4HTAA

The structure of the karrikin insensitive (kai2) protein in arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
276
structure length
271
Chain Sequence
SLYKGVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydrolase, alpha/beta fold family protein
publication title The Structure of the Karrikin-Insensitive Protein (KAI2) in Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 96
structure length 271
sequence length 276
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4htaA00
3I1IA 2XUQA 1XZEA 2QJWA 4X91A 5E4TA 4UHCA 1CUGA 4ZGBA 1XZGA 4C87A 5JZ9A 4QLOA 3WA7A 5ALFA 5AI8A 4BAGA 2Y6UA 2BUBA 4WDRA 5EIHA 4EZIA 5CXXA 1UOOA 4AZ3A 2ZYSA 3LIIA 1XKTA 5AKXA 5JASA 1PV1A 1QFSA 1CUWA 3H2IA 3PDCA 1E89A 1SC9A 2QTBA 1QIIA 4BB0A 3K9BA 1WHTA 4GHWA 1UKCA 2IX9A 4HVTA 1L7RA 2CB9A 3ESBA 5FDFA 5CMLA 1EDBA 3WK4A 1CRLA 5ALDA 1J06A 4PV7A 3E1GA 3R40A 4X92A 5KREA 5DWDA 2QOEA 3V1MA 4HRXA 1GT6A 1HKHA 3ZI7A 1LGYA 1G42A 1Z68A 5AH0A 1MNAA 4ZWNA 3HRHA 2VAVA 2AJDA 1DT3A 5D6OA 4BP9A 1TK3A 2HRQA 1DX4A 4UBIA 3R3WA 3RK4A 1DTEA 5A71A 5K3DA 2J3QA 3KDAA 5CH3A 2I78A 4UHHA 2JGIA 3WK8A 3PI6A 2XE4A 1MTZA 3BF7A 1IMJA 2ZYRA 1QLWA 1VE6A 4N8EA 3PUIA 1XKLA 3D2BA 4YASA 3B12A 3I28A 4J0KA 3KWJA 2Y2UA 3Q8WA 3FYTA 4F60A 5A2GA 4O08A 2K2QB 4QEKA 1ODSA 5ALOA 4UBJA 1AC5A 3WK6A 2Z3WA 3IB3A 3M81A 2WHPA 2X5XA 1EVQA 1MX1A 3G9TA 1TRHA 4FMPA 3HSSA 2CZQA 2R11A 2EDCA 4EUSA 2H9YA 4J03A 1SCQA 4N8SA 4B85A 5LZ4A 2QZPA 1DWOA 3O4GA 2I3DA 4MXDA 3G0BA 3G0CA 4YK7A 4Q05A 3CCBA 5EHZA 3C43A 5C81A 1YA8A 3W2TA 1BCRA 1AKNA 2HADA 5LP1A 4RGYA 4E46A 2X8BA 3O9MA 1Y7IA 4UBKA 1QIFA 2WJ4A 2XMCA 5K3BA 4OU5A 3C6BA 2I03A 4F5ZA 5ALVA 1QIMA 5HFNA 1XZLA 1S8OA 4H7IA 4X3CA 1BCSA 1CUAA 5JD6A 4EY5A 3H18A 3P2MA 2ZJ7A 5FKJA 1R3DA 2WTNA 1CUCA 3G02A 1ZGBA 2DHDA 1T4MA 5JZBA 3DYIA 1A7UA 2HL6A 4MYSA 1XRNA 1AGYA 1FFEA 3AUKA 2JGMA 3FSGD 7YASA 5JARA 5HQ3B 3BL8A 4BC1A 5IVKA 3F67A 4X85A 2GBFA 3ZLUA 3G8YA 3QM1A 2WIJA 2GZRA 5HF9A 4CIAA 2DR0A 5DNUA 4KYVA 4AO7A 1CR6A 2QMQA 2GBIA 3LS2A 1ZJ4A 2BAGA 1A8UA 3R3UA 4U2CA 3D7RA 3Q0TA 1LPMA 5JAHA 2BCEA 1CLEA 1K4YA 4ITVA 3LIPA 4B0OA 3VJKA 1FSSA 4S0XA 1P0IA 3GELA 2PU7A 4BE9A 4OU4A 5AM1A 2XB6A 5AK5A 1YASA 4Q1VA 3G9UA 3ZLTA 3WL8A 5ALWA 3AZOA 2C7BA 3AINA 3L1IA 5DLPA 4WJLA 3ZWQA 1UK7A 4H7JA 3VJMA 1JI3A 2JGKA 1R4ZA 1K63A 3I6ZA 1JU4A 3S8YA 2JGFA 5E2IA 2GYWA 4G8DA 2G63A 4BDTA 5EHNA 2G5TA 1T2NA 1L7AA 2PSEA 1F0PA 2VJDA 2ONCA 3PF9A 4JH0A 4KAJA 1BEZA 3CN7A 1CUJA 2XLBA 3C5WP 5JYCA 1GQSA 2QT9A 1LBSA 5DTIA 4G8BA 3RM3A 2HFKA 2XUDA 4UBOA 1UWCA 1XRRA 1GPNA 2ORYA 4W1PA 1CUSA 1WPXA 1BU8A 3ICVA 2DHCA 3GUUA 2BKLA 1QIDA 3HC7A 1GKLA 1OXMA 4CCWA 5JD4A 1NU6A 4N8DA 1E8MA 2BFNA 4H7DA 5FPQA 1BE0A 3IVMA 3QPAA 4OCZA 4ARAA 4H35A 3FLBA 2C58A 2C5FA 3OTQA 4FHZA 4RPCA 4C89A 3D0KA 5D7BA 1DWQA 1MJ5A 5DYYA 3R3XA 5AKEA 4KE8A 5HKAA 5I7UA 1QIEA 1W52X 1QJ4A 4AN1A 1FFDA 4DSAA 4V2IA 2HA4A 3U0VA 1SCIA 3O4IA 1QTIA 1UT6A 2ZYIA 1F0NA 2V9ZA 5LKAA 5FRDA 2CJPA 1N5MA 4W63A 5AM2A 4U2FA 4KAAA 4L72A 3ZV7A 4W9RA 3W9UA 4W1RA 1IUOA 4BATA 1UZAA 5ALYA 1HLGA 3OM8A 2WJ6A 4AB1A 4CI9A 1EB8A 3WL7A 3DL7A 4FTWA 3ANSA 1ZD3A 1ORWA 3DYVA 3D5EA 5AI4A 2UZ0A 5LZ8A 3WWEA 4UFOA 1J07A 1XROA 4DMHA 3TGLA 1WCYA 1XQXA 5LZ5A 3F8SA 3H2HA 4B84A 4YPVA 3N2ZB 2Z8XA 1SFRA 2NW6A 4PSDA 2I3ZA 4X97A 1XZFA 2J4CA 4WFJA 3FCXA 1HDEA 3D4LA 4Y2RA 1WOMA 2CBGA 2WIKA 2YYSA 3BXPA 3VISA 5BV7A 3UUEA 5LZ7A 5CW2A 4ZRDA 4M0MA 4X93A 3WLAA 2RI6A 3VDXA 2VATA 1ZGCA 3SC2A 3W05A 4HRYA 3DNMA 2ZJ6A 4A16A 1QE3A 2IIVA 1MX9A 4XX1A 4X71A 2PVSA 4Y2QA 3ESDA 2HA6A 3WYDA 4BE4A 1U4NA 4KR0A 2XMQA 1LLFA 1OCEA 5C8XA 2YH2A 2OAEA 4U2EA 3WZLA 3H17A 4U2BA 3QITA 3FYUC 2AJLI 2XT0A 1CUVA 4OYYA 1SOMA 2GYVA 2FJPA 2VSQA 4Y2XA 2XMGA 4AO6A 5CT6A 1KU6A 4U2GA 3BIXA 5ALGA 5HFAA 2JGJA 2PKYX 4WY5A 1AQLA 1WPRA 2V98A 2PL5A 1TCBA 4BDSA 1ZOIA 1CUBA 2WHQA 1X70A 1JMYA 2WFLA 4CG1A 3BE8A 5K5EA 3D59A 5ALLA 4LXHA 1P0MA 2JEYA 2OCGA 3DS8A 3I2JA 3A2NA 2ACKA 3WKCA 2PSFA 3FVTA 1TIBA 1MAAA 5A7FA 3I2IA 1PJAA 1USWA 5HF6A 1XRMA 2XUKA 2WUGA 5JIBA 5DJ5A 4B0PA 3TJMA 1XZIA 3EF3A 4W1QA 2VEOA 2DCMA 3FYUA 3WIBA 4J0CA 1EINA 3H0CA 4AXBA 3DL4A 4Y2PA 3W06A 4DNPA 4MQLA 4UHEA 3HJUA 5AO9A 1IUNA 5AKYA 1XZKA 1ETHA 1R9NA 1R50A 4DSZA 3DLTA 1CUHA 4G4IA 2WIGA 4Y2YA 4AN0A 1O6GA 1LPBB 1WB6A 2QS9A 4BVKA 4M0EA 3STYA 4Y2TA 5FP0A 2EEPA 1XZJA 4L9AA 4K2AA 3JW8A 2ZJFA 2Z8ZA 2EDAA 1A8SA 4GBGA 3ZPXA 4NZZA 4KACA 2HDWA 2ECFA 4MYDA 4AQDA 5LKRA 1W76A 2H7XA 3H1BA 4GI1A 1J1IA 1DQYA 2Y2VA 4BAZA 3QH4A 1QTRA 3WK5A 4MWTA 1YSCA 4J0DA 1DQZA 5T4HA 2QVBA 5ALEA 5DYWA 2WFZA 5CURA 1XLWA 4BTVA 2OAGA 4GW3A 1EXWA 5EHQA 1EK2A 3GBSA 2VJAA 3GA7A 3BJRA 4IO0A 3DD5A 3B3QA 1ZI8A 2DQYA 6YASA 4AMYA 4BRSA 3C6XA 4B83A 1GPLA 1NU8A 1MO2A 4LXIA 1CIJA 4KE6A 4Y2JA 5C7YA 4ZV9A 4HTAA 1EA5A 1N1MA 4CIBA 3T4UA 4G9EA 2XQIA 3C45A 3IUNA 2JEZA 3CCCA 3DOIA 2VF2A 4GWLA 2HU8A 3W9BA 1EB9A 1JJIA 2FJ0A 3MGAA 3V1LA 3M83A 1EI9A 3HYSA 2O2IA 4H77A 5AI0A 2ACEA 1E66A 1U65A 3BDVA 3G7NA 3IBTA 2HFJA 1CUYA 3UUFA 1KEZA 3TRDA 3OURA 5AM4A 1K6EA 3LP5A 5AKKA 4QZVA 5JATA 4E14A 1QGED 2WQZA 3TEJA 1ZD2P 4QA9A 5ALHA 2GZSA 4KRXA 4LXGA 5C8ZA 3T52A 3G0GA 1JMKC 3IUMA 4UUQA 1JT2A 1WM1A 1QIKA 2FUKA 2HHAA 5DNWA 4BYMA 2AXEA 4G8CA 1AZWA 2Z5GA 2QRUA 2Y1KA 4G1FA 3V1NA 4JYMA 3ANTA 1UOPA 3SWWA 3STTA 1HQDA 4MEAA 2JBWA 1E5TA 4KE7A 2J4FA 4H0CA 3B5EA 3FNBA 1LPSA 5AK4A 2ZSHA 4QWMA 1VZ2A 1XZCA 4IH4A 2WG0A 4ZXFA 2V96A 3KD2A 3STWA 4Y9SA 4BCCA 4B9EA 1QIJA 4G5XA 1ISPA 5HF5A 2QJRA 4IH1A 3WKBA 4LKOA 5JAOA 1XLUA 1H2WA 2PSDA 1XFDA 5AIAA 2V97A 3U1TA 5ALMA 2AJ8A 2BUCA 4B80A 2WM2A 4Y7DA 1CUDA 5I9IA 4Q82A 4CCYB 1U8EA 3DQZA 3OOSA 4DMKA 1DT5A 2OCIA 2PSHA 2Y6VA 1TCAA 2VQ6A 1IVYA 1L7QA 3C8DA 4GXNA 5ESRA 5LIPA 2D5LA 3E4DA 2OCKA 1E8DA 1X2EA 2GYUA 1EDDA 5HQ3A 5FLKA 1M33A 1ZICA 2YXPX 5HK9A 5JALA 3K2IA 2DQZA 5T4FA 5JADA 4C88A 4X95A 4BC0A 2RAUA 4FBMA 1G66A 1EK1A 1XQVA 3NGMA 1A8QA 1CUFA 5HK8A 3O9VA 2PSJA 5F4ZA 3YASA 3R3ZA 3VJLA 2OCLA 4FLFA 1QFMA 4DMFA 3PF8A 3PICA 4UFPA 2HA0A 3G9ZA 4UBLA 2VTVA 4CCYA 4Q34A 5ALPA 3PFCA 3HI4A 1W6RA 1I6WA 3ESAA 1LNSA 5HCUA 2HIHA 3QYJA 3FOBA 4XJVA 4KJXA 3A70A 3WL6A 2WFMA 3AIOA 5AKIA 5ALQA 4KRYA 4BZWA 5K3FB 5CBKA 2C0PA 4X7BA 4BCBA 3KXPA 3IIIA 2C5GA 3MVEA 2OQVA 2G4LA 3DKRA 1BRTA 5ALSA 5AI6A 3WKDA 3ED1A 4ROTA 3QVMA 4WFKA 4M0FA 1VOTA 4C4ZA 2WSLA 5D3ZA 1Y7HA 4J0HA 5AM3A 3IULA 3WK7A 4EHBA 5ALUA 4C4XA 4NVRA 1ZD4A 4Y2SA 2ZVDA 3ILSA 4JNCA 5FXMA 2HU5A 4HXFB 4CG3A 1K5PA 4H7HA 2HA7A 1B6GA 5K3EA 1UKAA 1R88A 3IUJA 3PUHA 1LPOA 4QWWA 3FWHA 5JAPA 4L0CA 2W22A 2GBGA 4A5SA 4K6KA 4DIUA 2WG2A 3OPMA 2XMSA 2HA2A 3MUOA 5D3KA 1E3QA 2DFPA 1VXRA 3VKFA 3LLCA 1XRLA 2BGNA 2VJBA 3EQ9A 4UHFA 4OPMA 5AM5A 3C6ZA 4NS4A 5AK6A 2O7VA 3WKEA 5J3JA 4ZREA 4ETWA 1H2XA 2O7RA 2OLEA 4G9GA 3BDIA 2OGSA 1CPYA 1MNQA 1VKHA 4BVLA 2GBCA 4QE3A 2CMFA 2XQGA 3FLAA 4P08A 1IZ7A 2WTMA 1XZAA 4J0GA 1R9MA 3D2AA 1ACJA 3FCYA 3WL5A 1CQZA 1CFJA 4H18A 1CUXA 1XZBA 5A7HA 4AMZA 1YS2X 5KWIA 4TGLA 4QLAA 2PUHA 1MAHA 5FOQA 4J3JA 5KBYA 1Y37A 1MPXA 2OXEA 1YB6A 4I3FA 4IH9A 4HXEB 2R8BA 4B7ZA 4XIIA 2RHWA 1G4HA 2BUAA 3FLEA 5EFZA 3EIOA 4EA6A 3F9CA 1YS1X 3HACA 5AKLA 1SCKA 1JKMA 2C4HA 4JEIA 2HRRA 3AZQA 5AK3A 4J7AA 3H2GA 1VZ3A 1BROA 3X3HA 2XMZA 4AZ0A 1XRQA 3QMVA 1HL7A 3R41A 4X6UA 5ALNA 4H7EA 5LLSA 2YASA 1XQYA 2HM7A 5ALZA 3O4HA 4BVJA 2WIDA 2DSNA 4D9JA 5LZ9A 1C4XA 1UKBA 2QKYA 5FV4A 3C70A 2XLCA 1GXSA 4AO8A 4CG2A 3AFIA 4OD0A 4OB7A 2WHRA 2JF0A 4DMCA 5IVIA 3CN9A 4DGQA 3IDAA 3HXKA 2C0QA 2WIFA 5AP9A 2B9VA 4LHEA 3I6MA 4NMWA 1UK8A 2WILA 3H19A 4UBMA 4FNMA 2AJCA 1VE7A 1XLVA 1XZMA 2QUBA 2WKWA 3D2CA 4Q3KA 3I2HA 4A23A 3EBLA 1UXOA 5ALRA 3S2ZA 5AIBA 1ZJ5A 4INZA 2IITA 2WJ3A 5E4JA 3L1HA 3C8HA 2VJCA 4DNQA 4PO3X 5AKHA 4F21A 4Q3OA 2XUPA 4CFSA 3OG9A 4PQEA 1O6FA 4DNOA 4KAFA 2XQFA 4QDTA 1UOQA 1WHSA 5AM0A 2PBLA 3WWCA 2XUAA 1JJBA 3V1KA 5DTJA 2VA9A 5CH5A 3M82A 3V9AA 3C5VA 1QIGA 3H1AA 1MN6A 4P93A 3WKAA 1CEXA 3N0TA 4XWGA 5JAUA 3AILA 1EH5A 2JGEA 3WWDA 1BN7A 2PM8A 2HA5A 3IA2A 5ALKA 4RE6A 1XZDA 5AJHA 5ALJA 4UPDA 5JANA 4BP8A 1EDEA 3A2LA 3KOOA 1CVLA 5FUMA 4X6XA 5CH8A 1DX6A 4FWBA 3FVRA 3L1JA 4C4YA 3RLIA 3ICWA 1F6WA 2WHPB 1W75A 4WCVA 1GPKA 4J0JA 3AIKA 3W04A 3DJYA 1YB7A 2CUTA 2RHTA 1GQRA 1N5RA 4X6YA 4BBZA 5CXUA 1VA5A 2HA3A 3NOXA 4LIPD 3K6KA 3WIOA 3WJ1A 5KWJA 4QDXA 3BF8A 3STXA 2WU4A 2OGZA 4DYHA 1UFOA 3E0XA 3LCRA 1PFQA 3DEAA 4QDZA 5HZGA 1CQWA 4F0JA 1FFCA 4B9AA 5CTAA 1DINA 2VT7A 3KWFA 3QPCA 4FKBA 3SX4A 1YR2A 3I6YA 4KEAA 4B81A 4DNFA 2D0DA 4MJ3A 5AKZA 2XUHA 2O2HA 3AJAA 4MQMA 1CUZA 4EB0A 3ZLVA 2JGLA 3FAKA 4K6GA 3GZJA 2VAXA 3WQHA 1X2BA 5AICA 3G0DA 3EQ7A 5E4YA 3H2JA 2VT6A 3O4JA 1GKKA 3WMRA 3M3DA 4FFWA 1G5FA 1YCDA 1AUOA 4N5IX 1RP1A 2WG1A 3QZUA 1THGA 1WB5A 5AKGA 3EQ8A 2OG1A 3DOHA 3JYHA 1UK6A 2XMRA 5YASA 4OSEA 1YAJA 1HPLA 2WUFA 2RGUA 5EIEA 1E8NA 5EIAA 3NUZA 1YAHA 1BN6A 1ACLA 3MUNA 4WFIA 4EY8A 1MX5A 2X76A 4IQ4A 3R0VA 2Z3ZA 1C7JA 3F96A 2ES4A 1TAHA 3O95A 3AZPA 1U2EA 4FOLA 1ODTC 4G4JA 3VVLA 4UHDA 1NX9A 4P9NA 1W1IA 4MWSA 3UMJA 1AX9A 5AOAA 2DHEA 2QUAA 4PNZA 1QONA 2XMDA 1FFAA 4ZV7A 1MU0A 1LZKA 1DWPA 5A7GA 1KU0A 3STVA 4Q3LA 1XQWA 2E3JA 4LYEA 2WLSA 1K8QA 5T4EA 2PU5A 1XRPA 4I4CA 4Y2VA 5IVDA 1THTA 5ALTA 4YX9A 5SYNA 3VVMA 1BS9A 4RE5A 1VA4A 1CV2A 1Q0RA 4Z49A 2OGTA 1H2ZA 2RIPA 3PE6A 4J0IA 4GDMA 2O2GA 2WUEA 1EVEA 5IKXA 1LZLA 3I2KA 1UK9A 3IURA 5BWCA 1VXOA 4W1SA 4FLEA 5A62A 4TPKA 4AX4A 2PPLA 3NWOA 4WY8A 1P0QA 4FLMA 5JZSA 1H2YA 1Q0ZA 2ROQA 1QIHA 4TVKA 1YA4A 5FPPA 5DNVA 2QXTA 3I2GA 4EBBA 5EGNA 3QMWA 4JUIA 3A6ZA 3H04A 1JJFA 4FDMA 4EY6A 3C6YA 4HXGA 2BGRA 1P0PA 1ZIXA 1ZI9A 1ZIYA 5I8PA 4EY7A 1ZD5A 4MEBA 3WWOA 3O0DA 2CEKA 4PW0A 1FJ2A 5HF8A 2XUIA 4ZI5A 3RKSA 1ORVA 2JIDA 3RARA 4E11A 2XDWA 1RWQA 3F97A 3BJMA 2OQIA 3F98A 4G4GA 1F8UA 4BZZA 1Q84A 1WB4A 5DYTA 5K3CA 5AOBA 1RYYA 2B61A 3FBWA 4C01A 1TKRA 2FX5A 4GLBA 5SYMA 4DLNA 4B82A 3HEAA 2XUGA 4GEGA 5CT4A 1OILA 3I2FA 1LBTA 3WYNA 1B41A 1D07A 1BEEA 3GFFA 5H3HA 3G9XA 3G0IA 3JWEA 2XUFA 2XUOA 4P92A 1GZ7A 3R3YA 2XI4A 4BAUA 4RNCA 5CRIA 1LPNA 1VJ5A 1AMNA 3DCNA 3H2KA 3I1YA 4HS9A 1H23A 4BRZA 4K5QA 3WI7A 1N8SA 1CUUA 5K3FA 4UHBA 4OUKX 4PSCA 3WZMA 1A88A 4X94A 1DU4A 4Y2UA 3HABA 3WA6A 5EHXA 4IHAA 5A6VA 3WWPA 2WUDA 1J2EA 1LPPA 4PSUA 3QBJA 4JYPA 1H22A 2CKMA 2XQJA 2ZYHA 2P8SA 4N5HX 5AI9A 3WK9A 4H7KA 1GGVA 3D3NA 1JFRA 4L3WA 5ISMA 4OB8A 1IUPA 2LIPA 4OYLA 3WJ2A 5LZ2A 4EY4A 4BCDA 1Q83A 4LYDA 4DM7A 4U2DA 2OPHA 3HLKA 5K3AA 5LYYA 1ODCA 2ZSIA 2G5PA 2H7YA 3ESCA 1CUIA 2QM0A 2Q0XA 4I19A 3IUQA 3OC0A 4H7FA 1TCCA 2RONA 4FNGA 5AKJA 1QO9A 1LPAB 1ZI6A 5AI5A 4XVCA 1C7IA 3DDUA 2WFLB 2AJBA 5EI5A 4X90A 1R1DA 3CXUA 4X00A 2WU3A 1QO7A 2PUJA 1VLQA 1XZHA 2XMBA 3VXKA 4UBNA 3BIWA 5BOVA 3DKKA 2XUJA 1AURA 3BWXA 4WDQA 1QOZA 4BTLA 3V48A 3KSRA 5AHXA 1TQHA 1EHYA 5JD5A 3HZOA 1QZ3A 3C87A 4UFNA 4HAIA 5AOCA 2QR5A 3FYUB 3QMMA 2QXUA 2B4KA 3PFBA 5ALXA 1CUEA 3A2MA 2BJHA 5T4BA 4QNNA 4ARBA 4DTCA 4HZGA 1MT3A 1W4LA 2H7CA 4K6HA 4PF1A 4FBLA 4QDOA 2H1IA 3AIMA 5CT8A 4OB6A 2B20A 4GECA 5IVHA 5ALIA 1IZ8A 3E3AA 4FFVA 3FSGA 4B6GA 1HBJA 5IH7A 4QDUA 3STUA 3QPDA 5C8VA 1EX9A 1FFBA 2W6CX 3R3VA 4C6HA 2PX6A 3SK0A 5CT9A 2J3DA 5HKBA 2XQKA 4E15A 3GROA 5BWBA 5CT5A 4KE9A 1JU3A 2HU7A
chains in the Genus database with same CATH superfamily
1W5TA 3N0WA 4XOUA 4ZA2A 2ENWA 4HGRA 5JBIA 1XZEA 3KSZO 1LVGA 1W96A 2C77A 2R96A 2L82A 3MTBA 1FMJA 2WMNB 1HZZC 4XUCA 2PXHA 4HNUA 3GN1A 2ZE8A 4UHCA 1KAHA 4E22A 4ZGBA 4BJHB 2JH9A 2V7TA 1XSEA 3QVLA 3A0UA 3NIBA 1NA5A 3ZHXA 5DT2A 3WYFA 4FSXA 3ZX4A 3MJRA 2JGDB 3IEXA 4NG4A 2DKFA 2OBNA 1ZMXA 1GDDA 3AF2A 1P5ZB 1M74A 2QUJA 4MLDA 4MS4B 5E6UB 5ALFA 1GZDA 2JH3A 3HJAA 2FQ1A 4L6IA 2GEJA 3C0KA 3SBOA 4CJXA 3ENKA 1FLVA 1N6LA 2IF2A 2BMJA 4BAGA 2XWPA 1VHLA 3BWBA 3RVQA 1GDTA 4ARIA 4K9DA 2BLNA 1SQFA 3OVMA 4TRMA 1N32B 2DTEA 3GQBA 1OIVA 3BWMA 3DEZA 5CXXA 2X9LA 3U3OA 3PQ7A 2CYCA 1P9RA 3I39X 4MW4A 4X66B 5AKXA 3HMKA 1QF9A 3TL6A 3Q5DA 3FB4A 5JASA 2PYIA 1SUIA 3L02A 3TD9A 2V03A 1Z2AA 2JCVA 2YFKA 3G2MA 5I7HA 5FWYA 1E89A 1SC9A 1X9IA 2I34A 1LDYA 4CQMA 3CJQA 3LDFA 3SNHA 3K9BA 5LA6F 1GU1A 3V34A 3V00A 3DWGA 4M0CA 4OHUA 3H5IA 3EEFA 2A57A 2IX9A 3EGVA 4OH1A 5TY0A 3BMQB 5GZ3A 2ZRCA 2FQQA 3K9WA 4CRWB 1X7DA 3S7TA 4ESOA 4QRHA 5IJZA 4DR7B 2HO4A 4LXUA 3OIFA 4H59A 1GIAA 4DVJA 1H0SA 1HY3A 2GRJA 3WK4A 4DMLA 2VCYA 1C5KA 1E62A 3V4SA 4Q7KA 3WO0A 4OHFA 1ZM2A 3UUWA 1J06A 1D2NA 1JV2B 2G83A 4Q3DA 2QGZA 3CNEA 2NXCA 3PWTA 4E3ZA 4G0OA 5FNVF 3A9UA 5GJWC 2ODAA 3CWQA 5A3VA 4D26A 3IP1A 5KREA 1F20A 3BE6A 5DWDA 4TUYB 5TR9A 1J49A 1XVAA 3SMQA 1ZR4A 3M3PA 1XJ5A 4GRIA 3IT3A 1HKHA 2CCGA 1VLZA 5JSUA 2HF8A 1Z68A 1C1HA 2INGX 3IVXA 1QP4A 3V4ZA 1U2GA 3FMFA 3WBBA 1J23A 3UK7A 4K05A 4AKTA 3GAAA 1SVIA 1W9MA 2R4UA 4K8OA 4XRRA 3I9OA 5FORA 2R6JA 4NFSA 4TVOA 3TLGA 5DGXA 3RVBA 2YXEA 4BYGA 4A6PA 2Q3HA 3FKSA 3NCTA 2X8LA 4G3XA 2XNJA 4H4EA 1EGMB 4JQOA 3WBKA 4BP9A 3O90A 2HRQA 5CX1B 5BQFA 2NQ2C 1DX4A 2IZ1A 2JJMA 3R3WA 4JQCA 4UBIA 4HMQA 1KI2A 3RK4A 4EG5A 4EMSA 5KOHA 5A71A 3BM5A 4XB1A 4FC6A 1NRIA 4MW0A 5CGZA 4BV2A 2EF0A 2BEUA 1RQRA 1W6UA 2NQTA 1TKBA 2JGIA 4MVJP 4UHHA 1MW9X 4YIKA 3S40A 2FLWA 3ZQKA 4YREA 4ACBA 4DV6B 1F8FA 1QHYA 4ALMA 5TQ2A 1KFCB 2Y71A 1IU9A 1K88A 3BF7A 1E4VA 4Q0MA 4U7JA 3SICE 1SELA 2R79A 4O2BA 2HMSA 3VH3A 4BLQA 1IMJA 3ROXA 4DV7B 4C7OB 1H6DA 3QVGB 4YJKA 2HJRA 1L4KA 1QLWA 1U6JA 1GTL1 1ZCJA 3HUUA 4WBSA 1YD7A 3M6UA 2I55A 3PUIA 3IKLA 2P2NA 4YCAA 2PGLA 4A10A 5A5VA 5B64A 2NP6A 4EJ2A 3PITA 5B1HA 1KH2A 3TD6A 3I28A 4CLRA 1REQA 1TQDA 5AVSA 4J0KA 2FR8C 1QPGA 1ABBA 3JRXA 4LZNA 4G24A 1SR8A 2ANCA 3WDSA 5D2CA 3H42B 3DNFA 1PCXA 2QQ5A 1Z7YA 1WXIA 2DWCA 1ZC4A 2HT6A 4WMLA 3X2EA 2FX3A 3P0FA 4E33A 4F45A 6CHYA 3FF4A 2K2QB 1X14A 4B6RA 3QKWA 5CNJA 4YRFA 5TGDA 5L3ZA 1TQ2A 4HZUB 3VX4A 3AF3A 5JNSA 2E5FA 1XAGA 4N9WA 4CIWA 1ZJYA 3M81A 2WHPA 4HO1X 1NUAA 4M9XA 2CMHA 2X5XA 3WGTA 3MYRA 2V7UA 3NR2A 5KCMA 4RMNA 5F5LA 1DZIA 1KJJA 2PR7A 2WAMA 4C6RA 3HSSA 2RHGB 1QBKC 5L95A 4ESEA 4RF2A 3JQ7A 5EQFA 1YJ5A 2NYRA 1EP3B 4ZVKA 4L5CA 5KTOA 3TM5A 1EBBA 4RZUA 1LUAA 4FUTA 4EUSA 3JASB 1A50B 1S3FA 1Z0KA 5I7RA 1U8ZA 2A9RA 3HA5A 3RU9A 4TV9F 1SCQA 4XGNA 2NN3C 3U7HB 1SK9A 2W00A 1SUAA 3EWIA 3GPBA 3PUJA 2P3LA 4K3VA 4LBWA 4WACA 2WP8J 3PV0A 4S2UA 3WLEA 3O4GA 1X3SA 4ROSA 1N6OA 1TVKA 2FHPA 3E27A 1IBMB 2I3DA 4MVJF 1PI3A 1OFGA 4FNAA 5LQRA 4O3MA 4MXDA 4QNMA 1O57A 5IG2A 4Z53A 2QYHA 3G0BA 1PZEA 2H16A 3G0CA 1IRIA 3AW8A 3JD3A 2XT6A 4UNQA 5EKDA 2NX2A 1T1IA 2Q50A 5LDGA 2AOUA 3K0FA 1SU7A 1U98A 4WECA 4S3MA 5EHZA 5HVNA 3C43A 3K6SA 5K4AA 4YDHB 3Q3VA 5E1OA 3QXCA 1FTQA 1RAGA 2K6GA 1AKNA 2V0CA 2JCXA 3CLVA 5IF9A 2XITA 4KQKA 1LA2A 4Y9RA 4HBZA 3L9XA 5LP1A 4W5JA 3I58A 3KKNA 1QB7A 1L8OA 3THYA 4NESA 3PFIA 4UOQA 3QVTA 2HHLA 4ZO6A 16PKA 4Y6GB 3RFXA 1ECLA 3H5OA 1ZK4A 4BNDA 3O9MA 2Y0EA 4UREA 4L8WB 5IBPA 4HR7A 5D3QA 1Q20A 1QIFA 1I2AA 1QKKA 1UEJA 4GZ5A 4OU5A 5K3BA 3HCPA 2E4VA 2OG2A 3DV0B 1G8SA 3CB4A 3BZBA 2CFOA 4WI1A 3MIZA 5I8ZA 4LC9A 2VBIA 4D74A 4MUJA 2DFLA 3CEJA 4V0NA 5ALVA 5HFNA 2JLBA 1C4KA 1YNSA 2G04A 3KKZA 2D62A 3LBNA 4JELA 4ZP1A 5DCYA 4CKWA 5JQGF 5LP6F 4RLQA 2BFAA 3DOOA 1G3QA 3OFJA 1MC4A 4R9UC 1T2VA 1MO4A 1ML3A 5ENDA 4EY5A 3ZY4A 2Q4BA 2PCJA 3K70C 3NM4A 2CKDA 2OB2A 4U1RA 2JKYA 3FOAA 3HO8A 5AW1A 2RGRA 2RFLA 1XALA 2ZJ7A 1R3DA 1L5QA 3L0SA 4PCAA 1KTVA 1SHTX 4IV0A 1CUCA 1Z4PX 2RC5A 1LK5A 3IVRA 1VRVA 3G02A 2EW1A 4C4OA 1CEYA 1ZGBA 1AN0A 1EJ0A 2DHDA 2WC1A 4RYDA 3LX4A 2DPXA 3ZXUB 4PHGA 2W58A 1WLYA 3LO5A 4PLCA 1S89A 1SXJB 1U0JA 4XIYA 4D6YA 1DJMA 1YRLA 4E1BA 2V6IA 4CMEA 3DYIA 1MT0A 2A1UA 4MLPA 3TR5A 3K20A 1QHGA 3BH6A 1AKEA 2GCOA 3K0AA 1V3TA 3W5DA 5T3UA 3IE0A 5GIPE 4LBYA 4C76A 2NSLA 5GTDA 2JGMA 3C24A 2RAFA 4GRAA 1IXRC 1T4GA 1TMGE 5LPNA 3D8NA 5IVKA 4CM9D 3SPXA 4CTNA 4MR9B 5JXIA 2UVPA 1C1XA 3EVGA 1D4FA 1TI7A 3R3JA 4LF8B 3P9IA 5JI2E 4NCKA 4PYJA 1JMVA 1PWEA 4M37A 5DNUA 1L4GA 2WD7B 3ZJTA 2ZCJA 3DFMA 2RK4A 4LHZA 3AHGA 2BAGA 1A8UA 2ZIVB 3JVIA 4I5GA 4O5AA 5DBGA 1YF3A 3OQJA 5TB5A 1R66A 3TNYA 5EESA 2PGOA 3Q0TA 4J1SA 2QQEA 1JDVA 4XYBA 2VAMA 5ARDA 1O5OA 1U2DA 1W5FA 2H2FA 3NRJA 5DTQA 2VTBA 1L5ZA 2KWIA 3JRNA 3Q5EA 2F00A 1E69A 2ZJYA 3ND7A 4U02A 3AF4A 2C2OA 3B6IA 3LIPA 3VJKA 4Z4EA 2SHKA 4BQRA 2HPAA 2HJVA 3J7AC 1Y1KE 3BYZA 3G79A 4MYCA 5FL7A 1FYEA 1SG0A 4NOMA 2UDPA 2PU7A 3VU3A 1GG8A 4B6JA 3AVOA 4X20B 2CFRA 4XDHA 5AK5A 2EJVA 3LQ1A 4LYJA 2QG4A 1U3DA 2PKRA 5AR1A 3AR2A 1E9SA 2BGWA 2OHOA 2DBYA 4F97A 1U0EA 4FUQA 5ALWA 1DXHA 5FTKA 2Q3BA 4IVNA 5JJCA 1EIWA 1A96A 3EQ6A 1EFRD 3RV3A 3CYFA 1U9IC 2YKGA 4JB0A 3SZ3A 4DLWA 1GN8A 2VJOA 1ISSA 4W7SA 1C7QA 4AC9A 2BSXA 4XWOA 1VI5A 2YJ4A 4KK3A 5LM3A 2YHSA 1H4QA 4RDCA 1FYVA 1NMZA 3SKYA 5FB3A 1QF7A 4NMLA 5KOJA 2L2QA 4TXNA 4BXOA 3KLNA 3OE5A 2JGFA 3QJYA 4N82A 5HEKA 3STHA 4G8DA 3U9TA 3WYGA 3VSEA 4CW7A 4DDVA 5EHNA 3O8OA 1DUVG 1L7AA 2PSEA 2NZYA 3HVIA 2VJDA 2H1LA 3ESQA 3SYKA 1RWKA 1SKUA 1JQBA 3Q41A 1YT5A 1SZDA 3E3MA 4F12A 1T91A 5C1DA 1PLLA 5IRCD 3T0FA 1AXEA 2JJ2D 3M6MD 2Z98A 1N5JA 4FOPA 1BEZA 1DAEA 1F8GA 2DZDA 2OZVA 3L6OO 2R0QC 3MJTA 2Z6VA 3R0JA 4FN5A 3NOVA 1A1SA 4HUQA 4TQGA 2C7RA 1MPTA 1THZA 5HR5A 1AQUA 3C5WP 4L4UA 1IBKB 2BRUA 1GQSA 2C2ZA 1EBFA 1Z5WA 1Z25A 2J41A 3BULA 2XUZA 3B2NA 3UAOA 3Q87B 2QW0X 4MPDA 4DJAA 3O1IC 1DCKA 5I5GA 2HFKA 1AMOA 1IIBA 1UWCA 4J1NA 4YGXB 1GPNA 4W1PA 2ONJA 3K9FC 2CV2A 1UJBA 3CRNA 1QMPA 4NMHA 1WMBA 1J8YF 1HE4A 2DBVO 4S0ZA 1XX6A 1MHTA 5B37A 2BKLA 1DEHA 2A0WA 1OIXA 3DT6A 3ROMA 1QIDA 3H4MA 3HC7A 2ZWAA 1WV1A 3RTEA 4CFZA 4PFQA 4CEJB 1AB6A 1A7KA 3CW9A 3E9MA 5JD4A 4N8DA 2JGNA 2GEDA 3OJOA 2QUKA 3EZ7A 1IDN1 3IVMA 2I2DA 4RVOA 1RI2A 4FHDA 1ZXXA 5DKFA 4OCZA 1OPXA 1GRQA 4MKIA 5FUWA 5B53A 4AJLA 1JG6A 1WBBA 1DG3A 4EI9A 1OFUA 2HRDA 4MCJA 2B35A 3FLBA 3P20A 1DKOA 1JXAA 5GONB 1RRPA 1ZOOA 1WMEA 3TFQA 4RPCA 3WAJA 2P9TA 2AFHA 4PO1A 5KWEA 4GYJA 3TLJA 5B1YA 4RH3A 3ZDAA 3AL0C 4BIMA 5D7BA 3GH1A 3V32A 3WLNA 3L8ZA 1MJ5A 5FQOA 2VJQA 2JFGA 1M7BA 2OO3A 2X9QA 3H4VA 4FXPA 5DYYA 3G0HA 3LH5A 2JCBA 4DZZA 1U1DA 3IEKA 4MVWA 2PK3A 3ZN2A 5I7UA 3DAOA 3VUFA 1QIEA 4HNQA 1WB9A 4B3GA 1FRQA 5FA8A 3A05A 3OZIA 2VJPA 3C4QA 1QJ4A 1H9AA 2QRVA 3LXXA 2N0SA 3SSAA 1SBNE 1YJBA 5KOYA 4QBTA 1FFDA 3KQLA 1G3RA 4R8KA 1PT6A 2HA4A 2ZWIA 3K31A 3U0VA 3O4IA 4S35A 1ADYA 1F3LA 1F0NA 3BGWA 3LY9A 1Q6YA 3W8FA 4RK1A 4CMIB 1RXEA 1M6NA 5FRDA 3BHMA 4HRVA 2CJPA 1U0HC 4M1QA 1IOVA 3AVTA 1ZIDA 4EGSA 1TM7E 4P83A 1Y81A 4YJHA 4ZEMA 2R7AA 5L8VA 1ORHA 3ER8A 2Y93A 3FVWA 2F62A 1V37A 1U3WA 1WZIA 4U2FA 2YZNA 4B1FA 5I3CA 5HWSA 2VRNA 1HDIA 2GN4A 5EZYF 3BMOA 5KTPA 3L41A 2GN1A 4LDRA 2YC4C 1KI8A 1N7JA 3KPUA 2ZVQX 1QFZA 1UZAA 4ZQCB 1YVUA 5ALYA 3F6BX 1BQ4A 5CCDA 3OM8A 2WJ6A 1BTOA 1H9BA 1QQ7A 2LCIA 2ACVA 3BIOA 4U5QA 3BJIC 3GRFA 4L2IB 3UV3A 1ZD3A 2D06A 2WMYA 1J56A 2YRFA 2RDMA 1WLSA 4BMOB 4ZT4A 1NJFA 3W4IA 4W5OA 2BFEB 4F96A 3H2ZA 3T7JA 3THSA 1FZTA 2HSDA 3D5EA 1T4BA 3RS4A 1T1GA 3L92A 5LZ8A 2FG5A 1RHKA 3ACBA 4HVAA 2KYRA 3ES9A 1JVBA 1Z0SA 3ROEA 3VVBA 2EERA 3HVUA 1F4LA 3JSXA 1XROA 4KC0A 3TLBA 3OZSA 3UCEA 5JWRA 4MMYB 2XSZA 4QUKA 1WCYA 5BN4B 3D8UA 5F35A 3BZWA 1K7FB 2Q9BA 2ISCA 1KA9H 4JMPA 4LGVA 5KTNA 4U6SA 3EXIB 3JATA 2R8ZA 4B84A 1YHZA 4QELA 4NBSA 1I0ZA 3RVOA 3EG9B 3CLRC 3LVRE 4RPLA 3RWOA 3WRXA 5HXAA 4DA9A 3CEPB 1H4TA 4I1SA 4M36A 1J0AA 5CJPA 3NX4A 3S2YA 5EGSA 3T4EA 1HDEA 4ARZA 2M32A 3IMFA 3DB1A 4KYUA 4UZSA 4Y2RA 3M9XA 3B3JA 4K6OA 2HRZA 1TE2A 3VISA 2DTDA 3TBKA 5C5IA 2AEMA 4C2UA 1IM2A 5ADVA 1DKLA 2W2KA 3OQIB 4DCJA 2CW5A 3AHDA 4FR0A 2JIZA 1CQIB 2PUWA 4WNAA 3VYTB 3ENQA 4YYEA 2J07A 4M0MA 4OHPA 1ITZA 3CX8A 4X93A 3WLAA 4CNQA 4TKVA 1QO0A 4YIHA 2CHFA 4PNHA 1UC4B 4YCCA 2HQOA 1X7WB 2OBYA 3HEMA 3EIUA 2DTXA 3NFYA 3SHOA 5BWLA 1YIOA 5BSEA 4KVAA 4CG0A 1IQUA 3T7SA 1FVXA 5EYPA 4DADA 5KVAA 1TTTA 4YMLA 3LCJA 5HFJA 1C9JA 2ANBA 5IKPA 5H81A 1TZCA 1QE3A 4YNBA 3AUYA 1XMOB 4C7XA 4XX1A 4IIXA 2IV2X 3L1VA 4CKCB 4X71A 5L3SA 4D3YA 2Z2JA 1C7FA 2UUPA 3AHIA 3MQFA 4EF6A 3VV2A 3R9XB 1PNRA 3HUTA 2HQRA 1P74A 4PGMA 1PR4A 3GAFA 3HG7A 1AA6A 1I36A 3PB3A 2D8AA 5JUWA 1GRNA 3RS9A 1E99A 3P96A 3U7QA 1O9HA 2ASEA 4B76A 3QIAA 4PN3A 5CA1F 5LWQA 4HQOA 4X1KB 1LLFA 1OCEA 4RV5A 1GXSB 4AY4A 2YH2A 2OAEA 1X1EA 3UT5A 4PYIA 1DBQA 1Z4KA 2IY9A 2RGNA 3H17A 1VDMA 1PGPA 3S8MA 1X0XA 4FBGA 3UFXB 2GCIA 4X0EA 4ESHA 3FPSA 3O84A 1M2EA 1T8SA 2YWBA 3E9NA 1COZA 4HEHA 4Z9FA 3X1KA 4BGDA 3FHOA 4FYMA 3OTOB 1KMNA 3D4IA 2IEAA 3BTSA 1EUZA 3LT4A 1M73E 2AN3A 4OAOA 3TQTA 1QHHB 1SOMA 4IVRA 4LXXA 1EESA 4MRAA 1ICEA 3LGSA 3CMCO 3RO7A 2GYVA 2FJPA 4HEJA 1ONBA 3T35A 4OLBA 2Q7XA 1UZLA 3SGLA 4GT1A 4B3RB 4EB3A 3NYIA 1JAYA 5A1JA 1FSPA 3JYQA 4UQOA 1U8YA 2ID8A 3V8QA 3PEVA 1HFJA 2HXYA 4M89A 4QU0A 5HS6A 4QOEA 1DDIA 4WY5A 1H8HD 2UKDA 4UUNA 3R7BA 4NAUA 5EJ8A 2ZBVA 1T25A 2P4SA 2BTQB 5LYJA 2V98A 1M5UA 3EMKA 1VHJA 1Q16A 2PL5A 4BDSA 4UNSA 1UXKA 5H02A 2WHQA 3QLTA 3G49A 3QEAZ 2YHIB 2FUNB 3TB6A 1QANA 1JMYA 3FR7A 2NWQA 2WHEA 4QXRA 3ZU5A 3ZWOA 3BE8A 4Q01A 3R74A 3MK31 5K6AC 3G0OA 4NICA 2MSCB 3R09A 4ND8A 3BS4A 2AB0A 3NTUA 2GM3A 4I4TF 1TM3E 5EJEA 4KXVA 2W8ZA 2JGRA 4QT0A 2R25B 4MIKA 2JEYA 3T06B 3VDRA 3ZWBA 3B6ZA 3DS8A 3ZWNA 1U0LA 2BMAA 1MA3A 3OMXA 4G0WA 2OKGA 2H5LA 1IZ9A 2PSFA 4BFTA 2B0CA 4P7JA 3PIRA 4XM1A 3P26A 3ZGNA 1VYTA 2CHEA 2UZAA 2YZ2A 4F56A 2X1LA 1W93A 2QD3A 4HDNB 5DHSA 5A7FA 2W2VA 5DRTA 2O48X 3L01A 1XHFA 2IOHA 1U7PA 3O93A 1O2DA 2H29A 3I2IA 1NQVA 2K87A 1PJAA 2R65A 2RGAA 3ETHA 3OUZA 1MGPA 2ONYA 1DKRA 3IOBA 2O2EA 1ZRMA 1XRMA 4UEQA 4DF3A 4PLVA 2G7MC 1UWLA 2FMXA 5BWMA 2FMKA 4HC4A 1G8PA 4GM4A 3RTCA 5BQ5A 3NGXA 1E3WA 5DJ5A 2BKUA 3PL5A 2ZROA 5E9AA 1VMAA 4HQFA 4XUEA 4A0RA 1N75A 1Y6JA 1PRYA 4Z6KA 3FHCB 5KOIA 2DCMA 3WIBA 2Q2WA 4W5NA 1NATA 1WXXA 1NL3A 2AL7A 2CN1A 3B8HA 3HY3A 2CHVA 3HBFA 3NTXA 3VYRB 2OBMA 3FFBA 3IR5A 4BVHA 1IVNA 1M2JA 5J5CA 1IBSA 2J33A 4BNFA 1PF7E 1KZ7B 4Y2PA 2UYOA 5HKOA 5FI5A 4DN6A 4DZTA 3TTSA 3P0RA 3CY6A 4XIFA 3KT0A 2IBTA 2DWOA 4OGKA 5A0FA 4MW6A 2FOXA 1Y5LA 4JLKA 2FZCA 3N7TA 1PJ2A 1IUNA 1YS9A 5AO9A 3UZUA 4ZYUA 5AKYA 3W9YA 1V1RA 2ZB4A 3GMDA 1W8DA 3TLMA 2BSQA 1BMTA 1R50A 1SC3A 4DSZA 2WE7A 4RAOA 1NULA 1KS2A 2NZJA 3RT1A 3L84A 1VLLA 1XAIA 4GMHA 5K45A 5CTJA 1DPGA 1CUHA 5EHGA 2IYQA 4OLHA 5IKEA 1VJRA 5AHKA 1TCVA 5BSUA 3ABRB 3ZC3A 5BN5B 1XU9A 4EG1A 3DD1A 4JUDX 1GNTA 3OX3A 4KTTE 2XGJA 1SZCA 3FFAA 3HFSA 4UUAA 5I9TA 1Y48E 2AG6A 4U0KA 1S6YA 1W4RA 1YS6A 1EG2A 3D2LA 5CT8A 4BVKA 3VR1A 1HEUA 2LIVA 3HR7A 3N74A 1W4ZA 3F3YA 4OJMX 3GB9A 1VYHA 1KWKA 4MHSA 5CM9C 2REBA 6ABPA 5FP0A 4X84A 3SX0A 1S4QA 4JLJA 4MO2A 2EEPA 3ORHA 1J42A 1VTKA 4HUJA 1LC3A 4MLCA 4YECA 5C1PA 4MRMB 4OXXA 5FO1A 4MRSA 3QK7A 5ULLA 4YUZA 3RSZA 4B79A 2W2NA 1UMKA 5IXSA 3IIKA 5KX5F 3S0JA 1THMA 3U3KA 1AB5A 2F8MA 1QQ6A 2Z30A 3ZPXA 1BVUA 2DFNA 1BAPA 3HEBA 3P9YA 4IX9A 2ECFA 5HJ5A 4GLJA 2I6FA 3RVMA 4IHJB 3ETDA 3RSQA 2OXIA 2W0SA 1JILA 2J5BA 3OOHA 3HO6A 2BD0A 4OFZA 3KAKA 2FWBA 3R20A 5DM60 3L6CA 5REQB 5T6MA 2JGDA 2DU8A 1J1IA 3Q3JB 5EJGA 3AOEA 3DZDA 1IJEA 1FQOA 1Y0BA 4MS4A 2OESA 4EX7A 2AFHE 3LNCA 1EFLA 1QK5A 3BQ9A 3IEPA 4OV6B 4BQQA 4ZEWA 5JDCC 4O4HF 1JHVA 2E2WA 2OE2A 2HMWA 3IMGA 2CNBA 4NCBA 4MWTA 2Q4DA 2Z9DA 3KS9A 5DCUA 1K8XB 3MB5A 3ADKA 1PJLA 2B8WA 2B4YA 4RPGA 1PHRA 4IFIA 2BV3A 2GRUA 4QL3A 1M1YE 3FGNA 3RK1A 1ZJJA 2X8JB 3RRZA 3D6AA 4DBLC 1PWZA 1TL7C 4RSGA 3WY9A 1N9GB 4YAOA 1EFPA 2AI1A 3EY9A 4R69A 4LG1A 3G8AA 2I9PA 4R2IA 1JGTA 5DXAA 1G3UA 1RACA 3WHPA 1BS1A 3L18A 3EUEA 5IP5A 2O50A 2A8YA 2DBZA 3UICA 1DB3A 2EBWA 1JLSA 3ANXA 4FEAA 1N1GA 4H1UA 3IBCA 2WJIA 1CCWA 1WPQA 5EJ9A 1FTNA 1A9OA 5DULA 1I2MA 3NTRA 2J67A 1F12A 2JK1A 4I5IA 3TLXA 2EL7A 3ZZ0A 2GJAA 4KK4A 2IV3A 1MOQA 3V6MA 1GAWA 2DQYA 3B48A 3QU4A 4UUBA 4QDJA 3N2NA 5E7IA 4HDMB 4QGHA 1ZBQA 3EIFA 5DWQA 2Z2XA 3RBAA 1GPLA 1VCNA 1A5ZA 1C0EA 1YB4A 3LL4A 4NTZA 3UW1A 4YT2A 2XKKA 1BA2A 2IYTA 2QVGA 3PDUA 1GNRA 1VBMA 3KR1A 4K6FA 3EEOA 5K0TA 3SX2A 4HTAA 2GR9A 1N1MA 4Z1MA 1XVIA 4KQMA 4COKA 4CIBA 3M4XA 4J4BA 3K0HA 4TUYA 3N3BC 3RDPA 5I4IA 1GGEA 2Q9AA 3MD9A 4LZOA 3GGPA 4EB6B 1MQSA 2PJRA 4S24A 4XR9A 2EZTA 1GWNA 4OTZA 1OSNA 2QTGA 1L5WA 3DOIA 1JZSA 4WKGA 2P65A 3DEIA 3EGOA 1EBUA 4Z7NB 1K66A 4KO2S 3OZXA 1G1MA 1V26A 2I8CA 3SE7A 3VFDA 3QP9A 1JJIA 2OV8A 2JAWA 1CEQA 2WF5A 4WEQA 3I01A 5G3ZA 3AEUB 3V1LA 1WP4A 5CX1A 2E6KA 1F6BA 2O3QA 1MR3F 3H1GA 1TA0A 2AQIA 1UXJA 4MMZB 1FLDA 1QV9A 2ZWMA 4MP8A 1R0LA 4HWTA 3HYSA 5KJCA 1Z13A 2ZB2A 4PC7A 2B5WA 1U65A 5A3QA 3CNOA 5DSTA 1KVSA 4ZGGA 5BMVF 4TS4A 3G1WA 1ZRNA 4QHYA 2Y0BA 4CM8B 3IBTA 2HFJA 5L7TA 2GEUA 4DIFA 4G8JA 1FPMA 4K9LA 2BFDB 1KEZA 1QFJA 3C7CB 2R751 3NATA 3QVGA 5DH9A 1G8KA 3OURA 3TRDA 4BN5A 4RWZA 521PA 2QA5A 4HQNA 3TEMA 4NPCA 3LHIA 4DR6B 2H54A 2IPXA 5AKKA 3QV1A 3Q9NA 2W0MA 2PQMA 3IALA 4QZVA 3VGJA 3LBAA 4O2AF 2FEKA 2VJYA 4C2BA 4E14A 1D9ZA 3SIPA 3WLKX 1QGED 4WZ6A 1PT7A 2Y66A 1E0DA 2WQZA 5F7JA 3MMSA 4GF5A 5TMEA 3TEJA 3TIXB 1C0LA 1FYXA 4BV9A 1C80A 1NW8A 4JP3A 5KTSA 3TW8B 4A27A 1AK2A 2MSKA 1MRZA 2HO5A 2YC2C 1SHUX 3U4CA 1FNMA 1TA4A 4I50A 2RI0A 4ZJUA 5TARA 2CVOA 2QW1A 3MT7A 4HZUA 1PSDA 3VTAA 4IRXA 2BHTA 1ZHHA 1NAHA 1JMKC 3G0GA 3QTTA 4R2LA 2H2WA 1UBHS 1ENOA 1TYBE 2FPLA 2QQ0A 4FR2A 5LB2A 2C3UA 3U17A 4N3GA 5JEEA 1FDRA 2XYRA 1FQWA 2WWWA 1ZINA 3AWIA 4FCCA 3NHKA 1YE8A 3VC2A 3TQCA 4CIDA 1RC0A 2OZEA 3CIFA 3PCXA 2VDWB 3NC0C 8MHTA 3JASA 2QORA 1Y1QA 2GZDA 3TZHA 2WT9A 1FUEA 2WWVD 4YV7A 1NLZA 2Y1KA 4G1FA 1M8GA 4BP3A 2CXNA 1JDTA 3OC6A 2J5QA 4DR1B 3O75A 3CFYA 4NU8X 5JY1A 1NF2A 1XWIA 3ILVA 4D8YA 3ANTA 4RLHA 3TPCA 3O74A 1VL6A 2NXWA 2DC1A 1LK7A 3HCRA 5F64A 2G1JA 2ZTSA 2Z8YA 1JAHA 1Y3FE 3S27A 8ABPA 3HFJA 1BX1A 1UOPA 2AV6A 5B55A 4F8EA 1HE3A 2PMFA 3RNOA 3HSYA 3MS7A 2YMQA 2J4FA 1Y1LA 3F4LA 3UB3A 4RETA 2RJNA 2G72A 2RGBA 3FNBA 1VI2A 4G1MB 4LN1A 2FPRA 2O9JA 2PKEA 1AN9A 2X58A 3O8NA 4ZXFA 3KD2A 3UBMA 3I23A 4HH3C 3U4AA 4BCCA 2O57A 1RKVA 1U2PA 2BVNA 2DJIA 4JKYA 2TSYB 3HFGA 5FYQA 4G1BA 4Z9XA 1NRXA 1Z7BA 1XTVA 2VJKA 2HIAA 2QJRA 3DV0A 3LQRA 2NU8B 4CM4B 5H80A 3ZNNA 5PGMA 4JOCA 3OA2A 3SR0A 4NJOA 1LFAA 3OCUA 2J08A 4ZI7F 1DZ3A 2JJ1A 1BGXT 3GJ5A 3K16A 4W6ZA 2OZKA 1T5DX 1A4IA 1CU1A 3P52A 1R8XA 1XFDA 4XEUA 2EOAA 1EXDA 1POXA 2HR1A 5EJ7A 4HQ0A 2V4ZA 4UDNA 4DYVA 1YDEA 1W2WB 1XTIA 2XJ4A 3K4HA 2QUHA 3ZVRA 5JMTA 2W2MA 5I9IA 3V8RA 4CPDA 3UJ8A 4IJQA 3OCCA 3MJEA 1L7EA 3L06A 3OLYA 5HTKA 1OXBB 3LQ4A 3T15A 1VHDA 1ZZGA 2ZCUA 3JYPA 4R8SA 4Z2YA 1XMPA 2AOTB 5DNCA 3OH8A 1XKXA 3H5NA 2OCIA 2ODNA 4B3HA 4ZI3A 1IPEA 1IVSA 1RMTA 4F7WA 4GKJB 5EWJB 2VQ6A 3JR7A 1L7QA 2WUWE 4O1IA 5AVJA 3VPSA 4GXNA 3HU3A 2B1RA 3BKWA 4FX2A 4KG7A 2Q3DA 2MDTA 3ETGA 2OXTA 2D5LA 4QO7A 1SIBE 2YXNA 4RU1A 4RTPA 1MOSA 1Y6ZA 3A6GA 1FS5A 2O07A 3MRXA 1Y9JA 3M6IA 2GYUA 4IDQA 4ATNA 2WWXA 2Q28A 2XAAA 3OLXA 4GVPA 4OSPA 4WFQA 4W8GA 5FLKA 1M33A 5F73A 6AT1A 1ZICA 2F90A 4MR9A 4A0GA 3GLGE 5GOTA 2XMPA 1IM5A 5HK9A 3TI9A 5IEJA 3M4YA 4IQ8A 2NZVG 3SJBA 1ESNA 4ENTA 2DQZA 2X15A 2ZETA 1YZQA 3CX4A 3HB1A 2D0PB 2PWAA 3DHYA 4FZ3A 4C88A 1U8CB 2WD7A 4BC0A 1EQAA 4JFRA 4LPKA 1AGXA 3GHHA 3QX9A 3NGMA 1KR2A 1ZK0A 2WM9B 2W2TA 3JZFA 4RD4A 1OMOA 1V1MB 1JW9B 2JKZA 1GYQA 3O0TA 3LHSA 3TWOA 1AXGA 1W5EA 2AI2A 4W82A 4YB8A 1O4VA 2PSJA 1WS6A 5F4ZA 4B46A 3JTMA 4BV3A 2WWFA 3EGIA 4KPGA 1L5LA 3HK2A 1I6MA 2E4ZA 5KNDD 4EGQA 1Y4ZA 5BV1A 1Q57A 1VP9A 3HXMA 2D5IA 5B58T 1HOTA 3VPCA 1O03A 5HBGA 1QFMA 4GP6A 1VMEA 3KZ1E 1DX9A 2ZBUA 3JARB 1Y6FA 3DV2A 1J2YA 4IDBA 1R0BA 2RKBA 4UFPA 1GA6A 2O2JA 4FYHA 6LDHA 2PYDA 4X20A 4INPA 4BFLA 2D7CA 4CE6A 4WXRA 2BN4A 4CCYA 5LXTB 4O1HA 5LQKA 2W2PA 5ALPA 4QQRA 7MDHA 4ZQIA 1U7DA 1H3NA 3BCUA 4FFDA 3IOEA 2R6DA 2EJBA 2Q49A 3QUSA 1TEVA 5EXTA 5BQPA 4YCMA 8LDHA 4EFNA 1B1AA 1QRDA 1S01A 2QL5A 3RC1A 4ZI2A 3FOBA 2ADFA 4WY2A 2A94A 1GZSA 2WNSA 3FTCA 2QAJA 5C4GB 4EUFA 1WD5A 1LXCA 1TUIA 2C9DA 2PN1A 1E59A 4FMDF 4MS1B 5C3UA 3ZZ1A 2AQHA 3PHBE 4KRYA 3D1LA 3DB2A 4HWPA 1ZZEA 2PNFA 2GOYA 1NYLA 3G2LA 4XSGA 5DNAA 5K3FB 3NT4A 1B15A 1E0AA 3AP1A 1SXQA 3KSMA 5COBA 4HH1A 2B99A 2HPVA 3W3ZB 2BR4A 2PAAA 2QYTA 1I80A 3D3KA 5LDHA 4RJIA 3D5QA 3FR8A 1C9NA 1QH1B 1J0EA 1F17A 2OP1A 3IIIA 4LA4A 2Z4RA 4XX0B 2C5GA 4NCAA 5DP2A 2G4LA 1G5HA 2PMKA 3DKRA 2ERXA 3AG5A 3GRPA 2OQVA 5ALSA 5FWAA 1RM4A 1KRWA 4YTEA 2OC9A 4PC6A 3LTEA 1PG5A 3JYOA 3O2JA 3THWB 1I7LA 1NLMA 4LMPA 4RVHA 1E1RA 2OMKA 3N6XA 5CLIA 2GXQA 2CBZA 1FUYB 3WK7A 1GT91 1XJCA 1L1FA 2WVHA 5JJIA 3K09C 1WULS 4FU0A 3AR8A 5LP6C 2XNDD 4CUKA 5ALUA 1CBUA 1Q0SA 4B8ZA 2Y05A 4RCVA 1F7VA 1H69A 4Q24A 2YXDA 4NVRA 4D57A 4EEZA 4KBYA 4RV9A 1UBUS 4JNCA 4Y6PA 4BFWA 3EPPA 2W9XA 3CLHA 5IZCA 4LWPA 1X86B 1C8BA 2YOFA 2VXBA 4MVXA 1T2CA 3EVZA 4I1YA 3BRQA 4I99A 2GJSA 5BMOA 1K5PA 4ZTZB 2PKCA 1NWHA 3LFUA 5SY4A 2HBYA 1B6GA 3PYMA 4OFBA 3WJAA 5K3EA 2G71A 1DC7A 1C2TA 5TV2A 4CV2A 4CEJA 1N3BA 3T94A 1WQ1R 2WF8A 3RUDA 1W0KD 3T9CA 3TLCA 4BO8A 5DGIA 4EFKA 2IUEA 3DVAA 2R7NA 3MOIA 1XYVA 3AHJA 2YZGA 2WKPA 2QTZA 2GVZC 2W22A 2AYZA 4BQIA 5GONA 3VOAA 4EMUA 4H0NA 4TV8B 4K6KA 3LQFA 3OIGA 3U80A 4YRNA 5F7ZA 5I48A 2DM6A 3RS3A 1TZJA 1J8FA 5TF4A 2BHLA 1RI3A 3P2KA 3SG0A 3Q10A 1E3QA 3K9QO 4BKPA 1VXRA 2EKPA 1KK0A 1QYDA 3EDCA 1XRLA 2GK3A 2ZT6A 4Z54A 2JIOA 3A2KA 3T9DA 3EQ9A 4UHFA 4MW7A 3ORRA 1KOLA 5KNCD 4OPMA 1VSUA 2MYPA 3UK2A 3X43A 1E32A 2IPMA 2XE7A 5ITVA 2QMUA 2I1LA 4ARUA 2ZBQA 4OHMA 4ETWA 8ADHA 3PEUA 2AT1A 3RJMA 1HTTA 1GN9A 1PAUA 5C35A 3DE3X 1XLTC 4GWGA 5TMDA 4CMIA 3NALA 4BO0A 1MOZA 3GA5A 3WIVA 4KKXB 4LVCA 4PCUA 3I4CA 5EMMA 4YACA 5CDUA 1Y4UA 1P1IA 3JQ8A 1W46A 3OFND 4WKBA 4BGUA 4ZDJA 3BDIA 2ZJ5A 1NF3A 5DNEA 4BQOA 3SLGA 1W44A 1ZK1A 1XA4A 2VHYA 3C3YA 2G70A 2V9PA 2AE1A 1C1DB 2BE7A 1P2GA 2FWRA 4O2BF 1GKYA 2AC7A 4UU1A 3BD9A 3DTVB 3BH7A 4P35A 3KQOA 1SBCA 3K1JA 4AZWA 5GINE 4QVIA 4DEVA 1IZ7A 1QE5A 3TXXA 1VKNA 3ZIAD 4OI2A 4BLSA 1EGAA 4MQ5A 4K9SA 1U81A 1XZAA 4L2IA 4KYTA 4IF6A 3FCYA 2HWWA 1YXMA 2FG7C 1XZQA 5J5VA 4BWVA 2N9UA 5LUAA 1GU7A 4BO7A 2WZBA 3DO8A 3C41J 4O63O 4LF7B 1P62B 3OWXA 1JDZA 2DWUA 4AMZA 1YFLA 4U7HA 1UJNA 2DUWA 3LKBA 4PGFA 2Q7OE 2YMPA 1PT8A 2AI3A 1C9EA 1DC5A 2ZP1A 5JS6A 2CLEB 3KVOA 2PRJA 3H16A 4DANA 1NOIA 1R0CA 1O94C 2WWTA 3QLUA 5CDSA 2ZR7A 5G1NA 1U0BB 1MAHA 1TLTA 2CXOA 3IQDB 4J3JA 3WSTA 4BX2A 1Y37A 5BN4A 2QSUA 1DAPA 2JLUA 3AX6A 1SXPA 3RODA 1CJKC 3GP3A 3EXIA 2XE6A 4NJMB 3PHGA 4TMFA 4DSNA 2ODEA 1YBMA 2ZS7A 1F2VA 3IFSA 3VOTA 5J4LA 3W5AA 5AW4A 3EG9A 3KQNA 4WJZA 4CF4A 2F9MA 3B6EA 1LH0A 4Q4DA 3U3JA 3W3AH 3CZ4A 1X74A 3T6KA 3W6NA 2EX0A 2VH2A 3K05A 5J59A 4U5XA 821PA 1YS1X 2QL6A 3H8VA 3OP1A 4LJYA 4MAFA 2AZMA 3L0DA 4K7JA 4KW7A 4XXHA 1BSVA 3C3AA 3DZKA 1TM5E 3OQIA 4MGEA 5CM8B 4FE3A 1S2DA 2FFJA 1CQIA 1JKMA 4XCVA 3OPVA 3EE6A 2C4HA 4CDNA 3KQUA 3HNRA 1GL6A 3ZY5A 4I1PA 1VRWA 1X8XA 2HU2A 3AZQA 2HJSA 1G20B 3FPGA 3H2GA 4J7AA 1BD4A 4P4SB 1X7WA 2C3PA 3PC3A 2WF7A 2OORA 3IAUA 1NPTO 4HRAA 2NU7B 4IJVA 4LNAA 4J07A 1Q0PA 4ZKEA 2QX9A 2ZK7A 4P5PA 1HL7A 2J85A 5ALNA 2UYHA 1DRVA 3L7LA 1IN5A 1G21B 3IT1A 3KD3A 1HQYE 4MR8B 2YASA 3CNLA 1XQYA 2HM7A 3NV9A 1ZM4A 4TL6A 5CX4A 5LLSA 1EZ1A 3T12A 4CKCA 3ZU2A 2W6OA 3ZWDA 2Y9PB 3UWKA 2C5EA 3GXOA 4JENA 2B1IA 5CDGA 2JPDA 4FYXA 4RANA 1Y4SA 4YRCA 3R9XA 4D92A 2XEXA 1JQJC 4KGDA 4WTOA 3JS5A 3A9TA 3T4PA 4B6EA 4F9FA 2FPMA 4PG6A 1MVOA 1RXUA 2DP4E 2ZQ5A 2BFPA 4HBGA 1J0DA 1JDBC 1UKBA 2GLUA 4X1KA 2BGKA 1F4PA 4B8YA 2M98A 3SQWA 1GXSA 2P5TB 1N25A 4S04A 1IN4A 3FUUA 3RFUA 5IDWA 2H1CA 2X3FA 5DK4A 3FNQA 4E5UA 1ZH4A 3AFIA 4OD0A 2Q1YA 3DWFA 3PXCX 4OB7A 3AESB 5JXHA 2G0NA 5KJ6A 4NFLA 1ILWA 1QS0B 2PRIA 2GHRA 3BX1A 3L46A 1E9AA 4OXNA 4D8VA 1VGVA 2BBTA 2WNHA 5DIZA 4DMCA 3W5CA 2XRMA 1VG0B 1X1CA 3CN9A 4JIMA 4DGQA 4JC4A 3ZDDA 2AEFA 3ETCA 4YWJA 3T5GA 1AVTA 2C0QA 5JFTA 2WIFA 3R0IA 3UF0A 2AC2A 1HL3A 1MG0A 3PNVA 4KR6A 4HXYA 1PR3A 1SXJE 3EWNA 4INJA 5KKAA 2B9VA 4DXHA 1AXRA 4U8GA 4NLLA 3V8EA 3ZGYA 3T9AA 3LUAA 3HLYA 4JD5A 2EVWX 1UK8A 2BTQA 4RYLA 4ZT3A 1WUTA 4Q39A 3TUIC 1OFVA 1YA6A 2YHIA 3CLSD 1WHTB 2AIRA 1VE9A 3M1YA 3ELYA 3R5JA 1PYDA 1SQ5A 1EVZA 4NAVA 3BB1A 4O4LF 4DZRA 1AQ6A 4AF8A 2RHJA 4QTYA 5TQ0B 1D6MA 1OZ0A 1QQAA 1XLVA 2R48A 3IB6A 1FUKA 5C8YB 3LC7O 5IFKA 2WKWA 4XFDA 4AIRA 3ZEAA 4YUWA 2WAOA 3I5UA 2FOLA 3I2HA 1UXGA 2W11A 4A23A 2HSZA 3B1WA 3C1AA 3ODPA 3AKCA 3CC8A 3DBRB 3S4YA 5EIXA 1NFRA 1PS8A 5AIBA 1KZ4A 1Y1RA 3D1VA 3DC2A 4AMGA 4D7AA 4HQKA 2WJ3A 5TVGA 1M66A 4HDNA 2I80A 3NZEA 2QLLA 3ADOA 4Y67A 5IS2A 2TMYA 4KFTA 4R0VA 3EXHB 1G2IA 2PH5A 2PY6A 3PJEA 1G2QA 4BJ1A 4DNQA 1WX1A 2JLZA 3OD5A 3ETJA 4P4NA 1O0SA 3NAZA 3RGGA 1TGYA 3LDGA 5LL6P 1R8QA 2UYQA 4NRDA 1BFUA 1UINA 1P44A 1JAXA 3LY7A 1IQPA 5DX0A 4JEHA 2XUPA 3DEHA 2NZWA 4BUCA 1ZL0A 4LJSA 2F6RA 2V7QA 3LQ2A 1OGIA 1Z28A 4JN6B 2X5JO 4BOYA 1MB2A 2XQFA 1W88B 2IOFK 2TMKA 4N1AA 4Z4FA 1HYEA 4HFRA 1UOQA 2X7JA 1K86A 4ASUA 1TCUA 3CSSA 5CAEA 4RTOA 3L4KA 2PDAA 2O2CA 2WI8A 5IHXA 3KL2A 3AL2A 2PZ8A 1SD1A 3MWFA 3T8YA 2ATXA 2O0KA 4FW9A 1NG1A 2GS9A 5DTJA 5AXCA 3K9LA 4UJ5A 4EJ6A 3V9AA 4CTJA 5G53C 4R9RA 3AVVA 2Z6AA 3RUCA 2I91A 4X7PA 1OZAA 1YKSA 1L8AA 3GGOA 2AR7A 1V8BA 4DYDA 4TTJA 4L85A 1TUGA 2FW8A 1CEXA 1DLJA 2O3UA 4XIGS 3MWLA 5JAUA 4OATA 2C4VA 3AILA 1EH5A 1KJQA 3IAS6 4QM7A 3VR3D 4RDHA 1UPCA 4L8VA 4BKRA 3UHAA 2YHUA 3PXGA 1H85A 2O59A 4AECA 3IA2A 1T3SA 5ALKA 1KFBB 4ARCA 3EOBI 1P3Y1 4IXWA 2V7WA 3C2QA 3QG1A 1EGHA 3GG9A 4BP8A 2ZBPA 1EDEA 2VOEA 2OHVA 2YCLA 1RHJA 1ST2A 5G3YA 5BN5A 3Q6NA 2NU9B 2Q45A 1Q5PA 2EGHA 1TPYA 4RDIA 4U3JB 1DX6A 2FMHA 3NFRA 5I9BA 3A7DA 4LJ8A 3JY6A 4QU9A 1YVRA 3RLIA 2I9KA 5D85A 4OP2A 4TKUB 4YMSA 2HOQA 1CS4C 4TLBA 4MVJD 2D5AA 2PUTA 2JARA 5C8DA 5DWVA 1SHZA 2WVJA 2CNWA 3FJOA 1NBIA 2MSNA 3RIMA 3C1UA 2G1UA 1MUUA 2G8LA 4YQYA 3VZQA 5KZMB 2R86A 3TZKA 1CQJA 2HNKA 3KJGA 3TQQA 2RHTA 1G8AA 3KT8A 4YRDA 3ROGA 1PGQA 2A5JA 4X1YB 3RYCA 3VKHA 1IHUA 2AZTA 3WGIA 1OZGA 1SMKA 4IR7A 1H0RA 1VA5A 1F51E 4PZCA 3KEMA 4LIPD 2GEVA 4LMAA 2VPPA 3EZYA 4LXYA 1NBHA 4MX8A 2VSYA 1P1RA 3PUVA 4M1SA 5KWJA 2ZYTX 5C1OA 3TTYA 1BRMA 4IHJA 4EHAA 2HZ7A 2P6UA 3SVZA 3SN6A 4GPIB 1UFOA 3ANNA 3MJCA 2IXDA 2PKWA 3E0XA 4A36A 3EHDA 3IJEB 4KSYA 4DLYA 3UQYS 1Z22A 4K03A 6Q21A 1CQWA 1LSSA 4F6CA 4HGNA 1BCRB 2FNAA 2VSFA 3AH8A 3DHVA 4ZEVA 3FW1A 3N5CA 8GPBA 2OCXA 4JUCA 3BK1A 4IM7A 4Q3CA 3TTWA 4D02A 1G5RA 1NZDA 4YQEA 1CR1A 4COOA 3R0XA 4D6PA 3EXFB 2J3EA 3P9CA 4BO1A 2PMWB 5FYDA 4CDGA 1V8ZA 2X8JA 3EULA 4JJEA 4Q9DA 1N9GA 1E2MA 2VT7A 1TJPB 3CEHA 3KWFA 3LCMA 2R6GA 1LQUA 3QPCA 4FKBA 1HXHA 1YR2A 4KXQA 3SX4A 1G7CA 2GN9A 3I6YA 3CGGA 5IK2D 1DI0A 1YS4A 2VZEA 2D0DA 3IQGX 1SO8A 1G5QA 1DBSA 3CH5A 3L07A 4LUCA 4MJ3A 4MQFB 1T3TA 2O2XA 4WN9B 4DCUA 4G1CA 1WUHS 2O2HA 1XMSA 4GXQA 1PUJA 2PVCA 4MQMA 1IHDA 1F9AA 4EB0A 3E7DA 3N87A 4K6GA 4KBFA 2QBYB 1TJ4A 4AU1A 4DRZA 2PVPA 2VAXA 3B1JA 4ZCTA 2WWHA 5AICA 5JCJD 2BMFA 4EPRA 3RFTA 1J2UA 5DI3B 4HDMA 4FYWA 3DQPA 2G28A 4R51A 2E9SA 4KLRA 1X42A 3VKUA 2QRGA 1Y42X 3O4JA 2RGCA 3FIUA 1GKKA 2XXJA 3WLOA 5TIIA 2W6PA 5FUYA 4ED9A 1J33A 4UCXA 4EVRA 1ISIA 2QV0A 3NWBA 1WCV1 1HH4A 4PG8A 4RJ2A 1QVAA 4KXNA 4ZYTA 1OHHD 2ILVA 1U1GA 2ZBGA 2AA3A 4QPNA 2E18A 3QKSB 1RP1A 3OEHD 2PWYA 3LKZA 1JZTA 3ZKWB 3QSYA 4XGKA 4U8HA 5CJ2A 1E1QD 3HGQA 1XBTA 4JODA 1I13A 4TQ9A 3ZWKA 1SQ0A 3EQ8A 1LV7A 2Q0SA 2VK4A 1SD5A 4D80A 1PQPA 2ZJBA 4LOIA 5B4UA 1NC1A 3FFTA 3FVQA 4HLDA 4ZVRA 5BYKA 1HRDA 1PFKA 4J4TA 5BW5A 4B2LA 1ES9A 2VP3A 1C8LA 3TTUA 4KR7A 1J21A 1P91A 2WU8A 1TJ3A 5BWNA 3NVKI 3DMHA 2BDTA 1HPLA 2B37A 1YB1A 2WUFA 3AEUA 3BXZA 2RGUA 3FGZA 3HCFA 4G9BA 2F59A 5AJUA 5EIEA 2PXAA 1E8NA 1NRJB 4PC1A 1S2GA 3JZDA 4PPFA 1DAHA 2GN8A 3OZ7A 2I71A 5DHQA 5E9QA 4NCNA 1Y8ZA 1I30A 4KIFA 1YAHA 3UATA 4EPWA 3O4VA 3TIFA 4ZOEA 3MUNA 1J7KA 2AH5A 2DKNA 4IQ0A 3FTDA 3TF5A 3T95A 4CM8A 4MUGA 5DI9A 2F3SA 4FN4A 2BFDA 4OEHA 5EKSA 5G0SA 4BQSA 1BE8A 1JSCA 2P9BA 2VWQA 1MQ9A 2HF9A 1N3LA 4IQ4A 5FL3A 5C52B 3WNBA 2H6EA 4ZRMA 2R2AA 2Z3ZA 4D9FA 1N6IA 4EQZA 1TAHA 2JKVA 2PEYA 2XPCA 5C5CA 3QOFA 3QKRB 2GUGA 4NNPA 1E2EA 4OH7A 2GUWA 2FEWB 2GI4A 3QE0A 2WSSA 5CNKA 5BR7A 1KIMA 1BWRA 2NGRA 4IDCA 2HGSA 1NX9A 2JFNA 2NNWB 3DGEC 3UTCA 1MJFA 4P9NA 1YBVA 2P9GA 3MMNA 3UMJA 2J59A 4YHBA 3U4MA 4Y6LA 2J8ZA 3TW8A 5EE9A 3ROTA 4J9UE 4H08A 5D86A 5A5EA 4X8MA 1V4BA 3EEBA 3JYLA 1DQRA 3HBAA 4KSBA 4RY0A 3VR2A 4J2TA 4M8IA 3ZXYA 4DJTA 2DHEA 3RHZA 4JBNA 5SY9A 3UH1A 4GMKA 2QEQA 1QONA 3IE1A 4MCAA 3G82C 4FNOA 5J1SB 1EFVA 1NI4B 4BECA 2WHYA 4ZV7A 1JH8A 5F5XA 5BSGA 1LZKA 3LPAA 5A7GA 1WSAA 2C3OA 2LPMA 3STVA 3ZD7A 4GKBA 1M76A 4KNVA 4MV9A 3LHDA 5H82A 4LYEA 1ZY2A 2WLSA 3BK7A 3IAS1 5FOWA 1JA1A 2Z09A 3PDWA 2VDWA 2QD1A 1UADA 2NU6B 5BW8A 1KXZA 4ZOQI 3GDOA 3WIUA 3HNPA 1ZO8A 3ISVA 4LV8B 8OHMA 4IYRA 1N2GA 4DVGA 2C78A 4WZBA 4UQPA 3PQ2A 3A4VA 1NVBA 3KB6A 4I4CA 5H70A 1T1EA 5TRTA 4WPGA 1KI7A 1P4RA 1I9GA 3IQIX 2B69A 1OOEA 2NTEA 1L5YA 4NU0A 3VVMA 1X13A 1Y8RB 2I62A 4HF7A 2VHQA 3QWHA 4RE5A 1VA4A 4EO7A 2I4RA 4HP8A 2P90A 3F7NA 4IZOA 2I6UA 1S9DA 3FCOA 1VBFA 1RZRD 2BMVA 3ECSA 2RI1A 2RIPA 1H5NA 4J0IA 5MDHA 3CZPA 2WQ6A 5E2BA 5U9CA 1XQ1A 3GW8A 1S0UA 5AVXA 4LSZA 1SA0B 5LYJF 3HN6A 2HI0A 2CLMB 4GI3A 1UJ2A 1UDAA 3EDYA 2H1SA 4ZZ1A 5TMBA 3L1UA 3HH8A 2WWGA 1EVKA 3H5VA 2UYCA 4FFNA 2YWXA 5D3MB 2PZJA 3ZTWA 4CN9A 2NXNA 1UK9A 4MA4A 2E21A 2CHQA 4O4JB 4CM4A 2NU8A 3SBDA 3V2HA 2C9CA 2GFIA 1PEYA 1KO5A 3CZAA 3VSAA 4AKGA 3UPTA 1Z4OA 2XWBF 1K3FA 1W7AA 1UWVA 1DAFA 3V4FA 3HY4A 3RU7A 4FLMA 1TEZA 1MLDA 1Q0ZA 2HRBA 2G1KA 1Z39A 4ZVVA 5ENZA 1E5XA 3O1JC 3E53A 1SOUA 2OD7A 3DW3X 2HX1A 1YA4A 5FPPA 4BO6A 3CZQA 1B1CA 4XM0A 4RF3A 4IOJA 3DE7X 1PBNA 2ZRAA 3KCQA 1RAAA 1OLXB 1R0RE 4EYEA 2C4KA 2YWJA 1HC7A 4LHSA 4RD1A 2Q3LA 3GUVA 3QMWA 5EGNA 1PNTA 2F1OA 4EL0A 1JDPA 3H04A 2BGMA 4FDMA 3W4JA 2AOTA 4DUGA 1D2MA 3ZXIA 2JFBA 1E2GA 4OLJA 5FBQB 1RRMA 4HXGA 1P0PA 4TXJA 5EWJA 1PJQA 5IMBA 4L50A 3MILA 1D9XA 3FBGA 1ZIYA 5BPFA 5JC1A 3DAPA 3D1JA 2AQ8A 2DT8A 4QLBA 4XQ9A 4C1BA 1SK8A 1DKQA 2HMTA 2BEKA 3KQTA 2OXCA 4MEBA 1KDVA 3WWOA 4DR4B 1G5PA 1HE2A 3PJGA 4NEQA 1QRSA 3P0EA 5HF8A 4XD7A 4Q00A 4C21A 1ZJWA 2IYOA 4FQ7A 4TTSA 3UWPA 3Q9SA 2N46A 2RSLA 3DEYX 3MLAA 1TM4E 5WRFA 1G8YA 1UDCA 1XEAA 4K6CA 2XDWA 3ASZA 5FH9A 1RWQA 5LQDA 3IBGA 5IJ9A 3BJMA 5K9ZA 2Q7DA 1F1BA 1MAUA 3IP9A 4RJTA 4G4GA 2H2IA 3Q15C 5JWHA 1I4OA 1MKYA 2G7ZA 4BZZA 1Q84A 3UWOA 1K6JA 1Y3CE 3LPMA 2HJHA 1FF9A 5K3CA 1XEFA 1NHGA 1V1MA 1ISRA 1VKRA 4RK4A 4AAYA 2XNKA 2VH5R 3II6X 2VRCA 3FBWA 5U1PA 2AG0A 4I08A 5ITZA 4DL9A 2QV7A 2FX5A 3ONNA 4GLBA 3A6PC 4L5AA 1LTQA 3OEED 1Q19A 1QRRA 2R00A 2ZVJA 3T3NA 3NS7A 4ZVQA 3RYFB 2IYNA 2XUGA 4IEIA 3H5WA 4QU8A 1O6CA 1Q7RA 1SEPA 5LD2B 3N6VA 4P5DA 1LBTA 2IYPA 2N75A 3KOXA 4H31A 3PQ8A 3GLRA 2YNMA 3BCSA 3G9XA 4CMKA 5CB4F 1G7SA 2JDIA 1I32A 5GQSA 5LXTA 1E2HA 1UPXA 1BA3A 3EPLA 1MMFB 1E2PA 2MIIA 4RHEA 1R12A 3D7NA 4B7XA 1A7JA 1HSZA 4LQ4A 5CRIA 4RQAA 1L7BA 2J0EA 1SHJA 1VJ5A 4JVOA 2WEKA 2WW8A 3WGQA 3ZU6A 1YNOA 1AMNA 4FD3A 2A86A 1NF8A 4MS1A 1E1KA 3CG0A 3VZBA 3RRXA 1F1JA 2PLWA 1YONA 3L43A 2HHHB 4AP6A 1GTG1 1O96A 5K3FA 4UHBA 2DXIA 1JDUA 3PFGA 4X94A 3KNZA 1DU4A 3ZDQA 2Q5OA 1NJSA 1G0OA 1Q21A 3DE5X 2H4XA 2PKXA 2WUDA 1PUIA 5EY5B 1QH1A 4UNIA 1KSJA 1N57A 4C4AA 2PLAA 4XX0A 5KEIA 1CF9A 4URVR 2C8JA 5B4VA 4RW0A 1H22A 3AVPA 4UMEA 3I42A 2I1WA 5IJXA 3SC2B 2XQJA 2E87A 1RM0A 3BK2A 3U40A 4C3UA 4EW3A 4E6EA 1T3LA 2FQXA 1U5AA 1PEAA 1JWBB 1PR2A 2AS0A 2J9GA 5EJFA 3THWA 1QPZA 3TPFA 3VJRA 3TRFA 1ATZA 4ZTBA 5AD1A 4MYRA 5UKDA 3GP8A 4RTLA 1M2WA 3ZI4A 3D3NA 2OTCA 5JSKA 4Q4CA 2CWDA 4P4UA 3H5TA 4X1OA 5JDIC 5EEHA 4ESVA 3L4JA 3EODA 4H15A 4L3WA 2J30A 4S12A 2OV4A 2XKAA 4OB8A 4PLZA 2D4HA 2WF9A 2XE8A 2OGUA 2VVTA 3DBLB 3HB4X 3W5JA 4AMUA 2BBOA 1T1SA 4QOIA 1GOTA 2QJOA 3N76A 2CLCX 4ZAVA 4DEYA 4LFBB 3FZQA 4EY4A 4C43A 1WUIS 1HTWA 4PXAA 3O8LA 4NZYA 1Q3TA 3A1CA 2Z2IA 4U2DA 1L3BA 1XDUA 5EP4A 4F38A 1W19A 3OTIA 2WYOA 3I53A 1KRXA 1L7DA 3RU3A 3HLKA 2O8DB 3TIVA 2HHJA 4FKZA 2WY2D 2VO1A 1JIVA 1JLKA 1G19A 2HDOA 2H7YA 3ESCA 3LXUX 1KAGA 2II6A 1E3SA 3H8SA 1OX4A 4O6VA 3TGPA 4D8WA 3NORA 9MHTA 5KC8A 1ZWLA 2FN4A 2GCNA 3FB1A 1RT9A 3N07A 3OC0A 2ZJ8A 4I46A 4FNGA 3IV6A 4TT8A 3G1TA 3ZE1B 5JS8A 2W2XA 3EB9A 4DDTA 1K5GA 5BRJA 1EEXB 2BMWA 2FWJA 4KDFA 1ZI6A 4UM8B 1ZNZA 2C4WA 3MBKA 4OKNA 4AZSA 5AI5A 2LZ0A 1J1UA 3BERA 1D1SA 2ZRQA 3HVRA 1XN1A 3LT2A 4PN7A 3A9RA 4DSOA 4HN4B 1Z2NX 2EYQA 2AJBA 3ITKA 3D6VA 1KJWA 5GAJA 3UM9A 5F7XA 3T5AA 2B9EA 5HDBB 1IEVA 1B0AA 2QMHA 2YN0A 3MZ0A 3T5CA 5KB3A 4X00A 5G1OA 3CNHA 1ETUA 3PCTA 2H17A 3E5HA 4RLFA 3UJ6A 3IYLW 3I04M 1B43A 1IY0A 1QO7A 1SIOA 1XGKA 2LTAA 4D1YA 4M3NA 3T0GA 1XZHA 2I7CA 2XMBA 4QM6A 4LGCA 1K68A 2AKEA 3WHIA 3BIWA 4PC2A 1ZKDA 1C1DA 1UT8A 3ONEA 5FF9A 3TXYA 1II0A 4F86A 3VX3A 2CEAA 3QWIA 3TN7A 3VOBA 2YIJA 2DWQA 2X5NA 2XUJA 1AF7A 2BOVA 1AURA 3BWXA 4WDQA 4KPFC 3GFQA 1QOZA 2QL7A 4QYMA 4C03A 1XEXB 3ELWA 4BQEA 3E5NA 3TGWA 2OOSA 3BIJA 3ELUA 3HZOA 4UVEA 1QZ3A 2XVZA 4A6EA 4BS9A 4DPLA 3IXQA 4JI5B 2VTDA 3AM1A 3DBHA 4J1QA 4KQFA 4R9VA 3V33A 4IKPA 5JNUA 1AH2A 3CRQA 3OAAA 1AOXA 5A0TA 1MGOA 1YUNA 4HAIA 5TS3A 2X0JA 1LCIA 2G88A 2GSWA 3MWDB 2BI8A 4NOKA 3O91A 3U19A 3KQKA 1PE0A 3FYUB 3QMMA 2EKQA 2VAPA 2QXUA 3IHKA 4CQJA 3LKDA 3PFBA 1KQOA 4U9UA 3WB9A 2TRSB 3L0IB 3FFWA 2W2QA 2HV9A 4I50F 4IIJB 4CI0B 1Z5OA 3RREA 5BT8A 3KTAB 1IB0A 5DZSA 2VK8A 2G9UA 3VR4A 4Q1EA 2ZJOA 1G4UR 1KZHA 4DTCA 4Q47A 1MT3A 2JCSA 1OGYA 2Q27A 3NP9A 1NNEA 4C0AC 2C59A 1BXZA 1B4DA 2OFPA 4GG1A 3SQOA 2YV2A 1LQTA 3HU2A 1XYGA 4FBLA 1Y5MA 4FINA 4NJMA 5KINB 2IS4A 2J6BA 3KKKA 2J0VA 2PZAA 3EZNA 1OWNA 2H1IA 3AIMA 3NLLA 2VWHA 5EP2A 5IVHA 2B20A 4JX9A 4Q3BA 3ZG6A 3V2IA 3GGJA