4HTAA

The structure of the karrikin insensitive (kai2) protein in arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
276
structure length
271
Chain Sequence
SLYKGVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Karrikin-Insensitive Protein (KAI2) in Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Hydrolase, alpha/beta fold family protein
total genus 96
structure length 271
sequence length 276
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4htaA00
3OG9A 3EQ7A 1TIBA 4B85A 2CBGA 2ZSHA 3GBSA 2HL6A 4DIUA 3PE6A 5AM2A 1AZWA 3ESAA 4YK7A 2Y2UA 1SOMA 2XE4A 4FKBA 3LP5A 3BF7A 2XUAA 5AI0A 2VATA 4OB6A 5LKAA 1DX6A 4NZZA 5HK8A 2WG0A 3AIOA 4BZWA 3M81A 2AJCA 1XZLA 2ZJ7A 4J3JA 4AZ3A 2DR0A 2JGEA 4I19A 1BCSA 1O6FA 3EBLA 3F67A 2XUPA 1XFDA 4AO8A 3SWWA 3ICWA 2AJ8A 4J0CA 4N8DA 5EIHA 2GBFA 2ZJ6A 5FDFA 4QDOA 2XMBA 2I3ZA 2AJDA 4X7BA 1J2EA 5AK5A 1A8UA 4B80A 5D7BA 4OPMA 2ZYRA 2OCGA 4ZWNA 2WSLA 4H7FA 2WUFA 1UKAA 1OILA 1XZCA 3IVMA 2OQIA 1WPRA 4BBZA 3JWEA 4M0MA 3WK7A 2WJ3A 1ZGCA 4HRYA 2CUTA 5I8PA 3H0CA 2WTMA 5C8XA 2ACEA 4WFJA 3G0DA 3G9ZA 4EY5A 1MNAA 3C45A 5ALYA 5K3FA 1CQZA 3SX4A 4X90A 4FOLA 5E2IA 2QS9A 3V1KA 1IUNA 2C0QA 2WIFA 4Q1VA 3WWDA 3KSRA 4AN1A 4BE9A 4N8EA 4DSZA 4KE9A 4PSDA 3MVEA 4BTLA 1G42A 4EBBA 2YXPX 3WK4A 3QMWA 1DT3A 5AK3A 1DINA 4C4ZA 4A16A 3F96A 4RPCA 3E0XA 3HEAA 4FBMA 5AKGA 4QDZA 4EY8A 4N8SA 5HKBA 4FTWA 3DYVA 2I03A 4QWMA 2WG2A 1QFSA 1UZAA 2CEKA 2QUBA 3H1BA 3WYNA 5AHXA 3C5WP 1C4XA 2XB6A 2HA3A 1ZI6A 1N5RA 1VZ2A 4X97A 5JD6A 5JAHA 1GZ7A 3WQHA 1Y37A 4UBMA 1CUUA 2J4CA 4EHBA 1UKCA 3H04A 2EDCA 2H1IA 1N1MA 1EDBA 5D3ZA 1FFDA 5CTAA 2I78A 5T4FA 4NS4A 3WKCA 4X85A 4JEIA 3I28A 3CCBA 3FSGD 3H2KA 1TCBA 1LZKA 4K5QA 2GBCA 4WDQA 5FPQA 5JAPA 4CIAA 2VTVA 2DCMA 2DHEA 3WK8A 1HBJA 5ALFA 2CB9A 4A23A 5HQ3A 2HU7A 1JKMA 2OCKA 5A62A 1PV1A 3U0VA 1RYYA 1HLGA 3RLIA 5AIBA 3AZPA 3C6BA 1XZMA 3DYIA 5KREA 4PSUA 3BIXA 1ZGBA 1QTRA 2OGZA 2D0DA 3C8DA 1BCRA 2IX9A 5HF5A 4Y2XA 5ALZA 1MX9A 3IA2A 1B41A 3BDIA 4H7KA 4MXDA 5T4HA 3QITA 3HJUA 3R3ZA 1XZFA 1LPOA 1Y7HA 4C89A 5BWCA 5A7HA 1E8NA 2WQZA 5AM1A 1IUPA 1BN7A 2QOEA 2PSEA 5KWIA 4Q3OA 3P2MA 4OD0A 3AUKA 3I1IA 3H2JA 1WHSA 1QTIA 5FPPA 1CUJA 1JMKC 5DYYA 3IB3A 5HZGA 5AK4A 1U4NA 4FLMA 2HFJA 1WPXA 4L0CA 3WK6A 3O9VA 4PV7A 1MO2A 1EK2A 1QO9A 1XQWA 1USWA 1KEZA 5AK6A 1T4MA 2HIHA 2QT9A 4OCZA 3WIOA 3OPMA 2OLEA 1UXOA 2XUDA 3ESDA 3FYUC 3EF3A 4KR0A 5BV7A 4GI1A 2BUAA 3DS8A 2V97A 1JFRA 3BIWA 2JGMA 2XMGA 1MX1A 3BL8A 3UMJA 3G02A 3HABA 1E5TA 3ANTA 4L72A 2DHCA 3O9MA 3T4UA 4QE3A 3WIBA 3N0TA 5JD4A 1CVLA 3W9UA 1BEEA 3LIIA 5AI5A 2XMSA 4D9JA 1U65A 3LLCA 4X00A 1BU8A 3CCCA 2QRUA 1Z68A 4Y9SA 2XUOA 2VJDA 3G9TA 4RGYA 1CUCA 2PL5A 5D6OA 2WLSA 5EHQA 2BAGA 1ZD5A 4FHZA 2H7YA 2QZPA 2PU7A 3ESBA 5AO9A 2XUKA 4DMHA 2DQYA 1LPPA 1YS2X 3O4JA 1FFEA 4CIBA 5JARA 1CUYA 2BUBA 1ACLA 1TK3A 4BDTA 2D5LA 2Y1KA 3FBWA 2ECFA 3VJLA 4B6GA 1XQXA 1G4HA 1UOPA 1CUSA 4QEKA 3AIKA 2WILA 3RKSA 1UKBA 2ROQA 4IO0A 1XQYA 1Y7IA 3WMRA 3QMVA 3BF8A 3R3YA 1BE0A 4ZV9A 3ANSA 3PFCA 1MJ5A 3VISA 3HACA 1QIJA 4I4CA 1BROA 3BJMA 2CMFA 3HXKA 1TRHA 1ZIXA 3DLTA 3SK0A 5ALOA 4QDUA 1ACJA 4FBLA 3WWEA 5DYTA 1QOZA 4BAUA 2PBLA 3B5EA 5HF6A 2C5GA 3ZV7A 1QLWA 5E4JA 3G8YA 3SC2A 1MX5A 2YASA 5A71A 3CN7A 1FSSA 3S8YA 3LCRA 4TVKA 2X8BA 5DLPA 4M0FA 5ESRA 1RWQA 2ZYSA 2ORYA 2WIKA 5FP0A 4ETWA 4MWTA 3HC7A 3TEJA 1K6EA 2HA2A 4DMKA 4UHEA 1ZOIA 4U2BA 1LPMA 1YA8A 4GXNA 1AQLA 3FCXA 4J0DA 2AJLI 3W2TA 2XLBA 2VEOA 3DD5A 3F8SA 4HVTA 1VE6A 1FJ2A 2PKYX 3IURA 4Q3KA 4W1PA 1DTEA 4ARAA 4H7JA 4BYMA 3FYTA 2VJAA 3WKAA 3STTA 1HDEA 4H7EA 4G4JA 5K3AA 5IKXA 5FUMA 3E3AA 1YA4A 4J0JA 4UFPA 5JADA 2XMCA 1U2EA 3HLKA 2C58A 4DNOA 3BWXA 5LZ2A 4FDMA 1A7UA 4HAIA 1R88A 2GZRA 2G5PA 5FV4A 1R9NA 2XQKA 4Y7DA 1J1IA 5FRDA 5YASA 2Z8XA 1E8MA 2C7BA 4DNFA 2ZYHA 4LHEA 4PO3X 1JMYA 1WB4A 3X3HA 4FMPA 4GLBA 4BATA 4XX1A 1CUWA 1XZBA 1DQYA 1XZAA 2XDWA 3D2AA 5T4EA 3N2ZB 4FFVA 4LYEA 3PUHA 3QYJA 3VVMA 4N5IX 5E4YA 2FX5A 4AQDA 2WIJA 3WK9A 1XLUA 1GPLA 4KAJA 2QVBA 3DKRA 4UHDA 1J06A 4U2EA 5ALIA 1ORWA 1YASA 3H19A 2WHRA 4WJLA 1ZD4A 5LYYA 1UK7A 2VJBA 1GQRA 1UK6A 4FLFA 4ZXFA 1QIDA 5AKYA 1H2XA 1GXSA 3I6ZA 1BEZA 3FWHA 3W06A 3HI4A 1QE3A 3I2KA 1D07A 1UT6A 5ALHA 1S8OA 3O95A 3R40A 2Y2VA 1SFRA 5KBYA 2CJPA 4LKOA 3GFFA 4G9GA 5F4ZA 3VJMA 5ALXA 5CH5A 4BTVA 2ACKA 3G9XA 1UOQA 3Q8WA 5KWJA 1BRTA 4KE7A 2VT7A 1ZICA 5T4BA 2QXUA 5A7FA 5CT6A 4B82A 4KE6A 3H2HA 4X6UA 5EHXA 1QIGA 4YPVA 5AOBA 5LZ4A 5ALWA 3AZQA 2WU4A 2JGFA 1NX9A 5CH3A 1CUEA 2JGLA 3NOXA 2X76A 1QIMA 3KWFA 1JI3A 2HA6A 3WKBA 4AN0A 4X6YA 3WL6A 1AUOA 4G8BA 5ALQA 3QPDA 3WKEA 2R11A 4UHHA 5DNWA 2ES4A 1TQHA 4KJXA 3RARA 5LLSA 4LXGA 1MAAA 3M83A 1KU0A 4Y2VA 5LIPA 3KWJA 3KXPA 5FKJA 4ZREA 4JH0A 1CUHA 5K3EA 5DYWA 1T2NA 1TCCA 1ODTC 1N5MA 4P9NA 1LGYA 2Z3WA 1A8SA 2EEPA 5JZSA 4HXGA 3I2GA 1L7QA 4KACA 4Q34A 4AXBA 3H18A 4G1FA 5IVKA 2WFLA 2OCIA 4AX4A 5ALLA 3C87A 3STWA 5JALA 1GT6A 5H3HA 2PX6A 4UPDA 4EY6A 2IITA 3D7RA 3CN9A 4B83A 4X95A 3L1HA 2WM2A 2VJCA 1ODCA 2W6CX 1QFMA 2QTBA 1THGA 2PSJA 4Q82A 1SC9A 1XLWA 4BCDA 3PICA 2OAEA 3HZOA 2I3DA 4ARBA 3H1AA 4FNGA 4AO6A 3ZLVA 4OB7A 4OYYA 1AC5A 1CUFA 3V1MA 2AJBA 4L9AA 1AX9A 1P0PA 2DFPA 2ZYIA 2WFZA 4U2GA 3ZPXA 4C01A 2OAGA 4QZVA 5AKHA 4MEBA 3G0GA 4UBJA 1THTA 2WJ4A 3I2JA 1XZGA 4MYDA 2YYSA 2V96A 1UK9A 1GGVA 1LPNA 1JJIA 4GECA 2BUCA 1EHYA 2WUEA 3C5VA 1TCAA 2HRQA 2XUJA 1LNSA 5EFZA 5CXUA 2GYUA 1ZIYA 1X2BA 3DQZA 1EH5A 4CCWA 5A7GA 4LIPD 1YB6A 4J0IA 5E4TA 1SCKA 3VDXA 2WU3A 4BP9A 3EIOA 3I1YA 3WI7A 5JASA 4ITVA 5AKZA 3IIIA 1I6WA 1Q83A 1RP1A 1XZEA 2RI6A 5EI5A 2XUFA 3V1LA 4Y2TA 4B9EA 4JNCA 3C43A 5HF8A 3VKFA 4ZGBA 4AO7A 1QONA 2XMQA 4WY8A 2H7CA 2VF2A 3WWOA 2FUKA 3L1IA 4OU4A 3EQ9A 4PW0A 4XIIA 3WWCA 3WLAA 4Z49A 2DSNA 4G8DA 4CFSA 3WA7A 3DDUA 2FJ0A 2XMZA 4WFIA 4W9RA 4U2CA 4IH1A 4HTAA 3GELA 1NU8A 4RE6A 4UUQA 2QXTA 4BZZA 5C7YA 3PUIA 2K2QB 5LZ5A 5JZBA 3FSGA 1IMJA 2RGUA 4AB1A 2JBWA 4BE4A 1TAHA 5ALRA 5AI4A 4ROTA 3A2LA 4UHBA 2WFMA 1TKRA 4DSAA 4UBLA 3TGLA 4J0GA 3DL4A 1YSCA 4CG2A 5CRIA 1CUGA 4FFWA 1JU4A 2YH2A 5AICA 2B20A 5JAUA 4Q3LA 1BN6A 4ZI5A 1YR2A 3RK4A 4X3CA 5BWBA 5AKEA 3R0VA 2B9VA 5AIAA 4QWWA 1CPYA 4MQLA 4DM7A 4MEAA 2O7VA 2H9YA 1C7IA 1OXMA 2GBGA 4K6KA 1EK1A 2RHTA 4CG3A 1E89A 5ALKA 4BVJA 4BAGA 2PU5A 5EGNA 2Z8ZA 3PF8A 3R41A 2LIPA 5CT9A 3K2IA 2E3JA 5HF9A 1EDEA 2WTNA 3NUZA 4CCYB 1VXRA 1R1DA 1XZJA 1AURA 1IVYA 4YX9A 3FYUA 4J03A 2G5TA 2G63A 4OU5A 2J3DA 1QZ3A 2QR5A 2VA9A 4F60A 1YB7A 5AKJA 1EINA 1H2ZA 4WCVA 1XZHA 4DLNA 4CCYA 2XMDA 4V2IA 1SCIA 3OTQA 3QMMA 3QVMA 1XKLA 1OCEA 4X71A 1CV2A 3QBJA 1QIHA 1FFAA 5FOQA 3E4DA 4E11A 3BXPA 2C0PA 3HRHA 1GKLA 4WDRA 2ONCA 3AINA 1UWCA 2HHAA 4CI9A 3TJMA 1Q0ZA 1UFOA 1AMNA 1XRNA 1EA5A 4PQEA 1XZDA 4KAFA 5C8VA 5C81A 5ALPA 4G4GA 1JT2A 1H22A 1ZI8A 1E66A 2WJ6A 1R4ZA 1JU3A 1EVQA 4H0CA 3BDVA 1CUDA 4IHAA 3R3UA 5AOCA 5HFNA 2JEZA 3ZWQA 5CW2A 4WFKA 3Q0TA 2HM7A 1QIEA 2PUJA 2HA5A 5ALGA 3A2NA 4JUIA 1P0QA 4MQMA 1EDDA 2OPHA 5DNVA 5EIAA 2FJPA 1XZIA 3D3NA 3IBTA 1ZI9A 1ODSA 5DNUA 5HKAA 1M33A 1LZLA 2HU5A 4BB0A 1IUOA 4OUKX 3AIMA 2WUDA 1AKNA 2GYWA 4DGQA 2G4LA 2Q0XA 3QPCA 4J0KA 2ZVDA 4F21A 4EY7A 3M3DA 5HCUA 3H17A 2OG1A 3KD2A 4H7DA 4KRYA 4QDXA 1LBSA 3ZLTA 2HDWA 3PF9A 3G7NA 1VXOA 1EVEA 1CR6A 1VE7A 1K8QA 5ALEA 1CUBA 4Y2RA 3S2ZA 3KOOA 1YCDA 4E15A 3WA6A 1VOTA 4KRXA 1YAJA 3VJKA 4JYMA 4KAAA 3FLAA 4XWGA 2QM0A 4RNCA 4EB0A 5AH0A 3DOIA 4JYPA 1Q84A 1EI9A 2O7RA 4IH9A 4XJVA 4AMZA 3FNBA 1NU6A 1MPXA 4HRXA 4E46A 2OGSA 3PFBA 3PDCA 4K2AA 1GPKA 5CH8A 3IDAA 4NMWA 5I9IA 2JGIA 2WUGA 4H77A 3F97A 3C6XA 1DWOA 3D5EA 1W1IA 1MAHA 1PFQA 1XKTA 4X92A 1X2EA 4DNQA 2WFLB 2H7XA 1F0NA 4XVCA 4B7ZA 4Q05A 4E14A 2XQIA 1VA4A 5LP1A 1DWPA 2JIDA 1A8QA 2EDAA 2OXEA 4Y2JA 4U2FA 4LXIA 3IUJA 3LIPA 4BC1A 3QH4A 1HL7A 3C6ZA 3W9BA 5DTIA 5AI9A 5HK9A 3STYA 4QLAA 2WKWA 5K3FB 3B3QA 3O4GA 1SCQA 4W1RA 1E8DA 2P8SA 4H35A 2Y6UA 1W75A 2UZ0A 4BCCA 4QNNA 4HXFB 2XUIA 3D0KA 3DCNA 5AKXA 2WHPB 3WWPA 3WYDA 1QIKA 4DNPA 2XMRA 4GBGA 4N5HX 4TPKA 5BOVA 2XQJA 1VKHA 2CKMA 3D59A 4C87A 4PSCA 1L7RA 4X91A 4L3WA 2GZSA 3C70A 4BCBA 5AM5A 5JD5A 1XRMA 4UBIA 2BCEA 3WZLA 1W76A 3V9AA 5AI8A 1UK8A 4UBOA 3F9CA 4TGLA 2WIDA 2PVSA 5AKKA 1LPSA 1N8SA 2R8BA 5ISMA 1R3DA 2PSFA 3WL8A 1JJFA 3QPAA 3D2CA 4H18A 4EZIA 1PJAA 3R3XA 1QIIA 3ICVA 1B6GA 4X93A 5IVDA 5AJHA 2PM8A 3DEAA 3A2MA 3GROA 2JF0A 2VAVA 2HA7A 4NVRA 2C4HA 3FVTA 1XRPA 4UBKA 1CRLA 2VT6A 4X94A 1VA5A 3OOSA 3UUFA 3FLEA 4MYSA 1YAHA 2XT0A 1VZ3A 1CUZA 4C6HA 2OGTA 4RE5A 3OURA 4GEGA 5EHNA 2J4FA 2QJWA 1VJ5A 1QGED 1GQSA 4Y2PA 3G0CA 5JYCA 3FYUB 3DNMA 1CLEA 5A2GA 4W1QA 5JATA 1JJBA 5AM3A 2HADA 3NWOA 2DQZA 4GWLA 5DJ5A 3FCYA 4DMFA 3QM1A 1DWQA 1AGYA 4Y2SA 4P08A 1IZ7A 1WM1A 1W6RA 3KDAA 4U2DA 4KE8A 3OM8A 3F98A 1X70A 1GPNA 2HA4A 7YASA 1F6WA 1QO7A 3WJ2A 2RIPA 3NGMA 3OC0A 4F5ZA 1CUIA 1EB8A 4K6HA 2B4KA 4CG1A 3GA7A 1O6GA 2QKYA 1DU4A 5CT5A 2VQ6A 1CFJA 4G8CA 4Y2UA 1KU6A 1W52X 3W05A 4B84A 4P92A 4H7HA 1XROA 5CT4A 4P93A 5ALTA 3W04A 1LLFA 3M82A 4UBNA 3I2IA 2GBIA 1P0MA 3K9BA 2WHQA 1ISPA 1DX4A 1F0PA 5JIBA 2XUGA 4B0OA 4GW3A 2WIGA 3B12A 2C5FA 1CUAA 3O0DA 3ED1A 2W22A 1XRRA 2IIVA 3RM3A 2XUQA 4ZRDA 2VSQA 2HU8A 1R50A 1MU0A 2O2HA 2BFNA 2BGRA 2XI4A 4FNMA 4C4YA 3A6ZA 1DT5A 1ZJ4A 3E1GA 3MUNA 1EB9A 2AXEA 5CXXA 4DMCA 3R3VA 4OB8A 1WB5A 4EA6A 4H7IA 4BRZA 1GKKA 4BC0A 3IUMA 1HKHA 2PUHA 3WZMA 3DKKA 4X6XA 5CMLA 5AOAA 4INZA 2JGJA 4J7AA 1LPBB 5K3DA 5SYNA 1ORVA 5K3CA 3FLBA 1LBTA 3YASA 4M0EA 4BDSA 2PSHA 4IQ4A 4G5XA 2ZJFA 5AI6A 5K3BA 5LKRA 3BJRA 1CUVA 5CBKA 4BAZA 1R9MA 1FFBA 4BP8A 5IVHA 5LZ8A 2J3QA 5EHZA 5ALNA 4A5SA 5LZ7A 2B61A 5AM4A 5SYMA 4B0PA 5LZ9A 1MT3A 5A6VA 5HQ3B 1CEXA 5DTJA 3WJ1A 3HSSA 4O08A 1E3QA 2XLCA 5DWDA 2WG1A 3MGAA 4AMYA 5EIEA 1XRLA 5AM0A 4EY4A 1WOMA 1ETHA 4LYDA 3UUEA 3G0IA 1VLQA 3C8HA 3FVRA 5C8ZA 3FOBA 1HQDA 4HXEB 1XQVA 4KYVA 2V9ZA 4HS9A 3V48A 5I7UA 1H23A 5D3KA 3H2GA 6YASA 5JAOA 3WL7A 1H2YA 1ZJ5A 3ZI7A 4UHCA 4OSEA 3IUNA 4B9AA 2CZQA 4PF1A 4UFNA 4EUSA 2VAXA 1DQZA 4S0XA 4K6GA 4PNZA 3DJYA 1H2WA 1EX9A 1K4YA 3A70A 2GYVA 2XUHA 4I3FA 2Z5GA 5AKLA 4WY5A 3FAKA 4FLEA 4Y2YA 3AJAA 2HFKA 2HRRA 2Y6VA 4F0JA 2QUAA 4W1SA 2JGKA 1F8UA 1YS1X 3G0BA 2JEYA 3EQ8A 2XQGA 1MTZA 1CUXA 3STVA 5ALJA 2BGNA 3O4HA 3GUUA 3HYSA 3TRDA 5IH7A 3O4IA 5ALVA 2OCLA 1P0IA 4UFOA 5HFAA 1FFCA 2NW6A 5FXMA 2V98A 1K5PA 3IULA 4BRSA 1G66A 2HA0A 2O2GA 3VVLA 1K63A 3WL5A 3WKDA 4QA9A 1XZKA 5ALMA 1QIFA 3STXA 2BJHA 4C88A 5JANA 1L7AA 4YASA 4DYHA 4FWBA 4W63A 3ILSA 1QJ4A 1G5FA 3R3WA 1A88A 2QJRA 3D4LA 3JYHA 4C4XA 5JZ9A 3AILA 3VXKA 2RAUA 1C7JA 1CIJA 1CQWA 1U8EA 4KEAA 1BS9A 2BKLA 4Y2QA 1EXWA 3WK5A 4BVLA 3STUA 2OQVA 3C6YA 4G4IA 3DL7A 5J3JA 5AP9A 3I2HA 5ALUA 1WHTA 5CURA 1LPAB 3V1NA 1WB6A 2RHWA 1Q0RA 4MWSA 3GZJA 4QLOA 2X5XA 1MN6A 4ZV7A 4G9EA 1UOOA 5CT8A 4QDTA 4MJ3A 5AKIA 3I6MA 1XLVA 3G9UA 2QMQA 5ALDA 3AFIA 3I6YA 1W4LA 3U1TA 1HPLA 3MUOA 4LXHA 4B81A 4GHWA 3CXUA 2PPLA 2XQFA 3BE8A 1MNQA 5K5EA 2Z3ZA 3ESCA 3D2BA 3T52A 5ALSA 3K6KA 5FLKA 3LS2A 1J07A 2DHDA 3IUQA 5IVIA 4BVKA 4UHFA 1XRQA 2WHPA 3QZUA 3L1JA 4OYLA 3PI6A 2PSDA 3I2FA 4AZ0A 2O2IA 4HZGA 1ZD2P 4J0HA 2ZSIA 3H2IA 2RONA 1WCYA 4IH4A 1IZ8A 1ZD3A 3ZLUA 3DOHA 3AZOA 4GDMA 3JW8A 4DTCA
chains in the Genus database with same CATH superfamily
1EZ1A 1B1CA 1W88B 3HJBA 4BPRA 1Z6TA 4D9GA 2WE7A 3GBSA 5LYJB 4DRYA 5TEVA 5KO2A 2LPMA 1XEAA 4O4JB 1GZUA 1O95C 1E1MA 2XAAA 5AM2A 2AVNA 2D2FA 1EVKA 3HZRA 3UIEA 1FFHA 3VOSA 3Q3IA 4HPWA 2YVKA 1P2BA 3HP4A 4M1WA 4X44A 3QYAA 4LMBA 3HB0A 3PZBA 4KQFA 3TCKA 1PGQA 2XE4A 1NMYA 3RB8A 2H85A 4FKBA 2MYTA 4P86A 2CLSA 1UP4A 3ZQUA 1CYEA 3LP5A 5AI0A 3FIUA 3GEDA 1J9EA 2IOYA 3DBVO 3G2KA 4WW0A 4IRXA 1FXSA 1U0OC 2ZAIA 3DBLB 3FB1A 4QXRA 5LKAA 2QN2A 2P3LA 3OCJA 4NZZA 3QNWA 2WG0A 1YVDA 2PLNA 4B8YA 5K6AC 1NQXA 1ZLYA 2RHDA 3KTDA 1R00A 4J3JA 2DR0A 3Q12A 4U8GA 3GQVA 4B3XA 3C1UA 3A32A 3F67A 4PTYA 1TM5E 4J1NA 1XFDA 2GXQA 4Z3DA 1GSHA 2V65A 1OHHA 3H4VA 2HMSA 2WWVD 3HUEA 5K6AA 2J9ZB 4IDHA 2AJ8A 3EXEA 4IZHA 4WKPA 2LNDA 3TLMA 2CWWA 5HTKA 4BMPB 4YMUA 1HFEL 1Y7PA 5TLSA 3IV9A 3VR2D 3QOFA 5JTUA 1D2NA 3MNFA 5KOHB 1PHPA 4KV9A 5AHKA 2GBFA 3EUAA 4ZI7F 5FDFA 2H7VA 2GUWA 1T3ZA 4QDOA 4WA8A 5I8WA 4HPJB 4K8OA 1XBTA 2G4VA 1F3OA 1PR9A 2Q4BA 2QRKA 3CINA 2TMGA 2AJDA 4QOIA 5AHRA 2ZTMA 4F3YA 1J2EA 5G3ZA 4C3UA 4QD3A 3T9AA 2VXBA 4Q1DA 2I55A 1RIIA 4DV6B 1RYMA 1UADA 5JS8A 2BYTA 4UAGA 2QE6A 4ZQBA 4G56A 1Z5OA 2OCGA 4ZWNA 2FVXA 2GPBA 4H7FA 4R0VA 4J9VA 1Z62A 2JFZA 4L6AA 4TN5A 1ENPA 4KN6A 5IC6A 3LCVB 3WFIA 1PX0A 2IBMA 1Y34E 2TYSB 4MKHA 2PDAA 4JFAA 1SOVA 1IQRA 2PX5A 2WJ3A 3RK0A 1U6IA 1ZGCA 1P33A 3DMNA 2X0EA 2CUTA 4KMOA 1N92A 2X4LA 3OOEA 3H0CA 5KYGA 3ZHSA 2ACEA 5A9SA 4YJ2A 1OB5A 4V03A 3EZ9A 3V34A 2QTVA 3HR4A 3I01A 5DBFA 3Q15C 4WD3A 5LXTA 1ARZA 2JFWA 2UZ4A 3ABIA 3G9ZA 3TQRA 4AY5A 5A5VA 4LCBA 4A8JB 1PW7A 1R18A 2A57A 3TL3A 1LRKA 3KQHA 3I52A 1SB8A 3D6VA 3UAXA 4AG6A 3EXHB 1CX9B 2REOA 2HYDA 1T2EA 4I1YA 2ATIA 1OI3A 3ABQB 821PA 5L6MB 4DPKA 2FA9A 2ZR0A 3H5IA 2XKJE 1KC3A 3RTCA 3SYLA 5J4YA 1I3MA 5E2IA 4AD8A 1SR8A 3EVCA 1ZRNA 2AYYA 2HCRA 5A04A 3BE6A 5GPBA 4FJ1A 3VNSA 5JZOA 1GAWA 5CJPA 2Z58A 1IUNA 4YRJA 4YT8A 5HKKA 3DTYA 2F59A 2BFCA 4CQNA 1DDIA 2C0QA 4MV5A 3BVPA 4XEUA 4A9AA 1Z2EA 1ODFA 3VH4A 3L06A 3ORHA 2NU7B 4AN1A 3WQQA 4B3IA 1Q2XA 2FPRA 2D2VA 2Q0HA 1YMUA 2QA5A 4DSZA 2N1BA 3L7OA 3ZW9A 4C1NA 1G42A 4RZ3A 3D02A 4G63A 4ZVVA 3DEYX 2YXPX 3M6AA 3PJGA 3ETDA 4EHNA 1JDSA 2OP0A 3QKRB 4C4ZA 1R74A 3G7UA 3SLKA 3ID6C 4FBMA 5B1YA 2CD9A 5KOYA 3MZ0A 2COUA 4EY8A 3IAS6 1TXGA 3DXXA 4JITA 4N8SA 2KB0A 2YHSA 2O2DA 2Z83A 1L0BA 1M5TA 2H3HA 3LHDA 4UMVA 5HFJA 3ROZA 3MUEA 2PFKA 4XUDA 4QXAA 3PV0A 1A1SA 1CTQA 1VIAA 2CLMB 1XXLA 5ENVA 1Y42X 1GRRA 2NVWA 2CEKA 2I76A 3TQSA 1Z7WA 2BBOA 2B1JA 2NUPB 3N7TA 2BDTA 1PHRA 1YBMA 1YB1A 2OO3A 3FVWA 3IPLA 1FDVA 3FA2A 4LE0A 4OBXA 4W5JA 5AHXA 3NC0C 3WBBA 4Y9UA 3JWIA 1OC4A 5KZMB 1C4XA 4Z51A 1VLZA 1NJ2A 2AQ8A 4XARA 1C0PA 1HR0B 5BMVA 4G8JA 5FBRB 1QG4A 1ZI6A 3KSUA 1YZNA 4X97A 1IEWA 4DJTA 1GZ7A 4NZPA 3WQHA 4DQKA 1WTAA 1BSVA 4UD2A 5LBUA 5C37A 1G38A 3K9CA 2BF7A 1RADA 3H04A 2NIPA 3SJBA 3OZDA 1Z6XA 1XP5A 2JIRA 2WJYA 3AETB 4GLFA 3W79A 1LX7A 5I9NA 1FCJA 1GYRA 3MJDA 1I10A 1QCDA 1Y3IA 2D54A 2CXXA 2F1HA 4UHKA 1EDBA 3ZXXA 1ZBDA 1CE8B 1S3GA 3RSQA 2OXCA 1FFDA 5CTAA 3OBBA 3JWJA 1QAOA 3OEEA 3ZCVA 1LSJA 2ZE5A 4IV8A 4JEIA 2IXFA 3SYKA 1L5KA 2WTEA 4DMLA 1KC1A 3PG5A 1NF8A 3SNKA 4GNKA 1F8XA 4UMDA 2NPFA 4JUFA 2A33A 1Y3DE 3O3NB 3R3HA 1TCBA 4NJOA 3TQHA 1Y89A 4YYZA 2EKQA 4EG6A 3PYXA 5JHGB 1W4RA 4EPRA 1RWBA 1X7YA 1IH8A 1RMYA 3ZCRA 3DD1A 1JG7A 1X7GA 2RI0A 4UTXA 2DCMA 3AF5A 3WK8A 4IIJB 1WSDA 2GJSA 1YRYE 2NWQA 3LUKA 4WCFA 5ALFA 3T1TA 3R5HA 5H02A 1QMPA 2OCKA 3EODA 4TS4A 3EJWA 3VTAA 5KJ6A 3LL7A 1QG0A 4YPFA 3INRA 1TYAE 3BERA 4QYMA 7ADHA 3CR3C 1MG0A 5TS2A 2Q29A 4IR7A 1HLGA 2CLDX 4FDAA 3W9SA 2FPWA 4U7JA 3ETLA 3C6BA 1YL6A 3IPCA 1DQNA 1G7TA 4PSUA 3RV4A 3LYHA 3TE6A 1QTRA 2OGZA 3K0EA 2OESA 3ORQA 1VL5A 1K8RA 3C8DA 3NTOA 1G1AA 2A5FA 2IX9A 2QDKA 3P0EA 4CV0A 4Z7QB 1V5IA 1NW4A 1SXHA 2W2PA 3EIFA 1NVWQ 3GMDA 3QU2A 4RM3A 1FMCA 1QQBA 4C4TA 1MDFA 1VGVA 5JSQA 4QULA 3UXHA 2HD4A 5CIYA 1QE0A 2VDWA 4KQGA 3QWIA 4OQEA 4H7KA 3TNYA 3H9EO 4E1BA 1RZRD 3VO8A 4JT8A 3R8XA 1YHZA 1YS9A 3WJAA 3IESA 3LOPA 1TE2A 3QITA 4ZYLA 3SBOA 1IONA 1JI0A 3DWGA 3UC9A 3DP7A 2EWMA 5EY5B 2OXTA 4KIFA 2POQX 2YJZA 3P32A 1M8GA 2GXUA 1OF1A 1THMA 2IX3A 3KQTA 2DWQA 1P45A 5IAOA 4E1VA 3QVGB 1BN7A 1PGOA 5G3YA 4ND3A 4B5KA 4JXXA 2RKBA 2QF7A 2X19A 2BM0A 4GX2A 4N6NA 4YJ3B 2M6KA 2C57A 3H6GA 3UWPA 4PLFA 1G60A 2OVFA 3P2MA 1W35A 3MBKA 4TS3A 1ZH2A 2AIRA 2B98A 5JRJA 2PFGA 2WLTA 1S8AA 2XDQB 1EK6A 3EFOB 4J75A 4YXWA 1WHSA 4YBZA 3IHTA 3KT3A 5BWNA 3UMMA 3O84A 3OJOA 2OB2A 1W9MA 2I7VA 2PRIA 3P2OA 4AS1A 1SCUA 2YN4A 1L4KA 4GKAA 3FFAA 1YOVB 1TYEB 4O59O 5DTEA 5LQAA 2BR5A 1ADCA 2IJGX 4L5AA 3X0DA 5AK4A 5H59A 1XEXA 3OTOB 2WKSA 4J90A 1QYXA 1OR8A 1TDJA 1PLJA 3REQB 4EYQA 4FLMA 4LJ6A 3OY7A 1SC1A 2DWOA 4RXTA 1J09A 1AB5A 1XZPA 3FI9A 2A5JA 1X1DA 2JHPA 3GJQA 3EGEA 1NSFA 2X1HA 4NJMA 3PFWO 4R9UC 3STHA 3S8EA 4HJXA 3ZGNA 1IK4A 3AL3A 3CB4A 4LBVA 5HSGA 2IYLD 2R86A 3X43A 1TJPB 3TRHA 3WL4A 2D1QA 1MO2A 2WQ6A 1H69A 3F7TA 3QKWA 7ABPA 2HF9A 2R6R1 4NP6A 4LFCB 1KEZA 4HH4A 3MXTA 1MP0A 1NZDA 3A9SA 5D00A 5IJ9B 4UE3S 1E0DA 4GVPA 3SSNA 4QUJA 3L43A 6CHYA 2DQ4A 1X94A 1GLVA 1PT6A 2ZJAA 2OLEA 1KJJA 1Z08A 5JYBA 4UVEA 2Q4TA 1H1TA 3OD5A 4ZU1X 4AP9A 2AYZA 3ZHRA 1VB3A 4RH0A 1W47A 1VBFA 2ODEA 4FYYA 4XR4A 5BV7A 3HJRA 1N2CE 3RH0A 4G1UC 3HBFA 2ZK7A 3BIWA 3BA1A 3WV4A 3GH1A 2H1LA 4JR0A 1MX1A 2XIQA 2C00A 3CUSA 4KO1S 4DM3A 2CUKA 3MM4A 1TEXA 2O5VA 1ISGA 3G02A 4V3BA 1SVOA 3QF4B 4BGIA 3RYCA 2V7GA 2FG5A 1WSAA 1T1RA 4EPXA 3AERB 3BG5A 3O9MA 2Q1XA 4GC9A 4HZUB 4P3OA 5JG7A 3EMVA 2D5AA 2FEKA 5EA2A 3QEMB 3DQQA 3K9NA 4OQYA 2ZWMA 3F2VA 4YRFA 1BX1A 1G8SA 4Z8YA 2W6JD 3W5BA 1DRWA 3LIIA 4L5BA 4CMEA 2HJGA 5KHAA 2XMSA 2UYQA 3P9XA 2JJ2D 5FFFA 4M3NA 2V9PA 1ABFA 4CG0A 2QTAA 3PRKE 1CK4A 1HZZA 4D9JA 3COJA 5ADUS 3OZ7A 2FOXA 3NANA 4P3KA 3HDQA 5ULLA 1U0LA 5IDXA 3ICOA 3DHEA 4QGFA 4RGQA 2WFAA 3CCCA 2WI8A 3L7KA 1X8KA 2WC1A 4G6ZA 2WAOA 1UJ4A 2N0SA 1PJLA 3GDGA 1S02A 3HVHA 1XEFA 4MRMB 4P1ZA 5COBA 1L5FA 3H0KA 4ASUD 4H2DA 1P4GA 3G9QA 4RMHA 1CUCA 3EC2A 5D6OA 2WLSA 4FYPA 1I36A 4BL5A 4MP3A 5EHQA 5MF6A 1FJHA 3QEBZ 4D8UA 3D43A 2I6SA 3TO5A 3BMQA 2INGX 1EP3B 2WNSA 1FZQA 3LF1A 4E2FA 2XUKA 3TAXA 4PNPA 3FIJA 3G0OA 4DMHA 5BSEA 3PFFA 1BIFA 1JFLA 1YS2X 2WYVA 5ENZA 4C7OB 2OC9A 3E27A 4BJHB 4CVNA 3BWEA 3KJQA 4BDTA 2Y1KA 3FBWA 1MO5A 2ZATA 1E7MA 3VJLA 1P39A 4FCTA 4N49A 4MO9A 4OP3A 2Q3HA 1XQXA 5MDHA 1XA0A 5H80A 4EATA 2CHEA 2XGGA 4KNWA 4ND6A 3FETA 3FWYA 3ESXA 4HNSA 3C4JA 4LDAA 2A86A 4QHYA 3ZI4A 1JKJB 3H9JA 3BDAA 1RLJA 4F4CA 4O4HA 4EYOA 4PYJA 1YZQA 2WF9A 3O4FA 2CXRA 2CJWA 4HNTA 1M2JA 2PZMA 3PKZA 1DIGA 4MW2A 2A5LA 1K06A 3QLEA 1ZVKA 5DM60 4R2JA 2DUJA 1U3VA 2R7MA 3WLEA 5EYPB 5BYBA 4LRTB 2QQFA 1GAQA 4XYMA 1EGAA 3LKVA 3LNTA 4LJYA 4RMNA 4C78A 1TTTA 2OXRA 4KQIA 4ZVKA 2EJTA 1YIOA 3ETGA 3P71T 5TIIA 1IRIA 1C8BA 4ZV9A 1WXQA 3ANSA 3P9ZA 3SS7X 4Y18A 1X3LA 3K8OE 4FFMA 5DHAA 4RLSA 2DZDA 5F64A 3SIXA 3W2FA 1YK0A 3GNLA 3ZJ4A 3GXBA 1WR8A 3W3ZB 3C15C 1QIJA 4I4CA 3A4LA 5J5AA 1JHXA 1UXGA 3PA6A 3N2KA 4MVYA 3WSTA 4ZICA 1H3EA 1U0HC 2Z2KA 3HXKA 4DV2B 1WUHS 1YZ3A 1C7QA 3IAFA 3DTVD 1ZIXA 1X1BA 3K6JA 4FSDA 1BWQA 1KQPA 1OWLA 3DLTA 3SK0A 5A4AA 2VZEA 2XTNA 1QQTA 1TAQA 4ZANA 2TMDA 3GA5A 5DBEX 1FX0B 1CJKC 3O8LA 4QDUA 1ZUD1 2R87A 4MKFA 2P9ZA 2VTBA 4MITA 1BGXT 4OIFA 3KQKA 2C77A 4QXMA 1C3VA 5DYTA 8ABPA 1N5OX 4BAUA 2FZGA 3ZCPA 3B5EA 2EP8A 3LO8A 3BRWA 1A96A 4MOWA 2EF0A 4PFJA 2ECQA 4JL6A 3N76A 1U0SY 4LOJA 4BB5A 1ZC3A 2C07A 4HDMA 4X62B 3WR5A 1S3IA 1N5IA 4YRLA 1ZHHA 4JCOA 4KO2S 4L6CA 4YMSA 5A71A 2PIDA 3K2EA 4DA4A 1DXYA 2P6UA 3LCRA 4BJ3A 2X2EA 4ZCMA 4HFRA 4MJ7A 1GYQA 1U2PA 3JZFA 2BZ1A 2ZYAA 5DLPA 1EWYA 4TV9F 1CP2A 2BKAA 4TMWA 2HMTA 4AL4A 1U6JA 1Z4OA 2ZYSA 2OBYA 2REQA 1DOAA 3PCRB 5FP0A 1VP9A 1CJUC 3ROPA 1DARA 5F7ZA 3L8MA 4V24A 3HC7A 3R76A 4RNDB 2P62A 2VJQA 1C1HA 3W6UA 2B6HA 5JLJA 2XWBF 1U2RA 2IH5A 4DMKA 5AVXA 3LBIA 4O4IB 1ZITA 1LPMA 2Q6KA 3SQOA 1T8PA 1B6SA 2BP7B 4EFDA 1EWQA 1E5QA 4DCNA 4DKJA 2TECE 3CB2A 3OJXA 4C7XA 5K8IA 1VTKA 5KNBH 1W5EA 3LLMA 1T9KA 5A4KA 3AG6A 2QRHA 3EVEA 3OEED 1ILWA 1XLTA 1Y3FE 2C04A 3B9BA 1R5OA 3A6LA 1H5UA 3B9PA 4HVTA 4AP6A 1P4AA 4BO4A 1MRSA 2IVFA 3D7NA 4JLAA 4L4YA 4NYMR 5F2OA 3W5JA 4MQ4A 3MJTA 5HHTA 2CVFA 1O6ZA 1KAQA 1G8FA 1RJFA 3PBKA 4JT4A 4KWTA 1DTEA 4MRPA 3KXDA 4H7JA 2PGIA 3KOYA 3L7CA 5AUNB 5IZCC 4BVBA 3RSCA 1E6WA 2W9XA 4FMDF 3AW8A 3E84A 3LRPA 1DQSA 2H3EA 4H1VA 1F2UB 3PUXA 3WKAA 3VOTA 1RHJA 4RD2A 2D1FA 4LWOA 1UPTA 4H7EA 5JQGB 1H6DA 1QV9A 4G4JA 2LUOA 1A71A 4J0JA 4GKJB 4XWYA 3X2FA 5FD8A 3U7QB 3R7DA 2IEYA 2ZU6A 1IM5A 4EM6A 1Q15A 2E4WA 4DCMA 2AOUA 1E7QA 4TZTA 5DXFA 2ZYVX 4IDCA 4F92B 3W8DA 2C5BA 4TL8A 4HZIA 2I4OA 5CLGA 3ZBPA 2XCIA 2QEQA 2CL5A 3GUCA 1RBYA 3N7AA 3N53A 5LXTB 1ULAA 4EB6A 4Q03A 4KW7A 2KHZA 1RKUA 4B4UA 3DFIA 2V59A 2G5PA 1LFAA 1V45E 2ANBA 3F8TA 4NF2A 4CM8B 5IKMA 5FUWA 2R4TA 1VIDA 3SDBA 3UJ7A 5KJ1A 1QPZA 4Y7DA 3K16A 3QLUC 1ND6A 3IMFA 4DPMA 5I51A 1I7QB 4Z54A 5I4CA 2VHTA 3MQFA 5FRDA 3MLAA 4J7UA 2QSUA 4P4UA 4FZ5A 3PYLA 1GRQA 2G0NA 1XWWA 1E8MA 4ER5A 1C80A 4RVNA 2FH5B 2ZE7A 4CMIB 1ZN9A 4B3CA 3N28A 2ZYHA 4LHEA 5B3AA 2ODTX 1YS7A 5ED0A 1JMYA 3VR4H 3JYLA 3T38A 1YR6A 2RBKA 3VFDA 1I0IA 1S7GA 2YHBA 4GLBA 5D86A 4ILKA 1OI2A 5CNMA 1BAPA 4FEAA 2NXWA 3BZWA 4CQLA 2OXFA 3IAHA 4D4GA 4M1OA 2ZBGA 4PGFA 1UH5A 2VDMB 3UKDA 2ENUA 3L84A 3U3RA 2XDWA 3DOEA 1SVWA 1QB7A 4TTSA 3V6MA 1ZNYA 2OCDA 4FFVA 2W37A 4JD5A 1NMQA 1NR7A 3PUHA 3QYJA 4LA4A 1IG0A 1VLJA 1Z28A 5E4YA 3VVMA 1CVIA 3ENZA 1WCIB 3RSOA 1UDCA 3GYGA 3IAXA 1P2FA 5LVAA 2YHAA 5REQB 4AQDA 3IKTA 1DAKA 4KMSA 1SM4A 2F1RA 3W3AA 4PYNA 1MENA 3QVJA 4CEHA 3QJYA 1N9KA 5IXJA 2KX7A 2Q5CA 2GK4A 2AOXA 3OPYA 3HGMA 3T3OA 1RI1A 4O4LF 4FYIA 3LVQE 5DN9A 3R7SA 2P69A 3A10A 3MXOA 1HE4A 3ZY2A 2QHXA 4YDHB 5ALIA 2VSXA 1ORWA 4RTQA 2WD7A 4FYVA 1FDUA 1YASA 2DU8A 4A92A 1TPYA 3M6IA 5EQFA 1QYIA 2ZDQA 4R71A 1GGNA 1ECCA 4KN8A 1D09A 1NMSA 2JHGA 2X9LA 3DB2A 2R2AA 4V2UA 2IBSA 4GI3A 3GX1A 1OX6A 2VJBA 4FLFA 3LPAA 1Z9BA 1PT5A 1J2YA 4OAPA 2PLAA 2ZREA 4KQMA 5GP1A 3WYFA 3DAOA 3WHIA 4RXUA 2DF8A 1V6AA 2PKQP 5IM4A 1Z4KA 4IGIA 1GXSA 3K0CA 4PSAA 3H6HA 4UMEA 1QE3A 1D07A 1DEAA 1UT6A 3HJGA 1VI6A 3I8XA 5E6RA 1O97D 4IGEA 2X6TA 5E9AA 3IDFA 3KEGA 3PUKA 4DCJA 2Y2VA 2WF6A 4QUDA 1CQIA 1VLHA 5IJZA 4F97A 2DE0X 1Y8ZA 3EZLA 3OZBA 1HG0A 1T2AA 5EMHA 3LP6A 3GFFA 1D5WA 3SIRA 3TRJA 2RB4A 2QRNA 4A8JC 3LGAA 1NFQA 2QG9A 3PVCA 1AY0A 5HIKA 4X60A 4XE5A 1KJ9A 2QG4A 3KKQA 2VHZA 3JAWB 3R5SA 2F00A 1NQVA 2RC5A 2ZQ5A 3G9XA 1UOQA 3KAPA 2QN1A 3Q8WA 1D1PA 1G20A 2WV7A 4TZ6A 2O7NA 3KB1A 1NFRA 3B6JA 3IO3A 5GONA 1CC1S 2VHQA 3QX8A 4IMIB 4X6LA 5BT9A 3SHTA 2BCJQ 1GUFA 2EZ4A 3IE2A 3RW9A 2H4JA 5L51A 5T4BA 2F8SA 4RQBA 3AF4A 1KO5A 2PL9A 2Q1SA 1JDNA 3GIDA 5SY9A 1DC3A 1FL9A 3PR1A 4B82A 1E6LA 1GSIA 1Y6ZA 2NUBA 1R15A 5HRUA 4RFSB 4UEQA 3AJ8A 4QXPA 4S35A 4BO2A 1K92A 3ND7A 3JVEA 5GINE 4H15A 5JXGA 1M2OB 1WABA 3RSHA 1V8FA 1K75A 4EGSA 5IYZF 4D79A 1PV4A 1PQYA 1LI5A 1IQ0A 1I2AA 3QU5A 3PSHA 2IPAB 3BGSA 3EGXA 4MMYB 3P9PA 4Q66C 3QXGA 3E15A 2WU4A 3VYSB 4F11A 2JGFA 5BSTA 1NX9A 2AFIB 2EP7A 2R7KA 4C4RA 1WSWA 4LJLA 4NU6A 1SUWA 1ZNXA 2FUG1 3N8HA 3NOXA 4LQDA 4R2IA 2H1CA 4C7MA 4WE3A 4YH1A 1JI3A 1T9AA 2HA6A 2R8RA 2ISQA 4N39A 1OTHA 2V6BA 4G8BA 3WKEA 2E49A 1ESDA 1JL3A 4UHHA 3TMKA 1AMUA 3EUFA 5KQPA 1TQHA 1D7OA 3HVRA 2RE8A 1Q6ZA 3OLXA 4JLVA 4LXGA 3ITEA 2EHJA 4HDSB 1T0HB 1KU0A 3KJFA 1B16A 3X1DA 5A02A 5FBZA 4FWIB 1RKVA 3NWBA 4MUJA 1X7ZA 1PJQA 2ZRDA 4DCCA 3ODGA 3SR3A 2Z4RA 4D3XA 1IHDA 4R54A 1VI5A 1WD7A 3C3YA 1JTVA 2GBLC 4LF9B 2JFHA 2VDVE 4D56A 2AW5A 1YB4A 1LS1A 1CUHA 4YCSA 1ZL2A 4N4AA 5AOVA 1H4SA 1Z5PA 2ZRQA 2OCXA 3I04A 3JY6A 2XSZA 5EZ6B 5IMSA 1N5MA 5KWJA 3KPVA 3OJWA 4P9NA 1OZ0A 2C9OA 1MIHA 2GEUA 4Q1EA 3WAKA 2RGBA 1O97C 3JQPA 4RTSA 1IN7A 1VE3A 3AEZA 2BRUA 4HXGA 3I2GA 1J90A 3QWBA 2JCBA 1P1KA 2B8JA 1QFJA 1T0IA 1E20A 2GPNA 2UV8A 4U8HA 3VR3D 3C3KA 3AXTA 4JJIA 5G1NA 3DFMA 4G1FA 4Q93A 3ZVLA 1UPFA 2YKGA 4J6EA 1XEXB 3KQQA 4IMJB 2ACWA 4F91B 3BXHA 3R7WB 1M5UA 1F4VA 2R25B 2MYNA 2X1LA 2AR0A 3JQAA 4LHXA 4QIHA 3RC3A 3B2NA 2J3LA 1QGOA 3B1VA 2G1KA 1OXSC 3R6LA 2ADMA 4QG7A 5CK5A 5JALA 3DHNA 4XYBA 2VH2A 1KI2A 2PX6A 3I0ZA 4FFNA 3M5DA 4FGKA 3D7RA 1UWKA 4L8VA 3DPUA 3K4PA 3NNSA 1HQCA 4GLJA 2YQ4A 2P9JA 4G97A 3MMNA 3BWMA 4B83A 1NYLA 2Y0BA 2ZCVA 1KIAA 3R5JA 2WW8A 3S40A 3C5CA 1Q0PA 2C9MA 3QVKA 4BQPA 4L15A 2ZBFA 2GTHA 1S1CA 1VJ1A 2WM2A 2W6CX 3K1AA 4MTCA 5EZYA 1GDTA 1Q1GA 1QFMA 2YN2A 2QTBA 3V8BA 4KNYA 2BTQA 2G09A 3PNYA 4KQCA 4NFLA 2XW6A 2CNWD 1V39A 1EFKA 2BCGY 2FG7C 1OKKD 2VDJA 1C2YA 2H8KA 2XVZA 3FTDA 2X42A 4OM8A 4OXRA 4O5OA 4FGUA 4DV0B 1DRKA 2YVAA 2ZTLA 1Q11A 4P5PA 3EIEA 2F43B 4C2AA 4ZKDA 1ZJWA 2PS3A 3JS5A 1V95A 2AI3A 3BREA 4S1VA 3EDOA 2OHVA 4ZT7A 2PO7A 3H1AA 2RKOA 3EE6A 4M1KA 4LDQA 4QPPA 4RD3A 3NOVA 4BFSA 1AH2A 1K3FA 2HNAA 2IIPA 3QFCA 2DWUA 3F7NA 4OB7A 2CXQA 1PL0A 2AT1A 1YE8A 2AWNA 1CUFA 3SBXA 4DHWA 5HUJA 2IHNA 1XF9A 3AR6A 4G09A 2BLLA 621PA 1J00A 4GKBA 4EG8A 1P5HA 2JI4A 4IYJA 2DFPA 2A84A 2RHLA 2JGAA 3OUTA 1OY1A 2WFZA 2ZBPA 5GOTA 3SOZA 3ZPXA 4CIXA 4ZHQB 1ILEA 1YQTA 3PCTA 2E55A 4C01A 2NO0A 1RXEA 3UBMA 4D4KA 1QQAA 2EJUA 4K8RB 4I6EA 1ZXLA 2EP5A 3D0RA 3IP6A 4TLCA 4YHBA 4MEBA 2M9MA 3L0SA 2V7EA 1G98A 5EJ4A 3G0GA 2IPOA 3WWYA 4K6MA 3S2YA 3VPBA 1NXSA 1UPAA 2P40A 3R3JA 1S2NA 1GZDA 4I4TA 4MYDA 2OC4A 2YFKA 4RTJA 1WXGA 2GZ2A 4GFDA 3OPQA 4A10A 1E2PA 4JZYA 3L07A 4JI0B 4HQ6A 5BNFA 3GZNA 4EDHA 4AY2A 5DMXA 1G7CA 4ZJPA 4W5TA 3W6PA 2WJZB 1QC5A 2YRWA 3BSYA 4RJLA 1PJ3A 1LPNA 4QQFA 2BUCA 1BWRA 1UT5A 1ZGGA 4ZVUA 1JB9A 1KVQA 1MAUA 2FQYA 1NULA 1L4FA 2PUWA 5DBGA 4C0LA 2QTGA 1TCAA 1USKA 1KKLA 5BW4A 2YW2A 1O9GA 1X42A 4M46A 1R0WA 1VL1A 5HM8A 4MPTA 4K28A 3IDOA 3BXXA 2ZCJA 1X2BA 1DKNA 4CETA 4GOJA 3I0NA 3DQZA 1EH5A 1NL3A 2W5UA 2G9NA 3AR7A 5E0KB 1TPZA 4LIPD 1YJCA 2RK4A 3D1VA 3K92A 3QYFA 1Q1BA 3D3QA 3WNZA 4WLUA 4F93B 5DK6A 4BNLA 3I09A 4US2R 3VDXA 1SPXA 4YMGA 1NDQA 3AR4A 4MCHA 4EZBA 13PKA 1EVLA 3H1FA 3QFFA 1UEJA 2R00C 5DHFA 4X3PA 1BXGB 2D0PB 5EJFA 5C9ZA 4LBYA 1BQ3A 1YOBA 5KEIA 1QHYA 4YO8A 2AFHE 2HN9A 4YAJA 4W5QA 2W58A 3EXAA 4M89A 4AKSA 5I7SA 2RHBA 3L0DA 1KK1A 5FQNA 3FZGA 3GUYA 1N7GA 1CEEA 4JNCA 2P2DA 3A1TA 3HCWA 1HX7A 2BJWA 1ETUA 2WMYA 5F4BA 2I1WA 3EK2A 2FKNA 3CTMA 4AO7A 1NPDA 1HFKA 1J8FA 1U7PA 2WE8A 5JNUA 3U4MA 2RKWA 4AZTA 1G9TA 3B52X 3FB4A 1E59A 2VF2A 3KP1A 5ENDA 3UGKA 1IJBA 1DG3A 2FUKA 1D0SA 2QR3A 4OREX 3VKWA 3EQ9A 5EP1A 4RENA 1O96A 2H06A 2VDUE 1P62B 3NVMB 4XIIA 3WWCA 1VLVA 2ZIFA 3CF4A 3F4LA 1HTWA 3QBTA 5DE3A 4KSBA 1LWOA 2DCUA 4MWGA 1DKMA 4N0MA 3DEIA 1Q6YA 1ECPA 1V1RA 2VP9A 5JSZA 3U81A 4NARA 1KAOA 2P5UA 4MR7A 1YK1A 2HCFA 2H54A 3K31A 6REQA 3TFQA 4G25A 3AM4A 1PFUA 2A35A 3DC2A 4C1BA 1KY3A 3TFWA 1PJCA 2EU8A 4EKYA 3T1YB 4QODA 1OYWA 1AUXA 3VO9A 3D6UA 2NM0A 4NBSA 1NG1A 4R7GA 3UMGA 2IYYA 2IXGA 4DA7A 4OVKA 5BO5A 2QLTA 5IPFA 3LFUA 2B2XA 5K6RA 3MJHA 3SVZA 3N8DA 4WFIA 1G5HA 4GSLA 2YXBA 4IH1A 4HTAA 4AKHA 2QTNA 1QC5B 1E1KA 1V6CA 3FD8A 1V4BA 3HHEA 3HXPA 2BSAA 4IEEA 3GPBA 1M6HA 1NU8A 4KSYA 4ZOBA 3SDZA 5JCXA 1F14A 3DAPA 5FORA 4BFYA 2HK7A 3H4IA 1SVUA 1T5BA 3P4YA 3PVSA 4UXIA 4ZV4A 1JYFA 2ECOA 5CAEB 2YWEA 3E3NA 5EWMB 1P7VA 3DZGA 2ODPA 4FQ7A 3AFNA 4DZZA 2NUTA 4KPFC 3OZCA 2PHZA 3FCUB 1F9EA 1NG9A 1Q0TA 3A4TA 5JZBA 1ZJ6A 1TJ3A 3ND8A 4HWPA 2EAUA 1SVMA 2WAYA 3GCGA 3DE7X 1OLSA 4IHKA 3ZZUA 1FP4B 1WMAA 3ZD9A 1ZXXA 2A0UA 2JBWA 3TRIA 4BE4A 4E6EA 2ON6A 3R6DA 3T3NA 3CHYA 3HB1A 3VVBA 4LFAB 3FI0A 1JWLA 1KJWA 3SBEA 2O8BA 2A0FA 5AI4A 4ROTA 1IN1A 1IZZA 4UU0A 5LOVF 2FPLA 1PS0A 1TIPA 1X7WB 4Q9IA 4FMBB 1WUYA 4TYWA 2GN8A 3BQNB 3DDCA 3W4IA 2KBEA 3EWNA 2WFMA 4I8IA 4EVQA 1XNJA 1ZM2A 4OKSA 1FBNA 1IOVA 3L4EA 2YVQA 5D7NA 2Q3CA 4BQOA 2MSWA 2ZJ1A 3DYBA 4HWSA 5FPYA 1P7PA 3MGKA 2DUWA 4MGIR 4AKEA 4CKEA 3WLSA 4C06A 3Q40A 4X8HA 4FFWA 3UYLA 1E3SA 4RELA 1TNDA 2LRHA 2Z2YA 1HK7A 3R7NA 5FL7D 1SEPA 4JYZA 4FGJA 3I6IA 2B20A 1AOXA 4Q9NA 4Q3LA 1FNBA 4LHYA 4PE5B 4R5HA 4I5IA 3GLIE 4ROSA 3S0JA 3EA5A 3USCS 3WADA 2H6EA 4OGLA 2D1SA 2IYOA 1TC1A 3I9JA 3GIWA 3LRTA 4QVKA 1YR2A 1XAHA 5KOIA 1SKUA 4AUEA 3PQ6A 1BXZA 3DEZA 3S27A 3TZKA 5BR4A 3THYA 4JQYA 3BGWA 3R0VA 4X1KA 5AIAA 1NVVR 4RDIA 1TB4A 3W8FA 1NBOA 2G76A 1I30A 4JASB 3BZUA 3T9BA 4KPYA 4A0QA 4ZVNA 6PFKA 4DM7A 1I0LA 6REQB 1RYNA 3ZKWA 1G55A 1NJ5A 1XNHA 2H9YA 5A6SA 1YL7A 1P1CA 4HEQA 2Q50A 2PWYA 3BK2A 3TLGA 1WUIS 1ZOOA 1EK1A 2I6FA 1RQPA 2RHTA 3AETA 3F2IA 4CG3A 3ENQA 1SBQA 2HGZA 5T6MA 3T5BA 5EGNA 3G2PA 1WXDA 4K3UA 4BB9A 1D4AA 2NU6A 3LUDA 1ELOA 3OIGA 4ZVOA 1MC8A 4BUCA 1IBSA 2I2WA 2O48X 3R41A 5I9SA 1KQNA 1V2HE 4JBNA 4C03A 4HNHA 1K86A 2BONA 4UNNA 5KTYA 1QZTA 1YULA 2AV6A 3ZIAD 4KLAA 4DRXB 4JGGA 1O0BA 4CUJA 1EKXA 2GN4A 3TLEA 3ZV5A 3H2ZA 3IP1A 1A04A 3JQRA 4IOJA 3A6KA 4M0KA 2XA2A 4E4TA 4J7CA 4JI7B 1AURA 1TF2A 2VFAA 2G5CA 4ZOLB 5IABA 1V26A 4MIOA 2SICE 1E58A 3PQ7A 3G13A 4RAOA 5D1NA 1EX1A 2FR1A 4S1WA 4IJMA 5HEKA 3RU7A 1XDSA 4LN1A 4QM7A 3P9KA 1IJKA 1A5TA 4PZAA 5FWDA 1QZ3A 4GWKA 4N7RA 4PLCA 4HG2A 2X3FA 3E18A 4IJ5A 4QUHA 4DHEA 2X5JO 5KCZA 3PK0A 1J5EB 1IPFA 4FEYA 4WK6A 4TT3A 5CD1A 1DIBA 4LY9A 1O8BA 1VE1A 1ZN2A 3CLTC 5DPMA 2G25A 1AS3A 1EINA 4HNRA 1XZHA 1EZZA 3KELA 4N3AA 1GZSA 4EEZA 1R4NB 4V2IA 4BO0A 4IQGA 2W2KA 1XMJA 2YBDA 1XKLA 2QENA 4KB5A 4CDRA 4ZQEA 3E5HA 4IDNA 5E7IA 3SICE 3RBVA 3CBGA 3SZ3A 4RHUA 2WV9A 1NSYA 4Y2GA 3IQHX 4E11A 3L4BC 4BXOA 1SVLA 4CQMB 2A59A 2XCTB 3NMUF 3ZDAA 4QBIA 3FFWA 5BVHA 4RZHA 3H9CA 5F1PA 4D81A 2FR8C 1W36C 2HHAA 3FMVA 2X8WA 1YDHA 1GZ6A 5KQRA 1PTJC 1TT7A 1X0VA 1SQGA 2MSKA 3VH1A 1F2DA 3HDGA 4BASA 5CA1F 1NA5A 3LK7A 2EBFX 4MKXA 1A9XA 1JWBB 1HYHA 3I01M 1KZHA 3C41J 4Z4EA 1OIXA 4P3NA 1XRNA 2R6CA 1Z2OX 5CLHA 5THQA 3ZWKA 4PQEA 5L7YA 4DE5A 5DSXA 1Y3HA 4TN1A 1DO2A 4KI0A 5C81A 4G4SO 4G4GA 3FMOB 5LU8A 3HXMA 5IAJA 2VJYA 2AJTA 3MJ4A 4LF6B 2ZJ8A 5H82A 2P3QA 2CNWA 3CG0A 2JZNA 4FIZA 4BLRA 1FTWA 4FYMA 4V0KA 1NN3A 1E66A 3B89A 1WMEA 2A8YA 1I4LD 3PXBA 1NBAA 1XRSB 1JU3A 1XCMA 4YV0A 2ODBA 4MYUA 2DUMA 2H29A 4KAXA 3CGGA 2OHFA 5JROA 5J2UF 3JVIA 1K7SN 5HZMA 3S68A 1WCV1 2Q3LA 3LXUX 1LVGA 3P4UA 5KTMA 2GEJA 3QU9A 5F51A 4RZQA 4XQCA 4BJ1A 5LOVB 1GNTA 1K2VN 2JEZA 1O3YA 2E18A 3H75A 3ZWQA 1N2ZA 3WAJA 4NDZA 4WFKA 2JA1A 4HKTA 2UKDA 3GT7A 1LRLA 3NBKA 4WJZA 2GHRA 5ALGA 4CLEA 2HLDD 5I5EA 3C85A 3B1FA 3HL0A 4JUIA 1NXVA 2RK6A 1Z0FA 1EDDA 2BMVA 1OZGA 5EZSA 4RJTA 1B3RA 2PUFA 3RGWS 4KPEC 2F9MA 3WGQA 1V3TA 3RS7A 3KAKA 3EDYA 3NUQA 1J0DA 1FFWA 3OO0A 2Z6QA 2PRYA 1ZIDA 2FJPA 4TWZA 1N36B 4IX9A 1O8CA 1P0CA 1ZI9A 3N70A 1WCIA 1ODSA 1QH0A 3UB2A 3FPLA 4TT8A 1L5OA 2V58A 3ONWA 1WF3A 4Z4GA 3QE9Y 4FP9A 3GA0A 3SC4A 1E9DA 1YC5A 4BIMA 1BGWA 1KMMA 4L28A 3AP3A 3P0HA 5EE5B 5IW8A 3W90A 4DCPA 5JMTA 5KNCD 1F7VA 3AIMA 2WUDA 5ANRB 3UJNA 1JKXA 5E1BA 2FMFA 2H2AA 5JAIA 3H5OA 1O2DA 3L4JA 3A25A 2Q0XA 2RGYA 1NVAA 2QSJA 2CXSA 2A7QA 1M8JA 1UMCA 1D2EA 2X1VA 2QX7A 3AV3A 4KKXB 4E31A 1HO3A 5BWLA 2IZOA 4CMHA 4MDYA 1WD5A 5K4HA 4OBWA 4MLZA 2PUEA 4FZJA 5K0NA 3D8SA 2HBYA 1RPNA 3TQTA 4Q47A 2IXTA 4BZXA 4EGCB 5C46F 3ZI0A 3NAMA 4EY7A 2X5NA 4RPJA 5JWOA 1K0UA 3T1VA 2NO1A 4BQIA 4QBTA 1B1AA 4IPTA 2RHCA 4HATA 3ZH2A 1G3UA 5K0FA 2MR5A 7AT1A 4DG9A 2P5TB 4H7DA 4N3CA 4XWTA 2X3YA 4HDMB 1GDDA 4KQEA 3AI1A 3EMKA 4CMIA 3PF9A 4TSRA 2HU2A 1YZLA 1NBIA 1J1UA 4RADA 1VXOA 3CRZA 1ZK2A 3WHKA 3WMXA 3IERA 4RK7A 1N2XA 2PWZA 1EVEA 1CR6A 1RIFA 2O6LA 2R6GA 2O20A 4MDEA 1K8QA 4QOFA 2BMWA 1LCIA 3FF4A 3DTNA 3TZBA 3ZV4A 3NEJA 4MVJP 3OA0A 1P72A 1CUBA 1NJFA 2HSGA 3EXIB 1XHLA 2XB8A 3HCEA 3IUEA 1A5BB 4NK5A 4EA8A 1I7DA 4DILA 1L5HB 5FWNA 3RV3A 5JJIA 3LTEA 4PO1A 1HG1A 5CYOA 3HH8A 4KLZA 3WA6A 1FMTA 2VDPB 3TIVA 1NI4B 3SQLA 1SU4A 4JYMA 3LKZA 2B35A 1IOLA 2I29A 4YMTA 4YREA 1EFRD 5FAKA 4IEFB 1G20B 4FGLA 3IV6A 2COKA 2CXOA 4J2HA 4D4LA 2OAQ1 2ST1A 1Z29A 1L4BA 5ILOA 3FNIA 3L92A 3OEWA 5EMNA 4U4AA 1ZVMA 3LQ4A 1KBOA 3GB9A 3UVEA 1RI3A 4JYPA 1HYQA 2CLKB 3AIIA 4IH9A 4O0LA 2JAHA 3FNBA 5JUWA 4OLAA 2VXOA 3KUUA 4AYXA 1SOUA 4C5AA 3ZWNA 5BPFA 3SYMA 3L6EA 3PSAA 4DLTA 5HKOA 3TINA 4A3SA 1F6BA 3PDCA 3UICA 5KTOA 4ZT4A 4J1SA 4AJJA 3OT1B 1VG9B 2CHUA 1C30A 4D9KA 5A4JA 1O89A 4M6WA 4O4LB 4FFOA 4ZYUA 1T2VA 1NLYA 1YF3A 1S2OA 4F71A 3PIIA 3SNHA 1JKJA 2C4NA 2GJAA 2C3YA 3PJFA 3OE7A 4MULA 3ICEA 2CV2A 3C6XA 1R7RA 1MV8A 1SGWA 2Y66A 1MAHA 2Z2XA 1J1ZA 1PGJA 3SE0A 2BI8A 3HYLA 4XRRA 1N6OA 2XOEA 5CB6A 3HMQA 3K05A 1BRMA 2JGRA 3IT0A 4FR2A 4JVLA 3RFCA 1UBTS 3VTZA 4CKBB 1RQXA 5JFTA 5JNRA 1Z18A 3SGLA 1CZUA 1F0NA 1F1BA 2W11A 1GGJA 3I1FA 3U3MA 3GNTA 5FO0A 4WN3A 4YQEA 4OGWA 5TGTA 1RW4A 1XXHA 3B7GA 2Z57A 4RKEA 5SV2A 3RTAA 4QX6A 3V46A 1PK8A 3RRZA 4M0DA 5BN4A 3H42B 4IWYA 4OA8A 1CY8A 3COPA 5IN5A 5C8DA 2B34A 1NQUA 2P11A 5GY7A 2I9KA 3P2EA 4CMJA 5LP1A 3TECE 1S1MA 4KXMA 5BORA 1YQWA 2PWAA 3GI1A 1SQ0A 3N5CA 1JXAA 3UG6A 1OZAA 2F8TA 4MRNA 3JR3A 4OUDA 4G9BA 3DR3A 4U7GA 4ISCA 1PZFA 1EEHA 3LSYA 1JMVA 1P6XA 2EW8A 3UWDA 3OSUA 4GOOD 2VS1A 4OK5A 1NUQA 4PXAA 4Y2JA 4U2FA 2PLFA 3IIJA 3A27A 1KY2A 1YZYA 3QRWA 3QXXA 4ZPXA 3AJEA 4GUAA 1H2AS 3LY7A 2PTHA 4EKNB 4Z1OA 3D4BA 3L8ZA 4G0WA 3WB0A 3UGTA 3ZWOA 1E5DA 2FMKA 3IQXA 2FR0A 1GPAA 3N5KA 1ZM3A 4K9QA 1EHCA 1HL7A 3MD9A 1SXQA 5TF0A 1M2HA 2BGIA 3H5TA 5B4VA 3W9BA 4M49A 2CVOA 2R0QC 1Y80A 1XTPA 5AI9A 4PYMA 5BP7A 4QYSA 2QLNA 1U1DA 3IAM6 5K3FB 3ZZ0A 4JCCA 4MVJM 2GJ8A 2VDOB 3C97A 4TLLB 4Z7OB 5G1OA 2F8LA 4E2XA 4J9UE 1ECJA 1MQAA 3OLYA 2J67A 4MCAA 4O8ZA 4YJGA 1XC7A 4ENSA 2Y6UA 1NY5A 4QU0A 4ZI7B 2E9SA 5CGZA 2DGDA 3NUGA 4R3NA 3RE1A 3PT5A 4CV1A 4QNNA 4DVJA 1JVBA 2WD7B 4DQDA 3ONFA 3OZRA 5BQPA 3B8HA 2PCJA 1FQKA 1JR4A 1KIFA 1A9SA 2XUIA 3D0KA 3DCNA 4M21A 2IXDA 2XMRA 1COZA 4B7UA 3MJEA 4Z0HO 2V1UA 2W4MA 2ZRIA 2FP3A 1EUCB 1QLHA 2PKWA 3SEZA 5CLLA 4B45A 1V5EA 2ZPAA 4KZPA 3U19A 2GLTA 1GKYA 3LKDA 2DSTA 2B94A 3MBOA 4Q7JB 5C8YB 2QI9F 4XRGA 1ADBA 2BW0A 1MEEA 3V7WA 1IHUA 1HF3A 1WW3A 4BGEA 3R75A 3IJ5A 4IXTA 5IT0A 4PSCA 1P2SA 1Q2UA 1V3UA 2G36A 2WYOA 2BGGA 4O3MA 3UJ3X 4L3WA 4BCBA 3BMCA 5J63A 5HXAA 3OUUA 1M2NA 2G28A 1IE3A 1EJ6A 1TM3E 2W93A 3E9DA 4INOA 4E5KA 2CK3A 2X14A 2FW1A 3F6BX 2H16A 5K8VA 1M1XB 1HGXA 1E99A 1G21B 1IWBB 3I8SA 1XDBA 1MB0A 1C8KA 1VMEA 1UBOS 4L9RA 4EQ6B 4RTMA 1NNI1 5B2ZA 5NULA 1SHUX 2WIDA 2YN0A 4N5MA 2YIMA 2GZHA 3GFGA 1MAWA 3UHAA 4RMGA 1AA6A 5LQRA 3IT3A 2Y3IA 4I4LA 4NOLA 3WGOA 4RCVA 1W96A 4O8CA 4S1NA 2X58A 4BKRA 5ISMA 4KR3A 1JIJA 3FGNA 4RK1A 4XQ0A 1NW7A 4D6YA 4GGPA 2EWWA 3WL8A 1JJFA 1ZNZA 1GN9A 1FVFA 4DS3A 2E0IA 1NJ1A 1TMYA 3K5PA 3OTWA 1BEUB 4R69A 4UAVA 2H08A 3VR5A 5AW8A 4CF5A 3D2CA 4H18A 1BDIA 1TAGA 2QGNA 2YIVX 5BN3B 3JD4A 2BC9A 4GRAA 3FOZA 2DFKB 1U2DC 2LIVA 3NXKA 4JXJA 1SIUA 1PJAA 2EW2A 1N9GA 2XWSA 3FE2A 4A15A 3GJ7A 3K0FB 3UPDA 1D4ZA 4RU1A 1EQ2A 1D9XA 3JASA 3QLJA 5CFRA 3GU3A 5KVSA 4TTQA 2NYAA 3VPFA 4PYIA 1NNUA 5AJHA 2ZTSA 2A67A 3HYRA 3TGPA 3GOQA 3GLFA 4Q4HA 3ADPA 1T5SA 4JELA 4PO8A 3LGXA 3UJ9A 3A2MA 5DHUA 5DSTA 2UZ1B 6ABPA 3GROA 2X3UA 5CBPB 4XSHA 2NXNA 3ZHXA 1BKSB 1SUFA 3LPCA 2MMGA 2HA7A 2XZDA 1G8KA 5BUSA 5J4VA 3OCYA 1QGDA 3SJ7A 2GK3A 2XITA 2M6SA 1IXYA 4Z4IA 1CRLA 4L3VA 1DAMA 1TU3A 2MINA 2ORED 4FHFA 4IQ8A 4KXQA 4S2UA 2ZB8A 4TV8A 3QF4A 3UEOA 4E08A 1ZCJA 2C4WA 2ZAOA 4JAVC 4K9RA 1QYVA 3OOSA 1CLUA 3FLEA 3E05A 4TTTS 1X9GA 1K1EA 2XT0A 2HB6A 1XAJA 2Y77A 2V7QD 721PA 4B4OA 5TMDA 1NJSA 2JLCA 2OGTA 2P9TA 1ENYA 3LSTA 4NENB 4RE5A 1P8JA 2Q5HA 4HB3A 4Y7CA 2WSBA 1KYTA 2OD2A 3W6OA 1P1IA 3X1WA 1KDYA 5G0UA 2YUTA 3RU3A 3AM1A 2WZQA 4GMFA 3OSZA 4REMA 2V0CA 3CH6A 4UE6A 1MOZA 2ZJ5A 1MX3A 1X19A 4MH0R 4A1OA 4MS1B 4BO9A 4MKRA 4X66B 2DKFA 3HI6A 1ZRMA 8OHMA 3TX6A 3T41A 5CDUA 4B7AA 4HWTA 2FW0A 3DNMA 2EFJA 2XF2A 4H3KB 4BMYA 1KJ8A 1RTKA 2B78A 2PPVA 5B64A 3F73A 3H99A 3TSAA 5JATA 1RXCA 3CUWA 4ERNA 5IFLA 1V7CA 1ZLXA 1JJBA 4KWHA 5AM3A 3BAZA 1W0JA 2NOAA 3OX2A 1GAXA 2FWMX 1QPBA 2J3MA 3O6VA 3OE1A 1PF7E 1WVMA 5ERXA 3OIDA 3HB9A 5G2OA 4CF3A 4DLRA 2XOKA 3CQ9A 1C29B 3GJ8A 5C1OA 1I6MA 1G3RA 4QNMA 4GPBA 5IZCA 4Y0NA 3C5EA 4RA6B 1KEPA 4REQA 3V7NA 2VOJA 2V6JA 4CM7A 4YT4A 1PX2A 2XA1A 1YTLA 1CQIB 1VPLA 3DWFA 4M1ZA 1YQXA 3IALA 1E3JA 2XKAA 3AM5A 3KVYA 4U0JA 4Y2SA 3MWFA 2YWJA 3GARA 4DXAA 3L1VA 1DXOA 2NNWB 5F9MA 5JSYA 1KKUA 1PL8A 2VUSA 4GG1A 4J29A 4URVR 3E7FA 3INTA 4PO9A 5IVPA 1A1VA 3EGOA 1ULSA 2DHQA 1H8EA 4TVBA 5DHQA 4D9HA 3ADOA 2CEAA 4RVHA 2AL7A 2VYQA 1DOHA 5DHRA 2PJRA 1NYQA 2IY8A 2BGMA 7YASA 5KAPA 3BTUA 2BFPA 1F6WA 1ZA1A 1JQ5A 1BXKA 1RLTA 1XD2A 1L7NA 4BEWA 2OKCA 3RPEA 1X1CA 2COEA 3NGMA 4K9LA 5G4KB 1UMCB 1Z2AA 3JQFA 5DVZA 1ZBQA 4NONA 2DECA 3QV1A 1NW6A 4K6HA 1YU9A 3LW7A 2WYIA 3X3HA 1OBFO 3DGFC 5KYNA 1CETA 2XA9A 4QOJA 1XTJA 4KYUA 3S7ZA 3VHRA 3AV0B 3ZH9B 5J4HA 4G41A 2PUDA 3IVRA 4U9HS 4ESHA 4DRZA 4I4NA 5ER6A 4CWAA 2DPLA 4JENA 2UVPA 4A0FA 4C3ZA 1TMKA 3AFMA 1W52X 4JWTA 4B84A 4BLOA 4ML3A 2PVCA 3W5CA 4EENA 5AJVB 1XROA 1GOTA 2GHIA 1NF9A 3N58A 4M98A 4RIFA 3KJZA 4IDDA 5ALTA 2YFQA 3O1JC 3I8OA 2A94A 4LY6A 1L1FA 4N03A 3FN4A 2VDQB 3E1SA 3I2IA 5AQ1A 4H3SA 2W98A 4R8VA 3WMGA 3GD7A 1CJTC 5GJCA 2FSGA 3TJZA 3WISA 1RM3A 3T35A 4DLLA 3SFZA 2WHQA 1MO4A 2V4UA 5JQGF 1OXVA 2JCVA 3MFQA 1F0PA 4KPGA 4K9NA 1NBEA 3BPSA 4Q3EA 2CMDA 4H6PA 3USES 2G88A 3SR4A 3ZE2B 2VT2A 4G89A 4AJIA 4U6NA 1OE0A 1RBQA 2WIGA 4GW3A 2HI0A 1AS2A 4YRPA 2C5FA 1J99A 4RDCA 4RVFA 1DSSG 2W6ID 3R44A 2EJCA 4XLLA 4YP6A 4CDNA 4EJ0A 1C1YA 1KRHA 1SD5A 1LV7A 3LCJA 1ZH6A 1ZMXA 3DDSA 4G2TA 4LSZA 2FMIA 1XRRA 4H3HB 2LW7A 4WUVA 3TTXA 4DJAA 4R9NA 1U7ZA 1QZZA 4Q1BA 1ESMA 2QX9A 2XUQA 4KH0A 4ZRDA 4OHXA 5J59A 3PXDA 4UPEA 4KGDA 1UC8A 2B21A 2VLIA 1ID1A 1AK1A 1U1GA 4EHFA 3DEKA 2H5EA 4FYWA 2XCLA 4OHUA 1S2MA 1DJPA 1DT5A 2FSVA 4Q4CA 3I1IA 3MUNA 2ZIAA 3SJZA 1XN4A 5K6TA 4ZYTA 4HGOA 3BIJA 3R3VA 4PINA 2NPOA 1ATZA 4EUFA 3H86A 4KFSA 4EA6A 5JR3A 1U0TA 2ZKIA 3BSFA 4RF5A 5H9WA 3HNOA 3OEHD 4IAOA 5DOZA 2HHLA 1UBFA 2HF7A 2I4MA 1CFZA 2JJQA 5CLFA 3IUMA 1BQEA 5EUMA 3TKLA 5IEJA 1PO7A 1TIKA 4M88A 3JTMA 1I1HA 1CS0A 4E88A 3TVYA 4RTKA 1T4GA 2AEFA 4BNKA 2EFEB 3BWYA 5DCLA 5EJIA 5P8WA 1XLTC 3QTLA 3GLQA 1QHGA 3YASA 3T9CA 1Z5VA 5LMZA 3PHCA 1UUFA 4WWHA 5D6NA 2RG1A 4BNTA 3X1JA 4CT5A 3KNZA 2P3SA 1J24A 5KJCA 1ZESA 5F33A 2O8FB 3WLJA 2H1FA 1BE1A 1I2DA 3ABRB 3BJRA 2IE0A 1CUVA 5LKRA 1FJXA 3ORYA 3TBKA 5E9QA 4BAZA 4IUDS 4CHTA 5KWSA 3QLUA 3E7DA 2OBMA 4Q15A 1I14A 3HWRA 3MT8A 3W77A 2AW3A 5IJAA 5DM2A 2G5GX 3SG0A 3ZD8A 4CLHA 2XNKA 4HT3B 2CHGA 4OHFA 4G5OA 3LMKA 1QS0A 3KZXA 4K87A 4MKIA 3SSAA 1U28A 1XCGB 2J07A 5DGCA 4A5SA 4CMAA 2B61A 4JC0A 5F9FA 1KEWA 1KI4A 2Y1GA 4B8ZA 1PNQA 4IDPA 4B0PA 4F1WA 4XQEA 5IDQA 4JJFA 2O0LA 5EINA 5KPDA 2FMHA 2D2EA 5A6VA 2DPGA 4X84A 4C3OB 1ZR2A 1F7UA 2B5VA 4OQ4A 1K6XA 1JPJA 2EJVA 3EAQA 5GONB 1FXUA 3PNKA 4P7FA 5FBQB 1UBMS 3UAVA 1JHZA 3ZCUA 2A5GA 4Q3AA 3KJHA 5EIEA 1XRLA 2FHPA 5AM0A 2PUVA 3RHTA 3W78A 3IQDB 3UT6A 1ETHA 1YDGA 1Y4ZA 4Y6OA 2CBZA 4XGKA 1N1DA 5AVJA 1XVAA 4OY3A 2OLKA 2R1UA 3G0IA 2J7PA 5PNTA 1VLQA 4YCNA 4JXZA 1K8YB 1L4MA 4LW8A 1CDOA 1TTPB 4YDRA 5M34A 2VPXA 4RAQA 1HQDA 5C1BA 4C0JA 3VAAA 1XQVA 2BFBA 2GCOB 3H5VA 1NXOA 1I9GA 2A6PA 2NQTA 3HG7A 2WYUA 3HB7A 1QRTA 3DXFA 4OAOA 3KSDO 2XCUA 4LGCA 2CF6A 3F3SA 2Q6IA 1IQPA 4H1UA 5I7UA 3I05A 4DVGA 1IHYA 5EJ8A 3M4YA 5JAOA 5F5NA 3CVUA 5BSRA 3PEUA 5AJWA 4MIKA 3DFUA 3VPDA 1OAAA 2PS9A 4L07A 4BU0A 4BLSA 5HIMA 3UXMA 2KLBA 4JR2A 3DZ8A 3IUNA 1CQPA 3OP4A 2YS7A 3TXAA 2C2HA 1KH2A 4W5OA 1D03A 1G1MA 4NIMA 4PF1A 5I47A 4EUSA 3GJTA 5F3WB 3RYHA 1N2OA 4DABA 1DQZA 3VSDA 3ON5A 2SCUA 4ENUA 1B73A 1Q7RA 1C30B 1D9ZA 3HDVA 4LZZA 5E9WA 5ERGB 2XD9A 4PQRA 5B2FA 5INTA 4XCXA 4RIHA 4UNRA 3FFBA 5JXJA 5LD2C 3WLPA 2X0FA 1SQFA 2PKRA 3BMOA 4FS3A 3ZWVA 1H2WA 5CXQA 2WSMA 2VPYA 3L7YA 2B83A 5AR1A 5LM3A 2NYVA 1EAMA 4JDUA 2XUHA 3DONA 3E2MA 4MQEB 5DK4A 5DTRA 3HGQA 1HKUA 1PUIA 2BWJA 4M9CA 1L3BA 4E30A 4NESA 5EJMA 4DLAA 1USGA 4CV2A 2WM3A 3LECA 3JQ9A 4CLRB 3R9KA 1CZHA 4IZ6A 2Q5EA 4P0QB 4F0JA 2QUAA 1U98A 4D0RA 1O94C 4R40A 4W1SA 1YJAA 3RTEA 1CRQA 5LWQA 4XB6B 3DPSA 3FPJA 3HQ4O 3LC2O 3HVJA 4HVCA 2OHOA 4MICA 1PFGA 2O8EB 2OHIA 2V6MA 3OTIA 4CM3A 4G0OA 1CJBA 3OIWA 2QW1A 3BSWA 1Z6AA 2AMLA 2YL2A 3CZRA 3UFXA 3WMFA 4E51A 1FRFS 5C53B 5DTQA 4I8DA 1EVYA 3STVA 3EPKA 3DT9A 3LT1A 2DULA 4CBVA 3E8MA 4CU5A 3V32A 2ZDGA 1RHKA 2I6TA 3ACDA 3QFHA 4TWJA 2FUEA 3UXEA 3GLTA 3A31A 3EVBA 3O4IA 3KYCB 3OIUA 4RMIA 4DA0A 5LWHA 1UBEA 1RRCA 3WQSB 3ZXYA 1X7XA 4PLGA 4RS4A 2GPTA 4FB5A 4ENWA 2HXYA 3GLUA 1J4AA 3QQPA 4TSFD 4JVOA 4BGVA 2DY1A 3WLOA 5FXMA 4KFUA 3LUAA 1O5TA 1VSUA 4OQNA 3CEAA 3HA5A 2FMUA 1K5PA 3BH0A 4GSKA 4CMEC 3Q2OA 4BLPA 3HA2A 4RY9A 4LVOA 3IE1A 3T7AA 2FPOA 3GHHA 1BHJA 2O2GA 1INLA 4UVDA 3WL5A 3WKDA 4C05A 3D8BA 1M34B 4JOQA 3TI9A 2NZUG 3C3JA 5IDVA 5HUHA 1JR3A 5JH7F 3KUDA 4HX9A 1JDVA 5CYFA 1V25A 5ALMA 5IJXA 2JD2A 5IAAA 1JPUA 2OR3A 3TQIA 4KMMA 2BJHA 5JANA 1L7AA 1LUAA 2B7CA 3T6KA 4DYHA 3U60B 4E70A 3KAQA 4Q0MA 2FQWA 2QVXX 1U90A 3ILSA 3U16A 1A88A 5DI3A 4D5EA 3P45A 3UWMA 1A4RA 1JJVA 2X5KO 3JYHA 1UL1X 3PPIA 4UCQA 4C4XA 1RFGE 3LO5A 1DUIA 2GESA 2QW0X 2WDZA 2YVUA 3AYXB 3RAFC 3I62A 1VJGA 2VAMA 5CPBA 4C4OA 3FZYA 4QT4A 5B55A 5EWLA 2FFJA 1NOJA 2GETA 1EFRA 1U8EA 3R0JA 1R8SA 3DOFA 3G1TA 4PC7A 1TI7A 1BS9A 5C7IO 3OFNA 4Y2QA 3WK5A 4P38A 3TD2A 1YJ5A 3A9CA 3QUQA 1GL9B 2FPIA 4NBVA 1YNSA 3SQWA 1M34E 3E8SA 3B1XA 2W0MA 1KYZA 4H1TA 3UJCA 3TI7A 1DKLA 4WEQA 3HB5X 1UBNA 1WHTA 1EGVB 5CDGA 3EPPA 1L5HA 4P2BA 1KJZA 4U2KA 3VI3B 1FLNA 1U9CA 3LUPA 4FD3A 4P81A 4FOOA 1SULA 1Q0RA 2GYYA 2Q2OA 1DDGA 3CW9A 2Q2WA 1KO1A 4WY2A 4Z8XA 4J3FA 4B47A 1FEZA 3L1UA 4I2NA 1KGSA 3AEKA 2C94A 2C3MA 1OPRA 3RREA 1DEHA 3UFXB 2PX4A 3PQ8A 4G9EA 4HSEA 1DTWB 4UQPA 1R5NA 1SCJA 1UAYA 5CT8A 4B3RB 3GJSA 2L0XA 4GQAA 4QDTA 1AGRA 2XV1A 4GXRA 3ZTTA 2RGRA 1M6VA 3G9UA 1DV2A 2H2DA 2OEPA 2EKZA 2LTAA 3FFTA 3LPMA 4U9IS 3ZJVA 4E5UA 4JI4B 4MVJH 4LGMA 3I6YA 3KYCA 1W4LA 4BFUA 3BHMA 4DNXA 3D3WB 4OJNA 1NY6A 5FWYB 5CA0B 2V74B 3VTFA 1XU4A 3LHSA 1V8OA 4IHJA 5H68A 2X0DA 4K3VA 1EJ2A 1Q3KA 1U7XA 3HU3A 3QEMA 1QKIA 2PPLA 2XQFA 1O9HA 5EZQA 1Y63A 1E9VA 4C0QC 1V11B 1MNQA 3KAJA 5K5EA 2ZGVA 3JD3A 1SKBA 2Q28A 3COYA 3T52A 3QU7A 4B7XA 5JAMA 2MTBA 3M6MD 4RJKA 5KNLA 2D0IA 2WYHA 3K6KA 3BRSA 4MRAA 3LS2A 4N6OA 3AVQA 1IBMB 3DE1X 3GMIA