4WBSA

Crystal structure of an abc transporter related protein from burkholderia phymatum
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
246
Chain Sequence
SSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDAGEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQVGDDGKRLSKDAIASRTEALLDELQISHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPGDIIENESVRRVYLGEHFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related
publication title Crystal structure of an ABC transporter related protein from Burkholderia phymatum
rcsb
source organism Burkholderia phymatum
molecule tags Transport protein
total genus 82
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wbsA00
3IQWA 1KI1A 4A36A 1KK3A 3AKEA 3U7HB 2ZE8A 1WE2A 4LHZA 2FN4A 4Z51A 4DB4A 2JATA 3THYB 2ZU6A 1DAMA 4LBWA 3KJIA 1S1CA 1ZC4A 2NOAA 1P4SA 3GJ6A 4JLVA 1E0KA 3BH6A 1G4UR 3L2OB 3WNCA 3FHTA 5EJEA 3Q7QA 2A5GA 2RCNA 1R7RA 1UF9A 2CE7A 3OIVA 2IYUA 4JLBA 1GKUB 4NZYA 4Q1FA 5EE9A 3K70C 2GJ9A 5JJLA 1HTWA 4OJKA 2BKEA 4WXPA 4FMCB 4UXHA 2WWYA 1FTSA 1Q3TA 4IXNA 4RD0A 2ZRGA 1SXJC 4D2IA 3KKQA 1Z83A 5DYIA 1VG1A 4ZCMA 1DO0A 4KV9A 4EFLA 2TMKA 2WM9B 4CW7A 4EFNA 4TYWA 1D2MA 2ZITA 1XD2A 5G53C 4DVGA 4TT3A 4O3MA 1J99A 2I1VB 1Q1QA 3NEJA 4HAYA 2VSFA 3QNUA 4YMUA 4V03A 4O2RA 1Q22A 1UPTA 2LWIA 3B2EA 3PQCA 1VCNA 4OQLA 1QHIA 3VKHA 1E9FA 5IRCD 1KKMA 3TBKA 4GDFA 2OFXA 2BMEA 3FE2A 4IOKA 4NCIA 1OH8A 3SOPA 2JJ1D 4WBSA 1T0HB 3BWDD 4NL4H 1FUUA 3LW7A 2BJWA 3DZ8A 4EPXA 3THYA 4Q4HB 2FFBA 3T06B 1ZM3A 1Z6TA 5FOSA 2HF8A 1JB1A 1Y3AA 2QORA 2QMEA 2YYZA 3AH8A 5IT5A 2FA9A 1Z08A 3I32A 4AYTA 4BRUA 5HKKA 1XTSA 2GJ8A 3BH7A 1P2VA 1Z0AA 5FH9A 3B60A 3KZ1E 2D62A 5GJBA 2IA5A 4C2UA 1CJVC 3GJ5A 2UKDA 4D80A 4XTRA 4LJ7A 5CB8A 4XD7A 5JJKA 5KTYA 5CDFA 1E6CA 4B73A 4M9SA 1OSNA 2HCJB 2P6UA 3LVRE 1UAAA 4B2PA 3SEAA 3AVYA 1NN0A 1CLUA 2FX3A 3H0KA 2PL3A 3T1OA 2H7VA 1KO1A 5CLLA 5LB2A 2GF9A 3QOFA 2PBRA 1R0WA 4DIEA 3P27A 1CKEA 1DAKA 3LX5A 3DM5A 2NG1A 3RS4A 3K0CC 4BFUA 4HAUA 2OCBA 1NVWQ 1P5ZB 5H70A 3ZVLA 3EPKA 3KXLA 2IHBA 1FFHA 3IQXA 5E4FA 4Q4HA 4C0BA 3D31A 1G1MA 4LK2A 1ZAKA 3UMFA 5G3YA 3OIYA 2ZRKA 3NKVA 4CRWB 3PUYA 3VR5A 1VHTA 4ITRC 4Z8XA 2J3EA 4V0KA 4DDUA 2OLKA 4I1VA 4US1R 3T12A 4G5RA 2PJRA 1XZQA 2OLJA 2IYTA 5TVKA 2IUTA 3B85A 4D4MA 1A82A 1ZNXA 1EWQA 2IX3A 4WA7A 4MUBA 3IHWA 1KI6B 2OUKA 3FMPB 2FPKA 2L0XA 4A9AA 2PZEA 3IBGA 5HTKA 4NMMA 2IUUA 5KPJA 1G41A 3WP1B 6Q21A 1IQPA 2H92A 5FBWB 5FPTA 4KYUA 1KIMA 4WZ6A 1OH6A 4D0LB 1ZVQA 4I99A 4NKRA 2O5VA 1E1QD 2XSZD 3X1YA 4ZIRB 4DSTA 3HU1A 1D2EA 4JJKA 3OEED 4Z1MA 4ESHA 5J5CA 1UJ2A 5SZIA 1FP6A 4AYXA 3CZQA 3VKGA 5EZ6B 1HURA 1FMJA 3EWAA 2QE7D 3FB4A 5BYKA 4UNPA 2J7PA 3A4NA 2CHVA 2OEPA 3OEEA 2RGAA 1E4YA 3SE0A 3VX3A 1VYVA 4C9BA 1FUKA 4PC3A 4EKDA 3B6EA 4JLAA 4DSNA 1R10A 4QKQA 1SZPA 4NYMQ 4RD4A 5EUMA 3W90A 1JQLB 1WDTA 1X1SA 1C9KA 4M9XA 4MQBA 3B9PA 1F6BA 1KI6A 5LD2B 1ZCBA 5JRZA 3B8HA 2ZXUA 2EW1A 5TB5A 1RRFA 4URVR 5F9FA 4JMPA 1U0LA 2C03A 2WJGA 4Q7JB 1NI3A 2CL0X 2KE5A 3VFDA 4IOJA 4JLOA 2GCPA 2QT0A 5FTNA 4Q7LA 1LV7A 1EFRD 5HZKA 3Q85A 4GP6A 1YZUA 5KNDA 1P72A 1AKEA 2R6FA 3A1SA 3KQLA 4ZIRA 4EJSC 1OFTA 2C96A 3W3ZB 4LV5B 4D26A 5J4YA 3AVPA 3CONA 1U0HC 4L16A 2X2FA 5A0FA 3U7GA 3CNLA 4ZKDA 4M1YA 4DLZA 4E22A 3H84A 1X8LA 5LBIA 3VR6A 4QM6A 1U8YA 4FCWA 1X6VA 2RH5A 3HPRA 4HUQB 1KO5A 3MG9A 5CITA 5CYPA 5DI9A 2B92A 3W6OA 3CF0A 2ZJAA 4JLNA 3QPWA 4B48A 1Z47A 4LBYA 3EIEA 2ZRMA 3BFVA 2ZI9A 3FOZA 3B1YA 4XSHA 4QRHA 3L82B 1OH5A 1Z0KA 1US8B 2VP4A 1AM4D 1HE8B 1TQDA 2FF7A 1IAQA 2R65A 2G83A 2R9VA 4QGAA 1Z6GA 1MRNA 3PIRA 3VR1A 4TMTA 4MRNA 3TW8B 4PTLA 4PC7A 1YZNA 3R20A 2JLQA 3CPHA 1GZSA 2YZ2A 4HLUC 4W5WA 3PEVA 1IN5A 2D06A 3M0EA 4GPTA 3DKVA 3VX4A 2GKSA 3BJIC 3EW9A 4DCTA 5TMPA 2GCNA 3DO6A 3FFBA 4XWKA 2Q3FA 1NRJB 4Q19A 2AL7A 1X8KA 1RRGA 3R9IA 1Z0IA 2IYSA 2ZJ5A 5JWHA 1KK1A 1XCPA 3TUJC 3B1ZA 3QEJA 2F3RA 4HEJA 1Q12A 3SR0A 1SXJD 3KFVA 5G41A 1T8TA 4HUQA 3DL0A 2LKCA 1MO4A 2N42A 2O0JA 4LJ5A 1UDWA 4B34A 1Q1BA 1WB9A 3TAUA 4WZAE 2ZAMA 3MWYW 3B82A 4GP7A 5EP4A 4MA4A 4PQRA 1KO7A 3PUZA 3AKDA 2Q21A 1CEEA 2C8VA 2WICA 3ICEA 4KLZA 5AUPB 2ANCA 1MO6A 2A5YB 1FMLA 2QP3A 1YZKA 4LX0A 3GFTA 1SVWA 1US8A 4LDJA 5CDFE 4PO9A 1NLFA 4RJLA 4R2IA 3SN6A 3ZH9B 1A4RA 4HLDA 3W5JA 4QGGA 2BMDA 2RGGA 5IF9A 1L2TA 2W2VA 3PUVA 3A8TA 5BXQC 2WHXA 4HDOB 1Q57A 4YQFA 4A2WA 1DAGA 4OBEA 3ZLJA 2QG6A 5FPSA 4FIDA 4TZ0A 2VRWA 3K8YA 3RRYA 4F92B 3I5XA 2PLFA 2G88A 4R9UC 2ZRAA 2ZPTX 2PMDA 3MGCA 3NG1A 3AVWA 1G3UA 3BH0A 1T91A 3IBYA 2B8TA 1GSIA 2BIFA 4HUTA 8OHMA 1E32A 1B0UA 5AWFC 5IHPA 3RRNA 2RGNA 2C78A 1DO2A 2E1RA 2D4HA 4CVNA 3KQNA 4OQNA 3ZS8A 1TQ4A 3LX8A 1YHNA 5CIWA 3VR2A 4FCTA 3P26A 4I81A 4LSGA 1D6JA 1GP2A 3FPAA 1JXOA 3WYFA 2H57A 1PJRA 3UWOA 1RZ3A 4JJZA 1CP2A 3SNHA 4JL5A 4G5SA 2XX3A 4L5BA 4TLAA 1IXZA 2WJIA 3PVSA 5BWMA 4JSYA 4IDHA 3W8NA 4DC9A 1NBMD 3BXZA 1S9HA 1P73A 4B44A 4D0NA 4DLYA 3FFAA 4U02A 1VCOA 3GEHA 3ZIAD 5EE5B 1M34E 4EQ6B 3REFA 3CW2A 3KB2A 4JLDA 3MLEA 4MKIA 1MABB 4TMZA 3KQUA 4LPKA 2WSSD 4HZUB 4POAA 4N3NA 3I61A 2KB0A 4TYNA 5AJXA 2ZRIA 4ZCIA 1HUQA 2G1JA 3EXAA 4X8LA 3KDSE 1PV4A 2WSSA 4AK9A 4NE2A 4YXWA 4D81A 2C95A 1F3OA 4A82A 1E9DA 4M2LA 5SZHB 4C4PA 4P4TA 3CRQA 2MSCB 5FUYA 1Z29A 2UVQA 4OK3A 4AC9A 4RZ2A 1OXSC 2IXGA 1R0YA 3CKLA 3GLHB 1OXVA 2EWVA 4HAXA 5DIFA 2OFWA 4PPQA 1E2HA 2QZ4A 3U2QA 3KKPA 4D4KA 4JYCA 4LHVA 2X2EA 2VHTA 2JIZA 1XD9A 4DLRA 1QF9A 2IF2A 3ONWA 2XITA 4IFEA 3U7FB 3K53A 4Q1DA 1G5PA 2ZTSA 3NEYA 4QXAA 5C2JB 1DE0A 2VPPA 4PR0A 3QF7A 3KUCA 1BMFD 4C0AC 1H8HA 1YRBA 3BFKA 2HT6A 2X1VA 5AUNB 2IXFA 1JI0A 3M4YA 4EQ6A 5K8IA 4Q66C 3KXKA 3PEYA 1MABA 3NTUA 4C2TA 4X8OA 2XZPA 1XCMA 1W47A 1BMFA 3OIWA 2WOJA 3UIEA 1DEKA 4HZUA 1WXQA 2V6JA 2VYFA 2IYLD 2YV5A 3I72A 3LY5A 1XTRA 4QBHA 3AGQA 3TQCA 4BLRA 5JRJA 3EIQA 1UADA 3MMPA 1ZU5A 5CB6A 3OESA 1CRQA 1TU4A 2YVUA 5HCNA 3K0SA 1OV4A 1WA5A 4NCJA 4MRPA 4OKSA 5B30A 2ATVA 3O8BA 3QI2A 2HDNB 1U94A 2DFNA 2FU5C 2XAUA 1ZD8A 4RCYA 3VTKA 1AIPA 1W5SA 2EFCB 4JZKA 2FFHA 2GAOA 3GLHA 4N1AA 1T3HA 1OIXA 2KSQA 4C0LA 1BYIA 1GUAA 3FMOB 5EE3A 4Y0VA 1E2LA 3TAHA 5GJWC 3RS2A 4HAVA 4NCNA 4LGMA 3K09A 4KSBA 4PPNA 4KBGA 2Z4SA 2FFAA 1YQTA 2NPFA 3LBIA 5FUVA 2QT1A 2BM0A 4P0TA 1CBUA 2ECKA 3GFOA 2X19A 1P2TA 2HUPA 3MWLA 2PCLA 1N0VC 2FSGA 3E1SA 2QL6A 3RS5A 4C3ZA 4DIDA 3EZ6A 3A37A 3F0TA 3QXSA 2FMXA 2G1KA 5BYJA 2YWFA 5IK2D 5JFGA 4W5HA 1YE8A 1QVRA 4PHFA 1E79D 2AX4A 1OKKD 2R6DA 2RGDA 3A4MA 1W7AA 2QAGB 3T5DA 3P4XA 3CO5A 3LQQA 2C2HA 2GRJA 1E79A 2ZS9A 4UNSA 1FX0B 1E9RA 3HR7A 2F9LA 4P4SB 2O8DA 3UWKA 2IYYA 4US0R 4IDPA 4KU4A 4P32A 5L3SB 4A6PA 3KQHA 1W49A 1GM5A 4GNKA 1GFIA 2QP9X 4B3FX 1ANKA 3OHMA 1RE0A 4Q4LA 3W3AA 2JLYA 4TLCA 1GDDA 2WMNB 3BK7A 1UBGA 4RVCA 4YLGA 3IIMA 4LRWA 4TMVA 5JWRA 1CIPA 1XP8A 4DLXA 3C14C 1BIFA 4JKIA 4YMSA 5JJIA 1W0JD 3FGNA 1LB1B 1HY3A 2WKQA 2RB4A 1IHUA 2GVDC 4M1OA 3KJEA 2VEDA 3LLUA 3AP1A 2J45A 4D25A 1KAGA 1CRPA 4KFRA 4BFSA 3WNBA 1W0JA 1PUIA 1GL7A 1LY1A 4D82A 3OEHD 2J7KA 2IW3A 2WOOA 3SFVA 1KMQA 1LVGA 3LH5A 5KPDA 2QAGA 1NY6A 2Q9AA 2D2FA 1W0KD 2ZRFA 1OB5A 4G5QA 1NKTA 4Q47A 4KHZA 1ZCAA 4LCBA 3KL4A 5KSYA 4PZYA 2ATXA 3GQBA 3I1FA 3C16C 1J8YF 4PHGA 4L4UA 3THWB 1W0KA 1S4QA 1WF3A 2OV2A 4P4SA 1OXTA 3H4MA 4PHHA 4DSUA 5L3SA 1NN1A 1YZLA 3BFXA 2AK3A 1W2HA 4NCHA 4JL6A 4RD3A 3PCRB 3UG7A 1SQ5A 5C1BA 2HYDA 2ORVA 1YJ5A 2V8OA 2MMCA 2W6JA 3KJGA 3ZD6A 1AS2A 1ZD1A 4MRSA 1GNRA 1MKYA 3GLIB 4X8MA 5KSOA 3GP8A 1E9EA 2R2AA 4Q7MB 2XJ9A 2K5UA 2IBMA 2WBLC 4MGYR 3A1WA 3IEUA 2QP4A 1R0ZA 4B43A 3WRYC 4ARZB 4UNQA 4LJ9A 4LY6A 1YR8A 2O8EB 4LJYA 3UMSA 1JNYA 1E69A 2WMOB 2XB4A 3BE4A 1XBTA 3W34A 4RZ3A 4F4JA 4B32A 1NMZA 4JBXA 3A58B 1E1RD 2O0KA 5JS8A 1HQCA 1JALA 2J0UB 2P5TB 1G7SA 2B8WA 4WAUA 4BQSA 2F55A 4PAMA 1DTSA 4XTCS 3UPUA 2GWHA 1UDXA 1G5TA 2F9MA 4MGIR 4R2HA 2A78A 2HEIA 4M0LA 5LD2C 1NLZA 3THWA 1LS6A 2GEUA 2ZR9A 1F60A 3DKPA 2OE2A 1E99A 4LJ4A 1JPJA 2EFEB 4AWXA 4OQFA 1GRRA 3EPHA 1J2JA 2RGBA 1OW3B 1ZMXA 3LW8A 3OIUA 2CLDX 2F43B 2GVZC 4QGHA 1XCGB 5HCIA 2NQ2C 4D0GA 2KJQA 1LF5A 1PUJA 1GAJA 2GJKA 3BERA 2W6IA 4NU0A 2EWWA 2AFIE 1KNQA 2GETA 5KDOA 4NHOA 3GLIA 1YR7A 2ORWA 3IO5A 4ZDKA 2ZRBA 1OFHA 2QA5A 4CT4B 2ZJYA 3G0HA 2ZVQX 3ZD7A 4HAWA 4ARZA 3TR0A 5J47A 2O8EA 1E9SA 3BAFA 1TADA 4JT4A 2ZR0A 1P9WA 1S1MA 3GCGA 1KJZA 1VG8A 2VP9A 1LW7A 1OFIA 1C1YA 1D9XA 2AD5A 1OE0A 3TVDA 2A5JA 3B1VA 5FI1B 1NMYA 3Q3JB 2ZM5A 4TT3D 3RAPR 5JEEA 4BFTA 2J0UA 3REGA 2ANBA 5JZVA 1E2KA 1MOZA 3EARA 3HYRA 4NH0A 3WYGA 4A92A 4R98A 2WWGA 2CK3A 4QNMA 4WZBE 1OHHD 4BECA 5FOTA 1ZNZA 2HJVA 3PV0A 3V4FA 2FZ4A 4DLSA 4PZLA 2BBOA 4TYPA 1U2RA 1A2KC 1OHHA 1TQ6A 2F43A 3GLHE 2QRNA 5FUXA 4GL2A 3AF0A 1GL9B 1YR6A 2FDCA 2KBEA 2WPDA 2AKAB 3CWQA 1KK2A 2BC9A 2V3CC 3AF4A 2PCJA 4HATA 5HKKD 1JAHA 5EXTA 1G18A 1D8TA 1RRCA 3MAAC 4JSTA 2ODWA 2VLIA 1H8ED 1XX6A 1S9DA 2B7BA 1N6KA 1GNPA 4W7SA 2IYXA 3B9QA 4FMDF 3IIJA 1P62B 4XD7D 4KFTA 3QXHA 4ILEA 1VKJA 2IC5A 1II9A 2REOA 4QOSA 1GOTA 1H8EA 2CXXA 3CRW1 2GF0A 4EPYA 1E98A 1KDRA 2FPLA 4OQMA 1N6PA 2O52A 3VHLB 2RGNC 3DPUA 5JMTA 2GDJA 2DFTA 4NBSA 4EFMA 5LDDC 4DCNA 1KI2A 3FTQA 4K81B 1GG2A 4QJ3A 5DO9A 2Q3HA 2P0EA 1G16A 1RW4A 1TU3A 4LPSA 2JJ2A 2ZS8A 1KSHA 4MH0R 1OB2A 4XJXA 2RAPA 2V54A 1QZXA 4PO8A 2C9CA 3HWSA 4Z8YA 1IXSB 1G5RA 2W00A 4C0QC 2WV9A 2ZYWX 2OCYC 1RJ9B 4QL3A 3PUWA 1QHHB 1ZIOA 1OIWA 5D3QA 3SBEA 4Q18A 3BS4A 3F8TA 1NN3A 4G0NA 3RDPA 2VP5A 4DLUA 5BN5A 4RD2A 1FNMA 4CYMA 1QHYA 2JJ8A 2PZFA 1S3SA 1LFDB 1R8SA 1EX6A 3ADCA 3WY9A 1T4GA 1TQ2A 3QKTA 3C41J 4TTQA 4MRRA 2VP2A 5DHAA 1W46A 4TN1A 2BEKA 3LBNA 4OK5A 2G9NA 4JVMA 3AP2A 2CLCX 1ZC3A 4C0KA 5BW8A 1IJFA 3QKRB 1MR3F 1DELA 4F38A 5FOVA 1CJUC 1R5BA 2VSXA 2WIBA 3X1WA 2IHYA 1M7HA 4YMWA 1CR1A 4A6XA 1SKYB 1W4BA 2VP6A 4LYJA 2RKOA 3EASA 4OK6A 4PAOA 4RZUA 3SZRA 4Z1MD 5JEDA 3IUYA 1Z63A 4IOLA 1DAHA 4JLJA 4IRUB 4EPTA 4PANA 4W9MC 1M74A 2FEMA 2C77A 1GITA 1RJ9A 3RS0A 4GBMA 3VU9B 1E2IA 1QHHA 2J7PD 1ONBA 1HQYE 2F7SA 4PC1A 4EIWA 3CRVA 2ZIAA 3N5CA 3NBFA 4I1UA 4RFSB 4ZDJA 4MDFA 1DAEA 4UJ5A 2WIAA 3W5IA 4TYQA 4MYTA 2DHRA 3AVVA 1KOFA 2QPTA 5E7IA 2FG5A 3QQ5A 2OG2A 1TAGA 2PEZA 2V55B 4HDQB 4B3GA 3PFIA 2IUSA 1KI8A 3EZ9A 1GKYA 2FSIA 1VHLA 1Y63A 3CNOA 3LFUA 3UKDA 4MYUA 2Z6VA 3D7MA 3WHKA 4OHWA 3U3JA 4TL7A 3AEZA 3DHWC 2YWHA 4YONB 3T1VA 2A3RA 3FYHA 4DZZA 2IWRA 3QKRA 2Q0HA 4BGDA 4WIAA 4Q9HA 2R44A 3LV8A 1O87A 3DVLA 2A7QA 5GJVC 1WBBA 5DSZA 1VG0B 1VYTA 4ZDWA 1VYUA 1AJEA 1Z2AA 4PAQA 1DAFA 2BOVA 2OAP1 4NYJQ 2ZE5A 2ZSBA 4BFXA 3GEEA 1AS0A 3IGFA 1TEVA 2Q9BA 1E9CA 3SJZA 2IS1A 2D74A 5FPKA 1U8AA 2W0SA 3K09C 3X1DA 1JJ7A 1QDEA 2CEAA 2ZVPX 1JEDA 1DS6A 1FPMA 1CR4A 1QHNA 4RFSA 1G8PA 3PEUA 3ZVNA 4AKHA 2YNMA 3A1VA 3GLIE 3CR8A 1EFTA 1WCV1 3ZZTA 4LV8B 3JZMA 4TL6A 1LF0A 1VMAA 5EE1A 4Q9KA 1P2SA 1E0SA 2FSFA 4KAXA 4KXFB 2AXNA 1ZYUA 3M6AA 1KNXA 1NVVQ 2W0MA 4JVLA 5DN6A 5FBRB 1FP7A 5GVSA 3NHBA 4RD6A 2ONKA 2JLXA 4PX9A 3QBVA 4GMXA 3C4JA 3RYTC 1K6MA 3L0PA 1K5GA 3L43A 1CJKC 2ZJOA 1D9ZA 2ZRPA 2J0SA 2QY9A 3AB3A 5J4VA 2Q3MA 4V02A 4II7A 5FFMA 5LB4A 2QBYB 1M1YE 4DLTA 1JBKA 1W2GA 1PLJA 4L9SA 4B3XA 1FQKA 4WOPA 1Q3HA 2ERXA 3RSOA 2QRZA 3O8CA 2B21A 3TH5A 1AGPA 2G0NA 1Q44A 2R6AA 4GOKA 4M22A 1JR3E 4V0MA 5AR1A 4B47A 2QAJA 2QMHA 3WRXC 1GVNB 1ZW6A 421PA 4ZI2A 4UQOA 1ZUNB 1U9IA 4G1UC 2QGNA 2DWOA 1KY2A 4X8HA 4JVNA 3CIOA 4DSOA 2AD1A 2BM1A 4PPFA 4BWYA 2RHMA 3LVQE 1JECA 2XZLA 4V0OA 3TUZC 2IS6A 1P9RA 4KITB 4BLSA 3TIFA 1N6LA 1S0UA 3U4QB 1KI3A 4Q00A 2QAGC 5LPNA 2ORIA 4DCVA 5C4MA 1XMVA 3FKQA 1SVOA 2H1LA 1OF1A 3DOEA 4TQ9A 1EWRA 3R7WB 5F98A 1EESA 4BE7B 3AUXA 4GFDA 5C46F 5L3VA 3ZVMA 3VAAA 5A5GA 2V1UA 5F3WB 4JBWA 4DCSA 2QBYA 2FH5B 5KSZA 4G3XA 5KU1A 2IYQA 1Z0JA 4OI4A 5EP1A 1JAIA 1GWNA 3TGPA 2CNWA 2C9OA 3SQWA 4OL0A 2EU8A 3FHOA 2YHSA 5FUWA 2JDID 4DKXA 4ACBA 3HP1A 3NBZC 5ANRB 3TKLA 4LHYA 3PR1A 3U5ZB 1AZTA 3AVOA 1ESMA 3V9PA 3E5HA 1RC8A 5CIQA 5IDVA 2JDIA 3U7EB 3D6TB 4FWTA 3T34A 2HV8A 5F9HA 2BBSA 2BV3A 4FW9A 1IN4A 1EGAA 2D3WA 4UXIA 5E3HA 1UBCA 1MH1A 2VBCA 4CIDA 2FOLA 2R8RA 1EFUA 3GMTA 3MJHA 2WJHA 3QIAA 1NF3A 2G77B 3DMNA 3U4QA 3T61A 3HR8A 4OHVA 2ODEA 4M1KA 1TF2A 2GILA 3QVUA 4LJ8A 5TY0A 3HYTA 1E2PA 1P60A 4RD1A 3A36A 2IF0A 3R7WA 2CBZA 4LUCA 2VA8A 5CM8B 1OYWA 4JKYA 4YMTA 4DB2A 2XTZA 1SVSA 3QG1A 2ZSEA 3EAQA 4PFSA 1XPUA 5KOYA 2VHQA 4ON9A 3TW4A 1KO4A 2NZ8A 4P33A 4QC2A 2W83A 3JVUA 1PVOA 2P6RA 4DEYA 4B3DA 3NBXX 4FI3C 3P1JA 2DY1A 4M1MA 1N25A 5G40A 1CR0A 4FMCF 3F5FA 1VCIA 3IDQA 2YC4C 3U61B 2AWOA 3T5GA 2GHIA 1OIVA 4ACAA 3RC8A 2A30A 2CE2X 2R6GA 1T5LA 4K46A 1OJLA 1IN8A 1UEJA 1JR6A 2CDNA 4Q01A 3VQTA 1E2EA 3K0EA 3GFPA 3SC3A 4B35A 2WWXA 3N2EA 1KY3A 4TWZA 1R8QA 3H2YA 1ZINA 5K8TA 2H18A 4LC0A 4DBLC 1COWA 1IONA 2JLRA 3K9GA 4YXWD 3RWOA 1QG2A 2F6RA 1AGRA 1Z0DA 4F91B 3CPJB 1SVLA 3AV0B 3TNFA 3IPYA 2QTVB 3PEWA 2XGJA 3KXIA 3AVUA 3A1TA 5CM9C 5BQ5A 2AKYA 4PSKA 1ZM9A 3WXMA 4BFYA 1UBEA 1NVUQ 1ZM7A 2XOKA 2BHRA 2ZUBA 5BN3A 4YMVA 2JIZD 3KKOA 3SHFA 1KSGA 1YKSA 1SKYE 1G6OA 1UBFA 2QNRA 3CH5A 2QM8A 3RS3A 3AGPA 1K8RA 5C18A 2Z5FA 4KSCA 5FL7D 1IJEA 3B1WA 1CR2A 1H8HD 3AVTA 4MUAA 1BYUA 1G7RA 2ZI7A 4D4JA 2AWNA 2XNDD 1SKQA 2UZIR 5FL7A 4AKIA 4LC1A 1UKVY 1UKEA 5SZJA 2ZRDA 4NYJR 4JLMA 1YZTA 3KUDA 3OF5A 1MO5A 2ZEJA 2H16A 3RWMB 2XNDA 2OCPA 1KK0A 3L0IB 2VTKA 2WAYA 3EC1A 1OLOA 2BVNA 4B3BA 2GZDA 3KTAB 4A1FA 1KSJA 2YWEA 5J4KA 3AP3A 4LOAA 4KODA 4PSVA 4ERNA 3TSOA 5JS7A 2FNAA 3BOSA 1NY5A 2DWPA 3H86A 4AD8A 1TEXA 1EG7A 3BIFA 4FINA 2BBTA 2VF7A 2ZJ8A 2JEOA 3EWSA 3D3QA 1W4RA 4HB4A 5DNYB 2IWHA 1NVVR 3LWNA 4LV6A 1XZPA 4IVRA 2AR7A 2GJSA 4DHEA 4B3CA 3U3OA 5KO2A 2ZJZA 4LYFA 3RHFA 3WMGA 1E9BA 3GJ8A 4LHXA 5EXSA 3TJZA 2J0VA 5KDLA 2OESA 3U3KA 2YWGA 4OHXA 4ESVA 1QHXA 3ICQB 3ZJYA 3QF4B 5TDHA 2O8CB 4QNRA 4V0ME 3R9WA 3WYAA 3BC1A 4N0EA 3OE7D 4QM7A 4MRVA 3LBHA 1DADA 4JS0A 5FOWA 3QY0A 1RYHA 5AK0A 1IY1A 3OE7A 2HJGA 1F48A 4Q02A 5JLJA 1JQJC 2OILA 1FZQA 1P75A 4AIIA 621PA 1E2GA 1OFUX 2A5FA 3QKUA 4PZZA 3KTAA 3D8BA 1TMKA 1XPRA 1O3YA 2J87A 1X86B 3U44B 2ZE6A 1TF7A 1RFLA 721PA 1SVKA 4L15A 1XF9A 1G6HA 4S35A 1N0WA 3W6NA 2HF9A 4A2QA 3AF3A 1UFQA 4OHZA 1OPXA 1UM8A 2ZJBA 4DJTA 1NVXQ 2WWIA 3C7KA 3NH9A 5GJCA 5TXGA 2HXSA 2ZRNA 4JYBA 2OAQ1 3W9YA 5HR5A 3ZGXA 2EVWX 1E96A 3PJRA 3PITA 3V00A 5FR1A 5HE8A 3W8RA 3RLFA 2C99A 3B1XA 3TK1A 5L3RA 3QF4A 1S3GA 1T0JB 2KWIA 3B78A 4FWIB 5AJYA 2O8CA 1NIPA 3O8DA 4WXRA 4OJQA 2UZ3A 4IEIA 4MITA 1Z07A 1S96A 1A5TA 2D7CA 3QXJA 5JECA 3MCAA 3BORA 4YDSA 2BCJQ 3LDAA 1E94E 2IYVA 1J8MF 2ZANA 1KDPA 3MSXA 5E7JA 4F4IA 1VDZA 2DR3A 2LCFA 3VNVA 4FMBB 4B33A 4HB0A 3KKNA 2REBA 4KLNA 4DUGA 1Z6AA 1FX0A 4RSGA 1SHZA 4ZV4A 2C9YA 2HCBA 4B75A 2A2ZA 2HXYA 3V4RA 1FOEB 1W4AA 3OZXA 2W6JD 1VCMA 5J40A 3ZS9A 4NCKA 4M1SA 2I4IA 4MYCA 4OI2A 5BN4A 3ZZ0A 1OXXK 1Q1EA 3MJRA 4XVRA 4PQYA 2OBNA 1R2QA 4UNRA 4BLOA 4C0HA 2G6BA 3ADDA 1P2UA 4HZIA 3FWYA 2E87A 3VNUA 2JCSA 2JLWA 3GD7A 3NDPA 1XD8A 2J5XA 2GBLA 2FGKA 1GTVA 5JI2E 4GZLA 4TMKA 4PHTA 2YJTD 3NXSA 4Q9JA 2IYWA 3KKMA 1FW6A 3FKSA 4M53A 1CF4A 4M1TA 1X8JA 2CL6X 2QENA 2BMFA 4BZQA 1Q0UA 5EZ5A 2NMVA 1KYIA 2QQ0A 1XEWX 1Z6YA 4ASUA 1AQUA 1KMHB 4IVPA 1TUEA 3AF2A 4TMXA 3QENA 1N6RA 2PT5A 3EZ7A 1KTVA 2HLDA 3KFXA 4G01B 4RKEA 5FBLB 4RY2A 3DDCA 1ZUHA 4B2IA 4A0RA 3NH6A 3IHLA 2GAAA 2J9RA 3CB4A 3QKSB 4IDOA 2A9KA 2IT1A 1N5LA 4O0MA 4Q9IA 5TARA 4URYR 3ZDQA 3HU2A 5FBVB 4OI0A 1G19A 3EZ2A 3THXB 2N46A 4U00A 5ELXA 1XMSA 2V7QA 4LYHA 2WJJA 1Z3IX 3CBQA 3QVVA 4TMWA 1HA3A 2W6ID 2OZEA 4QGFA 3L0OA 1RPZA 3O47A 2DCUA 2CJWB 3AF1A 4QBGB 1ELOA 3I62A 3WP0A 4YDHB 4L8GA 3RRMA 4EUNA 2P2LA 1HYQA 2O0HA 2WWWA 4Q1BA 5DH9A 2P65A 1G3QA 3Q72A 5B64A 1ETUA 2CHQA 4HAZA 1U9IC 3QEOA 2IEYA 4H9GA 4Q1AA 1XJQA 1W48A 3FHCB 2R62A 3K9LA 3S1AB 4QHTA 4OHYA 4C0SA 2LKDA 2D2EA 3CLVA 2ZUDA 1IOZA 2CVHA 3I4LA 1KMHA 2ZYTX 1G21E 2QROA 1ZM2A 3VR3A 4EPWA 1B23P 1G291 1XXHB 3A4LA 3CRRA 2BBWA 2CVFA 2CK3D 4V0NA 2WWHA 2F3TA 5FTMA 1F2TB 2VP0A 4LJ6A 1IN7A 4QHYA 4TSFA 3QKSA 5EP3A 4GRAA 3SU8A 1MO3A 2AXPA 2IXEA 2GXUA 4QJ5A 1ZNWA 4C30A 2JLUA 3PENA 1NIJA 1G4AE 1FQJA 3THXA 2YOFA 1JR3D 1XMJA 3LO5A 3UMRA 2R6CA 4H1VA 2ZJ2A 4JBYA 2G3YA 2PX0A 3B7GA 3GJ3A 2WPDD 2ZSDA 3IILA 4PXAA 3EX7C 3CRMA 2OO7A 2CJWA 2J46A 1I2DA 1JR3A 2RGXA 2WJYA 4WVFA 1KGDA 4XVUA 1C4OA 1PLLA 4A0GA 4C7OB 4D6PA 2BEJA 1E2DA 1XTJA 4EPVA 1FNNA 2P3SA 5L3QB 1T5IA 1HEIA 4DLVA 1TF5A 3PG5A 1CTQA 4IXMA 5JCZA 4DT1B 3C5CA 4AKGA 1H65A 3J81k 2VO1A 3GEIA 4QG7A 3S1AA 4UNNA 4AG6A 1W36B 4URUR 1QBKC 3LNCA 2OHFA 4Q4JB 3SYNA 2J59A 4XWAA 1GIAA 3T1TA 1KJWA 2IL1A 4P3YA 5AUOB 4URZR 1XXHA 1YZGA 2WKRA 3TSWA 1A1VA 1G3MA 1NP6A 1F2TA 2JJ2D 1OH7A 1G8YA 4RZXA 3UANA 1QVAA 3ZVRA 4Y0AA 4ZO4A 4BEBA 4PPGA 4N0DA 5L8VA 1T6NA 1YR9A 1Z8FA 2JJ1A 2YC2C 2ZI6A 4Q48A 5KNCA 2CCGA 4DCUA 1Z0FA 1R6BX 5FTJA 3OAAD 1ZU4A 4NONA 4YC7A 2H17A 4US2R 3B5JA 3I8XA 1CXZA 4KJZA 3TSZA 2OXRA 3QPUA 2CCKA 1RYFA 4IVQA 3SYLA 1SVIA 2ZQ5A 3OAAA 4XOIA 4C7OA 3SJAA 2ASEA 3NWJA 1KZGB 1TNDA 4PC2A 2QEQA 3ND9A 1W36D 1U81A 1AQYA 1WRBA 4BZXA 1HE1C 2ERYA 5L3QA 2CCJA 3RRZA 4DT1A 2MSDB 3DM9B 1BKDR 2W2TA 2P67A 3QUSA 2ZRCA 2NO1A 1GILA 4OYHA 2OM2A 4RFVA 3I92A 5JBQA 1E2JA 4KCGA 2YKGA 4L9WA 2GNOA 3O8RA 2YOHA 4Q4JA 4BLPA 1S8FA 4DEXA 1II8B 4O2LA 2Z4RA 821PA 1XJCA 1G7CA 2ODBA 4F4CA 3CF6R 5EXPA 5B57C 2OXCA 2QQEA 1GL6A 2KI5A 3QPVA 1L4YA 2F1JA 3THOA 1NMXA 3PUXA 4Z54A 3FMIA 3N70A 1X3SA 2IYRA 3ADKA 3FVQA 1J70A 2GTPA 1U99A 3P32A 1N5IA 3TLXA 3K0FB 3K1JA 3SHWA 3ZQJA 4BUJA 5B58C 2ONJA 1R4AA 4M4SA 2DB3A 1XU4A 4NPHA 5KNBA 5P21A 1DPFA 4TQAA 1N6HA 2NTYC 3GPLA 5JHHB 5H8WA 4KFSA 5EQTA 3FMFA 3HDTA 3LA6A 2G0TA 1XEWY 4IFBA 3U6KA 2JLZA 3NC0C 2ZSAA 4LWZA 1VIYA 1MRSA 1TL7C 2VQSA 3MFYA 2RGCA 2GK7A 4A8JB 3UATA 1HT1E 1N6NA 1KI9A 2DWQA 2C98A 5DGXA 4NTZA 5EE0A 2PX3A 1XDBA 3IEVA 1Q20A 4ZDIA 3U6BA 4KYIB 2ZUCA 4HLQB 1J90A 1II8A 4G5GA 4BLTA 1ZM4A 4KVAA 5FBQB 1ZIPA 2FJUA 1SHKA 1VIAA 2AK2A 3AKYA 5JWOA 1R5NA 5FL3A 1E1QA 2E9SA 2XSZA 4IOMA 2JASA 3BB1A 3LD9A 5CJ2A 2GXQA 4F7WA 4NP6A 4Q5IA 1A7JA 4ZCLA 3NVAA 1X1RA 2QTFA 1YRAA 3K0FA 3DEFA 2OBLA 2QE7A 3Q8XB 1VTKA 1II0A 2JGNA 4BFWA 4XWOA 1WP9A 3VU9A 2ZE7A 2GXSA 1E0JA 2EYQA 2DFKB 4GZMA 2QI9C 4FN5A 1ZP6A 5DE3A 4ZI3A 1D5CA 1M8PA 4LHWA 1ZNYA 1E4VA 2ZREA 3U3MA 4B2LA 4HI0E 4E5UA 1M7BA 2VHUA 4M8NE 5FTLA 1G3RA 2QU8A 5B2ZA 5DN6D 4A8JA 4Q9LA 2F1IA 4KFUA 1KI7A 2IEZA 3BD9A 1U8ZA 2X8AA 3KJHA 4O25A 3EIHA 3CR7A 1Z06A 2JLVA 5C4GB 1NJGA 1NNEA 5E7MA 5JCPA 5EXXA 2PMKA 1N6OA 4P31A 2WAXA 4UJ3A 2DBYA 3UK6A 2XB2A 1Q21A 1ZJ6A 5FPHA 1BS1A 1T3SA 3NBYC 1EFRA 3N2IA 1XNJA 2I3BA 1T9HA 1TUIA 3AKCA 2QSZA 1DBSA 2NO7A 3B13B 1XEFA 1E3MA 1KZ7B 5GVRA 2VH5R 4M9QA 4F93B 3BRWD 1N0UA 2YOGA 3CWZA 3DZDA 3K9HA 3MUFA 3Q7PA 4B74A 3K70B 1CULC 2IS4A 3T35A 4IJMA 1FTNA 4M1WA 3SS8A 2JLSA 3U3RA 1T3LA 1E2QA 1DG3A 1XRJA 2NO6A 1SXJB 1KAOA 2FGJA 5CJPA 1VG9B 2ZU0C 3ZZUA 1TTTA 1Z22A 2ZSFA 1E2NA 3AQ4A 3MWKA 5J4HA 2NPIA 2GZHA 5K8LA 1VPLA 3X2SA 3BB4A 3QSYA 3HU3A 3CUEF 4W5JA 5TV2A 1AZSC 2CMKA 2IK8A 3C8UA 2H5EA 1EFCA 5EP2A 4C0JA 4TYYA 2V6IA 5UKDA 2CLSA 1OYYA 2FSHA 3QBTA 1KDTA 4CF7A 5GADl 3EG5A 1I4DD 4B6FA 3C5HA 3MWJA 2CL7X 3EA0A 2WKPA 3ECCA 3TQFA 3IPXA 3EZFA 1SULA 3K9NA 4IDNA 4CT5A 3AVXA 2ZYUX 1BO6A 4UXJA 1XXHE 3K70D 3R8CA 3X1XA 5AJVB 4JL8A 1UKZA 1P3JA 2CNWD 1KI4A 1YVDA 2ZAOA 2ZROA 4KO8A 5KHOC 1XTKA 3G82C 2QMOA 1XJ0A 4E09A 1XEXB 3WHLA 5G3ZA 3RABA 3Q5DA 3WMEA 4JLPA 2C04A 2OSBA 3EC2A 4BASA 2DFLA 1QHGA 3P4YA 2PLRA 1SXJA 1UKYA 1GNQA 3EPJA 4MYHA 1W1WA 4Q7KA 2AN9A 5KDDA 1L4UA 2GBLC 1I4LD 4H1UA 4TL8A 4LI0A 4A0HA 2BWJA 221PA 2EYUA 2RHDA 4GT1A 2AFHE 4DDTA 1DG1G 4PSAA 5FTKA 3AUYA 2V1XA 5EUQB 4DDWA 3A1UA 1AA9A 5HE9A 2JA1A 5HPYB 3LXXA 1HT2E 4E03A 1DAIA 4TLBA 5CK5A 4HYYA 4XIGS 3M1IA 2Y8EA 1BH2A 2QGZA 1AN0A 2EFDB 3QG5A 2XJ4A 3Q5EA 3IIKA 1NLYA 3TMKA 2ZR7A 1MT0A 1W4CA 4PC6A 4E07A 4EPRA 3CPEA 4QHSA 1JPNA 4CZ2A 4LYAA 1R0XA 3R8FA 2BDTA 2GZAA 1W5TA 2N1BA 1Q1ZA 1EK0A 2V4ZA 1F2UB 1W44A 1KO8A 4FCVA 1XEXA 5FPYA 2VHJA 4OI1A 3RC3A 2GCOB 3VMFA 2DPXA 2ZI4A 4GOXA 4LZZA 1JJVA 1V43A 3GLFB 1NN5A 4JVSB 1R5OA 3JZAA 2IS2A 3E2IA 4TTPA 3CNNA 3GLGB 3NIBA 4ZKEA 3ASZA 3ZQ6A 1E2FA 4FMDB 2F1HA 4J0QA 4AURA 4DDVA 1COWD 2NZJA 2Q9CA 3R9XA 4QJ4A 3GJ7A 4BPBA 2Z83A 1N5JA 2VSOA 1D2NA 1TX4B 2ZI5A 1VECA 5D3MB 2V9PA 2H8KA 2PZGA 4D4LA 5HZHA 2GESA 1LNZA 3K0CA 2ODNA 3EPLA 2ZETA 2GK6A 4NYIQ 2C5LA 4HLCA 3GJ0A 2O8BB 1M2OB 4FD2A 4CEIB 2XOKD 3H1TA 1P61B 2P5SA 3QE0A 3VHXA 1G7TA 1NSTA 3Q9LA 2B6HA 4S2EA 1NBMA 1F2UA 4A0FA 3ETLA 1G8HA 1XTQA 2XTMA 4IDQA 2GCOA 3ZIAA 1RRPA 3U60B 2ZYVX 3TRFA 1CJTC 1E9AA 2FFQA 2GA8A 3WNDA 1N3BA 3GLFA 3K0AB 1G9XA 1KHTA 2Z43A 4I1OA 1ESNA 4AI6A 5M04A 3W6PA 5JSZB 3ADBA 2NIPA 1K5DA 4M9ZA 5H68A 3KX2A 4BFVA 4MDEA 2IYZA 2QTHA 4GSYA 1IY2A 2FE4A 3MD0A 1AKYA 2P6NA 3QXCA 1ZRHA 3GLGA 4XVQA 5F2EA 4B6EA 4TZ6A 1WMSA 1GRQA 2PH1A 2RMKA 4AYWA 5FR2A 2ZRJA 3ND8A 2A5DA 2EFHB 2WVJA 3E70C 4BRWA 4HB3A 2ZS7A 4JLKA 3TVTA 4NYMR 2QPOA 1M7GA 1AS3A 2GEVA 2XNSA 5D3MA 3RANA 4Q21A 1WQ1R 4EJSB 1G17A 4AG5A 3GJ4A 3GJXC 4M21A 2PEYA 1YU9A 3BB3A 4G5OA 2O8BA 5CLQA 2OCAA 4AKEA 4CEIA 1V5WA 5E95A 4A15A 1EX7A 3CF2A 1TPZA 1RKBA 5AJWA 4CEHB 2J41A 2MSEB 2FZLA 1F5NA 4KBFA 1ZD9A 1IN6A 1J7KA 1HH4A 3K0AA 3PXGA 2BJVA 1LTQA 3NHAA 3RSLA 5FOUA 3WBJA 5AUQA 5JSZA 2XXAB 3LAWA 2QSYA 1XWIA 1IM2A 3TUIC 2O8DB 5KSPA 1E0AA 4CEJB 1UEIA 3IO3A 1RIFA 4RKFA 4UKDA 1QHSA 1NKSA 2EFGA 4DRZA 4WW0A 1W36C 3L8ZA 3UG6A 2QPAA 1JXMA 2MMGA 1KKLA 1XPOA 4GOJA 2BMJA 2PT7A 3RS7A 3CZPA 4TL9A 2GEDA 2NO9A 2GXAA 1IXRC 1EXMA 3CH4B 3SYKA 4CGZA 3OFND 2J1LA 4EJSA 1FL9A 3WMFA 4FXPA 4V0LA 4I4LA 2RGEA 3CX6A 3DMDA 4MKGA 1BOFA 2CHGA 5DISB 4DLWA 1XB2A 2JAQA 5DHFA 2XEXA 2BKUA 1OXUA 1XTIA 3I3SR 4URXR 4AY2A 3OFNA 3X1ZA 3LQRA 4KI0A 1L7VC 1S2MA 4TLEA 3BBPA 2W58A 3HPQA 521PA 3WBKA 1ZUIA 1JEEA 4JT2A 2J0QA 4LBVA 4CEHA 1SVMA 4K8OA 5SZKB 4LBZA 1HV8A 4I1SA 3CX7A 2KBFA 5IK2A 1XMIA 2I1QA 3SJBA 1I4TD 4A2PA 1OT3A 1SXJE 1P9NA 3NC1C 4URWR 1DOAA 2F1RA 2OT3B 1OKKA 3I73A 4B76A 2XXAA 1G3IA 3JVVA 2QM7A 2HT1A 3SBDA 4CEJA 5KYKA 3P20A 2DYKA 4DXAA 1ZBDA 1G8GA 3RNLA 4OQXA 3QXXA 4KVGA 4Q03A 4EAQA 2WSMA 1CU1A 5DI3B 5DLQC 5JHGB 3TR5A 4DUGD 4HLUA 2D7DA 1PLKA 3A6PC 1P6XA 4Q4AB 4TTRA 1CS4C 4MKFA 1N2CE 4QBFA 3AVQA 3QJYA 3F3YA 3BGWA 3DOFA 1AK2A 2Q6TA 2OFOA 3L8YA 5AJZA 4EDHA 3VKWA 2PJZA 2O8FB 4PO1A 5J4LA 4JIMA 3SI7A 3SQXA 2AHOA 4QFMA 4TLDA 2BCGY 1EFHA 1T8UA 2REXB 3U44A 1DVRA 1G20E 121PA 4ABYA 1NG1A 2HYIC 4MKHA 4B71A 2SHKA 3KQKA 2QMUA 2W2XA 2X77A 5H1YA 3CX8A 3I8SA 2GJAA 4LJAA 1N6IA 1G8FA 2NO0A 3HJNA 1QRAA 4QBIA 2QUZA 3FKSD 4IW3B 5A4JA 1Z28A 2FPMA 3AM1A 1NL3A 1ODFA 3OEHA 1E2MA 3LXRA 4HDCA 4R71A 3G5UA 4BFZA 4Q1EA 2WJVA 1IBRA 4HSEA 1P7CA 3C15C 1N5KA 4MGZR 4ASUD 5KUTA 3LRPA 3RVBA 1KSFX 5FI0B 1KDOA 4U5XA 1WBDA 3ZYCA 3KB1A 2VL7A 2B7CA 1I2MA 1Z6XA 2HLDD 4PQFA 5FOXA 4A8JC 4BLQA 4BEJA 2ZRLA 4BZPA 1M6NA 2FV8A 2YINC 2Z0MA 4XSGA 3NDBB 5DI3A 1IY0A 1G64A 1KJYA 1RVDA 4Q4AA 1MV5A 3MRSA 2XZOA 1L8QA 4A4DA 4P4UA 2OBMA 2QN6A 2ZI3A 3TE6A 3IKJA 3SFZA 4IEEA 1QG4A 2V7QD 2VIIA 4CDGA 1GRNA 1Z5ZA 3SJCA 4DWJA 2O8FA 4Q1CA 2WZQA 1PZNA 4R7ZA 4XH9B 4NDZA 1NJFA 3I5YA 1XFAA 2WTUA 1YZQA 3EA5A 5DYGA 3FDIA 1Z2CA 1A2BA 1SGWA 4IHQA 3ASYA 1NBME 1NSFA 1U90A 2VF8A 2ZRHA 4TQUS 2WWFA 2EQBA 4IKEA 1GKIA 4GI7A 3T1QA 2FEOA 3LLMA 4NYIR 5CYOA 1CJMA 5K8UA 3CM0A 3UXMA 1DARA 2NGRA 3GLFE 1NG9A 3VR4A 4HB2A 3SDZA 4ZPXA 2XTNA 1XD2B 2VHCA 4MGKR 1E1RA 4U7DA 5CK4A 3GLGE 2FWRA 4RCZA 1U0JA 3T15A 4GMDA 3L0SA 5JI3E 1LS1A 1U98A 4TSFD
chains in the Genus database with same CATH superfamily
1KI1A 1KR5A 1UP7A 3BF7A 3PDUA 5E6UA 4DCOA 1HTTA 1C1DA 1NI4B 1YI8A 1XDGA 5BNFA 2FN4A 4DB4A 4X71A 1O08A 2JATA 4WERA 4ZP1A 2ZU6A 1GTL1 1DAMA 1QKIA 1CS0B 3KJIA 4RDHA 4PG6A 5IAEA 1JU9A 3PGKA 1P4SA 1E0KA 3L2OB 1G4UR 3C7CB 2IX9A 3HRIA 3NNDA 1U8XX 3NWEA 4LK3A 1IDN1 3Q9UA 1IHYA 3D5EA 2A5GA 1R7RA 2CE7A 2AT1A 4E88A 2IYUA 3P2MA 1IJKA 4KDRA 4MVJA 4XXHA 1HTWA 4BVKA 3CSDA 4IP0A 4WXPA 1HKHA 3QHPA 1GZ4A 2JBAA 5PGMA 1MXFA 3IDSA 3JWEA 4PWYA 3VO1A 5CDSA 5A6SB 1QVVA 3FYUC 4UHBA 3DFZA 1YH3A 1C1HA 2VRNA 1VG1A 2W5UA 5EL0A 4RTLA 2Z6UA 4ZEVA 3LHIA 4EFLA 4EFNA 4D9NA 5AXAA 2VDNB 2ZITA 4N7BA 5B37A 1VIDA 3VC7A 3DMPA 3DO5A 4FKZA 5G53C 3HCAA 2DUNA 3IAFA 1U0OC 4YMGA 3MJFA 1H0SA 1MEEA 3IX7A 1C9EA 2B8EA 5DZSA 4UFNA 1Y8RA 2DZDA 4V03A 1P39A 1SRQA 3NTRA 3O8OA 1G5IA 1CY0A 4O2RA 3RIGA 4B5LA 2RE8A 4IFIA 1YVPA 1XU9A 3NIFB 3RWBA 5KJFA 4G0UA 2ZATA 3HI4A 3HLYA 2F17A 4N6OA 4G84A 4GDFA 3TPFA 3FE2A 5JDIA 1OOEA 3SOPA 2JJ1D 4BBAA 4WN3A 3CXRA 1NI4A 2YHAA 4G0VA 4EPXA 4IIYA 1CS0A 4KE6A 4BX2A 1DIRA 1V37A 3T06B 2PLAA 3E7DA 2P9GA 5A2QA 3T99A 3OX3A 1HLPA 2IJGX 1Y3AA 2Y68A 1YB4A 2Z4TA 4PSUA 1UP4A 1GQSA 1SCIA 3AH8A 5AQEA 1QJCA 5IT5A 4DLLA 4I9FA 2OYRA 3JWJA 5GWXA 2C2XA 4F9GA 4BRUA 1FMFA 1TYDE 3BH7A 3PC8A 1P2VA 1SG6A 3FWKA 2QN1A 1QRDA 3RRBA 2PGNA 1Z0AA 2WF5A 3PHHA 2GD0A 4KX3A 4MUMA 1TD1A 3UNXA 3BSSA 5TX7A 2A6PA 1GNTA 2UKDA 3IV7A 2YX1A 5DRYA 5JG7A 3FDFA 5H0IA 3OWHA 4LJ7A 3ZZ1A 4EO7A 5A6SA 5KS2A 4AY6A 1ZH8A 4XD7A 2M6LA 4JENA 3HXLA 3JD0A 3LVRE 4QWWA 2EZUA 1LPBB 2DTEA 2P6UA 3QVXA 5A6VA 1UAAA 3I12A 1NN0A 1M75A 4LVUA 5IKPA 2JGKA 3OSUA 3UGKA 3JTMA 1ZRSA 3M7IA 4NFYA 4OFBA 2H7VA 4LF6B 4J75A 2H2FA 2GF9A 4LAFA 3DBVO 2XI4A 2NU9B 2VPXA 1VC2A 3BWMA 1CKEA 3C24A 1IQUA 2DH6A 4UUAA 4CBVA 2DQZA 4DG5A 2GKOA 3OQ6A 1ZRMA 3H5NA 2SKDA 4KIWA 5BQFA 3KELA 4BFUA 1JIUA 5AM0A 1NVWQ 2CJPA 3JQEA 3CGWA 3BRCA 2Z8YA 4NNPA 2DBVO 3ZVLA 4F8JA 4NZ9A 3EPKA 5E4JA 3IMGA 2DPGA 4C0BA 3LDHA 1MDFA 4GQBA 3RIYA 3VYVA 2AIRA 4L4YA 4TTSA 1FSGA 3SLKA 5G0TA 3W06A 3UMFA 4XQ9A 3RBAA 4OP2A 5JYEA 3T0IA 4AZ0B 4KQKA 4F2HA 4M8KA 3LUJA 4DDUA 4ZANA 4PIMA 3T12A 5JUWA 1U1GA 5C1DA 7AT1A 1QIEA 3HLTA 1OMOA 4H3VA 1A82A 4FZRA 1ZNXA 1QWOA 4RULA 4WA7A 4MUBA 5JCJA 3RKUA 4FBMA 1UMBB 2HK7A 2EHJA 4D9GA 4A9AA 3TPCA 1YVUA 4S1NA 4EFDA 3IBGA 2B37A 3F90A 5ALNA 4DAEA 1SD1A 4EM6A 5BNZA 6Q21A 3JARB 1IQPA 4EYQA 2XE4A 2NU9A 4FWBA 3FLAA 3WAKA 4OXYA 1RPNA 3FBTA 4WZ6A 1UJMA 5B55A 4M8LA 3ZHUA 3HU1A 1ORTA 1LRJA 1D2EA 1VHQA 2PX6A 4JJKA 2Q5HA 4BY9E 1PR9A 4WJZA 1X42A 2IGBA 1CVLA 1TM2A 5EIHA 5SZIA 3ZI4A 3ZW7A 4JI3B 5JNVA 1DUIA 1KQGA 1FMJA 1URPA 1P33A 3EWAA 2ZVJA 1UZNA 4FYWA 3JQAB 5FBLB 2CHVA 1XQ9A 2ERCA 3B53X 1WOYA 3LFHA 2W4MA 3USES 3VX3A 1ZK0A 3OU6A 2W6CX 3AFMA 4C9BA 3HXQA 1Q0TA 2H29A 4O3FA 4AZ0A 3Q3IA 2NP6A 5F51A 3GA5A 3B6EA 1N9GB 3W5UA 1GYQA 4AWAA 1L6IA 1L4NA 4MLCA 4NYMQ 3PCXA 5K3SA 5AW4A 1GR0A 1W73A 2IZ1A 4RY0A 3LCJA 1X1SA 2YZNA 3A4YA 3UJCA 2FAXA 2C1ZA 8ABPA 1F6BA 1TJNA 4IR7A 4CUJA 2A0XA 2QPLA 1UMBA 4UUMA 3UUFA 4WA8A 2B3TA 2HQBA 5KWVA 2JIMA 1RMQA 2CL0X 1P5HA 3MXTA 1E60A 5COAA 1JSCA 4IOJA 3VFDA 2JEZA 3QPAA 3GJTA 3JARA 5CG2A 1ZK1A 5TJHA 4Q7LA 4WSOA 1Z8NA 2IDMA 1LV7A 1CUHA 4GP6A 4KB5A 1SHJA 1YZUA 4TN5A 4KQGA 3LDFA 5LZ5A 3H5IA 3K2QA 3K73O 2I2WA 1OC2A 2Q6IA 1J06A 1F51E 1SUCA 4LV5B 2AG8A 3O7WA 4AIRA 1CUUA 1U0HC 1Z36A 5L40A 5A0FA 2C9ZA 4R6WA 4PGAA 3BQNB 4R7GA 3PL5A 2XWSA 3H84A 4G56A 1PZFA 4QM6A 3JQAA 4J4BA 3PNOA 4BLUA 4BYGA 5JE8A 1N3LA 1RYEA 1DWPA 3WI7A 4TS3A 2C7BA 5FAXA 5CYPA 1TZJA 5ARCA 1YGPA 3W5HA 5J1SB 1EXVA 5FF9A 3M2TA 4MVJE 4JLNA 3W6OA 4M7PA 2BE9A 1R0KA 1N9GA 1Q91A 3RTGA 1EFAA 1N1GA 4LBYA 3OCXA 2ZCUA 1AK9A 3DBLB 1R9GA 3RV4A 3FYSA 1VLQA 4CCWA 2XBMA 4ZODA 3IRVA 1XDZA 2VZ0A 4F06A 1PEDA 1US8B 4YALA 1HE8B 1TQDA 2I6XA 2IP4A 2G83A 2BR3A 3KPVA 4R31A 1YVRA 4A2CA 2DP4E 2G5PA 4AS3A 3RU2A 3FPFA 4MLPA 4E1VA 1IEXA 3I3OA 1YZNA 2GGSA 3MWDB 4M99A 4OXIA 3WL4A 4BWGA 3E5RA 3J80A 3K71B 4R2JA 1FX1A 1KJQA 1CUAA 2V4UA 1HG0A 4TWJA 3RKSA 1V8FA 1VKOA 1Q17A 1MVOA 3E4CA 4HWPA 1OBCA 2VUUA 3JD3A 3WA7A 5TMPA 5EZYB 1SELA 1JR4A 4Q19A 1UXGA 2C59A 5DBEX 1RRGA 4C6SA 5AW8A 5FEUA 1DMSA 4QQNA 1XZLA 1GU0A 2X22A 2H65A 4WY5A 4IIUA 3DLIA 1ZKMA 4ZI7B 4YI5A 2J3HA 2WIFA 2PZMA 2YV4A 3EODA 3QV2A 4JB0A 4AJIA 5U4XA 3OT1B 5I9SA 2GR9A 1H1LB 2LKCA 3AL3A 4PS1A 4JQSA 3L8HA 1Q1BA 1E8NA 4YH1A 5EWMB 2UZ4A 3KEOA 1MAHA 1DKNA 4REOA 5JXJA 4D26A 2ZAMA 2ZKIA 3MWYW 4WZZA 1F4VA 1P6UA 4GP7A 4PQRA 4K2AA 1G6KA 4RJJA 4LRSB 4AX4A 3H13A 3GFSA 2DR0A 4KPFC 3DBLA 3P9SA 1ULHA 3CLUC 3LBAA 3OEYA 3L0ZA 5DBGA 3ICEA 1CEEA 4KLZA 4II2A 3OCZA 4Z4HA 1MO6A 4F4HA 3ZLTA 1US8A 4RGBA 3EVZA 3HBJA 4FX5A 2H07A 2QTGA 3DL7A 3G8AA 4GIBA 3KPUA 4HSGA 3V55A 3PXUA 1C41A 3ZH9B 8AT1A 1F38A 1BTOA 1D6MA 1SC6A 2XA9A 1UZAA 3MWDA 4TWAA 2VBGA 4U5QA 4WNAB 3FXAA 3AHGA 3QOXA 5EKUA 1L2TA 2P2YA 1ZVVA 3PUVA 1T5TA 4JXXA 2WHXA 2ZVDA 3L7YA 1Q57A 1Q14A 2W6QA 3OWXA 4KPGA 2JAWA 5EZYA 1C3EA 3SVTA 3VTZA 2CXNA 3JD1A 3FI9A 3JQRA 5FPSA 3K8YA 3VR0A 4F92B 1JILA 1PD1A 2PLFA 4ZI7A 4QUKA 2Q4RA 2LCIA 2CEKA 3HVHA 3HJRA 3OT1A 1OV6A 1H1LA 2EJUA 3VM6A 1G3UA 3I6ZA 2HMVA 4J29A 5EWMA 4YXFA 1T91A 3IBYA 2XCOA 3MQ2A 1VIMA 4RGYA 3CSUA 4P22A 1XCBA 4M46A 3IMCA 5IHPA 2RK3A 5LQCA 2EWMA 1SOWA 1UPCA 4GR5A 1AH2A 1DO2A 3RGWS 4OQNA 3ZS8A 3ZCTA 1TQ4A 4BGVA 2A0KA 2O2IA 4WLFA 2IXAA 4G5XA 4G9EA 3JQ8B 5HG0A 3CR3C 1C7FA 1D6JA 5M3BA 2J32A 1DBRA 1J7JA 4EUEA 4KKXB 2H57A 1QONA 3ROMA 3HHEA 3IB6A 3TZ6A 3UWOA 1RZ3A 1SY7A 1CP2A 1HDXA 1PZMA 1VGRA 2JHPA 2IV2X 3SNHA 2VDJA 5DLEA 3CVVA 3KYIB 5K2MA 1TMYA 4KXVA 3TX6A 3K4PA 4TLAA 4TV9B 1M1XB 5BWMA 3PQEA 1MJGM 2GTHA 1MZPA 5TF0A 5F35A 3A9CA 3CHYA 2FPRA 4C3OB 5ALFA 2HJHA 3SWWA 3QSGA 4RABA 5C8DA 2HMAA 1P73A 4AF7A 2ENWA 4D0NA 3WS7A 3SS7X 4K86A 1YE5A 2PFSA 1WCXA 2R5FA 1SUDA 3GARA 1YCFA 1M34E 3DE4X 3KSZO 4W5QA 2WZDA 4NF2A 3FUXA 1UDRA 1RKQA 1Y80A 1A9XB 3CW2A 4IINA 3MLEA 4YJ2F 1QFSA 3B3QA 1CHDA 3H5LA 3PC2A 3SDSA 4BNYA 1V1MB 1AXRA 4UTVA 2YN2A 3LO8A 2I6FA 3B7WA 3PKZA 4C88A 3G9QA 4EZIA 3I61A 3PD7A 2IVFA 4ZT2A 4TYNA 1NUAA 4EYEA 4UDXX 1PP4A 5CYFA 4BO0A 1QH9A 2CGEA 1DC8A 3EXAA 1Z2EA 3PJDA 4X8LA 4WZBB 1PV4A 3S3TA 2X2OA 4AK9A 3G2OA 3QZUA 4R1TA 1L1QA 2C95A 2TS1A 1F3OA 2XKJE 4CMHA 3YASA 1HX7A 5B3KA 1E9DA 5SZHB 4IIFA 4X7MA 3CRQA 1CF2O 2MSCB 2UVQA 3N8IA 5FUYA 3JQ8A 1OXSC 3DQPA 2IXGA 1RHJA 1R0YA 5JD5A 4B3TB 3UMVA 3RIEA 1QQ6A 3A3PA 3WSTA 3HTXA 1XRRA 3C5WP 3B52X 3LE8A 5TGZA 4LF8B 1CZRA 2EWVA 4HAXA 2YDXA 4PPQA 2VF4X 1AURA 1JQKA 3BL5A 4L8WB 3HJGA 4D4KA 1GTZA 4TV9A 4BEVA 1ABBA 3NO4A 2VHTA 1XD9A 4JBGA 1QF9A 4ZHQB 4W1QA 3MPOA 3U1TA 5AVQA 1TRKA 3GL9A 3IFSA 2H1IA 2XYHA 1G5PA 2VC2B 4AZ3B 2PUAA 3L6OO 1XROA 1DE0A 3QUAA 5T4EA 2XOEA 2OQIA 3LVBA 4JH0A 2J09A 2ORED 3H05A 3KYBA 4EJ0A 2IXFA 2P4SA 3M4YA 3GRKA 1BFDA 3KXKA 4FT4A 1A9XA 4U7WA 4FM9A 2WMDA 4C2TA 4F60A 1PJ2A 4GKVA 3LTNC 3TLYA 1V1MA 3GPBA 2MDTA 2B1IA 2MINB 1XCMA 2XZPA 1GEGA 3JAKB 4QATA 3RSQA 3U7JA 1DEKA 3MMSA 4KQIA 1WM1A 1KHHA 1TZ2A 3DZBA 4QBHA 2Y1GA 1U2GC 1XTRA 4NV1A 3ZDYB 1MEJA 2IYFA 5JFTA 4MJLA 1G9TA 1CRQA 1TU4A 2X7HA 4GM4A 4WZBA 4WX2B 2R6HA 3RAJA 5K8VA 1XLTA 1WA5A 1JLMA 3C7AA 4JY7A 3OD1A 4INAA 3RYFB 2GYVA 4RDCA 2DFNA 1C9JA 1ZD8A 2DPMA 4RCYA 2G36A 1CPYA 4RHCA 4JB3A 1T1JA 2FFHA 2GAOA 2OQRA 2FWNA 1Y5IA 4C0LA 1V11B 1BYIA 1L5HB 5EE3A 2PX8A 1I5RA 3TAHA 1K89A 3BMNB 3EGVA 4FP9A 4ZJUA 3OZAA 3K09A 2B4RO 3PUKA 3DKIA 1PKXA 2FFAA 2N1MA 3K96A 1YQTA 3LBIA 3PHCA 4LYEA 3CVUA 4ZHQA 2D5CA 3WFJA 4PXYA 2R7AA 3UJ9A 1P2TA 2Q5JA 2XMSA 2IELA 3MWLA 4H7EA 4J94A 1FFWA 1I4OA 5E1MA 4AZ3A 4C3ZA 2G72A 3F0TA 2FMXA 2G1KA 5BYJA 5CCXA 1RKUA 1P7VA 2P9JA 2YVAA 4Y1EA 2PD6A 3AIIA 1E79D 5BNIA 1U1EA 3ZHZA 5ALMA 1UIMA 5HJ7A 3A4MA 3AXSA 2MINA 3EH1A 3F1LA 1MC1A 2B69A 3JAKA 4M54A 3UAYA 2C2HA 1U3FA 3FUTA 3KVNA 4S0ZA 1Z4IA 1JSZA 2GRJA 3ZJ5A 4BTVA 2YCLA 3WGYA 3TL3A 2ONZA 1UOOA 1KZYC 1L4MA 3GQBB 1E9RA 1CWUA 3KHUA 4XGNA 1VIVA 4NBRA 2XTAA 4P4SB 3VPDA 2IYYA 4GX2A 4US0R 2O8DA 1EVQA 2C5BA 2IU6A 1YDEA 3EQ6A 3KUKA 2Q2VA 4HRVA 4IDPA 4UCWA 1X1QA 5EESA 4CUZA 4EY7A 3FN4A 4X91A 3N2GB 1POXA 3RYFA 5AQ1A 3M1AA 5C4IA 1ANKA 1YCDA 3R4CA 1MORA 3W3AA 4UAVA 1GDDA 3BK7A 2IU4A 3TD2A 1V11A 1MJGA 1L5HA 4MWZA 4D9FA 4FFMA 4YLGA 1RHKA 3BMNA 5B3AA 2I99A 2VZ8A 1PGPA 4L95C 4DLXA 1OJ7A 2IHTA 4BNHA 4JKIA 1JKFA 4Y2HA 5LZ4A 3EYWA 3NHPA 2WKQA 1HY3A 2ILVA 4JQOA 3O1HB 3NTLA 3I39X 3AP1A 2YJ6A 2HH9A 3MBIA 4D25A 1CY8A 1KEEB 1D4ZA 1KAGA 1CRPA 1O95C 1A1SA 4MP3A 4QTXA 3IE0A 3WNBA 3ELUA 3BXHA 4U6QA 2HTFA 3TIGA 1VBNA 2HSJA 4IILA 3T3MB 3AHFA 3G8CA 3SYTA 2YIVX 3DCYA 3I83A 3T6KA 4Y7DA 2JLCA 2G82A 5KPDA 4N8EA 5LBUA 2Q9AA 2D2FA 4G0QA 4LGCA 4UE6A 1TKCA 2G71A 2XGSA 2ZUVA 1GVHA 3VPSA 4XFDA 1WW3A 1SAYA 2OORA 2Q3DA 4Y9DA 5H16A 2IV7A 4C7MA 3DE1X 4TT8A 4EHKA 3D7RA 3GQBA 3I1FA 4PHGA 3SLRA 3LOUA 2CNKA 2A86A 1U0FA 3O95A 4HMOA 1WF3A 2F1KA 2OV2A 2YVQA 3CUTA 4P4SA 5J2TF 4BNLA 1MC5A 1OXTA 4PHHA 5L3SA 3RVDA 1VPWA 4V1CA 1I6KA 1QK3A 4ZRNA 1WZ2A 1W2HA 3N2GA 1Y98A 4JL6A 3TCKA 4TXJA 1H05A 1SQ5A 3K1YA 5I4KA 2FG6C 2MMCA 5DHSA 4CLEA 3KJGA 1IY8A 3DAYA 3IAM1 4FYHA 4KQ9A 1ZLXA 1AS2A 1MO2A 4YS6A 4DYVA 1XK7A 2QRMA 3EXIB 3L9WA 5JY6A 5AXDA 1A9QA 1TU0A 1K0FA 1LC0A 4OX9B 1N2IA 4YDRA 1J1ZA 3H83A 1GD1O 2XJ9A 3FCYA 3KFLA 5I7AA 2A1UB 3IEUA 4GUAA 3WRYC 1KEEA 4BNUA 1H85A 1PQYA 2VNHA 3A9SA 3V1LA 3U4GA 5KYTA 3CIFA 4ZO8A 1E69A 1E8DA 2WMOB 4UTZA 3I30X 3QEKA 4P81A 2QD5A 4TLMB 4RZ3A 5J2UB 5JS8A 4F4JA 4B32A 2JFOA 5DULA 4B87A 3CY6A 1VL2A 1NV9A 3E3AA 5AW7A 2QDXA 3HXMA 1E1RD 1T29A 2OUIA 1HQCA 2QRKA 2J0UB 2P5TB 5FV4A 2B8WA 1JYEA 3O84A 2EL7A 3ZJ4A 2GWHA 3RVQA 2G67A 5SY4A 5JD4A 4FR2A 5B4UA 3HACA 1JIJA 2FCAA 3MMNA 4GO1A 4MQUA 4RK1A 3RSZA 4DDMA 2GEUA 1OC4A 1E99A 2FOXA 2PSFA 4KREA 3IOMA 1T3TA 2A57A 2JFUA 3FDXA 2GLTA 1HXHA 2OP1A 2P6MA 3RHZA 2WYWA 3T9CA 5FTWA 5D1HA 5DN9A 4YCMA 3OIUA 4QGHA 2OZLB 4I3GA 4NV0A 3VYSB 1ILEA 5HCIA 1UT5A 1MJHA 3H9CA 3W1EA 2O6HA 2KJQA 3HJUA 1NWCA 2GPNA 3QPBA 2RCYA 2W6IA 3EXIA 2Q3CA 2GETA 4NHOA 5D87A 3R7FA 3DP9A 1YR7A 1YF3A 2ORWA 1ADFA 1U5BB 1CJCA 1NBWB 2GSDA 2H2GA 3IO5A 4ZDKA 1L4BA 1WZNA 2XDYA 2OZKA 1L1EA 1OFHA 2A1UA 2AZTA 4J7UA 4ZYZA 4QXPA 5I8ZA 2VK2A 2QB5A 4KAFA 4I6JA 1WCWA 2CXUA 2IXDA 3BE6A 3EEBA 5FWXB 1A2OA 3A9UA 3BJEA 3ZD7A 3BAFA 4H3HB 3AWDA 1EA7A 1S1MA 1T15A 2Z9BA 5G1NA 5JJCA 4F4UA 1SUBA 3Q1LA 1WR8A 1C1YA 1GCGA 3TZLA 5J2UA 1Y9JA 4CLHA 1RAEA 1UH5A 2AD5A 5IKOA 2A5JA 1VXRA 1HPLA 1YNSA 2G0AA 2CVZA 3TVDA 3DFMA 1HT0A 2XY4A 3KBBA 4EO9A 1JE1A 4QBTA 2WK1A 3ABRB 5JSFA 2X4GA 4BFTA 2J0UA 4D5GA 4BP8A 2Q41A 1RKXA 4Z99A 1E2KA 1LRLA 4O4JB 4NH0A 3WYGA 4R98A 3CEJA 4FGUA 5J5AA 3NAZA 2R3SA 4R0NA 2HB6A 2BZGA 4WZBE 2CMHA 1DC6A 2LVBA 5FOTA 3PV0A 3ZWKA 3MCWA 1HK7A 5IM5A 4UVGA 2P2SA 1ADYA 4KR9A 1XNGA 2BBOA 2XYRA 4OBBA 1ONOA 2ZWIA 4R68A 1JXQA 1XVAA 1B8PA 2HPAA 2YUIA 1LQTA 4GLBA 2OZLA 4DG9A 4GL2A 3ZDXB 2OD7A 1YONA 5K0SA 4EA8A 3JZIA 5TGDA 2XVZA 4MV3A 3G2PA 1KK2A 2BC9A 1HDCA 5CRIA 2V3CC 1U5BA 1JLRA 4WK6A 4CMGA 2MYUA 1G18A 3MAAC 4WKCA 2IZ0A 1XX6A 1JBEA 3ST7A 1HETA 5FWXA 2B7BA 3AR9A 4EGQA 3RSSA 3U19A 4Q3CA 4HH0A 2IYXA 1GUFA 1COZA 1KJ9A 2JAPA 3HJHA 3HV0A 1P62B 1BC5A 4COKA 4PGGA 2ZT6A 4KFTA 2AB0A 4LQLA 3NM6B 4LE0A 4QOSA 1VKJA 4YP7A 1II9A 1K27A 2JFPA 2CB0A 1YFLA 3CRW1 4UEOA 5K09A 2GF0A 4WFIA 1E98A 3OECA 5DIZA 1L5MA 3D0RA 1DLJA 3I6MA 4MB2A 1B6TA 1N6PA 1QV9A 1XZGA 2O52A 2RGNC 1Q0QA 1LPMA 5DW0A 3VUEA 5JMTA 5LQUA 4NBSA 2FZEA 2GFQA 3PC6A 4O4JA 2HCFA 1OI4A 1PN3A 4K81B 1IPFA 1GG2A 3EA4A 1F6WA 4NZNA 5DO9A 2Q3HA 2P0EA 2XT6A 4N0PA 4ECEA 4OLJA 2VAMA 3ENKA 4K9QA 1M6EX 2G63A 4KAJA 1IZYA 1X77A 4MH0R 1D0SA 2RAPA 2V54A 4FNMA 4JC0A 3MERA 1NUUA 1U3WA 2YCBA 4C0QC 4PX2A 2D0OB 1PR3A 3O2JA 1LDNA 3CLSC 2WV9A 1JDPA 4QL3A 4DLBA 1KJJA 5CT8A 3PUWA 1BS2A 3QWAA 3D5QA 2HU2A 5FCDA 1EVZA 1L7MA 2AZMA 2MSWA 2LRHA 2WW8A 3STYA 1VOTA 1U3CA 1Z4KA 3CCCA 3I76A 4FZ3A 3LC2O 2VP5A 4AY5A 4DLUA 1KQ3A 1XZKA 5K3EA 3QE3A 4RD2A 1FNMA 1SXIA 1CUIA 3X0DA 1JH9A 1E6UA 1S89A 1Z5VA 4GGOA 1UJBA 4M0DA 5HBRA 1FP2A 1EX6A 4KE7A 4YHHB 1Z26A 2LCQA 2GO1A 1PFVA 2WVGA 4P54A 2IPMA 2BISA 4BMNA 3VZQA 4MRRA 3ASVA 2AN4A 1XDUA 3LBNA 4ID3A 4EKYA 2BFEB 3FAZA 1Z4OA 4B45A 1WSAA 1ZC3A 4WNCA 3Q40A 2R1VB 3QKRB 3RTEA 1MR3F 3Q7EA 4C87A 1DELA 3EDMA 5SYAA 3T7JA 4BCBA 1V4NA 1JHVA 1JDJA 1UBNA 1QH0A 3U4DA 5KYXA 4CKBB 3KZMA 5ADHA 1VMDA 1BVRA 3R41A 8ADHA 2X5NA 1N8SA 4RQAA 1W4BA 3HK2A 1DIHA 3WOVA 4RZUA 3F6CA 3NU1A 4NZZA 1V9SA 5THQA 4IRUB 2NSHA 2C58A 2FR8A 3DDUA 1XALA 1A76A 1KMIY 2C77A 4HAIA 1P31A 2HJWA 2IEDA 1O8CA 1AXGA 2J7PD 1ONBA 2W22A 2QJRA 3EGDB 3I1JA 4FYMA 2ZIAA 5JVDF 3M1YA 4N3GA 4RFSB 4ZDJA 3FOEC 3GDWA 2J6HA 3W5IA 4UJ5A 2BH9A 4GRIA 4CCAA 3PWTA 3VHRA 2B0JA 3OZ7A 1BD4A 3H5TA 4M6WB 2ZW9A 4PFKA 4AS1A 4HDQB 3ZI0A 3OQPA 1FIUA 3W7VA 1MD9A 1T9AA 3D3WB 1CFJA 3Q7IA 5EHIA 2WE8A 4RYDA 4GXRA 3KE9A 1I7DA 2FSIA 1Y63A 1B7GO 1IG3A 2P62A 2PSEA 4MYUA 2VQDA 3C8DA 1FUIA 2O2ZA 3GMSA 2Y67A 4YONB 2BGKA 2A3RA 3GR6A 4QYMA 2BFEA 3HZZA 1OI3A 3FYHA 3PNVA 1EUZA 4DZZA 2IWRA 3QKRA 3LYAA 4JOSA 4BGDA 4WIAA 4Q9HA 5LYYA 3NHKA 3PPWA 4ZXPA 3LV8A 1ZN8A 2P9CA 5F4ZA 2GCEA 3H3XA 1XAGA 3E84A 5C7YA 4CKBA 1Z2AA 1DAFA 3MB8A 3R40A 2AS0A 1CUWA 4RM3A 4UOZA 2C5GA 4NZMA 2PM8A 2PRZA 2ZE5A 4AJNA 3IERA 1ZMTA 4CCSA 4GZ5A 3GEEA 3IGFA 3QH4A 4IX1A 2EDAA 3FPLA 2FJ0A 2D74A 2ZDHA 1V48A 1LTKA 1O5IA 2W0SA 3IR7A 4NBUA 3X1DA 5JDCC 3VR6D 4F2DA 2CEAA 1KYXA 3RRFA 3EGDA 1J00A 4RFSA 1K9SA 1VL1A 4H7KA 1P8AA 4REQB 4Q3LA 3THRA 1PWYE 3A1VA 4NIMA 2UXDB 1EFTA 4M6WA 4ROTA 4LV8B 2VQFB 4TL6A 5EE1A 2FWJA 1VMAA 4OYLA 2FQXA 3U16A 4X3CA 1VQ1A 3D3WA 3DDZX 3HDHA 1C7RA 2PD4A 2FSFA 4IHJF 1PJAA 3HCNA 3W4IA 4C4AA 2IHVA 4KXFB 4Q16A 1SOMA 2Y6UA 4XD2A 3SY8A 3UTDA 3ZK7A 5IVDA 2W0MA 5FBRB 4PNZA 3F78A 2ONKA 3DUWA 4GMXA 3AOGA 1I8TA 1JU4A 2HEGA 4EI7A 1QWSA 2VNAA 2ZJOA 3OLZA 1E7RA 1D9ZA 1UPBA 3OM1A 2V7TA 1Q7BA 1CYDA 4LDRA 5J4VA 3E3NA 1P19A 3FROA 4DDHA 4II7A 5LB4A 2YWBA 4R3NA 4DLTA 3C8ZA 4DGSA 1RQXA 1SM4A 1JS1X 1KZ9A 1GQQA 1ZSNA 4LHEA 4ZQEA 4K9PA 4WOPA 1Q3HA 2JHAA 3BRWA 2QRZA 3IHTA 4N8SA 3U17A 3ORYA 1Y1PA 3V9AA 4GOND 3QU5A 5AR1A 4GOKA 4ARBA 5BO5A 1U3UA 4AJ9A 1GVNB 2HMYB 3DZKA 3TO5A 1P1HA 2Y9MB 4YX9A 5CFQA 3MJDA 2OHVA 4RIGA 4UBMA 2X41A 1MVNA 2QX6A 4JVNA 5FLKA 3V80A 4PPFA 2ZJ4A 2C0PA 4HH1A 2CV1A 1YJXA 3PR3A 4X64B 5KYWB 4KX5A 5ITVA 2IS6A 4DNOA 3WIBA 4ZYYA 1BQ3A 4KITB 1KEZA 3QWHA 2JFBA 1T6XA 1N6LA 1CUGA 2BFNA 2YASA 2V58A 3H2GA 1UKCA 1KI3A 4Q00A 2QAGC 4DUPA 1YNOA 4DCVA 2WF7A 3HZOA 3DTTA 3Q88A 4Z9YA 2H1LA 1L5FA 4B4WA 3LUKA 4K03A 1HDGO 1Z12A 3JQGB 2AW3A 2OXEA 3TSAA 1CVRA 4E08A 3EIUA 3N0RA 2AYXA 4UM5A 3V1TC 1GTRA 5F98A 2GVNA 3WLSA 4G4JA 4BE7B 1TO2E 1ZICA 4ND3A 4RPHA 2HADA 5IFKA 4XPIB 5B7QA 2FH5B 2CT8A 4G3XA 3IE2A 5HF6A 3HEAA 4B80A 3RG2A 1Z0JA 2V97A 1JAIA 3TGPA 3DZFA 4ZYXA 2OCIA 4OL0A 3SQWA 2CXQA 1WXGA 5DHUA 1KE2A 2PD3A 3FHOA 3KETA 3R3SA 4RM2A 1YMVA 4ACBA 5F7OA 4KRFA 1R66A 2E4VA 1H66A 2HBQA 3MD9A 4LHYA 4ZEOA 4RCVA 1E1CB 4BEWA 3R3ZA 1I1OA 3STHA 3H19A 1ECCA 2WTEA 3GFGA 4ZQFA 5K0BA 4BX0A 2H8GA 1HLGA 5K45A 1JHPA 4I5IA 3BIXA 3D6TB 4BMDA 1GPBA 3A4IA 4KAAA 2BV3A 1IZ8A 2BBSA 1PUXA 2ESRA 3LC0A 3WQBA 5U9CA 2YN4A 4HMQA 1VSVA 4A03A 4UXIA 2PA0A 3GEDA 1YCGA 3ER6A 1UBCA 5KYWA 3QJ5A 2O1WA 5ED0A 2FOLA 4K7JA 2V6MA 4L8FA 3GMTA 5CLIA 2FCRA 3LDUA 2G07A 3KJQA 2G77B 2E6KA 4XLTA 5ELMA 4K2HA 4M3NA 2UYHA 1R88A 4NV3A 1USWA 2R2GA 2QQFA 3E8SA 3A11A 4LJ8A 5AW5A 4XASA 4WEQA 3JQGA 1UANA 4RD1A 5CPFA 4CMKA 4H16A 1NYRA 2IF0A 1X87A 2Y05A 1RACA 1UOPA 3R5SA 4ARVA 5EWLB 1PT5A 3PPXA 1OYWA 2PL9A 3T5TA 4YMTA 2E4ZA 2GJ4A 3EAQA 4PFSA 3F7TA 4XPIA 1W0CA 2GPSA 3DBRB 3OJXA 3L4EA 2UYGA 2F1OA 1P5RA 2VOEA 1EHIA 4CCYB 3WGNA 4P33A 3SIXA 1O89A 1PSDA 3QK7A 2W83A 3JVUA 3TB6A 5K0JA 3HB5X 1VHJA 3M6UA 4LZAA 4FMPA 1HDOA 3G6WA 1XSEA 2Z5LA 3F6YA 4ALKA 1MQ8B 1BE1A 2Y1DA 3ABOB 3AHJA 1E1CA 3AYZB 3IDQA 3PGA1 4Y9SA 3TS1A 5KVAA 2C20A 1I24A 4PIPA 3E9RA 1NJ2A 1GFZA 3RC8A 4HO1X 1P4GA 1T5LA 1JR6A 1OJLA 1UEJA 2D8AA 1G42A 2VJMB 3VYUB 2GD2A 1YASA 1E2EA 1DRWA 1ORVA 4B35A 2NX2A 1G21B 2WWXA 1FFXB 1ID1A 1KY3A 2A35A 3H2BA 2PXCA 2ZQZA 2IYAA 4TWZA 1WOMA 4MDEA 1M2GA 1DFHA 5K8TA 1HFEL 2Q4BA 2ZT5A 3AJAA 5B36A 3K5WA 5JAOA 2OQ2A 1IUOA 1JL3A 4LXUA 1AGRA 3BHIA 3AV0B 4Z4IA 2WT4A 3CN9A 2RHLA 3KDAA 3I34X 3D4IA 3KXIA 1X1BA 3A1TA 3AK4A 5BQ5A 4L0CA 4U9IS 1KS9A 5EWLA 3H6HA 1I7LA 2QRJA 3C1TA 4PSKA 4UTOA 1NBEA 3DBRA 3WDKA 4CXMA 2YZGA 3UMMA 1MMFB 2HPHA 5AYVA 2VDMB 2VT7A 3FGOA 4CCYA 5FWNA 2JIZD 4ZCPA 1KSGA 1YQXA 5DTQA 2I8LA 2JIRA 4BV3A 2ZYGA 1VLMA 4OLFA 2PZAA 2EV9A 2QM8A 3CBGA 3RS3A 2CFCA 3WBFA 1NW4A 3TBHA 3AW9A 1CR2A 1R4MB 2O9JA 1H8HD 4K9MA 2QE6A 4H6PA 4MUAA 2G17A 3PLRA 2DRIA 4D4JA 4FOTA 4LXTA 4MVYA 2GPBA 1A88A 3MWGA 5HF5A 1SKQA 5HKBA 4CR6A 5B1YA 1J2RA 3SM9A 1KEVA 5FL7A 4NPCA 4LC1A 1UKVY 1UCFA 1HRKA 1PFUA 2ZRDA 1F14A 2VJMA 3KUDA 3OF5A 1GU1A 2ZEJA 4R4JA 4D42A 4I6GA 3OC0A 4OBXA 1G21A 2DHEA 4RZSA 1FFXA 4KXQA 5CB4B 1PQUA 2P4HX 3INYA 5ALKA 2B8NA 4LFBB 4AZSA 2VTKA 3DLCA 4U2DA 3FLBA 3H65A 1X8XA 2WAYA 4TTAA 2BVNA 2HMSA 3ICPA 4FUQA 1RAAA 3WO1A 3AP3A 4LOAA 3I9OA 4EO4A 2PS3A 1NUPA 1IM8A 1D2HA 2LP4Y 1YAJA 5B1SA 4YPFA 5L7WA 3H86A 1NY5A 4EYOA 2XYPA 4S1OA 3WLLA 4CIWA 3UBTA 1D4AA 4W9NA 5HFJA 5LA6B 1V26A 2CDBA 3BIFA 3I9JA 4LRUA 3N8KA 1NXOA 1PJZA 1RCFA 2P9BA 2QF7A 1Y1SA 4CV3A 4YAGA 3U3OA 4GNRA 5DMXA 2VK8A 4E11A 2WNIA 3TJZA 4EUFA 5HFAA 5KDLA 3U3KA 4CLXA 2YWGA 1PRYA 3KSUA 3OZEA 1R4MA 3ICQB 2NSLA 2HLHA 2ODPA 5TDHA 1WW8A 2FW6A 3R9WA 3BC1A 1FVHA 3PRYA 4N0EA 4DREA 4LTMA 1DADA 2F59A 5FOWA 2WM2A 2HSGA 3CJQA 3ZDRA 5I45A 1NHWA 1RYHA 2DHDA 1DIAA 2F67A 1QF7A 1XDDA 4J0IA 4BDTA 2W2OA 1M6VB 1NBHA 2AQIA 2Z8XA 5CB4A 2OILA 1BROA 3HVJA 4AIIA 1CDEA 1I0ZA 2SKCA 3FWHA 5KOIA 3UJNA 3V1YA 5DASA 1TAHA 2OHXA 1RPAA 1P44A 3KPYA 2J4DA 1KF0A 2QG4A 4KL8S 4XM2A 6ABPA 2ZULA 1JDZA 1TVCA 2R7NA 4IX9A 2J87A 3OHPA 2VNKA 1HZZC 4KQMA 4RTOA 2PZ8A 1TF7A 2D4AA 4FOPA 4EY4A 4ND4A 2QRUA 4HFRA 5KNDH 5LA6A 4NJEB 2O2DA 1LGYA 1XF9A 1G6HA 2I65A 4L15A 4S35A 3EEQA 5FAKA 4X65B 5SICE 4OHZA 2QTRA 3CNEA 4IZIA 2LGJA 4EUKA 1GPH1 1YOVB 2GO7A 2WWIA 3AYXB 4J1SA 4OHUA 4JJAA 2FF5A 4YRCA 3G8BA 4ZZ1A