3ZEAA

3d structure of the nifese hydrogenase from d. vulgaris hildenborough in the reduced state at 1.82 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
279
Chain Sequence
GERPPVFWLQGQGCTGCSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEGEHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDALKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVVNIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFGRNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNGGVNWCVQNAVCIGCVEPDFPDGKSPFYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMIC [NIFESE] HYDROGENASE, SMALL SUBUNIT
publication title Redox State-Dependent Changes in the Crystal Structure of [Nifese] Hydrogenase from Desulfovibrio Vulgaris Hildenborough
doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 279
sequence length 279
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3zeaA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3zeaA02
5JT1A 4UCWA 1YQ9A 3MYRA 4TTTS 2WPNA 1WUKS 1FRVA 1WUJS 1FRFS 1UBHS 5JSKA 2FRVA 1CC1S 3AYXB 1H2AS 1UBRS 3H3XA 1E3DA 3UQYS 3ZEAA 4KN9S 3ZE7A 1WULS 4URHA 5ADUS 1UBUS 4KO4S 3CURA 1YRQA 5JRDS 4UQLA 4UPVA 5JSYA 1UBKS 4UE3S 4IUDS 4UE6A 1UBLS 3ZE8A 3AYZB 4UD2A 4IUCS 4CI0B 4KL8S 4KO2S 4UEWA 4GD3Q 5D51S 4OMFG 1UBMS 1UBTS 3RGWS 4IUBS 1UBOS 1UBJS 4UQPA 4KO1S 3CUSA 1WUHS 1WUIS 3USES 4UCQA 3ZE6A 4UEQA 5JSUA 4UE2A 4C3OB 5A4IS 5A4MS 1H2RS 3USCS 5JSHA 4U9HS 4KO3S 3ZE9A 1YQWA 4UD6A 5A4FS 4UPEA 4UCXA 4U9IS
chains in the Genus database with same CATH superfamily
5TF4A 1GTZA 4N65A 2I1WA 3S70A 3R9XB 1DG1G 3BB3A 3PGKA 1RDFA 3A04A 3JQGB 1GAEO 4NBWA 4OMDA 2BYTA 3PITA 4AWXA 2G9RA 4FBMA 1KQGA 1PK8A 3WDMA 1QRDA 1T24A 1Z08A 2AHRA 4QUBA 3GX1A 4L85A 1EB9A 5JZBA 2IV3A 4HYEA 1E59A 3E3LA 4PZUA 4F1WA 3FVTA 1A9YA 1ADBA 4RNCA 4LRYA 4DSOA 1DU4A 3BHJA 3L18A 1IBSA 3NJ4A 4OREX 4XQCA 2VWHA 3TSAA 5KNLA 3CEMA 1OAKA 2VUIB 5MN5A 1XTBA 1TIPA 1ZN9A 2M2IA 2O0MA 3ABSB 3UJAA 5E6SB 3CVYA 1HDEA 2XMQA 1SXIA 3PFKA 2AOUA 3I5UA 4XA8A 5I4KA 5K0JA 1H2ZA 4IZOA 2F3TA 1P0QA 1VMEA 2JDIA 3DBIA 3LYLA 4H15A 4P5DA 5YASA 3IODA 4G4JA 4KYIB 2IS6A 4EG8A 1OAOC 2ZREA 1COWA 2OXFA 4FOOA 1FTSA 2FK7A 3R20A 3UUGA 3SNKA 2ZBVA 3ROMA 2ZROA 2C5AA 2JAWA 3KYIB 4FYXA 4RTLA 1Y6QA 1J7KA 4QNNA 3TSZA 4L74A 4DF3A 1IM5A 1E2FA 2CKDA 3IX7A 4MW6A 2FWIA 2Z8YM 3QV1A 2VP5A 1TMYA 2YVQA 2PCLA 1E8DA 2H11A 3BICA 1YRHA 2GPWA 4HP8A 4NK5A 1JR3D 4RD4A 4RLFA 4UNSA 2FZ4A 1SUEA 3DOIA 5E7JA 4ER6A 1RXWA 1NN0A 4Y0AA 4LX0A 5IBPA 3L0OA 3ZN2A 5KOHA 1XR3A 3ZBPA 2PJDA 3EVGA 1O4VA 3O4JA 3I1YA 2OV8A 2XA9A 4RM3A 1L6RA 4FLMA 3NYQA 3V34A 1INLA 4RIFA 4X1YA 4CQMB 2BKVA 5JXJA 2H9IA 2NW6A 3ZI7A 2J67A 3EODA 5JD6A 4L08A 1EM8A 4WN3A 4WCFC 4D02A 2F1IA 3IP1A 1RRVA 4IIFA 1L7BA 5HE9A 3WGVA 1MGOA 1E9FA 4BQQA 3QKIA 1HTTA 3G2IA 2EC5A 1BGXT 1N5LA 2QTVB 2WDZA 1ZD9A 4HNGA 4MJXA 1J24A 4UVDA 5HQ3B 2OORA 1MJ5A 2EVWX 4LX8A 3OA0A 4TSKA 4C08A 4F21A 4YUAA 5HPYB 1Z5VA 4G1EB 4MW7A 2WF5A 3FPGA 2BE7A 1JTEA 3BAZA 5L4LA 3TLEA 2H7CA 3M2PA 4Z9YA 3N6XA 4RENA 3X2EA 2DP4E 2LUOA 4HDRA 1RYMA 4GKVA 3PQFA 2OAGA 3WA6A 4EHFA 4P32A 4BIIA 3CLSC 5F2KA 5K4AA 2WWHA 3UKJA 2W2LA 2I9PA 2P75A 5J4VA 1X8KA 5ELLA 1RFLA 4ZOCA 4ETIA 4Q1BA 5H70A 3BH6A 4MIYA 4EG3A 4N0EA 4RQUA 2JJYA 3GZ4A 1F12A 3T7CA 1V41E 4E4YA 1VCMA 1DV1A 1PJRA 3C3WA 2WTUA 1ECCA 1LDEA 1SIBE 2GXUA 3OHPA 3ZQ6A 5J1SB 3L7JA 3WOVA 5TX7A 4ND6A 1CEXA 5JSQA 3ADDA 1GZ6A 1U1FA 2JK0A 3DPIA 2YNMC 4ZCIA 3SX2A 5C7YA 3E82A 5E0OA 1KR2A 2I7CA 4M1ZA 3BS4A 3V2HA 3HWRA 1PL7A 2OBXA 3KE8A 3HADA 2NXWA 4Y6PA 3A4MA 5IABA 5E1MA 1N92A 3V33A 3TR6A 4I4TF 5CA0B 5K6AA 1CT9A 3IMFA 5LXTF 3ROKA 4BEVA 3EGXA 4EX6A 3KQWA 1ZHOA 1M2WA 2B3DA 4WK4B 2DX7A 3G9XA 5A9SA 3ST7A 5FOXA 1LA2A 2ZWIA 4OH1A 4PO9A 3H2YA 4IDPA 5DULA 1SCIA 1FW8A 4INJA 1E7QA 4GX2A 5JTTA 1WHSA 5HS4A 4AT1A 1BGWA 2LD4A 4PY2A 5JLJA 3MXOA 4CNBA 4P4LA 1UZAA 4LZOA 4MI3A 4GX0A 4Z53A 4BNVA 1E1RA 1YA4A 2WIJA 3DEZA 4RJ2A 2EG9A 2IUTA 3ASVA 3N7TA 4ND3A 3PGXA 4CMGA 1YB6A 1A5TA 5K8CA 5KQGA 3GRYA 4GF5A 2RHGB 2PZLA 4D26A 1DE0A 5CW1A 3GLRA 4P3KA 2I6GA 1PJAA 4WDQA 4A82A 2ZUVA 1VGVA 2C4VA 2O2JA 2X5KO 4LK2A 4RPIA 2PMDA 1IMJA 3JPWA 4JI8B 3PI7A 5E3IA 3NNDA 3QNMA 1YAHA 2H2DA 2OK7A 5D51S 3T3HA 1JAIA 1TO1E 4ZQGA 4RTKA 3ZVMA 4LRUA 1QXSA 3CLUD 4PANA 5DDIP 3R3WA 1E9AA 3AR2A 4Q37A 4YYZA 5JASA 2ZYGA 1GL7A 1MO2A 3RFTA 3QBJA 4EJMA 1I8TA 2XNHA 3H84A 3S44A 2JJMA 3IYLW 4GR4A 5AW1A 2NO9A 2FFJA 2HIMA 4MUBA 2X0FA 2N1MA 2VDWB 2WEKA 1P18A 1S0UA 2RBEA 5K8UA 1CQXA 1S2IA 3TSOA 5LQDA 1GARA 3O8BA 2FPGB 2ZEJA 4MVJM 4TLAA 4AXBA 2DPXA 1RWVA 1TCVA 3D02A 2JA1A 2GJ8A 2ZR8A 3ABRB 1U8UA 2H00A 4IDFA 4J94A 4C7VA 1AM4D 2GWHA 4D81A 2V0GA 3GDHA 1Y9AA 2F17A 3NNNA 3AERA 2YY6A 3R24A 4QD3A 4IMIB 3SKVA 3SKXA 4KR7A 4C6TB 1DFIA 1ZGBA 2DFPA 1L7DA 1XA3A 2IY8A 2ZIFA 2Z8XA 2VNJA 2FMTA 2NSYA 4JT9A 3PEVA 3HS3A 1UC9A 4KI0A 2ORED 1VSTA 4UATA 3RF6A 4NKRA 5F12A 1GNPA 4TPKA 3JU3A 2JIZA 4WCFB 5E2IA 4P7FA 2IHUA 2POCA 3NT4A 4JB2A 2CZCA 3FBWA 5ECWA 4CIBA 2OLJA 2J9YB 3BWVA 1FNNA 3FD8A 5DSZA 4ER5A 3KQSA 1SD2A 2I7TA 3K92A 3OWOA 1MXFA 1V8BA 2AOTB 2NU9B 1AHPA 4ZU3A 4B81A 4DR7B 3Q7TA 3U26A 5SV2A 3G2PA 4TUYA 1CUFA 1P62B 3D6FA 1S6YA 3EZXA 2G1KA 4RVFA 1OX5A 2AWOA 3RADC 4I1YA 1KJIA 3DE0X 4ROSA 3RE1A 4QUJA 4Z3DA 4M53A 2WSSD 2DJIA 3DV2A 1Z18A 3VU0A 1E18A 1FU8A 3OTWA 5AICA 5E7IA 1OGIA 1HUQA 2BD0A 1SVOA 3AYXB 4OUKX 2X0IA 4HNQA 1O6BA 3RAGA 4HVAA 4CFYA 4EW2A 3LPDA 3FHCB 2FQWA 5A03A 3RR2A 3M49A 3PFBA 4KC0A 3KD2A 2Z57A 3ZDZB 5LSAA 3SDZA 1ENYA 3EGIA 4JBWA 4M0UA 3WWZA 2C8LA 2MT9A 1QLJA 2GHQA 2W8BB 2RHMA 3TBFA 5BQOA 2UUPA 3NPMA 5EWMA 2W6IA 3S1AA 5HUHA 1OPXA 3IO5A 3QLTA 1G16A 2A84A 5EHGA 2O1EA 2BLNA 2ZK7A 2C5BA 4Q4AA 5T57A 3U39A 4P3OA 3OQMA 3UPUA 2BUBA 1VIDA 5CVVA 3TDNA 1MV5A 2CY0A 4HRYA 3UPDA 4DIBA 5L7TA 1XV5A 3NB0A 3PDHA 4EUEA 1KDOA 4FFSA 4OB6A 2VATA 2VEDA 4WNAB 4W5QA 1X86B 2VPYA 1DXYA 4BMDA 3K3PA 4KE8A 3UUFA 1Q2XA 2VYVA 3B60A 5ENVA 1I4LD 3NTOA 2JCXA 5ENZA 4YRKA 4LWQA 4RANA 4HQLA 5JCOA 3GP5A 3IQXA 4CMCA 2WJPA 1DC6A 4DMGA 4BIMA 3K9FC 3RIXA 3TW0A 2ID4A 3K5WA 2V97A 3GIWA 5DHQA 1KDZA 4ETNA 4EL5A 1QKKA 3UT6A 4EGFA 1EWYA 4RTQA 4YN3A 2DMRA 2QZPA 3IMGA 4CQNA 3F6CA 2HDNB 4KIJA 5C52B 1VSQA 4V0LA 3F49S 2Q7XA 2JD2A 2VDMB 1W4BA 2CJWB 1NN5A 1GGEA 1UBFA 2CN1A 2WTAA 3CNHA 4XZ3A 1CB7A 1QB8A 1JX6A 2I4LA 4RO0A 2HDOA 2JAUA 1NW3A 2F62A 4INPA 2ZRCA 4MICA 3IP6A 3W1EA 1XRNA 2AYZA 4I50A 1O6CA 3GJ8A 5A9TA 3QU9A 1KGDA 7REQB 2IXAA 5KYWA 1A5ZA 2HA5A 5B30A 2IEIA 1R4MB 2CLSA 1NBMA 2RGYA 1EXWA 3HL0A 4K8OA 2GTIA 3G82C 1YBAA 3BJMA 1N5RA 5JNVA 2QPTA 3QFFA 1N77A 2GK7A 4DCGA 1XDUA 1ZS9A 3C3YA 3DVLA 4Q5IA 3VZCA 3RRMA 3F8WA 2IYWA 1NX6A 3EGCA 3KL2A 1R1DA 1K08A 1LTHR 3SSNA 1R88A 3K0AB 5JYDA 4QHSA 3ON5A 1Y4ZA 1NYLA 3RVSA 4KXNA 4II7A 3DMDA 5J2UB 1CULC 1ETUA 3GLGE 1UOQA 3AEKB 3BEOA 3PUKA 2I0FA 3KQQA 1OTHA 3PG5A 1UOEA 4E2XA 1G20E 4J75A 4IJKA 4TM7A 5K01A 2JIBA 2R6JA 4NICA 3HMQA 1ZR4A 4OCZA 1ZR2A 3I9LA 5D8DA 3ISVA 1DUIA 1XHFA 4IIJB 2ZYDA 4E22A 1KDPA 3GPDG 4X0EA 2BM9A 3JY6A 1P60A 4PYIA 1XALA 5JAUA 3CR3C 5DWVA 4D4KA 3AU8A 1K27A 3E8XA 3D6TB 1YCFA 2F3PA 4IZIA 5AMXA 1AUXA 1DKLA 1FRVA 1VLVA 1RBYA 4QBTA 4RMGA 3IHLA 5LP6A 1WF6A 1P0PA 5B12A 1VIMA 1Z2PX 2BAGA 4JBLA 4PTYA 2P3QA 3DDHA 4QATA 4UCFA 3T0IA 3VZSA 2BI7A 3P45A 3WMGA 2JLYA 4UAUA 1GGMA 4KVAA 5CB4F 2DY1A 2G9UA 3HA2A 1GKUB 1FTQA 1JHZA 3BFJA 3LOQA 1DO0A 1N2CE 4KAXA 5C8VA 4O4HA 1DAIA 1KJZA 3HGQA 3KVRA 1XQ6A 2R7NA 5DOZA 4CV1A 3EQZA 5CDHA 1QE3A 1AS3A 5JDIA 1O96A 1TQHA 3L79A 4DQXA 2AR0A 3TD6A 4K26A 1T4CB 1L4YA 2CNWD 2WFLA 1PNOA 1CLEA 1TMKA 2O0JA 1ORWA 1OLOA 4DM7A 5I7EA 4MDFA 3LZ6A 2HA7A 4AFNA 3DOHA 4E12A 3FDJA 1D0SA 3AEYA 3FWZA 3GUVA 4N3GA 4AUMA 2HQOA 5F3WB 2UXDB 1IN5A 5KU7A 2FHSA 1GNRA 5HRCA 1ZBQA 4H4CA 2E4UA 4OJNA 2LCFA 4U5XA 1UBLS 5F1PA 2RHJA 1PQWA 1MRZA 3EZNA 1LPAB 3HVJA 4C1NA 2VVTA 4RGVA 1ZGAA 2FFHA 1QG2A 2Q29A 4EQZA 4UNIA 2H1RA 2Q4DA 1YRAA 1GXSA 2ENUA 3CB2A 3HBMA 4D80A 3U19A 2ISSD 4GKKB 2BGKA 1IONA 1NC3A 1OZHA 4J03A 3QJ5A 4G5GA 1EYZA 2P4EA 5G0UA 3T1VA 2HU7A 5FUXA 2Q2WA 4GC5A 5B4TA 4Z4QA 1L4FA 1ECGA 2H4JA 3LLVA 5DI3A 4Z7OB 2OTCA 2HMVA 1V5EA 1OILA 3PZRA 4LF5B 1XVAA 1GPNA 2I2FA 5I48A 1FQOA 1WG8A 4Q7LA 1TMGE 4K9QA 3EOAI 3GJSA 1UZNA 2J3JA 3DBHB 4I9GA 3FRIA 5K3FA 1PFVA 3CTPA 4JJGA 5EMLA 2ZBEA 3U49A 2BMAA 5KVVA 4DG5A 4MVJP 1X7XA 1NVVQ 1OWNA 4YNBA 1PT8A 1SOVA 5CNJA 4QXMA 2IOQA 2OBBA 3KHTA 1EDZA 1NHGA 3E9ZA 1CZOA 1UM9A 1GPH1 2IYUA 3GRRA 4KMOA 4O02B 4QASA 4ZZIA 4ALJA 3MW8A 5IT5A 1P7WA 2B82A 3SJ7A 1C41A 3MRXA 3G1UA 4AS2A 2YL2A 2Q07A 2EQAA 2J3HA 4QLAA 2YRXA 2YXDA 2YZKA 2ZR9A 3ENNA 1OZGA 3GMIA 4ND8A 4N3BA 4OO3A 3V4VB 2ZIEA 1A2KC 2CL5A 4P6VF 2A86A 2PH5A 3QSYA 3KZVA 2NZUG 3TIGA 4G25A 4I4LA 2IY9A 1KERA 4BP9A 2CF6A 1XZBA 3IS3A 4OHZA 5J59A 5CB0A 5CX4A 3KLBA 2YS6A 4P5EA 2O3RA 3VR6H 4JI2B 4J1NA 4MLCA 2ZIXB 3NO4A 4RFLA 3W05A 4GL4A 5BSHA 2O8DB 1U28A 2WWXA 3TXYA 5EE1A 1MC4A 1OKKA 2O57A 4Q18A 4QSHA 1K7SN 2Q0QA 2Q1XA 5TMDA 4ML3A 1D2HA 1E5XA 4NBUA 2NP6A 2EP7A 2GA9A 2I80A 2P2CA 4FFVA 1V47A 1L7VC 2RBGA 2HJHA 3RSFA 3S2GA 4NYJR 3NAQA 2HDHA 3R0XA 4YIKA 2AN1A 3I76A 3HDQA 3AOGA 5JIBA 2CLMB 2HJRA 2GR9A 3FOAA 1EGMB 1JFFB 5JRJA 4GLLA 2P41A 1I2CA 3RU2A 3V7FA 3KXKA 1TTHA 2WG1A 4PR0A 1V4VA 2HCBA 5CT6A 3T3IA 1SXJD 3T3NA 2XCQA 5C7LO 5JH7F 1C3XA 3ANLA 2H1SA 4MVJH 1ML3A 2R1VB 4KNVA 5EUCA 1ORTA 3OZWA 3Q7QA 3ECAA 1ZSVA 4HEA1 3BGWA 3PDIA 2BHRA 3ID6C 3OLXA 3T7JA 3B6ZA 2AFHB 1EHIA 3GMTA 1R4NB 3B1JA 4JDPA 5EZQA 2OBLA 2QX9A 3FNIA 4FXPA 3TXAA 2NYRA 1UDRA 1K63A 2ZR0A 4ZYTA 1NR7A 3B1XA 4G1VA 2ZAGA 1X8LA 2QRZA 1EX7A 5A7HA 5JWRA 4L07A 1BH2A 4CN9A 3TLGB 1PS9A 4BZXA 4LFAB 1JSRA 3DZGA 2I78A 1ML4A 2FEAA 5EJAA 3H5TA 1TAHA 1TCCA 1U2DC 1FP4B 4Q9IA 2O0HA 4DBLE 4EB0A 5K8IA 5KTPA 2C88A 4L4XA 3O82A 2ZVJA 2ON6A 2FH5B 3TUJC 1I80A 3R5FA 4FP9A 1ADJA 1XCPA 3IVGA 4D92A 4KXLA 2AG8A 3CZCA 4L73A 1DRJA 3KUDA 4XGNA 4IIVA 4F85A 3SSOA 1UT6A 1SBHA 4H7IA 5LP1A 3ODPA 1AD2A 1TECE 5EKUA 2OSVA 5PNTA 1DELA 3HB5X 3SF8A 4BNKA 3BD9A 1R6DA 3FHJA 4PCUA 1NF9A 2TYSB 3O0DA 1E4EB 1NM5C 5A4IS 5HKBA 3RIYA 4TVSA 4EBBA 2Q7OE 1XVTA 4V0MA 5GZ1A 1BHQ1 1ZL2A 1MW8X 1XRSB 1VE3A 3CLSD 3GPIA 1LH0A 1SBZA 4RA9B 1IULA 3PNOA 1LNQA 1L1EA 2HJ9A 3WDLA 2Y3IA 4I81A 5CPFA 5HGJA 3ONNA 4FX5A 4G86A 121PA 3NNSA 4YDQA 2WWYA 4WZAE 2JLWA 1U0OC 4IDGA 2C9ZA 1PJQA 1TC2A 2PNFA 3A1SA 4QWWA 3QH4A 3V6MA 4C1BA 1FBTA 4DKXA 2PZFA 3F1KA 3UKOA 2HSGA 2YDYA 1RZRD 2QI9C 4BKOA 5DNWA 3OX2A 4QGSA 5HQJA 1B6RA 3IA7A 5IDVA 3Q98A 1TW2A 1ZUWA 1A9PA 2R8OA 4UBJA 4H17A 4ZV9A 1XL0A 2FUNB 1XIVA 3K4PA 1OXMA 1LQTA 4GKAA 4ZWNA 3F6PA 3NCHA 4W9NA 3LA8A 4PSVA 4WESB 4BB5A 3PPVA 4QU9A 3WHKA 1W29A 1IBKB 2QTRA 4US0R 1Y6ZA 4IS2A 1KZ7B 4MPJA 4MIEA 5FNVA 2J5BA 4NJMA 3HEAA 1N4AA 5C37A 5DN6D 4FMPA 1E2EA 1YJ5A 4JLOA 2J87A 3KTAA 4QQRA 3WIBA 3OPQA 1Y5IA 4L3OA 4HAXA 4LGCA 4U6QA 3VKFA 1WP4A 1NXPA 2FQXA 2CHUA 3PEFA 2AT1A 5JS2A 2CEAA 5COBA 3UQYS 1LEHA 3AJAA 4YLGA 4WX2B 1DP4A 3L6RA 2YCBA 3V2IA 5FBHA 1EUYA 4U4AA 3UUEA 5B4UA 4KR3A 3GFBA 2WAMA 1NRJB 3EDCA 2PA3A 1GTSA 1M6WA 2OILA 3NAGA 2JIRA 4MQ5A 3TO5A 3ITNA 4DV5B 1J4AA 4EY7A 4B2PA 2CHEA 4NS1A 3LFHA 1FLDA 3EPPA 4Y6GB 3BBPA 3CRQA 5FNZA 4DLPA 4G5XA 4ALLA 1J5EB 3SX0A 4YRRA 1JFSA 4EF5A 4Q9JA 1TB4A 3MMNA 4FCTA 4TYYA 3AB3A 3K53A 1J1UA 3C98A 1MENA 5COAA 4C4OA 1UEXC 1MEJA 2R68A 2Y92A 4HGPA 2QD1A 2FPIB 4MWOA 4MK4A 5B2EA 5KOYA 1MH1A 2N42A 5E2BA 2ATIA 2ODTX 3QU5A 2G08A 1H3NA 2G17A 2I67A 2XT6A 1PWXA 4LZAA 4R6XA 5T67A 1IVSA 3WB9A 5TARA 1XEWY 1CZRA 1P5RA 2QTMA 3AESB 4F4CA 1SKYE 1RZUA 3IBFA 4OJQA 4HQNA 5L8VA 5BQ5A 1IK4A 5E1OA 1UC8A 5AI9A 1Z62A 3MPUA 2ZATA 1XJWA 3NWBA 4TV9F 3SC4A 4GDFA 5D3ZA 5JFTA 5AKZA 2H4WA 5LUAA 1PWHA 1P1HA 4X7MA 3ZBUA 3NHZA 1URPA 4B7XA 4YJ2B 2W11A 5K0BA 1I1QB 2REBA 3FBTA 4GI7A 1SIWA 3EMKA 1HLFA 3IEIA 3S2YA 2NLOA 5BO5A 1RI1A 4YP1A 3WKCA 1MKYA 4B0PA 4OF4A 1CQIB 1PLJA 3SY8A 5IH7A 3SPXA 1O94A 4I4NA 4AJLA 4ASUD 3QUAA 1X9IA 1JHPA 3FTPA 2VXOA 3EIWA 4FFBA 3FSGA 1U1EA 1N9KA 4OXRA 1RACA 2P9QA 2GA8A 2ZJFA 4L4UA 4PTZA 4YO7A 4BRUA 2Q8NA 3VR4A 1OH7A 1ORVA 2DUJA 1EE1A 1VBFA 3IQWA 3C74A 4QNMA 4XB1A 3TZBA 1JHOA 2O7RA 3K9NA 3EZLA 1X7HA 3U7QB 1EDOA 2FQ1A 1KI3A 3BPSA 4JBGA 5E8RA 1JT9A 1PW5A 1RQ7A 2D2IA 3CM0A 3HM2A 3NIWA 4OLFA 5AM3A 1GM5A 1NJ5A 3M4NA 2EZ8A 2WU0A 2WUFA 2BMWA 4TV8A 3RVMA 1ESMA 3LDFA 4ESHA 4UEJA 4Y9SA 2DXIA 3WR5A 3ISJA 1C7IA 3DQQA 3CLKA 4FTWA 1QRAA 4OJTA 3GFVA 4U63A 3WAGA 1U5CA 5IJ0B 3I2IA 4IRUB 3P9RA 4ZDKA 4JLUA 4AO7A 4OQ4A 1IJFA 2WWWA 3MIIA 3UH1A 5BQ3A 4KNWA 5IWAB 3WV5A 3QNWA 3IDQA 3K30A 1TUGA 3B3GA 3ESRA 4M9UA 4K6HA 4S1PA 1TM4E 2WWGA 3HB7A 2FK8A 2VKQA 1IY1A 5G0WA 3I4FA 1I51A 2GO1A 4E07A 1R4ZA 4G07A 1JB9A 4YAEA 5U4XA 1FTNA 1XF9A 2EJBA 2ROQA 1F0KA 3CKKA 4QDOA 3ZXSA 5INTA 2XWSA 4HTAA 3UAVA 3EFBA 4JIGA 1DOAA 1TQDA 2OXTA 3EZGA 4ZQBA 3Q1LA 1J70A 3SSAA 4D0RA 1NRXA 2FU5C 1QAOA 4OYRA 3AW9A 1FPMA 1MJGA 2IZ1A 4MUNA 5EFZA 2C7GA 2WF6A 4MSUA 2VSFA 2IH4A 3RT9A 1AY0A 1KI7A 1N8NA 4I4TB 1E2NA 7REQA 2ACKA 2HOQA 3RAPR 1N7GA 2ES4A 3L8HA 5I7SA 3MG9A 3MLEA 5MGNA 2O3SA 2WTXA 3A6ZA 3NVDA 3RUDA 2RG7A 4TYPA 3U62A 1C8LA 4A8TA 3LY5A 5MN4A 2PLNA 1JHMA 1BEZA 1JZQA 1FJGB 2BEWA 1AK2A 4ZAWA 5LZ7A 2O2SA 1GPMA 1KAHA 1OLXB 3DHWC 4JKOA 1BMDA 3V32A 1QGYA 4I5EA 2JVKA 1XUOA 2WZQA 1WCXA 3Q11A 3ZCQA 1VBMA 4HZIA 1F38A 1YZ3A 3MVEA 2O59A 2ZITA 4CLHA 4HNRA 1XK6A 1RVDA 2BGJA 2WMYA 2X1LA 2IPLA 4GBED 1I10A 4DDTA 1YQEA 1FFWA 2BF7A 4H08A 4O2LA 4EJFA 5P8WA 4BFXA 3RGWS 4EYEA 5CCBA 3I23A 3O47A 1NWHA 4XPZA 1W96A 2CV2A 2WKRA 3RTBA 4DA0A 1V1RB 4G5YA 4BC0A 4DRYA 2NTNA 4GI1A 1JDBB 4DLXA 1QPGA 1ZD2P 3A3OA 2WPDA 4KO1S 1ICIA 1N6RA 1XNGA 2HHLA 2JD1A 4DCNA 1YB7A 3GMDA 3FTEA 3QMVA 4QFBA 4TN1A 1JR2A 2QPOA 3ZK9A 5DP1A 3HA3A 2GAFA 2ZG6A 4INZA 4DC9A 1V3TA 4GSLA 3VR5H 1M6HA 3EDRA 3TIFA 4DLTA 4X45A 4ABYA 1DINA 1Y89A 4KV7A 1PFYA 1JI3A 2GN0A 2GX6A 1MJHA 1W4LA 2WIBA 3H0KA 1TKCA 4JKIA 3KQKA 2HCFA 3FMGA 4KGZA 1XEFA 3X0DA 4UTVA 1B4DA 4BKPA 3IIJA 3R5TA 1BE0A 1Q84A 1VPLA 2GLTA 4K88A 4URYR 4C0JA 2OYRA 2ZGVA 3KWMA 1IWPB 4MW0A 1GL6A 1OJ7A 3UHOA 1FFAA 1OX4B 3PIRA 4BRSA 3WO0A 1SPXA 1T2UA 1Q3KA 4GVLA 3A7DA 2NT3A 4JYMA 1XA0A 3BXPA 4WV3A 5HK8A 5C8DA 3K6SA 2ESRA 4HAWA 2X1MA 1L5QA 5CJPA 1C80A 2IXGA 2VRNA 1E3IA 3UXMA 5JJCA 4DA4A 2H4FA 4OVKA 1P3Y1 2PLAA 1ODIA 5KBYA 3PUIA 3CEJA 3P96A 4A2CA 2PMKA 4U6SA 4W63A 1JLLA 3LKBA 2CLKB 4RXMA 1AZTA 1DJOA 3ELBA 4LE2A 4L22A 3ROGA 4A0QA 1TI7A 5DEIA 3UVEA 1CR0A 1U5AA 1F6WA 2L17A 1DWUA 1D04A 1SCBA 3H11A 3N74A 4LYGA 2Z56A 2X9GA 3B82A 2XCOA 1TJ3A 2ZJYA 3V8QA 5DNVA 5AUPB 1Q7RA 2DSNA 2IUYA 4WVFA 2HM7A 4DXDA 3U9TA 2VZEA 5A5VA 5IF9A 4A0FA 1Z35A 3DNFA 2ZS8A 3IXQA 4HBZA 3JVVA 3PYXA 3BORA 5KX5F 4NEGA 1B15A 1DHRA 1U4OA 3MCWA 3U1TA 3U37A 1C1XB 1RMYA 1SAYA 3EVZA 3SKYA 1YA8A 1EESA 2VN8A 1JYSA 2J09A 3M6MD 1F5SA 1KVRA 4FWIB 4H59A 5T6MA 1YVDA 2FDXA 3QYAA 4D8XA 3QEMA 2GCOA 5HMLA 4YGXB 1SVSA 1O2DA 3G6KA 3VNSA 3FPCA 2IDZA 3U3JA 1ONOA 3FWYA 3OFND 4B3DA 1TT5A 3EWNA 3PGJA 3R6GA 2FHPA 3UC9A 2JJQA 1VLZA 2GN4A 1SVLA 3PXAA 2XXAA 4K7JA 4KXWA 1I7DA 2NO4A 4BS9A 3ETDA 1XPUA 4HS9A 1I7LA 1DG9A 5D3MB 2V6IA 3ZG6A 5IUNC 1OGYA 5AWFC 1VKZA 1UJ4A 5DN9A 5JO0A 5AJUA 4D1YA 3A4IA 2VT6A 3AP2A 5ITVA 4JNCA 4YRNA 3Q8MA 2FPKA 4TLLB 2Q21A 3A1NA 4OATA 3SX4A 3DR3A 5L95A 2LKDA 3OQJA 5EOVA 5IT4A 3S81A 1ES9A 3KKMA 3MB8A 4JC0A 4UM8B 3TTSA 2I87A 3ZUPA 3LXRA 1W75A 3MSCA 5K2MA 1YF3A 2NSDA 1C3OB 4RDCA 1FFHA 2FZ5A 3JQCA 5F2NA 3N8IA 3HZHA 3S6JA 2B78A 2UZAA 4LOAA 3W6ZA 3BE4A 2Q8PA 1S2LA 4MUAA 4IEIA 4ZI5A 1NV9A 5TDHA 3F78A 5CNKA 3KZXA 5A4KA 3BD8A 4M7OA 1MQAA 2P5YA 2AUNA 4YJGA 2IY7A 3EIQA 3ICEA 4M87A 1BS2A 4W5TA 1YR1A 4HI0E 2QMZA 2EQBA 5DBEX 1IJEA 4CM4A 3R5SA 5ERGB 5FYDA 5GGXA 4BMSA 1TAGA 3HY3A 3OCUA 4KE7A 1LNZA 2E4VA 3EQ2A 2FMUA 3HKEB 2II6A 2P2SA 4GLJA 3RRYA 3CRMA 4X7BA 4B6FA 1ESEA 4I2VA 4I5DA 4PPQA 5DCYA 2BGRA 4UM9B 2RHCA 3SLKA 3WLTA 1P9OA 1EEXB 4G4SO 2XCUA 3QF4B 2NVBA 3C97A 1YOBA 1JSXA 1WXGA 2FPPB 2GZSA 3GWGA 1QF9A 1SR8A 3LCCA 4AYWA 3FFAA 3JQ9A 4RF4A 2DKNA 2EIXA 3PDJA 5CCXA 1L5HB 4MS1B 3N6RA 4LSWA 1YAJA 3OO0A 4I2NA 3NBKA 4CGZA 1KI6A 2DBYA 2VHEA 5LU9A 2EJTA 1YQTA 3CZ5A 1RLMA 5EE9A 4CYMA 3TQQA 2FWNA 1CK4A 3AFHA 1ZQ1A 1O97C 2DZDA 2H1WA 3GLQA 1XPOA 3W8FA 4K40A 3PC4A 4DY6A 4U2KA 2RGNA 821PA 2NOAA 1IEWA 1NLUA 2NGRA 4JLKA 4RGBA 4PLGA 4V1CA 5FTNA 3M2TA 1TEZA 4DN6A 2DTDA 4QHYA 5JXGA 1STOA 4LY6A 1MRSA 5E4YA 1HDZA 1MABB 1Y98A 2R6HA 2PAFA 1DS6A 2OMKA 3HE3A 3JX9A 5FDFA 5ILOA 2QRMA 2XYVA 2ZBRA 1KTIA 1RXCA 4PFKA 3TW8B 4DVGA 4P0QB 2JD0A 4WA8A 2CBGA 4FDLA 4U7WA 1NYRA 3RB8A 5JS7A 3K9GA 5TS3A 1FB5A 4QQ8A 4PYJA 5JSZB 4AJNA 1W48A 2JG3A 4M1WA 1X0VA 3UMJA 3ZPXA 8GPBA 1CV2A 2ZQZA 2E49A 1E0AA 2LIPA 2GJ4A 1WOYA 3QWFA 1VJRA 3I30X 4P53A 4LJYA 5JZOA 3NRJA 1E20A 3DBVO 3AC0A 3GVIA 4D98A 2YVKA 1E92A 3CO0S 2MYPA 3NM5A 3SXUA 1IY9A 1WF3A 3C8UA 5FL3A 3OEEA 1EUZA 1ZAKA 1QQ6A 3CPEA 1E7MA 1FFCA 1PKXA 4V0RA 5ALKA 1IBMB 4HSEA 1WUTA 8MHTA 5AM0A 1CETA 4HH4A 5CMLA 5CB4B 1WDWB 4RU1A 1ESDA 5F78A 1JEQB 4I8XA 2B2XA 2P79A 3KS9A 3N0VA 1FY2A 4AECA 5BSTA 3IHTA 4K6OA 2CK3D 4QPPA 2CJXA 4Y0VA 3VU9A 5C32A 4IJMA 4QEKA 3K6RA 4Z4CA 2DWCA 3OLCX 1L9XA 1TLLA 3C8HA 4IQGA 1ACLA 2GBIA 2H92A 3A1FA 2IXBA 3NT5A 4FN5A 3RBXA 3TLXA 2PVSA 4LSGA 4UE3S 5AK6A 5L3QA 4MR7B 1ZSNA 5FHQA 4HUQB 3ESBA 1M8JA 4UMVA 1KO7A 4TRJA 2PUDA 2QBYB 1OV4A 1Z4IA 4LMPA 4XAQA 2XGJA 4KQXA 1ZA1A 5ALDA 4MIKA 2WWTA 1OY1A 3THYB 3ZD7A 3SM9A 2ID9A 2HLNA 3L8EA 4H7HA 5EXSA 1LNSA 4E5VA 1DIOB 4NLLA 4RMIA 3TPCA 3IVRA 1UKCA 4J3JA 1ZUNB 2W2PA 2ZI7A 3DTTA 4POAA 1D4ZA 4YI5A 2RGRA 3D7KA 2HK6A 4IP0A 3CXUA 1U94A 2QORA 2UXBB 1P4RA 5J2TB 1XTUA 5IM4F 1X1RA 3CR8A 1U2PA 2V6MA 2VNKA 2RH4A 3ET4A 1OWMA 4MS4A 5FP0A 3ZE6A 1BSVA 1SHUX 2GEJA 1QYDA 2OHXA 4IMPA 3UMCA 4PN7A 3T7KA 4CKBB 2WJJA 2W6NA 3D2BA 3HO6A 3OKCA 1RIIA 3LQRA 4J29A 5BSMA 3NDIA 1JVNA 1NBIA 2ZT6A 1JJBA 3D4IA 5AOCA 4AJJA 4CPDA 2IELA 2IC5A 1CZUA 1PN3A 4U00A 2A4KA 2FWPA 4MRMB 4JI5B 3FWNA 2I03A 3D4NA 3NC1C 3ZY3A 1TPZA 3CEPB 2RHTA 3Q8KA 4MV9A 5C9ZA 1ST3A 5AKJA 3VSEA 1U1GA 1TPYA 2PHZA 2VH5R 4FGJA 1EE9A 1RKUA 3K9WA 4EYGA 4YAKA 1F51E 4RQBA 1DGQA 3GEDA 2D6FA 3NETA 2X5OA 4HGRA 2UZ1A 2I29A 3PQ3A 1TU4A 1CUJA 2PGJA 4ALNA 1VJTA 1K86A 3NHJA 1U90A 1TNDA 1ESZA 3I9KA 3UAGA 3JQBC 3N0WA 2G5CA 3ORHA 2LCQA 2WWVD 1EP1B 1F2VA 1XTIA 4WY2A 1POXA 3LD9A 4DB4A 2OCAA 4JFAA 1GPKA 5JY6A 2IH5A 4IJWA 1U0GA 2B36A 3IUEA 4Q7MB 1JXAA 4QPNA 2YYAA 1G6KA 4M9XA 3SVZA 7YASA 4KLNA 2I1LA 5FFMA 3GDGA 1LLCA 4MR8B 5IANA 2CMKA 2I71A 3QXSA 3CT6A 1ZGHA 1WW3A 3DD1A 4XX0A 4FFOA 4FN4A 2A9KA 4NWIA 2VNHA 3IUNA 5K3SA 3T3DA 3IEMA 2GN2A 3DTYA 1YXMA 5AH0A 1P2DA 3CTMA 2AHOA 4IDNA 4D25A 1BQ3A 3M0EA 4R6WA 3ZTTA 4FS3A 1KNQA 4BNGA 4G4SP 4N9WA 5UKDA 5HTOA 2FE4A 2WMNB 3O3NB 4WIAA 1J25A 2FFBA 3OEWA 4OKSA 3IEVA 2FLVA 3HB9A 4TN5A 4CT0A 2D1RA 2ZIWB 3LHSA 3NR2A 4P82A 4DJFC 4E32A 5IT9A 1KBZA 2X4LA 1M3SA 3OTHA 1H66A 1NBME 2W42A 4BVLA 4R8VA 4FIZA 3OY7A 3TYXA 4RVCA 3SHVA 3LC1O 2XLCA 3HFGA 4YXFA 4UVHA 3C5EA 3OU7A 2M6KA 3I2YX 2P6UA 2BR5A 2VHZA 4RVNA 2X9NA 3VJRA 4XR4A 4UTOA 5BT9A 5IHPA 3OLWA 1WEKA 5HF8A 4BP3A 4RK5A 3RHSA 4BDTA 2WJIA 1UPUA 2Y1KA 3S2FA 3WLLA 3DT8A 1P3DA 3L9WA 4FGUA 4GPAA 1KVTA 1SCKA 2FETA 3AF4A 3BB4A 5FWYA 1KY2A 3MQ4A 3O4IA 5FTWA 1P2TA 1GQYA 2EJUA 1CRLA 3LLSA 5AXCA 1E2PA 1Z07A 1ODKA 4W1SA 1T5OA 2GRJA 3EWIA 4AMZA 3OESA 3X44A 3HN6A 4KE6A 4UTXA 2D4HA 1DMSA 2YTZA 3NHYA 1DX9A 1LSUA 3DHNA 3L1JA 3ICPA 3KEQA 3UENA 1SUAA 2FEOA 3IJ5A 4RZSA 1WBDA 2H6EA 1M5RA 2AOXA 2AMVA 2Q46A 3FVRA 4NHOA 4QTYA 3RYCA 3J81k 2Z4TA 3ENWA 5G4KB 1W36C 4B3FX 5F1YA 3PR3A 1Z4NA 1NA5A 2QUJA 4FNGA 4GMGA 5BQFA 2BM1A 1HDRA 3L4JA 4PW0A 1J97A 2H65A 4YJ3A 4BEWA 3W5BA 2BBTA 1ZC3A 3OSZA 4G26A 4G1FA 1OXBB 4RD3A 1V16B 4AULA 3WL4A 4YY3B 2REOA 3PD0A 2BTOA 1QBGA 4MRAA 3RS8A 3UYLA 4XUDA 1X14A 1I32A 3BGOS 3HKCA 2HB6A 3NBAA 1WVGA 2I4MA 4DIOA 1L1FA 3SQXA 3QPWA 1NMZA 1QHHA 1FYWA 3FDZB 4UXHA 3FMIA 2C7QA 3BQNB 4U02A 3DL7A 3MTQA 4CCYA 3PPIA 1GD1O 1GGVA 1YZNA 4HDNB 3OOWA 2ZJ5A 1H0RA 5K0TA 4KFTA 4C0BA 3EFEA 3ROEA 1RYNA 5G0VA 2WE7A 3EJWA 1GAQA 3W5HA 1VYHA 5EHQA 4Q4LA 2JLCA 3G9UA 2OCYC 1E1QD 2I3GA 2R1TA 1QU2A 2ZANA 3E4CA 2B99A 2O2CA 1LDMA 4CLEA 3DZIA 1X38A 3OAAA 2OC4A 1S1MA 3D4PA 1AS0A 1H2BA 2GPAA 2ZTMA 3AX6A 4Y6LA 3ENQA 4ACAA 4ZCMA 1SXPA 2Q9CA 2DH6A 5FFFA 3GLHA 1XFAA 3R3ZA 2YN4A 3IEXA 3KX2A 1N6LA 1Y81A 4LYAA 3T5CA 5CFMA 4NYJQ 5CLQA 5EWLA 1VLJA 3FKSA 2QIOA 3L4EA 3B2QA 1NBOA 3Q9NA 4FQ7A 2QHXA 3DKPA 4CDNA 1MQ8B 1U6JA 3L9XA 4HNSA 2E87A 2VXYA 2CLEB 4WNCA 4Y2JA 3JARB 3ZHQA 5JZMA 3GROA 4B84A 4UBKA 1SCUB 2VC2B 1FC0A 3RVBA 1QH1B 4HFNA 4JX9A 4L0QA 2P9ZA 3PQ7A 4EY5A 2RHLA 5CHEA 3VO8A 4GZLA 4JENA 1O4WA 4LKRA 4WD3A 5KDDA 3II6X 2NACA 1Q0RA 1DC5A 3PJRA 1BX3A 3MWKA 2F1OA 1G8KA 2YHAA 2NXEA 5KYTA 3L4KA 5K05A 2FZLA 4RVGA 4BO1A 3PX3A 1WZEA 1J09A 3LWBA 3E58A 4YP9A 4CG1A 1XRPA 1BCRA 1WSAA 2PUFA 2OQ2A 1JIXA 1F6BA 4MVJA 1BQ4A 1ZH8A 3IV9A 2MIIA 3T4EA 1MRNA 2GM9A 3KU1A 1E99A 4ZCLA 1ONPA 4C7BA 2ZW9A 2FFRA 1EP3B 3R3VA 1VBNA 1ZCZA 2ZT5A 4S24A 5FRDA 5D00A 1IRXA 5L6LB 2PKYX 4P92A 3OECA 1N0IA 1DBPA 2AG0A 4YPVA 2XYQA 2PUJA 4NC9A 4ZGGA 3AW8A 3G0IA 3TFQA 1SN7A 1TADA 4EZBA 1S8OA 4G5HA 1L7QA 4DMRA 3LIPA 4X91A 4Q66C 3V1LA 5IN4A 2MSCB 1RRPA 2PGXA 2WD8A 4F2PA 3DYVA 1DCTA 1UDWA 2ZRBA 4PN3A 2ZSDA 3Q9SA 1FRQA 2GDZA 4TYQA 4TXJA 3EH1A 2XKAA 4J07A 1E8MA 1TRHA 5H3HA 3PL5A 1T9BA 4R1OA 1IBLB 4DPKA 3FRHA 4M8LA 2XEDA 1Z16A 2JC3A 3DDZX 2VJBA 3TBKA 3B85A 4NCBA 2GAJA 4DDUA 3C5WP 5JALA 4FJ1A 4MARA 4Q9AA 3T4UA 4IL5A 3QY0A 4MVWA 4UEKA 3VDXA 2ONCA 3ZNOA 2EJWA 2CEKA 3IVMA 1VSBA 3WGMA 4B4WA 2QD4A 3I9V1 4EL0A 1VLQA 4AJ1A 3ZDDA 2AI1A 4ISCA 3IHKA 4H0CA 2RJ3A 2J3KA 3UB2A 5BV0A 4FUQA 1DKOA 3U4CA 2IHYA 1NP3A 2CJPA 4IIHA 3DO8A 3WB0A 1HE5A 4W82A 2IBMA 1T5HX 4QHTA 5KYXB 1HI9A 1VJ0A 4TV9B 5CH5A 1D5CA 2FP3A 2C9BA 2A59A 3LX8A 2CNNA 1ZXXA 2OKGA 3AKEA 3I2GA 4M1KA 4W4TA 4AMVA 4DCMA 6YASA 4GLFA 1X7ZA 3C7AA 3A9UA 2IV2X 3E9DA 3JQAB 4G2TA 4DMMA 1JAXA 6REQB 1QGAA 1WVIA 2WP0A 4RKEA 1G8SA 1A04A 4R81A 4ZEVA 5EJEA 1ODJA 2QLJA 2HQ1A 3SS8A 2BZSA 3JYNA 4IXMA 2A9FA 3K7EA 1ABBA 3LF1A 4J0GA 4F4JA 1A1VA 1E32A 1UXHA 3NLLA 521PA 1SJ9A 4M99A 5C5CA 1Q14A 1NY6A 4GAEA 1SHZA 1L4EA 3DZDA 3H2SA 3L07A 1BAPA 3DTVA 4W1QA 1DV2A 3WFJA 4UPEA 2J4CA 4FFRA 1FXWF 3WBJA 2E37A 1MB0A 2WT8A 5B1IA 4BLOA 3H16A 4RIIA 4AX4A 1XTRA 3TZLA 3WLRA 2HV8A 1UKEA 3GLTA 2YFKA 2R7KA 3IE0A 3DKRA 3EMBA 4N40A 5DYYA 1MO5A 1GTL1 2F9LA 1P61B 2AA3A 2R8PA 1YUNA 2YWDA 3HWSA 2R60A 3T15A 1W49A 3WAJA 2O0LA 4LPSA 4CR8A 4QE3A 3EC2A 4FS8A 1Z73A 1Z34A 1SBCA 5FLEX 1YRWA 3NC4A 3QBTA 4BJ3A 3WK8A 1FS4A 2LRHA 3IQHX 3R6LA 4JUBA 1OX6A 3OIDA 3L06A 4S04A 4OMUA 5C8XA 3JPYA 3O1HB 1CE8B 2QVGA 3AUFA 3FDXA 1R6UA 3ELUA 2HCRA 3J7TA 1ENPA 4K86A 3W7VA 1G8MA 1K6IA 3V4RA 2GUGA 3K2IA 4JVNA 4QPJC 3SQOA 3VPCA 1VHDA 1NVWQ 2D4AA 3BIXA 4ACBA 2HYDA 3P97A 3ISTA 3TW4A 5LWHA 5TF0A 5TLSA 1QVRA 1MH9A 1JALA 3T0FA 3FUCA 3V2GA 4HMPA 5AW9A 2WOOA 5GJVC 4EG1A 2X0KA 4V0ME 1BFDA 2X22A 3BH7A 2UYOA 3DOOA 1SUIA 4IEFB 1E5VA 4X9XA 5BN1A 5DYIA 3DAPA 3DBOB 3QLEA 4C4YA 4C88A 2F6RA 3WWCA 3BHIA 1T3HA 2OZKA 3TRKA 2NYUA 5K8LA 5K3OA 2B8JA 1A72A 2G28A 2IS1A 2GYWA 5FULA 3QX3A 2BJWA 1D1PA 3ED1A 2FUG1 4Q4JA 1LUAA 5M5BA 4CMIB 2WU3A 3QU4A 4Z49A 2VRCA 3O9MA 2AW3A 4TVOA 4P2BA 2XDAA 1PRYA 2QVLA 3MT0A 2J7PA 2W5UA 4WPGA 1MX5A 4QUDA 5EJ9A 4J16C 1YNOA 3V8MA 1RXYA 1RQNA 5CVCA 3WRVA 3F9RA 1GCAA 2W58A 1MBZA 1ZRMA 3O8QB 4BQEA 3E1GA 3VNRA 4B48A 2ZTSA 2IIQA 5BN3B 1SB8A 4AROA 2RGXA 1GQ2A 1T1GA 3CT4A 2VTKA 3KFXA 4IOJA 3RJZA 4HEHA 3ZGZA 2ZYSA 3OBIA 1TK3A 2ZYUX 4FE7A 4BASA 1GSHA 3B6MA 1DXQA 2QUKA 4BQRA 3H8VA 3VNQA 5I8ZA 4LDZA 1AXRA 2BT4A 2WD7A 1R50A 4BB0A 4EW1A 2OKCA 1ZCBA 3LLMA 4AF6A 2G80A 3O21A 4P4TA 4YECA 5T64A 3BTOA 3OZUA 4OLAA 3ESCA 4K03A 2NZ8A 3RWBA 2ZRJA 5TEWA 4AMYA 3PXGA 1DT5A 4ED9A 1NZJA 1QOZA 4X65B 2EDAA 4O2AB 1Y6GA 1XXHB 2ZIGA 4DDMA 1BXRA 4Z3KA 5HCIA 1H5UA 4MQMA 3V48A 4ROTA 1RXVA 4HO1X 1SQ0A 5F64A 9GPBA 1FJHA 5BMVF 5HZHA 1SQGA 1A8HA 3PLRA 1IDOA 2GEFA 2QR2A 1FX1A 1HFWA 2BWJA 2I8CA 3IMCA 4RK1A 4YJFA 4N0PA 3B8EA 3SC3A 4E6EA 1W4CA 2ILTA 4DANA 4JQZA 3QVUA 3GA7A 1ISIA 1KSHA 1RVV1 5ELMA 3WGLA 1P2BA 1RAGA 2IYLD 2GSWA 2O05A 4Y6QA 2NUPB 5LA6A 4CKCA 5E7MA 4GOOD 3VDMA 4EELA 5FOUA 3W8NA 2BP7A 4A73A 4BBAA 1W5FA 3DFZA 3T52A 4EFKA 3QFHA 2QL5A 3EAGA 1MAVA 1N8KA 4HLUA 4FM9A 4NI5A 3E3NA 3T9CA 2Q62A 1E6UA 5BSEA 4IJQA 1E8NA 3L1HA 3V7NA 1DEOA 1N5KA 1O9HA 2DC1A 1RM4A 1MW9X 4I55A 3RG2A 3L0YA 5AM5A 3LPAA 1GPLA 2R4UA 1N8TA 1ULTA 1L5KA 3UWPA 4US2R 3BMOA 2FUEA 1U0NA 1SKMA 1TM7E 3VSBA 4LE1A 3WDSA 3GYGA 3CVVA 1OMOA 2JBAA 3BL6A 4HYTA 1G38A 4PLVA 4Y2XA 1X87A 4ARCA 4QM7A 1XJ0A 1FYFA 5DLEA 5KX5B 5E4TA 5KJ1A 1VDZA 2IBSA 2I9KA 3MTGA 4HL6A 5IC6A 4M0LA 4ARZA 3H8WA 1QFZA 5C8YB 1V96A 1IQRA 3IPRA 5JMTA 3Q9LA 3AVPA 1FUIA 4OI2A 4IX9A 5KYGA 5LZ9A 1TZMA 4QPCA 3W1VA 1XAHA 1AKVA 4JL5A 1T5DX 4M0KA 1Z22A 1ZU4A 3WLKX 3O9ZA 3JSXA 4DLWA 4JMPA 2WC1A 4JVMA 4ZJYA 3N8HA 2JLAA 4NTZA 2JBWA 1FDIA 2PM8A 4CE6A 1PI3A 3T7DA 4TWZA 4EJ6A 4JZYA 2C77A 4XWGA 4PLWA 4FFMA 1X2BA 5H82A 1XJ5A 1NXVA 2R3SA 5GONA 4WOCA 3W4IA 2WU4A 3RKSA 4C01A 1MXHA 3QE9Y 4RSHA 4RVSA 4FLFA 1E0KA 2PGOA 2C3UA 4WCVA 5IDXA 3IE1A 5A3VA 3RI3A 4Q24A 1HDIA 2Q45A 3EJ6A 4XJSA 2PD3A 1QIDA 4TKMA 2VJNA 4ARBA 4D3SA 1CDZA 2PZMA 4ZVNA 4AYXA 3P9PA 4A6EA 1ISHA 2ZUSA 5DIZA 3O4VA 4L6CA 4DSAA 4FFWA 5DCWA 4DSZA 1AQUA 4EB6A 3HRKA 4HQOA 3TTVA 4DEXA 4NG5A 4CJXA 2KX7A 3D6VA 2COKA 1JKXA 4KPUB 2FOXA 1AHHA 2C2ZA 3PE4A 3RC3A 1Z0SA 1SKAA 4RETA 3LW8A 4WLVA 2I2WA 1M6VA 3LY7A 1G6OA 1IPFA 3BJIC 2O2DA 4H6XA 4IIDA 1K66A 1DFHA 1J2JA 3WGTA 4RXUA 1QG6A 2B61A 1JQDA 1UCFA 3CZMA 3JYPA 4HJXA 4MAAA 2H08A 2JFYA 2QT0A 2BDEA 4U7PB 1SY7A 2WSMA 3WYGA 3W3AD 1P3JA 1ZJZA 1Q7TA 2UUOA 1QF6A 2FG5A 4LJSA 4F06A 5EUQB 1YZKA 4XVHA 4NARA 1CJCA 1BMTA 2NMVA 5ARDA 1XC7A 3P0JA 3QTBA 4NF2A 1KYVA 1CIJA 3UFBA 4ZQEA 1RC0A 3FVQA 3SFZA 3BL8A 2JLZA 4H16A 1U0TA 2X86A 3DM9B 3DZBA 3OM1A 1GUYA 2GSDA 3BYZA 1PNQA 4HLQB 1EG7A 2EFHB 4URZR 3EBLA 3O4HA 5SY4A 4R9NA 4JZKA 1IXKA 2OV3A 1R3UA 1A71A 2PKCA 3TJZA 1UMDB 1EA5A 4ZMRA 4ZTUB 1WAMA 1VL6A 3NOVA 2DHCA 3G7SA 3ROXA 1DI0A 1C4WA 3AI1A 2HSDA 4BVBA 3QA3E 1U7DA 2BEVB 2EGGA 2PX3A 2GZ1A 2G9ZA 3NHPA 3OIUA 4CV0A 4HFRA 4AG3A 3IEKA 1FUEA 1QJ4A 3UTDA 1PP4A 1TFRA 5ICEA 3VPXA 1NNUA 2HT1A 5F9FA 2AC4A 4BO7A 4RVUA 1S1CA 1UFOA 2DHQA 2WQ6A 5A6VA 2G1AA 1MIOB 4QDZA 3T8YA 1L7NA 3DOEA 4BX2A 4EIWA 1TIKA 1WLYA 1NPTO 1Y1TA 2V0CA 1KHTA 3D8RA 4LDJA 1WA5A 4EPYA 1MIHA 4UHDA 2HWWA 2P3OA 4JVLA 2DEUA 3A58B 5CVDA 1XZLA 5FI3A 2AD1A 1ZM3A 3OOEA 4UNNA 1DXOA 4KO4S 5A1JA 4A0SA 1JG3A 3ZGXA 2BFFB 3NUZA 2ERCA 2YVUA 4JQOA 3C2QA 4EO4A 4R69A 3WLEA 4RF3A 1ZONA 3FROA 2H2HA 3DYIA 2XY4A 1JVBA 3HCPA 3QUQA 4JVSB 4ZAFA 5G1PA 3R76A 4BLPA 3SFTA 2QRNA 4KI7A 1ESNA 2NU8A 1U0HC 1NDQA 4R1TA 3F7OA 2SECE 1E9RA 3S2UA 1X1BA 4L8FA 4LDPA 5LQSA 1XWFA 1DQPA 3RYHB 3BXHA 3PSAA 3KSUA 4UTZA 3NDJA 4QDUA 3TOXA 4MYHA 5CXUA 1VLMA 4BWGA 3PNPA 4AZ3A 4F5YA 1FYDA 2GCGA 1DOHA 3ZU5A 5JD5A 1SOMA 2Z3VA 3G2OA 3NJRA 3P2MA 4QULA 4UKDA 4WKBA 4DQDA 2ZSKA 4K6FA 1XU7A 1XRJA 3KJQA 3NT2A 2V58A 3I39X 1XZHA 4KXQA 1YCHA 4V0NA 4XTRA 1IHUA 1YS1X 4Q4HB 4QREA 5E6UB 1IVNA 4J1TA 3ZJVA 4P4SA 2RGBA 1VLHA 3QMWA 4KK4A 2GZAA 1W581 2FMFA 2D1FA 4K9PA 1PO7A 2JFZA 4WNIA 4E2FA 1N6PA 2FP4B 5GOZA 3UJ9A 4DMKA 1P0CA 3LQQA 4TROA 2ATCA 2H3EA 3HDHA 4I66A 3DKIA 1YDHA 3E27A 2B5OA 2HQSA 3RT1A 5JISA 2JEZA 4FGLA 3EXIB 2IZOA 3IT0A 2PU5A 4M1TA 4XYMA 1NU8A 5ALWA 4YUZA 4OPMA 3EGEA 2EL7A 1DUSA 5BV8A 4FE4A 5LZ4A 5LJIA 1MAWA 2C03A 3RVQA 3FTQA 1HDXA 3R3JA 1D2RA 1UMCB 5A3SA 2VWPA 2NSJA 4OOEA 4US1R 2H07A 4LYHA 4QQKA 5DGIA 3WL8A 3ZDQA 4CG0A 4DXAA 2JANA 3MLBA 3DP9A 2J46A 3FGZA 3VKVA 4EYSA 221PA 4Y9UA 4CLRA 3D8TA 5CXQA 2CHQA 3W6NA 1FP1D 1VQ1A 1K89A 1AV6A 2P40A 2VYFA 4BVFA 1TUBA 2D5IA 1A8SA 1GU0A 4PPNA 3FCCA 1RWPA 2WU8A 5IARA 1GG5A 2OA0A 2E4YA 3C7KA 4EA6A 5FAXA 4M9QA 4RZQA 4YH1A 5BSWA 4Q48A 1VKNA 1FQWA 1W88A 3A7EA 3E4DA 3K0CA 1H8EA 2HUNA 3OU6A 3ZTYA 3EW9A 1GQSA 4DILA 5ICSA 4YMWA 1N0HA 3PQ2A 3SYMA 4O1HA 5H02A 2YJ6A 5SZHB 2WABA 1RC8A 1Q1AA 3ORRA 4X90A 3SYRA 3IAM6 2I2DA 4H1WA 2DUMA 4D9CA 2X40A 3K94A 1TGVA 4P93A 2HEGA 1YQGA 3ICCA 2QYOA 3ZX4A 4BX3A 4Z9BA 4C2BA 2H2GA 4IG4A 3GV0A 3CC8A 2RC6A 3R6DA 1MB2A 1IB6A 3GLSA 2P1ZA 4LXQA 4Y2YA 4PC2A 1R3DA 1ZNZA 2LDBA 3PQDA 4YO8A 3SIRA 3WYNA 1PR4A 4QXQA 2HRCA 5J23A 5G3ZA 1SVMA 4PG8A 4HKTA 4DZZA 4PZEA 1XZKA 3N5KA 4RKFA 4GG1A 1KMNA 3IT1A 1GA4A 1RYBA 5E8JA 5KPDA 3I5YA 2Q41A 2GHIA 2PBFA 1FFGA 1QZXA 4IF6A 3WLFA 2ZSAA 1ZSYA 1QHGA 2RCYA 3OJEA 4BO2A 4IOMA 4Y1EA 1Z45A 5DRTA 5A5DA 4X3CA 2H4XA 1YZQA 1Y4AE 2B69A 3GJ7A 1FSZA 3IR7A 3ECSA 1G4AE 3FNBA 4IQ8A 5AXAA 1U3VA 3TZ6A 3GQVA 1KARA 3QKSB 4H1UA 1UXKA 4IHJB 4OI1A 2VTBA 4CEIA 3BJEA 3SC2B 1G3MA 3QPBA 4LFCB 1Y5MA 1GSIA 2OP0A 4JBYA 2J6CA 4OGGA 4CM6A 3A1UA 3LLUA 3M6LA 5ICGA 2HNBA 2YN0A 4W5WA 5DP2A 3RTEA 4EA9A 3H0CA 4KPYA 1GL9B 1G7CA 1XNRB 1C3LA 4LDNA 4N3NA 3RVLA 4GP6A 2HY7A 2H2IA 3G89A 3CG4A 4AUKA 4V0QA 3AEUA 4NABA 1RAHA 4X5OA 1KDTA 3KEOA 4Q47A 1BW9A 1L0BA 3AJEA 3QHAA 3DMTA 3VYTB 2QT9A 4LHXA 3ZQJA 3R9WA 1TVCA 1KKUA 1M2VA 2BW0A 5AI0A 1K0FA 4KAFA 3JWIA 4HX2A 3D1LA 4RE5A 3ANXA 4Z54A 1Z9BA 4K8RB 1NL3A 1EFHA 3M33A 3C70A 5ALPA 3FF4A 2A5YB 3TINA 2NZWA 3G13A 5H4GA 2TSYB 3I6YA 3M3PA 2GEVA 2LVBA 2X3YA 1U98A 2VYNA 1V48A 5LVAA 3SOPA 1B26A 1JU3A 5GQSA 1JG1A 4ZICA 2WHPA 3MMSA 4E4TA 5BXQC 4RLQA 3NV7A 1PNVA 1L8AA 5DYTA 4R0NA 2ZBPA 4HTFB 3AY6A 4TS3A 4CHGA 1LF0A 4B9AA 2V65A 3NDPA 4EO9A 2XUAA 3GP3A 4UBLA 4LDQA 4PCVA 1NMYA 2OXCA 3VHXB 1XZIA 3HSSA 4CDMA 4PEVA 2V4ZA 1CY0A 3R3YA 5EXTA 3UMRA 3CINA 1W85A 2YV1A 1KFKB 7ABPA 1C3JA 1KWKA 2Q50A 4KDFA 1JDVA 1W19A 3LU1A 1TQ8A 2C4TA 4FC7A 5ULLA 5K6TA 3RS9A 1HZZC 3T5AA 3IRVA 4H7KA 4BPBA 3BDIA 1U3GA 3OZEA 4GRIA 1DC4A 4NH0A 1PJ2A 5EMNA 3E9CA 3NCTA 5JQGF 1MQ9A 1RRMA 3D3KA 1Z33A 2Z1NA 3NBMA 1NDHA 2VXBA 5GVSA 1ELOA 2BFOA 3CUVA 2REQB 3AY3A 3OUZA 3JSAA 3ADBA 1FIUA 4MMZB 1VXRA 5A2GA 4G63A 2D3WA 3LECA 5FOQA 4G8DA 3LCMA 3ED5A 3GT4A 5CT9A 1T1IA 2CXXA 3CS3A 4DIMA 4QU5A 2A1UB 5F51A 3K0FA 1WNTA 3OD5A 4RSGA 3ZXYA 1SUCA 4O6VA 2RJOA 3E1KA 3NX4A 5DZSA 5AVXA 1YZVA 1E1CB 3BTVA 4KPFC 3G49A 4ALKA 5I7OA 3IQEA 4ZJZA 3FMVA 2RH8A 3K1ZA 3GCXA 1BO6A 4WK6A 5AHOA 5BSUA 4ZV4A 3CU5A 1OCEA 1THTA 2VLBA 3OLZA 4O3FA 3L7OA 5K99A 4W8GA 3SHWA 3KWLA 4JEHA 2ZXUA 3L77A 1N6HA 3AEZA 3B3AA 1BROA 2BKUA 4R0VA 4OBEA 5BNIA 2TMYA 3RSSA 5EJ6A 2YXPX 3AILA 3KR1A 3IAAA 5KTOA 3EF3A 1T25A 1WS6A 1NDUA 3N2YA 2R25B 3E84A 4W9MC 4GLBA 3W79A 4FLEA 4XEHA 2JRLA 1LLDA 3FNEA 3QE3A 3AUJB 3UJCA 3UO8B 5DM70 3PNSA 4XQ0A 3AVWA 1P4SA 3K2EA 1WO8A 1Q0SA 3RFVA 3VH2A 1YCDA 1ZIPA 3UAYA 2VDJA 1BFKA 1CDOA 1Z5GA 3KKZA 4L2IA 3ZDCA 1XEXA 2XUQA 3A4TA 1FUKA 1GAWA 4H31A 4LK3A 4ZAGA 1GPDG 3EQ9A 4CCSA 2XCSB 2CZGA 4GEKA 5JZSA 1XDGA 5CT4A 1NG9A 1CU1A 3FMPB 3DB1A 1F2UA 3RFUA 3GLFE 1RAFA 4B3GA 4E1BA 1YVUA 2WB4A 1X2EA 3FIUA 4HDMA 4OP3A 5DHFA 3FH0A 3UY4A 5J4KA 3Q0IA 4PVDA 1TJ4A 4RMNA 5B3AA 1T35A 3DV9A 3GPCA 4R8LA 4D4HA 4JOCA 4XLTA 4L5YA 4L4RA 4H0NA 4UU8A 3SN6A 5JAMA 1F1BA 2PT6A 5JNUA 2MSNA 5I01A 1CUHA 3E1SA 3EDOA 4NBNA 2B7BA 1QYWA 1K3TA 1ZQ9A 5JPCA 1CX9B 1Z3CA 1TZKA 3B1WA 5GTDA 1YB5A 1W47A 2FW7A 4MB2A 2CE2X 2RB5A 2E2WA 3CF6R 1B2RA 3JALB 3PK0A 1DWOA 1H85A 4G67A 3WYBA 3ZKWB 1FW6A 2XUPA 1PBNA 1M1YA 4CQLB 5HUJA 9MHTA 2QRVA 2FW8A 3G68A 4I14A 3SC6A 4S1WA 3A31A 3SLRA 4D41A 4CGYA 2C2KA 2XRYA 5BSRA 2IXEA 4LS3A 4AZ0B 3LA6A 2O3JA 2PTHA 1MOZA 1LWNA 4C5AA 4ZYZA 4HGOA 5C5EA 1G20B 3O6VA 1Z88A 1XMPA 2G09A 4AAYA 3NTQA 2FSHA 1SOWA 2Z9BA 4PXAA 4XVQA 3K4QA 2B4QA 3JD0A 4PZ9A 3RM3A 2OFWA 4OSPA 1PUIA 4Y2SA 3LWZA 2WKPA 2O2GA 3LRPA 5FB3A 4TQ9A 3RHZA 4F11A 1TYAE 2H2WA 2RC5A 5FT9A 4DKJA 5FWAA 4U3JB 2ZXEA 5KTMA 2I22A 2P7HA 1JR3A 3UT0A 4KVGA 1J07A 5LBUA 1OZAA 1RYFA 4HGYA 3ADKA 4JC5A 1OUMA 5EKXA 3WJ7A 1W25A 3VTKA 1KY5A 4GP9A 2IPOA 4L9RA 4RF2A 2HHHB 2WYWA 2C5EA 1SUWA 5B1HA 3PJDA 2XVXA 1SZPA 2BZGA 3K20A 5EMMA 1E1LA 3R7AA 2DUUA 3S2IA 1SWWA 4HAVA 4M9SA 3R6WA 3TD9A 4ZI7B 4QDTA 3AR9A 4FGWA 2QAGC 2XR1A 1L1RA 1YUMA 4I6EA 3GZJA 1HEIA 3KKPA 1JR4A 3CZ4A 4NDNE 3MN1A 1FTGA 2IXFA 3BA6A 3DOJA 3HJAA 1BD4A 2G4VA 4E33A 2X8JB 3PGLA 4GQIA 5CGZA 2ODBA 4FEEA 1M2OA 5BRJA 3L01A 4FK8A 2JH8A 3I45A 3KDPA 1U8FO 5DT2A 4TUYF 2VAXA 3DR5A 2CFCA 4CXMA 3H9BA 3MWDA 3OSUA 2NUAA 3QE0A 5G3YA 1JU9A 4ON9A 1JLMA 1SU7A 2NZXA 2ZPTX 1VJGA 5F5XA 3ZWDA 2I6TA 1ZFNA 4B3BA 1QTQA 5ALRA 2WM3A 2H2FA 4KYVA 1CG6A 1UDXA 4URHA 1SVKA 1ZNYA 4OL0A 4Z7JA 3VKUA 2QQGA 3TEFA 4N82A 3HCFA 3TN7A 2JI9A 5K0EA 1SD1A 2PZJA 4RKRA 5E6RB 3E23A 4YVFA 3BCSA 3S1SA 4F3KA 3IBCA 4M22A 2QK4A 3UOGA 4BMNA 3IT3A 4P4NA 3WQQA 1U0EA 3KVVA 2NVWA 2OD9A 2XECA 1PR5A 3HO8A 3DOCA 4FMDB 4FYIA 1OQAA 1SU4A 3I6IA 2GVZC 5DTIA 4QYXA 3OCWA 5BVHB 1BCSA 3CX8A 2AR9A 3MT9A 3WGZA 3FI9A 3QVWA 4U2EA 5DMHA 4CT4B 1KJWA 1YBMA 4QYWA 4TL9A 4DA7A 3QPCA 4Z0PA 4IBOA 1F0PA 2ANBA 4B3TB 1X39A 4BX0A 1A9OA 3LNTA 5CD9A 3OZVA 1CQJB 4EW3A 1OROA 2D3TA 2ZSIA 2ZCJA 3HBJA 2G9NA 1DQNA 1KEUA 4O4IF 3MBOA 3PHLA 3GLHE 1VBKA 2QMUA 1M34A 5L3SA 2FLWA 4CL8A 1KSFX 1VC2A 4YROA 2R1UA 2V45A 4J76A 4OYYA 4ZCSA 5C1DA 4MR9A 2VDQB 3ZU2A 3QZUA 2HL6A 2O2ZA 2FVYA 2ZYWX 1JPVA 3H9QA 4JIMA 3EFHA 2HU8A 2WFAA 2Y27A 4QFDA 5AW3A 1RQRA 3S8YA 1MV8A 2FW6A 5JJIA 1M6EX 4X1KB 3GLIA 2JHFA 1L4NA 4HDQB 2VAPA 1W5BA 1NUSA 1FX0B 1WE2A 2YINC 2RH5A 3MS2A 4BE9A 3GJRA 4B6JA 2A94A 4LXUA 4PYMA 3NAMA 4K3UA 4LZJA 4XPIA 3ZTWA 3ZXXA 2IGTA 3TOVA 2QNBA 3SLGA 1O6GA 1RLOA 2H1IA 3Q2KA 5DTMA 4IDCA 2X42A 3U2QA 1MO3A 2BKEA 3CCCA 3L4SO 3PUVA 1WL8A 3KEFA 5JH7A 1NMXA 4BO9A 1XTJA 4I50F 1CS0B 1E3WB 4GX1A 4IQ4A 4TTRA 5HFNA 4B6PA 2C98A 2Q5EA 3KT3A 3KPWA 4LI0A 4WBSA 4YALA 3TOSA 3LZCA 3F6BX 2YH2A 4QG3A 1AGRA 2BZ0A 2H2AA 4AD8A 1K5DA 1HE4A 3HGMA 3BMCB 2XUGA 1B76A 1JPNA 4K0RA 2C5FA 1LGYA 2Q49A 4XWOA 1J49A 1Q57A 3EVNA 2Q2VA 3CNNA 2CB9A 4WLUA 1FUUA 2BFCB 2G7ZA 4YWJA 3WLIA 2BUAA 1Q0UA 4YPOA 1E9CA 1Z0DA 2XMBA 4MQBA 3VO1A 3FDIA 1U3FA 3R7WB 4DBZA 3BSWA 5BMVB 3BKWA 2JCSA 3N07A 5L7WA 2P9HA 4O4LF 3OPVA 1BU5A 2JGDA 2GBLA 2XNJA 2IPNA 4MQ4A 1S3GA 4FQ8A 1QHNA 3GRPA 1LQUA 2YW9A 5AP9A 3A8TA 3GZNB 3EMVA 3DEHA 3NOOA 2QRGA 3EXFB 3PHJA 4KUHA 2Y0DA 1T0HB 1UFKA 2CFIA 3QJYA 3FW1A 4Q82A 1YRBA 4LRTB 3CV3A 1VG9B 3EYAA 1MB3A 3MERA 4S35A 4Q9DA 4IKPA 3G02A 3MEQA 1H69A 1I9CA 1XN4A 1U6KA 4R1PA 5B37A 2E1RA 4ZFNA 1WW2A 5FUQA 4R8SA 4N8EA 2IODA 2ZQYA 1GFIA 3DBRA 4HB4A 5FPSA 2EZ4A 4JCCA 3TWOA 3VZDA 3JYOA 3OJFA 4D4LA 1CQPA 2PMCA 4B3RB 4JN6B 4QU8A 1TK2A 1NJGA 4DCVA 2JI6A 4D9FA 4HNUA 1KVQA 1JLKA 1YMUA 2EWMA 4HB2A 4LQDA 4R7TA 1US8A 1AMNA 2BEJA 3BMXA 1QIGA 4MX8A 3V4ZA 1R0ZA 1NI4B 3WSTA 1EXVA 1QKJA 1XDZA 1WD7A 1PHPA 3HV2A 1HYGA 4O4HF 3IA2A 3GUHA 1QAMA 3H9JA 3OE4A 3C4VA 1QLWA 2OO5C 1E60A 1L3IA 3HI6A 1IQUA 2FSGA 2IL1A 3GNLA 3BSFA 2FSVA 3OZIA 2JFNA 4ICIA 4G5OA 2W70A 3ZU3A 3C45A 3IOEA 2QRJA 3Q8XB 5K2OA 1S2GA 2WSSA 3M4XA 4C0LA 3EVTA 4IUCS 2J9FA 1UKAA 4ZO9A 1O5TA 3EXEB 2O8NA 5DYNA 1TZ2A 3ZHSA 4OQEA 1W6UA 3Q7IA 4OMFG 4YRTA 4DLZA 2IEYA 1NRWA 1QJCA 1X80A 1L7RA 2XQFA 2ZTHA 3LJKA 4K05A 4X6UA 3RRBA 3WG9A 1XGKA 1HEYA 3CF4A 2WOJA 4JKYA 4BMPB 4WACA 1Y8RA 3LC2O 4DCSA 1DPFA 1Q19A 4LBZA 5DHRA 2ZRNA 2A0UA 5IAJA 2DKFA 1T36A 3TLBA 8ATCA 3NXKA 5LMUB 4X1IB 2YV3A 2WJ6A 3VOAA 1E1MA 3FWKA 3JAWA 3OX3A 1MAUA 1RHJA 4H1HA 2Z83A 4EABA 1EUDB 4L8LA 1DC8A 3C3JA 4LJ4A 4CDRA 1REQA 5ADVA 3NIGB 3WGKA 4C0QC 4C3VA 2C1ZA 3BXEA 3WK9A 1G8JA 1ISJA 3AIOA 2CJFA 3GEHA 3WJ2A 3EY9A 1OU4A 1QHXA 3DCYA 3IKVA 4UU0A 1WZUA 2R6CA 4WGFA 4RTSA 3FJ1A 4KLCA 1T6BY 4M38A 5BRAA 4R2LA 4DMHA 1VSUA 5L3VA 3V4OA 1FCJA 2BH2A 1F8YA 1EQAA 4MJ7A 3AF6A 1QIHA 3KR0A 2GBGA 4YUYA 4MQFA 2C1XA 2Q27A 2JFOA 3Q9UA 4E5NA 1DAOA 3F7TA 1OI2A 1P1BA 1USKA 4HLDA 3OT4A 1UBCA 5HHTA 1GDTA 1OXTA 5B3LA 3OTQA 2HZBA 4MQEB 1KQ3A 2RI1A 3LQKA 3AEQA 3WGNA 4DOMA 4KAAA 1YA6A 1E2DA 2HHCA 2IRWA 1I7NA 3IO3A 2WPDD 1GEEA 4S1TA 3UATA 1OH6A 3F9IA 1PWZA 1KYYA 4RM2A 3HCOA 4ZJPA 1XX6A 3TEMA 1NIJA 4IKOA 1QZTA 1P9NA 2NU6B 1P5JA 1A7UA 1LFDB 2GD0A 3D0OA 2GNOA 2XGMA 4FXOA 4LG1A 3ZWXA 2C2HA 4WBNB 3TTXA 1ESCA 1XP8A 3DMPA 3C24A 4F6RA 5BXYA 5G0TA 3ES9A 5CVJA 3L0BA 3KZCA 2KSQA 2OV6A 4ZCTA 4G0VA 1NBHA 3D6NB 1HOTA 1JIIA 4LVOA 2Q9AA 5DHPA 4E6PA 1QFXA 2CCJA 3EISA 1BYUA 5E9QA 3ME5A 4C7OA 1UKYA 3CMMA 1D7AA 1OC4A 2C9YA 3NBZC 3Q7EA 2QJWA 2CVQA 3MJFA 3T61A 3WSVA 4W1RA 1QYRA 3HCWA 4N5MA 1EIZA 2J9RA 3ZEAA 4KN9S 5JVDF 4RFVA 2EP8A 1Y7HA 4S3MA 5K51A 1WXDA 3UMGA 5I4CA 4BFZA 4UW9A 1V43A 3F3SA 4OK3A 3W5SA 5IP5A 4KSCA 3EBOA 4RHUA 3QWHA 5IYZF 1YRQA 2W83A 2BTQB 3FZEA 3OIVA 2C4MA 2G5TA 1NUUA 1SKYB 2QTLA 4E2ZA 1TD9A 2IUEA 3B38A 3JQFC 1OI4A 3KIPA 5EZ5A 3ESZA 4WXHA 4MUGA 1J1IA 1Z26A 2E48A 2LGJA 3F3YA 4UBMA 5AUQA 2FN9A 4LC1A 2O8EA 3CCFA 4DLVA 5FR1A 4W5HA 4L5IA 1JZTA 1TVEA 1XBTA 1WMAA 2KB0A 2R5NA 1P45A 3E3AA 3E8SA 1LPSA 3G9TA 2NXJA 3C3CA 4XFDA 3N8GA 3ZNQA 4UEWA 5HOQA 4EUFA 4NESA 4ID9A 4EEKA 1P19A 2Z04A 2B8WA 2E4WA 3QPDA 4FFPA 5KTKA 4MWGA 1NE2A 3RC2A 1R5NA 4Z5XA 5KHOC 2R44A 4K1LA 4E09A 4IDOA 1E7SA 2W00A 3O74A 2YXEA 3L0PA 3JZMA 1NLYA 1PSDA 3ESDA 5HM8A 4N48A 3G2NA 4BQSA 3C14C 1TJ5A 1JQLB 1SUSA 2V3WA 3M5CA 3N9IA 2VTDA 1WUIS 2ZVPX 3F2VA 4WMLA 3ROQA 3NUQA 4ANFA 3MD0A 1Q21A 2CNWA 3HABA 1FA9A 2JAOA 1MX9A 4LY3A 2QTVA 2NQ2C 3ETGA 2PKWA 3MPOA 5JHHB 2ZWPA 5T6BA 3UYKA 1PQ4A 3HYTA 2MINA 5AVRA 3DXXA 4IILA 4M7RA 2EW2A 2DGDA 1I4DD 1QE5A 4RY2A 3FOZA 2VTEA 1SZJG 2QTTA 4GYKA 4ZRNA 4EG4A 4F86A 5HJ5A 2J0UB 2XE7A 2DVMA 2XTAA 4HRAA 1VYTA 1WCWA 2JGKA 2ZI3A 4HQFA 4PRZA 1CR1A 2AQIA 4N03A 2GFIA 1VTKA 3W5VA 1SUFA 3RV4A 2AWNA 4A6PA 1N2HA 3C3KA 4YDHB 3GPLA 1C9DB 4U7JA 4QAQA 4EI7A 1TF2A 3HR7A 1NXTA 1SC1A 4QYMA 1NW4A 4NOLA 4UC0A 1AN9A 1N7JA 1PNRA 1OFTA 3AY7A 2CLIB 2Y1XA 2D1QA 5CNMA 4ND7A 4MVJG 1XQWA 2R00A 4BFVA 1N57A 2ARKA 1EHYA 3N2KB 3WBBA 5L40A 1W0KD 4ETWA 2CB0A 4UBNA 3TL6A 3I64A 2AEJA 3IL2A 2PSSA 2QXTA 4BCDA 3KCQA 5EZ6B 4BOYA 1PG0A 3LWNA 1Y63A 3EXG1 1LI7A 2VUUA 3GCWA 3DUFA 4KN6A 3URKA 4WXPA 2C0QA 1B7GO 1IIRA 5GVRA 2AIRA 2D1TA 3EFOB 4FQ5A 2CHGA 3AFOA 3GFQA 1E9EA 1EGHA 3IP5A 3OZRA 4NONA 3AV0B 4DM4A 5ENDA 4JLNA 4MQUA 1N34B 3RDPA 2HPVA 4RADA 4ZYLA 3RFCA 4YHBA 3I83A 1Z5UA 4FGZA 2BFMA 3H4IA 4MH0R 1WPGA 1M76A 1KP9A 1QP8A 3IALA 4B4VA 4RIHA 5DYWA 3V1TC 1RC1A 3WTBA 1RCTE 1N3YA 1VZ2A 3FVVA 4ALIA 5FF9A 2VT3A 5ADWA 1M1NA 2VDRB 3KPUA 1HE2A 1L6IA 1Q3HA 4G0QA 3UT5B 4BJ5A 5A04A 2XQGA 5L7YA 2J4FA 2B9VA 1O89A 5FNVF 2BFBB 1W52X 2EGUA 2VOEA 4L51A 3T9DA 3WISA 2B94A 4JB0A 3ZWNA 2Z9DA 4MNTA 3U80A 1KU0A 5DBIA 3SBEA 4BBZA 4FZJA 4X8HA 4KODA 1CP2A 2Z5FA 4JLAA 4REQA 1O08A 1ILWA 4GPEA 1UAYA 2GF9A 3LV8A 4OKNA 3L5OA 4LQ4A 2I8LA 1IXYA 3JV7A 4RWZA 3BMNA 4PAQA 1C1YA 1W30A 1Z8FA 4ZXFA 3AQ4A 3R75A 4F8YA 4YP6A 1KZHA 1I33A 2EG5A 1WDKA 1RI5A 4HWSA 4KPEC 1PX0A 2WF8A 3F47A 3TSCA 3TFOA 4QFCA 1IN4A 1E2KA 1NVFA 2YFYA 2BGNA 4W6QA 1Z6TA 1VL2A 5I9BA 2R6ZA 1G5TA 3AM4A 4WOPA 3INTA 4AKTA 2V7TA 2DPYA 2AOUB 2NSHA 1N36B 1OA1A 3INRA 3ZY4A 2AL7A 4JU8A 1LJUA 1S2OA 1XTVA 4IMRA 1AU9A 4TQAA 5TPZD 3CLVA 1Y6RA 4PQGA 4RH3A 2PT7A 2Q0HA 3HVKA 1OAOA 1T9KA 2XW6A 3T4PA 2VDWA 5L53A 3C39A 4XQEA 5I7WA 4Y6OA 1T5IA 1R5BA 2E85A 1Y5RA 3BWMA 3OQBA 4R8MA 3WRXC 3R4VA 4KRXA 1KO5A 3NFRA 4CZ2A 1C14A 4AP5A 3LLCA 4WZBB 4RDIA 1W94A 3LT5A 2WA1A 3BXXA 3INGA 4OU4A 3AHHA 2JIOA 4ND5A 3CUYA 4JL8A 5JNTA 2JGAA 4Q3CA 1F5NA 1PZMA 1R9GA 5KNDH 2Y1FA 2XTNA 1KBOA 2NT4A 3IUMA 2DQZA 5FUVA 3O5AA 3WFZA 1UXOA 1W4ZA 2G71A 3H1EA 2XF8A 5JXWA 5DLQC 4NL4H 1PFQA 1PUXA 4TS4A 3EVCA 2Y76A 4TWAA 3M34A 4MKGA 5DYGA 3SM3A 2X2OA 4DG9A 2YMPA 5JCXA 5KOHB 1NPDA 3THXA 3RNLA 1JG7A 4HR7A 2CNOA 2EAUA 3NJ8A 4G01B 5FUBA 3E2IA 1BHO1 2YVAA 5F9HA 3VKGA 1YNSA 2CHFA 1DBIA 3DSRA 3P2JA 1EM8B 5E9AA 5EUMA 1XRMA 5DNCA 2FV8A 1WXEA 4W99A 2O1XA 4DIEA 4MCJA 3VR0A 3YASA 2A1IA 2VR1A 3AKDA 4O2BA 1H6CA 1H6AA 2V8BA 3IVCA 3KJZA 4P7KA 2AOTA 2DPMA 3GLVA 4G5QA 1NNSA 4A91A 1M1ZA 3CNEA 3PF8A 4K3VA 3DMRA 1WCIA 1W1IA 3HYNA 1OLUA 1CUYA 4P4UA 3VAZA 1H9BA 4OQMA 4LXGA 1A8UA 1F20A 3KR2A 4NNOA 4N8DA 4PHCA 3RFXA 2GEBA 1J2RA 4KH0A 4DDWA 1OSNA 1K88A 4BV3A 4P7JA 3OZXA 1M7BA 4ZVLA 1V8ZA 4IDEA 1HLDA 2QW0X 1LSJA 1SCDA 4LBYA 1JVSA 4LZPA 4C6HA 1CC1S 4TV8F 5K3BA 4QRDA 5LUBA 1PS8A 1R74A 3QKUA 4WWHA 4BLWA 5EQJB 1P17A 1SK8A 1NFFA 4PGHA 2O20A 2C96A 1H94A 1N25A 2DR3A 1NQVA 3CJRA 3SZUA 4PWYA 4BTLA 5BWLA 5BYAA 3AVUA 3BMQA 4MUHA 2LPMA 3T06B 4B31A 1KC1A 1EWTA 4BJHB 3R41A 5LIRA 3LSYA 4ESVA 4R01A 4J4TA 3W2HA 4EKGA 3GBSA 3PXEA 1CDDA 4D8WA 1MR3F 3LDHA 2EKQA 2HI0A 2V7UA 3IMEA 4PSUA 4BGEA 2IOFK 2MR5A 4L0CA 5HR5A 4AJ9A 4LCEA 4WOJA 3LCUA 4ABTA 3NVMB 1RZRA 1B0PA 1I9GA 4J0EA 5BPFA 3R5XA 4H27A 5CR9A 5BOVA 3WL3A 1E2LA 4MPTA 4NBVA 1CY4A 1QGOA 3JASA 3HDGA 1O58A 3QU2A 4HGQA 3VO2A 1ZX1A 1P9WA 2YNMA 4NYMQ 2IZ7A 4XYBA 4C7XA 4OXIA 2O9JA 1ZEJA 1E5LA 1SG0A 3LWDA 3CW9A 1VECA 1W44A 3LL7A 4WNAA 1P2VA 4I1RA 1M73E 1YZGA 5JCJD 4PAGA 5FHRA 4I3GA 5M29A 1L3BA 3OA2A 5C1BA 2A9VA 2P6NA 1ZOLA 4D9NA 1X1TA 1NULA 2J33A 3DDWA 3FJOA 4LY0A 4BBJA 3I2JA 4KOAA 2CMHA 3EGXB 3AR4A 2C4WA 5DN6A 5A9SB 4QGFA 2Y0CA 1E2MA 2MSDB 2ZT7A 1SCJA 2WUWE 4FI3C 3T5TA 2GCEA 1JAHA 2XE6A 1UBGA 3CLTD 1PT9A 4BV9A 4G0OA 1YK1A 2IUFA 1J0EA 5AQ1A 2AE2A 1GGFA 1NATA 2ZJZA 1R66A 5HGXA 3WJ1A 2YWRA 2BHNA 2OC9A 1O0CA 4DM3A 1GRVA 4YQFA 4PXSA 4V3CA 5K7SA 1QRUA 5C7OO 4CTNA 1IHYA 3STWA 2A30A 5TGZA 3ONEA 3FGNA 4IFTA 3DDUA 4F4UA 1PE0A 1KJNA 2J5RA 3NKFA 2DR2A 4CIAA 4N12A 1FRZA 2ZZKA 2Z2ZA 3TR0A 721PA 4TS1A 2BHTA 1TA9A 3U4IA 4R83A 2HNAA 1JSLA 3WKBA 2R79A 1TKRA 5A4MS 4I5GA 5T3YA 2C5SA 4XIIA 1TD1A 2C3YA 2CXUA 2SKCA 3V46A 2RGEA 4Q7JB 4MXDA 4OAOA 4RL6A 4N0DA 1WSDA 4ILKA 5CU7A 5AYVA 3VU1A 2PSFA 4HT3B 1PZEA 2C7RA 4ZVKA 1JDUA 1KVSA 1XDWA 3ZWAA 2LE0A 3D6HA 4K1XA 3U3XA 1CR6A 1QC5A 2Z08A 1TAUA 1JKJB 3RVNA 4HS4A 5FTLA 4MYDA 1Y8AA