4WBSA

Crystal structure of an abc transporter related protein from burkholderia phymatum
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
246
Chain Sequence
SSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDAGEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQVGDDGKRLSKDAIASRTEALLDELQISHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPGDIIENESVRRVYLGEHFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter related
publication title Crystal structure of an ABC transporter related protein from Burkholderia phymatum
rcsb
source organism Burkholderia phymatum
total genus 82
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wbsA00
5ANRB 1G1MA 2Q9CA 1OYYA 3FFBA 2REXB 2ZETA 1BKDR 3W3ZB 421PA 1D9ZA 1TU4A 5M04A 2FSIA 3KUCA 1CXZA 1NBMD 4MUAA 1N5JA 3AF1A 4UXHA 2MSDB 5CDFE 2ZVPX 1COWD 4HAVA 5FBVB 2WIBA 1VG9B 3GJ3A 3W8RA 4B74A 5CB6A 2H18A 5DSZA 3GLHE 3I8XA 4B73A 2P0EA 3A4NA 1LB1B 1TMKA 2VP0A 3R9IA 2ZANA 1N2CE 1J70A 1G7CA 2IXFA 4DT1B 1VG0B 3RABA 5JWOA 1CEEA 1AK2A 2WTUA 1T0HB 1K8RA 1NSTA 2OFXA 4IEIA 4M22A 1TTTA 4D4LA 1E94E 2W00A 4YMSA 3RRYA 1ZUIA 3CX8A 2HLDA 2O0HA 2VBCA 2WKRA 3K70C 1FX0B 2FGJA 4TL7A 1SXJE 4KFTA 4HB4A 4O0MA 1ZU5A 2DFKB 3ZLJA 3SQWA 1QF9A 2XNDA 3E5HA 4TQ9A 2A5YB 1BH2A 3AB3A 1W36D 2V6JA 4HLCA 4GDFA 2QRNA 1XEXB 3CRQA 1HV8A 4KITB 1OH8A 2KBEA 2R44A 1YJ5A 3LD9A 3MWLA 4D25A 2IT1A 4AI6A 1W46A 5IK2D 2GXQA 2O0JA 2IF2A 3ETLA 3P26A 5ELXA 1OFHA 4L16A 5DGXA 1XCMA 4M9XA 2X2EA 4MRPA 4PX9A 1SQ5A 2JJ8A 1Q1EA 1Q22A 3FWYA 4LPSA 3C16C 1UFQA 5EQTA 1KKLA 4M4SA 1GDDA 1NSFA 2OXRA 5HE8A 4ARZA 2ATXA 4B3XA 4PAOA 3TAUA 3T15A 3K9LA 1SKYB 3DOFA 3U6BA 5KYKA 3AEZA 5FOTA 3UWKA 3GLFA 4B3DA 1CR4A 1OW3B 2DY1A 5AK0A 3LVQE 1GITA 4M2LA 3EASA 1M34E 4AG5A 4A82A 1ESMA 4JLAA 3TQCA 5AUOB 2D2FA 2J3EA 1XMIA 1TF5A 2F1JA 1J90A 4PANA 2YVUA 2RGGA 3ZVRA 1Q3HA 2ZS9A 1O87A 2QZ4A 4HB0A 4H1VA 3ZVNA 5EE3A 3GLIE 3EZ7A 4TYNA 5EXXA 4A6XA 1OE0A 3AF0A 4NZYA 4XTCS 3ZGXA 1IXSB 3U7FB 4QBFA 1PJRA 2EYQA 4C0AC 3B1ZA 5JEEA 3OAAD 1NNEA 4MKFA 3U61B 1AQYA 5GJCA 3TUZC 1F48A 2PMDA 5KPDA 4IJMA 2ZEJA 2ZR0A 4X8LA 1BS1A 3QXJA 2FG5A 3NIBA 3PQCA 2LCFA 4HATA 4C0JA 4F7WA 4QNMA 4PC3A 1SXJD 1WF3A 4V0ME 3T1OA 3A37A 3KB1A 2IYQA 1T8TA 1WRBA 1MH1A 4RZ2A 1S9HA 2D74A 4XVRA 2C95A 1NVXQ 4GFDA 4C0HA 2XXAB 1XTIA 2PEZA 4U02A 2HJGA 2GXUA 2WIAA 1W0KA 1XXHE 4ZV4A 4OK5A 4OKSA 5CM9C 3U7HB 1GP2A 1XBTA 1EX6A 4KYIB 4LI0A 3K8YA 3TJZA 1A2BA 1G3RA 2REOA 3BB3A 4OHZA 4W5JA 2WSSD 2OO7A 2WWWA 1ZD8A 1JXMA 3RANA 1NN3A 2WOJA 4ASUA 5KTYA 4CGZA 1WCV1 4M8NE 2FV8A 3VAAA 3AUYA 1VYTA 3H2YA 4A9AA 3V4FA 4TMTA 3E1SA 5E7IA 4JLVA 1CP2A 4R9UC 4G1UC 2FH5B 1OXVA 2CVHA 4QJ4A 5DI3B 3T06B 2CLDX 1FMJA 4D2IA 2D7CA 1U8AA 3TR0A 3LXRA 1Z5ZA 3A4LA 1LVGA 4TL8A 1OH7A 2CE2X 3ZD6A 4QHSA 1KSHA 3K09C 1SVIA 2ZJYA 3QJYA 1G5TA 1XEFA 2CMKA 4WIAA 4M0LA 1E0SA 3OEHD 2BCJQ 5LDDC 2J45A 4TSFA 3B1WA 2IYSA 3RVBA 4GOKA 4LZZA 4TLEA 3U4QB 3I73A 1UPTA 3CWQA 4HZUA 4YXWD 3AH8A 4PPFA 4HLDA 2XX3A 3A6PC 1OH6A 3C7KA 3B78A 2WWYA 2V54A 3RRMA 3SYNA 5DE3A 1LF0A 2QPTA 2ZRKA 5D3MA 1NKTA 1CJTC 4KBFA 4FMBB 2JCSA 3RSLA 4CEJB 3IILA 4Y0VA 3GJ0A 2GAAA 5KDOA 4QKQA 4URWR 2XNSA 4D82A 1SGWA 1E4YA 3HDTA 2ZRLA 2F3RA 1FP6A 1LS6A 3EA5A 4QM7A 3IKJA 1RIFA 5JWHA 5JEDA 2IXEA 4YC7A 1QHHA 1E1RD 2F1RA 4BFWA 4E03A 2YWGA 1HUQA 1QHSA 2ZRFA 4B75A 1D2EA 2J5XA 2QQ0A 1QG2A 4MUBA 5CIWA 3Q85A 3TAHA 1OB2A 4NYJQ 2J1LA 4LV8B 2Z83A 1N6PA 3JVVA 4E5UA 2O8FA 2QE7D 2VPPA 2R6AA 3LO5A 2Z4RA 4JLOA 4QJ5A 3O8CA 3TVDA 2O8DB 3C5HA 1RPZA 1KI6A 3H4MA 4G5OA 3EC1A 1KI7A 3QXCA 4HDCA 1JAHA 2OE2A 3Q72A 4PHGA 4AYTA 2XZOA 3B1YA 4NONA 1U9IC 2GESA 2ORVA 1ZINA 5FI0B 2OZEA 2PBRA 5G53C 4BLQA 5CB8A 3RS5A 3CM0A 3NC1C 3ECCA 2GEVA 1P3JA 2GF0A 3GLHB 2P5SA 2IYLD 2VEDA 4PHFA 4IOKA 4Q66C 2VP9A 4AYXA 4MDFA 2BEKA 3RHFA 4ZDWA 4ZI2A 3UPUA 1ZC3A 4JJKA 3HPRA 3MSXA 2PZGA 1KK3A 2W83A 5HE9A 4TYWA 3PEWA 2G6BA 1U94A 2VP6A 1IY0A 4JLBA 3SS8A 3DZDA 1KKMA 2FGKA 4ZCIA 1SXJB 3IEUA 5L3VA 4EJSA 4GMXA 8OHMA 2HCJB 1CS4C 2DHRA 4A36A 2D7DA 1SHKA 4ESHA 3AVQA 3THWA 2IS4A 3UWOA 3FFAA 3IIJA 4I81A 4XSGA 1PUIA 1E32A 3F3YA 2HJVA 4CRWB 5JI2E 1PZNA 2JIZA 3GEHA 4LJ4A 4HAWA 1E2PA 3BOSA 1MABB 2CCKA 4TMZA 5KSPA 2C03A 1LTQA 1E9BA 1HQCA 3WP1B 3CNLA 1N5IA 3QG5A 4BLOA 3QKUA 4DSOA 3R7WA 1ZNZA 4JLMA 4A2WA 4BUJA 1GG2A 1G17A 3ZD7A 2NG1A 1P4SA 3HPQA 1LY1A 3KFXA 1HTWA 4RCYA 3RC3A 4N0EA 4WAUA 4JLNA 4Y0AA 4OK3A 4DVGA 1Q0UA 4QXAA 5F98A 4BFTA 3QI2A 1UADA 5KOYA 2GF9A 2ZAOA 2HUPA 4B32A 3CO5A 3B8HA 3W6NA 1ZW6A 2V8OA 1FQJA 4QJ3A 2NIPA 2XTNA 3Q3JB 4ZCMA 2QROA 5L3RA 4Z54A 5JI3E 2XAUA 2ZROA 2J46A 2F3TA 2WZQA 2WKQA 3AP3A 3K0SA 1XTQA 3IUYA 3VR4A 3EARA 2RGBA 2IYVA 2NO1A 2CXXA 4JBWA 3GLGE 1UM8A 2Q3HA 5FFMA 2DWOA 2IYTA 4MGKR 1IBRA 4PR0A 4WBSA 2GNOA 4LBVA 1GSIA 1VG8A 4C0SA 2QG6A 4JVSB 4K81B 3HWSA 5FR1A 3VKGA 1DVRA 2DYKA 3LW7A 3B85A 4D80A 1OV4A 4LK2A 3FKSA 4P32A 1OHHD 4UNPA 1F2UA 1C1YA 1JR3E 1M8PA 1NKSA 5CIQA 3U44B 3OIYA 1OSNA 4M9QA 4AKEA 3Q9LA 3BH0A 2PT7A 1SVWA 1KO4A 3A4MA 4EPRA 2HXYA 4QM6A 2QP9X 721PA 2ZR7A 1ZJ6A 2Q9AA 3EPKA 2PJZA 2RGDA 4HEJA 2FFQA 5GJBA 2WWIA 1CKEA 5TV2A 3BERA 3CR7A 1P61B 1NI3A 2GILA 4G5RA 4DXAA 4Q4JB 3W5JA 4U5XA 2CNWA 4I1SA 3ZS9A 2F9LA 4CEIA 1E4VA 1F5NA 4HLQB 2JLYA 1HH4A 4YMVA 1QHIA 2ZRMA 3GEIA 4Z8YA 1RJ9A 2VF8A 5FPSA 3D7MA 2PZFA 1SHZA 3WYGA 3X1DA 1TQDA 1YE8A 2ASEA 3QSYA 4FW9A 2XITA 4UNRA 4IHQA 1W36C 1GKUB 3FHTA 2FFHA 4DKXA 1U99A 2IF0A 3RWMB 2YWFA 4B43A 4YONB 3OFND 2ZJ5A 3B7GA 1W44A 4MH0R 1KAOA 3JZAA 2CHQA 1QG4A 5JJKA 2PLRA 2V7QA 2ZI7A 4I1VA 2CDNA 1JXOA 1E9FA 2WICA 2WV9A 1VIAA 4LSGA 3AM1A 3BRWD 4M9ZA 1OKKA 3MD0A 2MSEB 4IVRA 4LHWA 2X19A 2J0UB 1CR0A 2QU8A 2NPIA 3FE2A 3B13B 4GT1A 2C96A 2WSMA 3REGA 2R9VA 4DCSA 2QNRA 4OL0A 2GRJA 3GD7A 5F3WB 4DCUA 5FBRB 2QAGB 3H84A 1ZCAA 2J7PA 3ZQJA 1BYUA 3BH7A 1JR3D 4FI3C 5KPJA 1AGRA 3TSOA 4FD2A 5AUPB 4XTRA 1XZPA 4Q4HB 2ZITA 2Q9BA 3AKYA 1G4UR 2R2AA 1Z0AA 2R62A 1N6LA 4Q5IA 3AKCA 3L2OB 3HYRA 4FMDB 1GFIA 1FZQA 3ZZTA 3PIRA 1R2QA 5EE1A 4UJ5A 4MYTA 1GM5A 1JAIA 1P2UA 2ZRJA 3CRW1 4Q9IA 3WMEA 5TMPA 3T1TA 5HCIA 3LNCA 3U3OA 4Q1EA 3UMSA 1E1QD 1Q21A 4TMVA 4Q4AB 4MRRA 5EUMA 3O8DA 1EESA 5HZKA 3GJ5A 3IIMA 1G3QA 1Q20A 1ONBA 4D0LB 2Q3FA 1SXJC 4RD4A 4YMWA 4BEBA 3THXB 1KSFX 2REBA 2GBLC 3SHFA 3UMRA 4HAYA 1DPFA 2AKYA 3BD9A 3FMOB 1GOTA 4US0R 3AGQA 2BBSA 1Q44A 3KFVA 1KJWA 4JT2A 3ZQ6A 4A0GA 1E0KA 3LXXA 4BPBA 5E7JA 1SKYE 3BAFA 1GKIA 1UDWA 1JQJC 1W0JA 3IGFA 1J7KA 4KAXA 3QXSA 1G19A 2QP4A 2QMHA 2D4HA 1Z22A 3PG5A 4A0HA 3LBHA 1UBFA 2HXSA 4RCZA 3TK1A 1H8HD 1XD9A 2GJ8A 4KLNA 4TMWA 4JS0A 4EFNA 4M1MA 1MO5A 2QL6A 4LOAA 4PXAA 4C3ZA 3AF2A 1KK2A 4GMDA 1OIVA 1CU1A 1JEEA 1AN0A 4MGZR 4DJTA 4IVPA 4BRWA 4NHOA 4LHZA 4A92A 3I62A 2ANCA 2V55B 3EIEA 2AKAB 2GXAA 3TH5A 3EPLA 3CUEF 4OHXA 5JBQA 2BCGY 3C4JA 2GCPA 1SVKA 1E79A 2O0KA 4RSGA 3AKDA 1GTVA 4PSAA 4NYIQ 4IXNA 3LLUA 4G01B 3L43A 5DN6A 1G8YA 2IW3A 3EZ9A 2BJWA 1Q1BA 2UVQA 2WJVA 3IO5A 3CNOA 2GK7A 2K5UA 1HT1E 1Z47A 2W6ID 1CJMA 3GEEA 2X8AA 3P20A 4NL4H 4OK6A 4PQRA 3HJNA 3U5ZB 4KO8A 3VNVA 1E9AA 2FJUA 2IYUA 3WNBA 2FSGA 1Z28A 3KZ1E 4TT3D 2ORIA 4MRVA 4LJ6A 4PAQA 1T5LA 1G16A 2NO9A 1SVSA 3AF3A 1N3BA 1E99A 1KY3A 2GK6A 3KTAA 5FUWA 1TQ6A 3V9PA 4ARZB 2YOGA 5C1BA 3QEJA 4DLZA 1KI8A 2O8EB 1KDOA 2ZI4A 1ANKA 3BWDD 3W6OA 1RC8A 1A5TA 3LBIA 4WZBE 1E69A 1U8ZA 2BKUA 4N0DA 1WMSA 2OFWA 1X3SA 1E2EA 3P4XA 4LJ8A 4BLSA 2IUSA 5SZIA 2EFEB 3RNLA 1U90A 2PL3A 1TADA 3AV0B 1UAAA 3ND9A 2ONKA 2AX4A 2NGRA 5AJYA 1KI2A 2Z6VA 2WWXA 3W3AA 2VO1A 5B30A 2F9MA 2G88A 1EG7A 1RE0A 1RYFA 2H16A 2ZJBA 4IEEA 5H68A 2ZYUX 1B0UA 3SOPA 2G1KA 3DHWC 1LV7A 2BBTA 2WKPA 4TZ6A 2D62A 4NKRA 4URVR 3O8RA 2ODEA 5K8LA 4GZLA 2OLJA 2YOFA 1R4AA 4B44A 2AWOA 3SJZA 4F4IA 4TTRA 1IY2A 2G83A 1RKBA 1VIYA 2VSFA 1A4RA 4P33A 3K0FA 3OEED 1DOAA 3AVXA 1HE8B 2ZSAA 2ZRNA 3BB1A 3B1XA 3CPHA 4BEJA 4P4UA 4GI7A 1DTSA 2BMJA 5JCZA 2R6DA 2OBNA 1NN1A 1X6VA 2IYWA 3UMFA 2WJYA 1Z2CA 2BBWA 3BIFA 5KNDA 2AN9A 2EFDB 4M1YA 1P9RA 4LC0A 5FBWB 5HKKA 1XD2B 1GL9B 3ICEA 2DWPA 1U8YA 1W4RA 3NG1A 1VHLA 2QAGC 3QOFA 1GAJA 2ZE7A 3P32A 2FFBA 4KFUA 1W2GA 1W4CA 3LX5A 1VCOA 4KCGA 1KAGA 4M1WA 4OJKA 2QM8A 1BMFD 2KJQA 1C4OA 2P6UA 1AS0A 3NHAA 3ICQB 1QBKC 4AYWA 5B58C 1T4GA 4BZQA 2VQSA 1E0JA 3B6EA 3VMFA 5EE5B 4FCTA 4XD7D 2GVDC 3O47A 1MO6A 1EFRA 5FL7D 3P27A 1M7BA 4JKIA 4A8JC 2OBLA 4LBZA 1NL3A 1R0XA 3SBEA 5CITA 1UJ2A 5A0FA 3G82C 2I4IA 4P0TA 3QF7A 2CE7A 4GSYA 5BW8A 4UNSA 3V00A 3ZVLA 5G3YA 4LYAA 1E3MA 5FUXA 1TQ2A 1AKYA 1ZVQA 3S1AA 2WOOA 2ZJOA 5FBQB 1DAEA 2XTZA 3LDAA 2GCOA 5LD2B 3NDPA 2VLIA 3TUJC 1IAQA 4Q9KA 4EKDA 3KKPA 4TYPA 4BLRA 1MO4A 4DSUA 1P7CA 4AWXA 3T1QA 1KIMA 5CK4A 4JBXA 2CJWA 3FYHA 2HEIA 2BMFA 1CJUC 3DVLA 4Q01A 5D3MB 3TR5A 2IC5A 2JJ1A 1G7SA 1II0A 1ZM3A 2NZJA 3SEAA 3A1WA 3KDSE 3CKLA 2XSZD 1R0WA 1X1SA 1G64A 3KUDA 4IOJA 2YZ2A 5HCNA 4LYFA 3BE4A 4P4SA 2RMKA 1WP9A 2ZJZA 1S9DA 1MV5A 2ZSEA 1X86B 2V9PA 1Z0JA 1YVDA 1D9XA 4FMCB 5SZKB 2CL6X 5FBLB 5J4LA 4D6PA 1QHHB 5AUQA 3PR1A 5DI9A 4JZKA 2DR3A 3DZ8A 4JVNA 1QHGA 4M1SA 1SKQA 1GNRA 4PQYA 4JSTA 1DE0A 3FVQA 1KO7A 4NYJR 5HPYB 1FTSA 4HAZA 4Q1FA 2O8FB 4HDQB 5EP3A 3UKDA 1KMHA 4ZIRA 2F55A 5G41A 2WPDA 2RB4A 4LPKA 2ZJ2A 1XX6A 1TEVA 1KI6B 2OLKA 1N6NA 4QC2A 4TZ0A 4RVCA 1QHYA 4G5GA 4K46A 1OIXA 1N25A 1CR1A 1VECA 4P4TA 1Z0IA 5D3QA 3IEVA 4S35A 1Z3IX 4WZ6A 2C77A 1N5LA 1O3YA 2QAJA 3VHXA 2CLCX 4C0LA 221PA 3N70A 4MKGA 1S0UA 2RKOA 3K1JA 1ZCBA 2GDJA 1ZP6A 1FOEB 2C98A 3VR3A 1E2GA 4IRUB 1CULC 4JSYA 2JJ2A 3IPXA 3I32A 2IYXA 4CEHA 3NBXX 4M1OA 2YWHA 2C5LA 3MJHA 2AFIE 4MGYR 4EQ6A 1YQTA 4US2R 2B8TA 1ETUA 3NH9A 4QNRA 4TYYA 1SVMA 1UBCA 4NMMA 5H1YA 2IUUA 2Z5FA 1XWIA 3AF4A 4B2LA 3KXKA 2ODBA 5L3SB 3GFPA 4F93B 5JZVA 1SULA 1JQLB 3IHLA 3ASYA 3THWB 1L7VC 2ZI6A 5C18A 3PJRA 4EFLA 4UKDA 1IN6A 4U00A 2GHIA 3DL0A 4TTPA 1OXXK 3VU9A 2ONJA 5KU1A 5DH9A 2QBYA 2WWFA 5FUYA 1WE2A 1S1MA 3I8SA 1GUAA 2J9RA 1R8SA 2H8KA 3R7WB 2XOKA 2VRWA 2ZSBA 1UKZA 2XGJA 1Z6GA 1E2IA 3T34A 3C5CA 3DM5A 2A5GA 3WBJA 5JCPA 4AIIA 3T35A 3BK7A 3QENA 2IHBA 2ZR9A 3HU3A 3K53A 5JS8A 1XMSA 4JJZA 4KI0A 4Q9JA 5C4MA 2A5DA 5EXSA 1LFDB 1HQYE 2JASA 4IFBA 3X1XA 3A8TA 4BQSA 3GQBA 3KL4A 3K09A 4BE7B 2EYUA 1KK1A 3D8BA 1AQUA 2P2LA 1WXQA 2W2TA 3A1VA 1MKYA 2C78A 1F3OA 4HUQA 3WY9A 5E3HA 1GNPA 4RD3A 4CDGA 4CT5A 2O8CA 1II8A 3EX7C 2JA1A 4W7SA 1J8MF 3EA0A 1NG9A 2DFNA 1CR2A 1AZSC 4II7A 1XJ0A 3AVYA 3CRVA 1KGDA 3F0TA 3SNHA 4IDOA 2FDCA 1EGAA 1YZKA 1NJGA 3I5YA 2JAQA 2BOVA 1G5PA 4IVQA 5J4KA 1US8B 2ZU0C 2W6JA 4FCVA 4BFSA 2QY9A 4UNNA 1F6BA 4AKGA 1CIPA 1Z6TA 1NP6A 5KDLA 4JYBA 2J41A 5CK5A 1E2LA 2FE4A 4DRZA 1TL7C 3FHOA 4FMDF 3A1TA 2A30A 1AZTA 4Q9LA 4NH0A 2YC4C 3WP0A 5KSZA 3CIOA 1Z08A 4P31A 1FUUA 1KDTA 2YNMA 1T9HA 4TN1A 5G40A 4B48A 5BYJA 3THYA 1JEDA 3AKEA 2C8VA 2LKDA 3FDIA 3L8ZA 1Y63A 2ZSDA 3LH5A 3OIVA 4XJXA 2GEUA 4V0NA 5LD2C 2IS2A 3WXMA 5SZJA 2OAP1 3NBZC 4CEIB 1IM2A 4PC2A 3PENA 1PV4A 2JATA 5CLQA 2ZYTX 4DUGD 4DDWA 2GJKA 1U9IA 2HF8A 4G3XA 4V0OA 1GNQA 1P73A 1R5BA 2HYIC 1ZNYA 2DFLA 4NYMQ 3BFKA 5AUNB 3M1IA 4ITRC 3HR7A 2PJRA 1UEJA 2CK3D 2JLVA 4A0RA 3HP1A 4B35A 1JALA 2MSCB 3GCGA 4B76A 2QT0A 2IWHA 1KOFA 3LA6A 5B57C 3EWSA 4CF7A 1EFUA 1R0YA 3UANA 1LNZA 1E2QA 2BVNA 4K8OA 4LRWA 4OJQA 5AJZA 4OI2A 5TDHA 3U7EB 2H57A 3AVUA 4MKIA 4LJ7A 4LBWA 3QKSB 1I4LD 1XEWX 2BHRA 4IDNA 1WBBA 1Z6YA 3M4YA 1YZQA 4LUCA 4YMTA 5EXPA 1KMQA 2R65A 1UBEA 2I3BA 3EG5A 2IYRA 4Q9HA 1OYWA 4ERNA 2AK3A 3VR5A 3SN6A 3DMDA 2JDID 3L8YA 5JLJA 2RAPA 3ZIAD 4H1UA 1XEWY 2WWHA 3RSOA 3C8UA 1FTNA 1W4AA 4JBYA 1H8ED 2IUTA 4URUR 2H5EA 4PQFA 1QZXA 1OFIA 5DIFA 5E95A 4LJ5A 2A5FA 4M53A 3TVTA 2HV8A 4Z1MD 4UXJA 2Z43A 3VR2A 3PV0A 1Z6XA 1T0JB 3MUFA 4PC7A 4OQFA 1XU4A 4RD2A 4LHVA 4B33A 2Q3MA 5KNBA 3VQTA 5KHOC 3NTUA 2RGAA 2XXAA 4RD6A 1KNQA 4F4CA 4HLUA 4TLBA 1SVLA 3VX4A 2FX3A 4B3GA 2CEAA 2G1JA 2OBMA 2PX0A 1QVRA 4G5QA 2VSOA 2F7SA 3CF2A 4W5WA 5C4GB 1DELA 3OE7D 3I92A 5JRJA 4BLTA 2JLQA 2QQEA 1S1CA 3ZJYA 3T12A 1KTVA 1KZ7B 5DYIA 2H92A 1KY2A 1DBSA 3HU1A 3PITA 3GP8A 4GP7A 3GLFE 1G9XA 1Y3AA 1E2DA 4PO8A 3KKQA 1T6NA 1NBMA 3TGPA 3VNUA 2B6HA 3BFXA 2JLXA 1T8UA 3BFVA 1P75A 3K9GA 2FZLA 5JSZA 2BIFA 4QBIA 3AVVA 3HU2A 5GVRA 1E9SA 1COWA 4DLTA 3DKVA 1M7GA 2WMOB 1DAFA 3U3KA 1XJCA 1ZIPA 3AGPA 3AP2A 1YZGA 2ZRAA 4DDUA 1OLOA 2VL7A 2OG2A 4YDSA 4Q19A 4JLJA 5FTKA 2GVZC 3KXLA 2C9CA 5KUTA 1RRPA 2G0TA 1TNDA 2GJSA 1JI0A 3EPHA 3A1SA 5DHAA 3G5UA 5BQ5A 1XTRA 1F2TA 2P3SA 4DBLC 4PZLA 1XZQA 4MYHA 2HLDD 2OCYC 1ODFA 4CZ2A 2G9NA 1CBUA 3BS4A 4UNQA 4BFYA 3E70C 3MWYW 4NYIR 3J81k 3WNDA 4A6PA 2QTFA 4KYUA 2XNDD 2E9SA 3CPJB 2DBYA 1R0ZA 2IX3A 2ZI5A 3KJGA 2AD5A 2O5VA 3X1ZA 1N5KA 3ADDA 4ZDKA 1R8QA 2KB0A 2D2EA 1HE1C 1UEIA 2IS1A 4YMUA 2ZYWX 1DARA 1P60A 1XTKA 5IK2A 1VCIA 2QSYA 4Q7MB 1E2HA 3WMGA 1EWQA 5FOVA 5B2ZA 3PVSA 1K6MA 1KI3A 3ONWA 1JECA 1XTJA 2RH5A 3IO3A 3KTAB 3LY5A 2PCLA 2ZUCA 4POAA 1FMLA 2OILA 5LBIA 5FH9A 5L3QB 1TX4B 1D6JA 1AGPA 2F1IA 5BN3A 4MQBA 3TIFA 1FW6A 4AC9A 1KO8A 3CX7A 5DLQC 2OM2A 3NHBA 1J8YF 3K9NA 2EW1A 2IL1A 2ZJ8A 1M6NA 2RHMA 5TXGA 4NCHA 2O8DA 3KQKA 4R7ZA 2E1RA 2VHTA 4XWKA 1DAGA 5CDFA 4E22A 1VCNA 2QP3A 4KSBA 4QHTA 1X1RA 2EFHB 3UG6A 2I1QA 3V4RA 3KQHA 4Q18A 1T91A 2R6GA 1G41A 3BXZA 1XB2A 3GLHA 4U7DA 4QGHA 2FMXA 4XH9B 4NCKA 4JKYA 1W1WA 4RD1A 2GAOA 2QSZA 4PSVA 4QGAA 3TE6A 1J2JA 2ORWA 2QEQA 1XPOA 2ZRDA 2CL0X 3K0FB 4L15A 4OI4A 1NMZA 1QHXA 4KXFB 3TUIC 4HI0E 3KKNA 4JL6A 3OAAA 3IBGA 3FMFA 2A3RA 2X77A 2ZXUA 2GWHA 4PHTA 4EPXA 2YJTD 5KNCA 4ILEA 5BXQC 1YR6A 3Q8XB 4FMCF 4CYMA 4LHXA 3U3RA 3K0EA 4KU4A 1SXJA 3GJXC 2VP2A 3TKLA 1P9NA 1W47A 2O8BB 3JVUA 2GBLA 2WM9B 2AK2A 1KJYA 2YINC 2YYZA 3D6TB 3MMPA 4CW7A 1W0KD 6Q21A 4YLGA 5FTJA 3VX3A 2PEYA 1L2TA 3L0PA 4Z51A 4BFUA 2OXCA 4I1OA 4EPWA 2JLUA 1MABA 2WJIA 2XJ9A 3A58B 3PEVA 2VF7A 1DO0A 2SHKA 4ASUD 2WSSA 1U0LA 2Z4SA 3OIWA 1H65A 2RGXA 3MFYA 1PLLA 2FSFA 1R7RA 1NMXA 3QPVA 4US1R 4A2QA 2UZIR 1QHNA 2B7BA 2V3CC 1G21E 4R98A 4A2PA 1HY3A 2QORA 4C30A 3ZS8A 3LW8A 3M6AA 2YWEA 2ERXA 3LV8A 3QF4A 2C2HA 4BWYA 5FTLA 2AL7A 1Z8FA 4HB2A 4WZAE 3S1AB 1MO3A 5HR5A 4XVQA 1L4UA 2GCOB 4FWTA 1KI1A 1E0AA 3CH4B 4TSFD 4X8MA 3K70B 3I3SR 1OXUA 3OEHA 2ZI9A 3NVAA 3T61A 2ODWA 2ANBA 2JGNA 4NE2A 5DYGA 2B92A 3OIUA 2NTYC 3AUXA 3BORA 3EWAA 4LYJA 2CJWB 3D31A 3GLIA 4YXWA 2KI5A 2VHJA 4XVUA 2GETA 5JFGA 2FSHA 1OPXA 1ZD1A 4BLPA 1NVUQ 4RZ3A 1ZNXA 5AJVB 5JMTA 1DAKA 4DEYA 1YZLA 3GJ8A 3VFDA 4PSKA 1NMYA 4P4SB 3RRZA 1Q3TA 2VHUA 2P6NA 5AJWA 3U44A 1II9A 4TWZA 2AHOA 2EFCB 4G5SA 4RFSA 2YV5A 5KSYA 3QG1A 2G77B 3DEFA 3TSWA 2BBOA 4BGDA 3IBYA 1XXHA 3SC3A 1TEXA 4EPVA 3WHLA 2GXSA 2F6RA 4DIDA 1E1RA 1ZM2A 2OESA 1KI9A 4Q03A 1NVWQ 2ERYA 3CR8A 3GPLA 1IN8A 1U81A 2IEZA 2ODNA 3THOA 1KO5A 4Q4LA 4Q1CA 4Q4JA 1YR7A 4ZIRB 4OHWA 3W90A 1G8GA 3RAPR 2QA5A 521PA 5A5GA 3REFA 1U2RA 4NU0A 2BM0A 2QE7A 3GLFB 1LS1A 4NCJA 5JECA 4NTZA 3QUSA 3PUXA 4Q47A 4F4JA 2J0SA 1E9CA 3MCAA 4ESVA 2W2VA 2CK3A 4KODA 4HB3A 3EIHA 2C9YA 4P3YA 3OESA 1GL7A 2UZ3A 4HDOB 3NBYC 4D26A 3AP1A 3QPWA 3FHCB 3GFTA 1MRSA 1DEKA 4B2IA 4DHEA 1N6HA 4PFSA 4TL6A 1ZUNB 1VKJA 2JLSA 4DCTA 4CEHB 2ZM5A 1YU9A 1P2VA 2ZS8A 3ZH9B 4JYCA 3LBNA 2XTMA 3K0AA 4EQ6B 4E07A 3VR6A 1XTSA 5FUVA 3CONA 2ZRHA 3ADKA 3CBQA 5BYKA 1OB5A 4Q7KA 3ZZUA 5C2JB 1W7AA 2N46A 2GZHA 5DISB 3LAWA 4B3FX 4RKFA 3U60B 1ZRHA 2Z0MA 3H0KA 3ZZ0A 4URXR 1SZPA 3MJRA 3VU9B 4KFRA 3K0CA 1IN7A 4JL8A 1N6OA 2QBYB 4KFSA 5C46F 5GVSA 1G291 2JIZD 2DFTA 1UDXA 4IOMA 4CVNA 5IHPA 3H1TA 2G0NA 4JVMA 1L8QA 4Q4HA 3PUYA 4LBYA 2QRZA 1Z0KA 2Q21A 3EXAA 2YC2C 2OFOA 3X1YA 3PUZA 4L9WA 5E4FA 4L5BA 1G7RA 2KE5A 4A8JA 5J4YA 2FEOA 2WHXA 5JHHB 2FN4A 1N0UA 4WA7A 2DPXA 3SR0A 3U3MA 4B6EA 821PA 4PO1A 2QTHA 2FA9A 2FU5C 3RYTC 5UKDA 2A78A 4NPHA 1JPNA 5FOXA 4AD8A 1IONA 3M0EA 2VP4A 2LKCA 2RGNC 3RS3A 3T1VA 4C2TA 3SQXA 3GJ7A 3CB4A 3UXMA 1KDRA 3LX8A 2QMEA 2ZVQX 3JZMA 1I4TD 4QFMA 1B23P 2EVWX 1WB9A 4UXIA 1TPZA 2G3YA 4MA4A 5JHGB 1TUEA 2KWIA 3FPAA 2C99A 5H8WA 4HZUB 4NP6A 4LX0A 5TARA 3L0SA 1XJQA 1C9KA 1BO6A 2BMEA 3FB4A 2A2ZA 4LDJA 3W34A 5K8IA 2WWGA 2ZSFA 4V0LA 3QXXA 4XWAA 3TLXA 4L8GA 2AFHE 3FKSD 4IOLA 3SYLA 3C15C 2FPLA 1KDPA 2QMOA 1G6HA 1IQPA 3FKQA 3KQUA 5CJPA 1JR6A 1J99A 1OHHA 1RRCA 2OHFA 1ELOA 2FNAA 1IN5A 3LQRA 4C7OA 3R20A 2X2FA 1W2HA 2W2XA 1KK0A 2V4ZA 4DDVA 1S8FA 4QBGB 2ZRIA 4ZDJA 3LLMA 2XJ4A 4HUTA 1IXRC 3DO6A 4Q1DA 1ZM7A 3DPUA 3THYB 3KKMA 1NVVQ 3RRNA 5K8UA 4CT4B 2C04A 3PEYA 3QKRA 5A4JA 3NC0C 2DCUA 2QPOA 2FZ4A 1NN0A 1VYUA 3Q7PA 4EDHA 4C9BA 2CNWD 4GOXA 2E87A 2ZIAA 2EU8A 1DAIA 5KO2A 1NLZA 4RD0A 4BZXA 1UF9A 1G3MA 3WBKA 1Z6AA 2FOLA 3BH6A 1XMVA 3A36A 1VG1A 1W5TA 3TW8B 3E2IA 4B2PA 2PCJA 4NYMR 1OF1A 1WA5A 4JIMA 1NIPA 4ZKDA 1AA9A 1ZBDA 2VTKA 1S96A 1VYVA 5B64A 5JRZA 1NIJA 2ZE5A 3G0HA 1ZD9A 2P65A 4C0QC 1RZ3A 1RRGA 3I5XA 4OI0A 4DB2A 1E2FA 2EQBA 3NKVA 2AWNA 2NMVA 3VKWA 2A7QA 1MRNA 4Z8XA 2R8RA 3OFNA 621PA 2V7QD 2ZRGA 2IWRA 1XRJA 4UQOA 3R8CA 4TQAA 2F43A 2O8EA 3X2SA 4D4JA 5J47A 1UKVY 1OKKD 1ZIOA 2WJGA 4MYUA 3PUWA 1G8HA 2FEMA 3GMTA 3VR1A 4GOJA 3GLGA 4URZR 4Q21A 2O52A 1VTKA 4WVFA 3SFVA 1AJEA 1GWNA 3C14C 3NEJA 3TRFA 4BRUA 5FPYA 1XCPA 4GBMA 1KJZA 2W58A 2J7PD 3WMFA 4D0GA 2CCGA 3IPYA 1Z07A 1YRAA 3ASZA 1JR3A 1CJVC 1G3UA 3MWKA 3KX2A 3VTKA 4IKEA 3OF5A 1IHUA 1RYHA 2B7CA 1RVDA 4EJSB 2BV3A 4QBHA 4KJZA 1EFCA 1G3IA 3W5IA 4DEXA 3B5JA 3RS7A 2BJVA 1W48A 1TU3A 2J7KA 4BFVA 1GRNA 4DSTA 1R6BX 5CM8B 1MOZA 1R5OA 1VPLA 2OAQ1 2OSBA 3U2QA 3NDBB 1CRPA 3EAQA 1FUKA 2WVJA 2MMGA 4PTLA 5J40A 1XF9A 1E1QA 3RS4A 1XD2A 2ZU6A 3DMNA 1PVOA 4TLAA 3CH5A 1DADA 2WJHA 4DC9A 4IXMA 3BGWA 2VYFA 1E2NA 4MRSA 2CHVA 3T5DA 4DZZA 3I1FA 4MDEA 1YKSA 4AURA 3W9YA 2ZI3A 1M1YE 1GRQA 3RS0A 2HF9A 4TLDA 1D5CA 4HYYA 1Z0FA 3IIKA 2FPMA 4O25A 4FIDA 4DCNA 1W0JD 4M1KA 2VHCA 1Q1QA 3NH6A 2NZ8A 1ESNA 4DLVA 5K8TA 3UATA 4ZKEA 3CPEA 2ZUDA 3EIQA 4DDTA 5JSZB 1DAMA 3CZQA 2AR7A 3CZPA 1GRRA 2W0MA 4O2LA 4PC6A 2CHGA 5AWFC 3QVUA 4L9SA 4M9SA 1PUJA 4JMPA 4MYCA 4QHYA 5DHFA 1H8HA 1TF2A 4C4PA 2IBMA 4AK9A 1OFUX 4UJ3A 4KVAA 1F2UB 5J5CA 1MR3F 4TTQA 5FL3A 4XOIA 3ND8A 4JL5A 1JB1A 3KQLA 4DLXA 4C2UA 4PO9A 4DT1A 4TL9A 1F2TB 1K5DA 4LCBA 2W0SA 4PC1A 5JS7A 1F60A 5CLLA 3R9WA 4PZYA 1P5ZB 1EXMA 4EPYA 5DNYB 1HEIA 4D4MA 1E79D 2QENA 2AXPA 4JLPA 4W5HA 3I61A 1FL9A 5HZHA 4N3NA 3ZVMA 1FNMA 1M7HA 4QRHA 5J4HA 4A4DA 1KYIA 2VHQA 5DN6D 5LPNA 1FX0A 1G5RA 1BYIA 5DO9A 2R6CA 5LB2A 1D8TA 1V43A 1CF4A 4MKHA 1W36B 5EP2A 5E7MA 5FI1B 3AVOA 4ZO4A 1IN4A 3ZYCA 1ZU4A 3CRRA 4LY6A 3D3QA 2P67A 5FOSA 3T5GA 5FR2A 1RJ9B 4W9MC 2W6IA 1LF5A 1XEXA 2BMDA 1FNNA 2GA8A 4I1UA 2RHDA 4B34A 2GTPA 2QM7A 4LGMA 4M21A 1YR9A 2GZDA 1GZSA 2GKSA 4TT3A 1MT0A 1E6CA 2IHYA 3QY0A 1AM4D 1XPRA 2YOHA 5F2EA 2OCAA 2ECKA 3F5FA 5GJWC 2DB3A 4LHYA 1D2MA 5EJEA 2R6FA 1NRJB 2PT5A 3B9QA 4PPNA 5F9FA 2HT1A 4LJAA 2NO6A 2OCBA 3UK6A 2MMCA 3WRXC 5FPKA 5BWMA 5IRCD 2JLZA 5EXTA 1GKYA 2ZRCA 3EZ6A 1AS2A 3KKOA 3QQ5A 2BM1A 3TW4A 1VDZA 4Q1BA 5KDDA 4H9GA 4BZPA 2QPAA 4M1TA 3KJIA 2XZLA 5LB4A 2ZRBA 1UKEA 2L0XA 3U7GA 3QNUA 4PPGA 2ZYVX 2J0VA 4AG6A 2QMUA 1OIWA 3W6PA 2VA8A 3KQNA 1XPUA 3UIEA 1NN5A 3OZXA 3IDQA 4URYR 2IS6A 3W8NA 1CRQA 2VSXA 1XD8A 2CLSA 4LJYA 1RW4A 2LWIA 2P5TB 3PFIA 1Z29A 3O8BA 5FPHA 3OEEA 3FMPB 4AY2A 1V5WA 1GL6A 5CYPA 4C0KA 4D81A 1VHTA 1KHTA 1P2SA 5CJ2A 3SI7A 5EE0A 4OQXA 1DO2A 1JJ7A 2BC9A 4RFVA 2ZAMA 5JJIA 4XIGS 4JT4A 3WYAA 5HKKD 5FPTA 5L3SA 2ZUBA 4HAUA 5CYOA 1G7TA 4MITA 3NWJA 1OFTA 4JLDA 4QL3A 3AVWA 3U3JA 1KZGB 1RRFA 2I1VB 1OXTA 4KVGA 1Z0DA 3SU8A 1NG1A 3BB4A 3IQXA 1M2OB 1BMFA 1JJVA 1G18A 3EW9A 4TLCA 3RWOA 4QGGA 2OV2A 3N2EA 4A1FA 2JLWA 4KBGA 4EJSC 1S3GA 2H1LA 1YHNA 2FFAA 3CLVA 2OUKA 1EFRD 1N6IA 1GVNB 1JBKA 4XD7A 5FL7A 2RGCA 2V6IA 4B47A 2VP5A 2BWJA 3MG9A 2HT6A 3QF4B 5FTNA 1T5IA 2IXGA 4FINA 5DI3A 1Q57A 3TSZA 1HA3A 4MRNA 2A9KA 3BJIC 2C9OA 1E9DA 4HLUC 2KBFA 4S2EA 1E2KA 1JNYA 2ZE6A 4WW0A 4DLSA 3SHWA 4G0NA 4XSHA 3K70D 2WBLC 1PLKA 1WDTA 4O2RA 1NJFA 1A2KC 3GLIB 2QUZA 4ZCLA 3U4QA 1X8KA 3QEOA 3SDZA 2QT1A 3PUVA 5G3ZA 2WJJA 1E2MA 4PZZA 3IHWA 2JJ1D 3EZFA 1US8A 2BKEA 4ON9A 4EFMA 4EPTA 1NY5A 1U0JA 1CJKC 1KO1A 2GJAA 2ZS7A 1EX7A 4RZXA 2CVFA 3WHKA 5L8VA 4XWOA 2XSZA 3P4YA 2J59A 4Q02A 1QDEA 3Q5DA 4OQMA 4WXRA 1TAGA 3C41J 4CEJA 3FTQA 4RFSB 3U6KA 3B9PA 3CWZA 1YRBA 1T3HA 3N2IA 4DCVA 4OHYA 4GP6A 2PZEA 2AD1A 4ZPXA 1FQKA 2H7VA 1L4YA 2UKDA 4QOSA 3K9HA 1P9WA 2HDNB 1XXHB 4GPTA 3VHLB 1Z63A 2IEYA 4RY2A 4LWZA 1KSJA 2XB2A 1NLYA 2BEJA 4B3BA 5FOUA 1W4BA 2WPDD 2IA5A 2PLFA 1I2MA 4JVLA 1Z2AA 2BDTA 4DIEA 2PX3A 2XEXA 3DKPA 4Q7JB 4FWIB 1KNXA 3B60A 4TMXA 2ZQ5A 3P1JA 4L4UA 1Z83A 1UBGA 2ZJAA 3CF6R 3A1UA 4I4LA 3SJCA 2F1HA 4AKIA 1EK0A 2AXNA 1W5SA 3HYTA 4EUNA 1K5GA 3QPUA 4IDHA 3BBPA 5KSOA 4BFZA 2J87A 5HTKA 3MWJA 3WNCA 3H86A 2JJ2D 2D3WA 3QIAA 3K0AB 4LYHA 1A1VA 2B8WA 2OEPA 4OQNA 1IJEA 2WAXA 4E09A 3DM9B 3QKSA 4PHHA 3L0OA 4OHVA 2QGZA 4DB4A 2XZPA 1FPMA 4DLRA 5EUQB 4N1AA 3ADBA 4R2IA 2CBZA 2QN6A 1QVAA 3AQ4A 5GADl 4LV6A 2RGEA 4WXPA 3ADCA 4OQLA 4DLWA 1I2DA 2ZTSA 1AIPA 4DWJA 4V03A 4OYHA 4QG7A 1P62B 4NCNA 1A82A 5GJVC 2YKGA 5EE9A 3SFZA 3PEUA 5TVKA 3NXSA 2XOKD 2ZE8A 1KI4A 1YZUA 2Y8EA 4A8JB 1YZNA 3DOEA 3NEYA 1E9EA 3TBKA 3OHMA 4D0NA 1DG1G 5IDVA 2FF7A 5TY0A 3CW2A 3VKHA 2WMNB 2ZPTX 3CF0A 1P6XA 1OT3A 2GEDA 1UKYA 3QVVA 3RDPA 1CTQA 2V1UA 5H70A 2EWWA 3IQWA 1S3SA 4DSNA 1LW7A 4LJ9A 1EWRA 3EPJA 2NPFA 5JJLA 3L0IB 3KJHA 4KHZA 3CNNA 1QRAA 4HSEA 4ZI3A 2N1BA 2RCNA 2EFGA 2XB4A 4YDHB 4BASA 3QBTA 3KB2A 5P21A 2FWRA 1Q1ZA 2QGNA 5EP4A 2QI9C 2FPKA 2GCNA 3PCRB 4RJLA 4A15A 1Q12A 5FTMA 1IY1A 2GJ9A 3F8TA 2VH5R 4X8OA 3PXGA 3R8FA 4B3CA 3MGCA 3RC8A 2NQ2C 4NBSA 2W6JD 2Q6TA 3LWNA 4AKHA 3QBVA 4DLUA 3BC1A 4MGIR 1DAHA 1GIAA 4R71A 1AS3A 4Q48A 4TMKA 2VIIA 4C7OB 3DDCA 1OH5A 1BOFA 1IXZA 3SJAA 4LC1A 5SZHB 1N6RA 1ZM4A 3KJEA 4V0MA 3TMKA 4V02A 2P6RA 2ATVA 3Q7QA 4IDQA 3X1WA 1IJFA 1G4AE 1TQ4A 3I4LA 3SZRA 1I4DD 2PH1A 3FGNA 5FOWA 1CLUA 1FFHA 1GILA 3AVTA 1HT2E 4O3MA 4GL2A 1NVVR 3QKRB 1PLJA 5EZ6B 1VCMA 3UG7A 2JEOA 4J0QA 1G8PA 4OI1A 3SBDA 3GJ6A 5AR1A 5TB5A 4BFXA 4F38A 3HR8A 1G8FA 2X1VA 1ZUHA 4EAQA 4I99A 2J0QA 1KMHB 1OXSC 1R10A 2KSQA 1U98A 1KSGA 4KV9A 2QTVB 1XNJA 1X8LA 4IW3B 1G20E 4DUGA 1RFLA 3B1VA 3GFOA 4DLYA 3R9XA 1S4QA 1XDBA 1YZTA 1ZYUA 2N42A 4FN5A 3CRMA 1ZAKA 1YR8A 4ABYA 2HYDA 4KSCA 3WYFA 4IFEA 4JLKA 3RS2A 4F91B 1M74A 2V1XA 1TF7A 2D06A 2IYZA 2Q0HA 1EFHA 1ZC4A 2DWQA 4Q00A 3KXIA 5BN5A 1E96A 4KLZA 5L3QA 1NF3A 1BIFA 3MRSA 3MLEA 3QKTA 4B6FA 2F43B 1SVOA 1ZM9A 1N0WA 1NBME 1P2TA 2JLRA 1E2JA 1U0HC 1W49A 4RZUA 2YHSA 4TYQA 1X8JA 3FOZA 3ZDQA 2PMKA 2B21A 2IK8A 4ACAA 1JPJA 4GRAA 4OBEA 2IYYA 2A5JA 3GLGB 4Q7LA 2GZAA 5EZ5A 2NO0A 1N6KA 3NBFA 5AJXA 4F92B 1IOZA 4FCWA 1D2NA 3SE0A 1OJLA 2HCBA 2CCJA 4X8HA 2J0UA 1VMAA 5J4VA 3RLFA 4ZDIA 4BECA 5JWRA 2TMKA 1P72A 2CL7X 1S2MA 4GNKA 2QAGA 4HZIA 1FP7A 5BN4A 1G6OA 2EWVA 4GZMA 2JDIA 3LQQA 1DG3A 1XMJA 3QE0A 4NDZA 2WAYA 2ZRPA 121PA 4PAMA 3TNFA 3ZIAA 2NOAA 1R5NA 4R2HA 2OT3B 4RKEA 1T3LA 2ZREA 2NO7A 3CX6A 1E9RA 1ZMXA 3L82B 4TQUS 4WOPA 1H8EA 4C0BA 1WQ1R 1A7JA 1DS6A 4YQFA 3N5CA 4A0FA 3WRYC 1HYQA 3FMIA 3SJBA 4HAXA 1NLFA 1XP8A 4Z1MA 3LVRE 4LV5B 4V0KA 2RGNA 1T3SA 3QXHA 1WBDA 5F9HA 3B82A 3TQFA 2H17A 1XFAA 5EP1A 1XCGB 4FXPA 1TUIA 3LRPA 3LFUA 4QGFA 3SYKA 3Q5EA 1EFTA 5IF9A 2O8BA 4PPQA 1NY6A 4ACBA 4Q4AA 3B2EA 1E98A 1N0VC 4IDPA 3GJ4A 4CIDA 1ZNWA 4HUQB 4Q1AA 3I72A 1AKEA 3AVPA 2OCPA 3MAAC 2O8CB 3THXA 1II8B 5IT5A 4D4KA 1HURA 4NCIA 3EC2A 3K0CC 3OE7A 1Z06A 4EIWA 4B71A 3EZ2A
chains in the Genus database with same CATH superfamily
4JB0A 1P1KA 2Q9CA 1Z45A 4FI3F 4KPYA 4ID3A 1CE8B 4JEHA 3SC2B 4H17A 4NHEA 5BOSB 1TU4A 4W9RA 4KAFA 2DU8A 3SEZA 4EZEA 3DLAA 3F2VA 4ZK2A 3LK6A 4AJNA 1QSGA 4ZOAA 5TT0A 1WEKA 4RXTA 4CMHA 4MCIA 5LQAA 3ZDXB 3NCHA 2GN0A 1ZOPA 2ASVA 2IQ5A 1LQUA 4FOPA 4BNWA 3B53X 2B8NA 4M36A 2H1SA 3GJ3A 3DDSA 3KE9A 3W8RA 1VSQA 2H18A 4B73A 4WOKA 1HE3A 1SC9A 1ZMOA 2GM9A 4EATA 4ZHQB 2H8GA 4U2FA 3MWGA 1JJBA 1CZNA 1DBWA 1S3IA 1V5FA 2PM8A 3BM5A 3D5QA 4WN9B 3RABA 3GVPA 3DBOB 1VOTA 2OFXA 3AB8A 5FBKA 4FFSA 4V39A 4M22A 2HPZA 4MVJE 4QYWA 1TTTA 1YDEA 4JR0A 1H22A 2YXEA 5ED0A 1BRMA 1HDGO 4YMSA 5CFNA 2QW8A 3CX8A 3HFSA 4FLEA 1D6SA 2JHAA 2WG0A 4UOZA 4L76A 2O0HA 3VUFA 2VBCA 3I9V6 2DF8A 3Q87B 5ENVA 1TECE 1JEOA 1F4PA 2QI9F 4PGMA 4OU5A 3CVJA 3ZE7A 2WQZA 1GSHA 5C53B 1JH8A 3AB3A 4EENA 1W36D 1I7QB 3IESA 3ILHA 4CIXA 2C7QA 2JGKA 1D5WA 1QKIA 4UFOA 4HZGA 4UQPA 3NKLA 1XEXB 4DLAA 4D25A 3LD9A 2R44A 3MWLA 4HDAA 4RJJA 2QX7A 4MS1B 1W46A 2GRUA 4HMPA 3TM5A 3O31A 3AHGA 2IF2A 1HOXA 1M1NB 1DKRA 1N9GA 3DD5A 2C5GA 5FT9A 3ZDYB 5ELXA 3ZW8A 5DGXA 3T4UA 2V3VA 3HV0A 4ZMSA 2XB9A 7MHTA 3DPSA 2C8LA 4QO8A 3FWYA 1TJ4A 2G80A 3M6WA 3QFCA 4MMYB 4PNEA 4Z7JA 1F4LA 4CM9A 3KHTA 2OXRA 2I7XA 1EVKA 3QVLA 4N7BA 4QUHA 4X1OA 4ARZA 4B3XA 3CLRC 3MIZA 3O75A 4D4IA 1PR6A 4GRIA 3BTUA 2IGTA 2DP4E 2XYPA 2ZB2A 4OHCA 1I7DA 2PQMA 1R0SA 1AKTA 3E3NA 4KH1A 2IRWA 4TVBA 2X3UA 3VPHA 2XYHA 3NHPA 2DY1A 2PGAA 5ICSA 3LVQE 1KPHA 1ID8A 3K0KA 4AG5A 2YWBA 3RLIA 2VK1A 4YDQA 4RMHA 1UBTS 4A82A 1J22A 1GPJA 3TQCA 5AUOB 2D2FA 2WFLA 3AFIA 4MS3A 2F1JA 4PANA 1D1PA 1LVHA 3OZWA 1Q3HA 2ZS9A 4HB0A 2BP7B 2YV1A 1VL1A 3EN0A 3ZVNA 2WAAA 1VXOA 1I01A 2H4FA 3EZ7A 5KX5B 1IOWA 4Q39A 2IHJA 4A6XA 4NZYA 4XTCS 1NBAA 5K99A 1L7RA 3EBPA 3ZQKA 1NNEA 2C1XA 4CL0A 3ZDBA 2PMDA 2PSEA 1QO7A 4RHUA 4ATNA 1N5OX 2ZEJA 4YRDA 1BS1A 2IEIA 3GJSA 3NIBA 4FGZA 2LCFA 4MB0A 2A9RA 1T3TA 2O2HA 3UXEA 5BSKA 4CM5A 3M6LA 3V8EA 1BU5A 2WF7A 4PC3A 4DGSA 1SXJD 3KB8A 4V0ME 1O97D 3AFMA 3KB1A 2IYQA 5HMMA 3AU9A 2P5YA 5TPWA 4HEQA 1PJ2A 3REQB 2I65A 2GTIA 2XZDA 3JQAB 1U0EA 2G7MC 2VWQA 3OOEA 4XVRA 1NVXQ 4XPIA 3D2LA 3SXUA 2XXAB 1WKCA 3HKCA 2PYIA 5K20A 4U02A 2JFBA 5FTWA 2HJGA 2VYCA 5JUWA 4NS4A 4ZV4A 3BXHA 5ESWA 5ULLA 5J9FA 5H4HA 2I4RA 3IP7A 4C3VA 5CM9C 5ICEA 1SBQA 2DCMA 5DHPA 5ER6A 1F7UA 1SKMA 3LRXA 1S3FA 3U4CA 1N8KA 1AHNA 1YULA 2J9FB 2W2KA 4HDMB 1GQRA 4OHZA 2QXYA 4W5JA 3SKVA 2WSSD 4CQLA 4EKYA 4FR2A 1NTRA 1ZD8A 4M1EA 4G8BA 4CGZA 1BWQA 4EGFA 3MBIA 1YIAA 4LOKA 1Q92A 1RM4A 4JLSA 4KXLA 2FV8A 2R48A 4OXKA 4HQ0A 2X9NA 7AT1A 1SBNE 1NSYA 1KR2A 2FEAA 3ZCUA 4KG7A 2VA9A 2ZPUA 3HI6A 4A9AA 4XQCA 4P83A 3OLQA 3GYBA 1XL0A 1LSOA 4YMIA 5IBQA 3E1SA 1Z7YA 4R9UC 4FDVA 4MQ6A 4Y2JA 1KTIA 1J0BA 3PQEA 3CX3A 4Z5XA 2IYNA 4F6LA 2CVHA 5DI3B 4MVJI 3JAKB 2IY9A 4AP6A 2QJWA 3B20A 3ZXXA 5BQ3A 3TR0A 5TQJA 4YRTA 1Z5ZA 4BZWA 4TL8A 3GUZA 1RZUA 4HXYA 4CKCA 1PUXA 7MDHA 5HP4A 4MVJM 4QHSA 3ZD6A 4E7PA 1JW9B 2GBPA 2ZSHA 2VQ6A 4M0PA 2XUOA 4IIUA 1Q7EA 1F8UA 1E1DA 1TVKB 1Z26A 2X58A 1MIOA 3PF9A 2N1MA 2ZUFA 4D9MA 4HZUA 3PE3A 3RS8A 3ZV6A 4B3MB 4PPFA 1JG6A 1KS2A 1UM9B 2Q2OA 4RHXA 1DZ3A 2A9VA 3R5JA 4IZIA 2X9GA 1Z62A 3SJ7A 3OZDA 4JJAA 3LPDA 3R8XA 3TDMA 4A23A 1QV6A 5THKA 1SFRA 1XLTC 2I4TA 5REQB 8ATCA 1LV8A 5JRDS 2C29D 4FMBB 4KBFA 3I5UA 3IILA 3H1EA 4TV8B 3TOCA 2Z2XA 3STWA 2EJBA 2JNWA 1NQUA 4EI7A 4I08A 3ZCPA 3ZVKA 3DBVO 3GO4A 5JS2A 1E4YA 3FBTA 5DP1A 2YJ4A 5MGBA 4CM6A 2RH9B 2RH8A 1I24A 4JJ7A 4QM7A 1LU9A 4B6PA 3EG9B 1RIFA 2PWZA 5JWHA 4NAVA 2KM1A 5F76A 3SR3A 5SYAA 4E03A 5IZCC 1YB7A 1A5AB 1PWZA 2CDCA 2ZRFA 4B75A 4F4DA 4O1HA 3TAHA 3V1UA 5IAEA 1CJSA 2Z83A 1VC2A 4B3SB 4D74A 4RTSA 5I7HA 2X2OA 4N9QA 4TSKA 2LZ0A 1CZLA 3PNOA 1OX4B 3E5MA 1GCIA 4RV4A 2DTXA 2H2DA 2R6AA 3O8CA 5BVGB 3TVDA 1E7MA 3GV0A 4IF6A 3LIIA 3CG4A 5IC4A 1FMFA 1HRKA 1PNTA 2V9ZA 3B5IA 1M2FA 2C4MA 3P9SA 4HDCA 1JAHA 2OE2A 3W77A 2XZOA 4E7OA 2FUKA 5G53C 2X0EA 2OZEA 3AC0A 3CM0A 3OZEA 5KYYB 2GF0A 3FAZA 1DX6A 3SGLA 4BQOA 2VEDA 3N0VA 1C8KA 3GT3A 3W5AA 3AK4A 3E27A 3KFLA 3QX8A 1FVXA 2QL5A 3RHFA 1NBEA 3RUCA 3ZV5A 5BR8B 3PQ6A 3BEDA 3CVVA 1G42A 1M2KA 3LJKA 4C20A 4H4DA 4G23A 4GI5A 1O6BA 4N5NA 3RYIA 1HR0B 1VMDA 2WG1A 5KWVA 1C9NA 5HE9A 2W83A 4FDAA 3UB3A 3OTWA 3TLZA 4TYWA 2JANA 1U94A 4OMFG 1OXMA 2QTWB 5ESDA 2QRUA 3EOBI 4WOBA 3DZDA 2PFGA 2NYUA 1N8TA 3GP5A 1KKMA 3KR2A 4ZCIA 4I1PA 1V4VA 1O8CA 3L49A 2OAGA 3RB8A 3GGCA 4GMXA 3W2HA 3CCFA 4KUHA 3WQHA 1CS4C 3HL4A 4EVSA 4LXTA 3STXA 3AVQA 5A2GA 1PGQA 5BR7A 2IS4A 1F8GA 2PX8A 2I4OA 2IQIA 2VWPA 5HKAA 3EPPA 3LUAA 1FFAA 3UV6A 1E32A 2IHZA 3F3YA 3H0EA 4YROA 4CRWB 1R6VA 4OQYA 4BQFA 4LJ4A 4HAWA 4EJSA 2C3UA 2XQVA 5JD4A 2H4WA 2VPZA 3DKKA 2FCRA 4EG8A 3CVYA 1ZNZA 3L8EA 4XJVA 1GG2A 1OREA 2IXBA 4UD6A 2Q8QA 3ZD7A 1MQSA 3G59A 1WDWB 1P4SA 4HP8A 3RT1A 4J94A 1XNGA 1WOMA 4DL9A 1LY1A 3AEKB 1M2EA 4RCYA 4QYMA 2QZ9A 3RC3A 1LNSA 4DIOA 4N0EA 2RHWA 3L1IA 1USGA 4IQ8A 4UCQA 3RSCA 2O14A 1D4AA 1E5VA 3H9JA 3I9JA 4N5DA 1B8VA 1FP1D 3QI2A 4XFDA 3CW8X 4AMVA 5F98A 2CEKA 4I8XA 3G0OA 4DR2B 3UMBA 5HIJA 8ADHA 1GR1A 2GF9A 2ZAOA 2PUCA 3OIFA 1ODTC 2R1TB 4DA0A 4OKNA 3T41A 3W6NA 2V8OA 2NIPA 3H5OA 2L2QA 4BFLA 3X0DA 2XTNA 1NRXA 2HHCA 2J5KA 3PC6A 2PQ2A 4CKZA 1C7IA 3DBRA 2XAUA 1HEYA 4N54A 2WZQA 5JPCA 2R6R1 1PNRA 4QBTA 5HILA 3VR4A 3AL2A 2GFIA 3EARA 3HCAA 2IYVA 1THTA 3ZHBA 1T29A 2WJ6A 1E18A 4JBWA 3KYCB 1UM8A 4PGAA 3NYWA 5FFMA 4BAZA 3CCBA 3KZVA 4O2AA 3PVCA 4J43A 3M6IA 1IBRA 1SOMA 4HQLA 4OM8A 2GNOA 3L7KA 1GSIA 4PR0A 4WBSA 1KETA 4JVSB 4R1LA 4HV4A 3NUQA 3HWSA 1BW9A 4YAKA 3VKGA 2IP1A 1DVRA 2BFOA 2DYKA 3LW7A 3B85A 1OV4A 5GONA 4YR7A 3AL0C 1PJCA 1OHHD 3BHIA 1M1XB 3K6SA 4Z9YA 3SF8B 3ITKA 5IVHA 1C1YA 1XKTA 3ZWXA 4RDXA 5KMGB 2Q4BA 3U44B 3OIYA 2XCQA 4IILA 3HM9A 5GMOA 3ZDAA 4D9EA 1SKBA 2B4AA 3Q9LA 5JVDF 4RL6A 5HUHA 1N8SA 1XYGA 2SICE 3F6PA 4R0NA 4EKGA 3P9XA 5J63A 3G89A 3F4KA 5H5JA 4AMUA 4B09A 1CC1S 1ENZA 1PCXA 2JGAA 1Y4SA 4K28A 4LWPA 3T5PA 2PJZA 3DE6X 1JPUA 5IPFA 4WJZA 5A4KA 3UAYA 1TRHA 2WWIA 1CKEA 5TV2A 4FILA 2QG4A 1A8SA 1B8OA 4POOA 1NI3A 2JK1A 5DM1A 3B12A 3VZCA 5JXIA 4NDZA 5ECGC 3V46A 3RTEA 4I1SA 4AW9A 1ULHA 4HYEA 2WYOA 3GARA 3PEFA 4HLQB 1UDAA 1IZ9A 5DXFA 4H3VA 4ZVNA 2ODAA 5FD8A 4EP1A 3LL4A 2B36A 1A0OA 3N58A 5I9BA 2QIOA 4Z8YA 1RJ9A 3JYLA 3NHJA 2GZMA 2XADA 2EW2A 3D7MA 4BUCA 2X23A 1WIWA 1E3WB 1NXSA 4H16A 1BHQ1 2ASEA 2VNKA 3L1KA 4IQGA 4Y98A 2XITA 3HI4A 3CJTA 4F4FA 3O73A 3K0HA 3RWMB 5LMNB 3ERCA 5J2UA 3WKBA 2ZB7A 3OFND 4RF3A 1T35A 5ADHA 1W44A 2RAFA 4Z99A 3ISVA 3CO0S 1PGPA 2WVHA 2HA5A 2VQ3A 1BXRB 1XXLA 2PLRA 2V7QA 3FCCA 4JCCA 5B12A 2CDNA 5ALYA 2OM6A 3S2SA 1YQEA 5AW2A 3RC9A 3BE5A 3CTPA 2GPBA 5DCLA 4DV6B 3MD0A 4CU2A 4ZJUA 2R6ZA 2BTOA 1YRLA 5JO0A 3ZYZA 1BE0A 1CR0A 3B6IA 1TD1A 1MPTA 2QNRA 4RS4A 3GD7A 1I3CA 3PVZA 3A9RA 1VE1A 3H84A 4DTCA 4YGYA 4ED9A 4OD0A 5IJZA 1WPQA 4LFAB 1JR3D 4E4TA 1QRUA 3ZZNA 1VKOA 3INYA 2ZUWA 5H3HA 1Y3FE 3MCVA 2WUGA 1RQGA 2HCRA 1TJNA 4XTRA 3LYLA 1XZPA 2QYHA 3ZDEA 1OWPA 1HO3A 4Q4HB 4HNSA 3MLAA 5DX0A 2Q9BA 3GG9A 2YXNA 1FFYA 3NBMA 1G4UR 1YB5A 5I9TA 2R2AA 1TQ8A 3JU3A 2R62A 3AJRA 4Y6GB 5FAXA 1HDIA 3EGDA 1U4SA 3AKCA 1GFIA 3R4CA 3AWDA 1YJCA 4ML3A 3OZSA 1ESCA 5LYJB 4IHJA 4MYTA 5CA0B 4UMFA 5JTTA 2KPOA 2HMWA 2AUTA 1JAIA 3QTLA 2HO4A 2ZRJA 3GDHA 1A69A 2C9ZA 3GNTA 4L22A 1MVNA 2NV6A 1C3LA 4Q9IA 3ECAA 4XRRA 5HCIA 3WO0A 4Q1EA 2XQFA 4RGVA 2O5RA 2YHIA 4RZIA 4ZANA 2DETA 1EESA 3T9EA 1U7ZA 3EFOB 3GB9A 5DNAA 2FXIA 3OT1B 1SURA 4WFJA 1ONBA 3AJEA 3VU1A 3THXB 1HL7A 2PVSA 5FWXA 3UMRA 4YRFA 1HDZA 3ENZA 3QKIA 1RP7A 1Z5NA 1F38A 1YS4A 2R96A 2OD9A 1GOTA 4US0R 1RQPA 3TZBA 1WL8A 1Q44A 1YS1X 2ZQZA 5CLGA 4JT2A 1QP8A 4RVFA 1DMSA 3LXXA 1Q11A 4BPBA 1ZN7A 1IZ0A 2C88A 2FVXA 4J07A 5E7JA 3BAFA 1U0BB 1NF2A 1U6IA 3IGFA 1IQ0A 3TJMA 1G19A 4FDMA 3UJPA 4MDYA 3TG2A 4KPEC 1CLEA 2LD4A 3GVCA 2D4HA 1Z22A 3KXPA 2BFMA 1C2YA 4ZZ2A 2PLWA 4KB5A 4Z9AA 1I51A 2HXSA 3T4PA 1AY0A 1CJCA 1D2RA 1H8HD 2GJ8A 3BSFA 3LFHA 4LRXA 4MICA 3OJOA 4BNGA 2X8JA 3UK0A 2Z04A 1MO5A 1EWYA 4LOAA 1P5JA 1XP5A 3AM3A 4RLSA 5CLHA 3VPCA 4BO2A 4C3ZA 3S81A 5G2OA 3GD5A 4BOYA 1DJNA 4DADA 1VGQA 2H65A 1AN0A 2ILVA 1YBHA 3FLBA 4IVPA 5D7NA 3VYTB 4BO5A 2GZ2A 5HEKA 3WE7A 2V55B 4EW3A 1PT8A 5JQGF 4HNVA 3GPBA 3SIXA 3EPLA 1QH9A 2PZMA 2QMZA 2F9FA 4G4SP 4OHXA 2O1XA 1H2WA 1SVKA 2GCPA 1E79A 3FBGA 4RPJA 4XDHA 3ZLUA 2QN9A 2K2WA 4IKOA 2D1SA 1EIWA 1GTVA 4Y6SA 3PFBA 4PSAA 4YX9A 3ITNA 2HXGA 3OCCA 5I7EA 2B69A 4WXHA 4JI1B 1F8XA 3DDZX 5DN6A 4C88A 3IQDB 2RI1A 4C89A 4HO1X 4W5TA 2WJVA 4Q9AA 1MORA 3UGQA 3CGGA 3OLVA 4BMXA 3FSJX 2I2DA 3PGKA 1CJMA 2CVQA 1U9CA 3GEEA 3P20A 4IDFA 4J1QA 4OK6A 1CIVA 4YCBA 1N9GB 3IE0A 5GQSA 1XVVA 1S2LA 4BBJA 1GNTA 3FPCA 2FSGA 2B8JA 1X7XB 2NSLA 2Q5OA 3DE1X 2OL4A 4MRVA 2Y1EA 4LJ6A 3TZ6A 4CV1A 1T5LA 4PRLA 1G16A 2W2LD 1SVSA 1VIDA 5E6SB 2GK6A 4DV2B 3DP7A 4QOIA 3OTQA 2Q3JA 1SUWA 4ARZB 1GPUA 2BISA 2YOGA 4JQCA 1KI8A 1G60A 1O9BA 2XMGA 4JLUA 3IALA 3QA9A 4Q4DA 2Z1NA 2ZI4A 3TLBA 1JI3A 3BWDD 2CW5A 3O1HB 3W6OA 1A5TA 1HLPA 3LBIA 3SFTA 3U80A 2HWKA 1H0SA 4X65B 4MUXA 1RLTA 3NEAA 1WMSA 3ESXA 4O02B 4MWDA 5CFZA 2VSQA 2TMGA 1KXZA 5SZIA 4PLFA 1EG2A 4TUYF 1U90A 2PL3A 1TADA 1UAAA 1MB9A 3K35A 3NFRA 1QF7A 2AX4A 4E13A 1KI2A 5M5BA 3B1FA 5EJIA 1NM5A 5BUSA 3K1TA 1EG7A 2WFLB 4IEEA 4MS3B 1ZN9A 3GVIA 3QBDA 4O4HF 5ISMA 1TRKA 1CZOA 2BBTA 1VSTA 4KMOA 4OX9B 2F90A 3PNPA 3FGOA 1G5IA 4UBKA 3D2AA 4GZLA 3O8RA 1TQHA 3JQEA 3WMRA 5C5EA 2UVDA 1LNQA 3X44A 1BA2A 2AEMA 1GNVA 4TTRA 2WHRA 1SIUA 4TX1A 5DTEA 2G83A 5LWHA 1PGOA 2ZTLA 1VFPA 1KQOA 1UWLA 3QVJA 4TXJA 3CNBA 1UPBA 3UUEA 5HKOA 5KQGA 3NQ41 2ZRNA 2AOWA 2H59A 3C7DB 3CPHA 1YZHA 1QUFA 2A0FA 1EXWA 4LZPA 2Z2YA 3H65A 4OSOA 1ATZA 1DTSA 4R05A 2QMYA 1KBOA 3BRQA 5IBCA 4ROTA 1X6VA 2Z09A 2VKQA 4MHSA 1B3BA 5TPWB 3UMFA 1RQ7A 4BNZA 4LTNA 4JI8B 3SXUB 4XOUA 2AN9A 3E81A 4JUBA 4LC0A 3SZMA 5HKKA 1A9XA 1XMOB 1DOZA 3RVLA 1PR0A 3H3JA 3ICEA 3RU9A 2W6NA 1GTMA 4AF6A 2HF7A 1COZA 3DEJA 4FBMA 5H83A 4D4GA 1ZQ1A 4DC1A 1TB4A 3OJ0A 3QOFA 1PS0A 4MW1A 2Y9MB 3HUUA 1MPXA 1XF1A 4DA7A 1U5CA 4KFUA 1W2GA 2P9QA 1XSEA 2Y76A 3G0DA 1KAGA 3I64A 3LX5A 4J9UE 3A6ZA 4BEJA 4CQLB 1GPYA 2KJQA 4DMUB 1C4OA 3I8OA 5B4UA 3EGWA 2WMYA 3C6XA 4MGHA 1AS0A 1W93A 1BE8A 4PSCA 5IC6A 5KVQA 2GUGA 4X9XA 3LPCA 1XDWA 4AN0A 3M70A 1I4EB 1T4GA 2HCTA 1NW4A 5CX1B 1EP9A 1E0JA 2CB0A 3B6EA 1GPLA 3NBQA 5FJJA 2VJOA 3ESYA 4FCTA 5COAA 4XD7D 4EARA 3IRUA 3O47A 2FPIB 2HZBA 1ACMA 3A1EA 1R66A 3P27A 4H35A 4A8JC 5AK3A 5IKEA 4XLTA 4UMDA 3GEMA 4D0SA 5DX1A 4YP5A 2R1ZA 1NDHA 2RHLA 3BE6A 4CF6A 4CKCB 4XGIA 2C57A 2GARA 3N8DA 5IHXA 1K1EA 5IF3A 5BYAA 2FZEA 5G4LA 1E3MA 4QDJA 5FUXA 3QMPA 3I58A 4GZ5A 4XX0A 1ZVQA 1QVZA 3KJQA 4YBZA 4BV2A 5B1SA 2XTZA 3LDAA 1MIOB 5LD2B 3NDPA 3TUJC 1IAQA 1IDOA 3QYFA 4CIBA 2PIDA 1TYCA 2PVCA 3PNLA 4PCLA 2G04A 3D6AA 4P3OA 4PZCA 4ZEWA 5C8YF 4X1KA 1T10A 3ND6A 4QPDA 1DEAA 1E92A 4ZMBA 4DV0B 2YICA 2HEIA 4ZAXA 2CV0A 3TR5A 1FXWF 4GAEA 2IC5A 2JJ1A 5BRNA 1II0A 2B83A 2IU6A 4MLPA 3SEAA 4BBPA 5MF6A 3KDSE 3CKLA 3T9AA 2WIFA 1JHQA 1RXEA 2DBRA 3HNRA 3R44A 4P84A 5HK8A 4XKJA 4QFBA 5CLFA 5F12A 4OV6B 2PD4A 1G64A 3MGBA 3KUDA 5KTTA 1BXGA 2VKTA 1KEEA 2X2PA 1EUQA 2YZ2A 4EI8A 4Z0PA 3HGMA 1WP9A 3E9NA 3ET4A 2WJZB 4NIMA 3RVJA 1X86B 2GS9A 2V9PA 5HCUA 2IUFA 4FMCB 1CCWA 3G2OA 2CL6X 5FBLB 4Z4GA 1TKRA 5J4LA 1XJ5A 5AUQA 3PR1A 4II3A 2VJPA 5BSMA 3DZ8A 3H5TA 4JVNA 3W8FA 2O59A 1I5EA 4MR8A 4RJKA 5BPFA 2B0CA 1LPNA 1DE0A 2X9QA 3D4IA 4QVKA 1KZ4A 3TFQA 2GAJA 3LRTA 5C7YA 3QUBA 2HNAA 4MRAA 4ZO7A 3S2YA 1FMTA 4HDQB 1RYBA 1EM8A 3PFNA 2FWNA 4CKWA 2G8NA 2VRNA 2F55A 2VF5X 2WPDA 3ENNA 4ALMA 4ZZ3A 5CB4B 4LPKA 1AH2A 1SUBA 4HH1A 1UOPA 5CVCA 2WT9A 5AOVA 3RYFB 3NALA 4KIUA 2CUZA 4IGIA 1JHOA 1N6NA 1T9CA 1JQBA 3E5RA 1EFPA 4JMLA 5KHAA 3WGQA 1KEWA 1N0HA 5BOVA 1OIXA 4OATA 4FFMA 2QUBA 1ZLXA 1WLYA 1Z3IX 2WYUA 4D1YA 3F49S 1N5LA 4N7JA 4CDMA 1O3YA 1EE9A 1L6IA 3EY4A 4N3CA 3GDGA 3GJYA 1A9TA 4QG3A 221PA 1VJGA 2Q5JA 1S0UA 4PHCA 1PG2A 2RKOA 2WJ4A 4D9JA 4ND8A 1ATIA 2YV2A 1WZNA 1FOEB 2C98A 3AXSA 4ZO6A 3QYJA 1L3BA 5FPQA 1CULC 1MLDA 2JJ2A 3O0DA 4WFIA 5K8CA 3RYIB 4IRXA 1JYFA 5U4XA 4V0QA 3FZNA 5ESRA 2AFIE 2AG1A 3SNKA 4BCDA 4BKUA 5JAOA 1T9ZA 4FE4A 3NH9A 5BWOA 3RW9A 4LZLA 4GNRA 2XA9A 3URMA 5CURA 5H1YA 2E48A 4QSHA 4OQDA 1JDUA 2IOFA 1DBPA 2QG9A 5AKYA 3STHA 1AKMA 4KVFA 1T9GS 1Z8DA 2RHHA 4PZDA 2VYVD 1JQLB 1RLUA 3JVEA 4S1WA 3ASYA 3PJRA 1VL2A 1FDUA 5DP2A 2ETVA 5IVKA 1Y1TA 5LIRA 2QN1A 1FYXA 4UKDA 1N2ZA 1CY8A 3LGSA 5C4IA 5J23A 2P41A 1IN6A 3VU9A 1V7ZA 2OV6A 4TTPA 4IO0A 1XCBA 3FCUB 3WA6A 3EQ9A 2ONJA 4AJ1A 5DH9A 3I5MA 1QPGA 2FX2A 1WE2A 3H04A 2FDXA 4PZ0A 4IP0A 5KJ1A 2X8WA 3N2YA 2H8KA 1VJCA 3GGPA 4OOFA 5JW6A 2XOKA 4M87A 2WLSA 4IMPA 1K06A 2GMWA 2VRWA 3L0YA 5CEEA 1UKCA 2NTEA 4KREA 2A5GA 3GLKA 4WK0B 4ARVA 1A77A 2GZRA 2O8NA 3N05A 3FVTA 4ZEOA 4AIIA 3BK7A 2F3SA 1DNPA 3QENA 2IHBA 2ZR9A 3WGOA 5JS8A 4JJZA 2E3JA 1LDGA 4HWTA 4Q9JA 2A5DA 5B3JA 1LFDB 5C4MA 5IT4A 2J5RA 1XRRA 5A5FA 4I4NA 1J0XO 3A8TA 1PTJC 4GLLA 1BKSB 1V6SA 2VXYA 3K09A 3UVEA 3GUYA 1HDEA 1UK7A 2EYUA 3P2JA 3S4YA 1AQUA 2GTHA 2P2LA 3AHHA 3GBPA 2GYWA 4HUQA 1F3OA 1U2PA 2O2DA 4RNDB 3EYWA 2A0KA 4CL8A 5IANA 3AZPA 1KQFA 4RO0A 1L4EA 3DBRB 3D7KA 4PCAA 3ZGOA 4DQKA 1FFWA 2NLOA 1I3NA 1ZO8A 3RFTA 3EX7C 1J8MF 4Z0HO 1J00A 1NG9A 4P7KA 1E3IA 1CR2A 2WZCA 4DNOA 4EX7A 1LK5A 2GN8A 3E3MA 3AR7A 1JEYA 3UTCA 3SNHA 4ZN6A 3G88A 4O2AB 4ZT4A 1YQUA 2IPMA 3PZRA 4HWKA 2BGWA 3K1ZA 4B6JA 1ZMRA 1O9GA 2JAQA 1BW9B 4H1HA 4BJ6A 1KEZA 4MTCA 1US8B 2ZU0C 4BX0A 2O2YA 2UZ0A 1FSZA 3F1LA 5GONB 3SVLA 4BWGA 3K6SB 1G5QA 1RCTE 2O0LA 1F6BA 1YZYA 3I34X 1JDNA 5K0NA 5J1SB 1HT0A 3GIWA 2J41A 5CK5A 1E2LA 3PRKE 1KZ9A 4DRZA 3H83A 4R01A 4YBRA 1ZK4A 1TCAA 3Q6NA 2D1YA 1N5MA 1Y9JA 1BGVA 4FYXA 4D8WA 4G41A 4YRCA 4BQRA 1AZTA 2YC4C 3WZ2A 2FE1A 1Z08A 3CIOA 4NY1A 1ZCJA 4P31A 4CEIB 2YNMA 3JWPA 5GP1A 1F0NA 5IBRA 2YJGA 3E0QA 5TQVA 3ROXA 3R0JA 1OAKA 2WTNA 3DXFA 4KP7A 1JEDA 1HWYA 3LH5A 4OLFA 1OGIA 1J24A 1KPGA 5K51A 5AM5A 2WV7A 5B7GA 2D7JA 1K2WA 5LD2C 2PY6A 4ZVQA 3U0BA 4JXZA 5GIOE 2FPPA 2OAP1 2G76A 2RG7A 3T7AA 1Z17A 4XSVA 3PYXA 2VBIA 4JIGA 4YUYA 3PENA 3K4QA 1Q77A 5KVCA 1D4OA 1ZEJA 3AOEA 4KE9A 2YDXA 3IVAA 2GJKA 5FUQA 1S4MA 2EBWA 2HF8A 4UASA 10MHA 1TLTA 4YCMA 4K9SA 4WLUA 1BX3A 2YHBA 2HYIC 1ZW1A 3WGLA 1RP1A 1CY7A 2VI5A 5BR1A 2Q5CA 4NYMQ 3Q2OA 2I6XA 1RDFA 3ISJA 1ZNQO 2B3DA 1OGYA 3T99A 4X6YA 4A0RA 1DX9A 5J2UB 3HP1A 5CX4A 3WMXA 3J7AC 3UAXA 4JKOA 4H1TA 3WFIA 1BGXT 1FJXA 4D8UA 2C2ZA 1WD5A 3GCGA 4I1RA 4RHCA 5TT1A 2I2WA 3RQIA 2XCLA 3CUYA 2VRCD 2WF5A 3UANA 2WFAA 3U7EB 2BVNA 3M33A 4MVWA 4OJQA 2VHEA 5AJZA 4OI2A 5TDHA 1IULA 5D84A 4TPKA 1SUEA 1F12A 1ZD2P 5MFZA 1FLAA 1Y8CA 3D0QA 1WXGA 5IW8A 4ZQIA 5JSKA 1T8PA 5CNJA 3T54A 3RIHA 1Z6YA 3M4YA 3IMEA 1YZQA 2GEFA 1C3VA 4MW4A 3VBEA 3WHPA 4YMTA 1R4NA 3DW3X 2WA1A 1KMQA 4N3AA 3ZI7A 1TKBA 1UBEA 1R5JA 2J9GA 4HX5A 3N0TA 4QPPA 1YBMA 1VJ0A 1Z5GA 2QM0A 4O33A 3ZX4A 3QOWA 2G9RA 1JVSA 3SN6A 3PJFA 1E6UA 3L8YA 4HDSB 5JLJA 2FX5A 1RRVA 4WMLA 3ZIAD 2AR0A 1XEWY 1WXWA 1M8GA 2WWHA 4IGAA 4XA8A 1QFZA 4R2KA 1UIMA 2ACVA 1LFAA 4RK7A 2VTBA 3GWZA 4IRMA 4V3CA 3EGDB 2HB6A 1KE2A 2QTTA 3WGUA 5DIFA 1R74A 3ANMA 2HU5A 3WWEA 1J06A 1ECGA 4IHJB 1SD2A 1L8AA 2VYQA 1HZZC 1AK1A 3EOAI 1DXYA 2WF6A 2WPNA 2X4DA 2OMEA 3FJ1A 1I8TA 4R1SA 4RL4A 3VR2A 3W7AA 4C7XA 1B93A 3KELA 3MUFA 3FWHA 1PK9A 4PC7A 3COJA 3O82A 2M9MA 2YHIB 3IKLA 3KOMA 4MA0A 5T6MA 4B33A 4B4UA 1E89A 3AUTA 4NJOA 1HE5A 2CNKA 4GM4A 2PS9A 3G8CA 2UUAB 3H9CA 3R5XA 4F4CA 3B52X 4UTXA 3VX4A 1SVLA 5CH8A 5FWXB 3NRCA 2FX3A 4B3GA 4C6RA 5HF8A 4RV5A 2PX0A 1QVRA 4G5QA 5CH3A 2BZSA 1D2HA 2F7SA 2VSOA 2XKAA 4YR9A 1DELA 5CG1A 3I92A 4H7JA 4BLTA 4DKJA 2MT9A 1TIKA 2C2BA 1ODLA 4N65A 4CM1A 2MINB 3GHHA 3L1UA 4HOYA 4R2LA 1D6MA 4ALNA 3ZHOA 1KTVA 4EEZA 1FPQA 5DYIA 3W5DA 2H92A 3E0XA 4ZWNA 1S02A 2QX9A 1KY2A 2VAVA 2Z58A 3FPKA 2O2EA 4JROA 1DBRA 4RHFA 3T1HB 3HKEA 2FP3A 2MTBA 1Q5PA 3GPIA 1OAOA 3AY6A 3C1AA 1RSZA 3OCWA 3F2IA 4GP7A 3GP8A 3PC7A 2YYAA 4MKRA 3RGGA 5LQDA 3NANA 2JLXA 3BFVA 3O6VA 2BIFA 4GKVA 4AWAA 2WU0A 1CYEA 1QB7A 3QEKA 5IZ4A 2FETA 2TMYA 3BWCA 3EK2A 2X8JB 3EULA 1DAFA 3JY6A 3QZUA 3NTVA 5AHXA 4NU5A 1N2BA 2QXTA 5BW6B 2FPWA 2ZRAA 1SEVA 2EARA 5JY6A 4DAEA 4H60A 3SEQA 3ZWWA 5FTKA 2GVZC 5KUTA 3MUNA 1XAHA 2G0TA 3BTOA 2HAEA 1JI0A 5IC5A 3S6JA 5CFOA 4EX6A 4X66B 5DHAA 4TUYA 2R11A 1XTRA 3LOQA 4ALLA 4DWOA 5IN4A 2VHXA 4AO6A 4ZYUA 3V7NA 4Q34A 1IJBA 1XZQA 4H6VA 2W5UA 3VPXA 4AIRA 2CLOB 4O4HA 1WTAA 1CBUA 3ORSA 4ZOBA 3UKOA 3E70C 5BQPA 1M2WA 4NYIR 4WBNF 1BFKA 2PUJA 3RVPA 2UUOA 3EBOA 3TTSA 3FNBA 1JWBB 2PH7A 3BEOA 3GYGA 3TRHA 3ZTYA 2DBYA 3USCS 3ZN2A 5ITZA 5HZGA 2WYHA 2ZI5A 3OBBA 1TAHA 1N5KA 1N1MA 4K9LA 1L5KA 3W6ZA 1DFIA 3HBJA 4ESEA 1OI3A 3G68A 2D2EA 3NJ4A 1UEIA 1FS6A 1KQ3A 3B2QA 3SIWA 4E31A 3K1YA 4QREA 3L4JA 1AO3A 2QSYA 3E3AA 3QWAA 5FOVA 5KYXA 3HA7A 3PVSA 1KI3A 3ONWA 2RH5A 4OXRA 4POAA 3O2JA 4C4ZA 3LNTA 2ZUCA 4JFAA 4QTYA 4KHPB 2OILA 2DPMA 4IS3A 1B2RA 1TX4B 4QIHA 2B20A 2X76A 1BVRA 1RXYA 2H5LA 3QV1A 4AJIA 3D6UA 4MQBA 4DJJA 4B6RA 3TIFA 3RAJA 4TM8A 1KAEA 2ENWA 2ZUUA 1J8YF 4GKKB 3ETEA 4V1CI 3OOWA 1YL7A 4J1TA 1M6NA 2Q6OA 4QYIA 5TXGA 2E4WA 4NCHA 2OHGA 2O8DA 3FDZA 5JCXA 3C4VA 4MQEA 1X13A 2E1RA 4HDRA 4B5LA 4C7VA 1DAGA 3ZU4A 2JK0A 4KSBA 4UHCA 1V1MA 1X1RA 1ZSYA 1Z15A 1ZS9A 4OFBA 3C6BA 3V4RA 3G7UA 4I7EA 3LY7A 4KUGA 3RBZA 3RJZA 2E82A 1TO1E 2QGFA 4PLWA 4W8HA 1AXGA 1QYWA 3BXZA 3GLHA 4XARA 4U7DA 1MO2A 3DFFA 1W9HA 2FMXA 2XUHA 5LC1A 3LVFO 2OORA 1N2CA 4Q93A 4Z1OA 5I51A 1B8UA 2GAOA 3IVXA 3P0HA 4PSVA 1GDHA 2ORWA 4QGAA 3TE6A 3ZDFA 4OI4A 3U0VA 5CXSA 3IOEA 1FDIA 2O7RA 3PUHA 3TQTA 1CUWA 3A11A 2UXBB 4C2BA 2VDKB 3KKNA 4JL6A 4Q1VA 3TECE 3OBIA 3JRXA 4ZQFA 4ZVKA 3ZHUA 1ORVA 1U5AA 4ILEA 4EG7A 2LR0A 4ZFNA 4MQ5A 1T25A 1I6MA 1T5TA 4LRSB 1SXJA 3UJ9A 3L46A 4C5CA 1P9NA 1J20A 5DNVA 3JVUA 2O8BB 2WM9B 4K1LA 2W6QA 1EJ0A 2AK2A 2YYZA 4UW9A 2I1WA 3MMPA 2G9UA 1ENYA 3R7LA 4TVOA 4YI3A 2GK3A 2E55A 4TTJA 1WF6A 1DQSA 2X9VA 4WKCA 5FTJA 1P81A 3V48A 4RF4A 1L2TA 3MMSA 4Z51A 4QQFA 4I1OA 1BHJA 2RK4A 4BBZA 4CWAA 1MABA 1SXHA 4B81A 3GVHA 4FJ0A 2K4MA 5A3SA 4KC0A 1TPYA 2WSSA 4XDGA 1DCKA 1E7WA 2Z4SA 3BK1A <