4XGRA

Crystal structure of addiction module from mycobacterial species
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
128
Chain Sequence
MMVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of the Mycobacterium tuberculosis VapBC30 toxin-antitoxin system: implications for the design of novel antimicrobial peptides
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Toxin/antitoxin
molecule keywords Ribonuclease VapC30
total genus 39
structure length 128
sequence length 132
chains with identical sequence C, E, G
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4xgrA00
1BGXT 1TFRA 5HMMA 3TNDA 5H4GA 5L6MB 3Q8KA 1UT8A 2QIPA 5FV7A 3ZDDA 5ECDA 1V8PA 2IZOA 1V96A 1UT5A 1A77A 1YE5A 1EXNA 3ORYA 3ZDEA 5HNKA 2FE1A 1TAQA 5HP4A 1W8IA 3Q8MA 1RXVA 1RXWA 2IHNA 4XGRA 3ZDAA 1TAUA 2H1OA 2HWXA 2WP8J 2BSQA 3ZVKA 3ZDBA 1O4WA 5ECWA 1V8OA 1Y82A 3Q8LA 3ZD9A 3H8WA 4CHGA 5H4HA 3ZD8A 3H87A 3H8JA 2DOKA 1B43A 3IX7A 5ED0A 2HWYA 4MJ7A 5SV2A 2LCQA 3H8SA 2HWWA 4XGQA 5ECYA 2MDTA 1XO1A 5HMLA 3I8OA 1MC8A 3DBOB 5L6LB 3QE9Y 1UL1X 3QEAZ 1A76A 4WA8A 2H1CA 3QEBZ 3ZDCA 5K8JB 3H7IA
chains in the Genus database with same CATH superfamily
3OM9A 1G19A 3QENA 4HDRA 4Y0VA 5CIQA 2P65A 1KPIA 3Q2IA 4ZEWA 1PTJC 3WGMA 4Q9JA 1H3FA 4MYSA 4EJ6A 4OHPA 4ND8A 1FB5A 2XF8A 4OHMA 2QZZA 2NVUA 2WSBA 1TTTA 2X0NA 3LQRA 2P9JA 4LDJA 1P2GA 1RC0A 2Z1DA 4O4LF 5DM4A 5FOVA 4D4LA 2Z04A 3K9CA 1JEQB 2C2OA 3EMBA 5AP9A 1FYFA 1IB0A 5AW2A 5JZSA 4L9AA 1N3IA 1X9IA 3FDZB 3TS1A 5DLQC 5B3AA 2AWOA 2ZYRA 5IARA 3GC6A 4LGVA 3RUPA 4FDVA 3MELA 1BHQ1 3O74A 1AGNA 2JJ1D 3PC8A 4NZOA 3KOZA 4DG8A 1DOZA 3KHSA 1SGWA 1S8AA 1I32A 4FK8A 1NBMD 1YQGA 2ASEA 2CEAA 2DBRA 2REQB 1WUTA 3WNQA 2PNJA 5EJFA 2EZ9A 1KPGA 3CKMA 3LA6A 4MV3A 3ZH9B 4YYZA 5L4SA 1UBSB 3JAKB 1NP7A 2WJGA 4XRGA 3EIUA 4X1OA 3OHPA 2WJIA 5EMNA 1QHGA 2WIFA 4IM7A 4L4SA 4WNYA 3VR1A 1UJ5A 3JQ9A 5CB8A 4EB8A 1YZTA 2RDMA 4FYPA 1D2AA 1EXVA 1P17A 2ALJA 2II6A 1U7TA 1K3UB 3M6VA 4JBLA 4Z3OA 1VP3A 2O0MA 1CJUC 2C4VA 2R1ZA 3REOA 2HX1A 4BVEA 4NXMB 1TPZA 2W6QA 1EGVB 3PFIA 5DHTA 1FYEA 4B1FA 1UJ4A 4LWOA 4RSMA 4CLOB 3CUVA 3F49S 5AVKA 4HF7A 4MITA 4JLKA 2HK8A 1BU8A 4WY2A 3FUXA 4P84A 4CW7A 5ALFA 5JATA 3P2YA 1WD7A 4FXOA 2VT2A 3WB9A 4G85A 4BCDA 4LY6A 4DLYA 4EVRA 1A7JA 4R0VA 1C1XA 3HL0A 4ZAWA 2AYXA 3B13B 1ZUHA 4JLWA 1UH5A 4O2LA 2VCHA 2A86A 2FVXA 1EWKA 1AK9A 2OZEA 4MAAA 4DRYA 2ACWA 1AK1A 1M1YB 1CT9A 3ED1A 5B55A 2XB2A 4Z3DA 3HFGA 4C07A 4MARA 3A25A 2R9VA 1HM5A 2QN2A 3A2NA 1OHHA 2A0XA 3PPYA 4IUBS 1IUNA 2A9VA 3DD5A 2WW8A 1MV8A 3FLEA 4XX0B 4RULA 3STWA 5DN9A 1L5RA 2KM1A 2P9QA 1CFZA 2UUPA 4BVFA 5HDBB 1D2CA 2GEDA 4EHJA 1GQQA 5EPUA 3A1CA 1NT2A 2BV3A 2IODA 3BSSA 1ZI6A 3FN4A 5D6OA 4Q3LA 2GCOB 5JVDB 2Y1OA 1HUQA 3O93A 3TRHA 1JIJA 1Y1RA 2BI4A 3BIJA 2P3LA 5HHTA 4W5RA 1TEHA 3MWJA 1ZOPA 5CDSA 4FHGA 1EMDA 4QOFA 5DHPA 2XUAA 3KQNA 3EY9A 1Y4SA 2G77B 2QRPA 4UJ5A 3M4ZA 4UDNA 3ICEA 1PZEA 4JI6B 1QGZA 2R6HA 4R0NA 3SG0A 1CPYA 1F6BA 2VHJA 4M8NE 3O2JA 4FJ2A 2H08A 4TTJA 1EJ2A 5D3KA 1USUA 1XMSA 3O8BA 4DMLA 2W11A 1AKTA 2ZYSA 1KH2A 4K0RA 2YW2A 4EUSA 2OAGA 3O1IC 3WP1B 3UMFA 5IUKC 1I7LA 5AUNB 4ZZ3A 2YVLA 3HLKA 3DHWC 2O3JA 4BQEA 1FSFA 1YE3A 1NQWA 4K9MA 4RK1A 3TL3A 5CNMA 1ZIPA 1EFPB 4K03A 4IQFA 4UPVA 4G0UA 3EDQA 1MB4A 4AYTA 5IANA 5CX4A 2APJA 2Q4OA 5KVQA 4KE9A 4WXEA 5A6SA 2WVAA 4CKWA 4KWCA 2YTZA 3B1FA 4JC0A 2BELA 1HOTA 1Q95A 2HL6A 2MR6A 1EPUA 3JVUA 5DGHA 5EWJB 1TM2A 4EARA 3H2KA 2IS1A 3ICCA 3G2OA 1MPTA 1DC4A 1T0PA 1N0WA 3AF6A 4F6RB 5AM5A 3FZGA 2CUTA 2GN1A 4NE9A 4U1RA 2C1EA 4E5VA 1FTSA 4CTKA 3LVFO 2QAGC 3THYB 4E5KA 3WGKA 1WDLA 3ROKA 1US8B 3ANTA 3MYYA 1BS1A 5LYJB 4JUCA 1TIPA 2CBGA 5HIAA 4BWVA 3U7EB 3RYCB 4Q4JB 3R8XA 1SUEA 1QDUA 4R7TA 4F6CA 1V4NA 4Q47A 4JWKA 2JEZA 2QE7A 3VKHA 4HR7A 1W6UA 3GDWA 4JZKA 3QLVC 2OXCA 4D99A 2FN4A 1VHLA 4OMDA 3RRZA 3RYHA 2GZ3A 3LBFA 1Q15A 1TJYA 1UQRA 2BFDB 2L69A 4GRDA 1KYWA 3KZMA 3QHPA 1ZVMA 3BMQB 3SP1A 3VR5D 2QVYX 3N2YA 3F0TA 4A8PA 1WPRA 4I4TF 4LE1A 4N7RA 4DM7A 4KPUA 4AZSA 4MGHA 1EB9A 2IC5A 4N5HX 3W5AA 2OO5A 4NV3A 1SHJA 1FP2A 1FNNA 4OGGA 2FQXA 4F4HA 3ACBA 3U62A 1FL9A 2BHSA 4WBSA 4Y9DA 3FRIA 4XX1A 1F3LA 1Z8DA 2F62A 5KVAA 5D84A 3WE7A 3LF2A 2QL7A 2UZ0A 2PSFA 4H6WA 1JKJA 4FYIA 5DM60 5L4LA 2HHCA 3R7BA 1ZSYA 4NZMA 2DWQA 3ER6A 5DMXA 5NULA 3TR5A 5I8WA 3PNPA 3DMPA 2RGXA 3WLQA 4ZDJA 4XCXA 2PUCA 3RPEA 4CYMA 3K0AB 1ACMA 1XTJA 3L0CA 5TPWA 1Z35A 1TI7A 4LRWA 3DDHA 4J03A 4MWDA 1ZO8A 1ZBQA 2W4IA 3HXQA 4RABA 2Y1FA 4FQ8A 1XYVA 3L5OA 4C4XA 5LD2C 3KXIA 4RK0A 3E3MA 1FP4A 3F46A 3WDKA 4BS9A 2QRNA 4WXRA 4E33A 1U6IA 5CXXA 2GEBA 3EULA 1J33A 2VJBA 3Q8XB 3KB6A 3PNLA 4GMGA 2AB0A 2BMVA 2C97A 3AO0B 3LTEA 3F6CA 4U7TB 5JJ5A 4XLZA 1KU6A 4O25A 2F8SA 1DO0A 3ZE8A 3L77A 4M6WA 3TQSA 3PRYA 1NLFA 4AQDA 3GPIA 3OQPA 3PF8A 3AU8A 1SKQA 2DQZA 4FE3A 3RBAA 4DIFA 1CUUA 3ZIDA 1T25A 4A2WA 1J7JA 2AR0A 2YOGA 3WVNA 3OEWA 1GPLA 2XMDA 2OLKA 8GPBA 3GLGB 3VYRB 4H15A 4BMSA 2IXTA 2PEYA 1RHQA 3FKSA 3H2SA 3HKEB 3HN7A 3VH4A 1MA0A 1UDRA 4MX8A 1U9IA 3CX4A 3C87A 2IEIA 2WTBA 5CLJA 2MU1A 4Z3KA 3GRUA 4GUDA 3K20A 4X85A 2GPWA 2B61A 4NHOA 1X1RA 4H4CA 1ZIYA 3AILA 5LU8A 1X1BA 2ANCA 2VSOA 1ICEA 4FMCB 2G28A 1R2QA 3GLGE 5AH0A 4BC1A 1Q6ZA 3UJAA 4PM4A 2F9MA 1CY8A 5DBGA 1SVKA 2A58A 4U9IS 3KV3O 3TFQA 1EFCA 4PZPA 1W8IA 2VR1A 5KQPA 4AD8A 1NLUA 3AM4A 4LHVA 4ZTUB 1A97A 3NHSA 3NHZA 5EIOA 1ESMA 3UXHA 1YR1A 4A6EA 2VWGA 2XUFA 5DF1A 5FOTA 4A8HA 1QC5A 2JNWA 2I3ZA 3OM0A 1T3LA 3K2QA 2IU0A 2A3NA 3D3JA 4XSVA 5IM4F 3DBLB 4Z4GA 1BAPA 3TSOA 4UTPA 3PRHA 1NDHA 2PRJA 3B6KA 4FEAA 3KQQA 1U02A 4BVKA 1DZ3A 3R23A 4BO0A 3RHFA 2HZBA 4PEVA 8MHTA 3DBHA 3U4DA 4W5TA 3FW1A 1VDZA 2O2CA 3O2SB 5HZGA 2R7KA 2WF9A 5ALXA 3HUUA 1H2AS 1P3Y1 1ZSVA 3FCXA 1HDOA 4L74A 4LE0A 2XCRB 1Z7WA 3QX7A 1G8FA 1NVVQ 5HKKD 4WXMA 2GCEA 2JLUA 3PQ5A 3OF2A 4IXTA 1UXOA 4JX9A 3AXTA 4D6XA 2W48A 1RYMA 3CX8A 3GNTA 2ISCA 4C14A 2VAVA 3PCRB 2HDOA 4NYMQ 1E98A 1F4VA 4QUHA 5K3CA 1QV9A 1Q19A 4BPRA 1GLGA 1ZM9A 2IU4A 4MR9A 3KQKA 1RKXA 2J3EA 3TM4A 4CLOA 3DAFA 2UYHA 1AQUA 1P2BA 3JVIA 4JXJA 2DCUA 3ROEA 5A9SB 3U61B 4YMIA 1P4JA 3ETLA 3NHWA 2PH1A 5BN1A 2E18A 5BWLA 3KPJA 4Q1AA 5AK6A 2VYVD 4ZOCA 4IDQA 5JS2A 4A0HA 2O59A 3VQTA 3GEPA 1PW7A 3TH5A 1C4KA 5ALYA 4L5CA 2XYHA 3AHGA 3ORYA 4LDNA 3BYZA 3Q0IA 4E2FA 4DIKA 2VJMA 1TT7A 3DBVO 1GZSA 2Q5EA 3K0HA 5JNWA 2I6GA 1OFVA 5JQGB 1MV5A 4ZGGA 5JXHA 3G0IA 3A1DA 1ZK1A 1E1QA 2BSXA 3LY5A 3VSCA 4JI1B 3ADBA 2IQ5A 3EZ7A 3O3NB 1PFUA 1X7HA 2MJLA 3B89A 2VSNA 4GWKA 4PCLA 1YQ9A 4I2VA 2C5HA 4IOMA 3WA6A 2HWKA 5JASA 3LSTA 2Y2UA 3A4MA 3AFNA 3O2QB 4WIAA 5KX5B 4HMOA 2DZDA 4BQPA 4YT8A 4WBNA 3OUUA 3HACA 4NY1A 5MFZA 4N0EA 2WU1A 5HA5A 3RUEA 2A0YA 3TDKA 3O3MB 3DEFA 3FKJA 3HZRA 1CNFA 3IVXA 3H3XA 1YKSA 3FDXA 1Q22A 4IS3A 1E7YA 2ZW9A 1Y1PA 4ZQBA 1EVEA 3QJ5A 3MBKA 3RVJA 4X65B 4BU1A 5LZ4A 2XB8A 3SJBA 3PD1A 1I6LA 2GN9A 221PA 4BNWA 4JOQA 3MWKA 1OXUA 3BUSA 4TTSA 2KWIA 1W49A 4OQNA 4PY2A 1GPKA 4ND7A 5CH5A 3DE1X 4JL6A 4QM6A 2F43B 4V1CI 2CJWB 3VZRA 3W5JA 4OUDA 4I50B 4JJ7A 4QOGA 3CH4B 3PJGA 1JH9A 2KE5A 1KJNA 1KH1A 3CMMA 3GPBA 2QR2A 4HLUA 3RUIA 5HXAA 2YVKA 5IYZA 3SQXA 1GA4A 2R5FA 3VC3A 4A26A 3C39A 3GRRA 4UDOA 2IWHA 3EIFA 1GAWA 5DWDA 4A3SA 4CT0A 3FROA 4DDKA 1II8B 4FOLA 4H27A 4QVKA 1WX1A 2R84A 4UU0A 3X3HA 2XCUA 5BV2P 4M86A 1XEFA 2WPDD 2GXUA 4NG4A 1KQNA 1V1RB 4RMGA 5CGQB 3VXKA 2YC4C 1LK7A 1VLJA 3C45A 1NT4A 2QY6A 1QANA 3QLUA 2I7VA 5F51A 3SLKA 2G71A 4BTEA 4EG3A 2ORED 2EGUA 4X1IB 1PWZA 4B3CA 2RGNC 2BEJA 2M1XA 3R0JA 4FGJA 4QGFA 1CZNA 5FOSA 1HGXA 1CJCA 1PV1A 1HNNA 2VG8A 4PQYA 3WG9A 4N8DA 3UJ6A 3WRYC 5IKEA 4JGBA 1GPBA 4ZMBA 3KYCA 4DY4A 5SY9A 4DY6A 5H02A 1DC7A 2HFJA 1EUYA 2OCXA 3OFND 2PT9A 4WZAB 1MO2A 1U6KA 2AEFA 2OCPA 3LBHA 4J16C 5CMLA 5JRDS 4RVFA 4RACA 3PNBA 3OQMA 1NJ2A 4JJFA 5C1IA 3WFJA 4LJRA 1ZAYA 4X1KB 5AVYA 4DJJA 2XCLA 1ZJZA 4EHAA 1UXKA 3NNDA 2C57A 5KX5A 2Z57A 3OHMA 4M1EA 4NBUA 1LLUA 2BFNA 4D9FA 1QHSA 4EFKA 5K0FA 2KHZA 1YOBA 1D2MA 3CUUA 1KERA 4XB2A 3DMGA 4EAQA 3CSSA 3GGPA 1RFGE 1WMDA 2YJ4A 8AT1A 4KXFB 4Y1GA 2PBZA 3GFFA 4ARCA 2XDWA 1H2BA 3NAMA 4TPKA 3U4MA 4JSTA 5FPSA 1E0AA 2J5BA 3QXSA 4MQEB 3HUFA 1KEZA 4KIWA 4I1PA 3WLEA 2GEFA 2V7UA 1WWKA 1ZD2P 1A72A 3DBHB 3KOWA 1APBA 3KKZA 3LWDA 2HQBA 2B82A 4Z1OA 4EQ6A 4FMPA 3E6AA 4OK6A 4NE2A 4FGUA 3T3IA 3QFSA 3BXHA 1N0HA 4HJRA 4UVHA 5L3SA 3SC4A 4HZIA 4LDQA 3AOGA 4QTUB 5JSUA 2E1RA 2NSLA 2OC4A 2O2GA 1Z45A 2BP7A 4K9NA 4RQTA 4AYXA 1Y3BE 5JALA 3OX2A 2CUZA 3S2IA 3D8RA 1CUHA 3KZKA 3NWJA 1Z06A 1RQRA 2YX1A 3LL4A 4PFKA 5ABPA 3V8PA 1N57A 2O48X 1H9AA 5T64A 2ZT7A 2HMAA 5JZMA 2CEKA 1IG3A 5I9IA 2Z95A 4XVHA 2JS7A 2TMDA 1E3EA 5JAZA 3KYIB 1G7RA 3BG5A 4ODIA 1R1DA 2BGTA 3REQB 3QLJA 1EQAA 3SX4A 3FNEA 3DLIA 3LVRE 1SH7A 1NL3A 3O4FA 4UTRA 2B35A 5ERGB 1FFEA 3U4AA 2DFTA 4OIMA 2Z3VA 3AP2A 2ONKA 1QONA 1ZXLA 1Z4KA 2BKVA 4AG5A 1FDOA 2FG7C 1NR1A 2PVSA 4L3OA 2D62A 4QE3A 1KY4A 2RHOA 3MMSA 3QI2A 4J6FA 4ZU1X 4EHKA 3MSXA 1ZLYA 2QMQA 3KOMA 3PXDA 4OQ4A 2FUEA 4PNHA 3IQZA 3UPDA 4DSOA 5JD5A 4LDRA 5BV7A 4HJXA 1FMCA 3ZV3A 4G5SA 2DH6A 3O4RA 2XODA 3IR6A 1DFHA 3GJYA 3LCUA 3QPUA 2BGGA 1ONPA 3NP9A 3HY3A 3E1GA 2FYTA 1TD9A 4IZIA 4AY6A 5AKKA 3OCUA 3V8NA 3OP4A 3U7FB 1Y3HA 4EX7A 2E87A 4H3KB 5E3JA 3KBOA 3DVRX 3LDFA 4E21A 3M33A 2VJDA 3FD8A 3OH8A 4MA5A 3DFMA 4HT3B 2WP8J 3RAPR 3I9OA 3OPXA 3IEMA 1IQRA 2ES4A 2EW1A 3J7TA 4ZRDA 3PGJA 5AXDA 3TRKA 3CVYA 4A27A 4RVGA 3M1YA 4K88A 1PNRA 9MHTA 3IT0A 1FA9A 4HXEB 4HFJA 1L5KA 3HKEA 1GKYA 1U8YA 1L4FA 2LRHA 2R2GA 1QG6A 2VPPA 4HQLA 1JR6A 1M2GA 2NO5A 2AUNA 4FYJA 1QYCA 1P7CA 5TF0A 4AC9A 1GQRA 2BFEB 3PQEA 1C8VB 2W2NA 2IYTA 2X8WA 1FCJA 1Q3KA 3GCXA 3GLHA 3H1EA 4URYR 3R3ZA 4IIEA 4UNQA 4RKQA 3RSGA 1F8YA 1N5OX 4HAZA 4YNBA 4MW2A 5H82A 3KM0A 1M0WA 3NPAA 1R6VA 3DDUA 3PKIA 5E4YA 3FB4A 5D01A 5TT1A 3T1VA 2ICAA 1BOOA 4DZTA 2ARKA 6AT1A 4I08A 4TQ9A 2DUMA 1Z37A 1M3SA 4K6CA 5F64A 3G2KA 2O5EA 4DT1A 2CK3D 3WTCA 3E7FA 1JXQA 1XG5A 1Y9DA 2BFFA 2D8AA 4JNKA 4M89A 3IUBA 4TS1A 2HSGA 4U2CA 5TE9A 4BKRA 4RESA 2C2BA 3G8AA 2XB4A 1P33A 1PGQA 3ZCQA 1TJPB 2R8EA 1RYYA 4DCCA 2IH2A 5T67A 1KJQA 5H7XA 2A2ZA 4TXMA 2CV2A 1U0BB 3MMNA 1XAGA 1IPEA 1KFBB 3LPAA 4PLVA 2P5UA 2R1VA 3B3JA 3CV3A 3DHVA 2IXAA 1NC1A 3WMFA 2MCFA 3FZYA 4RD3A 3NC4A 3PG5A 3IAS6 4G0ZA 4AW9A 3FPSA 3Q3EA 4AWAA 3FFXA 5IBPA 3PBKA 3S55A 4I6JA 1BJKA 3QHAA 3R5XA 4MR8B 4DQDA 1F2TA 3VU3A 2HXSA 4Q7KA 5AR1A 3NQ41 5ALIA 3I52A 5PNTA 2NUPB 5E6SB 2AS0A 2WIAA 3EZ9A 2CMHA 4FQ7A 5A4DA 3AUFA 4WECA 1T6BY 4R41A 3W1WA 2G6TA 3ZBUA 2O1XA 3T8YA 1JIXA 2EL7A 1I1QB 5J2TF 4YAWA 3SLRA 4EA9A 1BXZA 2B8NA 1C9EA 2DP4E 1XDSA 3NWPA 4FS8A 2DG2A 4IV8A 2OT3B 4RZHA 3TOXA 1H0SA 1LPSA 2C5BA 5K8VA 2WTUA 4RENA 2ZVJA 4PPGA 5E4TA 2XT6A 2JLWA 4CG0A 5JMPA 3V8MA 1X8KA 3BHNA 2IY8A 2FP3A 3V4PB 1VSTA 2J5QA 3HDTA 4P2GA 4ZQEA 3ZHXA 5AM3A 2UZ1A 4UUMA 5H9VA 5HM6A 2OGWA 3D2CA 2UU9B 1KK1A 1NVAA 3H5RA 3RBVA 3AWIA 1D8AA 1GG5A 1GPNA 4H08A 3T7IA 4TVSA 3RC1A 4MULA 3Q2KA 4PZLA 4GBGA 3MBIA 2JGDA 4RKEA 2AFHA 3ZEAA 4PYLA 4ZEVA 4PO1A 1DIHA 1EI9A 1R8YA 3GLHB 4B6EA 1AXGA 3C3DA 2VJPA 5HS4A 1DHTA 2ZRCA 1KMIY 3VO1A 3D3EA 5FL7D 3QOYA 4BMYA 5K3OA 1XN4A 2QTAA 4C4OA 3UOGA 3EAGA 2CKMA 4JSRA 1Z83A 4AJNA 1TCUA 1F2DA 3IUYA 1KMHA 4M9RA 3CYFA 2AUMA 4PPQA 4RVDA 5B3KA 3LV8A 3C5CA 2C4UA 1UPCA 5LP6A 3LLMA 3E1SA 5L51A 4RADA 3LQ4A 1YRYE 3GLIB 3F5MA 2BFDA 3F5DA 1WDMA 2CMKA 4FD3A 4UE2A 2WD8A 2OPHA 4EB6B 5IHPA 1W2GA 2CJXA 2XIQA 5TJ9A 3M1IA 3CTPA 4WK0B 4II7A 2DFNA 3HNRA 2VT7A 3I2YX 3B6ZA 5KYWB 4S2UA 3A2KA 1FJXA 2GZRA 2W6JD 4N03A 2H2DA 4NSNA 4U6QA 3BMNB 4L95C 1KBOA 1PNOA 4IW3B 4DARA 4TSKA 2I2FA 1E3MA 4HTAA 3UGKA 1W88B 4OHYA 2YNMA 2P2DA 3BMOA 4CIVA 2TRSB 3R7FA 1RKBA 5IYZB 5KNDD 1V4BA 2ZIXA 3NJRA 1WW2A 2AOWA 2R8BA 1XMPA 1GV0A 4GSLA 4DWOA 2NX2A 1AXEA 1NG1A 1RAFA 4QEDA 3PENA 1DDOA 1Y5RA 2PPVA 3DL2A 3GJ4A 1XYYA 3C6KA 4XGRA 5JZ9A 4BZWA 4RMNA 5JE8A 1O94A 5K2OA 3J7AC 1DJMA 3ZGOA 3Q3IA 4ZJYA 5J47A 3FIUA 3KQSA 1Z6YA 2PLWA 4MRRA 3RK4A 2RGWA 3KXKA 1QR6A 3FPGA 4YALA 4ZREA 5JCOC 3GLIA 4BFYA 2V65A 2I2XB 3L6UA 3FNIA 1B4DA 2B36A 1T9ZA 3NYRA 2QXYA 3OEED 1MB9A 3QKIA 2PZJA 2R8OA 2BMDA 3E15A 3ZWOA 2I87A 2VEOA 4Y6GB 4DBLC 3L2OB 4J0EA 4JI8B 3G79A 2NZYA 3DPSA 2B0JA 2PZKA 2WD7B 4GHWA 3KSRA 1ZBDA 2O3QA 3KWFA 1DG1G 1UPTA 1U4NA 2PL9A 1JJIA 1QKJA 3DEKA 5DYIA 4CLRA 1I13A 2WIBA 3MD0A 1NHWA 2BMJA 5LMZA 3CA8A 3LDAA 3DDCA 3JRNA 3MTGA 5CGZA 5A3RA 4L78A 4Y2XA 1KZ7B 1BHO1 1I3CA 1E0SA 4FFRA 4ZVRA 5M3BA 3G9TA 1KC1A 1OTHA 2JCYA 2C3MA 3LYHA 3QBVA 3RRJA 5CFZA 5EN4A 3DV2A 1G42A 5JVDF 2H2FA 4JELA 4H4EA 1QIMA 3DE3X 4ND8B 5EFZA 5AVRA 1LWNA 1UEJA 4R54A 1BE8A 1Y9ZA 1ISRA 1SBCA 2G5CA 3P32A 2IQIA 3P20A 5B1IA 4ZK6A 2HU5A 3M9XA 1YBMA 3QEMA 3VH1A 2A59A 1XZLA 1K7XB 4OB8A 4YP7A 2R4QA 4CDRA 4O2RA 4RZQA 2EYUA 2D7CA 3TXYA 1H2HA 1W1IA 2J5RA 2JLXA 1XZPA 3TGWA 3SS7X 3VPFA 5DRTA 1KSGA 2X6QA 3NYIA 1G8MA 1YZYA 1E9RA 1XRLA 2Y76A 3PPXA 4WFJA 4ZT5A 2YWXA 3TQTA 3I0MA 3W8DA 2CNKA 3MGAA 3V9AA 2P90A 4QJ4A 1YA4A 2J9GA 1WUYA 3PR1A 4OQLA 3TLMA 2MTBA 5GQSA 1E4VA 1P39A 5J58A 1I4TD 4JWTA 3PFFA 5CCXA 4UBLA 2P2LA 4BWYA 1NVGA 4EECA 1SUSA 2Q5FA 4JVSB 3SF0A 2FX2A 1QTNA 2QHXA 4UQLA 2W43A 3KFXA 3RH0A 5LP1A 3R6WA 1J23A 1GL6A 1XDGA 1ZWLA 3ESDA 3H99A 1ZM2A 3DUFB 3PR2B 4QDKA 2LIPA 3U3OA 3HBAA 4P3XA 3FWHA 3HCRA 4LXYA 1NWCA 1XCGB 3MAJA 2VHTA 3P71T 5TIIA 3NYQA 3KQWA 3QBJA 4B4WA 2Q5IA 4PO9A 3D8UA 2NQ8A 4YJ2A 3QMMA 1GT91 2KBEA 1KIMA 2R60A 4M1YA 5ESWA 4C0SA 1K66A 3AKCA 4N5LA 4B85A 1EDDA 1UM8A 3OKAA 3MJDA 1XTZA 2NO6A 3I2KA 3NP7A 4OA8A 1MEEA 1IEWA 1VPDA 4DLAA 5ALZA 3VA7A 2IYFA 2GAIA 3F90A 2IY9A 2TMYA 3OQIA 4GI7A 1NTOA 4RMJA 4E11A 2ZRJA 3QFTA 1M72A 1U8EA 121PA 3GJ8A 3ITDA 3OIFA 5EVJA 2CBZA 4XYEA 4LCJA 4QYTA 1WP9A 4EJMA 1VJCA 2O57A 3D4BA 4R1MA 1NZDA 2Y68A 1CRWG 2RARA 2AQHA 3OY2A 1U0HC 1T6ZA 3LPNA 4PC2A 4PGAA 2NOAA 4X91A 1GLNA 1P6QA 1T0HB 3H3FA 5HFAA 3UKJA 4M0LA 4RO0A 5IT9A 1Y8QA 4CF7A 5JBIA 4CTMA 5BOVA 1VI5A 2IIVA 2PBFA 2VVTA 4HAIA 4R1PA 5TNXA 3F9IA 3ERCA 1Q7CA 1QWOA 2OM2A 4L6IA 4ZAVA 1PHRA 1VL8A 4M76B 3VISA 3O26A 1BRMA 1TQDA 1Z25A 1ZMXA 2IPXA 2YN4A 1LEHA 5FTJA 3G2QA 5GINE 3RHTA 3N0TA 4HWGA 4PG5A 1TMGE 3QIVA 3OQNA 4PR3A 2WTAA 3PUKA 3V4FA 4B73A 1GZHB 4ZV4A 4DS3A 3GARA 1Q74A 1SZCA 4HD8A 3JQ7A 2PU7A 5CH8A 3L4KA 4QTYA 5DTEA 1W581 2JIZD 4H6VA 1HDRA 1YUNA 4FFBA 4P33A 4KNYA 4M83A 1EH5A 4ZCMA 4INAA 2BFMA 1ADYA 3LS2A 3SF8A 1X7ZA 2G67A 2YV2A 1N77A 3WKBA 4UPDA 5C1OA 1O0BA 4RAQA 4AS3A 1RDFA 4KUEA 3M8KA 1J97A 1Z13A 4ZDKA 4A82A 4F5YA 3EW7A 2FV8A 3UC5A 1QHFA 3W77A 3COYA 4JLMA 5G4KA 4E07A 1UOQA 3PF9A 3ST7A 2JIRA 2B98A 4M87A 2ZSFA 4G37A 1JV2B 3PT9A 3HU3A 1D7AA 1J07A 1E5DA 1X7XA 1XCBA 2R1VB 3QVSA 1RPAA 2I03A 1P6XA 5BSMA 1LLFA 3G0CA 4KMOA 3TVTA 2CY0A 4K26A 3R3JA 3SFTA 4A03A 1DJNA 4MHSA 1TIBA 1MQ8B 3ZCVA 4CMKA 4FI3C 1G59A 4BLWA 2E85A 1GSAA 2NAFA 4ID9A 1IL0A 1OQAA 2N46A 3M2TA 2OO5C 1XMQB 3SXPA 4QECA 1GM5A 1JU4A 3EVZA 4IGAA 5HF6A 3THRA 1EXMA 1ORTA 3IEXA 2W7TA 4AXBA 1WG8A 1TCAA 3AKYA 4YRIA 4WQMA 5BUSA 2ZM6B 2EEPA 4LFBB 1TKRA 2ISSD 4YFVA 5DP2A 3D2AA 1Z6ZA 1G98A 2I4OA 4MYTA 2OZLB 3AUKA 3SX0A 5KNCA 3UJ8A 2A92A 2CWWA 4FMBB 3EVGA 4FMDF 2YNMD 3AJAA 5KNDA 4YP5A 3LSYA 1FDTA 3PNKA 4JA2A 4KJXA 1I4OA 5DHQA 3CIOA 3LYLA 4F5ZA 2Y1GA 2CK3A 4UOQA 1GY8A 5L3QA 2VSXA 3R3HA 3RVQA 3HXLA 4LRSB 3GEMA 3GGGA 5KQLA 2WF6A 4TL6A 4CGYA 1M6WA 4WZBA 5TDHA 3G0DA 4RH3A 5GONF 4ZQGA 1YFKA 4CDGA 1ZVVA 5EIXA 3ONNA 5IVPA 2MT9A 4DR2B 4B45A 2R6DA 4H6XA 3ZQ6A 5KYXA 1NBMA 3PYMA 4FT2A 2EJVA 1SQ0A 2WZQA 4D02A 1KVRA 2WSMA 3IBSA 5REQB 1SA0A 1A9XA 1F48A 1EZ4A 4MPRA 2VHEA 3IQIX 3CLRC 1N36B 1JLLB 1QHYA 5IH3A 7REQB 1AT1A 1VJGA 4MHTA 1Z74A 2AF4C 3AI7A 2I2BA 3EHDA 5C5EA 1BX0A 4NLLA 2H2GA 3NHPA 4RJIA 3KVYA 2ACVA 3TZHA 4IHJF 2OG1A 1WAMA 1QH8B 2G7ZA 4DCTA 2ZUSA 4OVKA 4MRMA 2H57A 4B47A 1R16A 1JAXA 2AZMA 5CD1A 4NABA 2BKAA 4KHZA 4KJZA 2Y0PA 5I9NA 1MX3A 1TECE 2PSSA 5A0VA 3BS4A 3EARA 3TD9A 3L7MA 4FOSA 4DJ5X 1CRZA 1V41E 2O50A 4QHTA 4QYSA 5IW8A 1ISIA 5BNWA 1IY8A 2XF2A 2LE0A 1GRRA 2JH9A 2ZBVA 3E35A 1QAQA 4KXYA 1UZUA 2COEA 4TX1A 4DIOA 4BXOA 1SUBA 2Y0EA 4BKQA 4KREA 1K1EA 1LPPA 3MFQA 2VUTA 1M73E 3TG2A 1UADA 3PQDA 5DI3B 1RI2A 1ZW1A 2NQ2C 3A1TA 4N7JA 2FN3A 3OZRA 2PZ8A 4FX2A 2QTHA 4JUAA 1UFVA 1LDBA 2CCKA 1W8DA 1V37A 2QE6A 5BQPA 2OCYC 2JK1A 4G0YA 5CDFE 1LRJA 4GWLA 5JFGA 2WR8A 3EMVA 4QGBA 1VE3A 1MG0A 4R69A 2VHCA 4MEJA 3ZGXA 3ZJ4A 3Q8KA 1KARA 3B7GA 1CHDA 4N5DA 4Q15A 5FPPA 1OSNA 4R1OA 4BNXA 4DVJA 4DZZA 3QKRB 10MHA 4Y6RA 9LDTA 4E7OA 2JJMA 3OZVA 1SVOA 2PZMA 2X9GA 3CRNA 5TQ0A 5LIRA 3EZ6A 5J5VA 4OMUA 2EKPA 2BGRA 2CF6A 2VDJA 2BLNA 3ZWPA 1HDZA 1CDZA 1E18A 1XI2A 1QHHB 2MSCB 2X0RA 2ASVA 3G6WA 4RC9A 4GSYA 1V8ZA 1PG2A 1YE5A 3FGOA 1G3QA 5D5PA 2Y3IA 2OCLA 4C0LA 3ADCA 4GZ3A 3RVKA 1T26A 3ZV7A 1KTIA 1CUJA 3RVBA 3S1LA 4MUYA 2I8AA 1E94E 2IYPA 1XZAA 4HN4B 1ZUNB 1YCHA 2NZWA 3WQQA 1ZCJA 3QH4A 4Z7NB 1M6EX 2O2YA 2H54A 4F4CA 2GZHA 3BORA 3K1ZA 4MKIA 2QZJA 4QXQA 1CRQA 4NZZA 2ZWPA 2E4XA 4I1OA 5IH7A 3HEAA 3FGPA 4FR5A 3A8TA 4TV8F 3VAYA 2J3LA 2WG0A 1EWTA 5C8VA 4EGJA 4L9WA 3JTEA 1Y9EA 4Y7CA 1L8AA 4JJZA 4Q3NA 2Z2JA 3RVLA 4AY3A 3HM9A 1DB3A 1ULUA 2PX6A 1K6EA 1ICIA 2GDZA 1GYRA 2Q3MA 2XOXA 3D3WB 3FNBA 1F2UB 1T9DA 1HE1C 1XELA 1NQAO 2CL6X 2XNDA 2ZYTX 1QFSA 4WCFA 3WBJA 1R0KA 4ENWA 3COSA 4Y3UA 5B37A 5IS2A 1A8HA 3QMPA 1SXIA 3I9LA 4KBFA 2PX8A 3HP7A 3QVUA 4EG1A 5BR1A 5JROA 4W9RA 4LZNA 3DUWA 3HXMA 1Z5ZA 3B3AA 2JCSA 3RARA 2RAUA 3IX7A 1B43A 4ENQA 5GP1A 1FFBA 2ZFUA 4EGFA 1TTQB 5JEDA 3OFNA 3THWA 1CX9B 5C2JB 3O4JA 3URMA 4C6TA 3HI4A 2R0QC 2FEKA 4IRXA 4OHOA 4REQA 1OE0A 1VHWA 4ZEMA 3NHAA 3AVVA 5JWRA 3EK2A 2I22A 3IQEA 4BWGA 3AR3A 4R5HA 2OB2A 4C5CA 4OQXA 2PX0A 2VTKA 3KSDO 1MQ9A 1DS6A 2N9UA 4ZXFA 5I9TA 4IR7A 2GPTA 2C77A 1QQAA 2WYHA 4P80A 1RXUA 1P75A 1Y1QA 2PZLA 3M9LA 1NIPA 2AFHE 3O47A 5LVAA 2KBFA 2ZUDA 3AIKA 3EE6A 3NG1A 3ROGA 1SUAA 3D9QX 1F38A 1FFCA 3VJRA 1HG0A 4W1RA 4F60A 4HEJA 1T2AA 3B2EA 1H4VB 3V1TC 1YR8A 1F1BA 2A9KA 3DM5A 4XCQA 5CFNA 3AL0C 3KWLA 4RTSA 3AJEA 3G7SA 3IDSA 1SM4A 2RMKA 1CF2O 4TYNA 3FAKA 1ODKA 1X7DA 2FEMA 4H18A 3WKEA 1R3UA 5LMCA 2ZBDA 1T5IA 2RGDA 3LDUA 3DW1X 3SKYA 4D43A 3U6KA 5HP4A 2QD5A 4DC0A 4LF8B 1VLVA 2BM9A 2NADA 4U2KA 3D4OA 1BVRA 1YB2A 4N3AA 4WCDA 2FOLA 3BZBA 1Q16A 3MQ2A 1XLUA 1J25A 2GETA 3M1AA 3PUJA 3QM1A 4PRKA 4NMMA 4YRJA 4L5AA 1MAUA 4PICA 3TECE 1YONA 3LHSA 3G0OA 4ALKA 4K86A 4BC0A 4Q1BA 5IMSA 1N2CB 5CG2A 3ZKWB 2PYIA 2HK6A 3FI0A 3KXLA 4CQLA 2YXDA 3T0GA 3H4TA 5K8TA 1U2SA 2AZDA 1IVNA 5AM2A 1DKMA 1DJQA 5CK4A 3DPUA 2W71A 4HFNA 1AKVA 1CUFA 4LRTB 4B8ZA 5BW4A 2VF2A 1F2TB 5KQGA 2Q6OA 3VC7A 4LQCA 4LF9B 4G9GA 1L7RA 2WWRA 4RD4A 3WDSA 2F59A 3PQ3A 1EUZA 3LUFA 2CFTA 4I4TA 3QHQA 4L9SA 2LVBA 1MOQA 5FDFA 2CWDA 2ZPTX 3A27A 5KYGA 1FW8A 2W6MA 4K1LA 1HDEA 1FMTA 4INOA 2J4CA 1NVWQ 3TZ6A 3K2IA 4K8RB 3EUWA 2F17A 3D0QA 3DQPA 3L04A 3OCZA 1GUYA 1QDLB 2OCKA 4Q3BA 3TTYA 1QM5A 1X77A 4AWXA 3VPDA 2AOTB 2CSXA 1D4OA 6YASA 2J67A 3W5VA 3HS3A 1X1QA 2FFHA 4NDNE 5C8YA 2CLMB 5KOJB 2XCSB 4OJQA 5EZQA 4RFLA 5BNIA 2VUIB 1GTVA 1PT9A 2GBFA 2PKEA 1C7FA 2ZVQX 4M7WA 4OM8A 3NAZA 5E0OA 5KC8A 2J0SA 3JWGA 2A35A 4NP6A 3RGWS 4F9EA 4FFOA 3ZQKA 2ANBA 3JASB 3R8CA 1FMJA 4CV3A 1ZNYA 3LCJA 3NIFB 2W70A 5KTOA 1HLFA 4MUNA 1CUSA 1FTWA 5IN4A 5L6LB 5CLFA 4B35A 5FUQA 1G1AA 2CHQA 4NMXB 1W19A 5CVCA 1S7CA 3T5DA 3LX4A 7GPBA 1YB4A 4DAOA 3U16A 1RQPA 1AV6A 2XTZA 3NHKA 4YC7A 2PJZA 4F97A 1GKLA 1MAVA 2BY4A 4R31A 4I1SA 4UKDA 3RDPA 3EA0A 3LNCA 2CHEA 2B4RO 3G6KA 3OA2A 3TJRA 3KETA 3VC1A 3OIGA 3NR2A 3TB4A 5BUZA 1XZHA 4FWBA 4PWZA 3IL2A 3IS3A 1XKXA 3NC0C 1N2CA 1D5WA 3AEZA 4E4YA 2BI7A 2RBGA 4QELA 4EH1A 1HFEL 4X20A 4JOSA 5G4LA 1QKKA 2IXGA 2C2XA 2XUOA 3BCHA 5F1KA 5GY7A 5CFOA 2XCIA 4DWWA 4YMLA 5DBHX 1SBZA 5JYDA 1I2CA 3R8FA 5FUBA 3UKDA 1Q83A 4XDYA 1MW8X 2BBSA 2VUUA 5B64A 2JHAA 4GOMD 2IHKA 4CIWA 3A6FA 4GMXA 3QPCA 5L45A 2J9FB 1NFFA 1KKUA 3VR6H 3EWAA 3KPWA 2TS1A 3AWDA 1PJQA 3FNRA 4K3VA 4PBRA 4RJJA 3RCBA 1B23P 5ALUA 3S27A 1UKEA 1W34A 4DCJA 4X00A 2R11A 2EIXA 3P2KA 5TR9A 2YFHA 4BVAA 5AKHA 5K7SA 1T5SA 1KHTA 2PFKA 4XIGS 3EC7A 4PLPA 5IC4A 3L07A 3GW8A 1Y1KE 3RFXA 3UBTA 4G2NA 4TXLA 4ARZA 1JSZA 3PUWA 3ZK8A 1C8LA 5FBKA 2XT9A 4YCLA 1EA5A 5JH7B 3ZVNA 4I66A 2BFFB 3KJGA 5F7OA 1MXFA 1X7YA 5ETJA 5ADVA 3ZYZA 3C3YA 7MHTA 4EZEA 1QUFA 1M66A 3M2PA 2C9MA 1UMCB 2FEAA 2HF2A 2LKCA 4TS9A 3EG5A 1RD4A 2QTVB 4NR0A 4YJ2B 2HPHA 1JQBA 1T1IA 4URXR 1N2JA 4U9HS 3UVEA 1QGUA 2HJ9A 1TF7A 1LBHA 3Q3VA 4H3SA 1NW8A 3ZV6A 5JNRA 2Z1NA 4CV1A 1GTRA 5HBGA 5E1OA 3VGJA 3IP5A 3LBNA 1OAOC 1KOFA 1TUIA 1D2HA 3C7DB 2GWRA 4S1VA 1WJGA 4ZT2A 3TLJA 2CMGA 1BEEA 2QF7A 4H3VA 4LXXA 4QRIA 3HUTA 1XD9A 4N4AA 1H6CA 1YI8A 1IYZA 4JKYA 1H1TA 4F4UA 1S8NA 1A98A 4Q7MB 4OYYA 5HFJA 8ABPA 4PNEA 4QASA 4KIUA 1NFQA 1DV1A 4CUJA 4KACA 1OI2A 4NRDA 3A4NA 3SSNA 4DJTA 1EKXA 4F3YA 3V4RA 1ZJJA 1P29A 1JKFA 4Y1RA 4Y9TA 4TLMB 1OXVA 4TT3A 1ZXBA 5LUBA 3BZUA 2CV1A 1NXSA 2WFAA 3IKMB 5ICFA 2OP0A 5F77A 5U4XA 2C4MA 1FS6A 4P0QB 4PZYA 1XQXA 1MABB 3B9PA 2QE7D 4R2XA 3IDFA 1L1RA 2PSDA 2O8BB 2XA2A 3B1XA 4URWR 1BFUA 4G84A 1PWXA 2BP7B 4MV9A 2AOUA 3EF0A 3SM3A 1JE1A 3EODA 3KIPA 3L92A 2BE9A 5F4BA 1QYVA 4HG2A 2YXEA 5AKYA 1GUFA 1M5RA 1WZEA 1DC8A 3FTQA 1XU4A 1CQIB 1UMDA 2BBTA 3H9QA 3VUFA 4ZO9A 4J1TA 1BKSB 2AN4A 2V7QA 2YWFA 1TNDA 3BDIA 3TEJA 1EESA 1O2DA 2B92A 2GK4A 3GH3A 1JYEA 5IF9A 2NZUG 1PCXA 4G1BA 4QU8A 3AB7A 2CLEB 1SC4A 3OM8A 4FYVA 5JPDA 2NO7A 1K6JA 2O8FB 4EPYA 5A0TA 5KYWA 1EWVA 2OZLA 3T0FA 5KNBD 2BEWB 2K4MA 1CUCA 2OKGA 1R18A 4LVUA 4P31A 3A3OA 1DKOA 2WYVA 3RO7A 2JJ2A 4BJ5A 1EBUA 1GL9B 1JLKA 2ZYGA 4KQJA 3IUSA 5FBLB 3WJ7A 3ZBPA 1VZ2A 3I32A 4XYLA 4KQWA 2FHPA 3P9CA 3E0XA 4OAOA 2PD3A 1OUMA 3BXXA 4V0OA 4HVTA 4EY6A 5JDIC 4BB6A 4PC3A 4LTNA 4JIMA 1OT5A 4OMFG 4WV3A 2GD6A 2X77A 1SK8A 5AXBA 4CMBA 3NGMA 4S0XA 3PGXA 1HORA 3LD9A 4MINA 3MFYA 4MSUA 5DHUA 1AB6A 2H6EA 3GCGA 3BE5A 2HH9A 5JADA 1L6IA 2XLCA 4DIBA 2QNRA 4HXFB 4DQUA 2QSYA 1U28A 1MKYA 2O7RA 5B1DA 3SSAA 2Q5LA 2CFSA 3EYWA 4O3FA 1NV9A 3NM5A 1KEEB 4HX2A 2AZXA 5E7MA 4MB6A 3V8EA 3CVXA 3H13A 3VPAA 4W9NC 1RC1A 2GESA 4IOLA 3NJ4A 4UFNA 2FMFA 3LH5A 4UCFA 2XVAA 3UJCA 2GN4A 3R3VA 2QRJA 3BAZA 3GRZA 1L4EA 3O4HA 4BFSA 3PX7A 2FJPA 3AHEA 5ALTA 5DHFA 2FWMX 2GLXA 2D2XA 1GZ7A 2IXDA 1P2SA 4FFBB 4GBJA 3UB4A 1EP9A 3I1FA 4NG5A 4XUDA 1HZZA 2H8KA 4K9KA 2WYIA 3NT2A 3Q3JB 3U1VA 2PV0A 1HDYA 1RRKA 1MMFB 3H2HA 1ZKMA 1ANKA 1J8QA 1L5SA 4IQ8A 4J0DA 2F1KA 1FDSA 3RI3A 3L1IA 3O9MA 3PHHA 4RF5A 4YRQA 4BFVA 4EBFA 5AESA 2LD4A 5B57C 2A30A 2N3ZA 1X13A 4OAQA 4HH4A 2OQVA 3RSQA 1VECA 1FYVA 2IKSA 1PJ8A 2ZR8A 3A31A 3DF9A 1VE5A 3UOWA 4B5LA 3AF4A 4EFNA 4W5NA 4D3XA 4B3FX 3V1KA 2B3DA 3N2ZB 4Q34A 3GMTA 5LQDA 1OWNA 2Q2QA 3W5CA 2V1UA 2ONJA 1Q0QA 2Z4TA 1CC1S 4OFWA 4FGZA 4DCGA 1FPMA 2VNIA 3EUAA 1ONOA 1FDWA 5D5QA 2Y1EA 2PHZA 1IBSA 3D1JA 3SK0A 2ZYIA 4RE5A 5FL7A 4I1VA 1AQLA 2GD2A 2OM6A 3QW2A 1H22A 2AOUB 2W6OA 3HSKA 6ADHA 3UWKA 4JP8A 4YPOA 1Z73A 2QRUA 4GXNA 3MXTA 3QKTA 4MV5A 1UJMA 1UWCA 3K1AA 1C7JA 4F85A 4BNIA 1JI3A 4UEJA 4MXDA 1QTQA 3OZWA 2G0NA 2JHFA 4YR7A 1JDSA 2BT4A 3QQPA 2PQ0A 1Z63A 1J0CA 2BWJA 4C88A 1T35A 3FJYA 1X86B 2WUGA 2OO3A 1UBTS 2WBLC 3NH9A 2REOA 3ZHOA 4Y9SA 1YVEI 3D8SA 5I4KA 3I2JA 5IM4A 2Y67A 1UKAA 3CX6A 3WL3A 3OZ7A 2ID8A 4OP1A 2IUYA 4FFWA 1PFWA 1YIDA 2DH5A 3OD1A 1YDEA 1G63A 4C03A 5K51A 1ZP6A 3W3AA 5EKTA 4R8KA 5TS2A 2JD0A 5ALLA 4TLLB 1A0OA 2J85A 3EPLA 4BRZA 4P4GA 5IC5A 1UK8A 3DXXA 3D02A 4J4TA 1E8DA 1CJMA 2WJ3A 3L0BA 4NNPA 2O5VA 4EW6A 1B26A 1AGPA 2CXQA 3GVPA 3ZUGA 3WKAA 4MWOA 2VZEA 4CTJA 2VATA 5K2MA 1T3HA 1SEPA 2FDXA 4CDMA 2BPOA 3JQFC 5B12A 3PB3A 3IODA 4KSYA 4PSUA 5A3QA 1S3GA 4WJZA 2IYQA 4PO3X 2ZJ0A 5DV9A 1RZVA 4K6GA 3VOSA 1A8UA 2XQGA 3QXXA 5CW2A 4Q9LA 3PHIA 4WOJA 5K9ZA 1JAIA 3C7KA 2OQRA 1GN8A 1IAVA 1JALA 4QYXA 3PEVA 4HDQB 1F2VA 3FWYA 1D2GA 3NHRA 4QPJC 1QU3A 3EXIB 1H23A 2GMWA 4NULA 1E9CA 3PA6A 1RYBA 3RIEA 3KVRA 4X0EA 2XHEA 4JC4A 3U3JA 4MR7B 1EWRA 3EXFB 1NBAA 3I34X 3NBMA 4TUYF 4AMGA 1G291 2Z5GA 2Q2OA 2HWUA 1N2SA 3BMXA 3L4SO 3RFCA 4FB4A 3EEYA 4IDNA 1VC2A 3AV3A 1MFZA 3OD5A 1QIHA 2JAOA 1E3SA 4ZPXA 3V1YA 4IX9A 5LMNB 2JCVA 3NDIA 4M1WA 2CB9A 4S1PA 1BROA 1KDVA 2NYRA 4Y0NA 2YJ3A 5EJ8A 1YR7A 4ER6A 5F9FA 5TY0A 2ZIGA 1SUIA 3F6BX 4G5FA 3V00A 4EPVA 1DKPA 5JTTA 2PVCA 1DDIA 4WL0A 5TMPA 3DZBA 1DL5A 1SVWA 2ZJ8A 1Z2OX 3MS2A 4RLHA 1QCDA 1DUIA 2AE1A 2H29A 3K73O 3OE5A 3PNQA 3VJLA 2FB9A 5AJWA 4CM8B 2W8BB 4BGEA 3DOUA 2CXTA 1NVVR 3OLXA 4V0ME 3ILSA 3T9BA 5B7NA 1ZZEA 4EMSA 4NEGA 2BF4A 2CNLA 1JE0A 2FPIB 3JYNA 5FUYA 5C5CA 1FSPA 5IVKA 2XXBA 3GJXC 2A7XA 4KYIB 4DADA 1EEHA 1LB1B 3LHKA 1U7ZA 1X1DA 1Z75A 3QPBA 3SJCA 4M9SA 3STVA 5BRJA 3PC8C 1ZX1A 1YB7A 3SKVA 1Y7LA 2JLYA 3EDCA 2Y4OA 1C29B 1IVYA 2HV9A 2WJ6A 3PE4A 2ZIXB 3CF6R 1L0BA 3PR3A 4LSWA 5DLEA 1JTFA 3WNVA 3AKZA 1JSLA 3IE1A 3G2LA 3R5FA 4N47A 2QM8A 1GEGA 2ODNA 3C5WP 4H7HA 4IPTA 4L73A 3V7WA 2VQFB 2QOEA 2DT5A 4DV6B 2IBTA 1OASA 3CNNA 1N9GB 1CBUA 1YA8A 4EDFA 5H4GA 8ATCA 1ABBA 4IUYA 2HK7A 4M1TA 5FBVB 4I9NA 3KQMA 1YDGA 5IVHA 1ETHA 2PXXA 4KQCA 1Z5GA 1W30A 4JB2A 2GRUA 5FADA 2QV7A 5HZHA 5ARBA 2CLCX 4YT2A 1J2EA 3OU2A 4Y1RB 4Q4CA 4N0PA 2VOEA 1PUXA 2FZGA 3BA6A 4KE6A 1YZFA 1JHPA 2WIKA 3E8XA 4GC9A 3CUEF 4M7OA 3WDLA 4WJLA 4CIYA 1QF6A 2VDKB 4X24A 1OX4A 4D6PA 1MO4A 1HKHA 5LQRA 1P91A 5HGXA 3ZOZA 2X8BA 2EBUA 5LB4A 3NONA 1ISFA 1WXQA 5HBRA 3BMOB 4YJFA 3U7JA 1Z29A 3M6LA 1KO5A 4HWSA 1DWOA 3LO8A 4HDNB 1JDPA 2XWQA 1LFDB 1VMAA 5EKSA 2QVZX 3EF1A 4LBYA 3BGWA 3WLFA 3TN7A 1P0PA 2P11A 3FMVA 5G02A 1XC7A 5BN3B 3KDPA 3ZOKA 1E5XA 5EJ6A 4EJSC 3L3BA 1JG1A 4A6PA 1WQ3A 3GJSA 2JVIA 3TTVA 4HGZA 2XZLA 4MI1A 1SBNE 4BVHA 3I53A 2BTQB 2RGUA 3DT9A 3KXPA 3W3ZB 2E0IA 2PKRA 3NASA 4M1KA 3TQFA 3WSTA 2P4UA 1MFPA 3WXMA 1RW4A 3JD0A 5H8WA 3A9VA 2FLWA 2IF0A 1P0IA 3F74A 1C1DA 1HEUA 5TEWA 1G4HA 5L7WA 4B6PA 2NXWA 4G24A 4GX0A 2BFPA 3PX3A 5FFNA 4OXXA 5BNFA 4JV5B 5CHEA 3ND6A 1Z0DA 2GPSA 4K87A 4TXHA 2XI4A 2HA3A 2HC9A 4R2JA 5EMMA 5K0SA 4YV1A 2QDKA 3N3AC 4TQGA 3VR2D 1W5EA 1CFJA 3TQQA 1P3JA 3UWMA 3EZXA 5TGTA 4BY9E 5B1YA 1TFUA 2MYTA 3T3PB 1A5ZA 2F4NA 3UAOA 5EFOA 1BEZA 3GOQA 3AEKB 4M1QA 3SZUA 2VBCA 3LPLA 2RHBA 4JLAA 4L5JA 4IQGA 4HLNA 5FI3A 1RQ2A 1W59A 4NJEA 2HBRA 2Q3JA 1PZNA 1LC0A 2EXXA 3R09A 3WMXA 2FSUA 4LF4B 1GNSA 4Q4DA 5DBOA 4ZU6X 5BSVA 4Q7QA 5ICGA 1ML4A 2Y92A 1DEOA 3RS4A 4JJ8A 3GMSA 4BVBA 2OAEA 4BNJA 1E3QA 3C43A 3GRFA 1HYBA 3OOEA 1OIWA 2MINB 2ZB2A 3T95A 3JQ8B 4RSGA 1K5DA 3OX1A 3GBVA 2Z5VA 3HP4A 1CVRA 3RHSA 3OZCA 1JLMA 4QFMA 3CEJA 3W6OA 4CMAA 4TTVA 1XKLA 4MVJA 3BHMA 3RRYA 2FDRA 1Z2AA 3DP7A 4YMUA 3ZTYA 3ZI7A 3L46A 4IG9A 2QXUA 4OATA 5DT2A 3EW9A 2C5SA 1X7ZB 3ESZA 1Q7GA 1N25A 1GPJA 1Z8FA 2JGFA 1CEXA 2KLBA 4AP5A 5EVCA 3E9RA 3GJ5A 4HB4A 1UOEA 1JBQA 1HTBA 1EJ6A 3HRHA 3D3WA 4YJFB 1FFWA 4YMVA 1CEEA 1JPNA 3FTPA 1IWOA 1JAZA 1ODIA 3OMLA 4FW8A 2XOKA 1KY2A 1O8CA 4MIYA 3UFXA 4YRMA 3SIWA 3L84A 3FYTA 4OJNA 3QJYA 2P4EA 4J16A 2AQKA 3JZMA 1CHNA 1E2NA 3ZZUA 4Y0AA 5ESDA 4ZCTA 1T34A 3OEYA 2KLHA 2IYNA 2WHPB 2DTEA 4LGMA 5K3AA 3FOEC 4JENA 4M2LA 1GGKA 1EJ0A 3PEUA 2H1WA 5DHRA 2E48A 2JGEA 2PH5A 2Q7XA 2ROQA 3DF7A 3PCXA 1YNOA 6PFKA 5FWXB 3FVQA 4ZKDA 3T7RA 4QIHA 3ZDZB 1QUEA 3BWBA 4NC9A 1ZUNA 4S1TA 3KUKA 1L7DA 2XBLA 2GVNA 3F8TA 1DX4A 1JFFB 4M0UA 5GJCA 1LBIA 1W46A 2RCYA 3KS9A 4D9EA 4LYHA 1ETUA 4UAJA 5I9LA 4JXZA 1O6FA 3GT0A 1MENA 1Z0JA 1SZJG 5AQEA 3HEBA 1P7VA 3P0HA 4R6XA 1PR4A 1WIWA 4G0PA 1F60A 4BV8A 2H7XA 2HLPA 1L7NA 3ESYA 2EJWA 2G07A 4N12A 3SBXA 5YASA 1S2LA 4D4MA 2XVZA 1GL7A 1OH8A 3ZCRA 4B4VA 1UZAA 1ND5A 1CQJA 3ZLBA 4QRDA 4WA8A 2HJHA 4LXTA 4BMDA 3NBZC 4CL0A 1PDWA 4UBOA 1JQJC 1RAGA 1T3SA 1L5MA 4YP0A 4F4IA 3BCSA 2OUIA 2B8WA 3C3EA 2I71A 3H1PA 3MOIA 1M34E 1NN0A 4JHXA 4Y67A 3V3KA 2SECE 4RKRA 1UXGA 1YULA 2I2DA 2ZRQA 3B9BA 3KL2A 1N7JA 1KFCB 2XYGA 4G1FA 3RUDA 5AI0A 1UAYA 2JFYA 2EARA 3BWDD 2JG3A 1AD2A 1QYWA 2AV6A 4RK6A 1U31A 2PUTA 2I4TA 2AN9A 3NOQA 2BGMA 2GA8A 4M98A 3HVRA 1M7GA 3OO1A 1AUQA 1LQ2A 4GP9A 4PS0A 2G04A 2ZQ5A 1L5YA 2PBRA 2PT6A 3UUGA 5HIKA 3LOPA 4Y2JA 1BC5A 1F3OA 3LQKA 5JAIA 2XKJE 1XNQB 3LIIA 5C9ZA 2FF5A 1UJ6A 1VG0B 3HYSA 4F46A 4MTLA 4XPIA 3R7SA 2AWNA 1E61A 5J63A 4AN1A 3RV4A 5HWSA 1W36B 4LN1A 3PWZA 2FSHA 2Q29A 2BH2A 4QBHA 2XA9A 5DYNA 2FG5A 3D7SA 4BE9A 2QTVA 1ELOA 4GFDA 4C2AA 1NFRA 1PJ3A 2NZ2A 4XJXA 1R6UA 4ZI7F 4DCPA 1KYZA 3M4NA 1AZWA 4DLTA 4HAWA 1YJCA 4A36A 5ESRA 2QMHA 2I34A 2WFLA 2RK6A 1TLTA 2Z4RA 2D2IA 3QF4A 3UGQA 4YRZA 1A88A 1YCFA 2FWNA 4LE2A 4PX3A 3P26A 4WHMA 3HYLA 5JSZB 4KHPB 1YSCA 1MO5A 4PONA 4RQAA 4UBNA 3WJ1A 2J08A 5AJUA 4ZRMA 4ZN6A 1NRWA 5K8LA 1EDZA 2NT4A 4ZYXA 4D4JA 1C4WA 4KITB 1RLUA 3ICOA 1YJ8A 3X2FA 1S8FA 1V48A 4IF6A 4K6HA 1Y8CA 2B6NA 3I09A 1STOA 3BFPA 4IRMA 4R01A 3IP6A 3VMMA 5J2UF 1GQSA 4JGGA 1FTGA 1E9DA 2Y1KA 5BUCA 4N9WA 4NS4A 1P1HA 4RD2A 3FUVA 1CQZA 5F1OA 1OH7A 2IW1A 4DCSA 2Y0DA 4HWKA 4LTDA 5K8IA 3GQBB 3H8VA 4D26A 1DAIA 2C7QA 2KSQA 4ZYZA 4NHEA 2WHPA 5BP7A 3GB9A 4HEQA 5CYGA 3GUYA 3LI2A 2ID7A 3MWDB 3NHYA 1SBHA 4TMFA 3LGXA 2VP0A 1C7RA 4UFOA 2I99A 4QTXA 1RRPA 4JBWA 4FSHA 4GAEA 2GHRA 1RM0A 2CC2A 3BBPA 1E1DA 4RETA 2HUNA 4C29A 4GPD1 4CWAA 4CMIB 2QSZA 4KOAA 3U4HA 4CRWB 1FW6A 1UEXC 3O4VA 1E9SA 1SC6A 3A3NA 3CQ9A 1EE1A 5SYNA 4C7MA 1JHOA 1M8PA 3CMCO 2GYUA 5KTRA 2E4YA 4OHVA 4WX2B 1UAGA 2HYIC 2GASA 1YL5A 3OQ1A 1WUJS 4TTTS 5AIBA 5KSYA 1RZUA 3P94A 3R4VA 5LZ2A 4BVLA 2FTKE 4CEJB 3ABOB 1T9BA 2XQJA 3H9UA 2PU5A 1IZ8A 4ZVVA 1T3ZA 5JQGA 5BQ5A 5K4HA 4M8KA 1FJHA 1TGYA 4MUAA 2ZRMA 3V34A 1AQJA 2W8ZA 5F9MA 4KU4A 3NRJA 4WZAA 1FJ2A 2QLLA 3GV0A 4FNMA 4LJLA 2VBGA 4FT4A 4P36A 2ZG6A 4BMZA 1E20A 3KEOA 4P34A 5CT6A 2WF5A 3VVCA 4GRIA 3C6ZA 3FNFA 4WOCA 1LPBB 5EAIA 1QGAA 4ACBA 2ZPAA 4UNSA 4AAYA 1U0OC 6REQB 5JSHA 4ZAZA 1S4MA 4MO9A 4TXNA 1ODJA 4G86A 1DQPA 3R9IA 4DLKA 1U3GA 3WGGA 2QG9A 3S2FA 3JWHA 1Y3DE 1W4BA 3I01A 4I9FA 3TLXA 1FLDA 3IJEB 4Y2HA 4C21A 1YVPA 1XRJA 2Y27A 5HUQA 1PR2A 3PNVA 4KEAA 2WU4A 3MS7A 2FXVA 4NQRA 4W1QA 5FORA 4WGGA 4YPVA 3HC7A 2C9CA 2HSDA 2X1MA 2DY0A 2FE1A 3QLUC 3QYPA 3GQBA 1C1DB 2HEGA 3MRTA 4B7XA 5DT9A 5JPCA 2Q6TA 3B8EA 1Z0ZA 4YCBA 2G4VA 5C34B 4H59A 3TTXA 4AJ2A 1T4CA 4YCDA 1WB5A 3FF1A 2FA9A 3MG9A 5FBHA 4ERXA 3I8XA 3DVQX 1OTYA 4W8HA 3WBFA 2VPWA 4FYWA 4YLYA 4GEGA 2KYRA 1NUAA 2Q50A 3IAUA 1U4OA 1S4QA 2DHCA 3G5UA 3ONDA 4MKZA 1HQCA 3IHLA 2Q0HA 1BH2A 3LW8A 4MPPA 4NAVA 3QWBA 4WD3A 5HMLA 3SEFA 3VJKA 3V8QA 2VC2B 1LVGA 5A7HA 4EEZA 2IS6A 3B1JA 3A6KA 2B8JA 2H7YA 3GHHA 1NYRA 3LLSA 3OCVA 5DTMA 3WIBA 5BV1A 3AY0A 4PZZA 4P4UA 1LQTA 3OZAA 2XGJA 3WXBA 1HT1E 3JD3A 2D1QA 3L8HA 3IV6A 5E3IA 4QEKA 4HNTA 1NPTO 1SC1A 4WRRA 2QL6A 2QRVB 5EUBA 2C2GA 3W9YA 5CIWA 1PD0A 2FZWA 3PTAA 4KXQA 2X3FA 1W0KA 1KU0A 1K7EB 1U2DC 4UC0A 2M6KA 3MT9A 2BW0A 1NYLA 4RZUA 2ILVA 3IAM6 1G4UR 4XFJA 1OB2A 1EEXB 4V1CA 3PDIA 5DOVA 1ULTA 2MSEB 3ZE1B 3M0EA 2P2ZA 1DTWB 4FNAA 1W6RA 4FEGA 1Z9BA 5F4ZA 4JB3A 3U4CA 2WNSA 3VPHA 3T1HB 3HJAA 2WNIA 2C99A 3BTUA 3QVGB 3U2QA 1ADCA 2ZU0C 4YRSA 2HHHB 1HXHA 4LC0A 4CV0A 5LN1A 2QTMA 4EHNA 3O3OB 4WFQA 2AZTA 3QFHA 4BGDA 1Y8AA 3ZCUA 5LKAA 3DAHA 3NUZA 3NBQA 3G82C 4HQKA 4URVR 2V5VA 2C83A 5IKMA 2V98A 1XSEA 4LMBA 4MLCA 1SCUA 1CTQA 2FJ0A 2ZJ4A 3CW8X 1PK8A 1N9KA 1PF7E 2ZAMA 4IDGA 2P5SA 1FFYA 2A0FA 1LLDA 2I6TA 3MK31 4Z86A 1I36A 4K81B 2WJHA 4OXRA 3WRYA 1M2KA 2IX3A 4F4DA 2X3YA 2GF2A 1NBOA 3KLPX 5CX1A 5JD4A 1J1IA 3R9KA 2Y77A 5GJVC 4CMEA 1DPFA 1M6VA 1ZGAA 3ZDEA 4RV9A 3W9UA 1T3GA 1TU4A 4FQ5A 1WV0A 2ATCA 2Z30A 4P0PB 3RC8A 3NBXX 4EKDA 1JXAA 2FCAA 4B3SB 5I4IA 5EZSA 1UPXA 2C78A 2XMSA 3OZTA 1YJXA 1A4XA 1NE2A 4JB0A 2OD2A 4D0GA 4C1NA 5HQTA 3WIVA 3OTWA 1XPUA 1J5XA 1U2DA 4FYHA 4LYYA 3P4UA 3BTVA 4GPTA 4PWYA 2OBLA 1Z88A 2P6NA 4HAOA 3WL6A 5F3WB 5AI9A 1O6CA 2GN2A 3ETCA 4ZIRA 2WWYA 3DAYA 4RTPA 2OL4A 4PYQA 3B9QA 1QRUA 4C2TA 4LTMA 1K3FA 3NNSA 1L5VA 1RQLA 1GZVA 3N8IA 2XNSA 2A0UA 4P7GA 4Z8XA 3R3UA 2P1DA 4B4DA 2X1VA 4BX3A 1V39A 2B21A 2R97A 2XJ9A 3EAFA 1EXNA 2IUUA 3RJ5A 3WMEA 5CITA 2W6JA 1RYZA 4FINA 4DA0A 1Z5NA 3CZCA 3TZKA 4KO1S 4E12A 1BDMA 3ZDFA 4REOA 3CLRD 3RYIA 2P78A 2HA6A 2X41A 4MGEA 1DT3A 5TPWB 1E79D 3B7PA 2JZOA 1Y4ZA 4V0NA 2BMEA 5KC9A 5LOVB 3TUZC 2ODQA 5EEGA 5HKLA 2HFKA 2V3CC 5A04A 4FCTA 4PYMA 3FWNA 4X94A 4NATA 3M4YA 5H9WA 2ZUWA 5CVVA 2EJTA 3A3YA 3A1UA 3DZKA 3GI1A 1BCSB 4XWTA 3OU6A 2C9DA 1QH1A 4KPYA 1HDIA 3L82B 1BWQA 1YZNA 1RKUA 2P9CA 5DNDA 1LV7A 3EGCA 1FP7A 3JQAB 2B7BA 4XASA 1PR6A 4AQYB 4QLBA 4X7BA 1MPXA 1KQFA 2IXFA 3RIMA 4XZ3A 4M9CA 2FRXA 3A7EA 2GEVA 3DL4A 3RWOA 4D56A 5CBKA 2ZJ5A 3GZJA 4EYKA 1HLPA 5I51A 4X6UA 1Y6FA 2BBWA 2V4MA 1SXHA 4XVQA 3RVRA 3BSWA 5AW1A 1N2IA 2IYWA 1RWBA 3PCTA 1N6HA 4RHXA 5DCYA 1UWVA 1C7QA 4TROA 4O4HF 3TD2A 1V1JA 1P19A 4Q39A 4F91B 4HH3C 1P0MA 4PFJA 5ELXA 1Q57A 1SBTA 4YRLA 2CT8A 3GXBA 1EFRD 1BQ3A 2Q46A 3BE6A 3AG5A 3EFOA 4GXRA 2ZS7A 4HMPA 4TKZA 4F8EA 5KSPA 2XA1A 3HI6A 3H16A 1EK6A 3E81A 3KAKA 2VTEA 1SBYA 2XEXA 3VV3A 1NI3A 1FRVA 3ZK7A 2W6ZA 5HRUA 3T7EA 1LGYA 4MWEA 3S68A 4DV4B 2EKQA 3CZPA 1CR6A 3WGUA 1GSHA 4PZAA 2FMHA 5CLIA 3L7OA 4KN9S 3E05A 4AECA 4MQ6A 5IX8A 3GRVA 3UFXB 1GKIA 2EV9A 2ZR9A 2HDNB 5J4KA 4LJ9A 2WILA 3O0TA 3CLKA 4O29A 3VKFA 2I8LA 3KG2A 4DWJA 2AVNA 3UMBA 2PMBA 2IH5A 3KEGA 4E3WA 1Y6ZA 3ZC3A 1PGNA 1KP3A 1V5WA 3ZY5A 5DSZA 1WW8A 5CURA 1R8SA 2CVPA 3AFHA 4II2A 4A8JC 2JFGA 2ZBPA 1G20E 4MI6A 4I5EA 4EK9A 2XX3A 4TM7A 5JLAA 5K0LA 4MJ3A 3FSRA 3UJNA 1QJ4A 5F52A 1VKOA 1AUXA 1B0PA 1T8TA 4TVOA 3TNFA 5KWSA 5K0JA 2E4ZA 2BEUA 1B16A 4ZJZA 1JEYA 3R77A 3OTOB 3HA3A 2PFGA 3U3ZA 5IP5A 4HX9A 3E9MA 3R0VA 2XSZD 5LP6C 3R5KA 4MS4B 3ZZMA 4CCWA 4NCBA 1C30B 5FRDA 3G0BA 1GRVA 1SY7A 3AUUA 3ZUPA 3H5NA 2Q4BA 1A7UA 4NNJA 1RJWA 1UBOS 3K35A 5HFNA 2GK7A 2NUAB 1PBNA 4PAMA 4XJVA 4LQLA 2O4UX 2WWVD 1J8YF 2NP6A 1PJZA 1KEKA 3FYUC 4EWLA 5AK5A 3W06A 1N3YA 1P2TA 1S3IA 3CN9A 2C3OA 2GYVA 3OZUA 3HVIA 4FB5A 4BB0A 4CKCB 3GJQA 1GSOA 5I3CA 5HKOA 3KVNA 4W8OA 1XTTA 4BMNA 4CFSA 6LDHA 1KO4A 2L17A 3WBKA 4A0QA 2IHBA 1TQ4A 4Q3CA 1IHYA 4Z1MD 5DU2A 4D1YA 3PXGA 5KPDA 3EXG2 2WJYA 2J87A 2A4MA 2ZREA 2AN3A 3EGIA 3OKPA 3K6SB 5FPTA 2BFAA 3P9YA 4QG3A 2ZIZA 4ZGBA 1CIPA 3EEOA 4I46A 4LBWA 4MAMA 1DG9A 3FHOA 3ZK9A 2OPBA 9GPBA 3GFQA 1SOAA 3G68A 3A05A 4FYKA 5KQSA 1Q20A 2CKDA 3NETA 1NJ5A 5GIOE 4RTLA 3M70A 1NE7A 2GJAA 3IH5A 1P7YA 5GZ1A 1V8FA 3DXYA 1ESEA 5E1DA 2JZNA 2XE8A 4KO8A 2A5YB 4BFZA 5LDDC 4TZTA 4DV1B 2OYCA 3U7QA 1SUFA 4ZYYA 2YZ7A 1EZZA 2R86A 3RTAA 1WXHA 4DLWA 3FUUA 5KTPA 1MABA 4JJ6A 5IXSA 2NQTA 2BH9A 3DEAA 4FJ1A 3KO8A 4G81A 1SR8A 3IAFA 4XWOA 4LYFA 4Q24A 1AV7A 1Q7EA 1NYQA 1UL1X 1A5AB 3FLAA 3USZA 4XAQA 4XUCA 1OFIA 3K0KA 4FFSA 1U7WA 4KX5A 2VH1A 4IDHA 1YI1A 5FOWA 4BGVA 4QT4A 2OFXA 4JQCA 2PN1A 3M4XA 4KGDA 3NANA 4RNDB 2VDLB 2XKKA 4PN3A 2QJRA 2VEDA 4BFXA 3VZBA 3RKUA 4UM8B 2BDTA 3GJTA 3SQDA 3WI7A 2VA8A 3FGZA 3B1YA 3ROTA 1KYTA 2A5DA 2IBMA 5EYPB 1YBFA 1FQWA 3ANXA 1AHIA 1WEKA 4E6EA 3DQQA 5JS8A 3KKLA 1CYDA 3AUYA 5DM1A 1BKDR 2XUDA 1JZSA 3UBMA 5I7WA 2G1UA 1W44A 3O94A 2E82A 4GDMA 3D6UA 4PG8A 1CUAA 1RHMA 3RG8A 4KB5A 3RFVA 1POXA 2H7VA 1C0IA 3ENZA 4L76A 3BGVA 5C4MA 3GGOA 3JAKA 4QUIA 2VRCD 4KO2S 5HKKA 3OOYA 1Z38A 1PYDA 2DE0X 3ETDA 3HVKA 4IEEA 3ZHYA 4TYWA 3LPCA 1PN3A 2QSJA 4TKVA 1UDAA 1G21A 4PS1A 4BLOA 4PVDA 1VYUA 2AC4A 3EGVA 3G89A 4LYGA 2G82A 4QQFA 5FTKA 3RS5A 5A5VA 5E7QA 4TTAA 3B85A 2HCFA 4QARA 3T5BA 1ZEJA 3TE7A 1PGPA 2NPFA 3A4IA 5K6RA 2QJWA 2WC1A 2PX5A 2ZTHA 1XVIA 2XWBF 2GF0A 1T9GR 4AX4A 3G13A 3BTSA 3KSAC 5DHAA 3N7AA 4U2EA 3F6YA 3NWEA 1U1DA 1RU3A 1TEXA 1U2GA 1OGJA 3AM5A 2BHNA 1C9MA 1S6YA 1CUYA 2JGLA 4K3UA 3MA0A 3MUOA 4TWIA 3UEOA 4C5AA 3ONWA 1EU1A 4L8GA 5BN5A 1Y7PA 2IOYA 3D8NA 4NEQA 4TWJA 3M3HA 1GZDA 4AUMA 1JJBA 2QV0A 4QUBA 1RQ7A 1YMQA 3AYXB 4UVIA 3RKSA 3ORFA 3N0RA 4JX8A 1EJBA 2VYCA 5JJIA 3BL5A 4H0FA 2ID9A 3A58B 2CHVA 1UZNA 4WCFC 3W2IA 2HOQA 3USES 1G8GA 2CMDA 3DVAB 2JGIA 4G5HA 2RIRA 2NP7A 3QQ5A 4G65A 2X4GA 3Q7QA 4TZ0A 3ZX5A 2OCGA 1XTQA 4ZVTA 3Q3HA 4JMPA 4K9LA 4ZI5A 1FDRA 4JC8A 1BS2A 4DYHA 4QLAA 5FX2A 5T8KA 1M8KA 4BU0A 5IXJA 4XPIB 1WO8A 1EVZA 1CJBA 3PQFA 1AQ6A 4NESA 1OZAA 2F1IA 2J9XB 3TAHA 1KOJA 3QIAA 4WOKA 5AJXA 1V96A 1RI4A 3BMCB 4G0NA 3BWVA 4F06A 4DUZB 4P7KA 1JEDA 5MFPA 1Z07A 1E1MA 1NMEA 2WM2A 3KR2A 4GD3Q 2GHTA 5D3ZA 4DSZA 2XUHA 4RD6A 1BQ4A 3JD4A 4UHFA 3T7SA 3ADPA 1ISPA 1PFQA 3BOSA 4OHZA 2VYQA 1ZN9A 1FDIA 1H1LB 1N2CE 3HVJA 3L6CA 3PTLA 4QFCA 5L7TA 1LQUA 2QVCA 2X13A 4JITA 4R2HA 2QN9A 4KAJA 5K8CA 1TKCA 4H77A 4CKEB 2DC1A 3QVLA 3ISTA 2ILTA 1IN5A 3JU3A 5JDCA 3LDHA 2DFPA 2V7TA 3TYXA 3UY4A 1JQEA 5L7YA 3AXSA 3ZS9A 3MUNA 4ASUD 5ILOA 3IOYA 3O9ZA 3P2IA 3TOZA 5JI3E 4JLJA 3EXG1 3FBGA 4IWYA 1XHFA 1DAOA 5FBZA 1NLMA 3KZCA 2XQVA 4ZARA 3AY3A 2GJ4A 3ZBTA 4PN7A 4D9IA 4IXDA 4D57A 3KCNA 1RJ9A 1WU8A 3A9RA 3CKLA 4I5DA 4X6YA 1ST3A 4U3JA 2M2IA 4UUAA 3OSZA 2B20A 4J3FA 1B6RA 1LD3A 1II0A 1KO1A 4WZZA 1PJAA 4LF7B 2D5LA 4O4JF 1E5LA 2GF9A 3LYUA 5DOZA 1QIGA 4QOJA 3HGMA 1GZ3A 2QMZA 5B3JC 3TL2A 2QGFA 2DFVA 3A9CA 4GL2A 3JWJA 4HHEA 1CY4A 1FK8A 4MO2A 3TSZA 2OLEA 4EMUA 4FGKA 4I9UA 2FFRA 4EUFA 9LDBA 3C3MA 3JCZA 3BH7A 3NUGA 4DKJA 3Q6IA 3THYA 4GX5A 1M1ZA 4I1YA 1WOYA 1YVUA 1REQA 3PUXA 1ZL2A 4PLGA 5JZVA 2R6ZA 4LI3X 5IKOA 1H5UA 3DB2A 1WLSA 1I7DA 4QFDA 1H42A 1SA0B 1F0YA 1X1TA 3IPRA 4G1CA 3C5EA 3PNOA 3W9SA 5C3MA 4TYMA 4GE3A 4V0RA 2UUBB 4P08A 5ADHA 1Y48E 3RTCA 1VKZA 1KETA 2Z3WA 4C08A 3BF7A 3ZKAA 3PZBA 5IZCC 4LYEA 4J1QA 1DELA 4BECA 4F5WA 2WWHA 1AN0A 2JFUA 4INJA 4LHYA 2AXPA 2RHWA 4OOEA 4EFLA 4R4JA 1CZKA 1EGHA 1I6KA 1QG4A 1T1SA 2BGUA 2ODPA 4QO8A 2J4FA 3L7AA 5HCUA 3C3CA 4IDEA 3FPEA 2QUJA 4MV4A 3ADDA 3GFOA 1KO7A 1AKQA 1WSBA 2QY9A 1W5TA 3OETA 4HDKA 3CCCA 1RWWA 3U1TA 1YT5A 3CEPB 1EFKA 3RABA 3KTFA 1TU3A 1KAQA 4H60A 4WXPA 3ZU4A 4MR8A 5GVSA 1I51A 2P68A 4R8VA 3IPAA 3IA2A 1CIVA 1V8BA 3W2TA 1F4PA 2X4DA 3G8DA 4CCYB 4MUGA 2O8FA 4U7GA 4CTNA 1H1LA 5ALMA 3R5TA 3V2HA 4L57A 2HREA 1G6OA 3OIUA 2DR0A 3FWPA 4EY5A 1XAIA 3S28A 2OD9A 1GTMA 3MLBA 4OL9A 1O97D 4YH1A 1KFEB 3RJZA 1NPDA 5KJFA 3GAFA 2G8NA 2HN9A 1GV1A 4LOIA 3UJBA 4BNKA 1YBVA 1E99A 2C5AA 2R8YA 3UHJA 1FXWF 1BJRE 1PO7A 2V0CA 2EGHA 3A9WA 2WY2D 1CY2A 1BD4A 1ZW6A 3H42B 1RZ3A 5DNUA 1YL6A 4LZPA 3M9WA 5KMGB 1Y7IA 1E66A 3HY6A 1A96A 4X7MA 3WK7A 3IIEA 1ZK2A 1GU0A 1KYVA 4P3PA 3SEZA 3RK0A 4EG0A 4D4GA 4QQ8A 5IWAB 1SXJD 3G5TA 2X5KO 4GZ6A 4C7VA 4XVUA 1H4SA 2QJTA 3HJGA 2B5WA 3RTGA 3PFBA 1KK0A 1RTKA 2BHRA 1XZQA 4YMWA 1JU3A 3OZIA 3CWQA 4WKNA 3PGKA 5K5EA 2I67A 1YS7A 5KWEA 4X64B 2XDQB 2NXNA 5F98A 5EHQA 2R7MA 2FPRA 4KUGA 2VHQA 1A2BA 4PXYA 1QYDA 4YUAA 5CM9C 1CKEA 5KU1A 1H6AA 2GNPA 1WV1A 1A2OA 2FZCA 3PFGA 4G67A 4MB2A 1XA4A 3RYIB 5HKAA 1VTKA 4WBNF 1SVUA 1AQYA 1OWLA 2MSLA 2ZS9A 3MSCA 2WJAA 1ZD1A 3JQFA 3QYFA 4NZ9A 4V0KA 3AR8A 3RUCA 1J21A 4IVRA 2ZTMA 4ESEA 1WU7A 3GY0A 3VC2A 3OZFA 1ORHA 4ENPA 1U2QA 3WSVA 1EINA 1OAKA 1WXXA 1L4LA 3JWPA 2J6IA 3L41A 1TIKA 4ISCA 4KXNA 5DX1A 1RVV1 4XQGA 5A5FA 3ASVA 4K8OA 4S05A 1RPZA 2NNWB 3IPYA 1BJTA 1NN5A 5AI4A 4HNQA 1YB6A 2DSNA 1XN1A 3BRWA 4YDRA 3N3BC 2IP4A 1U2TA 4AJLA 1A95A 2VRWA 3IP1A 3JD1A 1CR1A 5EIAA 2OAQ1 3UCXA 4LJAA 4XLLA 2FUKA 1D09A 4FIZA 4IDFA 4YDQA 4YAUA 5JW6A 4XB1A 4CF4A 1WR8A 1N7GA 3L02A 4RA9A 5I45A 1MUUA 1OC2A 4YV7A 4BDTA 1KZ6A 4RMHA 2AX3A 2SHKA 3E70C 1W4AA 3O8QA 5AHWA 3PLNA 1QP7A 1NXXA 4OSPA 3WLPA 2E5LB 1BMFA 5EJ2A 4P53A 5AVOA 2WU0A 4RHUA 2W2KB 1NUSA 3WMRA 3DMDA 3HO1A 4FFDA 1LVUA 4J8PA 4OI4A 5KREA 3INTA 4BLRA 1M83A 1N1EA 1E0DA 3FTNA 3GUUA 4FLMA 1QB7A 3T99A 5A9SA 3LQYA 2ZUEA 4B3RB 3EVEA 3N9IA 2CDCA 2CVFA 2I3AA 1OBVA 2JJ2D 3GNQA 2OXFA 3T3HA 1EWYA 5KNDH 3D54D 3GUZA 2GBGA 1ZCAA 4A2PA 1I24A 1R4MB 2O1SA 4FFNA 2NXEA 4JU8A 1JHQA 1JR3E 1NA5A 1Y7HA 2Q7DA 1JR4A 1PT5A 3WR5A 1EAYA 2DYKA 5CEJA 3ELYA 1DOAA 1F5SA 1E9FA 2FSVA 2PS1A 1Z5VA 3T9AA 1HLDA 4BAZA 4EYQA 4LEIA 5HQ3A 2QN1A 4XIIA 4DAEA 1YJ5A 3H17A 4PC7A 4Q9HA 1UDCA 1VLHA 2B4KA 1OVGA 2EX1A 3AEUB 5D3MA 5JHGB 5AVQA 1UBNA 3LP5A 1JR2A 2G63A 4RHFA 1SWVA 1NY6A 3P2OA 3UG7A 4HAUA 1K8QA 1KYQA 1JT9A 3B12A 3PFWO 2D1RA 2HRRA 5HMMA 5D6NA 3STYA 1SHUX 2D8MA 2XKAA 2Z58A 2BE7A 3RS8A 3F96A 5K0EA 3PGVA 5BSUA 2PRKA 2FX3A 2ZBRA 1ZNQO 4A2CA 3O31A 1C1YA 1TMOA 3AFOA 4R1QA 5LR6A 4H0NA 1N32B 1J42A 3VR6D 2WPDA 2FFBA 2J09A 1IWBB 3UMGA 4YHBA 3G1UA 3LC0A 4B32A 1K27A 3PEEA 5HUHA 4I4NA 2O2HA 4G0WA 1EUDA 2PR7A 1D6JA 3PPWA 4A4DA 3LM8A 4V1CB 3K6KA 3LCRA 4KXLA 2YQZA 3H4IA 2DXIA 1XDUA 3D4LA 1N7IA 2ZTVA 4L28A 4L6CA 4LVNA 4PFSA 4RGVA 1O6GA 3WK9A 1Q77A 2SKDA 3GMDA 4DDMA 2HR1A 3FSEA 3UK2A 3ASZA 3K72B 1FYXA 4BNGA 3IMKA 3KUCA 4OHRA 2WIDA 4MS4A 1G5RA 2F1HA 2OXRA 1V3TA 2ORIA 4WZBE 3MYRA 2JIMA 3L49A 1U0JA 3H2GA 1LNSA 4G63A 4MVJH 5F3RA 1SJ9A 6GPBA 5CLLA 3OIWA 4YAGA 5JBNA 1PGOA 1N92A 4DZRA 3WFZA 1OFHA 3MLEA 3FMGA 3KD3A 4JJAA 3NKFA 3FMOB 4US0R 2AW3A 4W7HA 3WK8A 4ZAFA 2PMKA 1L5NA 1HDCA 3TOCA 5AW3A 4BGUA 3SSOA 4B31A 2F48A 1XZNA 3HY4A 1XVTA 2R751 3AHDA 4MQ5A 1BMQA 2CYCA 1MZPA 5DXFA 4BEJA 4X3CA 1V2GA 2PL3A 2AK3A 5D85A 4TLBA 5DIFA 2P6PA 3L7BA 1E0KA 3V8BA 2PZFA 2HKIA 3EEFA 3NBYC 3UWOA 3S7ZA 1MT3A 4CJXA 2Q5CA 2IPAB 2XGMA 3FCYA 5BT8A 5TLSA 1SIUA 5BYBA 1PKEA 3AR7A 3KX2A 4FD2A 1C30A 4FOOA 2B2XA 2PL1A 4FIDA 4V3BA 1TZBA 1XAJA 2XZOA 3BSFA 5K0CA 3G17A 4R05A 2O8DA 1JB9A 3KU4A 1VGVA 2SCUB 1RBYA 3IRUA 3IT3A 4ZHQF 3MWYW 5ALRA 3BFKA 3IKVA 5I7HA 1VG1A 3QEBZ 2AZ4A 1FYWA 3BQMB 2OE2A 3ND8A 3OJ0A 5AHKA 1PQPA 1LF5A 1CQXA 1IAQA 3TX2A 3K8ZA 1TUEA 5DRYA 1DAMA 3E4CA 4KK3A 2VYNA 5FPKA 1YDHA 2ZAGA 2GKOA 3WLIA 4Z4HA 4ZANA 1L7AA 1JUDA 1RMYA 1T8WA 3NTXA 4AFNA 2Q2WA 3D7LA 3GZNA 3K8OE 3NKVA 5EP2A 2W4QA 1U5CA 5ITSA 1B8V<