4WBSA

Crystal structure of an abc transporter related protein from burkholderia phymatum
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
246
Chain Sequence
SSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDAGEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQVGDDGKRLSKDAIASRTEALLDELQISHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPGDIIENESVRRVYLGEHFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an ABC transporter related protein from Burkholderia phymatum
rcsb
source organism Burkholderia phymatum
molecule tags Transport protein
molecule keywords ABC transporter related
total genus 82
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wbsA00
2IYVA 1E9EA 1CIPA 1YZQA 1Q22A 2QBYB 2CHGA 5LD2B 3K9GA 2QMOA 3MUFA 2GA8A 2F9MA 4B6FA 5FL7A 1I4TD 1AJEA 3O8RA 1AIPA 1E2GA 2NMVA 4V0KA 4F7WA 5HR5A 3TW4A 1D8TA 4A2WA 2C8VA 5HE9A 3ZQ6A 1F3OA 1UJ2A 3FGNA 5AUPB 3O8BA 4Q7LA 4EPYA 3ZJYA 1P72A 1T6NA 4RVCA 4CF7A 2IC5A 1KI4A 1XP8A 1CRPA 4M9XA 5FTJA 4D81A 3SE0A 2C78A 4TMVA 4P0TA 2CK3A 4W5HA 5FOWA 4GOXA 1XEFA 3IO3A 2FX3A 3T1QA 1DADA 2O5VA 1ETUA 1Z08A 2R6FA 3AB3A 1XXHB 4XH9B 1ZIPA 1QHNA 5FL3A 3KFVA 2GRJA 1OFUX 3I61A 1OYWA 2ZYTX 3VR1A 3OIYA 1KI1A 4RD6A 2PJZA 4RD1A 3IDQA 3ASZA 1HY3A 5KYKA 4NYMR 2HUPA 3EZ2A 4DLVA 3DKPA 4FMDB 2OO7A 3W34A 1KK3A 2W00A 4MUAA 3ICQB 621PA 3CO5A 2QGNA 2O8CB 1M7GA 2BVNA 5JHHB 2JLRA 5KNCA 1N6LA 4DEYA 1A7JA 4PAOA 3BB3A 3LXRA 5TARA 4M1TA 1OV4A 1SULA 1G64A 3T5DA 4H1UA 3VX4A 2GK6A 5FOTA 3LLMA 3QXCA 3E70C 4Q66C 2VBCA 5JS8A 1KOFA 2FWRA 2WICA 3MD0A 2QT1A 2IYZA 1VG0B 1E2JA 4TL7A 2YV5A 2CBZA 1VPLA 2JCSA 3BXZA 1XFAA 4LCBA 4Q9LA 1Z0IA 3IO5A 2D06A 4LBVA 2ERYA 2ZXUA 1BH2A 1XU4A 3WYAA 4DDWA 1G3RA 1C9KA 2WKQA 4FD2A 1ZM7A 4NBSA 2UZ3A 1NLYA 3FKQA 1W5TA 4AKEA 4QRHA 1KMQA 4PO8A 1U8YA 2OHFA 5JJIA 2QL6A 2CLSA 3SYKA 2JLVA 2RGNC 1E79D 3U7HB 2YYZA 4NYJR 4NYIR 4LGMA 1XTKA 4RCYA 4URUR 4TQAA 1E2MA 4M53A 4L16A 4AYWA 3U3KA 4TLAA 1WB9A 1CJTC 2ASEA 2P0EA 1N6NA 5JZVA 4WA7A 2O52A 4I81A 3VHXA 1T91A 2VP0A 4B33A 4KYIB 1DOAA 2G6BA 1W0KD 1VTKA 1GL6A 4E09A 4B34A 4M2LA 3B1YA 2VF8A 1Z6XA 1PV4A 2AFHE 5AR1A 1G3IA 5HKKA 5KSOA 3REGA 4BEJA 2JASA 2MSDB 1R5NA 1SGWA 3GEEA 2J0UA 2ZAMA 4EQ6A 1DTSA 4U02A 4D2IA 3QPVA 4HLUC 4URXR 5LB4A 2JJ2D 3FB4A 4KLNA 4DSOA 2G88A 3VR2A 2WPDA 1P4SA 2GVZC 3DKVA 4FXPA 1AK2A 2NO0A 1W2HA 1BKDR 3FKSA 1E9DA 2A5JA 3U3MA 3GLIA 3B13B 2BV3A 3U3JA 3T12A 2FOLA 2QN6A 5KUTA 1E96A 421PA 2Q6TA 2GVDC 5JMTA 4BZQA 4KBGA 2PZGA 3A36A 2ZEJA 3AVUA 3LVRE 4DIDA 1KI2A 4RD2A 2DPXA 1JJ7A 4J0QA 1Q1EA 4UXIA 4URVR 1U98A 1DAIA 4JLBA 1D5CA 1UDXA 2WMNB 4JS0A 4F38A 2Q9BA 1S9DA 2X1VA 4C2UA 1BMFA 2FMXA 2O8CA 2BEJA 3EIEA 4XTCS 5JWRA 1UEJA 1T3HA 4M8NE 3CKLA 4JJZA 3U4QA 2JAQA 5HE8A 4HLCA 1II9A 4B2LA 5L3SA 3GJXC 2NPIA 1OHHD 2VRWA 4WZAE 2NO7A 5AUQA 3CZPA 1Z5ZA 3X1WA 4LBWA 4MRPA 5FR2A 3FKSD 2WJYA 1NVXQ 4LJ9A 4DT1A 2H5EA 1X8LA 3B8HA 3QIAA 1YZKA 2DYKA 4U7DA 5FPTA 5DYIA 4AYXA 1K8RA 2J41A 2R65A 4X8HA 1IN8A 2V3CC 2FGJA 2XB4A 4MRRA 1I4DD 2DCUA 3A1VA 2QTHA 3BWDD 1HQYE 4PHTA 1L2TA 3GJ6A 5SZHB 4LBYA 2EFCB 2ZRBA 4K81B 1QG2A 2JJ1D 2ZSEA 3OAAA 4PZZA 4KO8A 1BOFA 1VYUA 2QA5A 1HT1E 1VHTA 4CZ2A 2ZJ2A 2ZJ8A 2KE5A 2RCNA 2XTMA 4Q01A 2Z83A 1XXHA 3UK6A 1GNQA 4F4JA 3TUZC 1FX0B 4IDNA 2QPAA 1IAQA 3RABA 2GHIA 1PJRA 4V0LA 5FPSA 3RC8A 3HYTA 5TDHA 3W5JA 1RPZA 2OBMA 2AR7A 3RAPR 2ZE8A 1TAGA 4RFVA 4D0NA 1CULC 2IS2A 3KJEA 4B2IA 3FMIA 1OFIA 1N0WA 4HLQB 4A0HA 1RJ9B 3WMGA 3UWOA 4DLXA 4HLUA 3V9PA 1D2EA 4DUGD 2ZI3A 3EA5A 2R44A 1B23P 3E1SA 4BPBA 1TL7C 1Z0DA 4FCVA 1RRGA 4OI2A 1TNDA 4Q4JB 3NG1A 3ZH9B 3QBTA 2ORIA 2JJ1A 3OAAD 4C0SA 4D4MA 4DLWA 3QE0A 2P2LA 4BE7B 2L0XA 5SZIA 4JZKA 1F48A 1NIJA 1SXJA 1U99A 2IF2A 1NBME 1XWIA 2ODEA 1XEWY 1FNNA 3THWA 5FUVA 1Q3HA 2UKDA 4LHWA 4YXWD 4UQOA 1AKEA 2Y8EA 3B9PA 3D31A 3GFTA 4B2PA 4IOJA 1E2IA 1W48A 3R7WB 2B7BA 2OCPA 2BC9A 4D4LA 3QI2A 4OQMA 5B2ZA 4M1SA 5FBVB 2P65A 3RSLA 4JL5A 1JR6A 1OB5A 2F43B 2ZANA 1BMFD 3WXMA 4ASUD 1E9AA 5DI9A 4US1R 2QBYA 2JLXA 4AC9A 4C0HA 1Z07A 1IJEA 1R0WA 2I1QA 4R7ZA 1TU4A 2WTUA 1GITA 2YWGA 4LJ6A 3SNHA 3W6OA 3HWSA 4IKEA 2QAGC 1TF2A 4C0KA 5F98A 1SVWA 5JWOA 1XD2A 2J7KA 1UBCA 5FTLA 1I2DA 1C1YA 2BCJQ 2PT7A 1IJFA 3TQFA 2XXAB 3I5YA 3QBVA 3AUXA 3THXA 1EG7A 2R6CA 3U5ZB 3BORA 5AUNB 3CPEA 1JECA 1Z6TA 4U5XA 5JCPA 1E0AA 4CIDA 1OXSC 2F3TA 5H8WA 3L0SA 4B44A 3LBHA 3I72A 5HPYB 1GOTA 2J9RA 1UFQA 2NOAA 1LS1A 2RHDA 2ATVA 2AFIE 4P33A 1AS0A 1QVAA 1KO7A 2ZRLA 5CB8A 2AD5A 5G3ZA 2PX0A 4TTRA 3NBFA 3A6PC 5IDVA 4ASUA 3A1SA 1GILA 4DT1B 2ZU0C 1AM4D 1MABA 1MRNA 1F60A 1ZBDA 1NF3A 3MFYA 4IDHA 2E87A 5DLQC 1J8YF 1G5RA 1KDTA 4KAXA 4ESHA 3QG1A 2DWOA 4F4IA 4G0NA 4LJ8A 3QVUA 1GTVA 5EE1A 1YE8A 2J7PA 3L8YA 4Q19A 2GXSA 5J47A 3ZS9A 3GLGB 1U9IC 4M1YA 3VKHA 1ZU5A 3BS4A 1G4UR 1XBTA 3AH8A 3B7GA 1RE0A 1Z83A 1DAFA 3L0OA 5KPDA 2ZM5A 1XTJA 5GJVC 2EFEB 1CU1A 4KLZA 2O8FA 1FNMA 5EXTA 1WA5A 2OCYC 1BIFA 2GJ8A 5CIWA 4BRWA 3JVUA 4JLDA 5CK4A 4OQFA 2AHOA 1HE8B 1Y63A 2V54A 3QXJA 5TB5A 3SU8A 1NSTA 3BB4A 4EIWA 1W36C 3TKLA 2C03A 1ZCAA 5KSZA 2VL7A 4TLCA 2PBRA 4LV8B 4GL2A 2G3YA 3WBKA 2WM9B 3GLHA 5EP3A 2WBLC 5ANRB 4D6PA 3K0SA 1CR0A 2QP4A 2EWWA 4GRAA 4Q4AA 1JALA 3FOZA 1N5LA 3K09C 5L3VA 4Q4HB 4YQFA 1GNRA 1CJKC 2A78A 2JDID 3HDTA 3HYRA 1COWA 2BJWA 1W0JA 2F43A 4ZI3A 2MMGA 4EFLA 4FIDA 4ITRC 3JVVA 4C0LA 4DLTA 1GNPA 3OFNA 3VFDA 1R2QA 5FPKA 4WXPA 2G77B 2YNMA 5EZ5A 4WZ6A 3QJYA 4C2TA 2B8WA 2F1IA 4JLAA 4X8MA 3HR8A 4TLEA 4JBWA 4BEBA 1NJGA 1N6IA 2AL7A 2GEVA 2BBTA 3IPYA 3K0CC 521PA 1ZINA 3SQWA 3LDAA 3P4YA 3CR7A 2HXSA 4LRWA 1FTNA 2PT5A 1Y3AA 3AKCA 5KSYA 3TK1A 4B73A 2N42A 5AUOB 2QORA 2NG1A 2VHTA 4BFZA 1E6CA 1OE0A 1ZM2A 3IIMA 4QXAA 3CONA 5C4MA 5L3QB 2FH5B 2NO9A 3O8DA 4NYMQ 1DEKA 1Q1BA 4RZ3A 1OIWA 4P4TA 3X1XA 4ZDIA 1QZXA 1KK0A 4LK2A 4Q9IA 1VIAA 1E9RA 2PL3A 1UM8A 3K0AB 4GOJA 5C1BA 2RH5A 2ZR9A 1E2KA 4TYPA 4TSFA 3HU2A 4K8OA 3K70B 2IYTA 3ZD7A 2P6NA 3ZIAD 1KI6B 3DZDA 2FEMA 2ZJ5A 4Q18A 5CYPA 3PUYA 1DS6A 2D62A 3KTAA 3RS0A 3SFZA 4N0DA 1TQDA 1UAAA 3C15C 1NKSA 4MGYR 1E3MA 1US8B 4ZKEA 3GD7A 3L8ZA 4M1WA 1G18A 1KJYA 3VNUA 4N3NA 2GF0A 4ZIRB 1RRFA 3K0EA 3P32A 4QBHA 3CNNA 3CNLA 1G9XA 1EWQA 4Z54A 2BM1A 3LXXA 4W5JA 2O8BA 1AQUA 5EE5B 2FSIA 1FP7A 3CW2A 121PA 3NVAA 2GK7A 2HLDA 2YHSA 4G5SA 4ARZB 3PQCA 3Q85A 1G5TA 4B74A 2ZRPA 4B3CA 4DWJA 1VKJA 1N2CE 3ZZUA 4QGAA 2J0UB 2Q21A 4QBFA 5FOVA 3PFIA 4ACBA 4DLRA 5B57C 2FDCA 4LWZA 4B3DA 1E9BA 5FI0B 4D80A 4BFSA 1DBSA 2GCNA 1ZC4A 4IVPA 4EPTA 4DB4A 1E9SA 1XJCA 2Z43A 5FOSA 3LWNA 2XGJA 2J5XA 4JVSB 5BWMA 2WJGA 2FPKA 4LZZA 1Z0JA 1XEXA 2ZYWX 3P1JA 1IOZA 4HAWA 4JT2A 1EFCA 4MGZR 3NDBB 5LPNA 4Q4AB 2XITA 3H84A 1ZM4A 1QHYA 2ZRMA 2ZSBA 1W47A 2D4HA 4IFBA 4S2EA 3VAAA 2W2XA 2HYDA 5EUQB 1HT2E 2ZJBA 4IOKA 5JHGB 3W9YA 1G8HA 3WHLA 5UKDA 1NMZA 4N0EA 4O2LA 2JJ8A 4TMKA 2UZIR 5DIFA 3W90A 4BLQA 3TAHA 3VR4A 4C9BA 4HYYA 4TLBA 4NHOA 3F5FA 2DFKB 4BGDA 5KU1A 1T3LA 2FEOA 3NBZC 1QHHA 2J0VA 2K5UA 2UVQA 4RCZA 3TUJC 3U7FB 4QJ5A 5EE3A 1NN1A 2C2HA 5FUXA 3RC3A 1J7KA 2QP3A 1VCOA 3D7MA 3IIKA 4QC2A 5CM9C 3ASYA 1G291 2YC4C 2CXXA 1G7SA 1SXJE 1IBRA 2D7CA 3IPXA 4D4JA 1L4YA 1N6HA 3B1VA 3NC1C 2YINC 4A9AA 2EFGA 4Q7KA 5KPJA 2KSQA 3F3YA 3PIRA 2W2VA 5F9HA 8OHMA 1OW3B 4FWIB 4OHVA 3ECCA 2G0TA 5CM8B 5P21A 1TTTA 3K8YA 4XVQA 4WXRA 5DN6D 2LKCA 3THYB 1W4BA 4JIMA 2GCOA 5JFGA 4LHZA 1MR3F 4UXJA 3CRMA 4Q1FA 2YJTD 1ESMA 2OFXA 4PAQA 3RS3A 1KGDA 2D7DA 2JLQA 4V0OA 3FHTA 5TMPA 2OCBA 1O3YA 1JI0A 1AGPA 3KXIA 2KWIA 1Q12A 1C4OA 3P26A 1JB1A 3L0IB 5EP4A 2ONJA 1RJ9A 1XCMA 1EXMA 2FZ4A 4DLUA 1DAEA 1YZUA 4OJKA 1R0ZA 2QAGA 3B85A 2DFLA 2QTFA 2WIBA 3VX3A 2XB2A 2GBLA 2H18A 4ZCLA 1KAOA 1BYIA 1S3GA 1HH4A 2A2ZA 3U44B 4XVRA 1SKYE 2ZREA 4M4SA 4DZZA 1PLKA 1FQJA 5CK5A 1PLJA 2P6UA 2W6ID 2WWWA 4CYMA 4KSBA 3Q9LA 3EZ6A 1QVRA 4OI1A 2X2FA 2CE2X 2CHQA 4GNKA 4NKRA 3EWSA 2LWIA 3KJHA 3UMRA 4HATA 2BEKA 4YONB 1UDWA 2CL6X 3M4YA 5D3QA 1X3SA 4KFTA 2JATA 2V4ZA 3PENA 3BE4A 3AVQA 5JCZA 1P73A 3I3SR 1ZUHA 1OJLA 2A5DA 2BKUA 4YMUA 1TMKA 1UPTA 2QT0A 1KDPA 2ZR7A 3FWYA 5AJZA 4ZIRA 3U7GA 2W2TA 1YR7A 2FV8A 4JLVA 4Q7JB 1P2VA 1D2MA 2OV2A 1PVOA 4B3BA 4GMDA 2WJHA 3LO5A 3VQTA 1MO3A 4G1UC 2F1HA 4XOIA 3GJ3A 1DO0A 1SXJB 2GAAA 2ZPTX 1SVMA 1HYQA 5JWHA 1XCGB 3W3AA 1JXOA 2E9SA 2ZI4A 3LV8A 1JJVA 1S0UA 3KKNA 3FVQA 4DLYA 1TQ4A 2QMEA 2FFAA 2W6IA 2YZ2A 2WWYA 2IBMA 2AK3A 5CLQA 2J59A 3REFA 5HKKD 2BCGY 1ZC3A 4WZBE 5DYGA 4AG5A 4B35A 1LW7A 4CEHA 3CRW1 3FHCB 2IX3A 2QE7D 2ZRNA 1LNZA 1ZUNB 2IWRA 4BFTA 4TZ0A 4IHQA 5G53C 1B0UA 4URWR 1WXQA 2XSZA 2ZTSA 1XD2B 3RRNA 1L7VC 3ND8A 1Z6AA 2R8RA 2REXB 3TUIC 4MRNA 2RHMA 4O3MA 2DFTA 1E2PA 1E2DA 3GLIE 1S9HA 3EXAA 1J70A 4FMDF 2JEOA 1E1QD 2LCFA 3R9IA 4DB2A 2C04A 3EARA 4A6XA 3R8FA 1M74A 4B6EA 4S35A 1CS4C 3OIWA 5DHAA 3KJIA 4PZLA 4HEJA 5FH9A 2CK3D 1VG9B 4H9GA 4A15A 2P5SA 4DRZA 1P2TA 1XRJA 1ZIOA 4QJ4A 1L4UA 2REBA 3ZZ0A 4LJ5A 3UIEA 1OH8A 4RKEA 1D6JA 1G3QA 1LB1B 3F8TA 4IOLA 3H2YA 1DAGA 1I2MA 1G7RA 2BJVA 4KXFB 1D2NA 1XMJA 2H7VA 3E2IA 4XTRA 1XF9A 4ACAA 1YVDA 1SXJD 3B60A 1MT0A 1VCMA 1OLOA 4NCIA 3ZLJA 4A6PA 1Q44A 2HJVA 3AP1A 3D6TB 2PCLA 1JR3E 3CR8A 2YVUA 3CX8A 1JAHA 1CJMA 1ZM9A 4NH0A 1K6MA 1GIAA 3AVYA 4B43A 1SHZA 2YKGA 1CF4A 3C14C 5FTNA 2YOHA 3R9XA 1VG1A 1H8HD 4TTPA 2VYFA 3GLHB 4XJXA 4O2RA 1T8TA 5F3WB 2HJGA 5FBLB 2D2EA 2GETA 1XPOA 1N6RA 2VHQA 1GFIA 5L3QA 4Q4HA 4DJTA 4PSAA 1NSFA 4HAXA 3T1TA 4AYTA 3PJRA 1RIFA 1CBUA 1Q1ZA 5EP1A 2H8KA 3QY0A 3CUEF 4KBFA 4LI0A 5J4YA 1RYHA 3NH6A 4OQLA 3IHWA 5A4JA 1DVRA 1GWNA 4CW7A 4XSGA 1TEXA 3CB4A 4I1VA 2RGGA 5FI1B 4Z1MD 3NHBA 5G40A 4Z1MA 2G9NA 1YR8A 1LVGA 1E2HA 2HT6A 1OXUA 1VYVA 4JVLA 1OFHA 2O8DB 1F2UA 1PZNA 4FCWA 4I1OA 4YMTA 1KY2A 3CPJB 5F9FA 3IQXA 1DAHA 3U6BA 1NMXA 2GCPA 5JI3E 4Q9JA 3AF1A 3A1WA 3F0TA 1ESNA 3QPUA 3W3ZB 4MUBA 1NN0A 5BYKA 4DVGA 3G0HA 3KZ1E 3UMSA 4BFUA 2OFWA 1XXHE 2ZSFA 2VEDA 3NWJA 1Z28A 4KHZA 3EIHA 2FSHA 4EFMA 5BQ5A 3QEOA 2AXNA 2IYXA 2QRNA 4JLOA 3TLXA 3Q5DA 1A4RA 1XCPA 2PZFA 3AP3A 4KVGA 5J4HA 2F55A 1EESA 5J4VA 3X1ZA 5E7IA 2NIPA 2VA8A 5ELXA 5FTKA 1P7CA 1SVSA 1W36B 2XNDD 3EASA 1BS1A 3LA6A 1VYTA 2ZJAA 1W4RA 3B6EA 1Z06A 4CT5A 4E22A 5JJKA 3A58B 1HE1C 3HP1A 1D9ZA 1R8SA 3RLFA 4ZCIA 3U4QB 3W8NA 2B21A 1RYFA 3BERA 1W5SA 2IK8A 3PCRB 3EZ7A 1UBGA 1ZMXA 4IVQA 1Z6YA 3TSOA 4C4PA 2V6JA 3SN6A 2ZUCA 4HI0E 1YRBA 5TY0A 3PUVA 3IHLA 3GEIA 3LQQA 1P60A 2C5LA 3OIVA 1OKKD 4I99A 5DI3B 3LFUA 2QM8A 2DWQA 1AQYA 3CBQA 3SBDA 2EQBA 1QBKC 2RGBA 3NIBA 4QBIA 1E0SA 4DDUA 2X77A 1JR3A 1X1SA 3UWKA 1JBKA 4Q47A 3QOFA 2IUTA 3ICEA 4JVNA 3ADCA 1OT3A 1E94E 3NDPA 3RWMB 3G5UA 5C4GB 2ZSDA 1ZU4A 3MSXA 1NG9A 2WWIA 4L15A 4L5BA 1H8HA 2ANBA 2CCJA 3SHFA 3PUXA 4OHWA 2HV8A 2YOFA 4TMWA 2HCBA 4PPNA 3SS8A 3SHWA 4NDZA 2GDJA 2OT3B 1UKYA 4GZMA 1NBMD 4HZUB 3ZS8A 1ODFA 2QQEA 1NP6A 2BMJA 1T4GA 2C98A 1QHIA 4TMXA 1FFHA 2WVJA 2BHRA 3B1ZA 4X8LA 1P61B 1TPZA 2Z5FA 4PO9A 4K46A 1NJFA 2NO1A 3HU3A 2ZYUX 1G8PA 4MYTA 5F2EA 2XZPA 4GPTA 3EW9A 3ZVMA 4TT3D 2B92A 1OIVA 2MSCB 2YWFA 3G82C 3FMFA 3R9WA 1E99A 3SQXA 4NONA 3CF2A 2AKYA 3WBJA 2MMCA 4PQYA 3PEWA 1IONA 1ZCBA 2I3BA 1F2UB 2CE7A 5TV2A 4PTLA 4D4KA 1S8FA 1SVLA 2QRZA 3A4LA 1FUUA 1YRAA 3KKPA 4IW3B 3RRZA 3S1AB 1E2NA 3TR0A 5J4LA 4LOAA 3UG7A 1VCIA 2ZU6A 3LD9A 4A0RA 2GZHA 3EG5A 3C8UA 3CX6A 2VP2A 2XTNA 2IYSA 4W7SA 2ODWA 2QNRA 4A4DA 5A0FA 1WBBA 4UJ3A 1HTWA 4P4SB 1NRJB 3VR6A 1J8MF 1ZNZA 4YDSA 2VHCA 4DCUA 4DCSA 2ZRIA 3THWB 1GZSA 1YZTA 3HR7A 3OF5A 4YMWA 2FPMA 1OSNA 1U94A 4BLRA 4F92B 5KTYA 2ZRFA 3LNCA 4MKHA 2R6DA 4OQNA 5JSZB 3M6AA 1CLUA 1KO5A 2JLUA 1II0A 3ZVNA 1RW4A 1XNJA 2HLDD 2FFBA 3EA0A 1U8AA 2N46A 1MO5A 3UATA 1TU3A 3QKTA 2XSZD 2Q3MA 4Q48A 4RD3A 5FTMA 3RVBA 3VKWA 1NLZA 2A3RA 3KKQA 4TMZA 2OAP1 3ETLA 4B3XA 1YZNA 4PSKA 1S4QA 2PH1A 3EPLA 1R8QA 2VPPA 4Q00A 1E9CA 5GJCA 1Q57A 3X1DA 2RGAA 3BBPA 4EDHA 3B1WA 2KI5A 3K0CA 5DH9A 2HXYA 2P5TB 1U0LA 4UNSA 1JR3D 1XTSA 4G5QA 3FHOA 1EX6A 2J7PD 1N5KA 2V6IA 1KDRA 2QAJA 1Z0AA 2OESA 4IRUB 5KNBA 4QL3A 1AS2A 3QKSA 3QXXA 3WNCA 1R6BX 1Z63A 4A92A 1XMSA 1J99A 3TSWA 1EWRA 2PLFA 3WMFA 1W4CA 3U44A 4FW9A 3FFAA 3TRFA 3T5GA 2ZJZA 4M1OA 1MO6A 4MKIA 1XTQA 5FUYA 2QI9C 4E03A 5LDDC 4I4LA 4BLSA 1MOZA 1N0UA 5DI3A 1F6BA 3GJ7A 5CJ2A 4EPVA 1E32A 1XJ0A 4QM7A 4CEJB 4OQXA 3CRRA 2FU5C 1M8PA 3EX7C 5IRCD 1FQKA 4Y0AA 5BXQC 3QEJA 2AN9A 2QGZA 4C0JA 4GOKA 2Z4SA 1W1WA 3BAFA 3KKMA 2ZI9A 3SJZA 1E2LA 1DG3A 1ZNYA 1P3JA 4XD7A 3NTUA 2IXEA 2OEPA 4Q4LA 4CEIA 3QSYA 4QM6A 3C16C 3KUCA 3L2OB 4MRSA 3RRMA 3LVQE 4DDVA 3HU1A 3GLIB 1GG2A 4HSEA 4KFRA 1J2JA 2HYIC 1Q21A 3MMPA 4KYUA 4LY6A 4V0MA 4KSCA 1KSHA 4Q1BA 1WQ1R 2OXCA 4XVUA 1NIPA 2JLZA 4MYHA 3DOFA 4YLGA 2IA5A 1YR9A 2ZJOA 1CP2A 2ODBA 2EYUA 1NG1A 1KI9A 4A0FA 4BRUA 1CTQA 4ABYA 5H1YA 4C30A 1RRPA 1IXZA 4QNRA 3T1OA 1NL3A 5E3HA 1KIMA 2NZ8A 2ZVQX 4LDJA 2OLJA 2C9OA 4HUQA 5K8IA 3OIUA 1KO4A 2E1RA 2ZRAA 4NPHA 5JS7A 1GKUB 2ZQ5A 2QMUA 4BQSA 3HPRA 1EK0A 3OE7A 3THOA 2H92A 3MLEA 3IBYA 3KXLA 2J87A 1G6HA 3S1AA 4OYHA 4RD0A 4LYFA 4DHEA 2X8AA 2ZS8A 4JBYA 4P3YA 2O8BB 1R5BA 1TUIA 5M04A 1DPFA 4P32A 1GDDA 4DXAA 2FGKA 2V1XA 3FYHA 2YWEA 2RGEA 4X8OA 1YZGA 3CH5A 4EPWA 3SFVA 1IXSB 1LS6A 2A5YB 3C7KA 4LV6A 2WWFA 4LJAA 4DDTA 4Q9HA 2IHYA 4JL6A 2IYQA 2IYWA 3MWJA 1KMHA 2X2EA 3UMFA 2P6RA 1M2OB 3AKEA 4O0MA 1XTRA 1AGRA 4G01B 3R7WA 1ZRHA 2WOJA 2A30A 2FSFA 5FFMA 3UKDA 3W8RA 4E07A 3AF0A 2QMHA 3I4LA 2P67A 2ZI5A 2CLDX 3PEVA 3Q7QA 1G20E 4KODA 2QPTA 5EE9A 1CEEA 1E9FA 4U00A 2GBLC 3RS4A 5JEEA 2QUZA 5JECA 3SJAA 4C0AC 1TUEA 1UBFA 2FNAA 1U0JA 3ADKA 2VHUA 3AP2A 3NBXX 4II7A 4NZYA 5J4KA 2PJRA 3LRPA 2QZ4A 4Q1DA 2CL0X 2OUKA 2ZI7A 3THXB 3DPUA 1E0KA 4G5OA 1F2TB 3BD9A 1KHTA 1H65A 2BOVA 4FN5A 3ZGXA 3KTAB 3P20A 5JEDA 2IEZA 4DCVA 1IY1A 1SVIA 1KI3A 1TQ2A 2XOKD 4WBSA 4JJKA 1US8A 2YOGA 2A9KA 3U2QA 2C9CA 2GESA 2QQ0A 1MO4A 5GJWC 3FFBA 1AN0A 3Q5EA 2D2FA 2J45A 1N6KA 1TEVA 1G6OA 3MG9A 2W0SA 4NMMA 2XJ4A 5LD2C 3CNOA 3A1TA 5IF9A 2X19A 3BFVA 2ODNA 3OZXA 1G8GA 3EPKA 4URZR 4AKIA 4R2HA 4JKIA 1GVNB 4ILEA 5FOUA 5KSPA 3SJBA 2QSYA 3FDIA 2JLWA 1GL7A 1DELA 3TBKA 3NHAA 1H8EA 2G1KA 4TN1A 4M1MA 2WZQA 3IQWA 4C0QC 4Q1CA 4MGIR 2BDTA 4HUQB 5B64A 5L3RA 1UKZA 1IN6A 1RC8A 4A8JB 4PAMA 3AKDA 4IDOA 1DO2A 1ZNWA 4A1FA 4EPXA 3U61B 4LUCA 1VMAA 1E1RD 2ZS9A 4CRWB 3KQUA 1WRBA 2ZE5A 3RYTC 1T3SA 1ZM3A 5EJEA 3VHLB 1OYYA 2GWHA 4XWAA 3GMTA 4AK9A 3MWYW 4HAZA 1NI3A 4YMVA 3K70C 1F5NA 4LYHA 2XX3A 4PO1A 4AURA 3Q8XB 4CDGA 5K8UA 1Z2AA 1DAKA 2F1JA 3RANA 2ECKA 3X1YA 3TAUA 5CB6A 4IXNA 3WNDA 2BBWA 4DLSA 1JEDA 3IUYA 2CNWA 4M9QA 3H86A 4IFEA 4R9UC 2BM0A 4QHYA 3IEUA 2PEZA 4E5UA 4KVAA 1JNYA 1K5GA 2ZYVX 4UNPA 3SR0A 4ZPXA 4KITB 1UEIA 1SHKA 1Z47A 1E98A 3AF2A 5FUWA 3L0PA 2O8FB 2EW1A 1H8ED 3GFOA 2QU8A 3QG5A 2QE7A 1VHLA 2JIZD 2JIZA 2WSSA 3P4XA 2NPFA 4HDCA 5C46F 3BFXA 3W6NA 5AJWA 4V03A 5EUMA 3DMDA 5SZJA 2XXAA 5FR1A 221PA 4C7OA 1AS3A 3EZFA 1Z6GA 1SKYB 4AIIA 3BK7A 3B9QA 3QQ5A 3BGWA 2Q3HA 4LJ7A 2ZAOA 4JKYA 4C0BA 1E1RA 2ZRGA 3TW8B 2FFHA 3BJIC 3OEED 3QF7A 4HUTA 2F7SA 4NTZA 1R10A 1NN5A 5TXGA 2BBOA 2NZJA 3I92A 1ZD8A 5AJVB 4GP7A 5EXPA 5FPHA 4BFVA 5C2JB 1M7HA 3VU9A 4YDHB 1E2EA 4Q03A 2VSXA 4D0GA 1II8A 1QDEA 1R0YA 5C18A 1JXMA 1GKIA 5DN6A 3BRWD 4L9WA 3U60B 1E2QA 3RDPA 1WBDA 2DHRA 1R0XA 3C5HA 1KSGA 3RRYA 2ZR0A 3CM0A 3WRYC 4XIGS 1DAMA 3KXKA 3T1VA 2WWHA 1P2UA 1TADA 3SBEA 2CCKA 3LY5A 3DMNA 2G1JA 4D0LB 3GJ0A 3HJNA 4OL0A 3MJRA 1ELOA 1IHUA 5FOXA 2OSBA 5E7MA 1OIXA 4ZKDA 5LB2A 2IYLD 3TMKA 4A2PA 1XEWX 4FMCB 5JJLA 2ORVA 5EZ6B 3QENA 2IUUA 3ZZTA 1JEEA 1OB2A 1YKSA 2OLKA 4NU0A 1JPJA 2R6GA 3FMOB 2WJVA 4CEJA 4Q9KA 2H16A 1P9RA 4BWYA 1UKEA 5L8VA 3I8SA 5AJYA 4OK3A 4MDFA 3B1XA 4LJYA 4MRVA 3CWZA 2BKEA 2KJQA 2J3EA 2NO6A 4OK6A 3RNLA 4DC9A 2WMOB 2Z4RA 2J0SA 1YHNA 1IY0A 2RAPA 1NBMA 4FINA 4DBLC 1W36D 4EJSC 1E2FA 1O87A 4B71A 2MSEB 4GP6A 5BW8A 3KKOA 4F93B 5DISB 2HDNB 5D3MB 3BOSA 2OCAA 4M9ZA 1XEXB 2DB3A 4OI4A 4WVFA 1HV8A 5EXXA 1LV7A 4EQ6B 3SC3A 4CGZA 2V7QD 1HQCA 2CEAA 3GPLA 1KKMA 2VQSA 1TQ6A 2WOOA 4BASA 3VU9B 3T06B 2NTYC 1SZPA 1NKTA 4GSYA 3TH5A 2RGXA 4B3GA 2D74A 4Q1AA 3TE6A 1CXZA 3UXMA 4LYAA 5B30A 5KO2A 1GL9B 2KBEA 3TQCA 3WP1B 1OKKA 4KI0A 4AG6A 2V1UA 2XJ9A 1RKBA 3GEHA 3CF6R 3DOEA 1NVVR 4EPRA 1LY1A 1WMSA 1FPMA 3PEUA 2FA9A 1ZAKA 3I32A 3ADDA 3QKSB 2HF8A 2BIFA 1NMYA 4V0NA 5BYJA 4QGGA 1MRSA 2ZROA 4UNRA 5HZHA 2RGCA 1V43A 2ZRDA 2VH5R 1QG4A 1W4AA 5JSZA 4ZDWA 3K0FA 3FPAA 1UF9A 2B8TA 5KOYA 3LQRA 3WYGA 3VMFA 2GJAA 3LX8A 1KJWA 2AX4A 2FE4A 4MYUA 1IXRC 2OXRA 3DDCA 2HF9A 4W5WA 1UADA 2PMKA 3GLHE 1GAJA 2V7QA 3LBIA 4LYJA 4A2QA 5L3SB 3RHFA 3UPUA 4B3FX 4I1SA 2GJKA 4B75A 5FBWB 3WNBA 2GXUA 3EC2A 1G8FA 2OBLA 4JLKA 4AKHA 4C7OB 2O0HA 2JA1A 3ZIAA 2ONKA 4XWKA 5DE3A 4IOMA 4P4UA 3EIQA 3DEFA 4US2R 1KI6A 2FJUA 2KBFA 2QM7A 3NBYC 1ZUIA 3QVVA 1KJZA 5FBQB 4V02A 1IN5A 2WWXA 4US0R 1Z0FA 2BMFA 1SVOA 3V00A 5B58C 4OK5A 4RZXA 4UJ5A 4BFWA 4D25A 4M22A 4M0LA 1CJVC 2G0NA 2IL1A 4NCKA 3WYFA 2FF7A 2GAOA 3VR3A 2ZRKA 2XTZA 3VKGA 3IGFA 3SYLA 4I1UA 3AV0B 4DCTA 3ZVRA 1II8B 3ZVLA 1AKYA 2ZITA 2IXGA 1ZD1A 2V55B 3KL4A 2CMKA 1FW6A 1G7CA 1FMJA 1N6OA 2ZE7A 5AWFC 3N70A 3PXGA 3B5JA 4M9SA 5IT5A 4Z8YA 5KNDA 1A1VA 1W0KA 4QGFA 3KQHA 1FX0A 3H4MA 4LC0A 4Q21A 4QGHA 3RSOA 3CRVA 4QHTA 3TIFA 2VF7A 3LBNA 4TMTA 3K9HA 1G1MA 2OG2A 3H1TA 5CDFE 4KFUA 3W6PA 1KDOA 2EVWX 1VIYA 4PPFA 4CEIB 4DCNA 1GRQA 2BMDA 4GFDA 1FMLA 1IN4A 1RFLA 2CVHA 4PC3A 4XD7D 3DZ8A 1FOEB 5J5CA 1S1MA 1KYIA 4R71A 5IHPA 3FTQA 3LW8A 3GLFE 1E69A 2IEYA 3UANA 1M7BA 3AVOA 2QPOA 3TSZA 2VP5A 2GEDA 4JYCA 3KDSE 2WAYA 1PLLA 4Q4JA 2I1VB 5HZKA 3MWKA 3GJ5A 3AGQA 1XDBA 1ZP6A 3BH0A 4DKXA 4PSVA 2HT1A 3WP0A 4B48A 2OBNA 2V9PA 4BZXA 1I4LD 1FP6A 1EFRD 1VECA 2YWHA 3KB2A 3I73A 4AD8A 2JDIA 2CVFA 3CX7A 4IDQA 4F91B 1XZQA 1T9HA 1A5TA 1XPRA 4C3ZA 1YJ5A 2FN4A 2ANCA 1ONBA 2ZE6A 3FE2A 3LAWA 4HB0A 5H68A 4DEXA 5H70A 4GI7A 2GXQA 3RS2A 2RGNA 2Z0MA 2GNOA 5DGXA 1U0HC 2G83A 4MYCA 3ZD6A 2IYRA 2KB0A 2GEUA 1V5WA 3AVXA 1RZ3A 3O8CA 1G16A 3EWAA 1YZLA 2H17A 4W9MC 3EC1A 1JQLB 2XOKA 1KZGB 1FZQA 4PQRA 5KHOC 2GXAA 1MH1A 2GCOB 5BN4A 3WHKA 1W44A 1KMHB 4H1VA 4LBZA 4NP6A 2ZSAA 1P62B 1Z8FA 1N25A 4EUNA 4ZDJA 4BLPA 2CJWB 1W46A 2FSGA 2ZUBA 3DHWC 3QKUA 4TL6A 2PEYA 3BH6A 3QXHA 2F1RA 1GRRA 1KY3A 1DE0A 2GF9A 4QBGB 5DO9A 1BYUA 1QHSA 1A2KC 2A5GA 4YC7A 2XZOA 3GQBA 3PG5A 3RWOA 4EJSA 2WHXA 2XEXA 3KJGA 4AKGA 2H1LA 4RY2A 3JZMA 1LTQA 2JLSA 4QJ3A 4HZUA 3SJCA 5AJXA 3L43A 4PHHA 2IYUA 4WIAA 4B47A 3FMPB 5DHFA 3EZ9A 1E4VA 2R62A 4ERNA 2VO1A 2AWNA 2CLCX 4P4SA 2GJ9A 3KUDA 2WAXA 1CR4A 1PUIA 5CITA 3QNUA 4A0GA 1ZJ6A 3BC1A 4QKQA 1DARA 1P75A 4PFSA 4BLTA 1KZ7B 3E5HA 1NN3A 4TQ9A 4Z8XA 1CJUC 3RS5A 1Q20A 2A7QA 3QKRA 2R2AA 5FBRB 5DNYB 3NEJA 4L4UA 3U3OA 1IN7A 3ZDQA 1KK1A 3K0FB 2PLRA 3LLUA 5G41A 3A8TA 3Q3JB 1CR1A 1CRQA 1XZPA 4TYQA 5GJBA 2GJSA 1T5IA 1NY5A 3QUSA 1OHHA 2J46A 3GLFA 1OXVA 2AK2A 2AKAB 1NVVQ 1X1RA 1VG8A 1M34E 2OAQ1 2VP9A 4LPSA 4B76A 1G41A 5KDDA 1XTIA 1MV5A 3P27A 1S1CA 1N3BA 2REOA 1KTVA 1ZW6A 2O8EA 3OEHD 2XNSA 3AVPA 3AM1A 4LV5B 4PC1A 4TYNA 1X6VA 3BIFA 4L8GA 1IY2A 4AWXA 4A36A 4N1AA 4GBMA 5AK0A 1L8QA 3PVSA 2EFDB 2RGDA 1ANKA 1M6NA 3MCAA 3KB1A 4NE2A 3D8BA 4RZ2A 4MKGA 5CYOA 1IQPA 5CDFA 1X86B 3QPWA 2IUSA 3QXSA 1GRNA 4A8JA 4IEIA 1WP9A 3LH5A 4MH0R 1N0VC 5SZKB 3GLGE 1GSIA 3K1JA 2ZUDA 4BFYA 2DFNA 2C9YA 1WDTA 2I4IA 3K0AA 4JLPA 4TL9A 3KQLA 1SKQA 3I5XA 1SQ5A 4M1KA 4AY2A 4Q1EA 4PX9A 4ARZA 2FG5A 4MITA 2B6HA 2QEQA 3QF4B 2VIIA 1S2MA 4JL8A 4LHVA 1AZSC 1OH5A 1NNEA 1ZD9A 1HA3A 1LFDB 1NY6A 1S96A 1XD9A 4FMCF 2PZEA 4P31A 4JLMA 4JSYA 3CZQA 2FFQA 3M0EA 2W6JA 4ZCMA 4ZO4A 2IYYA 3PEYA 1N6PA 3D3QA 1KNXA 1E4YA 1RRCA 2BMEA 1XX6A 2C77A 4QOSA 3T34A 5BN5A 5GVRA 4ZV4A 4QFMA 1ZYUA 2OM2A 1EX7A 4JBXA 4ZDKA 5HTKA 1QHXA 3DVLA 3AVTA 4QG7A 2HCJB 4DSTA 2VP4A 3PV0A 1N5IA 1ZVQA 4RFSB 3BH7A 4TZ6A 1U90A 2O8DA 1FTSA 1EFRA 1U81A 1AA9A 3WY9A 3NH9A 3J81k 1MKYA 3CIOA 3BB1A 3K9NA 2O0KA 2QTVB 5EQTA 4XWOA 2OFOA 4LHYA 1RVDA 2VP6A 2VSOA 1Z0KA 4DIEA 3DO6A 4RJLA 3WRXC 3DL0A 4DLZA 1DG1G 1KI8A 2CHVA 4HDQB 5K8LA 3KQNA 4R98A 4UNNA 2Q9AA 1VDZA 2VLIA 4BECA 4EKDA 1W2GA 3K09A 5EP2A 4D82A 2C96A 3M1IA 2ZS7A 1GP2A 1OF1A 4JMPA 2R6AA 1NLFA 5JLJA 2BBSA 2WPDD 3PUWA 3PUZA 3RS7A 1KI7A 4G3XA 3AKYA 1TX4B 1PUJA 2QSZA 4GT1A 2EYQA 2WV9A 3VR5A 1OH6A 2CCGA 2D3WA 1Z22A 4KV9A 1E1QA 821PA 1S3SA 4YXWA 3OHMA 3X2SA 4FWTA 3WMEA 1HUQA 2W0MA 3VTKA 1WF3A 4Q02A 3U3RA 2VHJA 3T35A 2VSFA 3TVTA 3ADBA 1WCV1 2P3SA 4KCGA 3CPHA 1X8JA 2B7CA 4POAA 2DR3A 1GUAA 2ZRCA 4NL4H 4KJZA 3NEYA 1G3MA 1FL9A 4WAUA 2OE2A 4TWZA 2DBYA 2Q3FA 1GKYA 1P5ZB 1U9IA 4PANA 1MABB 4MKFA 1E79A 2IS6A 1VCNA 2ERXA 2CL7X 1JQJC 3AVWA 1FUKA 3LX5A 1XJQA 3MGCA 5KDLA 3LW7A 4OHZA 4DSUA 6Q21A 3SDZA 4D26A 4HZIA 4BLOA 2JLYA 3EPHA 4IJMA 4B32A 1XPUA 3JZAA 4JLJA 3B2EA 2ZETA 2V8OA 1KNQA 2GILA 4CVNA 3AEZA 3B78A 3QF4A 4IVRA 2WKPA 3V4FA 4Q5IA 1OXXK 2ORWA 2N1BA 5D3MA 3IIJA 4TTQA 3OE7D 2ATXA 1QHHB 1CKEA 4EFNA 2O0JA 1Q3TA 1OXTA 3AUYA 1R5OA 4TYYA 3ZQJA 4Y0VA 1Q1QA 4PXAA 5HCNA 4OHXA 1EGAA 4PZYA 2Z6VA 3B82A 1U8ZA 3C4JA 2GZAA 2JGNA 2ZVPX 1T8UA 1G8YA 1JAIA 3C5CA 1OPXA 4L9SA 4TL8A 3AF3A 4UNQA 1M1YE 1ZNXA 4R2IA 1P9NA 4YMSA 4LX0A 2J1LA 1NVWQ 2F9LA 1JPNA 4XSHA 3THYA 1EFHA 4RFSA 1U2RA 1Z2CA 2IXFA 2TMKA 1XMIA 2ZIAA 2C95A 3GFPA 1KK2A 4NCHA 2ZRHA 4PPGA 4RZUA 2PMDA 4PQFA 2QG6A 3L82B 3PITA 4NCNA 5EE0A 4GMXA 3NKVA 4LSGA 2QAGB 4CEHB 4LHXA 4URYR 2W58A 4TYWA 1W0JD 1SXJC 1LF5A 4TQUS 4RSGA 2WJIA 2HEIA 3N2EA 4HB4A 4A8JC 4PC2A 3CH4B 3AGPA 2IW3A 2H57A 2W83A 4GZLA 5JRJA 2CDNA 4V0ME 3SEAA 5DSZA 2WWGA 3OEEA 2PCJA 1T5LA 5G3YA 1A2BA 2VTKA 3K70D 2J0QA 1HURA 3I8XA 2XNDA 1T0JB 1WE2A 3GP8A 3O47A 4EAQA 1K5DA 4JYBA 1D9XA 3NXSA 5E95A 4G5RA 1UBEA 2WKRA 2AD1A 2WJJA 5GADl 3SOPA 4ZI2A 1IM2A 3I1FA 3C41J 1OH7A 2R9VA 2ZI6A 3U6KA 4G5GA 4JT4A 2DWPA 2RMKA 4MA4A 2WSSD 4KFSA 4PC7A 3TVDA 5HCIA 3K53A 3A4MA 2WSMA 1KAGA 2C99A 1TF5A 3T15A 4Z51A 5K8TA 1W7AA 1BO6A 4OJQA 2WIAA 3K9LA 5JI2E 1KO8A 4OHYA 3UG6A 4MDEA 2XAUA 4ON9A 2IF0A 1R4AA 3SI7A 1NVUQ 3AF4A 4PC6A 3IEVA 1Z3IX 3GJ4A 1YQTA 4FI3C 4UXHA 4QNMA 3TNFA 1G19A 5E7JA 5BN3A 1XB2A 2IS1A 3CRQA 1A82A 2QENA 3ZYCA 3T61A 4BZPA 4TLDA 2F3RA 4ESVA 3H0KA 5CLLA 4DUGA 4NYIQ 4NYJQ 5JRZA 1G21E 4GDFA 3I62A 3BFKA 2FZLA 3IKJA 4HLDA 3MRSA 3KFXA 4RD4A 3A4NA 4PHFA 5FL7D 1Z29A 1KSFX 4BUJA 1R7RA 5CJPA 3MAAC 3MJHA 1P6XA 1X8KA 2A5FA 2ZJYA 5J40A 2FPLA 1G5PA 5FPYA 1HEIA 4TT3A 1G7TA 1KSJA 2AXPA 2NGRA 2OILA 3DM5A 3AVVA 3VNVA 2GKSA 4UKDA 3GJ8A 4LC1A 2CNWD 3IBGA 3ND9A 5CIQA 2GZDA 4FMBB 2QROA 2XZLA 3GCGA 2NQ2C 1W49A 1E0JA 1EFUA 3OESA 4A82A 1SVKA 3CF0A 5JBQA 4HB2A 3SZRA 3U7EB 2EWVA 3AQ4A 4MGKR 3TR5A 4HAVA 3EPJA 3A37A 4MQBA 4OBEA 1TF7A 1YR6A 1EFTA 1G4AE 4IXMA 4JVMA 4HB3A 4KU4A 2LKDA 3ONWA 4F4CA 5IK2D 3Q7PA 5E4FA 2GTPA 4HAYA 3GLFB 2F6RA 3Q72A 4IDPA 2ZRJA 1J90A 2RKOA 2OZEA 3PR1A 4LJ4A 1AZTA 2DY1A 4BFXA 1OFTA 1UKVY 4AI6A 3KX2A 1GM5A 3TJZA 5KDOA 3CLVA 4CT4B 3KQKA 1G17A 2CJWA 1KKLA 3R8CA 2PX3A 4PPQA 5GVSA 1P2SA 2QY9A 2W6JD 3IILA 3A1UA 2JJ2A 2IHBA 1KO1A 4IEEA 4EJSB 2AWOA 4JLNA 4DSNA 2SHKA 4HDOB 3SYNA 1T0HB 3MWLA 4PHGA 4QHSA 4LPKA 3DM9B 4Q7MB 1QF9A 5A5GA 3TGPA 1QRAA 4NCJA 721PA 2O8EB 3OEHA 3HPQA 3V4RA 3N2IA 4WOPA 1XD8A 2Q0HA 4TSFD 2IWHA 3W5IA 4OI0A 2IS4A 1YU9A 2QP9X 5IK2A 3N5CA 1LF0A 1F2TA 3OFND 5LBIA 1XMVA 4M21A 4PR0A 2BWJA 2EFHB 4OKSA 4HAUA 1QHGA 4FCTA 2Q9CA 1N5JA 1Q0UA 5EXSA 3EAQA 2EU8A 4O25A 1COWD 2YC2C 4WW0A 3CWQA 3NC0C 3QKRB 5TVKA 3R20A 2RB4A 1CR2A 4JSTA 3GLGA 1G3UA 1P9WA 4RKFA 2IT1A
chains in the Genus database with same CATH superfamily
5K0CA 4H1HA 4UEQA 5M34A 3CLUC 3MQFA 1YZQA 4LRTB 1RQGA 5DX8A 1WXEA 1U5AA 1Q22A 2Z95A 4BBAA 4CR8A 1NZJA 1RXCA 1SVNA 2XMZA 3K9GA 5T41A 4YRLA 5BSRA 3OPXA 2H4FA 4DLBA 2V7WA 1XDSA 2NMVA 1VHQA 3ILVA 5BSHA 1XQ6A 3EVZA 5BQPA 4AN1A 1ZN2A 3GLQA 5LKRA 2C8VA 3KD3A 5HE9A 1HQDA 4FUQA 1X9HA 1SZDA 1Z0ZA 3O8BA 4K9OA 4V24A 1LGYA 3QMVA 4O4JA 1DBVO 5CRIA 1B1CA 4Q4DA 1ZK2A 4RVCA 4CF7A 1I4OA 2IC5A 1T9DA 4FOOA 4IIBA 4MUFA 4M9CA 3M6XA 4EMUA 1SUSA 4UUAA 1NV9A 3UMYA 2XUKA 3L6OO 3SE0A 3VOBA 1ZI8A 1JQ5A 5LDGA 1P1FA 3NGXA 3HJUA 3WAKA 3ZLVA 3HM9A 3H5RA 1ETUA 2WNIA 4W1PA 3CLHA 3G89A 2WINI 2X5XA 4ZOAA 1C3XA 3IB6A 3GU3A 5AOVA 5C3UA 1B6SA 1EYZA 1N8KA 2IXTA 1QHNA 3LC1O 3KFVA 3WISA 1OFUX 3MJTA 1QAQA 3OIYA 4ROSA 4G9GA 1RJEA 1Z88A 1H5UA 4H3VA 5IVKA 1T34A 5HUHA 5FT9A 3FNGA 3H2SA 5MFPA 4OTZA 1CUVA 3C6BA 4LIPD 1QRTA 4NYMR 1JA9A 1EAYA 1E18A 2FHPA 2JFHA 3OUTA 4WXHA 5CH3A 2IIVA 2BPOA 4FMDB 3BGSA 4MKRA 5LP6A 2AI1A 5LU8A 1P44A 3MRTA 3G7NA 1O6BA 3WIVA 2O8CB 1M7GA 1ZFNA 3NHFA 2PGJA 4DEYA 9LDTA 4YJDA 5KX5B 3QI7A 5KAMA 4CR6A 1PCXA 2OA0A 2NUBA 3FPJA 4H1UA 3VX4A 5AM0A 5DDIP 4EF5A 3UBTA 1PI3A 5FOTA 3QXCA 4HWOA 4Q66C 2OORA 2P2DA 4FE3A 4DRXA 1MHPA 1WD5A 5T6MA 2WICA 4CV1A 5FUMA 4MQFA 1KBZA 2JAWA 4TL7A 4Z9XA 3KHKA 5M2QA 2YV5A 3ELBA 1Y37A 4QXMA 1EXWA 1OR8A 3E9ZA 3SF0A 2JCSA 3HKCA 1G38A 3ZCTA 3BXZA 1QRRA 2DPLA 3CEHA 4D9NA 4EA7A 4MHSA 4GVPA 2Z6UA 3IO5A 5CXQA 1RMQA 4N8DA 1BH2A 2BYTA 5C52B 4FHFA 4DDWA 5HKAA 1QQTA 1CFJA 2XUAA 3PUIA 3QFFA 3UTDA 3WHIA 1O9HA 3MCZA 3FYUC 2DHDA 1N8NA 3KVOA 1QCZA 1EWYA 2HMTA 2OHFA 3S2FA 1L9XA 4K9RA 3O5AA 5I7EA 2QL6A 5EA2A 3D4IA 1L1RA 1TVCA 1SU6A 1E79D 3I83A 2HLNA 1GZDA 4AKIA 1SIBE 4JOCA 4LGMA 4O59O 2P9QA 2OLEA 1E2MA 3GV0A 3QFHA 4M53A 3U3ZA 4AYWA 3NGLA 1QDUA 4YAJA 4AMVA 1XROA 3GH3A 3VU3A 3VM6A 4DC1A 1CJTC 2ASEA 5AHRA 4HQRA 3UC9A 3EEYA 1QCYA 5ALYA 1SUIA 4ALNA 5JZVA 1Y6RA 4MARA 1PR6A 1RMYA 1ZOPA 1T91A 1BVHA 3NU1A 2CXNA 3TLAA 1Z13A 2IZ7A 3SP1A 1PBNA 1T2DA 2W4QA 1PV4A 2V4UA 2AFHE 3ZY3A 2PXHA 2YL2A 3DZJA 5AR1A 2HSWA 2FP4B 3ANXA 4PWZA 3REGA 4BEJA 3QE4A 1SOUA 1EQ2A 2CVQA 3D6VA 4ND6A 3GGCA 4B8YA 4F56A 1AKQA 1HX7A 2ADOA 1ZWKA 2EBHX 4U02A 4J49A 2OHIA 1T8PA 4WKGA 5ALIA 2R25B 1MOQA 3W05A 3KBBA 3QPVA 3WLKX 4ZVRA 4D6PA 3LC7O 5EWLB 4XB2A 3HBLA 2PSSA 5ALQA 2FJPA 1EGVB 1WJGA 1EINA 2BF4A 2NO0A 3DDNA 3KE8A 4B82A 4BMSA 1E9DA 5IEJA 3U3MA 4A0QA 3O92A 1KTIA 3U4CA 1LJUA 2J48A 3B13B 1I6WA 3CNHA 2AGVA 4URFA 1ACMA 5KUTA 1NF9A 3V97A 1QGUB 2VWPA 4MP6A 1ZXXA 5TS2A 3TNJA 3P0HA 2WB2A 2I62A 4EUSA 2PZGA 2Q2VA 5IULC 2DC1A 4XJVA 4N3AA 2O05A 5EE5B 4J2OA 2VWGA 1L3CA 1Q1EA 2AOUA 3OQ6A 1KE1A 3DPIA 2NV6A 2NT4A 2O6LA 3IHTA 3K8ZA 3LG2A 3LP5A 4RIIA 4L50A 4ZC1A 4JLBA 4UVGA 1D5CA 1L8LA 2X8WA 3MIZA 3V8PA 1H4QA 4F38A 1CVRA 4FNAA 4BNHA 3WGOA 1QUFA 4IGKA 1FB5A 4X1OA 1UEJA 3EDYA 4RS3A 1AUVA 2NZXA 4OG2A 3SZGA 2DH6A 1QGAA 2RC6A 2VDKB 4JJZA 1UWCA 2JAQA 3F4LA 3PI6A 2RK3A 3L1UA 4IHKA 3SIWA 5B5SA 1JVSA 2G6TA 4G89A 1JE1A 5L3SA 1OHHD 2BISA 4N18A 5IKEA 3ZCRA 1ADFA 3EEQA 2XHEA 4PGHA 4BV2A 1JKMA 4UQLA 1TTPB 4PXYA 5IUKC 4KR2A 5L7YA 1JXAA 4MRPA 3FKSD 4MYDA 4XD2A 3Q8LA 1ULBA 3U62A 4AY5A 3T3IA 4DZRA 2XVZA 3GNLA 4LJ9A 4MVJA 4DT1A 5JAOA 5A9RA 1Z33A 2R6ZA 3B8HA 1YZKA 2CFRA 2IOYA 3JQGB 1CZRA 1LK0A 3FWHA 3MTQA 3URKA 3KE9A 3M70A 4PGFA 5FPTA 4COKA 4ZQCB 2BF7A 1QK5A 3A2NA 4U7DA 1U63A 3RYIA 1JIQA 1IN8A 3HB9A 4C6TB 3BULA 1U1GA 1NC1A 2IZ0A 2Q6IA 3GIWA 3OPYA 1DI0A 4JQZA 5TGZA 5CBPA 2G1PA 2DCUA 1IBCA 1BRMA 4BQEA 5LJIA 2Z3ZA 4XYMA 2FQYA 2FUG1 2N47A 2NYAA 3GDFA 1OX4B 3HVHA 4HVCA 2QYOA 2ZRBA 3E8XA 4M0FA 5DB4A 3ACDA 1DCMA 1SHLA 4K81B 4L8LA 3OAAA 2ZSEA 3D4BA 1WXWA 5CM2Z 4ZAXA 5LXTB 1YJCA 4RH3A 4MVJM 2PKQO 2W6QA 2QA5A 4TTVA 3DLTA 4E14A 3IQIX 5J63A 3WJAA 2QVGA 1XXHA 3KV1A 1EM8B 1ZAYA 1SZCA 4FFSA 3TLGA 4HK4A 2QRUA 1EJ6A 2AZ4A 3ANYB 2OBMA 3RWBA 2AR7A 1XNQB 2ZE8A 5JQGA 4MZXA 3MRVA 1YOVA 2PYIA 4EB0A 3W79A 3L7CA 3ROFA 1RJ9B 1YIOA 3UWOA 3R9KA 2PRSA 1XTVA 4MWDA 5JRZA 3AIMA 1TLTA 4PGMA 5AHWA 2VLBA 4M37A 2G9ZA 4X9XA 2JGEA 4JP3A 5K9ZA 1U3GA 4CM4A 4YV7A 3PNQA 3L6EA 3CCCA 1YT5A 2ZI3A 1JQBA 3EOBI 4X63A 4DUGD 3EA5A 3WL4A 1OZHA 1LBTA 1NI5A 1UPUA 3UUEA 5KQPA 2HGZA 2FUCA 3E1SA 4JP1A 1XV5A 3GOHA 1JIVA 3QYPA 4JQSA 4YJFB 3EFEA 4FT2A 4H4EA 4MUYA 3KS9A 4FX5A 4FCVA 4MWZA 1RRGA 3EZLA 1BHO1 1MQAA 4K6HA 5HK8A 3QBTA 3WK6A 1AKVA 1I1OA 3MOIA 4LJLA 4I9NA 2X1HA 3LT5A 1Z5WA 3C6MA 4D4MA 5DTEA 2P2LA 4XZ3A 5JATA 4H7DA 4F3KA 3BTSA 5E9JA 1T1GA 2UXCB 5SZIA 3ZLUA 1BU8A 2IOQA 3AUSA 1NIJA 2G72A 4AIRA 1XWIA 1UEXC 1FNNA 1P7PA 3AZPA 2JL1A 2UKDA 2C9MA 5ARCA 2R2GA 4UQOA 4X54A 3PI7A 3AFHA 3SZOA 1U28A 4IOJA 2WTAA 2XD9A 3TX6A 5KTNA 2PQ0A 4OOFA 4AJ9A 4NU5A 4D4LA 4OQMA 4MPJA 5B2ZA 3PNMA 4FHZA 1I4EB 5ECGC 5KNDH 2F43B 2PG3A 3BDVA 1TZKA 1BMFD 3WOHA 3CUUA 1RWOA 2P1ZA 1E9AA 3HYLA 4KMMA 3FETA 4US1R 2AHRA 3MBIA 4ASUD 2JLXA 3DEAA 4OQYA 3CVYA 4BVJA 3LQ1A 5EL0A 2A88A 5AKZA 3GLRA 3HLKA 3QM1A 1GITA 2OD2A 2W2MA 3A6GA 1I3LA 1E3DA 4LJ6A 3SNHA 2DPHA 4IKEA 4ZVPA 4RANA 2GO1A 5F98A 3NV7A 1SVWA 3K0KA 1XD2A 3JWJA 1NBAA 5FTLA 2BCJQ 1XHEA 2XNJA 3V34A 1J2YA 4HOYA 1TMOA 3PHIA 4R68A 3AUXA 2RBEA 3I5YA 3THXA 1GNSA 1U3FA 2IU6A 1EG7A 3LC2O 1DZ3A 4B6OA 2R1VA 4U8HA 3CPEA 3IFSA 1V2HE 1KXZA 2V5UA 3PQFA 2WAAA 5B1EA 3A70A 4MEJA 4U5XA 4HFNA 3WLNA 3WA7A 2RHWA 3QV1A 1P4RA 1E0AA 2MINB 1R4NA 5H8WA 3W2GA 4QVGA 1WHTA 2DR0A 2YRXA 2NOAA 3WGJA 1V3QE 1PNQA 2CLEB 1P45A 1LS1A 2RHDA 3DBVO 4I4TA 2W48A 3UUGA 2PRJA 1VPVA 5IFKA 2HW8A 3W3AH 1YHZA 1KO7A 2B4YA 2HZBA 1J39A 4HGYA 4TTRA 2YUTA 2HQ1A 1S7GA 5LA6A 4ZEMA 2ZU0C 1I13A 2QX4A 3M83A 2Z9BA 2OB2A 2Q5HA 3IMFA 4FW8A 4B4KA 1ZBDA 4TKUA 1VLMA 2IITA 1XQYA 1Z8NA 1T9GR 4YALA 5AHXA 4X62B 2CNDA 3K20A 5DLQC 4F04A 5GV8A 4ESHA 1L7AA 2DWOA 3EVAA 4BMXA 1G1AA 1DBIA 3VJKA 5C37A 1B41A 4J0HA 5CBPB 3BSWA 3D2BA 3QVUA 2G17A 1GTVA 4LJ8A 4O08A 2ZQZA 5TJ9A 1YE8A 2HGSA 2J7PA 3L8YA 4GLFA 2ZRQA 3ZU5A 2GXSA 3HI4A 3KG2A 3C70A 1M8JA 1U9IC 4YAGA 5J47A 3X43A 4L7QA 1VHWA 2C92A 4G4SO 4M1YA 4E2WA 1FFXB 7YASA 5DN9A 1NBWB 1VSBA 3P8ZA 2V98A 1Z83A 1DAFA 4PSCA 5KPDA 1XTJA 2ZM5A 4EKEA 1DWPA 4KC0A 1ZR2A 2JHFA 2Y6VA 3DZCA 4FPXA 2OCYC 5CIWA 4F8JA 4BRWA 1V3VA 3O3OB 4H27A 5BUCA 2CLMB 5BSUA 4UTRA 2GHQA 2WWVD 2AHOA 2L42A 4JBGA 4BTEA 2PUAA 2LIPA 1JLLB 1NXPA 5LZ7A 3UMVA 1PL7A 3SHQA 4ND2A 3SU8A 4WNAA 2XUFA 3OTOB 1PZEA 3PSHA 2CHEA 2OPHA 5L95A 1XTZA 2VL7A 3H9GA 3TDMA 1NJ8A 4BY9E 4ZEOA 5KQGA 2FR8A 3U13A 3LGXA 4DAOA 3IQGX 1K8XB 5HBRA 3WBKA 4YLYA 5ANRB 1WUHS 2QP4A 5IN4A 1ZXBA 2EWWA 2I99A 4DR2B 5ALDA 4J43A 4JB8A 4RF5A 2EW8A 1N5LA 1TXGA 1H3EA 4YRKA 1VLZA 1Z16A 4G8BA 3RROA 3HYRA 5K6AC 1COWA 2HMSA 1SN7A 3DNMA 3DDWA 3RVRA 1I5EA 1W88B 1DEOA 3GMDA 3AI2A 2NYUA 3ZGNA 3KBOA 4FIDA 2YY6A 3LRTA 5DCYA 3VFDA 3DSRA 3OZWA 1JW9B 2VT7A 3AFMA 5KNDD 2HM7A 2VTVA 5EJIA 3WLRA 3DHEA 4OEHA 4WZ6A 3QJYA 4MICA 4ZTZB 2HD4A 2F1IA 4JLAA 4MUNA 4UUOA 4XOUA 5GY7A 5KYXB 3DQZA 1RXIA 3HR8A 2GN1A 4TLEA 4YUXA 4RMHA 4EG6A 1B6RA 1PGNA 2VJMA 4J1TA 4DM3A 1KVRA 1N6IA 5EIWA 2BHLA 2FYTA 3IUMA 4HV4A 1I01A 3WLEA 2Q4OA 2HXSA 3RFTA 4P83A 3TN7A 1FTNA 3LCUA 4EVRA 1QIGA 4BRSA 1A2QA 2N42A 4HNAA 4E88A 1CQJA 1E6CA 1FLDA 4UBKA 4UPDA 2FMTA 5P8WA 3QZUA 3VH2A 2D6FA 4D7AA 1L4HA 5C4MA 3GAZA 1I14A 1AG9A 2JH8A 2VPYA 3O8DA 4FFWA 4I6GA 1DEKA 4NYMQ 4B7UA 1OIWA 3N2YA 3IEIA 2GM3A 4P4TA 4ZDIA 5ICGA 3D7NA 3IR5A 5JE8A 4GOJA 1DO8A 4JVOA 4N7BA 4ENSA 2RH5A 4OFXA 4TSFA 1PKXA 3HLTA 2WDPA 1FQWA 4BX0A 4WFKA 1N5OX 1FQOA 4KXYA 4RYLA 1Q0RA 3ZIAD 3JYQA 1FIUA 1KI6B 3DZDA 5LC1A 1GGHA 1DX9A 4HGOA 2D62A 2PL1A 4S24A 5AVWA 4JNKA 1WW2A 1TZCA 5BN1A 3W2FA 3FOAA 1NKSA 4QO7A 1JWBB 2WJAA 2O2JA 1IC6A 3FHJA 1NAIA 1UBRS 3AHJA 3N6VA 1SZJG 3AT1A 1KJYA 1L4MA 1ZCZA 5EJMA 4N3NA 1NR5A 1QCDA 3R6WA 4JLWA 4CMCA 4ZIRB 3CEPB 3D8UA 4U7TB 3PT9A 2QRMA 1NUHA 2HHHB 2BM1A 2X4LA 4C08A 3N3BC 2V7TA 3CBGA 3H7IA 1FP7A 3NVAA 1QGYA 4OIFA 4FOSA 4ARZB 3OCVA 3PQCA 2Y0CA 4YUYA 2I33A 5ES4B 8MHTA 3QWAA 5CLHA 3FXAA 3NBKA 1AXGA 1N2CE 4TPKA 3ZR4B 3T7KA 2J0UB 4ACBA 3VDMA 2FDCA 3IS3A 1E5VA 1H2AS 3JQBC 4NZMA 5A1TA 1E9BA 4KQHA 3QU2A 2ZZNA 4NFYA 3ILYA 3VDQA 1ZVMA 2GCNA 4F3YA 1E9SA 1XJCA 5JSYA 4ZYVA 2J5XA 3LFHA 4TGLA 4M9UA 5FFFA 4NE9A 3NFRA 2FPKA 4LZZA 4U2CA 1XEXA 3X2EA 1IOZA 2EKPA 3QVMA 1DB3A 5CX1B 1EFCA 2QMYA 4LDZA 2EKDA 3TOVA 2F4VB 4H3KB 1KMMA 2A1UA 2ZSBA 2D4HA 2QQFA 3PUKA 3ROXA 1JHZA 4QDXA 4X7BA 4D3DA 4DREA 1QZTA 2PBLA 2HNKA 2NAPA 4GE0A 4GQIA 4TWAA 1DKLA 4PRLA 3GRYA 5COAA 2VTDA 3B48A 4I3FA 2RK4A 5I9TA 3W90A 4QXPA 2X9VA 4HXFB 4JEIA 3TAHA 4C9BA 4I2VA 4HYYA 3CZ4A 3BA6A 5KU1A 4HNUA 1KORA 4BGDA 4Z4EA 3ROZA 2FEOA 1S5PA 2DZDA 2HCTA 5C7OO 1NU8A 2K5UA 4RCZA 4WASA 5I9LA 4JV5B 3U7FB 1Z26A 3SEZA 2AOWA 1X9IA 3IB3A 2B2NA 2FX2A 1OXBB 2QSUA 1E3IA 1Z34A 3ASYA 2YC4C 1U7XA 1G7SA 3DZIA 3GGGA 4XYLA 5LVAA 4CV2A 4KPEC 3Q3HA 4D4JA 3EMKA 1YB4A 4N01A 1EUDB 2NU6A 3NC1C 4Q7KA 4TYMA 2W6PA 2VWHA 2W2VA 3NWEA 4U6QA 5F9HA 2W2PA 1OW3B 4FWIB 4OHVA 4DCMA 1F5SA 3HHEA 3GBVA 5FAKA 4FK8A 5T7BA 1KZ1A 3K8YA 3RTAA 1BJTA 5DN6D 2AI2A 2D1RA 4RTLA 5FI3A 2OQVA 3JQAB 1RE1A 9ATCA 3RGGA 2O2ZA 4Q1FA 2VJMB 2OZPA 5C80A 2C3MA 1KGDA 3FCAA 3PQ6A 3M5PA 5TMPA 3U1BA 2HQRA 1D0VA 1O3YA 5JH7B 1YBMA 2QY6A 3R7LA 4TV8F 3P26A 4GXTA 4D9IA 2O0LA 5EP4A 4ZVOA 4ER6A 1UMBB 2ONCA 2AEFA 4K9MA 1JEQA 3R6GA 1BA2A 2N9UA 3WGKA 3QLUC 1P0QA 4QQKA 3JQ7A 2XB2A 3NLLA 4M54A 5K4HA 1CETA 3AR2A 2Q45A 1LKZA 3RAEC 4I4NA 3ZDBA 2C4WA 2J31A 4B6QA 1CUUA 1UOEA 2X0IA 3U44B 2XUGA 5CHYA 3RSSA 2C5AA 4M0UA 4M4SA 2K7FA 1JVNA 4RYDA 1WM1A 5CK5A 2P6UA 5K6AA 2WWWA 4CYMA 5AQ1A 2BHSA 4KSBA 1W35A 2I3GA 4NBWA 4PG6A 5EJ9A 2CHQA 2IPOA 4Z4HA 2XRFA 5JVDB 5JS1A 3KJHA 1ID8A 1PR3A 4WN9B 3O4HA 4YONB 3F71A 1ZGAA 1DMRA 4MLZA 4MVJI 5D3QA 4Y7DA 3O2JA 2V4ZA 4LW8A 5IJWA 2SECE 3W5DA 1UMDB 3ICEA 3AVQA 4URHA 1P73A 3I3SR 3PX3A 1JA0A 2FUG6 1TMKA 5LZ4A 4DNFA 2E21A 4K40A 3M89A 2XNKA 3CN7A 5T67A 2WG0A 3WV4A 5HJ5A 3U7GA 2FV8A 3CNEA 4E31A 4HNTA 1E1MA 1D2MA 1SA0B 1P7YA 1WUYA 3EHEA 3LHDA 3HDHA 4TSKA 5FHRA 4EI7A 2J9XB 1XNGA 3LO5A 3PRHA 4ZOQI 5EZYB 3L5OA 3D0QA 1V3TA 1KQPA 1RWBA 2JAHA 2PA3A 3GJ3A 3HDVA 1DO0A 3LVFO 1W96A 4X3PA 4ZHSA 4IS3A 1TKAA 3ZGLA 4D4GA 1ID1A 3GNTA 2OV3A 4EEZA 3W3AA 4EG7A 1S0UA 3ETNA 4OFWA 2GYUA 2M1XA 1NQ5A 3FVQA 5ECYA 1TQ4A 1N0HA 3U3DA 3VZDA 3ZWYA 4BVHA 1PR4A 4GZ3A 4WY8A 4K9DA 2WWYA 2AQIA 2BCGY 2FWJA 2EHDA 4HVTA 1MJFA 3MMSA 3DV2A 4RJ2A 4AMGA 3CKKA 5JAQA 2YIVX 3PDIA 3HVJA 1LW7A 2PMEA 4AG5A 1RC0A 1USKA 2ZRNA 2BDUA 2ORED 2QTBA 4YCSA 5BSFA 2BLLA 3FUVA 4D02A 3PVCA 4TZ0A 5G53C 3PFBA 4ALLA 5A7HA 2FSSA 5C3MA 4B4UA 3AYZB 2XSZA 4HMQA 3S1SA 1OY1A 1MV8A 1A9XB 3ND8A 4N47A 2NLOA 1Q91A 1TQHA 2QIPA 1Q7BA 5DHRA 3C8MA 4P3KA 4O3MA 3RIHA 1J25A 3TS1A 4DE5A 2FFJA 4DB2A 2WZCA 2X76A 4NV1A 1MO2A 1O5OA 2VJDA 4GPZA 4B6EA 4S35A 2I3AA 4GWKA 1CUGA 4J0JA 4R54A 1L1FA 4E2XA 5EMMA 1OT5A 1T8WA 4AJ4A 3KJIA 3J80A 1JHUA 3ST7A 3MOGA 1Z4JA 3LK6A 2CK3D 3CUVA 4MW7A 1Y33E 4DM4A 2P5SA 4ZT7A 4B6GA 4DRZA 3DTNA 4RKRA 1BXZA 1E4EB 1L4UA 5A1JA 3UIEA 1OH8A 3PFHA 1ZD4A 3F8TA 4RKEA 1HFEL 5HIJA 1DAGA 2GZ1A 3P9CA 1G7RA 1UXOA 1ZOLA 1D2NA 1XMJA 2H7VA 1ZGJA 1XF9A 2KX7A 2OGUA 3HL4A 1M6VA 1KVQA 1SXJD 1MT0A 3B60A 1VCMA 2QLLA 4A6PA 1LVHA 1V6AA 2X8LA 3D6TB 4OH1A 4G1MB 4NOMA 3TW6A 3FOWA 3BA1A 1JR3E 4UU1A 3EN0A 1HC7A 1C81A 3TZBA 1ZM9A 1MJHA 2ZTUA 1NATA 4NH0A 5E7QA 1GQYA 2VC2B 3CZAA 1GIAA 2XPCA 3A04A 1S2IA 3BXEA 1ESZA 3I45A 2WJZB 2YOHA 3UJ9A 3P45A 2BFEA 2ZSUA 1YACA 2GH1A 2OFFA 4XJXA 1RM5A 4O2RA 1T8TA 5ALPA 5T4HA 3UJHA 3UUWA 1KOJA 4H35A 4DV7B 2GETA 4XPZA 5AM4A 3T94A 2IY7A 3OC6A 4ZCSA 4ZAVA 1BXGA 4KP7A 1F17A 5EWLA 3T3EA 3HS3A 1NSFA 2FZEA 4FVTA 3NETA 2UZ4A 1V95A 1CBUA 1RPJA 5F4BA 3VHXB 4B35A 4N7JA 1ENPA 4PG5A 1GQ2A 4GQBA 5TGTA 1ZEMA 3K4HA 3SVZA 2B5WA 3DJFA 2OQRA 3FH0A 1EEHA 3QJGA 5AJUA 2Z1NA 4PBTA 4ARSA 4C29A 2GD6A 4UFPA 1S4MA 4OSOA 4I1VA 1WG8A 5FI1B 3FJYA 1POXA 4Z9AA 3T5CA 3ZHTA 1O95A 4J0IA 2VTEA 5E4JA 4KRFA 3TEJA 4JVLA 4CQLA 4HDNA 2O8NA 3E2MA 1VSVA 3R3YA 5CXUA 1KY2A 3CPJB 2BKVA 5I01A 1M66A 4OGLA 1HZZA 1SC1A 3IQXA 4M6WB 2J3DA 1KY5A 4E32A 2AR9A 3A3YA 1T1EA 3W1VA 3LL4A 3TNDA 2ZBUA 2CN1A 3F0TA 1CRZA 3JD2A 5I9IA 5J4YA 4UU8A 4DVGA 1MLDA 3KZ1E 4U2DA 2ECQA 2VEDA 3UFXA 3K6JA 4KHZA 3EIHA 1KZ4A 1LBQA 4U7FA 5KNBH 4LZJA 2AXNA 4Z9YA 3KWFA 4GW3A 3O8QA 1ND6A 4JLOA 4R3WA 3UM9A 4L5CA 2FZWA 3KEQA 4OU5A 2F55A 5KOHB 1T5BA 4AT1A 3IMCA 4XR9A 4EJ0A 3X1ZA 2EHJA 3IVRA 1AGXA 3JZFA 1L5GB 1P7CA 5HQ3B 2AYYA 3L8MA 1NXVA 2V7XA 4UCWA 5DYWA 2AFHB 5KVQA 4K6CA 3TD2A 1Z06A 2PWZA 4E22A 2HNAA 3HP1A 1HE1C 1D9ZA 4JI5B 1PSZA 5IJZA 3RLFA 2IEBA 3LOUA 2VG8A 3PF9A 4E30A 3U4QB 3SY8A 3TG2A 4RA6B 3BBLA 3IEXA 3BERA 1W5SA 3MINA 4RQBA 1WB4A 1ZX1A 1KE2A 1I2CA 1H23A 4C7VA 1QH8B 2WM2A 1ZMXA 5LCXA 3UYKA 3JYOA 4JQCA 5BVHB 2V6JA 4IM7A 2WSYB 4OCZA 5AIAA 4XIYA 3HBJA 3LUKA 5KWVA 1NXSA 1E2UA 5TY0A 3SVLA 4NS4A 1R50A 1G6KA 3IHLA 1LWOA 3NRJA 1Q11A 4G8JA 4WZAA 3N86A 3OIVA 5DI3B 1E6WA 1UOOA 3GIDA 3LFUA 3H19A 3WTCA 1IFXA 2DWQA 3OZRA 3BIWA 4JUAA 3U4MA 2BFDA 3T6KA 1N1GA 1NR1A 2A9RA 3ZWPA 3JD3A 3V1UA 1E1CA 4FBMA 7MDHA 2QRVA 3UWKA 1GU1A 3DYBA 4Q47A 4E5DA 2I3ZA 2Q3BA 2CV0A 3FNFA 3QBEA 4JVNA 4CM9A 5HYVA 5MF6A 3ONFA 3ADCA 3CZ5A 3QITA 5LQNA 1E94E 2IZ5A 3VNQA 3MJFA 1WB5A 1ZU4A 3ETEA 3TO5A 4L15A 1QH1A 2ANBA 2DU8A 4RV4A 1C8VB 2J3QA 4OHWA 3O0DA 2HV8A 1NOIA 5H3CA 5GZ6A 5JMPA 3PEFA 2P2YA 2JF0A 2P41A 3GG2A 2GDJA 1XZBA 1UKYA 1Y1TA 4AF6A 4L4SA 2BMJA 5KB3A 4IGIA 2A86A 1QHIA 5HHTA 3WKCA 2WVJA 4EHFA 2BHRA 4X8LA 1NNI1 4YRNA 1TPZA 4X60A 3OTGA 1P8AA 1C9NA 3JAKA 3LKZA 4K46A 1NJFA 3GCXA 2OL4A 4LQLA 4GPTA 2WYIA 3EW9A 3HUUA 5PNTA 2XZOA 3ZVMA 2PUEA 1OIVA 4RLHA 4ZT5A 5AVJA 5JOQA 2EOAA 1NM5A 4YP6A 3CF2A 4ZVQA 2OHGA 3ZHBA 4BO8A 3G59A 4A91A 3WGIA 1QHEA 3QTTA 3SX0A 1Y9JA 3G0BA 3L7MA 1ZCBA 4NEQA 4QD3A 1ADBA 1J9ZA 2NSJA 4D4KA 3OZFA 3PR3A 2XUZA 1FUUA 1YRAA 3IULA 3KKPA 4IW3B 2WW8A 1E2NA 3B3FA 2JRCA 3A6LA 3EIUA 1ATIA 2ZU6A 3LD9A 1WHSB 2PQ2A 3RE1A 3EMBA 2DAPA 4NXMB 1XLTA 1F2VA 1QOPB 3IUJA 4S1TA 1GPKA 2QNRA 4R8SA 4HADA 5DWQA 4KUEA 4P4SB 3EK2A 3AUFA 1E3SA 1J8MF 2VHCA 3QLTA 3VR6D 2C2BA 3OWOA 4G67A 4CV0A 4HG2A 5KNCD 2ZRIA 1CWUA 3THWB 1GV0A 1EBFA 1YE5A 1YZTA 2RHOA 3T0GA 3OQIB 1E7YA 3S68A 1UDAA 4YMWA 1N7GA 1OSNA 1TYCA 4HEQA 4CQLB 3BRCA 4PGGA 3DLCA 4S04A 3N9IA 1PYDA 3R5HA 5F9MA 3GUCA 4OQNA 4YJHB 5TR9A 5A03A 3M6AA 5E3JA 5JRDS 4IV8A 5CA1B 1CLUA 4H7JA 1KO5A 3P0EA 2MTBA 1J33A 2Z2YA 3DFKA 1GY8A 4BNGA 1H93A 2FFBA 3EA0A 4YR7A 1JUDA 2PVPA 3JQ7B 2G40A 4TS3A 1TU3A 3UATA 4A03A 5FTMA 4WNIA 5CVEA 2FHSA 1NLZA 2A3RA 5BSVA 5EMHA 2ZWVA 5J59A 1WSDA 1KEZA 1Y34E 3A1EA 3GDGA 4BQQA 1GTL1 1I1NA 4P7GA 4R84A 1CB7A 3DMFA 3ZTWA 1CDZA 4U7JA 1EGHA 3LYUA 4WNAB 2NU8A 4RS4A 5GJCA 3UXEA 4XVHA 4EGJA 1JFSA 2HXYA 5I48A 2P5TB 2F00A 1FFEA 2H4ZA 4RETA 1B4DA 2ATIA 1LUAA 2D7JA 1QORA 2GZSA 3ASVA 1PX2A 2W4MA 1G8JA 1I9GA 2NSLA 4F96A 4MVJG 5CD1A 2PX8A 4HXEB 1V4BA 3MMNA 4WCFC 2DT8A 2PKXA 3IKLA 3QXXA 4LNUA 4OKNA 3ZU4A 1R6BX 4TVKA 2J5QA 3CLTC 1XMSA 4P53A 1L8AA 1EWTA 2BH9A 2X58A 4J9VA 3WDSA 1XJ5A 3WFIA 3LQKA 1J99A 4Q15A 3QLEA 3M7IA 4I4CA 3H9QA 3CZCA 4AAYA 3WMFA 4Q3NA 4RMIA 3TZEA 1KH2A 1DIAA 2QVCA 2ZJZA 2XB8A 4J7UA 4M1OA 2OYRA 1K6EA 1MO6A 1QIEA 2NQ8A 5FUYA 2G5PA 3M6UA 3DMRA 2HSGA 1E6UA 4TV8A 2AMJA 3RT9A 4BLSA 4IO0A 1PDVA 1ORDA 5DI3A 4EPVA 1Q6YA 3D64A 4RHYA 4QM7A 4OFBA 1FQKA 3ND6A 4ND5A 2RHRA 2AN9A 3FUUA 4YRSA 2X5NA 4XYEA 5BNIA 2O20A 4GOKA 1SXPA 3BAFA 2REQA 3G88A 1E2LA 1DG3A 2GBCA 1XXLA 1BMQA 2K2QB 3R3JA 1RIIA 3O8OB 3ZEIA 5CT5A 5IZ4A 5E1BA 1EMDA 3DCJA 1VJRA 2Z09A 3EXG2 1GL3A 2CGEA 1RQLA 1ZA1A 3A9SA 2IXEA 3O1HB 3QVLA 4IQ8A 4QM6A 1RBYA 2HO5A 3C16C 3KUCA 3L2OB 4MRSA 2ORYA 4RXTA 3ZHXA 2H85A 1O89A 1U3TA 7ABPA 3UA4A 4FR0A 4KFRA 4C06A 5IABA 4LF7B 2JHCA 2AVDA 2FK8A 2DQYA 4DKJA 3IA2A 1Q21A 3OQPA 4LG1A 4H1WA 1YVPA 1MMFB 1DQSA 3RUCA 4HGNA 1NIPA 1SAYA 3ZVKA 2DHEA 2JI4A 4YLGA 5DTJA 4X1IA 2EYUA 5EJ6A 4NFHA 2F3SA 2I22A 4JUBA 1E8MA 3CXUA 4E5UA 1RRPA 2PA0A 2FJ0A 2H1SA 3ANMA 3G02A 3P9XA 2QV7A 1SD1A 3KOOA 3QFSA 4MB6A 5CW2A 1S6YA 3T1OA 4EEXA 1NL3A 3AILA 3LIPA 3AHCA 2J3KA 3H8VA 4G1CA 4NZZA 2CWDA 4ZI7A 1WEHA 3HSYA 4HUQA 4YPOA 3EUFA 1FVHA 1B26A 2O3TA 1EVYA 3K2IA 3JD0A 3OIGA 4QASA 4RA9A 4LS3A 1RBQA 4NPHA 2BN4A 1GKUB 2ZQ5A 2O2DA 3FB1A 4Q93A 2AG8A 4EYEA 5JH7F 2IKSA 3AIOA 1ISHA 2GQ0A 1EK0A 3JY6A 5KKAA 3O8LA 4M99A 3IAXA 1Q1GA 3O03A 4L8VA 1EAMA 1KAMA 4LXQA 1KFJB 3OLWA 5DBGA 4DG8A 1KVTA 3EGDB 1N2OA 1D7AA 4WH0A 2Z8XA 2FW9A 1P0MA 2Y4OA 2XRYA 2OY0A 1R5BA 2ZT6A 5D1NA 5GIOE 4DXAA 2V1XA 3HBNA 2OZVA 3FYHA 4ML3A 5FF9A 4PLFA 2A35A 2YWEA 4FGLA 1P9OA 2FRXA 3CH5A 1BQEA 1H22A 3WXBA 4YT5A 2KM1A 4XYGA 3OCCA 1Q83A 3X2FA 3C1AA 1TW3A 3HUDA 3H4IA 2WWFA 5GZ1A 2E82A 5DNWA 4K8RB 4P3OA 5F35A 2IYWA 1KMHA 4YASA 1M2OB 4ZEXA 4O0MA 4G01B 4ZTBA 3E9EA 2J3JA 3R7WA 4CLHA 4F4UA 1ZRHA 3T7JA 4F7DA 5FFMA 4EB8A 1GZ5A 5AYVA 3EOZA 1T3ZA 3W8RA 1AU9A 4Q3BA 4E07A 1S3FA 1MAVA 1HLDA 1L4GA 4BXOA 4LSZA 4QTZA 2OQIA 2VPTA 4QGBA 1PQYA 4Q3DA 3I4LA 3OJFA 2H1RA 1NBEA 2ZI5A 4UUBA 3M6WA 3PEVA 4IEFB 3SOZA 3SICE 3ZH2A 2J3HA 2D5CA 1W8IA 4KODA 2HJHA 2Y71A 4RLSA 4RIFA 1ECBA 1E9FA 1VKHA 3E48A 2D54A 3RS4A 2QUZA 3Q4GA 5JECA 2YJ3A 2R0QC 4QPJC 4RE6A 1GPJA 3NBXX 4Y9TA 1M2GA 1E7MA 2QZ4A 2EKQA 2ZI7A 3UVEA 1YIDA 4IX1A 4Q9AA 5L4SA 4HLNA 1H65A 1LK5A 4FN5A 3IBFA 4F5EA 3KTAB 3QHAA 1RZRA 5DRTA 1KI3A 5LWHA 1TQ2A 4D9KA 4JJKA 1ISJA 1OBHA 2YOGA 4BRZA 2Z9CA 2WP0A 3U2QA 2R8OA 1HYBA 4BZZA 2GCGA 1R0SA 5A6VA 5JJ5A 1AO3A 4JC5A 5A0TA 2J45A 2D13A 1TEVA 1LC0A 2W0SA 2R84A 2CVZA 1NW6A 4LOLA 5LD2C 1ZSVA 2IVFA 3IPCA 1T8RA 1RLUA 4IYRA 4QOEA 5FADA 2QHXA 3SE7A 5HS4A 1VBMA 3DXFA 4FX2A 3GAFA 4MW2A 4INJA 2R00C 4URZR 1JHQA 1DAOA 4GMKA 1FRFS 1W73A 4IZ6A 1JDBB 2C4TA 4NI5A 4HDSB 4P93A 3GCDA 1XZGA 4JKIA 4J2HA 5K03A 3H1GA 3W2EA 1G2PA 2ZJ0A 3FDIA 2B98A 1DELA 1P1BA 5A3VA 5H4HA 1BS9A 2G1KA 1L7OA 3EXEA 1AHPA 5ICCA 3MMXA 2WR8A 2JIPA 5LIRA 3FFTA 2ODAA 5JCOA 4D8WA 1BSVA 5B64A 5AH0A 2YZGA 1ORIA 1UKZA 3WQSB 2VUUA 4PAMA 4JYMA 4YX9A 4KI7A 1ZNWA 4X61A 1G9SA 1RBMA 3A3OA 3GRZA 4LUCA 3ZDYB 3W0LB 4DEVA 3PFNA 1DDOA 1E1RD 1OC4A 2J33A 2ZS9A 3I2JA 5CNKA 1JEYA 4CRWB 2Q0XA 3LYAA 5ADVA 1TIPA