2LVBA

Solution nmr structure de novo designed pfk fold protein, northeast structural genomics consortium (nesg) target or250
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
MGKVLLVISTDTNIISSVQERAKHNYPGREIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLKTAGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords DE NOVO DESIGNED PFK fold PROTEIN
total genus 36
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2012-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lvbA00
2LRHA 2MR6A 2N75A 4J29A 5GAJA 2LR0A 2N3ZA 2LNDA 2L82A 2LTAA 2KPOA 2LCIA 2MR5A 2LVBA 2L69A 2LV8A
chains in the Genus database with same CATH superfamily
2G8NA 3PICA 1GUDA 2BF7A 2DQKA 5FR2A 3X2SA 5KS2A 1YBVA 4Z1MA 4DPMA 1NN0A 1U2TA 1ZXBA 5HS4A 2WWGA 3FWYA 1ZCZA 2RK3A 5DHPA 1EDDA 1DRVA 1JFRA 5ALIA 4B83A 2IPNA 2XMPA 4BWVA 1FFGA 1QAMA 2I6XA 1GG2A 1WCV1 1GAJA 3C8DA 2CNNA 3KOZA 1JE1A 3OX3A 2WHEA 3N70A 2IHTA 5TQ2A 3CVOA 1HEIA 2SCUA 1JT9A 3W7BA 5JRJA 3OX2A 1T6BY 3R0VA 1NP7A 3OCVA 4BO8A 5CLFA 2GZDA 1GNPA 1XZDA 5K0FA 2K7FA 1QFSA 5KYNA 3G6KA 4TUYA 2IEBA 3QLVA 2CNBA 4MPDA 1RLOA 3MTDA 4CM8B 4A6EA 1I30A 3QVOA 4B4KA 3AM5A 1UQTA 1GKIA 2C59A 1DRKA 2JRLA 4B85A 1HBJA 5IVPA 5ADHA 1SHLA 5SZKB 4HGYA 4KTVE 1G2OA 4M0PA 1QKIA 2B4QA 1UEJA 3G79A 1U98A 3I12A 1H3FA 2BGTA 2HADA 3QW4B 5KHAA 5KTKA 3WWCA 1UXKA 2R79A 2QTVB 2X2FA 2OO5C 4YGXB 5DTQA 2REQA 4GLOA 3LUAA 1SQGA 5LLSA 4C3VA 2VYFA 1J33A 4I9FA 2O2GA 1Z6ZA 1EUCA 3QEJA 1GN9A 3F98A 2JVJA 1UDBA 3QQ5A 4M38A 4QPZA 4XQEA 3GLHA 3P8ZA 1GAWA 2WUFA 3AHJA 5FL3A 4R6XA 2OOKA 4R2LA 4RKRA 4PRKA 2W98A 1OLSB 3IJRA 3O3NB 2GWRA 2Y05A 2J6CA 1AQUA 1T8RA 3O1LA 4U7GA 4XIFA 1Q95A 5IAJA 1XA4A 2YJ5A 2UZ3A 3D0KA 2IX9A 4QBGB 4C0BA 4PX9A 1JNYA 3T4EA 1FJXA 4QOSA 1ZK4A 3R09A 1H22A 1JQJC 1P9RA 5BR8B 4B44A 3LBYA 1BYUA 2V7BA 3PJFA 4LZPA 4M6WB 1FL9A 4UM8B 1DP4A 2BKUA 3NALA 3TN7A 2FVXA 2E4WA 4KIJA 3TGLA 1TKAA 3L0YA 2IEAA 1IZYA 5CX1A 3EYAA 3OPQA 1SBTA 3E23A 2O0HA 1PJTA 5K03A 3OCYA 4CT0A 4MVJM 3FTCA 5KJ1A 3GARA 4JJKA 3RF6A 2ODEA 2VJMB 3AUFA 1CF9A 3QH4A 4W5NA 2XNDD 1AK1A 1J2UA 4P2BA 1WSAA 1P6UA 5DFAA 1MABA 4KXXA 4EFLA 4HQFA 2XB2A 1ELOA 1RI4A 2IP1A 121PA 4MR7B 3NTRA 1FDIA 1GRVA 1R00A 5DOVA 2A1TR 1AXEA 1X38A 4ZAFA 1BH2A 1N7GA 1U0RA 2RGGA 4HEA6 3DL2A 1S3IA 3OMLA 4J4TA 4PSUA 2FZWA 2OHVA 3BHNA 3PCXA 5K9ZA 1A71A 1C14A 2BHRA 3ZCTA 1IBSA 4PPGA 1EX6A 5B1HA 2AQ8A 2GBPA 4XASA 2IZZA 2PX0A 5JECA 3HCWA 3LUHA 2PU5A 3HB1A 3QEAZ 3JTMA 4F3NA 3OESA 1Z4KA 2R85A 4NL4H 1H65A 4B3DA 4YACA 5ALNA 3NAGA 1ZZGA 1DRWA 3SX2A 4LHWA 2DF8A 4QQNA 5JXJA 3OIYA 4M37A 4QUJA 4UPEA 2W0MA 4P5EA 3C70A 3H5WA 1MW8X 5L3SB 1OBFO 4YAWA 4I6EA 2DQSA 1X1SA 5G3ZA 2XEDA 3E2MA 4GBJA 4PNEA 2HMYB 2Q3HA 3KLPX 5AKHA 1N1EA 2EDCA 2I0FA 5GJVC 2ZAYA 5BQXA 4LTDA 4K6HA 2QMHA 3CEHA 5FT9A 3JZIA 4E15A 1XCJA 3CKLA 4EAAA 3QGMA 3H6HA 2Q9CA 3P0EA 3VYRB 1JV2B 4CIBA 2X1VA 2BI7A 3TW8B 3DM5A 4TYPA 2FRVA 2ZVQX 2JF0A 4RTNA 4D41A 1KJIA 3DHEA 1KL7A 1OX4B 4HKTA 4IDOA 3RLFA 1N6HA 3T7EA 1XLUA 4NS1A 4C6TB 4DLBA 2WAYA 3UMSA 4BLWA 1CJVC 2X2PA 1GNRA 4IVRA 2H85A 3GLGA 3B9QA 1Z7EA 2JFGA 2WDZA 4LXUA 4CM5A 4MAFA 5TIIA 2Q3CA 3L7BA 3QKRB 1V1MA 4HAZA 1IYZA 4AO8A 4C88A 5J2TA 2BH2A 3L6OO 3NV7A 3AJAA 4YCSA 5K3AA 5I7FA 2HRCA 3QMPA 2PLNA 1GV1A 5IAEA 4M2LA 3SQDA 1K8YB 1NWHA 2XHEA 5FLXA 4WW0A 4ZZ0A 1M1YA 3NU1A 1DQZA 1LJLA 2YHIB 3I9FA 2DPXA 3Q0TA 3FYUB 3EC1A 1KBQA 3H2YA 3OZDA 2HC9A 4DUGD 4EYEA 3E9QA 8ADHA 4MVJP 4X1YB 5KNCH 1I1QB 3GA5A 3QOXA 3IPLA 4IG9A 5K3FA 5H80A 3W1WA 5LZ2A 2JLQA 2X7XA 3ANSA 4NONA 4KPFC 1YRAA 2BL4A 3A9UA 3DE3X 1KIAA 3M2PA 3WNQA 3V1NA 5KAPA 4LZJA 4ES6A 3T3NA 1EP2B 2WM8A 2DSNA 3I0MA 4FZRA 4F1KA 4G0QA 4NAHA 1I32A 3VPAA 1DJQA 1E2MA 5GOTA 4YRSA 3B2QA 2IDKA 1ILEA 1P81A 3G8AA 5DH9A 2GKSA 4TN1A 4G23A 2XF8A 4DC9A 2HREA 2GAJA 4GLJA 5IVHA 5A0FA 1UODA 1O97D 1QDLB 1OBHA 4KR2A 2D1FA 3LIIA 1L8QA 4UHHA 2AFHA 4XWGA 2NU9B 2HNAA 4QD3A 4DBVO 4XH9B 1QPZA 3T61A 1OW3B 2LCQA 1WCWA 1JU9A 1V4VA 2ZJ8A 3C3CA 5D87A 5AM5A 4GP7A 3TLBA 4R0MA 5ESRA 3EPPA 1KKUA 3D8SA 4HLUA 1UWCA 1XK7A 1VI6A 2BEWB 2XCOA 2RGDA 3F2IA 4AUEA 4J0HA 1H9AA 1KEPA 1UBNA 1W59A 3OPNA 2A92A 1D2CA 3DTNA 3CZPA 4PQEA 2ZSIA 4YMSA 3VR6A 1J1IA 2B5OA 2HXGA 3EGXA 1AGXA 5BN5B 2QLJA 4HDSA 3JQ8A 3JQEA 2GJ4A 3NAZA 4E2YA 4KK3A 3G8BA 5FUMA 3ZWNA 5LMZA 2I03A 2FW1A 1C2YA 1UFRA 4TKVB 2IUFA 3TLZA 4HDCA 1F0NA 1TLFA 1KI1A 3CRRA 3FYTA 3U1VA 4A8HA 2QW0X 3BRQA 4ZI7B 4OBXA 1FP1D 4QYIB 1JR6A 2A9VA 4IIJA 2O19A 2Y4OA 3OQVA 3BSWA 1HNNA 1JS1X 5JT1A 3GGPA 1CUXA 2GUWA 4QDXA 5DCYA 3V2IA 5FFNA 2HYDA 5HKKA 2DB3A 3FSEA 1RYFA 3PQDA 2B5WA 1P0MA 1R0LA 5BSVA 4MVJG 3WTCA 1XTBA 3CVUA 1TTQB 3FKJA 2XUZA 4NZ9A 4B3HA 1W4RA 1Z3IX 3TNYA 4DB2A 1D7AA 2PU7A 5IDVA 1JQKA 2PUGA 4H7KA 1ZRNA 3RAFC 3EW7A 3V7UA 1MJNA 4KDFA 1J2JA 3G59A 2WJ3A 1U8YA 5F78A 2WAAA 3HY4A 3OQIB 1KOFA 2XW6A 2EKDA 3HB4X 3VC2A 1CS0B 1SCNE 2DRIA 1YQTA 1M2NA 2HBYA 4FJ0A 4J8PA 4FGLA 4XOUA 2GARA 2ORIA 5E6SA 4EG7A 3HR8A 4LSGA 1DTWB 2W58A 2JAHA 1NVVQ 5FTKA 1IB6A 1X7WB 4CUJA 3DPUA 1R5NA 1VTKA 4XJTA 1ML4A 4NH0A 4A8JB 1Y7LA 4CCWA 2BEUB 4LHSA 3K2BA 5DI3A 5ALYA 4YP7A 2YCLA 2RHHA 3ZUGA 1QVVA 3U5TA 5KQGA 3V1UA 4BZQA 3I37X 2PJDA 3IO3A 3PQ4A 5DGCA 3D8UA 4BX0A 1IDOA 1OHHD 4PM4A 2B5VA 1DLIA 5F77A 4BPRA 3FE2A 1P2VA 3AB7A 1P0QA 3N3AC 1E2IA 3HWX1 421PA 1TAGA 2F9MA 1FSFA 1HE4A 3FCOA 2I87A 5EJ7A 4PE5B 3EAQA 1Q1ZA 1K27A 4R1OA 1Y42X 2O48X 1S2LA 4JJ6A 1L5NA 1LZLA 3H3JA 5KSOA 5I3CA 1MB0A 1QRAA 4Q7KA 4MYUA 1G8FA 2GEDA 2IELA 1SPBS 2WHPB 4NBLA 2Y71A 5HMLA 4WVFA 3TZQA 3Q98A 1H8HA 2XCQA 2ZJ1A 3I9OA 4WSOA 3U3MA 2G1AA 1QGUA 1DJOA 3QA9A 4LMRA 1A4IA 2BRUA 4X9XA 4ZDKA 4YS6A 4GM1A 1GNVA 4UZSA 2PPLA 1WR8A 4Z9XA 4IBOA 1VRCA 1JVNA 2UVQA 1WTAA 2PZAA 3QWBA 3B51X 4J0JA 1E1CB 2CNDA 1EKXA 2MMGA 1IIBA 2ZG6A 5DVZA 3R44A 1UDCA 1UT5A 4TQ9A 1V8DA 4ZPJA 4IP0A 2ZIEA 1BD3A 3MF4A 4YCLA 4M0FA 4TWAA 2QOEA 1PJSA 4I50A 1Z6QA 3ESYA 3QKSB 4HN9A 1XMJA 4COKA 1TUGA 3N2KB 3DE4X 1W8DA 1K5HA 3RASA 1AKRA 3SNKA 1J9ZA 3DDSA 3GK3A 5JY1A 2PKQP 2XODA 3PCTA 4IY1A 4PG5A 1IN1A 1QJCA 1NYQA 1LPOA 3KFVA 3LS2A 4RNCA 3WGOA 3ZE1B 3C87A 4R0NA 1OB2A 5DOZA 2Q7DA 1F1JA 5FXMA 4U7WA 2ZE8A 3A6LA 4HTFB 4YJHB 3WLIA 1H85A 1U1DA 1FTNA 5D6OA 1A2KC 1FW6A 1RFGE 3DUFB 5FPSA 4HAVA 2IE8A 3MPUA 4BKUA 5LNK6 1CJCA 2YOFA 1AZTA 2Z08A 2B92A 1LV7A 3IHTA 2IE0A 5EE3A 4AX8A 3N8KA 1K9SA 1LRKA 3A1EA 4BLOA 1OXVA 5EUMA 5HUJA 1N5DA 1Q3KA 3U16A 3MLAA 1WAMA 2QJWA 3K6KA 4LQDA 1PT5A 4WAUA 1L7DA 4YP0A 4N3GA 3SBOA 4U9IS 1VKHA 3FPHA 1NJ1A 3VFDA 1IZ7A 1B43A 4IIXA 3RFTA 3RQIA 4F6RB 4EA6A 3LP6A 3R9KA 4P7GA 3ICQB 3IMEA 1GQQA 3OETA 4GOMD 5BWLA 3LUBA 3PB3A 4G0VA 4WKBA 1T4CB 4RWZA 1PDOA 3STYA 1ZUIA 2JCBA 1A76A 5FQOA 2I8AA 2IZ0A 3GPLA 1DAKA 3MYRA 3RSZA 4AWXA 1XRPA 1OLXA 2GERA 2J31A 1D2RA 4KJZA 4W5QA 4RDHA 4CBVA 5LQRA 3ITDA 3BGOS 4GKKB 2ODTX 1CUHA 2VJYA 4WBNB 1U2EA 4WLFA 1SBZA 5AWFC 1F2UB 3KOYA 4ENQA 4NCJA 2CN1A 5DM4A 5JMPA 3QEMA 4BATA 3OZIA 1C9DB 4HH1A 1Q74A 3HXOA 4LBVA 4EJ0A 4OHCA 4PG7A 2GBIA 4BFCA 1HRDA 1P60A 2N0SA 2Q1TA 3JWIA 3KD2A 1ZISA 5TXGA 1WBJB 2VA8A 3L5KA 4J03A 5BW6B 4GWKA 5FP0A 5JCZA 1Y37A 1I2MA 1XMSA 1Y7TA 4K9DA 2AS0A 3NNNA 2O07A 3H2KA 4FXOA 4K81B 4YECA 5EQDA 1R9MA 1EGQA 3SS7X 4C7BA 4GZ5A 1NR7A 5ICEA 2PWZA 1IVNA 1L5ZA 2CF6A 3L1KA 3A06A 3AYZB 1Z7GA 2I4RA 2NSYA 1SHKA 4WKCA 1DZ3A 2QYHA 5AH0A 2AQKA 3FETA 3SU8A 4A36A 2H3HA 3AMVA 1L4YA 2CVQA 3CF2A 3KWMA 7MDHA 3N5CA 1YVPA 2JFVA 4NBTA 4TTJA 2H1OA 3JQ7B 4R9SA 4BX2A 5AVXA 1GHTA 3O6VA 1USVA 4S2UA 2IUSA 4GFDA 1VSTA 4PZEA 5ITZA 4N5LA 2NLOA 5EJ4A 1T6ZA 4WFJA 2VTEA 2IS4A 3FAZA 2AFHB 2NU9A 3UG6A 3EVBA 2X8WA 3K1YA 4MR9B 4U2FA 4P7JA 4GC9A 3F1KA 1JYFA 4AB1A 1EDEA 3K0BA 1RZRD 1F8UA 3M5DA 2FSUA 2VUSA 2CLOB 4E7OA 1RPTA 2L42A 2VSNA 5DHQA 3EVNA 3ITEA 3C5EA 2Q49A 1EJBA 4ZVVA 3EFOB 4E70A 4CG1A 2MINB 4EHDA 2W6OA 1NQVA 3UW1A 1FQOA 1KU6A 1YRWA 2ACWA 3LJKA 1WKCA 4I1IA 4UNIA 4Z0TA 5FBRB 5AK5A 4BUZA 2ZUTA 3O21A 1IM5A 4FILA 3WGHA 3ZDDA 2V96A 4INJA 3IQHX 4R4JA 3CLTC 4RFVA 3UUGA 1DC3A 1NVUQ 3ZXIA 1U2PA 3U4HA 5K8IA 3OZTA 3TLYA 1X7HA 3V46A 3CWCA 1YE8A 4OGWA 4RK0A 4BBZA 2XWSA 2RK6A 4ZMRA 2AK3A 4FZVA 1NQAO 3H5VA 1NBOA 1WMDA 2L82A 3DR3A 1I9CA 4YUWA 3QBTA 1ZK3A 5TGZA 1HL7A 3LLCA 4DZRA 1T6NA 1R3UA 5HX7A 5JQGB 1OGYA 3H0EA 1WUHS 3OLQA 4WIAA 3G8DA 1RMTA 1UOQA 2YUTA 1KU0A 3I73A 3R3WA 5ESXA 1YQWA 4IKOA 2QAIA 2FAXA 4LS3A 2ZUBA 1E8NA 3S1AB 2YN2A 1OLSA 2P4HX 4Z4QA 2NG1A 2FCRA 3AUTA 2OGZA 3SYKA 1Z2EA 3B20A 2MSWA 3MLBA 1E5XA 3H42B 4QU9A 2GEUA 5GM1A 4MQEA 4EUEA 1E60A 5TVGA 2PY6A 1NBMD 3QSYA 4ZQEA 1GQOA 2YW9A 3KXLA 4P0TA 3R2JA 5F51A 1KQ3A 3Q5EA 5KKNB 2ZYGA 5TQ0A 1EK6A 3IVGA 2J48A 2QWXA 2FR8A 3N8IA 3VU3A 5AKYA 1EAYA 2WVHA 3E27A 4FFRA 1M8FA 1V5WA 4DWOA 4U2CA 2NMVA 3KVYA 3O84A 2Z2ZA 4UDOA 1PUJA 2XQVA 2QU8A 2SHKA 3PI6A 2RI6A 3NVAA 2PXHA 5GONF 2IW1A 4M1KA 1ZDMA 4OMFG 1UBTS 3EMDA 5EJFA 1MQ9A 2J3KA 4OCZA 5CLQA 3ZTTA 4URVR 4KPUB 3UT0A 4BBAA 3VOTA 1IVSA 4RIEA 2E4ZA 4ARSA 1SVLA 4UNPA 1JMKC 5AHRA 1DEAA 5ALTA 3U17A 2Y76A 3HI4A 3OJEA 5IF9A 2A9KA 1YSCA 4F45A 4F92B 1GZ7A 5CT9A 3BIFA 3FMVA 3GFBA 1PL0A 2CK3A 2G7ZA 4Y2VA 3TLAA 4NZZA 4C3ZA 4CL0A 5K8JB 3EN0A 4FC6A 1BE0A 1HZJA 5CPFA 3OWXA 2VDJA 1GR0A 5AVSA 2GJAA 3L8DA 3FLBA 2QAGB 5BSUA 4WXPA 4YDQA 1OXSC 3CEJA 3IVXA 4I5DA 2OOSA 3ESCA 1Q7BA 3GZNB 4RK5A 1UXOA 1YO6A 1UZNA 4FLEA 3I1YA 2VJNA 4KDRA 2C3PA 1TU3A 2O3QA 3Q3IA 3TXYA 3V55A 3BH0A 2FOXA 1BXGA 2GB4A 4OP2A 4PY2A 4IVQA 3SQOA 3FNIA 5BN5A 3IJEB 3KJZA 4GX1A 5EJ5A 1MHTA 3G2MA 4AS1A 5CLJA 2WF8A 3O90A 1QKJA 2WA2A 1FSGA 3I2IA 5DW0A 5AK6A 4A27A 5B3LA 5L53A 1IHPA 2FPKA 1V9SA 3B5JA 4F91B 4W5RA 2BGRA 2CB9A 2OECA 1DBRA 2NUTB 4CM9D 5BNZA 1KY5A 4H0FA 4FUTA 2WI8A 3PEFA 2OKCA 4CQMD 4WCFB 4K26A 5E6SB 2BUAA 4YMTA 5E3HA 4DYDA 1EWKA 3GT3A 4JJGA 2NVOA 2ERCA 2V7UA 3L40A 3WIVA 3BAFA 5AUNB 1C8KA 3N0WA 3UHOA 3P9YA 1SMKA 1C8LA 2O3JA 2JIDA 3B7WA 3HDGA 4FR0A 3AHFA 4ALMA 4B3CA 3NHUA 1Z2PX 2QN3A 3EODA 3KQWA 3UPDA 1AF7A 3PPXA 4AX4A 1WB4A 3DLCA 4R1UA 3O8BA 4IWXA 4QICA 1IU9A 3LQQA 5HCNA 5GVRA 4D4MA 3PXBA 1ZGHA 4JLJA 1WNTA 1EZ4A 2FZGA 3PC2A 4FW8A 1X8KA 4G4GA 4HEQA 5EPEA 4MS1A 3U61B 1ZHHA 2D00A 3K9BA 1RYNA 3M70A 2YWHA 4FBMA 5B6JA 1ESNA 3F2VA 3GN1A 4Y2HA 5IBRA 1S5PA 3IVRA 5K20A 2PIAA 4PG8A 2NV2B 1G0OA 1C29B 4QYXA 3BERA 5ILQA 1U8AA 1ZY2A 2OB2A 2O2JA 3WJ1A 1EUYA 2YJ6A 2B4TO 4G65A 4HTFA 3KEGA 5GWXA 3G5LA 4RTPA 4DA4A 3C5WP 4YT4A 1YQUA 3W78A 2WSYB 1NQXA 2AMVA 2DVMA 4RLQA 1Q17A 5AVUA 1PNTA 3HKCA 3TB4A 3CJRA 4EX6A 3EARA 2FEMA 3HYNA 3N0TA 3P2IA 4JJZA 3V8NA 4ESOA 3C1UA 3NWPA 3ZDXB 2H1HA 5IG2A 3EYWA 1VIDA 2R7KA 5EIHA 4OD0A 4ALIA 4JKIA 4FT2A 2IPAB 2XTZA 3PSHA 3UCFA 1ISMA 5JSQA 3U5ZB 1TJNA 3HMQA 3T1YB 3BEDA 3LT0A 3LYUA 3CZRA 1M2VB 2PZMA 2BOVA 5E7IA 4ZAWA 1DXOA 1CE8A 3I76A 4JMLA 4I5GA 4OQMA 4W9RA 4TMTA 5L7YA 4P81A 2V7EA 3MHTA 1Z83A 1TIKA 4CLHA 1NONA 2I2WA 3L7NA 2ZATA 5LYJB 1T9CA 3A1VA 4QWMA 1CQIA 2GF0A 2I2AA 4M55A 4F6LA 5ALZA 5F7OA 2WYIA 1PWXA 2DBZA 3G7UA 3D7NA 3F7NA 2R00C 1JAXA 3SJZA 4BGIA 2R65A 5IVKA 1BXRB 1A7AA 3W34A 2CFIA 2FP3A 1MEEA 2BFEB 4RVHA 4R54A 3WGTA 5JNRA 4NYJQ 1X80B 1S96A 1QQ6A 2ODAA 2X8BA 1K6XA 4YJ3F 4B8ZA 2DTXA 5SICE 3WLQA 5CXUA 2I3ZA 4G85A 1GVNB 1F60A 1AMNA 2D5AA 3WQQA 1T5HX 3KU1A 4MW5A 1RJ9B 3DWIA 4PBRA 1AIPA 3STWA 3E1KA 4MAMA 4BMVA 1OFTA 4G25A 2XVAA 2NZWA 3NIFB 3PE3A 1OROA 1F51E 2ZYRA 4W9NA 5KYGA 2NM0A 2WQ6A 3MAJA 2JBWA 2NYAA 4H35A 4GYJA 4P4UA 4B3XA 4FKMA 2AZXA 3GAAA 3HRHA 1VHTA 2O6LA 1WVGA 3WR5A 1QF7A 3CXRA 4JSRA 4DXAA 1HEUA 2BTQA 2WP0A 2HXYA 3GXOA 4P1ZA 2RK4A 5JSZB 3PJRA 3FH0A 3IULA 3HXKA 4CUKA 2NU6A 3KZXA 4UEWA 3D43A 5LYJF 4BFSA 4X65B 1AB6A 3DNPA 5B36A 4ZEOA 3D6HA 3R9XB 3LLMA 4D4IA 1JG1A 3DE0X 4ERXA 1XTVA 2VTKA 2P2YA 3I9NA 2QMQA 2B8JA 2ONYA 5IT4A 4AKHA 3H2IA 4R0VA 4N5IX 2P69A 1NQWA 1VLZA 1XD2B 2PUJA 2VQDA 2X8AA 3TOZA 4B3GA 5C4GB 2FWMX 1WDKA 3K6JA 2NUTA 2HLDD 1YUMA 2Q1UA 5A1TA 2FPIB 5IAKA 1GPUA 2NIPA 3W8EA 1JDPA 1U7DA 2V4MA 2VK8A 6ADHA 2HGZA 4ZKDA 1Q1GA 2O8VA 2VSXA 1II0A 1XE3A 1XRJA 3TWOA 1BW9A 2YXLA 1XFAA 2P30A 1LCIA 1YHNA 5A6SB 2QVGA 5A2QA 4KFTA 3H9EO 3HUTA 4L5AA 3LH5A 2DHDA 4M1EA 1HETA 2ECKA 2ZRKA 3H18A 3F5DA 2ZRNA 3G3EA 4HNAB 2XADA 5LWHA 3OLYA 3R20A 3HCEA 5MF6A 5MN4A 3FSGD 3PCRB 3WZLA 4AY2A 5D7BA 1DCFA 1TVCA 1GG5A 1NRXA 2UYYA 3MCVA 3RVOA 3S2GA 1Z8NA 3O8LA 5C2JB 2XCTB 1G7SA 1PRYA 3HCCA 1JJFA 4HEA1 4EAQA 5C7YA 5H9WA 9ATCA 2PH3A 3DFFA 1YC5A 2F1OA 2R8YA 5L9AA 1KMHA 5ELLA 4MOWA 2DTDA 1FXUA 5HILA 4BEWA 3NGLA 4AKIA 4NH4A 5IS2A 2VCHA 4KQMA 2DKFA 3DW1X 3BJIC 2AT1A 4V03A 2VATA 3CF4A 3JYHA 3AESB 4TL7A 1DKLA 2VAWA 5AK0A 4TS9A 4KPUA 1G2IA 2P35A 3JYNA 1Z4MA 4L57A 3PFIA 2ZM5A 3FXAA 4II3A 1ZUNB 4PG4A 2XXJA 2J33A 4E5UA 3DMHA 5AKZA 1U0LA 3LDGA 3C2QA 4LGVA 3GIWA 4B6JA 3DDHA 1WMFA 4FHZA 4G4IA 1CY6A 4UKDA 5IH7A 3GVIA 1WCIB 4HYQA 2XE4A 2OCDA 2QXYA 2YZ2A 4JJEA 3VZDA 2FDXA 1CZHA 1JZTA 3H2BA 1W4LA 2R4TA 2VH1A 2V0GA 3JQAB 2PYDA 1YZKA 3EIOA 2HDWA 3IEUA 4HZGA 4NDZA 2GM4A 1O5IA 1YL6A 2XR1A 2A5JA 3DEKA 1JHYA 3LPAA 1EFVB 5DN6A 3GT7A 5ALJA 3KT8A 5L3RA 3S40A 5IM4A 4LXQA 3MCZA 1G5PA 5CFQA 3K9CA 1NLZA 4UHKA 3V8RA 4F9FA 1WUKS 2X0JA 3AX6A 3W6OA 4BO3A 4EVSA 3DMRA 1SD5A 3FMPB 3IBSA 1HDEA 4HX5A 5A02A 2PXAA 3TSCA 2X41A 1KYZA 2FX2A 1KVTA 3EE6A 3ILVA 1VKNA 5HGXA 1P91A 1EDZA 2RAFA 2HA3A 4OG2A 1MQ8B 1AA9A 1FIUA 2GRAA 3OO1A 3I6MA 1KETA 3BKWA 2L0XA 3A26A 3SR4A 1IAQA 2ZETA 4IDNA 4L0QA 1HORA 1P2GA 4M76B 2C5EA 2NXEA 3O93A 3R3UA 3RFXA 1J06A 1JR3E 3LX5A 1Z15A 2PEZA 3MTGA 2FEXA 2LW7A 4P3NA 3HJHA 2X5OA 4KGDA 1DAPA 4DT1A 2NAFA 2A3RA 5I7SA 1FY2A 1BCRB 4OXQA 3O82A 3TPZA 4EUNA 1CX9B 4H0CA 1XCBA 4I9HA 4ZQGA 5EOVA 3KQLA 1W88A 2ATXA 2H2FA 3Q7TA 4I1UA 4D56A 5LLTA 1TMGE 1WDTA 2K5UA 1S2DA 4DRZA 2YWCA 4RTSA 3OCWA 1T0HB 3ABSB 1ENZA 4NC9A 5G3YA 7ABPA 4QXOA 3O2JA 1YHZA 2WMDA 1P4AA 4O4LF 3AG5A 4DLVA 4QULA 2J8ZA 1TIPA 4Y30A 1ECPA 1HMPA 4MO9A 1G5FA 4D9NA 3N75A 4BLRA 3PLNA 4B5KA 4X54A 3ADOA 4G4SO 2QTHA 3IUNA 4F21A 4Q4JB 4LPSA 3I28A 3P94A 3VO1A 1ZMBA 4QLOA 3O3OB 4A0GA 4TMWA 1RAEA 2RE8A 3CPEA 3MXTA 3MD9A 2IS6A 5EJMA 1PJAA 3IR7A 1L3IA 2HU2A 4JL8A 3KJFA 4AZTA 5JQGF 3IP3A 3CCCA 4HX9A 3S68A 4CR7A 4EFKA 2Z2YA 5J1SB 1JVBA 3MS4A 3RBAA 2H29A 3MRXA 4M60A 3ZHTA 2N75A 2X8JB 3FMOB 1VL2A 3R0IA 3SDZA 4MV9A 1JLKA 4K03A 2EX4A 2JFZA 5B1IA 2BMVA 4QJ3A 3LZDA 4QRDA 3IKJA 4NBNA 3UA4A 8LDHA 1QIEA 1Z5UA 5BV0A 4U00A 4WXHA 1KWGA 1M1ZA 3QWAA 4NYMQ 4NDAA 4DMCA 5BP7A 3EX7C 3SSNA 2UZ1A 1XZHA 3PL5A 2JGRA 5CX1B 2Y92A 5B5SA 1PO7A 2P0AA 1NDQA 4CZ2A 1V41E 1CNFA 2TSYB 4GRIA 4KGXA 4UCQA 4URFA 3G82C 2CL6X 3C1AA 2WK1A 3FNRA 1A5ZA 1E0DA 1FOEB 2GETA 5FLYA 3WDMA 4AI6A 2G77B 3Q4GA 3ND9A 2X5XA 3H9CA 2XMZA 1SBQA 2QY6A 3JQRA 3L07A 4LCEA 4N54A 3URMA 5HQ3B 4QJBA 4N8DA 5KBYA 2R8EA 3P9SA 3KHKA 4LK2A 3N86A 3W4KA 3KSBC 2QTAA 3KWFA 4JX8A 3KCQA 1GDDA 3F78A 1Y4ZA 3DM9B 3Q10A 3EEFA 3OZSA 1SC6A 3IQXA 3B5IA 4P7BA 3B36A 3HYCA 2GDJA 3L0BA 4UREA 3EEIA 3ZZUA 1H23A 1X8JA 2ZIFA 5EJEA 1SCJA 3SKVA 5K8LA 1H0RA 4AMBA 3O4GA 5LSAA 1AUVA 1A2QA 3DVRX 5KYUB 2RG7A 3QLUA 4OHFA 5EPUA 2WYHA 4UFPA 4I4IA 5TS2A 2XBMA 1ULUA 4KIGA 2JCGA 4L08A 1RXCA 5EXDA 5EGSA 2LDXA 3PR3A 4G1CA 5CDSA 2JJ8A 4MIKA 4DMFA 3IESA 1G9XA 4X6LA 2ZUSA 3FDXA 4HOYA 4TSFD 4B7CA 5CVTA 3RS3A 1GCOA 3KDPA 1JNXX 4PRYA 5DXAA 1M0TA 3BCRA 5CA1A 2AJ8A 5KOHB 1TCBA 2V7TA 4Y0AA 3V42A 5EJ8A 1V2GA 5AXBA 1Y8ZA 4JUDX 3FFXA 1WPQA 2PUWA 4K46A 2OAEA 2WJ6A 4OGGA 2NPOA 3JWPA 2ZXFA 3MCAA 4OGFA 4QLBA 3SEFA 4RJIA 3F49S 5EXXA 3KQTA 3WMRA 3IAAA 4L1KA 3KUKA 4Z4HA 4Q03A 4DNPA 3OJCA 1NXWA 3FPCA 4FE7A 1B74A 1MENA 3K15A 3K8OE 3LECA 1ZXXA 4R9NA 4ZA2A 3HP4A 3LYLA 5CB4B 8GPBA 2XE7A 3QYPA 4AXXA 1ONNA 5IW8A 2FF7A 3EXG1 3RBXA 5JCOC 1AH2A 2P4SA 2BMAA 3OM1A 2JRCA 4EGQA 3QVXA 3LHDA 3NUQA 4L4XA 2H0AA 5EIWA 3EQ9A 2CFOA 2JCXA 2F1HA 1A9PA 3DEAA 4GKVA 4TXHA 4NBSA 2B69A 4L3OA 4LRUA 5CCXA 2I6FA 1KAGA 4X71A 2Z58A 1TYEB 3QOWA 4R98A 4E6PA 4Z7JA 5L4LA 4D0LB 4D3DA 2O8EB 3P9KA 3BE8A 3RVKA 3MIIA 2PCJA 4J6EA 4EX7A 4X1KA 3KAJA 4ZXPA 3R7DA 3Q8KA 1ZQ9A 2IYOA 4RIIA 1OSNA 2OCLA 4IFEA 1QNFA 2NYRA 3PDHA 4G0WA 2Z4SA 3KAKA 5ALVA 2ZWVA 3UAVA 4EW2A 1OAAA 4FHFA 1CG6A 3ZZ0A 1YFLA 1F2VA 3S1LA 3A28A 4KO4S 2XXAA 2YR0A 1I4TD 4LOIA 4NK4A 3I61A 3OLWA 3B3GA 1A2BA 1NJSA 4GZ3A 1KDOA 3RV3A 5FUQA 1P0FA 1B0UA 2V0CA 2OR3A 4EYSA 3IIMA 4MLDA 4YWJA 4F4IA 1UK6A 1TPYA 1Z8FA 1XVAA 4UDYX 4WZBB 2CXNA 1XRNA 3FOAA 4BNTA 2PUTA 4ZT3A 3QHAA 3K7EA 3JYOA 1EQ2A 2ENWA 5DYWA 5KYXA 4ZEVA 3O74A 4FDLA 4S1NA 1TT5B 1F6WA 2QGFA 1A9RA 2JAPA 3G2PA 4KWEA 4L0DA 5EIAA 3D2AA 3HZRA 1DNPA 3D4BA 4L5YA 5M5BA 3WADA 4YJGA 3PUKA 1P7YA 5B4TA 5JAHA 2HB6A 1CY0A 4BWFB 1E5DA 4IJ6A 2C9MA 4Q48A 1DWUA 3ED1A 3QKTA 4CGYA 4PZDA 2Q4DA 3OA0A 4D8WA 1QCYA 2AXEA 2D2IA 2DQYA 3DKKA 3MGBA 3BHMA 1Z0JA 1PSWA 3WRXC 4RKQA 2FEWB 2DH6A 3ZDEA 3G6WA 4OQFA 2HPZA 3GLGE 3E9RA 1NYRA 4FFLA 4I66A 5IN4A 4TKUA 4R41A 3BMNA 3RQSA 1U6KA 1A8PA 1NMZA 1VB3A 2QM3A 1YB4A 4KYIB 5EZYF 4E7PA 1W36C 4FB5A 1ZGGA 3PJGA 1ZNXA 3AI1A 4CMKA 2NZJA 1YZGA 2QR5A 4NG4A 5HKLA 3R23A 3EJ6A 3PT5A 5BNWA 3CNHA 1JFSA 2VJCA 1J4AA 3AVPA 5IEJA 1RI2A 3EVCA 3JW8A 4B2YA 2REQB 5G41A 4CETA 1Z68A 3WJ7A 2I9PA 4JT4A 1ZNZA 4QYWA 2Q6VA 1ZK2A 3AHIA 5I9LA 1XU9A 1VYUA 4NCNA 3E5NA 2IUTA 4LXYA 3KZKA 1QH8A 1XC7A 2ZE6A 3ZJ5A 3GG9A 4B6QA 4KBYA 4ENVA 3QITA 2FK7A 2AZDA 2HH9A 5IDQA 2WUEA 1A0OA 3BCUA 3LXXA 1GPKA 4HQ0A 2R1VA 4K6OA 4J6FA 2VDKB 3ORRA 3ROGA 3QXGA 3PENA 3LD9A 1XT6A 4RF3A 3MWGA 4X63A 4TGLA 2JFNA 2YS6A 3HCFA 4BEBA 1SHZA 3DBRB 4LX0A 1RRMA 3DVAA 2J32A 4OEHA 2GPBA 4A9AA 4QFBA 1RRCA 4C4ZA 4DR6B 3GGCA 3EDRA 4PO1A 5ELMA 1XPUA 3OE4A 2HMTA 4NVRA 1LK0A 4LNUA 2B99A 1C8VB 2JGAA 1JLLA 2QGZA 1QIFA 3LW7A 4FNAA 3RUHA 3VZRA 3WIEA 3BK2A 4G5OA 5JCJD 1LBTA 4OQPA 3KEQA 3DOIA 1K89A 1T2EA 4YRPA 3I9LA 1MRZA 1I4DD 4UC0A 1KAMA 3OH8A 3RHSA 4H31A 5TNXA 2HWXA 4UW9A 5EMLA 1E7WA 1OYYA 1DKPA 1MABB 1JDNA 2Z3ZA 3BMNB 4OFZA 4UUAA 1JT2A 3UWKA 3SOPA 5HZHA 1G7CA 4KN6A 1GKKA 5TF4A 1TK2A 2XTAA 5IM4F 1CVLA 4AJOA 4EY5A 1K6IA 3AXTA 5CNIA 5B4UA 3WFJA 1CUCA 3NNDA 2HEIA 4ARIA 4F0JA 3ZWYA 4A8TA 3LPCA 3QVLA 5EINA 3O8NA 3W06A 4DQ0A 5F23A 4KMOA 1BHSA 1Z18A 2IXDA 4TS4A 3WSVA 1P4HA 2QLMA 1TO6A 4L3WA 3IUQA 5EFOA 5F1PA 5HZMA 2JLVA 3AHGA 2HN9A 4M1MA 5IN5A 2B1RA 3QUCA 2OZKA 1LS6A 4H59A 2XXAB 2IVFA 3O9ZA 4PS1A 2YN4A 2MSCB 2QX7A 4DA6A 3CLSC 5C37A 2WU4A 1NSYA 2FPOA 2J45A 1F0YA 3LX4A 3AEUB 3ICWA 4JJAA 1QO7A 1QS0A 3GUYA 3NOOA 4Q34A 5CXSA 4ESEA 2FRDA 1BSVA 3TQCA 5BR4A 2H0QA 2XB8A 5KDOA 1RJFA 2LKCA 3LZ6A 4MQEB 1NVVR 1V3TA 4EUFA 4YUXA 5ALHA 2CYAA 2NW6A 5DBFA 4MUBA 1XHLA 3TRKA 4TKZA 2H48A 4JLBA 3ZE7A 2I33A 1G98A 1NGSA 2H3EA 3PGVA 4YMUA 2IU6A 2GM5A 2QPTA 3IKVA 4UDNA 2QA5A 3BCSA 2ZJ4A 3H7IA 2QW1A 3O4IA 4YRNA 4OJMX 2Y1CA 3IBGA 4OJKA 1OXKB 1FDUA 1P4JA 3OF3A 4UD2A 4YJKA 3DEYX 2EZ9A 3O2SB 4RE6A 3WSTA 4OX9B 3NNSA 4JDUA 5EFZA 4BTVA 1A77A 1X42A 4JY7A 3RSHA 3T4PA 3K16A 1WHSA 1R3DA 4R9RA 5E1BA 4F86A 3VYTB 4NEQA 1SVWA 3AZQA 1P5JA 4YV2A 3B9BA 4MKZA 5GP1A 1TX4B 3N2KA 4FYVA 1XZ8A 4B2PA 4Y0VA 1P1FA 4YR7A 1VA4A 1YB7A 5CMLA 5EI5A 2AEFA 3CQ9A 3ZW9A 4A8JC 4X7BA 3KJIA 4DEXA 4EVIA 2ANBA 4MVJI 5D6NA 2HZBA 3ROMA 4RGYA 2UYQA 3ZZMA 4X7PA 3TTXA 2W37A 1EFRA 1VOTA 5E3JA 4F56A 1JWAB 1OVGA 1Q2UA 4MW7A 4AC9A 2WG0A 5ALXA 4KE7A 4K5QA 3M6FA 3E7FA 3E9NA 4JI6B 4DQXA 5L40A 4BX9A 3E6AA 4F11A 2GJSA 2RKBA 3PI7A 2AQIA 1V1JA 2BV3A 1O58A 5K01A 3K3PA 4RHEA 3L8GA 2DUNA 2WTNA 5K05A 4Q3LA 1QYIA 2AEMA 5A6VA 4LRYA 2AKEA 2XSZA 4J3JA 3UF0A 2O8FA 9ABPA 4RS3A 5IH3A 3L7MA 5HRUA 1JEEA 2O0KA 4BZWA 3B8EA 2JJ1D 2OZEA 3U2QA 2R7AA 4DN6A 1DGQA 2HT1A 1EWQA 1YC2A 1TW3A 2R1ZA 4PLWA 3RTDA 4E5KA 4N7RA 2XUFA 3HL0A 3O92A 1SQSA 1KRXA 3KALA 4LSWA 4ZANA 1DFIA 1CUYA 2YZMA 3OC6A 3P1JA 4WNAA 5KYWB 1VBKA 2QM7A 1MJ5A 4Y18A 2B94A 2JAXA 4DIMA 1T4CA 5LP6F 4YMLA 2C9BA 1JILA 3SHFA 1KDRA 3LKVA 3KT3A 3I0ZA 2J5QA 3FRJA 4UVEA 5DULA 3DBIA 3T9CA 4K7JA 2ZANA 3B2NA 1HKUA 3EG5A 1Y8QB 2XUGA 2C9DA 4L5JA 5C1IA 5DWQA 2ZJFA 2K6GA 3DMGA 2IUYA 4FINA 3X1XA 3SF8B 3IKLA 4BMYA 4HNVA 2DM6A 2YNMC 3ETLA 3X1YA 5JUWA 4PLHA 4I36A 3DDUA 5D1NA 1T3LA 2VNKA 2OBBA 4GZLA 2F3RA 1JAIA 4TXLA 4C2TA 4MI6A 3QG5A 2EJCA 3WMWA 5CLIA 5JH7B 2VHXA 3JQAD 4QEDA 1IQUA 1LBHA 2OG2A 4XPIB 4D4KA 1XEAA 1SKYE 1I3KA 3V8BA 3ZD9A 4FIZA 2ISSD 5D3MB 3U7JA 1IHXA 4ZOAA 3EGWA 4M9RA 5T64A 3HVIA 1TQHA 5LJLA 4CMEC 4ID3A 5ALWA 1O0SA 1JG3A 4HMPA 3AFNA 4CKWA 5J5AA 4PW0A 1VSUA 2HDOA 4DV7B 2B30A 1UJ4A 4DLXA 3NPMA 4GRDA 4ZVMA 4RTLA 4V02A 1F17A 5A0VA 2C31A 1NW7A 3DD5A 3CRMA 3HACA 2HCTA 3IH5A 8ATCA 3BEOA 1RW4A 4J16C 3I8SA 1C3JA 5BVGB 4JI0B 4J0KA 1DUIA 4ISCA 2NZXA 4MZDA 2VWPA 1AGRA 4NI5A 2O8DB 2VUIB 3VSBA 4GIBA 2FDRA 1CUFA 3DOEA 5KJEA 3W6NA 1E9DA 3ZHOA 1VJTA 4CU5A 1GRRA 1TZJA 2D0PB 4GDFA 2XDQA 4Z9AA 4R8MA 1F4LA 2BZ0A 3PXAA 3RTEA 5LYJA 1PTKA 2YFKA 2BAGA 2O57A 1UAGA 2C98A 1EWYA 1CW2B 1Z7YA 2Q3EA 2D4HA 3KHTA 3KZNA 4LHVA 3VDRA 2JL1A 2Q8PA 4YBZA 3M6WA 3WLNA 3PX7A 3HB7A 2BHNA 3FVWA 2EC5A 1ISJA 4GX2A 821PA 3HZHA 5DXFA 1Z4LA 2RKOA 5I4BA 4GE0A 4JWTA 4TKUB 2E5FA 3HFRA 4LXXA 3MJVA 4QOGA 2LTAA 4RZHA 5IXJA 4EG3A 3FMIA 1FUEA 3ELWA 3ND5A 4MZXA 4NJMA 1UP6A 3D6TB 4ILKA 1J09A 2WG1A 1U0OC 2ZIZA 5K4GA 4XQ9A 5ITSA 1Z2AA 3L1HA 5ED0A 4D57A 2QMZA 3ZGNA 3TTSA 1J0AA 2FPLA 2ZSKA 1M1YE 1TPZA 4MRMA 1N4AA 3WL6A 1XZJA 4U6SA 1OZ0A 2GA8A 4H1TA 4NU0A 5K6RA 1Y9JA 1RI1A 1UADA 5JWHA 4ND3A 2PA3A 3N07A 2VA9A 4LV8B 4OY3A 5EXTA 5K0ZA 1I2CA 4WMLA 1WD7A 3DTYA 2FK8A 4PLVA 5DLDA 4BC1A 3N8HA 2HHAA 3NHFA 3TJZA 2RBKA 4NULA 1QLWA 1P39A 2G5PA 2UU9B 3WO1A 4IQ0A 3LQ4A 1Y4DE 3THYB 4QQRA 1M1XB 3OFNA 2O50A 1BDIA 1W9MA 2F48A 2RH8A 4NLLA 3EDOA 4XX0A 3QMWA 3WRXA 4EPVA 1C1HA 4F2HA 1YR2A 4F7WA 5JS6A 1TEXA 4G0PA 2GNPA 4M89A 3BUSA 1P31A 4FDTA 6NULA 5DM70 2B1IA 4DLZA 5EWMB 1N5RA 4RACA 2JHFA 4FJ2A 1PR2A 3UWDA 1BJTA 2CLDX 3ENZA 3E35A 4Q39A 1GCAA 1MH1A 2XKBA 5IHXA 4B3SB 1E66A 3MPOA 4NMHA 2OHFA 1E64A 3PDWA 3Q7QA 4K3UA 5D1HA 4C3UA 4DS3A 3L4BA 1G63A 1Z35A 3BL6A 2W42A 2P7HA 4YYZA 3C4VA 2Y99A 3MJEA 1NUHA 1DRUA 3Q0IA 4MV4A 4KQHA 4DV0B 4JP3A 4QTTB 2CVZA 5LD2B 1W29A 4N47A 3VO9A 3RRYA 1FBTA 2FMUA 1EM8A 1FJHA 1QBKC 2ZRBA 4BQPA 3HKDB 1Z4OA 2IYSA 2HY7A 4TRNA 4BMZA 4O4HF 3ONFA 1H4SA 3D6VA 4JFRA 5FL7D 2IBMA 3ONWA 4WESA 2JFPA 2IUEA 4H17A 4B3MB 2G71A 3TR5A 1T9BA 2JAQA 3TTVA 3KOWA 5IC6A 1YD7A 4KYTA 5F7JA 1CS4C 5C46F 3NVKI 5KC9A 4ZVLA 1VJRA 5HIJA 3I1FA 3GYBA 3KQYA 3KEOA 4FGJA 1NATA 1WY7A 2YDYA 3ETHA 1E3MA 4LQLA 3N74A 3VH3A 1E2PA 1V4NA 2CUNA 1LDGA 2XUDA 3H5LA 1V25A 4Y2JA 2NYUA 5DRTA 3M1YA 4DMHA 3EMVA 1LNQA 1ZMXA 1E3JA 1CJKC 2H9IA 4Q7EA 4RYLA 3NOVA 4C7MA 3DO5A 4XTCS 4OL9A 5EUBA 1CUZA 1HQDA 1YMUA 4YCBA 2Q5HA 3F7MA 3LY5A 5B1DA 3V4OA 1MIHA 4XDHA 2RGYA 1DKRA 3PWSA 4B1FA 1M73E 1NUTA 1Y5IA 1N1GA 3CJTA 3QXXA 1M67A 4GI5A 1I3OA 3AKDA 4NENA 1HQYE 3GLSA 3KS9A 2ZW9A 4HRAA 1JIQA 4JP8A 1KBOA 3HWRA 3R6GA 4G84A 2J5KA 4AF8A 1E3SA 2W43A 3LF1A 5ECWA 2IA5A 2Q3JA 4Z7OB 5LQKA 2FCAA 2G76A 3NBAA 2HFKA 1U2RA 5LQJA 2GAAA 2IHKA 3IJ5A 1J7KA 4AZ3B 1IXRC 2H17A 5KTOA 1DOAA 3ULKA 2I6UA 2R00A 5L3QB 3H87A 4PZYA 1PWEA 1OPRA 4HQLA 3NKFA 3G02A 3R40A 3WB2A 4QFDA 3FUXA 8MHTA 1TL7C 1RQLA 4O5AA 1AKVA 4I55F 4PYKA 4F4DA 4A0SA 4D45A 3MFQA 1HMYA 2WUVA 5GPBA 4MKHA 4DM4A 5KYWA 4FOOA 3LYHA 4RYDA 1IN4A 1B00A 3CU5A 5BN3B 3ADCA 2IP2A 2VJKA 2HKIA 5FWYA 1N0UA 2V4UA 3HSSA 4ND6A 1NW8A 3D6JA 4UD6A 3DV2A 4G37A 2WT8A 2HU8A 4GPIB 3ZBQA 6YASA 2Z95A 2ZKIA 2VF7A 4BLVA 4IGKA 1AG9A 4R1NA 4IXMA 1K98A 3DOHA 5CJJA 7YASA 1C9MA 4HAUA 4OIFA 1E69A 1UC5B 3AR3A 2XUIA 4RF5A 1Y9EA 4JYBA 3S99A 1LVUA 1Z74A 1D04A 5EMHA 1UIRA 3MT9A 4NOLA 4CKZA 4TWRA 2AD1A 2Q4EA 3BGVA 5E8RA 2FWNA 3QVJA 5BMVA 3DHNA 4OYRA 2JDID 1SUBA 4MR7A 1ECCA 5FBKA 1HYBA 1O95A 2HCFA 2VP4A 2R4UA 1JSLA 3OT1A 4FMDB 5E9AA 2JFWA 2X77A 2YXPX 2ZEJA 4IJUA 4LYYA 3R4CA 3ZGZA 2DFVA 5IAGA 2BUCA 4Q37A 4OA8A 4EEXA 4QBFA 1JIXA 3VR4D 2W2XA 1KHTA 3IT3A 3T9BA 1BC5A 1E3WB 4IZOA 4EPTA 3K5HA 1AXGA 4JLDA 4YAFA 3HQ4O 4RFSA 4MUFA 4AO6A 3PYLA 4L4SA 3TIVA 2JIBA 4LY3A 4Y9UA 3T5AA 4CDRA 2EGHA 3L5OA 4WTOA 5E8JA 2KYRA 3H5TA 3PJEA 1G5QA 2VH2A 4N7JA 1KSJA 4OJYA 1A5BB 3EH2A 4QOIA 3V7WA 2R1TB 4CF6A 4WN3A 1PK7A 4MV0A 1NXPA 4IR7A 2GJKA 3SJBA 2BFWA 3RSOA 4INZA 4DVGA 4C29A 3GJRA 1SWWA 1CWUA 1PFUA 4KQJA 4LZLA 1QZZA 1U7XA 5CNJA 2PZKA 1GLNA 2WHXA 6AT1A 4DW8A 2CDBA 2EFYA 3HB9A 1PCXA 5K4AA 5TQ0B 2AA3A 1N6LA 1R4NA 2I91A 2ZPTX 4X94A 1IZ9A 3L0SA 2IBSA 1RPJA 3BGSA 3GGOA 1UMBB 2FB9A 1CT9A 721PA 1WXIA 4CG2A 4WACA 2WPDA 3EW9A 1FSZA 4Q1VA 1KEEA 3JQFA 5J40A 4JQOA 3R7LA 1E2DA 3E8XA 1AHIA 1H4QA 1OAOA 2RAUA 2XMGA 2DTEA 2A5YB 1T43A 5C8YA 4ZRMA 4BQNA 5JAUA 1V16A 4IXTA 2GO7A 3VGJA 4KE6A 2WV9A 1PJ8A 3K1ZA 4JEIA 4KB5A 4WECA 3DVQX 3NBKA 3RRFA 3T5CA 2NN3C 5CVEA 5BUZA 4LRWA 4TQAA 1C0IA 2GPJA 1BE1A 5KX5A 1PEDA 2OM2A 3BIOA 1S2NA 3QTTA 3QXHA 2QTFA 3J7TA 5LQNA 5ENZA 2XDYA 4MXDA 1NAIA 2HIGA 4X1YA 1DTSA 3O5AA 5IJWA 1RABA 2V98A 1WSBA 3IEVA 4O4IA 1H2AS 2GBGA 2J0UA 4AIRA 5KINB 4JXZA 3W2GA 4DDKA 3KJQA 4W1RA 5CAEB 2AKYA 4HG2A 1E92A 4REQA 4C14A 1GZ5A 2VZEA 2C07A 3MWDA 2LBPA 1HV8A 1DU4A 3LL4A 4BVFA 1RNLA 5HCUA 2EERA 1NJFA 1SK9A 3ZD7A 2E0IA 4Y2RA 1JBQA 5L4NA 3JZDA 5B3KA 5HRAA 3FLMA 4E5MA 5I9MA 3ONDA 2VAMA 1U0GA 5DTEA 3AM3A 1FK8A 2VQEB 1GXSB 4G1UC 1U28A 3VBEA 3R8XA 4DXDA 2NQTA 4DLRA 1TAHA 4HVCA 4C5BA 1P19A 2VOEA 1Y5RA 3C8HA 4FSHA 4XW2A 3ZWWA 4JJ8A 3GJ6A 1OFVA 2COUA 3EZGA 2GFHA 2AQHA 2ZT7A 3ANXA 4LNUB 3OIVA 4MYSA 3UK0A 3MBKA 3VXKA 2DFTA 1CDZA 2P2LA 1FC0A 2IIBA 1RLMA 4H77A 4MI1A 4PAQA 1HLDA 2PGDA 3E8SA 2VSOA 3RRNA 4C6HA 4IDAA 5JJIA 4BCCA 1P5FA 4F12A 5AJVB 4K9NA 1XBTA 2B6HA 4RZUA 3SI7A 3KQOA 3THRA 5D2CA 1NN1A 1FRFS 2QJOA 2BFMA 1GZDA 2IOFK 4OGLA 3EOAI 1Z6PA 2MHCA 5JS8A 3HNRA 3A1CA 4EY3A 1YQEA 3BE6A 5FKJA 2UYOA 4BKOA 1RYMA 1PQPA 1YI1A 1FX1A 1Z7BA 3PXGA 2DMRA 3ROPA 5KU1A 2O1XA 2A8YA 3I2HA 3CISA 3O3MB 1IEXA 1H2ZA 2VSYA 1ZNQO 3L0CA 1SWVA 3I1JA 5ERGB 2YZ7A 1JDVA 1UKYA 2FPIA 3EY9A 3FNFA 3HSKA 3I09A 1KYQA 1E9FA 1M2HA 1US8B 3GRYA 3WV5A 3OEHA 5FDFA 4E33A 5HP4A 5EIXA 2VHQA 3M83A 4UFOA 3LRPA 4NHEA 5ARDA 3UCEA 4HJXA 3QXSA 4CTOA 4PHFA 2XB4A 1P1IA 3TW4A 4C0LA 1LBQA 1QDUA 2HLHA 3M6AA 4IDGA 4CHGA 2RHTA 2OENG 1FQJA 2OMEA 4MWCA 3RSSA 1B0AA 2R751 3LY8A 2IEYA 3S0JA 3WAGA 4TTIA 4AL4A 4TZ0A 1G41A 3I01M 2ZUEA 2RIPA 4MWGA 2HCJB 4ZREA 3W04A 1GDHA 5KWVA 3OKPA 4NATA 3RYFA 4I1PA 2R97A 3IUPA 4CLXA 4LFBB 1QQBA 3PQ8A 3VAAA 5IKEA 4RVSA 1ZSNA 4LDNA 4ZGWA 1KORA 1U5BA 4FMPA 2HWUA 4WINA 2AYZA 3RB8A 4DY4A 4JV5B 2FN4A 1VSBA 2AN9A 2ST1A 2W48A 4ZU1X 1TE2A 3K30A 1DC7A 3B12A 3BD6A 4JIGA 3G2OA 4A10A 2VHZA 1DXHA 3UXEA 2D0DA 4RVDA 5KNBA 1NM5C 2HRRA 3C24A 3FCUB 4Q3DA 3LA8A 3QUQA 2SECE 4XCVA 3JCZA 4C0KA 1GGNA 1OA1A 4UVHA 4D3ZA 4E4RA 1DVRA 3AW9A 4ZYYA 3Q7IA 4OHZA 2GBFA 5BOVA 5DLPA 2VYVA 1GY8A 2PVPA 1E0JA 1XGKA 2JA2A 1LK7A 3ZZTA 2J0QA 2AIRA 4L8FA 1WXFA 2OV6A 3OJFA 4ZJUA 3R3VA 1QWSA 1PG0A 2QJRA 2H92A 4XCQA 1P2DA 1TAQA 4KQ6A 2H4HA 4UOZA 4J7UA 3ZVKA 2J3HA 5DTJA 2HLPA 3VV2A 4LWQA 1T91A 4QGBA 1C7EA 2XB9A 1PQ4A 4RTRA 5GONA 5DHFA 1B0ZA 3BMQA 4JGGA 4MDHA 1J7JA 2PL3A 1S89A 3WGJA 4BQOA 4JUAA 5AW5A 5KQLA 5DW3A 1GR1A 2DERA 1HF3A 1B1CA 2JGKA 3QKIA 1ICEA 3PVZA 1A4XA 3GLHE 3QFCA 4RESA 3TE7A 4CDNA 1E1CA 4FFDA 4IICA 1KC1A 1M34B 2ZSEA 5ICCA 1I7SB 3S8EA 2BGMA 1WIWA 4AKGA 2HSGA 3SICE 2X9LA 4H4DA 3HKDA 4P38A 1G1AA 2RKWA 3W5UA 4RS4A 1XDBA 4RU1A 4YQFA 2FFAA 1JSXA 3D02A 2QN7A 2VHVA 4AJEA 5JHHB 4NE2A 2XYRA 4B32A 2E4AA 2QMUA 3SBDA 4RAOA 3RU3A 2QYOA 1R0BA 4KCGA 1JQ5A 3OG9A 3WIUA 4BAGA 4PCLA 1ESDA 3GY0A 5C5EA 3EXFA 1GPNA 3E05A 1AHPA 1DCKA 2Y6UA 3C5HA 1DI0A 3L0DA 4RQBA 2R6CA 4RKWA 4C6TA 2AG0A 1AKUA 1SBCA 5IXYA 1NNEA 2VUUA 4H7IA 1QONA 1X8XA 2QI9C 4KRFA 3DT9A 4L95C 4O33A 3OQBA 4P84A 4MLPA 3ZJYA 2PL9A 5JSHA 1C7QA 3KCNA 4L72A 2G80A 1LS1A 3N0XA 4YRJA 2BUBA 1CUGA 4J1TA 1A97A 2ET6A 1SK8A 5F2KA 2DUJA 3BWMA 5DTIA 1JP7A 5CEEA 5JEEA 3O2NA 1KP9A 1LVHA 1V6AA 2WKRA 1YV9A 2ZVJA 3QV2A 3H99A 4LJRA 4G0ZA 2XKAA 3GB9A 5FL7A 5BSMA 1DTWA 1KJ9A 1NA5A 1H69A 3GW8A 4XQCA 1L5YA 2WHYA 2ZYVX 3B1ZA 3L18A 4HH0A 3L7IA 4YWHA 3RABA 3ZE2B 3ZQKA 3CR3C 2CVPA 4E3ZA 4B47A 1JQBA 2AC2A 2PRJA 4WQMA 1T5TA 4HLUC 4DLLA 5DI3B 2B83A 4EITA 4RIFA 3ANYB 3U4QA 1QFMA 2ZXEA 4URXR 2X7HA 3MJHA 5CURA 3ZGYA 2VRCA 3QVTA 1Y89A 3K32A 4MYRA 2IZOA 4RXUA 3HB5X 1TRHA 1DIBA 4OOEA 1ZVQA 4M83A 5ETJA 2P9HA 3QUSA 3RS4A 3P97A 2J7PA 4TV9F 1MV5A 2O5EA 1G8GA 2NSDA 3C3AA 5FUVA 2G17A 3L9WA 4KYVA 1D4ZA 5EEHA 5T67A 5BW4A 1OV4A 1WV0A 5HSGA 3FBWA 2XJ9A 4QBTA 4RJKA 3W5JA 4LJ8A 1W25A 2GVDC 3PRYA 3L04A 4HO1X 4HNTA 1V3QE 1XVTA 1M7BA 4ZU3A 5G0SA 4MQFA 3VYUB 2BMFA 4ND5A 3R5KA 1WF3A 4DWVA 3EEOA 4MULA 4AP6A 1MW9X 1WOMA 3OMXA 1VCNA 5FNVA 1KERA 2HQBA 5J2UB 3GRPA 5IZ4A 3AO0B 1J8QA 4MWBA 4R1SA 4R2MA 1L6IA 1XAIA 1L4EA 3HJUA 1I2BA 5CLGA 3QFRA 4AFNA 3M82A 1M7HA 4WFIA 1U3VA 4OUKX 1JXMA 4BO6A 5HRCA 1I5EA 4L2IB 4OSEA 1MOQA 2QZZA 3SX4A 2HF2A 3G17A 4ITVA 2FEAA 3T3GA 2WUGA 4LC1A 2HO5A 2EKLA 2WVJA 5IJAA 4D8XA 2J30A 3WIOA 4TSRA 4IIVA 5ECDA 4B80A 4JLKA 3GRVA 1HQKA 3FKSD 1RKXA 1WULS 4ZYTA 3U6KA 2J4FA 1YONA 3VR4H 3RS2A 2QN6A 3GMDA 1FB5A 4EYKA 2ID4A 2X40A 1KMCA 2ZI3A 2W2LA 3A6DA 3EWNA 3NYIA 3RYIB 1FUKA 3K96A 5A7HA 3UXHA 2AOUB 3WL3A 2JJMA 5BURA 4EY7A 2JJ2D 1MFZA 2F8LA 4OHKA 4EGJA 4I4NA 5EHZA 3CRNA 2O5RA 2YHBA 4RC9A 3T3IA 5CJ2A 1YDHA 1XNRB 2GVNA 3LRTA 3Q3EA 2PJRA 3ER8A 3K5IA 1J1UA 1A98A 2YQ5A 3WOHA 3F8TA 4LY6A 1JEQA 2EJVA 2QUJA 1RKVA 4N5HX 3RGWS 1XAHA 3VYVA 1USIA 5JHGB 2HA2A 2LE0A 4XB6B 1PGQA 4ZEMA 3P19A 5SYNA 1VECA 1DL5A 2QZSA 5AKKA 5DLEA 2Z4RA 3PBKA 3AG6A 2HU5A 2PUDA 3IL2A 1U99A 2VEDA 2TMDA 2HA4A 1E9BA 1UKVY 1U9ZA 3I4FA 1ZM9A 4MRNA 1ZA2A 4BXOB 3JD0A 3DSRA 3GH3A 4M0KA 4C1NA 2VHYA 3PUHA 1M2EA 3UICA 7AT1A 1M8JA 1WDLA 3QWHA 4Q3EA 3RTAA 2GZ1A 3CO0S 4UMDA 1KJ8A 1OVMA 1V6CA 1QK4A 1TO2E 5J2TF 3TSYA 3VM6A 3PFCA 4B2LA 5HIAA 5C51B 3TUJC 3FNEA 3NI2A 5B2EA 1EESA 2I80A 9LDTA 4HNQA 1THZA 3R9XA 5AD1A 2QYTA 1FBNA 3AVVA 1HLPA 3JSAA 3WWYA 1IOLA 4GPEA 1TQ6A 1G9TA 3AL3A 4DV1B 3ZHSA 5F2NA 1E6EA 3G0IA 3HCDA 3BL5A 3NGXA 2UVPB 3PX2A 4O02B 4CRWB 5CEJA 1XEXB 3KK0A 1OR8A 3KB8A 2HWKA 3D3EA 1IHYA 3GOHA 4RVGA 3SKXA 2NTNA 1IN6A 1G42A 1G7TA 2XA9A 3QP9A 4P35A 4ZZ2A 5I9TA 4JYZA 4AM8A 3D4NA 4EB6A 2IHNA 3OJXA 3PTAA 4TVSA 2I22A 3GBSA 5FYDA 4MICA 4XE5A 3D4OA 2OYSA 1YJ5A 5THQA 2Q7OE 5L6LB 4O2AB 3WG9A 3OF5A 2A1UA 3B5EA 2FV8A 1QANA 3AIOA 4TOIA 4PNZA 2RH5A 4NR0A 1XRMA 4WKGA 3ZCQA 3QE4A 3ZWAA 1E1MA 4J7AA 1ZD8A 2AJTA 4URYR 4RTQA 3KR2A 3QXJA 3O47A 3UWPA 1RU3A 4UBJA 1COWD 5I7HA 2G3YA 2H1LA 1ETHA 3H75A 4FCWA 4ZHSA 5AVTA 1P9WA 3KB6A 1LV8A 3F6CA 3KAPA 1ODCA 1JLSA 3ONNA 4OQNA 1E4VA 4UQPA 4Z86A 2OCXA 4XDGA 2R9VA 3GEGA 5CB0A 4MMYB 2QX6A 4CDMA 1KH3A 5BORA 1KKLA 3PRKE 3OU7A 1EBUA 2IWRA 2VDUE 1ACJA 2V9PA 2QIPA 4P3XA 4BGDA 3K2IA 3QA3E 1VE7A 4HXGA 1VHJA 2I34A 2V1XA 2CDAA 3U09A 2AV6A 2D1YA 1Z0DA 1N6OA 4JI5B 2E55A 4DEVA 2ZYSA 1E79D 3PYMA 3CUEF 4XYGA 5J4VA 3NHPA 4QA9A 5KOYA 1U8TA 3OLVA 4X3PA 5A6SA 1NBWB 2WFMA 1V71A 4IF4A 4LEIA 4JI7B 3FFTA 5E9WA 4EB0A 3G5AA 4FYKA 4AUNA 4D42A 5LQMA 1PZFA 2QZPA 4FZ5A 1LQUA 1T8PA 3DBLB 2D2EA 3MCWA 1IPHA 1PS9A 1WL8A 3KLOA 3JZFA 3VPCA 3ZCXA 4PGGA 1R9GA 8OHMA 1GQYA 4FGZA 4YCCA 3TG2A 4M1WA 4NSNA 5EP2A 4CQLA 1HQCA 4EKYA 3PNPA 3WS7A 2DKOA 3Q1KA 2POQX 3VNAA 1PT6A 3UMVA 1FP4B 3BDVA 4QIHA 4YUVA 1ND6A 1V96A 1EUQA 4HBZA 1KZ1A 3PT9A 3HDQA 3Q5GA 4RZ2A 4GP6A 3QFFA 2P3SA 3EUAA 3S5JA 1V5EA 2W2NA 1BWRA 4CKWB 1VG1A 4KI7A 1X1RA 1NM5A 2M1XA 4NCKA 1RBYA 5SZIA 3E5HA 3DO8A 4JLNA 3HADA 2O0LA 3S2FA 4QRHA 3CR8A 3JQBC 1M1UA 4JT2A 4IX1A 3WKDA 4EG6A 4OAPA 4W63A 1JHUA 4P8RA 2CY0A 3ZHXA 5IHPA 1I14A 1PD1A 2OD2A 1E2JA 4M9SA 3ABZA 3E9YA 4C0QC 2EWMA 5J1TB 1YBMA 3RT1A 5JDCA 4DR2B 4DAOA 2O4UX 1Q0LA 1KDPA 3GWZA 4H6PA 1ADBA 1XD8A 1U7HA 3L05A 4PPFA 4RLFA 2L18A 2VKQA 2G4VA 1OH6A 4R2XA 1EHYA 5K2OA 3AJ8A 3V9PA 5AR1A 1CQJB 2B8EA 5F3RA 1LU9A 1QRDA 2FPPB 4UMVA 1IOZA 4DA9A 2HQ1A 1LPNA 1FZQA 1QGZA 1N5MA 5F64A 2I3BA 2WQZA 3ED5A 1MIOB 4W9MC 1HRKA 4BP3A 1ECLA 2NUBA 4JHXA 3KOMA 5EJAA 4PANA 3WC4A 1O5TA 3FD8A 2DZDA 3K94A 4IQ4A 2Z83A 5JBQA 4FYXA 2WIFA 3AOEA 3FDFA 5B37A 2HDHA 1PFKA 3GQBA 2FFHA 4R3NA 4V0KA 5JD3A 5BOSA 1TF7A 4G1FA 3FOZA 2J85A 3BQ9A 3UMYA 4J0IA 1RFLA 5EY5B 3HJRA 1I7QB 3ADDA 1JKJB 5KTNA 3K1TA 3WMXA 3C6KA 2HW8A 1T2DA 1JLHA 4NESA 1L5VA 2WIBA 3R77A 4RKYA 4WXRA 1F9AA 3ZTYA 1CP3A 5JC1A 2XNHA 4MQBA 3SXUB 4N12A 3TSAA 2AG5A 1WHTA 3ZX5A 4AMZA 1IC6A 5IMBA 5I45A 1P4GA 2H1FA 3RJ5A 3WYEA 1H9CA 4PR3A 3WDSA 1D2EA 1NSFA 2Q28A 3LF2A 4KQ1A 1DX9A 3FAKA 2J9RA 3LMKA 4DJAA 4X20A 4IGFA 4H1VA 2GCPA 2RSLA 2JIMA 5JVDB 2B9EA 4LTNA 4AKSA 3TLGA 1OLXB 4ECEA 5FORA 2IDZA 5B1EA 1TVKB 3OOSA 4J7XA 5F4BA 3O91A 3WZMA 1ECGA 4KODA 5I51A 2PX4A 2QTTA 2WJAA 4LY0A 1Z08A 1JQEA 1WU8A 1OZHA 1E3LA 1QHHB 3QU5A 4MWEA 4OREX 4P4TA 4UUBA 4WD3A 4HUQB 1U7OA 1QV9A 2E82A 2BCGY 3FDJA 1Y80A 1IBMB 4PZZA 1SC1A 4S2EA 5GV7A 3RIGA 5DT9A 4CR6A 1A2OA 2WTMA 1JPJA 1Z7WA 2FEOA 3TEMA 2PSEA 2RG1A 4MH0R 3EUEA 4MK4A 1JAHA 2H54A 4XEUA 4PFQA 4R2IA 4DRXA 1BEZA 4J3FA 2IU4A 2XA1A 3IPRA 3RJ9A 2JG3A 4AG5A 1AKYA 3VUFA 4B3IA 2AJDA 4DG9A 1SVIA 3VZCA 5H02A 5CW1A 4G5QA 4DARA 2BKVA 1MQSA 3OLZA 3VTKA 1RCTE 3T5TA 3OT4A 2WD9A 3LQRA 3W1EA 1ZR2A 4DT1B 5SYMA 4GLFA 2IODA 3MB5A 5LUAA 3V00A 2C2WA 1JIKA 1C81A 1GD1O 1CIPA 1PBTA 4TRMA 3WOVA 2IS2A 5JJKA 1OLUB 2OV4A 3P9CA 4GICA 2C9OA 4U7FA 1G55A 5K0GA 1KMMA 1JTEA 3NDIA 3SD7A 3RR2A 3D54D 3UPTA 4GW3A 3HUUA 4RPCA 4B81A 3MIZA 1R4MB 1IMJA 2E85A 4ENRA 2R5NA 3QK7A 4CEJA 1N57A 4ZI7A 1YCFA 3WQSB 3OP4A 4F5WA 2D5LA 3B53X 5C8YF 1GQSA 4NPHA 1DRJA 1E5VA 4X24A 3OAAD 2ZTSA 3ZR4B 4Z1MD 2UZ0A 4PPYA 4DMGA 5JYEA 5HDBB 3LO5A 2AOVA 3TL2A 3EGCA 4AIIA 2IYNA 4H2DA 4X3CA 4GI7A 5AJHA 1NKTA 1EFAA 1UANA 4PPQA 4XSGA 3MJDA 3TAHA 2Z5GA 2H5JA 3IOYA 4MW6A 1NZJA 1VMEA 1ZJ5A 2XH8A 2C5SA 4XUGB 3AVOA 4KRYA 2QVLA 1XRRA 2PUAA 1VKJA 1YQQA 2ATVA 1ID8A 3EG9A 5JSUA 2I1VB 2V3CC 3U0VA 1ZVJA 3A4TA 2Z8YA 4BFWA 3T34A 2F90A 3QELB 3TZEA 1Q7EA 1HDYA 4KMMA 4EG8A 3SHTA 4E03A 4QUKA 3T1OA 4GI3A 1HL3A 1CPYA 3BMQB 3UA3A 1OIWA 2EFEB 2C2XA 1BN6A 1PR9A 2O2IA 3NANA 1TZKA 3P9RA 4FYPA 5IUNC 4J2TA 4D0GA 2PKWA 4EGSA 2EARA 4M9CA 4B43A 2QN1A 5LKRA 1HNWB 5L8VA 4D9KA 1S3SA 3PQ3A 1DIHA 2ROQA 4D9CA 1H3EA 4FEEA 3AVTA 2CKMA 2ZIGA 3H97A 2WF6A 2NVUB 3ZU3A 4QT4A 3DOJA 3W9BA 1MT0A 1EU1A 2C9ZA 1QYXA 1X9IA 2JFOA 3KOUA 4YDSA 2N9UA 4FQ7A 1LDNA 2P6MA 5TMEA 1VG9B 3SYLA 4B71A 1XDWA 1IFXA 5E7QA 1UEIA 3EXEA 1UBEA 3BXXA 3HJNA 3JVIA 1E62A 4R3WA 5AOAA 3O8OB 1W5SA 3RTGA 2V6IA 1QZUA 2HOQA 3DZDA 4HGRA 1XUOA 2JANA 7ADHA 2ZSUA 2XDQB 1GZUA 1ZH6A 2WDPA 1SB8A 1KO7A 1U0TA 4OSOA 5EUQB 3OTHA 3PHGA 3IOCA 5ICFA 4E31A 5EZ6B 5B30A 1QKKA 2WVAA 4YONB 2NUPA 4EELA 2WMNB 2XE6A 3C5CA 5CA0A 2QLTA 1ZMOA 1ZD5A 3HCOA 4OBWA 4D9JA 1DIRA 3U48A 1NLUA 1ESZA 5BVGA 3GP8A 1CJUC 1IM2A 2QENA 4P7FA 1K5DA 1QYWA 2CXRA 1JI3A 3IVMA 4OI2A 1Y0BA 4OKIA 1P80A 2CUKA 1A8QA 2O8EA 4MIEA 4ED9A 3WRYA 2VF2A 5H59A 1WO8A 4L9RA 4I55B 4XGQA 1UH5A 3EJWA 1YGPA 1OUMA 4I4TB 2OCKA 4BOYA 3A0UA 1XZFA 3BVPA 3PPVA 3ZS9A 4M8SA 4LI0A 3H6GA 4S12A 2VWHA 4ZT4A 1Q19A 2FXVA 3L0IB 4BX3A 4PXYA 4KR6A 2VJAA 3FPJA 4OB7A 1XTTA 2WTAA 4X6UA 4DPKA 6Q21A 1NQOA 3E15A 3EFOA 2GZMA 3CEPB 4J4BA 4CKCB 4M0LA 2Q1XA 1R0RE 2X1HA 3D9QX 2XTJA 4BY9E 3DBLA 3AUAA 3KTAB 4G1BA 3P45A 3SHVA 3RYHA 5JZMA 2KW5A 2YNMD 1YULA 1M34A 3AR9A 2QPOA 1BOOA 1GNTA 3HU5A 4MTLA 1KY2A 2DPLA 1ZIPA 2CL0X 1MU0A 3BWVA 4O2AF 2GBLA 1U9JA 4LCJA 2DLDA 1PEKE 3PF9A 1MAUA 2Y67A 3D2CA 3MT8A 2B2NA 2HYIC 4JC5A 4YAOA 1N4DA 3NHLA 3FPLA 1SZPA 1GNSA 1X7XB 5FUWA 1U94A 2YWGA 1J8MF 1XZKA 3T7RA 3H2GA 5CEFA 3FGOA 4UAUA 3L4EA 4AQDA 2V6BA 3B78A 1SOVA 1YNSA 1MAVA 3EZFA 5F21A 4EKDA 1CNMA 3H04A 2PS0A 2G40A 2GHTA 2HF9A 3KWLA 3UQYS 3RTCA 2NTVA 4PC2A 5CBPA 3CRW1 3VTAA 2XD9A 5CFOA 3LUFA 1QH0A 3A70A 4KQGA 1II8A 2FHSA 2ID7A 2J3EA 4N7MA 4NBVA 2JLAA 1CY8A 2HEGA 2HPAA 5HEKA 3X44A 3SG0A 5JYDA 4RQUA 4IFBA 3WGKA 3DXYA 1KO5A 3QSGA 2ADFA 1OY1A 3D5TA 3AUKA 2NO1A 2XMBA 2WB4A 4GQBA 2IXTA 3TKLA 1D6MA 1MIOA 3DC2A 3ZJTA 1KA9H 3TSZA 3ZE0B 2EX0A 3AM4A 3DZKA 2O7QA 1ISRA 4KSBA 1ZRMA 3KPWA 1QYDA 3KTAA 1A3CA 3UH1A 1XG5A 1D6NA 4RKFA 3O4HA 4PO8A 4LJ5A 1IG0A 1VKOA 4GXTA 2XYPA 4XGIA 5TEWA 4R7GA 2COKA 3FTDA 3SE7A 4DA0A 1KYTA 2ZI9A 1SU6A 4L0MA 1SCUA 1BZYA 3CE6A 4DR1B 4IIGA 1EVEA 1K7EB 5JANA 1UFQA 3WTBA 1IIRA 1I3CA 3RUAA 3W1VA 3HVJA 2GN2A 1IEQA 5E9JA 2OPHA 3HZOA 1SCIA 4H08A 5KU7A 3CTPA 3O9MA 1DC4A 1X7WA 3HDYA 4M1TA 4R05A 4GL2A 4PYMA 4ZC1A 3F9RA 4PU0A 1GRNA 3P4UA 1TC1A 2OHGA 2O2EA 3WYCA 3DFIA 4PZUA 2JW5A 2XKJE 1HYQA 3I30X 1X7GA 3EXHA 3HY3A 2KBFA 1WMAA 1TM5E 4TT3A 3WL7A 5BMVF 2W71A 2J6IA 1RM3A 3TQOA 2G5TA 2QB5A 5L51A 1OJ7A 4KKXB 3IHWA 3ETGA 5CBPB 1V1RA 3U62A 4DAEA 3DOCA 3NPAA 2GTPA 4W8GA 5KVSA 1UWVA 2C04A 2HI0A 1G3MA 1HPLA 2ZIXA 1NJ5A 3EZXA 1HKHA 3WI7A 5JR3A 2DFKB 2AK2A 4IIEA 3L7KA 4WPGA 1DOHA 1BDBA 1C3OB 1Y82A 2D54A 4G0NA 1JDSA 5G0VA 1KDYA 4EHKA 3F6YA 2EQ5A 2HHLA 2R25B 4HQNA 4MCIA 1EDOA 3TW0A 4E30A 1CQXA 1P6XA 5CITA 3FVTA 3ZJVA 1BGWA 5A4DA 2R6HA 3K1AA 3UN1A 4CTNA 1JA0A 1H93A 3CLRC 3BFPA 3LC2O 3M6LA 4M7OA 4CNBA 4XGNA 4MWTA 3UJDA 4EA8A 2VDWA 1OX5A 2JIRA 3PP8A 4P53A 2ESRA 2JBAB 1A69A 3Q6MA 4RMIA 5CGQB 3INYA 4UBOA 1DADA 1QPGA 3SJ7A 2Y1DA 4OMDA 5JY6A 4Q9HA 4WDQA 1OTHA 1TEVA 3IRUA 4X8MA 3CIFA 3FLAA 3PTLA 4HRXA 4X8OA 3UKJA 4EF5A 5CYGA 2B20A 3CG4A 1PT7A 3URKA 3HI6A 5AFSA 2A0UA 1WBDA 1QHYA 2H57A 1FQWA 1NOKA 4QELA 5EJIA 1QO0A 1VHWA 2PRZA 3OX1A 5IC5A 4BNGA 3PL1A 2GN8A 4B4WA 1HTBA 4V1CI 2QP4A 2OO5A 3FDIA 4JLSA 4JITA 4UE3S 4JENA 1B8VA 3SLGA 1CP2A 3EXHB 1DPGA 1SY7A 2XRFA 2YZKA 3OWHA 4P4NA 4QUDA 4EGCB 4CXMA 2QD5A 4Y1EA 3DYIA 1YDWA 4IGIA 4OHOA 2CD7A 4L5IA 4RAQA 3FKQA 3DWEX 3MGAA 3MN1A 5CP8A 3PEUA 2XCIA 2J08A 3D7RA 1DX6A 2FPGA 2QMOA 1AC5A 2W6NA 1EFPA 3BGWA 2FOLA 2Z43A 4EI2A 2QR2A 4G09A 1R0YA 4KN5A 4QBKA 3L8HA 1WS6A 3IHLA 5AW9A 4OIMA 1MA0A 5A03A 1MNAA 2RCNA 4IHJF 4OL0A 2W2KB 4O4JB 2UVPA 2GPYA 2ZUVA 4MMXB 3T3DA 3G7NA 3C3BA 4RA6A 3VR4A 3WZ2A 1QP4A 3DC7A 4A0FA 3GFRA 1L5RA 1CEXA 4BZPA 4DCGA 1IUKA 3JXEA 1TGYA 1GAXA 1LUAA 1EK0A 1OD6A 5AKLA 1XJ0A 5C1BA 3CGWA 1XQYA 2GZRA 2XOEA 1VE9A 2C3MA 2OORC 4PC6A 2AL7A 3AKCA 1H6DA 2GD0A 4PIPA 2IH2A 1N32B 1FFBA 1O0BA 1RYEA 3QX8A 1W0JD 3ZQ4A 4BNZA 4KVGA 1B6RA 1GNLA 3LT5A 2DGDA 4ZC8A 2QU7A 3NEPX 5DLQC 4ZCRA 2QTBA 5KSPA 4E07A 3TNDA 1BEEA 5GMOA 1I1HA 3BZWA 1UKBA 2JVKA 2WC1A 4HUJA 4DBZA 5A4KA 2HBZA 3UT6A 1ZRSA 4OV6B 2GF9A 2F8SA 4ZRNA 4UE6A 2QLLA 1FS4A 2M1ZA 2X14A 4U8HA 4PQFA 1EA7A 3F67A 1SVMA 3DDCA 4BNVA 2RAVA 2X9NA 1IQRA 5CW2A 1BXZA 4NK5A 5IX8A 3VSAA 4FOSA 1CUBA 1M7GA 3TW6A 2H5EA 3VPDA 1JDUA 4GDMA 3OZUA 2HNBA 4TLAA 3LUKA 3OE7D 1N0VC 2PUCA 1GDTA 4FFVA 5EXEA 4GX0A 3FWPA 3W6ZA 3FOCA 1OC2A 4I14A 2NU7A 4W82A 1DC6A 2HDNB 4QEZA 1U9YA 3LSYA 1XWWA 4P4SA 4BB6A 2BHLA 4CL8A 4CQMB 2VTBA 1YIAA 2IBTA 1EJ0A 3K70B 4ZVRA 2V3VA 3O0TA 5TPWB 3I2YX 3SSOA 4EGFA 5BSHA 1E1RD 3BJRA 4KVFA 4F7DA 3K73O 3X1WA 4MP8A 4LFCB 4J2OA 1QQ5A 1ULAA 5DTRA 2ZB2A 1JIVA 4OM8A 1U4SA 1ZCFA 2FZKA 5IYZB 1BJRE 3ZUPA 2D5BA 4AO7A 2IQ5A 3N28A 4PTYA 1ENYA 3KJXA 1HT1E 1RWOA 5I9IA 3G2QA 4CODB 1GTG1 1P5HA 4PX5A 4Z6KA 1XNJA 2BSQA 3HFSA 5LU9A 4Z4GA 5BN1A 2PSFA 4GYWA 3NTVA 1Y8CA 5EERA 2VPQA 1I4EB 5ICSA 1J00A 1GA6A 1XTZA 5KTSA 1OT5A 2KJQA 4LV6A 2PSJA 3CZ4A 1U0EA 4ZN6A 3DKVA 3PHIA 1VBFA 2XI4A 3HCPA 4JL6A 1JWBB 3GA0A 2AG6A 1MH9A 2AZTA 4GC5A 1DQPA 1V39A 5IUKC 1C3EA 3LP5A 2I55A 1QMPA 3Q9SA 1UJ2A 5F73A 5IC4A 5T8KC 3K0EA 2XKKA 3C8MA 3IC5A 1UMCB 3I5XA 3THXB 4LHXA 3MJFA 2A84A 4L51A 3TQRA 4XM2A 3G2HA 1AKEA 1M3SA 1MOSA 1TCUA 2HCRA 1UDAA 2A9PA 2VBFA 4WFQA 4YV7A 1FFDA 2NTYC 4NOKA 3VJMA 2AR0A 3RVNA 2VPYA 3B3AA 4PIVA 1C0PA 4KQWA 5B3JA 3F8SA 2DJIA 3R8CA 4NZYA 3ZNNA 1FXWF 1M6VB 1D2GA 2A35A 3C3EA 4LX8A 2D06A 4ROTA 1Z0ZA 1Y34E 3V2UA 3GVXA 5AO9A 1FZTA 1Q7CA 4Z99A 3L6DA 4BKRA 4YUYA 2DCUA 2AHRA 3GMSA 1TYCA 4AKEA 3QI2A 3H9JA 3O94A 3DP7A 4L8WB 1ZM4A 3NP9A 5IT0A 5B57C 3ZEAA 3QE3A 5DSTA 5FWXA 1E1RA 1YRHA 4PCAA 4DMUB 2JLXA 4I4TF 3OZRA 1U0HC 2QLNA 1Y7IA 5AJYA 4ZVPA 3U3ZA 3N6VA 3ICVA 1X0XA 4FGWA 5IJ0A 4I1RA 2HAEA 4OBEA 2O2CA 3ECSA 1N2JA 1UPTA 3STVA 2VPTA 3D6FA 3I32A 4JS0A 1AO0A 1RWMA 3LT4A 3JAWA 1F2TA 3KELA 3QMVA 3WK9A 4GE3A 1UF9A 1YVDA 4UUOA 2AJCA 1DV2A 1N9ZA 1NP3A 2EGGA 1Z5OA 3P7MA 4GXRA 4PFSA 4Q1DA 4XUDA 3VR2D 3AILA 5AT1A 3KB1A 3D2BA 4K9MA 3C97A 3NT2A 5JJLA 3H16A 1GPAA 4M0EA 3HBNA 1Z38A 4JYCA 1VYVA 3L9XA 3ZU5A 3VO8A 3E9ZA 5CU7A 4Y67A 2B35A 5LDDC 3DOOA 1ZZEA 3FZGA 3GUZA 3I5YA 4X95A 5KNCD 1M83A 2JAOA 2Q5QA 3M4JA 2WSSA 4XDYA 2H1IA 1MO3A 2BZ1A 1Y8AA 2OO7A 3T7AA 1RXEA 4KWCA 5CR9A 5EHQA 1A9YA 3B9PA 1DBPA 3HK2A 2P4QA 4LHEA 1RPNA 1U5CA 3V6MA 4E1BA 2A58A 2OESA 4FMCF 4OH7A 4LKOA 4PO3X 3PGJA 4ONEA 1NT2A 5E4JA 3B48A 2QRZA 4Q4AB 1N5KA 4WADA 1XIVA 1PZMA 2X4GA 5B4VA 3LRXA 3PUVA 4CFSA 3HBLA 4UUNA 4CF7A 1MO4A 4O2LA 1Q57A 2VQFB 3E84A 4ATNA 3ZY6A 5TPZD 4YQYA 2HSZA 2UUBB 1RRFA 5DK6A 2G28A 4OH1A 2Q6OA 3L7CA 3OIDA 1FF9A 2C8KA 2HL6A 4ND8A 4Y6GB 1EK1A 3F3YA 2H5LA 4P82A 1I4WA 2OGWA 5CUQA 3VPGA 1Z73A 2VTDA 3DLHA 2ZBVA 2Q62A 1U4OA 2XRMA 1TJYA 3HCBA 5AJUA 1S1CA 2AN1A 3PFNA 2CXQA 4EB6B 1O4WA 1FP4A 1TVMA 2PGIA 3DZ8A 2OTCA 1PW5A 3GMIA 3KQQA 4URUR 1IZ0A 2YIJA 3NT4A 4O3MA 5TR9A 1AQIA 4CEIB 4EWLA 2C88A 4IXWA 4GVXA 4JL5A 4PHGA 3RC9A 3A8TA 1SKUA 1OASA 3CUWA 1I4OA 4WERA 3CZQA 1WQ1R 1EHIA 2FSFA 3PTZA 5G1NA 4QTYA 2YY5A 2OXRA 3WWEA 3GZNA 2WJ4A 1QORA 5K0JA 4EYOA 4EZBA 2B3TA 1ODIA 4QBHA 2RMKA 1M0EA 3ZV4A 1EHCA 1JEDA 3I8OA 2VSQA 521PA 1QSGA 1UWLA 1ONOA 3AY6A 5TJHA 3IDAA