3ZEAA

3d structure of the nifese hydrogenase from d. vulgaris hildenborough in the reduced state at 1.82 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
279
Chain Sequence
b'GERPPVFWLQGQGCTGCSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEGEHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDALKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVVNIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFGRNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNGGVNWCVQNAVCIGCVEPDFPDGKSPFYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMIC [NIFESE] HYDROGENASE, SMALL SUBUNIT
molecule tags Oxidoreductase
publication title Redox State-Dependent Changes in the Crystal Structure of [Nifese] Hydrogenase from Desulfovibrio Vulgaris Hildenborough
doi rcsb
total genus 85
structure length 279
sequence length 279
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3zeaA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3zeaA02
4GD3Q 4CI0B 3USES 1UBUS 1UBOS 3MYRA 4UEQA 5JSKA 4UPVA 5A4IS 5JSYA 3AYZB 5JRDS 5JSHA 4OMFG 4UCWA 1UBMS 3RGWS 1FRFS 3ZE6A 2FRVA 1YQ9A 4IUCS 1YQWA 3ZE9A 5ADUS 4UCQA 5D51S 5A4FS 4UCXA 4URHA 4UE6A 1UBKS 2WPNA 3USCS 1FRVA 1H2RS 3CURA 1WUIS 4U9IS 4UPEA 1UBTS 1WUKS 3H3XA 4UD2A 4UQPA 4KO2S 3UQYS 4KO4S 3ZEAA 4C3OB 5JSUA 4UD6A 5A4MS 4UQLA 1CC1S 4UEWA 1UBHS 1E3DA 3AYXB 1UBLS 4KL8S 4KO1S 4U9HS 1H2AS 1WUJS 1WULS 1UBRS 1WUHS 4KO3S 4TTTS 4UE2A 5JT1A 4KN9S 3CUSA 3ZE8A 1UBJS 4IUDS 3ZE7A 4UE3S 4IUBS 1YRQA
chains in the Genus database with same CATH superfamily
3E4CA 3LUKA 2JIZA 2OP0A 1P5HA 4WZ6A 1R4NB 3WLOA 3I2IA 3INYA 2RGWA 4OFZA 3TLJA 1AMUA 3GMDA 3QI2A 4PPQA 4BV2A 5FTWA 1NOIA 2ZVJA 3VVLA 3FCAA 1Y4ZA 1E7YA 2V7GA 3GFVA 2HIMA 3PZRA 2QVGA 1O97D 3KPUA 5GJVC 1NURA 2GVZC 3C15C 1PJTA 2ZRLA 2HXYA 2XUZA 3ODPA 1ORIA 2XWBF 3AM3A 4QJ4A 2SKCA 2B9EA 5A3SA 2QUKA 2HLHA 4DRXB 3E9CA 3ICWA 3PX2A 4CEHB 1GFZA 1YE8A 2JPDA 4R01A 2IZ7A 3DWGA 5HJ5A 1QAOA 1JJFA 4P54A 4J9VA 3OIGA 2QTCA 4EWLA 3G1TA 2Z09A 1CS0B 3DE3X 4TSFD 1CY8A 5HE9A 2CBZA 3HM2A 5CW1A 2I2BA 2HMAA 2DUUA 3SIXA 4EEXA 3GJRA 3SICE 1NF9A 2XD9A 2PMFA 1U0GA 2A30A 1E1LA 4JLUA 1S8AA 3BJZA 3KKEA 1K27A 1SQ6A 5K7SA 2QSYA 5EIOA 4D99A 2FWRA 3LQYA 1KMMA 3ANLA 1RJWA 2ATCA 1DKMA 2EYUA 1VSVA 4IGKA 4JL5A 4OKSA 1GXSB 1GPMA 1I3KA 1LS6A 1Y4DE 2FP4B 2DX7A 2Y6VA 1NF8A 3ITDA 3KQQA 1PQYA 4KTVE 4BJ1A 5TDHA 1HPLA 2HM7A 1G5RA 3NKLA 1IBKB 2X2FA 4H0FA 3EXEA 4B40A 3NBYC 5TGZA 3UTCA 1CTQA 3WGZA 5LBIA 1PI3A 3N3BC 4IGEA 3SWWA 3I5XA 3T1HB 5L4LA 1A76A 4JWKA 2FMUA 2MSWA 3PJEA 5IJ0A 3IULA 1X0XA 1G2IA 4LE1A 3U7HB 3V4ZA 3KVOA 4EZBA 3KTFA 2ZUEA 2ZJYA 2D3WA 3DWIA 3LQFA 1GTJ1 5DNWA 1V9SA 4MYRA 3P97A 1U02A 4P83A 4AM8A 4BKOA 3VNUA 3LAWA 4I5IA 3FHLA 2R48A 1PEDA 3BFJA 5KNDD 2WJ4A 1AA6A 1ULAA 2GPSA 1U7WA 1H2EA 1U04A 4OXRA 1EBUA 5CCBA 4PG7A 4XGQA 3CEPB 1EUQA 2B7BA 2XDQB 4G25A 1HE5A 3AQ4A 4KAJA 4M88A 1SQGA 4Q4AA 2NXWA 1SUDA 2ZIAA 4CUJA 3DV2A 2FR8C 3BHMA 5IHXA 1E0DA 4OPMA 1FP1D 4QT0A 2B7LA 2VJBA 3AR8A 3Q8KA 3PKIA 2QX9A 1AZTA 1H9BA 1TCCA 1DTWA 1XZFA 2XH8A 2WI8A 1VPDA 4EATA 1GGHA 1N3BA 1E2EA 1FF9A 4WINA 1DRKA 3GBPA 1L1EA 2VDKB 3F6YA 4JLNA 4MUAA 5B3AA 4KP7A 2YR0A 5J9FA 2D6FA 3QA9A 3QLVC 3SVZA 2VPYA 4CU2A 2C2MA 2VHYA 2IYTA 3I3SR 1I1HA 2JBAA 4RORA 2NT3A 5HZKA 2J5XA 3VR6D 2AL7A 5AT1A 2QF7A 4ZOCA 3S2SA 5F33A 3W06A 3QEJA 5ED4A 4N7JA 1RQXA 2Z98A 3DE7X 3L0PA 4K6FA 5KOYA 4CXMA 1IPFA 4DREA 2F3QA 4KUGA 2OHVA 3FDZB 1MABB 1M0EA 2ZLBA 2EEZA 3HO6A 2RGEA 3F90A 4BXOB 1A8IA 2BPOA 2W71A 1W0KD 5BWMA 3A27A 4B33A 1AV7A 2D62A 2YIVX 1DRVA 4XYEA 3I34X 1XTRA 5BPHA 3DTTA 1V5GA 2X6TA 5IH7A 1QORA 2FZGA 3DZGA 5FAXA 1DAHA 1F51E 4G4JA 2W2KB 4K2AA 4TL6A 1MV8A 5AMXA 3RLFA 2OZKA 3PD0A 2PKYX 2ZYRA 4QO8A 3RJ9A 3DDZX 1Z82A 3D5EA 3DNPA 3SE7A 4ER0A 4MAMA 1SG6A 2ZXUA 1UKAA 2X6QA 3UATA 1WE2A 1QH1A 3BWVA 2IH2A 2GLXA 4E2ZA 1MNQA 2WFZA 3ZZTA 3OO0A 5IKEA 4UM9B 4DR7B 5AK3A 3T0IA 2O3QA 3CLUC 4E5KA 3NS7A 4YUYA 4NVRA 3WLIA 4NCAA 3UT5A 3PXUA 3QXHA 4KQXA 4IJ5A 3G0IA 1OZGA 1PV4A 4NBKA 1FMFA 1U7XA 3PXEA 3RF7A 2FJPA 4AJEA 2QRHA 5FR2A 2PEYA 3RBXA 3TMYA 1U7PA 1ENYA 1L4MA 2E9SA 3D0OA 4H7EA 1MO6A 1NNLA 4IX1A 4Q47A 3U0BA 2NUPB 3B7GA 3FFXA 3L7KA 3WS7A 4F8JA 7MDHA 4PYQA 3VSDA 1VL5A 3BIFA 5TQJA 2IYVA 2V65A 3BIWA 1L4LA 5FI5A 4J3JA 2D0OB 3PE6A 2R8ZA 4QPJC 2YVLA 3EEBA 3LCJA 3G6KA 4EJSA 4YDRA 5I7FA 3ZHYA 4NICA 1REQA 2Z6UA 7YASA 4GX1A 5IC6A 3JZIA 1LW7A 5JSKA 3TLMA 1HWYA 4ZJPA 4NCNA 5KPDA 1Y7PA 4LF9B 5IYZB 2HSZA 4QSHA 2Y1OA 3KWMA 2JEOA 4KYIB 2W83A 3CLVA 2RI6A 1KI3A 2IDMA 5BUQA 4A8TA 3Q2KA 1DNPA 2AF3C 1G291 2RK4A 3C3DA 2W6JD 1NL3A 2QX6A 3PUVA 5ECWA 1DUSA 5HCNA 3ZD6A 2AW3A 2VJNA 5I7RA 4B6GA 2GJ8A 4LZZA 1IBMB 3K6SA 1MLDA 1RI4A 4GHWA 4AQ7A 5KDDA 3CTMA 2G9NA 3AHIA 1UDRA 3TZHA 5J4HA 1A5AB 2WHQA 2ERYA 2GM9A 1PFVA 1K3UB 3HY4A 4OG2A 4JFAA 4OU4A 4LJ9A 3OQNA 3E82A 3W4JA 3D2CA 3U80A 1RQRA 1WW2A 3IPRA 5HP4A 3OLWA 2JLVA 4P4NA 1SKYB 2IITA 2PR2A 2LCIA 2BJWA 2QI9F 4ACAA 3Q87B 4EGAA 1TLFA 1XJ5A 3FSGA 4BMOB 3IP5A 3KZVA 1YS9A 5FI3A 3T9BA 3IT0A 3EX7C 2JFNA 4TXMA 2VDNB 3A2MA 1IDN1 4LSMA 2WD7A 5BN3B 3VU9B 1DU4A 3HU3A 4JKOA 1QIJA 1RMQA 3B6JA 5TSDA 3GJ3A 5IXJA 3HXPA 4DMMA 1W1IA 3AHJA 2BI8A 4O4JA 1NLUA 3IO5A 4R3UC 5DCWA 1G2OA 5TT0A 5L4SA 3WB2A 4B6PA 4M8LA 5CXSA 2I54A 1Q1BA 5KTKA 2I03A 2I5PO 3OOSA 4OP3A 3BIXA 1T6BY 1X38A 4F5WA 2HPHA 3MOGA 5I9TA 2PM8A 2VHEA 3QMPA 2VPTA 2FW7A 3DZJA 1QB7A 2NO7A 2O0LA 3DDUA 4A0SA 2XXBA 4XIIA 1AQJA 2DP4E 3MJDA 1Y8ZA 1R12A 3WAKA 3DTVD 1AGPA 4RQUA 4QQKA 3GK3A 4HC4A 2GB4A 4C08A 1F8YA 4O5OA 4NCHA 1KQ3A 5AJHA 1FX1A 4D98A 1ZMBA 3GFRA 3G7SA 3W3ZB 1EQAA 1HV8A 1Z6QA 2FDXA 2PT6A 1QBKC 2WMDA 1A96A 3H5TA 3L0YA 2OC4A 4JEIA 4Y2HA 3UAOA 3ZDFA 1VRWA 3G1WA 4H3SA 4OYHA 3WL7A 2WT4A 2DR2A 1XTBA 3DAGA 1IJEA 2D06A 3B1WA 4KUEA 4LG1A 3IP9A 1EGAA 1UMDB 1L7NA 4EI7A 3F7OA 4LA4A 1U8TA 1NTRA 1NBMD 3L7CA 5CM8B 1XVLA 3QNMA 3IEIA 1L5OA 3L8FA 2V55B 4BQEA 3ESQA 2X9LA 3WWPA 2X77A 3KJHA 1ZC3A 2R3SA 4ZYYA 5CEFA 1EIZA 1AQYA 1BXZA 1CQXA 1DP4A 1E63A 1NIJA 2EW8A 3G8DA 4FDLA 4J0QA 4N0QA 4U8HA 3IDFA 3QYFA 3ROXA 2WK1A 2A8YA 1A7AA 2P2GA 3PPXA 5SYMA 1VRCA 4QTUB 4CKEA 5IZCC 1FP7A 3ZCSA 4D4HA 4W8HA 1ZVQA 2GJ4A 2CY0A 4TTJA 2Z8YA 1GSOA 5K2MA 1HK7A 3IOEA 3X2SA 2QY6A 3C85A 3NDJA 4H16A 2BZ0A 2X4DA 3MLBA 4GPAA 1CRPA 2YWFA 2YX1A 3JQCA 4ZVMA 3PGKA 5KX5F 3UHJA 5FV7A 1RAEA 1TK2A 2ZIGA 1AZLA 2GPTA 3DZIA 4LMAA 3GDOA 2DULA 2FNAA 3QTTA 4Z9AA 5G3YA 2MINB 2OILA 5GY7A 3OT1B 4M1WA 2R7MA 3D6TB 2X0EA 1K2WA 4D9BA 2IIVA 4EG4A 4EYSA 5EGNA 2IT1A 4HLUC 1D4FA 5B7NA 2AXPA 1KYVA 4DPKA 3THSA 1FUIA 3LC1O 4NZ9A 4B3TB 1GGKA 2KM1A 1PCXA 5EUQB 3KJIA 2OGZA 2RGRA 1EJ6A 2DUMA 2H5JA 2JDIA 5T57A 3P27A 2EYQA 1WUYA 1EGHA 2QQ5A 2QS9A 4NDAA 2FQ1A 4GM1A 1V1RB 4J90A 1KEEB 4RQAA 1JKJB 1L2TA 1SRQA 2NVUA 4GI5A 2BGWA 2OP1A 3PJRA 3EUWA 3QBTA 1UXKA 5DM2A 4Z49A 2D8MA 4JB0A 5IKOA 1EESA 4CL0A 4HV4A 1C4XA 4M0UA 3KOUA 2CF6A 3M49A 3FRJA 4GL4A 5JMWA 3F74A 3V33A 2P79A 5T4FA 1LW6E 2VWQA 2NO5A 3H5VA 2AC2A 2Q50A 3EULA 3OIYA 3D4BA 3IIMA 4FJ1A 4PYNA 5CDFE 1MP0A 1GA1A 2V9ZA 3P9NA 3UPUA 1UKCA 3OEHA 1QV9A 2JGMA 2R84A 1ANKA 3AF2A 3HLYA 1SN7A 2A9KA 4B3MB 2PWZA 4YGYA 1VE7A 1R8SA 1DT3A 1XROA 4K3UA 2ZW9A 4N5NA 1C0IA 3R8FA 5T67A 4C4AA 3HWSA 5DIZA 2NO9A 3D59A 3H4MA 3OZBA 1D9ZA 1URPA 1A88A 5L6LB 2RBGA 3PF8A 5C81A 2JIQA 4E33A 3MFYA 4EGQA 1JS1X 5CFRA 1UR5A 4KIWA 1F12A 3R7WB 2IHKA 3CE9A 4CIDA 4R3WA 3JRXA 2J9YB 3QIVA 4G56A 3A37A 3INGA 1Y3HA 2BKUA 2FGKA 2VT3A 1AKUA 2B78A 1LY1A 3LZDA 3OU6A 4RGVA 1S9DA 2QUJA 4NFYA 2AR0A 3NUGA 4F6RB 1PGQA 3WMGA 1O03A 2BEUB 1KJNA 3WRWA 3B20A 1YI8A 1NVVQ 2GOYA 1DBSA 1WDKA 2MYPA 4PNPA 4UUAA 5TE9A 4D4MA 1C7EA 1ADYA 2BCGY 1V3UA 1KMNA 3GCZA 5KTRA 1QYCA 2CV0A 1C4WA 1TDJA 5I7HA 1SULA 3Q3EA 2Y1LA 4FBGA 4TUYA 3V8MA 3O8NA 1RWMA 2EFCB 4LOLA 4UXIA 4KOEC 1UK9A 2GPNA 3ZY2A 1O6FA 1P3Y1 5CM2Z 5EVCA 2CK3A 2E1RA 2E4AA 2FWJA 2UUCB 1ZI9A 4JMLA 3TAUA 5KYXB 3RGWS 1K7CA 1GM5A 1Y3IA 1ULBA 4UBIA 1P44A 3DD5A 4E2XA 5KUTA 4KRXA 2QZ9A 3T06B 3G9TA 3GHHA 3K9QO 2V7XA 3FTFA 4WA7A 4N40A 1DV1A 2OXFA 4EW3A 3TF5A 1MEOA 1UPXA 3MMZA 2P6RA 1T9ZA 4I3FA 4B2IA 5JQWA 1Y34E 3Q3CA 1LTHR 3H8WA 3IBTA 1RZUA 4EX6A 5ES4B 1XRMA 1CUUA 3QNWA 1AZSC 3FAKA 4IJVA 4EY6A 2DBRA 3GYGA 4O4IA 2BSAA 3EXAA 2QR2A 1QS0B 5BN1A 4K8OA 3UUWA 4PX5A 2JJ2D 1JFTA 2IXAA 3T15A 3R5HA 4FYHA 4RVNA 1POXA 4Q1FA 4JOBA 2GNPA 3RBZA 4FYPA 1E3IA 3VNRA 4KGZA 2YMMA 3WK5A 2QENA 2F9FA 2CLIB 3JWIA 3RHZA 3N8DA 1X1AA 3L1IA 3ZZUA 1RLOA 3BSWA 1KQOA 1QX4A 3UK6A 3JTEA 5EC8A 1L4HA 2PXXA 5DW3A 5EZQA 2BP7A 4HS4A 5EINA 1E1KA 1NW5A 1ZJYA 4MW7A 1Z4QA 2UUOA 4DPMA 3ZLJA 1JN0A 1YL6A 2NV2B 5B3KA 5EXPA 1CE8A 1U3GA 2J9FB 2Z2IA 4K8RB 1QHNA 2GN8A 5JRZA 2IW3A 1EK1A 2O5RA 4WERA 4E7OA 4YCBA 4UVEA 3O03A 4C6SA 4D0SA 2DQ4A 3ROGA 3AKYA 2A4KA 4LFCB 4KK4A 4TLAA 3NT5A 2R85A 2J4DA 4LVUA 1J9ZA 3EIWA 4AZ0B 2HPAA 4RK0A 2Z2ZA 1WB9A 3JQ7A 3TCNA 1XN1A 4IOKA 5I8WA 2AYXA 4HDKB 2OYRA 3T5CA 2A3NA 1F2UB 5BMVB 1X92A 4HOYA 2VAVA 6Q21A 1FTQA 5IAGA 4IDBA 3AILA 5K0LA 3RVMA 4YRKA 1ZGHA 5BVGB 4BNJA 1KQPA 1RAGA 2BEUA 4JJEA 2N0SA 1EVQA 4GR4A 4OHFA 4EB8A 1FNNA 3EYWA 2YHIB 3JQFA 4OJTA 1NULA 3KJEA 5HKLA 2AN5A 2ERXA 1X15A 4NATA 3RTCA 2CE7A 1SBZA 2JI8A 1ZP6A 2DTEA 2Y4NA 1A2KC 4JSRA 5DGIA 4LQLA 1WOMA 2LDXA 2QN9A 3MTAA 1JKJA 4E12A 3SEQA 1JL3A 2BMEA 3FNFA 3OE7D 3CPJB 4KLZA 4DEVA 5JAHA 1WW8A 4ISBA 4YJHB 1WLYA 3K9HA 1RWBA 2WAMA 4JR1A 1PLKA 2ZI4A 2Q8QA 4BNZA 4RJ2A 1PN3A 4DCMA 1H4VB 4DM3A 1TEZA 4YMUA 3D7RA 3QENA 4FOTA 4M4SA 4NCBA 5BW4A 2JI9A 3OICA 3U1TA 4TTTS 2CJPA 3T9CA 1T6YA 2Q9BA 1Z8DA 2R751 2WJWA 4Y1EA 4AROA 5FLKA 4C5AA 5D1NA 4GI1A 3LF1A 4H0CA 4OQ4A 4ARZA 3Q4GA 1FDRA 2A1IA 3EVTA 3BCHA 4HTAA 2Y68A 2BN4A 5D01A 1KYYA 3VC2A 1RD4A 4BQFA 3ZD7A 2HO4A 1W36C 3LLSA 1X14A 4BGEA 3GVCA 2LIVA 3EASA 3ZH2A 3KJZA 3MIZA 3QXJA 3Q1LA 2HA3A 1H0RA 5K8IA 5G41A 5AHKA 1RAIA 1Z12A 1I9CA 3EIFA 4DIMA 4BNGA 5BW8A 1QFMA 5BYKA 3D8HA 4BNUA 2PWPA 2QROA 4UDXX 3RVPA 5CYPA 3UW1A 3UBMA 4MDHA 5JZ9A 4DV6B 4FKBA 1PE0A 5F2EA 1NMEA 2JFPA 3MUEA 1FRNA 2JJMA 3QY9A 1PLLA 1DPFA 3ZN2A 2ANCA 3WIBA 5HIIA 4UDYX 4TN5A 2EBFX 1F6BA 1FCJA 4FXPA 4UULA 3KAQA 3IBSA 2QYSA 2J45A 4C88A 2VTVA 4LE0A 1XEXB 3GBSA 2DWUA 2QMYA 4EIWA 4HEHA 1XPJA 3P96A 1DHTA 2BEVA 1Y4UA 1P7PA 3PLAE 4FYYA 3QFRA 3G2KA 4HRAA 1V5EA 2YY5A 5FHRA 4FYIA 1KHHA 2AT1A 2W2QA 2Q5EA 3P0JA 3ZE0B 3BQNB 4R1UA 3SP1A 2EP8A 4KK3A 3S29A 3W05A 1J33A 2FMTA 3CWZA 3OJOA 3LZCA 821PA 3IJ5A 2I3ZA 3TB4A 2KBEA 4PTLA 4EJSB 2RCNA 3EVBA 2GCGA 2YWBA 4D92A 3B6ZA 2W43A 1T9GR 2C3PA 3LCUA 5ADUS 2H1WA 3JW8A 4QTYA 1SHKA 4MUBA 2XT0A 1E69A 1UPTA 2NZWA 4LXUA 4MV1A 3PL1A 3LH5A 1BEUB 2ZQ5A 4TMFA 1R1DA 1ECGA 4PC6A 1GNQA 5GM1A 3KQNA 1IUOA 1FFAA 4GC9A 4PFKA 1V7ZA 3PKJA 4P2BA 3H9CA 1RBZA 3LPDA 5FQNA 4E08A 2IHZA 1JXMA 2HJRA 2E82A 3FZGA 1W6RA 2BDTA 2QG4A 3C45A 3NEAA 3O8QB 3PFNA 4PCLA 4D3XA 2NYAA 5CDYA 2XXJA 3N87A 3N2EA 2O8EA 2A0UA 2V58A 3REQB 1EP9A 2CXUA 2RH8A 1E7SA 3K4PA 3R76A 3CPSA 1SUBA 3P0FA 3E58A 1G8PA 1K5HA 1G42A 3AKCA 4BDSA 1RI1A 3AEKA 4ZQIA 3RRZA 3B8HA 1E8DA 1QVRA 2F67A 4I4LA 1E0JA 2V8BA 3I62A 3IVXA 4LPKA 5DDIP 3T1TA 4GBGA 5JAQA 2PRSA 2IZOA 4FDTA 1G8MA 1H65A 3GN1A 4G5OA 4WT7A 4CKEB 5AKLA 3MMSA 4GAEA 4IIJA 1H2RS 3QEOA 1ARZA 4Z9FA 1N92A 2DF8A 2K7ZA 4PO1A 3R3ZA 4P32A 4M1YA 3U4CA 3UZUA 2R00A 4BVEA 1AO3A 3HP7A 3CCFA 3FNRA 1L7VC 1JSCA 1UF9A 4OI2A 5DXFA 4AJPA 2IS6A 3I01M 4E31A 1CF2O 3BMQA 4OB8A 4DLNA 5KMGB 1E6CA 1SCDA 5HGJA 2G7MC 3GX1A 3GH3A 4EO4A 2VQSA 4W5OA 2ZAGA 4HXFB 5FPQA 3VOTA 2ZJ8A 2EFHB 2W2PA 3V9AA 3L0SA 1G7TA 1M8GA 2HBYA 2YQ4A 3D6JA 4OCZA 3WIUA 2WM2A 1XF9A 3LBAA 3AF5A 3KWJA 4GQAA 2HSDA 4XEUA 5C5IA 3UJNA 2AX3A 3L8EA 5HF8A 3BGVA 3CXUA 1A7KA 2V6IA 3EBPA 3MCVA 4BLPA 4UM9D 5JCPA 2A57A 4WFQA 1HRDA 5CNMA 3FYUA 5EE5B 5FJIA 5A4AA 3T5AA 3VUFA 2AG8A 4YV2A 3DHVA 1YRAA 1W49A 3ETNA 1KAOA 4FFNA 2VNHA 4MRAA 3VU9A 4JV5B 1BKSB 1U81A 1P9OA 1C1XB 2JAPA 2CEKA 1KL7A 3L4SO 4WRRA 4OO3A 1A9ZA 1C3LA 2QLJA 3RFXA 4BMXA 1QRTA 4JXKA 4P35A 1PGOA 1TTQB 5EYPB 3HB9A 2VYCA 4OLBA 2FPUA 5F9FA 2LZ0A 3ONEA 1WAMA 4HB0A 3ZDCA 2NW6A 2ZRQA 2PD3A 5DLYA 4B83A 4CKYA 4N49A 1KK2A 5ICMA 3GP5A 4PO9A 3VO9A 2RHOA 1R0KA 5FO0A 1YR3A 2P6OA 4ZEOA 2GBPA 3SYTA 1N2CB 2A9JA 4W5NA 2P90A 5KO2A 9LDTA 4HDQB 1MENA 3ORYA 1GPJA 2IUUA 2IZ5A 3F9RA 5DHTA 1ZNXA 4B5KA 4OXKA 3U61B 3T38A 4QXPA 2OCBA 5CDSA 3GRKA 3NIWA 4C89A 1Z16A 3A05A 4PZ9A 5TARA 3WOHA 2O3TA 2PQ0A 3HSSA 1Q3TA 4MCHA 5MDHA 1W94A 3H5OA 3HJCA 4HADA 4XTCS 2BZSA 5SICE 4URWR 3EPPA 2JIBA 3DW1X 2IBSA 3E4DA 4FDAA 2YJNA 5E1OA 4F6LA 5BSEA 1E4YA 4KJXA 1KO5A 3TZBA 3W78A 1BXKA 2FZLA 2IYSA 3ORRA 3OZVA 1P1KA 2PXHA 2ZE5A 3ADKA 4MVJF 2I7XA 4A15A 3IILA 4ILEA 5ESRA 3LF2A 5EA2A 1SQ0A 5CFLA 2GH1A 5F3RA 3QKRB 2LXNA 3GNLA 2FW9A 4OJNA 2ZI9A 1RZ3A 2QT9A 1TT5B 3OLVA 2PZ8A 3VTFA 1YVDA 3P19A 4XPIB 2PMCA 3B9RA 2FWPA 4NHOA 3NMUF 3E9NA 2RGDA 2X0NA 3E9RA 3TX2A 1G5IA 5K0GA 3K71B 4NV0A 1QHFA 4FKMA 1F8UA 4DYVA 2AFHA 2B61A 2FW0A 1DKQA 2E18A 5DULA 3Q40A 1YWGO 3Q2IA 4L7VA 1CDZA 3AZOA 2A9VA 2RJ3A 4F06A 4QODA 2XAUA 4RQTA 2IRWA 4F5YA 4EUHA 3K09C 1TVMA 4X7BA 3H6GA 4ZZ2A 2C4TA 1G20B 3KUDA 3I9MA 1R0YA 4ITUA 3L5OA 2O6LA 4KWHA 1T8YA 1CJSA 3AEUA 4Q3CA 3ML1A 5DP1A 4PAOA 5GVRA 3L92A 4OFXA 2VJOA 1G21E 1P8AA 3O26A 4Q3NA 5C7LO 2IU0A 4JYZA 1YVRA 4TTIA 3K0AA 4ZRMA 4L78A 5J5CA 5HIJA 4HJXA 1UBUS 1GLVA 3N0VA 4RE6A 4WZAE 2AGVA 3ZLUA 4BU0A 3ZVNA 4DCGA 4FCTA 3FUCA 4RY8A 1V71A 3T5BA 1ORDA 3P9IA 3WGGA 2QU8A 4N0DA 3CE6A 4OBEA 1NJ1A 1WUTA 2NZUG 1ENPA 1QKKA 4UUPA 3SKXA 4PCVA 3KT6A 4CM9D 4GPTA 2ACVA 3OCZA 3LVQE 1TUGA 3QBDA 3BK7A 3UQYS 2OD2A 3UMYA 1LNSA 1VCNA 3AGPA 3C3CA 4DRXA 3IKJA 3KALA 5EWMA 4D5EA 1VSUA 3LQRA 3AUUA 4I81A 4F60A 2ZM6B 2G4CA 3JQQA 2H2AA 1D07A 1M1NA 3AKDA 3M6AA 3G0DA 4H77A 1OV4A 3AUTA 3TLCA 4FLMA 3ZBTA 1N2EA 4Z3KA 3BS4A 3TOXA 2ZB8A 5CB6A 2CB0A 1B26A 2QNIA 3B1XA 4CQLA 3OUUA 4FFVA 2X6RA 1GGEA 2VIIA 2NQTA 3KKZA 4HAXA 2V97A 4RKRA 3SC3A 4DJTA 4DR6B 7MHTA 2A59A 3GPBA 4RDCA 3E8SA 4KQ9A 4F9TA 1CNMA 2F48A 4QUBA 4FSXA 4J6EA 3DBVO 3Q15C 4KGXA 1IWOA 5DVZA 4G9GA 3FPHA 1LPSA 2GXUA 3T3PB 4ADSG 1PL6A 2D8AA 4BU1A 3FKJA 3W7BA 1F3LA 4D3FA 3TLZA 1VA4A 4FI3C 5EZSA 4RKWA 1PUJA 3CU5A 3H8SA 4LCEA 4CQJA 4UZSA 1SIBE 5A4MS 3OC6A 2DE0X 2AHRA 1ZG3A 2WNSA 1BC5A 4KN8A 3HEAA 1OA0A 1ZH8A 2JLCA 1QM5A 3JSAA 2BY4A 1ZCAA 3KSUA 2QM0A 5DE3A 3FYUB 3M0EA 1TVKB 2VDOB 3SIPA 3IEMA 2O0HA 2HN9A 2ONZA 3MGGA 5MGNA 4CMEC 2W8BB 3NONA 2EWWA 2OCIA 2J0VA 2Q4EA 3N2IA 4QOIA 1G41A 5THQA 3KQHA 4DV5B 1ZINA 2N1BA 1G6KA 2R8BA 3L6EA 4ZV9A 4OHWA 4IW3B 4HWTA 4B0OA 1N2SA 1A5ZA 3O93A 2VHXA 4V0MA 5H4GA 5JNRA 3Q10A 2BSQA 5DI3B 5DHFA 1VJ1A 4CTMA 4M9SA 3A0RB 1UKEA 3R0QA 1XTIA 3JQGA 2NGRA 2N3ZA 3OCUA 2ALJA 1T1JA 2I7VA 4H4EA 5BVHB 3SQMA 4D3DA 1V8FA 1E2MA 2OO5C 5DNUA 1OZAA 3EVFA 4FN5A 4UARA 3ED1A 4OGLA 3HMKA 4II2A 4ZJZA 2LR0A 4PQRA 2A1UB 1I2AA 2WSMA 5FFNA 2TSYB 3HXTA 4OHKA 3V97A 1UAGA 2UUAB 3RUAA 5IF3A 3JQ9C 3EH2A 1T2NA 3J7TA 4MVJE 1XZIA 2Z5LA 1YI0A 2XYVA 4JBYA 2B4KA 4FHCA 1RI3A 3R9WA 4AY5A 2VPWA 1QF6A 1KGDA 3DO6A 3W3AA 4LNHA 1DOHA 4A73A 3U48A 2YKGA 4CG1A 1KH3A 1CDEA 3QFCA 2XKBA 1XQXA 4CLOB 5NLLA 2UZ1A 3OLXA 1XD2B 2WYUA 4HGPA 4MUNA 4O8CA 1G98A 4XUGB 4Q00A 4WJKB 1JHRA 3O2SB 4REOA 1VB3A 3G2PA 6ADHA 1UZLA 5JXHA 2NT4A 1PS8A 1R6XA 2C2GA 2WINI 3P8ZA 3AR2A 4HWOA 1JLLB 2G4VA 4FT4A 4H7KA 2IBTA 4V0NA 1R4ZA 5C8YA 2V1XA 4G0UA 2ATVA 1FNCA 4B3FX 4Y3UA 3ECCA 5EQDA 2CWDA 3RO7A 4BNLA 2PJRA 2PQ2A 4Q3KA 1Z6AA 3BWXA 1N6OA 4OMUA 5IH3A 1MBZA 2WG1A 4CTOA 2SCUA 3IH5A 1G9SA 4B8ZA 2XMQA 3EAGA 1T4BA 4DL9A 4EBBA 1SHTX 2W8ZA 2X4IA 3OE4A 4WGFA 3NFYA 1ZICA 2FUNB 1OFUX 3KPVA 1KDYA 4D97A 1H2FA 2WTUA 1JWLA 3B78A 4MS3A 4S12A 5K0ZA 4IVRA 4C4XA 5JTUA 3U5ZB 4BPBA 3E9YA 3PRHA 1SUIA 5CDTA 3MRTA 1XDZA 1GPDG 1Q0PA 1Z6GA 1KETA 1HE3A 3KB1A 4AAYA 4YIHA 3GJ4A 1R64A 3LY8A 4E4YA 4R2XA 1EQUA 4DBLC 4YP0A 4YMHA 5BUZA 1T5DX 3DMDA 1J42A 1JEQB 2J46A 2IWRA 1NFRA 5JBQA 3KVRA 4CM8A 5K6AC 4YQZA 3W1VA 1CHNA 3W6OA 1LBQA 1FUUA 2JFFA 2PQMA 2XB4A 3U44A 1J5PA 3KV1A 1DJQA 4H1HA 2A1TS 3HDJA 1ISFA 3V8QA 2YWGA 3ESZA 1X7XB 3MOIA 2B35A 2WSLA 1DEHA 2A14A 3RF6A 2CXOA 2QE6A 4PLPA 4I4NA 2PUDA 3PX3A 3AU8A 4HYQA 3HABA 3NHMA 2GTHA 2Y0BA 1UXIA 4ZT4A 3IV6A 3GLHB 1ZEJA 1XDWA 3OA0A 2R00C 5LLDA 3DC7A 1SZDA 4G5HA 1Z5ZA 1J9EA 4W1PA 4J76A 3BZBA 5G1PA 1RQLA 1G66A 2UDPA 3KDAA 1RRCA 1E3WA 1E1DA 3CMMA 4WCVA 3I45A 4JP5A 1E2DA 2GRUA 2C4UA 5HOQA 2D7JA 1OX4A 3HN7A 4NMLA 4U6SA 5D6NA 4YI5A 3USCS 3ZQJA 3AVPA 3NTXA 4LI3X 4RETA 1E60A 2XNSA 3FTDA 4LWOA 3BGIA 4UQPA 3VNSA 3VAYA 2WM9B 3IE1A 2GF0A 2IH4A 2IS1A 5DXAA 4PR0A 3IYLW 3PYXA 5FB3A 2C9MA 4P4LA 1H2YA 5I9MA 3RWMB 3ZV3A 1GAXA 2Y77A 5JJCA 4IDQA 1D1QA 1YZGA 5DOZA 1Y3DE 3A1CA 3V4LA 4DLZA 3T0FA 4MSUA 1N2XA 4HDRB 4IKEA 1XRQA 4YMLA 3HTXA 3KUXA 1W9MA 4MQLA 1X8KA 5JXGA 4KKXB 1ULZA 2XW6A 3DFKA 3NJRA 3VR4D 5C0OE 3X0DA 1W25A 4MS1B 2PLFA 2NADA 2CYBA 4B5LA 3PDUA 2C94A 5HFAA 1TIBA 4W5JA 2NU6A 3ZE1B 3AL0C 4WK4B 2JNWA 5BRAA 4BX0A 2G8LA 3QM1A 4RXTA 2C9OA 4A2QA 4C2UA 1JU9A 2OXCA 2W2NA 1GV1A 2ZJOA 1GR1A 1N3LA 2R65A 1MG0A 3WLQA 121PA 3WLJA 1F17A 4G1UC 3W5SA 2A9QA 2EP5A 1LJUA 3ZXXA 1E0KA 3I05A 2PMEA 4JL6A 5DHSA 3N2ZB 4CKWA 1U6IA 3CBQA 4KQWA 2V6FA 3EQ6A 1LNQA 1A9RA 3CNBA 4Q7QA 4RANA 4RXUA 5TXGA 5FXMA 2IODA 2RHTA 1WG8A 4PRLA 4B31A 1JV2B 3P9ZA 1P5JA 2EQ5A 2GEVA 4MITA 1W6UA 4OA5A 4ALLA 2GK4A 2FCRA 1QHXA 3RRMA 3UH1A 1QOQB 4LF5B 3A4LA 4ZGGA 1R4MA 1D7AA 1OPXA 2AQIA 2MU1A 3P9RA 5HBRA 1C1DB 3LVFO 3EHEA 4TLEA 3MSCA 1FZTA 2R44A 5EIWA 4PFJA 4C0JA 3QF4A 4M3NA 5L3QA 1FFCA 3O8QA 2CLCX 4N6GA 3MJHA 4KCGA 5L40A 3FOEC 1P2UA 2PS0A 4HGZA 3AYXB 1JG4A 1C4OA 1OHHD 1RKUA 1BS9A 1U28C 1WUJS 2KYRA 2NVWA 3BRWA 3CKLA 3GUUA 2VJDA 3GZTB 3PE4A 5AR1A 1Z7EA 3VU0A 3ZCRA 4Y98A 1JR3D 1K6MA 2XOKD 2ZATA 3P2EA 2QJOA 4S3MA 4U39A 1PJ2A 1WMFA 2GLUA 2GEBA 1RIFA 2J6IA 3OM0A 721PA 8OHMA 1MC1A 2A35A 4GXQA 2CHUA 4KEAA 1ZEMA 1JDNA 2JAXA 3B6IA 1T4DA 3JQDA 3ODGA 2XWPA 5F98A 2AN1A 3G8CA 5SYNA 2B98A 2RGYA 3CO5A 3SQWA 2OHXA 1PBTA 2C9YA 4QYXA 2RBEA 4OSPA 2WHPB 3EOZA 5DB4A 2Q2OA 1D4AA 1ZD8A 1YRWA 2UZ3A 3OKPA 4KQKA 3TEMA 5AM1A 3JU3A 5HRUA 4IQ4A 1B0UA 3AF4A 1U1GA 1VDMA 2RJOA 3C1AA 1Z36A 4OQPA 4REQA 1R16A 2XCIA 4YNBA 4ZOEA 5DX1A 4HJRA 3E81A 4R1OA 4XVUA 3ETGA 1JX6A 4KX3A 3W6ZA 3ZGYA 1AJEA 4MQFA 1MAHA 2UV8A 4PTYA 4KFUA 3SQNA 5IVDA 4CQLB 2WUVA 2BFEA 2OR3A 4WBSA 1R8QA 3N8KA 1JDTA 4NI5A 3ZWNA 1YB5A 4YI3A 2QEQA 4TMZA 2RCYA 3O3CA 1L5KA 3FDFA 3RC7A 4GPEA 1RTKA 1I0LA 3EJWA 1RJEA 2H65A 4BFTA 1DGQA 2HDHA 4OYLA 4RCZA 1R4MB 1WMDA 4YRFA 1ZLXA 3ADCA 2VDMB 1LLQA 4OD0A 3PX7A 5JG7A 3P71T 1AXRA 4TX1A 3IAS6 3SBOA 1M83A 3O4GA 4RSRA 3A10A 5A9RA 4L8LA 2P9JA 2YOHA 3L1JA 4B6OA 4L5IA 4JD5A 2R97A 3BFKA 1XJWA 2FMXA 4L0MA 3TLBA 4ZYTA 2BTQA 4AKEA 2WIGA 3E9EA 1GNRA 2XTJA 4G97A 1FDVA 2ZKLA 4TL7A 2X13A 3GUYA 1LX7A 1QX3A 5ESDA 3ZIAD 4HNRA 4MMXB 1XPOA 3K0FB 1MORA 2FFAA 2BJVA 3L05A 1XGKA 4HAWA 1M33A 4LYGA 4RZQA 4W1RA 4XSHA 1S89A 1DRUA 1RCTE 4XW2A 3U17A 3VH2A 4HDMA 2I34A 3OX2A 4BBZA 1PEYA 2CNBA 1N2OA 1CJBA 1NTOA 5EI5A 3DP9A 1R2QA 1KIAA 3KJNA 2PBZA 3OLQA 2VF5X 1QZZA 4GOMD 4JGIA 4Q7MB 5AI4A 4RTSA 5JFTA 1MO2A 1T5OA 2P69A 5DLQC 4A9AA 3WSWA 1UP7A 3JQ7B 3RYCB 2REXB 4JHLA 4YH1A 4N41A 4QFDA 3D7LA 3OAAA 4R68A 4WXPA 1JH9A 1V11A 3J80A 2UVQA 1BN6A 4TT3A 4IWNA 1NJGA 4ENPA 5JALA 3MINB 4GSKA 2QBYB 1WJGA 2CYCA 3GLIA 1K4KA 2GD6A 1O6BA 1UQRA 1W2HA 1KBOA 2GN4A 2O2HA 2JJYA 3DFMA 1VIYA 3CNHA 3ESBA 1W46A 3EVZA 2VPZA 1AF7A 3GDHA 3H3XA 5CTJA 2O0JA 3I01A 5AOVA 3RS7A 3SX0A 3AW9A 2NO4A 2XB8A 6REQA 2JZCA 2UVPB 4XD7D 4IH9A 5FBVB 4BBAA 5FTNA 3IR7A 3NB0A 1GV0A 2ZRIA 4UE2A 4E5MA 5CVCA 3SVLA 2HW8A 4QM6A 1BD4A 2YOGA 5A0TA 4O29A 4TYYA 1ILWA 3NKFA 2F1HA 4RS4A 4GGPA 3B48A 4YMIA 1X2EA 1Z38A 1E20A 4YRLA 5IBPA 4E5UA 1RJ9A 3CB4A 2AFHE 4MROA 3M4JA 3LX8A 1SXPA 2PRIA 3IIEA 1CQZA 1D2GA 3JYQA 4I9FA 1XNGA 5KAMA 3OIVA 2AW5A 3HO1A 3PICA 3IT2A 5DN6D 4YJ3F 5JJKA 5JD3A 4M53A 3AF1A 5FA6A 1N5JA 4PINA 1V16A 3UENA 1IZ7A 2J41A 2ZE8A 3DEKA 2C00A 3CLRD 4LOAA 4DCCA 2VYFA 2XBMA 2WJGA 4YXWD 3LC2O 2YRXA 1FQJA 2VSXA 3B36A 3BM5A 4OHOA 5CGQB 1RYNA 3D54D 3KO8A 4Q3LA 5CAEA 1SXJB 4UEKA 2ZI7A 4P7JA 4X66B 1Z3CA 2RH9B 4FBMA 4I14A 1DJOA 5DNVA 1YUBA 4H7FA 4MWSA 2OQ2A 3KHKA 1RTTA 4GZ5A 2Q1SA 1GSHA 5HJ7A 1P2SA 2V7EA 2YMLA 4L9SA 4PHGA 3PQCA 2ZBRA 5A9SA 3KL2A 2AKYA 3ZU5A 4A6EA 5I9NA 4F93B 2AYZA 1U0SY 1U7UA 1XVVA 1EB8A 3EDQA 5A5VA 1QGZA 2IF0A 3C3BA 4QFMA 3BIJA 4Y0NA 1SCQA 1UFOA 5M29A 1TNDA 1KSHA 4W5QA 2DPLA 2YW2A 2ZYIA 5I7OA 2OUKA 5GZ3A 5EMLA 3V8BA 3IEUA 1E7MA 2RI1A 4WXHA 1BXRA 3D5QA 5HRCA 1Z0SA 4NK5A 3UPDA 4DJ5X 1X7YB 2C99A 4ETIA 1LBHA 3U0VA 5AD1A 3O4JA 3NHRA 4DLYA 1EBFA 2PNFA 4WZBB 5LA6A 4BFSA 5CA1F 3JD0A 5ELXA 4Y2XA 1B1AA 1HYBA 1QCZA 3WIEA 1YJAA 2HV8A 1GQFA 1DG1G 1IB0A 4L16A 1KPGA 5KNDH 2WQ7A 1UJNA 1NASA 4L8WB 5GGYA 3RRYA 3C1OA 2ADFA 3PITA 3NANA 4I4IA 4KLNA 4MS3B 4UU1A 4ZVUA 5GM2A 4ZI5A 3NHWA 4R51A 3AR4A 5BW6B 3JWGA 3M1YA 3VX4A 1P4SA 1YBAA 5CEEA 3BJIC 1N6PA 1LI5A 3GJ6A 2BC9A 2PK3A 3GIDA 1JZSA 4HEJA 4MPDA 5GOZA 5JCOC 5LMUB 1DZIA 5F7XA 2AZXA 2CL5A 1VTKA 5HSGA 2P6PA 3H9UA 1P1IA 2HT6A 4EA9A 3DOOA 1KZ4A 3FN4A 2E1PA 3IBYA 4MWZA 3T5GA 1Q0RA 3RSGA 1Q1GA 1KO1A 4F9EA 2IEZA 3OEYA 2O8EB 3WYEA 1PNVA 3FGNA 2YIJA 3OZGA 4B71A 3T7IA 4UBOA 4C2AA 4C4RA 4RMNA 1F7VA 2J6HA 3LS2A 5KQSA 1U3VA 2G5PA 4BXOA 1IXKA 1GLNA 1LUAA 2AC4A 3R41A 4QUDA 1W0JD 2H63A 3UGTA 3ZYZA 4DADA 2X3YA 1XXHE 5CA1B 4PZPA 5IM4A 1RYDA 3O3MB 5C7YA 3LY5A 3MRVA 3AGQA 3F5FA 3ETCA 1RLJA 2F7SA 1N7IA 2EX4A 4EKNB 3HVIA 3HEBA 1S1MA 4LZPA 4W9NA 3H9JA 3NNNA 2XITA 1KYQA 1XLUA 1OWMA 3D1VA 3DYIA 4HNTA 3WKCA 2D7DA 5EWJB 3NVDA 4R83A 3C39A 2IIPA 2XJ9A 3DDHA 3R0VA 1VCHA 2GYVA 3IRVA 3K1AB 1BRMA 1OWLA 2H2HA 1H8EA 3K5PA 3GOQA 3OMXA 1K4MA 3KYDB 3Q9SA 4MDFA 3HCRA 1PG2A 1FRVA 1XAJA 1EUCB 1BVHA 4C14A 2P4EA 4EPTA 1NVDA 2HA0A 3R7SA 2Y6UA 2OV3A 5K3FA 4BNWA 1XNRB 1ONSA 1NVMB 3FLEA 4JBHA 4C7MA 1CD5A 2DHCA 4EG5A 1KAHA 1WXDA 2VUIB 1L5GB 3UAGA 2C4NA 3P52A 4JYBA 4MKXA 4JMPA 4RZIA 5EEHA 5BQFA 1FFBA 4HDOB 2XODA 1DQYA 1T36A 4RYLA 1JUDA 4LMPA 1Q3HA 3FXAA 3DV0A 1YDWA 4KV9A 4YPFA 4NQZA 3DKKA 4OK3A 4PIMA 2VO1A 4RMGA 2QPLA 3QX9A 1HQDA 1PX0A 5EXDA 2RC6A 4JBWA 3RC8A 4KRFA 1DKNA 1ZL0A 1RLTA 3MHTA 1IEXA 3EZGA 1TQ2A 2WSSA 3KPJA 1HT2E 4IJUA 1NC3A 1VGVA 4PPYA 2XA2A 3TZQA 4P81A 1NA5A 2DH6A 2XWJI 4FNAA 4QEDA 4BNDB 2JLSA 3SDZA 1H6AA 1P0PA 4ND2A 1H9AA 1OJ7A 4P80A 5CFPA 4EJ0A 3DFIA 4MKGA 4URXR 3OQIA 1H0HA 3OPVA 4L3OA 2FPPB 1TMYA 4I6GA 5LBTA 1C8BA 2IYPA 5I8ZA 3FYCA 1Q95A 3A1VA 3SSNA 2XGMA 5CX4A 5TLSA 3JQBC 2ZBUA 5A3QA 1QKJA 4D9KA 5B1HA 5ISMA 1FBNA 4QU8A 5BN4A 1YD7A 3IDZA 2WICA 3WGNA 1IU9A 4G8DA 3PNKA 5GAJA 3SHVA 5EWLA 2ZBPA 4R1SA 2ZIVB 1ATZA 3RVKA 4B1FA 1Z8FA 4MVYA 1XZEA 2XE6A 1TPYA 1SCKA 4F0JA 4G41A 1VXRA 3R20A 4MOWA 4AZWA 4H31A 4BFZA 3RSFA 2PCLA 1K5PA 3GVXA 4HLUA 2J6CA 1BJTA 1JWBB 3HACA 3NYQA 2QL9A 3ICVA 2VHWA 3PC7A 4L8FA 3EGEA 2E4UA 2Q6VA 2V7QD 4PGMA 4Q1DA 4CKZA 2ZJBA 4MR9A 3TZKA 5A4IS 3U4QB 2IP4A 1L4GA 1B00A 1MT3A 4GBMA 1Y63A 4XUDA 3VJMA 4BE9A 2EFEB 4C05A 4D81A 5IT9A 2A5GA 3GARA 5J3JA 1WCIA 3EQ2A 2ZJ0A 3UOWA 4Q19A 2IV3A 4NSNA 5DWQA 3SYNA 4BTLA 2OCYC 5F7JA 5FBZA 2HR1A 3PDHA 4DBLE 4ND1A 3G59A 4IOLA 3I4CA 1IBCA 1GZ3A 1Q0HA 1W88B 1XLTC 3L0OA 4OLJA 2PBLA 2PA3A 4JT9A 1QRSA 1YFZA 2C8JA 3RVNA 1HMYA 1EK2A 3PSAA 3A4YA 4YONB 4A2CA 3D6NB 3GP8A 1JTVA 1Z2CA 4A03A 1A5BB 1S02A 1I2CA 2G76A 3ZWKA 2WAYA 2FHPA 5H9VA 2YFKA 5ALYA 3EZ2A 1PS9A 2YNMC 1MAWA 5J4YA 2OGUA 2YZKA 4PYLA 3BA6A 5JCJD 5I7VA 2YASA 2H11A 1E8MA 1L4NA 3EVAA 1D6JA 1QKIA 2B5OA 2ZJ2A 5AOBA 3FMPB 4A0FA 4LF6B 3JY6A 2WYWA 2ZRMA 3CSUA 2BI4A 4HVAA 4RD1A 4MHOA 3FYTA 1O4VA 4BX3A 2FPMA 2IX9A 5K8LA 4HWGA 3C7TA 3BJMA 1ZVJA 2ZE6A 2YY6A 4D0LB 1KF0A 5DOVA 1IQPA 1R10A 1T5BA 3T1VA 1GTRA 3U7JA 4TTQA 1XQWA 4XRRA 3ZDRA 3DZKA 4ZAVA 2AIRA 1QOZA 3W1WA 1V8OA 4ME6A 1AKTA 3I9JA 3KDPA 1T3TA 3DAYA 4NPCA 2O23A 4CCWA 1KR5A 1P77A 3IUQA 2GKSA 3Q3HA 4O2LA 5C5CA 2HX1A 4ZOLF 1CHDA 4RXMA 3V3KA 5LYJF 4QL3A 2BCJQ 1J56A 4L4YA 5J1SB 4QREA 4PGHA 3LC0A 3AB8A 2IU6A 2DTDA 1T2EA 4AZTA 2YJGA 3EEYA 2IGTA 3W8RA 1XMOB 2XNDD 4S24A 1ZM9A 4XE5A 4K28A 4BZZA 2I2DA 1VBMA 1GP2A 3QUCA 1XKLA 1NQOA 1ACMA 1GCAA 1OLUA 3FCYA 4FNGA 2H0AA 4GRAA 2PUAA 1GQSA 3OFND 3ZXUB 2P2NA 3FSEA 4FGKA 3AHFA 3OD1A 4YMSA 1SA0B 2IEBA 2AMLA 2OM2A 3S44A 2WTEA 4UVGA 4C22A 4JA2A 2XGGA 3CG4A 5L3QB 1GT91 1VB5A 2A67A 1L4EA 2IIBA 2P9QA 1FXWA 3BH6A 4AXBA 1ESMA 1JILA 1CUYA 4FLEA 4LGCA 2G8NA 4N48A 3I8XA 1IJFA 4D26A 1AF4A 5CFQA 2B25A 1QPGA 1XKQA 1YZTA 2L82A 1DHRA 1PGNA 1Z88A 4V0LA 2CE2X 3FJYA 1DKPA 4BFYA 2YJTD 3L3BA 3QP9A 4Y8VA 4DGSA 2F1JA 3ZPXA 1K7SN 4K9PA 4OOFA 5JDIC 1MEEA 1VPTA 3TXYA 4ZIRA 5FWYA 3WYNA 2WZCA 3Q88A 1X1BA 4UVHA 3DONA 3A04A 3K20A 4UBKA 2GJ9A 2PGOA 3P94A 3L4BC 4IPTA 1PT7A 4DNFA 2KJQA 5LBUA 1MO3A 1XZNA 1E5DA 2YJ5A 4QRIA 1XK7A 1XRSB 4JYCA 5L3RA 4CTJA 2HREA 3RC3A 4ZYXA 4W7SA 3GT4A 2X0JA 1SQFA 1J8QA 3SZLA 3HS3A 3HCAA 2ZVPX 3DBHA 3NETA 3RE1A 2YNMA 5FI0B 4AN0A 1KTVA 2GR9A 2JLRA 3PUYA 1EFTA 4F4FA 1GZUA 2G63A 3RAEC 2POQX 1SY7A 1JQ3A 1A97A 2CXHA 4J0DA 3VDNB 4NMWA 2NQ8A 4J6FA 4WKGA 3TRIA 1BFDA 3K05A 4ENRA 1T35A 2K2QB 1TUEA 2OFXA 3OJWA 2BKXA 3N07A 2J5BA 4J03A 4U9IS 1QHIA 1UMCB 3SJ7A 1LF5A 2AG1A 1JG2A 2VUUA 3CQ9A 3LU1A 4FJ2A 4PZYA 3SS8A 2FEPA 3ICCA 3IO3A 2NX2A 4G1FA 1GGJA 3X3HA 1MB9A 3IR5A 1OASA 4IGIA 4J0HA 1W34A 1JAXA 3IQDB 3Q5EA 3EGOA 3S1AB 3C0KA 3CINA 1J97A 1OUMA 1TKRA 2E37A 1SVNA 2ZEJA 3DL4A 4N7BA 4RD6A 4U7JA 4BL5A 5JCJA 1A2BA 4UMFA 4DJAA 4HP8A 1DBPA 3I37X 3LYLA 3DUWA 5E9WA 3TZ6A 3UJ3X 1H94A 1L8LA 1JT2A 4CMKA 1EZ1A 2FRDC 1P19A 3OCVA 4MS1A 4ZANA 1A82A 5B1IA 5AOAA 3W3AH 5HQ3B 3NDBB 4MZDA 3R7LA 3GGSA 1GYPA 4MUEA 5F2KA 3MTGA 2M1XA 1OT3A 1QGOA 3M9LA 3V6LA 5BNWA 5JV5A 2GUWA 2Q3CA 3PQ8A 4KDFA 2VTKA 1HDEA 5A3JA 1C7JA 3A2KA 3K0CA 3ZR4B 1R6VA 1UDAA 5DWVA 4KQMA 3SIRA 4UU8A 1UK7A 2IXTA 3WY9A 1KWKA 2NXJA 5KZMB 2R8OA 4D3ZA 1FTWA 1J39A 2CUNA 3H1EA 4IIXA 1RC0A 4FHDA 3F5DA 3O3OB 4C7JA 5D3QA 2Z83A 3TQFA 5DW0A 4WX2B 1PZMA 2WWVD 3UKJA 2G77B 5DM0A 1SBIA 2QXUA 3I9V1 1SCUB 4EO9A 1IXYA 2B7CA 4RCYA 1U99A 4Q1CA 1JDZA 4S1OA 5F4ZA 1GN9A 4FGLA 3X1MA 1TU0A 1ZXLA 2R8EA 4G0ZA 2PL9A 1XZHA 2FFQA 4X8MA 4URZR 3SSAA 4BVJA 4R9UC 2BTEA 2XA1A 2H0RA 2PL5A 3G89A 1GDTA 1VE1A 3DWEX 4Q7EA 5DGHA 5PGMA 2Q3LA 5CRIA 5ILGA 3ND8A 2Q3FA 4KBGA 5FNVB 5JAPA 2JLQA 2FSIA 3C3EA 4IO1A 4YJGB 5D3MB 1YVEI 1JHQA 3NALA 2JFYA 4KAXA 5AXAA 1NI4B 3STYA 4YRAA 1SK8A 3ABZA 3VR4H 1D03A 1XMIA 3BMNA 1ZI8A 4M0PA 5GONB 3TOVA 3LQQA 4PTZA 4DIDA 1T0BA 3EXIB 1N5LA 4YO8A 1NLFA 2B83A 3DPIA 1RABA 2Z5FA 3OJXA 3OE7A 2OENG 4JLOA 4ND3A 3LC7O 4TS9A 3U3ZA 3WXMA 3E1KA 1LSUA 1QK4A 1T29A 8ATCA 4JUBA 5HW0A 2B4TO 4MHSA 3H19A 4M9ZA 4TKUB 4QARA 3EXFB 3BEDA 2EKZA 3H5AA 3HKCB 4RD2A 4D8XA 4EY5A 1AKYA 2HDWA 2RHCA 4W9NC 4OX9B 1TIKA 3ACDA 3QWFA 4MKHA 4JI5B 3UFBA 4WDRA 4JI2B 3QVXA 4M1EA 4N3CA 3A2LA 2QQEA 4G26A 4AKGA 3N0XA 3P7MA 4KITB 2I9KA 5DHUA 3LIIA 2AUMA 3PNVA 4A91A 3V42A 1CJUC 3P2IA 1RQ7A 1TEVA 3IPCA 2FPIB 5GQSA 1Y3CE 1DX6A 2HWXA 2IY8A 5FNVF 4C06A 4JYMA 1UWLA 3I2HA 1DEKA 4ED9A 1ZKDA 1GZ5A 3HQ4O 3X1KA 4KGDA 2ODNA 3D4IA 2ZREA 2J85A 1SK9A 3SC2A 1KDTA 1M8KA 1NR5A 2HI0A 4PWYA 1FMCA 1JLKA 4BO6A 4CM6A 4LDQA 3TD9A 3WK7A 1BIFA 3S55A 1N6KA 3AI1A 4MW5A 1CUCA 1T0UA 3WZLA 4EG0A 1FJ2A 5C31A 1UT5A 5BUSA 3CG0A 5JECA 2Q5JA 2FR1A 3ZGXA 1RKVA 4NBLA 3UJHA 1CE8B 1HFJA 1P1BA 2C7VA 3L41A 3RTAA 2W9XA 2JEYA 3BMCB 3EOAI 2X86A 4HAVA 4NC9A 1T5SA 4X94A 1NUAA 3VU1A 1E98A 1ZSVA 2A9OA 3MGAA 2ZUDA 1EHIA 3EGDB 2H4XA 3WWEA 1JDVA 3QEKA 1XCOA 2GYUA 2QVYX 3HB5X 4ESOA 3LL7A 1Z33A 4LRXA 3CWCA 2HTEA 1YQQA 2JJ8A 4NIMA 1AS0A 1JE0A 3HYTA 3HI4A 3PZBA 1QTQA 3TM4A 2E4WA 4PAGA 5EJ4A 2WIBA 1DC5A 3RC9A 2AXQA 3UG7A 1B0ZA 1X70A 4PXAA 2C7GA 4F5DA 6AT1A 2HJHA 2XSZD 4UQLA 4IY1A 1RCFA 1YR9A 2AKEA 4YJGA 2BUAA 1C9MA 1G20A 5E9AA 3ZUGA 4TS4A 5ANRB 4A0GA 3FCOA 4JJ6A 5AVRA 4YN3A 4XIJA 2ZYVX 1XZPA 1KKLA 1TGYA 2B4RO 3FNQA 1PSZA 2EW1A 3HCDA 3O38A 4JIGA 3ZU6A 3AI7A 1XWWA 5JQGB 5CH3A 2ECKA 5KJCA 1MEJA 1H6DA 1VOTA 2V7PA 3CT4A 3LLUA 1NUUA 4JP1A 4LJSA 3ID6C 4PZLA 4BZPA 4A8PA 1UJBA 4HQOA 2FUKA 1TU3A 1P45A 2K4MA 3K2EA 4FFPA 1NSTA 3NOXA 3R40A 3LT2A 4KHZA 2PUGA 3CRQA 3O94A 4O02B 2REQA 2BJHA 2ECQA 3PCXA 4MUFA 1ZGGA 1RBMA 2EERA 4HNAA 2IOYA 4KFRA 3AFIA 3VDXA 5M5BA 2AD1A 1THTA 5EWMB 1M6VA 1J8FA 3OIWA 4DLUA 3NHFA 1AM4D 4MA0A 2C8LA 3FNGA 2H08A 4NYMQ 5HDQA 5A02A 5EQJB 4UMEA 3P20A 4IKOA 1E1RA 4YROA 1GKKA 1IG0A 2VHUA 2YVUA 3G0GA 4RENA 7REQB 3CF4G 2XIJA 1QHEA 4KW7A 4C9BA 2WAAA 3GAAA 2ODWA 3RHSA 3STHA 1SKAA 3EIUA 4PHHA 2BV3A 1CWUA 1P4AA 1VGQA 1VL8A 2MDTA 2Q6OA 2F90A 2XUPA 3NHYA 4PPGA 3PHLA 1SOAA 4Y7CA 4DUGD 3ELUA 3NU1A 2JGKA 3KBOA 3JATA 3PE3A 4OJYA 1MVOA 2CSUA 3HRIA 1USIA 1WMEA 3PHIA 4LY0A 3E7FA 4K81B 3OZTA 2X22A 1A50B 2AEJA 2JLAA 3IV7A 3AO0B 3QU5A 2FK8A 4Q3BA 4UAVA 3TLGA 4L0DA 1KH2A 3ANTA 1EUDB 5EIEA 1UBJS 1V4BA 2Q27A 2VQ3A 4NX2A 1E9SA 5DBOA 2H18A 1UQTA 1BQEA 1C2TA 4EOGA 4M9QA 4ZCTA 1RNLA 1G0OA 1TC2A 1Y1SA 1C8KA 1ZU5A 2MMCA 2NTJA 2VDWA 2Z3VA 3BPSA 2XMZA 3O5AA 3UJ9A 4JS0A 3WV4A 4QYMA 4TT3D 4J29A 1LC3A 2M2IA 5AW5A 3Q41A 3CVUA 3KK0A 4KQIA 4R7ZA 2GXQA 2O50A 3OZWA 4JXXA 3A1DA 2CB9A 4GOXA 4Q05A 4QUHA 3R5TA 1RRKA 1N2BA 1H0KA 3JV7A 3WLTA 1R5BA 4GM4A 1JB1A 2PFGA 2YJZA 3Q7EA 4BVAA 5KYKA 4LF8B 3NVKI 3TO5A 4IILA 3PI6A 3V8VA 2QVXX 4II3A 4YA6A 3LUBA 1ABFA 3IVMA 4R8RA 4TKUA 3MWLA 2Z4SA 4ZXFA 2X8JA 5K03A 1GADO 4XA8A 3FGOA 1HBJA 1JH8A 2X5XA 4EG8A 2XR1A 4ABYA 3LCVB 1BX1A 2F3SA 4IP0A 3U4IA 2B1QA 2VEOA 1G4AE 4CDNA 1N5MA 1OJLA 2FSGA 3IC5A 3T4UA 2XWQA 4DLWA 1E3JA 4AT1A 2WV9A 1EWRA 3GPDG 1I13A 4U9UA 4B7CA 3WGVA 4TYMA 4AS1A 5TNXA 2FG7C 3IPLA 4QNRA 4G4GA 1MC4A 3TK1A 2YHAA 3UH0A 4BMPB 2AF4C 4NJEB 5DN6A 4LTNA 3RJTA 2QN3A 3PWZA 1A1VA 1OY1A 3U39A 1I7SB 2D0IA 4JC0A 4PYRA 4MARA 4GRIA 3FBWA 5E1BA 3PEFA 5ALLA 5EFOA 1W85A 4Y2UA 2PSJA 5AKXA 3FCUB 1DQSA 3H8VA 1HG0A 4O4JF 1Q91A 4TWRA 1NQAO 1R6AA 3CZ9A 3H6KA 1F48A 4QFCA 4F8EA 4BECA 4X24A 2BR5A 1AXEA 1YCHA 3EISA 4A92A 3KSAC 3DF9A 3MPOA 4GVPA 1UQUA 1J49A 2QD4A 4MWCA 3ND5A 1NY6A 3HDTA 5BYBA 4BV8A 2IYEA 2IYWA 1O95D 3UY4A 3BMCA 4CF3A 1BOOA 5B1SA 3ZS8A 5CBKA 1WL8A 1X39A 1U3DA 3GJ7A 2R6FA 3D7MA 5IAJA 1OGIA 3NIDB 1R9NA 4LV8B 3U5TA 3EIEA 1UODA 1EVKA 1FSPA 2WJHA 4U7GA 3IAFA 3PGXA 4HRXA 1VG0B 4ZGBA 1TJPB 3GJ5A 5KWJA 4B7ZA 2Y1WA 1G9TA 4FE4A 3L7YA 3P9YA 2BH2A 2G25A 1UFQA 3UHOA 3ETEA 3VJLA 1PZHA 4JI3B 4A1OA 2BLLA 1EG2A 1NMZA 3TUZC 2QK4A 3T7DA 3W5DA 2VF7A 4LJLA 1M54A 1FL9A 4L08A 5F23A 2YRWA 2Q3MA 3EDRA 4LXQA 5HM6A 4R2MA 4C7OA 3TNJA 3HY6A 3IDOA 5AFSA 5KDOA 3TR5A 5DTIA 3OF2A 1N3IA 2E5LB 2Z43A 4LZOA 3AL3A 1KEVA 1T43A 2ZUBA 4ZREA 5LP6B 3L9XA 2Y4OA 2QUBA 4PZDA 3KYDA 5CK4A 1MRSA 4BGIA 4I1PA 2N47A 5CFZA 1V47A 3DOFA 3FZEA 4O3FA 1QHHB 1EVZA 1T2VA 1IHPA 2NNLD 4JLMA 4S1TA 3UNXA 4HH1A 4QUAA 3VPGA 1IVNA 4MYSA 2UYYA 3JR7A 4X8OA 2HQ1A 2JFZA 2WILA 3ZWXA 4RK5A 4RTRA 2W8BA 3NM4A 4R5MA 1WXQA 1U8CB 2X2EA 4ZKDA 3GEMA 4YMWA 4FM9A 2RB4A 2O2YA 4DQXA 1GIAA 1VC2A 2VXBA 1RXYA 3EQ7A 4MJXA 1UM9B 1AMNA 3WWOA 2CLFB 1UMBA 4XJTA 4FQ5A 4AJ2A 4E51A 3PXDA 3WL3A 1JFFA 2ANBA 3HBMA 1E3WB 3JD3A 5JAUA 1XWFA 1Z9BA 2FSFA 3VYWA 4ZDKA 5DHRA 1KDPA 5DCLA 5FTMA 4R16A 1RYEA 3CUUA 4DCTA 3ONNA 5BVHA 5ITSA 4KDRA 3RGGA 2ZIXA 4RAOA 3GGOA 1VL1A 1YB4A 2I9PA 4NQRA 2IGBA 5A06A 4XR4A 4YP1A 2ZTHA 1Z0AA 2GEUA 5AJZA 4L4XA 4E94A 3NTOA 2J9ZB 3UUFA 1WS6A 4PN3A 5TQ0B 4X60A 2HHJA 3VR4A 4AJ9A 4I5EA 2XADA 2VP4A 2O4CA 2OBYA 3DBHB 4FBLA 3AJ9A 4D74A 4TM8A 2B37A 2RHJA 3M9WA 3I0NA 4TYQA 2XMRA 2OBLA 3HFRA 4R2WA 1WZNA 4ZU6X 3C97A 1VIAA 4JCCA 4QHTA 4RGBA 3RUFA 1SBTA 1Q6ZA 1Q7TA 4YVFA 5CT4A 3RYHB 1Y8RA 3JZFA 4CI9A 3QE9Y 1AUVA 4BYGA 1O7JA 2P4SA 3IIKA 2FPGA 4Q39A 5G40A 4BGDA 4JGBA 5DCUA 2PO5A 1SXJC 3GEHA 3TQCA 4ANFA 5JVDB 1J09A 2OCKA 4OI0A 3SN6A 5LQMA 2XYGA 2JIMA 1XTSA 2XYQA 3MJTA 1QANA 4UAJA 4RDIA 1LB1B 1QP0A 3H2IA 5CHYA 4DJEC 3D31A 2IXFA 2H5EA 1Y5RA 1QAQA 2AOVA 3MJFA 4FCWA 4H1TA 4MUHA 3F6SA 1OAOA 4X95A 3DDWA 1KOJA 3D8SA 2C1XA 4IIHA 4AWAA 5A0VA 3ZKWA 1C1XA 3TFQA 1SVKA 3PUHA 1PJ4A 1DE0A 4INPA 5IABA 4KNYA 2CJWB 4RVUA 1EK0A 1EK6A 5TEWA 3MC1A 4M6WA 4C7BA 3GQBA 1J1ZA 4XVCA 4NAVA 1AV6A 3H0CA 4OMCA 2XOXA 3EFOB 2CNWD 3OD5A 1VHTA 3AFGA 4K6OA 1TX4B 1XQ1A 4AMBA 1XQ9A 5COAA 1UIRA 2E4ZA 4AUKA 2R5FA 3NM6B 1E59A 5A5FA 1AGRA 3FHOA 3HVHA 2VRBA 2OCLA 5JE8A 5B1YA 3EIQA 4MQ5A 5CAEB 3SJAA 3TPFA 2CUZA 3WLFA 1IOLA 1DO8A 3FNBA 2N42A 2PAAA 4UAUA 4O1IA 1JHYA 2BDUA 4MUGA 5KNDA 1QHYA 3G02A 2A6PA 3KB2A 4JUDX 3AERB 5E2BA 5JS6A 1EUCA 5A9SB 2P0EA 4M98A 5EYPA 3TQTA 1FFXB 4WD3A 5IF9A 5JZSA 3EIHA 1COZA 1ECJA 2CXTA 2GTIA 4QA9A 4S1PA 3SQDA 3I9LA 3FBTA 1XTVA 1IMJA 2QZZA 1JG7A 4KO8A 5B6PA 1RHKA 2VPPA 2R86A 4QOSA 4YQEA 1G7RA 4LZJA 3KAJA 4GVLA 5DKFA 1ADGA 1BAPA 1KJ9A 2VKQA 3FUUA 4KL8S 3IGFA 3R8CA 2F00A 3B52X 1TO6A 2PUJA 4ARUA 3AIKA 1NSFA 1WOYA 3NUQA 1ACLA 2WQ6A 1PR5A 4AJ1A 3W5CA 2OHJA 2I66A 4ASUD 1NIPA 2QR3A 1XI2A 2NUTB 2I6SA 3BD9A 5FCDA 4BLOA 3IFSA 4J75A 1H6CA 1PV2A 2BELA 2IPNA 3U7GA 3GU3A 3KQWA 2G4LA 5BR7A 4H4DA 5ECGC 1T3SA 3CLSD 1NQ5A 3OOEA 1VLMA 1DAEA 3JQ8A 3KVYA 4G0VA 1A4XA 3NO4A 4V0ME 5IUKC 1PFUA 2CHVA 1I4EB 2GGSA 1ZYUA 3QHPA 4BS9A 4DIKA 2C5LA 1CUVA 1PL7A 1K66A 1PW5A 1SHLA 4I2NA 3QGMA 4TXJA 3RT7A 2JKVA 3K7EA 4HN9A 3L5KA 2Y05A 5DGCA 2EZUA 4KVGA 1GHTA 3ES9A 5ULLA 2ID8A 2HKIA 4GXTA 3KR0A 4MR8B 1V1JA 3WGQA 4YCLA 1GG2A 2O52A 3SBXA 2IPXA 1QK3A 1ZIPA 4F7WA 2J3EA 1YH3A 2PT7A 3IKLA 4XDHA 4ZHQF 1PQ4A 1QRDA 4AECA 3USZA 2YBDA 2ZXEA 3N39C 3ZLTA 1C14A 3S28A 4QLAA 1NW7A 3JVVA 1RHRA 2C0PA 4L1KA 3WWZA 1U1DA 1L5SA 1K1EA 3N59A 3IUSA 2EXXA 2OKGA 2BFWA 1S6YA 2FTKE 3ZI4A 1ZUHA 2P3OA 2GN0A 2GNAA 1Q14A 4I19A 1YS7A 3U4HA 3ITNA 4WXYB 4X63A 1M8FA 2HBQA 2UYHA 4KN6A 1BMFD 4UW9A 3NORA 1SEPA 2ODPA 3O7MA 3QI7A 2Q46A 3PUXA 2W42A 2HSGA 4NCKA 2IUYA 1KK3A 1ZMRA 2V6BA 2V3WA 3NWBA 4ZJUA 1ZD2P 3LFTA 3M6LA 3I8SA 3ZBUA 2ZZNA 4U63A 1MJGA 2B2CA 5I8PA 3UUEA 4RC9A 1A8UA 4PR3A 2FQYA 5H4HA 2AVDA 2XZPA 4M0FA 2V1UA 2EQBA 4FFDA 3KOYA 3RG8A 3SVTA 1U8YA 2ONYA 3SU8A 1HE4A 4IDNA 4R1LA 4F46A 2YXNA 4F3TA 4HTFB 3O73A 4LNAA 3W5VA 4K5QA 4JLWA 3RFFA 1Y5NA 3UCEA 4D3SA 2O59A 4IJ6A 2RARA 3PC2A 1EH5A 1XCGB 4EYQA 4PBSA 1DAKA 3OPMA 4IWXA 5DNYB 1CS0A 1SHJA 1HLGA 2QN6A 2EBWA 3YASA 5DU2A 1MAAA 1VMDA 3S7TA 4TLCA 3I83A 3TQOA 4FC6A 4PSUA 3WK4A 3KUUA 4DG8A 4DWJA 2H8GA 4TLDA 2H2IA 2P5UA 4YP9A 3AEQB 4DQKA 5LSAA 1X1CA 5IT5A 4ARIA 1A71A 1N5OX 3MD9A 5JC8A 3OP4A 5DK4A 1YU6A 3KR2A 1MPTA 1KTIA 2P1ZA 4HEA1 5K3CA 1OYVA 1U0TA 3LP5A 2OK8A 3Q3IA 4OH1A 4FD3A 1N6HA 3ZHTA 3KR9A 5KNCH 1FUEA 2FLVA 3H4IA 4HNQA 1L5HA 1YFLA 3BCRA 3NHUA 2QV0A 1E66A 3C7CB 4Q9HA 3TE6A 2BAGA 2FAXA 3VO8A 1HFKA 2NXCA 3IPXA 3IMGA 3X44A 2C9BA 1OOEA 4I9UA 3DVAB 3R5FA 5FOUA 2ZBQA 4AMYA 3PPWA 3W9UA 2WJAA 1EHYA 1IRXA 4A0HA 2QTRA 3HCFA 1O2DA 5GV8A 2BMVA 3S70A 1QYXA 1L7AA 2DR3A 2YWRA 2ZRHA 3QPWA 2GVDC 4MCJA 3V4OA 2IKQA 3ZD8A 1GGFA 1E1QA 3Q7PA 1JHPA 1DBRA 1W85B 3LUDA 3K0BA 1KQNA 1M7BA 1NONA 2XTZA 3OPYB 4RVSA 4UM5A 3D8TA 5H83A 3VYUB 5HUHA 2NNWB 3BK2A 4MLPA 5AVKA 4RS3A 4BO2A 1XKXA 4F4CA 2HEGA 1EFRA 4PHFA 2G1JA 1R0BA 1XBTA 1RBYA 2OAEA 2WE7A 2XUHA 3OP1A 2EIHA 4FZ5A 3W4KA 5B58C 1TTHA 3GLHE 3P2KA 4MNTA 4I7EA 4R05A 2I67A 1IXZA 4ZTUB 4XX0A 3B7WA 1KNQA 1U1CA 4CMIB 2DFKB 1CQIB 1R0XA 1U9JA 4GMFA 3L7AA 1E5LA 5EKUA 4R8LA 3VI3B 1X7YA 2I3DA 4IIGA 4JZYA 1YMQA 2C5EA 2CYAA 2Q3DA 5EHQA 3JWHA 1A95A 1V39A 3WDSA 1MRZA 4V39A 5A9TA 4OI1A 2YYSA 1JXQA 2XVZA 5DTJA 4KIGA 1RRMA 5FWXA 3WTCA 3RS2A 3NKVA 4N01A 2HB6A 4K40A 5T4BA 1KE1A 3VOSA 1BA3A 1TPZA 3TTWA 2JAOA 2BCEA 2TMYA 1M5UA 4ZYLA 2J59A 1R4NA 1K8XB 2BGIA 1HDZA 5CVJA 1FYEA 4YO7A 2X8JB 1WXHA 2YH2A 3V7FA 1ZCFA 3EIOA 3MGBA 4L4UA 3QOXA 4FU0A 3O21A 2OZVA 3Q11A 4ZOAA 5KVVA 4HDNA 2JHPA 4DBZA 4YCSA 3ER9A 3L7DA 4H59A 2A92A 1DBVO 2PUHA 3BTOA 1RQGA 1E1MA 3OAAD 3MTQA 3X1WA 1U0JA 4AWXA 3AI3A 4FGSA 3Q72A 1CYDA 1I32A 4NFLA 1UZMA 1M66A 2QRPA 2EDCA 4FW8A 5D8DA 5FF9A 4D3YA 4CLRA 2WUEA 5IK2D 2KQUA 1ZGJA 5A0FA 3R09A 3S3TA 2J9GA 4LNUA 2B36A 2H2GA 3WC4A 2QXYA 2YICA 3EUAA 3NCHA 3SOPA 4B79A 1WBBA 5DM70 1JE1A 1YDMA 2G70A 1CY7A 1XVTA 1E79A 2NP6A 4B3CA 3UJBA 3DKRA 5T7BA 3E0XA 4Q9DA 2HJSA 2F8MA 1NQXA 3E7WA 3P4XA 3UVEA 4CKWB 1XJ0A 2BW0A 3WDMA 1SVOA 5BMVF 2JI6A 2FW8A 4BP8A 5HFJA 3BWBA 1GQQA 1EYZA 3DTYA 3CEAA 2PVPA 1HL7A 1UUFA 2FPSA 4KLCA 4DQLA 1ZMTA 5IT0A 2PANA 1H8ED 2EJWA 3ZK7A 4HGOA 4HFMA 2H7XA 3RNLA 1HNNA 5L45A 4LKOA 4IMIB 4ZO6A 3DDNA 3U7QA 1UDCA 4AULA 1LFAA 3FPSA 3ZDZB 3HO8A 5CEJA 2IHUA 3QG5A 1ENOA 3GRAA 5IUNC 2UXCB 1QHSA 1JEQA 2IHYA 2PZGA 1PJ3A 2DM6A 2H2WA 1HOXA 2I7DA 1SA0A 1DOAA 2RI0A 3T54A 1ENZA 4CYMA 2Y93A 3MHPA 1SB8A 4LYYA 2Q9AA 4BMSA 1T3ZA 3EUEA 4MTCA 2GFHA 1XJQA 2VA8A 1WVMA 4Q1AA 2GZHA 5IKXA 3REQA 1C30B 1AGNA 1R0RE 4Z0NA 2O8DB 2IZ1A 2O1SA 2NU8B 3BE8A 3K4QA 1OZFA 1ZBDA 3JZAA 5H8WA 1N5RA 1RWQA 1AK9A 5BQPA 1I4LD 3D6HA 2P8JA 5AXCA 3WB9A 2I55A 1NXSA 4FVTA 1PYGA 2RHRA 2X5KO 3GJQA 2OCPA 1WDLA 4Z53A 1GGMA 4NH4A 1AQIA 1U0OC 4X61A 3AHDA 3GCDA 2JCGA 4KE8A 3H1FA 3RUPA 5HK8A 4DCPA 1AQLA 2JD0A 3QW4B 5HF9A 3TBHA 2UZ0A 2FK7A 2QMEA 4JLBA 1VI2A 5FUWA 5KOJA 4G0QA 4J4TA 2O7QA 1W0KA 3BN3A 1VG1A 5CB4F 3RS4A 2Q8NA 4MEAA 4CF5A 1G5FA 3CH6A 3AZPA 2IYLD 4K26A 2H9IA 3LT1A 3CEMA 2ZTMA 2HK8A 4R6XA 3I9V6 1ULHA 4G0XA 4CJXA 5FT9A 4LV6A 2QW1A 3QMVA 2P8SA 4KMMA 4RY0A 4QELA 8ADHA 5H9WA 3NJ4A 3JRNA 3VYRB 1Q11A 2D54A 5ALQA 3SD7A 1G0NA 1HT1E 3BH0A 1M2NA 3D3WA 1T26A 5DT2A 4CL8A 4WN9B 3C43A 4YJ2A 4TZKA 2HQBA 3NAMA 4DR4B 5ALMA 1JAHA 1YK1A 3NHKA 5F7ZA 1YBVA 4OHRA 3TD2A 3SXPA 1F2TA 5F64A 4JENA 2YWXA 4RHEA 2F1IA 1U0FA 3RQIA 4MVJA 4LE2A 1AC5A 1R74A 3FZNA 2NU9A 5MN6A 1VYUA 2LV8A 3LX6A 2CVPA 2HU5A 4J1NA 3GWZA 5JCOA 3FOWA 5AKEA 3C14C 4I4TF 3GLGA 5B2FA 1BVRA 1KAEA 1BGVA 2YHUA 2Y2UA 4CKCB 1YZKA 3QF4B 3FCSB 3HADA 4LDAA 5EUBA 4DB4A 1MRNA 4LY9A 2PUWA 2XHZA 2ZZKA 4IHQA 2AFVA 1LDEA 3IVRA 2D3TA 5HKKA 5KC8A 3RIGA 5EMKA 3IPYA 1J0EA 4RU1A 4DJJA 5GJBA 5MFPA 3BAFA 3ZWYA 1N8SA 1TZCA 1UKZA 4ZEMA 4AKHA 3IOMA 5EMMA 4RIIA 3RSHA 5CVDA 5KS2A 3VKWA 3L7LA 2LWIA 3ZWOA 1D7OA 1XPRA 2BEWA 4GZ6A 2Z0MA 4Y0AA 1I2BA 1ODTC 1Z7WA 4OUKX 5IDQA 2ORVA 4AFNA 4N6NA 1G8HA 4CTKA 2GHIA 2YIMA 3QLUC 2J33A 4ZDWA 3D3NA 5I9SA 1KZHA 2V7WA 2C3YA 2ON6A 4NU6A 5C35A 5DSZA 4X1YA 1Z18A 2D2XA 1LSJA 1YQDA 3GLSA 4ZCSA 5LN1A 4U1RA 2EFYA 1KP9A 5CXUA 2Q4BA 4CIBA 1Y9EA 5JAZA 1FB5A 4I4TB 2NN3C 1ZGZA 5LWQA 2IEYA 4LBZA 1SOWA 4ZDIA 2JHFA 1RRPA 3TMAA 1G63A 4M0DA 5JSZA 4YXFA 4MR7B 3DEHA 1HZZA 1IFXA 2Z6VA 2V4UA 1F0PA 3WQBA 1BH2A 1NW3A 1KC3A 4RZ3A 5CT5A 3STXA 2X2PA 3OX1A 5DBHX 3L1KA 4R1QA 4KB5A 2PUFA 5HHTA 3EGDA 1PFQA 1VLZA 3MMXA 4QYTA 3KQSA 1AY0A 1DINA 4FC7A 4JL8A 4WJZA 2I6TA 3GD7A 4FONA 1K6XA 1U7DA 4LTMA 3SI7A 4CF7A 1MMFB 3L7NA 1Z5WA 4FD2A 3TL3A 2ACWA 4AY6A 2HK6A 4DQ0A 1QOPB 4FS8A 3WJ1A 5FKJA 2R6DA 3DF7A 2L2QA 1YRHA 3RSZA 1L8OA 5IDXA 2ID9A 2DG2A 1ZNZA 4QHYA 2H1VA 4JI1B 3U7EB 2YNMD 3TOZA 2W2KA 4OKIA 1S9HA 3U6BA 4FS3A 3MWDB 3BCSA 3DEYX 2XVYA 4H7JA 1P9NA 3FVVA 1NBOA 3F5QA 1EXMA 1T91A 2I8CA 2RJNA 1Y0BA 2DH5A 4QDUA 4YAOA 1GO2A 5CVUA 2EHJA 2V5UA 5MN5A 1JIXA 1ZNQO 4Z7NB 1B23P 2QL6A 5KTSA 1MXFA 4PFSA 3WK9A 2IX3A 3LHFA 3MWEB 3ZJUA 1FNBA 2KMLA 2E87A 4C78A 1XJCA 3DQZA 1LBEA 3P2YA 1C3EA 2PX4A 3NR2A 1VECA 2OLJA 1EP2B 2AN3A 3G5LA 3T1NA 2RHMA 3Q9LA 4P38A 3OOJA 1N0WA 4EB6A 3TPCA 1XDGA 3BWEA 4L6IA 1MGPA 1Z4NA 4AJIA 4F96A 3DTVA 2OD7A 4FWTA 3LX5A 4LQCA 3T4PA 1DJMA 5H80A 5SZIA 2Q3EA 2YS7A 4QBIA 4M87A 4DKXA 1NYLA 2AR7A 2C5BA 2WPDD 5ICCA 3RADC 5IUJC 4YCAA 1G60A 3L4KA 1XALA 3FWNA 4C3ZA 2F55A 4RBNA 3J7AC 2CJFA 4MYUA 4Z5XA 2RHGB 2PBRA 3D1LA 2VRNA 1KHTA 3JYNA 3PD1A 4HI0E 4I50F 4S0ZA 1RCUA 4PLCA 1B93A 2FH5B 3U4QA 2NU7A 2P2LA 3PQ4A 1VLHA 2DUNA 5AW8A 2RSLA 5HOEA 4EPRA 4DCSA 4NJOA 4S04A 3MD0A 3ZV5A 3RARA 1K6EA 1KEUA 5LQKA 3BBPA 1CQJB 2Q49A 3AH8A 3T3MB 1KSJA 1GFIA 2H9YA 2XQVA 2YC2C 5L3SA 3ZJVA 5CNKA 4I55F 4TRNA 3O8RA 1Z26A 1PD0A 2OV1A 3Q9UA 3Q7IA 3DOHA 3GDWA 1ZUNA 3O2NA 3MS4A 2A9PA 4OGWA 3UAWA 5J43A 3LRXA 3VTZA 4OAOA 4LJKA 1PDVA 2QD5A 4A2PA 3K53A 1RPZA 3AT1A 3MBOA 3JVEA 3DKVA 1BA2A 4TKLA 3RJ5A 1N0HA 3CKKA 1LDYA 4BFLA 1WF6A 3NQ41 4GKJB 2XWSA 3H5WA 1JZQA 5I48A 4S35A 3U7FB 4AUMA 1ETUA 3C7AA 3E84A 5K3EA 3GJYA 1T34A 1XHFA 4UPVA 3CR8A 4ZALA 2VDVE 2AA3A 2YWJA 5CNIA 2YZNA 1TCUA 3PC4A 2VYVA 4UNNA 2PS3A 1APBA 1K63A 1FPQA 3PT5A 5L95A 3M4ZA 2A9FA 4G5YA 4GGOA 4BMYA 3KKOA 4FKZA 5C8YF 3IEPA 1FXWF 3H13A 3FPLA 4IDAA 1D8TA 3TZCA 2EKQA 3M4NA 4OK6A 2AG5A 5PNTA 3BORA 4ENTA 1CRLA 1I2MA 1XVAA 1H1LB 4RLHA 4B4DA 1EHCA 1R8JA 3K0HA 4BIMA 3OZDA 1J2TA 4KWTA 5ALJA 1JSRA 1OSNA 1Y7HA 2B8EA 3AINA 3QEMA 2HOQA 3HA2A 1P4JA 2NU7B 2WTXA 4PGGA 2GPAA 1QTNA 4C3UA 2OCDA 2O8VA 2WRZA 4MVJP 1HYHA 2IOHA 1DEAA 5MF6A 4JEUA 3NOVA 4JVNA 3ZJTA 1FRFS 2PJZA 5KNCD 4YAEA 3PUWA 4D4KA 1V3TA 4X85A 3LYHA 2HXGA 2F2TA 2J07A 1OA1A 1IH8A 3WIDA 3HBJA 4WNAB 4DA0A 3ABRB 4G1MB 2MSNA 3H0EA 4N7MA 5REQA 4DT1B 4HTFA 2RG1A 1UWCA 5EIXA 4D0NA 3VSEA 1JDJA 3WAGA 2F3UA 5CDHA 4DV7B 2I22A 5K0NA 3BQ9A 1ULTA 2RHDA 1ODIA 1U4OA 3DV9A 4C29A 5THXA 3KLBA 1OWPA 1UPCA 2I4NA 4EB3A 3QLUA 1TO1E 4AJOA 2JJ2A 2O1XA 3U13A 3KB8A 1LI7A 1RFGE 2PX2A 2VSYA 2C7QA 3KCNA 3LV8A 4FFOA 3DZHA 4ITVA 5CPFA 4ZOBA 1PDOA 1DCTA 3SZ3A 1PT8A 4X5OA 3RBAA 3ZY5A 4DABA 1LVGA 2B34A 2HHCA 2LNDA 4MRPA 4DDKA 4DDMA 4X20A 2R7NA 2I2AA 3NWPA 4R54A 3BTVA 3NPMA 2ZR9A 1U2GA 1BQ4A 2FOXA 3U1VA 1OLXB 3ZQUA 4I3HA 4B34A 4D8VA 4A36A 1PKEA 1U5BB 4V02A 1NVXQ 2JB9A 3I2YX 4C6TA 4WK6A 3WKBA 2FJ0A 5IZ4A 5LDHA 1RKBA 3UWMA 1P1RA 3E6AA 2FPPA 3E05A 3AXTA 1G4HA 3R24A 4O4HB 4BC1A 2DPXA 4M9CA 1TFRA 4M8NE 1AUQA 1RW4A 1GYQA 3ND7A 1S2GA 1G8SA 1EX6A 1NR7A 1XAIA 5LZ2A 3MTBA 3E0QA 1JJIA 1QE0A 4G1VA 4BEBA 4QM7A 2GKOA 3O8LA 4GOOD 3H2BA 3MWJA 3VGJA 1Z5NA 2P9TA 3K0AB 3AFNA 2ZSAA 4L75A 3LXXA 2HF9A 1Q0LA 5HFNA 4D8WA 2YC4C 3IX7A 3T7CA