4XGRA

Crystal structure of addiction module from mycobacterial species
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
128
Chain Sequence
b'MMVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease VapC30
publication title Structural and functional studies of the Mycobacterium tuberculosis VapBC30 toxin-antitoxin system: implications for the design of novel antimicrobial peptides
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Toxin/antitoxin
total genus 39
structure length 128
sequence length 132
chains with identical sequence C, E, G
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4xgrA00
5HMMA 3QEBZ 2IZOA 5HMLA 1V96A 3ORYA 1EXNA 5HNKA 2MDTA 1BGXT 1A76A 5ECDA 2QIPA 3ZDDA 3ZD8A 3QEAZ 3Q8KA 5ECWA 1V8PA 3I8OA 5ECYA 3TNDA 3ZD9A 1UT5A 3ZVKA 3H7IA 1MC8A 1Y82A 2H1OA 2IHNA 4WA8A 3H8JA 5SV2A 3ZDCA 1UT8A 3DBOB 5L6MB 2WP8J 4XGRA 4XGQA 1YE5A 2HWWA 3QE9Y 4MJ7A 1XO1A 1TFRA 4CHGA 2BSQA 1O4WA 5FV7A 3H87A 5L6LB 2H1CA 2LCQA 1TAUA 1W8IA 2DOKA 2HWYA 5H4HA 5HP4A 3H8SA 1A77A 5ED0A 3IX7A 3ZDEA 3Q8LA 1UL1X 5K8JB 5H4GA 1RXVA 3ZDBA 3H8WA 2HWXA 1B43A 1RXWA 3Q8MA 3ZDAA 2FE1A 1V8OA 1TAQA
chains in the Genus database with same CATH superfamily
3X43A 1SUAA 5FULA 2XZDA 5FWAA 4EHJA 4P1ZA 5EINA 4JI5B 3EXG2 4RH1A 5EJ6A 1Z3CA 3E3MA 1FNMA 1LLFA 1RM4A 1FCJA 4G5YA 1KIFA 3ZE7A 1HDGO 3OY2A 3PQ2A 4FK8A 3WLFA 4RJIA 3U09A 1T2AA 2QMZA 4EHFA 5ER6A 5KJ6A 3E9NA 3OMWA 2VBIA 2Z30A 2D2VA 2VNHA 4AL4A 4CNBA 1N1DA 3FPLA 1SC1A 4U5QA 1X9IA 3QFFA 2XMQA 4EPRA 2ERXA 5EJGA 5EUBA 3FTQA 1IUNA 3ZY5A 1C3JA 3CZ4A 1F2UA 4ENUA 1GXSB 1EI9A 5KSYA 4UUPA 1F8FA 3CZ9A 3PVSA 2IYRA 3L92A 4UM7A 4Q9KA 5GONF 5B3KA 3EF0A 1E5XA 4IOKA 5KINB 3O8CA 1I4DD 4KTVE 2BLLA 2E5WA 1KMHB 4IIXA 3RS3A 5JUWA 4TRJA 5DBIA 2GILA 3MOGA 1YJBA 2QRGA 3OZWA 1HETA 1EB9A 4FDLA 4U7GA 1J39A 2C2ZA 4ZYVA 5I7WA 4CLOA 1BSVA 2WJJA 3LWDA 2J6HA 5G3ZA 4MVWA 4UTPA 1KI4A 3PDIB 3BEDA 2V74B 2WYIA 4H77A 1E1NA 2L2QA 4MARA 2JA2A 3HVKA 4YRRA 3N9IA 3THOA 1NJGA 4LXTA 2WYVA 3RT9A 1OYVA 1S9DA 3CQ9A 3PA6A 4A3SA 5LKRA 3LCMA 2MSLA 3O1IC 1DLJA 2W6CX 3AW8A 1KI2A 3HNRA 5EUQB 4CLDA 5DGCA 1E92A 3VJLA 3MILA 3FCYA 4UXJA 1X1QA 4KXQA 4FFLA 2XQKA 4J8PA 1G7SA 1N9ZA 2VDKB 3MTEA 3UN1A 1W87A 4LYDA 4HNSA 2NACA 3T9DA 4I9HA 4B84A 1QF9A 2QPTA 3I09A 4HGNA 5EWJB 4C7MA 3DVAB 4PNZA 2FFBA 2FMTA 4YJGA 1JQ5A 5KYXA 3FVQA 1WCIB 1B00A 3FYUA 1K3TA 4LC1A 3MJSA 3EQ8A 1YZTA 3NETA 2V7TA 3ISTA 3QK7A 1RWWA 2XYGA 1A72A 4FSHA 1YRAA 2HPHA 3P9CA 2DQYA 1MHPA 4KE7A 1H0RA 1PUXA 1Z07A 2CJXA 4RIGA 2MYPA 3DM5A 4QDZA 4DYVA 1CT9A 1WB9A 1Q91A 1XQ9A 2H7CA 5EA2A 4QNMA 4RLQA 2AOXA 1MPXA 1XEXB 1W0JA 2PGOA 4IQ8A 3KT8A 1WJGA 1M0WA 2CL5A 2OD9A 4QJ5A 2YVAA 2Z95A 2PT6A 2F6RA 4XGNA 3EK2A 1EP9A 3F6SA 3KHUA 4IG9A 3VU9B 3KXDA 3AT1A 1OROA 1XMJA 5BT9A 3H84A 4LFAB 1Q2XA 1XTQA 4RXTA 4AG5A 3CT4A 3C6MA 5HVNA 3DL0A 5ICCA 2LV8A 3UMGA 1P72A 1KVSA 4JOBA 5DGDA 3C14C 3EVAA 1T2CA 3QHPA 1BJKA 3VKUA 4AZ0B 5E1OA 2P2CA 1L5NA 3UEOA 4ECAA 5B7PA 1Q0RA 1ZGJA 3GG2A 3JARB 3JQPA 4AJLA 1OWOA 3D7RA 2XYPA 4HD8A 4M6WA 4JI1B 5DN6A 3L02A 4M54A 3VV2A 4YMLA 1B26A 4Q9DA 4R3NA 3R4CA 3P0EA 4PONA 4WXRA 3ML1A 4MGZR 2GFHA 2QN3A 2Q2OA 4WEOA 2GNOA 1TGVA 4PY2A 1W2HA 4DA6A 4QYIB 1QOZA 2YXNA 2GDJA 5HJ2A 2PL1A 4R4JA 3WQRA 3BK1A 4KH0A 2W4MA 4LDRA 5IH3A 2PR2A 5IJ0B 2P68A 5JH7A 1ORRA 3R0VA 2BGKA 1BMFA 4D3ZA 5ER9A 3WA7A 5K3SA 1G2IA 5AJWA 3A06A 3ROKA 8ATCA 2O52A 2X4LA 2OCDA 1GCUA 3BGVA 3LV8A 1YR6A 1UBLS 1RKVA 3PUJA 4X45A 5IXSA 5JC1A 1MABB 3LLMA 3WDLA 3M70A 3Q1KA 4ZQCB 5KYUB 4NZYA 1A8SA 3RYHA 5JADA 4PSUA 2II6A 4Q4HA 1D2NA 4EQ6A 2D0IA 3AO0B 3W4JA 4A73A 1NNUA 3MBOA 3T7CA 3MXTA 4X8OA 3DB2A 4DMHA 3NT2A 3IRUA 4Q3LA 5IF9A 4NV0A 3LLUA 1R3UA 2DR3A 5IM5A 4XRRA 3VAAA 5AKXA 3ZBTA 1KNXA 1NKSA 5DF1A 4BNDB 1VIAA 3LY7A 2JH9A 1R4NA 3D3WA 4IQ0A 3J7AC 1YZLA 2YW2A 3L4EA 1T1RA 4O0MA 5LQUA 4ND3A 2NPIA 1GQFA 1XPOA 5JJIA 1RWKA 3KSBC 3RIHA 3FFBA 5A7HA 5AIBA 2AKEA 5KHOC 1TMGE 4RD3A 1IOZA 1NN1A 4JYAB 1SR8A 1EFLA 3C7TA 4OA5A 3G2JA 3BFVA 4AKGA 4TV8B 3I04M 4EUNA 3EUWA 1NJ1A 1ISGA 5BQ3A 3WJAA 1EFRD 3O5AA 5JAMA 5CIQA 3Q3JB 3FBGA 3LYHA 4CV1A 1BX1A 4PVDA 5CNMA 1EZZA 2C82A 1IEXA 3EXG1 3RQSA 1R8SA 2C2WA 5A03A 1GCAA 5IAKA 3FY4A 2O3SA 1IG3A 4COKA 1E4EA 2C0PA 3P4UA 3L0IB 5JIBA 4FOPA 4WOPA 3D0OA 2A84A 2G4VA 1EFVB 1U1FA 4TLAA 2XXBA 4GX5A 4H0NA 1KJNA 2W6JD 3Q9LA 3BMOB 4RNDB 2HH9A 2X8BA 1UPXA 3O9VA 1EU1A 4IL5A 1VMKA 2P4EA 2H3EA 3LP5A 4M8LA 3UWDA 3TZBA 4LJ9A 1FDWA 1KU0A 3U6BA 2PUCA 1ZCJA 1T0IA 7ADHA 1J7JA 1RXVA 2ZI3A 2WD7B 3AGPA 3TVTA 3ACCA 4O4HF 5H9WA 5GIOE 2O2EA 1GGVA 2IWHA 1P29A 3C6QA 4D6PA 2QZPA 4WLNA 1NMQA 1N92A 1U0TA 1WF3A 3U49A 2WJHA 3BM5A 3L0OA 1RQNA 1U80A 1ZMTA 2MR5A 4ZOLA 4P22A 3HA5A 4UMVA 4KLAA 1M8PA 1OHHD 1SOUA 3Q2KA 2UYQA 1TK2A 5K03A 2IBTA 4G5QA 2A8YA 2VXOA 1UJMA 3CLRC 3E81A 3E9DA 2PE5A 1SHKA 1Q7GA 5HK8A 1PHPA 1MJ5A 1VSBA 3W3AA 2P2ZA 1EGAA 2HJ9A 3KQVA 1YS9A 1KZ6A 3RYIB 1THTA 4RFLA 3CH6A 4J0KA 4MTCA 2BP7B 3PXXA 4UUOA 3D6FA 4FDTA 3UM9A 4Z4HA 4F2GA 4FFDA 1TIBA 4F2WA 3AETA 1ODIA 3IBYA 1GPMA 3VUFA 2PFSA 1N34B 2J5RA 1H3NA 2CVFA 4ID3A 4KXXA 4NNJA 4MULA 3DEFA 4HEHA 3THRA 3DHWC 1KYZA 2B94A 3C98A 3F67A 4A8JA 1ZN2A 3IIEA 2WNIA 1QPZA 1VJ5A 1Z6AA 4TVKA 1SHZA 2CF5A 2FPWA 3AEUB 1X1AA 4I1UA 4Q34A 3VO8A 3MTJA 4HH4A 5LQMA 1B42A 5JO9A 1L7OA 4D4IA 3BL6A 2BIFA 1NY6A 1A69A 1JG1A 1TO2E 2FVXA 2J3KA 4HEQA 3IESA 2ZB8A 4KO4S 4GC9A 3VHQA 4ER7A 2WWYA 2RDMA 4FEYA 4PYNA 3TW4A 2UVDA 1Y6GA 3GDWA 3WO1A 1I7NA 1ONNA 2AW3A 4C4XA 5KQSA 5IC5A 2VA9A 3SBDA 1SM4A 4KXUA 3C74A 3U7QA 5FH9A 4DQKA 2PEYA 4OXRA 3HZOA 3KVOA 2VTKA 3I30X 1CNMA 1HK7A 5HKLA 1PFYA 1Z33A 2AV6A 4LPSA 2FZWA 4M0FA 3R7BA 5JXJA 1T0UA 2MINA 3B5JA 3KJFA 3SVZA 2CDBA 5DLEA 1Q0TA 2PAAA 4NONA 1RHKA 3OT1A 1L5HB 2BI4A 3C5CA 4A92A 3VH2A 5JVDA 1NG9A 1EUYA 5JD3A 1YC5A 3P19A 4YCBA 3TDKA 4P2BA 1D1PA 1JJBA 1LCIA 3BH6A 3FPCA 4JY7A 2X5OA 1I1QB 1T4BA 2ZS8A 5LJLA 2UYYA 2WF8A 1MGPA 4C5CA 4YHHB 2PGAA 2BM0A 1JALA 3G2QA 4ROSA 3T7AA 1EVYA 1JMKC 3WWDA 4CZ2A 1L5KA 1YVPA 4V1CA 3U3DA 2HK7A 5JY6A 1XZBA 2O8DA 3R3SA 3C3BA 4D46A 3JQ8B 4IGFA 1W8IA 1MB0A 4F96A 1RHMA 3KZXA 1NNLA 3TINA 1US8B 1GPDG 1ND6A 4XA8A 2GERA 2Z6VA 4OHKA 2IIBA 4BLRA 2V1UA 2IYSA 2EQ5A 4O63O 3SZMA 3ZHXA 5AVWA 5LBIA 5HIIA 1SCUA 5D3MB 4DCNA 1I01A 1ZRNA 3VJMA 5DKFA 1Q1AA 1XMSA 4REMA 3IQIX 4JKIA 2F62A 4CKCA 3CCFA 1FFYA 1OD6A 1KAEA 3A10A 1UPBA 1BA3A 3EWSA 4WLEA 4MV1A 2DXIA 2ZAGA 3ZHYA 1BVHA 1T8YA 3CRW1 4BWGA 3EEOA 4EB0A 3JQBC 5TJHA 3VSBA 5T8KC 4JV5B 3A4VA 4TOIA 1CY7A 4QUEA 3FPJA 1QIJA 5CB4A 1Q95A 1UF9A 2DC1A 4ODIA 1JG2A 2G08A 4EZBA 2R5WA 1C0KA 1G59A 3ZQJA 2XRMA 3D8BA 1GL3A 2OECA 4ZYYA 5I7VA 5F76A 4UASA 3WAJA 4EWLA 4WOJA 4WWHA 5K1ZA 1J0CA 3VTZA 3H18A 1FYEA 1U7HA 2EJUA 4GVXA 4XD2A 2FA9A 2J0EA 3FPAA 4FEEA 3ZU6A 2ORED 3GWGA 4OK3A 3S2FA 1NU8A 3KVNA 1OW3B 1O95C 1WY7A 2UYOA 3VBCA 4PIMA 1OI4A 2J5KA 3RGGA 2NX2A 3DYBA 4WZZA 1A4RA 1JDUA 3UJPA 3LM8A 4YUAA 4CQMB 5LZ4A 3IELA 3SAJA 4OMDA 4K9OA 1RIIA 2Y68A 2VDRB 2YYYA 2FUG1 2ZBUA 3SZGA 4YXWD 4BO7A 1A76A 1X7WA 1RYNA 9ABPA 1KGDA 2GWHA 1GLVA 2BMWA 5JAIA 1FFSA 4FBMA 2GBPA 3OHMA 5CLGA 1O0CA 2HPZA 2JBWA 2C8JA 4LCBA 4ZC8A 2BKUA 1PR9A 1U4NA 3G2PA 3LDGA 4EARA 4F4UA 4PCLA 4BE7B 1ODJA 2I4LA 1SH7A 4HT3B 3D2AA 2X3UA 5M3BA 5TX7A 1Z56C 3DT8A 3T06B 2PLRA 1IMJA 3TXAA 4KR3A 1N5LA 3TUIC 3R9WA 1IZ9A 3B38A 3FVRA 1HXHA 2VJBA 1KYQA 4YP1A 4GSYA 4F4IA 4LE2A 1SBYA 3O47A 6REQA 5MF6A 1QG2A 3DF7A 2X86A 4XQ9A 4Z3DA 3KVRA 1R3DA 2IP2A 3WKDA 4WE3A 4P0PB 1IPFA 2C59A 5JE8A 1Y1PA 2AK3A 3E53A 3OU7A 3LGSA 2R5FA 2Y2VA 4POAA 3E1SA 4LRQA 3T9CA 1FFHA 5KYNA 3H7AA 3QPVA 4PYLA 4H7DA 4JSRA 3ACBA 2IGTA 1PK7A 3IT3A 5AVRA 1CUYA 4Q39A 1LQTA 1VYTA 2CHFA 3G8YA 1CQXA 5A6SB 3ZUPA 3SYRA 1ZM9A 4IKOA 1ZD9A 3PVZA 3M2PA 2HW8A 1Q3TA 4DRZA 2ZU6A 4CG0A 2WWWA 4D4MA 2C96A 3TAXA 5BY2A 4FHCA 1L4BA 3NBFA 4G5SA 1FSSA 3TLMA 1SXPA 2OHGA 5KJFA 3D3NA 4JT2A 1T1GA 4PSAA 1CR4A 3MCVA 3FPEA 2X23A 1NG1A 4OX9B 1RR6A 3NUQA 3CKKA 1VMDA 5EXTA 1DMSA 4C4AA 4NZNA 1JR3D 2CLCX 2FSUA 4WINA 1NLZA 2RK6A 1DIOB 2FK8A 1F14A 2G4LA 4ED9A 4REQB 4F11A 1JMYA 1SU6A 4G24A 5F1KA 2W43A 3RSFA 4K9MA 1W4AA 3I9FA 1KQNA 1X3SA 3UKOA 1M1YA 2KPOA 3O7WA 3OZDA 4YUXA 1ODCA 1JLLA 3GLIE 3WMGA 3ND8A 2QRUA 4BNKA 1OKKA 4D9MA 2AFHA 3R5SA 5KWSA 5MGBA 1SUPA 3VKFA 3CV3A 4CKXA 4JXZA 2RG1A 3M33A 2W6ID 4BKUA 3QHQA 2EAUA 4URYR 1I4OA 1CB0A 1D2EA 1SGWA 2CNWA 2QZZA 3BRQA 5FWXA 3X2FA 5CW2A 4DUPA 4YJ2F 1Y5LA 3WDMA 2ZTVA 5H3HA 4WZ6A 1QLHA 3F6BX 1NF3A 1PBNA 1JZSA 1O54A 2Q7XA 2TYSB 3LUPA 1B14A 1GD1O 3N0TA 4GRDA 2E21A 3CSDA 1CDEA 4QNRA 1Z2EA 1K8RA 3I2IA 4RQTA 5DNVA 2RBKA 4UHDA 5D5PA 2RBGA 1G5PA 3AP1A 1FVHA 3TKAA 4R7GA 3KZ1E 3K9FC 4BJ3A 4E07A 5LZ2A 1V1MA 3GR6A 3M82A 1Z2PX 3BXXA 3PRHA 4MA5A 4ZI7A 1NVFA 1J2JA 1XTZA 2YJGA 2PUJA 2EFCB 3LWZA 4I46A 4RZHA 2OR3A 4BZXA 1SU4A 1RBZA 1P1IA 1RD4A 3W5DA 2QSYA 4HGYA 1MXFA 1R0XA 3DOOA 3ENNA 1X42A 1OR8A 2XCLA 1GFZA 1C30B 1JSRA 1JIJA 4W9NC 3FE2A 3UJBA 2KW5A 3KC2A 2AR7A 4GSLA 3PEFA 1UWKA 4GM0A 2QLLA 2ZUDA 1KYXA 1Q7CA 2O3UA 4LHEA 2WUWE 1G8JA 2CXPA 9ATCA 2PZEA 1B0ZA 3AJEA 3FMIA 4QDTA 4DT1A 2CDRA 2ONCA 2N47A 5ALUA 2W90A 5JS2A 1YS1X 1IVSA 2NO9A 3L82B 3OZTA 2WKWA 4BWVA 5BWMA 5JHGB 2VPQA 4E5YA 5DI9A 1HYBA 4RPIA 5CXSA 3H9BA 1QYRA 4OHVA 3OQIA 1CS4C 2I4RA 3LX6A 3DA8A 4G2NA 2R25B 1GPJA 1O6FA 3NUZA 2Q8PA 2CVHA 1NDUA 3AUAA 3AVPA 4P35A 4H4DA 4BNJA 2G9VA 4ZVMA 1QH8A 4MX8A 3CF4G 1UT8A 4PINA 4E70A 2XTNA 4TT3D 2CFRA 2XX3A 2FWPA 4G5GA 1JKXA 2HBZA 4LJKA 4EPXA 1R50A 3JQDA 2ZM5A 4P0QB 2W2LD 2PFGA 3HP7A 3Q87B 4HNRA 4S0XA 2IEBA 1H65A 2QQ5A 5E0OA 1MLDA 5DBOA 1V7ZA 4FFPA 2BJVA 1XO1A 3HABA 3RV3A 2EG9A 1U81A 4JBGA 1E3WB 1QZ3A 2E4YA 4RESA 3JZIA 1KVQA 2JIMA 2DUNA 3AL0C 2HEGA 1MC4A 4KDRA 2WUFA 2OBBA 3E9CA 1RCFA 3IQFA 1R74A 5J59A 4BJ5A 4XX0A 2FTKE 4BMPB 1YL7A 1XZFA 2NUBA 4EHNA 3ZY3A 4MP6A 3STVA 1OJLA 4YJFA 4XYMA 4GO1A 3VMMA 4X0EA 1Y9JA 5CA1A 2F48A 1M2EA 3BBPA 2G72A 3K9LA 4GI3A 2QV7A 1XB2A 6ADHA 1X19A 2P4SA 2QS9A 1PK9A 2CLSA 4N3AA 5LB2A 3AUFA 4JNCA 1J5EB 3UUWA 4RD6A 1GJRA 4Y6SA 2X4GA 3FX2A 1T8PA 2HRRA 3D7LA 3ZZ1A 1E1CA 2A9VA 4MR8A 1KDYA 4I4TF 2VFAA 1NQTA 2W8BB 3NUGA 1AS2A 3RFFA 5H4GA 1JDVA 2VDUE 4FHDA 3LVBA 3IKLA 3O31A 4CV3A 4MO2A 1FUIA 1GSIA 1QMPA 3H0EA 1ZG3A 1W36D 1IIBA 1TUGA 3RROA 3C87A 1Q0QA 3RBVA 1G2PA 5CVVA 1ZMBA 4BBJA 4D9JA 3N2KA 5DVZA 3S44A 2A35A 2R47A 3SFVA 4K05A 3BSSA 4ARVA 1JWLA 3CN9A 4BNUA 3SS9X 3GEMA 4ITRC 1FJHA 2CLOB 3BWEA 3JD2A 3O2SB 4OQQA 3K9NA 3ZHTA 2QF7A 1NQOA 2CN1A 1IZ7A 3M1IA 1ZHOA 3FWPA 2NO0A 2YNMD 2G25A 2WJGA 3KSDO 2HMWA 3DB1A 5DSXA 2ZITA 2YZ2A 1GAJA 4RMGA 4Y2QA 3ZV6A 5JECA 3PC6A 4JYBA 5A4AA 2J31A 1M2WA 3OCWA 5LA6F 5K9ZA 1H4QA 1PDVA 2ADFA 4FDAA 4FOTA 3WIDA 2HF9A 4G25A 2XSZA 3MSCA 3OE1A 3OPMA 4QYXA 5B57C 5EJ9A 4YNBA 5TQJA 4NFSA 4QIHA 3RM3A 4CCSA 4E2YA 3LP8A 2ZQZA 4Z99A 2WJVA 5FUXA 3QG5A 1ZJZA 5EZSA 1RRPA 3HA3A 4PHCA 3SX0A 3WYBA 3E9RA 2C99A 5BRJA 5CYOA 1IE3A 1Z38A 2OB2A 3GW8A 3RO7A 4COOA 4HB4A 3U19A 3TIFA 4JUCA 2FRDC 1NJ5A 5A71A 3QYJA 5FA6A 3ETLA 2V98A 1WZUA 3UWPA 1E2EA 4PLTA 1QQAA 1CUUA 1Y5NA 2F1KA 4PLCA 4QHYA 4X6XA 2WSIA 2ZUWA 2GBCA 4E22A 3CNQS 1KZ9A 3LE8A 1LKZA 2VSFA 3LNCA 4G5FA 1D2MA 5K05A 3VA7A 3RK1A 4TYYA 3R9XB 2AZDA 4KQEA 1E89A 4U2GA 5DI3B 1MJNA 1JKFA 4MMXB 3K53A 3Q3VA 1PT7A 3EY9A 3GHHA 1TT5B 2WINI 1PKEA 3R5KA 2ZSFA 1JH8A 1Y3HA 4BX2A 2OBNA 4D0RA 4I7EA 1G6HA 2VF2A 4LMBA 4XPIA 1QNLA 2FZLA 4FCCA 4H18A 4DM7A 4EB8A 1QTQA 3HUFA 3NP7A 1TFRA 2GAJA 3ZCRA 3QF4A 1SVUA 2WOOA 2X8WA 5AJXA 3I9NA 1Y9ZA 3N0XA 3T3PB 5G53C 1P7CA 1UPFA 4J0EA 4F93B 1RQLA 2CVPA 4ZEVA 1FU4A 2PS1A 2NLOA 2V7QA 4IH1A 2Z57A 2ZDQA 5FR2A 1OA1A 3HGQA 3PC8A 2R87A 3BSYA 4GNRA 2CE7A 3ZDFA 5DDIP 1GQ2A 3HDYA 2V3VA 4E2WA 2WMNB 3AKCA 2HU7A 4JB3A 3BD6A 2ZI7A 2WICA 3EBPA 3E5RA 2FMXA 3SHTA 4C88A 4CQMD 4MWCA 1QP4A 1U2GA 5DNDA 2DG2A 2XBLA 2GF0A 2XUPA 5EZYA 4NZOA 1PRYA 1S89A 2GH1A 2FPUA 3DMTA 3VPFA 3ZTYA 4BRSA 1OXSC 3QU9A 1E4OA 2P3QA 2GVNA 3PXCX 4E13A 5DU2A 2F9LA 1FFEA 1W0CA 3QE3A 1FP2A 1EE2A 4L0CA 3J81k 5E2IA 4LZZA 3DOFA 4Y9DA 3OLCX 4UNIA 5FBLB 3S1AB 4F1KA 4TKVA 5CVTA 1CVIA 3GXOA 3HUTA 4R2XA 3JASB 4C0QC 3WLEA 3DYIA 2XADA 3RKUA 3UOAB 4KDFA 1M8FA 1EBFA 2BRUC 1XMPA 3OHSX 1GO2A 2SCUB 3O2NA 1E3TA 4F04A 3WLIA 1E9FA 1SXQA 4KHZA 1P74A 4QXRA 3ZXYA 1W581 2G9QA 2P7IA 4YMTA 2DERA 2QPAA 4GUDA 2Y0BA 4EY6A 3UGQA 5TLSA 2ZB7A 3N28A 4NICA 1I2CA 2OCPA 1QBGA 1G5FA 2GEVA 4WNIA 1UZAA 1P7WA 1CQJA 4BMVA 5AUOB 2DT8A 3BTSA 1CF9A 3PCRB 3ABRB 1BFKA 4LTMA 1VE7A 2Z5LA 4O2AA 1CVRA 4QQ8A 5E1MA 5KNDD 1TRKA 1U2ZA 4QOHA 4ZO4A 3NXKA 2VDWB 5CW1A 1A27A 1TOAA 1XNJA 1Z0UA 2IBMA 2N42A 3LH5A 3SBEA 1BD4A 4YRMA 5HDBB 3OZAA 3OJLA 1B8OA 1IUPA 2RKWA 1KPHA 4OKSA 5ITSA 4W5QA 2YL2A 3I2KA 1H1TA 4HEA1 1WA5A 3BXEA 3AB8A 3R7SA 3V8BA 5HIKA 1CRQA 4F9TA 4FMCF 1S2DA 4S1OA 2QE6A 3EPPA 4HTFB 4MIOA 4PX3A 5DNYB 1HT1E 3L40A 2X76A 5DRTA 3MLAA 3BOSA 3WNBA 4F06A 1L5YA 4KR2A 1JXAA 1ZI8A 3S1LA 3WBJA 1NXSA 2E5LB 1A4IA 4DCOA 1Y89A 1NM5C 2ZTUA 3JALB 2Q3HA 3P0IA 4QG7A 5TE9A 5K0EA 3ZWOA 4ISBA 4WSOA 5AVKA 2OY0A 4ZTUB 1MO3A 2C9BA 4IJWA 3D6MA 4I4IA 4WA8A 4NPAA 4YJ3A 5CB0A 3HDHA 4HN4B 1FFAA 5E7JA 1QK5A 1L7EA 3FIJA 3ZE2B 2IRWA 3F5FA 1K8ZB 1FP1D 1MOPA 1EVIA 1N3IA 3CIOA 4BC0A 3OD1A 3GROA 4G0ZA 5KYWA 2FG6C 2QD5A 3CGGA 4OQYA 3GP3A 3VYRB 1FU8A 1DIAA 1AUQA 1M34A 1NZDA 1ZNXA 3E9EA 3O82A 3ZTTA 1KJJA 4GYWA 3JQFA 3OJCA 2NADA 4O8ZA 2ZIWB 3GUYA 2RGWA 4FHFA 4Q3AA 1VGQA 2VQDA 4LSWA 4N9WA 2VSNA 3KQLA 3OJOA 4KQWA 4K86A 3N3BC 3KKZA 4KFTA 3AI7A 1FX0A 5C8ZA 1AXRA 3ZHCA 2DAPA 4DLZA 5HZKA 5EERA 4QDKA 4UFOA 3OPXA 3K6SB 3BTVA 1KC1A 5FDFA 5BO5A 3QVUA 1LPOA 1PJSA 4HDQB 3OPYA 1VZ2A 1NVMB 3U7GA 2HDNB 3TDMA 6Q21A 3FPGA 1WMFA 4EDFA 1Z8NA 2OXIA 1LDMA 2ZE6A 3HLTA 3E18A 4HMPA 4KX3A 4PFJA 3FTDA 1NFFA 5D51S 5BVHA 1RKBA 5FJJA 1OLUA 3LT1A 1ZD1A 3ADCA 4G0UA 3SOZA 1C4OA 1WUJS 4WN3A 1BJRE 2ZQ5A 2IS2A 3PUXA 3PS9A 4HPWA 4DRYA 1N7JA 1CXZA 1Y33E 2HJWA 2VJMB 1VYUA 1JIIA 1C80A 1YXMA 4AS2A 4G56A 2ZYVX 4IRMA 4QATA 2C2BA 3MRVA 1CTQA 1XPUA 1KQGA 1N2EA 3BXGA 3F4BA 2Q5CA 3DEKA 2NZ2A 4F1WA 3WLNA 4HS4A 4JL6A 1BQEA 4II3A 3QE0A 5BMVB 3DCYA 1ZJ6A 2CCGA 2I7TA 2A78A 3BIFA 5AXBA 2ODQA 4AMGA 1N2CE 4CMIB 4WY8A 4EENA 3ZG6A 4RIEA 4FB4A 1KAHA 1YHYA 1K5HA 1IEWA 1AZLA 2DWPA 2GRAA 3DQQA 2I80A 3AONB 3UGKA 3CPJB 4LOHA 5FPKA 3A0UA 4ZV9A 2XCSB 2XNKA 1H5NA 1FW6A 4AX4A 2GK3A 1XN1A 2NO1A 1WSAA 1D8AA 3NWOA 4C7KA 4F6LA 1N75A 3G5TA 2KMLA 3BX1A 2EZUA 3B5IA 5LUBA 3UF0A 4CLEA 4ZT6A 4N7MA 1NDHA 4L73A 4Q1BA 5TC4A 4MS3A 2JLWA 2EHDA 1RAFA 1Z2AA 3ZBPA 5K3FA 3H2YA 1V25A 4Y0VA 4JEIA 2DH5A 4BRWA 4EYGA 4MCAA 4CW7A 4IJ5A 4WN9A 4JC8A 1E4VA 4NZPA 3TQCA 3Q6NA 3G7NA 3HWSA 5K3EA 1TJ3A 4U7HA 1T2NA 3TLJA 3P1JA 1M2HA 4HZIA 3L6BA 2VLIA 1F6DA 3LFUA 1VIVA 2DQ4A 4GEKA 4CLXA 1YVUA 5D87A 3EXHA 1RYBA 1EVZA 2HXYA 1H2BA 1UIRA 3QYFA 3GMIA 4IAOA 4WFIA 1PSWA 1QO0A 1KI9A 1T3ZA 1PTJA 5H1YA 1GPNA 1L4MA 4K2HA 2MSDB 3D8RA 1IONA 1T24A 5JEEA 3WLHA 1ZNZA 1OZHA 1YS4A 3KKQA 3SIWA 1FUEA 2Z43A 1XVIA 1U2DA 3IDAA 5AJZA 2E37A 5FUYA 2CWWA 3PC2A 1O9BA 1VYHA 5AI9A 5KWJA 1R64A 3BXFA 2PZLA 1R0KA 3N2LA 3G5MA 3DS8A 3QPUA 4EKGA 3ANXA 1EM8B 4KO3S 2HMUA 4U9HS 3STUA 3WK4A 4DDHA 1OTHA 4P53A 5CNJA 1VPDA 2XE7A 3CFYA 1HFJA 2RC6A 2L18A 3WK6A 4B33A 3U3OA 4DZZA 1KAQA 2H59A 2VYCA 4J0IA 4ZVSA 5T6BA 4BVHA 2MIIA 2Q3DA 4FHGA 1RP7A 2AG8A 2GTHA 2HU2A 2WW8A 4KXFB 4RH0A 2XDAA 5EE0A 1OT3A 3ZOZA 5HKOA 5K8TA 2H1CA 2Q3EA 3GGSA 3FM9A 5DOZA 4KXLA 1H8HA 4DB2A 3ICVA 4R54A 1BFDA 3WHIA 4ZYWA 2HAEA 5DBGA 1C9KA 2BISA 1GTZA 2C1EA 5K2MA 8OHMA 2X22A 1MJHA 2HWKA 2FRVA 1PYDA 2SECE 2Y71A 3CH7A 1DQPA 4RD1A 1IVNA 4L50A 1WZCA 2LKDA 2AEJA 1UBJS 1EFPA 3EGDA 3NGMA 4ZRMA 5JZSA 1YULA 1LTHR 1BHSA 1PZMA 2R1UA 4FX2A 5F1OA 1YRHA 4L75A 5BYJA 1T8RA 4LV5B 3MAAC 4JR0A 3NTVA 821PA 2GOYA 1GSHA 2GN8A 1A77A 1ECBA 1K89A 3P9PA 5FPTA 1YGPA 3VC3A 4A23A 4MPPA 1NVKA 3REFA 3DOHA 5HWSA 1BYIA 1D0SA 1Y4ZA 3T4PA 4U2KA 4NH0A 2G77B 4LJSA 1D1TA 2JFUA 4L9AA 2PX2A 5T4BA 3U0VA 3LY5A 4FN4A 4MZDA 3WK7A 4D4JA 4E6EA 5BWOA 1R4MA 2YWJA 2Q1UA 1R5JA 4NENB 3ZWMA 2C7PA 3HWRA 5U1PA 4G65A 4PZDA 4I0WB 4W7SA 4MKGA 5BRAA 1RDFA 3O21A 3PEEA 1I33A 2C84A 1WEHA 4BTLA 2ZYGA 5JYDA 1X80B 1YJ8A 2WQ6A 1PQUA 4MVJG 2WTXA 1VRWA 3AP3A 3REQA 3CNHA 3IP6A 3UCXA 1JAHA 2BEKA 2DFNA 1HTWA 4X60A 4UJ5A 1Z6YA 4OQXA 3KEFA 1AXGA 4KWTA 4RF5A 5U4QA 5IT5A 3RS4A 5AH0A 2PL5A 2YHIA 1S01A 2Z8YM 3NHAA 4PTZA 4MQ4A 1MQSA 2LDXA 2EDAA 2BM9A 2C83A 2IEGA 2Q4BA 1E3LA 4HAXA 3ZGLA 5I48A 4FTWA 3CCCA 3LPAA 4K81B 1NL3A 2PJRA 2RI0A 1N2XA 2J09A 3E7XA 4DIMA 1D6NA 5TV2A 1EFCA 2GBFA 1R6DA 3I28A 4A27A 1KDTA 5G4LA 3D6JA 5JFOA 2OAQ1 4F3TA 4ZTBA 4CWAA 4TXHA 1A5SB 1CETA 1DG9A 1Y3DE 3UW1A 3PB3A 3BMQA 4LBWA 2BCEA 3QKUA 1YBAA 3L43A 4LTDA 1CS0B 3V34A 5ALYA 2DHQA 1DBRA 3ZWBA 1M2OA 4HDRA 4ZOCA 5LZ8A 1DT3A 1JV2B 1EP2B 4X95A 1NLYA 1G8FA 2VAMA 1T8UA 2VDMB 1ZK1A 2Y1EA 3MB5A 4NU6A 3RODA 4LXIA 4C3UA 4BB5A 2BYTA 4C2AA 3V2UA 2YV3A 1JEYB 2JIZD 3RUAA 1K5PA 2E9SA 2QTTA 2QNBA 2L17A 3CBQA 4QO7A 4F92B 1KGSA 2CZGA 1IL0A 3S5JA 3BPSA 1HQDA 2CKMA 4JT9A 2C3UA 1KOLA 3NU1A 2W2QA 2XEDA 2D62A 1T2FA 2GMWA 1EUZA 2XUIA 5F1PA 2PQMA 2YZKA 1IXZA 2PKRA 2V5AA 4AJIA 3QGMA 1E94E 3VYTB 4ZPXA 3N1UA 2WM3A 5JH7F 1F6WA 4P4GA 4BQIA 3RAFC 2R6DA 3R3WA 4MJXA 4YTEA 4GGMX 2LIVA 1MAHA 1NTOA 1T9AA 1E1MA 3COSA 5L40A 4BU0A 1BKYA 4BVLA 4IJ6A 2HLHA 1N77A 4TTPA 2PJZA 1VKJA 2GWRA 1SQ6A 3GJ3A 4ENWA 2R1TA 3TZ6A 3V8PA 4ZREA 5EJMA 2C7RA 3TXXA 3W06A 3HXKA 4CJXA 4XD7D 1EFDN 2G9ZA 3FZEA 4WCFB 1LUAA 4B09A 1EFUA 3II6X 5KNCD 1N2CB 5DASA 5DHAA 3GZNA 1HT0A 4GW3A 1IY8A 1SZPA 1DINA 3I1IA 1DQYA 2X8LA 3EG9B 4PANA 4TWIA 4WJKB 4D57A 1D3AA 1JI3A 1FYDA 3FYHA 2ODPA 4PZAA 1WKBA 5HKAA 4J29A 3R3ZA 3WYDA 2FPKA 4AG6A 2QMQA 4IUYA 1GZHB 3BJEA 4OI0A 2DPHA 3D8UA 3NIGB 5J4HA 4CEIA 2J9YB 2YMMA 3UHPA 2DLCX 3ECSA 4LFBB 2P5YA 4NBTA 1W73A 4UBMA 221PA 2J3IA 3N2ZB 1T8WA 1ZK2A 4BCBA 3IAHA 2QM8A 1RHRA 3V46A 2ON6A 4BBAA 3AP2A 1I5RA 3TW8B 3VR5A 3BHNA 5EG5A 5J5VA 1H2FA 4EZIA 1ZGCA 4TX1A 3SF8B 4NR0A 3ROEA 3WLLA 2DMRA 1LRLA 3LI2A 1J33A 1V41E 2DTDA 2BFMA 2DUJA 3LQKA 4ZU6X 1YB5A 3IUQA 2AC2A 4X54A 3M49A 3S70A 3VOBA 2XYHA 5CVEA 1XNRB 4BXOB 2RAFA 3I58A 4V0OA 2Y1CA 4HNAA 3RU7A 1AO0A 2PRJA 3K05A 5GADl 3TRJA 3BSWA 3CLRD 2FZVA 4LXGA 1YB4A 2C78A 3GARA 3CKMA 1ZLXA 2B35A 5C35A 3OIWA 3EIOA 3VH4A 4CF4A 4EHIA 3I4FA 3WGKA 2KI5A 1DADA 2A0YA 5GPBA 5HM6A 1PGNA 1RYHA 4YASA 2EKLA 2QD3A 2Z5GA 4NDAA 3T7DA 3COVA 1RM3A 3N7AA 1Q57A 1DDOA 3QEAZ 2GRUA 4R3WA 2JVIA 1G3RA 2FFJA 3QZUA 4HYQA 1PJ3A 3IP3A 3PG5A 3Q0IA 2BKXA 2XMPA 2ZXEA 4B74A 4LGMA 1RJ9B 2VP2A 5CFRA 5JCPA 1E2BA 4EIWA 3X1MA 2MMGA 4MYDA 1VBKA 5EP3A 1Z26A 4L9WA 4DLWA 4X1OA 4E1BA 5K01A 5CD1A 4DMUB 4Y6OA 1UDRA 2FX5A 3I0NA 4RA9A 4C20A 1NVWQ 3QXHA 4HNHA 3A04A 2O0HA 2Q5FA 2M6RA 3BCUA 5GTDA 3WS7A 3WK5A 4ZXFA 3W6NA 2YIDA 2VQ6A 1T5HX 2WIKA 2CV2A 3EFOB 2YMLA 5FUBA 3RVNA 1VPEA 3WL5A 1H2RS 3HV0A 1ISJA 5L7WA 4H3VA 3T3OA 2FV8A 3K6KA 1AF4A 3EUEA 2IQIA 3UWMA 3U6KA 3O8NA 4O0LA 4P54A 4PNPA 4UBIA 1QS0A 3U7IA 3UA4A 3WRXC 4CDGA 5LQJA 4TKMA 3IHLA 2D1TA 1E98A 1YHNA 3FKSD 4ZIRA 2IOFA 1T6NA 3DCIA 3ZBUA 3UHAA 5I4BA 3T5BA 2GHQA 1WKCA 3DJFA 5EWLB 2X40A 1OTYA 3E5HA 1GLNA 4PF1A 2OO7A 1UFVA 3DXZA 3SHFA 4OXYA 3UJDA 1X1TA 1FLAA 2OVFA 1NPYA 4BHTA 5BVGB 4CM9D 2HU8A 4WL0A 3UENA 2XLBA 5IK2D 4IZ6A 4OHCA 4UMFA 1ESEA 2Q2VA 1BWQA 2WLSA 5G0UA 5H4HA 1NF9A 4M7PA 3WLPA 2K7ZA 1XDZA 2QVGA 4NFHA 1IYZA 1YK1A 3FHOA 5L53A 3BK7A 4O2BB 3AC0A 2CB0A 1U5BA 3PRKE 3ROMA 4QQKA 5CEFA 4NFYA 4PFQA 3ZZNA 4A1FA 1K8YB 2C31A 1YS2X 4RU1A 1ZINA 2EBWA 1LPPA 1FSFA 3LYUA 3M1YA 1AJEA 2OCBA 3HFJA 1XRNA 3AUTA 3CLTC 4PIPA 4QFCA 3WHLA 4EF6A 3RRYA 5IM4A 1Q0HA 3GEEA 4MRAA 4UTXA 1NBHA 2JHFA 2YQZA 2AJBA 3LCVB 2IZ1A 5LVAA 1DEAA 1ABEA 1JDJA 2HQRA 3DW1X 3DEHA 5TEWA 2WSYB 1FTNA 3LGXA 4QXPA 2I1LA 3O9MA 2TSYB 1BS2A 2O5EA 1KJYA 5TJ9A 1K86A 2QA5A 1U11A 1T6BY 5IMSA 1BG6A 2EZ4A 1EXVA 3GYBA 3WLKX 4PG4A 1MQ8B 3M4ZA 2FE1A 3WBBA 3A37A 1NW4A 1X0VA 3TIXB 4DRXA 4WA7A 2GUGA 1IXYA 3WZ2A 3QJGA 1E9DA 4I6JA 3L0CA 3NHZA 2R1VB 3DEJA 5EHIA 2RGNC 3JWIA 3PFNA 1GP2A 1ZEJA 5A3QA 5TQ0A 4KR0A 5DZSA 4DB4A 4JYMA 2ZYDA 4YGXB 1OF1A 3NDRA 3C5HA 3NV9A 4ND8A 2AR9A 2OFXA 3SMVA 5LOVA 3UBTA 5FT9A 3ONVA 1IK4A 3QEOA 1RYMA 2HHAA 1HEYA 1O95D 1EH5A 5ICFA 3QKWA 4BMXA 5HNKA 1FFXA 1KJ9A 1RLJA 1VPVA 2R7LA 4I50B 4O08A 4RGQA 5EY5B 3M6AA 4B7XA 4EEXA 1C1DA 5JSUA 2IY9A 3AOEC 1UM9B 1YD7A 5MFPA 3KOOA 4RD2A 3V7YA 3T1HB 2FEWB 4JXKA 5LZ9A 1N2IA 1KMQA 3AZOA 1J4AA 2ZBFA 3EXFA 4S1VA 5D6NA 2ESRA 1XDGA 1XALA 2WPDA 2W6OA 3G89A 3MYYA 3TLGB 1DCFA 4E5UA 3NBUA 3ADKA 4M0LA 5CLJA 2JJMA 2BKEA 2VPIA 1V1JA 3DDWA 3CRNA 3UH1A 1X1DA 5AW4A 3F8TA 4X7BA 1K5GA 4BNZA 4Y2HA 1DBWA 1PFVA 3D0QA 3DL4A 4LMPA 3IGFA 5FRDA 3LD9A 3SYNA 3WBKA 1Y81A 3A1FA 3ONWA 4GLBA 4D8UA 2F4VB 4XQEA 4P4SA 5E6UB 3DTYA 1T9BA 3AFNA 1IXSB 1XJ0A 2BTQA 2NO7A 2ZP1A 3CGWA 3HCRA 4WLUA 2HMSA 5IBQA 4EJSA 4B3RB 1QHHA 4Z9AA 1GFWA 1R6VA 3WKCA 4ZEXA 1M6VB 1X8XA 4XXHA 4KBGA 1KWGA 2DETA 1A50B 4LYFA 4L5CA 4LXHA 1BCRB 3OEWA 4L7VA 1JHZA 4IJQA 3LLCA 3EGIA 3TG8A 3B6ZA 3CX6A 3D1JA 5BSUA 5A4JA 1CF2O 4XIJA 3GLRA 3UHOA 1SQSA 5J2UB 4F84A 1GKIA 1WBJB 1NR1A 3KD2A 2R4TA 1QQ6A 2F3RA 5CYPA 5FTMA 4MWBA 4EGAA 2W71A 3VTFA 1DDGA 5FA5A 3ES9A 3QU5A 4U5XA 4EJFA 1W6UA 4KWHA 1GQQA 2G3YA 3GGGA 3P45A 5AM5A 4OLJA 4MROA 5CITA 1ISSA 2HK8A 3R8XA 3W5AA 2B6HA 4G67A 3C0KA 2G09A 4V3BA 1J2UA 3A1DA 4DADA 2FN9A 4ABTA 3I62A 5FUWA 5BNTA 1CPYA 5G3YA 1QCYA 3D4NA 1R18A 4MRRA 1QE0A 1SBHA 4JLMA 1ODTC 3S8MA 4HHEA 3L2OB 5AHOA 2JCVA 3FCEA 4C6SA 1E6UA 5TVGA 3VDNB 3IV7A 4Z0TA 2RSLA 3O84A 3LIIA 1FQJA 2X8JB 4UCQA 4J0DA 5ALFA 5IASA 2AI3A 2C8VA 2Y76A 5F3RA 1YFLA 1NXQA 1ZUD1 3PNLA 2Q28A 3AJ9A 4G0QA 4QBTA 1PWXA 3SYKA 4E7PA 4KYUA 3AEQB 3FOAA 3IBGA 1PLJA 3G1WA 4CMBA 3OZUA 3M3DA 2C61A 4JUBA 1V3QE 4WCDA 4JI6B 3SP1A 4BFTA 3EGCA 3GRUA 4D74A 1ECFA 4JX8A 1CEYA 1M5RA 2F2TA 4NHOA 4WJZA 5HK9A 5IKEA 1U2TA 1DQZA 2BCJQ 4PC7A 2Q4OA 4XTRA 4DTIA 2A88A 4B7CA 1KY4A 4GFDA 1RPNA 2Q27A 3JYHA 2FKNA 3EXAA 4TXMA 3DAFA 3GFTA 3GRVA 4NCAA 4NYIQ 4LHSA 1DAIA 3DOIA 5CCEA 1KMIY 3PC3A 3PTLA 3HZRA 4FLEA 5FWYB 2KWIA 2SICE 3OWXA 3PD7A 3WHPA 1G21B 1MQAA 1DKUA 1ULTA 1OVGA 4DMKA 1ENPA 5DW0A 2OK7A 4L3VA 2PSEA 3HBNA 2UYCA 1PFKA 3T9EA 2GCIA 4L57A 3GEGA 2PXAA 1G17A 3ED5A 3PR1A 5KOHB 2DPYA 1EVQA 1TA4A 2I99A 2YTZA 3VHXB 3NFRA 4JL8A 4RC9A 5K0TA 2EBUA 5CX1A 2XIQA 1NC1A 5IC4A 3HLYA 1OLXB 3AVQA 4Z9YA 1L9KA 1BROA 5DX8A 5KC9A 3T5AA 2NV2B 2Z6UA 2ZE5A 4MHTA 4BZPA 2WAYA 3ZCTA 3D54D 4L3OA 1QWSA 2BZ0A 4DJTA 1F3OA 3N87A 1VOTA 2VKQA 3HJRA 3WADA 4TTIA 3ZKWA 4DL9A 1LJUA 4MWTA 4OCZA 1N2BA 1L5VA 3RVOA 3K5HA 3VNRA 3ZZ0A 2ZJOA 2C4NA 1FXUA 4KLRA 5J4YA 4AROA 3U1TA 2JH3A 3KZOA 5FL3A 3ZVKA 2I62A 4ZI7F 1NYQA 1V8BA 2J4FA 1YOVB 4OHPA 1U7OA 3IUSA 3QPBA 2FF5A 1QG0A 3FWHA 4TYMA 1UJ5A 1ATIA 5FHQA 5F7OA 3QMVA 5KDOA 4DQLA 3QP9A 5HS6A 4YCDA 3FUTA 4EX7A 4DARA 4V2IA 2CFOA 3ZY4A 2ZATA 2MOKA 3B2EA 3I2JA 3V00A 3NEYA 3L8EA 3CG4A 4KOAA 4QULA 4CFSA 4Z0NA 4UNRA 3D4PA 5E6SA 1HQYE 1F7UA 3FOBA 3L6OO 1D1QA 3E4CA 1EDEA 3HLKA 5EIFA 1L6IA 1O6ZA 2ZWMA 4FYMA 2GPBA 3ZY2A 1J0XO 2HM7A 1FNCA 5JOQA 2PSFA 2HLPA 1BXZA 3DAOA 3G6KA 1XTKA 3OJEA 3VFDA 2R0QC 4RYDA 2QUZA 3QW4B 2CL7X 5E1DA 2XODA 2Z08A 2ZYSA 3CT6A 1GGHA 2HC9A 3WQSB 1N8TA 1BQ3A 3NONA 3UCFA 2P30A 1QOQB 4OATA 1SQFA 1EK0A 3IRVA 4PZPA 4WNCA 1NZJA 1EUQA 2I22A 4LAFA 1G2QA 2O05A 2BFEB 5DHRA 1Q14A 3Q3GE 2A0KA 1UOOA 2NT4A 3D31A 1H85A 4F0JA 5IKMA 4V0ME 4UUQA 4ARCA 3E82A 3EMVA 3JV7A 2IYQA 1FMJA 3IVCA 3OZGA 4JFRA 1PO7A 5TQ2A 1WRBA 4S1WA 4MW1A 3Q8LA 1MIHA 2BBSA 3DPIA 3GHYA 1E5VA 2ZWAA 4U39A 3FLMA 2I2CA 3GJRA 3JAKB 3SJAA 5ADHA 1HR0B 1JJIA 3BK2A 4GNKA 3FOZA 1H4SA 1J0BA 1D4AA 2Y6UA 2W37A 4PG6A 1W46A 1Z15A 4FGLA 1EK5A 3QYPA 4LYEA 5KYYB 3INRA 4EYSA 3FBWA 3GGOA 4MR9B 1J99A 2ROQA 2HA4A 3ZJ5A 3HBJA 1NBMD 2WB2A 4AYWA 4MUBA 4FR5A 4JELA 1ZU5A 2VT2A 4M98A 3OT4A 5C5IA 5CA1F 5L95A 3KWMA 1P7VA 3WGTA 3QU7A 3HJAA 1I10A 5FBZA 5FBHA 3K0AA 1KZ7B 1U0OC 2B1QA 2W2PA 2QE7D 3KKPA 3WIVA 3T54A 5KSZA 2V5VA 4QHSA 1HM5A 3U0BA 3L79A 3AHCA 4YLYA 1U7DA 2ZJ3A 3N86A 4WK4B 2JEYA 5AK4A 5ALPA 4QBHA 3B53X 1VSUA 3N3AC 1YZQA 2DFLA 1QXSA 2XWQA 3QKRA 3WWPA 4DJEC 4F3RA 7REQA 5HE8A 1VP3A 2FLWA 2IYUA 4RVHA 3ILVA 3D5TA 2PBRA 2V7XA 1E5DA 3KAPA 4Y8VA 1XAJA 1ZI6A 3R3VA 4ONEA 3OIUA 2DLDA 2DT5A 1ND5A 2W6JA 2WFLB 3AI3A 3QLJA 4BYGA 2Q9BA 3IV6A 1KIMA 4ARZB 1EFTA 5LQDA 3W0LB 1K27A 3C85A 3GDOA 5AKJA 3UAYA 3WLSA 1BXKA 5IXJA 3ROFA 4GE0A 5IWAB 4J43A 3VVCA 3HR8A 4CM5A 1OV6A 1JIVA 4TM8A 1XCLA 4JEHA 5DE3A 4F72A 1GT91 3IXLA 4D9HA 4M1MA 2B92A 3QBDA 4MI1A 4Q6BA 4TS9A 3TS1A 4EYOA 5UKDA 3RASA 3ZV4A 1BDHA 4EKIA 4GMKA 4X00A 2JGLA 1V5FA 1BEZA 4C5AA 1Z0KA 3ZD6A 3TRIA 3L8MA 2CB9A 2ET6A 3FYSA 2B8WA 4JQCA 1JRLA 3UTDA 5EIXA 3LA8A 4MKZA 1DAHA 3U3XA 5JSHA 4FLFA 3ZLTA 1DZIA 3DFKA 4BN5A 3SU8A 2QQFA 2R7MA 1T9CA 2PZJA 4ENPA 2UDPA 4J91A 1CV2A 1JXQA 2NUTB 3SY8A 2WM2A 5G4KB 4KRFA 1YB2A 1UK6A 4BO2A 2ISSD 2JIPA 4UPVA 3VU0A 4YDQA 3OQOA 2JCBA 2JBAA 2R6FA 3C3EA 5EIEA 5JS6A 2BY4A 1PJCA 1W29A 1PGPA 4B6RA 3K2BA 4IGAA 2GCEA 4TGLA 1UM8A 4W7HA 3HJNA 2C5HA 3IQEA 4ITUA 5AJYA 4C7OA 4MQEA 3C3PA 5JTTA 4U8GA 4C4RA 1VDMA 1YR3A 4IMRA 4V02A 5BRNA 1YZGA 3QM1A 1G6Q1 3SDZA 4M0KA 3RD5A 1X0XA 4RVCA 2V6JA 1TEZA 4JI3B 3SIPA 2INGX 2UZ4A 4DG8A 1OCEA 3AHHA 1O94C 4G86A 2XRYA 3VNSA 1EE1A 1E9RA 1ENOA 5L3SB 1VE6A 4H1HA 1XX6A 4MS4B 4BX0A 3P52A 1C7QA 5L3VA 3ID6C 2IW3A 2OUIA 4CM6A 4QBKA 3EXEB 3TE7A 1W35A 5KIAA 3R0QA 2P3LA 4Q1DA 2IYFA 3PZBA 3HU1A 1QG6A 3DV0B 3VJKA 3UJ7A 3S2GA 2F64A 2IK8A 1DT5A 4JYCA 4OJTA 4MINA 3F5DA 2ZWPA 3AUYA 4LQCA 1ZJJA 4LXUA 4MRMA 1QHSA 3O3OB 1OAAA 3IKJA 1FXWA 3GMDA 2AFRA 2QL9A 3C2QA 1A7JA 3MD9A 5B2EA 1ZN8A 2A2ZA 1TJ5A 2HIGA 3GLGE 1B23P 2Z1NA 2GPTA 2X4IA 4TL9A 3TVYA 3EEFA 1T36B 1XF9A 3O6VA 5CBPA 2B21A 3M83A 2GPAA 2DP4E 4KE8A 2B36A 5G40A 2KLHA 4QOSA 4YP5A 2FPPB 1ZI9A 3F0TA 1XN4A 3I6IA 1X8LA 2GJ8A 4H16A 1QH9A 1O96B 1XZPA 5EZYF 5EGSA 2IHBA 1BEUB 2QX8A 4GYJA 5LIPA 2D5IA 4TTVA 1NXWA 7ABPA 2C4MA 1V2GA 4BZQA 4PX5A 4MV6A 1P17A 3G1TA 4ABYA 4LZAA 1II8A 3HQ4O 5E4TA 1R0LA 3I9OA 3N0WA 2Q0SA 3DUWA 2QYHA 2VRBA 2ZT7A 3OTQA 1W6RA 5FOTA 3U37A 3I45A 2C2GA 4URVR 1JYFA 4KH1A 4QJIA 2QQGA 3HA7A 1J22A 1LPMA 3IJEB 3QXSA 1GXSA 2CD9A 2FMFA 3TAUA 1OXXK 3ZDRA 2JNWA 3ZZMA 2X9LA 2JIBA 1WO8A 4K9KA 5F35A 1M0EA 3NTUA 2EX4A 5IH7A 4IDDA 4K6KA 4QHTA 2FAXA 1FS5A 2FR8C 2IH4A 3GRPA 4BFUA 1E2MA 3AIIA 5H3CA 4OQFA 1Z9BA 3I8SA 2V4UA 1Q7RA 3LBFA 4WASA 4X6YA 2YV5A 4OJYA 3W2FA 3I6BA 3UC9A 3KKEA 4US1R 1GA4A 2QT1A 4A6XA 4EW6A 3JVUA 1K6MA 5C7YA 1MRZA 1LC0A 2GDZA 2HCRA 2XI4A 4O2AF 1JHRA 2B3TA 2J87A 2WJ3A 4RXMA 1IG0A 5EEGA 2PS3A 3U3ZA 2CMHA 4EG4A 5KNBH 5KWIA 3HADA 3T5TA 2FWAA 3OKPA 3LSYA 3CX7A 3FJ1A 4ER6A 2QRPA 4W9RA 1EGQA 1KRWA 4ZDWA 3C3WA 5KX5A 5EYPB 3SK0A 2ZE7A 4MJ7A 5KTYA 1KY2A 3EVCA 2C7QA 1JDSA 2D3TA 4CEHA 4JWTA 4ZTZB 1SCIA 2NU8B 5JJLA 1ESCA 1K2WA 4YXWA 5E2BA 5ES3A 3LQ1A 1L3BA 1Q22A 3I04A 1HYEA 1NRJB 3WNQA 3HXOA 2QVXX 1A8IA 4CGZA 2ZULA 4QBFA 1K7CA 2GHTA 2FFQA 1R2QA 2PGLA 3DUFB 2FOIA 3C1AA 3G8BA 2PSJA 4N3BA 4FYVA 4AECA 1WCIA 2EX1A 3NBYC 2IUUA 3M1AA 3EHEA 4YT2A 1W88A 3PPXA 2BOVA 3NPMA 1PK8A 1NIPA 4O6VA 4Q82A 5JMOA 3NHJA 4YFYA 1XDSA 3O8OA 4C0WA 1UINA 4WMLA 1EIWA 5EOVA 3WNDA 1NX6A 1WNFA 2A5DA 3I52A 4PNHA 4WJLA 3DOCA 3GFVA 1N32B 4UHEA 2R7AA 2JKZA 2H2FA 3P9SA 4ZT3A 3E22A 2G83A 1P9RA 4QXQA 1P5FA 4MB0A 1RJGA 1S2IA 1W1WA 1XZAA 4UQLA 1OFTA 3MZ0A 2HRZA 2W2VA 3AW9A 5BNZA 1RRVA 5JBIA 1Z28A 2HXGA 3G9QA 3LLSA 2F17A 4OH7A 1RQ2A 2EEZA 5E38A 4WRRA 4DSAA 1TADA 4DAOA 2RGDA 1T13A 2QTMA 1E8MA 3VV3A 3VR6H 1XVAA 3OESA 3ZPXA 1FDSA 3HVJA 3NI2A 5IUJC 4ZA2A 5F9MA 2AD1A 3LC2O 1KOGA 3DHVA 4O1MA 5C1IA 5LP6C 1SBIA 5DT2A 5J9FA 3K73O 3OWHA 4R2IA 5HMMA 4G84A 2OWDA 4QM7A 4OUKX 3UG6A 3M6FA 5DM2A 3PQCA 2FPIA 2JGJA 4IO0A 4V1CI 2BE9A 3TRDA 1CZOA 2XDQB 5CTAA 3WL3A 3LUCA 5BOSA 5BN4A 3OQHA 5SYNA 3RGWS 3DMYA 4R83A 3HPQA 3LX8A 3RU2A 3CO0S 3KO8A 4ACBA 1KK1A 2XZTA 3Q0EA 4KU4A 3UBMA 4RZUA 1YONA 3QJYA 3GLHE 2ZRFA 3CNLA 3F1KA 1EXNA 1PZXA 4O4JA 2J6BA 1FTGA 3HU5A 3TEFA 3ZS8A 3MHPA 1JR3A 4YQZA 4DR5B 2R4QA 2P6NA 5J5CA 5ALTA 2BZSA 2YIMA 2VHEA 2ADMA 3MWEA 3ZVLA 2BFAA 2WHQA 5G02A 1C7JA 1MTZA 1HTBA 4TS4A 4GU5A 4QGFA 2BR5A 4EVIA 4RPCA 3GT0A 3M4XA 1EUDB 5ECWA 2FHPA 1CIVA 3LXXA 1LY1A 4XEUA 1MABA 4XYBA 3E8MA 3KB6A 2O3JA 2W6IA 3V4VB 1U31A 4PLGA 4NARA 2IS4A 4EW2A 4AFNA 4D81A 2YKGA 1W1UA 2YQ5A 5KO2A 2YYAA 2HPAA 3T3GA 1FX1A 3DVQX 3ITEA 3PWTA 4JIGA 2ZI4A 3H0CA 1QPGA 2XT0A 3DAPA 3NTLA 1N6IA 4LG1A 4Q7MB 2BHRA 4UUAA 5FD8A 4YRZA 5HJ5A 3COJA 3H8JA 3C4QA 3O2QB 1KXZA 4EBBA 3FPKA 5ES4B 2FJPA 1U8CB 2FPSA 4K6MA 2PUVA 1Y1QA 3BCHA 4TN1A 1II9A 1W44A 1Y8QA 1H2XA 4YP6A 1YE5A 4YRKA 1A8UA 4DBZA 2CT8A 3G85A 4XJSA 2WU0A 3HE3A 4KODA 4QU5A 1U04A 4ZKEA 4QL3A 5FIUA 4J16A 4MLPA 3BWYA 3G2IA 3SD7A 2AX3A 5F12A 2M1ZA 1IZ8A 4KI0A 4QWMA 3RS5A 5KTKA 1Z2DA 1GADO 1U7TA 4TKUB 1HDXA 5TB5A 2P2SA 1A8QA 1HFWA 3HMKA 1JHVA 2WHPB 4TMFA 4B3BA 2GXAA 1SC3A 2FZKA 2IWRA 1T8SA 3KD3A 4FC6A 3D2CA 1DXOA 3W5VA 1T4DA 2FSSA 4GOOD 4EHLA 4ZOBA 4KWIA 2Z1DA 1JFRA 3EIQA 5GY7A 3R5FA 1NTRA 4BE9A 3CVUA 1EFVA 1ISIA 1KPIA 2IPNA 4NEQA 5L3QB 2PEZA 2O6LA 4E1VA 1J5PA 4G89A 1Y48E 3KT3A 4HLCA 2AUNA 3SX4A 3EA0A 2IS6A 2VJKA 1PT8A 5EHQA 3JX9A 4QXAA 2O8FB 2IYVA 3C39A 3KUKA 1FFWA 3L77A 5IDYA 3SKYA 3UYKA 1G9SA 2IDKA 5IYZB 3CEHA 1C7ZA 3PC4A 1S2OA 4X61A 2IH2A 4C1BA 1M2VA 1BYUA 4J3FA 2OGWA 4GZLA 4MUGA 4TT3A 3RH0A 4HNTA 2VSYA 5FOUA 1I9CA 1Q1GA 3BE8A 3IQDB 5EGNA 3TFQA 5AW0A 5KOJB 3NEAA 3RDPA 4E30A 5EMHA 5K8CA 3LIPA 2GN2A 2W2LA 1PI3A 4LNUB 1FTYA 3WP0A 1Z45A 1JEEA 3NGLA 1BOFA 2MSEB 3J7TA 2XNJA 1AKYA 4GQIA 5CFMA 1YRLA 2EGHA 5FTKA 3R6WA 3TQHA 1QHNA 5FR1A 2XXAB 3GCZA 3VNBA 3AF4A 3ZDQA 2Q4RA 5A02A 1PGOA 1HZZC 3HKDB 2EW1A 2WTAA 3RV4A 1V7QA 4BVBA 2VZ8A 1ZUHA 1U4OA 2B25A 3DBRA 2ZI6A 4FMDB 5KZMB 4FKZA 3UPTA 2FN8A 4FONA 3QIVA 4FDUA 1ZD8A 2YJ5A 3K1YA 1BFUA 3GLFA 2BEUA 5C34B 2AIRA 1L1EA 2WYUA 3ORYA 4HDNA 1Z83A 3Q5DA 1AUXA 3ITDA 1W5BA 5GGXA 4MR7A 4ZCPA 3RSQA 1TU0A 3A28A 1AGXA 3FKJA 3TBHA 2IPXA 5LXTB 3X2EA 4JI2B 4RJLA 2WEKA 5GJWC 3T3HA 2FCRA 3IODA 1DELA 1FDUA 2FDCA 4O4IA 3FWNA 1GG9A 3AYXB 4I99A 1VB5A 5DYTA 4CR8A 4FC7A 4JU9A 3P4XA 3PBKA 5DTMA 1P3JA 5TXGA 4BIMA 1XZJA 4MW2A 3M81A 4POOA 1P80A 2J5XA 3I5YA 5J2TB 3NAZA 4L15A 4O1IA 3NVDA 4MI3A 3L4BA 1D5CA 1EQAA 2PYDA 4JH0A 4AQDA 4YJDA 4ALNA 4KREA 3OJXA 2CLFB 1ZJWA 5EXDA 1LS1A 3RSLA 3KJNA 3BWCA 3MGKA 4AK9A 4H35A 4A82A 1U9JA 4L8GA 4QYTA 3S7TA 3O4RA 3BDAA 1EG7A 4N5HX 4WT7A 2BW0A 4MDYA 4S2UA 3OZRA 3TZEA 3D4IA 1ZWLA 5FQOA 3PHHA 2WAXA 1NASA 3T61A 4BP9A 2FDRA 4HLUA 2YNMA 1U9IA 2XVYA 2IXAA 4M0PA 3SSOA 4C4SA 4ZV7A 1OPXA 3AF2A 4G9BA 5G0TA 5TR9A 4P84A 5KAPA 3AESB 3E5NA 2P7HA 3EPLA 2BEWA 3BD9A 1AHHA 2EKQA 3ZEAA 2ONYA 1VMEA 2V0NA 3HM9A 3SZ3A 2F1IA 5FNVA 3W4KA 1NXTA 3A2KA 2YC4C 1C41A 3TG2A 2CUKA 2GUWA 1I3MA 1XG5A 2OP0A 2OHHA 3MRSA 4DA7A 1B8VA 4WIAA 1INLA 5CDGA 2A5FA 2Y1OA 1LBEA 1X77A 3D5QA 5CAEA 2ZDGA 3GEHA 2ZTHA 3EMDA 3MLEA 2BLNA 3GF4A 2UVPB 1RBMA 2Q4TA 4YAUA 1ZEMA 1E0SA 1BS9A 1WUKS 2XLCA 2G0NA 3FJYA 3L8DA 4Q12A 4V0RA 4PV7A 1PZNA 2ZB3A 1CVLA 3V5NA 4RK6A 5JY1A 1NQVA 3A6DA 3WK8A 3MJHA 4R0VA 1DEXA 3RS9A 3E7DA 4R41A 4BATA 4MZXA 1SXJC 3JQ7A 3T1VA 1XMXA 2NAPA 3H9QA 1LW7A 1Z13A 3HYRA 4MUFA 3DWEX 4M55A 1XI2A 3A0RB 3W78A 3GLHB 1WDLA 4E33A 2QXTA 4Y2TA 3WTCA 4UBLA 1L9XA 3DZDA 5K3CA 1U7PA 1USKA 4JROA 4ZGGA 1VIMA 3IIKA 3H8WA 1TQ2A 4RE5A 4H7FA 4B79A 2J9XB 2YFYA 2G06A 4NF2A 1L4EA 3I0ZA 3MUNA 4DLNA 5KREA 3PDHA 2Z5VA 3I1FA 5J40A 1IWBB 3G82C 1DFGA 4FFMA 2XDWA 3OZFA 2W42A 1G9XA 2VK4A 4HDCA 1M5TA 1MNAA 2F59A 1WB5A 2GPNA 4L74A 2IPOA 1XDDA 2FW7A 1PLLA 3LVRE 1JXMA 4OQDA 3KOWA 1OLOA 1X7ZA 3ZTWA 1M7BA 4IQFA 3ZE0B 4Y7DA 4BPBA 2GT1A 1XTJA 1IATA 3F7OA 3WXMA 2BH2A 4DR6B 1VGRA 4RH3A 3R8CA 5THKA 3MWFA 3C1TA 3RFVA 3RSSA 1K75A 5ADVA 2Q4EA 2KHZA 3P2MA 4Y9SA 4UUBA 3PFBA 1H1LB 5DOVA 4EG1A 1GTL1 1NW9B 4RGBA 1X7XB 1YO6A 5JXHA 2X0RA 1REQA 3GGPA 1XRQA 3ZWCA 4C2UA 4Q9IA 2J3DA 3KOYA 5EHZA 4QELA 4MLCA 421PA 2H5IA 3IPLA 1FBTA 4KPUB 4RHEA 3WRYA 1A7AA 3X1WA 4LZPA 1MO6A 2FZEA 2QAJA 3HKBB 4UVIA 3UA3A 5T7BA 3H4IA 3TCNA 2DM6A 1H4TA 1TW3A 4YJHA 4YPOA 3LXMA 2WC1A 3ZD9A 4EMUA 2AOUA 1JU4A 1YA8A 2JW5A 3U1BA 2CNDA 5GV8A 4MVJM 5P21A 2GSWA 4RTRA 4E3ZA 5AR1A 3ZW7A 2IHNA 2ID4A 3D8HA 1LEHA 1BDJA 2NSLA 4GI5A 4P98A 4R1QA 1PW7A 2GD0A 3K9GA 3PPIA 3TD9A 4R69A 1QR2A 2WP8J 4RK5A 1HMPA 5IVIA 3OFJA 4R2MA 5BSRA 5H82A 3SC2B 3H19A 1GRCA 3L8YA 4TXLA 5JANA 1QIGA 1FP4A 4X8HA 1T34A 1ZUWA 2DYKA 2GZHA 2BHSA 4BEWA 4KITB 2B9EA 4XWGA 4WXEA 4DV4B 1Z5UA 1RZ3A 2GM5A 2N46A 4FGWA 4N0QA 3QW2A 1GAEO 3L0DA 1B8PA 3H42B 3I76A 3DC2A 4QGHA 5CA0A 4BZWA 121PA 1CLEA 2BFDB 4KQJA 4E5KA 1M2GA 1Z88A 5FOXA 1TTTA 4JDUA 1FJGB 1AV6A 1EKXA 1UZLA 2VT3A 2EJVA 2Z2YA 3LLVA 4M37A 2EFGA 5JSKA 3BE4A 3SQLA 1L7AA 4ZZIA 3W77A 1NWCA 1L4FA 4CCWA 1Z7EA 3OMLA 1YCGA 4W99A 2F67A 1IM2A 1Y8RA 2F4NA 3OCUA 4F6CA 3R0JA 5B7NA 3SFTA 4HQOA 3RNLA 4X65B 4N76A 2IDJA 1RWQA 1NLUA 4S35A 1T5DX 1GCIA 1GYQA 1UCFA 4MS1A 3DDNA 4IMIB 3WYGA 1GPLA 1F5SA 3V3KA 4B47A 1UT6A 4YCCA 2B4KA 3BH7A 2W6ZA 1CJUC 1V6AA 3W79A 2Q5QA 3P9YA 1N6OA 2GF2A 2IL1A 1IJEA 4GGOA 2VZEA 4HUQB 4P2GA 2QDKA 2ALJA 2QORA 2VDOB 2QYSA 3Q5EA 4MVCA 3U4IA 3LY9A 2KQUA 4N65A 2YC2C 4DSUA 3IXMA 2GM3A 3CLTD 1R4AA 2ONZA 1KP2A 1V8DA 4KAXA 5DYWA 2VYNA 3EDQA 1P2UA 4PPNA 4UUNA 3W3AH 3WIOA 2ILTA 5A06A 1CUXA 1UBEA 2VTDA 3EZYA 1PR1A 1JEAA 5MN6A 1ADFA 2V97A 5I47A 5MHTA 4HP8A 3RJMA 1ZK3A 3T3NA 3AFGA 1S7GA 2JS7A 1KTIA 4RABA 2EBHX 1LS6A 2XUJA 3VR3D 3DO6A 4I55A 3A6KA 3THWB 2R8OA 1E6EA 2EOAA 1JTVA 3NHFA 3ETGA 2LXNA 3NAMA 4Q4JB 3SF0A 1C1XA 3FZGA 1ZSVA 4MI6A 4Z2AA 4TZ0A 2TMGA 3JZAA 2MMCA 3B85A 3GLSA 3VAZA 3BDVA 1QVWA 2P2NA 1UJBA 3WP1B 2OOKA 4NECA 3RABA 4E4YA 5IM4F 1FRVA 3FVTA 3CUKA 3DKKA 3QVLA 4K9PA 4MH0R 3OD5A 3V32A 3ZGVA 4YCJA 2XJ4A 5GONB 4YRCA 2C9YA 4R71A 3OOHA 2VL7A 1SPXA 2GZDA 2Q9UA 1UKVY 2QIPA 3ANSA 3GGDA 3HY4A 1KF0A 2R2AA 4P7BA 5F78A 3SNHA 2UUAB 2RB5A 3INGA 4OI4A 1E9BA 3CX3A 2Z0MA 4FIZA 4INZA 3W3ZB 2HLNA 4NEHB 2ZREA 4RHTA 1H2WA 5KOIA 4CM3A 5JALA 4RVDA 3FG9A 1IN7A 2DFPA 4PCUA 4CQLB 1RAHA 3BXHA 2XE4A 4FE7A 4M8IA 5TIIA 3O4FA 4Q4AB 5C1OA 5J47A 4NXNB 1BWSA 2QHXA 4Z4IA 4FNAA 1LRKA 3GUCA 2Y92A 1DX4A 2YINC 4LFCB 1QHGA 2FZ5A 1GLGA 2I4IA 3DE7X 3NRCA 5EAIA 3KJHA 4GQAA 1Q0PA 1Q7BA 3R5TA 4I5GA 3O3MB 5FORA 3LL7A 1WHTB 2OESA 3DWGA 3PNVA 5KAMA 4PFKA 3SSNA 4FFVA 5LOVF 3J80A 1EVEA 3EAQA 5EXSA 4H6PA 3VJRA 1C7RA 2AZXA 2WHYA 3RU3A 3ITNA 1YBMA 1GEEA 3HR4A 3P2IA 4WNAB 3T4XA 4Q48A 5KPJA 4QUBA 3W4IA 1XVUA 5FXMA 3PGXA 1PX2A 1T4CA 3PCTA 2D00A 1XPRA 2YYZA 1FFGA 1RADA 1OFUX 5H70A 2QPOA 3KKLA 1ULSA 2REOA 3DE0X 4FYIA 1CHDA 1X7YA 4W5OA 3HS3A 4W8OA 3K70C 4Y7CA 2JLXA 3RWMB 1DU4A 2YFKA 3IKVA 3QKSA 5LQRA 4FFNA 4MTLA 3IEVA 3LUDA 1Q5PA 1FYWA 1XLTC 1CF4A 4BFCA 3KXLA 1CJSA 1JLMA 1RRGA 4RHYA 3L0YA 3RRFA 1UC9A 4CKBB 4A6DA 1P0QA 1QG4A 3OZ7A 1G5HA 5C51B 3BRWD 3E0QA 1L7QA 1R6XA 3I0MA 1EUCA 3PHBE 4HDMA 4HDSB 1N1EA 4HS9A 4TMTA 4CTKA 2IVFA 1KI3A 4MIEA 4TSFD 1MZVA 5IDWA 4DA4A 1LD3A 3NJRA 1PJQA 4Q1VA 3ZIAA 5HR5A 3AZQA 1ZS9A 4ZVNA 4MV3A 5HKKD 2YV2A 4IH4A 2BZ1A 1VB3A 5K3OA 3IBFA 2POCA 5IHXA 1Z5ZA 2AVDA 1PFGA 2B34A 3B3FA 4RADA 3ZLUA 2FUEA 3SYLA 3OEYA 4AZ3A 2HOQA 3HYCA 3MT0A 4G8BA 4OMUA 2NZVG 2CNBA 2D7JA 1E66A 1K4YA 2DGDA 3NWPA 5IAGA 4XIYA 4TWBA 2MSCB 4HXEB 4PM4A 1WVIA 3GRKA 3NHSA 4Y6QA 1YBVA 4YRQA 3U4GA 1KP9A 4RL4A 1LU9A 4RSGA 3AJAA 4HGRA 4ME6A 2P8JA 3ZDAA 2AFIA 4US0R 1LX7A 1R0WA 5DIZA 4ZAWA 1A1SA 1V48A 1Q84A 1Z0IA 1ZH6A 3GN1A 3ZLJA 3U44B 3D43A 2GN1A 3OQ6A 3QX3A 3WKAA 3AEKB 3ZLVA 3EFBA 1HNNA 5E6RA 1N5JA 1FMFA 3GVIA 4I1VA 5L3ZA 1ESZA 5LYJA 3STYA 1XCJA 1UP4A 2QUHA 1V4NA 3V1MA 3WMFA 1D7AA 4IILA 5BUQA 4D0SA 4GP7A 4FS8A 1TAHA 3GJXC 3BTOA 3E9YA 3MMSA 1AKVA 4O25A 3QSGA 3GH1A 4CG3A 2HTEA 5CIWA 2QTCA 5EMMA 3A27A 3TOXA 2IU4A 3EVGA 4UZFA 3Q1LA 3ENZA 2P62A 4CQNA 3RC9A 2PLNA 3OPYI 4OBBA 4D4HA 1Y34E 1JU3A 4MUKA 4LOAA 2HBYA 1QOPB 4GXRA 4P7JA 3LKVA 3IP9A 2PGNA 4XR9A 4ZT2A 4WTOA 1KH3A 1UOPA 1ZPDA 5FA8A 3RG8A 2I7XA 5HEKA 4URXR 3TL2A 3IBTA 1KVRA 3OQJA 2AEMA 1QKJA 4ZANA 1I2BA 3EQ6A 4AN4A 2ZROA 4E2ZA 4YUZA 2Y1DA 3RHZA 1KK3A 5J3JA 4RTNA 5BWCA 1JHPA 4C30A 1CFZA 2PZGA 4MIKA 2VHCA 2HSDA 2VP6A 4JJGA 4N5MA 5G41A 3SDSA 3TN7A 5A5VA 1P0PA 4GOMD 2OBLA 3QVGA 5C53B 1I3KA 2OAGA 5AVVA 5IAAA 5A9RA 3FIUA 4Z4GA 4R8RA 1VHDA 2NNLD 2QMUA 1MH9A 3C7KA 3EAGA 1LDEA 4MCJA 1QH1A 5DYYA 3PNOA 4U9UA 5TMDA 1V3UA 4PYMA 4Q93A 3KEQA 1X8KA 2GPJA 3MGCA 4GBJA 1NFQA 1R9JA 5TPWA 3T34A 3U7EB 3PYMA 2ACEA 2H4XA 2WVHA 2NQ8A 2AT1A 1T10A 4PZEA 4QDJA 5BN3B 2GM4A 1XTUA 3JR7A 4NCBA 1Y98A 1ONOA 3UB4A 3VPHA 2EFDB 2YRXA 1ZQ1A 2AJCA 4WVLA 4DMRA 2QJFA 2IBSA 4OHFA 2PH3A 3MTIA 3WWOA 1HFKA 1E7SA 3H87A 5JCJD 1X92A 3N75A 4GR5A 16PKA 1Z5NA 4G26A 3EC1A 3V3TA 1LW6E 4Z1MD 1R12A 3BICA 2YIVX 1WU8A 5F73A 4JK3A 2H2AA 2VTBB 1PQWA 4LVCA 4ON9A 3A1NA 3PTAA 4J0FA 3ESDA 5IDVA 1KHTA 2D1FA 4NU5A 3DTNA 3N7UA 4MJLA 4TTSA 4B7ZA 4EG0A 1XDBA 2XV1A 4J9VA 3WLOA 3GPLA 2BGWA 1PS8A 4GE3A 4L95C 4Y9UA 1GL9B 1PEDA 4YT5A 2GFIA 5GJCA 2DQZA 4P7KA 4DSNA 2ZSHA 1EP1B 2A4KA 1PT6A 2XVAA 4U3JB 4YACA 2D5LA 2J3LA 4BNNA 1E0JA 2KLBA 4QEZA 3L01A 2BPOA 4JQOA 3H2JA 1HRKA 3T99A 3RRMA 1NW8A 1K2VN 2JIZA 4O4HB 1C0LA 4KSCA 3ETEA 4TMWA 5FBWB 4DS3A 2BGNA 4JN6B 2YZMA 4KO8A 4KGDA 4LDAA 2L69A 2VH5R 1NBOA 2WZDA 5K4AA 4B3DA 1DO0A 5DYNA 2X5NA 1NQUA 1JFFA 2RE8A 1KFBB 2H51A 3PDWA 4YAFA 4BP8A 2JGDB 5IZCC 2OENG 2DWQA 1XQXA 1DE0A 4PHHA 5JPIA 1KY5A 5IUNC 4G4GA 3UK0A 5SZHB 4IDEA 1QFJA 4YCAA 2Q62A 1PR4A 5FFFA 4GOND 1SUDA 4XX1A 1GCOA 4MCIA 8AT1A 1DBPA 2PGJA 4EY8A 1QGUA 4YLEA 2JAPA 3F5MA 5SY6A 2NVOA 1G8PA 4D9FA 3RAEC 4AYTA 4MICA 2IZOA 5ILQA 1JLHA 3FCCA 4O1HA 4OGFA 4DIFA 4XD7A 4Z0HO 2BD0A 3PGMA 4PSCA 1GPAA 4LMRA 1P62B 2GASA 1VIDA 4IWXA 2W4QA 3KP1A 3RVSA 4NMLA 3O75A 5LJIA 2NUAB 3AKYA 2GVZC 2GXUA 3OBIA 4WQMA 4CM1A 3O8QA 1EWTA 2PH1A 4YPVA 5CX4A 2Z3VA 1WQ4A 5B12A 4EJ2A 5JXIA 4MVXA 3HUEA 3RLFA 1ONPA 1XEWX 4ADSG 1MNQA 1ZOPA 3NOXA 3ZK9A 1EWRA 2QD4A 3EMBA 4LDPA 5C1BA 5HQTA 3ICPA 5KKCA 1FNBA 4QRDA 4R05A 2AL7A 5EQFA 3RTAA 4AP6A 1DAPA 2PMBA 3FPBA 3SWWA 1DCTA 1W0KD 4GUAA 1V8PA 1PL7A 4NK4A 5IEJA 4WNYA 1IHUA 1UXOA 1NXOA 5MFZA 5FUVA 1ECCA 4FR0A 4A9AA 2VUIB 4KMRA 3V4PB 4EI7A 4YR9A 1NONA 5HQ3A 2GZ1A 3DXXA 1N6KA 5FO0A 2JAWA 3BMNA 5AKIA 4L4RA 2QX6A 3PFGA 3SYMA 2O57A 2FXVA 3O4IA 1DKLA 5H68A 2J3JA 5J1SB 3EIHA 4TS3A 2WWRA 1TUBA 3STXA 3AK4A 1VYVA 4HNQA 2CEAA 4RF4A 3MXOA 3MG9A 2B8NA 3UHJA 4BFSA 1Z5WA 2HWWA 4QM6A 1ZIDA 1D09A 5ITZA 4PYQA 3UWKA 3DMRA 4TRMA 1L5WA 3C1OA 3C3AA 5CJ2A 3U5ZB 5LQCA 5AI5A 1SRQA 1YS7A 4AUMA 5FLKA 3I3SR 3AUSA 3L5OA 2FPGA 1NUTA 4XI9A 1PE0A 3GELA 4MQFA 2W2OA 2IEDA 2EFYA 1BXRA 1FSGA 3QNMA 5C4GB 1XAGA 1J09A 2E1RA 1JH9A 1H2ZA 1NAIA 1AQNA 3CUVA 4X3PA 1Q15A 1UAGA 1MOZA 3WQHA 5BUSA 5GGYA 1O4VA 4HVLA 1JW9B 3MTQA 4RKYA 1HNWB 4FQ8A 3DKVA 1DAKA 1GR1A 1SRRA 3VPGA 3ZWAA 2XQGA 1G6OA 1JQBA 3WGHA 3B9RA 4FQ5A 4EB3A 4G97A 1RWVA 5I9IA 2D1YA 1YR7A 3TYXA 3UH0A 1E3SA 1JB1A 4J03A 1QYVA 1VZ3A 3S27A 4C01A 1KETA 1V1RB 3G5AA 1DAEA 1F2TB 2KSQA 3DQPA 2ZGVA 3AR5A 4H6VA 1ZGHA 2PFKA 3BORA 3M89A 3B52X 4IIJA 4OGGA 3FGZA 2A3NA 5CPFA 5GAJA 2PAFA 3EUFA 3OLXA 5CGQB 1UMDA 3A3KA 4PRZA 1ORHA 1ZVQA 4YP0A 5C8DA 1O94D 3SFZA 1TMYA 5DNEA 1GM5A 2ZIXA 2O2CA 4GEGA 1PNRA 3JQ6A 2E6KA 1QGOA 4TYWA 5D86A 5JNLA 4C21A 2ZCJA 3NLLA 4RANA 5M04A 4DREA 3HKCA 1NYLA 3KOZA 3L7BA 4UOQA 2WF7A 3INTA 2CXSA 1JZTA 4F56A 5I7SA 3OQMA 2QDXA 3AH8A 3I9JA 3IDOA 5KCMA 2ATCA 1HUQA 3NAGA 3PHJA 4ZYXA 1VP9A 3RVMA 2H11A 3CISA 4E0BA 1JHYA 3ZI7A 2JCYA 4FUTA 4RSHA 2C4HA 4E09A 5EIBC 2FUCA 3KTAB 4EGQA 2AOTB 1BQ4A 1M6WA 1FU7A 2E4WA 1TZCA 1CE8B 2BR4A 2E7ZA 2VXBA 3DNFA 2C9MA 3VC2A 3PFHA 3DZFA 4RULA 4B7AA 1QV7A 3M6MD 4CM9A 3L9XA 5IWCA 1N9GB 1KNQA 4YUYA 1D03A 2FMIA 2EERA 3HEMA 2Z8YA 5IK2A 4R0MA 1G20A 1RT9A 2RKOA 4Y9TA 4KO2S 1TM4E 4II7A 5D3KA 5F23A 1H6CA 4DUGD 3RVLA 1GZ4A 2XA9A 2X15A 3NPAA 2DFTA 1C8BA 2BUAA 4B6OA 4Y3UA 1ZM3A 3KAKA 1U3VA 4YRLA 1VKNA 2QL6A 4DYDA 4Y30A 2QEQA 3R7WB 4C6TB 4PLVA 1V5EA 1FXWF 2AMJA 3ZDXB 1CEEA 3CW9A 1EEXB 1OXVA 4AY4A 1ABFA 3N2GB 3DBVO 1ZZEA 3TLBA 1WEKA 4IV8A 1OX6A 1M1NB 2AMFA 3JQBA 2YVQA 1HDIA 1GIAA 4RJJA 5T8KA 3EX7C 4OV6B 3WGGA 1AK1A 1UDBA 1E69A 5EIOA 1LFDB 2XGSA 1UPUA 2DBRA 4NOKA 1Y82A 3VZRA 4BVJA 1OZ0A 4ZCTA 2H1OA 1TM3E 3UATA 4DSZA 1ZVMA 1U7XA 3GLTA 4TPKA 4MITA 3FVVA 1BE8A 2Z4RA 4Q4LA 1LV8A 4K9SA 4DR1B 2C4VA 2C94A 2WUVA 2PZKA 5SZIA 4RTQA 2QBYA 2RKBA 4XAQA 3U7RA 4F2HA 2C07A 2ENWA 1Z4IA 3WOHA 3PDUA 1CP2A 3OURA 4J2HA 2TS1A 4O3FA 2BBTA 2XB8A 3QWHA 2BSQA 3K9BA 2XBUA 4NKRA 3ONEA 1O95A 4UATA 1WVGA 1GNVA 1PF7E 1IB0A 3BWXA 2WIJA 3K20A 4P3NA 3R7NA 2JPDA 3SJUA 1I7LA 1AB6A 3BFJA 4M36A 3CEAA 4IS2A 1PNQA 2ZBRA 3VR4H 2HHHB 2OCIA 2I6FA 1L5SA 2XUZA 8ABPA 1PFQA 5L4NA 3FHCB 4RX1A 1DOAA 1LLCA 1W59A 5K2OA 2EP7A 1UC8A 2NUPB 5CVJA 1JAZA 1ZJ5A 3UGJA 1TZ2A 2V7PA 1PN3A 1ZA1A 2UZ1B 1SBNE 4O02B 4RVOA 5EWMA 4PN7A 3RC1A 4PCVA 3FD8A 3ZQ4A 2X6TA 5DP2A 4G23A 5BXQC 4BNVA 1ZKMA 2YVKA 1ZJYA 2PIAA 4MYUA 2WWXA 5AUNB 4OEHA 5EFZA 2COKA 4TVOA 1USWA 4I8XA 3BAFA 4E94A 2BGUA 5KX5F 4YPFA 3P2JA 3O83A 3AXSA 1ZQ9A 4AF7A 1KAGA 1KI6B 4R5HA 1CJMA 3D02A 4YJ2B 6GPBA 1SCNE 4IVRA 4B75A 2V0GA 4IQGA 3CIFA 5AW2A 1HA3A 3PPYA 5JSZB 1HL7A 4D0LB 1B43A 3BMCA 4K9RA 1HC7A 2AEEA 3JW8A 5IBPA 4Q5IA 3RWOA 1GNTA 4G1VA 4X24A 4YMUA 1LK0A 1JQ3A 1RFLA 4KL8S 3INNA 1YH3A 3KL4A 4M0DA 4TUYA 2G80A 3RVKA 1D1SA 1OQAA <