1B1CA

Crystal structure of the fmn-binding domain of human cytochrome p450 reductase at 1.93a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
b'SSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NADPH-CYTOCHROME P450 REDUCTASE)
publication title Crystal structure of the FMN-binding domain of human cytochrome P450 reductase at 1.93 A resolution.
pubmed rcsb
molecule tags Oxidoreductase
total genus 62
structure length 166
sequence length 166
ec nomenclature ec 1.6.2.4: NADPH--hemoprotein reductase.
pdb deposition date 1998-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b1cA00
3NHJA 4ESEA 3EDOA 4FX2A 3NHPA 3LT5A 3F2VA 2HNAA 2M6RA 1XI2A 5FX2A 3W77A 4H2DA 2XODA 5LBTA 3GFRA 4ZVLA 1WSWA 1AG9A 3W78A 2Z9CA 1ZWLA 3F90A 1CZNA 4LTNA 1AKUA 3QE2A 1SQSA 3FNIA 2QWXA 2QR2A 4GQIA 5B3KA 3B6IA 3OJWA 2FOXA 3KAQA 2W5UA 1OBVA 3HA2A 3ZHOA 5LVAA 5B3LA 4U7FA 2RG1A 2N1MA 1QBGA 4PU0A 1C7FA 3NHRA 3OVMA 3OWHA 1RCFA 1OBOA 3W79A 1E5DA 2A5LA 2KQUA 1VMEA 2QX4A 4ZVMA 3O2NA 4R81A 3NFRA 5F12A 4Y7CA 4ZVNA 1AKTA 1B1CA 1J9EA 1AKWA 3KEGA 3KAPA 1CZOA 3ES9A 2KLBA 4XDHA 1YKGA 4LAFA 4FGKA 4QOFA 5F51A 1QHEA 2BN4A 1AKRA 2XOEA 1YDGA 2Q62A 1RLIA 3GFQA 4M0CA 3O73A 2ZKIA 3L9WA 5FA6A 5EMNA 2FCRA 4YQEA 5FUQA 3JSXA 2V5VA 4YAWA 2R96A 1X77A 1YCHA 2FX2A 2FZ5A 4N9QA 1CZLA 1YOBA 4FGJA 5ULLA 4LA4A 2ARKA 4C0XA 3OWXA 4FGLA 3W7AA 3R6WA 4CF6A 4HS4A 1ZWKA 1KBOA 2FDXA 5EAIA 1RTTA 2BMVA 5LLDA 3NHLA 3FJOA 3EYWA 1T5BA 1TIKA 2FLVA 3FX2A 1XT6A 2MWMA 4LTMA 4N65A 3UXHA 5LMCA 1J8QA 4C14A 3QFCA 4C0WA 1RLJA 3RPEA 3D7NA 1H69A 3NHYA 3NHKA 4QODA 4N82A 1GG5A 1QR2A 1AZLA 4GI5A 2D5IA 4ICIA 2HPVA 2OHIA 3UXEA 1BVYF 1ZX1A 2Q9UA 3K1YA 3FW1A 4YAFA 3OX2A 4YAOA 2WC1A 4PTYA 3N39C 4NLLA 1DX9A 3LCMA 1YCGA 1YCFA 3QFRA 1FLNA 2R97A 1I1OA 2FZVA 2X2OA 1OFVA 3GFSA 3ESYA 5NLLA 3S2YA 1YRHA 3P0RA 3SVLA 3U7RA 4DIKA 1V4BA 1JA0A 2Z9BA 2B3DA 1J9ZA 4C76A 4QOHA 5JROA 2Z98A 4H6PA 3F6RA 2MOKA 1SG0A 1CZHA 4F8YA 3TEMA 2M6SA 3U7IA 4LTDA 2QMYA 4CETA 4U7GA 4U7HA 1FLAA 1D04A 5F4BA 2X2PA 4QOJA 3L9XA 3OX3A 1FLDA 3GAMA 2MTBA 2V5UA 6NULA 2QX6A 4ZVKA 5LBUA 3NHFA 2AMJA 2HNBA 4HEQA 2MT9A 2Z9DA 5LJLA 5A4KA 4Y9UA 1D03A 4BMPB 1FTGA 5BUCA 3ESXA 3B6JA 4OXXA 3KLBA 3NHWA 1C7EA 2FAXA 2V9CA 2OYSA 5LJIA 1FX1A 1DXQA 1AHNA 3HLYA 2GSWA 3TZBA 1AKVA 3N3BC 1XYVA 1TLLA 5EA2A 1FVXA 2BZSA 3G5MA 1CZKA 1BU5A 4J8PA 4YALA 3TE7A 3ESZA 1WSBA 3OJXA 1JA1A 2QMZA 2BPOA 4QOEA 2BF4A 5TGZA 3N3AC 3F6SA 2OHHA 1J9GA 4D02A 1D4AA 4DILA 4NULA 1F4PA 1H66A 1NNI1 1FLVA 2QX8A 3OX1A 2OHJA 1DXOA 2F1OA 2QX9A 4QOGA 4QOIA 4YAUA 4Y9RA 2FVXA 3HR4A 3NHUA 1KBQA 3B6KA 1AKQA 4PTZA 1QRDA 3NHSA 4XDGA 5NULA 1CZRA 1XYYA 1AMOA 1FUEA 3NLLA 3K20A 1T0IA 3FVWA 4S24A 3B6MA 4GR9A 1CZUA 4DY4A 4BMOB
chains in the Genus database with same CATH superfamily
1XAIA 1IM5A 2ZRMA 3ESAA 3NHJA 4RGVA 3TIVA 2VKTA 1M5TA 4K46A 5DNWA 5KOHB 3QU5A 2AR7A 3Q2IA 4M9RA 4CMEA 3NYQA 4WK6A 2FEKA 3FAZA 2I87A 4RZ2A 1U4NA 2A1TR 1DRKA 3EMKA 4ER7A 5AD1A 2YWFA 3PFCA 5BV0A 1M2OA 2OC4A 1NQ5A 2VF8A 2O14A 1CR1A 1N6IA 2G28A 3W5HA 4KRYA 1TEHA 5FI5A 1P60A 2QTVB 2RAFA 2RGAA 1GO2A 2LV8A 3OIGA 3R5TA 4JBLA 4KO8A 3O9MA 2HMSA 1P7VA 3P9YA 4FHEA 1EX1A 1NLMA 3EZGA 3FPAA 2FQQA 3QX9A 3VI3B 4JCCA 3BDAA 4ZICA 4EGCB 5HCNA 3QTBA 2WF6A 4M60A 4NJOA 5BNIA 2NYVA 4RMGA 3I1FA 3TUJC 1GPBA 1KAMA 4RHCA 1QFJA 3WMXA 3ZDZB 5K6TA 4CPDA 4CL0A 3GRPA 3L92A 3CRQA 2X3UA 4MV5A 2X8AA 2J6IA 4FOOA 5J9FA 3ONFA 4CKYA 4UM7A 3A58B 3REFA 3RAPR 3BBLA 1PJRA 2BMEA 1M54A 5EMLA 1KEEB 3H2IA 3PDCA 1AD2A 4WCFA 4E11A 1J42A 2C04A 1OXVA 4OHRA 1R5JA 1B0AA 3IX7A 3NX4A 2CD9A 4CM5A 5AM1A 1L1QA 3NBQA 2IHNA 5H4HA 2R8ZA 4BWGA 1XL0A 1RQLA 2CZGA 5L4LA 3KOXA 1A97A 3DUWA 4CNQA 1KO1A 3BJIC 2V7VA 5JVDA 1P18A 3BE6A 2HAEA 3MRTA 4MKRA 3A31A 4IDFA 3SQMA 3AFIA 2QQ5A 5JT1A 1E6WA 2ZYIA 4XWGA 3B1XA 4DTCA 1N5DA 5CFLA 2XB4A 3EGDA 3PNMA 2BDUA 2MINA 4FR2A 5TT0A 3T4EA 1LX7A 1GKIA 3HJTA 2UXCB 3CVUA 3CSDA 5C1IA 3NTXA 4P2GA 5K2MA 4V0ME 3T1HB 1BDIA 4D4IA 2I66A 1G21B 1V1JA 1R00A 3RVDA 3OZUA 2O7QA 4HS9A 3SHOA 2O8DB 5SZHB 1O9HA 2HMTA 3HUUA 5K01A 521PA 3QU7A 1N6NA 1SBYA 1UK7A 3TH5A 3EVZA 2WWIA 4H16A 4BEJA 1D0IA 2C4VA 1JBQA 4JI8B 5CNMA 2NZXA 4F9EA 3FPEA 1DSSG 1SXJC 2FSVA 2R8PA 2X8LA 4RLQA 3CO5A 3H18A 1JFVA 1LDGA 3NFRA 4PYOA 1I7SB 4A8HA 1TZBA 2XA2A 3G2LA 3JPWA 4RTOA 1YR1A 5K0NA 4FIZA 3JASA 1AS3A 2QXUA 3FNGA 1IEXA 2YUIA 1UJMA 3ANMA 3FPBA 2WYOA 3PPIA 4GKBA 2J09A 5CK4A 3BGDA 3DLCA 4EDHA 4WESB 2IYWA 4GG1A 4EQZA 3KEGA 1DQZA 4D2IA 4Q3OA 2QJFA 1Y98A 1Q0PA 3IVGA 1GM5A 2PFKA 3KAPA 3ZWWA 3KEQA 2KS6A 5DNVA 2E5LB 1XTQA 1S1CA 2SKCA 3L6CA 3V4ZA 1YB1A 3UATA 3T9CA 4B3FX 2CFTA 4Z1MD 3EPPA 4PYRA 1DKMA 2Q3MA 2AWOA 4XD7A 1ONPA 2V8BA 4O2AA 3T0FA 4EPWA 3JQQA 3GFFA 1Z34A 2B9EA 4X9XA 3ND6A 3LC0A 2BN4A 1V39A 2G88A 5L7TA 4XWAA 2GN9A 3L84A 3K31A 4B8WA 3BL6A 3GLQA 1DO0A 3IEIA 3NIDB 1DAIA 3OMWA 4JLAA 2DY0A 3E9ZA 3EWSA 4RBNA 5CGQB 5ALFA 2YJZA 3VDMA 4CU2A 2HGZA 2YZ2A 4YJ2A 3BPSA 3FHOA 4YAGA 1X86B 3FJYA 1SUFA 3GLRA 1N6RA 2F3RA 3NATA 4PSUA 4LJ6A 4UNIA 4XJTA 1L5WA 1LUAA 5A71A 2NN3C 3EMDA 2Q5IA 1Z2AA 2JKYA 4ND3A 3OKCA 2QTTA 4IXMA 1U9IA 2JRLA 1DZ3A 2ZT7A 2F17A 4FMBB 4CM9A 3IO3A 1QIGA 2JCXA 1TQ4A 2ZTMA 4JJFA 7GPBA 2XB8A 2WHPB 3E22B 3GRVA 3JWJA 2YV2A 1ULHA 2OO7A 1Y3DE 1MXHA 5ERYA 4MR7B 1SHKA 4NMLA 1NBIA 1USVA 2RI6A 3L82B 3AJ8A 2PPVA 2B37A 2GOYA 2ZQ5A 5EY5B 2IWHA 2P4SA 4R84A 4IJMA 1X7HA 2OYCA 1UL1X 2ARKA 3IAS6 4KE9A 3GRYA 1N7HA 5AOCA 4LWPA 1ZUNA 5FHQA 1XNJA 3T3NA 1UQRA 4S04A 3A1VA 2GBCA 3KHSA 1I2MA 1M1YE 3JQBA 3BHNA 1EM8B 3LL7A 4EG7A 3CH4B 1QYCA 1IHDA 3Q0TA 4DSZA 1IC6A 2RJOA 2M6LA 5J4VA 3KYJB 5I4CA 1CY0A 4OB7A 3UAYA 2OO3A 1JFFA 4H6VA 5ALNA 1QIJA 2NWQA 4XGIA 4ACAA 5LLDA 4N5HX 2P6UA 2JVKA 3AKZA 1JR6A 5IUJC 4DCCA 4FYPA 1PGOA 4DUZB 1NBHA 2CZQA 4DCNA 3B51X 2XB6A 2JPDA 4LRQA 2HTEA 1V6CA 4UJ5A 4WFQA 2QLLA 3QPBA 2CMGA 3KT6A 3U44B 1FP6A 2OZLA 1T10A 1CR4A 2YMQA 2GDJA 4UPVA 1YJXA 5B4VA 3QU4A 4JXXA 3V8BA 4MYHA 1BE6A 3ECSA 3QK7A 3I5YA 2A7QA 3FGZA 1J09A 4PLWA 4EJ6A 2PJRA 2BFFA 4YMWA 2C31A 1JSZA 1UM8A 4MZDA 2A5FA 2BI7A 5BSGA 4AJ4A 2WTUA 2HRQA 4L8LA 2XXBA 3OCZA 1CUVA 3GOQA 4ESVA 2F3PA 3RIMA 5ICCA 2ZPAA 1E4EA 4EG4A 4DLSA 2EERA 4Z3KA 3R7FA 3ORYA 1UDBA 2G4LA 1E6LA 2G77B 3BRWA 3MD9A 1H69A 3D2BA 5CK5A 3X1YA 1W35A 1X7GA 2W6NA 2IFTA 1A4RA 1YJCA 3NWEA 3PWTA 4LNUA 1QV7A 3U81A 5AM4A 4XQ9A 1LRLA 1TAGA 2LPMA 4K6HA 3CUKA 2QTFA 3UEOA 5JCOC 1JLLB 1KHHA 1ULUA 4GE0A 4MQEA 4GR5A 2YASA 4C78A 2XR1A 5CB8A 4E07A 1JG1A 3OM8A 4F5YA 3DB1A 4ZYLA 4YRTA 1GU7A 2AI2A 1JHOA 3KTFA 4BN4A 1N3YA 2XXJA 3KQKA 2W2TA 1HBJA 1HKHA 4GBJA 2W58A 3CT6A 4RY9A 1S3GA 2EIXA 3PITA 4LXQA 5K99A 4LOJA 2IV7A 4DUGD 2EYQA 3L4BA 5F2EA 1C7RA 3OSZA 4DXAA 4FZRA 2VZEA 1ZN7A 2ZI5A 2GXAA 1UCFA 2OBBA 1NI5A 3QXGA 3X43A 5CD9A 3PGA1 5M5BA 3RRJA 2NXCA 3KXPA 1QFSA 4BVKA 4GOJA 1M74A 2EV9A 1BVYF 4I1VA 5F7ZA 5BRJA 3O83A 1Z5NA 3PC4A 4RWEA 2ZSKA 2RJ3A 1QAQA 4KQJA 3QSGA 5BV2P 5CCEA 3PC8A 1KVTA 5C4IA 3S2SA 3A25A 2ZSIA 1N4AA 5F7XA 2XDYA 4S1WA 2AZXA 1T9BA 1XEXB 5ALVA 4BV8A 1KF0A 2RHWA 3FCXA 4HOYA 3KYDA 1KDYA 4WE3A 2X86A 3I9KA 2VWQA 3M82A 1G8AA 3MTDA 1NP7A 4E3WA 1KFBB 5LOVA 4NLLA 5KTNA 1P33A 1PWZA 3PJEA 1JHMA 4PFQA 4ZYVA 5KSZA 5LSAA 1HDEA 4H59A 1J0EA 4G1VA 1FLNA 3IP6A 4NJMB 2YHIA 3G2MA 4XYLA 3BRQA 4LFBB 1Y33E 3F6CA 2FZVA 1WLYA 2QKYA 3ASVA 3STVA 1AQJA 4G2NA 2Q3FA 3OHSX 4OA5A 5ECWA 5FLKA 4YGXB 3ESYA 3KSZO 1E2KA 1Y6JA 2I4LA 3T5CA 2BLNA 1DQSA 1M66A 1ZM2A 3PIDA 2WUDA 3VHXA 2AHOA 1OLUB 2W0MA 4YP7A 1N0HA 3O7WA 4B32A 1RJDA 2P4HX 3VC3A 1FJXA 4AN4A 4OG2A 4PAWA 5GJWC 5K3SA 4F2PA 1VRCA 2ZRQA 2RGWA 4HLUA 3HO8A 2WWHA 5FBVB 5IDQA 3FYTA 1KI3A 2NO4A 5BW4A 4IQGA 3OFND 3NWJA 4ZYWA 1RACA 5KNBA 2ZJ7A 2CCGA 3ABQB 4OAQA 3JY6A 4MHTA 5HK8A 1FUKA 3I8XA 3LY8A 3S55A 3KKPA 2G72A 2AI3A 3TAXA 3IMGA 4KLAA 1FMFA 3AR8A 2R47A 4N18A 4ZVPA 1VJCA 4CETA 2HLDA 5IJAA 3VR3D 5TNXA 4UBKA 3IEPA 4NONA 1FFBA 4LF8B 1EBFA 1DC5A 1ONSA 1EWVA 1OAOA 5T4HA 1ZBDA 2LP4Y 5U4QA 4BQFA 1G63A 3SXUA 3DHYA 4EYKA 4KWTA 1ISJA 5EEHA 4D44A 2PO7A 3GRKA 4JYCA 3DBRA 2F9LA 4OEHA 4EUEA 5LBUA 3RBAA 4NFLA 1V5WA 4QHSA 1O6FA 3WA6A 3IDZA 4O59O 3NIBA 4IIHA 2VF5X 1AGPA 4PO1A 5B7PA 1V41E 1HZZA 5EP4A 1R0SA 1ISHA 3DUFB 3DMFA 1VCMA 5GZ6A 1NDHA 3N59A 4KACA 3WLFA 2QZ9A 3DF9A 5GGYA 4Y9UA 2D59A 4AYTA 2Y1OA 3R77A 1ZVKA 2XTZA 3X0DA 5KTMA 3OE5A 1G8KA 1D03A 1EFLA 3QRWA 3ONNA 1BKDR 4OXXA 5FTKA 2IDMA 5GM1A 1Q14A 2B61A 2I2XB 3NHWA 4P3PA 1GTZA 5HS6A 2C2GA 4BAZA 3O2JA 1ES9A 4TLEA 5CT9A 5I4IA 4H1TA 2CLOB 5E7IA 4ZIRB 4K6GA 1H9BA 1F06A 1Z8DA 1M1NB 4QVIA 1V8PA 4GI7A 2OZKA 4IFTA 1L3BA 4DPKA 2WJYA 3LHSA 2COEA 2YYZA 1RBZA 4II3A 4LV6A 3WK4A 3KFXA 3ZIDA 3HWSA 2XLBA 4H35A 3DE7X 4KVGA 5JPDA 3DEIA 1KNXA 3R9XB 2DEUA 4ZOAA 2EGHA 1DG9A 3ZX4A 4Z49A 1QIDA 3QJYA 3GEDA 3PS9A 4LDJA 1TTQB 5JPIA 3MRXA 1IG0A 1IUKA 3IPAA 1E3SA 1KNQA 3V1TC 2PM8A 4MV9A 2SICE 2EC5A 5CX1A 5H3HA 1T9ZA 1T0JB 1B6GA 1JKFA 1NW6A 1PG5A 3ETEA 4GW3A 3I12A 4JB0A 3NVDA 4U63A 5AK3A 4ZXPA 1PR5A 1GZUA 1VE1A 2RHMA 3CZAA 5LP1A 1XL1A 3GBVA 3I53A 3RWMB 3V8PA 3HJCA 3R3VA 3GPLA 3WY9A 4BMSA 3OM1A 4K88A 3KOZA 3DEKA 1KY4A 3WL4A 3X44A 1YU9A 2QD3A 2AMYA 3JRNA 3KEOA 4HN4B 4M8KA 3TTXA 2G70A 4GXRA 4LHSA 5AKLA 4FGSA 3GRZA 1WMSA 1ZA2A 3EMVA 4JLKA 3SHVA 2IYVA 5LXTF 5TGZA 5CLIA 1IOZA 2HLHA 4CF4A 3MIIA 5MF6A 1W4LA 2YDXA 2Z08A 3ZEIA 4TROA 1RKXA 2YXLA 4ZD6A 1Y81A 5KI6A 4PX3A 2NYRA 4PXAA 1PW7A 4DILA 1H4VB 2FFQA 5LYYA 3RROA 2RGYA 2VRWA 3DFMA 4FS3A 4IMJB 4JITA 4NS4A 5KAPA 5FUBA 1EHYA 1S2MA 2WIFA 4TKUA 2GCOA 1R6BX 4U3JB 4Z7QB 4I4TA 3GMTA 4QREA 2P0EA 3MCAA 4DKXA 4MEBA 2WLSA 3K9NA 2I80A 2X5XA 4A4DA 2BKEA 1FFGA 3FCEA 3KKEA 4RK7A 2O8EA 1R6AA 3L7JA 3L4SO 4OFBA 4WUTA 2XUQA 3KT8A 1FSSA 3SZGA 2F8LA 1DKLA 5EYPB 3FRIA 1A8IA 3CNLA 1E5QA 4A9AA 1MX3A 2OP0A 1JQLB 2ZANA 3HA3A 1KQGA 1OI7A 1E2PA 3BICA 4BNVA 3L04A 4XDGA 3PZBA 3AEUA 2X9VA 5DN9A 4B2PA 1DNPA 4CT4B 5CVUA 5IUNC 2O5CA 4AUEA 2C2OA 2ZWMA 1W46A 3O8DA 4B33A 1FUEA 5KQSA 4YASA 1E5LA 1V9CA 1KP2A 1KEUA 5DP1A 2AMFA 1QYIA 1C7ZA 3CLTC 1A9XB 1WXIA 3VUFA 3WBJA 5C5IA 1BE8A 1NVBA 3KETA 5B5SA 3WOHA 4HJRA 4I2NA 4B2LA 4KDCA 3C85A 2D2XA 1NZDA 1ONNA 1GNTA 1QE5A 2I6GA 4GPZA 4XPZA 2BDTA 5F78A 4YMVA 1BX3A 1KHTA 4GVXA 1DTWB 1OUMA 3C3DA 4KX5A 4WNAB 1ZM7A 4Q3BA 4U7WA 5AJXA 3ZU6A 1C1DA 2WFAA 4J7CA 2IHYA 3HWWA 3NDJA 4K6FA 4ZKEA 3KR0A 4YFYA 2Y1EA 2PXAA 3AC0A 5FLEX 1P0CA 1VIMA 1HDYA 2J0VA 3QZUA 4H7FA 4V02A 3U16A 3G2QA 2UYYA 4OXQA 4TXNA 2O8CA 4ZO9A 3QVTA 4C9BA 1G6OA 4CM3A 3HADA 4X3OA 3REQB 3S8EA 1Y8ZA 1OA1A 1EXDA 1DCFA 1JDSA 1MX9A 4XAQA 1JDUA 3ZD6A 5HK9A 1LVHA 1GFWA 1XHFA 3M2PA 3DVAB 1E2BA 2PBZA 2PH1A 4JYPA 3BMQB 3ZDDA 2PR2A 5HM6A 1XA4A 3BJRA 4LCEA 1PYOA 2HBZA 3DL2A 4Q19A 1NOIA 3TZHA 5JS2A 1QK5A 1GDTA 2VDVE 1UPBA 3H6GA 3NXSA 3WICA 3PRHA 1M33A 2NT3A 4UM9B 1H4TA 3FFXA 3FLAA 4KDFA 4ZAYA 1EVKA 3AM5A 4CYMA 5JNUA 1THGA 4L6AA 5KB3A 1SB9A 1V95A 3N6VA 1N6PA 3T7JA 1TYCA 3IQWA 3UV6A 2I4NA 4BB9A 4M1EA 3L18A 4E88A 5JASA 5JV5A 3M6VA 1BIFA 1R0XA 2W43A 3PR2B 3WS7A 3KTAB 2MYTA 2QLBA 4FHDA 1L4HA 2R7MA 3ODGA 1QQ7A 4FSDA 4WL0A 2L82A 3ZC3A 3PPWA 3GZJA 1Y3AA 1MXFA 1XD2B 2QPTA 2OECA 3SKXA 4QRDA 5EXTA 1QPGA 4IFBA 2RK6A 1E9DA 3BH0A 5LQKA 1SU4A 1H1LB 1D8TA 4MPPA 3UHJA 4AT1A 1QRUA 4J43A 4PANA 3CLHA 1X1EA 3NMUF 1YOVA 1WDKA 2D5LA 4YMGA 3NG1A 3C3MA 1V11B 4NU8X 4G24A 1ZAKA 4NZZA 3IQIX 5IF3A 2IEBA 5CJJA 4J49A 2F00A 3IIMA 4HWOA 1BJRE 4MKIA 2FRXA 4XYEA 2CWDA 3HA2A 1ZNWA 2CF5A 3OE4A 3AV0B 1PJ4A 1SXJA 4TYNA 4P31A 2AQHA 3B8HA 2NPFA 1CYDA 4HFNA 3FG9A 1YDHA 1RSZA 3K9CA 4KIWA 2AZ4A 4U7FA 2X7HA 3HE3A 3JXEA 4Q9IA 3TQFA 1XMJA 1R6UA 3HJAA 5BNZA 3ZVMA 3S99A 5KEIA 3X2FA 4LOAA 3NEAA 5KHLB 2AV6A 5THKA 2ONJA 4UEJA 1ANKA 2ZP1A 2R84A 2YQ5A 2O3QA 2FMXA 3RAJA 4WV3A 5J2TF 4P93A 3G9QA 4IHJB 4GMKA 2NU8A 1C1YA 2B7CA 2QQGA 1YQQA 3C3EA 4TMZA 1W2GA 2R48A 1PEAA 2AYZA 3H1PA 4RW0A 1YJAA 2ZQYA 4AMBA 5IYZB 2HX1A 1JJBA 2B25A 2R8EA 3C7AA 3ND8A 1O5IA 4JL5A 2CJPA 4LBZA 3TZKA 1L8AA 4FUTA 2O8FA 4YRGA 3AKYA 4ZHQB 1CJTC 5JYBA 4L15A 4EKEA 4LYEA 1DL5A 2NSYA 4Z99A 2BHRA 1HZJA 5K09A 1FUIA 3ZTTA 1U8TA 5BWNA 5KMGB 1FNSA 1TU3A 3A0RB 4OXYA 2WI8A 1KQPA 4UM9D 4X1KB 1B26A 2YICA 1ISMA 1PS9A 3BUSA 3CWZA 4ZOQI 1EGMB 1YHYA 4EEZA 4RKRA 4KN8A 3T7CA 2X9QA 3JALB 2YOGA 3N8IA 4GYJA 3RIGA 1JEOA 2P9CA 1SC3A 2JIMA 5G2OA 1U0EA 5FAKA 5LDGA 3UY4A 8GPBA 1MO5A 5DTQA 1Q0LA 4YCLA 2WAYA 3E9NA 1PKEA 1SA0A 1IZ7A 1VHDA 1EFVA 2RK4A 1AKRA 4H3HB 5AJZA 5GOTA 5J1TB 4X66B 4RESA 1RC8A 1I4EB 4UTPA 1G5FA 3K8ZA 1HYQA 3D8RA 1H4SA 1R6VA 5L3RA 1WMBA 3TBKA 3IBYA 1V8BA 2LUOA 4ZCPA 5KSPA 5FEMA 3FWZA 3OT1B 1L8XA 3NQ41 5COQA 3UFBA 1EDZA 4JKIA 4K81B 5FNVB 3W1WA 3B1JA 1QVVA 4KXMA 4YBRA 2YCLA 2J5XA 1BN6A 1YVRA 2E6UX 4GM1A 2C2HA 3A1SA 3BILA 4L8FA 4MITA 1IG3A 5F7OA 2JJ2A 5AXDA 4AG5A 1V9SA 1LKZA 1KTVA 2HCBA 2PKWA 3MPUA 1VYVA 4P34A 1ADGA 1UEJA 3O2SB 4MAAA 3BMCB 3PHJA 1ST3A 4GDMA 1M2WA 3RUIA 1PJ8A 3FTQA 4TQAA 2MMCA 3FZEA 4X91A 3FZYA 2QAGC 1DRVA 1W36B 1SXPA 4K1XA 1AU9A 1F8XA 4F3NA 3K6SB 3SM9A 4ER6A 1CIVA 2RHLA 3LT4A 3SC2B 4J9UE 4ZQGA 5BVHA 1OT5A 4MYRA 1D2GA 1MKYA 4RJLA 5J2UB 1WP9A 4OQNA 2PS3A 1K8RA 5IFLA 2ZUWA 1GKUB 5T4BA 1G20E 3W90A 3R44A 1QU2A 4QGBA 3MRVA 5ALUA 1JBEA 2OO5C 2QYOA 2BKLA 3LUBA 4PNPA 4UASA 3T15A 1TYZA 5CCDA 3UQZA 5EMMA 4C4TA 2HHAA 4RJKA 3O95A 4IUYA 1A5SB 4KOAA 4DSNA 2PKCA 4X62B 2H1VA 4G0MA 4ND6A 3DUFA 2PUFA 3WKAA 3A26A 4W1PA 1YASA 1JPJA 4TWIA 3NBKA 2VUHB 2FG7C 4FFVA 3OT5A 3EGOA 4QPCA 5LIRA 1L1EA 2Z8YA 1ZINA 4OK5A 1NVMB 3H0KA 4RZHA 3HRHA 3P4YA 3G17A 1T15A 4W63A 4RZSA 2D1SA 2MMGA 3N5KA 5EJ4A 4J16A 4N8EA 3OE1A 2FEWB 1VJGA 1RBMA 4LK2A 3OZ7A 4NTZA 3EXEB 5K7SA 1QKJA 1TQ8A 3OUTA 2GBLC 2GCPA 2VYFA 3EZNA 5I48A 2O07A 1CWUA 4LSMA 1SRRA 1Z3CA 2NZ8A 5C53B 5EWLA 3E5RA 3ZS9A 2VG8A 1CRLA 1VG1A 4F38A 1T5SA 4YVFA 4AG6A 4MINA 2GYUA 3TGWA 1Y8AA 4CFSA 1PLKA 1U65A 4K2AA 4QYSA 2QF7A 3KAJA 2I2CA 1TVKA 3S40A 5BW8A 1YH3A 2D00A 3HCAA 4EITA 1ESMA 1WUIS 3RGWS 3T06B 6LDHA 4RVUA 1ZGZA 3HI6A 2C4NA 3TLMA 2I4OA 1PFWA 1Q6YA 5EMKA 3BXPA 3QVOA 3TSOA 4D6XA 1SXQA 1OY1A 3QNWA 1XP8A 3TRKA 5KUTA 4QM7A 3T1YB 5I5EA 2Q3CA 1XQWA 4FYWA 2JKVA 1T4DA 2RB4A 1H94A 5TJHA 2PU7A 1JHAA 3LBIA 5E3JA 2V4ZA 5CB6A 2Q3HA 1XDGA 2DOKA 1HNNA 3EIWA 3G7NA 2PXXA 4JLUA 1JG7A 1VKOA 4CKEB 1QO0D 3FOEC 1QOQB 4D8TA 2F3SA 3QVGA 1DXYA 2QQEA 2V58A 3R5JA 5T5QA 3ROXA 2ZRKA 1JSCA 2C57A 3HO6A 3MF4A 2FP4B 3IAFA 4XI9A 3Q1KA 5A5DA 4WPGA 3FHJA 3MUOA 4CL2A 2ZE6A 1K7EB 2JLVA 4FVTA 5FI3A 3A1TA 3HHPA 1CT9A 1X7ZB 1Z0IA 2IYEA 2Q41A 3BJZA 4IY1A 4OQYA 4RPCA 1P45A 5ES3A 3RSQA 1UFRA 3K70B 1XTIA 3K6RA 2BGWA 2CVPA 4F72A 4LC1A 3B70A 1FDRA 1N8TA 1ZGBA 3CZPA 3KDPA 4ZMSA 2JFNA 4E2WA 1MNAA 3HNPA 3RCBA 3UHOA 4XRGA 4FW8A 1SD1A 4YRMA 2WTXA 4DRYA 1C7IA 1E5TA 4PLTA 1VE3A 2V3WA 4PO9A 3EPHA 5ERGB 2R6FA 3DZHA 4BLRA 5C0OE 1N5RA 2X41A 1F48A 2P6NA 1LDMA 2GM5A 2GA8A 1U81A 2G07A 2I34A 3QF4A 3I2IA 1G2PA 5EKXA 2YV4A 1FU7A 1R0RE 3GFSA 3H87A 1WF3A 1E9EA 2QAGB 4C88A 4UHEA 3AZOA 2UXDB 3SYLA 5JOQA 4ZZ1A 1JALA 4IOJA 5JCZA 2EF0A 1V4BA 2YV1A 2DJIA 3R5XA 4TWRA 1JIJA 5DTJA 2BZ1A 4I55B 1DHRA 3HB1A 3HKEA 5KYXA 1JFTA 3GR6A 3V1NA 1ODJA 1E6CA 1RXUA 2DWCA 4EI8A 1EZ4A 2WF9A 4EHDA 1EVYA 1FMJA 1NIPA 1WXXA 1L5MA 1NFQA 3LUDA 2WZDA 1SG0A 1MAUA 5KYYB 3GELA 2OAGA 5HF5A 4DOMA 3A1CA 2X76A 3TTSA 4BLSA 3ON5A 1UM9B 2WFMA 5ALZA 4FI3C 3HVHA 2CNBA 3IHKA 3KHTA 4OP1A 2WSMA 4CF3A 1W0CA 3GJYA 2ZB7A 3EARA 1ESNA 1Q16A 1WL8A 2VBIA 1NIJA 4J4HA 4FT4A 4I19A 5AMXA 3U13A 2J5RA 4R8LA 1OU4A 1R4AA 1GSHA 2E5FA 3FMPB 1G8FA 1XROA 3I2FA 2ACWA 1QFZA 1KGDA 3KHUA 4ID9A 3LG2A 2CFOA 4TKLA 3TQTA 2AG8A 3PQEA 1J90A 2FW0A 6NULA 4PNHA 1JR3A 3OZGA 4FD3A 1KEPA 4IDEA 2C5LA 3REQA 3UOAB 2IBSA 4EECA 1SBQA 3F9RA 1AIPA 3OBIA 4PO8A 1D1QA 5DYNA 3PUIA 1Q92A 3NVMB 1V96A 3LQKA 2REOA 2WY2D 4C07A 2D2VA 3U6BA 3IP5A 5AI4A 3WKDA 1JHRA 1VB5A 2A9PA 3IKMB 4MVJA 5FHRA 5D3MA 1U04A 1A5AB 4XJXA 2E3JA 1KETA 1Z0DA 3RTAA 3ZHCA 3NANA 3AESA 5IAAA 2HWWA 1O0CA 2ECKA 4L4UA 1NI3A 2RAUA 1C81A 5JSKA 1CDEA 2ONKA 3T38A 4WBNB 2W00A 1JE0A 2BCGY 5C31A 4EGAA 2X4GA 3QFTA 4CW7A 1P5RA 2YXNA 3DV0A 1A2QA 1ZGCA 2HA6A 3JQCA 4KXXA 3FSRA 3WX0A 1CSEE 1KAOA 2ECFA 1N5IA 3KFLA 4IICA 1OA0A 1UXJA 3IR7A 4YRQA 2P4UA 2ID9A 3EEOA 1R8SA 4LF6B 4XUCA 1L5QA 3A37A 1RPTA 3T3DA 4JZYA 3RS8A 4K03A 3TM4A 1XNRB 3RREA 1X7WB 3UUFA 3K9BA 1HX7A 3RSCA 3H9UA 2GJSA 4X6UA 4NU6A 2P6RA 4GPTA 4N0PA 1WB6A 3DKIA 1O97D 5BNTA 1HDXA 2L17A 4FFWA 4JL6A 4KDEA 4XPIA 4TTRA 1SXHA 3SMQA 4D3FA 3JW8A 2C2KA 3Q72A 4JT8A 4P83A 3WI7A 1I6WA 1NXPA 4FMCF 2GZ3A 4RJJA 1VSQA 2OGTA 1SK9A 3GDGA 5A6SB 2VI5A 1KY5A 3ZI4A 5LA6A 5JH7B 2DTEA 1UMDB 1OHHA 3OY2A 3PD1A 3P9PA 5CR9A 1N5KA 4DG5A 4URHA 3FHLA 3KXIA 3PDUA 3PX3A 1DC4A 2ODBA 3WLTA 2ZIXB 3QVUA 1CZKA 1BU5A 4X8LA 3A2LA 2V55B 3CB2A 4M1SA 1WBBA 1PEYA 4F84A 1PBNA 2YJ4A 4EL5A 4QDJA 5LKAA 1Q1BA 2EKZA 2WU0A 4B6RA 2B7LA 4V3BA 2O2IA 2YJGA 2CUTA 1NBMD 1OKKA 2Q4EA 3L7IA 4YRPA 3SAJA 3EZLA 4A5OA 1NATA 4MA5A 4RIHA 3WNVA 4WZAB 5C52B 1ZFNA 2BF4A 4ZDJA 1X8LA 5I7RA 3RT9A 3WYGA 3ZVRA 3E5HA 1GNRA 5KU1A 2OORC 3GLIE 2JIDA 3KZ1E 1DAPA 3O3CA 2CNLA 4R7GA 2OQ2A 4ZHQA 3CVVA 4QLOA 4LGCA 1NBOA 3OZSA 4L5JA 3R2JA 5D84A 5KMGA 3AJDA 1DTEA 3LW7A 4AJHA 5LP6B 4OL0A 1L5YA 1V16B 4UBLA 3L6RA 5TR9A 3ZKWA 5JCXA 3T5DA 3QX3A 4JLVA 3CBGA 1H85A 2HJVA 4K87A 4LPSA 1K2VN 2OHJA 3ZE7A 5AVUA 2F1OA 1K88A 5FBHA 1CS0A 2YC4C 1DQYA 3M6FA 1TGVA 4M0EA 4O02B 4Q9AA 5E8RA 2ZE5A 1QUEA 3B36A 2QUZA 1XZJA 3C3KA 3LY7A 4P4SA 3CO0S 1O08A 1SNYA 5KC9A 3M8KA 1TNDA 2O2SA 2GPJA 3IRVA 4TX1A 4N6OA 4OKIA 1OXTA 4UXHA 4AJJA 2BRUC 4DMLA 3BXXA 1E60A 1A1SA 1Y37A 5IKXA 4E4TA 4EB3A 2V0NA 5JXIA 3QJ5A 5CNIA 1UPXA 1V48A 2JD0A 1G17A 1KMNA 1XKXA 2EWMA 2KHZA 3BB1A 2CY0A 4WOBA 3U26A 1P31A 2C61A 1FY2A 2EJUA 2XBUA 2UVQA 1NMEA 4ZAVA 2DRIA 1XV5A 2PD4A 3AHIA 3OICA 5DXFA 5AXBA 2HT6A 2ZYTX 2OV6A 3CNHA 1K6EA 1IHYA 2HU5A 2IIVA 2J6BA 3AUAA 5DBFA 1PT6A 2FW7A 2PMFA 1I10A 4U0JA 2IP4A 1T2VA 2CFIA 4Z4GA 3G49A 4L57A 4KR9A 2WABA 4EY6A 2YXDA 2J45A 2Q5JA 3LYLA 3PR3A 5FXMA 4D42A 2JGEA 3I39X 4D26A 5EIXA 2WJIA 2OCIA 1ARZA 2WAAA 2X3FA 3AF3A 1R3UA 3OJEA 1FK8A 1AGYA 2I6FA 3PXDA 3G8AA 1K75A 4HXEB 1S2DA 1P7PA 1NRIA 2HDHA 3TIXB 1OVGA 3DM5A 3K96A 3EDOA 4WNCA 4D9JA 3GD5A 4FX2A 1MABB 1SCDA 1RWOA 3R3YA 1DELA 1JXAA 4R8VA 2A58A 5BQ5A 5KJ6A 4YTEA 1TT5B 5KYWA 5ANRB 3N8DA 3P5SA 4QVKA 2JAHA 4WASA 4A36A 3DP7A 4MR9B 4NF2A 4CFZA 3EQ7A 3L8YA 4MWSA 1RZRA 2QMEA 2VWHA 1FS6A 4JIGA 4PNZA 4BIMA 4TMWA 3O84A 5LBTA 1Y9EA 1VLQA 4RD0A 3RYIA 2RE8A 4BWYA 4HMOA 2OPHA 3TCNA 3TOCA 3N8NA 2H06A 3OZBA 1JSRA 4DPLA 1HSZA 1WSWA 5CDSA 1GILA 2ZBEA 3JRXA 3KQSA 5AKJA 4G0UA 1CBUA 3HV0A 2RMKA 4D4GA 821PA 4LCBA 1N2OA 2F67A 5K0FA 3RRZA 1SHUX 4HWKA 4LJSA 3RTBA 5LNK6 4I2VA 1VL1A 4WEOA 1X92A 4B3TB 4UAGA 1EVZA 3HCNA 3T1OA 3B7GA 4TOIA 2ZJYA 1FYDA 2Z5FA 4LY6A 1Y5MA 2JDIA 5TIIA 2WU4A 4HXGA 3HJGA 1MMFB 2ZK7A 5IAJA 1L7NA 1XZDA 4CMGA 3SCZA 4X00A 2D8AA 1CUIA 3PRJA 1TYAE 1W7AA 1JU9A 1MLDA 3H83A 4IVNA 4Y3UA 4EA9A 1XB2A 2EJWA 1N57A 3BCSA 4F8JA 1KJQA 4HQKA 3IAUA 3QG5A 4Y2XA 1P2TA 4QAQA 4C6HA 1CQZA 1J20A 1OBVA 1LFAA 2E85A 5C18A 2H4YA 2IPNA 2ISSD 3D59A 3P0JA 5KSYA 1LXCA 1W88B 2FFHA 2YXBA 3L79A 2BFEB 1VYTA 1VYHA 2Q0XA 4QBFA 1OV6A 2C2YA 2FCAA 2R65A 4H31A 4YAEA 4IYRA 2AYXA 5E2IA 4B5KA 4CR8A 1Q11A 2QS9A 5JXJA 4QUAA 1Z4IA 2CE7A 2PNFA 2ZSUA 1E3JA 4BCBA 4B4OA 1GA1A 2YFYA 2QNBA 3DCNA 3PXXA 4B79A 1FSGA 4NEGA 2J7PD 4MJXA 5FO1A 2H4JA 2AW5A 3W2IA 4RPJA 2I91A 3MJVA 3PQ2A 1EXNA 1E1DA 1JHYA 3T6KA 3ITDA 1G0NA 4IFEA 4M4SA 1H8ED 5GONB 2KQUA 1E3WB 4MH0R 4HAVA 1QXSA 4D3XA 4DMHA 4LV5B 2D3TA 1YZVA 4OMFG 2ZGVA 2VPIA 4CLOA 5AW7A 4GEKA 5TS2A 3HO1A 4R5HA 3PFIA 4DV1B 4DC9A 1AA9A 4O8CA 4QRIA 1OIWA 1EFTA 3LWZA 4Q16A 3ER8A 5BUSA 4KL8S 2JK0A 2H1IA 4NFHA 3C1TA 1B4DA 2VA9A 1SCIA 2GZRA 2W90A 3ANNA 4GGOA 2DJ5A 1MQSA 2IBMA 4CCSA 1LC0A 3PGJA 1D2MA 4RMJA 3TX2A 1NU8A 4RABA 3UWDA 1B15A 4EYEA 5JZVA 1XAGA 3OZEA 1M1UA 1FUYB 1SBCA 4Z0NA 3O8RA 4OQMA 4ZT2A 2GLXA 4N0QA 1HQYE 1SKAA 1QVRA 1JEQB 2K5UA 4O29A 4RSMA 1GHTA 4ER3A 5L3QA 1ND6A 3Q8XB 3UW1A 4EUNA 4O4LF 4EO4A 2YBDA 5EQFA 5B2EA 3JRWA 3FBGA 3K09C 2TMDA 4NBUA 3ZE6A 4O3FA 4P7BA 3LNTA 4M0CA 1NUTA 4ZI5A 4RD2A 1Q50A 2MSLA 4A8JC 3K9QO 5EI5A 3QFHA 2Q5CA 2UVPA 4I55A 4TXJA 5FA6A 4CMIB 4RTJA 4GZ5A 4V38A 4R7ZA 5DTMA 5CG2A 1KS2A 3A0UA 1WEKA 1IQUA 1X94A 3H84A 5JDIA 3H1GA 1E2EA 2DX7A 2JLXA 1KVRA 2PUAA 3V6LA 2G1PA 2GD0A 2G8NA 2V7QA 5J59A 4B43A 2DM6A 2B7BA 4KFRA 3F6YA 3S28A 3ZHSA 2OO5A 1X42A 1FFHA 2SKEA 4OIMA 3C8ZA 2IIQA 2W2LD 4HF7A 4K28A 2BI4A 3N2ZB 3OZRA 4BWFB 2ADOA 1FFDA 1AF4A 1TD1A 5TARA 3TW8A 2VSFA 4XSGA 3RVJA 2YXPX 4ROSA 2VDWB 2QA5A 1Q12A 2RGGA 2YJNA 3OAAD 4OBEA 5DLQC 4ZANA 3VR5A 4BNWA 4EFNA 3OQNA 1EWRA 1CYEA 1JHPA 3I28A 8ADHA 3GHYA 1G9XA 4DLXA 1K3TA 3CM0A 5T4FA 3BQMB 1YS7A 3BK2A 1HT0A 2OBXA 4HS4A 3TBFA 4B4VA 1REQB 1Y5IA 3B12A 4WOJA 3U4AA 4NOMA 3IEXA 4H3SA 1E2DA 1RWBA 1ZOOA 3EG9B 4MVJI 2QK4A 3ASYA 5CMLA 3RYHB 2UZ4A 3RRFA 2C8KA 3IR6A 3UUWA 2ROQA 1U9YA 1QIEA 1CUJA 5FTMA 1DJPA 4FNGA 4G56A 4DW8A 1C3EA 4EOGA 4CKCA 4GKVA 2V4MA 4JUAA 4GFDA 3PX2A 3PNQA 2J5QA 2BR3A 3BD7A 3CIOA 3KCQA 1V47A 4BRWA 1QOPB 4EG3A 2FN4A 1RRCA 3QYFA 2EEPA 4JB3A 2JA1A 1NC1A 4N54A 2C29D 2IZZA 3D6TB 4MCAA 3FMIA 3RU9A 4BQIA 3WRXC 1ND5A 1TGYA 1DAFA 2DBVO 5D7NA 4AO7A 1JW9B 3VO9A 4CT5A 4DLZA 1U3FA 4XXHA 5BT8A 4QJ5A 4W5HA 4D8VA 4C14A 5JVDF 4JUDX 3B9BA 4TV8A 1NUUA 5DHSA 1IFXA 3F96A 5L45A 1E64A 1WHTA 1CE8A 4ZEMA 4FZ3A 3IOYA 5ICGA 1PNOA 1DAKA 2ZJ5A 2Q0QA 1GL3A 1G3UA 2Z3VA 1H8HA 4DRXA 3QV1A 4HY3A 2PR7A 5E0KB 1LBQA 2JLZA 4N41A 4MRSA 3UT0A 2F8TA 2ZVJA 5BSFA 3OZCA 1NXWA 3E8SA 3K6JA 1PT5A 1KI6B 4RMIA 3K6KA 3IAAA 3LSTA 3Q2OA 4M0UA 5CA0B 2CLCX 1Z5UA 1XCOA 3CVJA 3OURA 2CHGA 3WMGA 3CCBA 5CLQA 1HLFA 3IUNA 4AZ0A 3JQ6A 5FPKA 2G5TA 1G3RA 3VAYA 1LJLA 3ZJ4A 3IELA 2BFNA 2BM9A 1BMDA 3B9QA 3GC6A 4TTQA 4DQLA 5L53A 2GI4A 3RHFA 3WGLA 4O8ZA 1WZIA 1N1DA 2BUBA 3UM9A 1U1DA 4C03A 1I7QB 3GDWA 1EWKA 1Z2NX 1DT3A 1JP7A 5BR4A 1F8YA 4REQB 4KW7A 4HVAA 1AURA 2ZWIA 1Y5RA 3QU2A 4FDAA 3SBEA 4E0BA 2OHIA 2CMKA 4QXQA 3LC2O 3R8XA 3STYA 4D9FA 3K1AB 3S1LA 5DSTA 3W5VA 5JS8A 1U8AA 3TS1A 5AHXA 2HCFA 3PB3A 1BFUA 3JR3A 2ZETA 3TJRA 3DWIA 2AG5A 1HG1A 2C4KA 3QLJA 3QWIA 4UU7A 3HJRA 4E5MA 5I8WA 1NJ1A 1OB5A 4R1PA 4TYQA 4K9OA 4O2AF 3C14C 4EHHA 3B3GA 4GOND 1G9SA 2CHVA 2FPOA 4PRZA 4X6LA 5AVSA 3EPKA 3AWIA 1Y1TA 4L7QA 3MWLA 3QHAA 4KPYA 3IXMA 1KR2A 1QANA 4KVZA 4F9GA 2ZZMA 2GCEA 1SVSA 1BQ4A 2ERCA 3USCS 4WIAA 1RKUA 2BM0A 1YAJA 5CDGA 2D0OB 4YUVA 4GUDA 4KQWA 2W2KA 2AE1A 2RBKA 5ECDA 4S3MA 3T7TA 3DPSA 2QTZA 3MJEA 3OJFA 4E5SA 1VTKA 4ZYTA 4PAOA 2YRWA 1Z0SA 1S2GA 1C3OB 1W9MA 4Z3DA 1TIBA 1VKJA 2QP3A 1XTBA 3F7TA 2ZBRA 3WB9A 4B83A 9GPBA 2CMHA 3IIKA 5C8ZA 3UHPA 3FWPA 1U11A 3R09A 3D4BA 1CV2A 2WDPA 4GP6A 4EB0A 1KDOA 4L2IB 1AXRA 3IAS1 3GJ5A 2F64A 4OLHA 4N40A 3OZFA 3QKRB 4PX2A 4BNIA 3MM4A 2JJ8A 2ILVA 4UEKA 3U31A 2GH1A 1IN5A 3L07A 3L7LA 1CZHA 2Z4TA 4F2HA 1VFNA 1B23P 1C8BA 4NX2A 1SVNA 3IIEA 3NC0C 4X20A 1PZEA 2UZ1A 2ZTUA 4JNKA 4E5YA 2FUNB 2H08A 2VHJA 3SE0A 1G7TA 2GD6A 3AVQA 3P9NA 4HWGA 1E2HA 4BNLA 3AVPA 1NJ8A 3E0QA 3PNOA 4CG3A 4BLUA 4QYTA 3KKKA 3IC5A 1VCIA 4CQMA 5IVIA 3KK0A 5JTTA 3LK7A 2V5UA 3ZTWA 4YH1A 3KOMA 1B8UA 3IEKA 5ALYA 3RT7A 3ZQ4A 1S01A 2L42A 2O4UX 3HGQA 3O4FA 5B6IA 4OAOA 4TM7A 1MW9X 5TE9A 1KRHA 2HNBA 3WK7A 4CE6A 3TR6A 2OESA 3MRSA 3P96A 3VTAA 4CMCA 4YLEA 3WNQA 2REQA 3HCOA 3QVWA 3IP9A 3C1AA 3NTVA 4HPWA 4WXMA 5A4KA 4LF9B 4Y9SA 2Y0EA 3O4IA 5B7QA 2CLHB 4WZBA 3DDWA 3EPLA 2BCJQ 2G82A 1XZAA 2XNJA 5BOSA 5GV7A 1XJWA 4TUYA 1N5JA 4KHPB 1M1ZA 3NTUA 5ITZA 1C7EA 3EA0A 3EW9A 2BBTA 3FTEA 2FSUA 1FQKA 3S7ZA 2VQDA 4LY3A 1OOEA 3BQ9A 4BQNA 4BNFA 3H11B 1OZAA 1ZA1A 2RHJA 3I45A 1T4BA 4MCJA 3DEFA 3PX7A 4FINA 4LXHA 4C5CA 2GSWA 4IDDA 1S3SA 1OBHA 1XMIA 3F6BX 2I8LA 5AM3A 2VJMA 3E9YA 3DE5X 1W6RA 3OCCA 4HB0A 1JU3A 1MEJA 3DDSA 4MTLA 2EKLA 1O9GA 1P2FA 5CIQA 3U7JA 4EABA 4Q3EA 3VSCA 3AQIA 2AEEA 2H63A 1NFFA 3CX8A 3IVXA 4G07A 3ELUA 4HBGA 4MJLA 3RASA 2IPLA 3DVRX 4AJIA 4BO8A 1RHUA 3GZNB 3LCJA 4K9PA 2ZRFA 3L49A 2JRCA 2PIDA 2QHXA 1P0FA 2P3QA 1ZJYA 4YI5A 1QM5A 3SR0A 4UMEA 2X2FA 3OZAA 1NKVA 1I2DA 3COYA 5JYCA 4UCFA 4D9KA 2IS6A 2J3DA 3K9HA 4IGAA 2UYOA 1IXYA 4RH1A 2YNMA 4PX5A 5BR8B 4Y6SA 2QVLA 3E23A 2BKAA 3MOIA 3LXUX 2PUVA 2OORA 3AX6A 1Q77A 4TLDA 3EXFB 3LLMA 4A0RA 3T5AA 1WQ3A 1V6AA 4YIKA 4OYHA 3AF6A 2AQIA 4LRUA 2OT3B 4RTKA 1ZD2P 2ZYAA 3ND5A 1TA9A 4DR4B 2DCUA 1M8FA 1QAMA 4O2BB 2MYPA 2PPLA 5BYKA 2EOAA 1N9GA 2KBEA 3LBNA 3WQBA 2HF9A 4DABA 3CXUA 2QMZA 4KSYA 1ORVA 1P62B 1ZOLA 3OOHA 3R7DA 2AJDA 4Q3LA 2IPMA 2D1QA 2R00A 4HX2A 4Z9YA 4D9IA 1M7HA 3KJNA 4B3JA 1CPYA 1KY3A 1SUEA 2DSTA 1OF1A 1O8BA 3OQHA 2W8BA 2ESRA 3FPJA 1KARA 1YZFA 2J3KA 4LJAA 3VVLA 3TEMA 1V3VA 2OE2A 1SEPA 3EWAA 3IT0A 4KUGA 4AP6A 1MRSA 2GN1A 5KQMA 1EE9A 1QYVA 1JECA 1ZNXA 3MTBA 4ZO7A 1XJ5A 3GMIA 4DMCA 4G0OA 4K2HA 1K98A 1RC1A 1WXFA 1U28C 2J9FA 3RG8A 4ENVA 1VL6A 2XIQA 1YI0A 2WDZA 3DFFA 4YWHA 1J8DA 4IDCA 1L7EA 3T7DA 2HQRA 7YASA 2WF7A 3FDZA 3TTTA 1FNCA 5AI6A 4YN3A 4W6ZA 2XECA 1XVTA 5FCDA 4CHGA 2O8BA 4ZZ2A 5JAQA 3IL2A 1KJ9A 2P41A 3H8VA 3EVFA 4TYWA 4LHWA 4G0YA 1MOPA 3HXLA 1EDBA 2PQMA 1IY0A 2WE7A 4PQYA 3ZR4B 3B6KA 3FLEA 3QITA 4P98A 2O48X 4DZRA 4TSFD 5BMVB 3ROQA 3QWHA 5CT6A 3VNUA 4YV0A 3PQ3A 4LYAA 3NHSA 4Q6WA 2A0WA 3AQ4A 3ONDA 3RSOA 4IR7A 2WZBA 4CQLB 2FW6A 1R15A 2X19A 3D8TA 4L08A 1UDCA 3D7SA 4XGQA 2PWPA 3R20A 5BP7A 1CZRA 4ATNA 3RDPA 2X77A 1B42A 1SIWA 3PHCA 4JA2A 3TCKA 1IE3A 2VJCA 1JBKA 2IKQA 3NNSA 2OM2A 3G6WA 3H0CA 4GWLA 2W98A 1B0PA 3AOEC 3NPAA 4PC6A 5F3RA 1AHPA 4R9SA 4BAGA 4BDTA 5IZCC 2BBSA 4IZHA 2DXIA 3EH2A 2Q3DA 3Q7QA 4FONA 3NOXA 5JALA 2CDRA 3GLSA 4MVXA 2MR6A 1JAZA 2J0UA 5FKJA 1NVVR 2XVZA 3PPVA 4JT2A 4LRTB 4N3NA 3PC3A 3C3AA 1ZZGA 4KN5A 1SU8A 3HDVA 2GPBA 1E0SA 4CV0A 3QEAZ 3OF2A 3GLTA 1MW8X 4HGQA 1IZ8A 3X2EA 1TVCA 1SUWA 4RZQA 1CETA 3H8WA 2W4MA 5TPWB 1DIAA 1DEHA 2ZJBA 4M76B 2QDXA 5EQDA 4BNZA 5BN3B 4BMZA 4M7RA 5SV2A 5KTOA 2PT9A 4BE7B 4Q39A 3ROPA 4LZLA 4F3TA 3MTGA 1YQXA 2HNAA 4D92A 5JCPA 2EL9A 1A8HA 3VR0A 2BM1A 1U5AA 2EP8A 1ZD3A 5DRYA 1TTHA 2AFHB 5ADUS 1CQIA 4JD5A 1GKKA 3H9CA 4FX5A 1Y80A 4HDNA 1ZR4A 4FSHA 3BWYA 3PVZA 3SLRA 4KRXA 3EUEA 3UCEA 3M1AA 4BP1A 5B64A 2JHCA 4JI0B 1JQBA 5EJ9A 1RE1A 2EDAA 3NC4A 4B8YA 2NU9B 1IEWA 3K9LA 4FKMA 3UMSA 4JLBA 1JR4A 4PE5B 1BW9A 1P6XA 4FKZA 3UWKA 4HBZA 2JCGA 3BFPA 1M7BA 2NSHA 1R4MA 2A5DA 3FVVA 4B7AA 4MKZA 5DCLA 4TMXA 1JG4A 5F64A 3KSMA 4RTLA 1XMQB 3N0WA 3T41A 4Y2YA 1EEXB 1XCPA 2CNDA 3AIIA 4C29A 1EJ6A 2BFBA 2EBFX 4PHCA 4A2QA 4PSDA 1XTZA 4DMFA 2DE0X 3FF4A 1R6XA 1W4ZA 1TAQA 5LFAA 4LOHA 1CEEA 4PO3X 3HXMA 2ODNA 3EGXB 2IU0A 1FJ2A 1PR3A 1RM3A 3WAKA 3P26A 3AETA 4BV2A 1PZGA 3HS3A 4AM8A 2GM4A 2MSCB 4HYEA 3TKLA 1VG9B 2IDJA 3U9SA 2NUTA 4JEHA 1UK8A 5IAKA 3R74A 4QFBA 3FSGA 5C7LO 1JJFA 2C77A 2Q2OA 3LCUA 4R1QA 2RCYA 5CA0A 3T5GA 4D45A 1IH8A 2XZOA 3C16C 1FIUA 4Q21A 2CDNA 3PA6A 3A10A 3L1UA 4BNDB 4MR8B 5CA1B 2AQKA 1FRZA 4D4MA 1OH5A 2D6FA 3MINA 1II0A 1N77A 4DLPA 2E2WA 1NMZA 4CLEA 2CLDX 2P0YA 1O94A 2ZRLA 1HT1E 1I9GA 4HHEA 4YACA 1Z62A 3NP7A 1PGPA 4I6EA 3FYUC 3DAFA 1QG2A 1Z7BA 3FOBA 2QTAA 4MGEA 4X7RA 4J0CA 4EB6A 1ILEA 2E48A 1G64A 1VZ3A 4B40A 3RVLA 4MDHA 3RSLA 1KYIA 3H4IA 4B34A 1RWVA 1LJUA 4XSVA 4N39A 1S6YA 2Z57A 1FTWA 1NHGA 2XNDA 1PI3A 3QMPA 4O25A 4RF5A 3OQOA 3L41A 1G2QA 1VMEA 1X38A 2G7ZA 4I4TF 5FO0A 4ENSA 1B73A 4PGMA 3UMGA 4GLLA 4YPFA 2EEZA 3AR6A 4G1EB 2C03A 4OUKX 4YMLA 1HYBA 1U8ZA 4M1WA 1IHUA 2OB1A 4ZVNA 1NULA 2DHDA 4Z53A 3ZWNA 4HYTA 2WMYA 3I9NA 4K05A 2BC9A 4ARCA 1AKWA 2DWQA 2VBFA 4L5YA 2QN1A 2Q2NA 3AERB 1X1DA 2QV0A 3RS3A 5IM5A 4DBZA 2XUZA 2WWTA 2QM7A 1V3UA 1WWKA 2Q21A 3FCOA 3MB8A 4L51A 2QLTA 4RYDA 4A8JA 2IKSA 3Q8MA 3SI7A 5JSZB 1Y6FA 2QD4A 1DCTA 3LY9A 1Z25A 4S1NA 3RFCA 3FVTA 5KINB 5AW3A 5MGNA 4KRFA 1P3DA 1TYBE 5CTJA 4FFLA 2B1IA 2XOEA 1ECJA 1W0KD 2A9QA 1CJSA 2J3MA 4M8SA 3QOWA 4PFSA 4MV8A 2YFQA 1PS0A 1XWIA 4O4HB 3VGPA 2ZIFA 3THWB 1SUBA 1SVUA 1ZESA 2H5LA 3PLAE 3GN1A 4BU1A 2N0SA 3EGCA 4GXNA 5EG5A 3F3SA 4Q9LA 3TUIC 4WH0A 3QEMB 4BP8A 5KHOC 4MUMA 1L8QA 1SCAA 3TL6A 4EELA 4DV7B 4BV3A 5IPFA 2IU3A 4KQ6A 4KWHA 3TTYA 2R3SA 2O52A 1JMVA 1Q1EA 3ZXSA 4BU0A 2X23A 1WTAA 4POOA 1YTUA 5FWDA 1FVHA 1U8YA 1BDMA 2QMQA 3EA5A 2FSPA 4P5PA 3WGVA 4DTIA 5HBGA 2P9JA 4TYPA 4IV8A 4E6PA 1UBGA 3UFXB 4DV3B 2EARA 2ZQZA 4IEFB 5BWOA 4HDSA 1WSAA 2IW3A 1BKYA 2NXNA 3OU7A 4MVJG 4ASUA 4J0FA 3UMJA 1M8GA 5TLSA 3W7AA 1UFQA 3PPYA 3OEHD 1XC7A 4NBWA 4DCSA 1XVLA 1Z6AA 1U1CA 4ZI3A 1I3MA 4LXUA 3H2SA 3HCBA 4M7OA 4MV0A 3WIDA 2YOHA 4FSXA 3NI2A 4WKOA 2EZUA 3TQRA 1JVNA 2PHZA 2C5BA 5DXAA 1JNYA 3I0MA 2WIAA 2NUBA 4B85A 4DSUA 1X2EA 1RI1A 4ZI7B 1ZMTA 4MNTA 1DX4A 1XTVA 1TB4A 4OFWA 2WAMA 1UH5A 2XQVA 2H59A 1JKIA 1T5BA 3PUHA 4OGFA 4Q03A 2BONA 1XT6A 1ZKDA 2GZHA 2O06A 4NNOA 3HFRA 1JTVA 3D8SA 3ZY6A 3LPAA 1ZJZA 3AVYA 4D5GA 5J43A 3V7NA 4IDHA 5DX1A 1YQGA 1BC5A 3IP7A 1C9NA 1NG1A 1WVMA 4PZZA 3OEWA 1FSFA 2F4VB 1SHTX 4KI7A 5DI3B 4UM5A 1OXMA 1RI3A 4W1SA 2B6NA 5ALTA 4WFJA 4K6MA 4CIYA 4QPPA 5MDHA 2ZUFA 4ZMRA 1EHCA 3WAJA 4NNJA 4FQ7A 1DJMA 2WPDA 2UZ0A 2B20A 4Y2TA 1TVMA 3C3JA 3JZAA 2I2DA 1XCBA 2HYDA 5BVGB 4HYYA 1NOJA 1WD5A 3DT8A 3FYUB 4X7PA 1E7WA 4WOCA 5IDVA 8AT1A 5FPYA 3MERA 2CC2A 1QRTA 1YDWA 3BEOA 4YPVA 1CUSA 1XSEA 2BZ0A 4HAXA 2VDUE 4Q01A 2Q1XA 4V0MA 2AIRA 1WOMA 4BX3A 3ZCVA 3Q5EA 1U0OC 2JAWA 2AT1A 3BYZA 1GG5A 4MRMB 3Q3GE 1CF2O 3FRJA 4JOCA 4QPNA 3KL4A 2UUCB 4QULA 4N76A 2BR4A 3MCUA 3W4JA 4BBPA 1FDUA 3M5WA 4IEEA 3JWPA 3EEYA 3NEYA 4R7TA 3THYA 4J0DA 1YO6A 2JHGA 3HI4A 3VOSA 3HKBB 2K7ZA 5JRJA 5FWXB 4YCSA 4P3OA 3U7QB 3QENA 1DJOA 1IPEA 1GU1A 1YGPA 2AH5A 2I6XA 2VP6A 3H2GA 3IFSA 3KRTA 1CR2A 4NV0A 1U02A 3THXA 1JPVA 4RTRA 3DJFA 1IM8A 2ERYA 3UJDA 3TLYA 3VNVA 1JHXA 3QGMA 1DC3A 5FBKA 1KZYC 1NW4A 4A6PA 5HVNA 3EWIA 3L8EA 16PKA 1USIA 4M8LA 3TNDA 2CYCA 2DQSA 2HA4A 3M4JA 4HMPA 2TMYA 4L9RA 4WDRA 3WGOA 4BJ5A 4EMTA 1KYQA 3W5IA 4YC7A 3ANXA 1ZLXA 1UC9A 3MWDA 4BNYA 2V0GA 3IGFA 2I6SA 4P7JA 4BGIA 1XNQB 2XKAA 3GA7A 1GXSA 3L0ZA 3ZHYA 3D8HA 3ZJYA 1K5PA 4EVIA 1XCJA 1RXCA 1ABBA 2AOUB 4YAOA 3Q0IA 4EJ2A 4MB2A 1QYWA 5I7EA 3WRYC 2JBWA 1TUBB 3A3YA 2IZ7A 3PP8A 4C7VA 4M1TA 3LCMA 4OHMA 4ER0A 1Y4ZA 4LNAA 2HN9A 3OQMA 3ZV4A 1NVFA 3VNRA 2CLSA 3V7FA 1L9KA 4DA8A 1BO6A 3KALA 4Z9AA 2REBA 2X2OA 3F7NA 3DD1A 4F6RB 3PNBA 1M76A 3OO1A 4H7JA 3UUGA 3VUEA 1YRHA 3AEKB 3P0RA 2JGRA 2PDAA 3L93A 3WTCA 2FUG6 4ZGWA 2FY8A 4JP2A 4KMSA 2DLNA 3C41J 3EQ8A 4U2KA 4CDGA 4E1VA 1PL6A 1TC2A 2EFDB 3HMQA 4F86A 2D1FA 5C7YA 2CK3D 1SXIA 4D0RA 3D7MA 3TIFA 3PT5A 5FBLB 4OHYA 3EIHA 5DSXA 2EKBA 4ZQHA 3J80A 3GUZA 1F17A 2WJZB 5H5JA 2XF2A 1X1BA 5EUQB 4BGEA 4DSOA 1VGQA 1HQCA 3L6UA 3PQ4A 4NH4A 3V2IA 3WNZA 4AIRA 3KNZA 1M1YA 3MTIA 1SQFA 5JLJA 1E1CA 1K1EA 4RK5A 4CMAA 1EE1A 2I62A 3O31A 4I50A 4JC0A 3T5MA 4BO4A 4DM4A 3ENQA 721PA 1EBBA 1L3CA 3I52A 2PSFA 2ZYGA 3K0FB 1MQ9A 1S1MA 3X1XA 2FE1A 3PLRA 5KPDA 2RHRA 3A1DA 4UVEA 3SQNA 4JUBA 5LZ5A 4BZPA 2Z8XA 1M72A 2I78A 2Y4NA 4AMZA 3UGJA 5AVXA 4B4UA 4BKUA 1J0AA 5CXQA 4H4DA 2HRCA 4DM3A 1JQDA 3BWBA 4MB0A 4OHCA 1YI1A 2Z9DA 2JATA 2XRFA 1Z7YA 1GCGA 4AJ1A 3RLFA 1OFGA 4WW0A 5I7AA 1FNDA 2IE8A 3KEMA 4WA8A 4A8TA 2WQ7A 3PDHA 3LUCA 2NLOA 2P75A 1AQUA 1W5EA 2QROA 1G18A 4C0BA 4BMPB 1GQFA 5DN6D 1DFHA 3OSUA 2B9VA 1OT3A 1Z38A 2VXOA 3PIRA 4Q0MA 1STOA 2DQ4A 1R7RA 2BGJA 5F1YA 1NURA 5IMSA 3PLNA 1Q3KA 4PC7A 4E08A 4PYJA 4JY7A 2G1KA 3E35A 5KCMA 1YVDA 4CIWA 1NA5A 2NZVG 1NBWB 2QVBA 3P0HA 5ALRA 2IF2A 3VSBA 1UINA 4TV9A 4B3CA 4W5OA 5FUYA 4XJVA 1MZVA 3TLAA 2HADA 4DMUB 5F5LA 1N2ZA 3OH8A 4CGYA 4IUDS 2C5EA 5AW4A 5K8CA 1NLFA 5CVDA 3E1KA 4N7MA 2PA3A 1B0ZA 1YA8A 1FA9A 1I6LA 1K9VF 1YQTA 4JKYA 1HE8B 1HLDA 1FTYA 2LR0A 3HBLA 4OU5A 4YFVA 1E2JA 1J23A 3KYIB 2HK6A 2P6MA 3KJQA 3EH1A 1Z2PX 1EFHA 3DFZA 2ZSDA 2JGJA 5IC4A 4MPJA 3ENVA 3FDIA 3BB3A 2A0UA 4DJJA 1BDHA 1XQ9A 4FEEA 1EUCB 1VLLA 1WE2A 2NU6B 1Y3BE 2ETVA 2PTGA 2GAOA 2MR5A 4DA6A 4QGHA 3OQ6A 1A95A 2FKAA 4FPXA 3TOVA 2EKQA 2UUBB 3FIJA 3EGVA 5BSKA 4Y9TA 3I72A 4IJQA 2O0HA 2NPOA 4ND7A 4TRRA 3CNQS 2X1VA 4RDHA 2FPLA 1AS2A 2OCGA 4FIDA 4OB6A 4Z0HO 3ZX5A 4EUSA 1T4CB 4BCCA 5HTOA 1U28A 2FR0A 2V7UA 1KPHA 2XRYA 4GMDA 5H83A 4OQQA 4W82A 5I9BA 3TVDA 1PW5A 1T8PA 4G0NA 5JO9A 3ZK9A 3TFOA 3Q8KA 3B1ZA 1YMVA 3AXTA 3CSSA 2JF0A 2ZSHA 1QC5B 3WJ1A 4QOEA 3T4XA 5E4YA 2UU9B 1OPRA 2E1RA 5HGJA 1I0IA 5AVRA 1FSZA 2JHAA 2XUIA 2IYPA 7ADHA 3TRDA 1RPZA 2YDYA 2N46A 3VJRA 3LC1O 1EVJA 2A1IA 1W4RA 3RSSA 3B82A 4JP3A 2NOAA 2DHEA 3A04A 1UKEA 4FYMA 4H17A 5DKFA 1JEYB 3AEQA 5KNDA 4UBNA 1UF9A 1NAHA 2QIPA 1WDTA 3LUHA 2JGNA 4ZVOA 4L8YA 1W8IA 5FPTA 4JXZA 2QSJA 1X9GA 3HDYA 1LF0A 3WDKA 3TIGA 3SQLA 3O8QB 3JU3A 5KTPA 4AY2A 2NVUA 3D0KA 2IOHA 3DKKA 3PHHA 4MGZR 2OBNA 4YMSA 1XHLA 5FOTA 4XUGB 2JEZA 4CMBA 2JNWA 4HAIA 2FVXA 3AOEA 3V9AA 3OU2A 4RIEA 2GN0A 3IUPA 2AR0A 1L7DA 4PY2A 4NDZA 4WECA 2IITA 2WWVD 4KXFB 3QTTA 1JMKC 2QM0A 3K9FC 4RAOA 4JLDA 4P3YA 2HD4A 1X9IA 1Q95A 2E21A 4BVLA 2GYWA 4UE6A 3K73O 4AF7A 3JAWB 1LS6A 4KV7A 4M8NE 4MGIR 3GDFA 4EHFA 3U6KA 3KQNA 4NZ9A 3KB2A 2NW6A 2JFBA 3FB1A 4EAAA 1SU6A 3D3NA 4U1RA 5JS7A 3GFGA 2C3UA 4UNNA 3LXRA 2CLEB 4IKPA 1U2DA 4TQGA 2OWDA 1YUBA 3JD3A 3FVWA 4Q93A 1ATZA 5TB5A 2EW1A 1FW8A 4X1YA 3A4LA 3IB3A 1UXGA 2I4TA 2H2HA 2JKZA 2I03A 3EZ2A 4R1LA 1H2YA 2Q2QA 3PE4A 3U3ZA 1YZQA 1KZ4A 5E3IA 5D2CA 1S4QA 1Z83A 2WYHA 3HGMA 3QE4A 3RI3A 4RJTA 5LIPA 4BKRA 1L6IA 1T2CA 4GZMA 1IYZA 3NASA 4W99A 4DLYA 1D09A 4HAZA 2ETXA 2YWJA 2ZB8A 3OCVA 5H0IA 1IPFA 2Q4OA 3R41A 5LDHA 3KB1A 5HTKA 4DF3A 3BGIA 1LBEA 5JU6A 5ITSA 2AI1A 2V74B 1G3MA 4INPA 5DHFA 3AVUA 1RCUA 4MVJF 2XT6A 1GN9A 2ZPTX 1QYRA 3LT5A 2O0MA 3DDCA 3OC0A 3Q87B 4V3CA 2XH8A 4DXDA 4KAFA 2XBMA 3DKVA 4F9FA 1XJQA 4Z3OA 2FPXA 4NEQA 5B1IA 3U0BA 3ZJ5A 3CCCA 3DEAA 3ZD8A 3OJ0A 2HHJA 3R6DA 2Q7DA 1OGIA 3INYA 4G85A 5HKBA 1JFSA 2RARA 2Y1FA 3F8WA 2PQ2A 4KQ2A 4D43A 4HV4A 4W9NC 4Q05A 4XFKA 4E2XA 5AM2A 1EK2A 1MPXA 2PE5A 3ENZA 2JC3A 2OZPA 2JFZA 3I73A 2A8YA 3WV5A 2RHDA 3MJHA 3OZVA 3QJGA 3UMFA 1WHSB 3AL2A 3QVMA 4E5PA 1W581 2C5GA 1DKOA 2XMZA 1G4HA 3QUQA 2H1OA 1ACMA 3ETJA 1PT9A 4GXQA 2AUMA 4NV1A 4PZDA 4B9AA 1SQSA 1WXHA 4CIDA 3TD2A 3K72B 1DDIA 4MW0A 3QPWA 3VXKA 2R6ZA 5K3AA 4L0CA 4CI9A 2V9ZA 5LA6F 3N6XA 1E32A 5JAIA 3L8ZA 3C70A 2O1EA 4RK0A 4HMQA 1U0FA 3ZCPA 4GQIA 3ZWAA 2C4UA 4C5BA 2VSYA 3K5HA 5INTA 1J5EB 1ZOIA 1X7XB 1KMHB 2OP1A 1TZMA 1E79A 2XEDA 3G9XA 3KOYA 4XUEA 5L7WA 1GAXA 3WYEA 1TCUA 2FOXA 5D3QA 1BS9A 1E2UA 5KNCA 4MMZB 1YE8A 5B37A 1HNWB 3K05A 3KE8A 1CCWA 5JBQA 3HU3A 5IM4F 3TG8A 4IHJF 4YDQA 5J4HA 1Q0SA 3HMKA 2N1MA 2R0QC 3KVNA 4E70A 3SU8A 4BDSA 4B6OA 5IYZF 3DE4X 4EG8A 3ICEA 5JYDA 4MIYA 1JQAA 3Q9LA 5IK2A 3LGAA 4C06A 2VF4X 4YUAA 2WA1A 1OBOA 4ZHQF 4J2HA 1JIKA 2WNIA 4DV2B 1IMJA 1Q57A 1K3FA 1E1QA 2DWOA 4DIBA 2WU3A 2C8JA 4NATA 3QOYA 3V1MA 2F59A 3L0OA 4AJOA 1J2TA 4QBHA 2ZATA 1DBQA 4UD2A 2VPZA 1XU4A 2J07A 3H0EA 2XUKA 4ZK6A 3O2NA 3G1UA 1Z07A 1PQWA 4QBTA 1HTTA 1JQEA 4IUBS 1M2NA 1YZKA 3HCRA 3QUSA 4W7HA 1G21E 1EFRA 4HNVA 1GSAA 1ZM9A 2ZJOA 3E3LA 3C3WA 2UYQA 2X0RA 1U7UA 1VPVA 5GJVC 5DDIP 3UAWA 3ZU2A 3QLUC 1CJBA 5JD6A 3P94A 4MI3A 2HWYA 1PIWA 1Q19A 1PWEA 3A6JA 2W6IA 1I0LA 1VKRA 2RH4A 4H9GA 5A4FS 3E18A 1TL7C 1DUVG 1TM4E 1T3HA 4X6YA 1W36D 3RC9A 4ETIA 2Q6KA 4YMTA 1RLUA 3RUDA 4RK6A 1EP9A 3PGMA 5FNVF 3RH0A 1ZCJA 3UMBA 2FFJA 5B6PA 4PLCA 1E8NA 3PXCX 2QZSA 3F7MA 3ZWOA 1KI9A 2R11A 4RH3A 4MQUA 2DVMA 2Q62A 2ZG6A 1QVAA 5JC1A 1SCKA 3BAFA 2WJPA 3ILXA 3TDMA 1K5GA 4GI1A 4MHOA 1XX6A 2IA5A 2Q2WA 3AFMA 2FXIA 1T9GR 3CFYA 3HU5A 5JCJD 1Y4AE 2DFNA 3CB4A 5FQOA 3L9WA 2Y1KA 5THQA 3A9CA 4R54A 4DHWA 4OQZA 1UBLS 3FNFA 3LBHA 4XEHA 4YYEA 4P7FA 1XA0A 4CTOA 3V7WA 4QDUA 3ZVNA 3VO1A 2FWNA 4H6WA 4LSWA 2ECQA 4H7IA 5IJ0A 1KDVA 2RSLA 3VA7A 2R96A 2WQ6A 2HB6A 1RC0A 3U19A 2BHTA 3TPCA 1ZL0A 2P79A 2BGUA 3EDCA 4M9ZA 5HCIA 3ZOKA 1XP5A 4YUXA 2QN8A 3SYTA 1CY8A 5JEEA 3HL4A 1XZNA 4HWTA 1MOZA 4PNEA 2XJ4A 1JGTA 4Q47A 3CPJB 4LA4A 4ACBA 4ZARA 1NVXQ 4L07A 1ZI6A 3JQ8B 3KUUA 5DYWA 1L5HA 1DAMA 4GLOA 4OJKA 2X8JA 4ZQBA 3WBFA 5LD2B 3EDRA 4HH4A 4B6PA 4KR2A 4B71A 4G5OA 3UC5A 4JQCA 3A4MA 1U8FO 2DGDA 2BMVA 2JB9A 1C7QA 2C7BA 4LS3A 3FOWA 2VDLB 4GQBA 3WYCA 3F73A 3G88A 2A1UB 4NK5A 5EIBD 4IBOA 5KHAA 6GPBA 2PS9A 4DLNA 1H0KA 2NU7B 3W05A 4MXDA 3V32A 5EP3A 2VSNA 4HUQB 4N65A 4QU5A 1XIVA 4ZO6A 2C1XA 3PCTA 1S89A 3QBDA 4JVOA 4CKBA 1ETUA 2XWJI 1UBFA 4X44A 1LLQA 5AOAA 3SPXA 4N7RA 1JG3A 3OQIB 3LXMA 3I04M 4GRAA 3C5EA 4R2KA 3R7LA 5CW2A 4L4ZA 2VPXA 1QCCA 4KO1S 4ARZB 2ZS7A 2ZR8A 2HF8A 4FFNA 2JFHA 2W6JA 2ZS9A 1OZHA 1K3UB 1NWCA 3AUTA 3M6XA 4XGNA 1KKMA 1LJ8A 4C21A 4C0WA 2Q9BA 5EC8A 2YY6A 2J08A 5JWHA 4BCDA 2WU8A 4FWBA 2ODQA 2J9RA 4F3CA 4D7AA 1ULBA 1SOAA 2JIZA 2WJ6A 2ZREA 3ZH9B 2V65A 3CG0A 3UH1A 1S7CA 1XMXA 1HE3A 1YR6A 3DAHA 5DM70 1GQ2A 2AEJA 2WAOA 2XWQA 4G9GA 4CLRA 1GUBA 4PG8A 4TGLA 3GFVA 4WKPA 3Q3CA 1T35A 5KKNB 3IE1A 3K70D 1JWLA 2R1ZA 3CWCA 4HR7A 1LK7A 2VP9A 1T4MA 4WY8A 1CR0A 2D5CA 3NH9A 5C7IO 5JISA 2FPWA 2ZBDA 5A1JA 2XW6A 1Z37A 3EOZA 2SECE 5LPNA 4FTWA 5JQGB 5JAOA 4GI5A 5CBKA 1FC0A 4C20A 2R2GA 1B6TA 1UBJS 2XRZA 1L5FA 3TQQA 2LNDA 4FYKA 1LW6E 4NYJR 4A23A 2ONYA 1KVUA 1Z82A 1GPKA 1ZU5A 4M0FA 4XVCA 2F43B 1PV4A 4JBYA 4OX9B 1N2SA 2H8GA 2NAFA 1L0BA 1VXRA 3O26A 1ZDMA 4H1HA 1KBZA 2JFGA 3VU9A 4LZOA 2EX0A 2ZXUA 4JV5B 4MK4A 1MC8A 4UVIA 2P1ZA 4YXWA 3HP4A 4BO1A 3IEMA 2PUJA 1OPXA 4HDCA 1SXJE 1BWPA 2OQIA 4PYIA 2I8CA 2P9YA 4RSGA 4QJ4A 4BZWA 3ZHVA 2QD5A 2WD8A 1NR7A 3KZKA 3PDIB 3MTJA 4CQJA 4ZEVA 5CCBA 3OFKA 1Q7BA 1SOMA 2E9SA 3L46A 5G3YA 3K0BA 5JQGA 1WY5A 4EA8A 4NCKA 3P27A 1Q0ZA 4FC6A 4ZT4A 4HSGA 3I5UA 5IT9A 5BXQC 1A2OA 2QSUA 3HA7A 4UEQA 2P9ZA 2P91A 4HQOA 2WC1A 4X8MA 2V7WA 4XB6B 3FFWA 4Y98A 4D81A 4DBVO 3AOGA 2Q7OE 1JDBC 4YRRA 2H4HA 3OPYB 1W9HA 2HMYB 2VH2A 1F5NA 4YJGA 3S0JA 1RD4A 4Q37A 3R23A 4OJTA 1NVWQ 2DPLA 4I55F 3SHTA 4EIWA 2VTBB 4NXMB 1QHIA 4N7BA 2FFAA 4XRRA 1HNZB 2NUAA 2O6LA 2WV7A 4RPIA 1KJWA 1NONA 1WULS 2O4CA 2XXAA 1TZCA 3K5PA 4QUKA 1E1LA 1I13A 1CLEA 3PEYA 2X1HA 3KJGA 4XB1A 1K5HA 3CZ5A 1BGXT 4YLGA 2W70A 1AGXA 5DI9A 1KH3A 4P33A 4YY3B 1MRZA 1NPDA 5E1BA 4RCZA 1EAMA 1Y7LA 3H2HA 4FDLA 3VPDA 4ZVQA 4C76A 5GTDA 2VNJA 1K92A 3H97A 1Q0UA 3KIPA 4RPLA 3LMKA 5CFRA 3I62A 3WKBA 2IQ5A 3B6EA 1TDJA 4H7DA 1A5TA 3A4YA 2JI8A 3HFGA 2D3WA 4J2OA 1U3GA 2UYGA 3LTEA 3CR3C 4NENB 1F1JA 2FN3A 5K05A 2WJ4A 3C8HA 3SS7X 1O4VA 4JGBA 1QH1B 4QXOA 1KK1A 1CEQA 3PDJA 2VQFB 2HWUA 4LGVA 4MAMA 3CZCA 3B5EA 4ISBA 1G8MA 4I1OA 1W48A 3GJZA 4MO2A 4ZQCB 3ZWBA 5FUWA 3H2KA 5CFNA 2F3QA 3DZFA 5HBRA 1YQDA 2O5RA 1XQ1A 3VDQA 1AN0A 1PFQA 1A71A 3D6AA 3FF1A 3FXAA 3DMGA 3M5PA 3O8OB 4EPXA 3A27A 3A11A 3U4IA 2D0DA 4R31A 5FEUA 1SG9A 4DUYB 1N2IA 2CVHA 5E7JA 2MIIA 3RFXA 4WBNF 4YR9A 2YS7A 5ICMA 1Q3HA 1Z0JA 4UNSA 4C7XA 4MYTA 9ATCA 5LJLA 4L95C 5C8YA 2VCEA 1E61A 2O20A 1ZRMA 2NADA 4O1MA 4BFYA 4TV8F 4CV1A 1ESDA 5KSOA 4E5KA 5JXHA 4UC0A 2GEKA 3N2GA 2IPOA 2NO5A 3R7WA 1YZGA 3H3JA 1JQJC 1QB8A 4JWKA 3A4VA 5BUCA 1H9CA 3K5WA 2EBWA 4B3IA 4KKVA 3HA5A 2CJWA 4UZEA 4C7OA 1PG2A 2A84A 3CPSA 4UM8B 3RHTA 1MJGM 1SCUB 2DTXA 2WUFA 3HXPA 3IAHA 3ZNQA 1TZJA 5L8VA 5K9ZA 1U3VA 2H2DA 3V3TA 4EY4A 1AXGA 2GNOA 1I30A 2RKBA 3DZDA 1B76A 1DFGA 1UPCA 4Y0NA 1UWKA 2BCEA 5H82A 3DLPX 1OX4A 3QHQA 3AUUA 5DW3A 3AP1A 4ARAA 3PHGA 4EF4A 1B74A 2JARA 2AWNA 5IW8A 1W30A 3UJ6A 3SJ7A 1GQRA 1XYVA 3N2IA 4HJXA 3SC4A 3BWMA 1TLLA 2WFZA 2DWPA 4HGNA 2JH3A 3E82A 3EVAA 2XCSB 1T9HA 1A9TA 4CKWA 1ZCBA 4Y1FA 1M34B 1AH2A 3S3TA 1DARA 2E49A 4WJZA 1KAQA 2XE4A 2FUKA 2RHGB 4QPZA 1KMHA 3KKOA 2JIOA 3NBXX 4U7JA 3SJZA 3KWJA 1YJ8A 4KPEC 4NDAA 4MB6A 2OKCA 4MVJM 2BFAA 1Z5OA 1UJ5A 2ATIA 2I3DA 3HPQA 2AHRA 4BNKA 2O7SA 4DQ0A 4EW3A 1CUHA 3OPQA 2HRDA 1PYDA 1QWSA 2QL5A 3CNNA 4ABTA 3I9FA 2H1SA 2D62A 1UC5B 3WWPA 2AX4A 4R9RA 3MTEA 3ZE9A 4HEA1 1RVV1 3QBTA 4GP7A 1A72A 5KYUB 3CRW1 4Z9BA 3S29A 3BL8A 1HI9A 1W52X 5JNLA 4YPOA 4MUEA 4HDRB 1EA7A 1TQ2A 4A5SA 4YQZA 5CVJA 4M1OA 4LHXA 4HFMA 1VI5A 2W6PA 3O47A 4NG5A 5FDFA 1R5NA 4KB5A 4NJEB 2QU7A 5F23A 5F2OA 4CXMA 1AUXA 1QHXA 3VYTB 2J4CA 2PA0A 1DLIA 1DKQA 4L8VA 4OHBA 4JODA 4DG8A 2J3JA 1RYZA 2B8JA 4RF3A 5BR7A 4A73A 1C2YA 2FPIB 4FI3F 4JT4A 1C9MA 1QG6A 1V8OA 5B3AA 4N03A 5EEGA 3S5UA 3WA7A 2O2JA 1FFCA 1NN1A 3SZRA 4P86A 5EPEA 1F9EA 5HDQA 3DXFA 3U3JA 3ZKAA 5BN5A 3IAXA 1LPPA 5KYTA 5JG7A 1CDDA 3BXHA 2GN2A 3NHMA 3NH6A 4M46A 3ZI7A 4B3MB 3QPVA 1KJNA 1FXWA 1GUDA 1B3RA 2A9OA 9LDBA 4KQ9A 4DUGA 2QP4A 5E6SB 5IDWA 3FUXA 1BA2A 2RB5A 3LGSA 4PQEA 2WWYA 1CF9A 1BGVA 4AF6A 3RFVA 1J5PA 3IVCA 3D5TA 5TC4A 1A5ZA 1EIWA 2SKDA 2V4UA 4WWHA 1XCLA 3JZMA 4S05A 2PJZA 5CFQA 4CODB 4ALJA 2VK1A 4IIUA 2ZYDA 4EJSA 4UKDA 4S24A 5EZYB 2D1YA 3BIFA 3N8KA 1YNOA 2IZ5A 2JK1A 4NYIQ 4I6GA 1CX9B 4RZ3A 4IG9A 1U2QA 4LXYA 5C4GB 3D3WB 5FI1B 1NHWA 2QN3A 3PKZA 4GPBA 1GT6A 3A1NA 4JSRA 3B53X 3WLEA 1SD2A 4CM8B 1I4OA 2W6MA 3TBHA 3ZZNA 5A0TA 3DG9A 4GPIB 4U0KA 2OMKA 2XGGA 1KFEB 1OJ7A 5FUMA 4PLGA 3T0IA 1EKXA 1F2DA 4TS9A 3OMLA 4ZAZA 4L75A 4XM2A 2X6RA 3NGMA 4Y0VA 3SF8A 2GBFA 2RGBA 4KXLA 4FFMA 2GZAA 1YZHA 1MIOB 2OGWA 3H16A 3TF5A 5JJCA 1A88A 1XRPA 3WO1A 4DL9A 1NUHA 2P8JA 4YJFA 3VR6H 5F2NA 1CG6A 1FXUA 5ALPA 1UBCA 4ETMA 4F3KA 4JBHA 3DE6X 4O4JA 2J33A 2BELA 3UN1A 4UZSA 2Y9MB 2ZJ8A 2RHTA 3V1YA 1VHWA 3Q3JB 3G8CA 4DA0A 4Z4EA 2BKUA 1GPH1 3IKJA 2LDXA 1R16A 1C3LA 5JRDS 1C4XA 2WWWA 2Z30A 1AKNA 1H2WA 3CJRA 3OFNA 3OOWA 3P2YA 1G6Q1 3JQAA 1JR3E 2F8MA 3H2ZA 3GPIA 1R1DA 1PUXA 3KVVA 4KGVA 4KLZA 3P8ZA 4MUNA 4PRKA 4R9UC 4IIYA 5JZ9A 1TD9A 2IIPA 3I6YA 5FP0A 4N0DA 4DIEA 2HL6A 2JBAA 3MCWA 4LHZA 3BKWA