4HTAA

The structure of the karrikin insensitive (kai2) protein in arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
276
structure length
271
Chain Sequence
SLYKGVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, alpha/beta fold family protein
publication title The Structure of the Karrikin-Insensitive Protein (KAI2) in Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 96
structure length 271
sequence length 276
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4htaA00
1THTA 4WFKA 3C6XA 5AKXA 4Y2TA 5AIAA 3O9VA 4AB1A 2DQYA 4I4CA 5A7GA 5DTJA 1ODCA 2QUBA 1LPOA 4DNQA 3IVMA 4Y2UA 1WCYA 2RGUA 2BAGA 1AURA 5JALA 3C5WP 2OAGA 3BWXA 2Z8XA 5FPQA 4WJLA 2QRUA 4YK7A 1XQVA 4H7DA 3G0DA 4UHHA 2B9VA 3WKDA 3WWEA 2XMZA 1HKHA 2LIPA 1HL7A 3F8SA 3I1IA 1JKMA 4FBLA 1AKNA 4J0GA 3DNMA 2ZYSA 2HM7A 5A2GA 1PFQA 3A2MA 2ZSIA 2OG1A 3GUUA 5ALKA 1A8SA 5I9IA 1XQYA 5BWBA 2QXUA 2YASA 2PUHA 3FBWA 4BC1A 3EQ7A 1U65A 4E14A 2GBFA 1GPKA 1XZAA 3G7NA 1GQRA 3L1JA 3WK4A 4EY8A 1YS1X 4EB0A 3IUJA 5JARA 5F4ZA 1EK1A 1U4NA 5E4TA 3WZMA 2Y2UA 3STUA 4C4YA 4X93A 5HFAA 1R9MA 1WM1A 3SWWA 1VE6A 3WJ1A 1JJIA 2PPLA 4OYLA 4X3CA 1ORVA 1E5TA 1VZ2A 3VVLA 1WPRA 1K5PA 4X92A 1GGVA 4DYHA 4BP9A 4KRXA 2PSHA 4DMCA 2X5XA 3WK6A 3VKFA 3S8YA 4W9RA 3KOOA 3PE6A 3V1MA 5JANA 1ISPA 5LZ7A 4C6HA 1VZ3A 2D0DA 3WK5A 1CLEA 2GZSA 5AM3A 3O95A 3QM1A 4UBNA 5AHXA 4KE9A 3W9UA 4H0CA 4FNGA 4P9NA 4X95A 5ALHA 4P92A 4QDOA 1JFRA 1UKCA 3FOBA 3IULA 5LKAA 3UUFA 1XZHA 5FKJA 2CB9A 1XZEA 3CCCA 3I2HA 2GZRA 2WUDA 1EH5A 1A88A 3STXA 1UOPA 1X2BA 3G9TA 5ALDA 2AJDA 2VJDA 3KSRA 5JZBA 2QJRA 2ZJ6A 3D7RA 4LXHA 1XFDA 4BAUA 5BV7A 3G0BA 3F98A 2VQ6A 1CUHA 5K3EA 4M0MA 2G63A 4KAAA 4FMPA 3DKRA 5DWDA 2DFPA 1GPNA 2VT6A 2XMBA 2PSDA 1NU6A 1EHYA 3WI7A 5ALVA 3X3HA 1ZD2P 4F60A 4A16A 2RHTA 5AI9A 4PSDA 3CXUA 1AGYA 1LPSA 2BKLA 2PM8A 4X85A 4BZWA 4DMHA 2WG1A 3DLTA 2XMCA 4FFWA 1CUWA 2XQGA 4XIIA 2JGEA 1R4ZA 3FYUA 3R3WA 4ITVA 1LPNA 4BVJA 2OGSA 3I2KA 1W1IA 2Z5GA 4EZIA 2VJAA 2WFLB 5HKBA 1T4MA 1CUAA 1JMKC 2HFKA 4J0JA 2CZQA 4BCDA 3DS8A 5K3AA 4KE6A 4ROTA 4H7HA 4LKOA 3L1HA 4A23A 2JGMA 3JW8A 3AJAA 1KEZA 3ZPXA 1ZOIA 1AC5A 2JGKA 4H7IA 4HXFB 1VXOA 4O08A 1J1IA 1ZIXA 4OYYA 3WL6A 3FSGD 1QIHA 1H2YA 4CCYB 4TGLA 4Z49A 2WHQA 1CUZA 5CRIA 1P0PA 3LCRA 5ALNA 1CUIA 4I19A 2V9ZA 2D5LA 1MX1A 5J3JA 1KU0A 3R3YA 5CMLA 5FRDA 3GZJA 1VOTA 4J0HA 4G4JA 4MQLA 2G4LA 4DNOA 4L9AA 4G4IA 2OXEA 1CR6A 5CURA 4A5SA 1BN7A 3VISA 2C58A 1U2EA 4Q1VA 1SOMA 5CH5A 4HVTA 5D3KA 4LYEA 1XZCA 1BCSA 5T4HA 2H7CA 1YCDA 4KAFA 5FPPA 5HCUA 3G0GA 4CFSA 5JD4A 5ALPA 2WFMA 1WB5A 5LZ4A 5E2IA 4X71A 2WHRA 1USWA 3ESAA 4GECA 1S8OA 1ACLA 4FBMA 3NGMA 3C6ZA 5LLSA 3PDCA 3MGAA 5K3FB 4B9AA 4FOLA 5H3HA 1SCKA 5SYMA 1R88A 4YX9A 3LS2A 3PUHA 3QZUA 4ZV7A 2QKYA 1GXSA 2WUFA 1AX9A 5JAPA 1QIJA 1THGA 4PV7A 2XE4A 3HZOA 5FP0A 1HPLA 3OOSA 4AZ3A 2V96A 1LPAB 5I8PA 4QDUA 1BCRA 2WJ3A 4JNCA 1YR2A 4K6HA 5ALSA 3FLEA 1JJBA 2HU5A 2C0PA 2XMRA 2EDCA 2I03A 2WHPA 3FVTA 1TKRA 5A7HA 4YASA 2RONA 4C89A 4N5HX 1H22A 3EF3A 5DNWA 4UBOA 2XLBA 3OURA 2Z3WA 2XB6A 4BTVA 5FDFA 4GHWA 4Q3LA 3AILA 3IUQA 4N5IX 1LPMA 1W4LA 3IB3A 2C5FA 1YAHA 4J0CA 4FLFA 5A7FA 1FFDA 3TEJA 1R50A 1BEZA 5D3ZA 3FLBA 4OCZA 5LP1A 2XUPA 3A70A 2HA7A 5AKIA 5HF6A 3G02A 2W22A 1DTEA 1YAJA 4TPKA 3L1IA 2J3QA 3CN7A 4ARBA 1L7AA 1A7UA 3MUOA 1QE3A 4HTAA 5ESRA 2XI4A 3VVMA 2QTBA 4Y2QA 5A6VA 1UK9A 3I2IA 1KU6A 3A6ZA 3WL5A 4Y2XA 2IIVA 3VXKA 1ZD3A 4BCCA 4J0IA 5HK9A 1XKTA 3IBTA 5EFZA 1MX5A 1CUEA 2BJHA 3QBJA 2JGIA 1IUOA 1AMNA 3F96A 4Y2JA 5LZ8A 5D6OA 5AKHA 5JD6A 1Q0ZA 2PSEA 4U2CA 2JF0A 2E3JA 3HACA 1CRLA 5CT8A 2WTNA 3QPDA 4Y7DA 2XLCA 4EY6A 5AICA 1ORWA 5AI0A 1IUNA 3O4GA 3Q0TA 1YA4A 1Z68A 5ALFA 4AO7A 3ZLUA 2OCKA 5DJ5A 4KE7A 2RAUA 2WU3A 5EHZA 1UK7A 2VSQA 3C8DA 1U8EA 1ZICA 1OCEA 1K63A 1YSCA 5LZ2A 5AKKA 3D3NA 1L7RA 4CCWA 4DMKA 3IUNA 2W6CX 1IUPA 4EHBA 2OGZA 2FJPA 1CUFA 1EVQA 3FLAA 1LBTA 1N8SA 1ZJ4A 3QITA 3PUIA 2HIHA 3WKCA 1UKAA 3QYJA 4WFIA 1UWCA 4NS4A 1G4HA 1K6EA 1CIJA 2I78A 1QIKA 2XUOA 4IHAA 1XZLA 1IZ8A 5K3DA 5JZSA 1X2EA 4ARAA 3E3AA 1IMJA 3WWPA 1G5FA 2HRQA 3PF8A 3PFCA 4XX1A 4E11A 2XUJA 3C5VA 3GBSA 3WJ2A 3FVRA 1WHTA 4B82A 5AM0A 2VF2A 1QIGA 1IVYA 5A62A 1SC9A 4UBIA 4B0PA 4ZWNA 1ODTC 2XT0A 2WSLA 5AM2A 3ILSA 1FSSA 2HU8A 5HQ3B 1ZGBA 2WG2A 3HI4A 3KXPA 1NU8A 1H23A 5DYWA 1DX4A 3AZOA 3WL8A 2YXPX 1XRQA 3WQHA 1UFOA 4GBGA 3DQZA 1WOMA 2X8BA 3IDAA 4IH1A 4QWWA 4UHEA 3ICWA 4GLBA 5D7BA 4UHFA 1N1MA 3H2JA 2ORYA 4B83A 7YASA 2XUFA 3H1AA 4K2AA 3ESCA 3W05A 2B61A 1DQZA 4S0XA 2GBGA 3M83A 2XMGA 3E0XA 1BU8A 3QPCA 2VJCA 2ACKA 2XMQA 3EBLA 2VTVA 4BAGA 1UOQA 1X70A 4BCBA 5SYNA 1W76A 4U2EA 3SC2A 1JU4A 4FDMA 1QIDA 3I1YA 4Q3KA 1K8QA 1MN6A 5AI8A 4ZGBA 3QMMA 4DSZA 2WUGA 4JH0A 2B4KA 4DM7A 1QIIA 3LIPA 4XJVA 3HABA 3C70A 3D2CA 3WLAA 1B6GA 4CIAA 3QPAA 4HZGA 1UXOA 3IUMA 2JGFA 2BUCA 4MYDA 1F6WA 5AKJA 4W1SA 1XZBA 3TRDA 1EA5A 4X91A 5ALMA 2HA0A 4CG1A 4H35A 1VE7A 3AZPA 4UFNA 4KACA 3W9BA 1CQWA 2G5TA 2DR0A 2DSNA 4JYMA 5A71A 2YYSA 2WM2A 3WWDA 1OXMA 3WKAA 5C8VA 3STTA 4D9JA 1XZIA 3WKBA 5CXXA 1P0MA 1E3QA 4AMZA 4AX4A 4OPMA 1EXWA 4FTWA 3W04A 3NOXA 3FAKA 3BDVA 4G8DA 1EB8A 1UOOA 4F0JA 1XKLA 4ZRDA 2P8SA 3QH4A 1XZMA 3YASA 3PI6A 2CEKA 3HSSA 1QO9A 4Q34A 4QDTA 3BE8A 5AIBA 1Q84A 1H2WA 4CIBA 3R0VA 4U2FA 3OPMA 4CG2A 2RI6A 3VJLA 2ONCA 2XQIA 3B12A 5EI5A 4Q05A 5AI4A 3QMWA 5CH3A 1H2XA 2JGLA 1J07A 3P2MA 1TIBA 5JAHA 4F5ZA 2VAVA 3B3QA 1YB6A 5HF9A 2PSJA 2BGNA 5IH7A 4AZ0A 2G5PA 1XZFA 3G9XA 4W1PA 4MJ3A 2WIFA 3AUKA 1SCQA 2OQVA 4Y2PA 4EBBA 2C4HA 5AJHA 4G4GA 4X00A 3FNBA 4AQDA 1QFSA 4I3FA 1HDEA 4X90A 3H2GA 5FXMA 3HYSA 1TRHA 4KRYA 3V1LA 3ZI7A 1SFRA 5HZGA 3G0CA 4YPVA 4WDQA 1VXRA 1T2NA 1J2EA 5ALOA 5ALLA 3PF9A 5LZ9A 4ZI5A 2PU7A 2Z3ZA 2WG0A 3V1KA 1DWOA 1XRPA 3RLIA 3QVMA 5ALYA 2OAEA 2PL5A 3DCNA 2XQKA 3BIXA 3K9BA 3CN9A 1W75A 3DYIA 3STWA 4LYDA 5E4YA 3T52A 2WLSA 3IIIA 1XRRA 1MJ5A 4C88A 4Y9SA 1B41A 1MAHA 2J4CA 4WFJA 1CUCA 4OB8A 5KWJA 5LKRA 1QZ3A 2JEZA 2QR5A 3AIMA 4DNPA 5AM5A 1LPPA 4Y2RA 4UFOA 1EVEA 1JMYA 2AJ8A 3CCBA 5ALGA 1CFJA 3KWFA 3A2LA 4H7FA 4FLMA 5CTAA 1Y7HA 3RK4A 1EX9A 2JBWA 5DNUA 1PV1A 3Q8WA 1LBSA 1MU0A 1F0NA 3V9AA 4C01A 3FYUC 1ACJA 5CT6A 1ZD4A 3O9MA 4P93A 2WJ6A 4GXNA 2CJPA 3G8YA 1G42A 3W2TA 3ZLTA 1EB9A 1R3DA 4GI1A 4B85A 4B0OA 1XLUA 4FNMA 2O2HA 4KAJA 4OB6A 3D2AA 1XRNA 3FYUB 4E15A 3DEAA 3WA7A 4BC0A 2H7YA 5AOAA 5AK6A 4CI9A 5CBKA 2HA6A 4G9EA 3STYA 2HDWA 2XQJA 4UBKA 4RGYA 3I28A 1WPXA 3C87A 3DL7A 1DWQA 3G0IA 1P0QA 4W1QA 3V48A 1LLFA 2EEPA 4BATA 1CUGA 1XQWA 1EDEA 3ESDA 2HL6A 3WZLA 2ACEA 5AP9A 1TCBA 4WCVA 2UZ0A 2O2IA 1JU3A 2R11A 3ANSA 3A2NA 3EIOA 4U2BA 1NX9A 3N2ZB 2EDAA 1QFMA 1GT6A 1M33A 4HS9A 4G9GA 1CQZA 2ZYIA 4BTLA 4UBMA 3HLKA 1FFBA 4EY4A 5K3CA 4PSCA 2JEYA 1PJAA 4PNZA 4U2DA 5CXUA 4B9EA 2XUAA 5IVDA 4H18A 2I3DA 3OG9A 5KREA 4UHDA 4C4ZA 2DHDA 4BE9A 2WFZA 4W1RA 3SK0A 4KJXA 3HC7A 5T4BA 2HA2A 3S2ZA 2QT9A 4OSEA 1E8DA 2Y1KA 1TCAA 4OB7A 2FUKA 5DNVA 4WDRA 2HFJA 4UHCA 3IURA 2ZJ7A 3R3VA 4QEKA 4XWGA 2FX5A 1QOZA 1CEXA 1CVLA 5HF8A 4KR0A 1HQDA 3DD5A 4NVRA 4X97A 4N8SA 2C5GA 1CUJA 1TCCA 3DOIA 4BYMA 2BFNA 4BVLA 4G8CA 2Y2VA 3TJMA 1O6FA 2DHEA 2WTMA 2C0QA 2QOEA 2R8BA 3I2JA 5ALTA 1MT3A 1I6WA 5IVIA 3ZWQA 4UFPA 3U1TA 4FHZA 5JADA 5FV4A 4IO0A 2HA4A 3LLCA 2WJ4A 4K6GA 3R3UA 2VA9A 1CUVA 1L7QA 1BS9A 3ZLVA 2ZJFA 4B84A 3IA2A 2O2GA 1QIEA 4F21A 4J7AA 2DHCA 2XMSA 5AKZA 4V2IA 4GDMA 1FFCA 1BEEA 1DT3A 1C4XA 1TAHA 2WHPB 3FSGA 3DKKA 2O7VA 4PO3X 2XUHA 2HU7A 2OQIA 2GYVA 3ED1A 5CT4A 3AIOA 4PF1A 3D4LA 1MPXA 2OPHA 1TQHA 2ZSHA 1QTIA 5IVHA 1CUDA 4J03A 2XDWA 4HRXA 1C7IA 5AKYA 3WA6A 3RARA 3H2IA 5CT5A 1CUBA 1N5RA 2C7BA 5IVKA 4ZREA 4BAZA 4DNFA 3N0TA 3VDXA 1AUOA 1ETHA 3DDUA 2WILA 1BN6A 5LZ5A 2HHAA 5FLKA 4P08A 1MX9A 3H1BA 3RM3A 1YS2X 3WKEA 4ETWA 5FUMA 5EIAA 5ALRA 4QZVA 5HFNA 1XLWA 3WK9A 4HXGA 1N5MA 4TVKA 1E89A 4H7KA 2QZPA 1OILA 4Q3OA 4N8DA 5AOCA 5DLPA 2VJBA 3H2HA 3C6BA 4UHBA 2WFLA 2WU4A 1UK6A 1MNQA 3EQ8A 3F9CA 3K6KA 4ZV9A 5DYYA 4QWMA 4OUKX 1E66A 4Q82A 1QLWA 1XRMA 5C7YA 2WIJA 3R41A 4CG3A 4X6UA 1MTZA 4H7EA 1GZ7A 2Y6VA 5EHQA 2ZVDA 1RWQA 2OLEA 3VJMA 4FKBA 4W63A 1AQLA 3JWEA 2X76A 4FWBA 5JIBA 1EI9A 4LHEA 4CCYA 4C4XA 5JZ9A 2HA5A 1BROA 1GPLA 3D5EA 4BZZA 2QVBA 4DSAA 4MWTA 1QGED 4MWSA 2ZYHA 3W06A 4DIUA 1J06A 5JD5A 1XRLA 1ZI6A 4PQEA 4QNNA 1QIMA 1O6GA 5CH8A 5KWIA 4EUSA 3H0CA 1AZWA 2HRRA 3AIKA 1XZGA 3NUZA 5C81A 2V98A 3FWHA 3H18A 4L3WA 2QUAA 1EK2A 1A8UA 5EGNA 3C45A 4DLNA 3HJUA 2PVSA 3O0DA 1GKKA 2PKYX 2OCLA 1RP1A 4OD0A 1YB7A 4MXDA 3HEAA 1XQXA 1QJ4A 3AFIA 5JATA 2RIPA 4IQ4A 2I3ZA 1LPBB 2QXTA 4KEAA 1ZGCA 5T4EA 3I2FA 1DT5A 1VKHA 2H9YA 5ALEA 4X6YA 3DL4A 1LNSA 5BWCA 1GQSA 3GFFA 1MNAA 2V97A 4IH4A 2BUBA 5K3FA 2H1IA 2VAXA 2GBIA 5AK3A 3BXPA 4JUIA 4AO6A 1D07A 5E4JA 1VJ5A 1FFAA 4GWLA 3BF8A 4MEAA 2XUIA 1DWPA 1BE0A 5BOVA 2AJBA 2WIGA 5JYCA 2VT7A 1E8MA 3D2BA 1HBJA 5JAUA 2IITA 3TGLA 1HLGA 4EA6A 3HRHA 1Y37A 4X6XA 2O7RA 3C43A 2BUAA 2XQFA 4QDZA 1CPYA 4H77A 5ALJA 2ROQA 3D0KA 1H2ZA 4QDXA 4K6KA 5EHNA 4RE5A 4MQMA 4BB0A 1DU4A 5DYTA 4DGQA 1EDDA 2NW6A 3FYTA 5AM1A 5C8ZA 4KE8A 3NWOA 5AK4A 4GEGA 4B81A 5AK5A 2Z8ZA 5CW2A 3VJKA 1Q83A 3I6YA 1JI3A 3GELA 1G66A 1JT2A 3OM8A 5HF5A 5YASA 2DCMA 2GYWA 3EQ9A 4INZA 4BP8A 1W6RA 2QMQA 2CUTA 1YA8A 5EHXA 3H19A 3H17A 5ALIA 4G1FA 4RNCA 1LZLA 2BCEA 5HKAA 1XZDA 2GYUA 2JGJA 5AM4A 1QIFA 3O4HA 2PU5A 4MEBA 4EY5A 5C8XA 1ODSA 1VLQA 4UPDA 4RPCA 4B6GA 3SX4A 4PW0A 5KBYA 1QTRA 5EIHA 4FFVA 3UUEA 5ALUA 1CUSA 5JASA 2FJ0A 4JEIA 1BRTA 3FCYA 3GROA 3E1GA 4AN0A 4J3JA 4OU5A 3DOHA 3I6MA 4B7ZA 2Y6UA 1UT6A 4QE3A 1MO2A 1YASA 3LP5A 2XUKA 1SCIA 5AOBA 4KYVA 1UK8A 1VA4A 3G9UA 1Y7IA 1XZJA 3FCXA 2VEOA 3PICA 3U0VA 3AINA 1ZD5A 2JIDA 5LYYA 1WB6A 5ALWA 2H7XA 5DTIA 1WHSA 4L72A 5ALZA 3STVA 1GKLA 4OU4A 3WK8A 1F0PA 1MAAA 3O4IA 3B5EA 1FJ2A 2CKMA 3G9ZA 5AKLA 4GW3A 3WYDA 1CUYA 4BRSA 3HXKA 2RHWA 4LXIA 1CV2A 3M82A 2VATA 4XVCA 4H7JA 5LIPA 4PSUA 1ZIYA 3R3ZA 1R9NA 1ZI8A 1JJFA 4B80A 3F67A 3WIOA 4L0CA 2J4FA 3MVEA 1E8NA 2CBGA 4NMWA 1ZI9A 1RYYA 2ECFA 2WUEA 3ZV7A 1UKBA 1LGYA 4LIPD 5FOQA 4Y2VA 4X7BA 5AI5A 5AKEA 3K2IA 2DQZA 4QLAA 4BDSA 4M0FA 4DMFA 1QO7A 3H2KA 2XMDA 2BGRA 1R1DA 1K4YA 4WY5A 3C8HA 2YH2A 4X94A 1W52X 3PFBA 4BVKA 2PBLA 4FLEA 1CUUA 3BJRA 4QLOA 4HXEB 1WB4A 3OC0A 5AH0A 5K3BA 4EY7A 1IZ7A 2J3DA 1P0IA 3JYHA 3MUNA 3C6YA 4AMYA 2PUJA 4JYPA 2AXEA 3AZQA 4K5QA 4BRZA 3WWOA 5HQ3A 4M0EA 4NZZA 2WIDA 4G8BA 1CUXA 2AJCA 1EDBA 1EINA 3WYNA 1UZAA 2ZYRA 4HRYA 2XUDA 4Y2SA 3OTQA 4UUQA 4U2GA 1TK3A 1DINA 3WMRA 3DYVA 2WIKA 5CT9A 2B20A 5ALXA 1XZKA 3WIBA 3WK7A 3T4UA 5I7UA 4DTCA 4UBLA 2WKWA 5HK8A 2QM0A 3KD2A 1VA5A 4E46A 3KDAA 2AJLI 5ISMA 4N8EA 4Y2YA 5EIEA 4BE4A 1F8UA 4QA9A 1XLVA 3BJMA 4AO8A 4G5XA 2HA3A 3LIIA 1FFEA 1C7JA 3F97A 2IX9A 2QS9A 1LZKA 1ZJ5A 2XUGA 2XUQA 3D59A 3H04A 3ICVA 2OCGA 5AO9A 4LXGA 3UMJA 3BL8A 2QJWA 2OGTA 3GA7A 4AN1A 1DX6A 3WL7A 6YASA 5AI6A 2OCIA 3BDIA 3I6ZA 4UBJA 3M81A 4IH9A 2PSFA 4ZXFA 4BBZA 3ESBA 3RKSA 3M3DA 5IKXA 1A8QA 4C87A 3I2GA 4BDTA 5JAOA 5T4FA 4J0DA 3DJYA 3BIWA 5ALQA 4AXBA 4RE6A 3ANTA 2WQZA 1DQYA 4J0KA 3BF7A 3E4DA 5AKGA 2CMFA 3V1NA 2K2QB 3QMVA 4HAIA 2ES4A 3R3XA 3O4JA 2HADA 3R40A 3WWCA 5K5EA 3KWJA 2Q0XA 4MYSA 4WY8A 2GBCA 1Q0RA 2PX6A 1QONA 1XROA
chains in the Genus database with same CATH superfamily
2CFTA 1W5AA 1DOZA 4PZ9A 1UJ6A 3OT1B 4BXOA 2AXPA 5AKXA 3AHCA 5CFNA 3AF4A 3PUJA 4BFVA 3O9VA 4OHMA 1QB8A 3LKDA 1UDCA 2VDRB 2ZDGA 4WKOA 3OWHA 3FPJA 3QW2A 2F6RA 4NZOA 2N1BA 2QUBA 4M46A 2PSSA 4MSUA 1LPOA 3IAFA 2QN2A 2FPIA 4O2RA 4OFXA 4B79A 3F73A 4ED9A 2IYWA 1Y8RA 1RLMA 3HNOA 3PR3A 2DEUA 2EQBA 4QD3A 3HP1A 1A3CA 2ZKIA 3HFSA 3ABOB 4N0MA 3RUPA 5JDCA 3C24A 1IPHA 5KAPA 3O2QB 5JALA 5IM4A 3GLHE 3MF4A 4KQWA 5IDYA 4AJKA 5I5GA 3ZS8A 1PX2A 1UINA 2BFAA 2FWJA 2HF8A 3IRVA 4FFPA 1BJTA 4DAOA 2J85A 1XZ8A 3KP1A 3G0DA 1CZHA 4UHHA 3OX2A 5ILOA 4DCCA 3F7NA 2CL6X 3ADCA 3WWEA 4FHDA 4IJ5A 5J2TB 1CNEA 4OAOA 2GK3A 2VIIA 1HGXA 3ESZA 3M6XA 2IYXA 4QPPA 4S2UA 1GG5A 3UG6A 3VZRA 4ARZB 1JAYA 2TYSB 1LCIA 2OR3A 5TEVA 1PTJA 4JELA 2J6HA 4R1OA 4MGHA 2A58A 5JOQA 5FTWA 3ZVRA 3PFFA 4FBLA 4OP2A 1K7XB 5D86A 3EVCA 3EZYA 1M3SA 3PNVA 2P1DA 2IEYA 2GPAA 3WMXA 1X1DA 2BMWA 4ERXA 1AZTA 4IS2A 4AL4A 2IGTA 4LGCA 1V47A 1GKIA 1OHHA 4NE7A 3A2MA 2ZSIA 2OG1A 5B7NA 3VHLB 3ER9A 4ZC8A 5ALKA 4DBLE 1A8SA 2FR8C 3JATA 2MYUA 5BT9A 1OBCA 4HQNA 4QSMA 3VX3A 4LPSA 4EJSC 2QXUA 3FBWA 4BC1A 1OTHA 1COWD 1KEUA 3EQ7A 4FFRA 2P6UA 5LNK1 1K8ZB 1OLUB 3DE1X 3KEFA 2D5AA 1U65A 4N7JA 4CM9D 2ZRHA 4PR3A 4EQZA 1N8TA 2PKWA 3ZTYA 4L51A 2PGLA 4NCAA 5LUAA 4YR9A 3ISJA 5TQ2A 3NRCA 4K6CA 4CF4A 2NAFA 3GF4A 3D3QA 1CQIA 3UK6A 2VTDA 1Q17A 2GXUA 2WUWE 3N53A 4C08A 4OKNA 4DQUA 1JQ3A 4KQ2A 1ZIPA 2VK8A 2JZNA 2Y8EA 3JD0A 1B2LA 1GZ4A 1ZUHA 3DTNA 3E2PA 4KXWA 5EWLA 4ZT5A 3RVPA 4EJSB 2XIJA 1FLAA 2UUPA 3BXGA 3F7OA 4TS4A 1DKRA 2QEQA 4HBGA 3MT0A 4X93A 1HE5A 2IUYA 1U3CA 3P2JA 3S2IA 5KKCA 2CD7A 2QRVA 4YCMA 1TPYA 5KTPA 2UUCB 3OFND 1IWOA 1WM1A 2P77A 3MOGA 5ECYA 4JJIA 3P0FA 4EKDA 2PQ2A 2AOUB 2CMHA 2ZXEA 3MBKA 4F7DA 4G0VA 2OL4A 2O0HA 3WJ1A 3GAZA 3JQGB 2QZJA 3H6HA 3GLGB 2A9VA 2DU8A 5I47A 3LWBA 1E5TA 3BGVA 1OXBB 3G2PA 3L7OA 4HK4A 4HWTA 4MV3A 4B2IA 2NP6A 4CL2A 1YQXA 4B3XA 1L1QA 1EFPA 3I92A 5GMOA 1UBRS 2QG9A 3EEQA 3GEHA 4YRBA 1O0BA 4V1CA 1JVSA 3L4EA 5AVKA 2ZCJA 1V43A 1W4BA 3OTIA 4C6TA 4KCGA 4CIXA 4QTYA 2ZITA 3ND9A 1SPXA 3ELUA 4ZTUB 1U9ZA 2PSHA 2QVGA 1WKCA 1FU8A 3A6PC 1N1GA 5JCXA 3MFQA 4YAOA 3LDHA 2HXGA 3EGVA 3WK6A 1ESNA 1OYVA 1DTWA 1BMQA 5EE3A 3VOTA 2ET6A 4C05A 4Q9DA 3VKFA 3UPTA 1O95A 2EX4A 2X9QA 3C5HA 2CCJA 4HL6A 4HDSA 4DMLA 3STHA 2NSJA 3IPRA 4E09A 2DQKA 2CD9A 3A32A 4WXMA 4CM5A 2Z57A 3NWPA 4GX2A 5LZ7A 4A03A 3IIKA 2WD7A 3WGZA 1VCMA 3RWOA 2FVYA 4XSHA 1P1BA 4JOSA 4MVJE 4U7DA 3UXHA 1PYDA 1NULA 2ZTMA 5HHTA 2GZSA 4JUDX 1OXUA 4UTPA 4G81A 4NH0A 4UBNA 4CKBA 5J5CA 2ZT6A 4HFMA 1ZNZA 1G2QA 3PHJA 4I66A 1HLPA 3W9UA 4DWWA 5ALHA 3FPSA 1LLUA 4EMSA 1BS1A 2W2XA 2ZPAA 1U7DA 3FCAA 5JTUA 2NZJA 3QNUA 5HE9A 4FCCA 3I8XA 3PWSA 3UBMA 3V8MA 3KYDB 1FDTA 1QMPA 1DO8A 3KJIA 4RM2A 2A0UA 3ELWA 1U0OC 3IULA 1CW2B 4FYPA 3RU3A 1XAJA 3WXMA 4D0GA 1AHPA 1OE0A 4RX1A 1C3OB 1FP4B 1TJ4A 2H52A 1C3VA 2J08A 3AY3A 4DMGA 1PSWA 1YRWA 5FFMA 3CMCO 1XZEA 2ZRJA 4LVNA 4MX8A 4P98A 3TAHA 2VWPA 3HYNA 3I2HA 4TYWA 2GZRA 2HSGA 2VH5R 1BMDA 1WSDA 1PNQA 2WUDA 3G5MA 3OEYA 4ZC1A 3U6KA 5G3ZA 4QBHA 1SOVA 9GPBA 2HBZA 1VG0B 1WWKA 3CF6R 2A67A 3AEUA 3ONVA 1XXHB 1U1FA 3OPNA 2AE2A 5CK4A 1X2BA 2GB4A 5ALDA 3DHYA 4Z2YA 5G0UA 5BSUA 2VJDA 1GTSA 2QJRA 4GP7A 4QEDA 5JTTA 2ZJ6A 2PUCA 2RHLA 2GEKA 2ZSJA 4JI2B 3IVRA 1W8DA 3KD3A 2H1CA 1DDGA 3ISVA 3M5WA 3O8QA 4BAUA 1SVKA 5BV7A 4Z4QA 2KLBA 2HBYA 2AB0A 3ITNA 3KQPA 3LPMA 3A6KA 1IQUA 1DUVG 5DHQA 4OI1A 3GB9A 3LWDA 4CCSA 2VQ6A 1CUHA 2IE8A 3OOHA 2BDEA 4HB0A 4QO8A 2DFLA 5G1OA 2G63A 3T7AA 2UXBB 3HV2A 1F5NA 4LY9A 4B76A 4NK4A 1M6HA 3VZQA 2JIOA 3C7DB 5C7OO 4OHBA 4XASA 2VJMA 3ENKA 5EPUA 3WIUA 1TZ2A 1KDVA 4LOHA 1JAZA 2JBHA 5IP5A 2CLHB 2ZUFA 5BN3B 3Q5GA 4MP6A 3PYXA 4YPFA 2G1JA 3PS9A 5KPJA 4XOIA 3H1EA 1Q44A 2AFIA 1JWBB 5B3JC 3HE3A 1B0AA 4HQLA 4RVGA 2XMBA 3REQA 5IG2A 1M8PA 5L7WA 1AMOA 2ZCUA 5CR9A 5ARCA 4F6RB 3CEJA 2QR2A 1JDZA 5DCWA 2O59A 1UBEA 2DTDA 1C9KA 4MMZB 1X7ZB 3QE2A 5CVDA 4DCVA 3U7HB 4ZHQF 1EXDA 2BMFA 5AI9A 4BNGA 4PAQA 1PJBA 3CXUA 4TXNA 2PM8A 1ULSA 3NIGB 4ZRMA 4LZLA 3TLMA 2QJTA 4BZWA 2TSYB 2XYRA 4DMHA 3DLTA 4ZZ1A 2O3SA 3CNNA 4FFWA 1Z7BA 5JG7A 4ZGGA 4YJ2A 3L8HA 2B34A 2BRUC 3LCMA 3NYRA 3I04A 1YBHA 5C3MA 2JATA 4BVJA 5I8ZA 5TSDA 4EYKA 1YR8A 2X4DA 4MPTA 1INLA 3OOEA 4YRCA 3PVCA 1VGVA 1P8AA 3H2SA 5IJ9A 2HWUA 4NEQA 1UBSB 1SVOA 1F3OA 3EQ6A 4EZIA 421PA 3TZKA 4OX9B 3WDMA 2G28A 5E3IA 1CUAA 3SQNA 2DQ4A 3NETA 8ATCA 2FXVA 5CDGA 2JLSA 4KVZA 5BSGA 3S99A 1KQGA 4POAA 2BN4A 4QG7A 1VJGA 2V9PA 3H8VA 3KSUA 4HDCA 3E84A 2FEPA 3ZS9A 4PZDA 3COSA 4N5NA 4TV9A 5A3JA 2Q1YA 5FPHA 2H29A 1PZHA 1AG9A 2BGJA 3ASZA 3L82B 3FNFA 4KDCA 3M5PA 3CLTD 3VX4A 4YUXA 1R6BX 2WT8A 1G8PA 1U94A 2ZYAA 3AJAA 3HXPA 2P9HA 3SJAA 5AVQA 4PFQA 4TS9A 1RW4A 3TDNA 3V4ZA 3ZPXA 4IG4A 4RS4A 2JI4A 4F8JA 2RAPA 2YV3A 1T5LA 1ULZA 2DM6A 2JGKA 4H7IA 3K09A 1N77A 1VXOA 3H3XA 3ZV6A 4KREA 2ICAA 1LTKA 5G0TA 2AG5A 1L4UA 1J7JA 1QOPB 5DHFA 4O4JA 3K53A 4BKOA 2BSXA 5FNZA 4GUAA 3I32A 1QIHA 1H2YA 3NKFA 4LRQA 4NMMA 4CCYB 3PQ2A 1OYOA 2EL7A 2X6QA 2FPGB 2IY8A 2XBLA 3GJXC 4JC5A 2WHQA 4F3RA 3GT3A 4ZHQB 1G5TA 3P97A 2IVFA 1LFDB 3GMDA 5KQMA 4AP5A 3TD2A 3LCRA 2C42A 2XW6A 2YHIA 3B13B 4I19A 3N05A 2QROA 2GEVA 2Q1XA 3AFNA 2V55B 1Q2UA 3O4VA 5HQJA 2F3QA 2ZWVA 2WM8A 3UKDA 4AJNA 4E7OA 3V9PA 3RD5A 3LQRA 3GZJA 1SC1A 3AEZA 3LP6A 4P6VF 1T4GA 3QQPA 2DFNA 4TZTA 5KYXB 4OFZA 1JDVA 5IBCA 3WQBA 5DCLA 4JQSA 2OP0A 4BIMA 4P80A 4DNOA 3DDZX 4L9AA 3VAZA 4A5SA 2WZDA 3MT7A 2PUDA 3DAGA 4CDNA 3TB4A 2OZVA 5BV0A 2JFVA 5CLHA 3KTAB 4HVTA 4NFYA 5D3KA 3G5TA 1XPRA 4YRAA 9MHTA 4PLFA 4IR7A 1BCSA 1AKVA 2E6UX 5LSAA 1PFKA 2WC1A 3RO7A 1N0HA 3EPKA 1XA4A 1BMFD 4S1TA 4DXAA 3VNUA 4TRJA 1KF0A 3K72B 4GH5A 1BU5A 4ZVLA 3E2IA 5B58C 2H17A 4JLDA 1E2HA 5HCUA 3HVHA 4FR2A 3T54A 1RYNA 3QE4A 2JFZA 5JD4A 1OJLA 4YP9A 2PS1A 1WB5A 5LZ4A 5H59A 4KZKA 3AKEA 1VECA 3PPWA 1YRLA 2WHRA 3AUXA 5C46F 4EJ2A 5K1ZA 1L5VA 4MWCA 4X1IB 4U0JA 5B1IA 4ZFNA 1GGFA 1U8CB 3CUKA 3KVYA 3N28A 3Q2OA 2DSTA 2C20A 2MINB 4TXJA 1AVTA 5JSZA 2WHXA 2XKKA 1MFZA 1OGYA 3BHIA 3GFSA 3ZHTA 3QBDA 3HCNA 4IKOA 1HNXB 1UFVA 2BGUA 3GD5A 1KDTA 2VDWA 4V2UA 3RVKA 1O0CA 3AU9A 1BW9B 2GYYA 4ESEA 2GETA 5LLSA 1OHHD 4KH1A 4FC7A 3KQWA 4F04A 2EBFX 1SHKA 3VYSB 4NFHA 4ESVA 4DREA 2R3SA 4MB6A 5IUNC 1DHRA 5CXQA 3H5LA 3ZDCA 4JLWA 1S4QA 1WW3A 2EFCB 4G1UC 5F77A 1XDUA 4FU0A 1R88A 3AR8A 5HX7A 4PAOA 2Q3EA 3LS2A 1B6TA 3PDIA 3SC6A 2QNIA 3PUHA 1EUQA 4OMCA 3FFTA 5IC4A 3GNLA 3KR0A 5A02A 3SSNA 2BD0A 4ND1A 1UWLA 1OAKA 2D7CA 1JIXA 1AX9A 1QKJA 1QIJA 2XWBF 4LJYA 3UJCA 3VAAA 3LA6A 4RJTA 2JRLA 2YY6A 4ZVQA 1U3FA 1JLMA 2JZCA 1P80A 3OOSA 4AZ3A 1YB1A 2BM9A 3IDSA 1N3YA 4JC4A 1TVKB 2YZMA 3ZJ5A 2CJWA 2V96A 3LHKA 4BVEA 2VQFB 4MRVA 1P4RA 3TJRA 1PJZA 4LMAA 2DOKA 4GKBA 2Y27A 3AB7A 1HEYA 3NBAA 4JNCA 3G5UA 3FLEA 4MMYB 1FNSA 4DTIA 3MCTA 5CB6A 5AR1A 3CNLA 4Q03A 5K20A 5FOVA 4A2CA 3N7UA 5NULA 3RVMA 3ZZ0A 5EQTA 3GJYA 2IHBA 3E05A 3H0KA 1ZUNA 2I03A 3LZDA 4BKMA 1E2PA 3DJFA 3U48A 1RHJA 4QOJA 4Z9BA 1EWVA 3IQIX 1KYTA 3VH1A 4AY3A 4D3SA 1TK9A 4HS4A 4BNKA 3SFZA 3PC3A 5IWCA 2PH7A 5CNKA 4YASA 2N75A 3ORQA 1GRQA 1ZOSA 2YZGA 3QWFA 4XDGA 3O26A 3G2HA 3FFXA 2RGCA 3BTUA 1CETA 2BWJA 1FDSA 3W4KA 4O63O 3L6RA 4YJFB 5B58T 4UBOA 5T5QA 4CTOA 1A82A 3HUFA 1O95D 4IV0A 1E63A 3NO4A 1UDAA 1CQJA 1GRNA 2GF2A 1P3DA 3E18A 4WAUA 4Y6LA 1VDZA 1E0DA 2CYBA 3QKWA 4Q3LA 1K8RA 1JBKA 4N5IX 4UTRA 4ADSG 4BLSA 2F4VB 2A8YA 3PX7A 2WABA 4MB0A 3U31A 2C5FA 1P74A 2WA1A 1YKSA 2OMEA 4R0VA 4WCFA 4GE3A 2QDXA 5HR5A 2IHTA 3PL1A 4PZYA 2B37A 4J16A 4PU0A 4Q00A 3VBEA 1PKEA 3FMOB 4FOOA 4J43A 5K2OA 2GK6A 1BEZA 5D3ZA 5M29A 2PKQP 1Z74A 4RNDB 4Y1GA 2WWGA 1OXVA 5LP6A 3DEZA 4Y6QA 5LP1A 4PBTA 1E1NA 3A70A 4ENSA 3TDMA 3ESQA 1OOEA 6REQA 2HLPA 3CC8A 5G0VA 1XMIA 5FFNA 1SKAA 221PA 4ZIRA 1EUZA 3PG5A 1Y9JA 3LUJA 5HF6A 1ZKDA 4DQLA 5ADWA 1ZHOA 2WQ6A 5ARBA 1KDYA 1G5HA 4UM8B 2CXOA 2Q3BA 3CNOA 3PE3A 2AFVA 4IKEA 5ESWA 3K5IA 4J0QA 1IBLB 3ODGA 2JAWA 2EX0A 3RVOA 4LYGA 1ESDA 3AVVA 1KL7A 3GGGA 1YHNA 1YRAA 1Y34E 1VRVA 1GUYA 3PSAA 7REQA 2X4GA 1WA5A 4GM0A 1VCIA 1VIVA 1OASA 4RVOA 1OFGA 3V5NA 2P5UA 3JD3A 4MROA 3VOAA 3AETB 1FDUA 2REQB 2O54A 3BMQA 2YVKA 5DI3A 2JFGA 1OLXA 4LGYA 3RTEA 4ALIA 1KMIY 3VMMA 4HUQB 5JAMA 1J49A 3OJWA 3UAGA 1A7JA 1BYUA 4B45A 4F56A 1ZD3A 1X7DA 2F7SA 5J59A 1RJEA 3GFRA 3MAGA 1QUEA 3TLKA 4DRYA 3GLTA 4OP3A 4BCCA 1XKTA 3GMTA 3IBTA 4J6FA 1OA0A 2I71A 3BFKA 3EPHA 5DULA 4YY3B 2BM0A 1L1EA 1Z0FA 3W78A 4FN4A 3TFQA 3U39A 3NCHA 1G64A 3UPUA 1UMDB 3G79A 5FQNA 4BZPA 2I67A 1AMNA 3BORA 1GR1A 2CVQA 2GN0A 2XD4A 2IOYA 1UJBA 3CLRD 3H5WA 3QELB 2R5WA 4TLAA 3WR5A 1Y48E 2HJHA 1WHSB 2GM9A 1FB5A 3VPXA 1M5RA 3N76A 2NACA 4GXTA 3QTLA 3DFMA 3JWJA 3LZCA 2C5LA 3V7UA 3DC2A 3NNNA 4H1WA 3H5TA 3HACA 3WFJA 1IIBA 4I36A 1WB9A 3OP4A 3SBEA 3U4HA 5HW0A 3SN6A 3X0DA 5BN5A 2BTQA 1DJLA 2JFOA 4Q48A 4R1QA 1BJKA 5KDDA 2XLCA 5CW1A 4YRIA 3TLAA 2XGJA 3WG9A 1MABB 3EHEA 1D4AA 1JSXA 3OA2A 3QTBA 1LH0A 3DEJA 4OHFA 4RK6A 3QKSB 4A0QA 5J58A 2CFSA 4GC9A 1G20E 4KIWA 3SHVA 4I4TF 2VWHA 3ZBTA 4E88A 3KQKA 4BLOA 4RJJA 1DUIA 2A0YA 4MVJI 1QU3A 1SKQA 4EGCB 1L7BA 2PTGA 2WR8A 3FYHA 5JO9A 3GARA 3ND5A 1RACA 2FUG6 1N4DA 4HYQA 4A1OA 3IILA 4RH3A 1FFHA 3ZLUA 2FCAA 2OCKA 4PICA 3RRFA 1I7SB 3KAJA 4RH0A 3TCNA 4GR5A 5CCEA 3OUTA 1OU0A 1W85B 5EJ5A 3E35A 1CQPA 2J3JA 4DBVO 3K8YA 3RC2A 3ROZA 2K7ZA 2EW8A 1H2FA 2YWFA 4TMYA 1MRNA 1GPBA 2VSQA 4FGLA 1Y6ZA 2QLNA 5F7JA 2FY8A 1TU4A 1YJBA 1IOZA 2ONZA 4K9LA 4A2PA 1QF7A 4E1AA 1GIAA 1VBFA 2PZMA 4F3YA 4KFCA 1YB5A 4ICIA 1YSCA 3F71A 4R1SA 2H31A 4R7TA 4AKHA 3ETLA 1DJPA 5AKKA 5HMLA 2JCYA 3K3PA 4X1OA 4D6XA 3LU1A 3UT0A 3EGXA 1X1SA 3UAWA 2XZLA 1UKZA 4JL8A 4OAPA 2JDID 1NJGA 1VI2A 2FSFA 2AX4A 4QAJA 1Z4PX 1KRWA 2QM7A 1NDQA 4CM8B 1IUPA 5JSKA 4W9NC 1FMTA 3DE4X 3SBXA 2XJ4A 2VBGA 4JDUA 2QRKA 3BXZA 1G9TA 2FJPA 1R6AA 3KJZA 4MV4A 1UH5A 5C1DA 2P7IA 5JYBA 5MGNA 2FQWA 4CQNA 4MA0A 4HXYA 1HX7A 2CWDA 1DV2A 1N8SA 4IUDS 1ODFA 1VLVA 5EJMA 4EDFA 5KYYA 2BBTA 1QDEA 1W29A 2XMPA 2F1IA 3WADA 5LWQA 1NJ1A 2CN1A 1JG1A 1U0LA 3IP1A 2V6FA 2H5JA 1WR8A 3GRYA 3NTRA 3PUIA 1M66A 1N6OA 4P36A 1W93A 4JBYA 1EVIA 2JFWA 4PZ0A 4N9WA 4YS6A 5GZ1A 2ZBPA 5IPFA 1D6NA 2OV2A 1TDJA 3IKJA 1URPA 3KJNA 2EGUA 2X2PA 5HJ7A 2VF5X 3C3WA 3HVIA 1FZQA 1CIJA 1Z3IX 1EGAA 2YNMA 2XUOA 3RUHA 4UAUA 1T15A 4JXZA 4EK9A 5LA6A 3OE5A 4CE6A 3AR5A 3EZLA 2O23A 5KOYA 2CZGA 3MQ2A 1A9PA 1HM5A 5K3DA 5FHQA 1ID1A 1X2EA 3TO5A 3A27A 5DWVA 4F1JA 4I4TB 3R7WA 1LSOA 2BSAA 4WASA 3R7BA 2BLLA 1YDHA 4O3MA 2D06A 2RGYA 1I9GA 4P2GA 3L2OB 4OBEA 2EV9A 4QHYA 1NWHA 3O2NA 3CO5A 1H85A 4H17A 4MKZA 1F0KA 5BYJA 2VUTA 1PHPA 1SBHA 4KO1S 1F2UB 2W2KA 4LJ5A 1WHTA 1IY1A 4CIVA 4R6WA 4B82A 5JZMA 5KOHA 2GEUA 3UF0A 4QUJA 3OX4A 1DG1G 2PY6A 3ONFA 3DFIA 4BY9E 4C04A 4CKEA 1MIOB 2AQHA 1O57A 4GU5A 4KPUB 1F7VA 4DIBA 2NUTB 1NQUA 3QXSA 2VK2A 3ZY5A 4CMIA 1KOJA 3GGPA 3OBIA 2GS9A 4GZMA 3DDCA 3FOWA 1II8A 3S8EA 2Y1LA 1XG5A 5KWVA 1EQ2A 3CB4A 2H9AA 3USCS 2ATXA 5MF6A 2OO5C 2MSLA 1UXKA 1UP4A 4ZN6A 1STOA 2J33A 4TLBA 1N33B 4RCYA 4AZSA 3O82A 1ADBA 1AUVA 4YUVA 4E5YA 5I7AA 2Q2WA 3LFTA 4ARUA 4GX0A 5CA0F 3FPFA 4XGRA 1IZYA 1ZK3A 4BRUA 1IJEA 1HNZB 3S2SA 4UREA 1GAWA 2BFBB 1NU8A 1WVMA 2DPHA 4PX3A 1NXSA 1E79A 1IOLA 5LXTA 4F2DA 3A1TA 3R0ZA 4HUTA 3NBMA 2EKBA 1TYDE 2OZEA 2VZ8A 3PXAA 2ZYVX 1SC6A 2AEEA 2R751 1QCYA 1EWRA 4HWKA 5TDHA 2WAOA 2Z6QA 5B6JA 1M0TA 1UJCA 2C9OA 2OOSA 5K0NA 2OG2A 3ML1A 1E1KA 2JZOA 3JVUA 3PXEA 3VPHA 1RKQA 3ZHRA 1WAMA 1P62B 1KI4A 1JSRA 1V5FA 3GEPA 3GFOA 1NAIA 1RWKA 3TRHA 2HUPA 4M99A 4GLBA 2UZ1B 4UHFA 4M7WA 5G41A 3TFOA 4GICA 2BFOA 5BNZA 1WCXA 1W0KA 3UYKA 3NBYC 6GPBA 1UQRA 4FX5A 3GJQA 4NCJA 4MIYA 5LU8A 1SIBE 4YAKA 3I09A 2XUFA 2R87A 5LKAA 2W98A 2XXBA 1TT7A 2DHQA 3N2LA 5K4AA 4J9UE 2J9XB 3Q3GE 1ZH0A 1E60A 3QWAA 4ZVVA 2P9YA 2BEJA 2DWQA 3F49S 3TZ6A 3QVLA 1C0PA 1U7PA 2GBGA 4HF7A 3OAAA 3IEMA 2D54A 2XGGA 3LVBA 1M83A 3P26A 4XGKA 1UBJS 4ABTA 4GSYA 1BKYA 4QJBA 3VNAA 4XWYA 4ZDIA 1NG1A 3PXGA 1D0SA 4YRRA 3JVVA 1FF9A 2PX2A 1ZQ9A 1DC7A 4KU4A 1LC3A 3OPYA 2VBCA 2G9UA 2XMQA 2VTVA 4NENB 1C4OA 4TTRA 2YV2A 5C5EA 4MJLA 1JBQA 4XYEA 3TTSA 3GLFE 2RG1A 3IJPA 5KNLA 4BCBA 3BZWA 1PO7A 5SYNA 2JW5A 1YJAA 5KEIA 3ZKWB 1W76A 2H4ZA 1RRMA 4IS3A 2VZ0A 3SC2A 1P91A 3NWEA 1JU4A 3I42A 3UW1A 3O92A 4NJEA 5IM4F 4H4EA 1QIDA 4M1ZA 2GNAA 3TB6A 4F3KA 3CQ9A 2RKOA 1RQLA 2FPKA 2X1MA 2XNJA 3QVSA 2TRSB 3D3EA 3HJHA 5CA0B 4YT4A 4ZGBA 5IT5A 2K6GA 1AKRA 1A7AA 2FTKE 3HWX1 4Q3BA 3K5HA 2Q4TA 3IPCA 4AJJA 4JH0A 5IN4A 2Q8QA 2O2CA 2D1TA 2B4KA 1JB9A 2ZSAA 4L85A 1NSYA 4EZEA 1H2BA 5JLAA 1QIIA 4DM7A 1EXVA 4DE5A 3FNIA 1OW3B 2RKBA 1OV4A 1FP2A 3ABZA 3EMBA 1GGEA 2O1XA 3HB0A 4IXNA 1SCBA 3FCOA 1C2YA 2VG8A 3HA7A 3NP7A 3LBHA 1T35A 3NVMB 2HTEA 3L7DA 4OH1A 4QAQA 1KO5A 4CIAA 1H9BA 1GPAA 1M2JA 2W2LA 1UQTA 3PEFA 2NXNA 1WLYA 4HZGA 3AX6A 5DM0A 4R16A 2O4CA 3V7YA 2O3QA 2KPOA 2ZPUA 1IIRA 2B82A 2PHZA 4WKPA 2F8TA 2JGFA 5EUBA 5H82A 2XRYA 5COBA 1QKIA 4MYDA 4JC0A 3D9QX 1IBMB 5K0GA 2COUA 1S8FA 1K5GA 1BS2A 4MULA 1OH8A 3B9RA 2QXYA 1JNYA 1Q6YA 2I3BA 2Z2ZA 5G40A 5JXJA 3W6ZA 5LJIA 2QD2A 1JG6A 2GEBA 4P0QB 1W8IA 3UMRA 1WJGA 3AZPA 4HDRB 3W6UA 1FRZA 1BFDA 2AHOA 4KACA 1OGIA 3ND8A 1GDDA 2FSPA 3T7SA 5JNUA 1LJLA 1DC8A 4L8LA 5AHOA 4Y3UA 5JDCC 2G5TA 3PBKA 2DR0A 2DSNA 2ECPA 4LE2A 2NU6A 4BXOB 4JYMA 5A71A 1W46A 3CZ5A 3UZUA 2YYSA 5LR6A 2NTNA 2WM2A 2ZR9A 3BK7A 2QL6A 1M2HA 3OTWA 1D0VA 3LOQA 3HJRA 1JQEA 4C78A 2WJVA 5AJXA 3FAZA 3KR2A 3SEAA 4W5HA 3WKAA 1E4YA 4BS9A 4ZK6A 4BMCA 1HQKA 4D9JA 2FPIB 2BBWA 4M4SA 4ZI7F 3M6WA 1Y8RB 2IHVA 3RW9A 1E3QA 4KJZA 4ID3A 1BDJA 1KETA 3U1BA 4CHTA 3NW9A 1IULA 1B1CA 2ZR7A 2ZXFA 1JQJC 2JCVA 2DMRA 3N2IA 3NOXA 3EAQA 3D4IA 5A4IS 2IS1A 1PTJC 3BDVA 3UT6A 3X1MA 1F5SA 3SXUB 3RS4A 4CR6A 2C7QA 1EB8A 5FOSA 1U2ZA 1ZO8A 1R6UA 2G6TA 4IRUB 1O5TA 4DCUA 5L4LA 1UR5A 1CY8A 1YE3A 1NBAA 3QH4A 4MVJG 2R8XA 4LS3A 2FWMX 3G23A 4NKRA 2C31A 2VT2A 3CF4G 3O83A 3PPYA 1JRLA 4BGVA 1QQ5A 2QORA 4EX6A 4Q34A 3E9YA 1MGOA 3KYCA 4BO4A 1SULA 1V26A 2JGRA 4EHFA 3GN2A 1L5GB 5IXJA 3U7FB 1YFJA 1QCCA 2BFMA 1Q84A 3H11A 3R6TA 4QUKA 4ZRNA 3R0VA 2B30A 3VSBA 3KKKA 2TMDA 4D4JA 2J9FA 3EGOA 2MDTA 4NYMQ 5IAOA 3OC6A 2C94A 4TM8A 2PZFA 2WKPA 6ABPA 1D4ZA 3FR8A 2XKAA 4C0AC 1V8FA 1RADA 1R10A 5AW2A 1RXWA 1GU7A 3PVZA 3VJLA 3R24A 3B12A 4G5FA 1GGMA 2JAQA 4FEYA 4XLLA 3S2EA 3JATB 3ILVA 4O2AA 1PGJA 1TTQB 4HAWA 3RHZA 5FUWA 5GOTA 4IQGA 2JB9A 1TB4A 4IICA 2BLNA 1T9ZA 2WE8A 1Z7WA 4JI6B 2QMUA 4WKNA 3W8RA 1NY6A 3PGLA 2NAPA 4QOSA 5JAHA 1APBA 3RF6A 2VTEA 1VBMA 2C7GA 3NT2A 4JLVA 4ZI3A 3V7WA 4R2JA 2AL7A 1FRVA 1BA3A 1CQIB 1NMXA 3JQPA 3M6IA 3L0SA 1S2IA 3U17A 1Z6XA 4ESHA 2VAVA 4NE9A 4ISBA 4S1WA 5KNBA 4LF4B 2CLSA 1H2EA 1A9ZA 5JFGA 2RIRA 5EWLB 2PSJA 1CYEA 1TM7E 3M8KA 3MS4A 2ONKA 4IW3B 4RZ3A 2EZ4A 1IY9A 1PS8A 2HIGA 2G5PA 2QRVB 3D4PA 3FNHA 1A97A 2HF2A 3F4LA 4MJ3A 4BP3A 2PFSA 2OXFA 5DK6A 4BB5A 1DIRA 1N6IA 4DMUB 2XDQA 5KX5A 3T1NA 1GLVA 2Y4NA 1HLDA 2BI7A 4ZI7B 5A9SA 5JV5A 1AMUA 2C4HA 2YQZA 2Z4RA 4HNUA 4AI6A 4E03A 2EXXA 2JFXA 3E23A 3TW6A 5CFMA 3VC3A 4G4GA 4D8TA 1KVSA 4OHCA 4TL6A 1O95C 2ZUCA 2VHTA 5CLGA 3V4OA 2UYCA 3MZ0A 2C8VA 5T8KA 1S3SA 4V1CB 2OUIA 2CV0A 1O7JA 5LNK6 1LY1A 1G60A 3BSFA 4I4LA 4R9UC 4URXR 1TZMA 1M1XB 5DYNA 3ZHSA 4N5MA 4X90A 4R2LA 3LM8A 5FXMA 2Z6AA 3IQZA 1CG6A 1HMYA 1TRHA 1XMSA 4TTPA 1EWQA 5J40A 1DTWB 2HMAA 4R7ZA 5HZGA 3W4IA 2IEAA 4G86A 1R5JA 4TSFA 1QTQA 4OHPA 3G0OA 1NYTA 3SX0A 1CQXA 4NSNA 4WDQA 2H2GA 4C5BA 1ZN7A 2WD7B 1J2EA 1KOFA 4M9UA 1XWFA 4BFUA 2EYQA 3Q6NA 5ALLA 4EUHA 4MV5A 2YNMD 2Q5JA 1JFLA 5AW1A 2NADA 4F71A 3LC7O 2HRZA 4RDIA 2J3HA 2X58A 4CKBB 1IYZA 3MTIA 4RHFA 1OH6A 2JKVA 2PU7A 2Y1GA 3UJAA 3HXMA 1QHSA 2WT4A 1K6MA 3HCOA 2WG0A 4X41A 5EZ5A 2F8SA 1JQDA 3MTEA 1XRPA 1NSFA 3HYTA 1EJ2A 4FWTA 1K97A 1U2SA 3QVMA 4YJ2F 2VWQA 2I2XB 3O90A 1RHMA 2BKEA 5B36A 3HQ4O 2ZI7A 2XQKA 2EFYA 2WZQA 3K9BA 3C1TA 4IDOA 2CB0A 4P82A 4K6FA 4UQPA 3OLVA 3QVGA 2YJGA 5BYBA 5J4VA 4Z7QB 3KZNA 2GBLA 1UDRA 3CF4A 3DYIA 1E3SA 3LG2A 4YO8A 1U02A 2PT6A 2WLSA 1NMEA 4HBZA 3WB1A 2EFDB 4C88A 3K2EA 4OAQA 4Y9SA 3TBFA 1Y3FE 3AEUB 4L6IA 3W7BA 5GM2A 4EF5A 1YB2A 3LSTA 1XRSB 4WFJA 2UUBB 1Y6RA 2WVGA 2EP5A 3MJDA 4J94A 4GOKA 3KRTA 4OB8A 1KZ6A 5KWJA 4ZVTA 1QZ3A 3JVDA 2VYVA 4RMIA 1PJRA 4UATA 5E4FA 2KYRA 5FA8A 5J63A 3EZ6A 3RS8A 4EGSA 1BTOA 4ACBA 2O8CA 3NDPA 2IOFK 2NV6A 3O8QB 3GRPA 1X77A 5A5VA 1GCAA 4TV9F 3SHQA 1DC4A 1UC4B 1I6LA 2L2QA 1IATA 1E5LA 2C4VA 2YHAA 1JSLA 3CCBA 1IXYA 4CU2A 4WE3A 3C98A 1YL7A 4OGGA 3KWFA 1E79D 2VJMB 3IDZA 5F33A 1WDLA 4WESA 3GPLA 2IU0A 1P1JA 3OZBA 1NVUQ 3IUBA 1ZP6A 4HEA1 4FT2A 3B6KA 1EX9A 1NLYA 1OUMA 1GL7A 3LUPA 1JSCA 4AD8A 4YMTA 1EHIA 2F3RA 1KP3A 4A0HA 5K8LA 3W90A 2X5JO 4JI4B 4XB2A 1N2CE 3V8QA 2BR4A 2JJ2A 2AFIB 1C9YA 3HJGA 3Q8WA 1T5HX 2PEYA 3S68A 3REQB 1A5TA 1C81A 1FP6A 4WXEA 5DEOA 4QUHA 3LUKA 3ESRA 1K3UB 5A1TA 1XHLA 2ACWA 3AG6A 1C0EA 1XJWA 1ZD4A 2HZ7A 3KR9A 5CT6A 3EC1A 3GJTA 3WGVA 2VOJA 4NE2A 1DBRA 4ER7A 1W0KD 3G8YA 4MLCA 2LGJA 4B44A 3QUTA 3GZ4A 3W2TA 3AM4A 1FMCA 3O84A 2GZAA 1RLTA 3ZXUB 1OH5A 3D7MA 4XCVA 3L4KA 3UOWA 4OHYA 2Z09A 3SR4A 3BD9A 3NJ4A 3P9IA 4YJ2B 2O2HA 4RZUA 1IZ9A 2SNIE 1P73A 3D2AA 4OB6A 5K01A 5K0JA 4FYYA 3LBIA 2WE7A 3WDSA 4AJIA 3E61A 1IEVA 1NDUA 3PQEA 3TCKA 4A36A 1GSOA 3OAAD 2GCPA 4I1UA 3WA7A 1TQ8A 5JCOA 3C7KA 4IHJF 2BEUA 3D6TB 4LX0A 4ALNA 5IJ9B 5BNWA 2R8RA 1EEHA 2OHJA 1KZ4A 3UATA 1Y4SA 3FH0A 4D3YA 3RYFA 3H42B 1JPJA 3DMTA 3STYA 3AVTA 2Q1WA 3PKIA 1QPZA 2WVHA 3ZGYA 2GTPA 4A0RA 3GI1A 2BT4A 4K6MA 3OIWA 1KQPA 2UKDA 3PGMA 4M87A 5KB3A 3R9XB 1SOWA 3QVTA 2GSWA 4A0SA 1H3FA 4UBKA 5E7JA 1BHJA 2GHRA 3FPLA 2L82A 3DNFA 3K09C 4TV9B 2VPXA 4NPAA 5THXA 2H1SA 2V9CA 3G88A 3JD4A 1WPXA 2RBKA 4ZO7A 3W1VA 2A4MA 1K5HA 3REGA 3FJ1A 4B43A 2PD6A 1P0QA 1VRCA 1QRAA 4QT4A 2WTBA 4Q19A 1UJ2A 2EEPA 1TVMA 3MLAA 1XQWA 4EF4A 2W2TA 3AUJB 1C1DA 3RJ5A 1TFUA 2PN1A 3RS7A 5FI0B 3WZLA 2K2WA 5IMSA 3EA5A 1CJCA 3CZRA 3KB2A 5K3OA 3WIVA 1FPQA 1MH1A 2VTBB 2ZJ5A 4FZJA 2BBSA 3ABRB 2UZ0A 2XF8A 3GA5A 3PCXA 4QSHA 3SOPA 3T61A 1I14A 2R11A 4CW7A 2GJ8A 3PTAA 1U0BB 4ZZ0A 2NUBA 4XQ0A 2I6FA 2IPLA 3Q3EA 3ZJTA 4DQVA 4HRAA 3DWFA 3O03A 4PS0A 4C2AA 4DFDA 1RD4A 3E9CA 3HA3A 2W2LD 2ENWA 2L0XA 4DEYA 3HCRA 4KTTE 3FNGA 2ECQA 1RS0A 4LRTB 4REOA 5GJCA 3EN0A 4CT4B 3L92A 3OETA 3GIDA 1O8BA 3VOSA 1E0AA 2WZCA 2QYOA 1JFVA 1JW9B 4OXQA 2XNDA 3CZAA 2OBYA 3T3HA 4BTLA 3NWBA 1XP8A 4HAXA 5TGDA 5ERYA 4FC6A 4EY4A 1C3JA 2DR3A 5K3CA 3KB8A 4WJZA 2OK8A 4KO2S 4RTRA 3DBOB 4QPZA 1EJ6A 3CINA 5BVGA 3EBPA 1FTYA 1PJAA 4QVKA 2PJDA 4ON9A 3SKXA 4LCJA 4ZALA 5U1PA 4J6EA 1G8MA 1UBHS 5FL7A 4ZCTA 2H11A 1SZCA 4B9EA 4RDHA 1NY5A 4ZJZA 1JXOA 1NQ5A 1NXOA 4IXTA 4IHJB 2PFGA 4UTXA 3GVIA 5J2UA 4MUNA 3PJRA 4HVLA 1NC3A 1QHIA 1J0CA 4OLBA 2WFZA 2HPZA 4W1RA 1DEAA 3DDNA 3IIJA 5JS1A 3SHWA 2JBAA 2ZJZA 2WJYA 1DIAA 2OHIA 3M1YA 1N2EA 1RM5A 1RTKA 3EDRA 1Z15A 3WDLA 2EP7A 3MSXA 1E1CA 1BCSB 4TM7A 3B36A 5EP4A 4QO7A 4ZEMA 4EKIA 4OSEA 4MW5A 3RG8A 1X8JA 2GZ3A 1DCMA 2IK8A 2C4NA 2LBPA 3ANMA 3B1KA 4BLTA 1L8XA 3Q0IA 4OB7A 4R1LA 1YZVA 5KMGA 4ESOA 4G6ZA 1OXXK 1GN8A 4PPYA 2ZJ7A 5BO5A 3R3VA 1KP2A 4QEKA 1U90A 1NONA 5HPYB 1NV9A 2GNPA 4OMUA 1HQDA 1LRLA 1D09A 1XBTA 4UAJA 4Y6PA 3RV3A 2A0WA 2C5GA 2XTMA 5CFPA 3OU2A 5ILGA 1W25A 3EHDA 1XVAA 3PA6A 4YJHA 3FTNA 4DZRA 2OCPA 5JSZB 5L3SA 1CNFA 1SBTA 4IYJA 4XD2A 3EJ6A 4CF3A 5BUQA 3TJMA 5A1JA 4FS3A 4RH1A 1WMDA 2VDWB 2CLCX 2OXTA 1ZBQA 2DHEA 5LQSA 2QOEA 1Q91A 1JIQA 2QQGA 1GTJ1 3I2JA 3USES 3WGJA 2JHGA 3Q6IA 3I01A 2UXDB 2I4MA 2GN1A 5JFOA 4RUKA 3IKTA 3JQBA 1ZX1A 4KR9A 3EYAA 2Q6IA 3PPVA 1PZXA 4DCTA 1FQJA 4KX3A 3U1TA 4UFPA 3MD0A 3PDIB 4FHZA 1SM4A 1BDIA 3EMKA 5JADA 2A92A 1DRVA 2ODWA 4KDFA 2OK7A 5LP6F 2WEKA 2JGAA 3ET4A 1SVIA 2F9MA 2I2BA 3IQHX 4RFLA 4WX2B 2E4ZA 4EYOA 2HW8A 3KU1A 4NBVA 1SRRA 3A6FA 1CUVA 4AP6A 1JFTA 2QN6A 2IODA 4XQGA 1DI0A 3WB2A 4D8XA 2B7LA 4BHTA 5E7IA 5KNBD 1RXCA 3GJ8A 4FE4A 4TWRA 1CBUA 5DU2A 4B84A 4Q9AA 5FORA 1KYYA 1QIEA 3B53X 4XH9B 4I3FA 2QSYA 3VZCA 1GZ3A 2GTIA 5CAEA 3I62A 3RIXA 4JQOA 3LAWA 5DNEA 2XMSA 2C9ZA 1OF1A 1SZPA 3QI7A 5AKZA 3TW4A 1YH3A 4I8IA 4JFAA 2VDNB 1E2IA 2ZEJA 3RFXA 4MLZA 1TIPA 1TTHA 3PZBA 4CGZA 2RH5A 1Y4AE 2W93A 4NS1A 4EFMA 1CB7A 1ZUNB 5EG5A 1TAHA 1H0KA 121PA 2CW5A 4R9SA 4LF6B 1Z4OA 2XUHA 4J0EA 3H9QA 2I1LA 3A6EA 1X7WA 3RAEC 2AOTA 3RVSA 2IW3A 4KFTA 5DGXA 1EP2B 2O3JA 5JMOA 2YZ7A 1TZKA 4JMLA 1E98A 5DE3A 2VQEB 2JL1A 4ZGWA 4JOQA 4R0NA 2OVFA 3ZV4A 3PNYA 4KXVA 3TRIA 1ZK1A 1TA4A 4WCFC 3WGTA 1BQ3A 3DLHA 1KXZA 5KTNA 1ID8A 2P3SA 4TS3A 2OPHA 5TJ9A 1I2DA 1TQHA 1U8ZA 3AEQA 1QTIA 4J16C 4TSFD 4U5XA 5HTKA 1YF3A 1CQJB 1XNHA 3AHIA 2RAFA 2ANBA 2AR7A 2FF5A 2ORVA 3GEGA 1UBCA 3E7WA 4CF7A 3AK4A 1T6YA 2IBMA 5LP6C 3RARA 4HB4A 5CT5A 1CUBA 1N5RA 2ZAYA 5CVCA 3VI4B 4DA4A 2QYTA 1O94D 5EIBD 4QJ5A 4D9BA 1JP7A 1VLMA 4WA8A 2EQ5A 4WCFB 3VDXA 3RC1A 1AUOA 1ETHA 3OLZA 4JY7A 2C9BA 3OCZA 3EIXA 3I9OA 4EHJA 2I4IA 2GCIA 3PXUA 1BN6A 3KOXA 5K0EA 1EFCA 1VI6A 4ALJA 2HHAA 1YZ3A 2XHEA 5J4HA 3ZQJA 1IBSA 2BM8A 1PJ2A 1XR3A 1MX9A 4XLZA 1MXFA 5EIWA 5CFOA 5LP6B 5HIAA 4KLCA 4MDEA 1OIXA 2H0QA 2IF0A 6REQB 1TM3E 1YS2X 3EOZA 1O97C 3VPCA 1K89A 2NU8B 3X1DA 4O0LA 2QTGA 4MVJD 4OREX 4ZIRB 1P0FA 4HLNA 4H6PA 3WNBA 3TIGA 2FOLA 4MCJA 1GTRA 5NLLA 4LQLA 4CV2A 4LJ4A 2O0MA 2WOJA 1V4VA 1E3TA 5ALRA 1OR8A 2PMFA 2XADA 5I9TA 3WICA 4F4JA 4MRAA 4MITA 2VRNA 1G9SA 4YT5A 5HOQA 1SKMA 3NTVA 4HXGA 4LZNA 2OHGA 5KNCH 5JS8A 4LQDA 2HHCA 2VDVE 2JVIA 5F1OA 1JXQA 3WNDA 2PS3A 4K0RA 3RIGA 4F4FA 3U4QB 3IV6A 3LUFA 3QG1A 5BWLA 4HDKA 1E9SA 2JAXA 3D6UA 2VYVD 4MP8A 4NFSA 4EI9A 1W34A 3ZUPA 7REQB 2QZPA 3QYPA 4MRMB 3DXFA 2X5NA 4KXLA 1AKTA 4W6QA 1DELA 1QK4A 5D1HA 4RK0A 2OFXA 4FMDF 2BHTA 2V7XA 4Z0TA 5DW0A 1M5UA 5DLPA 2JHAA 4CM4A 1QYCA 3OSZA 1RQNA 4I9GA 3BMQB 1RQGA 3WYGA 1YUBA 2A0KA 5FOTA 2SKCA 5DI3B 1OLXB 4LDQA 1FTQA 1WXGA 3CRQA 3Q8MA 1GCIA 1JWAB 3AH8A 1WZNA 5DN6A 3CG0A 5TY0A 2RJNA 1IN8A 3LRXA 3ORRA 3AUFA 3AONB 3T1QA 1KBZA 1GSHA 4K8RB 4XFJA 1XRMA 2JIPA 5C7YA 4L5IA 3HZZA 1E9FA 2XWQA 3ZZ1A 2A0FA 1AU9A 2FKAA 2P35A 2Q9CA 5BW4A 5ADUS 1BD4A 4CG3A 3WLOA 2JJ2D 3E9ZA 1L9XA 4ONEA 3R09A 4CF6A 1WD7A 2G82A 1EP3B 4FQ8A 4JVNA 4OKIA 3ZDFA 5FNVA 4Q37A 4TYYA 3MELA 1JHUA 5JU6A 2ZVDA 5JDIA 3QU4A 1B73A 3P96A 3C8ZA 4JXKA 4INPA 5DGCA 3VDNB 5F5LA 2D2IA 4EGFA 2XA1A 1NM5C 2IZ0A 5LA6F 2F3UA 5HRUA 1WXQA 5BN5B 2BTQB 2ZUUA 1AQLA 3BD6A 4IINA 4FWBA 5BY2A 1FU4A 3K0AA 3TOCA 7AT1A 1VYHA 4XUDA 3CZMA 2JH3A 3TMKA 5EOVA 3A9UA 1L5HB 4LFBB 3A1VA 1CNMA 3N6RA 1MO3A 4L5YA 2AA3A 3AJRA 1VBKA 3UIEA 4GLFA 2QVBA 4DSAA 1E5XA 1X42A 5IH3A 3A2KA 1QGED 1AS3A 4MWSA 4E4RA 2ZYHA 3IP6A 2GLTA 3PD0A 2F1RA 3K30A 5KDLA 2O19A 1WUYA 1ZI6A 4RSRA 1XC7A 1IRXA 2RD2A 3RWBA 1GSAA 3NPMA 4CU5A 3EZ7A 3I64A 3PUZA 4PZUA 3QENA 1EBBA 1SG0A 2DCUA 3W3ZB 1ULAA 3UJ8A 5KWIA 2D5IA 1F2TA 2HHLA 2OV4A 2XWPA 4EO7A 2R48A 1IFXA 4NATA 5K9ZA 2BBOA 1KE2A 1GG8A 2HRRA 1ENYA 1XZGA 1QRDA 2RHRA 2AG6A 3CJRA 2PGIA 3NVDA 4FMDB 5H16A 1E1DA 3F8TA 5GZ3A 1KJWA 1WV1A 1MJGA 4BNVA 1KIMA 1PUJA 3FWHA 3GWGA 5C3UA 1ATZA 4MUKA 1UJ4A 2MOKA 4O5AA 4PGHA 1A0OA 2Q7XA 3HJUA 4F96A 4FJ1A 1GKKA 1ND5A 1WDTA 4UARA 1LBHA 2GRJA 1NMZA 2GPNA 2OCLA 1RP1A 4Q4AA 2I7VA 3LUHA 2M6KA 1P1IA 2IQ5A 1YB7A 1JG3A 1QLHA 1ZJ6A 4LQ4A 4D81A 3HKCA 4B71A 3SBDA 4GEKA 2YNMC 3GRRA 1P1FA 2RHOA 4TKVA 1JEYA 4JSTA 4G0ZA 3VPBA 4G3XA 2P1ZA 4X6LA 5JEDA 1YR6A 1QH8A 4JI1B 5ARDA 1T9KA 3EXFA 1BXGA 1U3GA 2P4SA 3OZSA 4M8KA 3ZVNA 1XQXA 2JG3A 1JILA 3QMPA 2KM1A 4C07A 3W2EA 1QYWA 1ZONA 2I3ZA 5GJVC 5I7RA 2Z5FA 4HEQA 1T29A 3E3MA 3TI9A 2FMIA 2IP2A 4PZZA 3CEPB 4E2YA 1GNPA 1ZGCA 1HE2A 5LA6B 1NA5A 2XNDD 4UQLA 1G3RA 3UH1A 3B51X 4X64B 5JR3A 1PR1A 1PDOA 1CZNA 3HU3A 3QVVA 3F5DA 4NOLA 3NYIA 3WLSA 1MH9A 2H9YA 4YQYA 2HR1A 3IO5A 4X6YA 1S8NA 2JJYA 1Y3DE 3HBMA 1WMEA 3LVRE 1IAVA 3NGXA 5JY6A 3H2ZA 3DZBA 4HYYA 3R7WB 4B7CA 1KWGA 2V7UA 5H9WA 4MR9A 3SZMA 2XNCA 3QVWA 4IMJB 1FUYB 2QHXA 2BUBA 3OIGA 4C0LA 5BNTA 2I4OA 3I6QA 4FQ5A 2H1IA 2VAXA 4JZYA 2GBIA 5K3FA 4DLBA 1XN4A 2W2KB 3WFZA 1WHTB 3NHLA 3HCCA 5KOHB 5JZVA 4BMNA 1PGOA 3K4HA 2I9PA 3I3OA 2AYXA 4IXMA 2DZDA 3OECA 3W7VA 3V7FA 3VO8A 2A84A 2J5RA 4CKEB 1D07A 2C59A 2VUIB 2Z5LA 2BFCA 4CMIB 4F2WA 2ZIVB 2BHRA 3HCFA 4GWLA 4CJXA 1A9XA 5CX4A 5I7OA 1RRGA 4C20A 1II8B 1B42A 2I4LA 3UYLA 4J1NA 4AU1A 1DWPA 2QNBA 5B4UA 1Z5PA 1N5DA 2IYSA 2VH1A 3N0WA 2QV0A 2AJTA 4BV3A 1J09A 1ZIOA 5JO0A 2CBZA 2AJBA 2WIGA 1OFHA 2FZVA 1TKBA 1A9QA 3JR3A 3L0YA 2OGWA 1Z6YA 2OBLA 5D6NA 4TZ6A 3PTZA 2R0QC 5BW8A 2AN1A 1E77A 1SVLA 3K0EA 2V7QD 3LF1A 5JJKA 1IM2A 3LUGA 1YKGA 4MQ4A 5B2EA 4GOOD 1KO1A 1QRUA 1Y37A 2ATCA 1ADFA 3E9MA 3LNCA 3CR7A 2BUAA 3VAYA 1Q7TA 2B1JA 2J9ZB 5TV2A 3TE7A 4HTFA 1OT3A 1USVA 4WOJA 4Y6SA 1H2ZA 3AJEA 5DXJA 4Z7NB 3BULA 4RVHA 4NTZA 2VRCD 3I04M 1YONA 4K6KA 3R7SA 3ADKA 2JGNA 3T3OA 2A5FA 2PV0A 3R5FA 4TVBA 3ZN2A 3MJHA 1UZNA 4ZVKA 3MINB 4DGQA 2NW6A 3ZWDA 3FPGA 1UFKA 4LHZA 1PG2A 5KHOC 2QM3A 4KE8A 2DWUA 2SECE 3CLUD 1ESCA 3AWIA 4HGNA 3T5AA 3BQNB 2WSSA 1WY7A 3KQMA 1Y3AA 2EFJA 3N8HA 2VPQA 2ZANA 4QUBA 1G3MA 3LCVB 3DVQX 3KSMA 3OCUA 3T3PB 4RHUA 2H1OA 1BIFA 1RNLA 7GPBA 2VJOA 3ZCUA 1T43A 1AOXA 3E8MA 3VJKA 1QDLB 4GQAA 4V02A 1OYYA 1JI3A 1TYCA 1GPH1 1USGA 2HLNA 5JWHA 5CD9A 3GELA 2P2SA 3EVDA 3FKSA 1C9JA 3WL4A 3PUKA 2G80A 2PMDA 4H3KB 3ZQ6A 1JT2A 1L7MA 3OM8A 1MFPA 3TQHA 2W8ZA 1WS6A 1BVHA 2QZ9A 3PEWA 3DTVA 3EQ9A 4INZA 4MV1A 4WI1A 1TYBE 4P4UA 2QMQA 1UP6A 1SKYE 1VBNA 1YA8A 4GMGA 3H19A 4NEGA 2JFPA 3DBRB 4GR9A 4MUYA 2RKWA 4XUEA 3C3EA 5EMKA 1PU2A 1I7LA 3NUGA 4QQ8A 2YJZA 3OPYB 2O2SA 5HKAA 2GYUA 2EJVA 2QY9A 3DF9A 1Y89A 3L43A 4PIVA 5AM4A 4G0MA 1QIFA 5P21A 1I2MA 1U7XA 2CXQA 4IIEA 4V0RA 2PU5A 4BNDA 3FZGA 5C8XA 4F9TA 2WWIA 3MRTA 1QKKA 4ZT3A 3RF7A 3SC2B 4F97A 5JJCA 1QH9A 3L41A 3IEXA 4Q9JA 4B6GA 5C4MA 3RC8A 1QNLA 4NJEB 5IWAB 2W6MA 4PW0A 3L01A 4XWTA 1OBVA 5D5PA 2IELA 4G8JA 4FFVA 3TD9A 3U3DA 4E5KA 1G8AA 3MTGA 1ZCBA 5ALUA 4KLZA 1V6AA 1XALA 3A6LA 3FHOA 2O5EA 3M7IA 1F2DA 5CG2A 5J43A 1FX0A 2X9GA 4US0R 1HG0A 3OFSA 5JNWA 3Q7SA 3UG7A 3HV0A 4QYTA 4PPFA 2BFWA 2C9DA 4BVHA 3D8HA 2RGDA 5BMVA 1DUSA 1O0SA 3IVCA 3NAZA 4MI3A 4RCZA 4UUMA 2FGJA 1Q19A 3OZRA 4DCNA 2ZUEA 1DBPA 4KO4S 1LW6E 3GPCA 2ZTHA 5AOBA 3H5RA 4CUJA 5CHEA 3OLCX 3MMNA 2FSHA 5L51A 1I13A 4PBRA 4PYQA 4BN0A 4I50A 1KZGB 2ZRPA 3FCXA 4EL0A 4Q21A 3V46A 4P5EA 1Y33E 4TWAA 3EFOA 5EY5B 3AINA 1V8OA 3OF3A 4O2AF 1J0XO 1EGHA 1ZD5A 3K1JA 3JQAA 3LLUA 3OJFA 2JIDA 1NYRA 4XEHA 3T38A 1OX4A 3U09A 3QWHA 1NC1A 2OYSA 2G6BA 2ZSEA 1KKMA 4X8HA 3DW3X 3G68A 3IC5A 4GNKA 5BW6B 2PMBA 3Q9SA 2BMEA 2QTZA 2E85A 2ZROA 5EIOA 3IHLA 1NTOA 4I8DA 4QARA 1NNEA 3TTVA 3OTOB 3WK8A 4B46A 3GBPA 4I46A 2VAWA 3PLNA 3IAEA 4NQZA 4TOIA 1MAAA 1PG0A 2FPRA 5ITVA 2FR1A 4JKYA 1XZNA 2WAXA 3IPYA 2WD9A 5HJ2A 5GJWC 5KSYA 2EIXA 3A25A 2VJNA 2NU6B 2CKMA 2WPDA 1XL1A 4JJKA 4O59O 4PRYA 5ENDA 3UJ6A 5HVNA 1CUYA 1NJ8A 1VKRA 2QYHA 3FPHA 5DTQA 4MYTA 5IANA 1O6CA 2QRMA 3HXKA 4YRMA 4NNJA 3NKLA 2NVWA 1T0IA 2DBVO 3EW9A 2V3CC 3ZU3A 3M82A 3R9KA 2BCJQ 5KX5F 5LM3A 3KLPX 1RHUA 4QTXA 5B55A 3LRTA 2R68A 1PUXA 1T3LA 4QU8A 4AY6A 3HPRA 4FMBB 2ZB7A 4KN8A 1QHNA 1YDGA 1PR2A 3ZBPA 3NVKI 5LIPA 4JFRA 4DIDA 4O2BA 2FE1A 5C1BA 3KQSA 2JLBA 3BB1A 3LQQA 4I6JA 1IQRA 2O1WA 1Y7PA 3WISA 5DN6D 4DEVA 3A3NA 4CODB 1SUCA 1N2IA 1R9NA 3RDPA 3CWCA 3RIMA 4PQYA 3UT5A 3WWYA 4HV4A 1ZI8A 1PT8A 1I3OA 3VFDA 2I2FA 1XCOA 4XZ3A 4B80A 3J7AC 3F67A 3LO5A 3WIOA 3KYCB 4IJMA 3QE0A 3V55A 2HK8A 5HXAA 3GO4A 4WUVA 3EVTA 1VQ1A 3H11B 4MOWA 4NMWA 4D6YA 1EM6A 4UUBA 1OZGA 1YFZA 4TTSA 5DX1A 3WGIA 2OYRA 3ZV7A 2J9FB 3PYLA 5CVVA 5EP2A 3FGNA 4OHUA 3E9RA 1F6BA 3UCFA 4KBYA 4DC0A 1LBEA 1MOZA 5B4TA 4CT5A 4X7BA 5AI5A 3EPJA 1QGDA 2WA2A 3LK7A 3HP4A 1T5OA 1PJQA 4GPIB 3TVYA 3TS1A 4MLPA 2BMVA 4O2AB 1TW3A 4AJ2A 1AKUA 1GQYA 1KORA 4R9VA 3EGDA 4LRXA 1RYBA 4NYJR 3RUIA 1Q77A 2C2GA 2O6HA 4XVRA 5KVSA 1RYFA 2R2GA 1UC5B 2VJYA 3SIWA 3WGUA 2QX4A 3NHRA 4ENTA 3PFGA 1QVWA 1VGQA 1DIGA 1NQXA 2AFHE 3CGWA 3THSA 3G1WA 3ZD9A 3V8VA 3GUHA 5K0LA 3G13A 3LD9A 1K4YA 4BB6A 3C8HA 3IP5A 1YHZA 3Q3IA 4L5BA 4NLLA 4WK4B 3PQFA 3UVEA 2C77A 2JA2A 3GHHA 3ROQA 2MYPA 1N6PA 5THKA 4J29A 2IRWA 2WFAA 5AQEA 3H5IA 3I3SR 2C1XA 5EKXA 5T8KC 3T5DA 1W52X 1E5QA 4PXYA 2XCLA 2HCRA 1E7QA 3NBZC 2I1QA 1UJMA 4IFBA 3GLVA 2BKUA 4JP5A 2EF0A 4NOJA 1EFLA 2I62A 1I4LD 3L6BA 3AF5A 4FLEA 5KX5B 3ROKA 1MRZA 3QU2A 5CNIA 2QTAA 3OPVA 2R4QA 1T8RA 3K1AA 2HY7A 1WB4A 3TQRA 2CSUA 1UP7A 1V39A 2HDNB 2MU1A 4QBTA 3KUXA 4K7JA 1YOVA 4CTNA 2UAGA 3ZWOA 4F5YA 1DXYA 4A5OA 6Q21A 1H4SA 4NZ9A 1J8QA 4LDAA 4JBLA 3CSDA 3HO1A 3NT5A 2N46A 2XGOA 4BU1A 1T2FA 4DJEC 1ZR4A 1CX9B 4EVRA 3IBFA 4DR3B 1JBEA 1P0IA 3MUNA 1JDTA 3AFMA 5MGBA 2BZ1A 3GRFA 1MAVA 4RQUA 3UMYA 2IWHA 3HWRA 4G1MB 2C9CA 2NT4A 4FDTA 5EESA 3TG2A 4K5QA 3B48A 5M3BA 1FSPA 5EIBC 1ZESA 2HQBA 1N78A 3KR1A 3O6VA 4RO0A 3IE2A 4PC6A 5CDUA 3N87A 3A1SA 1W9MA 5I6DA 5DM60 3C1UA 1DAHA 1W5EA 2HPHA 5ADHA 3RRMA 2J7KA 1N34B 2YXLA 3H05A 3LXUX 2WIDA 3HJAA 2FXIA 4QIHA 3G6WA 3W34A 1IBRA 3KDSE 4GT1A 2JLYA 2QTMA 2GM4A 1SD1A 1SZDA 2D5CA 3HM9A 3ZDZB 1UZAA 4JUAA 4R8SA 4E3WA 3HXOA 3SSOA 2VHXA 1LVHA 4UUQA 3HJNA 2GBLC 3MRVA 4YTEA 1PR4A 5F2NA 1LQUA 4AKSA 5I8WA 1ORTA 1NJ5A 2F00A 1TZJA 2Q9BA 3BE6A 3WAKA 3CA8A 1P5FA 1Z73A 3FI0A 3HGMA 4M0KA 2OBFA 2QF7A 1S8AA 3RYCA 4LSWA 5ALXA 1FA9A 1XZKA 3WK7A 1REQB 1L3IA 3T4UA 4FFOA 1USIA 4KMOA 3DVAA 4Q3CA 4A0FA 2INGX 4BU0A 5I7UA 3QVGB 3KJXA 3PHIA 2R6R1 2QW8A 4CM3A 3B70A 4R2IA 4TTVA 4DTCA 1E9CA 1E6KA 3A9SA 1WP4A 5H1YA 2MYNA 2QGZA 4LMBA 3VOBA 1YWGO 5HK8A 5LMZA 4W5NA 5FBQB 1ZG3A 4GP9A 2FMXA 3HVKA 4N40A 3W2IA 3FF4A 2DB3A 4OQFA 4DKXA 4E46A 3L6UA 3PX2A 2HRBA 2AJLI 4EKYA 2QD1A 4RCVA 3WJAA 1G0NA 4Y2YA 4KL8S 2I1VB 4NBKA 5G0SA 5GAJA 4BE4A 5FV7A 2PR2A 4RZSA 4H2DA 2ANCA 3NU1A 4OGLA 2O8CB 4UCXA 2J6IA 3NHFA 1XT6A 4HWSA 4PHHA 2W0MA 1V11A 1VSBA 2AW5A 2I34A 4TKUA 4Z2AA 4OHKA 1ZH4A 4UZSA 1FFEA 4BWYA 1C7JA 1GV1A 2ZSDA 2IX9A 3R6DA 4AG3A 5CFRA 1KI8A 1M6WA 5KS2A 1DBSA 1SG6A 1NR7A 1SHZA 2PQ0A 4KG7A 4WESB 2QA5A 5CEFA 2ODAA 4F45A 2E48A 4EVQA 1RLUA 5BNFA 1G21A 4B47A 1Q12A 2C4UA 2E87A 5ENVA 2H2FA 4CHGA 3ZEIA 4FYVA 4J91A 2R1UA 3AFGA 3L05A 4PXAA 1UXHA 2JA1A 1AGPA 4Y6RA 5L3ZA 3EAFA 3ZC3A 4CMJA 2M2IA 5C1I