1B1CA

Crystal structure of the fmn-binding domain of human cytochrome p450 reductase at 1.93a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
SSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the FMN-binding domain of human cytochrome P450 reductase at 1.93 A resolution.
pubmed rcsb
molecule keywords PROTEIN (NADPH-CYTOCHROME P450 REDUCTASE)
molecule tags Oxidoreductase
total genus 62
structure length 166
sequence length 166
ec nomenclature ec 1.6.2.4: NADPH--hemoprotein reductase.
pdb deposition date 1998-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b1cA00
3GFQA 2W5UA 5B3KA 4ZVLA 1NNI1 1FLVA 1RTTA 4DIKA 1SG0A 5LBTA 2XOEA 1YCFA 3N3AC 2FOXA 3OX2A 2FX2A 3ESZA 1XYVA 3NHSA 3QE2A 1D03A 2ARKA 1QHEA 3FJOA 5NLLA 1FLAA 4S24A 1B1CA 2AMJA 3GFSA 5EAIA 6NULA 1D04A 5EMNA 1VMEA 2FZVA 1BVYF 1CZLA 3NLLA 2BMVA 2A5LA 1FLDA 4Y7CA 2BPOA 3OJXA 2FVXA 2N1MA 4M0CA 3HA2A 5F12A 4NLLA 4LTDA 2QX8A 4YAFA 3KAPA 3W7AA 3QFCA 4C76A 1ZX1A 3NHJA 2KLBA 1AKTA 1FLNA 1QRDA 2F1OA 3W79A 5F4BA 1J9EA 1TIKA 1SQSA 2XODA 3JSXA 1YOBA 3ES9A 1ZWKA 3W77A 1CZHA 3FVWA 2FLVA 3SVLA 3LCMA 2QX9A 2HNAA 2Z98A 3NHKA 4GI5A 5LBUA 5TGZA 5BUCA 1RLJA 2Z9CA 1AG9A 2V5VA 1YRHA 1QBGA 2MTBA 3B6KA 2OHIA 2QX6A 2RG1A 1XI2A 1DXQA 1KBOA 4CF6A 3NHFA 2ZKIA 5FA6A 3GFRA 1X77A 1TLLA 3N3BC 3EYWA 3ESXA 3F6RA 3KLBA 5F51A 1AMOA 3EDOA 1XYYA 1QR2A 4ZVKA 3FNIA 4C0XA 2WC1A 2HPVA 2R96A 2FCRA 3KEGA 1C7FA 4D02A 1I1OA 4N9QA 5EA2A 4YALA 3TEMA 3K1YA 3ESYA 1DX9A 4R81A 1T0IA 1YCHA 2X2OA 4F8YA 4QOJA 3B6IA 2QMZA 4GR9A 2MT9A 4GQIA 3K20A 4FGLA 2QR2A 5ULLA 1AKRA 4J8PA 5JROA 3KAQA 4HS4A 4Y9UA 4FGKA 3QFRA 3G5MA 2FDXA 3OX3A 3P0RA 2B3DA 4QOIA 4FX2A 5NULA 3R6WA 1KBQA 3NHUA 1RLIA 4FGJA 4QOGA 4NULA 1C7EA 4ZVMA 4YAUA 1YKGA 3FW1A 4Y9RA 2OYSA 1J8QA 4YQEA 1FTGA 4H2DA 3UXEA 4LTNA 1AKUA 1YDGA 5FUQA 3F90A 1T5BA 3W78A 4XDHA 1J9ZA 1XT6A 3OWHA 2QWXA 5LLDA 5LMCA 1OBVA 4ICIA 3B6MA 3ZHOA 2OHJA 3LT5A 1OFVA 4CETA 4DILA 4QOHA 2Q62A 1F4PA 3N39C 3OWXA 4QOEA 1JA1A 3HR4A 1CZOA 2MWMA 3OJWA 4U7FA 1YCGA 2X2PA 2OHHA 3U7IA 4OXXA 2QX4A 1E5DA 4QOFA 3TZBA 1FX1A 4QODA 2QMYA 3OVMA 1RCFA 1AHNA 4LA4A 1GG5A 4BMOB 4XDGA 2Q9UA 1J9GA 2FAXA 2BZSA 3UXHA 1AKVA 3F6SA 4YAWA 4DY4A 3NFRA 1JA0A 3GAMA 1WSWA 5LJLA 4ESEA 1H66A 3NHYA 2M6SA 4PTYA 4U7HA 4PTZA 3FX2A 5LJIA 1V4BA 1AKWA 4HEQA 2BF4A 1DXOA 5FX2A 3U7RA 1ZWLA 4ZVNA 3D7NA 4LTMA 3O2NA 2Z9DA 4PU0A 4YAOA 3TE7A 2V5UA 1FVXA 4H6PA 2Z9BA 2M6RA 5A4KA 3O73A 1AKQA 1OBOA 3NHWA 2FZ5A 4LAFA 1CZNA 4N65A 3OX1A 3NHLA 4N82A 1BU5A 3S2YA 2MOKA 1WSBA 1AZLA 2D5IA 1H69A 3B6JA 3L9WA 1CZKA 3L9XA 1CZUA 1CZRA 3F2VA 2BN4A 4C0WA 2V9CA 3NHRA 5B3LA 3HLYA 3NHPA 1FUEA 2R97A 2HNBA 1D4AA 4C14A 4BMPB 2GSWA 5LVAA 4U7GA 2KQUA 3RPEA
chains in the Genus database with same CATH superfamily
2WMYA 4N5HX 3JQ9C 4C3VA 2JK0A 1TF2A 4W8HA 1E6WA 1TM1E 2OESA 1XTZA 2ZT6A 4Y2UA 2C2YA 3VYTB 4YJFB 3OMLA 3VR6A 1R0XA 3E48A 4LXHA 3AIIA 7ADHA 2C2HA 2PZLA 4WA7A 2EC5A 4X00A 4HHEA 4MNTA 2FOXA 2EF0A 1JKXA 2AXEA 3UMYA 3AEKA 4NONA 5JS2A 1JKJA 2R25B 3HH8A 3FWZA 4G0XA 3CLRD 2CBXA 3TN7A 3BB4A 3SNKA 1TD1A 3P2OA 2OGSA 1OHHD 1Y7HA 5LBIA 2FSVC 3C3PA 5CYGA 1GAXA 3AXTA 4JDUA 5EY5B 2VHQA 1IG3A 1QHEA 3GGGA 2GJ9A 2ZTSA 1II0A 1YDWA 1AS0A 2B1IA 5LXTF 1RS0A 3MXOA 1Q19A 1REQA 3RS0A 4D8WA 4AKIA 4LPKA 1YWGO 2A4KA 1XTJA 5ALDA 3TQFA 5CB0A 3ADDA 5JV5A 2HU7A 5E4TA 4YBRA 3WMXA 3WNBA 4PZCA 1QZUA 2LE0A 3FF4A 2OZLA 3T7TA 1IWPB 3HWWA 3DG9A 1M0SA 3TTWA 1IZZA 2VPTA 5EMHA 2HQSA 5F1PA 4HEHA 4HGOA 1YS9A 4JOSA 3DC2A 1SXJA 3GPDG 3PGMA 3RYIB 5JMTA 3BGIA 1U8FO 1X8LA 1Q11A 2HGZA 5ELLA 5H4GA 4NC9A 2DJ5A 3VR5D 1I6WA 1VOTA 1OWPA 2QV7A 3IEXA 4F3KA 3TW6A 1KMMA 2C2BA 5GM2A 4B17A 5CB4A 3S1SA 2WDZA 2GOYA 4TV9B 2I2WA 3U5ZB 2QYSA 2FR8C 4M0CA 3CLHA 4EGAA 3PJEA 3O94A 2BMAA 4DNPA 1ZC4A 2PS1A 4AZTA 5HE8A 2VXBA 1FMLA 8GPBA 4Q9KA 3NASA 3QIAA 2GERA 3GUZA 3LC0A 1N5RA 4UVEA 1KEEA 5IJXA 3WFZA 1TPYA 3OZVA 1L2TA 1P5HA 1ZH8A 2AG6A 2BR5A 1SQ0A 3R7WB 5CYPA 4ZT7A 2J41A 2C0CA 2DFNA 3FUXA 3N2GB 4M9UA 4UXHA 4NOMA 1AK1A 3IPLA 1X7YB 1IBLB 1G55A 1Z25A 1C7QA 5IKXA 1GKIA 2F9MA 4ISCA 1IMJA 3ETGA 2V8OA 2QM7A 1QO0D 3ZGXA 5A4IS 3AHCA 1QHSA 5JO0A 3ZZTA 2PX2A 4OATA 4BFZA 1XEAA 3MERA 5EIOA 5EXDA 1KDZA 2ZE8A 4B34A 1XLUA 4KO8A 2R68A 2ZUSA 2P1DA 5KVVA 4PPQA 2I1LA 4PC3A 3PPIA 2RHMA 3D3WB 3QPAA 1BQ4A 4RDHA 3DDUA 3EQ7A 4H1UA 4J6FA 2HNAA 5KJ6A 2XGGA 5AICA 2I7XA 2Z58A 3IKJA 1C0PA 5GV7A 1HDCA 2NPFA 1XQ6A 4ZYYA 2PJDA 3LKZA 2OMKA 3RV3A 5FP0A 1DX6A 2BFCB 2P3QA 4NEQA 3CBGA 2AB0A 5EKDA 2WK1A 1E7YA 3EVFA 2Q6OA 2CNKA 1ZK0A 2Q2WA 2BM0A 1VFPA 2V4ZA 3LK7A 4MHOA 4MI6A 4L8VA 1VYVA 3MQ4A 3TF5A 3E5RA 1DE0A 3DAPA 5EHQA 4KR3A 2O8FB 2NN3C 3MT7A 5JI2E 2WWWA 4KYVA 2C9DA 3V4LA 4EY4A 3FROA 1Q12A 1CRLA 1OIVA 4KLZA 4MJXA 5I4CA 2ZETA 2HHHB 1MH1A 2OHIA 3EIXA 3PQCA 4CM6A 3FOWA 3IB3A 2BZ0A 5AJXA 4HC4A 2HO5A 2QSUA 4D8UA 3AHEA 3KOOA 2HK9A 3NGLA 4BOYA 2NO0A 1UPTA 1WSDA 4P54A 3PQDA 4QREA 1OB2A 1KI4A 2I3ZA 3GFRA 3AVVA 3A31A 4CLOB 3DMNA 5K0EA 1TLLA 1DAFA 3U61B 1W46A 5AM4A 4C4ZA 2GAOA 2NQ2C 4WZBA 1V9CA 2BDTA 4DQDA 3KLBA 5JSQA 3UHOA 1LJLA 1E94E 1MJGM 3X2SA 3HR8A 1X1AA 2WUEA 1K97A 3EFHA 2UYQA 4UAUA 1IBRA 4MGZR 4HYTA 4GS5A 4NYMR 4N54A 2RIRA 3ZI0A 1A2QA 2SKEA 2FKNA 4DUYB 3ENVA 2OZVA 4F4DA 3U16A 3WGZA 3AL0C 1WUTA 2PUTA 3QYFA 4R54A 4S1VA 5JHGB 3DOJA 5H81A 3ABSB 4C0XA 1CDDA 5IVHA 2FRDC 4G1FA 2OP0A 4RBNA 3QVVA 4S0ZA 2E4AA 4LF9B 2HSEA 4GMHA 4PSUA 3PP8A 4JGGA 5FNVB 3DMGA 1C7FA 1LQ2A 2DFPA 3EEFA 3LGSA 4KKVA 3UB3A 3UJ3X 1DDGA 4DA9A 3F73A 1Q21A 2JW5A 5E6UB 1OB5A 3JTEA 1HDYA 5FL7A 3HCAA 1MAHA 2Y1XA 2A57A 2O2XA 4D9HA 2WLTA 4X54A 4W5RA 4LHEA 3G8YA 2BTQB 2QRLA 1NYTA 1KQOA 4YUVA 4LSWA 2VDOB 5AUOB 3TSAA 4HAVA 1DAIA 1MUUA 5ADUS 3E7WA 4CMHA 4XYEA 1WQ4A 5IC6A 4UUNA 1Y7LA 1SD5A 4TSFD 4MICA 4BNMA 1TAQA 4NNJA 2O0MA 1A7KA 1D7OA 3QKIA 3WO1A 2BKXA 1UC9A 4E51A 4YJ3B 2WQ7A 1V5WA 3QLUA 4MI1A 5DI3B 2EL9A 2HF7A 1OPXA 4NABA 4ZHQF 1GFSA 4Q00A 2GN9A 2WMDA 1J06A 4YJGA 1SCIA 4J43A 4FYWA 4AT1A 3N2KB 1GQ2A 3V42A 1EGVB 3UQZA 2BEVA 5KYXB 3ABOB 3RFTA 3CEMA 5EE9A 2B36A 4H7KA 3SZLA 4DUPA 1Z4QA 2CLLB 2NTEA 2Q4DA 3GRZA 4Y2VA 1PGNA 4CCYB 2PUEA 4HADA 1Y37A 4JT9A 4DIEA 3I04M 2IV3A 3RK1A 4Z9AA 2WZCA 4EG1A 1JZQA 2AW3A 4N7BA 3BB1A 1ZH6A 3BA6A 4JUCA 5IFLA 2WP0A 1BEEA 1PNVA 4G67A 4Q0MA 2NTVA 1FUKA 1OX6A 3OICA 1NY6A 3TFOA 2WFLB 5DK6A 1DPGA 4Z51A 4KTVE 2BKAA 2LV8A 3H4VA 5D5PA 4YO7A 4EMUA 3P96A 2CMDA 4BNXA 4EPTA 3AUSA 1PZHA 1ZMBA 2CBGA 1O77A 3K4HA 3A6GA 3NTOA 5MFPA 4L4SA 1EDBA 1I2CA 1U2DA 4L78A 2C57A 3VVBA 4H7EA 3ZHZA 3VJKA 4MP6A 5B1EA 2I55A 1Q1EA 1DQYA 2P69A 4EB6A 2HIMA 3PNVA 1N3LA 3I1IA 1YTUA 1FVFA 1MEJA 1DBPA 1KEWA 2EJWA 2AQ8A 4LZOA 3QVOA 4JYCA 1SO8A 5TQJA 1ZQ9A 4ML3A 4Z0NA 4P35A 4BLPA 3WQQA 5EERA 5J23A 1T9AA 2GZ3A 3GEIA 3I2KA 3LQQA 4IGEA 4C4SA 4CKXA 4KXNA 5DYYA 4G0WA 2OM6A 4HZUB 3F5QA 2FFAA 4YACA 4AWAA 1UMDA 3PXGA 1SR8A 2PFKA 4HAZA 1LDBA 3U4AA 1ZA2A 1M6VA 2GZ2A 1CUZA 2PKYX 4D9FA 3OWHA 4ZMSA 3LCCA 2J31A 5ALYA 4UC0A 2GO7A 2HUNA 1E4OA 3CA8A 3KEQA 4I5GA 5DH9A 2NZJA 1IZ7A 2DAPA 4N5IX 4CTNA 3A58B 4KNVA 1B3BA 1J0BA 4CI9A 3QZUA 2HQ1A 2ZWAA 2GM3A 1OJ7A 3I72A 1L4YA 1A50B 2IPMA 4RHUA 2WAOA 4CNQA 1YZ3A 3BGOS 3PNMA 1RKXA 3VRHA 3NJRA 4IKOA 2QRQA 5KIAA 1U8XX 1S2IA 3EH2A 2ZRFA 3EY4A 3M6IA 2WMNB 2HDHA 3JZDA 3EW9A 1F2UB 2XOXA 3F7TA 4FJ0A 4QXOA 1X80B 1LX6A 1OI3A 4NY1A 3A2LA 1EFHA 2ZJ0A 1NF9A 2BKLA 1P8JA 3FR7A 3KVVA 3PXDA 1L6IA 2A6PA 2FMHA 4JT8A 2CT8A 2B6HA 5D3KA 2FJUA 3NU1A 2VJCA 1OAKA 1ZH0A 3W6ZA 1J2UA 3L82B 4ENSA 4X62B 1NY5A 1XXHE 1Z3CA 2FV8A 2HMYB 5H9VA 3DAGA 4RYLA 4CEHA 3BTVA 3DVAB 1VHDA 7MHTA 4OUDA 3PCRB 2GK3A 1ZLYA 3IAEA 3DZKA 4DC0A 4E6EA 1KY5A 3AR9A 1E3SA 4BNYA 3L79A 1FTWA 1YMQA 1O94A 2GDJA 4AQDA 4YUAA 2RE8A 1JJAA 3QJYA 5TY0A 1K7CA 1QGZA 2H5JA 4F6LA 3QLTA 4AIRA 5EWMA 4UNIA 4WJKB 3D81A 4I50F 3L0PA 4RKRA 3QKSB 4KXFB 2H4FA 3RKSA 4FDMA 2N0SA 3EXIB 1OFUA 4UEKA 1E9RA 3QVJA 3GCDA 1L7OA 2OB1A 1BXKA 2O52A 1XRSB 3OEED 2JIZD 1G42A 4BZQA 1ZG3A 1ND6A 3OVMA 2HLDD 3MTQA 3EPRA 4PW0A 5DMHA 5A4AA 3KQQA 4KP7A 4MRMB 5F78A 1AY0A 3JSAA 3AMVA 3MT9A 3SI7A 3VO8A 4JP8A 2Q1UA 2Q5QA 2R4QA 3SZOA 5DHTA 3JQEA 4A0SA 2VFAA 2AZXA 5L3RA 4JEHA 2YW2A 4JR2A 2CXOA 3WYBA 3HZZA 4M8SA 4CF4A 5C7YA 2QLNA 2FEXA 4JMPA 4WV3A 4Y3UA 3OUZA 5JZMA 1ABEA 4E5YA 2ZREA 4PY2A 3WKDA 2IHUA 5KJFA 5JCJD 1WBBA 1LVGA 1CUVA 2YY5A 5AM2A 1W52X 3DBHB 5CGQB 1FDSA 3RC9A 2VI5A 4JZKA 3EGXA 4ND2A 2OHOA 1AK9A 4DT1B 2NTJA 2PT5A 4IQ8A 3JQGA 2INGX 1IHYA 3Q1KA 4FDAA 2WSMA 3O90A 1RM3A 2QD2A 2FG7C 1AKEA 4J1QA 1JIXA 3N07A 4FCVA 1C9YA 4ZALA 1MV8A 3HKEA 1N2GA 1XZGA 2YWCA 4MRPA 2X0NA 3F0TA 1A5TA 4XM2A 3EN0A 5JVDB 5K0FA 1EDZA 1LTKA 3U13A 1G6Q1 1EFCA 3KJGA 1IXYA 1V4BA 3SR0A 1BEZA 2BCGY 2HK6A 3CNEA 1PJ4A 4M38A 1T8PA 4EW2A 5ALVA 1JG1A 4L8YA 2QT0A 2F59A 4RGQA 5DTQA 3TZHA 2XW6A 3U7RA 3C6ZA 3WLJA 4DXHA 5JS7A 1P17A 4N3CA 4ZJPA 1SOMA 4R01A 4RKFA 4CODB 1Z3IX 3T95A 1SXHA 2WVGA 1ISHA 1DKPA 4NMMA 3O2NA 5DBEX 2Z9DA 3GZJA 3R0IA 4YAOA 1JJBA 3K9QO 2R1TB 4CHGA 2PCLA 1IY1A 5J5VA 3VHXA 3GX1A 3F5DA 3QV2A 1B7GO 3IS3A 1CD5A 3FPCA 5CPFA 3GP5A 3FMGA 4G4GA 5FR1A 1KEPA 3LAWA 2OZKA 3V4PB 3BPSA 4AYTA 3KQVA 1SCJA 5JBNA 4OO3A 3ZWXA 2LD4A 1MC4A 2GN1A 3TWOA 1RE1A 2B78A 4ZMBA 2IYYA 4NNPA 5E4JA 1B0ZA 4LAFA 2FUKA 2XCLA 5FUMA 2OO3A 3H2BA 1PJAA 4E70A 1GDTA 4NBLA 4RJ2A 3TSZA 4JQZA 4HMPA 4NZYA 1MC5A 1UKZA 1OOEA 2Z3VA 3L7NA 2IV7A 4E09A 3V4VB 2IEAA 3HXLA 1TO6A 2C4UA 4CKCA 3QUTA 1T4DA 1IJBA 3PLAE 1N3YA 1GGNA 1VJDA 4AN4A 4ND5A 1E2KA 4A8TA 3PUIA 4Q9HA 4A9AA 3OM1A 2PKWA 4RD3A 3GLRA 4IINA 1MO4A 4OJTA 3P0HA 4EKEA 2CDNA 5H9WA 4F9GA 2FY8A 4DV6B 1BA3A 2ATVA 2WP8J 2NU9B 2HK7A 3ZXYA 2WZBA 4PN3A 3BK7A 2GHQA 1WHTA 3N6XA 3AZQA 4YT8A 2HY7A 1R16A 3EDMA 2ET6A 2VYND 4MW4A 2PJUA 1NVEA 4M1MA 3HMKA 4QNNA 4Z1OA 5ABPA 2JEOA 4BLUA 1XRQA 4I66A 4TV9F 3CNNA 3D5QA 1HMYA 2ZBFA 1PWEA 3GRFA 1HDZA 2ST1A 2PQMA 4MWTA 1P3JA 2BH2A 4ZT4A 5J2UA 1IUPA 4QBFA 2Z1NA 2BKEA 2ID8A 3PF9A 2CLEB 4K9MA 4UNNA 3OFJA 4Y6RA 5FOTA 4J90A 3VDNB 4MQFB 3RGGA 4O4IB 3SFZA 1IHOA 1RHRA 1ZM3A 2JD2A 3BD6A 4UCWA 4YIKA 4C14A 1ZAYA 2O8BA 4H3VA 1TVKA 2VSNA 2AUTA 3D2BA 4OXRA 2BYTA 3E1SA 2XUQA 4OEHA 1NMZA 2CLSA 2LIPA 1KAHA 3DV0B 4YRTA 3RRMA 1AGYA 5JPIA 3OY2A 4R31A 2XHEA 2HA0A 4QFMA 5ILOA 4JR0A 2OILA 3JYNA 5TPWB 3H9EO 3HJCA 4NAHA 1PT5A 1B8PA 1EP1B 1NMYA 1L4EA 2VUSA 1Z18A 4B6FA 4LY3A 1ICIA 6REQA 4X5OA 2GFHA 5JATA 2VRWA 3GJ0A 2FQQA 2LP4Y 3DPSA 1E1YA 2I3GA 4GE3A 3LUHA 2IXEA 1TCAA 4PF1A 4RA9B 1JLMA 4JYZA 3FLEA 4ZI7B 3VSDA 4UD6A 3OQIA 4CQLB 1CQIA 2DHCA 5EINA 4XX0B 3CRVA 3I0NA 3QWBA 5E6RB 2AYXA 2IHZA 5EWJB 4EYQA 4XWWA 4K2HA 3QU5A 1DG3A 2VPQA 4J7XA 1O6ZA 1QFXA 1MV5A 1P91A 3GUYA 2WQ6A 4GBGA 1XP8A 4JUDX 1D03A 4PYRA 2G71A 2M1XA 1UZMA 4IZIA 1CNMA 1IL0A 3ZW8A 4ZRNA 4BVAA 3ZD7A 1M1ZA 1K4KA 2VN8A 3CX3A 3PGLA 4QUAA 3QU9A 3CLTC 5KOHA 5KKNB 1HETA 4GFDA 1MNQA 4IFTA 5JNVA 2D3WA 3EEIA 2IS1A 1SFRA 1D04A 2R1VB 3ANLA 3IOCA 4YMVA 1Q91A 1CRZA 1CR1A 1QVRA 2XE8A 1PT6A 2V98A 2DUJA 1AHIA 4KJZA 3R1IA 4DIBA 4B71A 4MR7B 3PCTA 1P1HA 2D4HA 3AKCA 1NM5C 1CZLA 3NLLA 1UPAA 3BF7A 4YV1A 1Y6ZA 5EQFA 1AZSC 4DR4B 3VA7A 3LC2O 3JARB 3PQ3A 5HXAA 1ORIA 1T5DX 1ZOPA 4RD2A 2DEUA 1KR5A 1SD1A 3DHWC 2DVMA 1SY7A 3QXGA 4IWXA 4G89A 3PX7A 4EW6A 1GZ5A 3VUEA 3SSNA 2AC2A 1B8UA 3LA8A 5AP9A 3ZQ6A 4FE3A 3RFVA 4H6XA 3NIDB 4HYQA 3VR5A 1G4AE 4EKYA 5LP1A 2QDKA 3ZI7A 2BCJQ 1GL7A 1VCNA 4GI3A 5JNSA 3AEKB 1JKJB 4GKVA 4WH0A 3F9CA 2PU7A 3TZQA 4CLRA 1KYVA 4RFVA 1MRNA 1U1IA 3FH0A 4ABYA 4KSBA 2D2FA 1QH1A 1Z4IA 2KI5A 3TPZA 2LTAA 4X1KA 2BW0A 4J4HA 1JT2A 3KKOA 4K9QA 4ZCTA 3KLMX 3DBIA 4CIBA 2M98A 3OJCA 4YAJA 3BHJA 5THXA 2PWYA 1ZZEA 1TTPB 5TV2A 1U8ZA 2XX3A 3TL2A 4OGFA 2Q0SA 4KQIA 4QBGB 3P9XA 2PUCA 1G6KA 1MQ8B 3L06A 1MGPA 1KHHA 1SXGA 3WADA 4EY5A 4JI0B 1BHQ1 1ESZA 1KO7A 4V3BA 2OZLB 2YRXA 1U1GA 5HQTA 3SVLA 1NQ5A 3BIOA 3LRXA 4PX2A 4IRXA 3GVHA 9MHTA 1N1MA 3CKKA 1L4GA 4LHZA 3MRXA 1SXJB 1ISFA 1K06A 1K2WA 1SVKA 4ZYTA 2N47A 3R6GA 1PEYA 5FR2A 1EXNA 4TMVA 3TTUA 3ZVRA 5JSFA 1GKLA 1U7UA 1WY7A 4GF5A 4KQ2A 1IVSA 3WLEA 3AY3A 3OTWA 1IHXA 2Q6LA 3FM9A 4EYSA 4HDCA 5CG1A 4JBNA 3ILSA 1LWOA 1G4HA 3E9NA 4MB6A 4WKNA 1U3TA 2R6HA 4NH4A 1WU8A 2HQOA 2G3YA 4P82A 4RK5A 3WKCA 2GWRA 1IJKA 4RLSA 2QX6A 2Y92A 3OOSA 1ZS9A 4H4EA 4NFSA 3OQHA 4PLGA 4Y98A 1BJTA 2Q21A 3P9IA 5FA5A 4BZZA 3O03A 4LE2A 1UBEA 2JK1A 5FOUA 3HDQA 1M2JA 2VOJA 221PA 5JBQA 4OHBA 2VVTA 1XXHA 3SVZA 5BN3B 2ZKIA 1MLDA 1IK6A 1RKQA 4JYMA 1E3EA 3G1UA 1KVTA 5C1IA 1JGTA 1HT1E 3MTAA 1LSJA 5B53A 2CLDX 5C4MA 4CL2A 4TYQA 4RGYA 3M8KA 3B7GA 1DXYA 3J7TA 5TEWA 2CV0A 2WTBA 5TIIA 1X14A 1J0XO 3DO6A 2GZSA 2F8MA 4JROA 2WJHA 1FJXA 2G67A 4HQKA 1IHDA 2JI9A 1DBWA 1HY3A 2R87A 3KEOA 1A9XA 3SGLA 2CJFA 3WIEA 4EY6A 4LUCA 3K9NA 4B4OA 3PKZA 2HYDA 1W94A 5AIAA 2O3SA 3VR6H 4HGQA 4CT0A 2I62A 2ZJ6A 4EJ2A 2FWIA 1CULC 1SNYA 1H85A 4IOKA 4OK5A 4PRZA 5CW1A 5IAGA 5IBQA 4JI7B 2X6TA 2Z2XA 4Q1EA 3HM2A 5J1SB 2J3KA 5KTYA 1JN0A 1OV6A 2AOXA 3AJ9A 2D13A 5AOBA 5DNCA 1D9XA 2WW8A 4OQYA 1I2MA 5AW6A 4BECA 1QHXA 2H4JA 5ICEA 2MMGA 4GUDA 2YICA 1LTQA 1J1ZA 1Y4SA 5ARBA 3PQ8A 3TINA 3IOBA 1ZNYA 3BFKA 2V96A 1JFSA 4P3NA 3IEVA 3D8NA 1MAVA 2HSJA 4HFRA 3VOAA 4QFDA 2IYNA 2P0AA 3TNLA 3OD5A 1DKMA 2OK7A 5DIZA 3GDWA 4D57A 3AFOA 3OT5A 5G0TA 2ZR7A 5FI3A 2PPVA 2PQ2A 4EF5A 4YRSA 2YIVX 4MEJA 3G5LA 2JJ8A 1SVNA 1W7AA 4X3PA 3THRA 3UB2A 1YQDA 1FNNA 2G4CA 3NP7A 3VTZA 4RM3A 1CVIA 1YMVA 4DMFA 4JZYA 1TT5B 2BGGA 4Y1RB 3K9FC 4TSFA 2DERA 1HR0B 4KMOA 5IU6A 4CG1A 1XTTA 1RQXA 5EZ5A 3R9IA 5B1DA 1VB3A 2GCNA 4HEA1 4AFNA 4B79A 1GZ3A 3GIDA 2WJGA 2RB4A 3RSFA 4B2PA 1B8NA 3FNBA 3JV7A 4D9JA 4XWTA 4R8LA 5KNDA 3ZLJA 2PZMA 4XWKA 1NXTA 1QIFA 1AJEA 1N1EA 3UUEA 4TWRA 3UJAA 3WGKA 1XVUA 1I9CA 1RBMA 2EJVA 3B8EA 4G07A 5KTMA 5C8ZA 1GUBA 1J0DA 1PR2A 3AEUA 1TYDE 1Z06A 2CMGA 3N0XA 4QTZA 4MWDA 4E6PA 1ZW6A 2V9PA 3EXG1 4FP9A 5EMJA 1ECCA 2VAMA 5TNXA 4EHFA 3EPKA 4PTLA 3NHUA 3DDCA 2JLZA 2VK8A 3R40A 4M60A 1CW2B 1MFPA 1YS1X 3DDNA 2EKQA 3GEDA 5EXPA 1FRVA 2NZWA 1E2HA 4FGJA 4HATA 4D3ZA 3ET4A 2HRZA 1Y4DE 4NULA 4JL5A 3TEJA 4YT2A 2BGIA 2I34A 5T57A 5AK3A 3FFWA 1C2YA 1NATA 1WQ3A 3PYXA 3E3AA 2Z8ZA 3HFRA 4M87A 2UAGA 3QUBA 3JR7A 4JSTA 4BNZA 4YAUA 2NUPA 3BTOA 3MWFA 3D6MA 3C74A 2VQEB 3QITA 4MW0A 1M0WA 5EJ4A 3R8CA 3CVYA 4YJGB 1UT5A 4PIPA 2O59A 4Q7MB 1GQRA 4PFSA 1NYLA 1ZCZA 1WTCA 2PZFA 3CJRA 1YQTA 5C4GB 2VHJA 2BEVB 2VJBA 4GXRA 1KYTA 3DMFA 6Q21A 1P2BA 4PZEA 5DMXA 1XZNA 1UOPA 2EHDA 3E0QA 4TT3D 3EAQA 1T5BA 4BKUA 4E31A 3VR4A 4C4OA 3FOAA 1J9ZA 5EKUA 5IT5A 2EX4A 3H99A 3K96A 3R0ZA 1XMOB 2QGFA 3WMEA 3UOWA 4FLFA 2C0QA 1XT6A 3QW4B 2P2LA 4BAZA 4P8RA 4WFJA 5KNBA 4IICA 3KR9A 3SJBA 5CURA 1M1UA 3JVVA 3P9CA 1UANA 1I7DA 3VU8A 4EUNA 2X1HA 1K68A 1I01A 2VKTA 4IV8A 2WTXA 5F5XA 4ICIA 4K9DA 3AERA 4NOLA 2FOIA 2A9JA 1YR2A 1XP5A 3FCXA 3O9VA 4WFIA 3ZHOA 4LF4B 1RIFA 2FWNA 4Y2RA 3CLSC 4G3XA 5DASA 3B13B 4ACAA 5KYYB 1H2AS 3LXUX 3FCUB 3G2KA 2B69A 2V9ZA 4D74A 3DZFA 3R3XA 2XYVA 4MZXA 4AF7A 5HPYB 3K09A 3SQXA 4TRJA 4CT4B 3AOEC 1L1RA 2OBMA 4RACA 2OTCA 1VDZA 1N6KA 2F4NA 2R66A 1MOQA 4FQ8A 3C1TA 2A92A 2JJMA 4EB6B 2Z0MA 2J6CA 3LT0A 2QE7A 4JHLA 2QP4A 4RMHA 2WICA 4DMUB 4WLEA 3ZWCA 1KAQA 1M6YA 2X4LA 4KFTA 2IRWA 4WKOA 2R11A 3RF6A 3EWNA 3I76A 4G8CA 4B3BA 3MN1A 4RK7A 5DYTA 1EUCA 1I94B 1UMDB 3KTDA 3HCDA 3LL4A 1KH1A 2XB4A 3LUFA 3ZZ1A 1M6VB 1PDWA 2EKLA 2VUTA 4XD7D 3B53X 5BMVF 4QTYA 1DJLA 1NJGA 2V8BA 2VL7A 4Z7JA 4L27A 3BQ9A 2Y0DA 1NAHA 1RR6A 3HN7A 1U5BA 4ILEA 2F43B 4IHJA 3VQTA 2BGUA 1NIJA 1ZIXA 3RS2A 1T8WA 2BGLA 2Y2VA 2I33A 4RQUA 4WBNA 4JXKA 3DMRA 4GRIA 4QG3A 1J24A 2QTRA 3RVRA 4UDXX 1EK6A 4OIFA 2W2NA 3OF5A 3QX8A 4RQTA 5G3ZA 5G4KA 4BJHB 4MKIA 1OH8A 3TLGA 5ADHA 2NUAA 4GP9A 1S01A 2IZ6A 1N36B 1M2EA 2QTWB 2R6FA 3CH4B 3ELWA 3HR7A 1J39A 1OH6A 4MHTA 2HRDA 2QSJA 3SEZA 4DCVA 3P45A 3OZSA 4CZ2A 5DYGA 4TM7A 3LM8A 4G1BA 5F64A 5KHAA 3RDPA 4EGJA 3EPJA 2H1RA 2Y1FA 3GGDA 4KSYA 2A9KA 1WW8A 1JIUA 2I1WA 4TT8A 4CNBA 4Q24A 1RHKA 3H2YA 3WGUA 4DJEC 3GJXC 2FW1A 2NP7A 3KTFA 4LJ5A 4OXKA 2AZDA 4DY4A 2FSPA 3NFRA 4OUDB 5WRFA 4RTNA 2O05A 1KQ3A 2HKIA 3PHJA 4N03A 3SN6A 3TL6A 1FDWA 1P74A 2PE5A 4PG7A 5EIXA 1H66A 1NUSA 4RMIA 5JXWA 5JCJA 3COWA 3M5CA 3UPTA 1JHMA 3RYHA 3UOGA 3C6QA 1EVLA 1J49A 3CRMA 4OG2A 4ZQGA 1JR3D 3WYEA 5EWMB 5AI0A 4KFRA 2AXQA 1NFFA 2GKOA 2NO4A 1D0SA 1WKCA 3DPIA 4LN1A 5C5IA 4EPVA 1ZGCA 4I4TB 1ATIA 1W44A 3I83A 1IHPA 4YCDA 2C1EA 3G2QA 4MV8A 4OK3A 3WWYA 3OX4A 1EUQA 1A8QA 2RJ3A 4DLVA 4IIDA 2ZRAA 3JWPA 1VKRA 3QPCA 3W9UA 3REQA 1FYVA 4K0RA 5EZQA 4BQFA 1N0UA 1ZSYA 3MGCA 4YONB 1TZCA 1FVXA 1W5AA 4MRRA 3CHYA 1VHWA 1G18A 3PFCA 2P1RA 3BWYA 5D6NA 4PGFA 4B75A 3OUUA 3M3PA 3WLOA 2UZ3A 5AKHA 5BSKA 3MZ0A 4I3HA 3WIDA 3AR3A 2W2TA 3O73A 3Q87B 2QJWA 3P9PA 4IJKA 3LYUA 1NE2A 3BAZA 4KOAA 1AIPA 1Q0SA 1XTIA 3ZK9A 2FZ5A 2WJAA 1NMSA 3CJQA 3RVSA 5LB4A 2HREA 1QTIA 2TECE 4HVAA 1CLUA 5HEKA 1BRMA 4LY0A 2EBFX 3QE4A 4P0QB 1Q5PA 3D7SA 5E1MA 2QXUA 1Z0SA 3EGXB 1GXSA 4F2WA 3I8XA 1SEVA 3MLAA 1HEIA 5ESRA 4JEIA 4FWTA 5REQA 3E9YA 3B3QA 4ND8A 1BJKA 2EX0A 3OX1A 2XAAA 3N7UA 3PVSA 3I32A 4O59O 4TSKA 4WOCA 1PE0A 4JU8A 4JC0A 2XCUA 4RESA 4I2VA 2XTMA 4LOIA 3QGMA 3GT7A 3HKEB 1VYHA 3NT2A 4DE5A 5EJGA 4YQYA 2WM8A 5HBGA 1JG6A 5FTKA 3RM3A 3WNCA 3HCPA 3FMPB 1KEVA 2QJTA 5HILA 1T4GA 4Q3NA 1LSUA 3N2EA 4FW8A 2YJTD 4S0XA 3GLFB 2X22A 4V0RA 2LVBA 1ISJA 3VZCA 1R0BA 4J0GA 3S27A 5J9FA 2WUFA 2GPNA 4OFXA 1RYHA 4XIFA 3ESDA 3VAAA 1JIQA 4YDRA 2GJKA 4B48A 4DQUA 2VDLB 2Y76A 4WLNA 1T9KA 1DAKA 2YXBA 1XDUA 2XDYA 2A94A 3OZWA 4LZPA 3OFVA 3TCNA 4BBAA 4WASA 2F1IA 3HN2A 4TN5A 4KQ1A 4TTJA 3TBFA 4ACBA 1QQ7A 2D7DA 1SOVA 2EKBA 4K9RA 1X39A 1Z4KA 2ZI4A 4YP1A 4AZ0A 4YRZA 4AXBA 1ENZA 1HKUA 1ULSA 2PX5A 3KB2A 5F3DA 1Y33E 2XT9A 2NAPA 2R97A 2VYNA 3UMVA 3TVTA 1P0MA 2PMFA 3TZKA 5JAZA 3UFXA 1R8SA 1PNQA 1ODJA 3EOZA 4HJXA 1LPBB 2XIJA 1YIDA 2B99A 5KC8A 1A2OA 5JJKA 2JCVA 5LQCA 2IE0A 1AN9A 1Z6XA 2CLIB 4L07A 1IBKB 3LF1A 1MTZA 1U7OA 3W3AH 2GZ1A 5D3MA 3KUDA 5JW6A 1SN7A 1VE7A 1RYMA 1C3OB 2VNSA 1OU0A 2Z57A 4GHWA 4IMRA 4XI9A 3UAWA 4CKCB 4JLMA 2B2CA 4DV1B 1F0KA 1SBYA 4D41A 1Y1PA 4GYJA 4W9RA 3SMQA 4OFBA 1AKMA 4DR3B 2IELA 4OHFA 3B2EA 4UM9D 3KOZA 4EHKA 1DJNA 1NC3A 3EFOA 3FNFA 3ZUGA 1FFEA 4B3SB 1SURA 4YH1A 1ZMRA 4G5OA 4NPAA 1ZVKA 4JUFA 3BRCA 5TX7A 1MJFA 1T91A 1A76A 1WHTB 4YI3A 3AKEA 2IHYA 2KLHA 4QBKA 3DKKA 3C7KA 3OZGA 1R4AA 4D81A 4ZYUA 1R4NA 1TYAE 2P90A 3VDRA 4FM9A 1GYQA 4CDGA 4ZDJA 5CB4F 5M04A 1AB6A 3WP1B 3ME5A 3VGJA 2G5PA 5I9LA 3H87A 4HNGA 1G8KA 3RYFA 4NCAA 3OLCX 2VDJA 3K1JA 1U2GA 5SICE 3TO5A 3CNBA 2JBHA 3H83A 4KN8A 2Q46A 1HQKA 5G0VA 3RF7A 4B80A 3PXUA 4B85A 2WWYA 3IL2A 1QVZA 2JD0A 1TVKB 1I7LA 2XTJA 2NZ8A 3GB9A 4LZNA 4AMBA 4QVIA 4YDSA 3L84A 4DSAA 1LDMA 1BE6A 1W2GA 1NRJB 2UUOA 3ONFA 4HPXB 3V7UA 3ZKAA 3T3IA 4AF8A 1XKTA 2QSYA 1XA3A 4IDPA 4RVSA 4YVFA 5CLHA 2BSXA 5JDCC 4US1R 2BPOA 4E1AA 4LYDA 1Z0KA 2G0AA 2OK8A 1IY9A 4B6JA 4DB4A 2QE6A 2NYUA 3MWJA 2IGBA 1EFUA 1ZIYA 2P9HA 4RPKA 4X64B 4BO2A 2XRMA 4N5MA 2XMGA 3R3UA 4FYMA 1D2AA 1TMKA 4TQUS 3CFYA 3DPUA 4IOMA 4EWLA 1DEOA 2AD5A 3OHMA 2IP4A 4Y67A 4YAKA 1FFBA 2G82A 2VQ3A 3OZFA 3Q5EA 5HWSA 1OLOA 3FUTA 2Q4OA 2Z30A 4EATA 3DDHA 4WZ6A 1RCTE 2PKEA 1YR8A 4TTTS 1PT8A 1JFRA 2JI8A 4WK4B 4C76A 4QZVA 2HMUA 1AKTA 3WJ7A 1JSRA 1SK8A 1YGPA 1WXHA 1Z6QA 2P6RA 4JJ6A 4ASUA 2TMDA 4C3ZA 5C8VA 2ZJ3A 3GRVA 3QFFA 3HSKA 5J2TA 1L3BA 5B57C 5K8JB 4LYEA 2E18A 2XDAA 3BDIA 3C87A 1QGAA 4AY3A 3UV3A 3RVQA 1JAIA 1JFVA 2C8JA 4M1KA 4C0SA 2Q5CA 3RJ9A 2ROQA 1QIJA 2IZ0A 3HE3A 3O82A 1JR3E 1TW2A 2NO6A 2YIJA 3FVWA 3H11A 3VR2A 3U3RA 3WBBA 3ZDZB 1FUYB 1K4MA 3LCMA 3KLNA 3IPYA 2FW6A 4A8HA 3K92A 1Q1QA 1P60A 1USWA 2ALJA 1PJSA 2CCGA 1FBNA 3SG0A 4LF6B 2X8JA 2YVUA 1USUA 1M66A 1R37A 1VRCA 5GPBA 5BNWA 2BD0A 3WE7A 5IHXA 4DCUA 1VG0B 1GU7A 1ULTA 2PBZA 3OLWA 3WGNA 4EDFA 5BOSA 1N8KA 1PG2A 4MV1A 1AXGA 1O58A 2H16A 3KSZO 1L1FA 5KVQA 2AC4A 4WN3A 1J22A 4O4HA 2Y66A 3RIXA 4W5OA 2X15A 4PVDA 2D62A 4YP6A 1Y8AA 2QL5A 5FBKA 1FDRA 2BZGA 1C7RA 5DCUA 3BCSA 1WXQA 3I9V1 5DHUA 4DSNA 1E8MA 1SKQA 1ZCAA 3BK1A 3PK0A 5KNBD 1M2FA 2RARA 1D6MA 3BZBA 3L6RA 4R1OA 5TQ0A 1ISPA 5EIHA 5ECGC 4DUGD 3NHFA 5CFRA 1QH1B 4W82A 4KPUA 4EA9A 5JQGA 4IX9A 3E6AA 1FW8A 4YV2A 4B2LA 1FL9A 1I7PA 4KNWA 3RTEA 4J7AA 4BC1A 4CDRA 1OQAA 4YMHA 2Z1MA 3GYGA 4GICA 2WU4A 4D6PA 3RHSA 4UTZA 3JWHA 2VJAA 1T29A 4R1UA 1NVAA 1OI7A 1W85A 3VOTA 4CR8A 4X8OA 3MCAA 3E3LA 1JSZA 1B2RA 1TGVA 4UCFA 4TVSA 2HT6A 4XAQA 5JAQA 1JS1X 3MMXA 4ITUA 1Z2OX 5FJIA 2PH3A 4RWEA 4YMIA 1XTVA 1B23P 1C9JA 3FJYA 5ALGA 3DO8A 4ZQIA 1D3AA 2ZYHA 3EVAA 1B73A 4PPYA 2XDWA 5CEJA 5TMBA 1JDBC 3PTZA 5TDHA 3OESA 2JAPA 2V3VA 2PS9A 3GARA 5FWAA 5HA5A 2FPPA 1HX7A 2ZRLA 1KDTA 2Y1OA 1GTVA 1LZKA 1JDVA 2N3ZA 2PRJA 1P33A 2G63A 2VJLA 1RC1A 1U3CA 3K1YA 1EXDA 1Y1LA 3CCFA 4JFRA 4M0PA 4QU8A 1FDIA 5EE3A 4E13A 2REOA 3ESYA 4EA8A 1GYRA 2GJ4A 3AI3A 1JMYA 1T0IA 1Y42X 1FYFA 4FHFA 1J20A 4OA8A 5DNVA 2GM9A 4IJ6A 3RS8A 4FDLA 4EHNA 2ZIEA 2W6IA 3H5LA 1XK7A 4TXMA 4C03A 1DARA 1XUOA 4IG9A 3VO2A 1Z0UA 1QB8A 1T10A 3P19A 3GA7A 1XXHB 1BYIA 4GOXA 4R1PA 5HIMA 1P5JA 3ROZA 4BRWA 4ESOA 5DXFA 1EFPA 2XVMA 3PRKE 3AINA 3AR5A 1M7BA 2WTUA 4KXQA 1JVBA 3MVEA 4Z4QA 2W2OA 4DMKA 2QR2A 4LNHA 4MYUA 1ZXLA 4AY6A 1DCMA 1OAOC 2FPIA 2J7KA 4LK3A 4J1TA 2WJJA 3CEJA 3JQQA 3BFJA 2NZ2A 1VA5A 3CXUA 3KAQA 3PD1A 5KPDA 1GSOA 4HS4A 2GT1A 2AE2A 1EWVA 4HUJA 3WHKA 1JBEA 5FDFA 1GY8A 3GAFA 3W3ZB 4YRCA 4X71A 1XZLA 1R50A 1A9XB 1EUYA 3S0JA 2VQDA 1LPMA 3EF3A 4ILKA 4B7XA 3PJDA 2HSZA 5CD9A 5I6DA 3MOIA 2JLRA 4X84A 1F8XA 2R6ZA 4JX8A 4JXXA 1B14A 4AKSA 3M33A 4P31A 3T5PA 3OX3A 1E5LA 2B8NA 4R2LA 3MEQA 3NC4A 3P0RA 1ND5A 3VU3A 4DA7A 1UKEA 3VR5H 5BSWA 2YN4A 4I3GA 4BWFB 2Q1YA 2WSSD 1AOXA 3QLEA 3GLGE 3HL0A 1G5FA 2XMZA 3A06A 2H6EA 4YRAA 6LDHA 2UZ1A 3CVOA 2ENUA 5E1BA 4ZEVA 3TDNA 3W90A 2RC6A 4HDAA 1TB4A 3B5JA 2VTVA 2CXNA 3KG2A 3Q5DA 4ECAA 4LXGA 1KO5A 5C8YB 5JNRA 2FA9A 4BO8A 2P5SA 3HYSA 3IKMB 3HXKA 1CVRA 4H0FA 1STOA 3CSUA 2X0KA 1C9MA 3PUVA 1O3YA 5HZHA 4I1OA 2Y3IA 1M0TA 4UBOA 3FYUA 3NIFB 1BMTA 2A5DA 3C97A 4L85A 4UZFA 1ZJYA 3S2UA 4C0LA 3VO1A 5LQMA 1BE8A 2CFRA 2UYGA 4ZVMA 1XCGB 2B6NA 3GGJA 2PSDA 4I55F 5F5NA 5BQXA 1OX4A 2HUPA 2ZRJA 3C15C 3CW2A 4GEGA 1CRWG 1JPJA 2ZS7A 5DT2A 5MDHA 2DZDA 1NPTO 2JFBA 4E5NA 2YVLA 4RENA 3AJEA 3PENA 5HIKA 3ZDRA 3QVMA 5I7SA 4DNQA 3KTAA 4ETWA 5MFZA 2H5IA 2JGNA 1YAJA 3RODA 3O4GA 1T8TA 4I1SA 2AZTA 1W59A 2EYQA 3E5HA 1YDGA 5FF9A 1UM8A 2Y67A 4K26A 5LP6A 3P9QA 3PNKA 4OHVA 3OOEA 4HFMA 5CT8A 4A82A 2D6FA 4I1VA 3ZE8A 4BUZA 3PR1A 3AP2A 3KEFA 4UOQA 3ROKA 3DFMA 3D5EA 2AI1A 4POOA 4DDUA 2I71A 3ZD8A 2MSCB 2X5KO 3LO8A 1Z0IA 3TPFA 3B89A 4CTMA 1UC4B 3AEUB 1SVUA 3LBAA 3KJNA 4YRFA 3IEPA 5LOVF 1X1BA 2GKGA 3DTYA 3DDWA 4AS2A 2UXBB 3LLSA 1ML3A 2NAFA 2QDXA 4AWXA 1NR7A 4QUKA 3PFWO 5H02A 1FTNA 1EGQA 3GMTA 1LS1A 3KWMA 1AQ6A 1MAWA 2OBNA 3V80A 1Y6RA 2QB5A 1OYVA 2XB9A 1EWTA 2WHPA 2H85A 2IZZA 1T2FA 3DLCA 1ZH4A 3QUAA 3PFBA 4UMDA 4LF5B 4DGQA 1DC4A 2VXCA 3RTDA 3QOFA 4L4XA 4FOPA 4M7RA 4MZDA 4QOHA 5BURA 1RFGE 1EWRA 4DYDA 1ZXXA 4GI2A 1E2EA 5DGCA 3GELA 1CR4A 3C3AA 3MJ4A 2NUPB 2A86A 3V8QA 3BKWA 4DLNA 4AB1A 1Q95A 1IWBB 1W5FA 2YYYA 3QI2A 4RV9A 3SC4A 3ENWA 4JJGA 5DGIA 2IH2A 2V45A 4WD3A 2ZBUA 2H51A 4IJUA 3NR2A 1R0LA 1E9FA 3BS4A 3JD3A 2CFTA 4F5WA 3MJSA 1LQTA 3GO4A 2OHFA 4UNSA 4IFEA 3C7AA 3G9XA 4M7OA 2QVBA 3A9RA 3GC6A 4ZCPA 4QUEA 1GKKA 2FLKA 3UCFA 4GL2A 3HJBA 4OXXA 4QOFA 3AUTA 1CQXA 2X5NA 5E7MA 3IE2A 3F3YA 4ZEOA 1EWQA 2I87A 5B2EA 1Z47A 3GCGA 3L1HA 4D2IA 1O0CA 3DAFA 1PTJC 4XASA 3AERB 3MILA 2PS3A 2W83A 2QN1A 1ADGA 3BJEA 2GN6A 2A1IA 2A9OA 2YL2A 1OXSC 1VKOA 4FUTA 5LR6A 2I3DA 3A1TA 3PBKA 3TOCA 2NUTA 4FE7A 4ZAVA 2OV8A 3LHSA 1UMKA 4K6OA 3P27A 3PR3A 3T9DA 2B21A 3HU1A 5GJWC 4QHYA 3OKFA 4JJAA 1QFSA 2I03A 4OQEA 2PL9A 1E7QA 1U6IA 2QJRA 3WJ1A 4XH9B 4XDGA 2CC2A 4HVTA 3GQBA 3O8CA 1E0AA 1D8TA 3ZIAA 3WB0A 4HB2A 2Q9UA 3DMYA 4FI3F 4YMLA 1J97A 4JLJA 4Q12A 5KINB 3RUDA 4FFOA 1Z0JA 1Y3BE 2Q27A 2W2XA 2ZRHA 3MF4A 2HV9A 4DGSA 3F6SA 2IBMA 2PVPA 1E6UA 4BY9E 4KQJA 1TYEB 4ZT5A 1UWCA 4M6WB 4KVAA 1RRGA 1U9IC 3OQ6A 1M10A 4JNKA 5DP1A 1YJQA 2AVDA 2I4RA 2ILVA 3BGSA 3FWKA 4IIBA 4ES6A 3DLPX 2HQBA 1IIBA 3RS4A 3KCNA 3FNHA 3AVTA 4FZ5A 5EPEA 5IABA 1LDEA 3FZEA 1KJWA 3G2OA 5T8KA 3SQDA 1TMOA 4BLSA 2JLXA 3CUWA 5F73A 3FPJA 3SWWA 4RVGA 2IHJA 1UINA 3LUPA 1ADFA 1EYZA 2VT2A 1RPAA 4IDDA 5AVKA 4AUMA 1XEFA 4XPZA 4KH1A 1DXOA 4O8ZA 1JMKC 1PI3A 1LV8A 2XIQA 1IAVA 1W2HA 3FMFA 2XGMA 2C5GA 1ZCJA 2ZI5A 5EIAA 4BYMA 1Z29A 1JR3A 4GVXA 2NT3A 5DN9A 4WBNB 3VJRA 4X63A 2O19A 2ZI9A 3VTKA 2JB9A 5UKDA 2QTTA 2XUKA 3QBTA 3BXEA 5G4KB 2R8BA 1YZLA 1IQPA 5EMLA 5SZJA 3TLGB 1H4TA 2NUAB 2HB6A 3UAGA 2AYZA 3T7EA 3ZGLA 3WWZA 1SOWA 3QWAA 3BMCA 3BGDA 2ZAGA 4P81A 1YTLA 4TYMA 4WVLA 2B4YA 2DUWA 3FUCA 5CIQA 1Z5NA 1QP7A 4AKHA 2ILTA 2FEPA 1VG9B 3OQVA 1E6LA 2FWRA 3KU1A 3Q2OA 4G09A 3ER8A 3HK2A 1GUZA 4G4IA 1KQNA 4KR0A 1N3IA 4TKLA 1UAYA 3LPLA 4ZCQA 3UAXA 3VX3A 4A8JA 1PJRA 5LYYA 2TMKA 5DOZA 1HL3A 1OZAA 2PRYA 4I1RA 3T5DA 4Z2AA 4YPVA 3BWMA 1A4RA 2R8XA 4P08A 1H23A 2ERYA 4TKZA 1CT9A 5LD2B 2GEKA 2NM0A 5CVDA 2ZB3A 4O2AF 5K0ZA 2WKRA 3GJTA 2BFBA 3AB8A 5G2OA 2GF2A 2PRSA 3GD5A 1J00A 1A5SB 3GW8A 3LY9A 4V2UA 4YI5A 3RYHB 4MA5A 2UZAA 1XCBA 3ZJ5A 3SQLA 3T61A 4JI5B 5BWNA 3ZW9A 4IQFA 3R5XA 5H7XA 4TWBA 5J2UF 1JA9A 4E3WA 4XB6B 1X1EA 2PH1A 1VKHA 1V3UA 1Y5IA 2VXYA 4XFJA 3TQTA 4ZK2A 2R6DA 3I23A 4UATA 2IH4A 1SUSA 1KP3A 2ZUEA 4TLEA 4RHTA 3TBHA 2HADA 1S1CA 3EZGA 3UUFA 5KS2A 3OT1A 3F4KA 3KB6A 4JT2A 5I48A 5I51A 4UVIA 4B3XA 3WNQA 4PNHA 5JI3E 4CTOA 1TJ5A 1G3IA 1QG2A 4G56A 1AD2A 2QRPA 4FYIA 1X8JA 1WUKS 1RXWA 4CT5A 2A8YA 4GQBA 4RANA 3NIGB 2PD3A 1NW5A 3RWOA 1UADA 3A70A 1NTOA 2AYYA 4IWNA 1N5KA 4NCIA 4P4LA 4X7BA 5FHRA 4RVFA 4XB2A 1I14A 3KM0A 2HNBA 2JH9A 2RHRA 4HF7A 2O3RA 4PYOA 5CA1F 2ETXA 3EZ9A 4A2PA 4MS1A 3GGOA 2PVCA 3GZTB 2RDMA 3DNPA 1X6VA 2O4CA 4LY6A 4EI9A 1RYFA 1SCQA 1GL3A 1NSTA 1GN9A 3I5AA 5CT5A 4HXYA 4QGGA 1GXSB 3JAWA 4INJA 2J9XB 3HV0A 4HCJA 3IODA 3LX8A 1G8MA 2OE2A 2ODAA 5DCYA 1NBHA 2I66A 4HDRA 5REQB 3RWBA 2AEJA 1NHGA 3EIOA 4ISBA 4ND8B 4WINA 4G81A 1OGJA 4U7PB 1EX6A 1V47A 1IDOA 3VAZA 5BN4A 3OM0A 4BO0A 5BV2P 1HFEL 9GPBA 1OXBB 3IXQA 4WCFA 1USGA 2QGZA 1E2BA 3Q41A 1NUAA 3IP7A 5CK5A 3TIXB 3VDMA 2W2VA 2GD6A 1LUAA 1CF4A 2C8KA 2OY0A 4JSYA 3RBXA 3W5JA 4DA0A 1YONA 3M5PA 5FT9A 4ND4A 1D5WA 2QRUA 3EHDA 3FHTA 4R1LA 1QGUA 3BSSA 5E1OA 4ZN6A 3WLFA 3KZ1E 2EG5A 1IUKA 3MS2A 3E18A 2RKWA 2A88A 2P27A 3JX9A 1W1IA 4JP5A 4RC9A 2Q0XA 2PYZA 3LUJA 4IUYA 4P4NA 3QLVC 4J4BA 2XUPA 4KE9A 2HCTA 4W7HA 4UHJA 3H8SA 5H68A 4RULA 1KY2A 1PBTA 1X1CA 1Z8NA 4LCJA 4F71A 1L3IA 1S3GA 4NBUA 1YZGA 3UMBA 4PLTA 4AZ0B 1KSJA 3GLGA 5AM1A 3S81A 3SX4A 1IN6A 3GN2A 2FZKA 1Q15A 3DHVA 3SKYA 4DCPA 4C7BA 3AO0B 3A10A 4JWTA 1F51E 1ZEMA 3D0KA 2QMEA 2I2DA 3BFPA 1HYQA 2R6AA 4RHEA 1KI6A 1XJ0A 2HWYA 4H4DA 2Q2OA 3BRWD 3IAS6 3I05A 3IIMA 1CUSA 2R2AA 2I91A 3VPXA 4BLTA 2TRSB 5D3MB 1YB4A 2CUZA 4M1YA 3F4LA 1V4VA 1FP4A 4MP3A 3PZRA 3IHLA 3MWGA 4K86A 4QTUB 5EWLA 1P9OA 1L8QA 3S5JA 3HHEA 3L8ZA 3BBLA 1IIRA 4IILA 2HJSA 2QW0X 5JO9A 3ED5A 3EZLA 3HBFA 3V6MA 3J80A 1TEXA 1ICEA 1Q0UA 3AKDA 3EFOB 5CDGA 4B0OA 2DHEA 2QX8A 3LVRE 5LWHA 3BXFA 5J58A 1UAAA 4TKUA 3O2QB 4AJ1A 1KJ9A 3TMAA 4A91A 4FDUA 4PN7A 5MF6A 4DC9A 1H8HD 4FR2A 3ZWAA 3DOEA 4FFWA 4DLZA 3KHUA 1IZ8A 1L4HA 2JEZA 4C4XA 3RFFA 2PMEA 3HLKA 2ODTX 2P67A 1YOBA 5HOQA 5LU8A 3ES9A 3BIJA 3RT9A 1ZWKA 3DWIA 3SMVA 1YVRA 3RYFB 3WTBA 3WLHA 3IBCA 3PJRA 2QAGA 3EEQA 1JW9B 2A3NA 2PBFA 2VRCA 3LYLA 3T0FA 1OFTA 5JEEA 2CE2X 3LC1O 4D0LB 3QVSA 5FYDA 3SXPA 1PZGA 2DQYA 3VVCA 1JHRA 3M4ZA 3DVLA 1TX4B 3FPFA 3X1YA 4ENUA 4Q1BA 3ZCVA 5E3IA 3SAJA 1SKYE 1O8CA 3AIMA 1I1NA 3JRNA 3CBQA 4Z9BA 1ARZA 5H1YA 1T0PA 4URYR 1SUFA 3IUMA 5G4LA 5HKKA 1EKXA 3ELUA 1M6WA 4D0RA 5KTRA 3E0XA 5AVSA 2FN3A 2QN3A 4LYGA 1QLWA 2QD4A 3GMSA 4IGIA 5EZYB 2QRZA 1O5IA 4RD4A 1WXEA 1D1SA 3SJ7A 1NKTA 4PLPA 3BBPA 4I14A 2BHSA 2X77A 4LC1A 2QLFA 3EQ6A 1ZU4A 3IRUA 2FW8A 1VBKA 2DPYA 2W90A 5AM0A 2P5TB 3ZWQA 1SM4A 3L4EA 3D6JA 4D9NA 4REQB 4OQMA 1V6AA 1EEHA 1VPEA 4C05A 4HB0A 2R6GA 3R41A 2Z09A 5TMPA 2XYGA 4FFPA 1YC2A 5IJ9B 4FHCA 3T34A 1DC5A 4N3GA 3A0UA 4DJFC 4TMTA 1MFZA 1GGKA 3I52A 1V7PC 2W6ZA 5JLJA 4DUGA 2A78A 1DVRA 1A77A 2G28A 1BE1A 2P77A 3K0EA 1PUIA 4IDNA 3HI4A 4M36A 4MCJA 2ZRIA 3T0IA 3LDGA 5IAEA 3H11B 4EHDA 4MH0R 5E6SA 2FPWA 1WKVA 1T0UA 1ONBA 1KTIA 1JHVA 1C5KA 2UUBB 1ORRA 1RVDA 5K0LA 4ENQA 5DSZA 1K6IA 1PZEA 3P32A 3DMTC 3I1FA 4RE5A 1HYHA 2HPVA 3JTMA 4NP6A 2C2KA 1NOIA 3GT0A 1CJUC 3RFXA 5BOSB 4D02A 3COSA 4X8LA 4JI2B 3L6EA 3LWZA 3VPAA 1HDGO 3FIUA 2OO7A 4K05A 3HUDA 4L5BA 4I7EA 4ER7A 4BX2A 3L02A 1EA5A 1T3ZA 3RVLA 1P2SA 4B5LA 1OYOA 4RD1A 1YUBA 5IT9A 2W6QA 3IR5A 1PKEA 4F5EA 3SS8A 4W99A 1NF8A 2WAXA 3ZHRA 3AF5A 1U0GA 5TQ0B 2XXBA 4GBJA 3ISTA 1D4OA 4PZUA 1LFAA 5IJAA 2MT9A 1UM9B 4KPUB 5JARA 5JQGB 5GADl 1OVMA 3EUWA 4Z4HA 4WJZA 5BNFA 3INYA 4Q4LA 3QHPA 2ONCA 4JBWA 4EB8A 4KRYA 3NT4A 4AJKA 1P7WA 1P1KA 2JARA 3KAJA 5F7OA 1AKRA 4H9GA 4OKIA 3WX0A 2P7HA 2VHWA 1USKA 5KVSA 5JLAA 1W85B 3ZLTA 2B2XA 3WA6A 4PLFA 2FPSA 1JWAB 2EW1A 1UIRA 3C8HA 3KOUA 1UDCA 4O33A 4OHKA 4Q3KA 4QYSA 4CL0A 4B84A 2O7SA 1ZK2A 1XAGA 3ABZA 3DLIA 4QD3A 3IXLA 1JYEA 1TD9A 3DBRA 3UANA 5B5SA 4CIAA 1NJ8A 3UM9A 4NARA 2HL6A 1SHLA 5DM2A 4WK2B 2PQ6A 2C5SA 1I2ZA 5HJ5A 2H1WA 4ZKDA 4M3NA 2AK2A 4R1NA 4TUYA 3I53A 3RS7A 2L2QA 2L82A 4NPHA 2HA3A 1QCDA 2EP8A 3Q7EA 2FPPB 5JCZA 4EP1A 3MTBA 2EDAA 2IPXA 4IMPA 2SHKA 4PAOA 1QHIA 4ZOLA 3S4YA 3T3PB 3V2IA 2AWOA 2ANCA 3KZXA 4HXGA 3VDXA 2B82A 3KDAA 4G5YA 3FIJA 3NKFA 4UM7A 3NC0C 5JNTA 1ZM2A 4RAQA 2PXHA 2HH9A 5DKFA 4E07A 1YDFA 2HSGA 4RYDA 2PMCA 4IVQA 1X9IA 2OWEA 3KT8A 1KFCB 1WMEA 1LW7A 2FDRA 1Y80A 4CMEA 5IZCC 5EJIA 1UJBA 3CQ9A 3I9NA 3LPDA 3ND9A 1EFPB 4QGSA 1YB1A 1A98A 4JLVA 1GTG1 2IYTA 2P7IA 4L74A 4CM9A 4R7GA 4V0NA 1E96A 4B32A 1DMRA 4HDNA 1FF9A 1MAUA 2OHXA 1F6DA 4Q1DA 4D9MA 1M6NA 3INGA 1JTEA 2P6NA 1I7QB 5ITSA 1YKGA 4QGBA 2VDNB 1A7JA 4NBTA 4BU1A 1N9ZA 2AUNA 5KSZA 1XTUA 2FMTA 4LTNA 3TL3A 2V6BA 3PU6A 1DIRA 2ZWPA 3RBZA 2YQ5A 4D1YA 3UMSA 4F4JA 1SBIA 2AF3C 4WRRA 2V7EA 3U4CA 2Z6QA 1MIHA 2QL7A 4LCBA 5LYJF 3TRDA 1E77A 2H2AA 1VPLA 3AHIA 3G7NA 3KR0A 4QXQA 2IUUA 4WY2A 2AH5A 1L9XA 1PJZA 1T2EA 3B5IA 2PNJA 3THXA 2Q8PA 4B3FX 1DFIA 4MGKR 821PA 1GAQA 2JFGA 4G23A 4Q3EA 1GM5A 2UZ1B 3WL3A 4ZCIA 3Q3GE 2J7PD 1C9NA 1GPWB 4ZK6A 3H3XA 5CX4A 2FOLA 3ODPA 3IIIA 4QYXA 4AMGA 2CXXA 2AMVA 3UFBA 2WJIA 3AL3A 1X92A 3GDOA 2WSLA 5JBIA 1DLJA 1RSZA 1PGQA 3LQ2A 1TM4E 2OG1A 3ENKA 2FSUA 3NEYA 3FYUB 3SP1A 3PR2B 2R4TA 4MV0A 3QLJA 4ALLA 1GN8A 4AZSA 4DILA 1YXMA 3M4NA 1TIPA 3Q9SA 3QU2A 3EVEA 3ZUPA 3D0RA 3H9GA 3WHLA 4C7OA 3BD8A 1LRLA 1T5HX 3ORYA 4DUZB 1RKUA 3AWIA 3JZFA 2ZIFA 3HR4A 2PUAA 3OQPA 2DPMA 3DE6X 3KTAB 1TK3A 3CSSA 1GQSA 2DPHA 1ECPA 2WHXA 4Z86A 4IHJF 4MUFA 2FSGA 1M34E 3G68A 3I2FA 1P3Y1 3ZDXB 4KI0A 3GBVA 2I4MA 5LP6B 2E6KA 2O7VA 2QMUA 2IEIA 1KH3A 3N0TA 4TQ9A 4U7FA 2ZI6A 2QIOA 4BO5A 1MORA 1A69A 3ZHBA 4B0PA 1VBFA 1XZKA 4BPRA 1X7GA 1J5PA 2E7ZA 4RIFA 3RVJA 2C97A 2PD6A 2OCGA 5LQUA 5KYNA 3LC7O 3WLSA 3AILA 4CM5A 4ARAA 2GWHA 4MWSA 2P79A 2IV2X 3DCIA 2HCRA 1W35A 4L1KA 4F6RA 3QBVA 3KSBC 1LC3A 2Z5VA 4AJNA 4K87A 3HP7A 1WCIA 4LA4A 5GV8A 2AJLI 5KYWB 3D6AA 4KLNA 1G8FA 1ISGA 4DLSA 2H3HA 4IJVA 1Q0LA 1JQJC 5F35A 4ZXPA 1YIOA 3W05A 4NZZA 5A04A 3GH3A 2WHPB 4C29A 4NKRA 1QUEA 1HMPA 4INPA 4DEXA 4BVFA 3X2FA 4A1OA 2KX7A 3E53A 4Q3DA 3L4BA 1AKNA 5BSGA 1K8YB 1KPIA 1CX9B 1QBKC 1WVIA 3CF2A 4J3FA 4LHSA 4YGXB 4P0PB 4GE0A 1ESNA 4M9ZA 4WESA 4XCXA 1N5OX 4DCMA 5AW7A 3FTEA 2Q3FA 3HP4A 3R5KA 3HKDB 3I5MA 2CNBA 4ZZ1A 3RT7A 1H05A 1NRIA 4YAWA 4RJIA 2VH1A 2VJMA 1IY0A 3F6BX 2IU3A 3L93A 4GYKA 2XVXA 4KWEA 4OIMA 1YBFA 1U2PA 1XNGA 1DZIA 3FMVA 3IALA 2YCLA 1FPMA 2VHVA 5AKZA 3VU0A 1Z28A 3MWKA 4UTXA 4D9CA 2B37A 4E5VA 1RHUA 2M6SA 2PUHA 1S2NA 3CINA 2ZWIA 3HB9A 4N1AA 2E82A 4WZAB 2R3SA 3H65A 4Z0PA 3ZVLA 4EENA 4F12A 5IFKA 2XADA 4LDZA 4MSUA 1K7FB 1UMBA 4EJSA 3PFIA 3ZVNA 3SM3A 1RM4A 1UDXA 5ES3A 2ECFA 2FMUA 3O5AA 1YK0A 1FFWA 4RKWA 3KQHA 1XZPA 4OYLA 1W75A 1K9SA 5HE9A 6AT1A 3HYRA 1TJYA 3O8DA 3OTHA 1FZQA 3GWZA 3ZU5A 5I45A 3TJRA 4RZ3A 2VDKB 4Q4AA 4X94A 3T7RA 2EOAA 4XWGA 1IPFA 2IPOA 3G1WA 3I28A 4XVRA 5C3UA 1BMFD 4ERXA 3HXTA 1DAOA 1F3LA 4YBZA 4PX9A 3D7NA 1A27A 3S99A 1G6OA 4E2YA 2JLQA 4FWIB 5C7LO 3EZ7A 5BWLA 2V5UA 3PEYA 2ID9A 1XHLA 3BMQB 5CVCA 2NUTB 1BEUB 3VZBA 8LDHA 1KMHB 3PDJA 3CS3A 4IDEA 4A0QA 1PHRA 3NAGA 2B1JA 3M6VA 4IDFA 4WT7A 2VPIA 3ZHVA 1T36B 3N76A 4DN6A 1P2DA 3P52A 4ZANA 4RH3A 4NV1A 4HVCA 4W5QA 1Z9BA 3F47A 3G0BA 3GQBB 3IVMA 1UZUA 3GLVA 4KR6A 1A5ZA 3PPXA 4P0TA 3PFGA 3SHFA 4B4KA 4NTZA 1A8SA 3MCUA 4FGWA 3REFA 1S6YA 3B7WA 1OBHA 2GN2A 4N65A 1T13A 1J99A 4QO7A 3WLKX 3EGDA 3LVBA 2ZTUA 2ZPTX 4EEKA 4TWAA 5K3EA 4L0CA 1QP4A 3RBVA 3K70B 3AVXA 3ISVA 1RXUA 1B0AA 4IUCS 3VSAA 9ATCA 3DEZA 4V0KA 3EJ6A 3OBBA 2VPYA 2IF2A 2NVBA 3R7AA 1X7DA 3WMGA 3E2MA 3H3JA 3IRVA 4J1NA 3ZOKA 1QVWA 2EGUA 2II6A 3SBEA 3K0CC 2O6LA 5ED0A 2O07A 5EJ8A 4ENVA 2R7AA 3KXKA 3RNLA 1PDOA 3ZD6A 2XWBF 3CXRA 4P4TA 4MQEA 4AJOA 1OZFA 4WCDA 3CRW1 4OY3A 1HOXA 1PW5A 1JAHA 5HF9A 1TM7E 2X8WA 1JTFA 1M76A 1SHZA 2X8LA 3PEFA 4IZOA 2YN2A 3ZHSA 3FWNA 1U0OC 3A6PC 3NMUF 3KX2A 3D43A 5FLEX 4HDSA 5H70A 4PPNA 2V9CA 2YNMC 1JHQA 2W93A 4LZJA 4PGGA 4C0WA 2UVPA 3BMCB 3IVAA 1GRRA 1T3GA 2WA1A 4MUNA 4R2WA 4BASA 2J3MA 1S0UA 1DRWA 1MR3F 1Y89A 3I2GA 1LF0A 2XWSA 3LPMA 3R24A 4MUBA 3U4HA 3V1YA 4LDPA 2WHEA 4Q05A 2REQA 3HKCA 5BWBA 4K9SA 3RFUA 1SHTX 2P2YA 5LVAA 4NICA 1C30A 1NBAA 2OQVA 2XZDA 1W8IA 2GBIA 1RAAA 4YFYA 4A8JB 1WZIA 3LIIA 3DDZX 3HL4A 2VTEA 3PWSA 4IDQA 4QLAA 5AK6A 5FPHA 1PWZA 3CG0A 5K51A 4XJVA 3RREA 5JUWA 1E79A 1E3QA 3DLAA 4O0MA 3ZWPA 2HD4A 3EIWA 4KAFA 2DY1A 2O06A 1H0SA 3WISA 4DIKA 3HXQA 2BFBB 3K6RA 4GX5A 4UAVA 3JQBC 2Q3EA 4RKYA 4QLBA 3I6BA 5LU9A 3K1AA 2GK7A 5LBTA 3UJCA 1JZTA 3DBOB 2IQIA 2H08A 4KL8S 3UWDA 3NNSA 4AY2A 2F9FA 2VJQA 2GX6A 3I37X 2X8BA 4LOLA 4BNKA 1R9MA 2IT1A 3MINB 2ECPA 2XUHA 4GSKA 3ZV4A 2H1LA 4YRNA 3ZI4A 4MB0A 2HO4A 4AJEA 1YFLA 3U1BA 1T8YA 1IPHA 1E2IA 2NYRA 4XUEA 4ZEWA 2ASVA 3Q40A 2B94A 1KK0A 2G9UA 1JPNA 4A8PA 3C3MA 1FXWA 4LVUA 1C41A 1H0RA 2QU7A 1T1SA 1VE9A 2FR0A 2QTCA 1CY7A 3PRJA 4I1YA 4IS2A 2B0JA 4WW0A 2XQGA 5BSUA 3T1VA 4PNEA 8ADHA 10MHA 1DRVA 1MP0A 2C29D 4BLWA 4HQFA 4QHSA 5JPDA 2UU9B 5F3WB 3BWVA 4V38A 4YP9A 5TSDA 2I4LA 4IYJA 1DQSA 5JMOA 1OILA 3ZWVA 3W2HA 3WBFA 1NQUA 1U11A 3BD7A 3IT3A 1R0ZA 4MS1B 4INOA 4YMSA 5SY9A 4DLPA 5LQJA 2BMVA 1PQUA 5IKMA 5I8ZA 4QYMA 1EVZA 1Y4AE 2CL5A 2HDWA 3JAWB 3L0YA 5BN5B 2QENA 1YHZA 1P5ZB 1J8VA 2OHVA 3M2PA 4XPIB 4Q3LA 2YFYA 4JASB 1II9A 2FVXA 3BIXA 5JCOA 4FMDB 4TMFA 3ICPA 3NS7A 4LKOA 5AWFC 5J2TF 3K2QA 3DL7A 2RMKA 3EH1A 1JQBA 4XXHA 1UOEA 2QD1A 4ZJZA 5AVUA 1RXCA 4MIOA 1VKJA 1FE8A 2WM2A 3BRWA 4LTDA 4OFZA 4MVYA 5EJAA 4UOEA 4D3FA 1LLQA 4XIJA 1Q0RA 1MQSA 1UEXC 2XNDD 4O08A 4RX1A 4ZQBA 4YAFA 4KC0A 1HYBA 1TKCA 1YQWA 2YVQA 1QGUB 1VL5A 3E84A 3WB1A 2HJGA 5CLQA 4RCYA 4N0MA 3DGEC 5ALUA 5J4YA 5ELXA 1C4XA 3QJ5A 4FINA 3F8TA 1FLNA 2DHQA 4K1XA 4AMUA 2ONZA 4UM9B 3B9RA 3RRBA 1WPRA 4LWPA 1DTWB 3FFBA 4EW1A 3F6CA 4N3AA 4XM1A 1M74A 2PTHA 2UUCB 3ZXUB 5TS3A 1K6MA 2J6IA 2JHCA 4LFCB 1Q1GA 5G0UA 3SXJA 3F8WA 1AUOA 2E37A 4AUKA 1VJ1A 3GZ4A 1KO1A 3B1JA 4HTFA 4O4HF 3W77A 1CZHA 4CCSA 2OENG 4F86A 4UQLA 3GLGB 2LKDA 3RWMB 4I8IA 1XHEA 2H2DA 1FXUA 4RPIA 3EVBA 1LBSA 3NHKA 2G88A 4FDVA 4KX3A 5IZ4A 3O26A 1KI6B 1Z2NX 2CFCA 3GVXA 4R0MA 3A6JA 3SE7A 2X2EA 3OIUA 5DK4A 3IGFA 3STVA 1YFZA 5EWLB 2Q8NA 5EPUA 1WPXA 1ID1A 1YRHA 3WWCA 3ZEIA 1KEKA 3KB8A 3T1TA 1OPRA 2PX0A 1CUWA 4ZTBA 2QPOA 4ZT6A 1N2JA 4RVNA 5EYPB 4DR1B 4EJ0A 4NAUA 2C9MA 4LXQA 3JZMA 3PC6A 1S7GA 4IAOA 5DCLA 4Y2SA 4Q34A 4DYHA 2X9GA 5C0OE 1CIVA 3F5MA 4MPTA 2AOUA 4Z0TA 4B4UA 3JQPA 4RY0A 2JGIA 3IQHX 3DTVA 4IDHA 1XZHA 4YWHA 4U8HA 1UT6A 1M34A 1Q0PA 1XELA 1PQ4A 2AK3A 2C5FA 2NSLA 3GCWA 4LE1A 4CGYA 2W6NA 4OREX 4JLWA 4DJDC 3AVOA 1EGAA 3EXAA 1JDPA 4NH0A 1YVPA 4BKPA 1E1LA 1B0UA 2R86A 1XU7A 2HW8A 3EVDA 4MRNA 1TEVA 1T24A 4BXOA 2QAGB 3KTOA 4KQHA 3RD5A 4YCSA 5LMNB 2CHVA 4ER6A 1L7NA 5GOTA 5FEMA 1NVBA 1MO5A 3SNHA 2KWIA 2RHDA 2E5FA 3LI2A 1XYYA 1C1HA 3CO5A 3LUDA 3IH5A 1VIVA 2P41A 3CGGA 3Q5GA 4I5EA 2JATA 5JZOA 1EE2A 2OO5A 1OXXK 2R96A 3I2JA 5D5QA 2ZT5A 1K5HA 2Y99A 5H16A 5IVPA 3U9LA 5L51A 1VIYA 3D31A 2CKMA 1D4FA 3EIQA 1HRKA 3HDVA 4IWYA 2VHZA 4Q01A 2O23A 1RLMA 1IEXA 3TEMA 1LBQA 2HWXA 1THTA 3MCZA 1I10A 3KVOA 3PD7A 4FYVA 3VC1A 2V3WA 1GPH1 2YINC 4HX9A 4R05A 1P9RA 4M99A 1XB2A 1PLJA 2ZIZA 4R81A 1K3TA 4DIOA 5JH7F 4KEAA 3H86A 1ISMA 5AHWA 1T9GS 4LSZA 3JQ7A 4JB3A 2RGBA 3T5BA 1C4WA 1LVHA 2BI7A 3R74A 4QKQA 2EZ9A 3B3FA 4I08A 5E7QA 1I3NA 1RJWA 4Z3OA 4BTVA 1EDEA 1EP3B 3KFXA 3ORFA 3PEUA 3K20A 1XWWA 3IJEB 4PLCA 4XCQA 3CURA 3EF0A 5FXMA 1Q3KA 1ZICA 2BFFB 3AEZA 2OP1A 4KCGA 5JSKA 4DIFA 1TEZA 1G38A 4MGEA 2XHZA 3COYA 3RANA 4ZI5A 1M0EA 1Z13A 4H35A 5E7JA 4XUCA 5CCDA 3UWMA 4LDNA 4NDNE 4L8FA 1BX0A 3UQYS 4EHIA 2H18A 3KV1A 1MX9A 2YXNA 4AS1A 3HA5A 1N5DA 2B0CA 1TCCA 1I6KA 1DBQA 2JAXA 4W8GA 4N41A 3WDLA 3Q0IA 1Y8QA 1FP7A 2GJSA 2J4FA 2WAMA 3L2OB 4Z99A 3QTBA 3HUEA 3OE1A 4G86A 4N5LA 4R7ZA 2C2OA 3DFIA 2RGNA 2WILA 3H4TA 2I6TA 4J07A 4TLCA 5FUBA 1L5QA 1YVDA 2PK3A 3PUWA 4OQFA 2H0RA 2QL6A 5NULA 1NSFA 3BJMA 3N59A 4B6SA 2PGAA 4Y6GB 4I5IA 1RAFA 1C1XA 4UAJA 3Q8WA 2A33A 3DZIA 3RO7A 2I67A 3DKPA 3BDVA 4L95C 4CM8A 2O5CA 1KIMA 3WSTA 3IV7A 4A2WA 1T43A 1W5TA 2P5UA 3H8WA 3MD9A 4B7AA 4QL3A 1YE5A 4IJ5A 1KMNA 4Z7QB 1QQBA 1QYXA 2H4YA 2BFEA 4PZZA 4ZKEA 4AVYA 3QVKA 1TKBA 2ZBEA 4KRFA 3ZWNA 3JWJA 3H17A 5L3QA 5LP6F 1PLLA 3C6BA 4LRSB 3INNA 2IXFA 5IJWA 3U56A 3O47A 6ABPA 1TA4A 4RDIA 3FWHA 1M72A 1YS6A 3N87A 3G2HA 1VMDA 3KJEA 1U31A 3PDHA 1DC3A 1Z6AA 3BREA 1XMIA 2X19A 4HBZA 2C58A 4ALIA 2CDAA 2W71A 3UMFA 3DMPA 1J8QA 3O38A 4LWZA 3B9QA 1G20E 3GEGA 4IOJA 4RPLA 2EATA 4P2GA 1ORHA 3FGZA 4R8MA 5EXSA 4UHEA 1NZJA 4D99A 3W2GA 3K0SA 3S1AA 4KK4A 2VUHB 3NDPA 5GOZA 3U44A 1GP2A 4KI7A 3F90A 1P4SA 2PSSA 2SKCA 5LNK6 3BJIC 3G82C 1A5AB 1UH5A 2JVIA 2PKCA 3GBSA 3I3OA 4JA0A 4TUYB 1N25A 4TYWA 4K8OA 2EP7A 2Q3LA 4F93B 5HCNA 1E18A 1I33A 1COWA 4DLXA 2FX3A 1Q44A 3EDYA 4ZOLB 3CF4A 5DEOA 3DZGA 4R2IA 1N6RA 1ZESA 3M82A 2IYEA 1YR7A 2OCIA 5LLDA 4XLTA 1TJ3A 4NX2A 3F74A 4F2PA 2CUNA 3LKDA 2IA5A 2J3JA 5C35A 2ANBA 1SG6A 4H1VA 2J3LA 3C3YA 2XE4A 3BORA 2XKAA 2AJBA 4KU4A 3CF6R 4LC0A 1BS2A 4NYIQ 3R4CA 4LW8A 3FD8A 1VP9A 2FGJA 2CHGA 3N86A 5BV8A 1MF7A 2J7PA 2VDMB 5KNBH 1LD3A 1IHUA 4MI3A 1DPFA 3QNWA 2PGXA 4PZAA 2C2GA 1VE1A 2CCKA 3ST7A 3FCYA 3KE8A 3I1YA 2RH9B 1FSPA 3GJ6A 2GBLC 4HDNB 5CLFA 1PG5A 3P5SA 5JDIA 5JYDA 3GCZA 4M9XA 4UREA 3S3TA 3WGIA 4CQNA 2O2ZA 4HPWA 1WG8A 2ZDGA 4Q6BA 4H3SA 2D00A 4M4SA 1VIMA 2AX4A 3INRA 4DA8A 3RLIA 3JQDA 2HCJB 2DJIA 5TR9A 1DEHA 5KAMA 4REMA 3UA4A 1TI7A 1LGYA 4IFBA 2JI7A 3K0AA 5K8TA 5KTSA 1V43A 5AXDA 3SC6A 3THXB 5JS8A 2K5UA 2M6LA 5AVOA 4FGZA 1R0WA 4AI6A 3MGKA 4JSRA 4TGLA 3KJQA 5FTMA 5KWEA 4YPOA 2QX4A 4HNVA 3M83A 4PONA 1OY1A 1EUDB 3IP1A 1NBME 4LOJA 1TQ2A 2C7GA 4QODA 4QU5A 1L8LA 2JGRA 2FLWA 1GAJA 3RVOA 3CR3C 1AHNA 1BC5A 3IBSA 1KE2A 4WGFA 3RRNA 4J6EA 5H5JA 2BHRA 5THKA 5L9AA 1S2MA 5FD8A 3TDMA 1Q7CA 2ZYDA 5E9WA 2GUWA 2VF4X 4M89A 3V8NA 2HA5A 4NU8X 4GPD1 1VGVA 4H17A 2WVJA 3L8GA 5L3ZA 1I3CA 4K7JA 4EGQA 1L5KA 1QO7A 4JWKA 1YDEA 2WRZA 4YQFA 2AGVA 2WVAA 2RK6A 1KMQA 3SY8A 4B6QA 4PAGA 4C7OB 2PUJA 5KHLB 3BGVA 2O5VA 1XZ8A 3OEHD 4BGVA 4QOSA 4HUQA 3NJ8A 3R5JA 2QK4A 1MB3A 2JC3A 4PHCA 1QP8A 5AT1A 3VYRB 1E61A 3A3PA 5BV7A 2QTLA 3E7PA 3OQ1A 2XT6A 3PDIA 5HRCA 4FHDA 4HSEA 4K9KA 3MHTA 1U9JA 3FHOA 2OKCA 4OOFA 3WQHA 2QW1A 1C1DA 3EIUA 5HQ3A 1W581 2D1QA 2OXRA 1G63A 1OAAA 3KPWA 3OOWA 4JLSA 3UICA 1WETA 1C8BA 1W73A 2IOQA 1Z5VA 2HIAA 2QAIA 3QBJA 1Y6JA 2GPAA 3HCBA 3WRYC 3WMFA 4NK4A 4DIMA 4HTAA 3M9XA 3FXAA 3S2SA 3T7CA 4DM4A 4EMTA 5LXTA 5DI9A 1Q77A 2NLOA 4D42A 3GN1A 5JZ9A 2JGFA 1FFDA 2P9QA 4PYKA 4R6XA 5EJ6A 1GPLA 1UJ5A 3VI4B 1L7MA 3HYNA 3G6WA 2RGCA 4DADA 2JFWA 3PWKA 4F6RB 2O7QA 4J49A 5B3JC 4BQSA 4MQ5A 2EGHA 5A3SA 2AEEA 5HSGA 2F7SA 1L7EA 1XKXA 2JJ1A 4OL0A 2BRUC 2VWHA 3H0CA 4AQ7A 2XA9A 1U28A 4J4TA 2V7QA 2W7TA 5DLPA 2DH6A 2Z4SA 2W4IA 5ETJA 4H6PA 2CXSA 3SCZA 4N6OA 4TQAA 5FOWA 5A4KA 6GPBA 2RD2A 1QF6A 4FKMA 3VKVA 4NEHB 4EPWA 1I80A 3M4XA 3A1EA 4BVEA 3E27A 3KUXA 2PGIA 5DXAA 5FI5A 5M2QA 1AKYA 3N75A 1RQRA 4DLTA 4WESB 2RGUA 4KIGA 4PC6A 3N6RA 2AS0A 4KH0A 2IJGX 5AK4A 1BMDA 3IX7A 3HLTA 5JAPA 2VJMB 5E3JA 2YUIA 4NVRA 5I7HA 3R7FA 5JYCA 4X45A 1D6JA 4UOZA 2G1UA 3SU8A 4EFMA 2CHUA 1KAMA 1K5GA 4GZ6A 4IMJB 5T6BA 4BWGA 3OJ0A 2ORYA 3LCRA 4PEVA 3SIRA 3ZDEA 4E2XA 4ZOAA 4CIYA 1NU6A 3IOEA 3ZDFA 1FXSA 5BVGA 5AXBA 4EJSB 2IW1A 4RTLA 3V8PA 2DM6A 1E0JA 3I09A 3KU4A 4BB5A 1PBNA 4GT1A 1U3VA 2QTNA 4X20A 3TNFA 2I1QA 3ZBPA 3LPNA 4QEDA 2ZRBA 2ISSD 3QOYA 3CKYA 4FGSA 1WIWA 1HE4A 2G5GX 1SULA 4FMCF 2VP6A 1NWCA 3L9WA 4Q4AB 4UPVA 5HDQA 3RUEA 2YFKA 1HORA 2WZDA 3NWBA 1AGPA 1NFRA 1HH4A 4ZVSA 2DQ4A 5F9MA 1E9AA 5DOVA 3BM5A 3CLRC 4YAIA 5L4SA 3JRXA 2BM1A 1S3SA 1ZD4A 1U02A 2R7NA 4PFQA 2NACA 2FF7A 2O2JA 3AWDA 3E1GA 4DV7B 2B20A 2W2KA 1XPUA 3A3YA 4MVJE 1P1FA 3LHFA 2QY6A 4F5DA 1EFRA 2GSWA 4ALKA 2JF0A 5JJCA 1EFTA 5DBFA 1TKAA 1PX0A 2HEGA 2XBMA 2ZQZA 4BLOA 5DSTA 2KQUA 1XTRA 2FCAA 2FRXA 1BZYA 2P3SA 1Z83A 3A9SA 3GGCA 3FG9A 4PQGA 3OJOA 3P71T 4TV8A 5IN5A 4B47A 2XZTA 4OJQA 2DCMA 3L1JA 5LC1A 1SG0A 1SQGA 1QANA 1O0SA 1JWBB 1PFKA 1PYDA 4BNLA 2PUDA 5BXQC 4L51A 2ID4A 3N0VA 2OSVA 4EGCB 3UN1A 3GNTA 1JZSA 2CXUA 3MMSA 1P1BA 1THMA 3SK0A