4XGRA

Crystal structure of addiction module from mycobacterial species
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
128
Chain Sequence
MMVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/antitoxin
molecule keywords Ribonuclease VapC30
publication title Structural and functional studies of the Mycobacterium tuberculosis VapBC30 toxin-antitoxin system: implications for the design of novel antimicrobial peptides
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 39
structure length 128
sequence length 132
chains with identical sequence C, E, G
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4xgrA00
1TFRA 3IX7A 3QEAZ 3ZDBA 1RXVA 3H7IA 2H1OA 2FE1A 4WA8A 3TNDA 5HMMA 3I8OA 1UT8A 3ZDAA 3QE9Y 1UT5A 3QEBZ 1TAUA 5ECYA 1A76A 2MDTA 1XO1A 3Q8KA 1RXWA 5ECDA 1UL1X 3H8JA 1O4WA 3ZVKA 3ORYA 2HWYA 3H8SA 1BGXT 5K8JB 5HMLA 5H4HA 1TAQA 3ZDDA 2DOKA 5ED0A 3ZDCA 3ZD8A 1V96A 3Q8LA 3DBOB 2HWWA 2LCQA 4XGRA 5L6MB 5ECWA 2BSQA 3Q8MA 3H8WA 1YE5A 2IZOA 4XGQA 4MJ7A 5SV2A 1B43A 2HWXA 4CHGA 1Y82A 1EXNA 1W8IA 2WP8J 2H1CA 5FV7A 5L6LB 5HNKA 2QIPA 3ZD9A 1V8PA 5H4GA 1V8OA 5HP4A 2IHNA 1MC8A 3ZDEA 1A77A 3H87A
chains in the Genus database with same CATH superfamily
3G89A 1M1UA 3PNKA 2P40A 2ECOA 3GOQA 5JFOA 1KPGA 4RF2A 4FFBA 1VCMA 2O1XA 1SUEA 4ZYZA 2IS2A 5I7RA 2X5KO 2H9AA 1XXLA 4URWR 4G8JA 3QLEA 4F7WA 3UXHA 3OX2A 2GCOA 3VPSA 4FN5A 3R20A 1OTYA 1UMBA 2C9DA 2ZBVA 2P0EA 4N0MA 1X94A 3ST7A 4BY9E 1DIRA 1Y6FA 3S4YA 4GO1A 3H99A 3TRJA 4BU0A 6ADHA 3ZZTA 3A27A 1BZYA 1MORA 5DBEX 4MS4B 1IQRA 2HZ7A 4RDXA 1SQSA 4PZ9A 1PV1A 1Z2CA 3MHTA 1G2IA 2PMFA 4HRVA 4WCDA 1G21A 1SG0A 3OJXA 2FUG1 4IAOA 1U3TA 3A6KA 4QTYA 2ZIAA 1P0MA 2V4UA 3D3JA 1KMHA 2V98A 4QVGA 3KJEA 4UM8B 4UQPA 2B20A 4DOMA 5A5EA 4GOMD 1L7XA 1SXIA 4WFJA 4XX1A 1HQCA 1CZHA 1GAJA 4R7GA 3BK7A 4XRGA 4UEJA 1LU9A 5EY5B 4RFSA 1CY2A 3BWDD 5DWVA 5DI9A 1K86A 1UDBA 1N77A 2CD9A 3KKNA 3CE9A 3KWMA 3Q7PA 3P0EA 2WFZA 4RH3A 2ID4A 4RVUA 2X4IA 1N33B 1KFCB 2QW8A 1T1IA 2Q5JA 2VP4A 3NOOA 2XW6A 2WU8A 2MINB 5BVHA 1QHNA 2H5EA 1E6MA 1GZ4A 4KXQA 4WFIA 1NF8A 2O8CA 3OCVA 1A5ZA 1E9VA 4O2AF 4Q5IA 5FX2A 3FFWA 4K88A 1DEXA 3PVZA 5DYTA 1B0PA 4CDNA 1WZCA 5JJ5A 4KR6A 1NUTA 4MVJI 1K1EA 4OMUA 4RVSA 3FLEA 1YQDA 3ZV6A 1RM3A 3GZ4A 4XGRA 1EZ1A 4GKVA 1T2AA 3CX3A 2H4YA 1P0PA 2BSQA 1HYBA 4C7JA 2ZKLA 4KACA 4BLQA 4RQAA 5JY6A 4QM7A 5C35A 3B9QA 1RPJA 4BXOA 2PZLA 4YQFA 4AQDA 3OZCA 1T6ZA 2YYZA 3NKLA 1HE1C 4V03A 3T0GA 1JHZA 5K3BA 1R16A 3X2FA 2I1VB 3MOSA 4M37A 4WLVA 2C96A 3BH7A 1I2BA 3W9SA 4NS4A 5IF9A 3OOHA 4HDRA 4R1NA 3W3AA 1W8IA 3FNBA 1OCEA 1GAXA 1BU5A 1ZSYA 1ZICA 1OVMA 2E4AA 1GQRA 2ICAA 4PHCA 2W42A 4LMBA 3UJ3X 2IYXA 1E5QA 5KPDA 1W4LA 3BHJA 5DSTA 3GZNA 5IDXA 1CZLA 3T1VA 4UXIA 3BYZA 4HB4A 1N2IA 3WGTA 2GXUA 4KFUA 5IFLA 1PR4A 3IO3A 1XR3A 3R5JA 5IYZA 2I6FA 4FFVA 3PXXA 3VV2A 4KJXA 4DQUA 4F11A 2ZR9A 2X5OA 3ETCA 5LQJA 3LKZA 3R3ZA 4J16A 2GQ0A 3X3HA 3WGHA 1QVZA 4YRMA 3EAFA 3AVWA 1X1CA 4B6OA 1T1RA 1KTIA 1MAAA 3JTMA 3F6BX 3H7AA 4AW9A 3EVDA 1I3LA 1TVEA 4FSDA 2A58A 3S40A 4KQIA 2P8SA 1UINA 3ER9A 1MQ9A 4QYIB 4OTZA 1CW2B 3NVDA 3BFVA 3KLOA 1G5HA 3EG5A 5F73A 3EEFA 4AJNA 1EINA 1ZL0A 4C20A 1NAHA 1E2UA 5HYVA 1BKYA 3REOA 2FEOA 521PA 1QV7A 1R1DA 4ZVNA 1T3ZA 2JGDB 4K9KA 3RB8A 3K0CC 1N6LA 1W0KD 1QAMA 1RFGE 3CW8X 1Y7IA 1F7VA 2IK8A 1OX6A 3HRIA 1XNJA 2VZLA 4F5WA 3G0BA 4UU0A 1LBEA 1WHSA 4M0KA 2EIHA 4A2PA 2W6MA 4PHTA 5F21A 2XRMA 4C5AA 1CLUA 2OFFA 1KBQA 5ISMA 4N6NA 1PDWA 5B6IA 5C2JB 5C8XA 4CIAA 3AERA 1QZXA 1FF9A 3DONA 1QCZA 2FZKA 3KLMX 3KR1A 4TWJA 3T5DA 4EEKA 2JA1A 3PNSA 1N36B 2HFJA 3RKSA 1LD3A 2WJZB 4QNRA 3WLNA 4BNTA 1QF7A 3LPCA 2GWHA 2WM8A 3D2AA 5ALNA 3GPIA 4YREA 2XOXA 2DUWA 3M9WA 4PYMA 1GTZA 4TVKA 3OOWA 1YS4A 1ULZA 4W5HA 4X3PA 2ODNA 4UULA 4P36A 5F2NA 4YPOA 3GN2A 3TRKA 4KO4S 4D4JA 4K6GA 3UOAB 2XIJA 2ZSEA 2AFIE 4HTFB 3O7MA 5F3DA 2OC4A 2XMZA 5ED0A 1P1KA 1YZNA 2QXUA 3COVA 4WCVA 2ERXA 1TVKB 1NRJB 2AG0A 2J5BA 3HXPA 1GDHA 3ITDA 3JQ8B 3LE8A 4XB1A 2WFLB 2YFQA 5DTRA 4RKRA 3CG4A 1IC6A 4LGVA 3QW4B 2I6GA 1M6VB 4CMIA 1GQFA 4BGEA 1ZUHA 3HM9A 3ZD7A 5L7TA 2WSIA 4IDAA 4JJKA 1M34B 3RAFC 3H8WA 3ZW8A 1L7NA 4H7HA 4W5WA 1RMTA 5L40A 4H6WA 3PFWO 1PN3A 1W34A 2BBOA 4FUQA 4XIFA 4W7SA 3VDQA 2JFUA 3DOOA 1E2NA 4FYJA 2FQWA 4B0OA 1AS3A 1Z45A 4BE7B 1LGYA 1M8GA 1LF5A 2VUHB 2R8RA 2XQJA 4HEA1 2DX7A 3DXFA 3LFUA 4ID3A 4N3AA 3STUA 3ICQB 1GUFA 1GPBA 4KSCA 5KC8A 1NN1A 4HWKA 3WIBA 1H0RA 1BW9A 3AF1A 4HQOA 3O94A 5INTA 1BROA 3PEWA 2ECFA 5K0ZA 2HIHA 2OYRA 4JDPA 1UDRA 3TUIC 2OFPA 3T7CA 2Q3BA 3ZE1B 4CNBA 5CFLA 4H9GA 3FCSB 3GLIB 2YUTA 1YFZA 1JLSA 2YNMD 3CA8A 4LJKA 4CQLB 4EPXA 1QV6A 2P4UA 1YI0A 4YRBA 4GKKB 4GSYA 3W5SA 3TK1A 3HR7A 2C2MA 4KR2A 2P6MA 1MP0A 1ZUNA 3TL2A 2O7SA 3VZPA 2MR5A 1L5QA 4DNXA 4KZKA 3QFTA 5BV2P 3ZKAA 4OLJA 4B3TB 4CLRB 1Z7BA 2Y1GA 4WN3A 3M6AA 4UEOA 4X9XA 4QOJA 4RY2A 5KDDA 4JLNA 4R1MA 1L4UA 2P9EA 2ZIXA 1UBOS 3FSJX 3JTEA 3KOXA 2DT8A 1DPGA 1Z5OA 2RHTA 1XKTA 3MOGA 1G291 2X42A 3CPSA 4TXLA 5CITA 1P2UA 2FPPB 3WSTA 5KTSA 3KPWA 5LQSA 2DWUA 1QAOA 4BLPA 4EYKA 2YRWA 1AKUA 2XWQA 2C5EA 4XM2A 5FPSA 3OVMA 3RABA 1GQ2A 4MARA 3SVZA 1EGHA 1ZNWA 3I76A 3R09A 1CF2O 1SUSA 3QI7A 2DG2A 2QSYA 2RHMA 2V7WA 5IKPA 4QA9A 4I1IA 3ZI0A 1Z26A 3VKUA 4I1OA 1KGDA 5EJ7A 3FOEC 1F60A 2YIDA 2PEYA 2VDOB 1NHGA 3L9XA 3MAGA 3SX4A 1RIFA 3I8OA 5EESA 3OJFA 4I36A 1QG0A 4IPTA 4BB5A 3SAJA 4EKGA 2BR5A 1WBBA 3W2FA 3VPGA 3RDPA 4MQMA 2YOGA 4JI1B 2AMFA 1KBZA 1OREA 4WEQA 2J3QA 1VE6A 3GEPA 3ANXA 3H6HA 4R41A 5LP6F 1LRJA 4FHGA 4OAPA 1I3KA 1DWUA 2ZB7A 4JUAA 3EWAA 4HFRA 4RD6A 1D2EA 1V6AA 1G3IA 1IXZA 2XUFA 4BVFA 2C7VA 5F64A 3S44A 2ZIUB 1J0AA 1TA0A 2XCIA 1G60A 5T6BA 3SDBA 3MTAA 3ZWXA 1FW8A 4IV0A 2JKYA 3DR5A 3PQEA 1AJEA 1UOOA 2QV7A 3PNVA 3WK4A 2BFEA 2WQ6A 1SVSA 1T5DX 3CNHA 5T57A 3STXA 4D97A 5T4EA 5BYJA 4DQKA 4QT4A 1JDZA 3EOZA 2C8LA 5L7WA 1WCXA 2XYVA 1DQNA 4MUHA 1KJYA 5H68A 3JYLA 2JKZA 2WUVA 3FZGA 1SCBA 1QHHA 1OHHD 4D2IA 5LP1A 1EWKA 2WVJA 1BHQ1 1J25A 4PGFA 4K9SA 1RIIA 4Q34A 2GETA 3AF3A 3N0TA 4H7KA 4AF7A 2YV2A 4YRSA 1CS4C 3ADOA 3LQQA 3COJA 1E9SA 1SB9A 3WRXC 4ARVA 3KYCB 1P2FA 4GMDA 2W2OA 4KWIA 1V1MA 3PEVA 4B7ZA 3VR2D 1CB0A 1GITA 4O1HA 1HE4A 4C3UA 3L8EA 3K4PA 1ZIDA 1NSTA 1LPMA 3RBVA 3N07A 4ZT2A 4OY3A 1U0GA 2VPTA 5TMPA 1P9WA 3H2BA 3PV0A 5ALHA 2PCLA 3F0TA 4KFTA 2PVCA 4TTPA 1QX4A 1WXFA 3SSNA 1DINA 1IM5A 3OKAA 4I55A 1UMCB 4X8MA 1O1YA 3BXHA 2WHEA 4DYHA 4EBFA 2Y0BA 1Y7TA 5IPFA 4U3JA 5KU7A 1Y8QB 4ZAXA 1UZNA 4GOLD 3V7NA 4QOHA 3NM5A 1QHYA 3EGDA 3G13A 4MWZA 4RANA 5KIAA 3C6BA 3WE7A 4GKBA 4DR2B 5IVIA 1BJRE 4AN4A 3WBJA 4NOMA 5DU2A 3ROZA 4MIOA 3LBYA 2QM8A 4JVLA 4F4JA 3AVTA 1Y3HA 3W6UA 4Q3KA 5LBUA 1YR8A 2DR2A 5IM5A 1NWCA 4J29A 3LC1O 2QENA 3ETHA 4H7PA 4LNHA 4WNAB 4H77A 3T1HB 5HR5A 3LUAA 3O2SB 1BDHA 3K0AB 4GYYA 1DTEA 4DMGA 5IZCC 3NOQA 2BL4A 2PGAA 4KPUB 1ULSA 4J2TA 2C04A 1CFJA 2W98A 4N39A 3JARB 4G4SP 5EMNA 4XARA 5ER9A 2I7VA 1CJTC 1YR2A 5CVUA 4G65A 3KD3A 5TS3A 1WXIA 5IABA 4KKXB 1ZONA 3DAHA 4C08A 4YFVA 3MWEA 3LUFA 2QORA 3G2MA 1N2CB 2EQ5A 2H2WA 3ZQ6A 2NO9A 4UEWA 4RK1A 1EXWA 1SG6A 1WE2A 1FXUA 2NSDA 2XY4A 3GMIA 3CNQS 4U7JA 5CP8A 2FWJA 2Q3CA 4Q3NA 3R7WB 2DLNA 1G2QA 2O7RA 3ZZMA 5M7EA 3TJMA 5CJPA 4IIJB 1XLTA 2QMEA 1GP2A 2OXEA 3V4ZA 4BMDA 2QTRA 3W8EA 1OYVA 3AL3A 2NQTA 5DT2A 2VP0A 1ISRA 3DYBA 3QVOA 2WABA 1PYGA 3HN6A 1YU6A 4N4AA 3LCRA 1F4LA 4JC4A 1QH1A 5TV2A 4YDQA 2IBMA 1P7VA 3T7EA 1VLJA 4AMBA 4UVIA 4ZCLA 1TYCA 4KO2S 4RDHA 4EJ0A 3TGLA 1M7HA 3KEFA 4Z0NA 4H3SA 4D6XA 1XMQB 3ZLBA 1O5TA 5LMZA 3ZK8A 3BEDA 3LFHA 2AFRA 2FETA 1N0IA 2OV4A 2CXHA 4RXTA 5T8KA 1YDFA 1ZVQA 1PU2A 1T4GA 2HOQA 3QUQA 2BAGA 2YNMA 4IGKA 1HZZA 4KPEC 1W96A 4F3KA 2XSZD 1AF7A 1XDDA 4BPRA 4CUKA 3C7AA 4BQIA 5BSEA 3R0VA 4AJPA 3R5FA 2Z04A 1DIBA 1ZGGA 4BO2A 2VOEA 4YRAA 2HWWA 5DWDA 3NHAA 3G2JA 2VN8A 4JLOA 3A3PA 1WZNA 3EXHB 4L8GA 1ZRHA 5SY6A 1Y1SA 4KFRA 1NKVA 1RDFA 2GPWA 3P97A 4H6PA 3VNQA 3NT5A 1W1UA 3VPFA 1JILA 1I4DD 4PLGA 3A05A 1OFVA 2LWIA 2YVAA 5B36A 1IZ9A 4IP0A 4XGQA 3SQLA 3CH6A 3LPAA 3E84A 2GBPA 1XHLA 3HHPA 1RC8A 4JSYA 1T2VA 3EXG2 3TW8A 1X6VA 4Q37A 3AF6A 1Q1BA 2HLNA 3N7UA 3NDIA 1GVHA 1XNHA 2WTEA 3EIEA 4HGNA 4YUYA 2VF2A 4ALIA 5F7XA 1QH8A 4EKNB 1P7PA 5AXDA 1EAMA 4KQ9A 4RNDB 4U9IS 3HWX1 4OGFA 2OM6A 2IZ5A 1TRHA 4IRMA 1ODIA 1LSUA 4M8KA 4XEHA 5G1NA 3CX8A 1GUDA 4LJ6A 1A9OA 2FWPA 2CNWD 4X63A 2WKPA 2W83A 4MR7B 2NXJA 4BMCA 1G41A 1E79D 4QVKA 1H8EA 4E31A 3HABA 3IVGA 1MX1A 4GPIB 4ZXFA 3OOYA 1PGOA 4A3SA 1QKJA 5JMWA 1ZJYA 1Y1RA 3LY5A 2JIDA 4XIJA 4HXGA 3SLRA 4GP6A 3E8XA 4IXNA 5SY4A 5TQJA 3RVJA 5FV4A 4FLMA 1AG9A 3EPRA 1P4RA 3SOZA 1G8SA 2FZVA 2Q8NA 4ZCTA 5DLYA 3WNBA 1X14A 3E0QA 2GN2A 3WLPA 1J0CA 1IY1A 4HK4A 2R9VA 1OH8A 3T9DA 3IT0A 4MV1A 5EUMA 4BN4A 3ZJVA 2PUAA 2WZBA 4M4SA 2ZT5A 1OJ7A 1JFLA 4U2BA 3B5IA 3AQIA 2PUDA 4HVCA 1SWWA 4HCJA 1NVMB 4L15A 4O0MA 4XFJA 4FWIB 3ZJ4A 1OU0A 3GZTB 1PR2A 2FY8A 3IBSA 3LY9A 5AM5A 5LDHA 2GZ2A 3FCAA 5BSVA 1Y9EA 4M98A 4R8VA 4DW8A 5D01A 1KHHA 2F64A 4IMRA 2X22A 1Y6ZA 3I2GA 1FNDA 1XEFA 3FBGA 3TIXB 2QNBA 3QLVC 3JPYA 3L6BA 3QA3E 3SQOA 2WJWA 3OWXA 4F96A 4Y30A 4ZWNA 3QBTA 3H9GA 4LJAA 5SYAA 4F5ZA 2VO1A 4V1CI 5JY1A 3JYOA 1ZOLA 2WSYB 4YO7A 2A4MA 3L0IB 3RIGA 2C8VA 4JP3A 2GYUA 5KWEA 1YS6A 3IKVA 3WIDA 1B8PA 5BNIA 3M6WA 4FFRA 4JX8A 3WXBA 4NBWA 1O77A 4PPYA 2JG3A 2BVNA 2JZNA 1IBKB 1XCOA 3R3VA 4S2EA 4KFCA 3BSSA 3DCYA 2I4RA 5JAOA 2KQUA 3SKYA 3M1AA 3HJNA 1WXXA 3V55A 1SUAA 2QX9A 1N2JA 4WZAE 3CN7A 3IEPA 4OU4A 2CNBA 2PWPA 4GMKA 8GPBA 1GGKA 3E7FA 4NZPA 5EIBC 1W49A 4M1SA 2D1RA 2PKYX 4Q3OA 2OILA 1WZ2A 3I2IA 2G5CA 5FADA 1M8KA 4EZIA 5LBTA 2DY1A 5AOBA 3NYQA 2XB8A 5JECA 1QYVA 5HRCA 4E5SA 2WTAA 2CLMB 1VFPA 5KQPA 3TZBA 1Y8ZA 1Z75A 2G9NA 4BWGA 4F9GA 3IMEA 1DKQA 1BS9A 1HETA 2ZUCA 3HXQA 2XQGA 1UWCA 2WMDA 3RM3A 1OVGA 2AFHA 3Q7EA 1QG2A 3DOCA 3LUBA 4FVTA 4IHQA 4N12A 2GCEA 4REQA 2VH2A 1HRDA 4DMUB 4F8EA 3JQ9A 1YR3A 4ZAVA 3TECE 4C6TA 1SD5A 3D8TA 2J5RA 1C0LA 2I29A 4W1QA 4EPRA 4BKRA 2X8JA 4DSZA 2V45A 2O7QA 4S1WA 2RC5A 3KNZA 1A8SA 1YI1A 2XAUA 5B7PA 1MB3A 5JZBA 1KZ1A 3TLEA 5ILOA 4IIXA 1OBHA 2XUAA 4KQ2A 1A9XA 4MLCA 2ZUFA 3VPDA 2FSIA 5EJ4A 2I7DA 2XT0A 2QQEA 1L7RA 5SY9A 3A10A 4LA4A 4PG8A 2WB4A 3A11A 3FFBA 1DFIA 3WK6A 2FEXA 1RYMA 2BUAA 2IYSA 3D5EA 1S4MA 5M34A 1ZD2P 3MINA 1TB4A 2XF8A 4B3JA 1RQXA 1T1SA 5LQUA 3M9XA 5KWVA 1QHFA 1FFHA 4XIGS 2GFQA 4EKIA 3IDAA 4B47A 4CF6A 2C20A 3K9WA 5EWMA 3WBKA 4RZUA 1NF2A 3OP1A 5H16A 5GVSA 2EFHB 2R4TA 2J9ZB 5EXTA 2ISSD 3ZX4A 3SVLA 2VJPA 2GJSA 5IANA 2RGAA 2XJ4A 3F71A 3M6IA 3NETA 5LQAA 4ZTBA 2C59A 5TF4A 4G36A 4OIFA 4AZ3B 3OEYA 4PNHA 1UCFA 2IC5A 2V0GA 3IT1A 1IRIA 3VPAA 3QA9A 5CLFA 2EWMA 2VH1A 4N47A 4MQ6A 4HGOA 4Y2RA 3ESQA 1YK1A 3FNRA 3RFXA 4JVNA 3WGMA 3B12A 3C7DB 1CK4A 3FRIA 1IXSB 3H11B 4I9HA 4KHZA 5CK5A 4II7A 1E5TA 3WMFA 2OHJA 3JQPA 3FMPB 2XSZA 5KOJA 2VUUA 4BJ6A 3NEPX 1BDJA 5KNDD 4A23A 4R01A 4TROA 4QPCA 4B44A 1I1QB 4I50F 5IM4A 4C22A 4GQBA 1YDWA 3RVSA 1YCGA 4K6HA 1TYBE 3QEMB 5IFKA 2E4WA 2H4ZA 2QUKA 1C4WA 4JL6A 3P0JA 2QX8A 4UM7A 2ZRIA 5EZSA 2K6GA 2LNDA 4DILA 4X8OA 1EK0A 1IEQA 3LDHA 4AG3A 4H7FA 4BQRA 2B2XA 5K8LA 3TJZA 2PUWA 1ODTC 3MHPA 2QQFA 1F38A 3TXAA 1X3LA 4O4IA 5BYKA 1FL9A 1IHDA 2GZMA 3H42B 4GRDA 4A73A 1ZW6A 2C4KA 4PWYA 4BVHA 1C3OA 2D1FA 2NXNA 3U39A 3WWCA 4D3FA 3WYCA 4EIWA 1OT3A 1XZMA 3I4CA 3KSMA 4R2WA 1DIHA 1GYQA 3FYUB 4D8UA 5EGSA 3G0HA 1XVUA 4Q9IA 1Z4MA 1GZ6A 3C8DA 5FP0A 4I4IA 4ARUA 4A10A 4CTJA 1Z17A 2AVDA 4PO3X 4JFAA 2OXTA 1PZFA 5LLTA 2VJMB 4H4EA 3SZLA 2Y1XA 2CHQA 3DDOA 3DV0A 3GRZA 3NOVA 4K28A 5ULLA 3RLIA 1T91A 1CRLA 1NVWQ 2OD7A 3CLUD 2UZIR 4CW7A 3X2SA 1BQEA 4C88A 1JAXA 2WJJA 5CD9A 1VI2A 1NYRA 2JASA 3GGCA 3NYIA 2A0FA 2Y6VA 1N4DA 1NMQA 1TUEA 4NNOA 2PUGA 2CUTA 3M4JA 3REQA 2HPVA 3Q7SA 4G8DA 1IIRA 1CQIB 5EUCA 1NF9A 1JWLA 4QUDA 1DKRA 4WJLA 2AH5A 3FI9A 1YDEA 3SGLA 3UKJA 5DCUA 4DLPA 1L5OA 1THZA 5KTMA 2GD6A 4X7PA 1XPRA 5C1DA 4GW3A 2IZOA 5FULA 5ALRA 4HWRA 1G64A 1HMYA 4A8JA 1ZH2A 1PJQA 3EUFA 1SC9A 2V6FA 1W5BA 3DQQA 3FG9A 3OIVA 3OC6A 3ONDA 3S3TA 1H2WA 3N53A 2J0EA 3HFRA 3DTVD 4O2AB 5I9MA 1F8GA 1VE7A 2F1JA 1GL3A 2V5VA 2ZRDA 4LRQA 1SPBS 2BEVB 1KFJB 4BNWA 5CLJA 1NY6A 1OR8A 2BFCB 2BI4A 1X9IA 4K6FA 5GVRA 3NALA 5SICE 2EQBA 1K0FA 1DRKA 1ORRA 1UBLS 1WSBA 4L8YA 4UNSA 4W99A 1DAEA 2O14A 4ENTA 4DWJA 4XEUA 5BNFA 5HK9A 2XXAB 4IJQA 4EGFA 1SHJA 1ZUD1 3WIEA 3IAXA 1LRLA 2NYRA 1WCIA 3R0ZA 4AYTA 4JSTA 3UHAA 3VPXA 3X1XA 1WXQA 3QYPA 4AK9A 2G8LA 1XCPA 1QOPB 2R6JA 3UT5A 4D74A 2CZCA 4AJOA 5LYJA 4OHOA 2E5FA 1EPUA 1THTA 3N76A 4X1IA 5CLHA 2NYUA 1XTSA 4R0MA 2UUAB 3LT5A 4B81A 3F78A 5P21A 3NHPA 4ND7A 2CYCA 4UTNA 3AJEA 2IOHA 3KYIB 4LF8B 1VLMA 4XD7D 3PVSA 1OZ0A 2WT4A 1V7QA 3LQ4A 3RYTC 3T15A 1GL6A 2HA3A 4YCBA 1CJSA 1ZISA 3CLHA 3OKFA 2V7BA 1U9IC 1FDIA 1IXRC 1WNFA 2H4FA 2BGGA 1VL5A 4B7CA 1ECPA 1J5PA 4BO7A 4R2LA 2PZFA 2WAYA 4UMEA 5AW9A 3K6KA 2P3LA 4J76A 5CB0A 1B41A 1NQOA 3K1ZA 3HC7A 4M8IA 1XD2B 4MS4A 2GTHA 4HFJA 4ZODA 1R0RE 3AUXA 4TXMA 4BWYA 3KKQA 5BR8B 1CDOA 1KFEB 3F6RA 3INNA 1PK9A 1LI7A 4FGLA 4NU5A 3AR5A 1DRWA 2PZAA 4EYQA 2WOOA 1D7AA 4L76A 2ZS8A 4BNJA 5KOHB 2VTVA 2VDJA 4IMPA 4MVCA 4CMGA 4NU6A 4HMPA 3FPHA 1G17A 1JEOA 3ROEA 4D57A 2YVLA 3EEQA 4KAAA 2YFKA 1OGIA 3D4PA 1DAHA 1CZRA 1E1QD 1ZUIA 4JNKA 3H8VA 4LNUB 1GV1A 1YASA 3GK3A 1FTGA 4LJ8A 3D7NA 1OYOA 4TKZA 1PJ2A 3CNNA 2MINA 4R1TA 4Y7CA 5JMPA 1JEDA 1JIUA 4OD0A 5DJ5A 1XVTA 3PX7A 1UDAA 4YRIA 1PEAA 2J08A 5EZYB 4XB6B 3W04A 1LDMA 1A2QA 1NYQA 4J03A 3EIOA 4RY8A 4XJXA 5ICFA 4LXYA 1C30B 2WQ7A 1U28C 1Z35A 5I48A 1HE5A 2AD5A 1V8BA 2E2WA 3BE5A 4QJ3A 3UH0A 1NY5A 4ZOQI 1I0LA 2XB9A 3BDAA 3D02A 4PSCA 4Z1OA 2D0PB 2GHQA 1Y5RA 2XE8A 1FA9A 2L69A 1CRPA 2TMKA 2BZ0A 4G1FA 4DMFA 2AKAB 1YH3A 3L2OB 2VTBB 2FEWB 3FNQA 4R51A 1DJPA 1JBEA 3KDSE 3R3WA 1FXWA 2QGZA 4PLYA 3TRDA 3WGQA 1RXEA 1A9SA 5AW6A 3JVEA 2Q5HA 4ZGBA 3QX3A 3FX2A 1XQ9A 1DNPA 4IO0A 3A4MA 3P4UA 5BORA 5EIBD 1RWXA 2UZ0A 1GQQA 5KNCD 5KNDA 3U4GA 1CQXA 3STHA 3FGNA 3N2NA 3OJCA 2NV0A 4PYQA 1SVNA 4ISBA 4OGGA 3NH9A 1L4YA 3ZY6A 1D1PA 1MQSA 1J8QA 1P1JA 1PK8A 1QYRA 2J31A 4RULA 2ZATA 2CV1A 1C7JA 4PHFA 3HEAA 4H1TA 4FOOA 4NU8X 3O3CA 3UV7A 1D4FA 5JPIA 4K46A 4J1NA 2QTAA 2X8WA 2JJ1D 3HCBA 4C5CA 4HD8A 4YAOA 5HNKA 2P77A 3JR7A 2REOA 3LF2A 2X2EA 3SMVA 1QDUA 4OLHA 3NDPA 1NW4A 1FFGA 1Z4NA 4BEVA 4YHHB 2XZLA 3F8SA 1BFUA 2NZVG 4GICA 4DWWA 1JPUA 4I1VA 2Z08A 1I9GA 5HCUA 5C8YB 2W6JD 3COSA 4KK3A 4GDFA 2DERA 2C5SA 1NJ2A 4MCHA 2YJZA 5FKJA 3UUGA 5M04A 1VFNA 3RARA 3DM9B 4QYIA 1XDZA 1Q1NA 1QVAA 4HMQA 4G09A 3C4JA 3OO0A 5TIIA 2C0CA 3BXPA 1NUUA 4J07A 4LSWA 1TJ4A 1ZEMA 1T4MA 1XAGA 2ODAA 1VB3A 2ZRMA 2BM0A 4C0JA 4BB6A 4B6FA 3TKLA 1NGSA 1OLXB 1V41E 2Z9CA 1Q22A 2JGDA 3EOAI 4OI0A 4ZJPA 1NYTA 2FR8A 2PX0A 2FE1A 4IQ0A 2SKCA 3BXZA 3KB2A 1ZLXA 2DULA 4MUEA 1HRKA 4V0SA 1Z4OA 3VSBA 2OESA 2I7XA 2WM2A 5HA5A 3EXEB 5C7OO 4ZO9A 3TAHA 3HXMA 4AMUA 2XMCA 2ACWA 3RF6A 4JITA 4QC2A 4S0XA 2C84A 3DH0A 4NPAA 2CKMA 1DXYA 3F6PA 3HBLA 2H1VA 2IHTA 4HWPA 1PUJA 2Q0XA 2MSNA 2G1JA 1DG1G 4QUEA 4PO9A 3PX3A 2R79A 5I01A 4FONA 3IAM1 3IHLA 4IYJA 2GVZC 3ZVNA 2QTZA 2RHRA 2GHIA 3REGA 2CV0A 2QBYB 4INAA 5FNZA 1U6IA 1YA6A 3CUTA 3JWJA 1D7OA 2WWRA 4TWZA 1JALA 1D2RA 4WXYB 3WADA 3OQOA 1PVVA 2OV2A 4RMJA 1I7SB 4HTFA 3BWEA 1DI0A 2PUBA 4I5DA 4IHKA 1CERA 1L7AA 1PAUA 3SYTA 1TVKA 4P4TA 2M9MA 1G20E 3F97A 2LBPA 3JQ8A 4QUKA 4Y1RA 5LP6B 2WFLA 4YUWA 3X43A 4CTMA 3V4SA 1CSEE 3KR2A 1M7BA 3VC2A 1O58A 5GINE 5IVKA 5CU7A 5TQVA 2D2FA 4BNMA 4HX5A 4BVLA 1TD1A 5I3ZA 4MUYA 3GCWA 3GH3A 4PZAA 5MN4A 1M34A 2VEOA 2EFJA 4DMKA 4OHYA 3WB1A 1T43A 3I09A 3MWFA 2CLIB 1MPTA 1QKIA 4CM5A 3ND5A 1YAJA 1NG1A 3ODGA 4XD7A 5G0TA 2AZTA 3UMGA 3WAJA 4D42A 3RVMA 4JVSB 2VDRB 3GLSA 4MA4A 5B4UA 3U49A 2EF1A 1A7UA 2Z8XA 5GADl 1ISGA 1FP6A 1PR3A 3HJCA 2HCFA 3MOIA 2YZMA 3CLVA 4M8LA 1YQXA 1YQTA 1KK3A 1JN0A 1NQAO 1YBVA 2HNKA 4NDZA 4WEOA 3KKZA 1CY8A 5FBHA 4AJHA 1RPZA 3GLIA 1FVOA 2VI5A 4L85A 4QUIA 4CQLA 4EJ6A 3IFSA 2YWHA 3JZIA 3C3XA 1Z12A 1TF7A 4GU5A 1EX9A 3B51X 4ME6A 3IPXA 4X65B 1XUOA 1EK2A 4OHFA 1LB1B 3P9YA 1I8TA 4PRZA 2XBLA 4OHBA 2O8EB 2PWYA 1Z68A 4BMYA 4KVZA 3GAAA 3TNFA 2ZPTX 2FA9A 2FMKA 5EKDA 2Q1TA 1QCDA 1V48A 1DRJA 4LOHA 4G25A 4FZRA 4CF4A 1LTHR 3UB2A 1D03A 1S3FA 6REQB 3ND7A 4L07A 3RF7A 4UUNA 4A2WA 1FYDA 3I2HA 3I6QA 4EF5A 4Q93A 3ZWAA 3FOZA 2HA5A 3PNQA 3F5SA 5C5DA 2FPPA 3CBGA 4EI2A 2A3NA 5CB4A 1JHQA 2HHHB 2ZI6A 3S99A 2BFBB 5I4IA 2CJWB 3HY4A 1E1MA 3BD7A 3AY3A 4CR8A 4RHXA 1MG0A 3N05A 3LH5A 1VIAA 2QUBA 2OXFA 2WAOA 4DMHA 1JS1X 2FFJA 4OLAA 1YOVB 3AIMA 5CFPA 4ZV9A 2PA3A 5LIRA 1FFYA 3G17A 3IMGA 3IOBA 3YASA 4CFYA 4TT3A 1TT5B 4TS3A 3BHNA 1DWPA 3PEUA 4G63A 4LX0A 1HTTA 4L8VA 4UUBA 1YZFA 3IXQA 1K0UA 3WBFA 4YY3B 4IIYA 4G5XA 2PFGA 3ESXA 3OBIA 2AJDA 1RQGA 3R9KA 3RU7A 4LFBB 1VB5A 1MA0A 1B3BA 1EQAA 1KKLA 2ZJ8A 3KCNA 3HKEA 4RY9A 4ZDWA 1G8HA 4MR9A 2PD3A 4B9AA 4MB2A 2H52A 3LSTA 2CK3D 2IX3A 5T3YA 3TRIA 3K8QA 4X71A 3T3GA 2OBFA 4D0NA 2GLTA 3AUAA 4R5HA 1OAAA 1ZINA 5KNCA 1YBMA 2PKQO 3VTKA 4QU5A 2PTHA 1CNMA 1EX1A 1SXJD 2EXXA 2GAAA 4RQUA 4IQGA 3M82A 5D8DA 2FQ1A 4B46A 1PTJC 1NNSA 1RXUA 1ZU4A 1NQTA 3IB6A 3VYRB 4CIDA 1N7HA 4EDHA 5CFOA 1JU4A 3CF6R 4M0UA 4G2NA 2W6IA 4N0EA 1J0EA 3U62A 2GILA 4JSRA 5CR9A 2PL9A 1TQHA 2JJ1A 5IWAB 5BV8A 1QRDA 5ALFA 3RC1A 2ZJ4A 2FVXA 3OHMA 3A1SA 2EOAA 2PJDA 4YDHB 1G0OA 3VI4B 1G1AA 1GGJA 1U0OC 2H3EA 1JR3D 5JPCA 1R8SA 1GZ3A 5FD8A 3RROA 5JANA 1MFPA 4QDKA 2H2HA 4LYAA 4PIMA 4I5EA 4LMRA 3CXRA 1GZDA 4N5MA 4GPEA 4Y98A 3KYCA 2XI4A 3VUFA 1J8DA 1JIXA 1H0HA 4TTIA 5B7GA 1AX9A 1L5WA 1WKBA 4GMXA 1L7MA 1NDHA 4JA0A 2O8BB 2Q5FA 3HB0A 4EP1A 1G20B 1U2GA 4Y1GA 2VYFA 1XA0A 4MITA 3DLTA 5AM3A 4RX1A 1BC5A 2AHOA 3EULA 3WHIA 4O4HB 4NZMA 1O08A 4BLSA 4Q82A 1G0NA 1T9CA 1UMCA 5IKMA 1WMBA 3J81k 1Z5ZA 3Q3VA 3WB0A 2ZJ2A 3QF4A 3IQFA 1BCSB 3NLLA 4C4AA 1Z0SA 2CSUA 1Y8QA 1MC4A 2IYUA 3L02A 4R84A 5E9JA 5H3CA 1H2YA 2J48A 1N8TA 2VJAA 2WZCA 3TI9A 5T67A 4B8ZA 821PA 3ZHSA 3BZUA 1UT6A 3AONB 3EEBA 3KQOA 3U81A 4AY3A 2FVYA 2V0NA 4ZOLB 4WINA 1BKDR 1YZGA 2VK1A 5JW6A 4B84A 1JYEA 4GWKA 1CUCA 1CXZA 1AN9A 4HWSA 4UVEA 4EWLA 5C1BA 2C7RA 5GJVC 4WNAA 2J0VA 3GUZA 3RKRA 5A4AA 721PA 3QWFA 4G4SO 4TRJA 2ZCJA 1DOAA 3IVRA 3K0AA 2GBCA 1KYVA 1LBQA 5FA8A 5IAJA 1KEUA 1RNLA 3RC9A 4KPUA 3VJMA 1E3TA 2M6LA 4D9KA 5DYYA 2HB6A 1Y7HA 2E7ZA 2GZSA 2RAUA 4KXUA 2ZUSA 1WU8A 1J2EA 1KVSA 3UG6A 1PHRA 3WKAA 4UTPA 2VDMB 4P4GA 5AKZA 3BIOA 4D3DA 3D8RA 3KJIA 3QFFA 5LNK6 3M33A 1ODKA 2A9VA 2VPIA 4A7PA 3HCEA 5KVAA 2DPGA 2A8YA 1N2CA 1TW3A 3FYCA 3TUZC 1D6JA 2XCTB 1E3WB 3BAFA 4R8SA 3R7WA 5F2EA 1YR9A 1U0FA 2BFMA 1X7XB 4IIJA 3QG1A 1VG9B 4NNJA 5HUQA 4INZA 3PNLA 3HZHA 3H5IA 3GRCA 4I4LA 3HO1A 4S1PA 4YYEA 2BFNA 3GP3A 1C7FA 2WJYA 4LWQA 3UW1A 2DHRA 1I24A 1JXAA 4E51A 3HCAA 4K9NA 2I2DA 2AOUA 5GMOA 4D9JA 4OI4A 3EW9A 1SOUA 4RAQA 4RABA 3VXKA 2G1UA 2D5CA 2NAPA 3B3QA 5D6NA 3WI7A 4P38A 2CF6A 4TTAA 5IVPA 1PFVA 4M0DA 2EG5A 3EH1A 3ZVKA 4OATA 4I1SA 3K96A 3MTBA 1WDWB 3PKZA 3RGWS 2NZ8A 4YN3A 3UAXA 1W35A 1XVAA 2B4YA 1MD9A 1D07A 4YCDA 5EKUA 3VH3A 2OMEA 4E3WA 3T4EA 3RANA 3D5QA 4JWTA 3W79A 1C3EA 1H42A 1P4GA 3C3EA 3TFWA 1RYBA 3LHDA 2EERA 4S24A 5DRTA 5E9WA 2QRKA 3EXHA 2ADMA 1M75A 4G9EA 2VDPB 1CJUC 4K81B 5A1JA 3K2IA 4ZC8A 2OCBA 1WXHA 3BQNB 1NPYA 3OQHA 4WKBA 5G3YA 3DE0X 4IQFA 5TPWA 3PXEA 3QP9A 4EB8A 1MVOA 1REQA 3TF5A 4Z4QA 1O6CA 2HQ1A 4XCQA 1Q0QA 1YSCA 1NOKA 3H5NA 1K7CA 4FNOA 4LYYA 1TU4A 1K6XA 2QYSA 2C78A 2IE0A 2C29D 3QUSA 3VZCA 1Y63A 1W2WB 4K3VA 1JZSA 4NMMA 4IICA 1O6BA 1OC4A 5CG2A 3LXMA 1U8TA 2EKQA 3OM9A 1IU9A 3PA8A 2KW5A 4FR5A 4TTJA 1UKCA 4MUKA 4UUQA 2WP8J 3GLFE 2L42A 3N0XA 4MR7A 3EPLA 2XUJA 1RZRA 4BBAA 2W8BA 2VXYA 3C6KA 4HAUA 4HN2A 3DOHA 3ZY2A 2AZMA 4RKQA 4JLAA 1ABBA 5JV5A 1PVOA 3INGA 4IJKA 1ISMA 2HX1A 4ESEA 3T1QA 2VUIB 4XGNA 2CK3A 1XTTA 4GM1A 3B36A 5DNAA 3VSAA 5A0VA 4HBGA 3T94A 2JLXA 4I6JA 1SUWA 5ETJA 2NXCA 3S0JA 1E6EA 2PMCA 5K3FB 3JVIA 2J33A 5DK6A 4G8CA 3PQDA 3FM9A 2E87A 4B3CA 4P7FA 1SXJA 2CMDA 3GIWA 4LRUA 3GHYA 2EQAA 4YRQA 4DE5A 5F4ZA 4EJSC 2JGAA 2YASA 2OHVA 3R6LA 4GAEA 5DGDA 3R7LA 2RJNA 3TRFA 3TH5A 3LGAA 4ENVA 1K8XB 2ESRA 3ZWOA 3B20A 3WGUA 1B1CA 3DXZA 4I2VA 4GMGA 1Q21A 2ZP1A 1CUSA 1G4UR 3GJXC 3P9PA 4JLJA 5JD3A 2XWSA 3UATA 2YS7A 1YRQA 3A9SA 4RF3A 5I4CA 4PC2A 4YAKA 3KO8A 1HEUA 1Z62A 2AUTA 1Y8RB 4BFSA 2X3YA 2BR3A 1WHTB 2QZZA 5G2OA 3IMFA 1RW4A 3O0TA 3TLAA 4Z4FA 1DKOA 5EQTA 1T5HX 2IYOA 1SBZA 5A7FA 5MFZA 4N76A 3K1TA 2YBEA 4CL3A 3ZDYB 2NUTB 5DCYA 2XUPA 5DNWA 1SZJG 1I30A 4ARBA 1ECLA 2B2CA 3UJDA 3TGPA 1CWUA 2J3LA 2QN6A 4JI8B 5ILGA 4BUJA 3BT7A 1CHNA 3G9ZA 5AKXA 3WIOA 2IQ5A 4ZREA 5CW1A 3LNTA 3BWXA 4EA8A 3N6RA 4ZVKA 3AJDA 1IEVA 1LDGA 1X13A 3V32A 2H4JA 4UTRA 2INGX 3LS2A 2ZBGA 1B00A 3LDUA 4PRKA 3ZTWA 5HX7A 1A2BA 1T6NA 2QXTA 4G37A 5J5CA 5FI1B 3V97A 5IHXA 4V0ME 2JFZA 5IAOA 1M10A 4I50B 1G3MA 4ZDJA 1P0QA 3EMVA 4EG1A 1K9SA 1VKNA 1C1XB 3IMKA 4YECA 2NGRA 2VHYA 3VDMA 3X1ZA 1QANA 5EEHA 1NTOA 5TGDA 2XH8A 1VMIA 3HI4A 4G4IA 4BNHA 3ESDA 1KI9A 5CYPA 1XC7A 4YH1A 3SFVA 4FFSA 2V58A 3I4LA 4JJAA 4LOAA 4Z86A 1W9HA 1R2QA 2G70A 5HOQA 3KBOA 3IH5A 3AM5A 1GGHA 2FE4A 1KS2A 2YWEA 2IXGA 3FDFA 3P2YA 3K1YA 1WMEA 2VOJA 1NXPA 5EJMA 4BMVA 4E1VA 1QIHA 3WLAA 2C31A 2IP4A 2AW3A 2LCFA 3AVPA 4II3A 5G4KB 4URXR 3PL5A 4Z7NB 5JBQA 1EHCA 2O1WA 2Q28A 2QT0A 4JLWA 3ROXA 4QYXA 4DM7A 1OD6A 5JSUA 2PNFA 3H0CA 2C2ZA 4F72A 2PGIA 2IY7A 3QKRB 2VXCA 4LHZA 3IV9A 2OPHA 3RVQA 5FAKA 2WSMA 1TF5A 3KUKA 2E4ZA 3ZBPA 2H0QA 5DOZA 2CHUA 2G17A 3DUWA 3E9EA 3QUCA 4IUYA 3OFVA 4PTZA 4DC9A 5AUQA 4CIBA 3E5RA 2JIMA 1R7RA 4NENB 2IEIA 2HMWA 1EP1B 3GAZA 3BWCA 1FUKA 4ENWA 2YFHA 3Q87B 2F3RA 3BKXA 2PQ0A 1XWFA 5C7LO 1NJ5A 1UJCA 1UM9B 4CPDA 3C1UA 3MC1A 2VDKB 3AKDA 4UNPA 3VR5A 1K5DA 4NNPA 1KYYA 1DRVA 3NWOA 3I12A 3E9YA 2ORED 3I1IA 3B6JA 4WUTA 3UCXA 1NF3A 1VJGA 3DBIA 3VNSA 1D0VA 1UC4B 1XMOB 4LJSA 1XT6A 1PFWA 3SXUB 4D80A 5TQ0B 4X7BA 2ZJ3A 3PZRA 1S2OA 4KV7A 3TDKA 4BQPA 5HUHA 2TRSB 2AXNA 4M9QA 4PLWA 1GPMA 4A2CA 3F73A 3HGMA 5EERA 3VSCA 1Y3DE 1XQXA 3EHEA 4ZRDA 3VPBA 3GLFB 4RW0A 3H11A 4ANFA 2R1VB 4K03A 1A4RA 4HEJA 4OQZA 4J3NA 1CR6A 1H1DA 3HCWA 4D9FA 3D8NA 2IH2A 1KZGB 2W2VA 4OXIA 2WM3A 2ECPA 3DYVA 3FR8A 3C70A 3U60B 3FRJA 1ZD1A 3KE8A 4FX5A 4JYMA 1VSVA 2QA5A 2Z1NA 3MCZA 1YO6A 2HW8A 2ZOSA 2WKQA 3L0SA 4AJLA 4WV3A 5C9ZA 4FZJA 2WWHA 3E3AA 1MJFA 4KVAA 2C9MA 1RWQA 4ER5A 5F4BA 3UKDA 1KARA 5KNBH 4JXZA 4L1KA 5I9BA 2Y6UA 3BE8A 4EFMA 3FTQA 3LV8A 2WY2D 1UFOA 3TBHA 4RVGA 4EI7A 2IYEA 3JZFA 1NJSA 2VJQA 5GOTA 1VJDA 2Q6TA 1V5EA 1M72A 3AI1A 1OUMA 3WTCA 5BSGA 3WYGA 1SBCA 4YAFA 1R6UA 1QFJA 1THGA 2FX3A 3OQ1A 4GLOA 4AYXA 2H06A 4YMVA 5JZ9A 3GLHE 1CUUA 1M5UA 3FIJA 2NTJA 2Y4NA 3OZFA 2CKDA 3VHXB 3TBFA 3E8SA 2QJOA 2FSPA 3C3CA 5DM70 2MWMA 1G2OA 4B6JA 1RBYA 1NIJA 2BY4A 3FYUA 1Q3KA 2EYQA 2P3SA 5G0WA 4EHHA 1FQOA 2QWXA 4I2NA 1HTWA 1Z2NX 4KYUA 1RRFA 4FSHA 4H4DA 3OEHD 2CFRA 2BFPA 2OFOA 3OPQA 1P8AA 1YJBA 2VJMA 4GS5A 2P90A 1S2NA 5CAEB 3CVUA 3CF4A 4YQZA 5F77A 5E1BA 4D0GA 1MB4A 4QAQA 3N8HA 2G40A 3LO8A 3RC2A 3EDYA 3WV4A 1CY4A 4M1EA 2WJ4A 4EJ2A 4MYCA 3HGTA 2PYZA 1FLNA 1AS2A 3KRTA 1CQIA 5FTMA 1Q16A 2LP4Y 4KR3A 4ZCMA 4MCAA 2IV7A 1RFLA 4OOEA 4QPPA 3FOBA 4MVXA 1I5EA 2J59A 2YY5A 1GPKA 3GYGA 4YV0A 2HK7A 1HYHA 1KU6A 1Y98A 5IARA 2QMHA 4DV0B 3OZEA 3P8ZA 3PENA 1RPNA 2ZWPA 3ETLA 1V9LA 5DBIA 1WUJS 2ARKA 3UMYA 2QTLA 4M9ZA 3USCS 1L8LA 5KTKA 5TX7A 3BDVA 1SEVA 1TFUA 3HBFA 4CI9A 1K88A 4MV0A 3FIUA 4NBSA 1I3MA 4J1TA 2JK0A 1WSDA 4TQGA 3H2SA 2BJWA 1KJQA 1EBFA 4KQFA 3SS9X 3UAVA 2BEVA 3VOAA 1HPLA 3OJ0A 1HFKA 3LQYA 1WM1A 2BFCA 5A0FA 3SDSA 3TW0A 3BICA 3R7NA 5BWOA 5KSOA 1SWVA 1DXHA 1RHQA 3D7RA 2BN4A 2C2WA 3IRVA 3NBAA 4HO1X 2EC5A 3EIXA 4IKEA 1R8QA 1JP7A 4JBIA 4JXJA 2JI8A 2WWWA 3SLGA 2XXAA 1IQUA 2J6IA 2F9MA 2HFKA 3JAWB 1IMJA 4JN6B 3R5XA 3MUOA 4OLBA 8MHTA 3B2EA 1RJFA 1RHMA 1AN0A 2VRCD 3LUCA 4QNMA 3RIMA 4G85A 5K1ZA 4MQEB 5KYTA 2J6CA 3FMGA 3L1JA 1AKNA 2O2DA 2KYRA 1OXUA 4P35A 3FDXA 5CFMA 1ZHHA 4J0QA 3U3RA 1TEXA 1RZUA 2RFLA 2VZ8A 4ZMSA 4Z4CA 5A1TA 3GLGE 3WLRA 2ZB4A 3U4IA 2BGRA 3MD0A 3ZIAA 2M1ZA 3DVRX 2H2DA 4P0QB 1KZ7B 4AMVA 1G9SA 4AICA 1HC7A 1ZI8A 3U6KA 2HJWA 3CZ5A 3HVJA 2C5LA 2KHZA 2WU1A 4DCPA 1KEWA 1YR1A 2AOXA 4ZANA 4DSNA 3T3DA 2P9HA 3OCXA 1G3QA 4MV9A 5AYVA 3RFTA 3TEJA 3VYUB 2EZUA 4LCJA 1FFSA 1SPXA 2YUIA 4YAGA 1XD2A 4C0AC 3KJXA 3WLSA 2QRUA 2CDNA 4RL6A 3ZNQA 1A9QA 4YPVA 4NMLA 4TLEA 1NI4B 4FYWA 4C4ZA 4IUDS 1LQTA 3ZNPA 4ZZ0A 3O91A 4NCIA 1ZJJA 3GRFA 4KQJA 4EB6B 3FUWA 1ML3A 1OE0A 3WQQA 5FNVF 1MFZA 1BDMA 1JEQB 2VLIA 1K89A 3T0FA 3V4FA 3K09A 3HCPA 4KBFA 221PA 4LNUA 4X8LA 4RC9A 3L0OA 3SEFA 2Q1WA 3CIOA 1M0SA 4KXMA 3ORSA 1QRTA 2PJRA 2Z1DA 5BSUA 2R4QA 1SCUB 3R7BA 1EHYA 5GOZA 4EO9A 2C4MA 3GD5A 2A5DA 2QDKA 1L4KA 4WKNA 3AKEA 1RWNA 2A5LA 2O48X 3GBPA 5CJJA 3T12A 3V33A 4F2WA 5EZYA 1SXPA 1AM4D 5EMJA 1RHKA 1FFAA 1TX4B 3FSEA 3NIBA 3TLMA 2JARA 3K2EA 3FPSA 4YPFA 1A9TA 4B5LA 2BBSA 2IYVA 4UM9B 3CRW1 3LJKA 1CF9A 2TSYB 3TEMA 1B4DA 1NNUA 1R6AA 1VGVA 2II6A 2POCA 2R8ZA 4HAVA 4M9UA 1MN6A 2H1FA 1UDXA 2A5YB 4MYSA 4XPZA 3DAYA 3U1VA 1O9HA 1YB4A 2W2MA 2Y93A 4IL5A 5CVVA 4EGJA 4NDNE 5AVYA 4MQ4A 1TK2A 3AI2A 5AKIA 4FJ0A 5FEMA 1XDGA 2PRZA 2YWXA 2H2FA 4PX9A 4M76B 4NABA 4TLMB 2JH9A 2XVAA 1HTBA 3D9QX 3I9FA 2VTBA 3EPKA 1ESEA 3P0IA 1M76A 2FLVA 2G04A 4IH1A 3OPXA 5HKKA 4D6PA 1KAHA 4U7TB 1N6NA 4I0WB 4NCNA 4OJNA 4WFKA 5EAIA 3GLQA 3OIGA 1UK8A 1JB9A 2ASEA 1BSVA 1KVRA 4W5NA 3W0LB 3EXFB 1XPJA 4DTIA 2JD0A 3F46A 4RJIA 1T3LA 1EZZA 2CEKA 2XE7A 3KSDO 3MZ0A 3WDMA 3RTAA 1SELA 1P31A 1BHJA 2OFXA 4YAJA 3DPSA 2EAUA 4LXXA 1Z7EA 2PLNA 5EMHA 4BO4A 3CW2A 1WMAA 4JY7A 1QX3A 2XA1A 4QFDA 421PA 4ATNA 2H00A 3DZ8A 4NAUA 3RJ5A 1XJQA 2GZRA 2HKIA 1XJ5A 3HRHA 4OPMA 4B32A 5D3MB 4OAOA 3EVCA 4WRRA 1BVUA 3W6ZA 3E2PA 2IIQA 2WVHA 1E6WA 2VYCA 3H2JA 1TGVA 3R6DA 4M7PA 2N46A 3HN2A 3I34X 4HNUA 5C8YA 2XUZA 3CY6A 3UGTA 2DQYA 4ADSG 4DLRA 3VKGA 3LVQE 3M6FA 2ATCA 4CMBA 1XDSA 2Q4EA 3W5HA 2AE2A 2KJQA 4ER0A 4XVUA 1HI9A 4FR2A 2CJXA 4J4TA 2WB2A 4G86A 3C6XA 3GL9A 2B69A 2A84A 3QMWA 3RVNA 3E0XA 2QPTA 3IBTA 3A4LA 4CCAA 3EFOB 2HHAA 4HXEB 2N3ZA 3FPGA 2XDWA 3ND6A 1E5LA 1TFRA 2GFHA 3B5JA 5KYNA 1QKKA 1OLXA 1ZGJA 3ONNA 3HFJA 4RIGA 4B3GA 2D00A 4QARA 1KSHA 4F2HA 4O6VA 3GBVA 4JKIA 4X61A 1WUHS 4AXBA 2UXBB 3G0IA 3DHYA 1M5TA 4HDCA 3PC4A 1JXMA 4MO9A 4QPNA 5LVAA 4TYNA 3L79A 3S81A 5LKRA 4Z9YA 4G9GA 3EXEA 3RLFA 3ZZUA 2R66A 1C5KA 3NUGA 1O03A 3CSDA 4IDNA 5LQKA 2WQZA 4OQEA 1IXYA 3NPMA 3NC0C 3I30X 4U0KA 3L6RA 3A14A 2WJHA 4RTRA 2G5PA 1WD5A 2GI4A 4XCVA 1JLMA 1K06A 1V4NA 3UHFA 4M87A 3LX6A 2Y27A 4AZ0B 1Z8DA 2PGLA 4OQPA 4YIKA 1USGA 3JW8A 4BDSA 4DSTA 2RBEA 5GAJA 1EP3B 3WK8A 5JLAA 1ZOSA 4MW7A 4PLHA 3QQ5A 1G9TA 2HT6A 3EWIA 1ZQ9A 4GEKA 3FAKA 1EX7A 4D4GA 5C7IO 1Z6AA 1M1YB 3L8HA 4N8SA 5AHKA 4B75A 3K9CA 3L9WA 2O4CA 2PUFA 2DLDA 4Y9UA 1NBAA 3CZ9A 4ETMA 1JG7A 5EFOA 5CEEA 1PKXA 1W48A 2QUJA 3IA7A 2O5RA 1D9ZA 2JFNA 3SM3A 3C8UA 3WK9A 4CLDA 1YZHA 1U7ZA 4Z1MD 1X0XA 5LD2C 1V96A 3BK1A 1JR3E 2P75A 4OBBA 4AIIA 4BLUA 4CM8B 3ZJTA 3FHOA 4BOYA 4BTVA 1Y3AA 3OOJA 1O94C 3FWKA 4MGIR 4ZV4A 4OL0A 5ALOA 1JTFA 4EBBA 1S9DA 3DHNA 3WY9A 5C8ZA 1YC5A 4PR3A 3DC7A 3M6UA 4NG4A 1L1QA 4UVHA 4GP7A 1A82A 3I8XA 1GNQA 2XTAA 4JC0A 5CVEA 3ESRA 1OZAA 2HAEA 2J4FA 3A9RA 2WG1A 1G18A 3KXKA 4JGGA 3WNQA 2Q29A 3ZWQA 4OUDA 3LIIA 5BXQC 1O54A 3ASZA 2RI6A 2UDPA 2O0JA 5E6RA 5I4KA 3SD7A 1E2PA 3IOEA 1MW9X 4UBJA 3HYCA 4KLAA 4DCSA 4GPD1 3WGIA 3EQ7A 3PPXA 3DAGA 2AT1A 2MJLA 4E1AA 4DQLA 3LHFA 1TCVA 1R0LA 4HV4A 3GMSA 3D3NA 2O8EA 3CLSC 3I1YA 2PMWB 1E0JA 3I1JA 5DNYB 2X8BA 3NBKA 1RMYA 2V7QD 3BB1A 1P33A 2IUTA 2VBFA 5IJXA 6REQA 3ADCA 1Q17A 1Y3FE 2WIDA 3H05A 3KOWA 1NW5A 3DSRA 4LY9A 2ZBPA 4U00A 2HQRA 2H1LA 2KX7A 5AOCA 4C29A 3BGVA 3UV3A 4CL2A 3D2CA 1N6IA 3I0MA 3NW9A 3UJ6A 1AUPA 3EYAA 2ZJAA 2BFBA 1JL3A 3H9UA 2CJYA 2CJWA 2EZ4A 1WQ1R 2I6TA 3TPZA 1SZPA 2J45A 4O2BB 2ZBRA 4FFWA 3U4QB 4XD2A 4MP6A 3NHZA 4Z2YA 1YOVA 4YRJA 2NZJA 4EI8A 5LQNA 2AKEA 1X7HA 1D5CA 2BP7B 1BQ4A 4IWYA 1R6VA 2UAGA 7MDHA 5C52B 1TT5A 4RTJA 5HUJA 5IU6A 3LU1A 4QXPA 2AG5A 4M0MA 3KVRA 4NE9A 3U4DA 1ICEA 2GO7A 1N3LA 3I5MA 4PG6A 1T9HA 4WA8A 1JG1A 3LT0A 5AVSA 4GZ6A 2K4MA 3Q7RA 4TL8A 2PVPA 4DWOA 4S0ZA 1XZJA 4P5EA 4BQFA 1MVNA 1U4OA 2AS0A 5AVXA 4BNZA 3N2KB 1J2UA 4EYOA 2GERA 1FTYA 2R6AA 4F21A 4EVSA 1NXWA 1GA4A 1YS7A 4QEKA 1LQ2A 1GPNA 2H4WA 2PX5A 5AW0A 5JMTA 3NM6B 1Z6ZA 4NYJR 4R0VA 5EG5A 3DJYA 1GOTA 3U4AA 2AYYA 1TLLA 3K15A 3ZU2A 1U8CB 1Q92A 2OZPA 4NJMB 2Y1FA 4BO0A 4CMJA 1MGOA 3HXLA 4QBKA 4TMXA 1H05A 3W05A 2CB0A 4HRXA 1F8XA 1RM0A 1AK2A 4CEHB 5DN6D 3TPCA 3KEOA 4YP5A 4EUFA 3S2ZA 4ND1A 3A2LA 2OA0A 4FM9A 1P2BA 9MHTA 5AJXA 3AESB 2BFAA 5K3OA 1YGYA 4N48A 3W6NA 3QHPA 5A9SB 1OBVA 2PYIA 1P2VA 1PSDA 5TC4A 4HN4B 1Z0ZA 4JU8A 4CU5A 3QBEA 1CVRA 3GUHA 4RO0A 3IRUA 2RJ3A 1CNEA 1N3YA 1CS0B 3T7SA 4YCJA 2H8KA 3V4PB 3WYNA 3RYCB 3MMSA 2HCBA 4BBJA 4M9SA 4F5EA 4M1TA 3U56A 3A6PC 4TMWA 4PM4A 2N1MA 5U4XA 2QN2A 4L8FA 1I4OA 2C98A 3ZKWB 2CUZA 3PC2A 1PT9A 1V0JA 4JC5A 5ELXA 3QM1A 4IJVA 1W93A 1BEEA 3IS3A 4BU1A 2QTGA 1I5RA 2BGNA 2FG6C 2CN1A 2O2JA 2WTNA 2YXNA 3ES9A 3HU5A 3Q5EA 4HFNA 1G20A 1GGMA 2AX3A 4KXWA 2O8BA 3S2UA 1TDJA 2BJHA 3E7WA 4IUCS 5FHQA 3GJ3A 2FYTA 1J8YF 1ZIOA 4P2GA 2DKNA 4O4HA 3QFRA 5BUZA 1HDXA 3ICVA 4LZNA 4YCAA 3S2SA 1JAHA 4LE1A 3MYYA 3KUDA 4UBMA 1LPNA 4ND3A 3RSGA 3UWSA 1TGYA 2PUTA 1MDFA 3LL7A 4PQFA 1K75A 3CLRC 1HE2A 3BF8A 3NAQA 4IO1A 4ZJZA 1WZEA 1MRSA 5I7WA 2ZRQA 5FQNA 1BEUB 4JVMA 1NW7A 4OHZA 5BRAA 3JYNA 4G9BA 4I14A 4ZOLA 1MAHA 4KMRA 4W5OA 3TR6A 4UVGA 3ASYA 2FX5A 3PE3A 5JCOC 1K98A 1SBYA 1NVBA 1A88A 1DCFA 2R00C 4Y0VA 1KI2A 3JQBA 3NANA 5GM2A 1ZESA 4N7JA 1CC1S 1N5MA 3O92A 4TN5A 3IAUA 2QLNA 3LHSA 4OJKA 3ENNA 5A05A 1T2EA 2AR0A 3EBPA 3N39C 5DKFA 1SVMA 1NJ1A 1W5FA 3FTNA 3KKPA 4KQ6A 3RI3A 3ORRA 3UMBA 1XDUA 3WRWA 3P4YA 3RU9A 3ZOZA 1SU4A 2RB5A 3N5KA 1II0A 3R9XB 4EY6A 1DU4A 5CYOA 5K6AC 5IJ0A 2F62A 3N6VA 1XZHA 2HBYA 2W11A 4QDUA 2BGKA 3CJQA 3L8GA 3W5JA 4MV5A 1H3EA 2QAGB 3FDJA 5LJIA 2VQ6A 4JLPA 5IHPA 1E3WA 4Z1MA 1N4AA 3WGGA 3Q10A 3SZGA 3K05A 4EHAA 1SVWA 1V4VA 2QGNA 3RVDA 4LDPA 3TTWA 2IIPA 1X7XA 4E07A 5I4BA 5CT5A 3QX7A 5JNUA 4K3UA 5IEJA 2ZUBA 3ZDAA 3VU0A 1PNRA 3ANYB 3EA5A 2AUNA 5T6MA 1K6EA 1V35A 3O1JC 4XZ3A 5BV0A 2VP2A 5JS7A 3V1UA 2P0AA 2ZZNA 4UPDA 1PZMA 1MRZA 1Z28A 2PZEA 3EK2A 3H5OA 3MJ4A 3NQ41 4OSOA 1GLNA 1AQ6A 1Z0UA 4IG9A 4QICA 1EJ2A 3EARA 3K72B 2ZR0A 5EIAA 2WILA 3QYAA 5I47A 1KIFA 5JZSA 3D7SA 2OE2A 3DV2A 1HDIA 1ZMRA 3CUEF 3NJ8A 1UL1X 3N5CA 4J7UA 3DAOA 5KX5B 3KQMA 1W52X 3QENA 4TSKA 1ZXLA 5DI3B 4AU1A 4CCYB 4JT4A 4OEHA 2JCVA 3ZV5A 3U61B 4UBKA 5BN5B 3RUCA 1EXMA 1EG7A 1HKHA 2IDZA 3OTHA 4ACBA 1XZKA 1EFPB 4RJLA 1ZFNA 3P1JA 3T4XA 3LQ1A 5ALPA 2I5PO 3LM8A 4DPLA 3T5AA 4Q1VA 1EDBA 2VQ3A 1C3XA 1E5XA 1TO1E 3P2IA 3PU6A 2GYYA 1Q7BA 2FPSA 2YW2A 3ACDA 3K6RA 4J2OA 3UJBA 1SCDA 2Q2WA 1PT6A 1HDGO 3GDFA 4BGUA 5AESA 2HLHA 3OG9A 4NFLA 4FWTA 3K8OE 3OCUA 1TUGA 2QN9A 3DPUA 2K2QB 2ODBA 3C6MA 3E18A 4KE9A 4MDYA 2QRVB 3R8XA 4M22A 1LX7A 2WV7A 3WISA 1FVHA 5CA0B 4ZFNA 2J3DA 3CZAA 3VHRA 2EZ9A 4B09A 5ESDA 1E8DA 5BV1A 1XTKA 2JANA 1DAOA 3O4VA 1ZVVA 2IEZA 1A0OA 1B8VA 3CC8A 5U4QA 3GQVA 5TE9A 1JF8A 1PW5A 2QD1A 3C1AA 3LQ2A 2C83A 2VFAA 5KDLA 4BZZA 1J6UA 4WBSA 2QTWB 1JQBA 1JFFB 5J2UF 2BPOA 2J0UB 3GDHA 1P7YA 2B8EA 1Z8FA 1R9NA 3DCNA 3NHUA 4RA6A 2AD1A 3K20A 3PQ6A 3GB9A 4EVIA 4OX9B 3T38A 1ZA1A 3DEZA 4RXMA 5FOQA 1T6BY 1XCBA 3PJGA 5FV7A 4BKUA 2BTOA 2R7LA 5K3FA 1T34A 2XNJA 4C0HA 1TL7C 1U9JA 1O94D 1T2CA 2AA3A 3FPJA 3Q7IA 4ALJA 2LD4A 1TVMA 5FWAA 4L51A 5JSKA 4GOOD 4S1OA 4DSAA 3HM2A 3L7BA 1LPSA 1L8AA 5ALXA 5HIMA 4ZI5A 1JDNA 2EX1A 3IHKA 3QVWA 1JIKA 1TJYA 2XVYA 1YCHA 2ZRFA 4JB2A 3FPLA 4A6DA 4X90A 1PNVA 5DCLA 5DW0A 3K70C 2PXHA 3ZHCA 1LQUA 5KU1A 3GPDG 4ESVA 4A5SA 5JR3A 2GAIA 2ZYTX 1SUCA 3PE6A 1Y8RA 3C4VA 2QIOA 1MT3A 1WHTA 1NQVA 3M3HA 2K2WA 1Z8HA 3MLAA 5B53A 4ZDIA 2VT2A 4IDCA 1QK5A 4NCJA 2JFFA 1EP2B 1K8YB 5D84A 2NUTA 3EVZA 1KYTA 1Q1EA 1H69A 3VSEA 3O95A 2Y1KA 1E1CB 4IILA 4QOFA 4JYAB 4JEMA 2IVFA 4LYDA 2E4YA 3KKOA 3PD7A 4MKRA 1N75A 4UCQA 3PHLA 2XTMA 3CRVA 4OB7A 1I7PA 2OHOA 1L5YA 2Y71A 1NONA 4GRIA 5WRFA 4P7KA 3OZIA 8ABPA 2EF0A 1A72A 2BR4A 2EBUA 1EDDA 2CL7X 4I50A 4QPZA 4ALMA 4B6SA 4UMDA 1CUYA 2GZAA 3LA8A 4QNNA 2OR3A 3DF7A 1D2HA 3QLJA 4JLUA 5FO1A 3TQTA 4EYEA 2V6JA 3RBAA 3AETB 4ZTUB 1UIRA 2ZI4A 3R3JA 2WJ6A 1ECJA 5BR1A 4RESA 4QJ5A 2I6XA 4ND5A 5CDHA 1AMOA 2VHZA 3QLUC 2P6PA 1YT5A 1YUNA 1RM4A 1K97A 2DY0A 3CISA 2YQ4A 3H4IA 2ZR8A 3L92A 1V1RB 2BW0A 4QXAA 5B2FA 3PYLA 5FLXA 1Y37A 2PV0A 2VAMA 1U1EA 4NFHA 4P53A 2EX4A 1EUZA 2FWIA 3OE7D 5G4KA 1GSIA 4Y2PA 2CMKA 2J3HA 3CE6A 5EXDA 2Z9BA 3KAPA 4HYQA 4DUGD 4AZSA 4M9CA 1NKSA 1B74A 4FHCA 4UBOA 4D3SA 3S8MA 1KZ6A 1IG3A 3KQPA 1CUVA 3QKRA 3DBHB 1U6KA 2Y1EA 3BWMA 1DDGA 4OBWA 4ZC1A 5SYNA 4BRSA 1T8UA 5ARBA 2B8JA 3L43A 3P26A 4ZVSA 3AFHA 3EWSA 1NBOA 2RG1A 1BGVA 7GPBA 1NBMD 3EEYA 4F85A 1FMFA 4EHIA 4KLZA 3NRBA 5G0VA 2VLBA 2HPZA 4JLSA 2XMRA 4NENA 1Q50A 1J8VA 3ID6C 2W2TA 2IUUA 3B1WA 3JPWA 1PEYA 2TECE 3AFOA 2VHUA 4Q19A 2WAXA 2WUWE 4LE2A 3Q98A 3HYTA 4PRLA 4PSDA 1J06A 2QZ4A 4KDFA 3ZGVA 1LS6A 2QTHA 5ES3A 3CNLA 1V7ZA 5DVZA 5TSDA 4GLJA 1E2GA 4MH0R 4R69A 5HILA 3SXUA 3C5EA 4PANA 5TQ0A 3AF2A 4P08A 4A1OA 3P2EA 4J3JA 2FGJA 4R9UC 4BO1A 4Y2HA 1F4PA 1EFAA 2O2GA 3DFZA 3GLFA 2JBHA 2Z2ZA 2E3JA 2A92A 2R1VA 4NH4A 1FNNA 5CIYA 1P1RA 4P5DA 2DEUA 2IHNA 2V7TA 4MP8A 4AD8A 2ZT7A 2HF2A 1EM8B 1FTQA 3PRKE 1VL0A 3K2QA 3VNUA 2JHFA 3H1GA 3K0SA 3T1TA 1NE2A 3K2BA 3QIAA 4CMEC 5LZ4A 1Q91A 2RGCA 1K2WA 3E27A 5FBRB 1XZ8A 2E5WA 2E6UX 2Y2UA 4LAFA 1PZXA 4XKJA 2BEKA 3CLRD 3LLVA 3HFGA 2X1VA 1GG2A 3OWHA 3DPIA 3LFTA 3PWKA 5JQGF 4XPIB 1CBUA 2GCIA 1FK8A 1X92A 2XMSA 3DT6A 2XZTA 1OA0A 3OTGA 3GRRA 3QG5A 2J07A 1BEZA 3AG5A 4JP5A 3TNDA 3PHBE 4Z2AA 5CD1A 1ULAA 5F76A 4O4LF 3RSLA 2Q7DA 3V1YA 4MLDA 2HIAA 2XWPA 4GBJA 2X2PA 4FUTA 4HSGA 5AKYA 3VHXA 1OX5A 1RVDA 2RC6A 3NC1C 4FDVA 2Q4DA 3OU7A 4WN9B 3SE7A 1R66A 7REQB 2G07A 2YYAA 2OECA 4YV7A 3GN1A 1CQWA 4KPFC 5CDTA 5AQ1A 1UPTA 1DC6A 3LP6A 1Y9JA 2XWJI 2FUG6 2OORC 3CU5A 2JJQA 1TM4E 4PYRA 2FW0A 3ICWA 3D4NA 1GYPA 2J9FB 4W9RA 2ZE6A 2P2CA 1ZS9A 2NM0A 1QH0A 1IATA 2VYND 2Y77A 3ZHRA 1AKMA 1G6HA 1Q6ZA 3QMPA 4MUXA 1U9CA 1DTWB 5AKLA 3WRYA 4DRXB 5BUSA 4D92A 5FNVB 1WR8A 4Q15A 4AKGA 2AXPA 1W19A 2B6HA 3UPTA 3U09A 3E9NA 1UQTA 1A4UA 1CDDA 2I55A 3GX1A 3G8AA 4WJKB 3V4LA 4RBNA 4FJ1A 4YLEA 2N1BA 2ZYIA 3B6IA 5KMGB 2BZ1A 2GPTA 5J43A 2WTUA 1GTVA 1BX3A 2D1YA 2HBRA 1RRMA 3H9QA 3K9LA 2G4LA 3S1LA 5IVDA 3PIDA 3UJAA 4EEZA 3KWFA 4I1PA 1YDMA 4WKPA 4AJIA 5AW3A 4FC7A 4Q7LA 2F1HA 2R5NA 4MV7A 5DTQA 3KZ1E 1H2XA 2GXQA 2B37A 4EHKA 5IKEA 3ROKA 3ND8A 1YUBA 1T2DA 1MW8X 3MWKA 4BO5A 5GIPE 2FFQA 3RVKA 1NX6A 1ZK2A 4D4HA 4RTMA 3TLYA 5K8TA 2ODTX 2WNIA 3KCQA 4PVDA 1SBNE 2X2FA 5CK4A 2RHWA 3KQYA 4FE3A 5FCDA 4BFWA 3O2JA 3TB4A 4JI4B 1GTG1 5CTAA 3IBGA 3VR6D 2OCXA 1N7IA 5MN5A 5DNVA 1E92A 3JAWA 5B3JA 1VA5A 2GUGA 4V0QA 4RHFA 4AQ7A 2I9PA 3SHVA 1J9ZA 2JJMA 3DDSA 3DL0A 1ZBDA 1EIWA 2WYOA 1UXGA 3W5VA 1GPAA 3CVJA 1KZ4A 4BNVA 3BORA 4MQEA 4TV9F 1OWMA 3MMNA 1WOMA 2JCSA 1O6GA 4J2HA 3ZHBA 1XSEA 1N2ZA 3R5KA 2K87A 2FRDA 4CMCA 1XL0A 1QM5A 2D5BA 2IHKA 3NASA 1HWYA 3SHFA 4WX2B 2CVPA 1W1IA 1D6NA 2HWKA 1GUZA 2HEIA 3E70C 3O38A 3LZCA 2IL1A 4UM5A 3U17A 4JK3A 1RAFA 2WHQA 3AIOA 3P9KA 3TXXA 2IOYA 2VF5X 3A9VA 3L8FA 4MDEA 3HVIA 5B58T 2XOEA 1GU1A 5AJYA 5T4BA 2VNKA 2A94A 2OV6A 2QMOA 4FMPA 1KETA 4J75A 5DSZA 2P7HA 2BMJA 3RHSA 5A9RA 5FPHA 5FEUA 3B3JA 4C7BA 2JEOA 5HJEA 1P1FA 4CM7A 3AM1A 5BSKA 3TFQA 3OE7A 5JJCA 4GVXA 1V16B 1T6XA 5GONA 1QE0A 1QGUB 2YC2C 4I4CA 3ZHZA 4KLCA 4TKUB 6GPBA 2VPXA 1ESZA 4GPAA 3RYIB 1F48A 1SVKA 1QZTA 3G2OA 4PCAA 4LWZA 3VBCA 4AO8A 4BO3A 1YVDA 4EB6A 1P9LA 3ZCPA 2ZSFA 3PWSA 1G38A 3BXXA 4BFYA 1JEQA 1CD5A 3QE9Y 5HHTA 4C4TA 4UATA 2Z6UA 2QSZA 1X9GA 3H5RA 3QPDA 4JNCA 1Q57A 5BWLA 3CKYA 1RBQA 4YFYA 4MRRA 5I9NA 4PV7A 1DC8A 1E5DA 2BISA 2NQ8A 3IAS6 2OLEA 2GASA 2M98A 1ESCA 1K92A 2W8ZA 4QXMA 1SCUA 1YQUA 4O5AA 4FD2A 4ZT6A 1Y81A 3IGFA 3WKCA 1RT9A 4EG0A 3GMDA 2GSWA 4HI0E 4P80A 3WP1B 2XCUA 3K70D 3ZLJA 3WMGA 4C3OB 1IZYA 2GAFA 4HUTA 4WKGA 3VOSA 4M3NA 1BHSA 3K0FB 1I5OA 2X5JO 3MTQA 4W7IA 1JXOA 3I9V6 5KTNA 4FNGA 1Z5PA 4N8EA 3QPBA 1UZLA 1LV8A 1X8XA 2BRUA 2CXNA 3PD0A 3KELA 4FLFA 4H27A 1YVUA 5TQ2B 3VQTA 4TMKA 5BN1A 2PJUA 1T5OA 2P0YA 2D62A 3X1DA 3DKKA 5B4TA 4LF6B 2D2IA 3THWB 2VJLA 4PAGA 4DDHA 4F3YA 3JYHA 3ZD8A 3NO4A 4ZCPA 3HPQA 1Z5GA 3B6MA 4OXRA 1KP9A 2PUVA 1MABA 3ELWA 3DWFA 3AFMA 4Z3OA 4QM6A 1KAGA 3ACCA 1XIVA 1VDZA 3M4ZA 4OVKA 1IPFA 4LBVA 1NYLA 3WB2A 3JD1A 3CH4B 3JALB 4C03A 4DCUA 2H16A 5KHAA 2R1TB 1LBIA 4Q9LA 2IDKA 1H0SA 1G3UA 4RGQA 3MRXA 4GKJB 4KYTA 4MEJA 2J87A 1B43A 3KVVA 2H54A 4DEXA 4V3CA 5I7EA 1BDIA 3N87A 1Y0BA 1UFQA 1GZSA 4KJZA 5BVGA 1Q6YA 3IP3A 2DECA 1OWPA 3TSOA 3I01A 4P81A 2OO3A 4R8KA 4UD6A 1YJ8A 4CT0A 1RD4A 1XVLA 1D1TA 2Y3IA 3QVLA 4ILKA 3VU9B 3VJRA 5FL7D 3URKA 4M0CA 1RAIA 1TCCA 3OA2A 4HEA6 1B2RA 3I9MA 3GEGA 4EUEA 5D3MA 1O8CA 3GGDA 5E1DA 3A3OA 4O2RA 2XB2A 1E3EA 5HRUA 1H3NA 4EY8A 5C1PA 3RREA 2UVDA 3D8UA 3A2NA 2WT8A 3LLUA 5BR7A 3A1CA 3BSYA 1JDSA 1E9CA 2WU0A 1RQLA 2AOTB 3AEYA 3C4QA 4HPJB 5TT1A 4ND4A 1BOOA 5AJZA 3W5DA 2VUSA 3IELA 5AMXA 5DPMA 3ZVLA 2AWNA 1DHTA 2P4HX 3DMTC 1H6AA 3FCUB 3KG2A 4HLUC 3QPVA 4XJSA 2YV4A 1GNRA 2ID7A 2IITA 2PBLA 3EFOA 1N92A 3OOSA 4GNKA 3Q7QA 3WLQA 4BX9A 4FOPA 1SUDA 4CV2A 1E6KA 1NN3A 3RU3A 3S8YA 4GBED 3LK6A 4HNGA 2DBZA 1RCFA 4DQDA 2XE6A 1MAUA 2J9XB 5HS4A 3SHQA 4L4YA 4YT2A 4F4UA 2NSJA 3KHSA 1C4OA 3F9RA 4TYQA 3RIYA 2BI8A 1DBWA 2OB2A 3WNVA 1DPFA 7ADHA 3G2NA 4HJXA 1DG3A 3A6DA 5JCZA 2DQZA 3RCBA 3ME5A 3N2ZB 5KO2A 3L5OA 2X9QA 1HY3A 1AIPA 2ROQA 3UJ7A 1TIBA 4ZAYA 2HJ9A 1WXDA 5J3JA 1ZD8A 3V7WA 3HWWA 2J8ZA 3EJ6A 1KE1A 4JUBA 4C0KA 4MIYA 5FLEX 1N5OX 2Q3JA 5F9MA 1P29A 1C1HA 3NV9A 2ZPUA 4AZ0A 4XR9A 2QG4A 4DVGA 3L1HA 1X8JA 4ILEA 4PZUA 1N1GA 3W9YA 1IN8A 2YQ5A 2RHHA 1DX4A 2C9CA 1FYXA 2Q5CA 1QHXA 2Q4OA 3JQAD 3PNOA 4HMOA 4CQMD 1AKTA 4FFDA 5KSWB 3ZBTA 2O2SA 2HLDA 1YAHA 4MAAA 1FS4A 2NO5A 3C87A 1U7UA 2P6UA 4HLNA 4MVJD 5ALVA 1M1YA 3OZRA 1KMNA 1HT1E 1JAZA 3V7UA 4R9NA 4LXQA 4MRVA 1DEKA 5GM1A 1HQKA 3ORYA 1X80B 4BP8A 2IIBA 2CLHB 1UOEA 4QTTB 2XYRA 3IIIA 1CQJB 5ADWA 3E7PA 3VC1A 1TM5E 3ELUA 3GH1A 3HH8A 3RAPR 2R8YA 3BGDA 4A27A 5JS6A 3VR4D 3L7NA 2XR1A 3MT0A 4CM8A 2BHLA 1ARZA 1PTKA 2JFYA 2PWAA 3O3NB 2IYTA 3ZXYA 4BN5A 2QYOA 3B70A 4EFKA 4Z54A 3THYB 3QE4A 1L1EA 2VF4X 2OWDA 2NZXA 4PGAA 2P27A 4HDMB 2VL7A 1FW6A 3Q0IA 2G09A 1M2HA 2W6NA 4IF6A 2E21A 3D31A 5FUBA 5HSGA 3F5MA 3I53A 4LMPA 3O8DA 2B3TA 3T34A 3OQNA 3HJFA 1VZ2A 5KQMA 1IOZA 4FS8A 3RS5A 4XLLA 2KLBA 4BEWA 5ELMA 2EJCA 3V2HA 4CMAA 5AI5A 3F7NA 2XMGA 2A1IA 3U7HB 5HVNA 3QSYA 2JIZD 2J3EA 1NW6A 4G3XA 4NC9A 4ZN6A 1OI2A 5LXTB 5C31A 5IUJC 2EU8A 2ORIA 4FIZA 2WFAA 5EQJB 1OMOA 5KHOC 3CRMA 3QFHA 2G9RA 3SZMA 4A6EA 1P3DA 2VDWB 3O8NA 1GHTA 1XMJA 3ZLVA 4PZEA 4RY0A 2DHDA 3L40A 3FPAA 1C8VB 4DANA 4IFTA 2WKWA 2IHZA 3RC3A 2X4DA 3L46A 4JB0A 3T9EA 1FP7A 2IDMA 2P5TB 2Z95A 2JJ2D 2B83A 2JZOA 3FUXA 1KQNA 2SHKA 3NC4A 2FMFA 4MRSA 1EI9A 3UM9A 1RKUA 1NOIA 2Q5EA 4NX2A 1WB5A 2XA2A 2C2BA 1H1TA 3KSUA 4CKZA 5JDCC 2QM7A 2P3QA 4IEEA 1E9AA 3GO4A 1AO3A 3K0EA 4YDRA 5C1IA 3VKFA 2P91A 3LC0A 2A3RA 2IKSA 4O2BA 5AFSA 1FRNA 5DM1A 3U4QA 4R81A 1QRSA 1HSOA 3HYNA 1JZQA 1R12A 2HMAA 1R9JA 2HPHA 3QK7A 5JNSA 1Y1LA 4P92A 4QODA 5AXBA 2XECA 2BP7A 2ZXEA 1F6DA 1BA3A 1CQZA 4M6WB 1DDIA 3PVCA 3EG9B 2IPNA 1GDTA 1Q77A 1GPWB 3B52X 2RHDA 4RMHA 3HEMA 2OHXA 1G5PA 4K6CA 5HKBA 3NIGB 4IHJF 2FP4B 5IDVA 2PG3A 4R1SA 4LDNA 1SU8A 2Z98A 3N2KA 3W78A 3HY6A 4DLYA 1ENZA 1ORDA 4AY6A 1H2HA 1NM5C 1V25A 3HLKA 4PC1A 3NVAA 2ZTSA 1KOJA 2X5XA 3NHFA 1XB2A 5DYNA 4YP7A 4N3CA 1KEKA 1AHHA 1ID8A 4HQ6A 4CG0A 4LYJA 3WNZA 1UXKA 3ORQA 4HR7A 2J3JA 2C2YA 4H60A 4NJMA 1TXGA 3D6UA 1VSTA 1Z4JA 2YHBA 2LRHA 3GFRA 5AR1A 2X40A 1CCWA 2ZK7A 4OXQA 5E7JA 2OLKA 2ZB8A 3UB4A 1EGQA 2P9YA 4MVJF 4AMGA 4CEHA 4MGKR 4E5KA 4H6VA 1AQIA 3AESA 2PT9A 3RH0A 4M9XA 3VO2A 3MLEA 4HDAA 5A9SA 5KSZA 4XOIA 2I4LA 3BMQB 1E1DA 3BL6A 3OF5A 4A8TA 4ZHQF 1XRJA 3G2IA 4MVJP 5DIZA 3SWWA 4FCVA 1CS0A 3RYCA 2QTNA 2VJKA 3HYLA 1A2OA 1JJIA 4Z6KA 2WNHA 3ZCTA 4XFDA 3SM9A 3AYZB 1RYDA 1N0WA 4HADA 3KPUA 4CR6A 1VXOA 3L7MA 3ZKWA 1IB6A 5IJ9B 1FY2A 3SNKA 1E1LA 1Z2AA 4RV9A 3LHKA 3IPLA 3GNSA 1XFAA 3N8DA 5F35A 3URMA 2XV1A 4AM8A 2BH9A 3UK6A 1PJAA 1M3SA 1I6WA 4ZARA 5JYCA 1T8PA 1JI0A 1KAEA 2JJ8A 3GVHA 2WMOB 3ZVRA 4IH9A 3TBKA 5B1DA 1KI8A 2NADA 3MTIA 4BMPB 4DV3B 3FGPA 2JAHA 3GPCA 1DZIA 2QN8A 4OF4A 1XV5A 1XRNA 4Q47A 4F60A 3QXXA 1NJGA 1ONOA 2GN6A 4PN3A 3I92A 2VAWA 1D2CA 2AJBA 4X85A 3PGA1 3SFTA 2DBRA 4U8GA 4BLVA 1JZTA 1D3AA 3VJLA 1JRLA 1ZIYA 3ISVA 4ESOA 3OU2A 1OWOA 2XRFA 1Y4ZA 5CIWA 5EZQA 1USVA 4TGLA 3H17A 4QWMA 1L4HA 2FLKA 1G4AE 2VPPA 1E9DA 1G5IA 3OZBA 3SU8A 4GL2A 2YVUA 5KVQA 1OAKA 3A4VA 3QF7A 2BD0A 2QUZA 3HNPA 4B74A 4G89A 1RKBA 2JI6A 4WZBB 3VDRA 3BB4A 3MERA 4NQZA 2QIPA 3RADC 1FFCA 4RJKA 4AX4A 4GC9A 4CDGA 2H2AA 1TTTA 4ZO6A 4D3ZA 1C8KA 1JA1A 2P9QA 5JNTA 2NP7A 1UBTS 4BN0A 3R9XA 2NNLD 1ICIA 2VK8A 2A0XA 1SIOA 1CU1A 1SKYE 5J2UB 5JQWA 2RD2A 4FEEA 4HLQB 4R16A 1XMPA 4EVRA 5DHQA 4TV8F 3OZVA 2G25A 3KL2A 3N70A 4UAUA 1Z15A 4PBTA 4D9EA 4UCFA 4N7RA 4QOEA 2YHSA 4MQLA 2QAGA 1N34B 4I4TF 2IP1A 2R68A 4NZ9A 3A0UA 3TZEA 1KRHA 3THXA 4QBHA 5THQA 1DAKA 5HS6A 1P60A 2BJVA 2WHRA 2FSHA 3GEIA 4Q1CA 1AV6A 2G1AA 1E1KA 4L6IA 3NBQA 1AUVA 4R8RA 2CL6X 2ZFUA 2KM1A 3GA7A 3H0KA 3JR3A 4Y2SA 1KMCA 5JAMA 4I9UA 3DA8A 2WUFA 1OAOA 3ZBQA 5JIBA 1PUIA