1B1CA

Crystal structure of the fmn-binding domain of human cytochrome p450 reductase at 1.93a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
SSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NADPH-CYTOCHROME P450 REDUCTASE)
publication title Crystal structure of the FMN-binding domain of human cytochrome P450 reductase at 1.93 A resolution.
pubmed rcsb
molecule tags Oxidoreductase
total genus 62
structure length 166
sequence length 166
ec nomenclature ec 1.6.2.4: NADPH--hemoprotein reductase.
pdb deposition date 1998-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b1cA00
4FX2A 3JSXA 4F8YA 3ES9A 3U7RA 1CZUA 4D02A 3QFRA 4ZVMA 3B6MA 2AMJA 3ESXA 4XDHA 4DIKA 3D7NA 3EDOA 2QX6A 2FX2A 2F1OA 3FX2A 4C0XA 1D04A 1J9GA 2Z9CA 2FOXA 1DXQA 1DX9A 1CZKA 2V9CA 5ULLA 1QHEA 3B6IA 3NHJA 2QX8A 1CZLA 3ESZA 1RLJA 5LVAA 2FVXA 2V5UA 3NHWA 4N65A 2RG1A 1OFVA 2XODA 4PTYA 1J8QA 1FVXA 1ZX1A 1SG0A 3L9WA 4YQEA 3W77A 2QMZA 1J9EA 1CZHA 1CZNA 3W78A 3HR4A 4LTMA 4PTZA 3K20A 2QMYA 1KBQA 3F2VA 3OX2A 1H66A 4BMOB 5F51A 3NHUA 3NLLA 5TGZA 5FA6A 2MOKA 1YDGA 3NHLA 1YCHA 1XYYA 1JA0A 4FGKA 4GR9A 1TIKA 5LMCA 1QBGA 4N82A 3NHKA 4DILA 1OBOA 3U7IA 1AKUA 3KAPA 2BPOA 1D4AA 1WSWA 2BZSA 4QOEA 2HPVA 1YCFA 1FLDA 3GFQA 2MTBA 3NHRA 1QRDA 4M0CA 2N1MA 1AKVA 1RLIA 1C7FA 3NHSA 1GG5A 4PU0A 4LAFA 1B1CA 5FUQA 2XOEA 4N9QA 2M6RA 2FCRA 3R6WA 1AMOA 1V4BA 3OX3A 2BF4A 1YOBA 4R81A 4C76A 4DY4A 1C7EA 4H6PA 2A5LA 5B3KA 2KLBA 4ICIA 3OWXA 4CF6A 3UXHA 5LBUA 2D5IA 3NHYA 4LTDA 3S2YA 1ZWKA 4HS4A 3LCMA 4ZVNA 4YALA 3F6SA 1FLVA 1AKRA 2WC1A 4GQIA 4H2DA 1XI2A 1AG9A 5LBTA 3FW1A 3SVLA 5F4BA 1JA1A 1XYVA 4FGJA 3FVWA 4U7GA 3N39C 4YAOA 3RPEA 3QE2A 5BUCA 3W7AA 4GI5A 5EA2A 4BMPB 1F4PA 3HLYA 2X2OA 3W79A 1VMEA 5JROA 2R96A 1NNI1 3KAQA 3GFSA 1FLNA 1RTTA 2FLVA 2MWMA 5LLDA 1BVYF 6NULA 2Q9UA 4QOGA 1X77A 4FGLA 3P0RA 3NFRA 2OYSA 3B6KA 1D03A 4S24A 2OHIA 2Z98A 4ZVKA 2QR2A 2M6SA 3UXEA 4YAFA 3FJOA 1H69A 1FTGA 5FX2A 2OHJA 4J8PA 4CETA 1T0IA 1J9ZA 2BMVA 2Q62A 4LTNA 1E5DA 1DXOA 3GFRA 4OXXA 3FNIA 4U7FA 2FAXA 4NULA 3B6JA 3OJXA 3L9XA 3QFCA 3NHFA 4YAUA 3KEGA 3K1YA 3F90A 2Z9BA 4LA4A 3O2NA 4QODA 3ESYA 3OX1A 4Y9RA 2FDXA 4NLLA 4ESEA 1WSBA 1YKGA 4YAWA 1XT6A 3GAMA 5LJLA 1FLAA 4HEQA 5EAIA 2BN4A 2HNBA 5A4KA 1AHNA 2QX9A 4QOIA 3N3AC 1CZOA 1ZWLA 4QOHA 1FX1A 2QWXA 5NULA 3OWHA 1I1OA 3NHPA 1AKQA 4C14A 3TEMA 3KLBA 3TZBA 3N3BC 4ZVLA 3TE7A 2R97A 1YCGA 5LJIA 4Y7CA 4U7HA 5NLLA 1CZRA 2FZ5A 2OHHA 4XDGA 1OBVA 2ZKIA 1SQSA 5EMNA 3G5MA 2FZVA 3LT5A 3HA2A 1AKTA 2V5VA 2Z9DA 2ARKA 2X2PA 1KBOA 2KQUA 1QR2A 2B3DA 4QOFA 2W5UA 3OVMA 1FUEA 2MT9A 5B3LA 2GSWA 1YRHA 2HNAA 4QOJA 3O73A 1BU5A 1T5BA 2QX4A 4C0WA 1AKWA 1RCFA 3F6RA 4Y9UA 3OJWA 3EYWA 1AZLA 1TLLA 3ZHOA 5F12A
chains in the Genus database with same CATH superfamily
3WOHA 3CLKA 1C7QA 1KS9A 4P0QB 1X8LA 5JNRA 3H0KA 2Z8ZA 2JIQA 4EDFA 2XUKA 2NO7A 1HMYA 2QN1A 3J7TA 3EVBA 1HI9A 3KHTA 1J20A 4FTWA 2WJWA 3E2IA 4KH0A 4EPTA 4FFBB 1JFVA 2J1LA 2O0JA 4KAFA 2WM3A 4FMDF 3LK6A 3B6MA 4BXOB 4WCFB 3FB1A 2IIVA 4MVJF 5DULA 3SC6A 1YFZA 1JNXX 2AEMA 4L9WA 3VPAA 3ZHZA 3TK1A 1UFVA 3VYVA 3KSAC 1R0SA 3BMQA 4I1VA 3EDOA 4MLZA 4C2UA 1G1AA 1C5KA 2LCFA 4RIGA 5ALFA 4H1WA 1RHKA 3R3YA 4HXEB 3U2QA 3UJBA 4Q24A 1HETA 3AVXA 2HXYA 5KTRA 4MYTA 4LYJA 1CETA 1MBZA 4Q7MB 4IOJA 1XTJA 1CKEA 3RKUA 4UTZA 2FP4A 3VPDA 3AEQB 2FOXA 2J87A 1NHGA 4ZOEA 4EF4A 3CE6A 4IUCS 2KBFA 2ZWMA 4M9QA 2NGRA 3B5JA 3CZQA 4MMYB 3PIIA 4UUAA 3QYAA 4BLWA 2W37A 4BB0A 3GXBA 4K9KA 1SY7A 3VDRA 1E2JA 3ZY4A 2AN5A 5LZ9A 1VCHA 3KB2A 3A4TA 5DJ5A 2A78A 3F49S 4MUJA 1DRWA 1TM4E 2EP5A 3TKAA 3B6EA 3QX8A 5J59A 3FUXA 3WIEA 5JYEA 5LQJA 4BTEA 1U2SA 4KWIA 4RS4A 2ROQA 2WJPA 2WWFA 2ZB2A 1SEVA 3LYHA 3IXLA 2VHEA 5KNCD 2HREA 2OZEA 3QKRA 2OG1A 2V7XA 4N01A 2BELA 3C5EA 4K2HA 2HDHA 1K98A 4RTQA 3VPSA 1E1RD 4L4YA 2PS0A 2A0KA 2HSEA 3FLAA 3I6QA 4OI4A 4MYHA 5EE9A 5TEVA 3QFTA 3T5GA 4UXJA 5LMUB 4ALIA 3S2ZA 2AXEA 1TJ5A 2CNDA 2BGLA 2EFYA 3G9ZA 1QHFA 3VRHA 1OX6A 1I2CA 4BNVA 3I8XA 1W0JD 3FSGD 3BL5A 3IBYA 1UDRA 4PTZA 4XA8A 1V5WA 2WFZA 4TTTS 5BR1A 3O92A 1XU7A 4Y98A 5KQMA 5ITWA 4DCMA 3AVWA 5JZMA 3D7SA 1NNEA 1EQUA 1W76A 1IAVA 2INGX 2YHSA 3LX8A 4GMKA 4ZO4A 5BWMA 4ODIA 1H4VB 3UJNA 2BGJA 3NJ4A 2QX7A 1N6RA 1T10A 1TADA 1XXLA 3NFYA 4GBMA 4LRSB 1X1BA 2FG6C 4BP9A 3BF8A 1PJBA 4P83A 5EJ9A 1WSDA 2G0TA 2MOKA 4FFLA 4EEKA 3V46A 1DDGA 2EU8A 4YAJA 3GDWA 4H9GA 1XLTA 1P62B 4YUWA 3MBIA 4IHJA 2EBFX 5K4HA 4YX9A 1T15A 1JHZA 4BAZA 3CTMA 1NOIA 2PCJA 2VPXA 1PJRA 2X9VA 1I51A 3OY7A 5CNJA 1CVRA 4NU8X 5BXQC 3WIOA 3LOPA 1P80A 4A8JC 2LKCA 2AX3A 4ENQA 1WV0A 3TTVA 2Y1GA 3L5OA 1TI7A 1E4OA 5AM2A 3LWZA 3QPCA 3AXSA 1DB3A 3VNBA 1T2AA 3GDGA 4CE6A 4LW8A 3T7DA 4CMGA 3RRMA 2OAQ1 5LXTB 1SQGA 5IDVA 3V7UA 3KAPA 1U1EA 1B8VA 3GGDA 5H3CA 3RS3A 3DCJA 1W88B 2FN9A 1DARA 3JQCA 3JZIA 5HJ2A 3ZX5A 1GU0A 4F7DA 4B40A 3U61B 4ZVTA 5FWXA 4X91A 3AF4A 2BZGA 2V4ZA 3M6VA 5JSKA 1IXRC 1VL6A 2ZYIA 4JFRA 1M76A 3JTMA 2GYWA 1JHYA 4C0LA 4UEOA 3DVRX 4TMVA 4KO4S 4J43A 2C7RA 1VFNA 2IZ0A 4QBIA 1JDTA 2AC2A 4QJ3A 2AXPA 5K20A 4S04A 4EIWA 3BWCA 5A4DA 5G41A 4XH9B 5DBEX 4ZO7A 2XJ9A 4AN4A 4XJTA 3GX1A 3IP7A 2HSDA 4FC7A 2IYXA 5J23A 4EG3A 1ZEMA 4RTMA 1WV1A 3IBFA 2F55A 1N5MA 1YVDA 3FWZA 1J00A 3K70D 4FLEA 3JRWA 3EXEA 1RBQA 1L8XA 1T0HB 3AR4A 2FPRA 4R9SA 4N9QA 3ZWOA 4COOA 4XVCA 4S05A 1JGTA 4BJHB 4BZXA 2FKAA 2G36A 1ONBA 3FFWA 4O4HF 3LQ2A 1JPVA 2I29A 3HDHA 4OBBA 5CLIA 1WUKS 2DWOA 2QDKA 1G6Q1 3FBTA 4GLLA 1I80A 2HK9A 2PX3A 2VYCA 3B9QA 1W29A 4ENUA 5JQWA 2RKBA 3LAWA 1J2UA 1PTKA 3C85A 3LYLA 4MQBA 4DG5A 2HJHA 4JVLA 2O5RA 1MEEA 1FDTA 1V2HE 1VG9B 2GN0A 1PWHA 5F2KA 1MQ9A 3DHEA 1U2RA 1I5EA 1EGHA 1IN1A 2O06A 5H80A 1TEVA 4B4VA 5B57C 5JH7A 4CM8A 3K5PA 1QCCA 4DR3B 4PC6A 3B5EA 4O33A 3SK0A 3HR7A 1K9SA 2ADOA 4M1QA 4BKQA 1GPKA 5FBZA 2ZYVX 4UAUA 3JQ7A 2ZIEA 1FNBA 1TT5B 2HEIA 1QZZA 3WL7A 4DIBA 621PA 3H2GA 3S44A 4AECA 2EF0A 4TMKA 3WADA 3I05A 5J9FA 2XWQA 1HYQA 1X7YA 1YZVA 2WMYA 4M0MA 2Z56A 2H4FA 4B46A 4YT2A 2RHBA 7AT1A 1D2NA 1MQSA 3FFBA 2PQ2A 2FN3A 1PFGA 2Q4EA 3LX5A 1YOVB 3G02A 4EYEA 4IMJB 3LCVB 4IF6A 1LXCA 3OG9A 4GUDA 1IN5A 4FKBA 3PHLA 5DNCA 4MWZA 1JMVA 1U9YA 3LHFA 3OCUA 2KSQA 1AS0A 3G0DA 4G8BA 5T8KC 4YV0A 3FTEA 5DWQA 2V58A 3CZMA 3NGLA 2JA1A 5BN1A 1V7PC 3EPPA 3VSDA 3TOXA 5IZCC 2O7VA 1JWAB 1MTZA 1EXNA 3E4CA 1XF1A 3T12A 1AKEA 5CB6A 4LV8B 2RC6A 3GJ7A 2P90A 5FBHA 3CKMA 5EP4A 1AG9A 1JHAA 4UBLA 3T95A 3VR4H 5EIXA 2ZKLA 1GTSA 2GN4A 3KE9A 3L93A 1L5QA 4ALLA 1RBMA 1VKOA 3LV8A 4H3HB 4K81B 1JA1A 2HMVA 2HHAA 3KJZA 4KG7A 3N2ZB 1O3YA 4IRMA 1QOPB 3U9SA 2ZYWX 1YKSA 5CB4F 3H16A 4P3NA 5T4EA 5ICEA 1DQNA 1L7XA 2ZYDA 1HEIA 4W9RA 2BUAA 3UWMA 4N5LA 5ARCA 5J2UA 4U7GA 4MJ3A 3SYRA 1XDSA 4MUBA 2BFEB 4PGMA 3QVTA 2O1XA 1GKKA 3IRVA 3ZEIA 1E0AA 2QW1A 2OY0A 3IVRA 5LBIA 1ANKA 2I6TA 3OC0A 3DNMA 3MB8A 2GN9A 1UDWA 2A1TS 3OLCX 5D1HA 4AL4A 1QQAA 3LLCA 2E3JA 2IHZA 5H3HA 1K5PA 1CRZA 2VK1A 4URYR 3ELYA 3LP6A 4A1FA 2OZKA 1YRQA 3WBFA 2X2FA 3E5NA 4MROA 3W79A 3I9LA 4GLFA 4GP7A 5AW5A 1YB2A 1I2ZA 3BAFA 4MO9A 2H57A 2WKSA 5F7JA 4JVMA 2JCXA 4OXQA 2JC3A 1FP7A 2I6XA 1V1MB 1A2QA 2JLBA 2OBNA 2D62A 3MWKA 3PK0A 5EIBD 4BP8A 3PGA1 3SE7A 5JUWA 4OQLA 2D74A 1RWNA 1JI0A 4QTXA 3AEYA 3HJGA 4JLAA 5B1HA 4TZ6A 3EGOA 1XCOA 1MOSA 3E03A 2Q27A 4PZYA 4LOLA 1Y5RA 5DLDA 2XCSB 2VCEA 3I28A 4W8OA 4NSNA 3FI0A 1P6XA 2Q2VA 1N9KA 3HGMA 1MC5A 5AVKA 1W2WB 2CBGA 4L7QA 3TD2A 5KO2A 3W6PA 3HJNA 5IJWA 3T6KA 4PONA 3GGSA 3L7BA 4U63A 3MOIA 4J3FA 3L8DA 3OQIB 5HMMA 4EF5A 2EWMA 2FJPA 2OV8A 4XFKA 1WP4A 1T9BA 4K3UA 3TZCA 1MH1A 2Y1DA 1NM5A 1SK8A 3D3NA 1NAHA 1FTGA 3KB6A 5FX2A 2XT6A 1BA3A 1O94A 1BZYA 4PCVA 1M34E 3ON5A 4X8OA 2AG6A 4C88A 5IVPA 2F17A 1AN0A 3E9QA 4ZI7B 1B93A 2DX7A 3N8DA 3WHLA 1AS2A 2C2YA 3P96A 4JROA 2GXAA 3DBVO 5BN4B 5H59A 1WZUA 1PQ4A 3VOTA 2FYTA 4CETA 3PNMA 4GPTA 3KUUA 5E1DA 4ZGGA 2C7OA 4PZAA 1CE8A 1LDGA 3A6EA 4B7UA 4ZHQF 3UNXA 2ETXA 2JA2A 4FKZA 3COVA 1Y9EA 2JGJA 3U6BA 2HHCA 5K0FA 1DQPA 1Q17A 4KNYA 4OXXA 2QP9X 2PWZA 4H1TA 1JJBA 4UEJA 3ZJUA 2GZ3A 3OEEA 4IDGA 2FR1A 5DLYA 5TGDA 3H2KA 3PPIA 1UWLA 3EG9B 4QRHA 5LKAA 4KE8A 2VZEA 5CYFA 1NU8A 3EVEA 1HDXA 2RHLA 4U00A 2WD7A 5HK9A 3FNEA 4HN2A 2BKXA 3EZYA 3PWTA 4OJYA 2GPYA 3A2KA 2HPAA 3O2NA 3SJBA 3QPVA 4FB5A 5ES4B 1DGQA 4OX9B 3T4UA 2JIZA 1GQSA 1UWCA 3R5SA 1NW7A 3ZXIA 2FRDC 2Y0DA 2Q8QA 2AQIA 4Y9TA 3I6YA 4U2CA 3PT5A 1EFVA 2BGMA 4ESEA 1R6DA 1Y5MA 5ILOA 4C4YA 2O05A 1YDHA 2JAQA 2PKXA 1F60A 3NKFA 2GN1A 3OMLA 4LBZA 1PF7E 3OOHA 4I6JA 2NUPA 3X1ZA 1CQWA 3VQTA 4I7EA 3I6BA 2GBFA 1CERA 1YRYE 2BFPA 1EI9A 3MWDB 4MGEA 4O4HB 2FSGA 3HM2A 4TWJA 4D9IA 4Z1MA 4D9EA 5KU1A 2EYQA 1AUQA 3PUHA 1LNSA 2P7IA 3EAGA 3INRA 4ZREA 5A4IS 4D0LB 1X0XA 1AH2A 1YZHA 3EASA 2R1VA 5GOTA 5FPHA 2PVSA 3JW8A 1DX6A 2P9JA 3AB8A 2D1FA 4UVHA 1PYGA 5HK8A 1W8IA 4FZVA 1NYQA 3U7EB 1U3TA 5JJKA 3L77A 2J7KA 3VTZA 1UFQA 3N3AC 2YN4A 1AGXA 4YS6A 3NUZA 2CLDX 1OHHA 1DX4A 5J4YA 4V0QA 4DOMA 3T3PB 5NULA 1A1SA 1E1KA 4MS1B 1GTL1 1ZOSA 1I1OA 3AETA 3GOQA 5GJVC 2FOLA 3WGYA 3TQTA 3WICA 4YP1A 3ZZNA 1L8AA 4C78A 5CTJA 3A27A 4A2CA 3FLEA 2Q1UA 7REQB 3KLBA 1K6EA 4Q7KA 4JT2A 1IQUA 2C4MA 2QTBA 4ZVLA 3UM9A 3WRXA 3VKGA 4QNRA 5B30A 2EQBA 4S1OA 4R01A 1N8SA 2EJWA 3BWXA 1XRMA 1NPDA 4UAJA 1R4AA 3AR7A 3DBRA 1H8HA 3GP3A 5JCOC 1NC1A 1IM2A 3CPSA 3I72A 2NU9B 4DCGA 1E9SA 4EO7A 5LOVA 3PIRA 1GPJA 3UAYA 4A15A 2WK1A 3R8XA 3TFOA 2PS9A 1G5HA 2W2NA 4OJNA 1KJWA 1IN8A 3FPJA 5E2AA 2QTHA 1KFBB 2GHTA 3IDZA 3FXAA 3IVMA 1EZ4A 3AUFA 3IMEA 1U6JA 2P0EA 3IELA 3H9GA 1PT6A 2BDTA 3JQEA 4FSXA 4Q9NA 4WKNA 2DUUA 5ILGA 2VHVA 3R9KA 1SVLA 4UDOA 2I3DA 1FDOA 2PO5A 5DPMA 4OHKA 4DXAA 1IBLB 2BWJA 1KU0A 3W6OA 2XRFA 1ZGAA 3PG5A 2X6QA 3N2NA 2BCJQ 1EZZA 2PT7A 2VJPA 4ZOLB 1N7IA 1F14A 4K9QA 3T0FA 4JU9A 2K87A 1OU0A 4JGGA 3O6VA 4RE5A 3UWKA 1JLHA 2F3TA 1K7YA 2ODEA 1CR1A 4W5QA 3ITDA 1R0LA 1HFJA 2HM7A 1XZHA 4F3KA 3CBQA 1V11B 2WU0A 2F67A 1FP2A 1Z2OX 2QRQA 3A9TA 3MJFA 3SZGA 2BUCA 2ST1A 1CUUA 1OBFO 1KMCA 1UQUA 1XCGB 2EFJA 3CUWA 1FP4B 2VJCA 3RR2A 5JFOA 1TE2A 2EEPA 3BUSA 1OR8A 4QOFA 5E9QA 4LISA 1Y4UA 4NV1A 1SC6A 3D5QA 4JBWA 5B55A 3OJOA 5AW4A 4AZWA 4EA9A 1P2UA 1NRIA 5TDHA 1W44A 4FDUA 4FYYA 4YDSA 5K8CA 4R54A 1WJGA 3FZGA 1ES9A 3B3FA 4H7KA 4QYTA 5TQVA 3DE0X 1MJGA 4PFSA 3SIWA 4AY3A 2AVDA 5BUQA 3ZK8A 1DAHA 5J2TA 5KX5B 4MWSA 1YB5A 1MB3A 3G59A 3GT3A 5ALTA 2R8ZA 1R5BA 2OXRA 2RC5A 3C1UA 4B32A 2TYSB 3JQQA 1CWUA 1NFQA 4JBNA 4MVJG 5JAOA 3ETHA 1AZLA 3UJDA 4E15A 2Q99A 4NJEB 4BMSA 1NULA 3VC7A 3IQWA 4I5FA 3N58A 3NT5A 4DIDA 1VE9A 4N76A 1GYRA 1OYYA 1D2RA 1TCBA 4ER5A 3BWBA 4HCJA 5IJ9A 3CINA 2XLCA 1E0KA 1RCTE 2C59A 3Q8XB 1I5OA 1IJBA 4F8YA 5BSKA 1TXGA 3OOWA 5C4GB 2PZFA 3U7RA 1P2VA 4TSFA 4LF8B 4D0RA 3BORA 4FYJA 2OUKA 3DE3X 2JAHA 3PGVA 3W8FA 2NW6A 4WNAA 5C34B 3TVDA 3WXBA 3CUEF 2AMJA 1KK0A 3WLFA 1U04A 1V39A 5F3RA 2FK7A 2XUDA 3D7NA 5E95A 3PEFA 2ZZMA 4R8SA 4BRWA 4Z3OA 1Z4JA 4JKIA 4JIMA 1EZ1A 2ORED 3CJTA 3NBQA 4PLVA 5BW4A 2FQ1A 3DLCA 3KOYA 4WCVA 4C0JA 2YHIA 4Z0NA 4UNNA 3PR1A 2ZXFA 3H2BA 5DWDA 1M1ZA 3R7WB 3UHPA 1IJEA 1S3FA 3BXZA 4P8RA 5CBKA 2XWBF 3K35A 2OV6A 5TEWA 3A9VA 1EGMB 2QX8A 1X9HA 3QU9A 4LWOA 3MCWA 2W7TA 4JR1A 3RRBA 1J8MF 1GL3A 2Q5LA 4RUKA 3WQQA 5AXBA 3WWZA 4DDUA 3KWFA 2WFLB 2JGRA 4FHEA 1VE1A 5DXJA 5CJ2A 1C3OB 5K8UA 3AFIA 1B74A 1XKLA 3N74A 3UT5B 1ZNXA 1FFHA 2H08A 3MINA 4G0VA 1YS2X 1NV8A 4Z9XA 4C3VA 5B6JA 3UFXA 1X1TA 1JIJA 4RJJA 4D74A 3NHWA 4BQEA 5J4LA 4IQGA 3O4RA 4OXNA 4KYTA 4EW6A 3D3KA 1KO8A 1OFVA 2XGMA 1L6RA 4HTAA 3NAQA 1Y5LA 4C4ZA 1OFUA 3WGHA 4IJKA 5FRDA 1Z4IA 1DI0A 2Z4RA 4ZXPA 5EJEA 3ROGA 4EHDA 3SX2A 4Z4QA 1I30A 3GLIA 3GY0A 3MGKA 4IL5A 3AM1A 2Q50A 2QUZA 2ID7A 3GW8A 3HU5A 4J0QA 3M1LA 5K99A 2ID9A 3SZOA 2ZUTA 1I13A 4HPWA 1IN4A 1HTBA 1R6VA 2AHOA 1SVIA 3L84A 3LKBA 3N2KA 1WTCA 4P4GA 4YRFA 4CKBB 3GIDA 1WKBA 2ZIWB 4QJBA 3SVTA 3G2HA 4Q1EA 4ENTA 3RYTC 1UINA 1IHDA 1E9CA 3F8SA 1MG0A 2D3TA 1JG3A 2BP7B 4LJLA 2Z6QA 2PKWA 3KZXA 4RK5A 2EKPA 5K8VA 3C7TA 4JCCA 4DDMA 5CCBA 4BVFA 1W8DA 1FFGA 3DSRA 2WJHA 4PAQA 5JE8A 1SC3A 3IALA 1JYEA 1W9HA 1OWMA 2OHVA 4IRXA 4MW0A 3WGQA 3WS7A 4AQDA 1Z0UA 5EJAA 1AZSC 3ZIUA 2GFHA 3ONNA 2REQA 1TZJA 4I36A 1STOA 5IN5A 3VV3A 1ZNQO 1BQEA 2OECA 5GP1A 4H60A 3DEFA 3LT1A 5CD1A 2BFFA 4JC8A 1D2AA 4GP9A 4EKEA 3N7TA 2Z3ZA 2SKEA 4GR9A 3FY4A 4DV4B 3FDZB 3EXIB 4IXDA 1C0EA 1GZ3A 2VJMB 2ZDGA 2QGFA 2YJ3A 1SHKA 2IY8A 1NVFA 3O1IC 5ENZA 1OZGA 5B6IA 2V8BA 2IV7A 1RJ9A 2J46A 1V41E 2I2BA 4MXDA 4NAHA 3E7PA 5FR2A 3NTVA 1EP1B 1OFIA 4OGKA 1C1DB 1J33A 1ECGA 2Q4TA 4Q37A 2OZLB 4DNQA 4ER0A 5JPDA 1UFOA 2ZE5A 3AHDA 1BX1A 1EX9A 1J56A 1RJFA 2O2IA 4H1VA 2W6CX 1YAHA 1RHRA 3I32A 4KN6A 2A35A 4HDOB 1SXJC 4OHXA 4Z86A 4IQ8A 2Z2XA 4UUNA 2HPVA 4NENB 4EHJA 3EXFA 2BBSA 3GFQA 4Z54A 5CA1F 3FUUA 2FFRA 5BVHB 2W11A 1JZSA 2NVBA 1DELA 4LWQA 1QAQA 1W35A 2FETA 3DH0A 3NHRA 4PO3X 3V8EA 3VH2A 1T91A 3QSGA 2JFPA 1I1NA 5FAXA 4D9KA 3WJ1A 1X3SA 2LIVA 3OO1A 1OUMA 4OQFA 4DM3A 3N5CA 4TSRA 3QENA 2HWWA 2HJ9A 1ZN9A 4PHHA 5B7GA 1SCQA 1PVVA 2AFIA 3WKBA 4BO0A 1DO2A 1T8SA 4Z8YA 3S28A 3V8NA 1C0PA 2P9ZA 5CPBA 5CT9A 4BEWA 1JEQB 5EP3A 5HEKA 1MRSA 4MQFB 3OPYA 3V7WA 4EGCB 5LB2A 3O8CA 3KETA 4C0HA 1Y82A 4L4XA 5ILQA 3A1SA 1LCIA 1NMSA 2UZ4A 2PSSA 1J90A 2B82A 3JVDA 5DT2A 1TJNA 2XMSA 2OOSA 4R8RA 1UP7A 1VRWA 2WIBA 3BF7A 3IP1A 5BVGA 3SDBA 4RTRA 1N8TA 2XB2A 1DPFA 3OE1A 1FYDA 2XVZA 3E27A 2VDPB 2YASA 4YCCA 4NE9A 1RRCA 1DKLA 3O2SB 2VI5A 3OX3A 4BYGA 1ISMA 2C4VA 4K0RA 3LKVA 3NEPX 1TQ4A 3EQZA 4A8PA 5J4KA 5HDQA 1V16B 3K9BA 3C8ZA 4F1KA 3EQ9A 2D06A 3OZ7A 4MI1A 2QN2A 3IAXA 3CM0A 4U9UA 2PZLA 1SUIA 2VRCA 1QKJA 3QFSA 1X0VA 4QYWA 1YR9A 2O2GA 2RBGA 5GVRA 1CS0A 1GZUA 3FVTA 3QPBA 3M4JA 1W75A 5F9MA 4WMLA 2WQ7A 1CXZA 4CKWB 1NL3A 2V6FA 3ZU3A 5EXPA 5B4UA 1MORA 2WE7A 1AU9A 1MLDA 3IOYA 4HJRA 3TS1A 9ABPA 1KYQA 521PA 2OV2A 4ZT4A 2GEFA 2NV6A 2Z4TA 1GIAA 4KWCA 2BTOA 1Y5IA 1C2TA 5KC8A 2Y76A 4CM4B 5LDHA 1NN0A 4G0OA 1BOOA 1T2VA 3A06A 3ITEA 3F6SA 4N1AA 5CVEA 2YWGA 1NVVQ 2R1ZA 5FL3A 1LC0A 1YNOA 5D1NA 3PUXA 3EEFA 3RHTA 2AFHE 1U9JA 2PD6A 2PJUA 3Q11A 4LVCA 3IULA 1IWBB 4WZBE 2G5PA 2GFIA 3PF8A 2F3PA 4NYMQ 3U1TA 5EJFA 3WY9A 3D7KA 1RPAA 3HMQA 2BFBA 1ZLYA 2TMKA 4AI6A 3EQ7A 3HKCB 3DMFA 3ZWWA 1W0KA 2WU1A 3R5JA 1N0UA 5H83A 2AJLI 3NB0A 4URWR 2KJQA 3SXJA 1R0ZA 4C30A 3H2JA 1Y0BA 5GONF 1N6KA 2ACEA 4IEEA 4H6XA 3RIMA 3ZBUA 5AIBA 1CDZA 5I51A 4AUNA 1M74A 1G8MA 1U7TA 1YQWA 2FW6A 2WI8A 3JATA 4L5YA 4RKWA 3LC7O 5ALZA 1GTMA 1IYZA 1O7JA 1IB0A 3EFOB 3CCFA 2IX3A 4IFTA 4TTSA 2CSUA 2JLYA 4NBNA 1W9MA 4RK1A 4RYDA 5EXSA 1A88A 3HLKA 1QO9A 2IPMA 3FR7A 3MBKA 4NOKA 3FI9A 1XZBA 3SC3A 4O1IA 3ZW7A 3UATA 4AN1A 4E51A 4PYJA 4MV6A 1SMKA 1GKYA 2BHTA 1Y6GA 3H13A 5HBGA 4CN8A 5K0ZA 1EM8B 2HOQA 4DCPA 4BVGA 2X2OA 2VTBB 1RI2A 4BX9A 1PEDA 2W9XA 4GXTA 4EO4A 1J2YA 4ZMRA 2H3EA 5ESWA 5JPIA 2L0XA 4UKDA 1Q77A 1YR3A 2JFWA 3RYCB 1GAQA 3NYWA 3DVLA 5TQ2B 4FEGA 2YINC 4HB2A 2GPAA 5CNMA 1K2WA 2ATCA 3DQQA 3H65A 4XM2A 3UO8B 1P75A 1SHJA 1PW7A 2HWKA 2ZPUA 4XVUA 1DJMA 4YUYA 2OFXA 1LX7A 2OCGA 2ZUCA 1Y7TA 5GY7A 5I8PA 2V74B 5LLDA 4B4DA 1FYVA 5IBPA 2IXFA 5EKXA 2XUAA 2XYVA 2HUPA 1YZFA 1JTFA 3L7KA 4EY4A 1OHHD 3ANLA 4R6XA 1EFRD 3B6KA 1T4CB 3BX1A 5EGNA 2HRCA 1R00A 3TXAA 1MC4A 1WSAA 4G0NA 2V0NA 2W70A 3DKPA 1W25A 2Q2QA 2QR2A 3LPCA 4H7IA 2XCRB 1RM0A 3HFRA 1C9NA 2QQ5A 3D6FA 4GHWA 3SX0A 3T3OA 4KXWA 5EXEA 2AN1A 3JALA 1KI2A 2HQ1A 1V5EA 4QXQA 4DMGA 5D8DA 4XWOA 5CR9A 2AVNA 2AWNA 1NOKA 1T0IA 4ROTA 1NBIA 2QN8A 2GA8A 4UVGA 1ZUNA 1P4JA 1H1TA 5LPNA 1V9LA 2HEGA 3INYA 2JAUA 2PWPA 4YAGA 3MTJA 5GZ3A 1GR0A 2PUVA 2PXCA 2DC1A 3GHYA 3IXQA 1FVOA 4IMPA 4L8WB 3PNLA 1NVEA 4O25A 3QNMA 4XWYA 3HK2A 5EFOA 2OBLA 1CY8A 3HU2A 2OLKA 3S2UA 1DKQA 2PEYA 3E9EA 4BGDA 1E5DA 5K3AA 4IG9A 4NQRA 4AJJA 2DBZA 2QRJA 5BNTA 1U63A 2FAXA 2PUTA 2PSHA 3GOHA 1OIWA 1RPNA 4DQKA 3A1TA 1K8QA 3EVCA 4DC1A 2YYYA 2BFMA 1Z0SA 2PJDA 1F6DA 2XSZA 4HGNA 4KKVA 2CUKA 3H4VA 5FQNA 3TQSA 4EPXA 4UD2A 4F7WA 2HIMA 5LA6F 4GZMA 5CT6A 5K0EA 3Q9NA 1P3JA 4IWXA 2IWRA 3RIEA 4YQFA 4RJIA 2Q6LA 3A1UA 1A7KA 5I47A 4FMBB 1TCUA 1E5TA 5BNIA 3PFGA 4ZJYA 4IXWA 2OENG 5DM60 1WETA 3PXAA 4GPZA 5G1OA 1B16A 4D9FA 4ZT5A 2P27A 3TR5A 1P72A 5AK4A 3ZS9A 5HF6A 3KYBA 3HVJA 2ATXA 3BG5A 3DLPX 1XTIA 3WRWA 2RGUA 1QF6A 1W5SA 4LXHA 3NYQA 2JFOA 4H59A 4G4JA 1DCFA 4MNTA 4X1KB 4BNZA 1HL3A 2AUNA 1F51E 1LF0A 4G9GA 2GEDA 4X85A 1SH7A 2A7XA 2XTJA 2DBVO 2F48A 5L7WA 1E2PA 3CSDA 5IJXA 3QQPA 3URMA 4DIMA 1FSGA 2OPBA 2X15A 3UF0A 4YCSA 2YV2A 1E0SA 1JAHA 1XZFA 4K2AA 1ZONA 4OKSA 4PO8A 2Q3LA 2QX9A 2YIDA 2XLBA 3KLOA 4HVTA 2ANBA 5BSVA 2GBLA 1GSHA 5CDHA 1YTUA 3X1KA 1Z62A 2JBAB 2X3YA 3I58A 1FX0B 5TS2A 4I1PA 5I7RA 2A0YA 3PNKA 1JQJC 3VPFA 1JVNA 2HA4A 2HRRA 3DEZA 4TQ9A 3KT3A 2DQKA 3BMNA 2C2XA 4AKEA 4M9XA 4Y1RB 1FRFS 1YR8A 1U8TA 2XGGA 1XN4A 4L0QA 4UAGA 3OSZA 4RHCA 3WL6A 4ZJUA 3EEOA 4CEHB 4EHNA 1TYCA 4PPQA 4QYMA 1H9CA 1E9FA 3E9NA 4EPYA 5HP4A 1DC7A 3UOAB 2NVWA 3EG5A 1L5LA 3IPXA 3TSZA 4ERNA 3RRNA 1ZITA 5LJIA 4AB1A 4L50A 5H5JA 4Y7CA 5SY4A 1ZBQA 5J1SB 3RO7A 4UEWA 4INAA 5L3RA 1N4AA 3N07A 4EB8A 4AYTA 1BMFD 3R5XA 4FCCA 3OT1A 4R9NA 1U2GA 3ZDXB 3QVXA 4RY2A 1G5TA 1DBIA 1I7SB 5BSUA 2CFSA 4YUZA 5C1DA 1KOJA 3FPEA 1WQ4A 3C7DB 4CUZA 5C32A 3OCJA 1T2EA 1NPTO 1S4MA 3L7DA 1YRLA 2FSFA 3HU1A 2CNOA 2WJ3A 3AJ9A 3ILVA 4FHFA 4ZAVA 1EX6A 5FO0A 1DIGA 3TLZA 3WDSA 4BOYA 4LPSA 2VDRB 2YWJA 4JBLA 4MIKA 1I3NA 1LDNA 3BPSA 2OFFA 4RIHA 4DPKA 4ZT6A 1QGDA 2FZVA 1AKTA 4QUIA 1J2TA 1H05A 2AA3A 3Q6NA 3NHMA 2VTVA 3P1JA 1FP6A 1EVZA 2XNDA 4DWVA 5KQLA 3CX4A 3N2GA 3NBZC 5KREA 5A3JA 2J4FA 4WJZA 3JVEA 4L8LA 4XIFA 3TSWA 1Y3AA 1GGHA 3IEVA 1SELA 3HZRA 2FFAA 1SVKA 1VL2A 3LZ6A 4M0LA 2B3DA 2Z4SA 4Q9DA 4CXMA 5ER9A 3AUUA 3WNZA 1O54A 1ZOIA 2O54A 1E6LA 3F96A 3DE2X 2XXAA 3DTVD 3OUTA 4PBTA 1DADA 1O0SA 4E4RA 3WKEA 5ECWA 2VUUA 5DBIA 4BGVA 2X9QA 4ENVA 2LCIA 1B00A 1HDZA 4JELA 3L8CA 2VJAA 1MU0A 2XE8A 1PJLA 4RK6A 4AX4A 2QVLA 4QDUA 1PV4A 1DUSA 1VBMA 3H18A 3OFSA 3WLAA 3ZHTA 4IAOA 4OTZA 4DRZA 1ZKDA 3HXOA 1HDOA 4CCYB 4JS0A 1QMGA 1G3MA 3D8TA 2IZ7A 5CNIA 4Q05A 3FIUA 1WTAA 1AGPA 3ROKA 1CFZA 2RAFA 3IVXA 4MEAA 2NUAB 1S9HA 3JAWB 4GVLA 3NC4A 3Q4GA 4NCNA 2YWCA 4TLAA 1JKIA 1GADO 2X7XA 3CEJA 4FI3F 4LVOA 4RH0A 1OXXK 3LF1A 4GRAA 1CRLA 5H7XA 1V8DA 2J3QA 3BICA 4ND5A 3UMSA 3ZHOA 2J85A 4EFKA 5KNBD 1Z25A 4ZD6A 3DVQX 1YB4A 2ZE8A 3LW8A 4FX2A 4UVIA 4QGSA 1OMOA 3UMYA 3KRTA 4K6KA 3TI7A 1KI6A 2RGBA 1TFUA 5HUJA 3KTFA 1RRMA 1NBOA 2QUAA 4XCXA 5MN5A 4JGIA 3DUFA 4PC1A 4ZI5A 1XCPA 1Z07A 1E6CA 4PZ0A 1A96A 1G5QA 4QHYA 1O2DA 5KCMA 3SNKA 3BA6A 4O4LB 4BIIA 2UV8A 5KQRA 1JYSA 3AR2A 2FPPA 2YOFA 2R7LA 2Q5CA 5CG1A 4D43A 2YVQA 3Q5EA 1E62A 4ZCSA 1E1NA 3OWOA 7GPBA 4BGEA 2NO9A 3T3GA 5AVQA 4K6HA 1M5UA 2O0KA 2D3WA 5JD4A 1UPTA 1OFTA 3K1ZA 4KDFA 3BFJA 5CHEA 3WZMA 3BIFA 4EG7A 1U3FA 4EZBA 6YASA 3OQMA 1IHXA 3GZJA 4JUIA 3C48A 5B7QA 5ULLA 1R6AA 4FDLA 4MUAA 1A5AB 1P4AA 5IUNC 1NBEA 1UBCA 2FMKA 2FHSA 1TYDE 2D59A 5LZ5A 4CNBA 2W6OA 1EVYA 3OZRA 4IV5A 3SZ3A 4MR7B 4S2EA 5JAPA 5ALLA 1KVUA 4RZUA 3L46A 2IGTA 1U65A 3W90A 1PFVA 1YB1A 2C2OA 1GTJ1 3IERA 3EQ2A 4L57A 1JHOA 4QOSA 3SM9A 3ZPXA 4XLTA 2PKCA 2POCA 5F98A 1RRGA 2FWRA 2PTHA 1F8XA 3B9PA 3FRIA 3MT9A 4LBWA 1DKUA 4OB7A 2IUTA 3BM5A 1UWVA 3DD5A 4PTYA 5AHXA 3VC3A 5AJWA 1FVXA 5L4SA 1UBTS 2C5FA 3WIDA 3CRZA 4MCJA 4L5IA 4M9ZA 2IEIA 2XE6A 4Q3KA 4R7TA 4S1WA 4XPIA 1X7XA 4ZVSA 3HRIA 5JW6A 4H4CA 4DCVA 3K9FC 1CP3A 4ZOQI 3PV0A 4HWPA 3ACCA 1QV6A 1WPGA 3BZUA 5K9ZA 1T2CA 1CZHA 2QRGA 4CG1A 1WM1A 1CRPA 4TGLA 3HBAA 3K20A 3AEKB 3KAJA 4DW8A 4LXQA 1R7RA 2Q0HA 3E5HA 2OQ2A 1KP3A 4LHSA 4YREA 1YSCA 3ECAA 3GA7A 3LUBA 3Q7QA 4JLMA 3OQBA 1H66A 4LOAA 2AW5A 1LV7A 3FWPA 4Q66C 5AVJA 1YL6A 1NR7A 3RU2A 5LQNA 1HZZC 5AXCA 3AIIA 3NGXA 4J16C 2X23A 1D1SA 4YMLA 1Y4DE 4FBLA 1L7MA 3TOVA 4KR6A 3NLLA 3AM5A 4GC9A 4K8OA 1G8HA 4LWZA 5FFNA 4Z49A 5CDYA 4LJYA 2CV1A 3FLBA 3COWA 4FDAA 1SEPA 1YA8A 4GKBA 4HTFA 1Z0JA 2H4ZA 3RS2A 1I0IA 1VJRA 2NLOA 1CF2O 1ZCAA 3HVHA 4P7FA 3T34A 4UCWA 1ETUA 4CIBA 2G40A 2QAGB 4RSGA 3VR4A 4NNOA 4Q9IA 3P9IA 3NKLA 5LMCA 4DDHA 5CDFE 5K6AC 4N82A 1T3TA 1Y8ZA 3JWJA 3DEIA 3CPEA 3F9IA 1QGUB 2IU0A 1OBOA 3ET5A 1GN9A 3GUZA 4HR7A 2EFDB 4YWJA 4YROA 3BC1A 2B1RA 4BKOA 4MZDA 5JDIC 3FLMA 4UVEA 3WV5A 3P9YA 2EQ5A 4KFCA 3QKWA 2YRXA 4HWTA 4I99A 4RE6A 2QRKA 1TYZA 1EQAA 3V2IA 1EFLA 2QM0A 4I19A 1E2EA 3CZRA 4I9NA 1W0KD 2I0FA 2Z5GA 2WZDA 3P52A 4Q1AA 4JXXA 5CH5A 2X22A 2H2AA 4BBPA 1YCFA 1LSUA 3O0TA 3PNQA 1MAWA 4JI7B 4M86A 1YC2A 2FXIA 3UJAA 1YQXA 1X2EA 3H5IA 4YJ2A 2H85A 3CKYA 1AUXA 1EWYA 1UXOA 3WWEA 4L07A 1ACLA 4WBNA 1G9TA 3SE0A 3T4PA 2N1MA 4R3WA 3WDKA 1J1ZA 1XJCA 1WDMA 5BYJA 1MDBA 4PPNA 4BNHA 4YUAA 1A5SB 3CWZA 3E1SA 2JI8A 5KVCA 4UU1A 2F4VB 4ZDIA 4R1MA 2OT3B 3K92A 1DWUA 1W34A 4YVFA 1L7NA 4K6FA 1ZK4A 3MEQA 2DE0X 4XIIA 3QYPA 4OMDA 2QJWA 3LDHA 3KVOA 3TE6A 2DFPA 4QECA 3URKA 4YAIA 4E11A 8ADHA 2PPVA 3CY6A 3VMMA 2QL7A 4OV6B 3GB9A 2G1PA 1J2RA 3OE5A 3QFHA 4AKSA 1U0NA 1P5JA 1MJ5A 1UDXA 1JFRA 2GCEA 1XALA 2PLRA 4H0CA 2PAAA 5DX0A 5HYVA 3BYZA 3PC8C 3GLGB 3J80A 4E21A 1UEIA 1JN0A 1L9XA 1SC4A 3KYCB 1SU6A 3R4VA 3L6DA 3VKUA 4EPRA 4FB4A 3DLAA 5DASA 5FBLB 4CIYA 5KTNA 5DGDA 1YR1A 3DWIA 1IXYA 3REQB 3QW4B 3E2PA 4IFEA 4MOWA 2JAXA 2BBOA 2Q3HA 1U8XX 3DWEX 3V97A 4EECA 2GKGA 1E7MA 5A04A 2C3YA 3O1HB 1LW7A 5EPEA 4LGVA 2BFCA 2CJWB 1K63A 1D4ZA 1U1CA 2I33A 2Q45A 3IEIA 3IKVA 3AR6A 2PBRA 3GGCA 4RKEA 4ZU1X 4TZTA 3TL6A 1KSHA 3DD1A 4GRIA 1F38A 3V2HA 3ETDA 1K3UB 2FW1A 1L7BA 3DBHA 4JJ7A 4MLPA 4MQ6A 2UUOA 1S2DA 2GS9A 4HS4A 1AHIA 2Z30A 3CH4B 2QBYA 1VMIA 2G67A 3ZWAA 4ARAA 2OB2A 2WWWA 1IDOA 4RCVA 4S35A 4DCSA 2GPNA 4L16A 3UUEA 1JQKA 3O38A 3BKWA 3OOEA 3UJ8A 1M2GA 2YIMA 4AIRA 3B1XA 2QW0X 1ZIYA 2A0FA 3FWYA 5BV1A 1PL0A 4CQMD 5CDSA 1RI4A 3ND5A 4MVYA 5KMGB 1NYLA 1LSOA 1OXBB 2WMOB 1WXEA 4FOSA 4KWEA 1C4KA 1WUIS 2FEXA 4PZEA 2CJYA 3TM4A 1OW3B 2IF2A 2JVIA 1BFDA 4AAYA 1SQ5A 2DOKA 3PL5A 1QNFA 2XHEA 1Z74A 1QYCA 4YCMA 5HTOA 4C0KA 3FCCA 2P40A 3BT7A 3PTZA 4DLVA 1W87A 1SA0A 3ZE8A 2Q07A 1YQDA 2DTXA 1R0BA 4YIKA 3M3HA 3SC2A 3MWLA 4DCNA 1MABA 1MKYA 2FEAA 4NL4H 4WCDA 1W30A 1NP6A 2ZTLA 4FGJA 5EYPA 3TBFA 2QT1A 3AESA 2P9FA 2HJGA 3HA3A 5DH9A 4ESHA 1ZEJA 4AZ3A 4LJKA 4EGSA 3TJZA 1AQYA 4RTSA 1JHQA 3TRHA 3BRQA 5FT9A 5IABA 1U6KA 1DLJA 2OEPA 4RD3A 1E2MA 1GPH1 1KEUA 3LT2A 4Q34A 1OC4A 2BI7A 5EKTA 1UXIA 3GC6A 5K3FB 4BMPB 3AVOA 3LLVA 4MVJM 3ST7A 5JVDA 3T7RA 1T9AA 2C3OA 3LTNC 2YKGA 4ID3A 4BVEA 5IHPA 3AM3A 1KU6A 3EB9A 4AZTA 1VMEA 1MA0A 2ZTHA 1QLJA 1KMNA 3QKSB 1FNCA 3NJ8A 4A5OA 1E3WA 3ROQA 1ST3A 1FFWA 2OZVA 4NV0A 1TF5A 2QMEA 3WQSB 2E87A 2Q3BA 4MV1A 3W9YA 2X1HA 1X94A 1KC1A 2PL5A 4D99A 3SSOA 3W2FA 3D4OA 1BQ4A 5BSFA 4H18A 1R5JA 5GIOE 4F86A 1OPRA 4UMVA 1WF3A 3BE5A 2WA2A 1Y34E 2PXAA 4TXJA 3EA4A 4X6LA 1N5KA 2ZI9A 3DWGA 2A9PA 2UU9B 1WBJB 4NJOA 4YMSA 5T6MA 2DBYA 1BXRA 2XD9A 4YECA 2G09A 1HNWB 3D1JA 5FBVB 1L7AA 4QVKA 4ISCA 4MYRA 1YHNA 2MSLA 5HGXA 1J09A 3L04A 3FFXA 3QUAA 2OXFA 2QPTA 4IJ6A 3RYIA 4EM6A 3G49A 1GRQA 3N2LA 3A3PA 4QXMA 4AZ0B 1V71A 3RLFA 1HDCA 3KZVA 3SOPA 4PF1A 4MI9A 2UYCA 3G0CA 3MT8A 1C3EA 2EATA 4LGCA 1H69A 4Q3BA 5AVSA 3N0VA 2Q8PA 4BMXA 2X4IA 4D3ZA 2XVMA 5LNK1 1MHTA 1K92A 1N1MA 1PK7A 4HNAB 1PGQA 4U9HS 3RKSA 3S7ZA 2GILA 4O2BA 4Q4AB 1GGNA 2FZEA 3VDXA 5A1JA 1WIWA 3PGLA 4JQYA 1LTKA 1SXGA 5FUMA 1CUIA 5JDCA 1Q83A 4EQ6A 2FWMX 1P7WA 1E2KA 3N0TA 4INOA 5AJUA 5CEEA 1L1RA 1VXRA 4HXYA 1NT2A 3I5AA 3RQSA 4ECEA 3AT1A 3D8BA 5CFMA 3I04M 2O2YA 4R51A 3WMEA 3HKEB 4UNPA 2MINA 2WF9A 3QOFA 1LB1B 3QXSA 1IY1A 1MVOA 3NTQA 5F7ZA 5IW8A 1IMOA 1U7OA 1VHJA 3GLHB 1OAAA 5KBYA 1FDIA 3ZNOA 4K40A 4CIWA 2ZETA 2E1RA 3N9IA 1ORVA 1MAUA 3MTGA 2EW1A 4L5CA 3AEUB 2PANA 1NN1A 4MEJA 4L51A 3JQ9A 4Q39A 3W05A 1Z22A 4AZSA 4F2WA 2G1KA 4ISBA 4L9RA 3M5WA 1IOZA 4JGBA 4KDRA 4GI2A 1F2UA 5L45A 1I2MA 1JFFB 1T9GS 1DXYA 1WUTA 2MSCB 3QW2A 1Y63A 2I78A 2PYDA 2RGAA 4P92A 4OLJA 1DLIA 3D4LA 5TXGA 3IHKA 4BB6A 1IUKA 4EZIA 4OHWA 3RDPA 4DYHA 3PFHA 2AGVA 1OFHA 2CXOA 3DWFA 4MB2A 4Y2GA 1OASA 2X13A 2YYSA 1IHYA 1QG4A 1NVTA 2VYQA 2XCQA 3NXSA 3C8MA 1M33A 4N5NA 4OLHA 4R40A 3ZDEA 1ILEA 2IELA 2VPYA 4PQRA 1UH5A 3R6DA 4GMXA 4TLLB 3DMTA 5JYBA 3NIGB 4ND8A 4HEQA 1BCSA 3CCCA 4JP1A 4BV8A 1W2GA 4P3XA 2XRYA 3EIOA 5L9AA 4C6RA 3K6SA 3OPQA 1ZGBA 4U3JA 2JKZA 2QPOA 4ZCRA 3CF4A 2JLXA 4TL9A 5A3SA 1G8FA 3J81k 1I3KA 1KY5A 3Q87B 5DBHX 3HUUA 2VEOA 3LA6A 1ULZA 3Q3EA 4KBYA 4JJEA 2P6NA 2FW8A 4TWAA 4CEIB 3CYFA 4B2PA 1VMDA 4HBGA 1RWVA 1VJGA 1SG9A 5F52A 1DEOA 1NMZA 1VPDA 2AKYA 2F9LA 1DHTA 3GPDG 3OBIA 3VSBA 4CT0A 4ACAA 2WJJA 4ZK2A 4AJEA 4N3GA 1FFDA 5LYJA 4D8YA 3ILHA 1R5OA 4Q4HA 1AKQA 5K0CA 1NZDA 3WSVA 4MGIR 2YMLA 3EZNA 5DI3B 4ARUA 1ZHFA 2OCXA 3GUYA 3ZV5A 3F5SA 1KI4A 2R6AA 3QUBA 4RM3A 4XRGA 1AZTA 3Q98A 1LPBB 3OZDA 1P1RA 4IGKA 4YJ3A 1GYPA 1EFPB 1WRBA 4V1CB 2OVFA 2V7QA 4JEIA 5CP8A 3RWBA 2JDIA 3ZWNA 2H31A 2V59A 5HCNA 1Q1NA 1UJMA 3KQHA 5A0TA 4YXWD 4QAQA 4BNDB 2VF8A 3E9ZA 2PRZA 1EVIA 3DMNA 3L8YA 3LL7A 4A0RA 4I9HA 4XGIA 5FLEX 2G07A 4TSKA 3PUIA 4JLSA 2GAJA 2C5LA 3UJ3X 1A5TA 2CUTA 2P8JA 3AUAA 1QWSA 3NOOA 1DJQA 1ZQ1A 3KB1A 2PLFA 4LSWA 1L5HA 3UGKA 9LDBA 1ENZA 1ZW1A 1H65A 2ZRQA 2IYYA 1CQIA 2PRKA 3G5MA 4RIIA 1KPHA 1M6NA 1PNOA 2VUTA 3HB9A 3RS7A 4DN6A 3DO8A 4PW0A 1JQBA 1ZIDA 3GK3A 2JIRA 3HCPA 1FK8A 3LA8A 3OF3A 1M34A 3TNLA 3TGLA 3D6HA 3DL0A 2JKVA 2X7JA 3IUMA 1JJIA 3D3EA 1EK0A 1I6MA 3QLEA 1O95A 3IAUA 3CA8A 4OFZA 4RD2A 4UU8A 3MCAA 5JI2E 5K2OA 3AR8A 2OC4A 3TZHA 4LZAA 3D0QA 3KEMA 1OE0A 2BYTA 1P61B 1Q7GA 1KMHB 4UHKA 3EGEA 5JLAA 3UWSA 3UGJA 3Q41A 5C8ZA 3MWEB 2HJVA 1U2EA 2PCLA 4GBED 4PGGA 1Z6GA 4QSHA 1HE2A 4E5KA 2I4IA 1C3JA 1AKMA 3BXXA 3OLWA 4IHJF 1T6YA 1N3LA 1YS7A 4FCTA 1ESEA 2J32A 3ED1A 3G0IA 3K73O 4PRKA 3H9UA 5HQTA 1F12A 2JCGA 3FCSB 5BQOA 1ESCA 1WD5A 4JC4A 3M82A 4CYMA 5JQGB 2HKIA 2Y0EA 4F46A 2OSVA 3S68A 8GPBA 1KMIY 1N1EA 3Q9SA 3ETCA 4KODA 2RAPA 3U9LA 4ED9A 5BR7A 2ZJYA 3SR0A 2QG9A 3KWJA 5IBCA 5TRTA 1QZ3A 3RUEA 4MVJP 1U0GA 5EZ6B 2HMAA 2VVTA 4A36A 4FU0A 3U3RA 2P69A 2J9RA 4PLWA 2NZUG 3NU1A 4CIVA 3KWLA 2P4UA 3WB2A 4OY3A 4X7PA 1ZM7A 2BGGA 3FTCA 4UARA 3R3JA 1VPWA 3TTUA 3O4IA 5B37A 1O97C 1NIPA 3FR8A 4J0KA 1C9JA 3LUHA 3JRNA 1XVAA 3BHNA 2ZI5A 2IPOA 3FCEA 5CVJA 5HFJA 3FFAA 5B6PA 4B17A 4B3GA 3ZGYA 4XQEA 4QLAA 1N5DA 1E6KA 4M1YA 4ZIRA 1IY2A 1GQ2A 4R0VA 1TC1A 3BD7A 4OUDA 2G3YA 4YNBA 3H86A 3RTGA 1XAIA 5C8YB 5IG2A 3K71B 3F7NA 4ZVMA 5MN4A 2NNWB 2P30A 3R5FA 2B69A 1DFGA 3GUHA 4MVXA 1TMYA 4H7FA 3CWCA 1CEQA 1O96A 1T1EA 5D5PA 4BEJA 1UK9A 3P26A 4KLNA 1A9XB 3O8QA 2CLIB 2QXYA 2RK4A 2FX2A 4OEHA 4E7PA 3SZLA 4B4WA 1VBKA 1TT7A 5AHWA 4TT8A 4L5JA 4FIDA 1SKQA 5DM1A 1LJLA 2UZ3A 2VCYA 4KX3A 1V1JA 1KAHA 3QBVA 1NI4A 1R4NA 2XXJA 1YTLA 1XMIA 2ECQA 4PVCA 5WRFA 2C5HA 3AC0A 3VSEA 3QJYA 4DCUA 1N7GA 4DJ5X 3PNPA 4QASA 1EVEA 2YY6A 1XTPA 2CNWD 4Y18A 1N6NA 1HDRA 1KZ1A 3VJKA 3F5MA 5F35A 4F4CA 5A7GA 5JS6A 3KZCA 1ZL0A 4QUDA 2R6HA 5ADUS 4ILEA 2WKRA 4L4SA 3H5OA 4IDPA 2HZ7A 4DMLA 2HNKA 3COYA 2EV9A 4EMUA 1OX4B 1U3DA 4XD2A 5IC4A 4R2JA 3Q3CA 5JSUA 3CNHA 5AW1A 2EXXA 4Q4DA 5ALDA 4BFVA 3HN2A 1YRAA 2D8MA 4MDEA 2QE7A 3BHMA 3MCZA 3FHJA 4WK6A 1DQRA 1N8KA 5CH8A 3WGTA 4W7HA 4IH4A 1ZX1A 2ODQA 2ZSJA 4IDOA 4LE1A 3A25A 2O4CA 2A86A 1E1QA 5LCXA 4BNMA 4JFAA 1J9EA 1S9DA 4N7JA 1WF6A 4LYHA 3TPZA 1FW6A 3W78A 2H4JA 2PH7A 2XV1A 3HNOA 1VSBA 5KDLA 3OH8A 4KC0A 1A98A 2QU8A 4J91A 1T3GA 1U2DC 3A6HA 4JT4A 4UTOA 4PSKA 4F6CA 3UUGA 2OG2A 3F2VA 3DFKA 4GW3A 4DAOA 3FHLA 2OBYA 4MYDA 4GM4A 4MGKR 5EFZA 3FMFA 3BMQB 2Z57A 2G76A 1BA2A 3JPYA 3O4VA 5TMEA 3QEBZ 4V0ME 1N0VC 5F51A 4D0NA 1ZJ6A 2PRSA 4HAIA 1JSLA 2F90A 5TGZA 3OO0A 4Y6QA 1FUYB 1OZAA 3KTAB 1F2DA 4Y2QA 1X1QA 2GKOA 1XMXA 1GG8A 3H4IA 1GU1A 3ABIA 4LJ7A 2CHVA 3PENA 1UC8A 2R3SA 1EQ2A 1TJPB 3FUWA 3IPLA 2PKRA 3A2NA 3CLVA 4FQ5A 3ZY3A 3A9RA 5J2UF 2VUSA 1H2RS 2ZSHA 3AWIA 3DMPA 3PI6A 1NQTA 4LNHA 4WOKA 4AS3A 3ZWBA 1XQYA 3OTQA 3IUYA 1MIOB 1JLSA 4GX5A 5U4XA 3ZU2A 5JZBA 5JBNA 4ZMSA 1PJ2A 2OBXA 4HQOA 1Z13A 2HBRA 5CLQA 1PBTA 1KZ7B 1KYWA 1PWEA 2FMXA 3MUEA 3OCZA 3O8DA 3WYNA 5JD3A 5KVVA 2QOEA 4A8JB 2XNJA 4DWWA 1YONA 1PLKA 4JXZA 3T38A 4IEIA 2XJ4A 4DG9A 4RGVA 3EZ2A 4OKIA 1UK6A 1XZKA 1NXTA 2HV8A 2P9EA 4GMGA 5AKIA 2HTEA 3QKRB 3RAGA 2PU7A 4HG2A 3B1ZA 4LY6A 3TRDA 3KB8A 4HN9A 1AMOA 1C80A 4MDHA 2ZB8A 1JRLA 3R0ZA 3KQPA 1BVRA 1DOHA 4L73A 4OYYA 4EVSA 1NI3A 2JLAA 1L5OA 1RDFA 2GN2A 3KYJB 3OMXA 4HQRA 4LX0A 4ZDWA 1BW9A 5LYYA 5K8LA 3H2IA 2JCVA 4OK3A 4CR8A 3RC8A 1JAYA 3R7FA 2PBFA 2HIAA 2QVYX 3I2YX 4W6QA 2OILA 1MB2A 3ROTA 1KZYC 1H2XA 4M0CA 3GMDA 2F8TA 2BDEA 4IYJA 4BLPA 1MGOA 2H63A 3THXB 2G71A 3TIVA 4HDMA 4P54A 3LD9A 1LW6E 2CSXA 3JQGA 3NONA 3UTCA 4AO8A 1QU2A 2L2QA 4Q3EA 4QXPA 4QWWA 1K97A 2QT0A 4FHCA 4QQRA 5B58C 4NE7A 5AKLA 2VJYA 3ETLA 1RWPA 4OSPA 1MO6A 4KE9A 1I2DA 1NQUA 2MIIA 2X0NA 1G5FA 2R48A 3LSYA 1ZK1A 5DOVA 2M32A 5IKOA 4X95A 1HX7A 3LBAA 5CURA 2PH3A 3HCAA 2B4KA 5F3DA 3UMCA 5IKPA 2Z0MA 1FS5A 1YJBA 2OO5A 2R79A 4L28A 1BXKA 1A9TA 5DTJA 2UXDB 5I5GA 3PYMA 1YOBA 4AJOA 3K5WA 1GUBA 3JVIA 4C76A 1JEAA 3EC7A 4AICA 2V3CC 3DO6A 1K6JA 1WEKA 2C61A 3UVEA 1CQJB 3MPOA 2H2GA 2REOA 2FUKA 2IUUA 2KLBA 3G2QA 2LPMA 3TKYA 1FRNA 1TEZA 1B6SA 4KBFA 4MA0A 5B2FA 1ZK3A 3V1KA 3BJEA 4X3OA 4KP7A 1E58A 1YASA 2E4YA 2OTCA 1U81A 3M2TA 1XZAA 3TRKA 2NP7A 3IIIA 1E3MA 4CTJA 1VKRA 2FUNB 3LUGA 5DLQC 3GRZA 1MVLA 1IN7A 5DXFA 2WYHA 1CUBA 2CVHA 2ZBRA 2FV8A 2PRIA 4IGFA 3VPCA 4D5GA 5JAHA 3QY0A 1P74A 5ALYA 5FOXA 5HZHA 4OX9Y 2JIOA 3C1AA 1IIBA 1VJTA 4Q9LA 2J59A 5HE9A 3B52X 5TY0A 4DKJA 2WWHA 4FBMA 1UMCB 2CMFA 3A4MA 4U2BA 3WNQA 1G7RA 2APJA 1YMQA 2C9CA 2SKDA 3PNOA 4GR5A 4EHIA 3BGVA 5TPZD 1WY5A 2VBGA 1K7FB 1RAHA 3HUTA 3JQAA 4H2DA 3LT4A 3SX4A 4TZ0A 1FY2A 3DJYA 3R24A 3JAMA 1D0VA 5BWBA 4JN6B 2B30A 2EYUA 4NNPA 4EKYA 5JMOA 2LV8A 3UKOA 1GQRA 2EKQA 2Z8XA 5CX4A 1EA5A 1FF9A 3D8NA 5E6UA 4BNUA 1G3IA 2XKBA 3WFIA 4E46A 3CZ9A 4PBRA 1P7VA 1I8TA 3KSRA 2PPLA 3NTUA 2NYRA 2P5YA 5FWAA 2NU7A 1Z88A 1ZH2A 2BCEA 2CCGA 5EJ2A 3G7UA 3V8MA 4ZAWA 1DG9A 2FU5C 3VM6A 5JNTA 2H9YA 3I2KA 4LYEA 1QLHA 3I2FA 3HZHA 5JH7B 1S8NA 1E5XA 1XQ6A 2GD1O 2RHGB 2HU8A 2VDQB 5D86A 5I9MA 5KJEA 3VR3A 2CE7A 3JVUA 1LVUA 2BE7A 3EZFA 4QT4A 3WOVA 1UMDA 2FJ0A 1KIMA 1LI4A 4JASB 3R3VA 3QX7A 1X1DA 1X39A 4KAAA 4LVUA 1U4NA 4KRFA 2DGDA 2A94A 2VLIA 4DR2B 4FHGA 4OHOA 2J7PD 2E48A 3QMWA 3ZV7A 1X7YB 4DLKA 3OZCA 3WDMA 2Z1DA 4MQLA 2R96A 2OXEA 3RBZA 3J81A 3ND7A 1SCDA 1ZM9A 1FLNA 1W5BA 2XOKD 5KQPA 3WHKA 2ZTMA 4UEQA 5LOVF 2BBWA 4TV8A 1II8A 3DLTA 3NT4A 2J3IA 3BE4A 1E2NA 3IRUA 1I0ZA 3JWHA 6NULA 3OI7A 1UDCA 4R2KA 4V2IA 4F60A 3SR3A 2P4SA 2YHUA 1H0SA 5G4KA 2X0EA 2PA0A 4KIFA 5TMBA 1P17A 1C7RA 4HLUC 4AF8A 5FPPA 4DBZA 2BM9A 5DM70 4NBLA 1H2HA 2PUCA 4EI7A 4QZVA 1JXAA 1HE5A 1KPIA 3OMWA 5AK0A 4ZVKA 2PZBA 5FPYA 3IMGA 2MYPA 1QSGA 3RHSA 4D8VA 4FLMA 2WG2A 3G0HA 3P0FA 3ZCSA 4D3XA 2FPUA 1HPLA 1PV2A 5HIKA 1KVSA 3HO8A 1E2LA 1XU4A 3EFHA 3JWIA 4RZXA 4X90A 4Y6OA 3UANA 3W3AH 1U8CB 2W98A 4CU2A 4HDAA 1GTZA 2PLNA 3JASA 3PP8A 4MAFA 2BFNA 3Q7EA 4I4TA 4UM8B 1Z8FA 3NPAA 4O6VA 13PKA 2Q62A 1SUAA 1V7CA 5FOUA 3NTOA 2G9RA 1Y9AA 1SN7A 4KMMA 4NFYA 2R5WA 2NU6A 1T0BA 2F3SA 5LQRA 3OF2A 1EBFA 1XVVA 4E2ZA 4L27A 4CMIA 3L4SO 3NP9A 3RIYA 4REOA 4H16A 4UOZA 3EVGA 4CTOA 4B76A 1CYEA 4XDYA 1G4UR 4K9RA 4DM7A 4QGFA 4JIGA 1IBMB 1P1IA 3OE7A 4I0WB 4PQGA 3BIJA 3F90A 1AGNA 4YMWA 3EE6A 2JLUA 3ZCQA 1Z7YA 3U60B 3FMIA 3HADA 4PQFA 5J2TF 2AFHA 2H51A 2QKYA 3INGA 4NZYA 2PZMA 5CDGA 5EXTA 4YDRA 3ZIAD 1NBWB 2WYVA 4MR8A 3G17A 4WZBA 1YQUA 1CP2A 5A3RA 1DEHA 1K3TA 1N25A 3E1KA 3OCXA 4G07A 4HFNA 3TW8B 3V2GA 1EX7A 1U2QA 3DZHA 1T5IA 4P7KA 3VYUB 3CLSC 1ZJYA 2O0HA 2EW8A 2WT8A 3D4BA 2VNSA 3K09C 2ZJ1A 1WPQA 3MXOA 4M8NE 4B71A 6ABPA 3RBVA 3UWPA 1RACA 3NCTA 3LFUA 5CK5A 1I4LD 3MT7A 4TV9B 2IHVA 2O5VA 2QZPA 3R0IA 2COKA 1HQYE 3PTAA 4EVIA 1WA5A 1T29A 4X20A 3W5SA 3HY4A 4QEDA 3AKZA 3THYA 2V9PA 2C9BA 4QTYA 4C0QC 4ZZ3A 1SBNE 2TS1A 4H7DA 4KTVE 5CW1A 1CE8B 1E2HA 2FPSA 3IUJA 3T7SA 4HNUA 3IEMA 1UBKS 3I5XA 4F5WA 4GEGA 2GVDC 1VQ1A 4W1PA 4ABYA 3UJHA 2V9ZA 3T9DA 3QVVA 3Q12A 3PITA 4W82A 1ZPDA 1NFFA 3A9UA 3ET4A 4RFSA 3RC1A 1AHPA 1M7BA 1QMPA 1R0YA 1GY8A 3DOIA 5AKYA 1IQ0A 4F71A 2QN6A 3A6FA 5JRZA 3OTGA 2O3TA 2PBLA 2FZWA 4II7A 2HLDD 3W6NA 4DADA 4MW9A 1D2MA 1JU3A 5EWJA 5G1NA 2WD7B 3KKMA 3TE7A 1DFHA 2OUIA 1TYAE 1IXKA 1VIMA 2L18A 3NM5A 3PT9A 3FAKA 1RCUA 3UICA 3H1BA 1K8XB 3T0IA 4YJGB 4U7HA 3OIVA 1ABBA 1FNNA 1CZRA 3W6UA 2DQYA 2YZKA 1I14A 3A3YA 3KDPA 3Q40A 1T1GA 1D8TA 1V43A 2XUZA 1R6XA 3P9KA 1ADCA 5I9BA 4BNLA 3PX3A 1YBAA 4QM7A 1C1YA 2GJ9A 1YJ5A 4G1CA 4X8MA 3RVBA 1NMXA 3PYXA 4ZGWA 5DK6A 4J1QA 4ITVA 2QSUA 3SYTA 3BBPA 1L5ZA 5KYWB 2NUPB 2OKGA 3OEWA 3E18A 3E9DA 2CVQA 2X5JO 1DIBA 3JSAA 4POOA 4HDKB 2C31A 3R20A 3NUQA 3NYIA 4TKZA 5AJZA 2XCTB 4BMYA 4Q48A 1WXXA 4B09A 4PRYA 1QFSA 3VYWA 4JJ6A 2ZB3A 4X1YB 1EJBA 1Z18A 2FSVA 4RY8A 4UUMA 3KXIA 1PWYE 1V3UA 5FLYA 3WK9A 3T5PA 1E7YA 5L8VA 4P3OA 4BP3A 1XKTA 1WZNA 2FZLA 1KBOA 1LWNA 2XGOA 4K3VA 4BNJA 3C3JA 2PH5A 1WW8A 1NKVA 3QYFA 3GRFA 4N3NA 2HCFA 3HYTA 1I3LA 3B7PA 2QE7D 2YV5A 5F4ZA 2QW8A 1M6VA 3ZZ0A 4IDDA 4WA7A 4WXEA 2YUTA 5DNWA 2X9LA 4N6OA 2HJRA 1CSEE 2FX5A 2H3HA 5CYPA 1X42A 1KQFA 2UXCB 1OH5A 1Z47A 2EJVA 1G6OA 4MIOA 5JS2A 2OPHA 3TX6A 2DWQA 4TZKA 5IXYA 4JVNA 1ECPA 3GLKA 1FE8A 1GOTA 3MCTA 4PZ9A 4TKUA 2AV6A 4XUGB 4LMAA 4FK8A 1WDLA 4WDRA 1RKBA 3GCWA 5CXQA 2CKMA 4M54A 4AX8A 4O2LA 5J58A 2FE1A 4WK0B 1F0NA 1FBTA 1XKQA 4A91A 1LDEA 2QX4A 4C0WA 1IN6A 4YBZA 4MS4B 1E2DA 2GD2A 1AKWA 1WKVA 3L0PA 5AT1A 5KHOC 5ALWA 3OJWA 3P4YA 1SIOA 3KNZA 2V0CA 2PD4A 3DT8A 4NECA 4QGHA 5LC1A 2LZ0A 5TPWA 4BTVA 1A95A 3AJRA 4TKLA 4M1WA 3D4NA 4NONA 5K0TA 3HCBA 4QM6A 5KUTA 5DMXA 2A0XA 1XZNA 3VOBA 3ICQB 3EMBA 2X19A 3JD3A 3JSXA 1YVUA 2YQZA 5AW2A 3DZ8A 1MMFB 2Q6OA 3QKIA 1BAPA 4TRJA 4B8WA 3HCFA 3MTIA 1BDIA 2FWNA 1DBSA 4XFDA 3DNPA 3NQ41 4LS3A 2ZYRA 2AX4A 4N39A 4H6VA 2XTAA 3ID6C 2V54A 1Q3KA 2ZUSA 1JR3D 3BB4A 4MB0A 2ZE7A 3T5CA 5EUQB 2CK3D 2GRUA 3HUEA 1Z5GA 4CKXA 1SC1A 1YL7A 4JYBA 2JI7A 4H35A 1TUEA 3AIMA 5AXDA 4EA7A 1OB2A 4LRXA 2VDWA 4CQNA 3IURA 4LCEA 1RLMA 3L2OB 5EJ7A 1JYFA 4YMGA 3WIBA 3OQ6A 4BHTA 1I9GA 4PNHA 3L0ZA 2LUOA 4HPJB 2H29A 1H6DA 4XAQA 5C2JB 5T4HA 2C4TA 2FNAA 2DFDA 1DX9A 4AF6A 1U3CA 2P9QA 1NXWA 1OFUX 1OFGA 3Q1KA 4PQYA 1UIRA 3E7XA 1V9CA 1CX9B 2WEKA 4RPGA 5KSPA 4DLWA 2FY8A 3OURA 1T9ZA 1AY0A 1P73A 4LC1A 2OR3A 2PK3A 2ZGVA 3GPIA 3NALA 1FMJA 1Q12A 4P4LA 1SUPA 2KWIA 1FZTA 2FPGA 2FR8A 2O23A 2VF7A 2H1FA 2G4CA 4K28A 2F8SA 1RKQA 4KXQA 3DGFC 4RK7A 3CS3A 5JAMA 4P32A 3PQ2A 1EDZA 1ADYA 1TLFA 2QMHA 2XQJA 4N0EA 4UPDA 2HYDA 2CFCA 1RKXA 1FSSA 4TXMA 2WG0A 5DYWA 2C88A 2CL5A 2VLBA 3HYNA 1CUFA 1K1EA 3QP9A 3G82C 3DDNA 1QC5B 3HGQA 4HN4B 1ZJJA 5JSFA 5IJ9B 2WF6A 2JRLA 1Z28A 1Y3IA 2IYTA 4AWXA 1L5MA 2E4AA 3BRWA 2GBGA 1NJ5A 3NVAA 4ZVUA 3IDAA 7YASA 3I5YA 1J21A 2P4HX 2O48X 1A69A 4MV0A 5DF1A 2PZEA 1Z6QA 4NOJA 1F4VA 2QUKA 4BX8A 3FYUA 5HSGA 3SR4A 4WNAB 4FWIB 4PGFA 3K9QO 1WMBA 1KBQA 4UVDA 3VPBA 3OX2A 1WBBA 1JJAA 3A37A 1C14A 1UOOA 3TIGA 1S2IA 4LDQA 1PI3A 1AK2A 7MHTA 2OORA 4QC2A 5E1BA 1SUSA 3AKDA 3RVDA 4BEVA 3M4NA 4MUIA 1ML4A 2GM9A 3KPVA 3OAAA 3VGPA 3W6ZA 3ZOZA 5IYZB 1ODSA 1E2GA 3NNNA 4CTNA 1LDYA 4V1CI 3N7UA 1A7AA 2JASA 3OJCA 1KNQA 4LUCA 1EJ2A 4AXXA 1XZMA 2IZOA 1YCHA 5AFSA 4LRTB 4V3BA 2YIVX 2IEYA 3MWGA 1WEHA 4LKRA 4M9RA 2CJFA 2OAEA 3RJTA 1DV1A 4MW1A 1NOJA 1E6WA 2FW7A 2GEBA 4KUGA 2V4MA 2XR1A 5A1TA 1JALA 1OXMA 4WLOA 4E1BA 4MKHA 1BKSB 2GO1A 2Z95A 4I50A 4D3DA 4J94A 4NWIA 3MINB 4WLFA 4JL6A 4B34A 3DZJA 3UFXB 3BILA 1VZ3A 1M6HA 3ESDA 3U7IA 1W46A 5K03A 4IICA 3TIXB 1OKKD 1ZESA 4YK7A 4XYEA 4N5DA 3U7GA 1A3CA 2V96A 2PKYX 1OD6A 2QTVA 4OM7A 5IZCA 4D6XA 3OPMA 3Q15C 3IE2A 3GLIB 4YUXA 4ZDJA 4MR9A 2K7FA 1K8YB 3WLMA 3A4YA 4ZYLA 2F3QA 2XI4A 1NQAO 3R5HA 4DEYA 3NRJA 3MW8A 1MX9A 5EL0A 4QA9A 1S2GA 3U13A 4ZEMA 3PLNA 3N2KB 2VJOA 4GL2A 3QVGA 1OVGA 1J5PA 2I22A 2VG8A 4GNKA 3ZHYA 4D4IA 4UQOA 1T26A 1VKHA 1XJWA 2HIHA 2WJYA 3GWGA 3PPVA 4IY1A 3TTWA 1D5WA 5M04A 2QXTA 4L75A 4AMYA 3BJIC 4DA8A 1LC3A 3DP9A 3K8YA 2QM7A 4EDHA 5KTMA 4PG5A 4X6XA 3KV3O 1J0EA 4K03A 1JW9B 1KC3A 3MSXA 4BYMA 1PT7A 4KYVA 2HHHB 4M6WA 1CG6A 2IHTA 1ZXXA 3CW8X 2B61A 4YP6A 4JUAA 4NS1A 2ZWPA 3HG7A 1F6WA 1O9BA 1YKFA 2O3RA 1EHCA 1OGIA 1VJCA 3K32A 2REQB 4PHFA 1G4HA 1TK2A 4XM0A 5SYMA 3TLEA 1MRNA 2ANCA 3WRYA 1L6IA 3CEPB 1JIXA 3DL2A 2BFFB 3M81A 4TLDA 2A4MA 4TT3D 5KKAA 2B0CA 1YZKA 3M4ZA 4Y9DA 1N57A 5J47A 3ENVA 1E64A 1JAXA 2A5JA 2W4QA 2ZJ3A 2ZRAA 4NH4A 2XUIA 4Z5XA 3ZGZA 3P2IA 3WMRA 4F4HA 1S4QA 3I01M 5KOHB 1AMNA 1UC9A 2P1ZA 3SFZA 6REQA 3FGZA 3FA2A 4LYFA 2FPIA 9ATCA 2FSHA 4KAJA 4D4KA 5JFGA 2A84A 2I2AA 5KOIA 1QRUA 3H1FA 3QBDA 5F23A 3O4HA 3U4AA 3VNQA 1PT5A 2XDQA 2QQEA 4IR7A 4UUPA 1EXDA 1MA3A 3D8HA 1Z63A 1JZQA 2WIFA 2JKYA 1PBNA 4OGWA 1RQNA 1U8AA 2H8KA 4D79A 3BQMB 2QSZA 4JI3B 2ACVA 1BEZA 1NJSA 2GEVA 1PTJC 4MSUA 1A9YA 4ZC8A 3RYFA 2I4OA 1ZIXA 3B20A 4XCVA 3EFEA 4B83A 4P38A 1ADFA 4DUGA 1HT3A 2X5OA 2Y1KA 3GEBA 2DFVA 5EOVA 1ODKA 2A9QA 3E9RA 3VVLA 2V97A 4OREX 1E2BA 1HL7A 2A3NA 4GZLA 3DEYX 4K9PA 4HYTA 1PSDA 4YQZA 5ANRB 1ZXLA 3K4PA 3NDJA 2DR0A 4F2HA 1X70A 3VJMA 2I7CA 2C57A 4WLNA 4AROA 1U8ZA 1ZHHA 2LCQA 1GCAA 1GKIA 2W0MA 4D2IA 4R1NA 3K5HA 3EMDA 4ZQIA 1PR1A 3DVSX 3B89A 2HF2A 2PKQO 2F64A 3L7YA 1UDAA 1IK4A 1BEUB 4X44A 2FX3A 3SZRA 3VSCA 3GNTA 1G6KA 4MRNA 4REQA 1LQUA 1XA4A 1NMYA 1TVKB 2C9DA 4KQXA 4OLAA 5B36A 4CODB 3FVWA 1E1YA 4C6TB 4MARA 5CCEA 1CY2A 3ESQA 4XWTA 2IRWA 5FL7A 4CM9D 4EY5A 4L8GA 5KTKA 1OAOC 3PDJA 4HOYA 5CDFA 1J06A 1A50B 1MHPA 1Q0ZA 3P9NA 4H3VA 1XG5A 1Z0FA 2XQVA 4FYKA 4WEOA 5JAQA 4HO1X 1OTHA 1VJ5A 3IC5A 5FOTA 3TW0A 5AYVA 3CURA 5KOJA 3OFNA 2IX9A 2BL4A 3SJAA 3W9BA 1ZRHA 3M6XA 4MB6A 1AE1A 4GI5A 4KJZA 1BE6A 4RPIA 5EZSA 3P0JA 1RJWA 5A3VA 1YBHA 5E3JA 1Y98A 2X1MA 3AP3A 4MINA 2NP6A 5FWDA 2GUGA 3ABRB 3Q3IA 4RVNA 3T5AA 1G38A 4X7RA 4KTTE 2UUCB 3M6IA 2ZBEA 1B1AA 1N2SA 2R85A 3H1TA 3IHTA 1BVHA 1SZCA 5FLXA 4KIJA 2XKKA 4NPCA 1IU9A 2X40A 4J2HA 4JL8A 3E7WA 2EX4A 3T94A 1SCBA 5BYBA 3S1AA 4CM7A 3EAQA 3H4TA 1W2HA 4J7CA 5FV4A 5IVKA 3MRSA 1ODLA 1EE2A 2NPFA 2AI1A 2WOOA 3OQVA 1NJFA 3SN6A 5CGQB 1OI3A 1CT9A 3P0RA 4G5XA 3ZW9A 3WSWA 2QAGC 4YHHB 3E48A 3GDHA 3LS2A 4X45A 3UC5A 3GJ8A 2B5VA 2C0CA 2GZDA 2XY4A 2BFBB 2YXEA 1VCMA 2VP5A 2VQDA 4G25A 1A27A 3NVKI 5GQSA 1JP7A 1E4EB 2J09A 2ZS7A 4OU5A 5AQ1A 1VJ0A 4KQ6A 3RVQA 4LBYA 2H1VA 4ZHQA 2Q5EA 3D1VA 4IP0A 4RLHA 4YAFA 3RV3A 3F6BX 4B6JA 2YV3A 4QDOA 1GGEA 4ARIA 4PVDA 1Q6YA 2V8OA 3FKSD 3G1WA 3JATB 3UCXA 1DAFA 4GGOA 2X7HA 4B2YA 5D7NA 1T5DX 2R2GA 5D3QA 3WP1B 4AG3A 3THSA 3PUWA 3GVIA 1TMOA 2XZTA 5AKJA 3BGOS 3OZTA 5IXJA 3ELWA 1KK3A 1EM6A 3PUVA 2HT6A 2WLTA 5JCOA 2HZBA 2VNIA 3QEMB 4A92A 1Y8RA 4DABA 1Y89A 3ZW8A 2FQQA 2ZWAA 1T36A 1NWHA 2QQGA 1JLKA 1P1KA 4JYZA 3E15A 4B82A 3L9XA 4QULA 3OX4A 3Q1LA 3NHFA 2RCYA 1ZRNA 4XQGA 4ZRNA 1W19A 1T8YA 4B4OA 3ERCA 2I1LA 3CVJA 1SKYB 3CLRC 1R0WA 2B34A 2B99A 1AS3A 1ZZGA 4NNJA 3DZGA 4Y9SA 2CXQA 4BX2A 1U0RA 2HLHA 1EGAA 3KZKA 1J49A 4CCWA 1AA6A 2FSIA 1DTWA 1UXGA 2P8SA 4DG8A 1V3QE 4DA7A 1JVSA 3CEMA 5I7FA 4INJA 4NYJR 1I1HA 1UWKA 3ZHRA 2FMHA 3FVQA 2VHQA 3PQ7A 2W6JD 3NWPA 1QP0A 3I0ZA 4WZAB 5JMWA 1ZI6A 1UF9A 2LGJA 2W8BB 2G8NA 4PG6A 1NNUA 1TJ3A 3GR6A 1OLSA 4HWSA 3Q72A 4DMCA 4AS1A 3O4JA 4BCDA 4TTPA 4RA9A 5A05A 3F6YA 4G1BA 1R8YA 2HPHA 4OI2A 2K5UA 3FMVA 4ZQCB 1IUOA 2IV3A 2B7BA 3HKDB 5C0OE 1YT5A 4UDNA 1E1CA 4IGAA 4JSRA 5JY6A 2EG5A 3T1HB 5CIWA 2PWYA 1VPEA 1K7EB 1Q21A 3TDMA 2NV2B 4KQWA 4DYVA 3PC7A 4PG8A 3W5AA 5L4NA 1ZUNB 3BSSA 4BY9E 1HG1A 2AQHA 1RM3A 2VDMB 3ELDA 3SS7X 1YFJA 2PMWB 5A4KA 4FDMA 1EUCB 4HRAA 3TCXB 3HA5A 3F4KA 1B0PA 4FVTA 4FWTA 4FI3C 1RBZA 3NIWA 1LWOA 1EHYA 4EZEA 1RXSA 1V1RA 2BR3A 5AM0A 4D6YA 4TTRA 3H6KA 3AVTA 2QWXA 4A27A 1TF2A 3C74A 2Y1LA 4FZJA 1ZJZA 1DAEA 1YUBA 4RCYA 4NDZA 2QRZA 3KYIB 3PKZA 4Q1CA 2PUDA 1R9GA 4NDNE 1XZDA 3L1VA 4MH0R 1T0UA 2YNMC 2HU5A 4G4SO 1N75A 3OLVA 1BCRB 3L18A 4I14A 4EMSA 1XMJA 2XEDA 2R47A 1N2JA 2GBPA 2P79A 3EW7A 2ZDHA 4JJIA 3WGZA 4LJ8A 4BZZA 2I7XA 2JD0A 4INPA 1ZNWA 2CFRA 5FOWA 4DT1A 2Y0PA 1XRNA 3DS8A 5AM1A 3LXUX 4L74A 2IHYA 3GVPA 5NLLA 4RS3A 2ZVQX 4P93A 1QBKC 1O6GA 4GYKA 1MCZA 2PQ0A 4JQCA 2O8BA 4FJ2A 4E2XA 2J3DA 4GXRA 1RYYA 1U3VA 4XDGA 1OBVA 2W2MA 2PNFA 3SVZA 4CL0A 5LL6P 1GM5A 1X7GA 5A9TA 3HXLA 4YRGA 3ADCA 4N0DA 3CZPA 3AU9A 3HBLA 5L51A 1V95A 1ZHOA 3TFWA 4MVJH 5CM9C 2Z08A 2BEKA 3D6TB 4LY9A 5F64A 4DWOA 3UH0A 3WLSA 1MEOA 3NG1A 4O08A 4U2GA 3UMBA 4XXHA 2OQRA 1RAAA 3ROPA 5BV8A 5HOEA 3BXEA 3MAGA 3WK6A 1SFRA 2A1TR 4HHEA 1F0KA 1KF0A 1QO0A 1ZMRA 2Q9CA 2RHDA 2V5VA 2UZAA 4TWRA 4D42A 8LDHA 3G2MA 1E20A 4Z6KA 3TF5A 4UM5A 5DU2A 4IDBA 3PXDA 1L7PA 2P11A 4GWGA 1ODTC 4RHFA 1RYBA 4JLUA 4OYLA 3JQ8A 4PHGA 2JH9A 2N3ZA 1CY1A 3DE6X 4KPUA 3HHEA 2Y77A 4ZT7A 3FYCA 1T43A 4GF5A 2ZAYA 4XLLA 1SWVA 3FZNA 2CE2X 1ISJA 4PAWA 3GBPA 4KR3A 4C6SA 5HJ5A 3VR5H 3BMNB 1ZJWA 1ZH8A 2C8KA 1J8YF 1H5UA 2YN0A 4EG4A 2QSYA 3JWPA 1E9EA 3QELB 2ZVDA 4JODA 3OQ1A 1N92A 3IBGA 1OLUB 2IYRA 3A4NA 1ZK2A 1Q2UA 3HV2A 4J76A 1GXSA 3BRWD 4DTIA 1K3FA 4TXNA 2FMTA 1BYIA 4QSMA 1D2HA 4W5RA 4KVZA 4C3OB 4ZZIA 5CFOA 3L1UA 2NTJA 4HMQA 3AUTA 3OFKA 4A2WA 6GPBA 1WXQA 3GROA 2LKDA 2ZCVA 1NKSA 2PO7A 2PX6A 4HUQA 3UWDA 1MVNA 3RUAA 3OT1B 4D4JA 1T8TA 4MEBA 5A2QA 1K9VF 3BGDA 2QI9C 3NOQA 1QIGA 2OHOA 3WLIA 3LC2O 1AOXA 1CS4C 1RQLA 3H1PA 4Q4JA 1KE1A 3CPJB 1GFWA 1OXVA 2P2GA 3GBSA 3IB6A 3NBYC 1U1DA 1E2FA 1TUIA 2WA1A 1TIBA 4FFVA 4PG4A 1IH8A 1FPQA 2ZSIA 3WK4A 2QMZA 3V80A 2BI8A 4WBNF 2RJNA 3M2PA 1PR2A 4NJMA 1QHIA 3WLEA 4B8ZA 2PUJA 1TDJA 3REFA 3D8SA 4P3YA 2H7CA 4V38A