1B1CA

Crystal structure of the fmn-binding domain of human cytochrome p450 reductase at 1.93a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
SSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the FMN-binding domain of human cytochrome P450 reductase at 1.93 A resolution.
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (NADPH-CYTOCHROME P450 REDUCTASE)
total genus 62
structure length 166
sequence length 166
ec nomenclature ec 1.6.2.4: NADPH--hemoprotein reductase.
pdb deposition date 1998-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b1cA00
5LVAA 1YDGA 2AMJA 3R6WA 1AKQA 3TZBA 1OBVA 2OHIA 2FX2A 1VMEA 3O73A 4FGLA 5ULLA 4ZVKA 4DIKA 4ESEA 4YAUA 2MWMA 5JROA 1RCFA 2QX8A 2Z9DA 1KBQA 2OHJA 2RG1A 4GI5A 1CZHA 1YCFA 3QE2A 3ESXA 4U7HA 1CZNA 2Q9UA 3NHLA 3OJWA 3W79A 3ESZA 5F4BA 2M6RA 4S24A 3GFRA 3QFRA 4YAFA 2QX9A 3U7IA 5B3LA 1CZOA 2FOXA 1H69A 2V9CA 3B6MA 3GFSA 2QMYA 3K20A 4QOHA 2ZKIA 1AKRA 1OFVA 1WSWA 4PTZA 1AKVA 4U7GA 3OWXA 5NLLA 1WSBA 2F1OA 3NHSA 4XDGA 2HNAA 3B6KA 1AKTA 1FLAA 3B6JA 1SQSA 4LTDA 2BF4A 1AHNA 2FZ5A 4HEQA 4YAWA 2WC1A 2XODA 4ZVMA 2FZVA 3HLYA 5LBUA 1FLDA 5A4KA 2MTBA 4PTYA 3N39C 6NULA 4U7FA 1TIKA 1X77A 3OJXA 4BMOB 3OVMA 3P0RA 3F2VA 3N3AC 3NHYA 1AG9A 1AKWA 2FCRA 4YALA 1BU5A 2QX4A 5LJIA 2QX6A 1JA0A 1XYVA 2FAXA 4N65A 3QFCA 1AMOA 4ICIA 1NNI1 1AZLA 1FVXA 4C0WA 1T5BA 1J9GA 3RPEA 5LMCA 3N3BC 3TE7A 1E5DA 3FNIA 5FUQA 4H6PA 3FW1A 1QR2A 1C7EA 2B3DA 3NHWA 2BZSA 2R97A 1I1OA 2MOKA 4C76A 4PU0A 1QRDA 4GQIA 3D7NA 4H2DA 5FX2A 3W7AA 2QR2A 4D02A 3NHUA 3GAMA 3GFQA 2BMVA 3O2NA 1ZWLA 2BN4A 4YQEA 4LTMA 1FUEA 2OHHA 3EYWA 2Z98A 3L9XA 3JSXA 1XI2A 1FLNA 4J8PA 3FX2A 2QMZA 4Y9RA 4C14A 3NHJA 4N82A 3NHRA 3F6RA 4HS4A 3W78A 2W5UA 4BMPB 4XDHA 3B6IA 5LLDA 4LA4A 2XOEA 2BPOA 1FTGA 2FLVA 3FVWA 3TEMA 3UXEA 3OX1A 1YOBA 1B1CA 1RLIA 3OX3A 1CZUA 1SG0A 3OX2A 4R81A 1JA1A 3SVLA 4QOIA 4LTNA 1FX1A 4ZVLA 1YKGA 1J8QA 2M6SA 3G5MA 1DXOA 1QBGA 3LT5A 3LCMA 4M0CA 3W77A 4QODA 1CZKA 2FDXA 1OBOA 3KAQA 3L9WA 2X2PA 1BVYF 2OYSA 1H66A 2FVXA 2D5IA 5NULA 4QOGA 3ESYA 5B3KA 4OXXA 1DX9A 4YAOA 5LBTA 5EMNA 1YRHA 5LJLA 4Y9UA 3KAPA 5F12A 2MT9A 3EDOA 3HA2A 1T0IA 2GSWA 5FA6A 3NHKA 1YCGA 2HNBA 3NFRA 3U7RA 5TGZA 4QOJA 1KBOA 3ES9A 5BUCA 2KLBA 4ZVNA 3HR4A 1D04A 1ZWKA 2Q62A 4GR9A 5F51A 3ZHOA 2R96A 2N1MA 1ZX1A 1V4BA 3UXHA 1CZRA 4C0XA 1J9ZA 4F8YA 1TLLA 2V5VA 4QOFA 1YCHA 2HPVA 4Y7CA 4NLLA 2ARKA 3FJOA 3KLBA 2V5UA 3F6SA 4CETA 3NLLA 3NHPA 4N9QA 3K1YA 1XT6A 4DILA 4DY4A 1RLJA 1C7FA 1AKUA 3NHFA 2KQUA 2A5LA 3KEGA 1GG5A 1CZLA 1D4AA 4QOEA 1DXQA 3F90A 1F4PA 3OWHA 5EA2A 2QWXA 4NULA 1FLVA 4LAFA 4FGJA 2Z9BA 4CF6A 1XYYA 4FGKA 3S2YA 2X2OA 4FX2A 5EAIA 2Z9CA 1D03A 1RTTA 1J9EA 1QHEA
chains in the Genus database with same CATH superfamily
5T57A 1P8AA 2VTVA 3ZU3A 3UAWA 1ONNA 3C4QA 2YZGA 1F17A 4HNVA 2A86A 2I7DA 1QSGA 1I7NA 2D1QA 1YZHA 1X0XA 2Y1FA 3EEYA 3G0BA 3KELA 4UZSA 2A4MA 2Q8QA 1Q0SA 4EKNB 4P08A 1I80A 3IAS6 3QFRA 3ZNQA 1NHWA 1TW3A 2R44A 2GEDA 1X9HA 1XFDA 3H2JA 3L49A 4YCLA 2RHJA 1BMQA 5KYTA 5FRDA 4IIVA 2VVTA 5CVCA 1ESNA 5ALOA 5EZ6B 3RGGA 3NXKA 4X85A 4S0ZA 3L07A 1QB8A 2XVZA 5CFMA 1C7QA 3M6UA 1VI5A 5AXBA 2A57A 2O0MA 4LZZA 1D4OA 3B1JA 5F23A 2C1XA 3IS3A 3UNXA 3REFA 1Z3IX 1G8KA 3LDHA 4UNQA 1KA9H 2VRCA 3ROXA 1GZ6A 2NN3C 5F7JA 3V4VB 1BJTA 3TLKA 4ZAFA 4JLPA 4KQCA 4ZVTA 2YWRA 3BIJA 1Y5NA 2IC5A 4EOGA 4F6RB 1V9LA 2JVJA 2AFHB 3FGNA 2Q45A 2WF9A 2WKWA 4RQUA 4JUAA 4Q3AA 4Z3DA 3OTWA 1FLNA 4NU5A 3F3MA 2XQJA 2WV9A 4UNNA 3U19A 1IOWA 1NT4A 1XAGA 4O4JB 4ZICA 3L7DA 4O8CA 3JD0A 1O8BA 3GK3A 1TAGA 4LRYA 4BBPA 1V2HE 2GN4A 4G36A 4DDUA 2ZR9A 3JWJA 1CCWA 3GYBA 1WF6A 3CEHA 2VN8A 1I33A 2HHJA 3HU5A 1LBIA 3CT6A 3BL8A 1FX1A 3JALB 2QOEA 3OA0A 4XIGS 4ZWNA 4G23A 3SC2B 3SF8B 1GLGA 2JFQA 4YJGB 4QX6A 4TWAA 3I83A 4AUEA 1NXXA 5IZ4A 3U62A 4Q47A 3RBAA 2N1BA 3H1EA 4ALLA 1DVRA 2W83A 1OX6A 4D3YA 5A02A 1EKXA 5F7XA 2G08A 3ABIA 5BQ5A 5DCUA 1MW8X 3GL9A 2E5FA 1AUPA 3HKDA 3K70C 2X5NA 2F3QA 2W2KA 5KYWB 2H2IA 4YUYA 4DDWA 1ZNZA 3G9XA 4XCXA 1UKVY 1PGQA 3ZX5A 2PXAA 3O03A 1JQEA 1MFPA 1PEKE 3UXYA 1E94E 1RSZA 3RT9A 4BO2A 5D51S 4MS4A 4MW6A 4DRYA 1WMSA 5CUQA 3JV7A 2WTAA 4I4CA 5D7NA 4EA7A 4TV9F 1BHJA 4RDCA 2X22A 3KS9A 5IF3A 1YZQA 2QTRA 3JAKA 4B83A 4GR4A 2EFDB 2BCGY 2PXHA 4JL6A 1E66A 1NWCA 3R6GA 2Q3DA 3I8OA 5BNFA 3TTUA 3AERA 1P1FA 3CBGA 1RC1A 1KHHA 2E7ZA 2HMAA 5LU8A 1X7ZA 3BQNB 3RFUA 1PR1A 4UBKA 2QI9F 1C1YA 1VJCA 3F6CA 3LHDA 2YL2A 2YVUA 5DTMA 3JXEA 5IYZA 1XJ0A 3AILA 4NPAA 1A4IA 3WE7A 5FWXB 4Z8YA 4WY2A 4EF4A 4BYGA 1T26A 2P2YA 1XNJA 4AN1A 3EA4A 1GG8A 2QXTA 4M9CA 3D8RA 3DCIA 4P5DA 2V6BA 2WK1A 3PEUA 1AO3A 2J1LA 3DVRX 3FUWA 1T5OA 3PCRB 5DXJA 5HZGA 3DE6X 4DJDC 3NNNA 2CD7A 4Q02A 4QGAA 1E62A 3ISTA 5CDFA 4OKNA 3OLVA 3BRCA 2B8TA 2PLFA 2PQ2A 1RWXA 4WK2B 1WUHS 5HF8A 3QP9A 2DC1A 2K2WA 4AURA 3CZAA 4BO3A 4I36A 3LPMA 4QECA 2FI1A 3RJZA 3DTVA 3ZCPA 5HILA 2I8CA 2ZPUA 3IVAA 1EX9A 2EBUA 3R3VA 2UUCB 4EEXA 3RFFA 3RKSA 3A7DA 4GPTA 1EGQA 4HO1X 1VKRA 4IUDS 4ALNA 3OEED 4XWWA 1AD2A 1AKWA 1O9GA 2G76A 1JSRA 3WO0A 2NLOA 4QHTA 5EMHA 4Q9HA 4YCDA 1RQGA 4BN0A 1Y4SA 3CS3A 4TOIA 2I71A 3UFBA 3FOFC 2PT5A 2Y4NA 2AI2A 1UAYA 3MJHA 3GLIE 5LNK6 2Q1XA 1Y4AE 2Q1YA 3GUYA 4Q7MB 4MQEA 4RETA 5DMHA 2D5BA 4D9BA 3Q3GE 4FHGA 3Q9UA 4RE6A 1W52X 2Q6IA 2BKAA 5FOSA 5DNYB 1E2UA 2DB3A 5CA1A 3GDHA 3OQIA 1UXKA 1FYFA 2LWIA 3I42A 3ZUGA 1W2GA 3G8DA 1IQPA 4HBZA 3EDQA 2EZ4A 2PV7A 5CFOA 2NSJA 3LDUA 3SWWA 3UH0A 3EXHC 5LYJB 3IIJA 2O8CB 4ECAA 4MDHA 3KR2A 3MG9A 1VBMA 4O4HB 1UPAA 4OP1A 4GDMA 2R1VA 3QI2A 4WLNA 5JSHA 5LBIA 3NWEA 3R0ZA 1L7AA 1QUFA 3MTBA 1AGRA 3OCJA 4OKSA 2J7PD 1CJMA 4AO8A 3LCMA 1OWMA 4DIBA 1U0LA 3DZ8A 2B5VA 2ZATA 3EHDA 4FD3A 4HN2A 1LF0A 3RUFA 2R3SA 3IL2A 4Y9UA 2HBYA 3KAPA 3OE7A 4W9NA 6ABPA 1R4AA 4QULA 1DXYA 3RAGA 2HD4A 3FI0A 4LX0A 4WKCA 5E2AA 1I6WA 2VYFA 3TLGA 3PDCA 4R2HA 4G67A 2I9PA 3WL5A 1YT5A 1THTA 3EN0A 2G0AA 1TUBA 1ND5A 4EZBA 3HXTA 2Q1UA 1YJXA 3EUFA 1JFVA 3Q8XB 1D2HA 4EHHA 1Q0LA 1N75A 1XDWA 4FMCB 4X6LA 1FS5A 1NQAO 1T5DX 4IXTA 5JSUA 2DH5A 3KZVA 4FC7A 3WAGA 4G0YA 4P22A 4ETIA 1ZA2A 3PDIB 3FTQA 4DMGA 4W5RA 1NN0A 1NW5A 2VAVA 2ZRHA 3QPBA 3RRXA 5BQXA 2R8ZA 5FDFA 5IT9A 4FOPA 3HYNA 3TKLA 4L6IA 2EKPA 1WSAA 3BGWA 3PD0A 2JFGA 4DMMA 5AM4A 1SZCA 3ID6C 3AY7A 3JASA 1F6DA 4RKRA 5B36A 2H0QA 1QGUA 2HCBA 1HBJA 2R7NA 4JROA 3S2YA 8OHMA 4WKPA 4HEHA 4ML3A 2GF0A 2FG7C 2WLSA 1L5VA 3NBFA 5ILGA 1BOFA 3LAWA 2Z4SA 1HE4A 1U2DC 1EG2A 1LI7A 4YT8A 3UMFA 2JLWA 3DAGA 4AZ0A 5L3QB 3SVTA 5D6NA 5GJVC 1XDSA 5TS2A 4KAFA 1S02A 1Z47A 4MAAA 5CH5A 3ZGVA 3FMGA 2OC9A 4ZQIA 3CIOA 3I04M 3QIVA 3CG0A 4LJYA 4LRWA 2LBPA 2B1GA 2O6LA 3L92A 1X3LA 4E4YA 3JZMA 5HSGA 5TMBA 1DWQA 2AFVA 4GRDA 4XDGA 2CNWD 2GBLA 3TGWA 4EK9A 4UE6A 4OCZA 4BWVA 1Z2EA 2J9YB 2CJFA 5HRCA 4BZZA 2AKEA 4ZCIA 1W87A 1OXKB 4AC9A 1VLVA 2OBXA 3I2FA 4J1NA 3UAGA 4LEIA 4A92A 4ZYWA 2O07A 5IYZB 1EHIA 5HIIA 1VLJA 4X45A 1RLTA 3AVPA 4P32A 1TYAE 4TRMA 3CSDA 3E0QA 4EVQA 3O75A 2PSSA 2DSTA 3TRFA 4CMGA 3KQNA 1G7TA 3VZRA 3A2MA 1UFRA 5A03A 2FPRA 1G5HA 2C8LA 3MCAA 2H4HA 2OV3A 4MS3B 3UJ6A 1X14A 5IH3A 2Z83A 2CLOB 5JFOA 1G8JA 2GILA 2PT9A 5DPMA 3I9V1 3LUBA 4MAFA 4ZVQA 2E4XA 5BOVA 3IELA 1JJAA 4JLWA 5EJIA 3ZWOA 1UZLA 1TC1A 3VMMA 4P4TA 3K35A 3JSXA 3X1XA 3AUTA 4AM8A 1V8OA 3EDRA 3JAWA 3B5EA 4BVEA 1A9ZA 1B0ZA 1PGOA 4DEYA 1MO6A 2PN1A 4COOA 1K0UA 4E5UA 2ZB8A 1W5AA 4ARVA 3U3KA 1GRCA 3OA2A 5KHOC 4EB0A 2NU7B 2W22A 4R81A 2NT4A 3IKLA 5AWFC 5T6BA 3LVBA 2MYUA 1K6XA 2QNIA 1FDOA 2EYQA 4BP9A 1BOOA 3SIPA 2P3LA 3H1AA 5CLJA 1LDBA 1XA4A 3NTRA 2I76A 3H7IA 1IG0A 3AL2A 1M2EA 1TUIA 3N6VA 5B3KA 1C7IA 4G8BA 1ZOOA 1NLMA 3UFXB 1QG4A 2H2DA 4BVLA 1C2TA 1B8NA 4DA4A 2OK7A 3EDOA 3N2KA 2B1JA 4GVXA 2XDWA 3SKXA 3ZKWB 3AESA 4AS3A 3KBBA 2ZWIA 3PEEA 4L07A 1JFTA 1M83A 2BH9A 3B2EA 1Q84A 4UUBA 4C0XA 1VSBA 1ZN9A 3G7SA 4HH1A 4HDAA 1O89A 4CGZA 3PS9A 1VB5A 3B7WA 3BE8A 1X3SA 2SBTA 3OPQA 3PNMA 1CF9A 2QW1A 4IDPA 2J5QA 5G4KB 2XUZA 1SN7A 3VH4A 4PYKA 2HW8A 2NU6A 5AVOA 3ADBA 3QEMB 3HCAA 2ZYGA 4K1XA 1PTJA 5ITSA 2B4QA 4HQ0A 4OD0A 1Z36A 3D8NA 4O4JF 1KYZA 1WETA 2PMBA 1Z9BA 3LBYA 1J06A 2P5SA 3W8DA 2LNDA 3H83A 1FFEA 1UMBB 1RWVA 1KK3A 2HO5A 4BCBA 5AOCA 4ZYZA 1KBQA 5JFGA 2AYZA 4CF4A 4UM9B 1XA3A 4NMMA 1RJ9A 5J1TB 3K71B 4ZV9A 3WFJA 4EGJA 2XMGA 4GMKA 4RTLA 2OAQ1 5CT5A 3A6PC 4TRRA 1QTIA 5CYOA 1Z4QA 2C94A 4O2BA 2H31A 2O8EA 2H18A 3H6GA 3LIPA 3I4CA 2JLUA 4O0MA 1XXHE 5CPBA 2EFJA 5KQGA 1I01A 4GU5A 4KWHA 5F21A 5T4FA 1TD9A 3IX7A 2HJSA 4B33A 3H2KA 1CTQA 1I2CA 5GOTA 3SX4A 2H17A 3WWDA 1AA9A 4ZJUA 2H2AA 2P9ZA 2DHRA 1HSOA 1Y63A 2YIVX 3LVFO 2FSHA 5KDLA 4B74A 4X20A 2QLTA 2G4VA 3GEPA 2QVYX 1FFGA 3A6FA 1EXNA 1Y5IA 3QKRB 3PQ3A 2VZEA 4I1RA 3RPEA 4PLHA 4C88A 1LS1A 1JEQB 1SOWA 1LH0A 2FXIA 2FZEA 1F9AA 1EP3B 1EP1B 2JH3A 3P9NA 1KSJA 4LE1A 3AF5A 4EKGA 1DIOB 3IHWA 1Z4OA 2ZM5A 1Z2AA 1LLFA 1UPUA 2R1UA 5E6UB 2CHEA 4DQXA 3CXRA 5BWNA 2O1WA 2X3UA 4NH4A 4ZFNA 2CCJA 1AVTA 1NP7A 1CRPA 1VMIA 1W4RA 4URWR 5DW3A 4TS4A 4JI2B 2GM9A 2W6NA 1U5BA 2JZNA 4G37A 1SJ9A 4KLCA 5YASA 2HUNA 2QB5A 1U6IA 1UBKS 2YUTA 1HGXA 3OZIA 3RSCA 4FB5A 5GTDA 3MPOA 2ZTHA 3H5NA 1I51A 1C14A 1THZA 5FFMA 2BEVB 1BDMA 1JS1X 2G0TA 1ATIA 4BDTA 1P0IA 3O90A 2VA8A 1RMQA 4PBSA 3ZX4A 4JELA 2I99A 4WNAB 4RY8A 5LDDC 3ZDZB 2Z3WA 3UJ7A 1ILEA 3T7RA 5JXIA 1AKYA 2JANA 3RVBA 5EE3A 1EP9A 3ABRB 3EQ6A 3ZGXA 4WMLA 3G5AA 2FW8A 1WL8A 1QS0A 3KAQA 4W5NA 4AKEA 2Z2XA 2C58A 3NHBA 4N5HX 4IUCS 5A5DA 2VQ3A 5E0OA 5CD9A 1ZK4A 2AI1A 1DAPA 2Q5EA 4LYHA 4DF3A 1TCAA 1SKMA 3X0DA 2FSPA 1BQ3A 5IVDA 4IQGA 1WUYA 1UBOS 4CDGA 4NX2A 3MCTA 3OLWA 3UV6A 4F11A 3KP1A 2D4AA 5CB4B 1T4CA 1R4ZA 2VZ0A 4WDRA 3CPEA 4MWZA 1FFBA 1OLUB 4EY8A 3HKCB 3PWZA 2IU3A 4RM3A 3WZ2A 4ZYLA 3THXB 1J23A 3P0IA 5AJXA 4FLFA 4DILA 4DY4A 2YN2A 1VI6A 4OQQA 1I4TD 3CQ9A 4MQLA 4QNNA 4HF7A 4EDFA 1TLTA 3ZR4B 1NQ5A 1V11A 4YJHB 5J2TF 5JZSA 3U49A 2DXIA 5FWYB 2REQB 1Z5NA 5DGIA 4CM6A 5K8IA 3CB4A 1S7CA 2DWPA 2XI4A 3ZIAD 2ATIA 2HWWA 1NRJB 4QEKA 3C4JA 2WWHA 4GMFA 3GP5A 1SHLA 1Z33A 4A8HA 4U6QA 2WV7A 1OXUA 3NO4A 5DSTA 3ZD9A 1K7EB 1SVMA 3VAZA 3ZEIA 1SPBS 2EX0A 3PG5A 2DWQA 4M9XA 4EYKA 1GRVA 1L5GB 1T9GS 1PBNA 1RCFA 2KPOA 1W36D 2XUFA 3NU1A 3F97A 1Y9AA 3BMNA 3IILA 4RF2A 3IEKA 4Y2YA 2M6RA 4YAFA 3S8MA 4CG0A 2M2IA 4MPRA 4ZO9A 3EFOB 1IB6A 2ZS7A 1UAAA 3DLCA 3EOAI 2BAGA 4DWJA 4DCPA 1WV0A 4O63O 1K92A 1LI5A 2WPNA 2X0EA 5AUOB 4OFZA 4KVZA 3CNEA 5BUQA 4N3BA 1KMHB 3I2IA 4ZV4A 3H87A 2IS2A 3A1SA 3KKPA 3SKVA 3NR2A 2IQ5A 3AONB 3AFNA 3BSYA 1E63A 3ASYA 3BG5A 1UOPA 4ZOEA 4HEA1 4IDBA 1O4VA 3M9XA 3FCSB 3I5XA 4II3A 1WKBA 3ZC3A 1J49A 1K8QA 4M8KA 3LCUA 3PF9A 2Q2NA 3KL2A 3Q72A 2FA9A 1JYEA 1X0VA 1U1GA 2OZLB 3IE0A 4BZXA 4YPOA 4AQ7A 1MLDA 3OZGA 1UJ6A 1QP8A 5E2BA 1NP6A 3USES 3F7MA 4RPCA 3ZZNA 5K01A 3PUZA 2CC2A 4QJIA 2C2MA 2PVSA 1P17A 1QCYA 3NOQA 3G02A 3NP9A 4H0NA 5DP1A 1YQDA 1HYHA 3VM6A 5EHZA 1T25A 2OGTA 1E77A 5F2OA 1TTHA 4J8PA 1BJRE 2AZDA 3ONEA 2Q7DA 1PG5A 3VH3A 5HKAA 2AG0A 4ZPXA 1YMUA 1HDCA 1ZESA 3GXOA 2PH7A 3UTDA 3IDOA 4Z9AA 3ZVLA 1PNVA 3HH8A 1MHTA 3PE6A 1E2IA 1TZKA 3GI1A 3IEPA 3PI7A 4KXQA 1L1RA 1U02A 3RAJA 3THYA 3E2IA 3DB1A 4BAUA 3OHMA 2ZWOA 3ILHA 5NULA 1D8TA 3PQ6A 2JBHA 9ATCA 4M1YA 4MIKA 5ES3A 2PU7A 2VZ8A 3JWPA 3PQ7A 3ECSA 4CL8A 3D7MA 5DHQA 5HIJA 4MAMA 2X0IA 3WWEA 3ESCA 2FPOA 3K4HA 4LRTB 3ZK7A 5IJZA 2GD1O 4P3PA 1G8AA 2BFNA 3A2LA 1M8JA 4JBHA 3WBFA 5HM8A 1EJ0A 4Y3UA 1GSOA 3EC7A 4A23A 1IZYA 3EB9A 4XJVA 2FEMA 3U5ZB 2EU8A 1J2UA 4TKVB 4GF5A 2JIPA 5AYVA 4DNQA 1K8YB 2YY5A 4TL7A 4BVKA 4RHUA 2ZYHA 4Z4FA 1ONOA 3C5EA 3ABSB 3V9AA 2RBEA 2JARA 1KMQA 4IS2A 4P83A 4QPJC 3UKJA 3ELBA 1EFTA 3RIYA 4XM0A 4B3JA 4D0GA 3MINB 3I52A 1ZRNA 4MWSA 1DOZA 3S7ZA 4CMEA 3M4ZA 1GQFA 1QFYA 2BEUA 4J49A 2WG0A 4WWHA 3HE3A 1HFWA 1JP7A 3B8HA 3D1LA 4RVUA 1NBAA 1H2ZA 3DBLA 3MTJA 3PHGA 2VNAA 1JILA 1FFXB 1K3UB 2E1PA 2Y1GA 3KCQA 4J3FA 3EQ9A 4NMXB 4NARA 4WGFA 4ALMA 4I3GA 1OKKA 4HLDA 1ESEA 1N2XA 4F3NA 1ORDA 4ZAWA 3DH0A 1P1IA 3D3EA 2CBGA 3C87A 3K6KA 3O8QB 1C4OA 4PG4A 2CVPA 3BRQA 4FNMA 3TZBA 4MINA 3N70A 4YJ2F 4EMSA 4BJ3A 4QVKA 1N4DA 2NQ8A 4C03A 2X8AA 4IDCA 3SQOA 3MGBA 4PZCA 3FOEC 1CU1A 1PWYE 4KZPA 2NZWA 4ODIA 1G5PA 3OOSA 2EFYA 1EHYA 2WM3A 2ERCA 3EFEA 3LPAA 2ZYRA 1PK7A 2CHFA 5FA8A 4ARSA 1PEYA 1VHQA 1VJ5A 4GMDA 1D6NA 1RFGE 3H9CA 4ZYVA 1A2OA 1LUAA 3OZXA 4E1VA 3GWGA 3TPCA 4RPJA 1I4OA 2GH1A 4C4SA 4HUQA 1T1JA 5FCDA 1EDZA 1PU2A 4BNGA 1PR6A 1Q0ZA 4BZWA 3F2VA 1B41A 1XTPA 2OAGA 2Y9PB 3SBDA 4AW9A 1XQWA 2D0PB 3NH6A 3PIIA 3KO8A 2XOKD 1MC4A 3G5UA 2XUQA 4HQKA 2VXOA 2J7KA 4JLOA 4RFVA 4RSMA 3O8DA 1KFEB 3IEIA 4HAZA 2WM2A 5IUJC 3DTVB 4ASUD 3V2GA 1R2QA 4V0MA 2ZYVX 4U00A 1OJLA 1I3NA 2ZRGA 1V4NA 2WFLB 1RWQA 2R8XA 1RHKA 2ZI9A 1H8HD 1P1KA 2WNHA 2XTZA 4E30A 1WO8A 3AB8A 1Z0KA 1ZNYA 1Z62A 2P2NA 3WRXA 2BFBB 1G98A 4I8IA 4D4HA 5DM1A 2AJBA 1NW8A 4J75A 4COKA 4U6SA 4IJUA 3B85A 2I6QA 4WW0A 3EGDB 2Z6QA 2QTAA 2PTGA 1A9YA 2D59A 5J4HA 1A97A 1DAKA 1V1JA 1UT8A 5ENDA 1CHNA 4QFMA 4DL9A 3QBDA 2L69A 1RZVA 4L08A 5CT6A 1A88A 3MSCA 3GA0A 1GKKA 2NXEA 3PDWA 3SI7A 4FT4A 1ZGZA 2D2VA 1A5BB 1NOJA 3AU9A 3FPBA 3K05A 3Q85A 5DBGA 2MCFA 2ZIXB 2PUBA 3BC1A 5F73A 2JAHA 1J39A 3VHXB 2Z2IA 5ILOA 4HVTA 4G5GA 4XRRA 1Z82A 1I4WA 1SU8A 2HV8A 4EBFA 4GNRA 1Q1GA 1VSVA 5FYQA 3LUKA 5HFAA 2B1IA 2OM6A 1LTQA 3PWSA 5FEMA 3NWBA 1MO4A 1ZM4A 4EHNA 2RGYA 4O1IA 2OBBA 1QGYA 2XNDA 4R5MA 2D06A 4KK3A 1U8CB 2D1RA 1CUWA 3S44A 2X8WA 2Z6VA 1RHQA 2FZGA 8ATCA 2R00C 1D09A 1RC8A 5L3ZA 2P6RA 2JLBA 3AINA 5BV8A 3U09A 2Z6UA 4FFLA 3GIWA 4YLGA 5DYNA 3T06B 2XB9A 1ES9A 4HBGA 1MRSA 2V0CA 2WPDD 4HZUA 3WTCA 2OQIA 3LJKA 4ZJZA 3AKYA 3MWDA 3FBGA 1JVBA 1X1DA 4G8JA 2JGAA 2A5DA 1DO8A 2F17A 5A5GA 4JKOA 5HCUA 4HNHA 1IN8A 1QZ3A 4I7EA 3KXLA 1N1DA 4LFBB 1K3TA 1CQJA 8GPBA 4K6FA 4TXMA 1S8NA 2K7ZA 1MNAA 4U0KA 2SKDA 2Q2QA 3QI7A 3H19A 2HOQA 4KE8A 1ZMRA 3PUJA 1EXMA 2ZVJA 1NUPA 4TZ6A 5BVHA 1CB0A 2OBMA 4G8CA 1X8JA 5LWHA 1CUHA 1R88A 1BMTA 2WDZA 1IEVA 3LZDA 5CCDA 1YBHA 2I80A 4MW9A 4O25A 4NDAA 5KIAA 3KR0A 3ZV3A 3MWDB 4KAJA 3A9TA 3WQQA 3MMXA 5A9SA 4CTJA 1T4BA 4GI2A 4MWOA 4N0MA 3OSZA 4UM7A 3H8SA 2E5LB 2Q6KA 3MSXA 3NTUA 4LGMA 4MUFA 4DAEA 4MSUA 1Q22A 4TS1A 3AR8A 4R7TA 3U7IA 2WTUA 4PO8A 2WW8A 2YUIA 4FUTA 2WBLC 4CKWA 3QX3A 4J1SA 2Z3VA 2CY0A 4ES6A 4C4XA 4WXEA 3DBLB 2Y1KA 3QW4B 2MU1A 3RJMA 2GETA 5BN4B 4EUKA 3NTXA 4LYGA 5K2OA 4HAUA 5DFAA 5EUCA 2O4UX 4FB4A 3DFMA 3VZDA 2WSSA 3KEQA 5ITZA 1XF1A 2VPWA 1VPDA 4ZOQI 2VIIA 3DMHA 4LVNA 3OLYA 4KMOA 4QATA 2WMYA 2Y2VA 4MCHA 3V4PB 1ULSA 2CN1A 2GWHA 1QIKA 2HF7A 3HP7A 4LV5B 4C9BA 4Q4HA 3UB4A 1QCDA 4KWCA 1WQ1R 3D6TB 2DU8A 2WE8A 3LGAA 1GPKA 4MV4A 3IMFA 3W3AA 5AI5A 3SFTA 3WZLA 2C5AA 3QXCA 1UK8A 2MSLA 2P75A 3OESA 3LY8A 1G2IA 1ZQ1A 2GF2A 2A5FA 2GD6A 2YMQA 2O8EB 2YY6A 1CETA 1DV2A 4G81A 4MR8B 1UAGA 2BDEA 4W9MC 1QG0A 1WCIB 3KYCA 1EWKA 3DFIA 4YMGA 4RENA 4M1TA 1XTVA 3KJQA 1K9SA 4DMRA 2WJWA 1LCIA 4ON9A 3ZZUA 5LD2B 1MZVA 4C1BA 1ZK1A 2FQQA 3DOEA 2BF7A 1S96A 1FDUA 3QUTA 4BAGA 4KGZA 3RO7A 1LBTA 3LYLA 4XVQA 4QYXA 2WAAA 2F8LA 5DN6D 1TGYA 2H7YA 4YUAA 2BMAA 4FFMA 2Q46A 4RH3A 2R751 2VG8A 4D5GA 5C52B 1JLLB 3LPCA 1DAOA 3HL0A 3OICA 3LTNC 3GRPA 1CVRA 2BHRA 1LX6A 2DPYA 2OWDA 1ZOLA 3CIFA 3GEGA 3R7SA 1G5TA 2Y1EA 4RE5A 4OXXA 3OKCA 1E8DA 2JFFA 3A6KA 1G1MA 1K0FA 1MC1A 2FR1A 3HXLA 4HATA 1RT9A 1M1UA 2QXUA 4XSHA 1O77A 2GPYA 3FHJA 5EHGA 3R75A 3WGKA 2GM3A 1F2UA 4EVRA 2PXXA 3GJ4A 3R0QA 3B9QA 4YACA 5ILQA 3ZXSA 3I9V6 4QOJA 2X9VA 2XUKA 3J81k 2RIRA 1SD5A 2A3RA 3LRPA 4WXMA 3CW2A 4XUDA 1UMCA 4BOYA 5ALPA 3ZWKA 5EEHA 2FCAA 1M8GA 2OAP1 4Q03A 5FO0A 5CEFA 3PUIA 5EXPA 1KZ7B 3GVIA 3V1MA 4W5TA 2DTEA 2ZGVA 3O3NB 3U26A 3E9YA 2FWNA 2J3HA 5HM6A 1ADJA 2WSBA 5H0IA 4TT8A 4QLBA 4J0HA 4BLWA 3INYA 5KVQA 1SCKA 1D6JA 4EYQA 4LAFA 3I61A 1M2OA 4BKQA 1QTQA 4HDQB 3SHFA 3C16C 3W8FA 4QBHA 2B1RA 1JG7A 2IEDA 4JBNA 2ZRAA 4CRWB 2H4JA 3EFBA 4ESVA 3N86A 4LXTA 2NYVA 1RKBA 4JVNA 2GCOB 4K46A 3W5JA 3W4IA 1JWAB 2BDUA 1CQPA 2IEBA 4Y9SA 2J6BA 3AR6A 4KTVE 3BDIA 3C7AA 1L5MA 2Q1SA 2W6MA 2XPCA 1XD2A 1DJPA 3O8BA 4L3OA 4BQOA 5B6IA 1XJ5A 2VHJA 2PX6A 2YYZA 5CBKA 2H9IA 1U0SY 2ZTSA 2XB8A 2R6GA 1MR3F 3GVHA 3N2LA 4II2A 5EZ5A 5IXYA 2QW8A 2I7TA 3IV6A 4AZ0B 1JLLA 4UARA 1G21B 4P93A 3EF1A 5EHQA 5GJBA 1KEWA 3H2HA 1P2FA 4QU9A 4A4DA 4IGFA 4HEQA 5A5FA 1N7JA 1T2EA 3JQAD 1WZ2A 5EKTA 4IFIA 4WDQA 4Y1GA 3HBJA 1CPYA 1L4UA 4DCNA 1RWWA 1G66A 4QHYA 5HEKA 3Q41A 1X42A 1W5SA 1FXUA 5AJUA 1SXJD 2ZSDA 1OYYA 2G5CA 4ZOAA 5ESDA 4BMNA 1FYWA 3BD8A 5KYKA 1CRWG 2JHFA 4NU6A 4PC3A 5TNXA 3EEBA 2O7NA 3NPAA 4CJXA 4E6PA 3RT7A 5KREA 1OJ7A 2QUZA 1BX1A 1JIVA 1KFBB 2OZEA 5LPNA 2RI1A 3KTAA 1HWYA 3ZU5A 4FNOA 3KL4A 2PX5A 1XZAA 2BBWA 4PNZA 3TUJC 3OKAA 3EF0A 3VU9B 2I8AA 3IXQA 5IEJA 1C0PA 2B8WA 2FUG6 1M6VA 3ZH9B 2VXBA 3NFYA 4KQ1A 4M9UA 2Y8EA 5LQKA 4OFWA 4LMRA 4LDAA 4CM5A 5BSEA 2DGDA 1K2VN 3E22A 3OU6A 2FZWA 4RPIA 1SKQA 4MMYB 3W4KA 2O3SA 2VH1A 3QPWA 5G3ZA 3SZLA 4B4OA 2GJ4A 3BGOS 3GX1A 1XUOA 4HQOA 3U1VA 1FNNA 1FNSA 1L9KA 3U3XA 2JL1A 5EXDA 2QL9A 3QTBA 3T7DA 3WFZA 2O0KA 3SIXA 2V7TA 5JISA 1ZR4A 4WJZA 4ZDJA 5LN1A 3E7FA 3QNUA 2JI6A 4WX2B 1N4AA 3VR4A 4EWLA 3MWFA 1QIGA 1WUIS 3JQ7B 3PQFA 1MTZA 3QG5A 2VHEA 1YJ8A 4UM5A 5J3JA 3DL2A 4IJ6A 3OZWA 4JCOA 4WEOA 1E3WB 1QIJA 1QR6A 1O58A 2EZTA 3OY2A 1V47A 1ULHA 1OASA 3E9NA 3IDAA 4GL2A 4XDYA 5DX0A 1XMVA 4IMRA 4JIGA 4YJ2A 3ANYB 3FLEA 1PD1A 1TUBB 1R4MA 1POXA 3CLRD 4P35A 1JIJA 4ZEVA 2NNWB 1RU3A 2KLBA 2X42A 4CKCB 4R1UA 1D04A 1HT0A 2H1SA 3BMQA 3K09A 1AU9A 2PEYA 2YHIA 4B09A 2FMXA 3PNSA 2AQIA 1T2VA 4UCWA 5F9FA 1VE9A 2XGSA 3AHHA 2QE6A 4E5PA 2R00A 1P9NA 3GJ5A 2O6HA 3T1VA 4EI7A 4YR7A 5I4CA 2QHXA 3IAEA 1GUZA 5JXWA 2XOXA 4C3UA 4LRQA 4DHEA 4R98A 2VHWA 3VKVA 2QK4A 3C6BA 4L8WB 2ZRMA 2JJ1D 1K68A 5BW6B 1T3ZA 1YGPA 3HJAA 4H1VA 1GUDA 1L6IA 1VKHA 4O8ZA 4RK5A 4F06A 3THXA 3NAGA 2H7CA 3CRQA 1T3SA 1Y48E 1TFUA 1SB9A 1MJGM 2PLNA 2XR1A 3SYKA 5B58C 1GSHA 3I73A 4U39A 1I7QB 5LYJA 1QRAA 2KB0A 3BKXA 3R20A 4AZVA 1TD1A 1WB9A 2QUHA 1CZNA 2YINC 5BN5B 3VMFA 5JNVA 2WHEA 4EPVA 2Q5LA 1TAUA 4F8YA 4PYJA 2ZVPX 1E3TA 4JLSA 4EIWA 4I1PA 4C4RA 1JQAA 1SC9A 1W2HA 1UR5A 3KPUA 3U80A 4W5OA 2ZREA 3VDNB 3DLPX 5EPUA 4QE3A 3WRXC 2DM6A 4RD4A 3WFIA 1LBEA 2Q9CA 1WV1A 5K0TA 2VOEA 5IN5A 4JR1A 1RBQA 3KIPA 4D6PA 1EDEA 5JS2A 1JDZA 1CEQA 5C4IA 1N5RA 1NOIA 2OXEA 3NAMA 3PUVA 3CLSD 2W2QA 3VGJA 2FE4A 3V3TA 4CMIB 1NZJA 4ZOLB 2Y2UA 5BOSA 1JDPA 2BT4A 2FAXA 1FYEA 4H6XA 4N65A 4AMGA 2HLPA 1OV6A 1ECGA 4NMLA 2P4SA 2YXNA 3AEUA 4IQ4A 4CU5A 3EISA 4Q5IA 1FRFS 3BZBA 4Z8XA 3JVIA 2Y66A 3QUQA 2B3DA 2IHTA 1E5TA 2WLTA 3ICPA 2R97A 4KQIA 3TTTA 4DNFA 2AXQA 3QU5A 5T3UA 2EF1A 2AEJA 5JXHA 5F7OA 5LCXA 1JMYA 1UQRA 1TU4A 1ZRHA 4F5EA 4ZGBA 5AKKA 1HQYE 3ZHQA 3L40A 5E7IA 4KO4S 1LXCA 4UUNA 2F1HA 5INTA 4Q05A 2OHHA 2ZUFA 4KI0A 1YUNA 4LE0A 3VC1A 3IYLW 1TX4B 1WU7A 3HWWA 1IB0A 3HRKA 4PANA 5FOTA 2C0CA 1G21E 1L8OA 3ZWAA 4AL4A 2X8LA 4LJSA 5GP1A 3QVLA 4MW5A 2VAXA 1IUNA 4HSGA 4KO8A 1XTTA 3B20A 4DABA 3DAPA 1CZUA 1NIJA 2O2DA 2XKBA 4MS1B 4OGGA 4QTXA 5LC1A 1JG2A 2ZJ3A 4MDYA 1T4DA 4F97A 5IBRA 5LQCA 1AXGA 1YRWA 1KYWA 2C61A 2YVLA 1JBQA 1P3JA 3H3JA 4NV3A 1Z88A 5KYVA 5CX4A 1PZMA 4AJIA 1XXHA 2LRHA 5C18A 3EJWA 1T91A 4H1HA 2D00A 2O1EA 4DLKA 3KVYA 4A15A 1O6FA 3FMFA 3ZGYA 4KR7A 3DHWC 3LBIA 5FI0B 4B80A 4BGDA 2HGZA 2V7QD 3H7AA 5JH7F 1AA6A 1A7UA 1ADFA 1PUXA 2LD4A 2COUA 4L16A 3KQSA 3U17A 2AT1A 3TPFA 3BIFA 1KBZA 1NVMB 5KQLA 4UDOA 3VBEA 4DVJA 5EWJA 2PKWA 2R7LA 3K5WA 2AMLA 4P34A 5FL7A 4MGYR 5K0NA 3X1KA 2GM4A 2KW5A 3F1KA 4UXHA 4INZA 2EOAA 3P8ZA 1KXJA 3VVCA 4OGFA 2HGSA 2JGEA 3IB3A 3C45A 3QLVA 5EIBD 2XIQA 2RGUA 1GNRA 1WPGA 2BMFA 1DZ3A 1JFLA 3HO8A 3KAJA 4I5GA 1ZMOA 3WYAA 3ZCQA 3NHFA 2DYKA 2NIPA 1FPMA 2CSUA 2BYTA 3ZGOA 2GX6A 3LQ2A 3TBFA 1Y1TA 4RXTA 2IEAA 2KHZA 3ZQKA 1PT7A 1JDTA 1H6DA 4IYRA 4R6WA 5JH7A 5EHXA 1D03A 4A2QA 3JQBC 2CBZA 1JKFA 1RYYA 3R6WA 4CQMD 3L7BA 3T1HB 1IHUA 1PUJA 2C4MA 1UODA 1W47A 1Z34A 2F1JA 2I78A 2OKGA 2R6FA 4Q9AA 4R8KA 5E0KB 1K7XB 1ZN8A 1U8UA 4LUCA 4UW9A 3WK9A 5KYXA 5AI8A 4XLTA 2I4TA 4MHOA 4G4SP 2GRJA 2RHBA 2YZ2A 5FUWA 3TQRA 5J43A 2H07A 5U9CA 4WCVA 3D2CA 2B9VA 5LA6B 4E22A 3CUWA 1NUQA 3PBKA 3RYFA 1H4TA 3UJDA 1G17A 5LBUA 3ZJTA 4WFQA 3UW3A 1WTCA 1TU0A 2VZLA 4YAEA 4EPXA 6NULA 1HLDA 2O8DA 2K4MA 2HU7A 2FPXA 4JLMA 3AF6A 4OHPA 4QGHA 3EAGA 1NW4A 1NBHA 3N3AC 1MQ8B 2UVQA 3FJYA 3M70A 5GJWC 3AHFA 2O8DB 2A59A 5BSMA 5BMOA 2NXWA 1JQJC 5HIMA 4ZCLA 4KNVA 1QR2A 4RNCA 1TZJA 1TL7C 2VTDA 1THMA 2J0VA 3P94A 4KHZA 4U2EA 1R15A 1Z08A 2QT9A 4FE7A 1V43A 4L22A 5DLDA 5K8CA 2D5LA 2O8VA 1YVUA 3PUYA 2HLDA 4LNUA 3LBHA 5CGZA 3JAKB 5F77A 4AICA 3AR9A 2OXTA 3RJTA 4EB8A 4KITB 4WZAB 3I6MA 3LIIA 2F43B 4BCCA 2A7XA 3RH0A 1ZIDA 3TN7A 1MOSA 1LV7A 1NX9A 2CXNA 2REXB 3T52A 3DLBA 1AK1A 4BMPB 3P2IA 3H1BA 2Y77A 3WGZA 2AX4A 4KKXB 3X3HA 1BXRB 4ETNA 4ND2A 5KYUB 3ZKAA 5B4TA 3V2UA 3P9ZA 4RDHA 1ODKA 1T29A 2RI0A 3DOUA 3TLEA 3I01A 3IUNA 3K1ZA 1N2GA 3V7WA 2I4IA 3EDCA 3HJGA 4H16A 4EJSC 3TX2A 2I1LA 2PSHA 3NHMA 4IUYA 2XZTA 2GA9A 1W0JA 1D6SA 1JQKA 1XTJA 1RHRA 2FPUA 3EDYA 4YRQA 3STUA 3BMXA 4YGXB 4IHJA 4XVRA 1ZGBA 3EPJA 4YGYA 3QYPA 2PGNA 3D02A 4LWQA 2VK2A 2WTNA 4E2YA 2CL7X 4ZN6A 5EG5A 3G2JA 2GK3A 5KPDA 1IE3A 3PLNA 3TW4A 3ZN2A 3GV0A 3RVJA 3ZDYB 4E09A 5BWOA 1DAIA 1YQGA 1QGAA 2FPSA 3H05A 4YDSA 5H59A 2PUFA 2C9BA 2ODEA 4O4JA 2YFHA 3I32A 1YB4A 1CZRA 1WXWA 4O59O 3U7EB 3D2AA 1EM8A 1XTUA 2IRWA 3C6ZA 4EI2A 4KIWA 4UNIA 2NU8A 2AEFA 3M6MD 2WVGA 5LOVA 3U40A 4S1NA 1UJBA 1S2DA 5ALQA 2AFHA 3SNKA 4MX8A 2QVXX 4GPBA 4KVGA 5IT5A 1B73A 1Q5PA 4MPDA 5F3WB 1Z4PX 1QQBA 2QWXA 5IF9A 1PD0A 1XEWY 4R51A 2WFAA 1G59A 3OHPA 1F2VA 3A4MA 3U4AA 4A2PA 5JJKA 1NXWA 3CEJA 3DZBA 1NRXA 4JOQA 1H1DA 4MRMA 4ZZ2A 4ZEWA 1QHGA 2G07A 3KPWA 3K92A 5FH9A 3UJPA 5JQWA 4MR8A 1GCGA 3NONA 3ZVRA 5LQUA 1PVDA 4CUZA 2NO6A 4NQZA 2FN8A 3BX1A 3ZBTA 4E2FA 2HV9A 4O5AA 1F0PA 4OXKA 4CCYB 4B6SA 1MJGA 2TMKA 1CZHA 3JQCA 1Z2PX 4G0VA 4LZWA 4A1OA 4DR7B 1MOZA 3B38A 2ST1A 2AN5A 3AZOA 1IN7A 5A0FA 1IPHA 3HV0A 4TMTA 3QSGA 3KQLA 1JRLA 2CXTA 3Q4GA 3HWX1 5AW5A 3GQVA 1H8HA 2IPXA 4H7IA 3SHVA 1IIBA 5I7UA 1EP2B 3WB9A 1IZ9A 3NBZC 3SQXA 4ZOCA 4EI8A 3A6EA 4ZALA 1WB6A 4J0DA 2NP6A 4D74A 3G23A 2QNRA 1K7FB 3A9CA 4R0NA 1JA0A 4CODB 3TDKA 1O0BA 1AHPA 1Z13A 3FPKA 4DUGA 4LGCA 4DMKA 3RLFA 1NE7A 2TYSB 2LW7A 2BUBA 3PXAA 2PL3A 1GCUA 3I64A 3LL4A 4IJ5A 2OBNA 2YWBA 3IB6A 4UBMA 3RTAA 5C4MA 4KLZA 4YCNA 1DS6A 1JMVA 4EH1A 3DAOA 2BFPA 2QD2A 3AEQB 3HCDA 1YZGA 1E7QA 1VZ2A 5EZSA 5LQSA 5BV0A 4MYHA 4JI1B 5D5HA 1PN3A 4Z3OA 3FNQA 3MOGA 4GG1A 3R7LA 4UUMA 3CW9A 3HXOA 1LK7A 1UKZA 2XZLA 1MTOA 4G0XA 3HS3A 1U9CA 1C4WA 1FZQA 2TMYA 3PRYA 4H7JA 4J6EA 4LXYA 5D01A 5TPWA 3SX0A 1Y7TA 4KVAA 4KR6A 2HA2A 3PX3A 1V1RA 3OJFA 4BAZA 3AIMA 4D41A 1Q7EA 1SWWA 2DF8A 3ND8A 1LX7A 1GHTA 3NETA 3VO2A 1GQOA 3E23A 5KDOA 2EYUA 2R6ZA 5LMNB 5A4FS 4K9NA 5KWVA 1AJEA 3ENWA 3IDQA 1MC5A 3KKLA 3L7YA 4FSXA 4AIIA 5ICSA 3SOZA 4Q9JA 1KYQA 1NPDA 3QU7A 5E1MA 1XVLA 4FWIB 4HVAA 5FEUA 4C78A 3AUAA 2NSDA 3IQZA 4P2GA 3UWKA 5IYZF 3WICA 4BQNA 4OP2A 3W5BA 3DZHA 3E7PA 3L06A 1Q3TA 5D5PA 3T4UA 1U0HC 1I7DA 1GTRA 4G0NA 3H5RA 2JJ2D 3DZJA 4DA7A 2ISSD 3C6XA 4KE9A 4WUTA 4YASA 4PRZA 5E7JA 2VF8A 3AFHA 3H5OA 3NTQA 4R7ZA 3RRYA 4ZVNA 5FB3A 1IG3A 2QV7A 4PR3A 4I8XA 4GPAA 1A9TA 2CFSA 4L7VA 4UM9D 4RGBA 3P19A 3V8PA 2Z57A 1L5HB 4MQEB 1GT6A 1OAAA 4H08A 2V5UA 4QDZA 1E79A 3KZXA 3OO0A 2CVQA 4F7DA 2ISCA 2Q0SA 5DNWA 2C8KA 4TYNA 1A5AB 3ETGA 1Z6QA 2BV3A 2GS9A 4TQGA 4BDSA 4NSNA 3TFWA 3OJEA 3HUDA 4M9QA 1JU4A 2JRLA 2W70A 5JNTA 3ZHTA 4J4BA 2GRUA 4KBYA 4Q7KA 3KQUA 1ZZGA 1M7GA 2AW5A 3PLRA 3VOSA 4EJSB 3VU9A 1X7ZB 1SUDA 3F49S 2PT6A 4EY5A 4NXMB 4HXYA 5EJFA 1NXSA 4O4HA 4YNBA 3GPIA 3TE6A 1MJ5A 1VGQA 4R69A 3OOHA 1VPWA 1QK4A 2BOVA 3Q7SA 3GLVA 2B4TO 3UQZA 4WY8A 1FB5A 1AV7A 5TB5A 1TJ4A 2Q29A 1CDDA 2HHCA 1M1ZA 1R8YA 1WXGA 1YK0A 2BCJQ 2FVYA 3VZQA 5KPJA 3USCS 3EXAA 1TA4A 3A3KA 1U1FA 3AVYA 1CUYA 4Y6GB 1Z2CA 2DTDA 4Z9YA 3ZNOA 1W36B 4LHWA 3QKIA 4UHFA 1PZHA 4CQJA 4O08A 2CV1A 2ZIXA 5KSWB 1W5TA 5A3RA 2CDRA 4PYLA 3JQ9A 3B1FA 1M2JA 3WB1A 3WG9A 5IJ0B 3RS7A 2H06A 3WJ1A 2IPNA 4GZ3A 4RW0A 4YALA 2K2QB 4KWTA 1SVLA 3FFTA 4ZU1X 1MAHA 1RM4A 4XKJA 4RK1A 1IXKA 5GVSA 1EVKA 5T6MA 3I72A 1DAGA 2BBSA 3L0CA 4HDSB 1GAXA 5FTKA 2QIPA 3V46A 1HLGA 2JAOA 4LF5B 4ZT5A 1GZUA 5FTNA 4K2AA 1GA6A 3Q5DA 4G5FA 5TT0A 1OZGA 4JMPA 1WY7A 1UIMA 3BILA 3N5CA 4D02A 1J2JA 5HQTA 3L6DA 4I55A 3K9WA 2OUKA 1VKZA 2BGRA 3JRNA 3M1IA 1XKLA 2K5UA 1H1LB 2EBHX 1XO1A 1E9SA 1TYEB 4FHCA 1W6RA 3SFVA 4YO7A 3W5SA 4C14A 3M5PA 3DR5A 4X1KA 1MKYA 3W78A 1T8TA 2W58A 1QVRA 2IHJA 4C2AA 3K6RA 2V45A 3LHIA 2ISQA 2JVKA 2AVDA 5GZ3A 3NBQA 2BC9A 4XVCA 4FSDA 3TAXA 5EIEA 5C5IA 1YKGA 5K0BA 2EP8A 2Q2WA 2JCSA 1UH5A 1XWIA 1ZONA 1Z07A 1P7ZA 4P3KA 1HT1E 5EI5A 4G2TA 1E3DA 2E3JA 3K96A 3L0BA 2BEJA 3HN6A 3B2QA 1JHDA 5KYYB 1BS9A 1J00A 3FDFA 4EA8A 2ZVDA 4LRSB 5H3LA 3R24A 2EJUA 3AKDA 3TKAA 1QE3A 2GK6A 1Y8AA 3K0HA 1FFSA 4PC6A 2OMEA 1T0IA 3BPSA 3BZWA 3HUFA 1ZUWA 1MA0A 2R4TA 2OB2A 3DAHA 3MJ4A 3PDIA 8MHTA 1DB3A 2FU5C 2XWJI 2NSLA 2XZDA 1JR3E 3DWIA 1RJEA 2BONA 1P0PA 1RTKA 3CPJB 3PE4A 4GXTA 3UWPA 5IDWA 3U4MA 3HB0A 3RKRA 1Y82A 1RZ3A 3JASB 1DC4A 5JSFA 4BNJA 3EEQA 2P4HX 4YI3A 3T9FA 1VJTA 4R41A 2ZT7A 2O2GA 4TGLA 3ZY2A 3HADA 4K03A 4OQZA 1XXLA 3DEJA 1H8EA 3OIVA 5LB4A 4HSEA 1N3IA 4MVJA 4NCKA 4D3SA 3KDPA 1W85A 2CNOA 1CNEA 2GKSA 1D1PA 2X0RA 1D7AA 2VAMA 2OHXA 4MGEA 4RIGA 5DXAA 5F52A 2O3TA 4NECA 4Y2TA 5DH9A 3IBYA 5BN5A 4N5NA 1IHOA 5LXTB 3TMYA 1A2QA 4OLBA 4GAEA 2WINI 4IIXA 5MHTA 3BE4A 2RIPA 3FDZB 1E1RD 4RKFA 1UT5A 1OIVA 4KDFA 5AVZA 5JRZA 1OBHA 4G1BA 2H4FA 3NYWA 4FZRA 5HJ2A 3M3HA 1QLWA 1EDDA 1SB8A 1SG9A 1ECJA 1HEUA 1T35A 5EJAA 1X15A 3IQIX 2Q9UA 1JHPA 3AHEA 2PX0A 1V8FA 1YS2X 4J2TA 4NVRA 2WF8A 2Q5HA 3GRAA 4F9GA 4MJ7A 1HG1A 1H69A 1DWOA 3ETJA 5JPIA 4PCUA 3L0DA 4YC7A 4RHCA 4X1IB 2PUDA 4BRUA 4URVR 4IQ8A 3INRA 4S0XA 4PYQA 1JQLB 3BJEA 3N0WA 2FHPA 2M1XA 5HQ3B 1FFHA 4L9AA 1CP2A 5EJMA 3AEZA 4RTPA 1D5CA 4YJ3B 2ODTX 5C34B 1Y1LA 4HWKA 1WMBA 4BQFA 2RAVA 2VEOA 2XE7A 1V16B 2EBWA 2JGRA 3RWMB 3PRKE 3TE7A 2NU7A 4H6PA 3UWOA 2HK9A 3FW1A 1P7WA 1ZRSA 1ZD1A 4DCTA 4A2CA 5BYJA 4B32A 4AJ1A 1E3WA 1RPNA 4YUWA 3L1IA 2DVMA 3EZNA 4B40A 1P45A 1C3JA 2XUDA 2ZT6A 4CL0A 2WMNB 3NRCA 3DL7A 3JQPA 1QCCA 1MGPA 2W6ZA 5JI2E 4F4UA 3OZ7A 4DN6A 1KZ9A 1RWMA 1GNTA 2PIDA 3JRXA 1UC4B 2IELA 2I8LA 5JARA 1EMDA 2BPOA 3R6LA 5DEIA 3T7IA 3HY4A 3MWLA 5ADHA 2D4HA 4EGSA 1E6WA 3OX2A 3DLTA 4FYVA 1GFSA 4M3NA 3SF0A 4CEIA 4HH0A 4RCYA 1JGTA 1NXVA 1UMDA 3MWEA 1FPQA 5SICE 2PY6A 2VHZA 2AN4A 1RKVA 1SURA 3DMDA 3HYRA 4HJXA 4YRCA 1QK5A 4Q16A 4UTXA 3AJ9A 3BVPA 4KHPB 2WJZB 3GPLA 3BBLA 3G2KA 4QOGA 2QTMA 5HZKA 3WZMA 1RLUA 1ONBA 1U7HA 1ZU5A 1UEJA 1FVHA 2ZAGA 2P0EA 1Q7CA 4GLOA 3QFTA 4GQAA 4IG9A 4OKIA 2AF3C 3UOWA 1G6Q1 1KI4A 2IHUA 4R8VA 3SR0A 3QJ5A 5KSYA 1Q7BA 1F6WA 1EUDA 1HE2A 1I14A 2GPAA 3A3NA 3BAZA 4WASA 3AR4A 1Y81A 2BI7A 4E51A 1CUAA 3P4XA 5BV7A 2E18A 3O95A 2HSDA 1IHXA 2DFLA 3PK0A 2H8GA 3UXMA 5I7HA 3QVMA 1TQ6A 3TCNA 4C7MA 3HFGA 8LDHA 3P27A 1A7AA 1L7VC 4GX0A 5A4DA 3VR0A 4JNCA 4BBAA 1ECFA 1KP9A 2OENG 1HYBA 2P2SA 3GHYA 3MUOA 3RQIA 2QVLA 2GEKA 4ZANA 1OMOA 1RWKA 1MB2A 3HHPA 3PGJA 4YDHB 5ALMA 2PSJA 3GDFA 2DPGA 2CFCA 3KSRA 2B7BA 3AKCA 3KFVA 3ER6A 4U2KA 3FTDA 1DMRA 3WADA 3DE1X 1EBFA 4JOBA 1F0NA 1W9MA 2A92A 1N2BA 1ADGA 2G71A 2Z2YA 1KFJB 2AOTB 3OSUA 2IOFA 3K6JA 2FPPB 3CZ9A 4H7HA 3SXUB 2QPAA 3WWPA 4CM8A 2HIMA 2Y92A 2WM9B 4ZVKA 3L6OO 1WXEA 4PPGA 1E4VA 2O0LA 2ZPAA 1VJRA 1Y33E 1K8XB 2RI6A 3E27A 1K1EA 2IZ6A 2QE7A 3DDWA 3T38A 4BLVA 4L0DA 4GFDA 2EKQA 3MK31 4B71A 1JEQA 2FLWA 4HB4A 3K0SA 1N7GA 4ZEOA 2AKYA 1AKRA 2I1VB 3MWEB 4XQEA 1FRVA 4DSZA 4X20B 1IY1A 4WNAA 3FI9A 1L8XA 1V6AA 4BFWA 2FFQA 4FDTA 4TXNA 4KR2A 1FJGB 2IIPA 3ZWDA 5ALDA 3R74A 5JCOC 3B13B 3QU9A 2P6MA 1GSIA 4DUZB 2YRWA 3JVDA 4GBJA 4Z4IA 4L5CA 2B8EA 4JITA 4KDRA 3ZQUA 4AYTA 1VL8A 3CF2A 4ATNA 4I9NA 4OYHA 1W35A 2ZCVA 1MA3A 4M53A 1WHSB 4F4JA 2EHDA 3ASVA 3MMSA 5FF9A 2QORA 1R0BA 4JJZA 5IKMA 5JMTA 5ELMA 1M1NB 2VRNA 1XRLA 2WU1A 3ZWCA 5KTKA 1E6CA 1ZL0A 2OTCA 5IH7A 1B16A 1S2NA 2D7JA 5KX5A 2BRUA 2GPSA 3K0AB 4N18A 3O2NA 3FAZA 1JHOA 3FHOA 4J0EA 2DETA 1NF3A 4HGRA 5I8ZA 3ZQJA 3CLVA 3GGDA 3KZCA 4K05A 3JTEA 3LUDA 2HRRA 5AJYA 1PS9A 2FFJA 3D64A 3V4OA 1ZUD1 1U3TA 3GLHB 4MVCA 1BEUB 3AK4A 5DX8A 3TEMA 1QX4A 2CXOA 2ONZA 2R84A 2X1LA 3Q3HA 3SKYA 3B5JA 4BNTA 1JIXA 2W48A 3LW8A 1C8LA 2ZKLA 1W76A 4XM2A 3ANTA 4K81B 5HJ5A 3OZRA 3ZPXA 1M6HA 2VXYA 4AT1A 4BFYA 3HQ4O 4F46A 3PJRA 3VDMA 3RYCB 1R1DA 4DXAA 1IHYA 1GXSB 3PWKA 3DC2A 4CLHA 3EWSA 5G3YA 3K94A 2R11A 1M2VA 2POQX 3NV7A 4BO5A 3ADDA 4IOKA 3BXZA 2IY9A 2UZ0A 4EA9A 4W1PA 4MUGA 4C4TA 2HJGA 2R8PA 1KVTA 5AKGA 5TC4A 5HMLA 4CKCA 1Q1AA 5BWCA 4N12A 3BAFA 1BN7A 3COVA 1KI6A 3G0DA 1NY6A 3MTGA 3UFXA 4JJ6A 5BSWA 5DM4A 1R6BX 4D46A 1SKUA 4L75A 2RGGA 4ZI7A 2ILVA 1QH8A 1IQUA 2DZDA 2ZB2A 2VF5X 2NTNA 4EG6A 2YJ5A 4AKIA 1JU3A 2Z4TA 1QFXA 3ABQB 3HCCA 5BNWA 3C3JA 2DUWA 4RLHA 4AJ2A 1XCGB 1Y34E 2A0FA 1QFSA 3A1DA 2Q4OA 3EIQA 2I4MA 1ZJ4A 4PLCA 2RB4A 4K8OA 6AT1A 2VPTA 1BH2A 3RIHA 2AW3A 3RYFB 4RKYA 3DZKA 2VDWB 3GT4A 2P9YA 1Z2DA 1SKBA 4IOMA 2C9YA 2NTEA 4UVDA 3TQSA 3LUJA 4ZTBA 5DNDA 2H7VA 5C8XA 5FUMA 3A3OA 1KMHA 4WSOA 4C7OB 1LGYA 3AERB 2NU8B 2YVKA 1FRZA 4D3ZA 1FXWA 3MVEA 5KBYA 1SIWA 2NZVG 5C8YA 3F4KA 1KYVA 2HCJB 2I87A 5DBIA 5DLQC 5FULA 1JHRA 4NBUA 4QWWA 3FSEA 1AK2A 1WNTA 4PYRA 4DIKA 1JB9A 3EEFA 3U56A 4TTRA 5EP2A 5AIAA 3HBLA 1SOAA 2P11A 4DMFA 1VFPA 3IA7A 3RU7A 5ALKA 3SMQA 1FQOA 1R4NB 3A05A 4ZDIA 4HB3A 2OUIA 3FCYA 1PWXA 2FJPA 4B6RA 1E1MA 4F72A 1CUGA 2I1QA 1WSBA 4FJ2A 4JLJA 1MF7A 4BPRA 1KIFA 5LUAA 4UBLA 2OQVA 2C4VA 2CUKA 2QSYA 1PGNA 4PXYA 4B3TB 4LJRA 3A1WA 4EA6A 4UUAA 1D07A 3QEOA 3HM2A 2IGBA 4YUZA 2VYNA 4PPNA 1SXIA 2FN7A 2JAUA 1PBTA 2POCA 2Y6UA 1IZZA 3R5HA 4A6DA 5EIXA 3CT4A 4R1QA 3TO5A 5K8UA 1CF4A 5FWYA 5KHLB 3IOCA 5K09A 1PR3A 4TT3A 5AK0A 1GLNA 3E03A 4KQ6A 4P33A 4FCVA 5EZYA 3F9IA 3G7NA 1KO7A 2HCTA 1WBBA 1ZUIA 4LXQA 4P5PA 5L6MB 2XF8A 1Q0QA 1EFVA 1VSQA 3V8MA 3A6HA 3L4BC 1ML3A 1SUFA 3WRYC 5BT8A 1Y1SA 4OXIA 2CL6X 4UTOA 3PEVA 2P4EA 4XVHA 1ZC3A 2PMFA 3LK6A 2FDRA 3DMFA 1HKHA 3I4FA 2NU9B 2XUIA 3VO1A 1B7GO 4JDPA 2JEZA 3NT2A 1CLUA 4D97A 4LSMA 1QHYA 4B6JA 2C4KA 4O29A 1Z0IA 1EVLA 2VTEA 2A1IA 3QLEA 4EF6A 2G17A 1N6HA 4YRFA 1JPJA 2VDPB 5ALGA 1QYIA 2WD7A 5KNLA 1W1UA 1EBBA 1F1JA 1QS0B 5DTEA 3VQTA 1LQTA 1DC6A 1P1CA 2DWOA 3I9LA 1R6AA 1DCMA 4QQNA 4LY6A 4RSHA 3S70A 1XVVA 4Q1FA 4BKOA 1Y1KE 1DG3A 3LT5A 2WWWA 3FF1A 1XMQB 2J9GA 4DC0A 3FYUA 1R4NA 2WD8A 3BH6A 1HNXB 4JDUA 3NIGB 3L5KA 4H7EA 2QPTA 3VX4A 5AK3A 4EUEA 1T0PA 1VP3A 2Q0QA 1BMDA 1U9IA 2I2FA 3RVRA 3DG9A 1B42A 1P19A 1X2BA 2WTEA 2ZJFA 5C8VA 3PFBA 4BLOA 4ZJYA 1DC3A 4RS4A 1TLLA 4F6RA 2ZLBA 2OCBA 2DE0X 5A4JA 1B6SA 3LC2O 5CDYA 2YV3A 1XPRA 3T0IA 4IV0A 9GPBA 1QAQA 3ZZ1A 3VU0A 3A9VA 1JIQA 1L5YA 3GZNB 3MLAA 2YV1A 4REQB 3PHIA 5CM2Z 2A5LA 2PU5A 4I9HA 3W6NA 1Z0AA 4HP8A 1GPDG 1OBFO 3KWFA 4QYMA 4LC0A 2X1MA 2E4ZA 3R6TA 4NU0A 1GPLA 5FWNA 1WUKS 2LCIA 3A4YA 1E3IA 3K9LA 3FMPB 4I99A 4R8SA 2XYGA 3Q12A 4QG7A 2J45A 5FPQA 3OLXA 4I14A 2ZB3A 3ABOB 4J0QA 1I5OA 3BHMA 4KQHA 3K73O 3JWGA 4LSWA 3HFSA 2IH4A 4NHEA 2Q4RA 4DG9A 4OI4A 1G7SA 3PUKA 5E7MA 5K9ZA 3RU9A 1U6KA 4DZTA 1E3MA 2FPKA 4KAAA 1I2MA 2YJTD 4AMBA 2CXQA 4IWNA 4NK4A 1ISGA 5CA0A 4GYJA 2ODWA 4IKEA 4OBEA 2OECA 3B9BA 5KYGA 1YUBA 1CJSA 2J09A 4JLDA 2YZNA 1E4EB 2WIGA 3A04A 3OCUA 4FJ0A 1GGEA 1G5IA 2Z2ZA 4M8LA 4U8GA 1YB1A 1DDOA 1T6XA 1U5CA 1SBYA 1SGWA 1VA4A 1W0KA 1WDLA 2IBMA 3ICWA 3ED5A 4PYOA 4K6MA 1UM8A 4TRNA 5IBPA 3S1AA 4C7JA 2P30A 2FMFA 1WXQA 1FMJA 1S5PA 4C2UA 4GC9A 1QC5A 5LJIA 1WDKA 2QX4A 1YZLA 2IOHA 3FY4A 5LLSA 1L1FA 4E1AA 4DC9A 3U61B 3MCUA 4HLUA 4OUDB 1PLJA 4FWBA 1NR1A 3AEQA 1RXIA 1O87A 1T5IA 2JAPA 3BGSA 4PE5B 4RPKA 2VJLA 5JQGF 3TX6A 1SA0B 1BFUA 4XD2A 2W9XA 4O3FA 1EYZA 1XMXA 3EVAA 2BBOA 4URZR 1QYDA 5BVHB 5P21A 1UCFA 1YTLA 4IGKA 2BZGA 3RWOA 2PKXA 1BH6A 1LSJA 4CLRA 4ND4A 5D1NA 3MFYA 3AVVA 4B7XA 3N28A 3P0JA 3RF6A 3E35A 5C5EA 2EQAA 4WZ6A 2V55B 1M75A 2DCMA 2F9MA 3VKWA 1NBMA 3A2KA 3ZV4A 1O6ZA 4CM9D 4CDRA 4BP8A 3IHKA 4LDRA 1ZAYA 4TMXA 1YDWA 3K53A 4IZOA 3VHRA 3ZJYA 1TQHA 3IOEA 3P2KA 3PKZA 3Q15C 5AOBA 4FNGA 3L1VA 1QDLB 2HBRA 4WE3A 4I5IA 5IAEA 4F8JA 3CKLA 1NNSA 4JR0A 1IPEA 1IEQA 1Z0FA 1GEGA 2RC6A 5AHWA 4BNUA 1K88A 2HIGA 4OK5A 1Y8RB 1GJRA 1KXZA 2OO5A 3VAYA 3ZWBA 4C22A 2BR3A 3G68A 1W88B 1Y1RA 1FE8A 1GN9A 4J90A 3GJYA 5LJLA 3KETA 2BELA 3BXHA 3AMVA 4C4OA 2V3WA 3LUCA 1FFWA 3HA2A 1VIMA 3STWA 1UXHA 1YCGA 2OO7A 1BG6A 4BUZA 2OLKA 5CJ2A 3JWEA 4CEJA 5F3DA 4Z7JA 3ON5A 1LBSA 3LC7O 5KWIA 1A4UA 3LT4A 4P2BA 2QGNA 1E32A 4ZI5A 2AZXA 2OYRA 4JLNA 4DCUA 3NCTA 5ISMA 4Z4CA 3DXYA 1F1BA 1A71A 1WULS 5KS2A 4NBRA 3T15A 3G13A 2PZGA 3GLHE 4DEXA 1R6DA 1UFVA 3JQGB 2ZOSA 4B0PA 3AM1A 2NV6A 3UWMA 1ZVMA 5CBPA 3CUSA 5DBEX 2ADMA 3PXXA 3THRA 2UV8A 2EWMA 1GU7A 1Z4LA 1IN1A 4I1YA 1TMGE 1I2AA 4NULA 4OXQA 5IANA 4TL9A 2I9KA 1YJQA 3LY7A 4RLSA 2BEUB 1OT3A 3DDZX 3ROMA 3TR6A 1PFKA 2MMCA 3AUYA 2J3IA 1XTQA 2PLRA 3C41J 4RELA 5CDSA 4PV7A 1OQAA 4D7AA 3RUAA 2RHRA 1BDIA 3H5TA 2YVQA 3K9QO 4MWGA 3TL6A 1YNSA 4JL8A 1PZEA 2FSVA 3QX8A 1DLJA 1Q91A 3IULA 1RI5A 3DV0A 3PD1A 1AUVA 4ND1A 1U8FO 2HK6A 5BW8A 1AQUA 2H16A 1CZOA 3FTNA 2C78A 3KJNA 4QOHA 5A3QA 2AR7A 5JWRA 3V7YA 4DCCA 4EYOA 5HFJA 1FTYA 3P2EA 1F4LA 3T7AA 1F0KA 2GDJA 2ECPA 3B12A 1A3CA 4X71A 5HRUA 4DB2A 3HEBA 1UFOA 1XP8A 3KU4A 4D9NA 4NK5A 2VZ9A 3R3UA 2E49A 3BXOA 1CY8A 1ZI9A 5L3VA 4PAMA 2EKZA 4N8SA 4A03A 3W5DA 4DHWA 5DIFA 1HDOA 2NO1A 4OM7A 4HNAA 1Y7PA 1Y3AA 4U9IS 2VNKA 3L1JA 4X1IA 1QFMA 2YJ4A 1YI8A 3DE5X 3A1CA 3ZNPA 3ZV5A 4X6XA 3SC6A 4W99A 4JWKA 2XQGA 4FFDA 4Y1RB 4EY7A 2QQGA 1EVQA 3WYCA 4M7OA 1JTFA 3HJFA 2VPPA 4FR5A 5CXQA 1NPTO 2JDID 3WO1A 3FOAA 4TSFD 1FEZA 2UZAA 4RHYA 3WLSA 4OHFA 3L82B 1CS0B 3MUNA 2V4MA 3HCBA 2DY0A 1YS1X 5BT9A 2YV5A 5JATA 4LTMA 1J1ZA 1CQZA 1T2NA 2VEDA 1L5HA 3B1ZA 3FA2A 1QORA 3H11B 2AOWA 5IP5A 2M6LA 1DIAA 5FNZA 2PGIA 4Y9RA 1FP4A 3WKDA 4PHTA 4KO3S 1TFRA 1PUIA 1QTRA 3KAKA 1YQ9A 1TKAA 4CUJA 2QN1A 5LLDA 3OG9A 1KYTA 5IK2D 5K4HA 1LLCA 1ZGCA 1C3XA 2AOTA 5AR1A 1LBQA 4RYLA 4E3ZA 4OUDA 3QLUA 4IH9A 1T9CA 3VNVA 1SEPA 2VSNA 4Q1EA 4Q4AB 4X94A 4DXDA 2H0RA 2CHUA 4RTRA 1A5SB 2JIQA 4JWTA 4BIIA 2IUUA 4FI3C 3SU8A 3A9WA 4BRZA 3U31A 4GKVA 1KP3A 3G1UA 2IDJA 3S5JA 3BFKA 4YXFA 5ELLA 2NOAA 3QV2A 2I91A 1ULUA 1HETA 2QTFA 2BWJA 3FRHA 3MXOA 3PRJA 4Q6WA 4WN9B 4ZOLF 4ZC1A 1EWQA 3LKVA 4B3GA 4OL0A 4C6TB 5ED4A 4M0FA 1Q0HA 2XNDD 2QRQA 2WM8A 2SKEA 3QXXA 1WMAA 5B3JA 4C6TA 4YQFA 4DJEC 2NYRA 3QFSA 5K3CA 1P74A 2VTKA 1CJUC 5CM9C 2C0PA 3ILYA 2JIRA 5I5EA 3V1LA 2OPHA 4X24A 4FM9A 2Q8PA 1ZUHA 3QYJA 5GV8A 5AW9A 4H35A 3ZU2A 1H3EA 3KALA 5HK8A 3A9UA 4JN6B 3BEDA 3ZYZA 1E1QD 3KB1A 2OD9A 3PQ8A 3FWKA 4C7KA 2BGUA 3IH5A 1DCTA 2QD3A 3WIDA 4B45A 1Y7LA 2N3ZA 1DKRA 3TBHA 3QQPA 3JYQA 3TRIA 4BB6A 4F12A 3OEHD 3ASUA 3O0TA 3I76A 1QCZA 2YXEA 2OHOA 2AIRA 1KI3A 5K3FB 1LSSA 4ITUA 3X1WA 4JEHA 5KVCA 4Y2RA 3SSAA 1C80A 2X9NA 1LK5A 4GE3A 2XLCA 1RYFA 1S8OA 1Z5OA 2FH5B 2FKNA 1LNSA 2R7KA 2DSNA 3EMBA 1OFVA 2GZMA 4WFIA 5JBQA 4WD3A 3HKEA 3KB2A 1ZXBA 4KMMA 5H80A 1SMKA 2R7MA 2VLIA 4MLZA 3RFCA 4Z3KA 2I55A 4HFRA 5ANRB 1IDN1 5IVHA 1ISIA 3HCEA 3PXBA 3A1TA 1PFVA 3RVLA 1NVFA 1SZPA 1TIKA 1S1CA 1W48A 1XDDA 2F62A 3E81A 1LS6A 3GU3A 3OJXA 3WGJA 2WUEA 4Q3KA 4ZT2A 3F7TA 3TSOA 2QV0A 5SZJA 1YZUA 4QNRA 3JYHA 1JKJA 2B82A 4XE5A 5CDGA 2V3CC 5FUBA 1GZVA 4DQLA 2P9CA 4PLPA 3ZI4A 3K8YA 5LMCA 2RGEA 1KI2A 1DUVG 1M8PA 2Q49A 3DD1A 3VYVA 1RC0A 2M9MA 2O2IA 1LK0A 2RGDA 3NI2A 3QM1A 4KVFA 4NCHA 4QREA 4R9RA 3KYCB 4PW0A 1VCNA 2X4DA 3BWEA 4LDJA 4E3WA 3V2HA 5CYGA 4OH1A 3QKSA 1W44A 2JIMA 3C85A 1F2TB 3GFQA 1FQWA 1TIBA 3OO1A 2YRFA 4DANA 5HWSA 3UBTA 1M5RA 3FPLA 4WUVA 1ZL2A 2HHHB 4QRHA 5G1NA 1I10A 3PA6A 1OLXA 4QPCA 2DHDA 2WTXA 3FUTA 3IUSA 1RACA 4IXMA 1T36B 3E22B 3LCJA 1NV8A 1G3IA 1YB6A 3ORRA 5IG2A 2PTHA 3L8YA 1L5OA 2N46A 4D9JA 2Q6VA 4X62B 5EXEA 2WKRA 1C1HA 1E2PA 2MSNA 1DOAA 3BWXA 2CF5A 3CLUC 4GYKA 3JATB 4B2PA 1LVHA 2AF4C 1N33B 3KZOA 2NW6A 2NXJA 3RBXA 4B6EA 1RQ2A 1A8HA 2A9KA 4PCAA 1MIOA 2OV4A 3NALA 2YHUA 1VYUA 1J7KA 3HL4A 5T4BA 1CZKA 3H0EA 4WAUA 3O83A 4DIUA 2QA5A 3H99A 4E11A 2DQZA 3CUYA 2WJHA 1VC2A 2JI7A 3G2MA 3V8BA 5DGCA 3DOCA 2C2ZA 5DNCA 4US2R 2UZ3A 3C15C 2A3NA 3D5TA 3DONA 5DP2A 3KZKA 3LS2A 3AEKB 3I3OA 4KE7A 3NFRA 4JUCA 4YIKA 3F73A 2IY7A 2ORWA 2QN2A 1A76A 1YV9A 1OILA 2AZ4A 4PG6A 4RK4A 1ZXXA 5I7AA 5PNTA 2ZZMA 1NQXA 3ZLVA 3FFBA 2OY0A 2X7XA 4WHMA 1S2GA 5H16A 3LQ4A 4QXAA 2Y27A 5FBVB 4GE0A 4MQFB 1AS3A 2Q3LA 2M6KA 3PCTA 2WI8A 2FQYA 1N8TA 1U28A 2ZJ5A 3E8MA 5IAOA 1XCBA 7MDHA 3Q3IA 1TM7E 2DUJA 1PDVA 1W8IA 3FPGA 4Z0TA 5IAJA 3RS4A 4QOEA 1MP0A 4DCVA 2P91A 1JXAA 2BM1A 521PA 2VP2A 1N92A 4GECA 1SC4A 3MZ0A 4OX9Y 3QPCA 1AHHA 4V0LA 3I45A 3Q7PA 4IDEA 3U13A 1YS7A 2D2EA 2Q9AA 3WB0A 3K7EA 3VTAA 3KE9A 4AQDA 4N7MA 3GB9A 2FX2A 1L6RA 1PJTA 2VDRB 2O1SA 1II8A 1FDSA 5TGDA 3GUVA 1DV1A 2IX9A 5CCEA 4KK4A 3G9TA 4U6NA 4FFVA 2HH9A 3ESQA 3U6KA 4CMCA 5I8PA 2C1EA 2B6NA 4D9HA 4DNPA 4FYXA 2ZTVA 1J22A 1CY0A 1PHPA 1VE5A 4P3OA 4OQFA 2V7QA 4ZP1A 4RA9B 2IPLA 4JUIA 4NBVA 2HNAA 3CM0A 3G2IA 3QXSA 1PT9A 4MEBA 3ACDA 1UKCA 3C8HA 5SV2A 1R0XA 1SK9A 1H5NA 1KF0A 1W0JD 3FZEA 2G7MC 3H17A 5B2FA 1NC1A 1PW7A 1RRPA 5FI5A 2OYCA 3HK2A 1KTIA 1M0TA 5TF0A 3B82A 3PXDA 5T64A 1QYXA 3CH4B 4M1KA 4D4GA 1H85A 1I3OA 1GPBA 2HWUA 1QO0D 1L8LA 1RJWA 2R4QA 1ABEA 1WM1A 3OC6A 1KOFA 2E55A 5KMGB 3SXJA 4P7KA 4J3NA 3KSAC 4RSRA 4W82A 5BNZA 1HQCA 3DE7X 5CVTA 4JI0B 5KDDA 1ABBA 2AR9A 2G72A 3NB0A 2I2DA 2H85A 4UU8A 3ROGA 4ESOA 2WU3A 1MIHA 3TSWA 4WESA 2WSLA 4MO9A 3TECE 1PFGA 4OG2A 4BLQA 2JKZA 2QP4A 3QITA 3T4PA 1KY5A 3OFVA 4WKNA 2DULA 2IP2A 2JI9A 2WAMA 3ISJA 4R8LA 4LGYA 1R6XA 2GO7A 2HJRA 1E1YA 4NDZA 2C84A 2J5XA 5KX5B 1RBYA 4QEDA 1ZBQA 3BTSA 2B4AA 2QUBA 4XWAA 5C80A 1JI3A 2HZBA 3DF9A 4JKIA 1JSXA 1KSHA 4UPDA 1I4EB 3B1VA 3MELA 4UDNA 4I9GA 3UMMA 3U7GA 3DDHA 3ZE6A 5LZ2A 2HU8A 2QM7A 2G82A 2ZUWA 1YZFA 4LXUA 1ZJYA 5F2NA 3AWDA 2COEA 4DLUA 5DVZA 1KWKA 1ZISA 1N6IA 3MWJA 1H0RA 5JOQA 1EBUA 2B99A 1E1NA 4HWPA 3HXPA 1GRQA 2HA5A 2H1VA 3F98A 3PICA 3TJZA 3IPXA 3FYDA 1DX9A 2Y4OA 1V37A 2H5LA 3GO4A 1M6NA 2E9SA 2OBYA 3BULA 3KEOA 5KJEA 4FFOA 2IBSA 5J2UF 1SXJE 1K8RA 1DL5A 4NYIQ 3C3PA 2IYEA 6CHYA 2BL4A 4GOXA 1XTKA 2WSYB 3MT0A 1EFRD 2IZZA 4O2AA 2VJBA 1I24A 4YB8A 4RZUA 5A5VA 4TM7A 4TMFA 2C96A 2QTTA 1L7MA 3FTEA 1G6OA 3KFXA 1FS4A 1TU3A 1WXDA 2VP9A 1IJKA 3Q8MA 3GMDA 1XZEA 3AJRA 2CWDA 5AXDA 3LKBA 4TZ0A 1RJFA 1W4CA 4RKQA 4G09A 1KYXA 3VI3B 4A6EA 3PR3A 3E58A 4D9IA 2FKAA 3Q5EA 4MO2A 3B70A 4MRSA 1W1IA 2OD2A 3UK6A 4BVBA 5CAEA 4XWTA 4QT4A 4PZYA 5ESRA 4P0QB 3EIHA 2V7EA 3SZGA 4MV6A 2ORED 3L02A 1O95C 1KU0A 2BI4A 1JKIA 5DWQA 1TEVA 4PIPA 3VDQA 2O23A 2R5WA 2UVDA 4D4JA 1MXFA 1HM5A 1MX3A 2FQXA 3DEFA 3OQ6A 5DM2A 4I50B 3P97A 4N7RA 5JH7B 4YMHA 1FUUA 4FR2A 1AIPA 2ETXA 4LHSA 1X1QA 1PJ3A 3GD7A 4YP7A 2IHKA 3RJ5A 3EVBA 4F2PA 2JFHA 4GI5A 3EMVA 2P69A 4DSOA 1A8QA 1BD4A 1YQTA 3N0VA 3ZHCA 3FD8A 3PJFA 3W4JA 3WWZA 4JA2A 1GFIA 2V0NA 2EZ8A 4YI5A 4ZVUA 4F9EA 5H3HA 1B93A 4HTFB 3VR3A 4A5OA 1H2YA 1JLMA 2IOYA 1E9DA 1KVQA 4TTAA 4Y2GA 1J0CA 4A2WA 1BJKA 1RXWA 3ULKA 3L77A 3R0XA 2PZ8A 2PX3A 3F46A 3MGCA 2VDVE 5LFAA 1PCXA 4NATA 1T4CB 2XAUA 1EIZA 3FNFA 5EZYB 4ECEA 1UKAA 2REOA 2ZB7A 3LLUA 1RAIA 4IMIB 3WGGA 2QQFA 4I0WB 4BNZA 1IN6A 4GZ5A 2JFNA 3DVAA 1UJMA 2JH9A 2WIBA 4ICIA 2WFLA 3WHKA 3GLGE 3G0IA 2QZPA 3HVRA 2UXBB 1KPIA 3IT0A 5IUKC 5FUQA 2JEYA 3HGQA 1V48A 2RFLA 2BZSA 5IW8A 4CQMB 1DEXA 1NYRA 4ZCPA 2YICA 3SJCA 4B4KA 1JIKA 3HWRA 4ZOBA 4ERXA 1ESDA 5T41A 4L6AA 2GZHA 2C42A 3IERA 1P2BA 5JSYA 1X86B 2LTAA 3GF4A 3ZWPA 1XNRB 3RV4A 3RANA 2BW0A 1DEOA 4OY3A 4CKZA 5C7OO 4W8GA 3UAZA 1PEAA 4JFRA 5JT1A 1L7DA 3AUSA 1BE6A 1HOXA 4R5HA 1ML4A 4V1CB 4ARAA 4OK3A 2J0QA 3GRVA 1NVTA 2B37A 1EIWA 3MWKA 4C43A 3GRUA 5C9ZA 2GA8A 3B3GA 2AUNA 3I1JA 1J5XA 3LDGA 4OBWA 3IA2A 3T6KA 3LUGA 1PG2A 4U2BA 1A7JA 4I8DA 2UZ1A 5SZIA 1Z18A 5HW0A 1RIFA 3DQZA 2FDXA 3OZUA 1EH5A 2R60A 3NG1A 1G6HA 4TV8B 1C9YA 2ZSKA 4JU9A 5DMXA 5T4EA 4TN5A 4XGRA 4CIXA 2H54A 1IJFA 2NZ8A 4BJ1A 2OORA 1EFPA 1Z17A 4RMJA 1SUAA 2X5OA 2Z5LA 3E7WA 4R2XA 5EQFA 2FDCA 1P5RA 3E1KA 5ESXA 4YLYA 2OCAA 5JSQA 3OQIB 4V0KA 4YN3A 5DOZA 3PGMA 1MNQA 3H42B 5I9BA 3T99A 3TW8B 4A10A 3GDOA 4HB2A 1XNQB 3STVA 3R3YA 4Y7CA 1SRRA 4NLLA 2QU8A 1BFKA 3ND6A 3MNFA 3ICCA 3HGTA 2I67A 4IXWA 4N9QA 1HURA 2ESRA 3CNHA 3S28A 4E2WA 1NNEA 1E20A 2QIOA 3FHCB 5DI9A 3VPBA 5E4FA 2QLJA 4RKEA 4F1KA 3WLLA 1WX1A 4ME6A 2WYUA 3ZDQA 2BSAA 1NVEA 3CUUA 2AV6A 3VZCA 1GARA 2FLKA 1NAHA 4YRPA 3ZWWA 4CG2A 3NASA 3X1YA 1O97D 3IAHA 1JAXA 3WQSB 4F60A 1OB5A 3NDPA 4QTTB 4TMZA 4IGAA 2NAFA 4IOLA 3M8KA 1WBJB 3R41A 2JBAB 4FGLA 4YHBA 4K87A 3EDMA 3S29A 1W34A 1A9QA 4R9NA 3HXQA 2ATEA 3G8BA 3HUUA 4YRRA 3KJHA 2RK4A 3L0PA 1DRKA 5DNAA 3N58A 2E1RA 1QE5A 4LPKA 2LPMA 2XE4A 3ELUA 3SBOA 1RAFA 1DBIA 2WF7A 3GNSA 4PPQA 5H3CA 2GN8A 3OCVA 2JFVA 1KE1A 2B8JA 2QLFA 5CXSA 1XK7A 1CULC 4KOEC 3NHSA 3T1TA 3HI4A 3PP8A 3WNCA 2VK4A 1C50A 3TEFA 3EZ7A 3CG4A 3VC3A 3I6BA 5GM2A 1USWA 3R9XB 2QENA 4YROA 1AKEA 1N6NA 5ABPA 1K5HA 4MYTA 1T6ZA 4GVLA 4NPCA 3R7AA 1O03A 4GPEA 2G9VA 5UKDA 3DL0A 4NJMA 3GELA 1V16A 2GWRA 2LV8A 3LX4A 5AHRA 2GPBA 4WVFA 3ZDRA 5C32A 3IBCA 2HPZA 3RLIA 3WOHA 4KX5A 3BFXA 1FW8A 1K86A 4DLSA 3QKTA 4KRXA 1NVDA 1NJFA 3JYLA 4XDZA 3T3GA 4UE3S 2CT8A 4LS3A 1CUVA 1KEEA 4Y2XA 3DXXA 2YZ7A 4GWGA 4E13A 4BU0A 1W4AA 3DOFA 5HUHA 3I4LA 4L3VA 5B4UA 3JS5A 2BJWA 3FSRA 4LYYA 4DBLE 1NSTA