2LVBA

Solution nmr structure de novo designed pfk fold protein, northeast structural genomics consortium (nesg) target or250
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
MGKVLLVISTDTNIISSVQERAKHNYPGREIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLKTAGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords DE NOVO DESIGNED PFK fold PROTEIN
total genus 36
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2012-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lvbA00
2LRHA 2LCIA 2LV8A 2L82A 2LVBA 2N75A 5GAJA 2MR5A 2LNDA 2L69A 4J29A 2N3ZA 2LTAA 2MR6A 2KPOA 2LR0A
chains in the Genus database with same CATH superfamily
1TZBA 4AUKA 5G0TA 3R5HA 4M21A 4JSRA 1OAOC 2OGWA 1EVLA 3DZIA 5KHAA 4D9NA 5NLLA 2WSSD 5K0EA 1CRPA 4EW2A 2X19A 3NDIA 1Z5UA 2ECFA 2OCYC 2O7QA 1TQ8A 2IEZA 1JR3D 2ZBGA 1SWVA 3RGGA 3O84A 4GL2A 2NADA 3CUEF 1GNTA 2WPNA 4GIBA 3VR4D 5LUBA 2VCEA 3VPXA 4PLGA 5FUVA 4O3MA 4UAGA 3WDMA 4QD3A 1UPBA 2YL2A 5KREA 4HP8A 3FPEA 5AVYA 3NZEA 3EFHA 5EJIA 3SQDA 3RFCA 4D9MA 1ABBA 3EWNA 2KI5A 3PBKA 1O1YA 3PC6A 4WXPA 1EE2A 3I5XA 1VGQA 2VOJA 1QFYA 4EW1A 5C1DA 3DMHA 2RG7A 1DOHA 1KO5A 1E99A 2JGAA 4V0QA 2BF7A 2J3QA 2EBUA 5J40A 4DZRA 5CLFA 4B71A 1XL0A 2RHTA 4EGSA 3NGMA 4CMEA 3ZKWA 1E1RD 4PAMA 2JIBA 5AJUA 2ZSJA 4NY1A 2P9ZA 4X60A 5CNKA 4Y2GA 1QQTA 3WO1A 4DG5A 5J43A 4G37A 1UBOS 4O02B 3A6JA 4ZHQB 2QG9A 1URPA 5AD1A 1SBHA 3JPYA 5BV0A 4JJEA 2PX6A 2WC1A 2A5LA 3OEHD 4OK6A 4XJVA 4NK4A 1K4YA 2P62A 5E9JA 1DJQA 3GFPA 3DF7A 3N8IA 4D3ZA 4DV7B 3LCJA 3GR6A 2D7DA 4E1AA 2F48A 4YAIA 1KFJB 2CNLA 3LPDA 3QPVA 4R2KA 4FHGA 1KO8A 3V9AA 2C7VA 1JB9A 1QHHA 2OC9A 4DJAA 3Q8MA 1Z38A 2X5XA 1Z9BA 2CHGA 3IIKA 1E5XA 4L0DA 1FP7A 4ME6A 3TZLA 2VS1A 1PDVA 1QLWA 4Y18A 1X87A 2BCJQ 3OCWA 2BC9A 5DDIP 4QVIA 1CRWG 2RGBA 4P7FA 4CTKA 2I2CA 4UDNA 1KF0A 1Q92A 5CXQA 3C4QA 1ZM4A 3EIOA 1DQYA 1ZH0A 3KVYA 1J9ZA 4Q7EA 1PR4A 2HWKA 3DEIA 3A6HA 5KQPA 3K9FC 1AF4A 4G8CA 1NNUA 5IEBA 3RIGA 3MBIA 4BLQA 4B76A 2BEVA 4CEIA 3AJ8A 2CEAA 1ZGBA 1DQZA 2H8GA 2QJOA 4MV9A 1DBPA 1QIDA 2EDAA 4MR8B 3RR2A 3UAYA 4AUMA 4DQUA 3WGIA 3ECCA 4BLWA 3W5AA 1H05A 2HI0A 2VN8A 4XQCA 1NXWA 2GH1A 3CX3A 4G97A 4W1SA 5CFLA 3NOXA 4YRZA 2VHVA 4A6DA 1QHSA 4I14A 4LRTB 3FHOA 2YUTA 2Z6QA 2R79A 3LC1O 3K1YA 3RYHA 2ACWA 4TRRA 4MWCA 3C39A 3DKKA 4TV8B 4Q9KA 2Z2JA 5TARA 3L6RA 3ZX5A 1X1TA 2PKQP 4YAGA 5BMOA 1CCWA 1FU7A 3ND6A 1O9BA 4MV5A 5JY6A 3E3MA 4XGKA 2EFJA 4R9SA 2HFJA 5FA8A 2XKKA 4NDNE 4BV2A 4BQNA 4H7DA 4A3SA 1AUPA 1D6SA 1X9GA 1NQOA 3HKDA 3PS9A 4HL6A 1LDMA 1C3LA 4TTTS 5AOBA 5I8ZA 1LJLA 4UJ3A 1ZM3A 4Q48A 4DL9A 2C2BA 4ZQCB 1C1YA 4PAWA 2F9LA 4ARVA 4J16C 1J8YF 4KYTA 4S35A 2O23A 1G21B 3IE0A 3LT4A 1OXMA 4MW0A 3GLHE 1WNFA 4A6XA 1F4PA 2XB8A 1OYOA 4LXHA 1BC5A 2VT2A 1X0XA 3AQIA 4PEVA 3TLAA 5LLTA 1Z4NA 2H5IA 4FFWA 5HQ3A 5KYXB 2X58A 4J0DA 2BFEB 2IA5A 2P40A 5KJEA 2YIDA 1J07A 1XQ6A 1FRQA 1KI3A 2GSDA 2HHJA 2XRYA 3O8OA 5IJXA 1RFGE 1AKUA 4LZLA 2OGZA 3DDCA 4AWXA 2MOKA 2PTHA 2GT1A 3DP7A 721PA 1R5OA 4R16A 1T2FA 3L4BC 3LS2A 4FEEA 1ONBA 4Z3DA 2QPTA 1EVEA 2VZLA 4DCPA 5C51B 3EC1A 1CJVC 2BFOA 3RS9A 3K0AB 4LHWA 3WLHA 5GM1A 1NBOA 3EF1A 3H75A 3ZHVA 4RMNA 4BJ6A 4EBBA 1YS7A 2FPMA 3OZGA 4M76B 4C7BA 4KR6A 1PTJA 4PLZA 4LQ4A 3S29A 3GDHA 2TMKA 3QVXA 3DHEA 4HI0E 4RZSA 2I4RA 3SE7A 2IHUA 3FYHA 3P2MA 3QX8A 1K7XB 1QG2A 2JGIA 3CEMA 1Z6TA 2VA8A 4IDEA 4DWJA 3MRSA 1IVNA 3NC4A 4IIYA 4X1YB 2JEYA 3V4FA 5AW4A 2SICE 1G64A 2ZRNA 5KJ6A 4IQFA 4BP8A 3EOZA 1KDVA 3KKOA 1E61A 5E4TA 2HY7A 1S2OA 1VG9B 2ISCA 3QH4A 2R84A 3FVQA 3K0HA 1R4MA 4URUR 4EO9A 3BQMB 4BRZA 1SULA 4J90A 3TD6A 4KV9A 2V9ZA 1ABEA 1WO8A 3M7IA 5IUJC 3LW8A 3CNOA 1W9HA 2VPQA 4LNUB 3KQYA 1VIVA 1W6UA 3DD5A 4ZVRA 3BSFA 4G5RA 3O4FA 5C7LO 3LUAA 3ORQA 3RS5A 3CF2A 3WHPA 1UCFA 1ILWA 1XWIA 4B2LA 1L3IA 4LF5B 4HLNA 4D41A 2A9OA 4DUPA 4U0JA 3RO7A 5F7OA 5TMEA 1LDEA 1UBFA 4J1NA 2OVFA 1XNGA 4JA2A 4ZYTA 4PO9A 4YY3B 3LGAA 2HJWA 2DY1A 1KAGA 1KYTA 2ZU0C 4TSKA 1ZA1A 2PKCA 1EHYA 1QH1A 1JKJA 4ZOLB 4CEJB 5J5CA 2H85A 1YBFA 4I4TF 2BKLA 4ZVMA 1G42A 1YBHA 3FR8A 4UEOA 2VEOA 2X8JB 2IYPA 4Z1MA 5HF5A 2NUTA 3DOJA 3I4FA 1HOXA 1ML3A 1FPQA 5L7YA 3AV0B 1T8WA 1XPRA 4WHMA 4CT0A 3HLKA 2ZVJA 1CY6A 3UNXA 4B3TB 1QBGA 2HCTA 3AUXA 3HB7A 3WLKX 2FPGA 4YRGA 3MN1A 2ID7A 1SKBA 1I5RA 4TLAA 5F98A 3G0OA 1N1GA 3RIYA 1K9SA 2PSJA 1LPMA 4R7TA 4R41A 3V55A 5C37A 4AJLA 4CEHA 4MI9A 3M9XA 4UNQA 3T1OA 1TVCA 4YACA 3KFXA 3K2BA 3T0GA 4B0OA 2Z0MA 4NL4H 2HRCA 3I1JA 4B8ZA 1O58A 3X1ZA 1V8ZA 2JHAA 3UANA 4Z5XA 3QPBA 2R6GA 1EUZA 3N0RA 4TTJA 3NJRA 4ZO6A 4CL3A 5L3VA 1MO4A 1Z5GA 2XODA 3KHUA 5K6AA 1LNQA 1M66A 5DXJA 1J2UA 4IDQA 2XYQA 3M3HA 4FI3C 3CLRD 1H8HD 4FWTA 3TN7A 3BYZA 4PYQA 4K86A 2J9GA 1NT4A 3CJRA 4MUGA 1WHTB 4YECA 3SZMA 2ZREA 1JA9A 2QJWA 1WXDA 3A32A 3CLKA 5I5GA 5AI8A 1UFQA 2ASVA 3GL9A 3R44A 3ZDQA 1LJ8A 4N5MA 3DEYX 3HVJA 5DM4A 4XD7A 1L5NA 2B9EA 2PH1A 3DTVD 4EBFA 1N36B 4W6QA 3NYQA 2CZCA 1A7JA 4J6EA 3NEAA 2AC4A 3VDXA 1C5KA 2A9RA 2ZBEA 3IJRA 4IW3B 5ULLA 4YMTA 5I9NA 3OPVA 1M8KA 1XKQA 4U7HA 4X1KA 7ABPA 1JIIA 1V7CA 1UKCA 4UMEA 3HU2A 5DBHX 4JQCA 2OXCA 2WAMA 1DC3A 1GEEA 1AKEA 2GJAA 1UXIA 3MJVA 4MR7B 3WOHA 3JQRA 2ZRMA 2W2LD 2BOVA 2ZQZA 3P2IA 1C8KA 3FCOA 4AECA 4YPVA 4BVFA 1TM7E 2OCAA 2IV2X 3KQLA 1FNNA 4HADA 3CV3A 5FP0A 2Y9MB 3B1WA 4G1VA 1U3TA 3KOZA 1MB3A 1X80A 1RJEA 1JA0A 3HU1A 1GIAA 3R4CA 4ERXA 1VIYA 2PUHA 3QVVA 3OFND 4L6AA 1DCKA 4GKAA 2IYXA 3UK6A 3EN0A 5HCNA 3GEDA 3AB3A 4J6FA 3BN3A 2PQMA 3QOYA 4P3PA 1ZM2A 3WJAA 3RHTA 4QATA 2YN4A 5E2BA 5DYNA 2OBXA 4XQ9A 1OT5A 4GZMA 3DHYA 4OGWA 4ED9A 4XA8A 4H59A 2DFVA 1KI1A 2VL7A 4O4JF 5CX4A 3N9IA 2O5EA 1GTL1 3SS8A 1GTZA 2PNJA 2X3FA 1MV5A 3AG6A 3VH2A 3BRQA 5ADWA 1V1MA 3ZN2A 3MOIA 1Y1QA 3A2KA 4W9MC 3IEUA 5F1KA 3H5NA 2J46A 2C4TA 4HFRA 4YQEA 3I62A 4OUDA 5HDQA 2A14A 1I0LA 2IDJA 4RZXA 4C0QC 3LX6A 1WB6A 1ZLYA 1JKMA 3C74A 2Z5LA 1YQ9A 1FS6A 1E1MA 1SY7A 3U44A 5EXTA 1W96A 3HJNA 1D0VA 2GR9A 2IUEA 1J00A 2PX4A 2Z5FA 3VYUB 4CUZA 2CJWB 3PGVA 2QZSA 4ZAWA 1FXSA 1Z5ZA 2YZ2A 2BEKA 3PFFA 4E11A 1DQNA 1TQ2A 3AI3A 4KN6A 3RS3A 2AHRA 1THTA 1V3TA 4NBUA 2ZYWX 3LFUA 4CMGA 3MC1A 3NUQA 3OEEA 4PTLA 4WFQA 2IHJA 2ZJFA 3SG0A 1J9EA 1PW5A 1R8QA 2DKOA 4QQFA 4UXHA 3RG8A 2ZIXB 4LG1A 2QN3A 3ETDA 1RM4A 4BNGA 1NXOA 2XAUA 4HN2A 5H3CA 4BTEA 5HKKD 2JI6A 2O8DA 1E8NA 4F84A 3U4CA 1F20A 2VJCA 4G4SO 3HYNA 3VVMA 1SD2A 4M55A 1ZMRA 5FFNA 2DFNA 1JR3E 4HTFB 4DUGA 2Z95A 5A5GA 1IUKA 5I3ZA 4Q12A 3LWBA 1KFKB 2HL6A 2ZRIA 3MUOA 4CJXA 5ALMA 5IWCA 1L7MA 4N40A 4EX6A 1N9ZA 1P1BA 3W04A 4EB8A 5KYWB 3FPHA 1E5VA 1V7ZA 3UJ7A 4Q01A 5A2GA 4UAJA 1VCOA 2HMVA 1SD5A 3IAM1 1EUCA 5EWJA 3WP1B 5FEUA 2VF5X 3J81k 4MV7A 4OI1A 5HQ3B 2Z83A 2ZW9A 2P67A 4Z2YA 4L85A 1PW7A 1WKBA 1J4AA 3A6FA 2NTEA 2ON6A 2EJBA 2NZ2A 3TNJA 2IOHA 4JLUA 4PCAA 1SCNE 3F4BA 3IV9A 4O08A 2N42A 2Z98A 5I4BA 2D54A 1GGHA 1KZYC 3ONFA 4TLBA 1DUIA 2J08A 1S4QA 2J3KA 3FYUA 4DNPA 1R0ZA 1I2AA 4OP2A 2QTCA 1W1UA 1EB8A 4C4XA 4P86A 4HMOA 3FUVA 4TV9A 1GFWA 1MH1A 2RHGB 3GJZA 2OFOA 5DNEA 1XLTC 3M5DA 3WIVA 2CNWA 1WCIA 1Q2UA 1ADGA 3IKMB 4TV8A 4DCVA 1ODIA 4Z0NA 3PYMA 1P9NA 1L7XA 2X9VA 3LVQE 1CUBA 4CFZA 3GJXC 1DKLA 3IBSA 4NMLA 4RIHA 4IXDA 4JY7A 4IM7A 1N8SA 4YRIA 2WWGA 2XR1A 3UN1A 3RAEC 2AYZA 1P7VA 1V45E 1A98A 4MV6A 2B0JA 5FRDA 4BN4A 2X7XA 2II6A 4CXMA 4UMFA 5B58T 4RC9A 2WY2D 4C5BA 4CLOA 4KRXA 3BMCB 2CLMB 3JQAA 4ZMBA 3BTUA 3IDAA 1FA9A 4IDOA 4JLWA 5KAPA 4DDKA 3U09A 3C3BA 3EQ6A 4RKQA 1LI5A 3IT1A 3I5MA 4ZREA 2A59A 3L84A 3MS7A 1VL5A 5EGNA 5EWMA 2J1LA 2OWEA 4FPXA 4E5DA 3IP5A 4WCVA 4J91A 3BGIA 3ILXA 4L4RA 1TFUA 1OX4B 4EARA 3ESZA 1Z8NA 3OUUA 4ZI7B 4M0UA 5C5EA 5HNKA 4AKGA 1W4CA 3ODPA 1G59A 1IXYA 1J2JA 1GPNA 1DKMA 5LQKA 3Q6NA 5KTYA 2XITA 3P9QA 2ROQA 4NBWA 4ND8A 1EVZA 2IITA 2PEZA 1R5NA 4K0RA 4QYWA 4ZT7A 3UOWA 4QDJA 1JILA 1JLRA 1KARA 2QTBA 4ZVUA 4WLNA 4RHFA 3Q6MA 5HX7A 4F5ZA 1K3TA 3Q85A 4HZUB 3HXTA 2PT9A 4LYFA 1Z6PA 1G55A 1AE1A 1AGXA 2DSTA 4AJEA 1H2EA 1LF0A 1YFJA 2WIKA 1FYXA 4E5PA 2EJVA 1DRUA 2I6FA 4MX8A 3Q3CA 3KYCB 1I1OA 2QL6A 4CKBB 3IE1A 2H2HA 1TTQB 1W5TA 3MCAA 1OJLA 4BJ3A 1FP1D 3FNHA 2IUYA 3PYXA 3RADC 2JGDB 3IHWA 2KQUA 4NBSA 3SX0A 5E6SB 1RAHA 1HE4A 4DMUB 1EGVB 3EZ7A 3T4UA 1M72A 1WCV1 1U7DA 3C1OA 4FDAA 1NY6A 3ET5A 4NH4A 4QDOA 4ZPJA 4EB6B 2GN6A 3GFSA 3BWEA 3A0RB 2G28A 2AC7A 1U99A 1Y6ZA 2FSPA 2I3ZA 2JZOA 5JS7A 3LJKA 2COKA 2JCBA 4GI2A 4F3KA 3GWZA 1UPAA 2PK3A 2C7BA 2QT1A 2CSUA 4X1KB 4YLYA 1N9KA 4P2GA 4QAJA 1A8UA 5K3BA 2J45A 2VPZA 5HKLA 1KDZA 3UO8B 3PSHA 1AQYA 2KHZA 5AW3A 1E0KA 2BSQA 3RK4A 3PX7A 1SUBA 4FFSA 2ZZNA 4LOKA 1YRQA 3UJ9A 3LCVB 4IXMA 1AUOA 4UUOA 1O4VA 1Z75A 5EPEA 4GVXA 3EVEA 3O38A 1T24A 3C6YA 4P35A 4ZHSA 1UJMA 1E4OA 2GRJA 3UYLA 4F3YA 4QU8A 3GCWA 1TB4A 3QLTA 4HAXA 3T5BA 3LV8A 1FTQA 3OSUA 3PA8A 5ALEA 3SQNA 3VV2A 1RXSA 1U9IC 1OASA 2XWSA 1V4VA 3LKBA 4KO4S 2Z3ZA 3P26A 3HXKA 1F9AA 2JLYA 1Z5WA 2B2NA 4BN0A 1C3OA 4V39A 2IBSA 5MHTA 2YC4C 5BNTA 2RHLA 4I1SA 1P73A 1XTQA 4CU5A 5CG1A 4Y2SA 2P5YA 4O1HA 4KMMA 5ARCA 3GUCA 4RQTA 2GXAA 3O7WA 1WMFA 3OU6A 2JHPA 4Y9DA 1SKMA 1GY8A 4OAOA 5CEEA 2AI2A 3OC0A 4C2BA 4FE7A 3GAFA 2BDEA 1LSJA 4Q6BA 3OIWA 3AETA 2GJ8A 1RE1A 2VJQA 3BMQA 5CJPA 4YDHB 2BKEA 1TUBB 1LQTA 3LI2A 5EWLB 1QQBA 3KVRA 4P4TA 3NC1C 2WKPA 3ZDZB 3JD0A 4MPDA 3G2JA 1JLLB 5BP7A 5JH7A 4I5FA 3DTVA 4ML3A 4CMEC 3BRSA 4JLOA 1LVGA 1PJCA 1PZHA 3CLVA 5CTAA 3VC1A 4DIOA 2XE4A 3I9V6 4Z9XA 2HDWA 5F3WB 2CC2A 3PTAA 4BZWA 2XCIA 4NICA 4QKQA 2O2IA 3CGWA 2LCQA 4IJKA 2C78A 2EBFX 2IPOA 3GZNA 1EUYA 2BBSA 3DPSA 4CIAA 4QDZA 5TF0A 4IO0A 4QDXA 4UQOA 5TJHA 3TTUA 1RWNA 1AGRA 1G7RA 3O92A 1BS2A 1UBEA 2H3EA 3WV5A 4KLAA 1DB3A 1NMEA 2XTNA 4MJXA 1AV6A 1JFFB 1QIHA 3UF0A 1RJFA 3EYWA 3U61B 2G25A 2H2FA 4J0FA 3IA2A 1QORA 1BA3A 3NRJA 1EEHA 3KKEA 3OP4A 1MPTA 2V7GA 3V7UA 4QGFA 3LLSA 4QWMA 3OJEA 1QFMA 3UA3A 1QH8B 3ELUA 1U7UA 3IXQA 3F3SA 3OH8A 4M53A 4NS4A 3UMGA 5HUQA 5I7EA 1TEZA 3OQIA 3CSDA 4BC1A 1ACJA 4X1OA 3EPJA 4HUQA 2HD4A 3T9BA 1Y5IA 4LPKA 2W58A 3UJ3X 3X2FA 1Z5NA 4CCYA 2DC1A 1I7DA 4XWKA 1PS9A 2FEKA 1GZSA 2I03A 2PZFA 4GP9A 1M2OA 3Q2IA 4HLCA 4K46A 2FQXA 4MQMA 2TRSB 4EVIA 1JQEA 1QS0B 2E1PA 3GELA 1JDJA 2WNIA 3WE7A 4UPEA 5HZHA 3QXXA 5JU6A 2GBPA 1DC7A 5CH3A 2W8BA 3HDTA 1C1DA 2JC3A 3EGDB 4CIYA 5G3YA 2XOKA 1P74A 2HM7A 1ISPA 4BLOA 2FZ5A 3WMXA 2O7VA 2VYVD 4GC5A 3GW8A 2VDJA 4NAVA 4UEJA 2GPAA 1U5BA 3PHCA 1UEJA 1Y3IA 2F8TA 1XVVA 4K9LA 1E7QA 5IFLA 3G9ZA 3R75A 1E3WA 3DFZA 1OGYA 4YJ3F 4YJDA 1B41A 1CY8A 4BMXA 5LMNB 3GJ3A 3LPMA 1XMIA 1IBSA 3IBCA 4M1WA 3DOHA 3U9TA 3FMIA 2NO9A 4G81A 4ZJZA 1EP2B 5GZ6A 3VMMA 4MI3A 1XIVA 4B7AA 1F2UB 1JIUA 3IP3A 1I2BA 4G2TA 5KQMA 2R85A 1NAHA 3HACA 1T2CA 4CV1A 1UC5B 1SK9A 2Q4OA 2AI3A 2EZ9A 4W4TA 5I9IA 4UBLA 1EP1B 2VH2A 4NATA 5C7YA 5MN6A 3H2SA 3KALA 1PEDA 3DV9A 3K72B 3VXKA 1WY7A 3ABRB 5CVDA 2YW9A 2QD3A 3FGZA 2QF7A 5DE3A 4G85A 5BV8A 2RFLA 4K1XA 2V65A 3WMFA 4TWAA 4PC6A 1DIBA 4M1KA 3INTA 4B85A 4D3SA 1I3LA 1DADA 3KJGA 4MQFA 1KKUA 3K16A 5FNVA 2UUOA 3DWGA 3SNHA 1SBZA 1SKAA 1M6EX 4KQKA 3DLIA 4CNQA 4AP9A 4ND8B 2A5GA 3AWIA 1X92A 2A3RA 1WL8A 3FUUA 4EDHA 5CDGA 2ORYA 2GBLA 1JDBB 1BMQA 1VE7A 4N47A 1L5FA 5D1NA 4RTOA 3O93A 4XGNA 3TZBA 2OGUA 2R68A 2PR7A 5B53A 2JIZD 1L5GB 5CBPA 3ZD8A 4A5SA 3L46A 4KR7A 3MQ4A 3DOEA 1ADCA 1LVUA 3H5AA 2WSIA 4E03A 3HXPA 2HT1A 1UOEA 5I9TA 3PQ5A 4H7FA 3VX3A 3CX8A 1J0CA 1I4EB 4YC7A 1SZCA 2BGNA 4RLSA 1NVBA 4F38A 1GN8A 1NQAO 2WPDA 2B5WA 3MWDB 2V54A 4QGSA 4Z4FA 4QPCA 3KZKA 1KEPA 3ETJA 1FNCA 2CV1A 4G8JA 1RI5A 1R9MA 2EJTA 4DYHA 3KQWA 2H1IA 3LY8A 4X0EA 1GPKA 2VSOA 2QT9A 4F1JA 4K9MA 1O77A 5EIOA 3V34A 3O3MB 3L6OO 3UENA 3HCEA 3ZIDA 2BMVA 5G53C 3L7KA 2GM3A 4YT2A 1XXLA 5EPUA 3C6ZA 3UT6A 5DBGA 4BBAA 3HHPA 3B82A 1SUAA 2RAVA 4R2XA 3UIEA 2HR1A 2C9MA 1ATIA 2VDWA 3F97A 2C3UA 3HRKA 1OUMA 1R66A 1O54A 3OCCA 2C98A 2DTXA 4H27A 3WTCA 3ENKA 2HCFA 4HWKA 4KWEA 4LKRA 1K4MA 1E2NA 2N9UA 4MDYA 2R6R1 1DKQA 3KXKA 3OUTA 4J0QA 3EVZA 2OHXA 1MAUA 2UKDA 4L5YA 4NOJA 2PL5A 5AKYA 3N8GA 2FB9A 2BMJA 5H70A 1CR0A 1DAKA 2FWNA 4WZBA 3ZD6A 2O6HA 1WY5A 2PRSA 2COUA 3K0EA 4PF1A 5HS4A 5DYWA 3F74A 3P9KA 3H1GA 4UBNA 1FP4A 2BBTA 4X8LA 1NBME 3JD2A 2VTBA 4DA0A 1Z8DA 2WTNA 3KEOA 1O6CA 1YULA 1KOLA 4R2IA 4B8YA 3EWIA 2NW6A 4CN9A 4POAA 2K6GA 4HKTA 3PUYA 1RQGA 4NBLA 3ZPXA 1HE1C 1E77A 5ALDA 5GVRA 3V8VA 4E3WA 3K53A 1RU3A 2XWQA 3IJEB 3T7AA 3VR2D 1TO1E 3U5ZB 4BYGA 1Y8AA 2QTVA 3LVRE 5H9WA 4TQGA 2MSCB 2RGCA 3TLGB 1W88A 1U0SY 5TQVA 4JOSA 1KQNA 3ZQ6A 2WG2A 2R00C 4G4JA 1V9LA 4IKEA 3ILYA 2H31A 2AOUB 1W1IA 3LD9A 3AONB 5HBRA 3PCTA 1IDOA 3CG4A 1Y4SA 2FN9A 1TMOA 3FW1A 4YXWA 3H1FA 1GZ7A 1NVUQ 2OESA 2VK1A 1Q3KA 1T36A 2QY6A 3ZDCA 3QF7A 4LCBA 4X3OA 1USGA 4EYGA 1QPZA 4JXZA 2E7ZA 3QF4A 1DX4A 4RGQA 4MRAA 5TR9A 2HIGA 2VDOB 2JK0A 1S8NA 4HBZA 4B34A 2Y0DA 1YS1X 4F5WA 1VLJA 1YO6A 4IIFA 1NNEA 5JI2E 1S1CA 3AQ4A 2IEYA 4QJ5A 5F7JA 4CCWA 4JB8A 1UWKA 1YDEA 4FKZA 421PA 4AROA 3WGUA 5ES3A 5JNLA 2FFHA 1IONA 1BMFD 2IXDA 2Q5OA 1SCIA 4R1UA 4EGCB 1DTWB 5EMMA 4K05A 2P9TA 1PAUA 3COWA 5L3RA 5KYKA 4R9NA 1HZJA 1ZJ5A 4N8DA 4E2XA 3PPWA 2JGNA 4OA8A 1VHJA 1VHDA 2CW5A 1TUBA 3H3FA 3BZWA 3HN2A 2CNKA 4C7JA 2FLVA 3T3DA 3ZGOA 2WF7A 5F3DA 1DX6A 2P2ZA 3PUIA 4HWSA 2C92A 3E0QA 5EJEA 3VUEA 4QJ3A 2CNDA 1AIPA 1JHMA 1MRZA 2FX3A 2GUGA 2OO5C 1W87A 3AFNA 3DHWC 3ZHTA 5HKKA 5FBVB 2PCJA 3SFZA 2L17A 1T5IA 2YXEA 5L3ZA 2CXNA 3M9LA 4HRVA 4FINA 4ZYXA 4JDPA 4CL8A 3JALB 3GXOA 3FPLA 5DYYA 5FBHA 4R98A 1OE0A 4M8IA 2AN3A 1ZONA 1DKRA 2AZ4A 3VVBA 5IAGA 1IBKB 1E3MA 1UKBA 3SDBA 3EXHA 3DLAA 2GEKA 1R9GA 2V8BA 3OZWA 4DCCA 1PV1A 5ERYA 1AMUA 3HTXA 1V3UA 4M98A 4YREA 3GUHA 1CE8A 3G2QA 4QIHA 1ESMA 1EUDB 1GZ3A 1WUIS 4GMKA 4JT8A 2DXIA 2ODQA 5CJ2A 5JCPA 4FYPA 4LWPA 2QU7A 4DCUA 1MTZA 1EXWA 2HQOA 3U4HA 4DCMA 5KOIA 4NARA 4OGLA 3VR4H 1UWCA 2QSYA 3CC8A 1ADFA 1FRNA 2PLNA 1QDLB 4KYUA 5FOTA 1G60A 5FWYA 3U3MA 2LWIA 1P2VA 1K89A 2DHQA 2GPTA 3C7TA 4DJEC 4HUQB 1KBOA 1X7XB 2XCQA 3MUNA 1YDHA 4MW2A 4EYQA 5INTA 1KZ1A 4WT7A 4C4OA 1Y9ZA 4M7RA 4F72A 5B7QA 1JXAA 3U1VA 4ZCTA 4W7HA 5HMLA 2WKRA 1C3JA 1LZLA 5FOQA 3HA7A 1I32A 3EYAA 5CDSA 4O1IA 3TSZA 5KUTA 2HSGA 4WGFA 3T9AA 2GS9A 1BWQA 4N4AA 4AJJA 1NBEA 4IMRA 1OWLA 2WM2A 3BH6A 1U1FA 4OY3A 2H9YA 5LP6C 1C1DB 2NZWA 3DLTA 4ZO9A 3AFMA 4MW9A 4GLLA 5G4KA 1GZUA 3E3LA 2PT6A 2UZ4A 3T7DA 4CI0B 2ABWA 2FWAA 3LVBA 3BWYA 4FDLA 3WK4A 2J48A 5K3FA 4FFMA 5AM4A 1W34A 3GD7A 2FF7A 3Q4GA 3KLPX 2JLVA 3N7TA 4X71A 1XELA 3TE7A 2BM9A 1T3GA 3S70A 1YJCA 1ZJ4A 3FNBA 4HXGA 5H16A 3B7WA 3AHHA 3H17A 3OZUA 1X9IA 4URXR 3ENZA 1YE8A 2IHVA 3THXA 4MS1A 3NVAA 2YHUA 3D4OA 4W82A 3HCNA 4NENA 2QX9A 3JQEA 2ZUCA 4G4IA 4XB1A 5LWHA 4WXMA 4CWAA 4Q9HA 1BHQ1 2WSSA 1ZP6A 4FIDA 3NBXX 1VLHA 4RMHA 1QZXA 2NT4A 4D43A 5DI3B 3DKPA 5JOQA 1RRPA 4HOYA 2VPXA 1IY0A 4JYCA 1J1IA 1J42A 1T0UA 2IHBA 1CD5A 1BRMA 3PJDA 3DXZA 3NIDB 2TMDA 1W5SA 1P2DA 4TS1A 2ZXEA 3CLTD 1KP2A 3KXDA 4U0KA 1AKRA 4LTDA 3L3BA 4WADA 3C8DA 4F6CA 1SC3A 5AVOA 2GETA 2C4UA 4MWGA 1CVLA 4URWR 4YGYA 4GC9A 2ZIWB 4H0CA 4KQHA 4YQYA 1KSJA 4FDUA 4XWWA 4D4JA 2WW8A 2R2AA 3ANMA 1DO0A 2JD1A 4FJ0A 4QNNA 2P9FA 2RHRA 2ZBUA 2GD6A 2I3BA 2J67A 4W5TA 2ZSHA 4D4MA 2V5AA 1VKJA 4QARA 3AJAA 4IJVA 3IBYA 4G5HA 4BXOA 3KG2A 3K8OE 3SJAA 1Z4MA 4OKIA 4BGEA 4O1MA 1ETHA 4BFZA 2VTBB 4E88A 2A4MA 2BFDA 4PNPA 4EY7A 2G82A 3W8RA 2Y9PB 4UPVA 3LQ1A 3DTTA 2G0AA 1KMIY 1WBJB 4XLZA 1T2DA 4A10A 1PU2A 5DLPA 5FFMA 4D9HA 5CW1A 4YMGA 3PEWA 1Y6GA 3OPQA 5EHIA 3AL0C 5J1SB 1U9ZA 4B87A 1JE1A 2J6BA 3ACBA 1BN6A 2ZP1A 3EUFA 3K5IA 3VGPA 4GVPA 1TJNA 3ZCUA 1XK7A 4OHXA 2HWYA 2AOTB 1RQPA 4F86A 4L1KA 4WUVA 1D7AA 2IX9A 4RVFA 3ZI0A 3P27A 3PI6A 5A04A 3PFNA 3IRVA 4JEMA 2EP5A 4M22A 4RTRA 3FTNA 3EX7C 2VK8A 2NO5A 5JXJA 3ITEA 3K32A 2QWXA 3W2FA 4X66B 5COAA 1TW3A 2O07A 2XPCA 1CPYA 4QHSA 5AKXA 1S7CA 4OLHA 1P1RA 3R0IA 4QX6A 4TTIA 5FI5A 4U7DA 4K8OA 1KDPA 1QH1B 1V3VA 3LZDA 4X54A 4F1KA 5KOHB 3OTOB 3KAKA 4MEAA 4PIVA 2AN5A 1BWRA 1OLUA 1WF3A 1MU0A 5JS6A 3QVWA 1CB0A 1RYFA 3PD0A 3RTDA 4KSBA 1TK2A 2GN8A 3MF4A 3IAEA 4LSZA 1JG1A 3RAGA 2XDQB 3AY7A 4DCGA 3EEYA 1EDDA 3I6QA 1WV0A 1OSNA 3K0KA 4DLNA 1DS6A 1YK0A 4M0PA 1B7GO 3VVCA 4H1VA 4JUCA 3Q7SA 3H6GA 4K9QA 1KDTA 2FYTA 3TPFA 1EEXB 1Z3CA 5REQB 2AN9A 2J4DA 3ROKA 4BKUA 4Z7QB 3EIWA 1Z15A 3TOXA 3TIVA 3G79A 4QFMA 4BNDA 1T29A 1FXUA 1Y9JA 3EZ2A 1QH8A 4LF9B 4MGZR 1CFJA 2D3TA 2CXHA 5AKEA 3HGMA 5EP3A 1HQKA 3M9WA 3ZNOA 3U37A 2NU9A 1GV0A 1NC1A 3E22B 4TMXA 5HRCA 1GAJA 1TIKA 2OAEA 2OUKA 3W5IA 5KHLB 3VA7A 1FLVA 2AEMA 1CNEA 2C77A 2JW5A 2OMEA 2WWXA 3KCNA 3L7JA 3SX4A 3MINB 1XSEA 3UHFA 3ZK8A 5AI4A 4MR8A 4QHYA 1ULUA 3MSXA 1QS0A 3VV3A 3U4AA 1SXGA 3DT6A 3QOFA 4WMLA 1MQ8B 5TPZD 3SE0A 1HKHA 4XAQA 3L4JA 2OKCA 4KR2A 3VKGA 1G4HA 3M1AA 2A8YA 1VCNA 1QPGA 1K6EA 1NZJA 4GOND 2WPDD 1GQSA 2OTCA 4K6CA 4GZLA 1LK0A 1Q57A 3CH6A 3D5TA 1U28A 2HZBA 5A1JA 3H5WA 2XE7A 2ZI7A 3T38A 5K0JA 2F3PA 4IG4A 4Q1DA 2HXGA 3R6LA 1FLDA 1E3WB 1EGHA 3RUDA 1JU3A 1Z6YA 5FUBA 3V4LA 4E5NA 1JUDA 3RTGA 3ICQB 4F4UA 2EKDA 4B47A 5A5FA 3AJEA 3AGPA 5T3UA 1U28C 3G5MA 2QW1A 1TF7A 1W5EA 4KUHA 5LC1A 3GUUA 4PC7A 2Y1GA 2Z4TA 4IGAA 2CXUA 2C57A 3W1EA 2PMEA 4II2A 2WYIA 1FYEA 3EBLA 1KIFA 2XCUA 1UK6A 1XEWY 3H18A 4I8DA 5E3HA 3FGNA 2W6PA 4I6EA 5AW5A 1VDMA 5TXGA 1PJSA 4FDTA 1KU0A 1ZPDA 2PD3A 2FR8A 3OZXA 3FDZA 1NZFA 4ZQBA 4EHAA 2H07A 1JH9A 3TCKA 1J8FA 4ZOAA 5GMOA 5HE9A 2FETA 2WNSA 4DQKA 4PPNA 4QLOA 2PYDA 1QVVA 2ZUEA 3WRWA 1ICEA 1Q0PA 3IXMA 4DARA 2H5LA 1JDZA 4PX3A 3K15A 3F5FA 1W0JA 4QJIA 3VH1A 4AXXA 2BELA 5JFTA 5LL6P 1O0BA 1JWLA 3ZXXA 4AKHA 2GBFA 4BQPA 4W9NC 2QTNA 2HJVA 4DBLC 3BCHA 5JROA 3T3EA 1AMNA 4GLFA 2AEFA 2R4UA 2VDLB 1AQNA 4LJSA 5HOEA 3F8TA 3LX8A 2WIJA 1Z83A 3DXXA 3L6BA 3LVFO 4QFDA 1R6AA 3QWAA 1XP5A 2JAWA 3NBMA 1VA4A 4WLEA 4QNRA 3MWLA 2VG8A 1QXSA 3SBXA 1H9BA 2ZUVA 1DBWA 1XQYA 5IZCA 3RBAA 1L5HB 4IIEA 1ZK0A 3T4XA 5KJCA 3M6FA 2NZ8A 2OBBA 4TL6A 4D79A 4JLBA 2ENWA 1E3JA 1E9DA 2ZEJA 4L27A 2M6KA 1TKAA 1XKTA 3HFSA 3W4KA 4DN6A 2HU2A 1PQUA 2FMTA 1VRVA 1J7KA 3K5WA 3A1DA 3DMRA 1Z12A 3GBSA 1N5JA 2Y6UA 3Q7RA 4DEYA 1ECGA 1SRQA 3E7WA 5LZ5A 1SB8A 1EE1A 8GPBA 4MW6A 1MORA 5FL7D 5FL3A 3RVJA 1LS1A 4QVKA 4RTKA 4ZV4A 2GZ2A 1GL9B 1QYVA 2YX1A 3H9GA 4J1QA 1BW9A 3VO9A 4AJKA 2Z2YA 3EUAA 2DWPA 2WJIA 1X1RA 1KL7A 2B0CA 4X97A 4LI3X 5EUQB 4D9JA 2AK2A 3HJUA 2NVUB 1DEXA 2J4CA 4N18A 4CMKA 1T1SA 4DCJA 3P9IA 4MYUA 4AJOA 1CJMA 4WJZA 4EMTA 3DE0X 2QGNA 1FQWA 3CN7A 4S0ZA 2XUQA 1PLKA 1EZZA 5BORA 3X1YA 4WSOA 2R1TB 2I8CA 4RHUA 1DEAA 1JALA 3H0CA 2QM7A 2XV1A 3OT5A 5LP6A 3PG5A 1ISJA 3DL7A 3QHPA 4BFLA 3MQ2A 3HS3A 2QV7A 3OX3A 1QB8A 3K9WA 2CCGA 5LQSA 2ZRGA 3I0MA 1RR6A 4MZDA 2GAFA 5KVCA 1BA2A 1LY1A 1DNPA 4WCFA 3O1HB 1EVKA 5AUNB 1DO8A 3IUYA 2GZSA 5DHQA 4XCQA 2GI4A 5T5QA 3VPHA 1ID1A 4NYMR 4ZFNA 2W2PA 1W6RA 3RRMA 2O1XA 4WV3A 1ZMXA 5SZJA 4MTCA 3FX2A 1NN0A 2C4HA 3IXLA 5LBIA 2AEJA 1C29B 1QHIA 3T99A 3F98A 4ESOA 1HDRA 2VJAA 5IX8A 1NI4B 3HZRA 2QN8A 3O8BA 2HUPA 3H8WA 1DZIA 1UK8A 1XZFA 4OEHA 1PNVA 2W83A 3R40A 2L18A 4DMKA 3I72A 4QUDA 2ZI5A 5SYNA 2P75A 3U9LA 5TMPA 1AXEA 3U4QA 1XZDA 3U7HB 3AHFA 1TK3A 4XDYA 3W79A 1PBNA 4MVJE 3KL4A 3DONA 1DHTA 3KLMX 3L5OA 4MEJA 4YJHB 3D0OA 3KQMA 4MW1A 3JZDA 1Q11A 2ZBQA 3A6KA 1E6KA 2ODBA 4B4WA 1RYMA 4RFLA 2AI1A 2ZWIA 4CN8A 4DR4B 2R97A 2O8NA 3MTQA 3OX1A 3ADKA 2W2VA 3LT2A 1T9GS 2FG7C 3A58B 3CU5A 4HAIA 3K73O 1TCVA 4LYJA 2PN1A 1JKJB 1JEOA 2C58A 4ZOLA 5EJMA 5EZ5A 2J6CA 1B2LA 4PLVA 2X9LA 4MS1B 4ASUD 2BGLA 2A9QA 3A1WA 1MEEA 1N1DA 3NGXA 5A02A 2LPMA 3JCZA 1ZIOA 2F64A 3SI7A 2HJRA 1DWOA 5HFJA 1IHDA 1EA5A 5BN4B 4CTNA 1RI3A 1NMSA 2OAP1 3LAWA 5EE0A 4CKEB 4PG5A 4GGMX 4RH0A 4YX9A 3I5AA 1WB4A 4GOOD 1FUIA 4GMFA 2CFTA 1SC6A 1NW8A 1T43A 4MKHA 3G0HA 3E61A 2DHCA 2PWAA 5F2EA 4A6EA 2OV4A 5DTMA 4BNDB 1ULZA 1DXQA 2VJDA 5FULA 3ZHQA 5BSFA 2YFKA 3Q9LA 1Q44A 3AEXA 3ROPA 3L92A 3RASA 2NGRA 1WZ2A 3DO6A 3PWSA 1MJFA 2F8MA 2I4TA 3KFVA 5FDFA 2BGGA 3ORHA 1P9OA 4DMLA 3S4YA 4BMZA 1F60A 1O9GA 4HFMA 1BMFA 1T0PA 2FPOA 4P34A 4FYMA 1D0IA 3V80A 1M3SA 1AUVA 3MW8A 3PWKA 3E9RA 1QIKA 3B13B 3EA4A 3BZUA 4GUDA 1KA9H 1NG1A 5AXBA 4BATA 4CKBA 2CDAA 5J2TB 1CK4A 2R3SA 1OHHA 1GKUB 1XTJA 1YDGA 2GJSA 3AKYA 3PRYA 5EEHA 3IKTA 4LGYA 3SZOA 4HT3B 5H8WA 1DBVO 1OQAA 1U1DA 1V96A 3K9CA 4WIAA 4DAEA 3KBOA 1KI4A 2YRFA 1PUJA 1XKLA 1KEKA 5JPDA 4I5GA 4IHAA 3CURA 3SMVA 2CDNA 1XAIA 3GJSA 1ZICA 5TNXA 1PYOA 4MP8A 4O8ZA 1CIPA 1L7BA 2O48X 2NP7A 2XZDA 4KUEA 4RLFA 1TOAA 4C2AA 1NHGA 2EFHB 2KSQA 2VYNA 5KSPA 3B1JA 3K2EA 5G0WA 1KE1A 2HK7A 1L4HA 4UOQA 4O0MA 3AGQA 3DDHA 4B9AA 2TECE 1YBVA 1C3EA 1TAHA 3OHPA 1SZJG 4ZYVA 1BZYA 1Q7EA 2BLNA 1L8QA 1OLXB 1U6IA 3SQXA 3CNNA 2ZJAA 3ADOA 4QLBA 3PHGA 4XSVA 1OU0A 4F0JA 1WSWA 4HQRA 3SZGA 4E2ZA 1VC2A 5KB3A 5G3ZA 1C1HA 1TQ4A 2Q0HA 3MEQA 4L9WA 3RIHA 3WZLA 4EUEA 1UBGA 3BCRA 3PB3A 5FD8A 4EA9A 1YUBA 1KDYA 3U3RA 1OGJA 3T61A 5G40A 3KUCA 3TX2A 3ZXIA 4DG8A 3CB2A 3CIFA 2IBMA 3GBPA 4G5FA 1HDZA 3VFDA 1TUGA 5KTMA 4WWHA 1PT7A 2F43A 3BA6A 4G1MB 2CWDA 1JI0A 3DA8A 5A4KA 1NR5A 1MFZA 1CNMA 1TXGA 5DYTA 5CEJA 2QG6A 4Y1EA 4PSCA 5K0GA 4FGKA 3K9NA 3DW3X 4A9AA 2AG5A 3L5KA 3RWOA 4BWYA 1VB3A 1N8TA 3IAM6 4US2R 1LW7A 2X5OA 1A1VA 2D5IA 2IYLD 1ZD2P 2O52A 1RE0A 2GTIA 3T41A 3RAJA 2Y93A 1VRWA 1Y1SA 3I01M 2HXYA 5AKKA 3HY3A 4URYR 3NM5A 1NMYA 1QF7A 3I42A 3N8KA 1B43A 4Q3LA 4ZA2A 2A6PA 3FMFA 3T7CA 4KWCA 4L57A 2LRHA 4Z9YA 4OA5A 1FYWA 1GPH1 1XTIA 1S2IA 2AOXA 4MRMA 2CB0A 1Q0ZA 3DFKA 4WASA 3T12A 2VF2A 4G8DA 3E1SA 3DMYA 4JP1A 3TFQA 2O2XA 2YVKA 4LOLA 2FGJA 3WYAA 4B6PA 3NMUF 4RA6A 2VQ3A 4JSYA 1GZ4A 1NR1A 4CQJA 4OQEA 5GPBA 2GN1A 3PHJA 1OU4A 1A3CA 1YRBA 5TT0A 5JYBA 3MLEA 1I94B 1HO3A 1P17A 3CMMA 3ZHXA 3H2IA 2ZQYA 2EERA 2QLLA 3JRNA 4MIYA 1R6DA 1MHTA 1AJEA 2NVUA 1E0SA 3R7DA 4JIGA 5CIQA 4CDMA 2M6LA 3DCJA 13PKA 1UMDB 3QEMB 2TMYA 1WQ3A 1GSHA 3MJHA 4A92A 2JGRA 1ZH6A 2ZIXA 3L04A 3UJ6A 3AYZB 3E35A 2OV3A 1SXJC 3HPRA 2DECA 2XD4A 5BRAA 3QY0A 3VNUA 5CFRA 1T2UA 2ZUWA 3AJ9A 4QOGA 4EJSC 3CYFA 1F0PA 5JCXA 3CX7A 1Z37A 3DBRA 4ALKA 4Z4QA 4CM7A 2I6XA 3E82A 4WTOA 2Z43A 3KBBA 3O21A 2G7ZA 2AFIB 1X7WB 1ZOOA 3MT7A 1SQ5A 1X8KA 1M1UA 2WU0A 2QTFA 1FBTA 2ZRPA 5HA5A 1PO7A 2QPAA 2FZGA 1QZ3A 2TS1A 3H9QA 1WIWA 4I5DA 3OP1A 4HLUC 4YXFA 3PV0A 1YT5A 2ZAYA 4MHOA 2J5BA 3E1GA 4HY3A 4PZPA 2AG6A 4DLPA 2ZRDA 3K94A 2AJLI 3Q3GE 3X1MA 4KN8A 2VP3A 1QR2A 3ZNNA 2YYSA 1X3LA 3IMKA 4N82A 5BQPA 5C80A 4DMRA 5ADHA 2VAVA 1TT5B 2FSGA 3FPFA 1ARZA 1ZMTA 1SO8A 4Z3OA 3ZWXA 1T3SA 1XD9A 2HSDA 3NHBA 4UXJA 2XMPA 3SHWA 2J3LA 5CT9A 4F9EA 4NCBA 1GCOA 3B89A 3P9ZA 3L7AA 2FK8A 1ESCA 3B5EA 1KYIA 1S3FA 1VCIA 1L8LA 1XJ0A 3K1ZA 3AR6A 4JL6A 3OY7A 4JD5A 4NEQA 3H86A 1P9RA 2XVAA 4MLPA 5AXDA 3CKYA 1NYQA 4Q9IA 3LTNC 1DMRA 1OC4A 4HC4A 5CFZA 4X64B 3UBTA 4C05A 1U1CA 2DFDA 4L02A 3GJYA 5HS6A 4K9RA 1AS0A 1NIJA 1IUOA 3WO0A 2AJTA 1Z4IA 3AOEA 2I4NA 2D5BA 4M9CA 4JCOA 4UAUA 2X4GA 4B09A 4BAUA 4CG1A 1TLLA 2AG8A 1KKMA 2XF8A 3FPSA 4DA4A 3THSA 3TG8A 2DUUA 2ETVA 2FPLA 5L4SA 2CJPA 5EIFA 1L5VA 2RKWA 4OHKA 1X1BA 4QUHA 4IZIA 2I91A 2EIHA 1T13A 3EH2A 1JG4A 1A27A 3PLRA 1W7AA 1YSCA 4E70A 4MUXA 3WFJA 3LQKA 1XQWA 2A67A 4P5PA 1GKIA 1ZX1A 2NO6A 3IAS6 4IDBA 4D3DA 4JI0B 3DBIA 4AN1A 4ZCIA 4LHYA 1PGNA 2NYAA 3HK2A 3WVNA 2WSBA 2OLEA 4HGOA 5GGXA 1J8DA 3OBBA 3LWNA 2J7KA 3EUWA 3PNBA 4I55F 5T6BA 3V97A 2KJQA 5FNVB 3LY7A 3ZNPA 4EG3A 4FTWA 3WGGA 4KMOA 4AS2A 2WT4A 4B6FA 3U3DA 1Z35A 3BCSA 5FBWB 1H0SA 3MT0A 3IMCA 3TSCA 3TW4A 3WMWA 2GFHA 2EFDB 5IWAB 2EFEB 2HRQA 5E95A 2I80A 4O5AA 4KQEA 5D3QA 4C01A 2DYKA 4Q4DA 4BFWA 3A1EA 1U8XX 3O82A 4UUBA 5EP1A 1MG5A 1HLGA 2XQIA 3PI7A 1MJHA 3EFBA 3ZVKA 3CUYA 3EODA 4B3XA 4DXHA 4I1VA 3IX7A 3SSNA 3M1IA 1MG0A 4FD2A 1HNNA 3WKDA 1CEEA 4JC4A 1FC0A 3BZBA 4HDKA 4KK3A 2YTZA 2CFSA 3RF7A 3HSYA 1CUWA 4N0DA 3DNPA 4RTLA 3GFQA 3T54A 5ECDA 2WFLB 1MX3A 4EHJA 2NNLD 1NQ5A 2OFXA 2JGDA 1YU6A 3CLSD 1U8AA 3SOPA 3WGZA 1OKKD 3G5TA 3P71T 5E2AA 1T3HA 2C8LA 3KKLA 5AI0A 2GLXA 3WWOA 3ZGXA 4UE3S 1E7RA 1H5UA 3L1IA 2ECKA 2PJZA 3GRFA 3VTAA 3A6GA 1GSIA 1K6MA 2X5NA 1T4DA 1Y81A 5FL7A 2F59A 1QH9A 5FYDA 3O1JC 2IU6A 2FW7A 2XA1A 3GP8A 3Q0TA 4QBGB 1ND5A 3E15A 3ANYB 2ZJYA 1XE3A 4P58A 1E2QA 2I2FA 1GQRA 4LMBA 4RGYA 2AMFA 1SG0A 3ZWVA 3DAGA 4CLDA 4JI7B 3C1AA 3SYMA 1PWZA 4Q47A 4XSGA 2YCBA 4U7TB 1DOZA 1W44A 5GINE 2HZ7A 2HYDA 3A6PC 2I6UA 2OM6A 2WHEA 2FU5C 4IH4A 3ILHA 4J8PA 5I4IA 2C2KA 4MIKA 4QSMA 1W36D 3FDJA 4DIMA 3CUTA 3R3SA 5KDLA 2DPGA 1UM9A 3E48A 5DP2A 3SBEA 4D96A 5BSEA 3T95A 1SBYA 1AO3A 4J0IA 1OZAA 4U3JA 2YMPA 2IDKA 5EXEA 4BWFB 1KMNA 4OATA 1MLDA 4EG4A 5HK9A 3KCQA 3SFVA 1LZKA 2CL7X 2XWJI 5BR1A 2Q8PA 1VZ2A 3JQBA 1J99A 4M37A 5AQEA 1PZNA 4ZAFA 3FPJA 1U2SA 2BV3A 1T0BA 3FNFA 3U3KA 1QGZA 5NULA 3OIUA 5JBIA 5JBNA 3RKUA 4ZHQF 1NQUA 1O5OA 1BCRA 1HMYA 1PHRA 3OE7D 1FLAA 1ZUHA 4L72A 4AM8A 1O95C 2QTVB 5EJ4A 1B8PA 3I2HA 4BVLA 1G20E 2FH5B 5H02A 3CMCO 1W88B 5ICFA 1P91A 4LGMA 4GRAA 4OVKA 4D8TA 1N7GA 4DLTA 5EE5B 2YH2A 5K8CA 5K0ZA 1RZRA 4EECA 4XD7D 2G9VA 5JAOA 1LA2A 4GPBA 3NWOA 3FSRA 3IAAA 3OF5A 2BI4A 2WE8A 3TZEA 2HIHA 3OQIB 3GRUA 3BMNA 5ICSA 3GLIB 2AYYA 2VYFA 4K8RB 3ADBA 3ZV5A 2ZJBA 1PJTA 5CXUA 3DBLB 3OMXA 2I1LA 3KV1A 4GPEA 3F73A 1Y7HA 4ARBA 5I48A 3KZCA 4Q15A 2LXNA 1LH0A 4HQLA 2WM8A 4Z4GA 3VU9A 4JB2A 2QN6A 4ZT3A 1N77A 1CY0A 3WQBA 2GQ0A 3FHJA 3JQ8B 4EG5A 2HT6A 5AJZA 2XCRB 4OYLA 4XPIB 5IK2D 1KR2A 4LJ7A 1ZNQO 2XMGA 1M0EA 4YO8A 3VU8A 1IFXA 1RSZA 4FUQA 2YNMC 4JA0A 2Z6UA 1Z2CA 3UAWA 1XALA 2ZIGA 2GA9A 5ERXA 4QEKA 4RKWA 3OVMA 3GG9A 4FZVA 1MJGA 3OWXA 3TEFA 4P38A 1WVIA 4GM4A 3NWEA 2ZSBA 3PDJA 3T5TA 2FP4A 4R5HA 2WYWA 2EAUA 5IM5A 2CCJA 4IVRA 5FOUA 5EUMA 1KSFX 4AJ9A 4DIBA 2FMFA 4QO7A 3TJZA 3PD7A 4NPCA 4F12A 5JMOA 4M8NE 2ZZKA 3SP1A 3SQLA 2L69A 3L9XA 2P2SA 1X2BA 4G41A 3ONDA 3V1TC 1Z0UA 1EK5A 1XK6A 3DSRA 3KZOA 1EWKA 4JUFA 3GGSA 1Q0HA 4R68A 2JLBA 4PC3A 3RUEA 1U4OA 4WKGA 5ER6A 1YCHA 4FSDA 4YT8A 2RD2A 5EZYF 3IMEA 1M2OB 1BH6A 2NIPA 2Y1LA 3ANSA 4JBHA 5G4LA 1NI4A 4CE6A 1XZ8A 5ALQA 1T34A 3L0ZA 1EP3B 3OZTA 4AF7A 2VQFB 5IFKA 1JHXA 3SZUA 2C00A 5I9MA 4Z4EA 1L5LA 4G25A 3O8DA 4ENPA 3UJBA 5B6IA 5BYKA 1W0KA 4WN9B 2JH3A 4EKYA 2C5GA 4M0KA 3UT5B 4IY1A 3U7IA 2Q6OA 1VYTA 1GO2A 3HO6A 1K98A 2XBMA 1NFQA 4E3ZA 4B32A 4YRRA 4HEA6 1J70A 2H0QA 4WVLA 3UHOA 5I8PA 1PJAA 1JSCA 4V1CI 5KJ1A 1A8IA 2BW0A 4WK4B 2XZOA 1KPGA 2OCGA 2UUAB 2QYSA 1JE0A 1Z2OX 3IUPA 2B4RO 2HNAA 3LCCA 5B12A 1ZJZA 3GDFA 3HNPA 3P8ZA 4MYRA 1BXZA 4K87A 4JC0A 3Q15C 5B1DA 1NN5A 2W90A 3DVQX 4HSGA 2ACKA 1N3BA 3HJTA 3AK4A 1UXKA 3GYGA 4RD1A 1G4AE 3FCAA 1V9CA 4LJAA 4W5JA 5K0LA 2OILA 1H94A 4HQ0A 4CKEA 1ZD9A 3CZ5A 1VXRA 1YRHA 3SLGA 5F1YA 4DYDA 1X86B 3KE9A 2Q2OA 3N0XA 1EFHA 4NR0A 1SVNA 4R1NA 3UCFA 4CW7A 3KXPA 1PP4A 3NHAA 4FS3A 4HYTA 1L5OA 4OHOA 4PX5A 4FFBB 1YE3A 4EKDA 1Q19A 4INOA 1L4KA 3WB9A 3OQBA 2V3CC 2PGLA 1A7AA 2FZ4A 5EVCA 4UVHA 2PRJA 4D9KA 1NW4A 1UP4A 2D2FA 3BEDA 4P22A 5ALTA 5ITZA 5DSTA 2QI9F 5JAMA 1M2VB 2E4UA 1DEHA 3CBQA 3ZGYA 2A86A 2Q5LA 4HWGA 4UZEA 3NIBA 4LS3A 3AERA 4IKPA 3OO1A 1JNXX 3IKVA 3TECE 3P9XA 4E1BA 3R0XA 2YJ3A 5JVDF 4QASA 5J2TA 4AY6A 5AO9A 5FI1B 2QMZA 1W4LA 1ZU4A 3HA2A 1UXOA 1NMQA 1S01A 1SIOA 2B2XA 3DOCA 3F49S 3L8MA 4RORA 4BL5A 5JCOC 3W5CA 4J4BA 2YVAA 1BE0A 1VP9A 3REQB 2IPNA 4XZ3A 3P9PA 3HWWA 1V5IA 1ZQ1A 1XRRA 4PZ9A 4UHFA 4WFJA 5CDYA 2XAAA 2AOVA 3G88A 4QICA 1NYTA 4X7BA 2B8EA 3B7PA 2IV3A 1EKXA 2E6UX 5YASA 2NPFA 1SQ6A 1D09A 4F5EA 1X1SA 1Z7BA 2DT8A 3V2UA 3KD3A 1I3MA 4WDQA 4EG1A 1I6KA 1FCJA 2QRQA 2ZRJA 3OTGA 4LA4A 5KKCA 5DLQC 5DHTA 3RRFA 4OSOA 4BJ1A 1ZM9A 4Q7QA 3KT6A 2OZKA 3EG9A 1E79A 2ZSIA 3V7FA 3W9BA 5IH7A 4YJ2A 4C14A 1KK0A 1VG1A 1YJ8A 1RTTA 4KLRA 4B43A 3K71B 2WABA 4PRKA 1II9A 5AIAA 2P4SA 4DUYB 1Z4KA 3WNZA 1L8XA 1HORA 3PE3A 2FOXA 4OQPA 4G0YA 1H66A 1KTVA 3GROA 3WXMA 3WBFA 1V4BA 2ES4A 2GPNA 2P2DA 3COSA 3QVJA 2NM0A 4TMKA 2DFKB 1UDXA 2JAOA 2WFLA 1GGMA 3P0HA 5LQAA 3Q8LA 4BVHA 4W9RA 4M46A 2O3RA 2ZBRA 4XDHA 4ER5A 4N8SA 1ZESA 3FJOA 3MWFA 1R15A 1YBMA 4HH3C 1C9JA 3GJ5A 2QUZA 1IHOA 3L0OA 4K2AA 1U8CB 4M0EA 4MCHA 5IARA 4C7MA 4Y2XA 1VYUA 3JWGA 1GR1A 5JS1A 2FUG6 1M75A 1U11A 2Q45A 3B6ZA 2P41A 3VAAA 3ANXA 4MP6A 3A9TA 3H1BA 1QUFA 3H9EO 4FSXA 4Q03A 4DEXA 3TXAA 2R6AA 1B8OA 1U2DA 2P9BA 3HDGA 1ZVQA 3K5HA 3N0TA 3ORFA 3ROMA 3VUFA 1C4OA 2HTEA 5CVEA 4LOAA 1DAPA 5DOVA 3SS9X 4BNKA 6PFKA 1P2BA 2YR0A 1RP7A 3G23A 1N92A 2J4FA 1E0AA 2AGVA 1U0EA 4HXYA 4C6RA 3AFGA 3UWMA 1DPGA 2C0CA 4XH9B 5CT4A 5CT6A 5K4HA 5LA6F 5I4KA 3TBKA 4RNCA 1SCUB 2C3YA 1ZN2A 3INYA 3R7WA 3RVNA 3DL2A 1K1EA 2D2VA 3JD3A 1W4ZA 1P31A 3ABSB 1DBQA 2O8VA 4M1OA 4B6GA 3A37A 4BO1A 2PNFA 4EYOA 821PA 5K0NA 1E3SA 3SR0A 2YW2A 4FIZA 5DX0A 3IH5A 3NRBA 4BYMA 5E8JA 4PSUA 1K88A 1Z17A 4EB3A 3TDKA 2NTYC 3DZBA 4O4JB 3VM6A 2QR3A 1YKFA 2ZE6A 3PX3A 2Y1DA 4UUMA 4AULA 2ACVA 3C6QA 5L6LB 4HGYA 2B35A 3SICE 1MB2A 5H59A 2QYTA 1BCRB 1IC6A 1NUAA 2J30A 3P2EA 1DTWA 3TOCA 3O47A 1T0JB 1S0UA 2PLWA 3CM0A 3PQDA 1M9NA 2PGXA 1F14A 1N2IA 5DHRA 4DKJA 1C7IA 4NSNA 1VSBA 1G5IA 4KQFA 5F52A 1MO6A 4FXOA 5B5SA 1KIAA 3WIBA 3BMNB 5KCZA 4G0OA 4LFBB 3UAZA 3CINA 3T9EA 1GXSB 3JYNA 2C82A 2YNMD 2IUUA 4YRBA 4Z49A 1PVVA 5JNRA 3KR2A 2OG2A 4N6NA 3FRIA 7REQB 2IH2A 1Z0IA 3JQPA 3JALA 2QV0A 3GIWA 3NNDA 1QHEA 4MPRA 1TZKA 1E1YA 4FC7A 4FGJA 1AQ6A 1VL1A 3B1VA 1P75A 5EJGA 4CF5A 1TGYA 3SYNA 2W6OA 1FDOA 1SGWA 4IV8A 3VDNB 2B20A 4PZZA 4DRZA 1HXHA 5IS2A 3GLGB 2H7VA 4URZR 2JANA 4A27A 2OUIA 3OQNA 2RJ3A 2V7QD 4OFXA 4NG4A 4QQ8A 4RXMA 1SUDA 2DQYA 4EL5A 3ZDBA 1SVSA 3WC4A 3MJRA 3T3MB 2IODA 4MYHA 3D4NA 3RYFB 2A1IA 2JLXA 1GJRA 4QVGA 3BB4A 1VL6A 1R3UA 2FP4B 1D0SA 2EGGA 1E3LA 1UJ4A 1WMAA 2PFKA 3P5BA 3D2LA 4GKVA 4MVJH 5JYEA 1ZOPA 2QXYA 1X9HA 3AXSA 3L8FA 4RD4A 4I4CA 4PICA 4H1WA 5TVKA 8OHMA 4Q34A 2C97A 1PVOA 3QA9A 1GFSA 4B3IA 3PYLA 2C0QA 2W4IA 4EYKA 1N5KA 3TPCA 4Q21A 1MNAA 3WL3A 1YAHA 5KX5B 1HNXB 3WL4A 1NM5C 5LZ7A 2EEPA 2M1ZA 5E7QA 2O8EB 4BO7A 1U5AA 2RIPA 1X2EA 3FSGD 4L6IA 4YGXB 5SZKB 2Q7XA 3D8TA 4NCNA 1PHPA 5KMGA 1JLSA 1FXWF 2CLOB 2GF2A 2D1SA 1NBWB 2CEKA 2QRVB 3QPWA 1PUXA 1QYWA 2JGLA 3I23A 2VDQB 3HLTA 4KQMA 1G9TA 1V39A 4CCAA 5C0OE 3RWBA 1SXHA 3F1LA 3VOBA 2YINC 3TQOA 3UW1A 2A0KA 1T9GR 2DH5A 3L79A 5JVDA 3TZQA 1DINA 3INRA 2R7KA 1HRKA 4X3PA 1P4AA 1QRUA 2J7PA 3OQ1A 4GSYA 1X74A 4HB4A 5ITWA 3IQXA 4M87A 1PJ8A 1R4NA 4HDKB 2B3TA 2O8CA 2A0UA 2A33A 5KWEA 2B6NA 2VJPA 3MMSA 1R50A 2WUGA 1YZQA 2F6RA 1UMBB 1R0CA 2W6IA 3H3JA 1RBYA 1PNOA 1S2MA 3UHJA 4CM6A 4E08A 1ADJA 3LDUA 5THQA 3T8YA 2JCXA 3HCDA 2F3QA 4FHEA 2CK3D 4JR2A 5KNBD 1PJ4A 3HE3A 5JJ5A 2DT5A 3N3AC 1MENA 3KSZO 4BBPA 5K0FA 3IILA 3QLVC 4F4CA 5GGYA 1HDOA 2EW1A 3RS0A 4ES6A 2IZOA 1JEYB 2X4DA 4I81A 3UV6A 1JXQA 3B5JA 3O6VA 4YUVA 5CT5A 1NQWA 5E8RA 4OQZA 5EE9A 1N6OA 2JFUA 1KO1A 4MDEA 5IVDA 3H8VA 3ZDYB 5ITZB 2EYUA 3UFBA 3JQCA 1TTHA 4X7RA 2YOGA 3ZWPA 2V7BA 5HKBA 1YR9A 3ZE2B 1A9TA 2XLBA 3R3YA 2W42A 4WXRA 3PLNA 2VHQA 5I7WA 4A8JC 4RDCA 1WX1A 5TPWB 3AF1A 1J23A 2BH2A 2ZSFA 5T6MA 4BO0A 3JQDA 2VTKA 1NT2A 4JENA 1V6AA 1B0PA 1QAOA 1CZNA 1QDUA 3MJDA 4LDZA 3TW8A 2A0WA 4D0RA 4YRSA 4I1UA 1GADO 4WUTA 2ZI6A 3LX5A 3U7EB 3D2CA 1U3FA 4N3BA 3U60B 1EJ2A 4CKCA 4UTRA 3L7DA 1MXHA 1OLSB 4JR0A 2GHRA 2C3PA 4PHGA 3A1CA 3SZ3A 3AFHA 4R1TA 3LF1A 2BTOA 4Q1CA 4O29A 5EZYA 1ZI6A 3I12A 3O3CA 5G0VA 5F64A 3ZHRA 4B3MB 1JAZA 3B20A 621PA 1A76A 4FR2A 5IUNC 4KN5A 3I2YX 1XCGB 4UZFA 2XMDA 3JARA 3FYCA 4TVBA 3VR6D 1DXHA 1GSAA 1U2EA 3CNBA 4RABA 3JW8A 3PICA 4RGBA 4QQKA 4XSHA 3DFFA 1SIWA 3BIFA 4GZ5A 5HZGA 4P4UA 3IS3A 5LWQA 4JVLA 2GGSA 2FSVC 2G1AA 3K96A 5CIWA 1FMTA 4V2IA 5E6RA 1P3DA 2H4ZA 5CLQA 4XYEA 4NXNB 2QNRA 2NXCA 4C30A 4WJLA 2PWYA 3G85A 1EGQA 2ATCA 3ZWDA 2WQ6A 3NCHA 2CHUA 3JV7A 1XDSA 5I4CA 2I5PO 5FI0B 3HU3A 4FZJA 3C97A 4ZCQA 4QG3A 2VPIA 2ATVA 1Z18A 1JWBB 2PV0A 3C3DA 4C76A 1KK2A 2R62A 5JO0A 1ZIXA 4II3A 3T5AA 4LQDA 3AIKA 3M5CA 5B1YA 2PPLA 3F6EX 1T35A 2PS1A 2RB5A 2Z2XA 4H3SA 4BVKA 5JS2A 2OT3B 2MIIA 1J8QA 1H3NA 1JDSA 4OB6A 3TTTA 5ERGB 1GRQA 1MW9X 1KXJA 4QFBA 2GAJA 2ZBDA 1HBJA 1GPWB 4REOA 4WBNB 1ZINA 1DGQA 4YJ2B 3C85A 2INGX 3WB2A 5L3SA 2GEFA 5T41A 1KAHA 3DV0A 2F1KA 5GV7A 4AJPA 1RFLA 2JI7A 2Y1OA 3EW7A 4N8EA 4YP9A 1Z5PA 4XB2A 3IEXA 2RGUA 3EPRA 2BUCA 4TQUS 4ZCMA 5KYGA 3VJKA 3A1SA 3MLBA 2G9QA 4XYBA 2OVBA 3LPCA 3AI1A 3HUTA 1M6YA 2PYIA 1H0RA 4DV4B 2H1LA 4IQ0A 5LSAA 2QTWB 4FNGA 2Q3CA 1E6LA 4LTMA 5E1OA 2O3TA 3TLYA 4C7XA 4GO1A 4JB3A 5BSMA 1YZYA 2B25A 4D8YA 1EFRA 3AKCA 1G9SA 1KWGA 1KP9A 3ZWBA 3ETEA 5BWNA 2QRPA 4NOLA 2W70A 2OL4A 1BXKA 2WIAA 4JN6B 4A2CA 2E55A 2VAPA 4EUFA 5IJ0A 2EL7A 1IEVA 4QJBA 5JUWA 1L5MA 4ALIA 4ZYLA 4KX5A 4U2GA 4BX2A 5KTSA 3R2JA 1B76A 1TJ5A 2BSXA 2YVLA 4N03A 5CD9A 1F06A 2B69A 3GMTA 4QOHA 4ZCLA 1JV2B 2BFCA 3GPIA 1SZDA 2WMOB 4AS3A 5BSGA 121PA 4LBZA 2V58A 4S1WA 1DIHA 5JRZA 4HATA 4LMRA 2KWIA 3TINA 3HFJA 4X6YA 5EIEA 3KKZA 2WF8A 3JWPA 3AESB 4Q0MA 3TR6A 3ILSA 1PT8A 2IEGA 3DE4X 3MD0A 5JH7B 2B83A 3RM3A 1MAAA 1I4TD 2IZZA 2JJQA 4JNCA 2AIRA 1QU2A 4PU0A 3NXKA 2Q9AA 4Y6PA 1NRXA 2E87A 1Q22A 2YFYA 5GV8A 1C7RA 2C31A 2Y67A 3MCWA 1PWYE 2X3YA 2Q7DA 1JW9B 5I47A 1U90A 4GLJA 1R5JA 4G67A 5I6DA 1SQ0A 4M0DA 4NU0A 4FKMA 3EC2A 3BF7A 1QRTA 3UC5A 4ZTBA 3CRRA 2QL7A 3QSYA 4YCDA 2QZ9A 1A9XB 1O6GA 1XI2A 2O2HA 4WN3A 5FBLB 3VX4A 2WJVA 2HW8A 1PWEA 3AERB 4N0PA 2VYQA 5CCDA 3R9XA 1I7SB 3O1LA 1XRSB 4AKEA 2D13A 1XR3A 4ZI5A 3WWZA 5K2OA 1JLKA 1Y89A 2WT9A 2IXFA 2LCFA 2VXCA 3S40A 1NVWQ 3NTUA 3DNMA 3LM8A 2Q8QA 3V6MA 4D42A 2P35A 1E8MA 3DYVA 4WCFB 5BSKA 3IPXA 4S04A 5H3HA 3REQA 4EWLA 3ZCPA 3SYRA 2XX3A 1O8BA 4F5YA 2BZ1A 4I55A 4LRSB 3QBEA 5EKDA 4EVQA 2DWOA 4UCFA 5IVKA 2NVOA 2ADOA 1XN1A 2SECE 3Q3IA 4U7FA 5HKOA 3T3HA 5JFGA 2G76A 1GZVA 1KI6B 4ZI3A 1CP2A 3EZYA 1N3IA 4EY5A 4DREA 4IH9A 3HXOA 2H1FA 3HCOA 4A4DA 3QI2A 4PAOA 1ESZA 3TAXA 2AXPA 2XT6A 2C5AA 2DERA 1YQWA 3OE7A 1F8FA 1T8PA 5A1TA 4G84A 3L7BA 2G1KA 3WWCA 3AR9A 4L5IA 5HQJA 3LLVA 1V11B 1PQ4A 3N74A 4BV8A 4G86A 4DGQA 1XOIA 4DR6B 1ODCA 1ACLA 1A8SA 1YC5A 4Q3DA 5AVWA 2GN2A 1MO5A 5J4LA 3WAKA 3DUWA 4HDRA 1K92A 5BUCA 2QD2A 5EPOA 1NJ5A 3QNWA 3NHMA 4J4TA 3N05A 3OZCA 3R77A 4K3VA 1KO7A 4A8TA 5JZBA 5K3EA 3QX3A 2G6TA 2BHRA 3NBFA 2VHJA 1U8FO 1WLYA 2BAGA 4FMCF 4GX0A 4MQBA 1LV7A 3TSWA 3EZNA 3TEJA 4IHJB 2PSHA 3S2IA 2AF3C 1HDIA 3PFCA 1ZJWA 1M1ZA 4OXNA 1US8B 3JZIA 2G0NA 1O4WA 3EC7A 3NHKA 4NONA 4RVDA 4ZVNA 3AHJA 2A5FA 4PG8A 2C2XA 4Y1RA 4LBYA 1DAHA 3TRIA 5IXSA 4L5CA 3BIJA 1IATA 3CS3A 1IBMB 2ZUBA 3B2NA 4UHDA 5DI9A 4EJSB 1YB5A 4HNAA 1N2SA 3TTYA 3BXFA 1T5BA 3BVPA 1G21A 1JSLA 3DAPA 4C1NA 5BW4A 2HF8A 2FPRA 3VKUA 4S3MA 3LZCA 4JMLA 1HE8B 4M1YA 4WOJA 2FRDC 4EVSA 1B3BA 3I2JA 4P7KA 3AZOA 4D9EA 2WAOA 1YZ3A 2AXEA 3W77A 3ECSA 5DU2A 1UXHA 3G2HA 2V55B 3RBZA 1DZ3A 3ESXA 4BMSA 2PBRA 5AVZA 5L95A 2XEDA 3SMQA 4Q7LA 5LYYA 1T9DA 1ZS9A 3TLMA 3VYVA 2QAIA 5BYJA 3T3OA 1S3SA 1WDWB 2GPYA 3MCVA 1HK7A 4NC9A 1XN4A 5JR3A 4LYGA 4CQMA 1CVIA 5F51A 1FX0A 2O8BB 1L8OA 1XD2B 4Z86A 3M70A 3TS1A 5EJFA 1J20A 4WY5A 1FK8A 2FF5A 2IXTA 3OKAA 4AZ3B 2GERA 3HBNA 5E0OA 4BFXA 1B6SA 2P6UA 2ZWPA 3LBAA 3DFMA 3MAAC 3STUA 3WL5A 5TVGA 1FEZA 4IX1A 2BCGY 2L42A 1EBUA 1L7VC 3EGCA 2B98A 3EQ7A 3F6SA 4IMJB 4KBFA 4NMHA 5BWBA 5KJFA 4A15A 3URKA 1A9PA 1MFPA 4DFDA 5BRNA 1KFEB 3AEQB 1XBTA 4PIMA 5GIOE 2FPIB 3OJCA 4AZSA 2ORVA 1UH5A 2DAPA 3THWA 1EFPA 2JLRA 2Q1SA 1I0IA 3RBVA 1BE1A 1R6TA 2EKLA 2V98A 4HNQA 1QHNA 4PGMA 2J3JA 2PUTA 2H1SA 3U3XA 4TYYA 1PRYA 3O0DA 4R0VA 3FWPA 4RFVA 4RF5A 4PZUA 3WWEA 1N25A 2AK3A 5I7VA 3RABA 1J33A 4CLEA 4QTYA 3Q88A 3OQHA 2Q1XA 4NQZA 1H4QA 3ER8A 4U63A 1M8FA 2GYYA 3ZU4A 3OFVA 3AZQA 4FOSA 4HDAA 3M3DA 3AU9A 1UM8A 4AW9A 3I5YA 3NIFB 4QDKA 5BOVA 4LDPA 4BMVA 1T6YA 4OX9Y 4PHFA 4MKIA 4YJ3B 4JOBA 3HEMA 4KXLA 4WZBB 2ODTX 3PPVA 5J2TF 1NI5A 4JI1B 4DJJA 3LY5A 5KTKA 4JWTA 1G19A 3FPBA 3Q9SA 3KYDA 4ETMA 3HI6A 1RZVA 4IX9A 1JVNA 4F46A 3CVYA 4U2FA 3D4LA 5AW7A 1SKUA 1FRZA 2OHOA 3D5QA 4CEJA 1UOQA 2IIQA 1TCCA 4DTCA 2H1HA 3JYLA 1STOA 1RQRA 1FVXA 4NZPA 4UUAA 2XEXA 1QFJA 3FBTA 2O8CB 2X8JA 3I2IA 5HFAA 3P2KA 4N0EA 1YI8A 2WU4A 4GKKB 3ENNA 2YY7A 3LGSA 2IZ5A 1TMKA 2KMLA 1FVFA 1OBFO 2WTXA 5BNWA 4G5SA 1ZIYA 2JFQA 1P6UA 2G4VA 2QUJA 5MDHA 2PD4A 1RCTE 4MRMB 2AOUA 4LUCA 4ZGBA 3KDPA 1RYNA 4GGOA 5FOVA 3ZW7A 1IHUA 1U7OA 4DVJA 1EG2A 4DWVA 3GNTA 3HJBA 1X3SA 1QDEA 4KWIA 1ZEJA 2BGJA 2WVHA 3TE6A 1H1DA 2BBWA 1P2TA 2QRZA 4BLTA 3CPEA 1JQ3A 2FW9A 4ICIA 5BXQC 5THKA 1NC3A 4KVAA 3GJ6A 5H81A 4L7VA 3ZHSA 5KHOC 4RZUA 4J7UA 4ZQHA 4GW3A 4XUEA 1HFKA 1E7MA 2CLIB 4LY0A 1T4GA 2IHTA 1F2TA 4AMGA 5IAOA 3AKEA 1M5UA 2FPPB 2Z58A 2B1GA 3SDZA 3FSGA 2JZNA 3IOEA 4CMBA 2R6DA 3IDZA 3WHKA 3BKXA 5BY2A 4MAFA 2WMDA 4HDNB 1R00A 3VO2A 3ASYA 4QXRA 2GZ1A 2BEWA 4KXXA 3AUAA 4QYSA 4P4SB 2W2MA 4JMPA 1BN7A 4XIFA 5LQRA 2ZJ6A 1ND6A 1YGYA 3F78A 3QUBA 5AWFC 2EZUA 1WM1A 4F8JA 5CH8A 2WZQA 4C9BA 4JKOA 3QKWA 4EPRA 4GI7A 5CU7A 3GLIA 1IL0A 2ICAA 4ENVA 3EBPA 2J33A 1OD6A 1P1JA 3QPDA 4ZYYA 2IVFA 3R3WA 4FILA 5JY1A 1NJ2A 1A4XA 4OXKA 2W2NA 4KDRA 4U7GA 5DNDA 5LQUA 1GTRA 1JB1A 3C8MA 1YB2A 2ZJ3A 2WEKA 4RIIA 1VZ3A 5IDXA 2J85A 2QK4A 5F2OA 1KRWA 1UBJS 1TU4A 4J7XA 4EHLA 3GLVA 3UYKA 3TKAA 2PKRA 1PSDA 1FDIA 1M34B 1ULSA 2WE7A 3CTMA 4M0LA 2RG1A 2X2EA 2I6QA 4PSAA 1CUEA 4XPIA 1I7NA 3IVXA 5TT1A 5IDWA 3Q5GA 3K1JA 1A9XA 1DT5A 5KO2A 4W9NA 1U2ZA 5EP4A 2A1TS 3V4VB 5E2IA 3H5OA 4UJ5A 5DXFA 1PGQA 4DR3B 1OR8A 3JZAA 2UVDA 4B4VA 3HB9A 4HGZA 1Q7TA 3T3NA 3NWPA 2DG2A 4B2PA 1C9EA 4KSYA 5L4LA 1R8YA 3L0PA 3RS7A 5IC6A 3F3KA 4V3CA 4ZK2A 1XEXB 1OIVA 1ZMBA 2N1BA 3H9UA 4HAUA 4B45A 4EH1A 3U7GA 1LPAB 1X39A 2IYZA 3I39X 4FEYA 4RD6A 3RLFA 4MI6A 1I3OA 3LK6A 4M86A 1U9JA 2ID9A 4DJDC 2MR6A 1RWMA 4YRLA 1GZ6A 4IGIA 4CUKA 4F92B 2Q3EA 2EJWA 3TW0A 4ZU3A 4Y6RA 2NUPB 5K5EA 1SZPA 3G3EA 3JQGA 2RE8A 5TSDA 2M32A 1BDBA 2GEBA 4OP3A 4BCBA 3DYIA 1EDBA 4UC0A 1I2MA 1TCAA 4FB4A 4LZWA 3UHPA 5P21A 3W6UA 1VIMA 5JALA 2V6BA 1KJNA 2JDIA 3F5QA 2VP5A 4LNHA 3K35A 2AFVA 1F8UA 1TEXA 1OFUX 1AF7A 2C8VA 2PMWB 1L7RA 2PRIA 4PYNA 4XKJA 1IZ8A 1K7YA 2X9GA 3AF0A 3OUZA 2P5SA 3HH8A 5EMHA 1G8FA 4NZYA 4YP7A 2F2TA 5K2MA 4D3FA 1IDN1 2GAIA 2ILVA 2RHOA 2ZPUA 4A2PA 2GBIA 2Y66A 2ZUUA 4PZAA 5LOVB 2PE5A 4I4TA 3BUSA 1FS5A 4KQGA 1C4WA 3MNFA 5KTNA 4TLDA 3TIFA 2J0EA 4GWKA 2XDWA 1CY1A 2JJMA 2IY7A 2Q5QA 2RC6A 3CCBA 4KIWA 3TSYA 2OY0A 1KGDA 4Q1VA 3KLNA 1BG6A 1D3AA 5JO9A 5KVVA 3C3AA 4NJMB 1AA6A 2PGNA 4ZTUB 5LXTB 3BCUA 3V42A 1CG6A 4OXRA 3BL5A 1G5QA 4CTOA 4HVLA 3OLWA 4IUBS 3K0SA 3I0NA 5DEOA 1JDTA 2MYNA 2FA9A 4TPKA 2CF6A 4OKNA 1JVSA 2ZT8A 3R76A 3RS2A 3GC6A 3UICA 3WGMA 2EWMA 1ZCFA 1G1MA 4EJSA 5KKNB 4HNAB 1PFYA 4ZVVA 4JI5B 1Q0SA 3F2IA 3QVMA 3TWOA 3U9SA 3FIJA 4MVWA 4PN7A 1TYAE 2NZYA 1BJTA 3COVA 5GJCA 3K70D 2I0FA 3QUCA 4BB9A 5C1BA 1Z7GA 5E0KB 5I9LA 1FQJA 1SHTX 3TTSA 1YJQA 3VNRA 1F7VA 2RGRA 4FMDB 3G7NA 2EQBA 2FW8A 1D5CA 4LFCB 2EXXA 1OMOA 1E6MA 2BFBB 5K8UA 3NDJA 4WNCA 3G8BA 4PHTA 2PSDA 3WDLA 1JPNA 4BNJA 4XPZA 2IXAA 3AF5A 2PVPA 4IF6A 3WBKA 2J9ZB 3CRNA 4MROA 3U7JA 3L7OA 1Q74A 1U8ZA 2GILA 1SUEA 3D7RA 4JJGA 3KQUA 5KSZA 1JFVA 3JR3A 1QP7A 1OI4A 2OZPA 2VHTA 4S24A 3VYTB 3FHLA 4XWTA 1XHEA 3LUGA 4RTPA 4EEXA 4Q5IA 1ZO8A 4XR9A 4ZO7A 1FTGA 3HZHA 3MAGA 1HDGO 4A82A 3HBMA 4XYLA 1ETUA 1CX9B 2FMHA 5LD2C 3DKRA 2WJHA 4TWZA 1DJNA 3ZBTA 3K09A 3N8HA 3KSAC 1HMPA 3BSWA 4V0MA 5B7PA 5BPFA 1EM6A 5TPZA 3SR3A 2VJOA 5BWMA 2ZJ4A 3F7MA 1VRCA 4IO1A 1M6NA 3KSUA 3VPFA 2Y99A 4XUGB 4NDAA 4ZICA 1VTKA 3B3AA 3H19A 4O4HF 1UDRA 2ORWA 4Q1BA 4BRSA 1XP8A 4D80A 5TV2A 3RC2A 3ROQA 5JSHA 3PC2A 5AW8A 1XTTA 2EATA 2Q3FA 1ZVJA 3K9QO 4HR7A 3I9KA 1ZK1A 4M6WB 4R2WA 3RQIA 3RVPA 1SC1A 5BURA 2IUSA 3QHQA 4UQPA 4KXYA 4UDOA 1E3EA 2X0FA 1JQKA 5CR9A 5K45A 1B00A 4QUAA 2ATIA 4BAGA 2R7AA 3FPCA 4ID9A 4PZ0A 3OURA 3U4IA 3COPA 4TS4A 5J63A 2I8LA 4EA8A 5C9ZA 3FG9A 3U16A 2QAGB 1QQ5A 1VYVA 2ZE8A 3BB3A 1RABA 3FNGA 1DWUA 1O6ZA 1T1IA 3EXEA 1H2ZA 4IFTA 3BMOB 4C0BA 1L1RA 2ECOA 4D6PA 3G9TA 4B40A 4F71A 4UNRA 3X2SA 1DEKA 3BXZA 4TTAA 3RROA 3Q2KA 4RADA 5KBYA 4EHFA 3R8XA 1FJXA 2G04A 1V7QA 2ZANA 3GUZA 1BKYA 3I8SA 5J2UF 5D6NA 1AKWA 2D1QA 2FFAA 2QLBA 4OJKA 4Q4LA 4RETA 2Z8ZA 4ECEA 2PGAA 3TLCA 4DLLA 1M2EA 2Q6VA 3TVYA 5BMVA 2OK8A 4PC2A 4MV3A 2Y0BA 2HNKA 1QZUA 4L0CA 3EB9A 1CR1A 1GVHA 4UU8A 3UOAB 3IDFA 1RLMA 5C5IA 2BRUA 1IOVA 1L9KA 4ZZIA 1T9BA 1ZGAA 5J2UA 3DS8A 1HV8A 2G9NA 2R8OA 4KTVE 1HLFA 1FY2A 1R8SA 3CZAA 1N2HA 5A7FA 2V6IA 4HQKA 5FUWA 1HRDA 1PQWA 1RI2A 3NT5A 1QUEA 4F2DA 1P0MA 4MVYA 1N6LA 5IMBA 3PXUA 2PXAA 3DOFA 4KMRA 1C9YA 2FEMA 1BFKA 4LZJA 1IM5A 1J39A 3JS5A 1PS0A 4V0NA 3QTTA 3A31A 3E27A 4C4SA 3ZLBA 4RK1A 5TLSA 4AUEA 4ZDIA 3B3GA 4C07A 1DHRA 3Q40A 1BNCA 4NMMA 3ZU5A 3PDCA 2NU9B 5JNVA 1COZA 3IO3A 1GOTA 4PIPA 4IDCA 1I36A 3G9XA 5EUCA 1AKTA 2W4MA 1WVGA 1WPQA 2XBUA 4C4RA 1TYDE 2R6ZA 3ICEA 5KVSA 4BDSA 1AY0A 4TUYA 5AESA 2YWCA 4ATNA 3P94A 3B1KA 4I9GA 2GD0A 2ZROA 1LTHR 4A8HA 3VRHA 2NXWA 3FM9A 4KXVA 3S8YA 1CJBA 1J2YA 4IOMA 3HKEB 3PEEA 4JV5B 3SLKA 1NUHA 2I6SA 4WN9A 1FLNA 3LYAA 2YXBA 1IZYA 9ATCA 1IUNA 1G3IA 1M2NA 3GJ8A 2C2OA 1GG9A 3PJFA 3G6WA 2G6BA 4LAFA 1K27A 1X7YB 2C07A 2ZYTX 3GLQA 2GXSA 3VSEA 4B6QA 1AX9A 1U3VA 3M8KA 2H1WA 2OCDA 1BXGA 3Q8KA 3OBIA 3GZJA 3H99A 4IDFA 2YICA 1ZCBA 3NXSA 4GRIA 4DA7A 2ZQ5A 4TV9F 4TVSA 1NOKA 2ECPA 1NA5A 1WV1A 2SNIE 4MWDA 4OV6B 4TTQA 3HFGA 2VA9A 5ER9A 3ZZMA 1K06A 4ZTZB 1L3BA 5JT1A 1J5XA 1QTIA 3QM1A 2WAAA 2PRKA 4D44A 5C81A 4IH1A 1E9RA 1TYZA 5KNDH 2NP6A 3Q10A 3MPOA 4FZ5A 5WRFA 4Y2PA 2JKZA 2ASEA 2GEUA 1PNTA 1PR3A 1S8FA 4JYBA 2WQZA 2ZS8A 4AUNA 1RKXA 1HTBA 4ZVQA 1JHRA 4RV9A 5CCXA 1JLLA 3STXA 3CR3C 1NJ1A 2CHFA 4O63O 3U3JA 2RAPA 4IVQA 2QRUA 1WSBA 1ZEMA 2GLUA 4X6LA 4DB4A 2J0SA 3W4IA 2W71A 3GRZA