3QVMA

The structure of olei00960, a hydrolase from oleispira antarctica
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
b'DVICYEKEDVVKRNNINITGGGEKTVLLAHGFGCDQNMWRFMLPELEKQFTVIVFDYVGSGQSDLESFSTKRYSSLEGYAKDVEEILVALDLVNVSIIGHSVSSIIAGIASTHVGDRISDITMICPSPCFMNFPPDYVGGFERDDLEELINLMDKNYIGWANYLAPLVMGASHSSELIGELSGSFCTTDPIVAKTFAKATFFSDYRSLLEDISTPALIFQSAKDSLASPEVGQYMAENIPNSQLELIQAEGHCLHMTDAGLITPLLIHFIQNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olei00960
molecule tags Hydrolase
source organism Oleispira antarctica
publication title Genome sequence and functional genomic analysis of the oil-degrading bacterium Oleispira antarctica.
pubmed doi rcsb
total genus 95
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qvmA00
3H2HA 3H2IA 2RGUA 3BJMA 1LBTA 1AGYA 4HXEB 2DQYA 2HA5A 4WFJA 4AN1A 3C6ZA 1VE7A 2WKWA 2QR5A 2JF0A 1CRLA 3KXPA 4G9GA 4MWSA 4Q3LA 4ZREA 4LIPD 2C5GA 3FCXA 4EUSA 3JWEA 2OG1A 5I8PA 3RLIA 1K6EA 1ZJ4A 4C4YA 1BRTA 5SYMA 1XRLA 3ANTA 5AICA 1CUZA 3E1GA 3KSRA 4MEAA 1XZCA 2WUDA 1THTA 4KR0A 1ZD3A 2XQFA 4KE9A 3C5WP 3AIOA 4EY4A 5ESRA 4N8SA 4IH4A 5FXMA 1EXWA 1IUNA 4XX1A 5DTIA 2RI6A 4BRSA 1XZIA 2CBGA 4H7HA 4OPMA 1RP1A 1UK7A 1Y7IA 4KE8A 5JD6A 4J0JA 4ROTA 1MJ5A 4W1RA 4OYYA 1LPPA 4E14A 1J1IA 3CN7A 1JJBA 3FAKA 1XZKA 1TIBA 5LLSA 5C7YA 4C4XA 5LZ8A 1YB7A 4U2EA 1O6FA 2BUCA 5CXUA 3U1TA 4EY6A 1O6GA 4QWMA 3F97A 5DYTA 2RONA 1N1MA 2PX6A 1ACJA 5A62A 3O0DA 1D07A 4F5ZA 1CUFA 1YCDA 2XUJA 1S8OA 2RIPA 1CLEA 2YYSA 3VVMA 4DM7A 4ETWA 3C70A 3F9CA 2R11A 5JADA 3ESAA 4H7JA 3FCYA 3O4HA 1UK9A 3WK7A 4Y7DA 1JMYA 2IX9A 4MEBA 5BV7A 4FLMA 4YASA 1XZDA 4BAUA 1BEZA 3BF7A 3JW8A 3O4IA 3AZPA 4UFOA 4E46A 1DWPA 5ALLA 3S2ZA 3HC7A 1N8SA 4K2AA 1NX9A 4DMKA 2HU5A 3ZWQA 1SOMA 3QPAA 3K6KA 3WKAA 5KREA 4PSDA 3N2ZB 1EK2A 2QXTA 1FFDA 1ZI9A 4B9EA 4BBZA 5FRDA 1E5TA 1CIJA 4FOLA 1MNQA 3I28A 3I1IA 2BJHA 3NWOA 4YPVA 1WCYA 1C7IA 3HXKA 3ZLVA 4FBMA 3DYVA 1EHYA 5IH7A 5D6OA 4IHAA 4OD0A 4N8EA 4Q05A 3WYNA 1DU4A 1IZ7A 1QTIA 1W52X 3G0IA 2WUGA 1EK1A 4GDMA 1EX9A 2ZJFA 1CUWA 4KJXA 1CFJA 2BGRA 4UHHA 3OPMA 5EHZA 4FNGA 1SFRA 4KAAA 5C8ZA 5AM5A 5C8XA 1MU0A 4HS9A 5EGNA 3UUEA 4TGLA 4XIIA 2DSNA 2XUKA 1EH5A 5ALGA 1GXSA 2NW6A 2X8BA 3VKFA 3VJKA 4UBIA 3WIBA 4FMPA 5LZ9A 2QMQA 1MO2A 4LXGA 1LPMA 1ZD4A 3ED1A 3WZLA 2C58A 1ODCA 4L0CA 1X70A 4TVKA 2HU7A 2B9VA 4AO7A 5FKJA 4DMHA 1L7QA 1R3DA 3R40A 3IB3A 3F67A 5CT6A 2OGZA 4GECA 4GHWA 2I03A 4LHEA 3V9AA 1QONA 4BDSA 1TAHA 3CCBA 1AURA 1XLWA 5ALYA 1J2EA 4BZZA 1HPLA 4JH0A 4I4CA 5FP0A 3WK9A 3OM8A 1ZICA 2WHRA 2WU3A 1EDDA 1MNAA 2QKYA 2WSLA 2Z8XA 2G63A 2O7RA 1U2EA 1WHSA 3M81A 2ZSHA 5DYWA 3I6MA 5ALIA 4C6HA 1NU6A 3G0CA 4BVLA 2GBFA 1K4YA 3UMJA 4KEAA 1P0MA 1VXOA 2CEKA 3AUKA 3S8YA 5AKEA 4GXNA 1YS1X 1B41A 4RPCA 2HA7A 1MPXA 3QH4A 5HQ3A 4UBJA 1VZ3A 4J7AA 1N5RA 5CXXA 4QZVA 1B6GA 1ACLA 4U2BA 5JZ9A 1IUPA 4HXGA 5EFZA 3H2KA 2WIDA 3BWXA 3DQZA 3FYUB 1A88A 2BUAA 5HFAA 4W9RA 4X93A 3W04A 4WY5A 4Q34A 2D5LA 1BS9A 1K63A 4FBLA 2OGTA 2O2GA 3HRHA 2VJDA 2C0PA 3JYHA 1LPNA 1XZHA 1R88A 3BDIA 2JIDA 2VATA 4J0GA 4CCWA 5KBYA 4Y2PA 3WMRA 1QO7A 1DT5A 2PU7A 3W05A 3AIMA 4DNPA 2WU4A 5JZBA 3D2AA 1F0NA 3I2HA 4P08A 3VXKA 3GUUA 3PDCA 3R3XA 3ESDA 1J07A 1E8DA 2PM8A 4N5IX 5ISMA 4CG1A 4EY8A 4IO0A 2HRQA 1RYYA 2ACEA 5A6VA 2AJCA 4KRXA 5AM4A 1Z68A 3AILA 3D7RA 5A7HA 4UUQA 4J0HA 2VF2A 4DYHA 5ALHA 4DNQA 4W1PA 5LIPA 4UHBA 3MVEA 5HF8A 3PF9A 3DOIA 4Y2VA 1U8EA 2O2IA 3HJUA 1E8NA 3WWDA 4CI9A 1MN6A 4AZ3A 3KDAA 7YASA 4BVJA 1L7RA 4Y2RA 3D0KA 3WKEA 2HA0A 2XQJA 2WIFA 4V2IA 2JGLA 1C4XA 3I2IA 4W1SA 2O7VA 4IQ4A 4INZA 1EDEA 5HKAA 4Y2SA 2RAUA 1R4ZA 5D7BA 1WM1A 1JT2A 1XRQA 4JYMA 4G8DA 4CG3A 2WG0A 1CQWA 3DD5A 5JAOA 5A7GA 3EF3A 1JKMA 4X97A 1M33A 5AM0A 4I19A 2PU5A 2QM0A 4H35A 3FSGD 4JUIA 2XMBA 1XZAA 2XLBA 5IKXA 4B7ZA 4AO8A 2XUFA 2BCEA 3SWWA 4DMFA 1BCSA 2I78A 3QITA 4X91A 5JZSA 2PSHA 4KE7A 4BE9A 2C7BA 4BCCA 4P92A 1TK3A 5E4TA 3MUOA 1H23A 1UOQA 2CKMA 4WDRA 4MQMA 3WIOA 1GT6A 3G0DA 2CMFA 2GZSA 2PSEA 2WUEA 3KWJA 4B0OA 4M0MA 1XKTA 2WJ6A 2OAEA 3WWPA 5CT9A 3G0BA 4LYEA 2WILA 3B3QA 5AKZA 4CFSA 3M83A 1GPKA 1DT3A 2QJRA 3NOXA 2WM2A 1FFBA 3F98A 1ZD5A 4H7KA 2PL5A 2J3DA 3DCNA 4G1FA 3IUJA 4LXHA 3WI7A 5DLPA 4K5QA 1EVQA 3DJYA 4YX9A 5T4HA 2XUAA 2QUBA 3G9XA 3OC0A 1C7JA 4TPKA 5ALKA 2XDWA 5AKGA 5IVKA 4BCDA 3EBLA 2ECFA 4B84A 5ALJA 2Q0XA 2W22A 3FYUC 2CUTA 5JD4A 3VJLA 2WJ4A 3CXUA 3GELA 4ZRDA 2I3DA 1AQLA 2QJWA 3FVRA 5CMLA 5AKKA 1W75A 4P9NA 2JGFA 5ALTA 2JBWA 4FLFA 1MX9A 2WHQA 1F8UA 4HAIA 2JEYA 3EQ9A 5DNWA 1PFQA 5D3KA 4QDZA 2WJ3A 2FX5A 3IVMA 1CUIA 1VA5A 1VKHA 4WY8A 3HACA 2V9ZA 4Y2YA 1H2XA 1UWCA 3W9BA 1JFRA 1R1DA 4PSCA 1JJFA 4UHCA 4PSUA 3FLAA 5K3CA 3H2GA 1YA8A 1KU6A 5FPPA 2QUAA 1IZ8A 3MUNA 5BOVA 5HFNA 3FNBA 4QDTA 1QE3A 2PKYX 5LZ4A 3W06A 4Y2XA 5EHXA 3RARA 5ALZA 3WK8A 1CUEA 4DIUA 4PNZA 4WCVA 3ANSA 2DQZA 5JARA 1BN6A 4EBBA 4A5SA 2C5FA 5EI5A 1BU8A 5BWBA 1XLUA 3FLBA 5CT5A 5IVDA 3HLKA 3B5EA 3DS8A 3R41A 3AFIA 2WIKA 2XMSA 4B6GA 5K3AA 4W63A 4XJVA 1QIIA 4DMCA 2AXEA 1LPBB 4CG2A 3I1YA 5ALQA 3WL6A 2HFKA 2GBCA 2JEZA 2VTVA 3E3AA 4UBLA 5ALWA 4EZIA 1CUYA 2VEOA 4HRYA 2Y2VA 1XFDA 1XZGA 5FOQA 4UBOA 3V1LA 4UPDA 3RKSA 4DSAA 5T4EA 5JAUA 4MJ3A 4ZV7A 4C01A 1UK8A 5EIAA 1XZMA 1Q0ZA 3TEJA 4BRZA 1JI3A 1W6RA 5DTJA 3D59A 4AMYA 3Q8WA 4FFWA 3C87A 2B20A 2XUOA 1CUVA 1DINA 1L7AA 4UHEA 4GI1A 2I3ZA 1CUAA 4C4ZA 3G7NA 5AP9A 2Y6UA 3PFBA 1TCAA 3H19A 5CT4A 4C89A 2JGKA 5AI0A 2GZRA 1DTEA 4U2GA 2FJPA 3GFFA 3WK6A 5LKRA 1OILA 1XKLA 1DQYA 2BGNA 5CBKA 2XUPA 3IUQA 2EDCA 1YAHA 3M82A 3R3WA 2R8BA 1XZLA 1AC5A 1W1IA 1YR2A 4X85A 4BP8A 2EEPA 2XMZA 3F96A 3M3DA 4JYPA 4J03A 1LZKA 4HTAA 1JU3A 2DFPA 4NVRA 3R3UA 3QBJA 5AOBA 3D5EA 3DYIA 2GBIA 5JATA 4C88A 3G8YA 2HFJA 4QDOA 3I6YA 2Y1KA 2XT0A 5EIHA 3H2JA 5AO9A 1BEEA 1CUSA 2G4LA 1LBSA 2J3QA 3I2JA 4X94A 4N8DA 5I9IA 4P93A 4DNFA 4BATA 1XZEA 4QLAA 1VJ5A 2VJBA 4LYDA 5HK8A 5SYNA 1YASA 3C6YA 5EIEA 3W9UA 4ARAA 1WB4A 5JAHA 4X6XA 5AI8A 2G5TA 3HZOA 1FFCA 1K8QA 2VJAA 1CUUA 5IVIA 2HA6A 2VT6A 2H7YA 2PBLA 2Z8ZA 1UK6A 3DDUA 3ZI7A 4IH1A 2OCIA 2WFLA 4JNCA 1BROA 3FVTA 5K3DA 4G9EA 1SCKA 4B9AA 1DX6A 3BDVA 3BE8A 4ZI5A 3DNMA 3DOHA 1XZBA 2OXEA 2V97A 1H22A 3C6BA 4RNCA 4J3JA 3KD2A 1CVLA 1E89A 3C45A 3E4DA 3R3YA 4F60A 3E0XA 4PV7A 3IURA 4GBGA 2WG1A 5HK9A 2EDAA 4X3CA 2WFLB 4HRXA 1P0PA 1I6WA 3V1MA 1FJ2A 1ZOIA 3FYUA 1QIKA 3CN9A 4UHFA 1NU8A 1Y7HA 4QEKA 4X90A 5AI6A 4F21A 3OTQA 5ALXA 5JYCA 4KACA 4PW0A 1EA5A 5K3BA 4DLNA 3PUHA 1LPSA 3STYA 5ALVA 2LIPA 4HZGA 3QMMA 5C81A 1J06A 3ICVA 1ISPA 3C8HA 2B61A 3WZMA 2HU8A 4G4JA 1MAAA 3O9VA 1E8MA 1G66A 2XUDA 4A23A 4NMWA 3HSSA 5LZ5A 1W4LA 1TRHA 2BFNA 3WYDA 3PICA 3O95A 4J0IA 5HZGA 4L3WA 2CJPA 5ALMA 3VJMA 4EB0A 3EQ7A 1FSSA 1UKBA 3T4UA 3G9UA 4UHDA 1QO9A 3FYTA 1YB6A 2BUBA 1AX9A 1P0IA 1R50A 3A70A 1HKHA 2VT7A 4LKOA 5T4FA 1AMNA 1SCIA 1TCBA 2QS9A 4Y2UA 1FFAA 3GROA 1UFOA 5DYYA 1IVYA 3N0TA 5ALDA 4B81A 1CUHA 3W2TA 1MAHA 5JIBA 5ALUA 3MGAA 3FSGA 4AMZA 2HA2A 2BAGA 4H0CA 2ZJ7A 4X92A 1ORVA 1VE6A 3OG9A 1HLGA 4YK7A 1KU0A 2ZVDA 5BWCA 1T4MA 1GGVA 3SK0A 3AIKA 2XQGA 4UBNA 2XB6A 1A7UA 1WB6A 3GA7A 5CT8A 3WWCA 5AOCA 4K6KA 4B0PA 5CH8A 5DJ5A 1QGED 2XMCA 3BJRA 2XE4A 3FOBA 6YASA 4O08A 1YA4A 4KAJA 5AM2A 3B12A 4Y2JA 5AKXA 4BB0A 2D0DA 3LIIA 4QDUA 1XRNA 2PVSA 2AJLI 5IVHA 3PUIA 2ZSIA 4B80A 5LZ2A 5LZ7A 2GYUA 1WB5A 5AJHA 1SCQA 1IMJA 2ZYHA 4OUKX 4BAGA 3WWOA 1VLQA 1BN7A 4D9JA 5HF9A 5DNVA 3STWA 2WFMA 3PF8A 3V1KA 5LP1A 2QXUA 5YASA 2CB9A 4B85A 3IIIA 4MWTA 3SC2A 3NUZA 3IUNA 3U0VA 2C4HA 1ZIYA 2J4CA 3AZOA 4XVCA 3OOSA 1VA4A 4QA9A 1OCEA 2VAXA 1TCCA 1G42A 2XMQA 2OCLA 3A6ZA 2Z5GA 3LP5A 1QFMA 4ZXFA 2ORYA 1CEXA 2XLCA 4E11A 4X95A 2FJ0A 4OB8A 3WQHA 1DWOA 3A2NA 2OAGA 1QIMA 3C6XA 4FHZA 5JANA 1GPLA 5FV4A 4B83A 2WIGA 2OCKA 1XQXA 3HEAA 1CR6A 1XLVA 3QMVA 3DEAA 2Z3ZA 3LIPA 1QIEA 1GZ7A 3HABA 3DL4A 3QZUA 2BKLA 4UBMA 5AI5A 1EDBA 5AKIA 2OCGA 4F0JA 2P8SA 1YSCA 5K3FB 2HRRA 3LS2A 4BC0A 3P2MA 2DCMA 2PPLA 3L1JA 5ALFA 2HA4A 3Q0TA 3FWHA 2VQ6A 1GKKA 3D2CA 3LCRA 4OYLA 3KOOA 1PV1A 5HF6A 3C5VA 4ARBA 3ICWA 4MXDA 4GLBA 1CV2A 3I2KA 5D3ZA 3VDXA 1UOOA 5I7UA 3DL7A 5AK3A 5AKYA 1ODTC 5DNUA 1FFEA 4H7EA 2H1IA 1DX4A 4CCYB 5KWJA 3TGLA 1QIFA 1LZLA 1WPXA 2ONCA 1K5PA 4CIBA 4I3FA 3FLEA 3QPCA 4AX4A 4MYSA 1Q0RA 4FWBA 2FUKA 3IULA 4BVKA 3D4LA 4FFVA 4AO6A 2WTNA 2OPHA 4EHBA 2ZYSA 3EIOA 1BCRA 2VSQA 4X71A 2WQZA 4AB1A 2VA9A 4GEGA 2UZ0A 4KAFA 1XRPA 2OQIA 4Y9SA 2PUJA 2QOEA 3D2BA 3WKCA 5KWIA 4M0FA 1A8UA 2XUGA 3RK4A 3WL8A 2XMGA 4UBKA 3H0CA 1RWQA 2Z3WA 5CRIA 4E15A 3PI6A 4EA6A 4OU5A 5FDFA 1AKNA 5AKHA 1QOZA 3H18A 4QLOA 3GBSA 1WHTA 1HL7A 4OCZA 1N5MA 1CUBA 3I2GA 4LXIA 5ALNA 1XRRA 3WL7A 2WLSA 2IIVA 2JGEA 4BTVA 4BE4A 1AUOA 2HA3A 3BXPA 2YH2A 4RE5A 2PSFA 2VAVA 4PO3X 2YASA 4BTLA 2G5PA 3R3ZA 4L9AA 2H7XA 2QZPA 3BF8A 3STVA 3QM1A 3K2IA 4H18A 2DR0A 1MX1A 3DKRA 4HXFB 2W6CX 5FLKA 4G8BA 1ZI6A 4AN0A 5AM1A 1HDEA 1QIGA 3HYSA 1ODSA 4X00A 3WWEA 4X6YA 1LGYA 4QWWA 5K3FA 3G9TA 4MQLA 1ZGCA 4KRYA 4MYDA 1AZWA 1UKCA 1CUGA 4AZ0A 5CW2A 1UKAA 1WPRA 1VOTA 2GYWA 3O9MA 5A7FA 5A71A 1Q84A 5ALSA 2AJBA 3LLCA 4M0EA 1MX5A 4H7FA 5AK6A 1BE0A 5AOAA 3AJAA 3L1IA 2ZJ6A 1ZI8A 5K5EA 3H1BA 1CUJA 5LYYA 2OLEA 4QNNA 3WK4A 3ZV7A 3BIXA 2K2QB 2QTBA 1G4HA 1HBJA 2OGSA 3R3VA 1JJIA 5AK5A 2HDWA 4AXBA 1W76A 2ACKA 3I2FA 2XUHA 4KYVA 4PF1A 3L1HA 5E4JA 3TJMA 1EB8A 3DKKA 3WKBA 4J0KA 1T2NA 5CURA 2YXPX 3V48A 2C0QA 3G9ZA 4A16A 2Y6VA 4H7DA 3PFCA 4BYMA 3FBWA 5E4YA 2V96A 1QJ4A 2HADA 4BC1A 5CH3A 2AJDA 3BIWA 2XQIA 4FLEA 1H2YA 1R9MA 4BCBA 4DTCA 3ESBA 4S0XA 3ZLTA 2XMDA 1XRMA 5H3HA 1KEZA 1XZJA 2Y2UA 5LKAA 3G0GA 1XROA 3X3HA 1QIDA 3IDAA 4BZWA 3NGMA 3A2MA 2PSJA 2VJCA 1LLFA 4BP9A 3R0VA 1R9NA 1TQHA 3VISA 5AH0A 3HI4A 1QIHA 2ES4A 5AIBA 3UUFA 5J3JA 1USWA 4OB7A 3STUA 1GKLA 4BAZA 4EY5A 3PE6A 1OXMA 3KWFA 1MTZA 2PSDA 3H1AA 2B4KA 2WIJA 5AK4A 2DHEA 3BL8A 1CUXA 4XWGA 3A2LA 3IBTA 4K6GA 4Q82A 4G5XA 4X7BA 1F6WA 4Q1VA 1ZD2P 4ITVA 2ZYIA 1UZAA 5JD5A 1QIJA 4Y2TA 5HF5A 5C8VA 5DWDA 1ZIXA 1MT3A 2GBGA 3DLTA 1GQSA 2JGMA 2QVBA 1LPOA 5JALA 2XQKA 5FUMA 4K6HA 2J4FA 4U2CA 5HQ3B 2H7CA 1Y37A 4B82A 2V98A 3O4GA 1CUCA 4C87A 3ZPXA 1PJAA 1X2EA 2PUHA 4WJLA 3C8DA 3ILSA 3IUMA 3WK5A 3CCCA 2CZQA 1EVEA 1VXRA 1DQZA 2DHDA 3YASA 1EI9A 4NS4A 4Q3OA 3AZQA 1THGA 1GPNA 1ZGBA 2X5XA 4EY7A 3C43A 1IUOA 1LPAB 4G4IA 1XQWA 5CH5A 4ZGBA 1E66A 5CTAA 1F0PA 4X6UA 4ZWNA 4G8CA 4FNMA 4U2DA 4WDQA 2O2HA 1P0QA 2HL6A 5T4BA 3SX4A 4L72A 1CPYA 4FKBA 1UT6A 2HIHA 4DSZA 4OU4A 3T52A 1HQDA 1XQVA 5JAPA 4PQEA 3TRDA 1XQYA 1E3QA 1JMKC 1GQRA 5F4ZA 4OSEA 5AIAA 4J0CA 5ALEA 4FDMA 3OURA 1G5FA 3WJ2A 4Y2QA 2JGJA 4KE6A 4W1QA 3WKDA 5AHXA 1EINA 1U4NA 3ZLUA 1A8SA 5AKJA 3GZJA 5ALRA 2H9YA 3STXA 3IA2A 1SC9A 2RHWA 5JASA 1UOPA 2JGIA 5AI9A 1QFSA 4Z49A 3AINA 5HCUA 3WA6A 2WHPA 4QE3A 1YAJA 5AKLA 3STTA 4JEIA 1QZ3A 4UFNA 5FPQA 4ZV9A 4DNOA 3QYJA 5HKBA 2ZYRA 3K9BA 4RGYA 4NZZA 4OB6A 2AJ8A 2WG2A 4CIAA 4AQDA 3RM3A 4HVTA 1QLWA 4QDXA 4IH9A 1JU4A 2XUIA 4WFIA 2WUFA 4BDTA 1WOMA 1A8QA 4WFKA 3G02A 1CUDA 1DWQA 3ESCA 1LNSA 2E3JA 3EQ8A 3H17A 4U2FA 3QMWA 4GWLA 4CCYA 4G4GA 3D3NA 2ROQA 1TKRA 1Q83A 3WA7A 2XI4A 5E2IA 5EHNA 3F8SA 2WFZA 4H7IA 2QT9A 1ETHA 5ALOA 2HM7A 2OQVA 5ALPA 4UFPA 4N5HX 3QPDA 2DHCA 2X76A 2GYVA 5AM3A 1ORWA 2IITA 2XUQA 4GW3A 1CQZA 4J0DA 2XMRA 4H77A 3I6ZA 1ZJ5A 1H2ZA 3H04A 1XZFA 3V1NA 3VVLA 5K3EA 5A2GA 4DGQA 1U65A 1YS2X 1VZ2A 3QVMA 1H2WA 1UXOA 2RHTA 1X2BA 3WJ1A 1EB9A 2HHAA 3WL5A 4FTWA 4Q3KA 3WLAA 3O4JA 2WTMA 5EHQA 2QRUA 2WHPB 4RE6A 5AI4A 1QTRA
chains in the Genus database with same CATH superfamily
2HF8A 3PQDA 1A97A 5HIJA 1I4TD 1U28C 3MWYW 3OQJA 4EKDA 1RVDA 4MWOA 3JZMA 3ESYA 1Z4IA 1J33A 1K27A 4B3MB 1AGYA 2YY5A 3LKDA 1U0EA 2Y1FA 4P5DA 3IT2A 3QTBA 4NHEA 4WBNF 1X7GA 2ZT7A 1SXHA 3PQEA 4BN4A 121PA 2XNKA 1E3WB 4E31A 5DTRA 4D57A 1VE7A 4J0QA 1E3SA 1NXPA 1Q3KA 2QF7A 4AK9A 4G5OA 3A26A 4DIMA 4J76A 4B3FX 1QYVA 4KMMA 4NCAA 2FW7A 3OFJA 1XK6A 2P1RA 2ZT5A 5LBUA 1NJ2A 1M0TA 5G1NA 1ID8A 1ZJ6A 4M38A 1CY8A 3CZ9A 3I9MA 4MWSA 4GI5A 4NH4A 3RS8A 1NIJA 2YC2C 4LIPD 4D6XA 1E7SA 4YALA 4Y6GB 3CVOA 3JWEA 2FEMA 5I8PA 4QUGA 2OBMA 4CDMA 1KC1A 3DTVB 4YXFA 3TR6A 5A0TA 2GPTA 1Y6RA 4D97A 4ZRMA 1GAQA 4C4YA 1TEVA 3UMRA 3DUFB 3N7AA 4QASA 4MWBA 4CODB 2R8OA 1XRLA 4F4FA 2O7QA 1X94A 2X58A 1Q0QA 2Z8YA 1N0HA 3ANTA 3INTA 1TUBB 3KB6A 2NSYA 2YMPA 4NOMA 1A8PA 4GIBA 1XZCA 3GLHA 3FPSA 1EFTA 1S8AA 4HWRA 3BDAA 4Q9IA 5G0TA 5IZ4A 4QUKA 4D81A 3K9HA 4ZN6A 4ZJYA 2XQFA 1Y5RA 4KR3A 3R8XA 4OX9B 3IOEA 3BH6A 3JYQA 2Q7DA 5JO9A 3C5WP 4RKEA 2EX1A 4J1SA 3GNSA 1MOZA 4R7GA 2AOVA 2VTDA 3IP1A 3D8TA 1SVOA 2ATIA 4CM8B 5HWSA 1C0LA 1TNDA 3OKAA 4ESEA 1M2OB 4DIBA 3CJTA 3NVAA 1KDVA 1IXSB 2GFQA 2PRYA 1UIMA 4E0BA 2B8WA 3KT8A 2N1MA 3JQ8A 4OHRA 4TQUS 4HUTA 1IN5A 2FPIA 3OCUA 4FDUA 4XX1A 4ED9A 2Z4SA 4MQEA 4PR3A 3BD6A 3ZNPA 5H9WA 5JAHA 2IUTA 2OZPA 4BRSA 2D1YA 1DAKA 1NOJA 2A5GA 4LZPA 1U9IC 4MW6A 1XRJA 3VDMA 4BLWA 2W8BB 4P33A 3K09C 4ND1A 4HWPA 1A9ZA 1ODFA 4L9SA 3KYJB 5K8JB 5DHFA 1KK0A 1P1IA 1NVGA 3BSWA 3GEHA 4G3XA 4J0JA 1NF3A 4P35A 5IHPA 2OXRA 4GMDA 1Q3HA 1J21A 1YS9A 4MRAA 4IUCS 2I91A 1ZXBA 3AESA 4ZJUA 4M1KA 4P34A 2H06A 3VAAA 2ECQA 5EKSA 4MW2A 4QPPA 3FAKA 4RYLA 3RWOA 5B5SA 1XZKA 1CEYA 4QQNA 4CR8A 3THSA 2AXNA 5LSAA 1KVRA 2ENWA 2OAQ1 4UMFA 3V46A 1EP9A 2BR3A 5ESXA 4EY6A 2PKXA 3I64A 3QK7A 1G2IA 5IKEA 4QWMA 5K09A 2QG9A 1P9RA 4B5LA 4R0MA 1N1MA 1YH3A 2Y1DA 4I6GA 5KWEA 3IQXA 4OO3A 3HBAA 1ACJA 2FSVC 2JIBA 4IGEA 3G5LA 4YBRA 5EE3A 3CUKA 3ZHVA 3RUHA 3OZEA 1J5PA 1QG6A 5FWYA 1RWVA 1EHCA 2IS6A 4LDRA 4H17A 4R1UA 4N41A 4GL4A 2WTAA 3DBVO 2YY7A 2P9EA 2HJWA 4I1PA 4GR9A 3WDMA 1CLEA 4PXYA 4HWOA 4TS9A 4DG8A 3C70A 1NBME 4H7PA 2JCYA 1ZNQO 3ZS9A 5CD1A 1EWTA 3UW1A 4H7JA 2ZIVB 2IDMA 2EBHX 3EFOA 4CKWB 3MXTA 1V6AA 2OZLA 3G13A 4P98A 3CWZA 3MGGA 1RYBA 1LVHA 4QOHA 2K7ZA 3UV6A 2UUOA 3W78A 2FMTA 3AEQA 2O19A 4MEBA 4NCBA 3KJFA 4BNYA 4FLMA 1T4DA 5BWMA 4YASA 4N3BA 5CNJA 4MIYA 2CDAA 1B6SA 4BAUA 1AA6A 1BEZA 4MKIA 3A1NA 4HQ6A 2L18A 3O4IA 5HGJA 1W29A 4W6ZA 5J2TF 2JASA 4IDOA 3H4MA 3DMTC 4MS4B 1T24A 3H9UA 4R9NA 3S2ZA 2OC9A 2V0NA 3EPJA 2OCDA 4DSNA 1NX9A 1JG4A 1SUEA 1DUIA 2RHRA 4QATA 3O8DA 2HU5A 4DMKA 1G20E 3KTAB 3HJGA 4LZOA 3LA6A 5KREA 3AI1A 1XUOA 3DZJA 4JYCA 1A9QA 2X41A 2QXTA 4NE9A 2V6BA 4ZU6X 5FOXA 3HKEB 4B9EA 4ZCQA 3RK0A 4YONB 4BBZA 4OJMX 5BSWA 2CLFB 4D0SA 2GXAA 3PS9A 1RKUA 1U3DA 2GZ3A 1MNQA 1JHRA 4FOLA 3LCMA 5TGTA 3IALA 1QTNA 4PTLA 2AC2A 4TS4A 1YIDA 4NLLA 3S28A 3E7DA 3DFMA 4X3PA 2XB4A 1UZNA 5H82A 2VNSA 4RYDA 1IMOA 1PJQA 3FN4A 5JS8A 2QV7A 2P62A 2AZXA 2ZOSA 2DFVA 3AM3A 4OD0A 1X1TA 4B6QA 3W5DA 4RVOA 4DR1B 3HCEA 4C7OA 2NO7A 5JO0A 2NN3C 3RRFA 3FMFA 1GEGA 5CR9A 3LYLA 1W30A 1SXIA 4UMDA 3WYNA 1DU4A 4C0LA 1PLJA 1JDBC 3C8UA 3DO6A 4PCLA 4QSMA 2C83A 4D92A 2GHRA 2JFFA 1ZUNB 1HDZA 4JVMA 3HGQA 1E4VA 1W52X 1VE9A 3KTAA 3LC2O 3SDZA 1LV7A 3G0IA 13PKA 3U81A 3KT6A 1T2VA 1U98A 1EX9A 2OUIA 4BJ6A 3EXFB 4DV3B 1D09A 2DPYA 2MSKA 1P61B 4O4JB 5IK2A 4V1CI 2A3RA 1ORHA 1Z4QA 2C5AA 3MCZA 4KJXA 2GEKA 2SCUB 4MV5A 4HNRA 5JOQA 3VGPA 1Z08A 1YZVA 1UODA 4G24A 3A1FA 4UHHA 4CKEA 3THWA 1AOXA 1ODJA 3FX2A 3OX2A 4FNGA 4KAAA 5C8ZA 4CM5A 3B13B 1QGOA 1QVWA 3KJEA 3ISJA 4YNBA 2DLCX 5JNLA 5AM5A 1UBUS 1MU0A 1XU7A 5EGNA 3ZQUA 4MV9A 4BGIA 1IEWA 2DTEA 3USCS 3X1YA 4INOA 4WGFA 4JR0A 3PFKA 1NOIA 4LDQA 2XUKA 1GRQA 2ZUEA 1JKXA 4FFOA 1ZMRA 2ZQ5A 1HXHA 2X7JA 1RWOA 3MCAA 4AJNA 3HRKA 2UXDB 2XYGA 2X8BA 3FZQA 2VCHA 1MJGA 1UC4B 1Q5PA 2QNIA 3I1JA 5T67A 1DFHA 3EVTA 2W6NA 3EDQA 4IIUA 1RCFA 1CIPA 5LZ9A 1V5FA 2WYUA 4R98A 5IJXA 4QT0A 3RIMA 3SIXA 1OLOA 2X0NA 4JD5A 4YDSA 4LXGA 1LPMA 3U2QA 1GRVA 4UKDA 1FMFA 1EUCB 3S7ZA 2G0AA 3AF1A 3R8CA 1Y6FA 4DWOA 1J00A 2C58A 4BMNA 1YDGA 1OA1A 3ZE1B 3JPWA 5BQ3A 3OMXA 1GTJ1 1BAPA 4E1VA 3ZXXA 3NP7A 2DSTA 3LO8A 2IPOA 4I4TF 4LHZA 5AW6A 4PR0A 1JNXX 2CLDX 2ZRGA 1L7QA 4M53A 1OX4B 4PVCA 4CNBA 2C61A 2EKZA 4EKNB 1I1OA 1V7PC 3PLAE 4BJHB 3TI9A 3IPAA 2Z9DA 3RUCA 4BEJA 3R4VA 1JDNA 3IB3A 2Q4RA 1CVRA 3U4MA 2PLWA 4LHEA 2ZDGA 2EZUA 4O4HF 5B37A 2BHTA 3NHKA 3CNOA 1VHLA 4WLUA 3G8AA 3WLLA 3N39C 2DB3A 1CHDA 2J67A 2PWPA 3IQHX 1T43A 5DM1A 2BKVA 4B4DA 1J2EA 3MJDA 4QQKA 4JH0A 5TEVA 2Y0BA 3PC6A 4LSZA 3CVYA 1P2DA 3C16C 4Z2AA 4QUHA 1TYBE 3GEDA 3HBNA 1C50A 1XNQB 2ZJ0A 2RGDA 2HMUA 3VR0A 4FIDA 4CMIB 3AKCA 3E7WA 3V80A 3G1UA 3DXYA 2JAXA 4HUQA 4URZR 5CBPB 2KSQA 5BSHA 3UOAB 4YJ2A 5FOUA 2XOXA 3KQYA 1DX9A 1E9FA 1UMBA 3VR4D 1U9YA 2IEAA 3BXFA 4TQAA 2VRWA 1JFTA 1RR6A 1I51A 3M81A 3IAM6 4MVWA 4KITB 1H4VB 1GOTA 3AOEA 3PTLA 4PX3A 4UEOA 5ALIA 4C6HA 5ETJA 1IAQA 1X6VA 1UPXA 1P2VA 2CJWB 4J4HA 2XXJA 3OU2A 5FNVA 1ADGA 4CMEA 2GBFA 4JJFA 2J31A 4GNRA 1JIIA 1P1HA 1CETA 3V8EA 2ZM5A 2H2GA 4FYPA 2JW5A 1RQGA 2WA2A 3ROQA 1VIMA 2P1DA 5CHYA 4AP5A 4FHGA 5HXAA 2J9ZB 1PVDA 2OECA 3HDGA 2SNIE 3S8YA 3RUPA 5DK6A 2YRWA 4FMCF 1B41A 1DZ3A 1E1LA 1F0YA 2I76A 4GYWA 1DO0A 1MPXA 3QH4A 1B1CA 4LHWA 4UBJA 5C7IO 5HQ3A 1PG0A 1B8NA 5F7JA 4F3CA 4FE3A 4I8DA 4YAJA 4BNZA 1N5RA 2JFNA 2NUTB 3E1KA 4EI2A 1SQ5A 4XUCA 3JD0A 4EGFA 4ILEA 4YV7A 5L4SA 1QGYA 4Z4HA 1YI8A 4FSXA 3QY0A 1E69A 4YA6A 1B16A 1VMEA 2JEOA 2YIDA 3OZSA 5ES4B 1QP0A 2WIDA 3BWXA 3DQZA 3FNQA 5JPDA 1A88A 1LLQA 3TUJC 1K1EA 3OESA 1JLLB 3HDHA 4MWEA 4W9RA 3VSEA 5F9FA 3OEHD 4FCCA 4YLGA 1M6NA 3OH8A 5FBRB 3S8MA 2NU6A 3CZQA 2Q50A 1MO4A 1S3GA 4HRVA 1E4OA 2JJ1D 4OK5A 3F3MA 3OQBA 1FP7A 4JIGA 5BN4B 3BHMA 4KIWA 4FBLA 4C0QC 5C8YB 3V1UA 3V4OA 1OB5A 1B00A 5MGBA 3PYXA 1VPDA 1F60A 2O2GA 4K28A 4WUVA 5AW5A 1XZHA 4GEKA 2C4TA 3MBOA 1VB5A 1R88A 4GU5A 4XSHA 2V1UA 2MR6A 2VATA 4AUMA 5B7QA 1SXJB 4J0GA 4RGQA 5LNK1 4Y2PA 3G7SA 2DUUA 3TFQA 1I6LA 3NV7A 4K9QA 3HWRA 3NCTA 1DT5A 2AI1A 1LFAA 2PU7A 3I23A 1V37A 3AHIA 3AIMA 1SUIA 2WU4A 4HDOB 1T1RA 1U7UA 4FFBA 4LOJA 2PXAA 4K6OA 5TY0A 2AE1A 2H18A 3I2HA 4AWXA 4E5MA 1WCXA 5BVGB 6Q21A 1DDIA 3PDCA 3IE1A 2CLEB 1RWBA 4F7WA 1U8XX 2R4UA 5AW8A 3LBAA 4IG4A 1MW9X 3EIQA 5DULA 1IHUA 1YIOA 2B92A 1R8QA 2YHIA 1RYYA 3ASVA 3N6VA 1VYUA 2X4DA 3OIVA 1RXCA 2QRVB 4MRNA 3GT4A 4XB6B 1O57A 4Q03A 5BN4A 4DR2B 2CFSA 1JA1A 1Z68A 3D7RA 3GJ0A 3W1EA 3ZW8A 4TMYA 2OXTA 1R0WA 2V6JA 4LDNA 1P5JA 4PBTA 4PG7A 1ZM2A 4F0JA 2VF2A 4C2TA 4GC9A 1IK4A 3E9RA 3QVOA 1F06A 4KC0A 5G53C 5BYJA 4AUEA 3DBRB 2HWYA 1JLRA 5ER6A 3I01A 4EW2A 4YMSA 3C3BA 5HF8A 4ZMRA 3KOXA 5EVCA 2JD2A 3B82A 1PW7A 3W2FA 2JZOA 3OLQA 3IR6A 2ET6A 2V7UA 3H65A 3MIZA 5CB4A 2EKLA 1DAIA 4OV6B 4Y2VA 1AKUA 3K1AB 2O2IA 2XTAA 2WHEA 4JLKA 3HJUA 1O03A 2R7LA 1KFEB 3TTSA 4BMDA 3BA6A 1MN6A 1V3UA 3HDTA 1YQWA 4JCOA 2BMVA 3TUIC 7YASA 3SE0A 2WWGA 2DGDA 2FPUA 3F5QA 3TDMA 4FWTA 2O2ZA 2Y92A 3KQVA 1MXFA 3D0KA 2QTFA 3R23A 5KJCA 1QYWA 1UDCA 4LWPA 2HA0A 1XA4A 4ZYXA 1GCIA 2C4WA 4RA6B 5JEDA 4KWEA 5CLFA 2PAAA 1Z22A 2YKGA 1XD2B 2H7VA 3SMQA 5I5GA 4MVCA 6CHYA 3EGDA 3CH6A 1MVOA 9ABPA 4L8WB 4RK4A 1CNFA 4NNPA 3T0FA 2PJZA 2PS1A 2AFHE 2GF9A 5WRFA 3RT9A 5CA1A 5LU8A 1DSSG 1WW3A 5HKAA 3LW8A 1Y9ZA 2QQ0A 3KFVA 4QG7A 4TLCA 4Y2SA 5EJIA 1V16A 2VOJA 3ZWBA 1HNNA 2IS2A 3GK3A 1ZW1A 1R4ZA 1YL5A 5D7BA 5CB4B 5AMXA 1JT2A 4KQ6A 1XRQA 4KW7A 4FGJA 2VCEA 4ITRC 4HNUA 2V3CC 3RYTC 4MUKA 1FJXA 1U1DA 3UMMA 3EEOA 3DD5A 1G5PA 2F6RA 1R0YA 3ABQB 2F3SA 3OX3A 3U3RA 3UWKA 1TAQA 3UBMA 1H0HA 1V6CA 4ALKA 4HFMA 1F8YA 1QP4A 3EA5A 4ZOEA 3W3AH 2HPAA 2PU5A 2VDNB 4B7UA 2MYPA 1ND5A 2QM0A 3ZWWA 3Q6NA 5IAKA 3T4EA 4AQYB 4LGCA 2XMBA 2GETA 4Q4AB 1C4KA 2P6PA 4GM1A 2BFCA 3FSJX 3PCXA 2W9XA 4YQFA 2NO4A 4ZMBA 4D3ZA 4DB4A 2XLBA 1Z12A 3B6EA 5DNDA 1U2GC 4B7ZA 2F43B 4WXHA 2XUFA 2C82A 1NTRA 1E5XA 2EHDA 3BICA 3NEAA 3Q9UA 4L2IB 3WV4A 4F4UA 4NARA 1GM5A 4L4UA 1O9GA 3RWMB 1Q0HA 1Q21A 3HHPA 4MRPA 2ZI7A 1DLJA 1V5WA 2I78A 1NSYA 4PNHA 3SP1A 1PQPA 1K08A 3HNPA 2XDYA 1R2QA 3BPSA 3DZDA 1U3WA 4KKVA 2ZIFA 1BYUA 1C3OA 2JHGA 4RIFA 4DEVA 2AKYA 1EFKA 4R31A 3TAXA 2RGEA 4IOMA 3PNYA 3U37A 3Q9LA 4JXZA 2B8JA 3UJNA 4P92A 1TA4A 3MUOA 3PHGA 1L5GB 3Q5EA 1F4LA 1SVWA 2QI9C 1B3RA 3P2JA 2WWTA 4I0WB 5JSUA 2QTVA 5GADl 1W4CA 4LX0A 2CHFA 1SCAA 2D5AA 2G08A 5JD3A 4DCCA 4G97A 4Q7KA 1V8BA 5HM8A 3A6JA 4MEJA 1IZZA 4JL8A 3FFTA 3L79A 2PZMA 4F38A 5SZJA 5EKXA 2WUEA 1V3QE 4YXWA 2BKXA 1V47A 3OQVA 2PO7A 3KWJA 1HUQA 1N57A 2QUHA 1FSPA 3PEVA 4ITUA 3EZXA 3SAJA 1N33B 3TZEA 5BRNA 2IK8A 4IIXA 2OAEA 4TS3A 4FINA 3O8CA 3KUDA 4HSEA 3GLGA 1SA0A 3M34A 4GICA 3G0BA 3A11A 2HCTA 3WB2A 2WILA 3B3QA 3ORSA 4GPTA 2ZPAA 1SVIA 1Q17A 2E4VA 2QJRA 3FPAA 4PC7A 4C7MA 1NJ5A 2WM2A 4O2BF 5KVVA 3LGAA 2GN8A 2VZ8A 4EKGA 2YNMA 1C3JA 1KDPA 4Y1RB 1I2AA 2PL5A 3OJEA 4L0QA 3IUJA 4MCHA 5HE8A 5FUXA 3QXJA 4CEHA 4LXHA 2CFIA 2CHUA 5AVKA 5HIIA 3BWCA 3EVCA 1PO7A 1MQSA 2WFAA 3DJYA 4JL5A 3KQHA 4OX9Y 3LNTA 4TL7A 3GNQA 4X8MA 4YAGA 1VJ1A 4NABA 1CF4A 4KU4A 5GJWC 4BPRA 4YX9A 1J1ZA 1DIBA 1N2CA 2VFAA 1Z4NA 3LGXA 3R6GA 3ZZ1A 4F8EA 3ZD9A 4WLNA 3ORQA 1K4MA 3HDJA 4KGDA 5A3RA 1YT5A 3MWEA 1IH8A 3WXBA 1JAYA 5HUJA 1Z34A 1UT8A 2XDWA 5JAIA 1NN0A 1UJMA 3EBLA 5LMNB 3AR3A 5I9BA 4CKXA 4ON9A 4YP1A 1DVRA 4FFPA 1R4NB 1QFYA 1C9DB 2PA0A 3Q7RA 1RI3A 4HYEA 1KJZA 1Z63A 2R4QA 2R8YA 2WJ4A 3C7KA 4Q3EA 4R8SA 3GELA 3HA7A 5JWRA 1AQLA 1QCCA 3C48A 5GV8A 2IYFA 1ZEMA 2JGFA 3C39A 2VKQA 4ICIA 4QVGA 3K31A 3KU1A 1OBOA 4LVNA 5COAA 2O3UA 7REQB 1F8UA 1E3WA 3PU6A 4PC1A 2QJOA 4RORA 5AHKA 2IPXA 2Q1TA 2JEYA 3B1ZA 4KDEA 2DTDA 3HXTA 5DNWA 5LUAA 3IHWA 3ZHTA 2DR2A 2JHAA 3V3KA 1H42A 1I24A 3O9ZA 4AZ3B 2OM2A 3F1KA 2CL0X 4IIGA 5MDHA 4QYIA 4XI9A 3TLEA 1SG0A 4Z51A 3EGXB 5KQSA 3PC8C 4KLNA 4LF8B 3EAGA 1CUIA 2RKBA 3QOWA 2C8LA 4GBED 1VA5A 2HEGA 1PJLA 4R8RA 3THRA 5LP6A 4KREA 4D9BA 3HACA 1L4MA 4BV2A 4BX3A 3D7SA 3TZKA 7GPBA 1BVHA 3VSBA 2GVZC 421PA 1UWCA 2PH5A 4B6OA 4EHNA 4F6CA 1JFRA 3PPXA 1JJFA 3QE4A 4RK1A 1AZTA 3ICEA 4PSUA 1NZJA 3FLAA 4WNCA 3C8MA 3SM3A 5L3QA 5CVJA 1OBVA 1QYDA 2H1FA 3OM1A 1B2RA 4N03A 1P1KA 4L76A 4YYEA 3ZTYA 5FPPA 2QUAA 5CIYA 1UPTA 3EFOB 3MUNA 4NYIQ 4E94A 4CKWA 2UYGA 4GH5A 5A3QA 1D0VA 1VLJA 1KPGA 2XB8A 3FNBA 4E2XA 1QE3A 5AESA 3M1IA 2QMYA 3B1FA 3QVGB 2YWEA 1PR6A 3N0VA 1OU4A 1KJ9A 4Y2XA 5DFAA 2C20A 3TNLA 3KP1A 1ZCBA 1CBUA 2Y1CA 1YJAA 4UTRA 2V8OA 5ALZA 2P67A 4YR7A 3HXQA 4O63O 4DIUA 3NRBA 2HH9A 3V7YA 1P17A 3GAAA 4WCVA 1IN6A 3ASUA 3TNDA 4DRXB 5BN3A 4RU1A 4RHFA 3PA8A 1YXMA 1BN6A 2W2QA 4CMEC 4B6PA 4A5SA 3HKDB 3BHNA 5ED4A 2G36A 2JAHA 3EE6A 4KI0A 4R9SA 3LL7A 1NDHA 1AUQA 4KQ1A 4HAUA 5BWBA 2NUAA 3L7CA 1HRDA 2VPPA 4M49A 1ZH8A 4ZGWA 5CB8A 9LDBA 5L3QB 3RYCA 1QVAA 5HMLA 5EIBC 1VBMA 4TMTA 5JXIA 4JYAB 4X84A 1OIVA 3DGFC 2GPSA 3G85A 3H11B 3ODGA 4QQFA 3LKVA 3DS8A 1MEOA 4OHBA 5DOZA 8OHMA 4JKIA 3DTTA 3DMNA 3AFIA 1FTNA 2XMSA 4I4IA 3C97A 4KN9S 4UNNA 4DIEA 4NFYA 2UVQA 1K8YB 5J43A 2BSQA 1SIBE 1PK8A 4CL3A 1NAHA 4QGFA 3CLHA 1D2GA 3V7UA 2FPWA 4QXAA 1E7WA 3JZIA 1QIIA 2XT9A 3V34A 2D2FA 2JFOA 1DXHA 3FROA 2AXEA 3CH5A 4KQ9A 1LPBB 2J9YB 4O2AA 5AVUA 2O8EA 4PHCA 1ZESA 3I1YA 1P8JA 1K0FA 3VKUA 1WRBA 5ALQA 2HMTA 4JEMA 4G25A 1XVLA 2HFKA 4I9NA 4V0SA 5HEKA 3RK1A 1YMQA 2G88A 3M5CA 1TU3A 3MELA 1QDUA 1OYYA 4J2TA 4Q93A 4K1XA 2ZROA 3C3EA 5GOTA 4NMLA 3T9BA 4AIRA 1J5EB 2J08A 2O2JA 1M2NA 3AP1A 4L3OA 1E1DA 3GPIA 4E7OA 1N8NA 3WOVA 2VBIA 3HYLA 4W6QA 4MR7B 4ZQFA 3RAFC 3EW9A 3QTLA 4DCUA 1LY1A 4J75A 3NHWA 2AZ4A 1WQ4A 1XFDA 2AHRA 1JSRA 4G1EB 5E38A 5AVRA 1Z0KA 3QU2A 3AXSA 3F6RA 4M0PA 3WLQA 1L4BA 1SXJE 4CLHA 3AF4A 2H29A 4X3OA 1V4VA 5L40A 1Y6GA 1XAGA 2DH5A 2ZSJA 3UG6A 4DHWA 5HM6A 3JALA 4UPDA 3RBZA 3BGDA 3T7EA 4TUYB 3PGMA 5T3YA 5M5BA 1ULAA 3TIGA 4YT4A 4NEGA 5EIAA 1F2TA 2YUTA 1N2GA 4K6MA 1NVKA 3NT2A 2G9NA 3PGVA 4A0SA 1UPUA 3OJLA 4IXNA 1USVA 3GP5A 1JDUA 1FX1A 3M4ZA 4Z86A 1W85B 3L4EA 1ORTA 3VBEA 4A1FA 2BFDB 1FL9A 1C7QA 4F11A 1RIFA 3JU3A 2FFHA 1HOXA 2IU6A 2ODBA 5E3IA 1CZOA 5EKTA 3TL2A 1ZH4A 1RWKA 3GLKA 3H83A 5I01A 2V9CA 2R1ZA 3VPBA 3VYRB 2B20A 3CEAA 2VA8A 1OASA 3DQQA 3ZG6A 4NPHA 5F1YA 3ZGNA 2HWKA 4R4JA 3DNFA 2G71A 2FP3A 2WAMA 3EJ6A 4MQ5A 4DDWA 2R8XA 2ZR0A 1TO2E 3LVBA 4KO3S 1AZSC 3OZXA 4GI1A 4UHEA 3WGJA 5KTRA 1PNRA 1FDTA 3LVQE 2P5SA 2Z5VA 4JZKA 4C7OB 1Z39A 5EJ6A 2J59A 5AP9A 1N6LA 1DI0A 3BH0A 1IY2A 3FGZA 4XGIA 3CRMA 4J16C 3TNFA 1II9A 2XCQA 1PR2A 1JNYA 3CZ4A 4MYHA 5IC6A 3IOYA 1RZ3A 1K7XB 5DHTA 4C89A 5LNK6 2YV1A 1N3LA 2PK3A 1C14A 1WD7A 4LECA 4URWR 2OXIA 5EEGA 1KSHA 1Z15A 4JBLA 4XUEA 3ZDFA 3HN7A 5EJAA 4EA8A 3NJRA 1T6YA 4UNRA 5BO5A 1VL0A 3R3JA 3GFFA 4X45A 3WK6A 4EJ6A 3AWIA 2X8AA 5FOWA 4GDFA 2RJOA 2V1XA 4MRMA 4DVGA 2PT9A 2DECA 2P2DA 2FUEA 3OPYI 2R85A 4EZEA 5LKRA 2I7CA 4DB2A 1JFFA 3F1LA 2G77B 5IBCA 1DQYA 3KQMA 3TBFA 4Q9LA 2EHJA 2NTYC 2VWPA 4YN3A 3P96A 2PMEA 1YTUA 3IUQA 2QRMA 2NZUG 4MI1A 4DQLA 1JT9A 1GR0A 2LIVA 3KAKA 1ULUA 3TWOA 1J2YA 1DRUA 1LBIA 1EJ0A 4G63A 4R1QA 2WICA 3H1TA 2UYQA 5CGQB 4P38A 1QBKC 1U0GA 3T0GA 4AJ4A 4AJJA 4ESHA 2I9KA 2CFOA 4H16A 4KDRA 4AJEA 1L5ZA 3MLAA 1EUQA 4COOA 3RE1A 3VMMA 4YIKA 1PJ2A 3R3WA 1J99A 3GRUA 3BHJA 5B30A 2JFBA 4MRRA 5JEEA 5K0JA 1DAOA 1AIPA 3PKZA 1BS2A 1H1DA 2VYND 4E1BA 3VYTB 1U2DC 4EG8A 1YR2A 2N47A 4AG3A 2EZ9A 2DFDA 2X3YA 1T8PA 1YQTA 2HMWA 3KKMA 1GL9B 2HSGA 2GRAA 3F96A 1JHMA 1HTWA 3GO4A 4NV1A 2ZRMA 5FLYA 1PSDA 5KX5B 4LRYA 2O0MA 4KQEA 3BIFA 2GEVA 3L6RA 4LJAA 3B1XA 1E2KA 4UMVA 4WK0B 5D51S 1VHWA 4FW8A 2G1PA 5GJBA 4MQFB 4LZAA 4QGBA 4MGHA 2FUG1 2CGEA 3R3UA 3CO5A 1RAFA 3WMFA 1WLSA 3OEEA 1VHJA 4KI7A 1ZK3A 3NTRA 3B5IA 3DYIA 3EZFA 5H81A 3TXYA 1XMPA 1VI6A 4ZAVA 3PSHA 3HI6A 2ZREA 1Z7GA 3D64A 3G1TA 1GDDA 3AUJB 4C88A 3Q8LA 2HFJA 1XD9A 2OHXA 3I6YA 2Y1KA 4QDOA 1O94D 1W87A 4J0FA 4LOAA 3K4PA 5EIHA 3ERCA 4G41A 1R8JA 1SEVA 2AOXA 1TK2A 3WK7A 1KMIY 3O0TA 1ECCA 1LBSA 1SBIA 2J3QA 5HJ5A 1UWKA 3ITEA 4I3GA 1SBCA 2VZEA 3C3WA 4N8DA 3KL4A 4RGVA 5THKA 1ENYA 5KJEA 5PNTA 4DEXA 1T5SA 2BDEA 3A58B 4O2AF 3RC8A 3L2OB 1QYCA 2F3TA 2XODA 3HU3A 4ZAWA 3KVYA 1E4EB 3A3YA 4MDEA 3AHHA 3CBGA 3ND9A 5EZYB 4EM6A 1KMQA 2VJBA 1P91A 2J9FB 2WJHA 4I4LA 4QGSA 1W96A 5SYNA 1SHKA 2YQ5A 1YASA 3C6YA 3P71T 5ECYA 2BHSA 1Z5NA 2VTBA 3DO8A 1P5RA 1BXGA 3GDHA 3BEOA 2E2WA 3MGCA 3ZUGA 3FCCA 1Y9DA 2IHJA 4YS6A 4ZGGA 1VKRA 5F7XA 4YP9A 1C9NA 2HDNB 5LWHA 4ZOBA 5G3YA 4UM7A 3NB0A 1Y3DE 1JHXA 4I4NA 4OF4A 3T7DA 3W5JA 3W9UA 4EQ6A 1L4HA 4MJLA 4PZUA 9ATCA 1ZRNA 1CJCA 3U7RA 4NFLA 2CZGA 1WB4A 3I5MA 2J0QA 1YJQA 3IP9A 4KIFA 3OHPA 1ZXLA 4P4SB 5BPFA 1IZ9A 2QDXA 3UUWA 3GFGA 1YVRA 3DDCA 3KJGA 1C9EA 4YP7A 3V00A 1M7BA 1C41A 1NG1A 4JKYA 2G5TA 2IUSA 3BE5A 2HN9A 2Z2XA 2WKPA 2IZ1A 4MUNA 4OMUA 5INTA 5KSOA 8ATCA 3AVTA 4PQGA 2C95A 4RXMA 3EOBI 5L8VA 3F7MA 4E22A 1LSSA 3J7AC 5L6MB 4IIVA 3DHWC 2WUVA 4J1QA 3A9WA 4WINA 1OHHA 1TFUA 2I1QA 3CVUA 4FYXA 1XG5A 4GWKA 2HA6A 3D1JA 3QFSA 1SUDA 4FMBB 3VV3A 2VT6A 5BNTA 4HDAA 5K8CA 3BZWA 2BGKA 1JLMA 3L4JA 1P4GA 3VI3B 1G291 3AF0A 2NGRA 3I73A 4Y6SA 4BQIA 2WFLA 3ENWA 3L7MA 2C31A 2RAVA 5K3DA 2YFKA 1SCKA 5E0KB 3TQIA 3CZCA 3RFCA 3W6ZA 1WUTA 1CF9A 3Q7TA 3DOHA 2MYUA 3DBLB 4MINA 4ZAFA 4YRNA 1O95A 1XZBA 2JKVA 4L8FA 3A04A 3H7AA 2OXEA 1Y9AA 2NSLA 2SBTA 3KYDA 3NIFB 1D04A 4J29A 4LBYA 1Y3AA 3S44A 2C7GA 2XTJA 2Y9PB 3ZW7A 3ZX5A 4B3BA 3CEMA 5GINE 1K88A 3D8RA 1E89A 5C8YA 1NVWQ 4MI9A 2IXFA 3CX8A 2VHXA 3R3YA 1IZ0A 1NF9A 4KXQA 1TM5E 4LE2A 2FPSA 3I4LA 1ZG3A 3NTOA 4F60A 3E0XA 2A8YA 4PV7A 3VX3A 4BO1A 1XKQA 3O21A 3AONB 3U3XA 5K7SA 1KE2A 3IURA 3CEHA 3K0EA 5BVHA 4HJXA 1IJFA 4FEEA 3AY0A 1KXJA 2QLBA 3QPBA 4U5XA 5DBIA 2WG1A 3JAKA 5H7XA 3O1LA 3MCTA 1MUUA 1Q2UA 2WFLB 3EX7C 4OATA 1I6WA 3V1MA 3WRWA 4M76B 3K1JA 5K0SA 1ZUD1 3IL2A 1ZNWA 1E1YA 2ZVPX 3SE7A 1GG2A 3OUTA 3WDKA 1YRBA 1NW6A 4IFEA 4ZVNA 3HA3A 3DMPA 1MB2A 2AKEA 2ONJA 1JWLA 1Q1EA 4UHFA 3E58A 1NU8A 3AU9A 3PFNA 3OTQA 1U6IA 2CFRA 1Z25A 4KACA 4H27A 5LDDC 2XBUA 1HDRA 4JGBA 4HJRA 3S1SA 4I99A 2YHIB 1KJQA 5GIPE 5LFAA 5EXXA 5IWAB 1DRJA 5ECWA 1X1CA 3PUHA 4X7PA 4DARA 4F5EA 1M6EX 1E2UA 2EL7A 3EEIA 3K8YA 1B15A 3TBHA 4F04A 2PD3A 5IJ0B 5I9SA 4ATNA 5ALVA 4NE2A 2LIPA 1HX7A 3JATB 2ZANA 1IDN1 2VJNA 2JCXA 4YP5A 2GT1A 4RO0A 2BCJQ 4X8HA 1FYFA 3CE6A 3WZMA 3L9WA 1A1VA 3ICOA 3M4JA 3O8BA 4JUAA 4US1R 1QRSA 4P6VF 4G4JA 2V7PA 3A4IA 3A7DA 4OQ4A 3M7IA 3OT4A 5JWHA 4BLSA 1RWWA 1ZM9A 1O8CA 3HDYA 4PZ0A 3B8HA 2HGSA 4FK8A 1G66A 1BFUA 1U3GA 1E62A 1FNNA 4CF5A 2HU2A 5AQ1A 3G6WA 4ZRNA 4B45A 1M34E 2EKBA 3N3AC 2I54A 2VH1A 4KXLA 5EERA 2IOYA 3WO1A 4C4TA 4KPFC 3H5LA 2XD9A 5EYPB 1PWZA 4DQUA 3GRCA 3I04A 3JQDA 4BN0A 3JQFC 2O05A 4C6RA 1TRHA 2BFNA 3VOTA 3WGOA 1WW8A 4R2KA 2XV1A 1CYEA 3AFNA 2V6MA 4OHYA 5CLIA 4HB3A 3E9QA 2JC3A 3IDOA 4L3WA 4F2PA 5E1OA 1OOEA 1HR0B 4MCIA 2FDCA 3FM9A 2GN0A 1PJSA 3RNOA 1GPMA 1XMVA 3WGUA 4YAEA 3N7UA 1CRWG 4HWSA 4EECA 3WJ7A 3G5AA 1CY7A 4JDUA 1N7HA 4EHIA 1R50A 4B34A 5HZMA 4L8GA 3IAUA 4OA8A 1M34A 3KVNA 1EX7A 1AMNA 3HGMA 3WIEA 2BCGY 1TCBA 2PPVA 4DV2B 1FFAA 1JIKA 3JQEA 3OT5A 4ETIA 3OPYB 2A2ZA 5JVDF 3N0TA 1JQ5A 2B21A 3A31A 2ZLBA 4DLPA 5B58T 4V1CB 4JBYA 4F6RA 4PZ9A 1K89A 1GL3A 3S55A 3SOZA 2DC1A 2QTTA 5IANA 2QYOA 1JLHA 2VP6A 1FPMA 2VTKA 4Z0HO 4AIIA 3OLVA 3WB9A 5CPBA 5CUQA 5DCUA 3TEMA 2HA2A 2E4ZA 1ONSA 4YEDA 3ZDCA 1JIQA 2VP9A 3MEQA 1SCNE 3N0RA 2NV6A 4MUXA 2C84A 4H0CA 1J39A 5JHGB 1O94A 1PVOA 1NQ5A 1YVDA 3U7HB 1WVGA 1UJ2A 1LNZA 3OG9A 1NN5A 1J8VA 2FWMX 3EEFA 3QELA 1KU0A 3RVQA 1CYDA 3SVTA 4UTVA 1LBHA 4PICA 2XCRB 3F73A 4Q47A 1T4MA 2RIRA 2W93A 4AULA 1SBYA 3EBPA 1NG9A 2ORED 4OHZA 3B85A 5LD2B 2XSZA 3BC1A 3CB2A 3UWOA 4GLJA 4B3JA 3HCOA 1SKMA 3WGYA 3UEOA 4CT5A 2PUCA 1E0DA 3GA7A 1TXGA 4Z9BA 1KPHA 1PS8A 1GUBA 3RJMA 2DFNA 4O4JF 3BGWA 1EFLA 3NLLA 1V2HE 2ZULA 3SF0A 4WBSA 1VJTA 5CT8A 4TLBA 1YK0A 4J43A 4BQFA 3C1OA 3MOGA 2VF4X 3LHDA 1AQIA 2XYQA 1YRHA 4PEVA 5DYNA 2F8SA 2I6GA 3NDJA 1WX1A 4D0NA 3S99A 2UZAA 3LCCA 4KX5A 2BM0A 1Y1QA 3IMFA 4N5LA 1WY5A 1SC4A 4WLEA 3ZOZA 1XNRB 1Q7GA 1TM2A 3CQ9A 3IMGA 3NTXA 1QGED 3ZCVA 1K6IA 3K09A 4TTJA 3BJRA 2EQBA 3L5KA 4IV0A 2IUUA 2G70A 1YRWA 1EK5A 4UHJA 2W0MA 3O8NA 4RTJA 1OLSA 4HBZA 3ZH9B 1MP0A 1NPYA 3H13A 3PCRB 4QYIB 3H3JA 1P75A 4W8GA 1KO8A 3VAZA 2AIRA 4XGQA 3RF7A 4KAJA 1JA0A 3Q72A 1UJ6A 3A1SA 2I9PA 2R66A 4BX9A 1LBQA 2RCNA 3RSGA 3PXAA 1O6CA 2D0DA 3LIIA 1KAGA 2E49A 1ISJA 1V8DA 3G8CA 4L5IA 4PQRA 4QDUA 4GI7A 2WMOB 4U7TB 4JHLA 5B2EA 1GRCA 5IVHA 3N76A 2JZCA 3PUIA 4KNVA 4N7JA 2BW0A 2EJWA 4NCJA 4RHYA 5EP1A 5KOHB 3RC7A 3T95A 2X0IA 1N7GA 1JEEA 1WB5A 1WO8A 1YQ9A 2ASEA 2IF0A 2OCXA 2WA1A 3HVHA 1G3MA 3SG0A 4KFTA 4FCWA 1RKVA 2X2FA 4XQ0A 1C2YA 1JA9A 4BAGA 1TVMA 2OHIA 4ECEA 1JPVA 4IZIA 1BN7A 1W4RA 2A5YB 3QHQA 5JLJA 4NBVA 1US8A 3ET5A 3Q3EA 2ZVQX 4OI2A 3IJEB 3GT3A 3JQAA 1NUTA 3GA5A 3IAEA 3STWA 2WFMA 2DWUA 5CDTA 1ISMA 2QXUA 2R2AA 3DDSA 2ZCVA 1P5FA 2C4NA 3UJPA 3K5WA 3RR2A 5DGCA 4MWTA 4UTZA 5JZMA 3OM0A 4YJ3B 2AH5A 2FZ4A 3SC2A 4LRXA 4PLCA 4C6TB 3JD1A 3NC4A 3IUNA 4DLXA 1TUEA 4RMGA 3AMVA 2GO1A 3JZFA 5J4LA 2KBFA 4TRMA 3F3KA 3UGTA 1VL8A 4IP0A 1VGQA 4K9NA 4XVCA 2RJNA 2OGWA 4TMZA 1X87A 1LDMA 2D62A 1OCEA 3SQXA 4N6OA 3TZ6A 4FR2A 3RSFA 1GZSA 4P3XA 4Y0NA 1TCCA 1WZIA 2KHZA 2LVBA 5DNCA 3H11A 2XMQA 2C7RA 1GG5A 4PZDA 2I2DA 1CXZA 3O8QB 2GRUA 2QDKA 3C7TA 4HLNA 4BO2A 3V2HA 5IU6A 5K0LA 1VECA 3GOHA 1UPFA 3LP5A 4HPWA 1K6JA 4IUDS 4ZXFA 3U7FB 5F5LA 3SZMA 3KQNA 4KQWA 5ELXA 2XLCA 1BHJA 1F5NA 2DWQA 2JFUA 2X8LA 1ZGHA 1F0KA 3AY7A 3K5PA 2PQ0A 4X95A 1OZ0A 4IQ8A 5CA0A 1XVUA 5LB4A 4RZ3A 3GPBA 1DWOA 3JTEA 2ZJ1A 3JQ8B 4WHMA 1T36B 2GBLC 1IFXA 4D9EA 5JANA 4N48A 1P6QA 3IMEA 4X66B 2G17A 2BBTA 3FOWA 2NV0A 4B83A 4Z3KA 2AR7A 3AU8A 4PPNA 4Z9YA 1TC2A 1UANA 2WIGA 1E18A 5B3KA 5B58C 3H05A 1V5GA 4P3NA 5HKKA 1GNRA 2IYQA 4AG5A 4QL3A 3LX6A 1KQFA 2DU8A 2OCKA 5HYVA 2QE7D 1K7CA 2GN2A 2PCJA 1XQXA 5HJ7A 3IILA 4E5NA 4JASB 2JIZD 5GOZA 4AC9A 4ABTA 4Q1FA 6NULA 1B76A 1NR5A 3C3XA 3F5MA 5KVAA 3LIPA 3BHIA 2IVZA 2AOWA 2CFTA 2YS6A 4GPZA 5FNVB 1GITA 1G6HA 1MV5A 3SJUA 4B87A 1GP2A 2YWFA 4E32A 4DJAA 1DV2A 3DL4A 1L7PA 4MKRA 1XTZA 5BV0A 2JL1A 1KI3A 1NMZA 4HMPA 2A0UA 3QZUA 2IEYA 4IIHA 4OSPA 4XQEA 3MFQA 3TRHA 4F3YA 3GXOA 5GM2A 4LJSA 2ZB7A 4M1EA 3PRHA 2SKDA 4U0JA 5JZVA 1FLDA 4UBMA 4NI5A 1EDBA 5CXSA 5AI5A 3UQZA 4EJ0A 5B1EA 1Z37A 3MQFA 4F5WA 1E6CA 2V7QA 1I1NA 4QAQA 3ESQA 1ISRA 1KMMA 2P8SA 3L05A 1DS6A 4L27A 3U4DA 4BKRA 1KJYA 4F9GA 4IUBS 3VU0A 2HRRA 1ZPDA 4HLCA 3GLHB 4A26A 3L1JA 4U6SA 3G2IA 2ZZMA 3BRQA 3RSOA 2UU9B 1K8RA 3NFRA 3LF1A 2OWDA 3UG7A 2UDPA 2C1ZA 4OYRA 16PKA 1HG1A 2P8JA 3PJRA 2NM0A 5EIWA 3W8EA 2O50A 4EABA 1FS5A 1GKKA 4CDGA 2X40A 4OYLA 5FI3A 3KR9A 4MKHA 3KOOA 4HGQA 4IHJB 4LUCA 1JXMA 2O8NA 5LQNA 1QR6A 3SQLA 1L3CA 2ZG6A 1NV9A 5LBTA 1O4VA 4ARBA 2PJUA 2RGNC 2OBBA 4E7PA 1CV2A 1ZWLA 2BL4A 3IMKA 4B2PA 4EJFA 3DPSA 2BI7A 4M36A 1OFHA 1GTL1 5I7UA 2WT8A 3DL7A 1QB8A 2D6FA 1KF0A 3KKQA 5JS2A 1NZFA 3SLRA 1Z5ZA 3W9YA 3T34A 2LRHA 4H7EA 1YQUA 4LY0A 4RHEA 1ZKMA 3GVPA 3O3NB 4TXHA 1JE0A 1LV8A 3K0AB 1CR1A 1QIFA 2GTPA 3A06A 1LZLA 5DRYA 1Q1NA 4O4IF 2Q6VA 3T9FA 4L5YA 1N6OA 4WV3A 1IBRA 1PJ8A 2AOTB 3F3YA 3RG2A 3ZDRA 4BWFB 4DKXA 1NJ8A 5BURA 2UUBB 1RWNA 5BN5A 2NTNA 1XEXA 1E61A 3FLEA 3HNRA 4Q1CA 4A2QA 3C4VA 5HE9A 5E1DA 1SHUX 4PINA 3JAWB 4WXRA 1YJXA 3RGGA 4AX4A 2E87A 1KWGA 1UBRS 1UMCA 3EXIB 3IH5A 3IVRA 1Z6TA 3VNBA 4UDNA 1XIVA 3O03A 4BVKA 1CLUA 3GFPA 2WTNA 3I39X 4QTUB 2O2CA 1YBHA 2GTHA 3L6EA 4D4KA 2H4WA 2ZYSA 2QRPA 2B83A 5IYZA 1O0SA 3EIOA 1AE1A 1M1YE 1DCKA 1Z73A 2VSQA 4II3A 3WQRA 2XADA 3JQBA 1NKTA 3LMKA 5JQGA 4GPBA 2I8LA 1ML3A 2AMJA 3W7AA 1NASA 2Q2QA 1BXZA 5T6MA 2VA9A 1H5NA 2IZ0A 3G8BA 3RU9A 2LCFA 2XYPA 3PWTA 4UCXA 4KAFA 3W34A 1HY3A 1XRPA 3OQ6A 4IJQA 5DHUA 2PUJA 2FW9A 5IT9A 3C8ZA 4DA4A 1IN1A 3DDOA 3WKCA 1AGXA 3FVQA 5D3QA 4V0RA 2NP6A 4OOEA 1F4VA 2P6NA 2XUGA 2I1WA 4L4YA 2MMCA 3SYTA 1ZP6A 2XMGA 3LRTA 4UTNA 5L3SA 2VCYA 3MYYA 5LC1A 3D8HA 1X9IA 1L4YA 1S9HA 2ZYAA 3QFTA 5EJFA 1REQB 4RTLA 1RWQA 3IB6A 2Z3WA 3M6IA 4LXUA 4M9XA 2YQZA 3Q12A 3W3ZB 4UQPA 5CRIA 1QYXA 2ZTLA 2NWQA 3S27A 1QS0A 3VPXA 1KY5A 3ND8A 2DYKA 3L1VA 5JH7B 4JL6A 3H5AA 2ACVA 3UV3A 3FZYA 3NC0C 2IYSA 2GAAA 1JQDA 2RDMA 5DLDA 1EVYA 2YZMA 3N05A 5LQDA 4DL9A 3PR3A 7AT1A 1PTJA 1CP2A 1HL7A 1N5MA 4LHSA 4G5RA 4AQ7A 1SOUA 3CX7A 1P2GA 1NRIA 1QLHA 4HEA6 2ABWA 4K05A 1H8ED 4MB6A 3RF6A 1WDLA 1A8IA 3OWHA 5IUNC 1OH6A 4OG2A 3RVRA 1A98A 3EOAI 4UPVA 3INYA 2C04A 2JGEA 3GVCA 5AHWA 3MSCA 4V3BA 4XA8A 2AG1A 3N8KA 1JS1X 3ND7A 1DRKA 3WRXC 2HA3A 2HRBA 1QCYA 1LDYA 2Q6TA 2NZYA 3MQ4A 2ZT8A 1ORDA 4X1OA 1EFVA 3TOZA 1PL6A 5I45A 2WUWE 2PMFA 3LDFA 4Y9DA 1X8JA 1I7QB 2EATA 2CHGA 1IWOA 2C42A 3ONVA 2Q4BA 4OHXA 3Q7PA 1BXGB 4BTLA 4ETMA 2AK2A 3RGWS 4F4CA 1G55A 3QBEA 2AMLA 4KIJA 4D98A 2H7XA 2OO5A 3CUYA 4NYMR 3DWGA 3BF8A 4DGSA 4EQ6B 1J7JA 2X42A 4IHQA 4LQDA 4XSVA 3STVA 3ZY4A 5I4KA 2X0KA 2FR8C 2ZQYA 3EY4A 3EWSA 4PYLA 3OOJA 2NO9A 1RKBA 4H18A 3QEBZ 1G17A 2ZM6B 3P97A 1DJNA 3MRXA 3V8MA 1L5OA 1TJYA 4HRAA 3ZWPA 5CLLA 1NNEA 5BQFA 3V97A 5BR7A 2ZETA 2W6CX 3LC7O 3CZMA 1B2LA 3IOCA 3GGCA 5F2OA 3RD5A 4QJ3A 2CVQA 4KHZA 5FLKA 2WNSA 1MAUA 3V4VB 2OYSA 4MO2A 4LV8B 4QICA 4P32A 3R6LA 1OKKA 1RC0A 3PJDA 5B1DA 2CUKA 4NNOA 1G0OA 3WWEA 1LVUA 2EGUA 2I3AA 4XLTA 3NXSA 3RI3A 2R8PA 4EYQA 2AF3C 2IHTA 2XMPA 3DE4X 3N8NA 2ADOA 4DCSA 1W59A 5K3FA 3VH2A 2V7BA 2VH2A 3G9TA 3JSXA 1BWPA 1UAYA 3T5TA 1ZGCA 3L7KA 3QYAA 4KRYA 521PA 2CD7A 1UAAA 3L7BA 3MERA 4I1RA 5DVZA 2O8CB 1IJEA 1CT9A 2ERYA 1K7SN 1Y8RA 1ZOLA 2K6GA 2YJNA 3D0OA 3KTFA 3UAVA 4HN2A 2A30A 4AZ0A 2HJSA 4ZAXA 2IXTA 1YA6A 1U8ZA 3E53A 1Y4AE 1VOTA 2J3IA 1NQXA 1N75A 2EX0A 1UEIA 2GYWA 3KPVA 5KCMA 1IIRA 3V4LA 3G0HA 4PCVA 4W9NC 4CV0A 1PGQA 4PPQA 1N4AA 3R9KA 4OHWA 1HEIA 4C7XA 4G6ZA 3ENVA 4U63A 1GNTA 1H0SA 3PC8A 5IDXA 5J47A 4UNQA 4H3VA 4PCUA 1SK9A 2CE2X 2AX3A 2R1UA 3NNNA 3HDVA 4M0EA 5IX8A 1Z2AA 2X6QA 3DMDA 1YVUA 2WJJA 3U19A 1P7ZA 2BWJA 5F4BA 3U26A 1K6MA 4QXQA 2BE9A 3AQIA 5B12A 3C3YA 3JZAA 3AJAA 3BBLA 1LX7A 1UDBA 1TT5B 2V5AA 2KLHA 2ZJ6A 5E2BA 1T6NA 2B7CA 1KSJA 2R79A 5K5EA 1QH9A 2E6KA 1Z06A 1ZMBA 3HKBA 3RRNA 1CUJA 5DXJA 2HHHB 1CDDA 4JJKA 2XHZA 2GVNA 2X22A 3KK0A 1F2UB 1BA3A 1ZJYA 4D96A 1GTZA 3CTMA 1KI6A 1JSXA 1XCMA 3TOVA 3OFVA 3ZV7A 1U6JA 1Y4ZA 4FQ8A 1UWVA 4QBFA 4AKIA 1QQTA 3D6NB 1A0OA 2GA8A 2MMGA 5KAMA 1E79D 5BNWA 4Q37A 5DASA 5CNKA 3WG9A 3T1HB 4FE4A 4TS1A 1JJIA 2ZYVX 3PEWA 5J63A 2HDWA 3P9CA 3IV7A 4AXBA 4S2UA 3FTCA 5GZ1A 4I4TB 4PG8A 1S4MA 3KVVA 1Y1SA 1SGWA 2H8KA 4J3NA 1D3AA 1R4NA 2DPLA 2ZZNA 1D1SA 2O7SA 3I2FA 4B4VA 4OH1A 3DTVA 2ZSBA 3G5UA 3L1HA 3ITDA 4H4CA 3TJMA 2BZGA 2QN1A 2RARA 2ZWVA 3DKKA 4TROA 2V6IA 1TT5A 1TE2A 3BFVA 2GM9A 2N9UA 1T2NA 3M6MD 2C9OA 1A3CA 2C0QA 2WT9A 2YXPX 1ZOPA 3T99A 3V48A 2Y6VA 5JFGA 1TEZA 4K9PA 3GWGA 3H6KA 4Q48A 4H7DA 5CFLA 1U7PA 2PT6A 4BYMA 1UT5A 4DT1B 3FBWA 4EJMA 1GGMA 2VG8A 3IAS1 4GXRA 5E4YA 4GSLA 2H1VA 2DUJA 1XZQA 2VHZA 3DV0B 3I92A 4R8KA 2GN4A 1HQYE 4DMLA 1LRKA 2LCIA 1HE3A 2VH5R 3CM0A 1ILEA 3LZCA 1B4DA 3T7RA 1Z4OA 3SS9X 4JLMA 4XFKA 1BD3A 2X0EA 3ZJTA 3LFUA 2DT8A 4EVSA 5JVDA 3TAUA 1H2YA 1AO0A 1P1FA 1H9BA 4BCBA 1EXVA 4I9HA 2Z2KA 3W5UA 2BSAA 2VDMB 4RF3A 4RETA 1KZ1A 3ESBA 1QHNA 1EMDA 5ICSA 4S0XA 2Z1MA 2FK8A 3OQIA 3GMSA 1N2JA 2Q2NA 1GUYA 1SHZA 4QC2A 1M5RA 2QYHA 4ZK6A 4Z6KA 4IKEA 1V41E 3P20A 3GGDA 1Y4UA 3OZRA 2HHJA 5L7TA 4CTOA 3NDPA 5H3HA 3JAKB 3BJZA 3VO1A 4PLHA 4D7AA 2R84A 5FI0B 2O57A 2F17A 4NBTA 1DOZA 1RQPA 2DUMA 2F3PA 3FCUB 3UATA 4BUJA 4EUHA 1VCIA 4R9RA 1W0KD 5FO1A 1DG3A 2G28A 2RBKA 4QTTB 3IHKA 3E61A 2WQ7A 1XROA 3OA2A 1J20A 3K53A 3D1LA 5F98A 2QX9A 4W5QA 5KTPA 1YS6A 3X3HA 4MV8A 5C5EA 3QVKA 3QUCA 4FFSA 2BDTA 4N5MA 5E6UA 3RBAA 5TVGA 4F6RB 1V95A 1W34A 2QTCA 5CM8B 4HNGA 4QYMA 4RQUA 3GJYA 3UT5A 2XA1A 2XA2A 4MVJG 3ILYA 1JSLA 2JFZA 1YCFA 2R6JA 4BP9A 4ESVA 3AFGA 4RA6A 4TKUA 1QIHA 5KWSA 2ES4A 3H4IA 3HU2A 3LBIA 3MT8A 3K9LA 4FD2A 4LC9A 2PZAA 2Y8EA 4IHKA 2NZVG 1LK5A 4EGSA 4MP3A 2IY9A 1RM4A 4ROSA 2DCUA 3L4BC 4K6FA 4UASA 2EWWA 4OIFA 1UBLS 1USWA 3RHTA 4LOHA 3DF7A 3EOZA 2COUA 3H2YA 1KDTA 1OBHA 2R7KA 1OXKB 2AYZA 3FSRA 2O5CA 4EY5A 3RVMA 5TT1A 3KQLA 3DHYA 3OY2A 3AYZB 1N1EA 1J2RA 5BNFA 3WS7A 3IJPA 3M6FA 5IJ9B 3N28A 2W6PA 3CYFA 2PSDA 5AVYA 4KR2A 2HUPA 2JLQA 2QIPA 3ONNA 5KTYA 4LJRA 4F85A 4XWGA 5MFPA 5DGTA 2IWHA 3AVXA 3TL3A 4XTCS 4TKVB 2G40A 1LUAA 2P0EA 5BVHB 2XEXA 1KA9H 1ZWKA 2C2XA 1OGYA 4EELA 3DE2X 4X7BA 5EN4A 3TZHA 1ZAYA 1E4YA 1C9YA 1E7QA 3GT7A 3LQ1A 4RKFA 5F1KA 1HOTA 3V2GA 4C0HA 3C0KA 3MB5A 5A4KA 3LM8A 3K6JA 4C21A 2AG0A 2PQMA 1ADCA 3K15A 2AR0A 3ZJ5A 4C0BA 3GRVA 1GQSA 2YW9A 3C3CA 4O4LA 3KKEA 3GLRA 2QVBA 2JB9A 3B2QA 1G1MA 1L6RA 1MO5A 4MZDA 4WZAA 4ZVKA 2R3SA 3ETNA 4ZMSA 3LOPA 3Q6MA 5BV8A 5IPFA 4ARCA 2NO5A 1JGTA 3EYAA 1PG2A 4HEJA 2O3JA 3EEYA 2J4FA 5FFMA 4U2CA 1DJPA 3U62A 2J5KA 2CF5A 3OLXA 3TAHA 3LHKA 4HSGA 4M1OA 3R5TA 3DE5X 4RM2A 2WEKA 3HH8A 5A1JA 4L4SA 4TT3D 3TNYA 2H7CA 1TTQB 5FULA 1KEEA 4KXYA 1CUCA 4WESB 3H8SA 4C87A 2CE7A 1TIKA 1J4AA 2H4XA 4JUDX 3VDQA 5DM0A 1SULA 1X2EA 1WMEA 3ILSA 3ZD6A 1JDPA 3NM4A 5K01A 2GEDA 1LRJA 1QE0A 3OCWA 5JISA 2CZQA 4J6EA 1LA2A 4I5DA 4TWJA 3JPYA 5JECA 4GLFA 4BNVA 2ZJBA 4QSHA 2A9KA 2C96A 1AY0A 1JQAA 2CHVA 1W85A 3KUKA 4N39A 4J07A 4NS4A 1X7XA 3D5QA 4Q3OA 2IVFA 3C3PA 3C4JA 5DX1A 4B75A 3ZYCA 1J42A 4CCSA 4WASA 3SKVA 5B1YA 5CX1A 3DDZX 3GZ4A 3MCWA 8LDHA 4F93B 4QFMA 2IE8A 4FJ2A 4CDNA 2RK4A 1X7WA 2MHCA 2QN3A 1P81A 2XNDA 5LP6C 4H1HA 1U0HC 1LPAB 4A4DA 4HADA 1GPH1 2V0CA 3L0OA 2PUFA 5JRZA 5BWLA 3MG9A 3K1YA 1W1UA 5JS6A 2ZE5A 5CTAA 4E4RA 2EERA 1F0PA 2HBQA 3TEFA 4AYWA 4X6UA 3OZGA 5IM4F 2AFHA 1DCMA 4G8CA 4FNMA 3QUTA 1W4AA 4FS3A 4U2DA 1ES9A 1N2IA 4UD6A 2VYCA 5FHQA 2P2LA 5EP2A 3NALA 3W8RA 1E63A 1H6BA 2AFIE 3SX4A 3AL3A 3IXLA 4L51A 1JJ7A 2VLIA 4N6GA 4EYOA 4EJSB 4FKBA 1B8VA 1PZXA 4U4AA 5F12A 4QREA 2IXDA 1RRGA 4M8KA 2VPXA 4PPYA 2F3UA 2XVMA 4A2CA 4ND7A 1HQDA 1QYRA 1Z2OX 4PQEA 1TMKA 3TRDA 1P73A 2NO1A 5ARCA 3D81A 1N5KA 3DMGA 4J2HA 1T1JA 3DB1A 3HB1A 1R00A 1Z47A 5FWXB 1GQRA 2Q29A 3I52A 4PRKA 1X0VA 2TMKA 2XHEA 4J90A 4TL8A 4YBZA 5EUMA 3QNWA 3ZGYA 2GCNA 1ZN9A 3HN2A 2XAUA 3PVSA 2WV9A 4V0NA 4A6XA 1NXTA 2ESRA 1J0XO 1G5FA 1U2QA 2FGJA 3EVEA 3BBPA 2X5NA 4HG2A 1N9ZA 4JQYA 4IPTA 2GK7A 5SZKB 2JGJA 2I2CA 4KE6A 4D42A 2ZR8A 1J2UA 5EQJB 4EVIA 2HEIA 3A0UA 3QE2A 1O58A 2ZJAA 4MUJA 3QJ5A 4R40A 1ZR2A 2X1MA 2BMAA 2YV5A 5H83A 3IA2A 3OPXA 3ZQKA 3SSAA 4QDKA 4ZYZA 3BCRA 2JRLA 4X5OA 2CLMB 5AI9A 5U4QA 1H6CA 4IG9A 1E64A 2FX2A 1ZY2A 4UVEA 4LNHA 3IXQA 5HCUA 1CY4A 2FSFA 2EJTA 2PUBA 4WKPA 4CMCA 1UDXA 5AKLA 1P74A 2A88A 2QTWB 3LUBA 3T9CA 4RLSA 1ZCAA 3I8SA 5IH3A 1AV7A 1U9CA 2XOEA 2AMVA 1Q0TA 2CYBA 2OD2A 4UCQA 3T9DA 3K72B 4B3IA 2AQHA 2ZI6A 5HKBA 2ZYRA 1GN9A 1U2RA 2HO5A 2PZLA 3I8XA 2R5WA 4BNTA 1QFZA 2AMFA 5FL7D 5B3LA 4L75A 3CO0S 1Y3IA 3H2ZA 3ZHBA 4RY0A 5T57A 1J56A 3IE0A 4CETA 5KOJB 4YJ2B 1JHAA 5FPSA 1VMDA 4WAUA 1B8UA 3CKLA 4HN9A 4OB6A 3IIKA 3J80A 1ZVMA 3G2MA 1YR9A 2WG2A 7ADHA 3AV0B 3FHLA 4HLUA 2VRNA 5BV2P 3BWEA 4HVTA 4OMCA 3UK2A 4EUFA 5I5EA 4N0MA 4WN9B 3PEFA 4PZCA 4YWHA 3VZBA 3EEBA 1UFVA 3TW4A 4WH0A 2AZMA 1FFXA 4IV5A 1WOMA 1NURA 2RG7A 5FJJA 3ZDYB 1HV8A 5G4KA 3HXOA 3U4QA 1G5RA 2W6ZA 1TF5A 2HPHA 1I8TA 2HNKA 1RSZA 4V39A 5G40A 5IUJC 4ZYVA 3E3NA 3EBOA 3CPJB 4NS1A 2PIAA 3HV0A 3U3JA 4EW6A 2H51A 3JASA 1EVIA 3X1KA 3ESCA 1LNSA 3ZWYA 1II8A 4OHKA 5FFFA 3UGJA 2GAFA 4Z9FA 1SU6A 2CHQA 4PC6A 1Z36A 1NUAA 3FUUA 3ZV3A 4LGVA 3KTDA 4U2FA 3QMWA 1ODKA 5EJGA 2QN6A 1FTGA 2O1WA 4WLOA 2QZJA 5EWMB 5LQSA 4DV5B 5I3ZA 1J2JA 1KSFX 2JIMA 1GSHA 5A9SA 3U3DA 5ICGA 4FI3C 4MGYR 2IZ6A 1WMSA 4M37A 4HV4A 1T6ZA 1O87A 4EF6A 2RBGA 3DAYA 3BAFA 1UBEA 3HB4X 3UKOA 4JR2A 3H1GA 1EXDA 2D7CA 2WMYA 1P0CA 5D6NA 1Y7TA 4W9MC 4BBAA 1GRNA 3QG1A 5M34A 1ZD1A 5C46F 5MFZA 1W581 4ZOAA 4XYEA 2APJA 1WSWA 1Z17A 2O0HA 5B55A 4D79A 2I4LA 3AI2A 1QAMA 3GC6A 1FP4B 4S1NA 3X1XA 3OIFA 2XA9A 2OQVA 3U1VA 4LF9B 5ALPA 1BMFA 1AM4D 1NX6A 1G2QA 3TQFA 3OA0A 1KWKA 1RMTA 2CJXA 1DQSA 3GUHA 2DHCA 2X76A 5EXTA 5K3SA 1WP4A 2C07A 2GYVA 2GJ4A 2W2LA 4MULA 4QHSA 3RS7A 4BEVA 3RQIA 1GARA 4LSMA 2IHUA 5LA6F 2XUQA 5BW8A