2DQZA 5JPIA 2CW5A 3N8KA 4FFVA 2VZ9A 1DOAA 4C76A 1DOHA 2TYSB 4ARAA 1H6AA 5TY0A 3K1AB 1VSTA 1C4OA 3FUWA 3QW2A 1XALA 4UMDA 4R2JA 2I4OA 2XZPA 1KMNA 3D3NA 3QMWA 4J0IA 3DEJA 1XA0A 3H8JA 1BSVA 3HADA 4DBLC 3IUQA 3G3EA 4EO9A 2G6BA 2PRYA 1QDEA 4DCNA 5JJKA 5AJHA 2VSYA 3TUIC 3WNVA 5F2EA 1P7PA 4YRBA 2ACEA 3GJXC 2OSVA 1W5TA 4EECA 1EFRD 1XQWA 3FCOA 3IA2A 2Y9MB 1D0IA 2GBFA 4K2HA 2GMWA 4C4TA 5GTDA 2CFTA 2HSJA 3IB3A 1S8FA 2X1VA 1TB4A 2RSLA 3T7AA 1HDRA 1BZYA 3HSSA 3NLLA 4B48A 1C5KA 1UOOA 3CKYA 3L8HA 1FMTA 4GKAA 4ZOLB 1R9GA 3K4HA 1BS1A 2ZDQA 1IQ0A 3O93A 4XUEA 5CPBA 4NCBA 2JZOA 4EMBA 1VG0B 5P21A 4J0KA 3U7GA 1MB9A 3BHMA 1WULS 1JPNA 3VOBA 4RIFA 2D3WA 2YOHA 3LC2O 3FB1A 3HKDA 4L4ZA 5LXTA 3DBVO 3DB1A 3JV7A 1QK4A 3TNFA 3WQRA 4MUGA 4JUAA 1HFKA 2ROQA 3EIUA 2VWPA 4JP8A 4M9SA 1KO7A 1P1CA 4M6WA 4Y0VA 3C7DB 1O8CA 1GWNA 5CHEA 3VSDA 1WWKA 4QSHA 3E82A 4Y0NA 3ENVA 4L73A 4P08A 1U3WA 3MJCA 2FUG6 5AUOB 3PBKA 2Z56A 4G85A 4RLSA 4C88A 4JLSA 4KR0A 2GZMA 2GOYA 4XDGA 2QW8A 5C8DA 2Z30A 3LY5A 4R4JA 1CRZA 3PHHA 2GXSA 1AGYA 1GN8A 2P3QA 3CISA 1U4NA 4KYIB 5DLEA 2OA0A 5B3AA 4OAPA 4GH5A 4NQRA 4P34A 1LFDB 1A5BB 3ZYCA 2EATA 4JSTA 4UHDA 1EA7A 1ST3A 1OZHA 1XP8A 4B2IA 1UDAA 3QF7A 2GN6A 2HD4A 3QKWA 5CT9A 1R5OA 5GV8A 1XU9A 3IP7A 3O3CA 4NWIA 2PLFA 3C87A 3GQBA 2XSZA 2IP4A 4IXTA 4F97A 1WXXA 3EWSA 4Y2GA 1DHRA 4B2PA 5ARCA 3SHQA 1OLXA 4NFSA 2YFQA 1PR6A 2QOEA 3QOFA 1LA2A 3R4CA 4P2BA 3SFTA 3SS8A 2XCSB 1XK7A 3QYFA 2CWDA 2YIJA 3F2IA 3ZXUB 9LDTA 3OUUA 3G8CA 1RLOA 3UWDA 3LLVA 4KXUA 1GPBA 1ENPA 1CY6A 1L1QA 1NT4A 1VCMA 2CUKA 1SVLA 3QE4A 4GE0A 4RABA 4RQAA 2FW7A 5IF3A 5K45A 2HWYA 1AGXA 1WU8A 3TD9A 5T4BA 5JT1A 4RTNA 3G6KA 3HKCA 4KXYA 4Q0MA 3SIXA 4ROTA 3WSVA 4X24A 3GDWA 5EY5B 4DDHA 3FUUA 3GLQA 4ZJZA 4MKGA 1G4HA 1OYOA 1JTEA 2H54A 4TTAA 1Q1BA 2WTXA 3BORA 4YN3A 4A8TA 3AVUA 3DOOA 3EAGA 2ZAMA 4C04A 1MW8X 3NDIA 1B3RA 1RHMA 1GQOA 4JI6B 3I9NA 1DCMA 3LH5A 1K88A 1ZITA 2GZ3A 2I03A 1DXYA 3C6QA 1C30A 1YQTA 5AVKA 5I01A 4RPKA 2QMYA 2Q5IA 1VE3A 5C32A 4EI2A 1RZVA 2L2QA 3LXUX 1G2PA 4MA0A 1PU2A 3LW8A 3OZSA 2AEEA 2F1RA 2JI4A 4MIYA 2AF4C 4O3FA 5EMJA 1LS6A 5L7YA 4QYTA 3AVPA 3PF9A 4RZUA 4GBJA 4ZP1A 2QL6A 1FZQA 3LXMA 3TGLA 3CM0A 1T1RA 3OQ6A 2IHUA 4N5LA 1FNMA 1TC1A 1ZRHA 4XGIA 4AT1A 1ZWLA 4DYDA 3AVXA 4NE7A 3OZFA 3I8XA 4FXPA 3NATA 1MJNA 4PG6A 1C3OA 5HG0A 2QN3A 3IUEA 2QUBA 3RSFA 2ZCVA 1S2GA 3DZKA 4A6PA 5IJ9A 1MTZA 1Q6ZA 3K0AB 5E8RA 1C7ZA 1SUAA 2OHVA 4LQDA 1L3CA 5FLEX 1IBLB 1LCIA 1VKHA 1E6MA 1J2JA 1TJYA 1CHDA 3R6WA 4HAIA 5FOUA 3C3AA 3O2NA 3FOWA 1NR5A 2AEJA 3F6PA 3GFSA 1VC2A 4F1WA 1TFUA 1A95A 1ZM2A 1TGYA 1M1XB 2ATEA 3P2YA 1BE8A 1KSJA 4PV7A 2BTOA 3LPAA 3SXUA 3I4LA 2H4JA 2RGAA 1W0CA 1E89A 4EG8A 4L0CA 2V4UA 1GNRA 1M1ZA 2WAYA 2DHDA 2QJWA 1VCNA 3IPRA 1QOPB 3VSCA 5DIZA 3L07A 3RF6A 1XTZA 4FP9A 4KHZA 4XIGS 4DDWA 3LWZA 3M49A 6YASA 5BXQC 1QK5A