4XGRA

Crystal structure of addiction module from mycobacterial species
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
128
Chain Sequence
b'MMVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease VapC30
molecule tags Toxin/antitoxin
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
publication title Structural and functional studies of the Mycobacterium tuberculosis VapBC30 toxin-antitoxin system: implications for the design of novel antimicrobial peptides
pubmed doi rcsb
total genus 39
structure length 128
sequence length 132
chains with identical sequence C, E, G
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4xgrA00
1A76A 1UT5A 1V96A 1MC8A 3DBOB 2MDTA 4XGRA 2IZOA 5HMMA 5H4GA 5ECWA 3H87A 5FV7A 5ECDA 3QEBZ 3ZDDA 1YE5A 5HP4A 3H7IA 4WA8A 3ZDAA 5ED0A 4CHGA 2H1OA 3I8OA 1V8OA 3H8SA 2HWXA 1TFRA 2QIPA 2FE1A 5H4HA 2IHNA 3ZDEA 3ZDBA 3TNDA 2HWYA 2LCQA 1TAUA 1EXNA 3QEAZ 5L6MB 3Q8MA 1RXWA 1B43A 4MJ7A 1UL1X 1V8PA 3IX7A 2DOKA 1UT8A 1O4WA 2H1CA 3ORYA 5ECYA 5SV2A 5K8JB 3ZVKA 3Q8LA 3Q8KA 5L6LB 5HNKA 3ZD9A 3H8JA 3QE9Y 1RXVA 2HWWA 2WP8J 3ZDCA 3ZD8A 3H8WA 1TAQA 1W8IA 1Y82A 5HMLA 1A77A 1BGXT 2BSQA 4XGQA 1XO1A
chains in the Genus database with same CATH superfamily
4EG3A 1UBNA 4X3CA 4DY4A 1CU1A 3OQVA 3SOPA 1MC1A 1JXAA 2OBBA 5EG5A 4YAIA 2G7MC 3Q7IA 5JC8A 1SVOA 1WU8A 3SZRA 2QTRA 5F7OA 4XYBA 1U8FO 2ZR8A 3NNNA 1NMEA 2Q5FA 4TTIA 2EFYA 4LE0A 3RO7A 1OXVA 1FLAA 1ZA2A 4MI3A 4Q15A 2VNJA 4JBNA 3RH0A 3CIOA 4AN1A 4CMIA 5HZHA 2J9RA 4MPJA 4TLMB 2GPJA 2NXEA 2FVXA 3EW9A 3IAEA 3V3TA 4LVOA 4NLLA 3BA6A 2YXLA 4RA6B 4ENRA 4EGCB 3FNBA 1FNSA 3OIUA 2CFCA 2XTJA 5DH9A 1FSPA 3A3YA 3INNA 4TUYA 4NYJQ 1ZI6A 3QX9A 4M99A 1JJVA 1FJHA 2IDMA 3BDIA 3VTAA 2X6QA 2XDYA 3FI9A 2VDVE 2Z5FA 1ZRNA 3H2BA 3EGWA 4HUQB 2B98A 2RGEA 4ONEA 4TTPA 5IK2A 3BCHA 2QU8A 5IEJA 4JELA 1E18A 1GNTA 2FW1A 4BGEA 3CCCA 3QPVA 4PR3A 4M1QA 3V7WA 3U09A 3S5UA 1YTLA 2A9QA 1JIXA 2X76A 4AS2A 3KQMA 1LS1A 1BHO1 4TKUA 2GPTA 1JJIA 1EUDB 4NCAA 4QTTB 3ZTTA 1UXHA 3MRXA 1B1CA 2ZWIA 1PEAA 2BUAA 3BWBA 4BLQA 2ZB4A 3NKLA 4WV3A 3T94A 3GD5A 1XZHA 2HD4A 2PBFA 3KR9A 4JJEA 1Q19A 2AJDA 1IK6A 2J6IA 1E58A 2XIQA 4G4GA 4MYUA 1EFHA 1CFZA 3QBEA 1AQNA 1T34A 2JH3A 2DP4E 2WSYB 3BS4A 1PT7A 1U7ZA 4EPYA 1TQHA 3GEHA 2G82A 3DDHA 4YT2A 1RBZA 2EEZA 2G07A 3C8DA 4RK7A 4AY3A 1PSDA 3ELUA 4S24A 3MJTA 3RT9A 1DEOA 1DRWA 1E3TA 1UBRS 2C9OA 3JQCA 1GLNA 3D3WB 3G5AA 1VJ5A 3MWEA 5F5NA 3GRPA 1JKMA 1CCWA 2H9YA 3E3MA 5FTMA 2G04A 4P0TA 3V46A 3FPFA 3EZ2A 4HAWA 4OHCA 5IULC 3QY0A 3OKPA 1O0BA 2XMCA 1QK5A 1P45A 4TS1A 5AKGA 1T9GS 2OLJA 3GFBA 5KQGA 3CRVA 1U2EA 1XEWY 1RZ3A 3D7KA 3FTPA 1QWSA 2VNSA 1KERA 3QYJA 4NPHA 3S44A 4ZDIA 4O2AB 5HHTA 2QU7A 3VU1A 1W1WA 5DULA 1NJFA 3U13A 1D0IA 1X42A 1NF9A 4KQCA 2PSJA 4TLDA 1R4AA 2B9EA 5ALSA 4OI1A 3RABA 2Y0CA 1OPXA 2W0MA 1C2TA 4KPFC 1SD2A 3LUJA 5KSZA 2PL5A 5A2GA 3E61A 4YJ2F 4ZVUA 4MQFA 1V8PA 3ZHUA 1P9NA 3JYPA 4BMPB 4O4LB 1ZH0A 2IKQA 4D8XA 2GCNA 1GOTA 1GQYA 2PPLA 3W6OA 2ZATA 2ZPAA 3RUDA 5JYBA 4ZT6A 2Q6TA 1BFDA 1L8AA 2ZYGA 5TGZA 1QGYA 1QMPA 1NXXA 2Z4SA 3GL9A 1Z3CA 1WTAA 4PSAA 3ZJVA 1LUAA 1XVUA 2NQ8A 1OSNA 4J2TA 3TDMA 3KTAB 5K3BA 4KE9A 3BRSA 2YZMA 2IOFK 1DLIA 2ZU0C 4M9UA 3UQZA 4JMLA 4DDVA 1WJGA 4GM0A 4I50A 4E08A 3FOAA 3UV7A 3QF4B 4XR4A 5FPTA 1I6LA 3RUAA 2CUTA 3FGPA 3FSGA 2JKVA 5E7MA 2WM8A 1YQ9A 3DT6A 3JASA 3EWSA 3PF8A 1BS1A 3LUAA 4TSRA 1SIOA 2AZDA 1UP6A 4X63A 2AB0A 4Q1DA 1A5TA 1SULA 5CP8A 2JFHA 5BWBA 5DW0A 3OCYA 2OQ2A 2IXFA 4BLVA 3HJGA 1EE9A 2PGOA 3II6X 2HQOA 2XGGA 4OQEA 4BEVA 1X7WB 3IT0A 3Q5GA 3U3RA 3FFXA 1KZYC 3CZ9A 3IXLA 3L4EA 4FW9A 3JQ8B 2JIBA 2MTBA 4WUVA 4V0KA 2XAAA 3CEPB 3LVRE 3IPRA 3VZRA 2HRDA 2I6FA 2WB4A 4URVR 2Q49A 3DZJA 1PJCA 4EX6A 4ALKA 3NTXA 3T4PA 4IFBA 2NUAA 1UBTS 4UM7A 3MTQA 3N5KA 1JWAB 3H8JA 2IVFA 4O33A 3QE9Y 2ZG6A 4K9KA 3LLSA 3AYZB 3BGWA 4NHEA 4KU4A 4PEVA 1T1SA 5A5VA 7MDHA 1BIFA 3AW8A 2A78A 2ZE7A 1W5FA 4NMLA 2G4LA 2EWMA 4ZK6A 2YIJA 2AXEA 4V03A 3IT2A 3UUGA 4MKGA 1GD1O 1V26A 4HVLA 1EGQA 3N2KA 1WXHA 3E8MA 3CSDA 1SAYA 4LSZA 4EKIA 1X92A 1SZDA 1TGYA 1QPZA 1EH5A 2PUFA 1F1BA 1DAIA 4XIYA 2PYZA 1K27A 4EG4A 1E5VA 3QE4A 4KX5A 3RTDA 4ALIA 1TJNA 3ZBTA 4CVNA 5K8JB 4WK0B 2XMSA 2BJVA 2ZYTX 5D1NA 3AF5A 4KXYA 2ORVA 1RM3A 2C2HA 3OFND 5FUWA 1T9KA 2DFLA 4PHCA 3UA3A 5JW6A 2I7CA 3DT8A 1E0AA 1YDWA 2AH5A 2FEOA 1J8FA 4PAMA 1DEHA 2PKEA 3OZAA 2NXWA 2RMKA 2JIMA 3SQNA 2C96A 1GTJ1 2CLHB 3WMRA 2WIFA 3L7KA 3NU1A 5CFLA 4X71A 4ZPJA 1RQXA 2VO1A 2XCRB 1G8FA 1A8HA 5EWLB 1ODCA 3TL3A 1JBKA 1NW8A 2DT8A 4EY6A 3IL2A 1XZJA 4NZMA 1CUEA 4QQFA 2ZIEA 1E2KA 3DOEA 4LC9A 4GM1A 3P0EA 3ESQA 3F3YA 3WY9A 1QV9A 2QE6A 2EBWA 3ZXYA 1G8KA 2NG1A 4Q37A 2YZ7A 521PA 4IIGA 5EXPA 1M0EA 1PZMA 3F6YA 4Z0NA 3Q8LA 2ZB7A 5EE1A 2F48A 2ICAA 3TQSA 1EPUA 3E05A 3VR3D 3OEYA 1M1ZA 1U6JA 2EFJA 3CXUA 4QUGA 5JDIA 4KO1S 5KOHA 1JUDA 2VSYA 2FE4A 4PINA 4EW6A 2J3KA 3JQDA 4AKHA 1SXHA 2VF4X 1MJGM 5JXJA 3QUQA 3M34A 2LE0A 2ECFA 4B8YA 3O2QB 6ADHA 4YREA 1LXCA 5FTWA 4C43A 1O6CA 4EJSA 2FN8A 4J49A 1G16A 5AI8A 2ACEA 4BNHA 3A2MA 5K3AA 1XF9A 1IM5A 1Q7BA 5AVSA 5DLQC 3WDMA 2WT8A 3EYAA 4Z7JA 3D3NA 1MU0A 2UUAB 1N5MA 4D0SA 3HB1A 4KV7A 3D8NA 2RCYA 3EB9A 3TW8B 1B8OA 2RHTA 1XDGA 4D4JA 1G8SA 5E7IA 4MQ6A 5KWJA 3FHJA 4AZ3B 1CR0A 5D3QA 2X0JA 3DGEC 3R9KA 1VG9B 5REQA 1MAAA 3ROMA 4FHFA 4F7WA 3E9QA 1AQIA 3IVRA 2WFAA 3LC2O 1MX3A 1OH8A 1QP4A 1ZITA 1VJRA 3CF2A 2VPIA 4K9QA 4DSUA 3KXIA 4K8OA 4GVLA 3F7MA 3IIIA 1WMAA 1Z35A 4XYEA 5D6OA 1E2IA 4J3NA 4NULA 4H3HB 4TYNA 4HBGA 4Y6OA 3MWGA 4DDTA 1GPAA 3BAZA 2CFSA 1EI9A 4H2DA 1W8DA 4OA8A 1HT3A 3V3KA 4GPIB 1BXGA 1G0NA 4R3UC 4K1LA 2WHYA 3ANXA 2PX4A 4C4ZA 1M75A 4F4JA 3IBCA 1U0EA 1G17A 2J7KA 1EVYA 1SBIA 2F9LA 2OE2A 4J6FA 1I6WA 4G0ZA 1FZTA 2R3SA 4HDRA 1Q91A 1KJQA 1KDZA 1NM5C 2BEUA 1BRTA 1D4OA 3AY7A 1J1ZA 4XUGB 4XPIA 2QTGA 4D3YA 4EY3A 2V0GA 4OREX 1OXKB 4ZD6A 3R23A 3WJ2A 1WM1A 1HA3A 3AT1A 4P32A 4MRSA 4WKNA 4B7AA 3ESYA 5KYWB 3OMLA 5JNLA 4DSZA 2QD1A 3Q0EA 4Z54A 2WTNA 3EAQA 1TA4A 1OBFO 3D6VA 1JG3A 1J5PA 3TBKA 3CG0A 5JCPA 5EWMA 4R9VA 2ZEJA 4OJQA 2VWHA 2O2CA 2W0SA 3W5BA 3K09A 2P6MA 1E1RD 5J2UF 1KC3A 1KS2A 1PFKA 2ZXEA 2UYYA 4E5DA 5IVHA 4F60A 1SKUA 2QUIA 2XYQA 4G1MB 1U1IA 4RMHA 3FDIA 4H35A 2B3TA 3A4VA 1V16B 1E94E 4NBUA 4NESA 3WWCA 3X43A 3TLZA 1I24A 4FIZA 3RSFA 3DHVA 1KI1A 1DQPA 1E2MA 3CNQS 4IS2A 1HEYA 5GQSA 2F7SA 1SUPA 1PZGA 5AKXA 5HKAA 1KPGA 1C7JA 1JHMA 3BCSA 3IBSA 3T5GA 3VR3A 5CLFA 3MAJA 1D0SA 2GLXA 3DJFA 5AK0A 5AVXA 5BWLA 2B1RA 3FIJA 3WR5A 4JT8A 1BWSA 2JAQA 5JH7B 4P93A 1FSGA 3K9HA 1Y6QA 4BBPA 1KVQA 1T1GA 1OASA 1GP2A 3TG2A 3FUWA 1PV1A 3IMCA 1CIVA 1DBIA 1SD5A 4KQEA 4R9UC 1NT2A 4BCCA 1UPAA 1XNJA 4IO1A 3GIDA 3VAYA 1NW7A 5EOVA 5L3QA 2QZSA 4RKWA 4N0MA 3NYQA 5IH7A 1W581 2ATIA 2X7HA 4KXUA 3IAFA 4RVCA 5FI0B 4BO6A 2GD2A 3L04A 4HLQB 2ETXA 4YJ2A 4KXVA 4I9FA 1VP3A 5JCOC 1Z2AA 1ZO8A 2B4TO 4BQIA 4V1CI 4MLDA 1UDWA 4E3ZA 5KDDA 1JZTA 3GOHA 1YRAA 4ALNA 5LP6F 3UJ7A 2F3RA 5KNDD 1VCHA 2IELA 3T7IA 3RFTA 1BTOA 4FPXA 4C6TA 4CXMA 3UUEA 3I04M 2QAGB 3NONA 4RA9A 3DKRA 3Q4GA 3W77A 2ZJ4A 1IAVA 1A96A 1VPDA 1JVNA 2MSNA 1K8QA 3WK9A 4DR5B 4YK7A 4OM8A 3LMKA 1FDWA 2ZB3A 4LFBB 1KI4A 1JI3A 2HF2A 4FEGA 4FYYA 3AP3A 4IDOA 1LK5A 3H6KA 3I2KA 3KVOA 4TYPA 3I1IA 5K01A 5MGNA 4D3XA 1ZSVA 4DPLA 4ZVLA 3FPAA 1U2GA 5JY6A 2O2EA 3IV7A 1CRZA 5ITZB 1AKEA 3HY3A 2O57A 2ZI9A 3AXSA 1MV8A 4K9RA 4CCSA 1R4ZA 3RYHB 2I3ZA 2OKGA 3KYIB 2DOKA 4OQ4A 2VHXA 3OM0A 5DHPA 5CMLA 3L1KA 1LDBA 3BQ9A 1H2YA 4JKOA 2LWIA 1NVAA 1J8YF 2V7TA 1HE5A 1JDTA 2PNFA 2VK2A 2X0IA 3LT4A 1KZ9A 4FFBA 2CB0A 4S35A 3LUKA 5DEOA 4F5DA 4EJ6A 2QY6A 4EJ2A 3F7OA 3USZA 4CM5A 1XNHA 3X1YA 1TI7A 1S3GA 2AJCA 2C07A 2GT1A 3WIUA 4YRZA 1C0KA 1C0PA 1O77A 1VMIA 3VNRA 5KC9A 3V00A 3WB0A 1H42A 2AS0A 4LRSB 3DWFA 1A2OA 3CM0A 1FMTA 1V6SA 2IQIA 4FZRA 3ZI4A 1K9SA 1KKUA 1R8JA 3A6JA 3ZHVA 1MT3A 5K3DA 2C9DA 4EW1A 4MVXA 3KV1A 1ST3A 2ZUWA 3GRVA 3QUCA 4C7OA 5JVDB 2JK1A 1CZUA 2X19A 3ZE2B 3OVMA 1TLLA 1U2PA 2IOQA 3ECSA 1Q7TA 5ESXA 1THGA 2AWOA 3MMXA 4W8GA 5DBFA 4AKTA 4PZCA 3BIFA 3IH5A 2NX2A 2OCYC 2QI9F 4M53A 4BVJA 4Q93A 2NO0A 2P30A 4H7JA 4K9LA 1XCOA 1KAQA 2OCLA 2YASA 4AJKA 4CQMD 2XV1A 4L3VA 1GCUA 5B1SA 3HY4A 4YQZA 1HF3A 2HMUA 2K2WA 4NF2A 5IJAA 4DRXA 2KLBA 4IIUA 3RWOA 4F2WA 2OPBA 2C7OA 3LDHA 2J4FA 2IQ5A 1I6KA 4NY1A 1TYEB 1I36A 1WE2A 2QIPA 3LP8A 2RGBA 3P4UA 4QTUB 3VPCA 1JHQA 3OA0A 5IDWA 5KNCA 2VQDA 2ZXUA 2WHPA 5CVDA 1TPYA 2FYTA 5FXMA 3RADC 3LCUA 3M33A 4I50F 4AM8A 1JJ7A 3QHAA 1XPOA 3DEJA 3LDUA 1Z68A 2KB0A 3WZ2A 4Z7QB 3DM9B 2PUEA 4BV3A 4YRBA 1A7AA 5A02A 4FD3A 1FTSA 4KFTA 1QHIA 2XMQA 4IIVA 4QU5A 1IG3A 2JHAA 2OVBA 1ZCZA 3AY6A 1I9GA 1H5UA 1MXFA 2VYQA 2FW0A 2VZ0A 3DDUA 3VKWA 2I0FA 2QAGC 2XVMA 3BQMB 5MN6A 3VH2A 3GLHA 2ZSBA 3IXQA 5AVWA 2YV1A 3LVQE 1BROA 2EZ9A 4PLHA 5DCUA 3W8FA 1YZLA 3HDGA 3KYJB 1WDLA 2KYRA 2ZSUA 1CY4A 4JHXA 1QG0A 2P3QA 3DV0A 4N5HX 4A2PA 1ZMRA 2JBAA 5EP1A 3IP5A 2WY2D 3DE6X 2HNKA 2F3UA 5H3HA 2E6UX 4M0DA 2PL1A 3DTTA 4BMXA 1MIOA 3QGMA 4YT5A 2QRGA 4GMHA 2PX2A 2O3RA 4IJVA 4KBYA 2EKDA 3NIFB 1B23P 3LXMA 3PC8A 1W94A 3PFBA 3EVFA 4YTEA 3IB3A 3WLEA 2IFTA 2Z2IA 2AOUA 4JLMA 4WASA 2B4KA 5KJFA 1XTUA 4KB5A 1BD3A 1M1NA 4GSLA 2O2SA 1HKUA 2P4UA 3G2PA 1H6CA 3PNQA 3UJ6A 4EHFA 4YJGB 3AMVA 1OLUB 2CHEA 3D8TA 3LJKA 1ZI8A 3LPLA 4FGWA 4ACAA 4KSYA 3T7CA 4RSGA 5CJJA 3IHWA 3SSNA 4AG5A 4Z5XA 3P9SA 1P4GA 1MENA 3AERB 2P4QA 2P9TA 2XLBA 3ICPA 3AFNA 3KTAA 1DKUA 4YCDA 5DIZA 1OYOA 2NT3A 3SHTA 2G7ZA 3VM6A 4ZYVA 1ZJYA 4OFBA 3WLSA 2OBYA 1BU5A 5KS2A 1OZ0A 2YIVX 3DKPA 4G86A 4IIBA 4HGQA 2DHDA 3IIKA 3O91A 5HF9A 5JEDA 5LBTA 1HM5A 4C0JA 5J2TA 1FFWA 1PNQA 4UE3S 1OLXB 2HAEA 2E3JA 4G23A 5EHGA 2SICE 1J0BA 4ND2A 1T36A 5BN5B 1B0AA 4IDFA 1E1QD 2CN1A 4MK4A 4KQ1A 3JD2A 3NDIA 3RIEA 1SHUX 4P4SA 4LJ7A 1WMSA 3K31A 2G25A 2J3DA 4KQ9A 2DR3A 3HCAA 2AX3A 1RRPA 1ONPA 4UUNA 1OZGA 3BWCA 1A8PA 2V8BA 1NONA 1G5HA 3NAZA 3QVGB 4OI2A 4UAJA 4A10A 1JHVA 3GGDA 2RJNA 3LFUA 3GLQA 2AKAB 2CXPA 2Y68A 2AFIA 2WJPA 1NX9A 1VBKA 1D5CA 5AKJA 3R8CA 2XKBA 1AZWA 3RVJA 4DLSA 3LC7O 3UJCA 3F47A 1C3VA 1N5IA 4NBRA 5BV2P 4O2BA 2O7RA 1BHJA 2PUJA 3EA5A 2ZYDA 2DPXA 5DNDA 1Z5ZA 3IP1A 1YMVA 1DOHA 2GUWA 1A50B 5D3ZA 5ER6A 5CYGA 4AJHA 1OWMA 1U2RA 4Z4IA 3GQBA 1T10A 3ZIDA 4N0QA 1HSZA 2HADA 3R20A 4TUYF 4TV9B 3G1UA 2J09A 3SXUB 2K6GA 2P9EA 3K92A 1E5XA 1HDOA 1QYCA 2V7VA 3PXBA 4LOLA 4HGNA 2VWGA 2G09A 4OV6B 3B5JA 3D9QX 3VKHA 4BX0A 1U04A 4U0KA 4WXHA 1NQTA 2W11A 1JVBA 1TEXA 4ODIA 1YQUA 3FVVA 3CNHA 4GPEA 4U2GA 4ARZB 3WQRA 4C0AC 1VA4A 1ITZA 1QM5A 1N3YA 2Y9PB 3BSFA 3ORSA 2C1XA 4INJA 4BFCA 1ABBA 5KNLA 2XCLA 1UH5A 5LYJB 1YMUA 2V55B 1Z8NA 3I2GA 2YRXA 2VCEA 1ZUWA 2QTNA 1BVRA 2CLDX 3HU3A 3OPNA 2XT9A 3TIVA 3B1VA 5KVCA 3FDJA 3VPXA 2EFHB 1Y3IA 5AW2A 4UBNA 3DEKA 4QXAA 3H5AA 2QD5A 3RAJA 1QH1A 4AO8A 4AXXA 3KSBC 2BH9A 2LVBA 2FZWA 3JD3A 3FLEA 2DY1A 2JFGA 1VE9A 4H6PA 3QLVC 4OBWA 3L84A 2ZTSA 4EM6A 2QW1A 2ZETA 2RHCA 5DWVA 3CC8A 1OFTA 2BSXA 5FBLB 1TU0A 3UH0A 3MWFA 2YW2A 1XDSA 1G60A 4KSCA 1EGMB 5EWLA 1YKFA 4AUKA 5K0SA 4LHSA 3HHEA 1YVUA 4G37A 3RYTC 4ZOLA 3UA4A 1PJRA 1A2BA 2P5TB 5COBA 5HGJA 5KWSA 2JLBA 3T12A 4I55F 1GAJA 1LI7A 4LHZA 1FE8A 4ROTA 2P2ZA 1EIZA 4MB2A 4UCQA 3R7WA 2M1XA 1KBZA 4G9GA 2EW8A 3OLCX 1JQDA 3ABOB 3HZHA 4ZJZA 4P7BA 1OMOA 4U5XA 3CG4A 2PTHA 3B1ZA 3KSMA 2D74A 5CM2Z 1WAMA 2OXIA 2A59A 1ZNXA 4I6GA 2VHEA 1KVRA 5EEHA 3N59A 2IYZA 1DUVG 2W8BA 3OU6A 4L6CA 4MV7A 4PZZA 4XDGA 4Q9LA 5HRAA 1GN9A 1GPNA 3O26A 2CXHA 3HR7A 1UXGA 5EESA 4DUGA 3SXPA 3KWJA 4TMZA 1ZVKA 1YR2A 3G1TA 2B4QA 4C0QC 3AESA 1MFZA 1ZK2A 2AG1A 3T9EA 2RB5A 3OC0A 1IFXA 3IRVA 3NP7A 1X1AA 2YWBA 3JQEA 3ESZA 4BX2A 2WAYA 4MDYA 3P4YA 5TPZA 5JD3A 4DA6A 1VYVA 3ELWA 5CB4A 2WZBA 3PT5A 3OUZA 1CULC 1KAEA 3WQSB 1P2SA 1OZFA 2AOVA 2ZUDA 4LHVA 1S01A 1V95A 2ZT6A 2HJSA 4BFUA 1VKOA 5JWOA 4I1VA 1SKYE 5B53A 3IVAA 3M4ZA 5FD8A 1TECE 1X7DA 3V80A 2QOEA 4WCFC 2A0WA 1UAGA 4R16A 5AJHA 4AD8A 4A2CA 1BOOA 5LXTB 3S81A 1AM4D 4HFJA 2HK7A 4Z49A 5KQSA 2FSSA 3U17A 1KP3A 2B1IA 2JPDA 3K9BA 3FCEA 1FVXA 2NXJA 2XMGA 2OD2A 4FE4A 3U3JA 2C83A 1GPH1 5IJWA 1H9AA 1RPTA 2SCUA 3BIJA 1T25A 1XMPA 3IDOA 1SVWA 3LUCA 4KYIB 4KYUA 2WTEA 3I5YA 1DPFA 5IJ0A 4G01B 2XWQA 4FDTA 3OZIA 5FWYA 4MX8A 3GJ8A 4NR0A 4WOKA 1X9IA 4QICA 1JJFA 3K0EA 2ZWAA 1GYQA 1GJRA 1HL7A 1YK1A 1WW2A 2IZOA 1BVYF 1KZGB 4XUCA 4L16A 1PFWA 3AG5A 5CGQB 2COKA 3HU2A 4YRPA 3QXGA 3W9BA 2I03A 3LXXA 2FFQA 2ZRHA 3PJFA 5ED0A 4C7JA 1TEVA 4IICA 3FWKA 1IHPA 1QGDA 1W44A 1KSGA 3IQWA 3GRZA 2PKQP 5KHLB 4JP8A 2FQWA 4TYWA 3PX3A 3DOUA 4EARA 5H3LA 2JLXA 1IZ7A 4MAAA 4R83A 3IMGA 5F12A 1P3Y1 4DA4A 4QUEA 3GK3A 2OV1A 2Q5QA 2FLKA 3EARA 2H7CA 3T9AA 3FLBA 2B82A 2P9BA 3RPEA 5BQ3A 1U8UA 2O1EA 3LQQA 3L01A 1QUEA 1V8FA 4QBGB 3NPMA 4Q4AA 4CJXA 4B3XA 2QMUA 4UTVA 1OX5A 5CFNA 1NQUA 2CZQA 3OP1A 1TM4E 3VSDA 3N75A 5FUYA 4BKQA 3QBDA 1G4HA 2WD7B 2OD9A 3AIMA 3HJUA 2WLTA 4PLTA 3REFA 3TRHA 2KE5A 3WS7A 1E63A 2ENWA 1Z4OA 1Z9BA 2GPSA 3OFKA 4FOPA 3VU3A 3DFUA 3WICA 4Q3DA 1IM8A 3P1JA 2I34A 1RXIA 4XEUA 4DCOA 4JVOA 1NR1A 1SM4A 2J9YB 3C7KA 3GPIA 4OHFA 3TIGA 3UMFA 4E2FA 1UUFA 5I4BA 3BRQA 1AY0A 1X1RA 3OT5A 4N0PA 2FSFA 1CQWA 2ZM5A 1N4DA 1WA5A 3K6JA 1U4SA 1H1DA 3F6SA 3M3HA 3PC7A 2J4DA 1C7QA 4BV2A 1RLMA 4C21A 2BMDA 1I7PA 3NUGA 4C7XA 2A86A 1OT3A 1XFDA 3SF0A 1A9OA 1BEZA 1ZONA 2D8AA 2OHVA 3AL2A 4QOEA 2ZZKA 3FFAA 4FGSA 3HJRA 1C7FA 3FCOA 4RVUA 1VI6A 1YDHA 1XD2A 2NSLA 4HDMA 2PRSA 2QJRA 1NIJA 1ZAYA 1RI5A 3T0FA 1Q17A 3MEQA 3IALA 3OZEA 2P6NA 3QRWA 2O8FB 5K3OA 4PCVA 2IUYA 3EA4A 1GT91 1PS0A 4UEJA 4B79A 8ADHA 4QKQA 3ZDCA 2ZANA 3KFXA 3V34A 2H29A 1IEWA 4RZ3A 3V8PA 5HM6A 1P77A 4FVTA 4RA9B 1N2CE 2ATXA 2HA4A 3UHFA 4BJ5A 3ZJUA 1BWRA 3H9JA 3MFYA 4W5NA 2DFKB 2YRFA 3I2IA 4POAA 1QU2A 4PX5A 1VLVA 3LZDA 1VA5A 5I9TA 3AETB 2C2ZA 2FPLA 1PYDA 1YE3A 1YR1A 4LF5B 4YJFB 3ES9A 2QTHA 2QXTA 1U7XA 3DE4X 3HWRA 1FS5A 3AF4A 4N54A 4D6PA 4J94A 2EKQA 3CH7A 3QOWA 3Q3VA 4HTFB 5C7OO 4PSUA 4Y0VA 5K1ZA 3S4YA 1QYWA 1U3TA 2VP5A 3H4IA 3TX2A 1JEJA 1II0A 3UPDA 5EJ2A 5KX5A 2F2TA 4FWIB 3IDSA 4HQOA 2FWIA 3R5SA 4X7MA 5E9QA 5B7NA 2REOA 2W42A 4QAJA 3BT7A 1TZKA 4L22A 3E3OA 1W48A 1M6HA 4MCHA 3KWFA 1XZDA 5CH3A 4BNTA 2RG7A 3A6EA 2BTOA 3TTXA 1L3CA 1T2CA 1JBEA 3B6KA 3CGGA 3ZU4A 4CWAA 2JFYA 3MSXA 1EFPB 2DR0A 1G21A 4EENA 4EO7A 3UXEA 4Q3LA 2IZ7A 2OBXA 5E6SB 3PNOA 1FFEA 4JKIA 4YMSA 4WY8A 1VXOA 1IONA 3TINA 4HNRA 4JZYA 2CJWA 5FNZA 1TKBA 3LQ4A 3Q7QA 3LF2A 3E7DA 3O92A 4RMIA 1S3IA 2QPOA 1XDZA 4G09A 2M98A 5IZCC 5LOVB 1QK3A 3UK6A 1LSSA 5KJEA 3BD9A 4KQ2A 4ZU1X 5HE8A 1SQFA 2GFQA 1GKLA 1VL6A 1ZM2A 3G8CA 3LTNC 3O9MA 1Z47A 4TLCA 4LV6A 1EQUA 3HYNA 4WHMA 4EG5A 3WGZA 5KTOA 3N76A 2G1UA 2Z1NA 4ZAGA 2H07A 3FMIA 1K7EB 5A3JA 4ZI3A 4D80A 2IPAB 5I6DA 2HU2A 2JIZD 2Z2ZA 4U6SA 4CMKA 5JWHA 1U4NA 3U4MA 2C2XA 1SPBS 1YCFA 3BMCB 4ER7A 2YINC 1YJ8A 4JKYA 3OF5A 3QEAZ 3HXOA 1BMDA 1DFIA 1A7KA 3EXG1 2EW2A 2VF7A 5JASA 3GUZA 4MEBA 2ZBPA 4X1YB 5IC5A 4LY0A 3KHSA 3DHYA 3LY8A 4X6LA 4N9QA 1E2LA 3KYDA 4MW7A 4YDSA 4NIMA 1MB4A 2ZFUA 1X7YA 1QRSA 1TVKA 3RVMA 5K6TA 2C2WA 4W7IA 3TZCA 2NADA 3ZI7A 5C3MA 1GITA 5EJFA 1NN0A 5EJ9A 3F1LA 3AEUA 4JBXA 1GSOA 3ANLA 3HCWA 1CE8A 3NEAA 1FEZA 4PZYA 5LL6P 3B8HA 1UPCA 2CNWD 3DYVA 3IAHA 4RY0A 2IXEA 2ZUEA 5EJ4A 3IO3A 4MB0A 3TQRA 5T4BA 1P1HA 4UHCA 3E3LA 4IXDA 3ZKWA 4YRGA 4YXWA 1ZEJA 1M0TA 3CF4A 4Q05A 1Z56C 3NVAA 3WRYA 4BOYA 4FEYA 1K0UA 5DASA 3VV2A 3CX3A 1KFCB 2YMMA 3KWLA 3RD5A 4D97A 4LMBA 1U2DA 1RWQA 3JAKB 2R60A 4J1TA 2GCOB 3D1JA 2EP8A 1AU9A 5EJGA 1F6DA 2IT1A 4GRIA 2C2KA 1VLZA 2PLNA 1Z0DA 4TOIA 5LLTA 4UTPA 2DHEA 2I3GA 2UXCB 3TRDA 3H5LA 4KI0A 3HBLA 3QPWA 1DAKA 2BP7B 4HWSA 4KXFB 5FEMA 2BL4A 4F4FA 2NTJA 4LYDA 3U7IA 1XEWX 4Z7NB 3MS2A 5C35A 4QVGA 2R1TB 4UZEA 1FJXA 4XM2A 4XEHA 3CW8X 3GGJA 3PU6A 4LCBA 1AUXA 2OK8A 3JQ7B 3W8NA 1K97A 2B6NA 3NGMA 3B1YA 1NNI1 3SMVA 1SUSA 3SIRA 2YJGA 3GEIA 4PIPA 4A6EA 4U7TB 4E1VA 4UDOA 1M5UA 1UBHS 1W49A 2XYPA 4NE2A 1MB9A 2Z56A 4UHDA 4ZARA 5G3YA 3VZBA 4F9TA 2HCBA 3T5AA 4YV0A 2B30A 5A1TA 2JGNA 3GNLA 3KZMA 5IJXA 1P17A 4F04A 5KQPA 4AJ4A 1A0OA 1Q5PA 1QHHA 3UKJA 2I2BA 2CY0A 1Z2DA 2FETA 4ZVKA 3FA2A 4DWOA 4AZTA 4UM9B 1DAGA 4P33A 4QXRA 4IMIB 3R6DA 1G66A 4KGDA 2PSSA 3FJYA 2LIVA 3LYHA 1JLLB 1PCXA 2LGJA 3CNEA 1EFVA 3EF1A 3FMOB 1C9YA 3MGAA 2HQRA 5FA8A 2H59A 3F8TA 4HDSA 4WY2A 5IAGA 4ZIRB 1IEXA 1U98A 4WKCA 1J6UA 5B4TA 3IILA 2PO7A 4MQEA 2D1QA 3WZMA 2O2ZA 1DINA 3KAQA 4NEQA 4IW3B 3V1LA 1E66A 1OWPA 1X0XA 3PZRA 3AU9A 3RS4A 1I7LA 2GK3A 4CR7A 1AHPA 3ZCRA 2OHFA 3DCYA 5ERGB 1TD9A 1OROA 3LKBA 1Y4SA 3GQBB 4JEUA 2HFJA 1A76A 1KO7A 1E9BA 2XUPA 3UHJA 1DJLA 2H2FA 3MLBA 2FR0A 4TLLB 1CKEA 3L8CA 3MVEA 1Y7HA 3VR4A 1EFKA 4F1KA 4F0JA 2E4ZA 3EH2A 3P9QA 5T6MA 5G0WA 4MIYA 2A9OA 5FOVA 2QP9X 3ITKA 3SEFA 3C8ZA 4JQOA 1M2GA 1KNQA 2BRUC 4YA6A 3EXG2 3RGWS 3R1IA 4PQGA 4ZVPA 3UFXB 5BSGA 1C1DB 3C15C 4Q0MA 4F84A 4ISCA 3TKYA 4ED9A 1E69A 5CNJA 3UUFA 2A84A 3NB0A 1RXSA 2GYUA 2YBEA 3FSRA 1ZN7A 4J90A 1G8HA 3JQBC 3KJFA 2QMEA 5BW8A 4D9BA 3UJBA 1J2JA 1K7YA 4OFWA 1LBTA 1LF5A 3PFNA 1OVGA 3HI4A 4WE3A 4YMUA 2Q2QA 2CJYA 2YICA 1E1DA 4BQNA 1RLOA 1IHUA 2G71A 4EZEA 4OUKX 4KXWA 5JDIC 5ITWA 5ES4B 1R50A 1UK8A 5BXQC 3EXEB 3OBIA 2PS1A 3C39A 4OBEA 4RTNA 1ORTA 1TW2A 3ORHA 2G5CA 3CWCA 3GZTB 3PDUA 4RX1A 1SA0B 2JB9A 3AUTA 3N1UA 1FDIA 4Q9HA 4XYGA 1SFRA 1VPVA 3ROPA 2DERA 3LQ2A 2Q2VA 2QZ4A 3BCRA 2RHWA 2VJLA 1YZVA 4GMFA 4MR8B 1T4CB 2H1CA 5B2FA 2Q1UA 5ED4A 2PH7A 4JL5A 4XWWA 3L7BA 4G85A 3GMDA 1H6AA 2OP0A 1AK2A 3E0QA 4EA9A 1L4BA 3H6HA 2Q1SA 2AXQA 3AF3A 3C8UA 4KRXA 1KTIA 3ESDA 3I9LA 3PJGA 4JJ6A 1WB9A 3M6MD 1MG0A 2OVFA 1TB4A 1XRSB 4DMUB 5BNTA 4DZRA 1GVNB 2ACVA 4YONB 1Z22A 4GZLA 1ULSA 5ECGC 5G3ZA 3ISTA 1YACA 1NY6A 2CNDA 2C7GA 1SVMA 1EBBA 2FAXA 2PKXA 4EB6B 2GFHA 4M0MA 5EZYF 3STYA 3I5XA 1FRFS 1ZN2A 1RS0A 1E6MA 2QX8A 2BONA 4AURA 1IQ0A 2GF2A 3HBNA 1W4LA 4KZPA 1VPTA 3DVQX 1RPNA 3O8OB 1Z5GA 3ZDZB 2HY7A 2O4UX 4IUCS 4PHFA 4C6RA 4DB2A 1M83A 1TU3A 5KYNA 2O2JA 1ZBDA 3GMTA 4M0KA 4BWYA 1QHYA 3C8MA 3ZY6A 1MC5A 4PBSA 1H4VB 3OD5A 1HL3A 1KZ4A 2Y3IA 4WZZA 2O2GA 3SVLA 3H11B 2F1HA 2PIAA 4N6GA 4F3CA 1OI2A 3BXHA 1QVZA 2ZSKA 2V1XA 4FNGA 2Z6AA 2CB9A 1ID1A 1GLGA 2Z9DA 1KEEB 2WFMA 2XOXA 4NFHA 2VN8A 1B15A 1D2CA 2PFKA 4IJMA 1OC4A 4XGIA 4N5NA 5M5BA 4YHHB 4ESVA 1J5XA 5GAJA 3UBTA 3MJHA 3QVVA 1J2UA 2D13A 2PWYA 1U3DA 2PKRA 2WU8A 1GR0A 3L1IA 1R3DA 4C3UA 1XHEA 1XZBA 2QT9A 4ZYUA 4D6YA 1P60A 2WM2A 4WBSA 5FBZA 1MDBA 3EGXB 1TC2A 5DX1A 2VI5A 2YHIA 4M0EA 3LYUA 1AS2A 2BMAA 2HJVA 3T1VA 4JXZA 2UU9B 1AMUA 3P2YA 3EDCA 1EUCB 2XD4A 4LGCA 1NY5A 3NETA 4LW8A 1KEKA 2V98A 3IC5A 3UXMA 3H84A 3K2QA 4CEJB 3WMGA 1A04A 4H6XA 1NG1A 4MW4A 2H1IA 2UZAA 4GBJA 4DCMA 3G02A 2Y8EA 3GVPA 1DTWA 5JC1A 5JCJA 2DAPA 4MQ4A 3Q98A 5T4FA 1KSJA 2Q29A 1Z06A 4UW9A 3RJ9A 5LDGA 4BVAA 2VOJA 1L5MA 3L7YA 3ZDDA 2N0SA 4Z7OB 5JV5A 2A8YA 3SQDA 2VK8A 3EXFA 1MKYA 2P0AA 4UPEA 1IL0A 1P7WA 1TTHA 2ODEA 1SC6A 1ECGA 1JRLA 2YOHA 2Z5GA 4H31A 4I1SA 2IWRA 3GLGB 4FOOA 1UKZA 1EWKA 3FCYA 1ISHA 3FDZB 3QIAA 1L4NA 3HDTA 4XSHA 3ZU5A 1LI5A 5B3AA 3FOEC 5KNDA 1DXQA 4DT1B 4DUYB 4GWKA 1C9JA 2YJ5A 3NKFA 2QXYA 2Y4NA 5IKPA 1V47A 1E7WA 2NZJA 1BEUB 4MUEA 5T5QA 2WD7A 1JH9A 1QHGA 1I3LA 3DOIA 4DM4A 4LPKA 5C4IA 1W4BA 2NO9A 4ZQFA 3N6XA 2VIIA 3F74A 1TEHA 2AGVA 3NANA 5HIJA 1LDYA 5EJEA 4HNAA 3IRUA 2AWNA 4IHJA 4KQXA 1DG3A 4GBED 3R40A 4YAEA 1P33A 4IF4A 1EUYA 2XTAA 3OQBA 1HDYA 4QXOA 5WRFA 2FP4A 4MDHA 4LE2A 1Z2NX 4UU1A 2BM0A 3FTDA 3BEOA 3D6HA 3O0TA 2YWGA 1U0LA 3O3CA 3IERA 4Q3EA 4ECAA 2QM7A 4BMOB 2VYVD 3GDGA 1TD1A 3QWFA 2DFTA 3ER8A 4FZVA 2YN4A 1WCWA 4UOZA 5BRAA 2R6CA 1MW8X 3ASZA 3B9RA 1XD2B 3LT1A 1QE3A 1ZRHA 3IVGA 4YJ2B 4QPDA 5IBCA 3IR7A 3CW9A 4Z86A 3TLAA 4EOGA 5FBVB 5JANA 4O4LA 4EP1A 1UK6A 1O54A 1VYTA 3GBVA 4OQPA 2H9AA 2AJLI 3R24A 2XYVA 1KQNA 2O8FA 1VECA 3ZZUA 2X6TA 2XUJA 4GBGA 2ZJZA 4B87A 4DYVA 4F6CA 3KCNA 2GM3A 4CIDA 2LUOA 4HAOA 2VDWA 3AVWA 2JZNA 4X5OA 4XJSA 4Q3OA 5HUQA 2XUGA 3L0CA 1A1VA 3MHPA 4E4RA 4GRAA 4ZO9A 3G23A 4WW0A 2VOEA 4KIFA 2ZU6A 3NAMA 3P0FA 1S2GA 5FOXA 1GG5A 3TZQA 1NUTA 1X6VA 1YR6A 4DF3A 4BE4A 2W6OA 3ZX4A 2CKMA 5C8YF 1TJ3A 3ODGA 4HDKB 5CCBA 2QQFA 3HXTA 1ZOSA 4DQKA 4FP9A 3V8QA 1ZN8A 4IIHA 1GTVA 1I3OA 1ML3A 1YRWA 5DYWA 1X2EA 4EGFA 3HCDA 1JYEA 4P81A 4E4TA 1R15A 4RUKA 4I4NA 1XCJA 1Z0JA 3JQ8A 4H7IA 2JK0A 4EF4A 5I8PA 1N3BA 1XN1A 2ODBA 4M87A 3DPUA 1C1YA 1PNTA 2E37A 3E1SA 5FOSA 1EFPA 1M2KA 2QJWA 2Z4TA 3RFFA 1V2HE 2I4TA 3MXOA 3THSA 5KU1A 4I4TF 2GHIA 1RPAA 3HZOA 4NARA 3FOWA 5JAOA 3CN9A 3EX7C 5AQ1A 5JD6A 1PEDA 1AF7A 4JLWA 2ZVPX 2YCLA 4Q1CA 2BI8A 8GPBA 3Q7EA 1IK4A 2J46A 2E18A 1G19A 1X1CA 2VQ3A 5ELXA 3OKCA 5LOVA 1I4LD 2GJ8A 4R0MA 1V5FA 1LFDB 4V0ME 4J0JA 1QE0A 4LZOA 3LXUX 1GNSA 1B8PA 2VH1A 5HBGA 4TM8A 1UBMS 5B58C 4BQEA 4EX7A 3RYIB 2X3FA 2ZRAA 5DNWA 2NUBA 3MILA 3UOWA 1F1JA 4K81B 5K51A 1E3SA 3CH6A 1KO5A 2WVJA 3CS3A 4N6NA 4OJYA 2D7JA 5KX5F 1ML4A 2PX3A 2GAIA 5JG7A 1VCIA 2H06A 3Q8XB 4LV5B 5BR1A 3IEPA 1QJ4A 4NYMR 1OKKD 3QFHA 4LDRA 2C97A 3ZV4A 2GEUA 5CIQA 5DTMA 1PL6A 1DHRA 2XA9A 1J0EA 1S2MA 4W1RA 1AE1A 3QUAA 4XXHA 3HKEB 4FB4A 4HXEB 4QU0A 3NWBA 5CDFA 1AN9A 1AQYA 3CRNA 4RS3A 4ERNA 1O94C 2H8GA 4TVOA 1KU6A 4L5CA 2DF8A 3ZBQA 3MYYA 1RIFA 3AO0B 1E5TA 3CU5A 4BV9A 4HMOA 1YT5A 2BEWA 2B8NA 5CA0B 2FX3A 1KVSA 3UOGA 3AEUB 2VJAA 1BOFA 1XJCA 1M2WA 4DN6A 3PR2B 4B2LA 4Z51A 2RHGB 2JGAA 5LBUA 1GV0A 3JWGA 3SD7A 1SN7A 3A1FA 4M2LA 3GJRA 1V7CA 2G67A 2JI4A 1J06A 2A1UB 2J7PA 2O1WA 2RGRA 1GPLA 4PM4A 1E7RA 2H1SA 3BVPA 4G25A 3RTGA 5I4CA 5A05A 4LFAB 4MYCA 4EELA 5JOQA 1UAYA 5EINA 3THWA 2XE6A 2UZ1B 2EU8A 2EZ4A 4IKOA 1EWTA 4P4UA 1SB8A 4ZREA 4J0EA 3KJXA 2PZAA 2RI0A 2TMYA 5FFFA 1KJ9A 4TMXA 3V55A 3PA8A 1MH1A 1L4LA 2JIZA 3ETEA 1JXMA 3WJ1A 2HMAA 1GWNA 1RQRA 3QTLA 4JJ4A 4OXXA 2YNMA 1TL7C 4AMYA 2WFLA 4BLUA 4A0RA 2NTYC 2WMYA 3OICA 4UBOA 2IYOA 4MQLA 4UC0A 2JAPA 2I67A 4NU0A 4OL9A 2ORED 3UCXA 2ODWA 1WXFA 2BGIA 3NNDA 4HRXA 4LYEA 4UCXA 4YRTA 4D0RA 1WDKA 4G41A 3K9FC 4HB0A 3G5MA 3WBKA 4A16A 2IBTA 1UT8A 1L4EA 1WB5A 2BI7A 3I1FA 3ZD7A 3PHGA 1VCOA 3GUUA 3LDFA 3OQHA 3WIVA 1IHDA 4PG4A 4QFMA 1G64A 2QLJA 1PSZA 4M9QA 1ZEMA 4OP1A 2ZIAA 1DOAA 3LECA 4FGUA 4Q3AA 4JU9A 5LZ9A 1M0SA 1OAOC 2AV6A 2ZI3A 4JFRA 5EY5B 3SHVA 1PJBA 4ARVA 5CXUA 4AWBA 1V71A 3H87A 1RDFA 3X1DA 4OHVA 1DC3A 1Y8AA 5HKKA 3GCWA 1DZ3A 1UPBA 3RF7A 1EIWA 1KQFA 1IOZA 3CLUC 2J5QA 3QOFA 3PXXA 2QTCA 4GUAA 5M2QA 4XW2A 1ZVVA 2YCBA 4OMDA 3WB9A 5K2OA 3BHNA 2ZB2A 1L5YA 2RCNA 4L9RA 1N6IA 4WGGA 2XLCA 1YBMA 2C20A 1UP4A 5T3YA 5JTTA 1E20A 4E09A 2XITA 2YHSA 3NOOA 4PN7A 2IZ0A 3EIWA 1T5LA 4L57A 1Z74A 1CUYA 3I92A 5GVSA 2W83A 3D7RA 3F9RA 4ZEXA 4S12A 4DCGA 4R2XA 5FNVA 3U26A 4DRYA 3ANMA 4DUZB 2OOSA 2WM9B 5I51A 5AUNB 6GPBA 2ZZNA 2XECA 2QW0X 3ET4A 5B7QA 4X1OA 2XPCA 4RK1A 4E70A 4P0PB 4BS9A 4QYWA 2IXDA 4B6GA 2ZJ8A 1U90A 3QEKA 4L9WA 3ZCXA 3I23A 1UC9A 2HUNA 1XEFA 4HUTA 4KLCA 2VPQA 1NUHA 3C6YA 1TRKA 3PFGA 5BR4A 2V1UA 1H1TA 1CY0A 2OYSA 5BQOA 4HL6A 5HZGA 2HLDD 3UFXA 3QWAA 4R8KA 3GUYA 3FCUB 1FRVA 4KITB 2HQSA 3TSAA 3GLRA 4MAFA 1N34B 4BZPA 4KL8S 4OJNA 4UARA 2AOWA 4ZC1A 4DGSA 2A5FA 3TLEA 3AR8A 1AGYA 3OQJA 2JJQA 3ZK8A 1T4DA 1Y9EA 3JQ9C 1HDGO 1VSVA 4RKQA 3HL4A 5GY7A 3UO8B 5BUSA 2JLAA 3OWOA 3V7NA 2QD4A 1KK1A 1Q0RA 3E5MA 1V7QA 1Z8DA 3AOEA 3OOHA 4C6SA 4FBGA 4WI1A 2ZE8A 3AYXB 3DLIA 1XIVA 3S1AB 1SU8A 1KDOA 3DGFC 1I7DA 4RTQA 1JE1A 3CF4G 1GKUB 2AVNA 5CYFA 3H4VA 1L7EA 2JEZA 1QXSA 1PN3A 1Z2OX 4RVSA 1GGFA 2VDKB 3E15A 1RZUA 1ULUA 4DBZA 2QPTA 3SJ7A 1ZJ4A 3B2NA 1GQQA 3NGXA 1ATIA 2JLCA 5BSVA 3RR2A 1V96A 2HK9A 1P4JA 3E82A 2HJWA 4FYKA 4ZAXA 1PHRA 4G0UA 3CUWA 2AQ8A 4QQRA 1QCDA 3GVCA 2QZZA 1L5HA 2VAWA 1QRDA 3C3XA 4DSAA 3WKBA 2EZUA 1X2BA 3PFCA 1ADYA 3P2IA 4O0LA 3CPHA 1V1MA 2VP4A 4OYYA 2GHTA 2FKAA 4MIOA 3ZN2A 4EEXA 5CFZA 4PLGA 4BVHA 4P1ZA 3S8YA 2I76A 1WG8A 4RIGA 5HIMA 1TMOA 3SXJA 4UQOA 4ZO7A 5K6RA 4EHAA 2C7VA 1JMVA 1SXJD 1SD1A 4Q3NA 1AK1A 3O8NA 2XUFA 5AM2A 4B3GA 2XBUA 3DWGA 3ESAA 2XOKD 2YZKA 3OEEA 1ZBQA 1KI3A 2MT9A 5T7BA 2QMZA 3A0RB 4XWYA 3Q1KA 5C5IA 3F67A 3BFVA 4AYXA 1IY1A 3Q3JB 1RWKA 3D8RA 1VSUA 2FEMA 3WL4A 3DE1X 4L8LA 4BECA 5B3LA 5H8WA 3HM9A 2R1UA 2BGLA 1IN6A 1ZVQA 3MBOA 3NAQA 3W2TA 2XBMA 1MJGA 1RYNA 1UINA 2F3SA 1CG6A 2ZS7A 2OGZA 2ZBUA 5J23A 1U0TA 3VZQA 1DGQA 1YFLA 5EZQA 3F71A 5TS3A 3LS2A 3UJPA 4NJOA 1EX9A 4FN5A 1SEPA 2AKEA 4Q7QA 3OEHA 4H6VA 3ACBA 4BMNA 1Q0SA 4EL5A 4JLUA 3CB4A 4X9XA 5DCLA 5FWYB 3TCKA 2H2AA 3WRVA 4MUKA 4U2DA 4XJTA 1QANA 2JLYA 3T52A 4OHZA 3IP7A 2PKYX 1CR6A 3L8MA 1Y3BE 3FYHA 5CFOA 2V4ZA 3AJRA 5F78A 1JR2A 3ZNNA 1Q3HA 2JIOA 4DBLE 1IWPB 1NJ8A 2PRYA 3FR8A 3PL5A 5FL7A 4Q12A 4P4GA 4P3OA 4I08A 5BR8B 2R4TA 4DJDC 9LDTA 1KWGA 3KZCA 3P27A 2X2FA 2BE7A 1DC4A 5A62A 4BFXA 3TZEA 1I5OA 3WNZA 3LUFA 3ZLTA 4K9SA 1R4NA 1WZ2A 4OPMA 2V7PA 1LBSA 2FSHA 5AHOA 3MM4A 1CSEE 3VO8A 3EZ7A 1PFGA 2Z2XA 3C7TA 3L6EA 3RSLA 3RVNA 3MZ0A 4HLCA 4RM2A 3LKZA 4ZDKA 2FQ1A 4PZDA 3DMTA 5IDXA 1YDEA 4YHBA 2RIRA 2B21A 4RTJA 4P38A 2CV0A 2P6UA 4E31A 3O1IC 1GIAA 4R69A 3RUIA 2J0VA 2P11A 2QVGA 5IUKC 3DTYA 4BRSA 5KTMA 4LVCA 3C48A 2Q5JA 2Q5CA 3IKMB 3RSQA 1FS4A 4LNHA 2BFMA 1Z33A 5KREA 4UTXA 4GGOA 2LRHA 2PJRA 1QBKC 1REQA 2AR9A 2NACA 3DC2A 3M5PA 3SJZA 3LX4A 4FDUA 4UTOA 1V35A 3F90A 3G2NA 4ZV4A 1MXHA 4MUMA 2GD6A 1SCIA 4W1SA 2V4UA 4FXPA 2C5BA 2AG8A 4HPJB 3TL2A 4NAUA 4EHDA 1JIKA 4MW2A 4LX0A 4V3CA 3U39A 4CF3A 3R3JA 3LQYA 1NMZA 4WVFA 4FB5A 3OLYA 1WCYA 5JCXA 3DULA 2C8VA 4DLRA 1N6LA 3V1TC 5K9ZA 2L2QA 2PU7A 4IDHA 121PA 5BSMA 3W4IA 5KOYA 2X58A 3L0YA 3R3ZA 1JVSA 2OFPA 2G8NA 3TLYA 1POWA 1ZGBA 4DV4B 3TR0A 3WWEA 2WWIA 3QM1A 4C03A 3FVRA 4N3AA 4Y98A 3A32A 3GFVA 4DR3B 1JIQA 2CNBA 3TM5A 3WP0A 4PC3A 4W6ZA 5K3EA 1YB1A 4KO2S 4YUXA 1GU1A 1MEJA 2AHOA 3BEDA 4J76A 5EWJA 1AQLA 2HR1A 1KQPA 3DMPA 4YCJA 3AVOA 4YJGA 2IBMA 3M3DA 3PPYA 2DECA 4S2UA 4MUXA 4U7JA 4X0EA 2M32A 1H4QA 1FTQA 2NVUA 3LBIA 1B76A 1QV6A 3BHMA 3AERA 2WIKA 2PZ8A 1UKVY 1VKHA 5A0VA 4J75A 5KMGB 2WWHA 3AETA 3R7BA 2PX6A 2Z8YA 3OEWA 3GBSA 1UKCA 3B5IA 2GHRA 1K66A 3SKYA 3UK0A 3OQMA 4CV3A 1MAWA 4EHIA 5IT9A 4OLJA 3HVUA 1IN8A 4HTFA 4NCBA 1T36B 1CUGA 3GELA 3COWA 3K1YA 1HPLA 4KMRA 1MGOA 3ZBUA 4XFKA 2QLNA 3KEGA 1XZQA 2IEIA 1EK5A 3CRMA 4KUGA 1N2GA 2HPHA 3U0VA 2XKKA 4REQB 3HMKA 4TZ6A 4OLBA 5BSKA 1EXMA 4YFYA 2I1VB 1GU7A 5HJ5A 1IVNA 3BFJA 2N1BA 4PXAA 1SMKA 3I09A 3QVGA 1HE3A 1PZXA 4NK5A 3QLEA 4WAUA 3RS7A 2IIQA 2YJZA 1Z5UA 5K8TA 5F9MA 2B83A 1TTQB 2GPAA 1NMXA 2CNOA 3A10A 1D03A 3KS9A 3LY7A 3P9XA 4I1YA 4MA4A 4BQRA 4HZGA 1UEXC 1FU7A 3LX6A 4TGLA 2QM8A 5DOVA 1XUOA 5AXCA 4NE7A 4H7DA 2WUGA 4Z4QA 2F64A 4BV8A 2R66A 1MZVA 3TSZA 5JAHA 1R9JA 1NVEA 4ZANA 4EI2A 2Y1WA 4BNMA 3I0ZA 5DN6A 3BN3A 2P2LA 3TIXB 4BBAA 1GZ5A 3KYBA 4PO9A 1JL3A 1TKAA 2YS6A 3NT2A 3PGXA 1T9BA 3TZLA 3SBXA 5JTUA 3ENNA 4FHGA 4GL4A 1C30A 1XZIA 2AX4A 2NPOA 3VBEA 4ALJA 1ZSNA 4KNVA 4D9HA 4L85A 3K20A 4BP1A 1XQVA 5BW6B 5KYUB 1GAWA 1M3SA 1MA3A 3I8OA 3GEMA 3O75A 2GZ1A 3OJWA 4K6OA 4N7BA 4X6UA 1G3IA 5B12A 5FI3A 2VDLB 1Q0QA 3RSOA 2VDQB 1EWRA 2VKTA 3LBYA 3OTHA 1H6DA 4UNIA 4NDAA 1VI5A 3LC0A 3S1LA 2GESA 4NOKA 3ST7A 3TZ6A 4DARA 1UOOA 3JS5A 3KJZA 3DKIA 1N8KA 2J0UA 4HR7A 4RH3A 4LRWA 3ROTA 3ZQUA 3E2PA 3TJZA 3I0NA 5C7YA 4YECA 3PG5A 2NSJA 5DGXA 1DKPA 4IG9A 4B2YA 3A1SA 4X20A 2ECOA 3MT8A 4B17A 3FWPA 4YLGA 5AO9A 1DIOB 1JYFA 1VGVA 3GW8A 1E89A 3GDOA 3QI7A 4IMJB 5JLAA 1KO8A 3NYIA 4F9GA 4AQ7A 2BEWB 4NS4A 2I1QA 2QMHA 3C8HA 3IP9A 3L4BC 2QVCA 1UOPA 4UKDA 4ZOLB 2DKFA 3C74A 2AEEA 1QO0A 5K0FA 4L0CA 1G3QA 3A9RA 3OF3A 3PLNA 1I3CA 2XWSA 3OLWA 4FJ2A 1TW3A 1EX1A 3GT4A 1LSOA 1UZUA 2BC9A 4JJKA 4YJ3B 4YBZA 2F8SA 3WNCA 1SKAA 3JSAA 1Y3DE 3M4NA 2FN4A 3A4IA 1G3MA 3PKJA 2A3RA 5HKLA 5UKDA 3AR7A 2GCOA 3DCIA 3WKCA 4W5TA 1EHYA 2QUHA 3G6KA 2B8TA 5EUMA 1FIUA 4HSEA 4AY2A 5KOJA 3MTIA 2ID8A 4EVIA 5INTA 1LNQA 1J8DA 5H4GA 1UXOA 2OGTA 2GXUA 1A5ZA 4M8IA 4TT3D 3RLFA 2G9UA 4M9SA 4NFSA 1YUMA 1WCIA 2D2FA 2I22A 4RCYA 1QRTA 1CY1A 2CFIA 1NI4A 4F5ZA 1RAAA 5JS2A 3ZVNA 1JA1A 3BZUA 5AJZA 4F21A 5HQ3B 2Y77A 3M5DA 4E30A 4EY4A 1OC2A 3P8ZA 1JEEA 5KYGA 4YRRA 5GOTA 3DE2X 4MJLA 4LZZA 3TXXA 5ALGA 4JEHA 1EFUA 1PR6A 2ISCA 3EXHC 3KR2A 4MKHA 4QGSA 3I05A 4J03A 4EZBA 4GUDA 1CJCA 1T43A 4PYJA 5IT5A 2P3LA 2QAJA 2WTAA 3H8VA 5EI5A 1WL8A 1J49A 2BFDA 1UK9A 3EGDA 5H68A 2X42A 3NBZC 3WGTA 4DDWA 1X74A 1VLHA 5H9WA 2XB8A 4Y6GB 4XFDA 5GIPE 1SRRA 4JI7B 3R3UA 3TTVA 5JDCA 3NEYA 3QLUC 3AW9A 3BD7A 2R65A 1UEIA 2PLAA 3QYPA 4GZ6A 3HVJA 2PAFA 3DP7A 3TJRA 5CIYA 4KVFA 3ZW9A 2QGZA 4LNUB 4KVAA 1U1DA 1G3RA 4CFZA 1CR1A 4TXJA 3PRYA 5CG2A 2J32A 1I01A 1C3OA 1Z83A 2AEMA 3ENWA 2HMSA 3GHYA 3NC1C 4FCCA 3SP1A 2WVHA 4D9FA 3CLHA 4RHXA 4X7RA 1WUYA 4HQ0A 2A58A 3MLAA 4M7PA 2IHYA 4JJIA 5ADHA 2ZJ6A 2IGTA 4C4TA 3A3KA 4MW1A 5IJ0B 2R6R1 3RS3A 1UQTA 4G0OA 1WCXA 2JCYA 3PNPA 4KIWA 1ZH6A 1G6KA 3EXHA 2ZAIA 3HCEA 3QEMA 4H3VA 1DARA 4RQBA 2FSIA 1JP7A 1TGVA 2VNIA 2WOJA 5AKLA 2BH2A 5FNVB 1AH2A 2X0DA 3T8YA 2GM9A 3DMRA 4HADA 5B1HA 1OHHA 3AI3A 2NZUG 5FWDA 1PFUA 1ZWKA 2JAXA 3R9IA 1O89A 2A14A 3F3KA 3I3SR 3L7MA 1UPTA 4CM9A 2GFIA 5A3QA 2HV8A 3OU7A 4IZ6A 1L1FA 2FUKA 1UF9A 2R6FA 5IYZA 1BMTA 3BJIC 2PZJA 4KLZA 5AW1A 1GXSB 2PM8A 4B85A 5F7XA 1NOJA 1QYXA 2JGMA 2JGFA 3CZ5A 4L3WA 1JAXA 3RV4A 2RE8A 1XOIA 5DNUA 4CKEA 3C24A 4J7CA 4K2HA 4NICA 2C8JA 4U6NA 2I7XA 5DGIA 3KOMA 1W4CA 4Q9KA 2P27A 1HDIA 3VPFA 5P21A 5EE9A 4BVFA 1P74A 3JR7A 3AFHA 4ZA2A 1TNDA 2W4QA 4PLCA 4TWBA 3AVXA 4D5GA 2ADOA 1ISJA 4DWJA 1IBLB 3WSTA 4DM7A 2OGWA 3RSGA 4QHSA 2PMEA 1IY0A 1FYDA 3IKJA 4ETWA 4CEIA 1MQ8B 1NDQA 1S8OA 2QN8A 3D6JA 2BZSA 3KQQA 1FXUA 4NBWA 5FUMA 4FQ8A 1N8NA 3UMBA 1MLDA 4NK4A 3Q9SA 1WS6A 3OSZA 2UVPB 4GEGA 5HJEA 3D3EA 1R8SA 4NEHB 1OJLA 3O3NB 3SBEA 3S1AA 5H02A 5CR9A 2JARA 1P62B 2AN4A 2TS1A 1LJLA 2VF8A 2WIJA 4ENQA 2IUUA 4GP9A 4HNQA 4B5LA 3HYLA 4MITA 3V1KA 4FR5A 4E2WA 3BTUA 2NSYA 2RC5A 4FFMA 3CUKA 4HDMB 1ATZA 3I39X 4LRUA 4M9CA 5ANRB 4B83A 1PJ3A 8LDHA 3T06B 4JLBA 3LA8A 4TQAA 3NM6B 4AUMA 1SQ5A 1JN0A 1B6SA 1FUYB 5G4LA 3VSEA 1D2RA 1A7UA 2FN7A 3MGKA 4G8JA 4LTMA 1AHNA 5B1IA 3O83A 2P2SA 4MO9A 4Q6WA 3B7GA 5FKJA 2Y71A 2JAUA 1PFVA 3D6FA 1JQBA 4FQ7A 5B64A 1IN7A 4IINA 4L74A 3TI9A 4KZKA 5F33A 5KYXB 4Y1EA 3TDNA 2Q8QA 3O8OA 1ABFA 4QUIA 1U94A 3AEYA 4ZVRA 1WOMA 4KSBA 3IJRA 3ZWPA 9MHTA 1NF8A 5FO0A 4PSVA 1Z18A 2VWQA 5CLGA 4DKXA 4CTKA 2ISQA 2YR0A 1IOVA 5G2OA 3EGEA 2GILA 3C1UA 4HT3B 1O87A 3LA6A 2JDID 3KWMA 2W98A 1NYRA 1ZJ6A 1R74A 1SZPA 2FPWA 3HR8A 5T8KA 1HYEA 2BEJA 2MWMA 3BRWA 1A69A 3N2LA 3ZNQA 3ICQB 4QO7A 1JEOA 2OXRA 5AUOB 4R41A 3JZIA 1SOMA 3BXZA 1U1EA 1NN1A 1WBJB 2GJAA 3TF5A 2RB4A 3L4SO 2BISA 4OYHA 3WQQA 2ZBFA 1Q22A 3D6UA 4MCAA 4N18A 1AKVA 2V74B 3CEJA 3STVA 5SV2A 1SIBE 4ZT4A 1ZK4A 2H7YA 5EIWA 4XVQA 1D07A 4YP6A 3SCZA 4EJFA 4YCNA 5BVHB 1CJBA 2JKYA 4J0DA 3EVAA 2ECQA 5ENVA 1YS6A 4EMTA 3WX0A 3JVIA 3CKYA 3EGXA 3OE4A 4U9IS 2CDNA 2Z3ZA 4N03A 2O8BA 5KQMA 1SC9A 1WDTA 1P7CA 2NT4A 1E1YA 2PH3A 1Z26A 5AMXA 1ZGGA 1DTEA 1NTOA 2W90A 3W2GA 5E7JA 3LQ1A 1EAMA 4MV9A 2AMLA 2JW5A 3ONDA 3OY2A 2EIXA 3C1AA 2YVLA 5D3MB 2ID9A 4Q7KA 3SE0A 3AUJB 5BN3A 3X2FA 1S2OA 2PE5A 3VO1A 3IHKA 3THYB 4LIPD 3PQCA 3CYFA 1K6IA 2WSLA 2WQZA 3FKJA 2IE0A 1F2UA 3NKVA 3OIVA 4GMGA 1P80A 2XBLA 5CYPA 2HPVA 1HG0A 1AKYA 2P2CA 3PJRA 3GYGA 1LD3A 2AYXA 4HYEA 4MRVA 5DBHX 1WXQA 2O2IA 2PZLA 3EG9B 1CZLA 3IJ5A 3IESA 1WOYA 2GM4A 3GLGA 2PCJA 1X1QA 2Z58A 3IR5A 3M6VA 3MUEA 3O1HB 5EKUA 3WA6A 3CEMA 1CUFA 1XTIA 6NULA 1BMQA 4KQHA 1T6BY 2JG3A 1BN7A 3OTGA 2WFZA 4M46A 3FDFA 4RPJA 4KBGA 3A37A 2FMKA 3I72A 3V97A 4DVJA 3O4HA 4YR9A 1GL7A 1EDDA 1SVUA 1TUEA 4RESA 3SHOA 5BR7A 2CSXA 2C59A 4U9HS 2D00A 5KNCH 3L1UA 4JODA 1N2CB 1A82A 5D5QA 4XX0B 5LWQA 1Z6QA 1W4RA 1XRNA 2QEQA 2X3UA 1ZD5A 5TT0A 2IVZA 2Z5VA 4GSYA 1N7IA 3EQZA 3QXCA 1D7AA 4MLCA 3QBVA 3ZZTA 2CT8A 2PQ2A 1KC1A 3W8DA 1NVKA 1YA6A 2KHZA 2XQFA 2BZGA 1IAQA 1YI0A 5LBIA 4EG1A 2D4HA 3X3HA 5CDGA 2B61A 1DV1A 4FFSA 4M88A 5C81A 4X8MA 1GDTA 4WECA 5BN4A 1KBQA 4PRZA 1PI3A 1N78A 2V0CA 3M5WA 2HWXA 4K6HA 3SF8B 5DI3A 4EWLA 4IOMA 1Y3AA 1GUFA 3O4RA 4KIGA 4DJTA 1GRQA 1VHQA 2O5VA 4I81A 4OFZA 2HSZA 4X1IA 5DHQA 5J1TB 3OKAA 4LDNA 4XYLA 4IQ4A 3MS4A 2WWGA 3VZSA 4EVRA 4C87A 2RHRA 2ZB8A 1ZCJA 1I10A 1KK0A 1UMDA 1F6BA 1Z5WA 4ZHSA 4ZAZA 4CQLA 5BWMA 2BTEA 4NEGA 3TGLA 1B3BA 3C1OA 4MI6A 5HA5A 1N6KA 3JWEA 1P61B 4Q7EA 5LA6A 2DLNA 5J47A 3RKSA 3WYFA 1Y6JA 4PIVA 2VJOA 1IH8A 2VDWB 3HGQA 1WNFA 1UP7A 1SHTX 1JQ3A 2FK7A 2VK4A 4Y2GA 4FMDF 1XE3A 3KB6A 3OIDA 5DBOA 2V96A 2X8JA 3A2NA 1SK9A 5DX0A 1V1RB 5C0OE 2XXAB 3RV3A 5KYKA 2H5EA 4O2BF 2F1IA 3MWDA 2R751 3ZD6A 1U3GA 4Y2SA 2AA3A 5LIRA 2WKSA 3MQFA 4JJGA 2YVQA 1Y63A 1E3EA 2Y1FA 3MCWA 4CGZA 1EHIA 1J23A 2V59A 4EA7A 3L8YA 4EQ6A 1F7UA 1OYYA 2ZJ0A 2O7SA 4MH0R 4WSOA 3WNDA 2NZVG 3U2QA 1IBMB 1RPJA 4B3CA 2C8KA 1IYZA 1EAYA 4YRDA 1L0BA 3H5RA 3RVDA 3VVBA 4ZMRA 1GQ2A 1SRQA 2PXCA 4FSXA 1PQWA 2BFBA 3P9IA 3K8OE 3X2SA 2P67A 4QBFA 1YU6A 2HT6A 4DCSA 4E07A 1N5JA 5JSZA 1G2PA 1ZKDA 1Z36A 1KETA 2C0PA 2CXOA 5AW7A 2C84A 3T5PA 4FCVA 1O6GA 2H1HA 4HZUA 2HA6A 2Q7XA 1IJFA 1BQEA 1DJOA 1I5RA 1T1EA 3RCBA 1QGOA 4AK9A 1CQPA 2AKYA 1YI8A 3P2MA 4M9RA 4UQPA 5GV7A 3U7HB 5BSRA 1IM2A 1YQGA 1X3LA 1W52X 3DM5A 2ZYVX 3TRKA 1IE3A 3T99A 4JSYA 4BNJA 2W2LD 5KVAA 2O5CA 4HWGA 5ENZA 2JZCA 2RJ3A 1X70A 3LHFA 2FWNA 3DVAA 5JQGA 1QG2A 1Z4JA 2FNAA 2J7PD 3C41J 2Q7OE 3RRXA 1WU7A 4JC8A 2JCBA 4JJAA 2C5GA 2E5WA 2JLWA 3A1WA 1W30A 2H2DA 3I2JA 5AW6A 8AT1A 1Y4AE 2Q6VA 3V8RA 5CH5A 3VHXB 1SBCA 4FZ5A 4RZ2A 4G24A 5B7PA 4S05A 1QQTA 3TSOA 1IXZA 4ME6A 1RYHA 3RBXA 3PQEA 3EFOB 5CX1B 2NU9B 4FINA 1X1EA 4DCVA 1C1HA 3HB4X 3THRA 3EJ6A 1V6CA 3HC7A 3HEAA 4HN9A 3SLGA 5DNAA 4AICA 2Z6QA 1WV0A 5DLDA 2NYVA 4M55A 1IY2A 2O2YA 3X1MA 5B55A 2RBKA 5EIOA 3GCGA 3G9XA 1DHTA 4B8ZA 2QNBA 4R9NA 1X7GA 3ROZA 3PD7A 3TUIC 3HNPA 5C4MA 1GPDG 1TKRA 1NHWA 3GLFE 3VKUA 4CHGA 4IVNA 1G9XA 3GC6A 3C5WP 5DHRA 4WERA 3E8SA 3Q9LA 1FQKA 4GVXA 4L8YA 1R12A 4RV4A 3IHLA 2IBSA 3GRFA 1CNEA 1XAIA 1WP9A 4RJLA 3S68A 1TTPB 2V5VA 2AJBA 1Q0UA 1CBUA 3A6ZA 3KVNA 2NU7B 4XSVA 4O4HA 2GR9A 3RKRA 1MHPA 4HATA 2JKZA 1ISMA 3EPKA 1N33B 2X1MA 1NW9B 1QCZA 2FZVA 3B3AA 2FQXA 2YY6A 1J9EA 4I1IA 1UDBA 1NUUA 1XEXA 1N57A 1QK4A 1L9XA 2EXXA 4IYRA 1JJBA 1XZNA 4KAXA 1QWOA 3IQHX 4G5RA 5T57A 3Q5EA 2P0YA 3CURA 3HK2A 721PA 3HKDA 3T7DA 1DBSA 1E79A 4XB1A 2OZVA 1KH3A 1YCHA 1Q7EA 1NI4B 1QIFA 3WIOA 4QUKA 2D4AA 4TRNA 4JBWA 3Q7SA 1Y7IA 1TYCA 2V4MA 2AZTA 2ZITA 1NQAO 3OO1A 4XQEA 2OO5A 1ZD8A 1JH8A 2GBFA 4IGKA 4JVNA 2VHQA 3EZGA 4M1KA 2F3TA 1KYYA 4LZJA 4MA0A 2JI6A 4M98A 4Q24A 3ZXSA 1QS0B 2BFCA 3WWZA 2QJTA 1HSOA 4HH0A 4DCNA 4EGJA 4EBBA 4MIKA 5BN1A 1YL7A 2W37A 4IWNA 2AFHE 1AQJA 1DJPA 2J30A 2W2KA 5A0TA 2DY0A 2QN2A 5BNZA 2FDXA 2FX2A 1ARZA 4MVJI 2EDCA 5A4JA 3V32A 3E5HA 3CPJB 1KGDA 1W5TA 4RF3A 2VFAA 1LDGA 4MR9B 3G8AA 2GK4A 2RKBA 5TX7A 2EBHX 3O8DA 4B2IA 4RJJA 3I3OA 1TVCA 1QZ3A 3I32A 3MRVA 2XA1A 4IO0A 4XZ3A 1N9GB 1EVLA 1KEPA 2IIVA 3GJ0A 4R68A 1V8ZA 2JEYA 4B3TB 1DKOA 3N0WA 3KC2A 5IX8A 2X8LA 1A9QA 1NASA 2HKIA 3IUBA 1TK3A 4AY6A 2BMWA 2QYHA 4CR6A 3EC7A 2V3CC 3A25A 2ECPA 621PA 4TYQA 2E5LB 3HDVA 1YVPA 3DBLA 2FKNA 2GZRA 4LISA 3H9BA 1F2DA 1H2EA 2OO5C 1EQ2A 2SHKA 4O8ZA 1Z39A 3FRHA 4W5WA 3AUAA 4R3NA 3SC3A 1EWYA 3U31A 3EIOA 3J81A 1SUEA 1M6EX 3KJEA 3M2PA 2HDWA 1X39A 2IHJA 2OENG 1XVIA 2GNOA 3K73O 1PNVA 4MMXB 2I4IA 3D7SA 4OH1A 1USGA 1UMCA 3K0CA 2XCTB 2HLHA 2O8EB 1OGIA 2AYZA 1EDBA 4Y2XA 4XR9A 3CSUA 3I04A 3TM4A 4QPZA 2WYVA 1WHSA 4A6PA 4ACBA 5CEEA 1HZZA 4ZKEA 3Q6MA 4C4OA 2X41A 3BE5A 4U02A 5JFTA 5DK4A 5F1PA 3GR6A 3QVXA 4DQXA 4LQLA 2FPGB 4Z9FA 4NXNB 1M8KA 1ORHA 1P6QA 2J45A 2WU1A 3NWPA 4K3VA 3G5UA 3GJTA 4OQYA 1HFEL 4P9NA 3QJGA 1XMSA 2A4MA 4ZAVA 2BKEA 1CUUA 4F56A 3UK7A 3VU9B 4NBSA 3DQPA 3NTUA 2J3HA 4IXTA 1THTA 4RD1A 4EUHA 4LSWA 3DAFA 2PQMA 1NGSA 4TMTA 3DNFA 1ZJ5A 3W05A 1DB3A 4M0UA 4M1MA 2BFNA 1O96B 4R6WA 2JH8A 1VLJA 4RSRA 4LE1A 4PYRA 2BJWA 2V6FA 1NX6A 3LXRA 1M2FA 3L93A 5KHAA 2XF2A 2YV2A 1VGQA 2XXJA 1CFJA 3DL2A 1UR5A 2REQB 4L4ZA 2DKOA 2VYND 3HL0A 2EX4A 4HFMA 3Q8MA 4C0WA 1NPYA 2PSHA 1KRHA 3R6LA 5U4QA 2QVZX 4JP5A 4LJKA 1R5OA 1XVTA 3AHIA 3L92A 4BNYA 3G0HA 2JJYA 4JXXA 3B70A 2TSYB 4RE5A 3MWYW 2YOGA 1G2OA 3PNKA 4MARA 1PZHA 1UIRA 2WSSD 5ALMA 2WNIA 4QQKA 4WL0A 2QTTA 5EKSA 1N6HA 5GWXA 3ZVRA 3ONEA 4QPPA 3A04A 1BHSA 3ZK7A 5F1OA 3UWDA 2G83A 3HBMA 2R4UA 2PLFA 4KRFA 1L5HB 4ZIRA 1GPJA 3JD4A 4LXQA 4UZSA 5LLSA 1HR0B 4J7UA 1Z28A 4QOFA 4NZNA 4PR0A 3HZRA 1J39A 3IEXA 2ZIGA 1EGVB 1NT4A 3A1NA 2VAPA 2AOXA 3AKCA 3B3JA 1CPYA 4Q4HB 5J63A 4AJLA 1RFGE 1W36C 5AVTA 2L82A 3FGNA 3VR5A 1XF1A 2Q5LA 1PR1A 4UBKA 4Y6RA 2BDTA 5IKEA 1UM9B 4EHLA 1W46A 1WUJS 1B00A 1EA7A 5ITVA 2ATCA 3GDWA 4DDHA 3GT0A 1E0DA 3AJAA 3JZAA 3NYWA 4CLHA 1S8AA 5K8IA 5FCDA 1JFRA 4EYQA 1RYFA 3O8BA 2AFIE 3SQXA 3C16C 4E5UA 3ER9A 4CCAA 3OQ1A 3CR8A 5J40A 1P9WA 2V0NA 4TS9A 3ZIAA 2WHEA 3PI7A 5BUQA 4QLBA 1PEYA 3LG2A 1E2UA 1L4MA 1Q1GA 4IIDA 4S04A 3GJSA 4YMWA 4EPVA 1Z07A 2BSAA 4MJ3A 3H1EA 1ZMBA 4XDZA 3M9WA 4R2KA 1JHYA 5IP5A 5C7IO 3EPLA 1XWFA 3W1VA 1EP1B 3ADKA 2OR3A 5TY0A 1NXQA 3THXB 2VRWA 3B3QA 5DT9A 3KQPA 1IUOA 4JA0A 1LLQA 2FUNB 3ZC3A 3A9VA 3U1VA 1GCAA 4G81A 2XSZA 1ZRMA 1KF0A 4XUEA 2OB2A 2XYHA 3FPEA 4EKDA 3MCAA 1Z4NA 1K4YA 4IMRA 4UNQA 2O8BB 4RTRA 2OYCA 4HN2A 4PCLA 4TV9F 3N05A 3L05A 5DYYA 1CUHA 4L02A 3EAGA 4I8IA 1XXHE 2ZGVA 1NA5A 2XNHA 2LKDA 4HMQA 2EWVA 2RGNC 3CZAA 3MK31 4FYPA 5AHKA 1YJQA 4QHYA 4I99A 1Y37A 1K0FA 3K1ZA 4NU8X 3KEMA 5AT1A 2XH8A 4JVMA 3ME5A 3A4MA 5FO1A 1J09A 4Y9SA 3R09A 2GVZC 4JLAA 1O0CA 4GAEA 3UYKA 1RQ7A 4WZBB 5AVJA 2A0YA 2NO6A 3N2IA 2R48A 2F90A 5BORA 5AVZA 3CEAA 3O3OB 2W58A 5K3SA 1DAMA 4KMOA 6Q21A 1K2VN 1E3LA 3IAXA 4L7VA 2Z6UA 2B69A 2PFGA 1TZJA 2VHVA 3NJ8A 5TVGA 2GEKA 3NDJA 4XM1A 3W5AA 1E9VA 5GZ6A 5FPKA 3GLSA 5HMMA 5DM70 3PEYA 2YWDA 4YUWA 1TC1A 5I9SA 5JRDS 2IWHA 2VHYA 1WSWA 1GSAA 2QTVB 2VYNA 4MTCA 4ND8B 4C5CA 4DJ5X 1EVZA 4YUVA 3NIDB 2J5KA 3HJCA 3PEFA 3MWLA 2IA5A 2NYRA 3GRRA 1IRXA 2CCKA 3D5TA 4HQNA 1OFIA 1UCFA 2YMLA 3P5BA 4GNKA 5CDFE 1MA0A 3F7NA 1FMCA 5E2IA 1L9KA 2ZCUA 1EFDN 4DNOA 4XX0A 3FMGA 4ILKA 5L95A 4UEKA 5BV8A 4S3MA 2R5FA 2WIAA 5T8KC 3D2CA 2AG0A 2B5WA 2BGKA 3PFFA 1PG0A 5KNBH 1DU4A 4TV8B 3O6VA 1ZIYA 5J58A 2YFHA 2ZRNA 1S6YA 2YVAA 4HXYA 3EVDA 2QUBA 2GM5A 2RGAA 3RFVA 4D9GA 3OU2A 4F5EA 1GILA 4Z9BA 4FR0A 1K88A 1QIJA 3AUXA 2VT3A 1CUIA 3E7PA 3R5KA 1U1FA 4U7FA 5DM2A 5DKFA 2H52A 1IUKA 3HFRA 1AZTA 3PP8A 3U44B 3H9QA 3IGFA 1MJFA 2RK6A 5E1DA 4BLPA 2A30A 3LBAA 4BZWA 2EYQA 1DX4A 5HEKA 1G55A 5GJWC 3HPQA 3ILVA 3ET5A 3NXKA 4X3PA 5A71A 3TRIA 2JFZA 1GCIA 1RJDA 3QW2A 4J4HA 4QZVA 2QA5A 3AH8A 1GPKA 5DLYA 4F4CA 3U7FB 5LA6B 3SJCA 5JALA 3PQ2A 4QEKA 3ZLBA 9LDBA 5L4LA 1KDRA 1L7MA 3Q41A 1L5VA 1NW5A 1NVDA 2O2DA 2X0KA 3UHPA 1CUBA 1Y1RA 1VBNA 1Z0KA 3AK4A 3HUTA 3LZCA 2XADA 4JC4A 4KE8A 2B1QA 1TXGA 3M6LA 2I62A 3HEBA 4AN0A 1QGZA 4C89A 4M0CA 1GUZA 4C2UA 3FYUC 4AJNA 1O4VA 2DULA 3AUKA 5HDBB 4I50B 4I5FA 1Z4IA 3QF4A 5JJBA 4TPKA 3NHUA 4D02A 1ZYUA 5JPDA 4V3BA 5I7UA 1IEQA 2A7XA 4QDZA 1F4LA 4Z3KA 2ZWOA 3QYFA 3DL7A 1LBEA 3E70C 4B40A 4BVEA 4AQYB 5IKMA 3EOZA 5AR1A 4F1WA 1W85A 4EMBA 2SKDA 3NV9A 5ENDA 2JLVA 1EZZA 2CHFA 2B2XA 3SR4A 2HA3A 2RKOA 3OUTA 4XASA 4KP7A 4DR4B 3BF7A 4Y2JA 5G1OA 3R74A 2V5AA 4LF9B 4XJXA 1FLDA 3H5NA 2P62A 4RF4A 1JHUA 2XNJA 5K4HA 1ESMA 3FW1A 3ZWNA 1TQDA 1MABB 1BW9A 4HC4A 4OK3A 4CCYB 1HUQA 2H92A 3KOYA 1V3VA 3VMMA 4X95A 3DO8A 4EYKA 3DSRA 1H2RS 4B4OA 5LMZA 2UYOA 3KQSA 2HJRA 3LUHA 5AOAA 2G9ZA 4LI0A 3M0EA 2XCSB 1C80A 1CDOA 3FG9A 4NXMB 2C9YA 4QUBA 2H2WA 4F06A 4H7KA 2L42A 4UHBA 2F43B 4DG5A 5JZMA 4PC1A 2I2FA 1WP4A 4FGLA 3PE6A 5I7OA 1UDCA 3D4LA 4I5EA 1C30B 1OXXK 2AI3A 1ODJA 2Q5HA 4P83A 5FBQB 3ZGXA 4WXYB 3RTCA 2DFNA 3QVOA 1BQ4A 3WKDA 3S7ZA 1HNWB 3AI2A 5A3VA 5LP6C 3GU3A 1UADA 3UPTA 1NR5A 1P5ZB 2ZJAA 3ZWBA 3CE9A 2V6BA 5IDVA 4EG6A 4XCXA 4BP9A 3V2HA 2UZ3A 2NU8A 2F00A 2GJSA 4R0NA 2PV0A 4J91A 3AFGA 4LXGA 2OSBA 2WILA 1MOSA 4IS3A 4B4VA 1R00A 4RV9A 4MWOA 5ERXA 4HRYA 3A3PA 4H7PA 3IO5A 5E95A 4S2EA 2JI9A 2GA8A 4TTJA 4I55B 4YUAA 4R1TA 3GJXC 4KNYA 2XB4A 1PU2A 4OMCA 4ND7A 3KSDO 1ADGA 3AJEA 4BZZA 4F8YA 2J0SA 2PU5A 4BWVA 2DETA 4RH0A 1E2BA 1EK2A 3GVIA 2Q0SA 1R27A 3DKKA 5I9LA 5B1YA 3CZRA 2I6XA 2VSOA 1PTJC 1ID8A 2VPXA 1A88A 2OXCA 2P75A 3I2FA 4DLNA 4PAGA 1AKQA 2IW1A 2HCJB 2IZZA 4Z2AA 1P5HA 4Z4GA 4J8PA 1QRUA 3GWZA 4IAOA 5EMKA 4I4CA 1GADO 2WIGA 1EFRD 2O9JA 3AR3A 3Q3HA 4FYIA 3UTDA 4O3FA 3LCVB 1KJNA 3D1VA 3FCSB 3OTOB 1LC3A 2P4EA 2PT9A 3V2GA 3GAMA 4YJ3F 5CBPB 3AB7A 3BGIA 3KQUA 3L7CA 1SCNE 1F8FA 2IYRA 3W3ZB 4EPTA 3ICEA 3QKIA 5ALRA 2AJ8A 1JKXA 4J16A 1HZJA 1OF1A 3EASA 2C5AA 4B4KA 1MJHA 3LRPA 2M6LA 3GLIE 1PR3A 4U2EA 1F60A 5ALQA 5IDYA 3DL0A 3WYNA 3TS1A 3WRYC 3KT8A 1G4UR 2YV4A 3K1AA 2OAEA 3VYVA 2F62A 1PDWA 2ATVA 1LLCA 1R0ZA 2EKZA 1KAOA 1MT0A 2BZ0A 5FHQA 4BASA 2QQ5A 2WJWA 1T9DA 1VLMA 4J0IA 2VAMA 4MUYA 5ILGA 1SOVA 2FMFA 3H7AA 4V24A 2PH1A 3NUZA 2XHZA 1LBIA 3ZVMA 4EG7A 1QF6A 4GI7A 5BSEA 4ZOQI 4MUBA 2VSNA 1DTSA 1BMFD 5C5DA 1OA1A 1ULHA 3O9ZA 3I4CA 3TL6A 4K26A 4U39A 5CVCA 1ISRA 2A57A 4FDMA 1H94A 4NDNE 4Y1RB 2V7QA 4YIKA 2WICA 4CKCB 3UNXA 5LQUA 1M1YE 1C3OB 1RXWA 5FT9A 1U7UA 2R1ZA 1NLFA 2A5YB 3DDSA 3H1GA 3KYCB 3B51X 4I14A 3GZNB 4QQNA 3W5CA 1B26A 1UPFA 2RBEA 4IXMA 1JAIA 3MN1A 4NCNA 1Z0AA 4PN3A 4ZMSA 2QPLA 4YQEA 2Y05A 1WEHA 4RD2A 5DGTA 1TZCA 5TNXA 2VHUA 2ZAMA 1QIMA 2Q3EA 2WWWA 4REOA 4N48A 2QLFA 4BFYA 1ZD1A 1G9SA 2VKQA 2W43A 3E9ZA 2NU6B 2QL5A 1P8AA 2GDJA 4CLOB 3RAEC 3AVTA 1TT5A 1RWWA 1DT3A 1XTTA 3BBPA 3MAGA 4EMSA 1XPUA 2W6IA 1HE2A 1UMCB 1TVEA 1GYRA 5HK9A 2IS6A 3AUYA 2D5LA 4BLWA 1L7QA 3ZDRA 1MQAA 1WHSB <