2LVBA

Solution nmr structure de novo designed pfk fold protein, northeast structural genomics consortium (nesg) target or250
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
MGKVLLVISTDTNIISSVQERAKHNYPGREIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLKTAGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DE NOVO DESIGNED PFK fold PROTEIN
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 36
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2012-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lvbA00
4J29A 2LCIA 2L82A 2LR0A 5GAJA 2LVBA 2LNDA 2LV8A 2L69A 2N75A 2LTAA 2LRHA 2KPOA 2N3ZA 2MR6A 2MR5A
chains in the Genus database with same CATH superfamily
2G1KA 4MKIA 3IUBA 4CKCB 2P77A 1LV8A 1ZL2A 3ZHXA 1V7CA 2FZVA 3OT5A 2R68A 4HB0A 2Q0QA 4WXYB 1PR1A 3EZLA 3GMSA 3SKXA 3GARA 2MYNA 1T0UA 2XT6A 5GZ6A 1KDZA 3C8MA 4ZOAA 1U2EA 3T06B 5KQMA 4HEHA 1UBUS 3K20A 4TWRA 1LPMA 1Z8DA 4NAUA 3AB3A 1ID8A 4KUEA 3ISVA 3KJFA 4Q1AA 2O3JA 4E33A 5LOVF 4TN1A 4XD7A 2MSNA 3R6GA 5COBA 1YOBA 3ISTA 3BE8A 4EVRA 3ZK8A 3DZGA 1LX7A 1XGKA 2GVDC 4UXHA 2H2WA 2QD5A 4I1PA 2NT4A 4YXWA 4XWYA 4H3KB 4WECA 3RNLA 1IHOA 4Q39A 1U8ZA 5HHTA 3E35A 4J0CA 1V1RB 5L4NA 3KX2A 1EBFA 1N0HA 1R0KA 1S01A 3C5VA 5EJ9A 2HWKA 5FI3A 4NY1A 2MMGA 4X1OA 3P2OA 1VLJA 2NV6A 3UK2A 4MLPA 4QDOA 4F5EA 4RZSA 4HC4A 2B7LA 1TMGE 3F3SA 2IS2A 2Q6KA 2IUUA 4DA0A 4HLDA 4E7OA 4A2PA 1E32A 3L7NA 4FI3F 2NZWA 4MINA 3BHMA 4P4TA 3RFVA 4KNVA 3GW8A 4QOFA 2CVOA 2ZYSA 1L7VC 2HADA 1W75A 3L3BA 5L3SB 2DE0X 2WT8A 4YS6A 2D1RA 5TDHA 4RK4A 3JATA 3X1MA 4B5KA 4CJXA 4F7DA 4BMSA 4NAVA 3W34A 1XK6A 1B93A 3C3YA 3EF1A 1J1ZA 5I4IA 1VG1A 1NC3A 2VRBA 3SZRA 4UUPA 1UQUA 5F12A 3QV1A 4I1RA 4JLDA 5EWJA 4A0HA 3THYB 1I6LA 3WG9A 1A5ZA 1N2CA 2O1EA 4HNSA 1Z2OX 2WD7B 3TRJA 2RH4A 3ZXIA 4MKRA 2FWBA 3L2OB 4NYMQ 1J2UA 3ZJ5A 4MR8B 3K1AA 2VHWA 2F6RA 4IZIA 4B09A 4LYAA 4OH7A 3GJ8A 5T67A 1K3TA 1O9BA 2A8YA 3PD0A 4OYYA 4MS1A 3WMEA 4BV3A 2CGEA 4RIEA 3N9IA 1YIOA 2PS3A 3IHKA 4XYLA 2J5RA 3C6KA 1V71A 4RF3A 3V32A 1VIDA 5T4HA 3WGQA 4AMUA 1EZ1A 3WK8A 1KI2A 3B8HA 4XIFA 3ZXSA 1MDFA 1QZ3A 3DDOA 4JB8A 4MDYA 4F4IA 2P35A 3QELB 2E4ZA 3RH0A 2OAQ1 4RU1A 1VI2A 5K3SA 1Y4ZA 2XE8A 4Q7QA 1H6CA 2OMKA 3C6XA 2X19A 3WYFA 3PTLA 1F2VA 4QGFA 1FB5A 4YCNA 4POAA 3RRJA 2EJVA 1KWKA 1GTJ1 3NIGB 4HJXA 4Q3OA 3J80A 2VAMA 1Q1BA 3NRJA 2FPMA 1T0BA 3RC9A 4DWOA 1L7MA 1K1EA 3HCNA 1L3BA 1WEKA 3PX3A 4EJFA 4QECA 4PTLA 2W2LD 2YVAA 2QDXA 5DNUA 2GKGA 4RPIA 1TW2A 5BWMA 1DGQA 3BTUA 5CG1A 2BZ0A 2EQBA 2V6BA 2G04A 5ALNA 1E5DA 4HEJA 4MA4A 4OI2A 3CSSA 5G0VA 3UANA 4RTPA 1RC8A 1PWHA 4UMDA 4KMRA 5GZ3A 1U04A 2C1ZA 2G5CA 2G76A 2ZRGA 3NW9A 4AD8A 5EEHA 4Y0AA 5DZSA 1Z7EA 2IX9A 2GM5A 1QVZA 1SRRA 2J3HA 5AK5A 4XLTA 4BQIA 4WLNA 1D7OA 3LIIA 1F48A 4RLQA 4JP5A 3P9QA 1UM9B 5H59A 1XAGA 2B30A 5FLYA 1ZJJA 4IDQA 1GPKA 2HPZA 4OOEA 4QQ8A 3T7RA 2YMLA 4BAUA 1P7ZA 3U7QB 2ZDQA 4GM1A 1UQRA 2HREA 3F7TA 1NU6A 2C4VA 2FRDC 3WK5A 1RXSA 2RHCA 2YXPX 4RF4A 4LF6B 1Y1SA 2PHZA 3EG9A 2VVTA 1G8MA 4I4LA 1IN8A 4EFKA 4J07A 1Q57A 4OHFA 3J7AC 3PEVA 1Z75A 3D0QA 3ZZNA 4DIMA 5ERGB 4AJNA 1QHSA 1ZI9A 1Z2DA 1U1DA 2PBRA 1YE5A 1U7HA 4KK4A 5EE1A 3N2YA 5G40A 3TEFA 1GGNA 3NIFB 1MOQA 3FAZA 1K6MA 4X20B 4QZVA 3ND8A 4CCYA 7AT1A 1GDTA 3HB4X 2WYOA 2CEAA 2XE7A 1VJ5A 2C97A 1F2UA 4QL3A 2DCMA 4YJ3B 2C54A 3WFIA 1ACLA 1QO9A 2QRVB 5EXEA 1ZGAA 1JJAA 4KXYA 2IBMA 1DBIA 1SZDA 1T9CA 4OQXA 4CR6A 5AD1A 5KYUA 4KWCA 1ECGA 4URZR 2NYVA 2OHJA 4RTSA 2OHVA 3ZHQA 1VSBA 4NFSA 1E0AA 1G291 5INTA 1SZPA 3RV3A 5THKA 2PJDA 1N75A 2W9XA 2XUFA 5DYIA 2MSLA 4N6NA 2Z8XA 3GRCA 3HDQA 4MCAA 4TMWA 3AFIA 1Z4KA 3W9SA 5GJBA 1NXPA 5BP7A 2IIPA 3DTYA 4RV9A 4WNCA 4UTVA 1XLVA 1NVWQ 3R9XB 1F4VA 3O93A 3D0OA 1VA5A 2B78A 10MHA 3EUEA 4GZMA 2GYYA 5CX4A 4JR1A 5F3DA 2E4YA 4QU5A 2DPYA 5D7BA 5K3BA 2CLEB 2JFUA 4NQRA 5DBEX 4G9GA 3LJKA 2CDBA 1GTG1 3CV3A 1U80A 3CRNA 1T8SA 2FLVA 1CDOA 2R2GA 1Y5IA 4CF6A 5K9ZA 2QXTA 3Q9UA 3KK0A 1FX0B 4J1SA 1IQ0A 3O3OB 3NB0A 4CEJA 2P30A 1DC3A 2VFAA 1SKUA 1N3YA 2BONA 2ZUTA 1WE2A 4GL4A 1PJBA 1FW8A 3TLBA 3UUGA 1FTGA 2IOFA 1GUYA 5K3FA 1OI2A 2I6UA 4WNAB 1MTOA 1PR9A 1Q1QA 3W5JA 4CLHA 3UT6A 4B6GA 2GVZC 4BKQA 2P2YA 1Y3CE 4EQ6A 1CR6A 4E1AA 1BCRA 3JAWB 1N3IA 1RAIA 2YZ7A 3RSSA 3H2KA 3WV4A 3MCAA 4LVNA 2LP4Y 5A4AA 3H0EA 4REQA 5KTSA 2M9MA 2P9CA 2VXOA 2VYCA 3L6EA 1Q83A 1Y81A 2Q27A 1SUPA 3LA6A 3W9UA 4UVGA 3RC2A 4BGUA 4Z7QB 1P72A 1X19A 3ZH9B 3LDUA 1MJGM 3K4HA 2A1IA 1LLFA 2FMXA 4RL6A 4RIFA 5TB5A 1V39A 4FQ8A 1GM5A 5SZKB 1GKYA 2JI9A 3T5MA 4EF6A 3AHGA 3RVMA 1ZRMA 1J1UA 2A0XA 2GTHA 3H1BA 3QU9A 4ZYYA 1Q14A 2YW2A 1AGRA 1NLYA 3B85A 3MWDA 3OOYA 1YOVB 1NP7A 1YVDA 1V43A 2YHIA 4JNKA 1DAOA 2ZPTX 1G8HA 2YN2A 4O4LF 5CM9C 8OHMA 5LYJB 5DWQA 2FQYA 2H17A 1VMAA 5P21A 1RBMA 5G0WA 1UBGA 2HSDA 1NATA 5EIBC 3SR0A 2KSQA 3ZU2A 5KKAA 1W76A 4A1FA 4B35A 2BLLA 4YCCA 4FYXA 2GJ4A 2K7ZA 4RH3A 2EZ4A 2VJLA 2X2OA 3PQCA 3ROFA 5AYVA 1HG1A 1IM5A 1HQYE 2I55A 2WUWE 3CPSA 3IBTA 1EYZA 4G9EA 3RIYA 4EHIA 1E6UA 3T61A 4A8JC 2IL1A 3TJMA 1REQB 3D0KA 1JYFA 1XL1A 3MGBA 4E4YA 4DV4B 3RHSA 4BMYA 3PDJA 3DH0A 4KX3A 1O4WA 3KB1A 4GRDA 4BOYA 3G0HA 5JO9A 2DYKA 1FSPA 4BNWA 3CRVA 2R8ZA 3CIOA 2VI5A 3ZE2B 3QOYA 3SQXA 4MPRA 3QKRA 1KRWA 2H7VA 2VK8A 1NVVR 1W85B 1QNLA 2X8JB 2YY5A 3SHTA 4ZRDA 3FZNA 4WACA 2G0TA 4X1IB 1I3MA 5IBRA 3UVEA 4B47A 1O0BA 1SXPA 3B1KA 2MTBA 3VVMA 5DYWA 4IXDA 5CYPA 4CRWB 1DEXA 4IIHA 4ZARA 1WSAA 2B34A 3DDSA 4KE9A 3MELA 4CKBA 2J09A 1Z47A 3F46A 1NRXA 2IXFA 3WA7A 1TVKA 1ESMA 1ST3A 1Q0PA 1XDZA 1LWNA 1ZD3A 4LMPA 4XX1A 4YXWD 2GAAA 4BNLA 4JBHA 1B4DA 2GXAA 3LLMA 3GLTA 1ZU5A 3Q1KA 5EKTA 2OXTA 3NC0C 4OXIA 3PJEA 2VZ8A 5KOHA 4RMIA 4YDSA 3O1JC 5ALUA 1IK4A 2OUIA 2ADFA 2XDQB 2P0AA 3ZJTA 1AVTA 2GZAA 3FNQA 3DT9A 3F9RA 2WT4A 3BXOA 3UHAA 3ETGA 3OZSA 4L16A 3L7BA 3OWHA 2HF9A 2G4CA 2IP4A 4MYTA 4BNYA 4EHJA 5CFNA 2IYEA 3QVUA 3VU9B 4GLFA 4MI1A 3E2PA 5A7FA 1Z6TA 1LVGA 5HA5A 4IILA 3RRZA 2EQAA 2P91A 3R6LA 5KTRA 2AX3A 2HMAA 3TKAA 2IJGX 1XV5A 3AEXA 1WXHA 3CWCA 4L0MA 4G5RA 3H9JA 5BN3A 4UMVA 2FMIA 1JLMA 1E9RA 1FVHA 3NI2A 3NRBA 1Z7BA 1T1SA 4P38A 1I3KA 3H7AA 4ZEVA 2XUOA 3K8QA 1XIVA 5IPFA 1U9CA 1EM8A 3QXXA 2NP6A 4NG4A 4PYQA 2KM1A 4FMDF 2PNJA 4M22A 2HMVA 5EYPA 4PIVA 3EPRA 4I4TF 4NF2A 1U81A 3IJPA 4RA9A 1ZOSA 5EPEA 2GYUA 3HQ4O 1EVJA 2HDWA 4YP6A 3SZUA 5JBNA 1KEEB 1T3ZA 4PZCA 1QKKA 1C0KA 4AUKA 1XTBA 2QW1A 5A7GA 2ZRIA 5K03A 3LBYA 4HF7A 4WT7A 2XOEA 5DHAA 3F2VA 1S2GA 4R98A 5ARCA 1UIRA 3BGVA 2AZDA 4RV5A 3E2IA 1Q6YA 3LBHA 4IQ4A 2OP1A 2PYIA 1X86B 3KRTA 3H2SA 5DV9A 3SDZA 3DVLA 1N34B 2H1WA 5FPTA 2VSNA 2FOXA 3CLKA 3UOAB 4D99A 1OW3B 3IQZA 3ZGLA 5BURA 5LXTB 4LMRA 2GKOA 3NEAA 3NHSA 4KNWA 1JR4A 1N92A 2HDOA 4FMCF 2LGJA 4IDFA 2JJ8A 1HI9A 2WFLB 3LY8A 5ALYA 4WRRA 2I6GA 3B48A 3ZG6A 3D8SA 5DN6A 3WIVA 1KOLA 1BS2A 1F8FA 1WU7A 1Z39A 2CMDA 1P19A 3PJRA 2R00C 2NNLD 4DNQA 2TMDA 4GT1A 4UEQA 5DTIA 1JEJA 5HWSA 4FZRA 1F2TB 2F3RA 1LLUA 4I55A 4Q18A 3P0EA 4QHTA 3MB5A 3RVBA 3SHFA 1CSEE 2EKPA 1V8ZA 5AM3A 1FDVA 1OXXK 1X94A 2QN1A 2PBFA 4H7IA 2ZAGA 1TEHA 1YZVA 2CKDA 3P19A 3AF4A 2WSSA 3D43A 4R0VA 2GZ2A 3P9YA 3CUEF 2C92A 1DC8A 5JSUA 5EJ2A 5IAGA 3MAGA 2D8MA 4LJ6A 4Q03A 3ZGNA 5BWBA 4CXMA 5FLEX 2CNWD 1AXEA 2VDVE 3OESA 3E2MA 3GFRA 4GX1A 4LGCA 4WE3A 4BGIA 3I2HA 3ROMA 1HBJA 5CT6A 5EMLA 3ZVRA 1QHIA 4DCSA 1DTWA 1HDGO 2NPFA 1JXQA 4FDTA 3W6UA 4CTMA 4FHGA 3BRCA 2V74B 1A04A 1B1CA 1J9EA 2I2BA 3CVOA 4QU9A 4MVCA 4BLSA 4MGEA 2ONKA 4H15A 2HA5A 2Z6AA 5I48A 1FBNA 3UNXA 2XIJA 1PGOA 2A84A 3V1KA 2OB1A 4MR9A 2WA2A 5JC8A 1R3DA 2IYNA 2C5EA 3ELDA 1L5ZA 3C39A 3UATA 2J0VA 3T0IA 5KOYA 4HMQA 4HZIA 1RACA 4LFBB 4INZA 4U2CA 1AA6A 5GQSA 3NTLA 2DGDA 1JTEA 2JGDB 1GZ7A 2VHYA 1XVLA 4NICA 4Y9UA 5F1PA 4DCOA 3FYTA 1JT9A 3IXLA 2IV3A 3K70C 2OOSA 1X7HA 1LS1A 2GAIA 2A30A 2J6CA 3DZBA 1ISJA 4KDCA 4CKXA 1ZJ6A 4YRZA 4B6OA 1TMOA 1TD1A 1KZ9A 3DOFA 1ADCA 3P7MA 2AFIE 3PU6A 3VO2A 4A8JA 4FHEA 5K5EA 3VBEA 2D3TA 3ONVA 1L1QA 3K0CC 2F00A 5A1JA 3DHYA 4BCDA 1PLJA 1B8OA 3F4KA 3MXOA 1WVIA 1UKVY 1Z0UA 4IJMA 1Y8QB 5KVVA 4PC7A 3CF4G 3A58B 3L1UA 3AI3A 1GJRA 3GDWA 3DLAA 3TQTA 4P5PA 3KELA 1G7SA 5CT9A 1T6YA 4Q66C 1MEOA 1FSZA 1YUBA 3LGXA 4JUBA 5G41A 4AFNA 4CCSA 5JZVA 5I9TA 1JG4A 3SLGA 2WMYA 3B2NA 3FUTA 1J2TA 1EFDN 1ENOA 3TRDA 3RKSA 3PGJA 1TJ3A 5KTYA 3K9BA 2QTLA 3F8TA 1DBSA 1X3LA 2QRPA 2R1VB 1O9GA 4MQLA 2XY4A 4R2IA 3RIGA 4PLFA 1ORIA 2JCBA 3EW9A 3VSDA 3PGKA 4CDMA 8MHTA 2ACWA 2EHJA 1G60A 1PD0A 2J9FB 4ALIA 1NMZA 1B15A 3UH0A 4EGCB 1EEHA 4GP9A 5EKDA 1A9YA 4LNUA 4EAQA 1NA5A 5J1SB 1GFZA 1K75A 1Z9BA 1X77A 1CNFA 2KYRA 3VNVA 2Q2VA 1EE1A 3GT0A 3QG5A 4GR9A 4J1QA 1Z68A 2W4IA 1NPYA 4DMRA 1CETA 5KZMB 2VQDA 5CNMA 1P6QA 4D42A 1CZNA 4F6CA 3N8IA 1EPUA 1YKGA 3AGPA 5JRDS 1WPGA 2P67A 3AF2A 3ROZA 1US8B 3OUTA 3ZJUA 3O94A 4P3XA 1AHNA 2XKBA 1Q2UA 2WJIA 1GFWA 2O8CA 3GPDG 3A9VA 5AOVA 3IT0A 1K2VN 2W2KB 4U0JA 4TT8A 1WSWA 4HTFB 2I3GA 2K2WA 5AI8A 3H97A 1ZCJA 2KHZA 3C1AA 3SIXA 3V33A 3VX4A 2OL4A 3OJEA 3EEIA 5B53A 3VMFA 2F8TA 4IO0A 2FTKE 3U09A 4TUYA 1KE2A 1G3MA 1FU8A 3AFNA 4OYHA 1W5AA 2HB6A 3BFVA 3C6ZA 1VYHA 3D1LA 4YK7A 5DU2A 3TF5A 2YZGA 1J20A 3HC7A 1EFCA 2VUIB 4BE9A 2EARA 1XEWX 4I19A 6REQA 1JVNA 5L40A 1K7EB 2IF0A 2QLBA 2BEUA 2CMKA 2CMFA 2OESA 4HQLA 1WHSB 2VP6A 2PEZA 2PAFA 3B2EA 1HETA 1DZ3A 2ZRHA 3ECCA 3EZ2A 3UCFA 3UT5B 2XAUA 2DCUA 1MB3A 3O9VA 4LJLA 2UYGA 4C7XA 1QGUA 4MPTA 3NASA 1JIKA 1QRDA 4DXDA 5H4HA 5L45A 4M9UA 3FR8A 2QKYA 3ZYZA 3LUDA 1XRLA 5CYOA 3VZRA 3TD2A 3TO5A 1RHUA 4NI5A 2HGZA 1I7DA 4FILA 4PLPA 3R7AA 2YMPA 2E87A 3RYTC 3UB3A 3UAOA 5L7YA 3SAJA 2ZJZA 3K30A 3D3JA 1N6HA 2J9RA 3QYAA 4C0LA 3NMUF 1Q0HA 3PFIA 1M75A 1ZWLA 3EXIA 5U4XA 4KI0A 1SHZA 3CQ9A 3OC0A 1LDYA 1E0KA 2HF7A 2XTAA 4ZMBA 1UJCA 3LGAA 2HHCA 3LDFA 3TLCA 2R00A 2CFTA 3IAHA 4EZIA 1HG0A 1I2AA 2ZTLA 2NSJA 3I12A 5GP1A 2QVYX 3V80A 1D07A 1NT4A 2XB6A 2HW8A 5DTJA 1JG7A 3FTNA 4DMFA 4IXTA 2PKEA 3KEQA 2RI0A 4CTJA 1NX9A 3WDSA 2C0CA 2GJ9A 4UUOA 4CV3A 1S7CA 1LSOA 1V3VA 1QO7A 5ALJA 1RFLA 2CLLB 5E9QA 4BBAA 2C9DA 1KDYA 4YMLA 3JQ9C 4OB7A 4F3TA 5KYYA 4DDUA 1X80B 2X86A 3ECAA 1E9FA 4PAQA 1SCAA 2HIMA 4E3ZA 2VUSA 1F0YA 1N3BA 1QWOA 2I54A 2D0PB 3C15C 4IFEA 4U7PB 3V7FA 5IZCA 3BA6A 2P5SA 2WFMA 2AN3A 3QJ5A 1GSHA 1DG9A 5HIJA 3WGHA 1P4SA 2CB9A 5JUWA 3L8FA 2F1OA 2IXBA 4MUMA 1W19A 4HDMA 5E6SB 3ZOZA 5J2UB 3OQHA 1F17A 1PJCA 4RH0A 1MC1A 1H5QA 5ENZA 3NNSA 2E4UA 4R4JA 4BO6A 3LY5A 3QE3A 5E1BA 2IH2A 3P0JA 5MHTA 2Z09A 4ZVPA 4TYNA 2DMRA 1TX4B 4JH0A 4AG5A 3SCZA 3ACBA 4KVGA 3IDQA 1R0WA 1U90A 1YI0A 1GU7A 2Z04A 3U3XA 4HT3B 3AB8A 4W5RA 1UT8A 1MG5A 5C7LO 5JYDA 4P93A 5ITVA 3IKVA 4KYVA 3CA8A 1H3FA 1PGJA 1MB4A 3HDVA 1NX6A 4KOEC 4N0MA 2WTXA 2DVMA 4LHYA 1KIFA 1PL0A 4N7BA 5IJ0B 3EGDA 2N0SA 3EWNA 1T2AA 2GEKA 2QLJA 3QQ5A 1M1YB 4R9RA 4DBLE 1P6UA 4HX2A 4PLWA 2HHLA 3R2JA 2NUPA 5E6RA 5CUQA 5ITZB 4AI6A 1BMFA 1RLUA 3KFLA 4DMLA 5CEJA 1Z7YA 2Y05A 5FH9A 3K0CA 1TCUA 5K45A 3IOEA 2BWJA 5LKAA 4GGPA 3IUPA 3GZ4A 4YAWA 5DTEA 1J0CA 3HN6A 4HBGA 4R5MA 1X7XB 3HK2A 1B3BA 1T8TA 2QZPA 4QFDA 4BMDA 1TFRA 1KAEA 1M6EX 2OCKA 3KPVA 4MZXA 4DSTA 2ZSAA 2FCRA 3TW8A 3B60A 1QCCA 3N70A 2FA9A 5TQ0B 1PW5A 3U3DA 2A9QA 1B0AA 4BVKA 2FSHA 1YXMA 3HBLA 2I65A 3L40A 2EX0A 1R8JA 2RIRA 4ZK2A 1E5LA 1T9DA 1U5AA 4MQMA 4RVOA 2PUAA 3QVMA 2KX7A 5LL6P 2ZT6A 3UFXB 3FLEA 1OOEA 4Z3OA 4OGGA 3CT6A 4ZYLA 4RADA 1Z26A 3O1HB 1TF7A 2OK8A 2WPDA 2B83A 3BTSA 3NBFA 1RMQA 2BFDA 1RVDA 4YBZA 3TM4A 1DJPA 5ITWA 3GT4A 4UBNA 3U3ZA 1U4SA 4L9SA 4WLFA 5DN6D 3ETHA 2ZJBA 5A5VA 1E1RD 1RLOA 4GR4A 4C89A 4L8GA 2HRRA 4QBTA 2VPZA 2C5GA 2EEPA 3E0XA 4B9EA 4YMHA 3MMSA 2NTJA 1TDJA 3Q9LA 4C6TA 1NOKA 4O4HB 3K0FA 4EARA 3DEHA 3SC2B 1DXHA 4LJ7A 2Y68A 4C0JA 1L3IA 2WSSD 2AZXA 1VGQA 3BD9A 4H17A 3DNPA 1P18A 1Z33A 3NHPA 3B7WA 5IKPA 5CYFA 5I7UA 1OB5A 3HEAA 4JBWA 4RXTA 3TMAA 1D03A 2FPIA 4CQMD 4K40A 2QR2A 5JRJA 4Y0NA 1E8MA 2EG9A 3OJOA 3WGZA 2I7VA 1EJ0A 3FUWA 2FX2A 1UXGA 4KX5A 1ODJA 2WMOB 1KOJA 3MM4A 2I2WA 5K09A 2VQ6A 2H3HA 4TKZA 4YJ3F 2D4AA 3TWOA 2R2AA 3FOBA 4ZCQA 3ZV3A 1WB5A 3UHFA 4AO8A 3FPEA 3BCUA 3IIJA 3L0IB 1GZ4A 4KE8A 3REQA 5BSKA 1P2GA 3HHEA 4EHDA 5I7EA 2BFEB 2HJSA 3G8DA 4FFPA 4JK3A 3NC1C 2A4KA 3WWDA 1XMJA 4DZRA 5EIHA 3BYZA 1SXJB 3HUEA 1MTZA 4GYKA 2WWXA 3FLAA 4LYYA 4DR4B 5F2EA 2ALJA 4L0CA 4TM7A 4YB8A 5FX2A 5EIBD 2FK8A 3UV6A 3AOEC 4G2TA 4JA0A 1GGEA 1M2VB 2Q1XA 1EQUA 4BNKA 3HTXA 2HQBA 2GESA 2RGDA 2PS0A 5FUBA 3NBZC 4K7JA 4JU8A 5BRAA 5FAXA 1GZVA 1R66A 2FG7C 2VP4A 4TS1A 5ED0A 4DEXA 1UUFA 1Z34A 3CKKA 4TYQA 1IYZA 3AFMA 4UFNA 5SZHB 3GUYA 4HDAA 1RYBA 1W48A 1Y8ZA 2CXPA 2ANCA 1JLKA 5IXYA 4CGZA 1P0FA 7REQA 2CFOA 2XV1A 3X2EA 5AXBA 3TM5A 4F6RA 1T4BA 1JRLA 1XDSA 4P3OA 4WESB 3PHCA 4L6CA 2IT1A 4GPD1 5EP1A 1FFHA 4LXQA 2UVQA 4UZSA 4N49A 3TQOA 3PQ8A 1MQSA 1JJBA 3OPYB 5TQ2A 1SEPA 4KLZA 4AKEA 1RTKA 4ZT2A 2BUBA 5JMPA 4D46A 3B6ZA 1P7VA 2ZREA 3JQ9A 3C6QA 3FOEC 2HIAA 2H0QA 2BRUC 3M4YA 4KIUA 1JVSA 1VTKA 4FKBA 1DC6A 4ND2A 2KBFA 3BVPA 3PS9A 1QVAA 1VDZA 1RJ9A 3DZKA 3CC8A 1ESCA 3R24A 2GRJA 4KPFC 3ZGVA 4EGJA 5K8UA 5E9WA 2HRCA 4MKXA 4E5DA 2C9CA 2VYFA 3OSUA 3S2ZA 3ONFA 4PC1A 3C74A 3N8DA 3WL4A 1V1JA 4NMLA 1RLIA 1M7GA 4I9UA 5EQDA 1XZPA 1I9GA 1TT7A 4DRXA 4I9HA 4AJHA 1JLHA 1XEWY 4J4TA 1L5QA 1T4MA 1M2HA 4U4AA 1GQSA 4BX3A 1ZC3A 1AQJA 5K0LA 1EXWA 4DANA 1Q1NA 1V95A 2YFKA 3N2EA 3EZGA 2X5KO 5B57C 4IBOA 3E22A 2BEJA 4BLRA 3T1TA 2Y2VA 4JGBA 3OQOA 1CF4A 1RJGA 2HU8A 2P11A 3LLVA 5T4BA 3ML1A 1DEAA 4Q48A 5CNIA 2JGMA 4KQKA 4DGSA 4GBGA 2P9TA 4OGFA 1ODCA 1D4ZA 1RM0A 1T5IA 1FFSA 4M9CA 2XUDA 2GD0A 3R3YA 4NMWA 5L6LB 4DR6B 1XUOA 3BH6A 3DMGA 5IDXA 5EWLB 5JDIC 2BISA 2P6MA 4TQUS 3FOFC 1IH8A 3GUHA 3IURA 3DO6A 2AWNA 2ZITA 2V8BA 2IUEA 3MC1A 5TC4A 1JLSA 4G8DA 3SZLA 2FRXA 4PAWA 4WUTA 1FYEA 1UJMA 3HWRA 5C32A 3OC6A 1YZUA 4YASA 2Z56A 1Z08A 3A10A 3GUZA 3ORFA 1N2BA 1P80A 2H8KA 1Q12A 3KKZA 2FRVA 2IS6A 3SFZA 2B4TO 2C42A 2H2AA 3HCPA 5ADHA 1K7YA 2HMYB 4DMCA 1RW4A 4A8PA 3ZHRA 4LNAA 3JSXA 1VQ1A 5JWRA 1FZTA 3GQBB 1YA4A 4C08A 4D3YA 4QQRA 4NBTA 1HNXB 1QH1A 3I4FA 3GJ0A 1USWA 3QF7A 4OP2A 1GDDA 5F1YA 2IEAA 2V65A 3Q5GA 3WQRA 2G83A 4NCBA 2YZNA 1E62A 4ZQCB 1W25A 5J2TB 4HUJA 3WK7A 3V1YA 5AM2A 3DR5A 4DSUA 1A8UA 4YTEA 1EHYA 2C4WA 1UT6A 3VDMA 2RIPA 2VSYA 4BO3A 3UA4A 2IF2A 2IOYA 4CT4B 4ML3A 2M6LA 1IFXA 3RM3A 4J1TA 5HKLA 5EIEA 1EUYA 2EW1A 2W83A 3SPXA 2QVCA 3TR5A 4UU7A 4E1BA 3NHAA 4OXQA 3CZ9A 1UPAA 5AVKA 2YV3A 5D51S 1D5CA 1P62B 3NV9A 1YJAA 3D1JA 4GM0A 2VQEB 5HS6A 2XRZA 1W7AA 3H11A 2EJBA 3AI7A 1HFKA 3T1VA 4X6XA 4EJ6A 2EBWA 3RS7A 3QEMA 2YMMA 3EAFA 3P0HA 4WCFC 3W8FA 2QUZA 2WAMA 5H82A 3ZE9A 2FR1A 4IG4A 5LWHA 4YFVA 1LK7A 3TIVA 4Q16A 3RSQA 1FC0A 4A9AA 4TKVB 5A6SA 2TMKA 1XA0A 2CDRA 2H29A 3I62A 3GF4A 2D0DA 1AN9A 1ZZGA 4QPJC 1PYDA 1RWPA 1FLNA 4IEFB 4IUDS 1PFYA 2P75A 1Q1AA 2Z3WA 2ZVDA 3IT3A 2ZI5A 3K9WA 3T1YB 4AROA 2DTXA 2QHXA 3V1MA 2P3QA 1BHQ1 3IESA 4ZPXA 1ZONA 2O2IA 2K4MA 1IN6A 2I3DA 3F1LA 4WZAE 2A35A 2AEEA 4ZN6A 3PUWA 2R6HA 3C6BA 2CXHA 1T4CB 3ABZA 1GUAA 2WSYB 4C43A 1SVMA 4TYWA 3HUUA 3NONA 4TXJA 1AT1A 3BZWA 2ZSFA 1KYYA 4IVPA 5CDFE 1JFTA 1PX2A 1K8YB 3A9UA 4FGWA 5CHYA 1PR2A 1T2FA 1HRKA 3I9OA 1QORA 4ER0A 3R44A 2XNJA 3U6KA 3K70D 2RHRA 1XPRA 3Q7RA 3TBKA 3PEYA 2Y92A 1E1DA 2PX4A 1JHPA 1ZH0A 3AF0A 3BK7A 3QH4A 1BMFD 4ROSA 4MHSA 2OM6A 2YZKA 4LYFA 4ASUA 4BB5A 4NJEB 4IQGA 4G25A 2YBDA 3SFTA 3PXXA 5I7HA 4U8GA 2JRLA 3KP1A 3DDZX 4QBHA 1WBDA 2I62A 2VJQA 4GXRA 1ONPA 2D06A 1DWUA 3WHLA 4B6JA 4TWZA 1YJ5A 1B6GA 4B6QA 2H4HA 3CH4B 4P3NA 2UYCA 1PT8A 1KPIA 2CVFA 4UREA 2C94A 4HEQA 4MULA 4UHBA 4ZQIA 4CMAA 1AD2A 4B3CA 5AJWA 1TYEB 4CR8A 2O8EA 3UG7A 3A3PA 2BRUA 1Y3AA 3GNQA 3Q7TA 4Y98A 4B81A 5DBOA 3O8DA 1J25A 1VJCA 1DPFA 3PIRA 4JODA 4Y6LA 1TAUA 2E1PA 2ZRMA 4GWGA 2JFFA 1P1CA 2WPDD 2XMRA 5K3CA 4QOJA 5KQLA 1VHTA 2QR3A 5ENVA 3TQSA 3EZYA 4IWYA 3P2MA 3UWSA 4DXAA 1Z6YA 5DM70 3GVHA 1FFEA 3FNFA 4YPVA 1NIJA 2IXEA 4E51A 1ZCBA 4PWYA 1S3GA 2E5LB 1BDBA 2WIBA 4DIEA 3KOWA 1HY3A 1JWBB 1YZ3A 2PSEA 2X3UA 3MJCA 5D85A 3SXUB 2YUTA 4QGHA 4XX0B 1E1YA 1XX6A 2Q2QA 3QNWA 4D8WA 2WUEA 3IPRA 1AO3A 2P6OA 4GMXA 4L5BA 2JI8A 1PYGA 1PWZA 1V11B 3NATA 3N07A 2G88A 3WL5A 2VQ3A 2VATA 2P9JA 3PUJA 3QNMA 2YWJA 4ZYVA 2PO7A 3K1TA 2VT6A 2GQ0A 1HE8B 1Z2AA 2FPUA 3HDGA 4KV7A 3NEJA 5DNDA 3OTOB 1NW8A 2AXEA 4KI7A 1V4BA 3C41J 1C7QA 1HYBA 1O6GA 2D4HA 2FV8A 1IUNA 2Y77A 3AY0A 5JDIA 1MN6A 3LK6A 1D1SA 3W4KA 3O7MA 4ND8B 5C80A 3KQTA 4JLKA 4OHWA 5HFNA 1M9NA 3LVQE 2BMJA 4FU0A 4DV1B 3A1CA 4UARA 3UJ9A 1T34A 5HMLA 4NL4H 3JARB 1SHUX 2XCLA 5LMZA 1FTQA 4Q3NA 5A1TA 1TL7C 3OZBA 1PN3A 1LSJA 1Y7IA 4OL9A 3M33A 3F4LA 3TFWA 5HIIA 3NBMA 4G8BA 4LHEA 2Z08A 4FSXA 1OIWA 2IV7A 1UZAA 2GPTA 1MNQA 3AG5A 4KITB 5BMVA 4F4DA 4KPEC 2R0QC 2QE6A 3KEMA 4FCWA 1ZK2A 2QJTA 1H9AA 3H04A 4ICIA 3MW8A 4UTXA 3AF1A 4I4IA 4JP8A 4MARA 1U7XA 3L0OA 1LZLA 3VZDA 1UP6A 4Q9HA 4F56A 3H8WA 2IBSA 2GNOA 1F9AA 2WABA 3OF3A 1UJNA 1UOPA 3ZI0A 1XZGA 2IXAA 1TPZA 2HBRA 3KT8A 1OMOA 3KR2A 3MEQA 3OPVA 4LZZA 5CW2A 4JZYA 3TYXA 1ZRHA 3C0KA 4B4DA 5KOIA 2FDXA 4FZVA 4L85A 3PFCA 3GB9A 4FYVA 5AW9A 3JQBC 1H69A 1BGXT 4L74A 4LY3A 3TZCA 1KMHB 5NULA 5DGXA 4FCVA 1GRCA 5K8VA 3KOZA 1I7NA 1VRCA 3K73O 4E6PA 4JELA 4D2IA 5H0IA 1GPJA 1FFXB 1XE3A 2QR5A 1XQ9A 4ZEWA 2ZJ5A 1JHDA 2PRZA 3FHCB 3V4FA 1MQ9A 1YB6A 3NXKA 2UXDB 3UA3A 4HDOB 1XRQA 2QQ0A 1I94B 3M1LA 4D3ZA 5AKEA 4R6WA 1RE1A 1D8AA 3C8UA 4WCFA 1D2MA 1VLMA 4R3UC 1J8DA 5ICEA 5BQ5A 1ORWA 1ZWKA 2C4TA 2IIQA 4L6AA 1WWKA 3A05A 4CIYA 4JJKA 5IU6A 5LZ5A 4EECA 2GZRA 2Z2YA 2PCJA 3FTQA 1LPPA 1JU9A 2R84A 5DXAA 5A5EA 4Y9RA 3KVVA 1RXIA 3GLKA 1PT7A 3E53A 5IKOA 4PXAA 3QY0A 1QM5A 3MJSA 4BJ6A 5L7TA 1KWGA 4P22A 4CT0A 5I6DA 2VPPA 2NVBA 1W36C 5L7WA 1FP4B 1RABA 3IALA 3GJZA 3LZDA 3RVRA 1D3AA 4X24A 2VTBB 3TUJC 2BCEA 1RYMA 3LDGA 3EMKA 2JFGA 4HDSB 4MVWA 5F77A 5ES4B 2YJ3A 1RRMA 4IUBS 4QTYA 1H2AS 2A67A 4L5YA 4C0WA 2PH5A 3OE4A 4MR7B 2IFTA 3WJ2A 1Y34E 1IIBA 1H23A 1RHQA 2VTKA 3WX0A 3IV6A 3ENNA 3OTHA 3PRJA 4V1CB 1DIAA 4ZAYA 1KVRA 3WADA 4C0QC 4B48A 4EVSA 3L46A 4BGEA 1G8GA 1I0LA 2B8TA 3NTUA 4NYJQ 1KSGA 3CG4A 5JFOA 4ZA2A 1RBYA 3F9IA 3WBBA 3NM6B 2VWPA 1ZA2A 2PR7A 1W4RA 1UXKA 1Y4SA 4J0KA 2FEMA 3MTGA 2WWVD 3MWYW 4BN4A 2CUTA 1F06A 4C4AA 3GG9A 4TTQA 3JQGA 2ILVA 1YR2A 5AW4A 1CUSA 3C7AA 5FHQA 1I01A 4ZXPA 2XZPA 3LCMA 4OP3A 3SYMA 1CWUA 2BBSA 2VT3A 5TY0A 3S99A 2WF6A 2GZ3A 2Y6UA 4QPDA 4CM4A 4K6GA 1LPBB 2WIGA 4JOSA 3UHOA 4WJKB 1G64A 4XCXA 3DHNA 1M3SA 3E15A 3KQPA 2E4VA 3AKCA 4GYWA 2FPOA 1FNBA 2NT3A 4N82A 3TKYA 1ZNZA 1FP7A 3WC4A 4D6PA 2WV9A 4BFSA 1OAOC 5BXYA 3C85A 1NKSA 3HU1A 4JL8A 5ARBA 1UMKA 3Q5EA 1GA1A 1X9IA 3K72B 2ZSEA 1ZAKA 2FN3A 3CEAA 4JJIA 4PEVA 2J5KA 1NM5C 1T1RA 1ULUA 3WLAA 5IM5A 3GROA 3GGSA 3IV7A 1NMQA 1IEXA 3ZVNA 1XZIA 2G1AA 1HDRA 3I58A 3AJAA 1GKKA 1UMCA 3F97A 5DO9A 3ZWOA 1AMOA 3IAXA 3LS2A 2IA5A 2GKSA 4F2HA 3LD9A 2WWFA 4IDAA 3G6KA 5DBHX 1L7RA 5A02A 3IDOA 1UDAA 3WZLA 2XXAB 4L51A 4X63A 5MDHA 1F8GA 2ZE8A 3QJYA 3B9QA 3GELA 1EK6A 2OT3B 4ENUA 3CGWA 5H1YA 2HJRA 3W8NA 5JR3A 1SVLA 2EFEB 3U3OA 1N2ZA 2W37A 1S9HA 1CUAA 3JVDA 1I80A 1YACA 2V1XA 5IYZA 4LY0A 1FP1D 1GR1A 2XVAA 3HA5A 4UQLA 2BI7A 3PJFA 1I6KA 2RC6A 4YREA 1SZCA 3OWXA 1I2CA 2A9OA 5BPHA 3GBPA 3UUWA 2Z2XA 3W04A 1OC2A 1PBNA 2FW6A 1VXRA 3O4RA 3C98A 2FUNB 3PXDA 4UEOA 3AG6A 2ZTMA 3G13A 4ZCTA 3MQ2A 4EUSA 1FRFS 5FP0A 2ODAA 3AGQA 4P58A 1GEGA 3NTRA 1PFGA 2WHPB 1FMFA 1RQNA 3HXLA 1H2ZA 4L2IA 2DLNA 5AO9A 3DTVA 4MVJG 1OIXA 3GGGA 1IC6A 1TPYA 3WLOA 4BX2A 1QG2A 1YJBA 3DOUA 3UKDA 5C35A 4L4YA 3CSUA 1VKOA 1R6TA 2DFNA 1F2DA 1SUIA 4P4UA 5EIWA 3F6RA 4NYMR 4H35A 4PTYA 3O92A 3PGVA 4RELA 2WVHA 3EVCA 2ZJOA 3G2PA 5GONA 4D9MA 4YMGA 2DQYA 3OCWA 1PV4A 2J07A 4IFIA 5EZYF 1N2JA 3E9EA 2X1LA 5FPHA 2XCOA 2VAXA 4OHVA 1RI4A 1W6UA 2EGGA 2ZROA 2CVZA 3P9CA 2YV2A 4A0GA 5E9AA 1CIJA 4ASUD 2BFFA 1SEVA 2HUPA 3JQBA 4J7XA 2NO5A 4R41A 5DCWA 4N1AA 4S24A 4BNUA 2RAFA 1VIVA 1L1FA 3CRQA 4B33A 3ASYA 4XVCA 2FWIA 1NI4A 1GNVA 1X7DA 1JG1A 2FZLA 2W8BB 3Q12A 1B8VA 2MSCB 1A9QA 3L7CA 2FR8C 1QWSA 2DPLA 2W2OA 2UUBB 3BWVA 1A2OA 1TO1E 4GKJB 2CNKA 1HT3A 5DXFA 3CR3C 4YUWA 5JXWA 4W1PA 2EL9A 2RHTA 2XUHA 3EF0A 4BYGA 1EXDA 4KV9A 3AV3A 3P52A 3QFFA 4N41A 1XA3A 1RM3A 2J45A 3FDIA 2GCEA 4PYIA 3R3ZA 3H2YA 4QXOA 4X5OA 2V6JA 5CH3A 2GH1A 1ZGBA 3VYVA 1YQWA 1JB1A 4X92A 1N2EA 2R6DA 3G9QA 3A1VA 4LWQA 1CQIB 3MINA 1GUFA 4H7EA 4M0DA 2BJWA 4QOSA 2C9OA 3H2IA 2ZYHA 4W4TA 4WIAA 2DECA 3VOAA 2NOAA 4NQZA 4AMYA 4Q4CA 1U0NA 4WK6A 5HMMA 1EI9A 3E9CA 2GB4A 2VDMB 4FT2A 4Y7CA 1ZOIA 2JLWA 2GGSA 3V1UA 3I6BA 1GWNA 3D6FA 4UUQA 4K8OA 2CLMB 1M1XB 3FCOA 4H6XA 5E0OA 1EZ4A 2IY9A 5L8VA 3EXHC 2PTHA 3N8GA 4D74A 2BFCB 1KO7A 3FFTA 2I4OA 5B6PA 1RHMA 1U0EA 2P4EA 1XMXA 2OKGA 4BO4A 3MERA 4Z9XA 5HQ3A 3B7GA 3H2GA 1IZ0A 3OQPA 2IOHA 2AOUA 3A1NA 1WKCA 3AY3A 4BYMA 1R37A 5AW1A 1Z83A 3LUHA 5ADWA 2G6BA 2B1RA 5JY1A 2I34A 4J7CA 3U1VA 3LWDA 4DR5B 3H5TA 5DRTA 3JRXA 1F9EA 1OHHA 2H4WA 3NM4A 3Q6MA 5IJXA 2XOXA 1XZJA 4HGNA 4MTCA 3RFTA 2G4LA 3C14C 3X3HA 5KQPA 4BO5A 1NY6A 1SQFA 4MUYA 1V9SA 4PFSA 1GPAA 4LSMA 4RZ3A 4N7MA 4D4IA 4IHKA 4W5HA 3EZ7A 2GZDA 1SIOA 1JTFA 4C2UA 2XDWA 3C24A 1JSRA 3TUZC 4OX9B 1H42A 2AK2A 2XDYA 4HZGA 4KDRA 4G09A 1RAHA 3ADOA 4XPIB 4D9CA 5A03A 1OKKA 2HEGA 2HNKA 5KTMA 4OLFA 1FXWF 2QT9A 1PDWA 5EXTA 4BO1A 2J4DA 1XFAA 2C03A 5GOZA 3SX0A 5IMSA 3GLIA 3HJRA 1YI1A 1JVBA 4RPHA 1RYDA 2C5BA 4O1IA 3V8EA 4JEMA 4YP1A 2JDIA 2Y71A 2ZQZA 4NBSA 1NJ1A 2QVXX 3FN4A 5A4KA 4XUCA 5AJXA 1NM5A 3KAQA 1EK0A 1IXSB 2A0FA 6ABPA 3ICWA 4JLOA 1QH0A 3FCXA 3UEOA 1NIPA 1PG2A 4BJ3A 5BNWA 4XQ9A 3T8YA 1PVOA 1QLJA 3PHIA 2RB5A 2VNIA 3ZD6A 2P2DA 4KIGA 3WQQA 2XD4A 5CGZA 4KAJA 4WKGA 3UJHA 2RI1A 3ND7A 4HB3A 4D0RA 1Y42X 1PNVA 1P4HA 2ECKA 1JBKA 3GVCA 2GN0A 2B36A 3D02A 3TVYA 5A5GA 2RH5A 3KKEA 4A5OA 1UKZA 2V5AA 5AVZA 1JQEA 1C5KA 3C3MA 2QTVA 2QY9A 3BSFA 3EWSA 4Q9JA 4F04A 5JSZA 3AR4A 3EXG1 1ARZA 1VZ3A 3GQVA 3QBEA 1NBMA 3OHSX 2GFIA 3W2TA 3U44B 3LIPA 2UXBB 3CM0A 1N0UA 4AZVA 1AX9A 1G5QA 1XU7A 5FOVA 1PCXA 4ZOLA 1BRMA 4KL8S 1FSSA 1QBKC 4IHJB 2YQZA 1C30B 3CE6A 2XMDA 3RBVA 1JQLB 3HPQA 1JA1A 4BZQA 4XA8A 3ESAA 2PS1A 4XSVA 5CTJA 2P8JA 2AKAB 5DTRA 3HFGA 3PUVA 2GYVA 3FUXA 4A27A 1N7HA 5KWEA 3ICCA 5F5NA 4V24A 5KC9A 3ZDBA 4R9VA 2E21A 3VNAA 3ZZ1A 4IDCA 1M1NB 2MYUA 4N0QA 4RY9A 4OOFA 3G5LA 1CUFA 4MUBA 1JF8A 4G1CA 1H5NA 2JD0A 3U4QA 1W4CA 2I2XB 2HLDA 4Q24A 2GOYA 1C0EA 3UAGA 1ABBA 4V0SA 3PVSA 5THXA 2X58A 3CG0A 3ESBA 1SHTX 2OO3A 2EWMA 3GCGA 4WJLA 1RHJA 3EARA 4R1QA 4JX8A 3FUUA 4MWEA 1GYRA 3FXAA 5BRJA 1JDJA 3ZLUA 2XZLA 1LI7A 3KSMA 4GL2A 4HZUB 1J8MF 1L4GA 5B6JA 1MFZA 4UBOA 4FBLA 2YZ2A 1KA9H 1VJ1A 5JMWA 1R4NA 4FR5A 4TWAA 3THSA 1PX0A 5CIYA 1D2AA 3DC2A 3HV2A 4L3WA 1B0ZA 3DW1X 5F21A 3OE1A 4N7RA 4MVXA 1T4DA 1GN9A 4UFPA 3OEWA 4MPJA 2FPKA 4D9JA 2KWIA 3W6OA 5AKJA 5F52A 4XCVA 4UNNA 2L18A 5ALKA 3HJUA 4HHEA 3EAGA 4R84A 3LKBA 3QX8A 2FR8A 4UJ3A 1DTEA 5FUVA 4BKUA 1K9SA 1QP8A 3L7DA 3C87A 2BFNA 5BV1A 3M1YA 3A1UA 4QIHA 4DGQA 2X6QA 1ZXXA 3TGLA 1LGYA 4JGGA 2CFSA 1JKXA 3D6TB 4LDNA 2IPXA 1KI9A 3UMSA 4BRSA 3D8TA 1H0RA 3H87A 2NACA 2WF8A 3CNBA 2X0EA 3ZNNA 3PUHA 5IUJC 5KMGA 3AX6A 2VHVA 5GV7A 1DMSA 1YULA 3AEQA 3CF6R 5I9SA 4X91A 2PZBA 2BYTA 3O8BA 3RDPA 2WTNA 1DXQA 2WTUA 1JBQA 1RLMA 2K2QB 4UZEA 1KGDA 3A37A 4IIDA 5JWHA 2WG2A 5F3WB 2BBOA 4C6HA 2NO6A 3IB3A 1G5HA 1U1EA 5G0UA 1JFRA 4MYCA 3EXHA 5KSYA 3PFWO 4RABA 3NUQA 4CV1A 1RWOA 1R0XA 4E5SA 4IGAA 2FX3A 1T9HA 3ZWNA 1EBUA 2DSNA 1E96A 2ZB8A 3OHPA 4QHSA 1GVHA 3C43A 4QQFA 4K88A 3WKEA 3PUKA 4X1KA 4A6DA 1KMQA 2Z2IA 5HDQA 2PLAA 1HR0B 1GSOA 2WWWA 2YX1A 1DAHA 2HCJB 4UE6A 1TEXA 4QNMA 4K9MA 3DLTA 4P84A 5AHRA 3S2UA 4E09A 5CD9A 5LQNA 5CCXA 1J2EA 2NPOA 1KRXA 1ZSNA 2AJTA 1BE8A 1IOZA 2F43B 2IZOA 4AKSA 3MT0A 1BFUA 1BWSA 1EHCA 1XKXA 2ZBVA 1XDWA 4M87A 5E4YA 2Q29A 4DC0A 1PNOA 3PE3A 2XKJE 3ZDFA 3EAQA 1ZVJA 1NSTA 3FDZB 4M54A 4XQGA 3WIUA 1HLFA 4E5NA 4NOMA 2YXBA 3FYUC 3M5WA 4LGMA 3EC2A 3H84A 4Q3EA 1JEYB 2YXDA 4O8CA 3VHXB 1EFVB 4AQ7A 2VRCA 2V4UA 2I2FA 3FB4A 4RTQA 3TLZA 1WHTB 2BOVA 3L7MA 2QWXA 3DTVD 5HFAA 4E5VA 4XQCA 5HKOA 1L4FA 3NHKA 1PZXA 1PZMA 3DOJA 3QYFA 4HWPA 2PE5A 2JLZA 4R7ZA 3FZQA 1CZOA 1Q44A 1TRHA 2FOLA 2H92A 3VSCA 1T6XA 3D2CA 1VKRA 5A05A 4MWCA 3I37X 2XMZA 4J0EA 4JIGA 5AKZA 5DX8A 3QVOA 5G1PA 1JNYA 3CBQA 4L08A 2ZAIA 1E2FA 1A82A 1UKAA 3K0AA 1XKQA 1WIWA 4WBXC 5FPYA 3WBKA 4FFSA 2ZM5A 1O4VA 1UZUA 1TUBA 2BMEA 2NZJA 3CGGA 3EG9B 2IYZA 1PK9A 4H0NA 1R0SA 1ZP6A 2QN9A 2C4NA 1VB3A 1DEKA 1DS6A 2A0UA 1I2DA 1USUA 3K1ZA 3LWBA 3PL5A 4PO3X 2P0YA 3CF2A 3K0EA 4Z2AA 1TQ2A 3HBNA 5A3QA 3K9NA 2QMEA 3MTIA 5G3YA 1GVNB 4A10A 4HVLA 2VBGA 3HJAA 2O20A 1W35A 4W9MC 2QP9X 2QTBA 2WAAA 1NQWA 3BH7A 3M9LA 2QG6A 3KD3A 4KN8A 4UULA 2AD1A 4BV2A 3QLTA 5JJLA 2WICA 3BEOA 3QFTA 4C76A 3OFNA 1A4UA 2VDLB 3PZRA 4XDGA 3LQ2A 3FVWA 5LWQA 3KOYA 2R8RA 5TV2A 1A27A 1PE0A 2A1UB 1PEYA 2KE5A 4PBTA 2W6PA 1E92A 1I30A 1ODTC 2D8AA 2YJ4A 3M8KA 3U7GA 5JQWA 1H9CA 1BW9A 2HU5A 3UQYS 3NRCA 1K27A 4ALLA 4OJYA 2H65A 1NVGA 3MGAA 4B7ZA 1DBWA 5HBGA 4Z4FA 1CUDA 4RJLA 4JXKA 3N05A 4DLXA 1GQQA 2XYPA 2ZWIA 3OSZA 1HYEA 1LFDB 3WXBA 4D56A 2CE2X 3TLYA 5EG5A 5AXAA 3ZDEA 4BNIA 2ZP1A 3CRW1 2UZIR 3T9AA 2AYYA 2Q4TA 3SS8A 4DMHA 2C9YA 3E82A 1W36D 2UVDA 3ENQA 4WDQA 1BZYA 2FJUA 3OFJA 4QPNA 2H5EA 2NU8A 1ZINA 3GRAA 4ND7A 4WKNA 1QAOA 3W05A 1Z3CA 2OVFA 2ZIXB 3H6GA 2KPOA 2FETA 4ZWNA 3T12A 1MIHA 3HLYA 3JALA 3HKEA 4M0KA 3U39A 1AQNA 4R2JA 3B3QA 4KC0A 3G2MA 1QKJA 2NU7B 2RG7A 3ZU5A 3QNUA 3T5BA 1WOYA 1JSCA 2Y76A 1Y8RB 3NTVA 4AWAA 5L4SA 4Q1VA 3IDAA 4DCTA 4CDNA 2BEWB 3H2JA 2INGX 1RSZA 1SC1A 3KZVA 4JSYA 2JAWA 3FPGA 1FDUA 5EOVA 3NHBA 2IXGA 1OXUA 2XUAA 2ZYRA 3RU7A 3TNJA 1MC4A 5JAHA 5KJ6A 2D7DA 1Z15A 1OHHD 2OVBA 3QPVA 4HLCA 4BGVA 2OHIA 5TSDA 3RSZA 3T7KA 1R0CA 3GGPA 3KIPA 3VI3B 4BE7B 3AVWA 1YA8A 2Z1NA 3F5QA 4F8YA 1C9KA 1DKOA 2AJBA 3GD5A 4O2AB 4EQ6B 2B21A 3MILA 4X7BA 1GT6A 1P81A 5JNSA 4OB8A 4EGAA 4GOLD 2XEDA 4E32A 1NV8A 4DJFC 2JJ1A 4V0RA 4MW2A 5HJ2A 4G4SP 3U9TA 2PUEA 4DF3A 3H19A 5JBIA 1AXRA 3GEMA 1ZDMA 4KAXA 1I10A 1OKKD 3FCUB 4Q1CA 3PE4A 3NIWA 3DDNA 4U9UA 1RRCA 4ZQFA 3P9ZA 1CE8A 3RS9A 1KI4A 2N9UA 5HKBA 1CKEA 1XRPA 1VKZA 4FD3A 3R7WA 3VPAA 4ZGWA 3RODA 3Q8KA 2F1JA 2IH4A 4BLQA 3SSOA 2BGNA 2J3MA 4XYBA 5BQFA 2M6SA 3NGXA 2K7FA 3ZHYA 1DC5A 1OX4A 4URYR 4Z4CA 1Y7PA 4LDZA 1T8RA 1JSLA 2WYVA 3QXHA 3H3XA 2QRHA 1FVOA 1T1EA 2XMPA 2W98A 5LSAA 1U99A 1OBCA 3CR8A 4O1HA 4GQAA 3KQUA 1SCQA 2HQRA 5DLDA 4PSAA 4HOYA 1AH2A 2QQEA 4IIBA 2WG0A 1GCUA 4GMFA 3GVPA 1HEIA 3H65A 4MV1A 1TQ8A 3ZVLA 1TUIA 3INTA 3A3NA 4LPSA 3BFJA 3K8YA 3O4GA 1NBMD 4C05A 4C4XA 1L1EA 4AM8A 3KSRA 1AZSC 2YHUA 3K1JA 1GGVA 3FKSA 5BPFA 3ROGA 1OILA 4DVJA 1VL8A 3THXB 1TTTA 1XD9A 4GPAA 1NLMA 3GBSA 3E8MA 4HNQA 1GGKA 2GN1A 4C3UA 1JDPA 5EL0A 1COZA 4PGMA 1S9DA 4V39A 4EK9A 1A5TA 4F4HA 2VCEA 3H5LA 3P97A 3C3EA 3DAPA 3GP3A 3QZUA 3GGCA 5IX8A 3DW3X 2CZCA 1PFQA 4M9ZA 1OH5A 5MGNA 1XCOA 1XN4A 2GAFA 3AUYA 3LC0A 3OCXA 4MKGA 3W79A 3SXPA 1ULAA 2J1LA 4BB6A 4RHFA 4TTVA 1MGOA 4WH0A 2ZBFA 1JHQA 3A3KA 3GOHA 2FFJA 2GYWA 2C9ZA 2FFHA 1RRVA 5LR6A 4NATA 4XWOA 2HLDD 5CVCA 4J8PA 4P4LA 4NVRA 1J06A 1E99A 2F3PA 1SH7A 3QIAA 4ZJZA 2NGRA 3L8DA 2J9YB 2XWJI 1YMVA 4EJ0A 1Z74A 3MJVA 1OLXB 3TAXA 1U3FA 4AJ2A 1K6EA 1ZGGA 4KREA 4MGIR 3RIXA 3C8DA 3UGTA 5CFMA 1DAMA 4UASA 1DRUA 3ZWPA 5T6BA 1MV8A 2X0JA 5F7XA 1EJBA 2GCOA 2PWZA 4PXYA 5JPCA 1ML3A 4CZ2A 2EJUA 4IDHA 3PENA 4N3NA 3W5IA 1CS0A 3V2IA 1VM6A 4PONA 1T2UA 4HGPA 1X7ZA 1D09A 4EHBA 1QIMA 4FW8A 1NLUA 1SMKA 4TV8F 2YOGA 4GVLA 4WXPA 4UW9A 3FROA 3I3SR 1EM8B 1YUNA 1N5LA 3GAFA 3GLRA 2PQ0A 3I9MA 3M9WA 3NTXA 2VPQA 4WBSA 3TOVA 4DJAA 2CMGA 4Y6OA 5JHGB 4BP1A 4AJPA 2JFHA 1W6RA 1YRAA 2Q49A 4N6GA 4QE3A 4QNNA 3CUWA 4ZVVA 5AJUA 3UIEA 4D1YA 2PDAA 1GZ3A 4AAYA 1MO4A 4LQDA 4HXYA 1SBYA 4FQ7A 1BN6A 1TMYA 5HRAA 4MP3A 2J46A 3LRTA 4G56A 3LPMA 3QMPA 1GRRA 4RJIA 4C3OB 3EVNA 1L5OA 3G2JA 4Y2YA 4R1OA 4L4UA 4KO3S 1IOVA 3BXGA 1FU7A 4I3GA 3U7FB 2JI7A 5I5EA 3R20A 4G26A 3P4YA 2OHFA 4K6CA 1ZMXA 3F8WA 1C7ZA 1XRRA 2DTDA 4ZZ3A 3IP3A 3HABA 5CVTA 5JXGA 3S81A 1MF7A 4ABYA 2X7JA 3VR5H 5JPDA 2DT8A 2JGNA 5AW8A 2AG8A 1OVMA 3OZGA 2FEXA 4PE5B 5KINB 2BGKA 4KSCA 2HLPA 3EVBA 2BTQA 3I2IA 1SBNE 3QV2A 4M0PA 4NRDA 1CYEA 5BWCA 4TS4A 3Q2OA 3TN7A 1BXRA 3JWIA 4CUZA 5C3UA 1BQ3A 1BVYF 3RKRA 2GCGA 1K6IA 2YYSA 1LDMA 1QS0B 3ONDA 5EIFA 1P0QA 4L22A 4HNTA 4JL6A 5JD4A 5FWYB 3WWCA 1L5NA 1SRQA 3AJ9A 1V9CA 4DLPA 5HJ5A 4GGOA 3EVDA 2VH1A 1G3UA 3F98A 4CL3A 2ZW9A 3PJGA 5JNWA 3BIWA 5CVDA 3W2EA 4B6SA 3RABA 5BSTA 2FEPA 3GP5A 3D5TA 1WXIA 3IRUA 1I1HA 2VRCD 3KKLA 3AESA 1VE6A 3CF0A 4L3OA 2OB2A 2E9SA 4C0XA 1CQPA 4WK2B 1SG9A 2PVCA 3RYHA 1K88A 2VQSA 4XLLA 1R4MA 1DT5A 1QH8A 3TQFA 2HUNA 3UAXA 3OZAA 4DSAA 3WWOA 5JVDB 3A9SA 4YAGA 5FXMA 3WHKA 4G0UA 1I4LD 4JJFA 4EIWA 5JZMA 1NUPA 3ZLVA 2A0YA 1T3HA 1VSQA 4Q7MB 1SOUA 3HV0A 2C2YA 5AI4A 4N8EA 3RI3A 1C0LA 1JHRA 1XTUA 1R0YA 5HM6A 1OIVA 1PHRA 3OU7A 3ZY6A 1B23P 2JHAA 2HBYA 1YO6A 3IVAA 2DF8A 1XRSB 4PM4A 3HNPA 3OPYI 4AJKA 2IYYA 4BMXA 3FHJA 3P9XA 3V8BA 1E3IA 2YVQA 1FMJA 2EEZA 3EOBI 3K53A 1WB6A 4MYHA 3R74A 4XM1A 1B76A 1OJ7A 1FYFA 3ENVA 4MVJP 3LXRA 4DIOA 4B3JA 4YAEA 1HH4A 2PKQO 3DE7X 3GYGA 4Y1GA 3OFND 1ZNXA 3TW4A 4YRGA 3AUSA 1YK0A 1P17A 2ZE5A 3OQIB 3TFQA 1C9MA 1ZW1A 2PSJA 4RXUA 4EAAA 1D2NA 1DLJA 1DQPA 4JMLA 3LRPA 5CA0F 1L7EA 2V96A 1N5JA 3X0DA 2R44A 5IK2D 1QGDA 5DIZA 1KK1A 4ZC1A 5ICMA 2B1GA 2DUMA 4AY3A 1UJBA 3A26A 3GT3A 4XVUA 3GPCA 3TGWA 3RYIA 4FFMA 4HN9A 3FSJX 3ZWVA 3EBPA 3LCVB 4IXNA 3R7FA 2IP1A 3JQCA 5JSHA 3GRUA 2WBLC 4M0UA 4ZVOA 3BCSA 1U9IC 4NZNA 4AJ4A 4AYTA 3HXQA 2QD2A 1X1AA 2OFWA 2WMDA 4J0GA 5CTAA 3HYRA 1JPNA 5JAPA 4M1MA 4MB2A 1XDDA 4E6EA 2CV0A 1SG0A 3DF7A 2R48A 1KYVA 3LCJA 1GT91 5CT5A 2JF0A 3OIDA 2G82A 3VDRA 1LKZA 2H1LA 4M7RA 2X8AA 4PX3A 1SOWA 2GASA 4LYDA 4JYAB 5JWOA 2D5IA 4BCBA 2NU9B 3E03A 4W82A 2EFHB 1LC3A 5K7SA 3KKKA 1DRWA 2RARA 3RU3A 2LRHA 4RNCA 1ELOA 4JLUA 4DQKA 1M66A 1EGMB 3DAYA 3DZIA 3HUFA 3OAAA 4BNDA 4RTJA 2J08A 3QX3A 3E70C 2AFRA 3WAKA 2ZTSA 3ZS9A 1F38A 2ARKA 1YQXA 3V3TA 1AHPA 1GKLA 1G7TA 5HF8A 3FMGA 1GL6A 1LQUA 4MZDA 4RMHA 4ZDWA 3JV7A 4HLQB 4KQIA 2QXUA 4LK2A 5K6AC 2PUTA 1Y37A 2XLBA 2C8KA 4M99A 3PWTA 2JJ1D 4ECEA 1CJBA 1HWYA 4DSZA 1ADBA 2PMEA 2HJGA 1WDWB 2NO7A 1KBOA 4JBXA 1XQVA 1SCUA 3FSEA 3IERA 1R0RE 4EHKA 3DUWA 5C1IA 1A8HA 4F11A 1BFDA 4UOQA 3T5GA 4LSWA 4DLYA 2RGRA 4GSKA 3A3YA 4N5DA 5FOQA 4TWBA 3JWEA 3ILHA 3W2IA 4AQDA 2XD9A 3DLBA 1O96A 1KJQA 2C5SA 2OXEA 1ZXBA 3CKMA 3P1JA 4JVSB 1NQXA 2BEUB 1VC2A 3AZOA 3I92A 4RPGA 5ECDA 1J39A 2VBCA 3NGLA 3ZZUA 4B79A 5EMJA 1S1CA 3V1NA 4E21A 3N0RA 3MXTA 4CKEA 4WDRA 3QVGA 4QGAA 4DA6A 4H16A 1VL6A 1M0WA 5D5HA 4FFOA 4A03A 2HK7A 3EH2A 3KT3A 5JMOA 5JSFA 4DDMA 2O06A 2Z9DA 1GTZA 1WS6A 1ENYA 1G4AE 1KK2A 1KBQA 3OM1A 4WLEA 2O2YA 5GY7A 3THOA 1OFGA 3WFZA 5BR8B 5AJHA 1F6DA 1M34B 1EH5A 2D00A 3FSRA 1VLQA 2AN9A 3O8LA 1GYQA 3EXIB 3ZU4A 4BV9A 2A9JA 4UAVA 3RASA 1RKUA 2H06A 3DQQA 4GNKA 4JMPA 1SQGA 1WUHS 3U7JA 1T4GA 3MJDA 3QENA 4NABA 2NADA 2XQFA 3AQIA 3FKSD 3W3AD 1EKXA 2JKVA 1AF4A 4KQ1A 2FW7A 4BWFB 1WUJS 4DARA 1FQOA 3E0QA 2ODPA 4RSHA 2NYUA 1C8BA 3IUEA 3L49A 5DEOA 5D7NA 3KTAB 4NCJA 2PG3A 1X8XA 2F9LA 1T8UA 5H16A 5JQGB 1T2VA 1MO2A 1XN1A 1WD5A 2G9NA 4G0PA 4LBYA 3L8CA 2PMKA 1V1RA 2IZ7A 4Q34A 4B3SB 2Z1MA 1BGWA 3U19A 2DLCX 3U37A 3O8OB 2J3LA 2GWRA 5FO1A 3SZ3A 2ZKLA 3PHJA 1PQUA 4JYPA 2DFTA 1WB9A 3V2GA 3FH0A 2OD7A 1EG7A 3A1DA 4Y9TA 2EKBA 1N57A 3NORA 1BS1A 1WKBA 4G0YA 1DQZA 3M6MD 5DEIA 3JQDA 3GG2A 3SEAA 1Q17A 3L0BA 1I4WA 4BN0A 3HNRA 4NR0A 4HDMB 1JU4A 2I5PO 4V02A 2NVWA 2OBXA 4I6EA 3PA8A 4IJVA 2XUZA 5ER6A 5KYTA 3AHCA 1JE1A 5H02A 2CLHB 2A5DA 1Z6GA 1QFJA 1HLDA 3S68A 2H63A 2VDPB 1EE9A 4XWKA 3A2NA 4M0EA 1K98A 1XLTA 2KI5A 4CEHB 1SVNA 4AIIA 2FUG6 3GC6A 3BD8A 4CMCA 4CYMA 3L1IA 4QBFA 3ZWKA 2PZAA 4EI8A 4YUAA 3GX1A 5BV0A 3G5MA 4IS2A 3RTEA 2J5XA 3GUCA 4GOOD 4CI9A 4ZYXA 2ZXUA 5ALZA 4O3MA 4L8LA 4KHPB 3U0BA 4WFQA 4TLBA 4RZIA 1JB9A 4LNHA 4EEXA 4MIEA 5B58C 1PQWA 3THYA 3FTDA 4PHFA 4R40A 4QLOA 4K9PA 4XGIA 3BT7A 1GRQA 2J9GA 4Z3DA 3OCZA 2WD7A 4NK4A 1Z5UA 3IH5A 4S1WA 4X41A 1Q50A 4MR8A 1QGOA 5C37A 4K05A 3DKIA 4JL5A 4TYPA 1I3CA 2X0NA 4J03A 1BWQA 1OXMA 1YS7A 4LWZA 2I33A 3CSDA 1UFVA 2E5WA 3LT2A 3MIZA 1NN5A 4OMCA 4P92A 4ABTA 3WJ1A 1V9LA 4E31A 1U0OC 4ZV7A 3TB6A 3WIDA 2NZYA 5IZ4A 1S5PA 2YYZA 3O4HA 3NHYA 4M36A 2ID8A 5BSVA 3QELA 2L82A 2XCTB 1KORA 1P39A 3G82C 3WYNA 1GFSA 1YB5A 2JATA 2BZSA 3R5HA 3ZBTA 1C3OB 2O8EB 3WMXA 3CEMA 4KGXA 2Q7DA 1IBCA 1U9IA 4Q6WA 3KLMX 4GH5A 3I4LA 3OQJA 2JAUA 3LCCA 4LYGA 3NKVA 2COKA 3HEBA 1ZSVA 1M72A 4PSDA 2EZ8A 3DZHA 2IV2X 4C06A 2WSMA 4UBLA 4YPOA 3S3TA 1CULC 5KTPA 2J6BA 1E9AA 1WDMA 3T3MB 7YASA 3VUFA 1EZZA 1NNUA 1IONA 1G6HA 2C84A 2ZTUA 3D6VA 1YDFA 3PJDA 4RHEA 1UPXA 3FWZA 5DYNA 3QW4B 4EJSA 4MVJM 3VVLA 3BGWA 3WI7A 2BGTA 1DJNA 3X1WA 3HY3A 3AY6A 1RFGE 2PR2A 3CTMA 3CW9A 4DHWA 2Y1EA 1SCNE 3GLHB 3AF6A 1GPBA 1O5OA 3AY7A 3GZTB 3ILYA 3TINA 1NQVA 3RVQA 2I71A 1A98A 1NY5A 1VL2A 2BUAA 2W6IA 3AL3A 2Z5VA 3COWA 4K3VA 3W1EA 4HMOA 1SQ6A 2YVKA 3PK0A 1PT5A 4R1SA 3TI7A 4WZBE 5JJCA 1OH7A 3TE7A 5DYGA 2V7QA 2WYUA 4UD2A 4RV4A 4F92B 1S0UA 1UOOA 2O57A 3H1TA 5KYWB 4CFYA 3LPAA 3S0JA 2FPIB 3X1DA 3U7QA 3RTGA 5CLFA 1GPUA 3UB4A 1Z3IX 3R09A 3AP1A 3VPCA 1GTVA 4BKMA 4N9WA 4WASA 3U6BA 2RHOA 4IJQA 3FWHA 1KHTA 3EQ7A 1K5GA 3KB8A 3OEYA 3MUEA 4MQ6A 4BKPA 2AW3A 4IOLA 4HUQB 4XB6B 3OLXA 3HKBB 1PQ4A 4ESVA 2IYUA 3V55A 2EWWA 1E3TA 5JSKA 3ZUGA 2W00A 1WUYA 3FRJA 2WJWA 4YUVA 2X40A 3GK3A 1MX5A 1NNI1 1Q7BA 3A11A 3AF5A 2IDMA 1XWWA 3LHKA 3OA2A 4UZFA 5DRYA 3LT4A 1JPVA 3EPLA 5DX1A 2X1MA 1LV7A 5IN4A 1DIBA 3VSEA 1NVEA 1OVGA 3RVLA 1KL7A 3CH5A 1JLLB 3PIIA 4YJ3A 5BVHB 3DCNA 2QRVA 3KU4A 3RRXA 1KMIY 4RTKA 1TQ4A 4K9QA 5FOTA 3CR7A 3HGTA 2WJ6A 3D7NA 1CUGA 2B7BA 2Q3LA 3I01A 3S1LA 3EIEA 1L2TA 4BFUA 1GEEA 3GJ6A 1MR3F 5BYAA 4LIPD 5EFZA 1YTUA 1CZUA 4ZEXA 4DG9A 2ZIAA 3F8SA 1B6TA 1KJZA 3QGMA 1C80A 3SYLA 4DE5A 7REQB 2GJSA 1QXSA 1PJAA 2JGLA 4R51A 2VIIA 3VRHA 5KWVA 1TVEA 1HL3A 1U2TA 3A1EA 3T3DA 1Q7RA 4L4XA 4YFYA 1E3SA 5CPFA 4TVOA 4ZVNA 2R8OA 1Q20A 1JKFA 3KCNA 1NXWA 2R8EA 3H18A 5EJFA 2WAOA 3C3XA 1RWNA 2HY7A 1Z45A 4NENB 5FPQA 1KFBB 1KEPA 1CEYA 1Z0JA 3VR3A 3WTBA 3EIXA 4ENRA 4GLBA 1CNMA 2WWGA 1NTOA 4C22A 1RPAA 3KL4A 1D4OA 3KOOA 4MW5A 1RLTA 2D2FA 4IDEA 3PDUA 1HTBA 1C50A 1TW3A 1YR9A 3LF2A 5PNTA 1NF3A 2FEOA 4V1CI 1FFAA 1A77A 2PKXA 5H8WA 2ZTHA 4MUKA 5IABA 2VLBA 3GD7A 3HVUA 3I5UA 5ESRA 1LW6E 1FX0A 3NH9A 1QIEA 2Q3FA 2ZIFA 4R1UA 3SIRA 2IPAB 3ZU3A 4GHWA 1TU3A 4GSYA 1FFBA 3WS7A 4C6SA 3IVGA 1TF5A 5F7ZA 1P33A 4K86A 4XSHA 4WNAA 1QIKA 2DPXA 1RLJA 4FEYA 3KJQA 1QV7A 3UJNA 3E22B 3OAAD 3JAWA 2BF7A 5DBIA 2QTFA 1DELA 3E9ZA 1J22A 3COZA 4KR2A 2HGSA 2Z8YM 2IZ6A 4OHUA 5BOVA 4DG5A 1NASA 1KO1A 3M6AA 121PA 4BNHA 1EVQA 3EEFA 4IOJA 3FOWA 2F1HA 3FZYA 3OX3A 1EXVA 2PX3A 1L4NA 3A6DA 1O89A 1P0MA 2IIBA 4GF5A 1U9YA 2AF4C 3CZPA 1CJUC 4EJ2A 4C3VA 2WJZB 5EQFA 3V8QA 1HDIA 3CUSA 4B6EA 4YUYA 4OHXA 1YOVA 5LM3A 2JAPA 3AM3A 1VE5A 4TSRA 2DHRA 5LYJA 3AVQA 1AC5A 1WQ3A 4ZVLA 1YVEI 2Q6LA 3FAKA 1Z4MA 4FLEA 1JDZA 1IN4A 4LDPA 5DSXA 1BD3A 1A4XA 2VK1A 4CLXA 4M8LA 3PHLA 3AI2A 2CV1A 3H0CA 2I4TA 3EDMA 3EQ2A 3QWIA 4BZPA 2CLOB 4IKOA 1BYIA 2HA0A 2YCLA 1JG6A 1UEXC 2JFBA 3EA4A 4QEZA 1I7SB 3LZ6A 1I5RA 1EJ6A 1REQA 2HAEA 2NN3C 1T1GA 4MDHA 4Q5IA 3UG6A 4NOKA 3K2EA 3CRMA 4RWZA 3CYFA 3MJHA 5DGTA 2BSQA 4E11A 4INPA 3KR0A 2Q6VA 3V7WA 4DYDA 4MS4B 2ZSHA 1WNFA 2J7KA 3H75A 3QI7A 3TRFA 4D8TA 3PTAA 1Y1KE 2HD4A 4PWZA 2C3OA 3EZ9A 1NNLA 1SD1A 1RWXA 1W85A 2BAGA 2OENG 2X8JA 2BGUA 5FPKA 3HZRA 5DT2A 3D5EA 2ZUWA 3LUJA 5D87A 1E61A 1XDGA 1GGJA 4FEEA 5TPZA 3T0FA 1WL8A 3E48A 3FPKA 1OGYA 4UUAA 3WL6A 5J4LA 3OCJA 4LJRA 1ESZA 1PS0A 4BFYA 3HHPA 1XJ0A 3A6PC 3EYAA 2I4NA 4HJRA 1TC1A 3U4DA 1GL9B 4FQ5A 2CV2A 2PD6A 3CONA 3HVKA 4EM6A 1XKTA 2B20A 1KY3A 2WKSA 2ZBDA 1F60A 3E9MA 4LW8A 3KQSA 1V26A 1GLVA 1XYYA 2IE8A 1RXVA 3FKQA 4NYJR 4P33A 4EKIA 4R2WA 3PFNA 3S4YA 3FSGA 1CZRA 2JFXA 1TKRA 1AXGA 1ZGJA 2MU1A 2XDQA 1NYRA 1KYZA 2ZJ4A 4DMKA 5K3OA 2EG5A 1Q0SA 5AKKA 1HF3A 2W4MA 4NXMB 3ICOA 3BJRA 5G1NA 3VU9A 3VJRA 2JEZA 4KQMA 1TMKA 2HL6A 3F7MA 3K92A 4YPFA 2IGTA 2J85A 3UXEA 4D57A 5BVGB 5C7IO 2Z2KA 1I6WA 5HE8A 1KJWA 3BXPA 2FPGB 3T3PB 3ET4A 2Y1OA 1MC5A 4HYYA 4QG7A 4Z99A 3ZDQA 5BNZA 2REXB 2FPXA 1YR3A 3FZEA 1BKSB 3U1TA 4CU2A 1MV5A 5HNKA 4P3KA 1ZM4A 2AIRA 4GDMA 1K5HA 3VKUA 2Q5HA 2XMBA 3GJ5A 2O54A 4DCCA 1HPLA 2CLCX 1MMFB 2WLTA 1VFNA 2OCAA 3RGWS 2PXHA 4UHFA 4I5FA 4W99A 2EWVA 3UCXA 1CJMA 7ABPA 4IIJB 1W1IA 5AESA 5KSOA 2QL7A 1FF9A 2OD2A 1OZAA 4HDCA 5ALEA 4EJMA 3I28A 1RWWA 2PBZA 5I8ZA 3HXMA 2H48A 1KEEA 3HXOA 3GLGE 4P81A 3BBPA 1O95C 1Y6JA 2RHLA 2CL0X 4N6OA 3G85A 4UU8A 2P2SA 5AW7A 1YHZA 3G0BA 4BBJA 4Y1RB 2Z5GA 2WB2A 3FNGA 2JLBA 2PMWB 4OJTA 4FGKA 5ILOA 1PQYA 3R0XA 4I1OA 4LISA 5BSMA 1V4VA 2SNIE 4XDYA 4CT5A 3Q85A 5F33A 5LXTA 4I55F 2B4YA 5DHPA 4D82A 1JQAA 5ENDA 1SB8A 3JWJA 5BSRA 4CG0A 4CL2A 4E5YA 1AKYA 2IYSA 4N7JA 4ARCA 4GICA 1N1MA 2DQZA 2V6FA 3N5KA 4B73A 1YKFA 4KPYA 3A4LA 3PWKA 3L92A 1VG8A 4QJIA 2G72A 5A06A 1KNQA 2PH3A 3LQKA 3QPBA 3IUJA 4UDOA 4G85A 1CZHA 1H2YA 4X65B 1HNWB 3ORSA 4WN3A 3KHUA 4OTZA 2KMLA 5U9CA 2GHRA 2B7CA 3WLKX 4EY6A 1GSAA 1SOAA 3AR2A 1LBTA 2XVXA 4X1YB 4NMXB 1IULA 2B37A 5THQA 1M6NA 4C2AA 2VR1A 3UK1A 3F1KA 5FL7A 1NOIA 1LTHR 1QO0A 5C7OO 2C0PA 2P9FA 1E2MA 2FWNA 4DDHA 3M4ZA 1JHOA 1EVEA 2VJPA 1FSGA 3EBLA 4KRXA 4M7PA 4QWMA 4OXYA 5AOBA 2W6ID 1YC5A 3QP9A 1Z29A 3KYIB 3WZ2A 4XJVA 1NZFA 4MGZR 3SGLA 2VDOB 1X38A 4ZC8A 2QB5A 4GKKB 4MGYR 2V7QD 2AOWA 3Q0IA 4H59A 3LDHA 1EWQA 1HUQA 4Q4DA 5FKJA 2H3EA 2E48A 2FW1A 5E2BA 1N8KA 4R2LA 3DOOA 1G21B 2FP4B 3SJAA 3MGKA 2V0NA 5JS7A 2A6PA 2X77A 5DYTA 3LF1A 4OQEA 4Q93A 2JHFA 1WZCA 3O2SB 2LVBA 3DV0B 4IIVA 2W2NA 3H8VA 3QI2A 3LBIA 3JTMA 2UYQA 2NO9A 3I04A 5EMMA 4MV4A 2JD2A 4U7TB 2PIAA 3B2QA 1DV2A 3C5HA 3DE6X 3LW8A 2JGDA 3OZCA 5TVGA 3IBSA 2ZRPA 2ORVA 3FHOA 1N7JA 5GMOA 1GPWB 4WY8A 4MKZA 3H9CA 2VAWA 1VSVA 2P4HX 4OHMA 3BQNB 4EATA 4MIKA 1O0CA 4JYMA 1CY8A 3DVSX 4HFRA 1MAHA 3CNLA 2BM1A 3PQFA 3LOUA 2ZG6A 1NJFA 2DUWA 4DM3A 2IZZA 1WF6A 4UMEA 2QUAA 2EJCA 1DWPA 2CLDX 2AXNA 2WPNA 2VO1A 4LGYA 4WN9B 5BNFA 4ARIA 4OI0A 3K4PA 2ZPAA 3ANMA 4X84A 3JASB 4B43A 4F1WA 1Y8QA 3NEYA 2A9KA 2PX2A 4J6EA 1P1KA 1BYUA 1RHKA 3UYLA 1A4IA 3IBCA 5K20A 1EJ2A 4RTNA 3AVPA 3D64A 1M1ZA 2AJ8A 4CM8B 1XYVA 4TL7A 4D80A 1VP3A 3K0HA 1GKIA 2GPYA 3GPIA 2BT4A 1I4TD 4G63A 5EESA 1HNNA 1Z17A 3UWOA 5LZ4A 3ESDA 3KT6A 2O4UX 1RADA 2HK8A 5EHNA 1GGHA 3SSNA 2QW8A 2OY0A 1WVGA 4BQEA 5JCXA 1W59A 2JCSA 2I76A 1P9RA 2R1VA 3HS3A 3PNQA 3LLSA 1RKQA 1OLOA 2Y0EA 1SU8A 2WAXA 3TLXA 3VR3D 4D8XA 2I99A 3PNLA 2W71A 2J9FA 1CU1A 4ZOEA 4O1MA 3KJEA 1Z0AA 4V0MA 5F51A 4DYVA 1IWPB 1P0IA 5HTKA 1ECCA 1D6JA 1XLWA 2AI3A 3KWFA 4BC0A 4AS1A 4GX2A 3L7LA 3U16A 2OG1A 1MABB 1GO2A 2C83A 4QJ4A 3B1VA 2QXYA 3MMZA 4I1YA 3MCUA 3ADKA 1YL7A 2R6AA 5SICE 3W8DA 3LUFA 1EA5A 3C2QA 3QHQA 4TUYF 4B45A 2VDJA 1X39A 2FG6C 4YUZA 1ZM7A 2UYHA 3HG7A 4DV5B 1US8A 2C98A 3V00A 4PCUA 3KE9A 2HRZA 4CDRA 4OHZA 1NJ8A 1UL1X 1OAAA 2VJBA 4QYXA 1FYVA 2RJOA 2Y0PA 1RYHA 2F3TA 1OYWA 1PFVA 3GLQA 2E82A 2ZXEA 3I72A 2VSFA 5IBQA 3UMMA 2RGUA 4HDNB 2QGZA 5ER9A 4HTFA 4INJA 4A3SA 2EFJA 5ALRA 3SWWA 5FNVB 3O03A 2XYGA 1QTRA 4BEVA 1XCJA 4BBPA 5JASA 1BXGB 4KQGA 2GHQA 8LDHA 3H3FA 2RE8A 1P31A 2UUOA 1XROA 3QEOA 3T7IA 3N0WA 5H5JA 3L4BA 1AIPA 4YCDA 4F2DA 1PNRA 3IGFA 4C0AC 5TNXA 2XR1A 3ER9A 1LEHA 5BQOA 5AKLA 1ISSA 3AH8A 4KQXA 3QSYA 1JJFA 4ILKA 4YRCA 4Z6KA 4N0EA 1GU0A 3IUSA 1B0PA 1WHSA 2GF0A 1YBHA 2RGCA 2Z1DA 1TO6A 1T15A 2ZI4A 1B2RA 1O95A 4DMMA 3UT5A 4QJ3A 4DLTA 2JLRA 2UZ3A 5JNUA 1SXJC 3ETLA 5LNK6 3A1FA 5ECGC 3GYBA 4F8EA 1NVXQ 4G97A 4EKDA 3JD3A 2P9ZA 4E46A 3M4JA 1VHJA 1CY2A 1NT2A 1KJNA 4HPXB 2QQGA 2W2QA 4R81A 2O7RA 5CGQB 4YP7A 1Y6ZA 4CG1A 4TTRA 5D3ZA 3TD9A 4CM4B 4URVR 4D26A 1MRZA 4E7PA 2WM3A 4TTPA 3D7KA 3H8SA 5IDWA 2SECE 2BDTA 3DEKA 2YXNA 3T5CA 4BXOA 3MWFA 4QJ5A 3TPCA 4KBFA 5ESWA 4Z1OA 1NMEA 1Y1QA 1QVWA 1C1YA 4UU1A 1H6AA 4OXRA 4Y2VA 1SAYA 1BEUB 4E2YA 3H9UA 5JS2A 3KUUA 1KTIA 1U0SY 5U1PA 3R76A 3I64A 3KFVA 5DIFA 3U7HB 1SJ9A 3KSDO 3PQ6A 4UNQA 4U7HA 1NN3A 2DP4E 3OCCA 3PQ5A 4L4ZA 3EIFA 1K92A 3QVVA 5IK2A 3ZDYB 5D8DA 1PTJC 4RHXA 1WEHA 2XWPA 4DN6A 1SR8A 1XT6A 3P27A 4XW2A 5TPZD 4MGKR 5ELXA 2H2HA 2YN4A 2AHOA 2IP2A 3KL2A 5CXXA 4F4JA 1X80A 1PJLA 1KZHA 3E18A 5JNRA 5LMCA 2AF3C 3BZBA 3H6HA 721PA 1SIBE 3DMPA 5D3MB 5DASA 5DM4A 3II6X 4Q1FA 1DQRA 4X7MA 5ALTA 1WP4A 4L5IA 1IK6A 3B9PA 5HUQA 1OCEA 2QM8A 4RVFA 3FSGD 4LE2A 4TTAA 2DUNA 4ER3A 2NUTB 1KK0A 5J2UA 1S8FA 2HSJA 1JQ5A 4RZHA 3IKLA 4P35A 2ONZA 4YONB 4EO9A 1AS3A 3GLFB 2QI9F 5BWOA 1VIMA 1IBMB 4MQBA 3GAMA 3I6QA 2VSOA 3DGFC 4UM9B 1EGAA 1HOXA 1QUFA 1EX9A 3BHJA 3SP1A 5I9LA 1DOAA 3D3QA 2ID4A 2OZVA 5GJVC 4M1SA 1L4LA 1WCIB 2A92A 2R7NA 3OKCA 3WYCA 9MHTA 4I5EA 4MV7A 1T29A 2OV8A 3N7TA 3PR3A 1E59A 3DE0X 2AUTA 2ADOA 3T7AA 4TZ0A 4PR3A 1N77A 2B2CA 1TCAA 3OIYA 3RFXA 1FDIA 2OV2A 4LJ5A 1XVAA 1XTVA 5DSZA 4QXPA 1M83A 1Y9ZA 4KOAA 4YJ2B 5DNAA 1M1YA 4XKJA 3T7JA 3TX2A 2OCDA 3VVCA 4AMZA 1N8NA 3MS2A 4XSGA 5ICCA 2ZQ5A 3CPHA 1H0SA 1LVHA 2CUZA 4GBED 2AI1A 5EQJB 3RS2A 2JZOA 3TOCA 4UAGA 1Z82A 3CEHA 3ZIAD 1EHIA 4HGYA 3F6YA 4FGLA 2RHMA 4GEGA 4RK6A 3SMQA 1H4TA 3BE6A 3I6IA 4OIMA 1X7XA 1DMRA 4HFJA 5DKFA 4YAIA 5CIWA 4RKWA 2IHTA 4HDRB 3MWKA 3GUUA 3FI9A 1P73A 3GNTA 4G5XA 1MAAA 1L8LA 3C3CA 3KB2A 1STOA 4KXNA 5TGDA 2Z9CA 5TQ0A 3NDRA 3MRVA 5B4UA 4K0RA 4C7OB 4L4SA 2PPLA 3AEYA 3BE4A 3T3IA 3L4SO 1NBWB 1U3CA 1QE3A 1O94A 2AI2A 2QLFA 4JKO